3STLC

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3stlC00
3T4DA 4P30A 2KB1A 2K1EA 2ZXWC 4JTCB 4MVZA 2WLMA 4P9PA 3WG7C 1K4CC 2R9RB 3E8BA 5B3SC 3K0GA 2P7TC 1P7BA 3ABMC 2QTOA 1S5HC 2WLIB 3OR6C 4JTDB 3RVZA 2A9HA 2ZD9A 4MTOA 4KFMA 3E89A 2Q67A 2Y69C 4G27B 3AG2C 4PA4A 2WLNA 4MVSA 5EC1C 3AG1C 4X8AA 4MVOA 4QE7A 1JVMA 2WLIA 3ASNC 2A0LA 2EIKC 3K04A 5EBLC 3K06A 5KUMA 3RVYA 5CBFA 4DXWA 2DYSC 1M56C 1XL4A 2X6CA 3E8HA 1K4DC 3EFFK 5E1AC 5EBMC 3SPJA 3GB7C 4GX0A 3UM7A 4WFFA 4PA3A 2ITDC 2HFEC 3T1CA 5J9PC 4OXSA 1R3JC 3HPLC 2ATKC 2EIMC 3R65A 3KG2A 4LP8A 4GX1A 3AG4C 4X89A 1G4YB 4WFGA 1XL6A 4QE9A 4R50A 1M57C 3F7VC 5B1BC 2QKSA 2Q6AA 4H37A 3T2MA 3RBZA 3VOUA 4PA7A 4RO2A 3SYQA 3TCUA 3SYAA 4CBCA 3TETA 4PA9A 2Q68A 2YEVA 3SJQC 4EKWA 4I9WA 2OCCC 3ASOC 4J9ZB 1ORQC 3ZJZA 4UUJC 4MTGA 4P9OA 2DWEC 3T4ZA 2HJFC 3LDEA 4PDRA 3ZRSA 4RAIA 3E83A 2Q69A 2WLLB 4H33A 3IGAC 2BOBC 3ABLC 2IH1C 4GX2A 1V54C 2BOCC 3K03A 5CBGA 3FB7C 4TWKA 1R3LC 3LUTB 3SPHA 4R8CA 4R7CA 1KKDA 2EIJC 4R6ZA 3SPCA 3SPGA 3SYOA 3UKMA 4WFEA 2HVKC 3SYCA 3X2QC 4G28B 4MTFA 4RUEA 1R3KC 4P2ZA 2W0FC 5EC2C 4MSWC 4JTAB 4MW8A 2X6BA 2HVJC 4ZBMA 4HZ3A 3SPIA 1QLEC 2NLJC 4J9YB 4MW3A 1OCCC 3PJSK 3LDDA 4PDLA 4PDVA 2H8PC 2ITCC 3AG3C 4MVRA 4LBEC 3LNMB 1LNQA 4XDLA 1OCRC 3FB5C 3LDCA 3OGCC 1OCOC 4F4LA 5IY5C 5EBWC 2X6AA 1OCZC 1R3IC 4WFHA 4QNHB 2AHYA 4RUFA 2WLLA 4BW5A 2IH3C 1V55C 3FB8C 3ABKC 3JYCA 4HYOA 4PA6A 4MVUA 3IFXA 3STZC 5CBHA 1J95A 5KUKA 2A79B 5BZBA 2WLJA 4MVQA 3STLC 3BEHA 5B1AC 2HG5C 3E86A 2AHZA 3E8GA 3OUSA 3F5WC 4XDJA 3RW0A 3E8FA 3SYPA 2EINC 1BL8A 3FB6C 2DYRC 3OUFA 4X88A 2WLHA 4PDMA 5EK0A 4GX5A 4LCUC 3K08A 4MVMA 1ZWIC 4MS2A 2EILC 4XDKA 2WLKA 3F7YC 3OR7C 2DWDC 3K0DA 2JK5C
chains in the Genus database with same CATH superfamily
2KB1A 1IBKB 3CJHB 2EZPA 1P7BA 3MAQA 3RVZA 5JCOC 1AI6A 1XOUA 1L8DA 2Q67A 4MVOA 2A0LA 1W2BU 3ZRWA 2RNBA 3U0ZA 4X1IB 4YJ3B 4IYIA 5KA6A 3T2MA 4RO2A 3BHPA 3RYHB 1SKVA 1IBMO 4LFBO 3E22A 3UO3A 2ODMA 1XREA 2ZR2A 2ILMA 2GTAA 1XILA 4DUZO 1W59A 3ABLC 4UFZA 3K03A 2Z3YA 5GTHZ 1KKDA 4JGSA 2C2AA 1SZTA 4BIZA 5BY1A 1JJ2U 1DF5A 4FK5C 1THZA 1V55B 4K3AA 1QLEC 3OAAG 4UB6Z 1VQ7V 3CCEV 4FLVA 4JI7B 2YS8A 1R73A 4I55A 3JD0A 1MZEA 3IFXA 1F4MA 4B3RB 2E5LO 3CEIA 3CRMA 5KHJA 5CA1B 1N0NA 1EZJA 5LP6C 3ZBHA 4X88A 5EIBD 1NR7A 3BRCA 1GTOA 1RM1C 3K5LA 1WPXA 3B8MA 1YJNV 3OMAB 1VQPV 4MS2A 3K79A 2YUAA 2YXLA 4H44B 1P49A 4LC1A 3T1HB 1Q5OA 3CSXA 3JD2A 4MTOA 1QR8A 4NVPA 4MVSA 2RJZA 3AG1C 3WB1A 4DR1B 3NR7A 3ZN1A 2XAJA 4DXWA 2OCHA 4DK1A 3L73H 5IJ0B 5LP6B 1YZBA 4X89A 4WFGA 1XL6A 1Q6IA 2GHYA 2R70A 4FVMA 2B5UA 3TCUA 5GONA 3ABLB 5LA6A 1Q82W 1BHBA 4YY3O 2NNUA 5C93A 3U11A 3A8TA 3OEHG 3OD4A 3E83A 2E74B 4FLWA 1IBKO 2XASA 2BE3A 3LUTB 5D5PA 2VRZA 1JCHA 2UXXA 2A7WA 3P3NA 4P2ZA 2W0FC 2Q5ZA 4TV9B 2UXNA 1OCCC 1H8HG 4B08A 3L74H 1SERA 4MVRA 3AEIA 1KD1W 3K57A 4IL6Z 2Z5UA 1OCZC 2DOSA 4BW5A 3ABKC 3FYEB 4FIPC 4BWAA 2Q0OC 4EFEA 4UXNA 1AI5A 3OUSA 1Y76A 4Z2WA 1M1KW 1SF9A 5J2TA 3T1YB 1WB8A 1SETA 4JV5B 1Q8IA 4LCUC 1NBMG 4AHCA 5J2TB 4GT1A 5LGTA 3LSQA 4G2KA 5LYJB 3AK2A 3RYFB 3OEEG 5E79Z 4E2LA 3K0DA 5JVDA 1BQZA 5GONB 2UUAB 5LA6B 2VWJA 4DV1O 4DR2O 4EB6B 1GK9A 4O4LA 1LUVA 5EC1C 3K9SA 4KHPB 5EIBC 1XMOB 1ZLZA 2LW7A 3K5OA 2ZQMA 2X6CA 3SPJA 1K4DC 1HNXO 3UM7A 3H1HH 1W0JG 3K59A 1Z5WA 2LFRA 1H2LA 5B1BC 1XQ8A 4QE9A 4TV9A 4R50A 2LW1A 1L0NH 3K5MA 4EFBA 5L3CA 4IIJB 4PA9A 1VF6C 3WU2Z 2IJHA 1RFYA 3LDEA 4PV1B 2XAHA 1HNWO 4H33A 3IGAC 4WFAV 3P32A 2IW5A 3AG1B 1X4TA 4KUMA 1X59A 2L35A 3TK1A 3DGEA 4X1KA 3SYOA 3N2KB 4O2AA 4DR1O 1R3KC 1GN3A 1KMIZ 3CE2A 1Q86W 4X1KB 2P90A 3FX7A 3LDDA 1US6A 3H1KH 3G67A 2NN4A 3JATB 3SR2C 4DV2B 5IY5C 1OV9A 1TA8A 3S3WA 2RCVA 4FZ1A 4DV7B 1N36O 2XT9A 2JEXA 5BZBA 2WLJA 1FYJA 2UU9O 1G8MA 3GWKC 3E86A 3L9DA 3SYPA 3HKBA 4B7EA 3OUFA 4PHZA 4DV0O 1K7DA 4I9QA 2LGWA 2DYSB 4X20B 5B1OA 4HBNA 5DECA 1E79G 1WAZA 2GUZB 1SC5B 3RYCA 2CTPA 3K9AA 4P9PA 4WFEA 4P30A 2X0LA 4DR6O 1Z2GA 4UVBA 3SJAC 5FNVA 2XUMA 5LHHA 3IC9A 2W0XA 2YXYA 2P22C 3OGIB 2QWQB 1S5JA 4HNAB 2WLIA 4JI8B 3K06A 1WA8A 3ASNB 1ZL8B 3ZJZA 4DUYB 2Y69B 1XNQB 4QJFB 1M90W 4JI0B 2BSKA 1N0JA 4PI0A 4DV5B 2CH7A 1J5EO 1WPBA 4A5UB 4LFCB 3CCMV 4RQFA 4UV9A 1VF7A 5IY5B 5D5QA 4UUJC 4MTGA 3ETQA 2HJFC 3A0HZ 1RSOA 1BGYH 5KAIZ 3PN1A 4DV6O 4JI1O 4D7TA 1S77D 3BY6A 3SPGA 3UKMA 2PTMA 5LGNA 5B5EZ 3R66A 3Q4HA 4FMTA 3LSUA 4U3FH 4LFAO 3E2EA 3WB0A 1BE3H 2P67A 3S3XA 4XDLA 4N23A 2XAFA 1AR5A 3ETEA 4AQYO 5JH7B 3APOA 5FNVB 2UXCB 4LR3A 5B3SB 2UUBO 3CMEV 1XNRB 2EILB 4HNAA 2UXCO 2PF4E 3CC2V 3RW0A 3OE7G 1KQSU 4J10A 1IXBA 4UCSA 2KKWA 2GTSA 4DUZB 3QTCA 4DR7O 1FXHA 2YIBD 1VQ9V 4IHJA 4ZIBA 5L3DA 1BQ0A 1AR4A 2Y48A 3OR7C 2ZE5A 2F93B 4MVZA 5EZYA 1VQLV 3OTOB 3ABMC 1BHAA 1NTKH 1URFA 3RGBA 1KU9A 4GKKO 1QCEA 4LWSA 2XTAA 1B06A 3RN4A 3I5DA 2EIKB 5IWAB 1YTFB 5IJ0A 2Z0AA 4WFFA 4X1YB 4UVAA 4YHHO 1WJZA 4B3SO 2EIMC 3O9OA 3CCLV 4LP8A 5B66Z 1G4YB 3F7VC 3ABKB 2CK3G 2WA3A 4UCRA 2DE0X 1ZUQA 1UFIA 5JH7A 2G38A 3ZHVA 4JYBA 1H2GA 2PGGA 3FB7C 2N05A 3JAWA 2DN9A 3CCQV 4NTXA 4JYCA 2EIJC 4ZOLB 5J2UA 4B3TB 3X2QC 2OIGA 1T5EA 4MTFA 1R6TA 3JAWB 1O9GA 4K0KB 4HZ3A 4DR3O 4LH6A 5IT9N 2KG7B 5JJEB 4PDVA 2ZINA 3JASB 3L75H 2ZNJA 3ZRVA 5CB4A 3ZS8C 4CC5A 4F4LA 2X6AA 2OCCB 4LFCO 1FAFA 2W6JG 2FB5A 1GM9A 3BEHA 4LF9B 1Y4MA 4XDJA 5KMGA 1FXKB 3C90A 5IDJA 3D8CA 3K08A 3UT5A 2WLKA 2D2CB 1K3EA 1FPOA 1P7GA 2KSDA 4EB6A 1AJNA 3H1LH 3ZMUA 1UPGA 1DTOA 1I08A 2XHBA 1MOFA 2ETNA 1H2SB 1BT8A 1NTZH 4PI2A 5F2VO 5IYBO 1M93A 1K34A 3B4SA 1NT2B 5CA0B 3JAKA 3R65A 2VQEO 1GH6A 4GKJB 3N2GB 3APQA 4WBNA 2Y4UA 1YTFD 4GKJO 1BS3A 5BMVB 3AK1A 1QHTA 3H9VA 1QLEB 1L0LH 2HVKC 4G28B 4IGGA 5L3BA 1MNGA 4JTAB 2X6BA 3BCCH 2NLJC 5KA5A 3GWOA 1K8AW 4XBFA 4DW1A 2JIZG 3CCVV 1FKAO 2E5LB 1GN2A 3G6BA 2IU3A 1R6NA 2AXTZ 1PNKA 1SESA 4TQFA 1R3IC 1F7YA 2CUGA 1JMKC 3B2EE 3FB8C 3HKEB 1D2DA 1RPRA 3N27A 3QO7A 2IBZH 2GSMB 1SQBH 3HKBB 1XMOO 2EJRA 5LXTB 3MDSA 4MTXA 4FLUA 4X64B 5LMUO 1A32A 4YIOA 4JI1B 1XUQA 5LXTA 3QNEA 1GO3F 5K1PA 1AJPA 1ZTEA 4YJ2A 1KKCA 2FYUH 3ABMB 2ZXWC 4IIJA 3T1HO 3CWBH 2ZE7A 1YEWA 1Q7YW 1VP7A 2YI9A 2A9HA 1WP8A 1EN5A 1SQGA 3AG2C 2ZE8A 1Y6XA 5BMVA 4H0LB 3K04A 1XHXA 4X62O 2P6JA 4LF7O 3ZMTA 4JI2B 2CGOA 3CRAA 5HFMA 3ML0A 5KAFZ 3ABUA 2QKSA 2UU9B 1JPXA 1N32B 4CBCA 4YY3B 3HKDA 2LO1A 2ZE6A 3ZMZA 1M5IA 2XNDG 5KHGA 3HKDB 2OT5A 4RAIA 4FLTA 3OMNB 1LR1A 4LFBB 1FFTB 2YIDA 3UCSC 1HW7A 2UXDB 1MA1A 3RWRD 2XAQA 1K92A 4FFBA 2ZM6O 1XMQO 1HNZO 4MSWC 2UXDO 2QM4A 1FD9A 1ZSPA 1WLEA 4PDLA 5CA3A 1VQKV 4DW0A 4C7UA 1GN4A 4PD4F 4JI3O 3FB5C 3D3IA 2AZ0A 1XI1A 4QNHB 2Y0IA 4U3JA 4O4HA 3ETGA 4PA6A 3WG7B 4X66O 1J5EB 3STLC 3X2QB 5B1AC 3IJ4A 2AHZA 1I5XA 1OCZB 1N33B 4J41A 5LMUB 1KP2A 3J7AU 1BSMA 5DEDA 3ZMVA 3GVMA 1E1QG 1KECA 2ZCEA 5EK0A 3W7SA 1DGSA 1TUBB 1JFFA 2V7QG 4K0KO 4FZ0A 2A06H 4LNUB 3DTUB 2KQXA 3MHSC 3BVOA 3I56V 4DR4B 1IBLO 4LF5B 5JJNB 4CC6A 1VQ5V 4J7KA 4LFAB 1HWYA 1Q43A 1MSWD 4G27B 1RPOA 3CRCA 4B3RO 4O4LB 4NYKA 2PYLA 3CCRV 2DYSC 3E8HA 1HR0O 2FL4A 4DO2A 4GYCB 4FM0A 3KCYA 1VMGA 4IYHA 3VBBA 1PD3A 3F5TA 4F6RA 2QDOA 2JGDA 2PI5A 4TUYB 2QSAA 2EBOA 3M7MX 2AW9A 1OCOB 2YEVA 3W7WA 1AI4A 1ROPA 3B8NA 4NB5A 5LOVA 4O4HB 1COWG 2MW2B 2ADPA 1M56B 3ZRXA 4CS2A 3AG3B 2ZT9B 4R8CA 2E3CA 4R7CA 4WFBV 4ZHQB 3MHHC 2R9AA 3RFRA 1NKDA 5CN0A 3K5NA 2YIBA 5FL7G 2F66C 4MW8A 2WA4A 3N2KA 3SPIA 3H1JH 4GLXA 4IHJB 1P84F 1JFFB 1NVPD 1F51A 3K58A 5KHHA 1NQTA 1B3QA 1N36B 3JD4A 2VQFB 1VQ8V 1QLNA 1SRYA 4MVUA 1YDXA 5KMGB 3M8AA 2RMKB 2HHHO 4DR7B 2FTKA 2CE4A 1GRJA 1Y67A 5C8YB 5FPRA 1QNMA 4JAAA 2IM9A 3UT5B 1WNSA 4JYAB 2CAZC 1IBMB 4TOIA 2OTLV 1K5QA 2BTQA 2QKAA 2K1EA 1QQCA 4NXNB 1YITV 3OTFA 4JZ2A 1YVWA 2YIAA 3E8BA 3TXSA 4DV0B 3E35A 3H01A 4JTDB 1P4RA 4B3MB 3KZIZ 4YHHB 1EN6A 1IURA 4X8AA 3P30A 2PY5A 1NZ6A 4ZHQA 4X1IA 3ZRWB 3VQYA 3LNNA 1ZL8A 2Y0PA 4MT8A 1KP3A 4K8XA 3EVKA 3KG2A 3AG4C 5H6QA 2XOKG 5LHGA 1HNXB 3VOUA 4PA7A 4JI8O 4K8ZA 5LL6Y 2RN9A 3TETA 5EZYB 4W4LA 4CZZA 2W6IG 1XNQO 4I9WA 3CRQA 4DV4B 2VWKA 4DR2B 1Y74A 4ZI7B 4NR1A 5BR8B 4TQDA 1G6UA 2BOBC 2ZNIA 3FAVA 4NKGB 3CCSV 4ZI7A 3JAMN 4LF4B 1YJWV 4QGPA 3SPHA 1HP8A 3D36A 1DLBA 3ZMSA 3SPCA 2A3QA 3CCUV 3O65A 1KC8W 1FFXA 4ABMA 4FM2A 4Z1MG 4W4KA 3LNMB 1NH2B 4I55B 4BW9A 5H9CA 3CJHA 3QVNA 3D36C 2EINB 3JYCA 4UCVA 2JS3A 3W7UA 2A79B 1F23A 2EX3A 4DV3B 1YHQV 4CS3A 1GM8A 3L71H 2QM7A 1H38A 1PL4A 1U96A 3SJCC 1Q81W 1NTMH 5CA1A 4DYLA 2CTQA 2QWRB 2Q7GA 3DXRB 1WB7A 3KKYA 4YJ3A 4YXWG 4JI6B 3WB2A 1ZWIC 3FD9A 4UCUA 4LF6O 4JTCB 3HKCA 4FPPA 1W0KG 2R9RB 5B3SC 3E22B 2P7TC 3OR6C 4B7KA 4LF6B 2BCCH 1Y74B 4O4IA 3C3TA 1VQOV 4O4IB 3UQ8A 2JJ1G 1N33O 2ATKC 2LJ2A 1XEQA 4GX1A 2DW4A 2K9PA 3G71V 4X66B 5LYJA 2H94A 4I4TA 3RBZA 3SYQA 1PP9H 2UXBB 3LSSA 1KUQA 3QG5A 3VQVA 3P3PA 1PM9A 1PNLA 4JYAO 1GKFA 3SJBC 1SQQH 1UJWB 4NXNO 1IZ3A 1V54C 5H6RA 4JAVA 2N74A 2FMLA 2Y4TA 3OFNG 5A2QN 1SQPH 1K73W 4R6ZA 3JAKB 3ICXA 2EIMB 1ENVA 2IJJA 1K97A 1S3JA 1MABG 4J9YB 3A0BZ 1VIBA 4J7ZA 2H8PC 5L3EA 4JZGA 3C3SA 4L8JA 4OGQB 4FJCC 1S76D 2CGNA 3H1IH 4X64O 1OCCB 2QE7G 1PKXA 2IH3C 3STZC 4TT3G 5IYCO 1VQ4V 1MSDA 1M9NA 1PNMA 3E8GA 2UUCB 4U7NA 3DSQA 4I50A 3HR0A 1HNWB 4BIOA 3TJTA 1K33A 3JSNA 1JA8A 2ZKOA 4I0XB 1SZXA 1CP9A 2WSSG 3JATA 4JI6O 4J80A 2R72A 1IXMA 4PJ0Z 5JQGB 2IU0A 2JK5C 3CB2A 4I0XA 3ZHTA 5B1AB 2M7WA 2RQ6A 2QKCA 1E1RG 1TVKB 1I5YA 3HKEA 3CP1A 2V1DA 4QE7A 5JCOA 3RVYA 4DR5B 3L70H 2HHHB 3AK3A 3QF7A 4FFKA 1GMGA 2ITDC 2F95B 4BIUA 3CXCU 3CRRA 2JGDB 3MD0A 5LBQA 1MMMA 4JAUA 3RYCB 4BR6A 5CA0A 1JQ0A 2WWWA 4H13B 2OYQA 3JCUZ 3SYAA 2ARHA 2N04A 2UXBO 4EKWA 2F4VO 4O2BB 3ZRSA 4PDRA 5FLXN 3VQXA 3OTOO 2P4VA 1SQFA 2E76B 3A0RA 4EEQA 4B3MO 1L1FA 1YF2A 1AP6A 2OTJV 1N34B 2HP8A 2BSKB 1EN4A 1YIJV 1Q6UA 3VQWA 2FKXA 5AG2A 3AG3C 3B09A 4O4JA 5JVDB 3RYFA 2DYRB 2CDYA 4TV8B 5EBWC 4O4JB 1N4CA 3B40A 2LP7A 2P06A 1TVKA 1V55C 1KB9F 4ZKIA 2WPDG 5KUKA 5C8YA 4QPJA 2EULA 4MVQA 1EBOA 4Q20A 2JGUA 4FLYA 2UUCO 2EINC 5EYPA 3CX5F 1NH2D 2ADQB 5ITZB 2WLHA 2BTQB 4DR3B 4X20A 4X9QA 1FS0G 3CC7V 4AILC 1H8EG 2QTSA 4DRXA 1BCCH 3WG7C 1S5LZ 1JOYA 3KCXA 3BAAA 4DRXB 5LGUA 2LGQA 4TSFG 1V54B 3E89A 2HR3A 3JALA 2PUSA 5L3GA 4FM1A 5E1AC 4GX0A 2GDSA 4JPRA 3G4SV 3BFRA 5CMUA 2VQFO 1R3JC 3HPLC 1MG1A 4OX9B 2EJ7A 1M57B 4WF9V 4LNUA 4LF8O 4JYYA 3L72H 1VF5B 2RDCA 2VS0A 2CTRA 2CH7B 3AG4B 2HLDG 1OCRB 1ORQC 4P9OA 3RT3C 3T4ZA 2VQEB 3OMIB 3FKSG 1H2MA 3CD6V 4LWSB 5DM6V 3CHXA 2JS5A 4GX2A 1G1XB 1R6KA 4TWKA 3ZIAG 1RSOB 1K5SA 2IJKA 1VQ6V 5ITZA 4NXMO 5BXZA 4TUYA 4LH7A 5LMNB 4KP4A 1AROP 2ITCC 1WP7A 4LBEC 1XHZA 3OGCC 1ZAUA 1NVPB 2Q8VA 2B9ZA 1SA0B 5K1XA 1HNZB 5KHKA 1O9HA 5IWAO 4KL1A 3G80A 4ASUG 1I7FA 2NR5A 1K9MW 4DV5O 4CH4A 3F5WC 4DV6B 1YJ9V 1V9PA 1RM1B 2AGAA 3JASA 4I5SA 3AG2B 4JV5O 3ZN0A 4JI5O 4DR4O 3K0GA 2JDIG 2ZD9A 1B04A 2ZXWB 4NTWA 1WN7A 2Y69C 4CH5A 5DN6G 1JVMA 3ASNC 5KUMA 4B3TO 5CBFA 3FAVB 1JR9A 4D6TH 1M56C 5IYDO 5LP6A 2HFEC 1PPJH 2HEPA 4CH6A 2JEUA 1BMFG 2EZOA 2DMXA 4DV4O 4OX9O 4X65B 2F23A 3FYIB 1GM7A 1NU1H 1EFRG 4DV2O 3B77A 1N32O 1SA0A 4D7SA 5A9GA 3TXQA 5CBGA 1XMQB 2Q9LA 4JI2O 3CC4V 1M4UA 4DR5O 3ZHUA 4RUEA 3QO8A 1CPYA 3IAYA 1XDCA 3DXRA 3RYHA 4I7ZB 5KX5B 4WBNB 2Q7EA 1Y66A 1F4NA 2AHYA 3W7XA 4RUFA 2YSUB 4DV7O 2HG5C 1AVMA 3W7TA 1FJGB 4JI4O 1MZFA 1AB3A 3FB6C 4X1YA 1FJGO 4DV1B 2ZM6B 4U7OA 3BA9A 2F4VB 5JQGA 1QVFU 4MVMA 2H3OA 4YIPA 5JWPA 3G6EV 2DWDC 4J42A 5B1NA 3ZCCA 4JI3B 1NJIW 2WLMA 2QJ1A 4JI7O 4UCOA 1N34O 2UUAO 2QWNB 1OZ0A 3J81N 2PI4A 2L6LA 2LFSA 3OW2U 2QWOB 2WLNA 5IYZA 1CXZB 4UV8A 2DJVA 1H2NA 1SS3A 1XL4A 1Q6HA 5IYZB 2OWOA 3GB7C 4PA3A 1VF6A 1AI7A 2JJ2G 1I0HA 3ZEDA 2EIJB 2Q4PA 1M57C 1FXKC 2F1MA 1PV0A 2Q6AA 1FXVA 4H37A 2IJIA 3HKCB 2JVDA 4O2BA 4JF3A 3D3QA 2Q68A 3BPZA 3AG7A 3BA8A 2OCCC 5CB4B 5GTIZ 1I94B 5BR8O 2Q69A 1S72V 4OPHA 1S0VA 3CCJV 4LF4O 4BAYA 2YICA 4AI8A 4ICGA 1FXKA 3SYCA 1D5AA 1R1BA 4HAMA 1SQXH 1JX9A 1DF4A 1Z5VA 2F43G 2QR4A 1YXBA 3PJSK 4PELA 4UB8Z 2ZIMA 3THOA 1LNQA 1TGOA 4GUNA 2UUBB 3EXAA 5GW7A 5KLVH 3ETDA 2YXHA 2WLLA 1U97A 4E4EA 3ZHRA 5CBHA 4DV3O 4X62B 1AILA 1XBLA 2B1IA 1NR1A 4GCZA 4KXRA 3ZHSA 5FPOA 4JI4B 2DYRC 4FFBB 3RYIA 1VARA 2YC0A 5IJ9B 1OJHA 1SQVH 4CH3A 3FFQA 5IJ9A 4K35A 2EILC 2ZIOA 3F7YC 4GKKB 4YJ2B 3A2FA 3T1YO 3M99B 3N2GA 4DR6B 2QTOA 1S5HC 2WLIB 3JALB 2XAGA 4KFMA 3CYOA 3TGUH 4PA4A 2ZDIC 3CXHF 1Y76B 2Q7HA 5EBMC 1YCIA 2Q73A 3EFFK 3BABA 4I50B 3HB3B 4FLZA 1IDSA 5J9PC 4OXSA 4O2AB 2P5OA 3CMAV 2HJDA 1DK1A 1H2KA 2R9IA 1QVGU 1QR9A 3J80N 2OIEA 1KBHA 2LQTA 1BZKA 3JCZA 4I4TB 1D5NA 2ZDIA 5L3FA 1GAXA 4J9ZB 2PZSA 3JARB 2WLLB 1OHHG 2IH1C 3EHBB 3JARA 3Q4HB 3ZX6A 2O57A 4JASA 5IE9A 1RP3B 4JI5B 4LF7B 3SGIA 3RYIB 4Z1VA 4ZBMA 3OM3B 1QBZA 3U10A 4F6RB 1EM1A 3DC5A 5H5NA 2GUZA 1XNRO 1TAEA 4F6EA 4OPAA 2YEVB 1IX9A 4U3JB 1IBLB 4LF5O 4Q6GA 4QPKA 1OCRC 2X7RB 1GN6A 1OCOC 4AQYB 1J95A 4LF8B 1PL0A 2QM8A 1YSCA 2D3OW 3CS5A 3OT7A 5JJJB 3WFVA 4L87A 1ZX3A 3DC6A 4LF9O 4J7JA 4PDMA 4GX5A 4IT5A 2DQ3A 1IVSA 4UVCA 4XDKA 3JD1A 3SDLA 1KYOF 3QO5A 3T4DA 1TUBA 2WAMA 4GZRB 1K4CC 2CTWA 4DK0A 2B1GA 5EBLC 3NXSA 2EIKC 3I55V 1B6QA 3K3WA 3UO2A 1N8RW 4CS4A 5H2FZ 3T1CA 4B3SB 2BTOA 2DQ0A 4RWUA 4QIWF 4NTYA 4DUYO 3ZHQA 5LMNO 1EZVH 2HKOA 2M6YA 2GBOA 1AR1B 3SJQC 2QGNA 3ASOC 1NS1A 2GV9A 2DWEC 2YDEA 2Q0AA 2V4DA 4WCEV 2QWPB 1VEWA 1WA8B 2BOCC 1VQMV 4ZOLA 5J2UB 5LOVB 1R3LC 4NXMB 1LUWA 5B1BB 5KHIA 3CPWU 2KG7A 1CEZA 2E75B 1Q3EA 5EC2C 4RQEA 2HVJC 4KHPO 4MW3A 5KX5A 2QEXV 5LHIA 1JJOA 3JD3A 4UCTA 2PYJA 2YI8A 3LDCA 1VQNV 4WFHA 4JI0O 1AP5A 3IC7A 1HR0B 1NI8A 4HYOA 4FLXA 4TV8A 4X65O 5HFLA 2JRIA 3JSLA 1TUEB 2QA4V 1HDJA 3E8FA 1YI2V 2MK3A 4J11A 3ABTA 2AZ2A 1BL8A 2ZR3A 1FFXB 1QU7A 3ASOB 2P4KA 1Q90D 1I94O 5EYPB 1AJQA 5TISZ 4N21A
chains in the Genus database with same CATH topology
2KB1A 2K1EA 4MVZA 3ZN0A 1YITV 2EZPA 3E8BA 3E35A 3K0GA 1P7BA 1VQLV 3ABMC 2JDIG 3H01A 4JTDB 1BHAA 3RVZA 1P4RA 2ZD9A 2ZXWB 1AI6A 2Q67A 2Y69C 1QCEA 5DN6G 4X8AA 4MVOA 1JVMA 3ASNC 3P30A 2A0LA 5KUMA 3ZRWA 1W2BU 2EIKB 5CBFA 1YTFB 1M56C 5IYDO 4WFFA 4UVAA 2HFEC 3ZRWB 4MT8A 2JEUA 1BMFG 1KP3A 2EIMC 3KG2A 3CCLV 4LP8A 2EZOA 3AG4C 1G4YB 2XOKG 5H6QA 5LHGA 5KA6A 3F7VC 3T2MA 3VOUA 4PA7A 3ABKB 2CK3G 4RO2A 3FYIB 3TETA 1GM7A 4CZZA 2W6IG 1EFRG 4I9WA 2ZR2A 3B77A 4JYBA 2BOBC 3ABLC 1H2GA 5CBGA 3K03A 3CCSV 2Z3YA 3FB7C 1YJWV 3SPHA 1KKDA 3D36A 3CCQV 1DLBA 4JYCA 3CC4V 2EIJC 4JGSA 3SPCA 3ZMSA 3X2QC 3CCUV 2C2AA 1SZTA 4MTFA 4RUEA 4BIZA 3QO8A 1KC8W 1JJ2U 1DF5A 4FK5C 1CPYA 1THZA 1V55B 4HZ3A 1QLEC 3OAAG 4Z1MG 1VQ7V 4PDVA 3CCEV 3LNMB 1NH2B 3ZRVA 1Y66A 1F4NA 5H9CA 1R73A 4F4LA 2X6AA 2AHYA 2OCCB 4RUFA 3W7XA 2EINB 3JYCA 3JD0A 3IFXA 3W7UA 2W6JG 1F4MA 2A79B 1F23A 1YHQV 2YSUB 1GM8A 3BEHA 1GM9A 2HG5C 3W7TA 1Y4MA 4XDJA 2QM7A 1FXKB 1H38A 1EZJA 1Q81W 3FB6C 4X88A 1NR7A 1GTOA 4U7OA 1RM1C 5IDJA 1QVFU 3K08A 4MVMA 4YXWG 1WPXA 1ZWIC 3B8MA 3G6EV 2WLKA 3OMAB 1YJNV 1K3EA 1VQPV 2DWDC 4MS2A 5B1NA 3ZCCA 3K79A 1AJNA 1NJIW 4JTCB 2WLMA 3ZMUA 4FPPA 4LC1A 1W0KG 2R9RB 5B3SC 1DTOA 2P7TC 1OZ0A 3JD2A 3OR6C 2PI4A 1MOFA 2LFSA 4MTOA 1QR8A 3OW2U 2WLNA 4MVSA 3AG1C 4UV8A 5IYBO 3ZN1A 2XAJA 4DXWA 1XL4A 1K34A 3GB7C 1VQOV 4PA3A 1AI7A 2JJ2G 2JJ1G 2ATKC 3R65A 4GX1A 2DW4A 4X89A 2EIJB 4WFGA 1XL6A 3G71V 1M57C 1FXKC 2GHYA 2Q6AA 1FXVA 4H37A 2H94A 3RBZA 2IJIA 2B5UA 3SYQA 3TCUA 3ABLB 3LSSA 4JF3A 1Q82W 2Q68A 1BHBA 2NNUA 5C93A 2OCCC 1YTFD 1PNLA 1GKFA 3OEHG 3E83A 2Q69A 1S72V 1UJWB 1S0VA 3CCJV 1V54C 2XASA 4BAYA 5H6RA 4JAVA 3LUTB 3OFNG 1QLEB 1FXKA 1JCHA 1K73W 4R6ZA 2UXXA 3SYCA 2HVKC 2EIMB 1ENVA 2IJJA 4G28B 5L3BA 4P2ZA 1K97A 2W0FC 4HAMA 1S3JA 4JTAB 2X6BA 1JX9A 1DF4A 1MABG 2F43G 2NLJC 4J9YB 2UXNA 3GWOA 1OCCC 1H8HG 3PJSK 4PELA 5KA5A 1K8AW 4XBFA 3CCVV 2JIZG 2H8PC 5L3EA 1SERA 4MVRA 3AEIA 2IU3A 1LNQA 1KD1W 1R6NA 1PNKA 1SESA 4FJCC 1S76D 5GW7A 2Z5UA 1OCZC 1OCCB 1R3IC 2QE7G 3ETDA 2WLLA 1PKXA 4BW5A 2IH3C 3STZC 3FB8C 3ABKC 1RPRA 3QO7A 4TT3G 3FYEB 4FIPC 5CBHA 5IYCO 2GSMB 1VQ4V 4UXNA 2EJRA 1M9NA 1AI5A 1PNMA 2B1IA 3E8GA 3OUSA 4MTXA 1NR1A 4GCZA 4U7NA 2DYRC 3QNEA 1M1KW 1GO3F 1K33A 1SETA 1AJPA 4LCUC 1NBMG 4GT1A 5LGTA 1CP9A 2WSSG 2EILC 3LSQA 3F7YC 4G2KA 4E2LA 1IXMA 3ABMB 3OEEG 3K0DA 2IU0A 2JK5C 2ZXWC 5B1AB 2M7WA 3M99B 1E1RG 1Q7YW 1I5YA 2QTOA 1S5HC 1GK9A 2WLIB 2A9HA 3CP1A 2XAGA 4KFMA 2V1DA 3CYOA 3AG2C 4PA4A 5EC1C 2ZDIC 4QE7A 3K04A 3RVYA 2P6JA 2ZQMA 3EFFK 2X6CA 5EBMC 1K4DC 3SPJA 3ZMTA 3HB3B 3UM7A 1GMGA 2ITDC 5HFMA 1W0JG 5J9PC 4OXSA 4BIUA 3CXCU 3ML0A 3MD0A 5LBQA 3CMAV 2LFRA 5B1BC 4JAUA 4QE9A 4R50A 1JQ0A 2QKSA 3ABUA 2R9IA 1JPXA 1QVGU 1QR9A 2WWWA 3SYAA 4CBCA 5L3CA 4PA9A 3JCZA 3ZMZA 4EKWA 2ZDIA 2IJHA 5L3FA 4J9ZB 2XNDG 3LDEA 3ZRSA 4PDRA 4RAIA 2OT5A 2XAHA 2WLLB 3OMNB 3A0RA 4H33A 1OHHG 3IGAC 4WFAV 2IH1C 3EHBB 3P32A 1L1FA 2IW5A 3AG1B 4KUMA 1FFTB 3TK1A 4JASA 3DGEA 2OTJV 3SYOA 2XAQA 1K92A 1R3KC 1Q86W 4MSWC 1YIJV 4ZBMA 3OM3B 1WLEA 1QBZA 2P90A 4PDLA 3LDDA 5CA3A 1VQKV 3AG3C 2YEVB 4QPKA 1OCRC 3FB5C 2X7RB 2DYRB 3D3IA 1OCOC 5IY5C 5EBWC 4QNHB 2LP7A 1V55C 3ETGA 4PA6A 4ZKIA 2WPDG 3WG7B 5KUKA 1J95A 2JEXA 5BZBA 1PL0A 2WLJA 4QPJA 2QM8A 4MVQA 3STLC 3X2QB 1YSCA 2D3OW 1EBOA 1G8MA 4Q20A 5B1AC 3E86A 2AHZA 1I5XA 3SYPA 3WFVA 1OCZB 4L87A 2EINC 3OUFA 1NH2D 1KP2A 1K7DA 2DYSB 5B1OA 3ZMVA 1E1QG 2WLHA 4PDMA 1KECA 5EK0A 1E79G 4GX5A 2DQ3A 3W7SA 4UVCA 1FS0G 2V7QG 3CC7V 3K9AA 4XDKA 3JD1A 1H8EG 4P9PA 4WFEA 3QO5A 3DTUB 3T4DA 4P30A 3MHSC 2WAMA 2X0LA 3WG7C 4UVBA 1K4CC 1JOYA 3I56V 5LGUA 5LHHA 1VQ5V 1HWYA 4TSFG 1MSWD 1V54B 3E89A 4G27B 1RPOA 2B1GA 5EBLC 2WLIA 3NXSA 2EIKC 3K06A 2HR3A 3ASNB 5L3GA 3I55V 3CCRV 1B6QA 2DYSC 3E8HA 3K3WA 5E1AC 3ZJZA 2Y69B 4GX0A 1N8RW 4JPRA 3G4SV 4QJFB 4DO2A 1M90W 5CMUA 3T1CA 1R3JC 3HPLC 2DQ0A 1MG1A 3VBBA 1PD3A 4QIWF 1M57B 4WF9V 2PI5A 2HKOA 2EBOA 3CCMV 1AR1B 4RQFA 4UV9A 3AG4B 1OCOB 2YEVA 5IY5B 3W7WA 3SJQC 2HLDG 3ASOC 1AI4A 1OCRB 1ORQC 1ROPA 4MTGA 3B8NA 2DWEC 4P9OA 4UUJC 2HJFC 3OMIB 3T4ZA 3FKSG 1COWG 4WCEV 3CD6V 1M56B 3ZRXA 5DM6V 4GX2A 2BOCC 3AG3B 1VQMV 1R6KA 4TWKA 1R3LC 1S77D 3ZIAG 1K5SA 4R8CA 3BY6A 4R7CA 4WFBV 3MHHC 5B1BB 3SPGA 3UKMA 5LGNA 1NKDA 2IJKA 3CPWU 5CN0A 1VQ6V 5FL7G 1CEZA 4FMTA 5EC2C 4RQEA 4MW8A 2HVJC 3SPIA 4MW3A 2QEXV 3E2EA 4KP4A 1AROP 5LHIA 2ITCC 2P67A 4LBEC 1NVPD 3JD3A 1F51A 4XDLA 3LDCA 3OGCC 1VQNV 4N23A 2XAFA 3ETEA 1NVPB 1NQTA 4WFHA 3JD4A 1VQ8V 1QLNA 3IC7A 4HYOA 1SRYA 4MVUA 5HFLA 5B3SB 2FTKA 4ASUG 3CMEV 1K9MW 2EILB 1TUEB 3F5WC 2QA4V 3RW0A 3E8FA 3OE7G 1YI2V 3CC2V 2MK3A 1KQSU 1YJ9V 3ABTA 1BL8A 2ZR3A 3ASOB 1FXHA 1RM1B 1VQ9V 5L3DA 1AJQA 2Y48A 4I5SA 2OTLV 3OR7C 1K5QA 3AG2B 4N21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4D A;  4P30 A;  2KB1 A;  2K1E A;  2ZXW C;  4JTC B;  4MVZ A;  2WLM A;  4P9P A;  3WG7 C;  1K4C C;  2R9R B;  3E8B A;  5B3S C;  3K0G A;  2P7T C;  1P7B A;  3ABM C;  2QTO A;  1S5H C;  2WLI B;  3OR6 C;  4JTD B;  3RVZ A;  2A9H A;  2ZD9 A;  4MTO A;  4KFM A;  3E89 A;  2Q67 A;  2Y69 C;  4G27 B;  3AG2 C;  4PA4 A;  2WLN A;  4MVS A;  5EC1 C;  3AG1 C;  4X8A A;  4MVO A;  4QE7 A;  1JVM A;  2WLI A;  3ASN C;  2A0L A;  2EIK C;  3K04 A;  5EBL C;  3K06 A;  5KUM A;  3RVY A;  5CBF A;  4DXW A;  2DYS C;  1M56 C;  1XL4 A;  2X6C A;  3E8H A;  1K4D C;  3EFF K;  5E1A C;  5EBM C;  3SPJ A;  3GB7 C;  4GX0 A;  3UM7 A;  4WFF A;  4PA3 A;  2ITD C;  2HFE C;  3T1C A;  5J9P C;  4OXS A;  1R3J C;  3HPL C;  2ATK C;  2EIM C;  3R65 A;  3KG2 A;  4LP8 A;  4GX1 A;  3AG4 C;  4X89 A;  1G4Y B;  4WFG A;  1XL6 A;  4QE9 A;  4R50 A;  1M57 C;  3F7V C;  5B1B C;  2QKS A;  2Q6A A;  4H37 A;  3T2M A;  3RBZ A;  3VOU A;  4PA7 A;  4RO2 A;  3SYQ A;  3TCU A;  3SYA A;  4CBC A;  3TET A;  4PA9 A;  2Q68 A;  2YEV A;  3SJQ C;  4EKW A;  4I9W A;  2OCC C;  3ASO C;  4J9Z B;  1ORQ C;  3ZJZ A;  4UUJ C;  4MTG A;  4P9O A;  2DWE C;  3T4Z A;  2HJF C;  3LDE A;  4PDR A;  3ZRS A;  4RAI A;  3E83 A;  2Q69 A;  2WLL B;  4H33 A;  3IGA C;  2BOB C;  3ABL C;  2IH1 C;  4GX2 A;  1V54 C;  2BOC C;  3K03 A;  5CBG A;  3FB7 C;  4TWK A;  1R3L C;  3LUT B;  3SPH A;  4R8C A;  4R7C A;  1KKD A;  2EIJ C;  4R6Z A;  3SPC A;  3SPG A;  3SYO A;  3UKM A;  4WFE A;  2HVK C;  3SYC A;  3X2Q C;  4G28 B;  4MTF A;  4RUE A;  1R3K C;  4P2Z A;  2W0F C;  5EC2 C;  4MSW C;  4JTA B;  4MW8 A;  2X6B A;  2HVJ C;  4ZBM A;  4HZ3 A;  3SPI A;  1QLE C;  2NLJ C;  4J9Y B;  4MW3 A;  1OCC C;  3PJS K;  3LDD A;  4PDL A;  4PDV A;  2H8P C;  2ITC C;  3AG3 C;  4MVR A;  4LBE C;  3LNM B;  1LNQ A;  4XDL A;  1OCR C;  3FB5 C;  3LDC A;  3OGC C;  1OCO C;  4F4L A;  5IY5 C;  5EBW C;  2X6A A;  1OCZ C;  1R3I C;  4WFH A;  4QNH B;  2AHY A;  4RUF A;  2WLL A;  4BW5 A;  2IH3 C;  1V55 C;  3FB8 C;  3ABK C;  3JYC A;  4HYO A;  4PA6 A;  4MVU A;  3IFX A;  3STZ C;  5CBH A;  1J95 A;  5KUK A;  2A79 B;  5BZB A;  2WLJ A;  4MVQ A;  3STL C;  3BEH A;  5B1A C;  2HG5 C;  3E86 A;  2AHZ A;  3E8G A;  3OUS A;  3F5W C;  4XDJ A;  3RW0 A;  3E8F A;  3SYP A;  2EIN C;  1BL8 A;  3FB6 C;  2DYR C;  3OUF A;  4X88 A;  2WLH A;  4PDM A;  5EK0 A;  4GX5 A;  4LCU C;  3K08 A;  4MVM A;  1ZWI C;  4MS2 A;  2EIL C;  4XDK A;  2WLK A;  3F7Y C;  3OR7 C;  2DWD C;  3K0D A;  2JK5 C; 
#chains in the Genus database with same CATH topology
 2KB1 A;  1IBK B;  3CJH B;  2EZP A;  1P7B A;  3MAQ A;  3RVZ A;  5JCO C;  1AI6 A;  1XOU A;  1L8D A;  2Q67 A;  4MVO A;  2A0L A;  1W2B U;  3ZRW A;  2RNB A;  3U0Z A;  4X1I B;  4YJ3 B;  4IYI A;  5KA6 A;  3T2M A;  4RO2 A;  3BHP A;  3RYH B;  1SKV A;  1IBM O;  4LFB O;  3E22 A;  3UO3 A;  2ODM A;  1XRE A;  2ZR2 A;  2ILM A;  2GTA A;  1XIL A;  4DUZ O;  1W59 A;  3ABL C;  4UFZ A;  3K03 A;  2Z3Y A;  5GTH Z;  1KKD A;  4JGS A;  2C2A A;  1SZT A;  4BIZ A;  5BY1 A;  1JJ2 U;  1DF5 A;  4FK5 C;  1THZ A;  1V55 B;  4K3A A;  1QLE C;  3OAA G;  4UB6 Z;  1VQ7 V;  3CCE V;  4FLV A;  4JI7 B;  2YS8 A;  1R73 A;  4I55 A;  3JD0 A;  1MZE A;  3IFX A;  1F4M A;  4B3R B;  2E5L O;  3CEI A;  3CRM A;  5KHJ A;  5CA1 B;  1N0N A;  1EZJ A;  5LP6 C;  3ZBH A;  4X88 A;  5EIB D;  1NR7 A;  3BRC A;  1GTO A;  1RM1 C;  3K5L A;  1WPX A;  3B8M A;  1YJN V;  3OMA B;  1VQP V;  4MS2 A;  3K79 A;  2YUA A;  2YXL A;  4H44 B;  1P49 A;  4LC1 A;  3T1H B;  1Q5O A;  3CSX A;  3JD2 A;  4MTO A;  1QR8 A;  4NVP A;  4MVS A;  2RJZ A;  3AG1 C;  3WB1 A;  4DR1 B;  3NR7 A;  3ZN1 A;  2XAJ A;  4DXW A;  2OCH A;  4DK1 A;  3L73 H;  5IJ0 B;  5LP6 B;  1YZB A;  4X89 A;  4WFG A;  1XL6 A;  1Q6I A;  2GHY A;  2R70 A;  4FVM A;  2B5U A;  3TCU A;  5GON A;  3ABL B;  5LA6 A;  1Q82 W;  1BHB A;  4YY3 O;  2NNU A;  5C93 A;  3U11 A;  3A8T A;  3OEH G;  3OD4 A;  3E83 A;  2E74 B;  4FLW A;  1IBK O;  2XAS A;  2BE3 A;  3LUT B;  5D5P A;  2VRZ A;  1JCH A;  2UXX A;  2A7W A;  3P3N A;  4P2Z A;  2W0F C;  2Q5Z A;  4TV9 B;  2UXN A;  1OCC C;  1H8H G;  4B08 A;  3L74 H;  1SER A;  4MVR A;  3AEI A;  1KD1 W;  3K57 A;  4IL6 Z;  2Z5U A;  1OCZ C;  2DOS A;  4BW5 A;  3ABK C;  3FYE B;  4FIP C;  4BWA A;  2Q0O C;  4EFE A;  4UXN A;  1AI5 A;  3OUS A;  1Y76 A;  4Z2W A;  1M1K W;  1SF9 A;  5J2T A;  3T1Y B;  1WB8 A;  1SET A;  4JV5 B;  1Q8I A;  4LCU C;  1NBM G;  4AHC A;  5J2T B;  4GT1 A;  5LGT A;  3LSQ A;  4G2K A;  5LYJ B;  3AK2 A;  3RYF B;  3OEE G;  5E79 Z;  4E2L A;  3K0D A;  5JVD A;  1BQZ A;  5GON B;  2UUA B;  5LA6 B;  2VWJ A;  4DV1 O;  4DR2 O;  4EB6 B;  1GK9 A;  4O4L A;  1LUV A;  5EC1 C;  3K9S A;  4KHP B;  5EIB C;  1XMO B;  1ZLZ A;  2LW7 A;  3K5O A;  2ZQM A;  2X6C A;  3SPJ A;  1K4D C;  1HNX O;  3UM7 A;  3H1H H;  1W0J G;  3K59 A;  1Z5W A;  2LFR A;  1H2L A;  5B1B C;  1XQ8 A;  4QE9 A;  4TV9 A;  4R50 A;  2LW1 A;  1L0N H;  3K5M A;  4EFB A;  5L3C A;  4IIJ B;  4PA9 A;  1VF6 C;  3WU2 Z;  2IJH A;  1RFY A;  3LDE A;  4PV1 B;  2XAH A;  1HNW O;  4H33 A;  3IGA C;  4WFA V;  3P32 A;  2IW5 A;  3AG1 B;  1X4T A;  4KUM A;  1X59 A;  2L35 A;  3TK1 A;  3DGE A;  4X1K A;  3SYO A;  3N2K B;  4O2A A;  4DR1 O;  1R3K C;  1GN3 A;  1KMI Z;  3CE2 A;  1Q86 W;  4X1K B;  2P90 A;  3FX7 A;  3LDD A;  1US6 A;  3H1K H;  3G67 A;  2NN4 A;  3JAT B;  3SR2 C;  4DV2 B;  5IY5 C;  1OV9 A;  1TA8 A;  3S3W A;  2RCV A;  4FZ1 A;  4DV7 B;  1N36 O;  2XT9 A;  2JEX A;  5BZB A;  2WLJ A;  1FYJ A;  2UU9 O;  1G8M A;  3GWK C;  3E86 A;  3L9D A;  3SYP A;  3HKB A;  4B7E A;  3OUF A;  4PHZ A;  4DV0 O;  1K7D A;  4I9Q A;  2LGW A;  2DYS B;  4X20 B;  5B1O A;  4HBN A;  5DEC A;  1E79 G;  1WAZ A;  2GUZ B;  1SC5 B;  3RYC A;  2CTP A;  3K9A A;  4P9P A;  4WFE A;  4P30 A;  2X0L A;  4DR6 O;  1Z2G A;  4UVB A;  3SJA C;  5FNV A;  2XUM A;  5LHH A;  3IC9 A;  2W0X A;  2YXY A;  2P22 C;  3OGI B;  2QWQ B;  1S5J A;  4HNA B;  2WLI A;  4JI8 B;  3K06 A;  1WA8 A;  3ASN B;  1ZL8 B;  3ZJZ A;  4DUY B;  2Y69 B;  1XNQ B;  4QJF B;  1M90 W;  4JI0 B;  2BSK A;  1N0J A;  4PI0 A;  4DV5 B;  2CH7 A;  1J5E O;  1WPB A;  4A5U B;  4LFC B;  3CCM V;  4RQF A;  4UV9 A;  1VF7 A;  5IY5 B;  5D5Q A;  4UUJ C;  4MTG A;  3ETQ A;  2HJF C;  3A0H Z;  1RSO A;  1BGY H;  5KAI Z;  3PN1 A;  4DV6 O;  4JI1 O;  4D7T A;  1S77 D;  3BY6 A;  3SPG A;  3UKM A;  2PTM A;  5LGN A;  5B5E Z;  3R66 A;  3Q4H A;  4FMT A;  3LSU A;  4U3F H;  4LFA O;  3E2E A;  3WB0 A;  1BE3 H;  2P67 A;  3S3X A;  4XDL A;  4N23 A;  2XAF A;  1AR5 A;  3ETE A;  4AQY O;  5JH7 B;  3APO A;  5FNV B;  2UXC B;  4LR3 A;  5B3S B;  2UUB O;  3CME V;  1XNR B;  2EIL B;  4HNA A;  2UXC O;  2PF4 E;  3CC2 V;  3RW0 A;  3OE7 G;  1KQS U;  4J10 A;  1IXB A;  4UCS A;  2KKW A;  2GTS A;  4DUZ B;  3QTC A;  4DR7 O;  1FXH A;  2YIB D;  1VQ9 V;  4IHJ A;  4ZIB A;  5L3D A;  1BQ0 A;  1AR4 A;  2Y48 A;  3OR7 C;  2ZE5 A;  2F93 B;  4MVZ A;  5EZY A;  1VQL V;  3OTO B;  3ABM C;  1BHA A;  1NTK H;  1URF A;  3RGB A;  1KU9 A;  4GKK O;  1QCE A;  4LWS A;  2XTA A;  1B06 A;  3RN4 A;  3I5D A;  2EIK B;  5IWA B;  1YTF B;  5IJ0 A;  2Z0A A;  4WFF A;  4X1Y B;  4UVA A;  4YHH O;  1WJZ A;  4B3S O;  2EIM C;  3O9O A;  3CCL V;  4LP8 A;  5B66 Z;  1G4Y B;  3F7V C;  3ABK B;  2CK3 G;  2WA3 A;  4UCR A;  2DE0 X;  1ZUQ A;  1UFI A;  5JH7 A;  2G38 A;  3ZHV A;  4JYB A;  1H2G A;  2PGG A;  3FB7 C;  2N05 A;  3JAW A;  2DN9 A;  3CCQ V;  4NTX A;  4JYC A;  2EIJ C;  4ZOL B;  5J2U A;  4B3T B;  3X2Q C;  2OIG A;  1T5E A;  4MTF A;  1R6T A;  3JAW B;  1O9G A;  4K0K B;  4HZ3 A;  4DR3 O;  4LH6 A;  5IT9 N;  2KG7 B;  5JJE B;  4PDV A;  2ZIN A;  3JAS B;  3L75 H;  2ZNJ A;  3ZRV A;  5CB4 A;  3ZS8 C;  4CC5 A;  4F4L A;  2X6A A;  2OCC B;  4LFC O;  1FAF A;  2W6J G;  2FB5 A;  1GM9 A;  3BEH A;  4LF9 B;  1Y4M A;  4XDJ A;  5KMG A;  1FXK B;  3C90 A;  5IDJ A;  3D8C A;  3K08 A;  3UT5 A;  2WLK A;  2D2C B;  1K3E A;  1FPO A;  1P7G A;  2KSD A;  4EB6 A;  1AJN A;  3H1L H;  3ZMU A;  1UPG A;  1DTO A;  1I08 A;  2XHB A;  1MOF A;  2ETN A;  1H2S B;  1BT8 A;  1NTZ H;  4PI2 A;  5F2V O;  5IYB O;  1M93 A;  1K34 A;  3B4S A;  1NT2 B;  5CA0 B;  3JAK A;  3R65 A;  2VQE O;  1GH6 A;  4GKJ B;  3N2G B;  3APQ A;  4WBN A;  2Y4U A;  1YTF D;  4GKJ O;  1BS3 A;  5BMV B;  3AK1 A;  1QHT A;  3H9V A;  1QLE B;  1L0L H;  2HVK C;  4G28 B;  4IGG A;  5L3B A;  1MNG A;  4JTA B;  2X6B A;  3BCC H;  2NLJ C;  5KA5 A;  3GWO A;  1K8A W;  4XBF A;  4DW1 A;  2JIZ G;  3CCV V;  1FKA O;  2E5L B;  1GN2 A;  3G6B A;  2IU3 A;  1R6N A;  2AXT Z;  1PNK A;  1SES A;  4TQF A;  1R3I C;  1F7Y A;  2CUG A;  1JMK C;  3B2E E;  3FB8 C;  3HKE B;  1D2D A;  1RPR A;  3N27 A;  3QO7 A;  2IBZ H;  2GSM B;  1SQB H;  3HKB B;  1XMO O;  2EJR A;  5LXT B;  3MDS A;  4MTX A;  4FLU A;  4X64 B;  5LMU O;  1A32 A;  4YIO A;  4JI1 B;  1XUQ A;  5LXT A;  3QNE A;  1GO3 F;  5K1P A;  1AJP A;  1ZTE A;  4YJ2 A;  1KKC A;  2FYU H;  3ABM B;  2ZXW C;  4IIJ A;  3T1H O;  3CWB H;  2ZE7 A;  1YEW A;  1Q7Y W;  1VP7 A;  2YI9 A;  2A9H A;  1WP8 A;  1EN5 A;  1SQG A;  3AG2 C;  2ZE8 A;  1Y6X A;  5BMV A;  4H0L B;  3K04 A;  1XHX A;  4X62 O;  2P6J A;  4LF7 O;  3ZMT A;  4JI2 B;  2CGO A;  3CRA A;  5HFM A;  3ML0 A;  5KAF Z;  3ABU A;  2QKS A;  2UU9 B;  1JPX A;  1N32 B;  4CBC A;  4YY3 B;  3HKD A;  2LO1 A;  2ZE6 A;  3ZMZ A;  1M5I A;  2XND G;  5KHG A;  3HKD B;  2OT5 A;  4RAI A;  4FLT A;  3OMN B;  1LR1 A;  4LFB B;  1FFT B;  2YID A;  3UCS C;  1HW7 A;  2UXD B;  1MA1 A;  3RWR D;  2XAQ A;  1K92 A;  4FFB A;  2ZM6 O;  1XMQ O;  1HNZ O;  4MSW C;  2UXD O;  2QM4 A;  1FD9 A;  1ZSP A;  1WLE A;  4PDL A;  5CA3 A;  1VQK V;  4DW0 A;  4C7U A;  1GN4 A;  4PD4 F;  4JI3 O;  3FB5 C;  3D3I A;  2AZ0 A;  1XI1 A;  4QNH B;  2Y0I A;  4U3J A;  4O4H A;  3ETG A;  4PA6 A;  3WG7 B;  4X66 O;  1J5E B;  3STL C;  3X2Q B;  5B1A C;  3IJ4 A;  2AHZ A;  1I5X A;  1OCZ B;  1N33 B;  4J41 A;  5LMU B;  1KP2 A;  3J7A U;  1BSM A;  5DED A;  3ZMV A;  3GVM A;  1E1Q G;  1KEC A;  2ZCE A;  5EK0 A;  3W7S A;  1DGS A;  1TUB B;  1JFF A;  2V7Q G;  4K0K O;  4FZ0 A;  2A06 H;  4LNU B;  3DTU B;  2KQX A;  3MHS C;  3BVO A;  3I56 V;  4DR4 B;  1IBL O;  4LF5 B;  5JJN B;  4CC6 A;  1VQ5 V;  4J7K A;  4LFA B;  1HWY A;  1Q43 A;  1MSW D;  4G27 B;  1RPO A;  3CRC A;  4B3R O;  4O4L B;  4NYK A;  2PYL A;  3CCR V;  2DYS C;  3E8H A;  1HR0 O;  2FL4 A;  4DO2 A;  4GYC B;  4FM0 A;  3KCY A;  1VMG A;  4IYH A;  3VBB A;  1PD3 A;  3F5T A;  4F6R A;  2QDO A;  2JGD A;  2PI5 A;  4TUY B;  2QSA A;  2EBO A;  3M7M X;  2AW9 A;  1OCO B;  2YEV A;  3W7W A;  1AI4 A;  1ROP A;  3B8N A;  4NB5 A;  5LOV A;  4O4H B;  1COW G;  2MW2 B;  2ADP A;  1M56 B;  3ZRX A;  4CS2 A;  3AG3 B;  2ZT9 B;  4R8C A;  2E3C A;  4R7C A;  4WFB V;  4ZHQ B;  3MHH C;  2R9A A;  3RFR A;  1NKD A;  5CN0 A;  3K5N A;  2YIB A;  5FL7 G;  2F66 C;  4MW8 A;  2WA4 A;  3N2K A;  3SPI A;  3H1J H;  4GLX A;  4IHJ B;  1P84 F;  1JFF B;  1NVP D;  1F51 A;  3K58 A;  5KHH A;  1NQT A;  1B3Q A;  1N36 B;  3JD4 A;  2VQF B;  1VQ8 V;  1QLN A;  1SRY A;  4MVU A;  1YDX A;  5KMG B;  3M8A A;  2RMK B;  2HHH O;  4DR7 B;  2FTK A;  2CE4 A;  1GRJ A;  1Y67 A;  5C8Y B;  5FPR A;  1QNM A;  4JAA A;  2IM9 A;  3UT5 B;  1WNS A;  4JYA B;  2CAZ C;  1IBM B;  4TOI A;  2OTL V;  1K5Q A;  2BTQ A;  2QKA A;  2K1E A;  1QQC A;  4NXN B;  1YIT V;  3OTF A;  4JZ2 A;  1YVW A;  2YIA A;  3E8B A;  3TXS A;  4DV0 B;  3E35 A;  3H01 A;  4JTD B;  1P4R A;  4B3M B;  3KZI Z;  4YHH B;  1EN6 A;  1IUR A;  4X8A A;  3P30 A;  2PY5 A;  1NZ6 A;  4ZHQ A;  4X1I A;  3ZRW B;  3VQY A;  3LNN A;  1ZL8 A;  2Y0P A;  4MT8 A;  1KP3 A;  4K8X A;  3EVK A;  3KG2 A;  3AG4 C;  5H6Q A;  2XOK G;  5LHG A;  1HNX B;  3VOU A;  4PA7 A;  4JI8 O;  4K8Z A;  5LL6 Y;  2RN9 A;  3TET A;  5EZY B;  4W4L A;  4CZZ A;  2W6I G;  1XNQ O;  4I9W A;  3CRQ A;  4DV4 B;  2VWK A;  4DR2 B;  1Y74 A;  4ZI7 B;  4NR1 A;  5BR8 B;  4TQD A;  1G6U A;  2BOB C;  2ZNI A;  3FAV A;  4NKG B;  3CCS V;  4ZI7 A;  3JAM N;  4LF4 B;  1YJW V;  4QGP A;  3SPH A;  1HP8 A;  3D36 A;  1DLB A;  3ZMS A;  3SPC A;  2A3Q A;  3CCU V;  3O65 A;  1KC8 W;  1FFX A;  4ABM A;  4FM2 A;  4Z1M G;  4W4K A;  3LNM B;  1NH2 B;  4I55 B;  4BW9 A;  5H9C A;  3CJH A;  3QVN A;  3D36 C;  2EIN B;  3JYC A;  4UCV A;  2JS3 A;  3W7U A;  2A79 B;  1F23 A;  2EX3 A;  4DV3 B;  1YHQ V;  4CS3 A;  1GM8 A;  3L71 H;  2QM7 A;  1H38 A;  1PL4 A;  1U96 A;  3SJC C;  1Q81 W;  1NTM H;  5CA1 A;  4DYL A;  2CTQ A;  2QWR B;  2Q7G A;  3DXR B;  1WB7 A;  3KKY A;  4YJ3 A;  4YXW G;  4JI6 B;  3WB2 A;  1ZWI C;  3FD9 A;  4UCU A;  4LF6 O;  4JTC B;  3HKC A;  4FPP A;  1W0K G;  2R9R B;  5B3S C;  3E22 B;  2P7T C;  3OR6 C;  4B7K A;  4LF6 B;  2BCC H;  1Y74 B;  4O4I A;  3C3T A;  1VQO V;  4O4I B;  3UQ8 A;  2JJ1 G;  1N33 O;  2ATK C;  2LJ2 A;  1XEQ A;  4GX1 A;  2DW4 A;  2K9P A;  3G71 V;  4X66 B;  5LYJ A;  2H94 A;  4I4T A;  3RBZ A;  3SYQ A;  1PP9 H;  2UXB B;  3LSS A;  1KUQ A;  3QG5 A;  3VQV A;  3P3P A;  1PM9 A;  1PNL A;  4JYA O;  1GKF A;  3SJB C;  1SQQ H;  1UJW B;  4NXN O;  1IZ3 A;  1V54 C;  5H6R A;  4JAV A;  2N74 A;  2FML A;  2Y4T A;  3OFN G;  5A2Q N;  1SQP H;  1K73 W;  4R6Z A;  3JAK B;  3ICX A;  2EIM B;  1ENV A;  2IJJ A;  1K97 A;  1S3J A;  1MAB G;  4J9Y B;  3A0B Z;  1VIB A;  4J7Z A;  2H8P C;  5L3E A;  4JZG A;  3C3S A;  4L8J A;  4OGQ B;  4FJC C;  1S76 D;  2CGN A;  3H1I H;  4X64 O;  1OCC B;  2QE7 G;  1PKX A;  2IH3 C;  3STZ C;  4TT3 G;  5IYC O;  1VQ4 V;  1MSD A;  1M9N A;  1PNM A;  3E8G A;  2UUC B;  4U7N A;  3DSQ A;  4I50 A;  3HR0 A;  1HNW B;  4BIO A;  3TJT A;  1K33 A;  3JSN A;  1JA8 A;  2ZKO A;  4I0X B;  1SZX A;  1CP9 A;  2WSS G;  3JAT A;  4JI6 O;  4J80 A;  2R72 A;  1IXM A;  4PJ0 Z;  5JQG B;  2IU0 A;  2JK5 C;  3CB2 A;  4I0X A;  3ZHT A;  5B1A B;  2M7W A;  2RQ6 A;  2QKC A;  1E1R G;  1TVK B;  1I5Y A;  3HKE A;  3CP1 A;  2V1D A;  4QE7 A;  5JCO A;  3RVY A;  4DR5 B;  3L70 H;  2HHH B;  3AK3 A;  3QF7 A;  4FFK A;  1GMG A;  2ITD C;  2F95 B;  4BIU A;  3CXC U;  3CRR A;  2JGD B;  3MD0 A;  5LBQ A;  1MMM A;  4JAU A;  3RYC B;  4BR6 A;  5CA0 A;  1JQ0 A;  2WWW A;  4H13 B;  2OYQ A;  3JCU Z;  3SYA A;  2ARH A;  2N04 A;  2UXB O;  4EKW A;  2F4V O;  4O2B B;  3ZRS A;  4PDR A;  5FLX N;  3VQX A;  3OTO O;  2P4V A;  1SQF A;  2E76 B;  3A0R A;  4EEQ A;  4B3M O;  1L1F A;  1YF2 A;  1AP6 A;  2OTJ V;  1N34 B;  2HP8 A;  2BSK B;  1EN4 A;  1YIJ V;  1Q6U A;  3VQW A;  2FKX A;  5AG2 A;  3AG3 C;  3B09 A;  4O4J A;  5JVD B;  3RYF A;  2DYR B;  2CDY A;  4TV8 B;  5EBW C;  4O4J B;  1N4C A;  3B40 A;  2LP7 A;  2P06 A;  1TVK A;  1V55 C;  1KB9 F;  4ZKI A;  2WPD G;  5KUK A;  5C8Y A;  4QPJ A;  2EUL A;  4MVQ A;  1EBO A;  4Q20 A;  2JGU A;  4FLY A;  2UUC O;  2EIN C;  5EYP A;  3CX5 F;  1NH2 D;  2ADQ B;  5ITZ B;  2WLH A;  2BTQ B;  4DR3 B;  4X20 A;  4X9Q A;  1FS0 G;  3CC7 V;  4AIL C;  1H8E G;  2QTS A;  4DRX A;  1BCC H;  3WG7 C;  1S5L Z;  1JOY A;  3KCX A;  3BAA A;  4DRX B;  5LGU A;  2LGQ A;  4TSF G;  1V54 B;  3E89 A;  2HR3 A;  3JAL A;  2PUS A;  5L3G A;  4FM1 A;  5E1A C;  4GX0 A;  2GDS A;  4JPR A;  3G4S V;  3BFR A;  5CMU A;  2VQF O;  1R3J C;  3HPL C;  1MG1 A;  4OX9 B;  2EJ7 A;  1M57 B;  4WF9 V;  4LNU A;  4LF8 O;  4JYY A;  3L72 H;  1VF5 B;  2RDC A;  2VS0 A;  2CTR A;  2CH7 B;  3AG4 B;  2HLD G;  1OCR B;  1ORQ C;  4P9O A;  3RT3 C;  3T4Z A;  2VQE B;  3OMI B;  3FKS G;  1H2M A;  3CD6 V;  4LWS B;  5DM6 V;  3CHX A;  2JS5 A;  4GX2 A;  1G1X B;  1R6K A;  4TWK A;  3ZIA G;  1RSO B;  1K5S A;  2IJK A;  1VQ6 V;  5ITZ A;  4NXM O;  5BXZ A;  4TUY A;  4LH7 A;  5LMN B;  4KP4 A;  1ARO P;  2ITC C;  1WP7 A;  4LBE C;  1XHZ A;  3OGC C;  1ZAU A;  1NVP B;  2Q8V A;  2B9Z A;  1SA0 B;  5K1X A;  1HNZ B;  5KHK A;  1O9H A;  5IWA O;  4KL1 A;  3G80 A;  4ASU G;  1I7F A;  2NR5 A;  1K9M W;  4DV5 O;  4CH4 A;  3F5W C;  4DV6 B;  1YJ9 V;  1V9P A;  1RM1 B;  2AGA A;  3JAS A;  4I5S A;  3AG2 B;  4JV5 O;  3ZN0 A;  4JI5 O;  4DR4 O;  3K0G A;  2JDI G;  2ZD9 A;  1B04 A;  2ZXW B;  4NTW A;  1WN7 A;  2Y69 C;  4CH5 A;  5DN6 G;  1JVM A;  3ASN C;  5KUM A;  4B3T O;  5CBF A;  3FAV B;  1JR9 A;  4D6T H;  1M56 C;  5IYD O;  5LP6 A;  2HFE C;  1PPJ H;  2HEP A;  4CH6 A;  2JEU A;  1BMF G;  2EZO A;  2DMX A;  4DV4 O;  4OX9 O;  4X65 B;  2F23 A;  3FYI B;  1GM7 A;  1NU1 H;  1EFR G;  4DV2 O;  3B77 A;  1N32 O;  1SA0 A;  4D7S A;  5A9G A;  3TXQ A;  5CBG A;  1XMQ B;  2Q9L A;  4JI2 O;  3CC4 V;  1M4U A;  4DR5 O;  3ZHU A;  4RUE A;  3QO8 A;  1CPY A;  3IAY A;  1XDC A;  3DXR A;  3RYH A;  4I7Z B;  5KX5 B;  4WBN B;  2Q7E A;  1Y66 A;  1F4N A;  2AHY A;  3W7X A;  4RUF A;  2YSU B;  4DV7 O;  2HG5 C;  1AVM A;  3W7T A;  1FJG B;  4JI4 O;  1MZF A;  1AB3 A;  3FB6 C;  4X1Y A;  1FJG O;  4DV1 B;  2ZM6 B;  4U7O A;  3BA9 A;  2F4V B;  5JQG A;  1QVF U;  4MVM A;  2H3O A;  4YIP A;  5JWP A;  3G6E V;  2DWD C;  4J42 A;  5B1N A;  3ZCC A;  4JI3 B;  1NJI W;  2WLM A;  2QJ1 A;  4JI7 O;  4UCO A;  1N34 O;  2UUA O;  2QWN B;  1OZ0 A;  3J81 N;  2PI4 A;  2L6L A;  2LFS A;  3OW2 U;  2QWO B;  2WLN A;  5IYZ A;  1CXZ B;  4UV8 A;  2DJV A;  1H2N A;  1SS3 A;  1XL4 A;  1Q6H A;  5IYZ B;  2OWO A;  3GB7 C;  4PA3 A;  1VF6 A;  1AI7 A;  2JJ2 G;  1I0H A;  3ZED A;  2EIJ B;  2Q4P A;  1M57 C;  1FXK C;  2F1M A;  1PV0 A;  2Q6A A;  1FXV A;  4H37 A;  2IJI A;  3HKC B;  2JVD A;  4O2B A;  4JF3 A;  3D3Q A;  2Q68 A;  3BPZ A;  3AG7 A;  3BA8 A;  2OCC C;  5CB4 B;  5GTI Z;  1I94 B;  5BR8 O;  2Q69 A;  1S72 V;  4OPH A;  1S0V A;  3CCJ V;  4LF4 O;  4BAY A;  2YIC A;  4AI8 A;  4ICG A;  1FXK A;  3SYC A;  1D5A A;  1R1B A;  4HAM A;  1SQX H;  1JX9 A;  1DF4 A;  1Z5V A;  2F43 G;  2QR4 A;  1YXB A;  3PJS K;  4PEL A;  4UB8 Z;  2ZIM A;  3THO A;  1LNQ A;  1TGO A;  4GUN A;  2UUB B;  3EXA A;  5GW7 A;  5KLV H;  3ETD A;  2YXH A;  2WLL A;  1U97 A;  4E4E A;  3ZHR A;  5CBH A;  4DV3 O;  4X62 B;  1AIL A;  1XBL A;  2B1I A;  1NR1 A;  4GCZ A;  4KXR A;  3ZHS A;  5FPO A;  4JI4 B;  2DYR C;  4FFB B;  3RYI A;  1VAR A;  2YC0 A;  5IJ9 B;  1OJH A;  1SQV H;  4CH3 A;  3FFQ A;  5IJ9 A;  4K35 A;  2EIL C;  2ZIO A;  3F7Y C;  4GKK B;  4YJ2 B;  3A2F A;  3T1Y O;  3M99 B;  3N2G A;  4DR6 B;  2QTO A;  1S5H C;  2WLI B;  3JAL B;  2XAG A;  4KFM A;  3CYO A;  3TGU H;  4PA4 A;  2ZDI C;  3CXH F;  1Y76 B;  2Q7H A;  5EBM C;  1YCI A;  2Q73 A;  3EFF K;  3BAB A;  4I50 B;  3HB3 B;  4FLZ A;  1IDS A;  5J9P C;  4OXS A;  4O2A B;  2P5O A;  3CMA V;  2HJD A;  1DK1 A;  1H2K A;  2R9I A;  1QVG U;  1QR9 A;  3J80 N;  2OIE A;  1KBH A;  2LQT A;  1BZK A;  3JCZ A;  4I4T B;  1D5N A;  2ZDI A;  5L3F A;  1GAX A;  4J9Z B;  2PZS A;  3JAR B;  2WLL B;  1OHH G;  2IH1 C;  3EHB B;  3JAR A;  3Q4H B;  3ZX6 A;  2O57 A;  4JAS A;  5IE9 A;  1RP3 B;  4JI5 B;  4LF7 B;  3SGI A;  3RYI B;  4Z1V A;  4ZBM A;  3OM3 B;  1QBZ A;  3U10 A;  4F6R B;  1EM1 A;  3DC5 A;  5H5N A;  2GUZ A;  1XNR O;  1TAE A;  4F6E A;  4OPA A;  2YEV B;  1IX9 A;  4U3J B;  1IBL B;  4LF5 O;  4Q6G A;  4QPK A;  1OCR C;  2X7R B;  1GN6 A;  1OCO C;  4AQY B;  1J95 A;  4LF8 B;  1PL0 A;  2QM8 A;  1YSC A;  2D3O W;  3CS5 A;  3OT7 A;  5JJJ B;  3WFV A;  4L87 A;  1ZX3 A;  3DC6 A;  4LF9 O;  4J7J A;  4PDM A;  4GX5 A;  4IT5 A;  2DQ3 A;  1IVS A;  4UVC A;  4XDK A;  3JD1 A;  3SDL A;  1KYO F;  3QO5 A;  3T4D A;  1TUB A;  2WAM A;  4GZR B;  1K4C C;  2CTW A;  4DK0 A;  2B1G A;  5EBL C;  3NXS A;  2EIK C;  3I55 V;  1B6Q A;  3K3W A;  3UO2 A;  1N8R W;  4CS4 A;  5H2F Z;  3T1C A;  4B3S B;  2BTO A;  2DQ0 A;  4RWU A;  4QIW F;  4NTY A;  4DUY O;  3ZHQ A;  5LMN O;  1EZV H;  2HKO A;  2M6Y A;  2GBO A;  1AR1 B;  3SJQ C;  2QGN A;  3ASO C;  1NS1 A;  2GV9 A;  2DWE C;  2YDE A;  2Q0A A;  2V4D A;  4WCE V;  2QWP B;  1VEW A;  1WA8 B;  2BOC C;  1VQM V;  4ZOL A;  5J2U B;  5LOV B;  1R3L C;  4NXM B;  1LUW A;  5B1B B;  5KHI A;  3CPW U;  2KG7 A;  1CEZ A;  2E75 B;  1Q3E A;  5EC2 C;  4RQE A;  2HVJ C;  4KHP O;  4MW3 A;  5KX5 A;  2QEX V;  5LHI A;  1JJO A;  3JD3 A;  4UCT A;  2PYJ A;  2YI8 A;  3LDC A;  1VQN V;  4WFH A;  4JI0 O;  1AP5 A;  3IC7 A;  1HR0 B;  1NI8 A;  4HYO A;  4FLX A;  4TV8 A;  4X65 O;  5HFL A;  2JRI A;  3JSL A;  1TUE B;  2QA4 V;  1HDJ A;  3E8F A;  1YI2 V;  2MK3 A;  4J11 A;  3ABT A;  2AZ2 A;  1BL8 A;  2ZR3 A;  1FFX B;  1QU7 A;  3ASO B;  2P4K A;  1Q90 D;  1I94 O;  5EYP B;  1AJQ A;  5TIS Z;  4N21 A; 
#chains in the Genus database with same CATH homology
 2KB1 A;  2K1E A;  4MVZ A;  3ZN0 A;  1YIT V;  2EZP A;  3E8B A;  3E35 A;  3K0G A;  1P7B A;  1VQL V;  3ABM C;  2JDI G;  3H01 A;  4JTD B;  1BHA A;  3RVZ A;  1P4R A;  2ZD9 A;  2ZXW B;  1AI6 A;  2Q67 A;  2Y69 C;  1QCE A;  5DN6 G;  4X8A A;  4MVO A;  1JVM A;  3ASN C;  3P30 A;  2A0L A;  5KUM A;  3ZRW A;  1W2B U;  2EIK B;  5CBF A;  1YTF B;  1M56 C;  5IYD O;  4WFF A;  4UVA A;  2HFE C;  3ZRW B;  4MT8 A;  2JEU A;  1BMF G;  1KP3 A;  2EIM C;  3KG2 A;  3CCL V;  4LP8 A;  2EZO A;  3AG4 C;  1G4Y B;  2XOK G;  5H6Q A;  5LHG A;  5KA6 A;  3F7V C;  3T2M A;  3VOU A;  4PA7 A;  3ABK B;  2CK3 G;  4RO2 A;  3FYI B;  3TET A;  1GM7 A;  4CZZ A;  2W6I G;  1EFR G;  4I9W A;  2ZR2 A;  3B77 A;  4JYB A;  2BOB C;  3ABL C;  1H2G A;  5CBG A;  3K03 A;  3CCS V;  2Z3Y A;  3FB7 C;  1YJW V;  3SPH A;  1KKD A;  3D36 A;  3CCQ V;  1DLB A;  4JYC A;  3CC4 V;  2EIJ C;  4JGS A;  3SPC A;  3ZMS A;  3X2Q C;  3CCU V;  2C2A A;  1SZT A;  4MTF A;  4RUE A;  4BIZ A;  3QO8 A;  1KC8 W;  1JJ2 U;  1DF5 A;  4FK5 C;  1CPY A;  1THZ A;  1V55 B;  4HZ3 A;  1QLE C;  3OAA G;  4Z1M G;  1VQ7 V;  4PDV A;  3CCE V;  3LNM B;  1NH2 B;  3ZRV A;  1Y66 A;  1F4N A;  5H9C A;  1R73 A;  4F4L A;  2X6A A;  2AHY A;  2OCC B;  4RUF A;  3W7X A;  2EIN B;  3JYC A;  3JD0 A;  3IFX A;  3W7U A;  2W6J G;  1F4M A;  2A79 B;  1F23 A;  1YHQ V;  2YSU B;  1GM8 A;  3BEH A;  1GM9 A;  2HG5 C;  3W7T A;  1Y4M A;  4XDJ A;  2QM7 A;  1FXK B;  1H38 A;  1EZJ A;  1Q81 W;  3FB6 C;  4X88 A;  1NR7 A;  1GTO A;  4U7O A;  1RM1 C;  5IDJ A;  1QVF U;  3K08 A;  4MVM A;  4YXW G;  1WPX A;  1ZWI C;  3B8M A;  3G6E V;  2WLK A;  3OMA B;  1YJN V;  1K3E A;  1VQP V;  2DWD C;  4MS2 A;  5B1N A;  3ZCC A;  3K79 A;  1AJN A;  1NJI W;  4JTC B;  2WLM A;  3ZMU A;  4FPP A;  4LC1 A;  1W0K G;  2R9R B;  5B3S C;  1DTO A;  2P7T C;  1OZ0 A;  3JD2 A;  3OR6 C;  2PI4 A;  1MOF A;  2LFS A;  4MTO A;  1QR8 A;  3OW2 U;  2WLN A;  4MVS A;  3AG1 C;  4UV8 A;  5IYB O;  3ZN1 A;  2XAJ A;  4DXW A;  1XL4 A;  1K34 A;  3GB7 C;  1VQO V;  4PA3 A;  1AI7 A;  2JJ2 G;  2JJ1 G;  2ATK C;  3R65 A;  4GX1 A;  2DW4 A;  4X89 A;  2EIJ B;  4WFG A;  1XL6 A;  3G71 V;  1M57 C;  1FXK C;  2GHY A;  2Q6A A;  1FXV A;  4H37 A;  2H94 A;  3RBZ A;  2IJI A;  2B5U A;  3SYQ A;  3TCU A;  3ABL B;  3LSS A;  4JF3 A;  1Q82 W;  2Q68 A;  1BHB A;  2NNU A;  5C93 A;  2OCC C;  1YTF D;  1PNL A;  1GKF A;  3OEH G;  3E83 A;  2Q69 A;  1S72 V;  1UJW B;  1S0V A;  3CCJ V;  1V54 C;  2XAS A;  4BAY A;  5H6R A;  4JAV A;  3LUT B;  3OFN G;  1QLE B;  1FXK A;  1JCH A;  1K73 W;  4R6Z A;  2UXX A;  3SYC A;  2HVK C;  2EIM B;  1ENV A;  2IJJ A;  4G28 B;  5L3B A;  4P2Z A;  1K97 A;  2W0F C;  4HAM A;  1S3J A;  4JTA B;  2X6B A;  1JX9 A;  1DF4 A;  1MAB G;  2F43 G;  2NLJ C;  4J9Y B;  2UXN A;  3GWO A;  1OCC C;  1H8H G;  3PJS K;  4PEL A;  5KA5 A;  1K8A W;  4XBF A;  3CCV V;  2JIZ G;  2H8P C;  5L3E A;  1SER A;  4MVR A;  3AEI A;  2IU3 A;  1LNQ A;  1KD1 W;  1R6N A;  1PNK A;  1SES A;  4FJC C;  1S76 D;  5GW7 A;  2Z5U A;  1OCZ C;  1OCC B;  1R3I C;  2QE7 G;  3ETD A;  2WLL A;  1PKX A;  4BW5 A;  2IH3 C;  3STZ C;  3FB8 C;  3ABK C;  1RPR A;  3QO7 A;  4TT3 G;  3FYE B;  4FIP C;  5CBH A;  5IYC O;  2GSM B;  1VQ4 V;  4UXN A;  2EJR A;  1M9N A;  1AI5 A;  1PNM A;  2B1I A;  3E8G A;  3OUS A;  4MTX A;  1NR1 A;  4GCZ A;  4U7N A;  2DYR C;  3QNE A;  1M1K W;  1GO3 F;  1K33 A;  1SET A;  1AJP A;  4LCU C;  1NBM G;  4GT1 A;  5LGT A;  1CP9 A;  2WSS G;  2EIL C;  3LSQ A;  3F7Y C;  4G2K A;  4E2L A;  1IXM A;  3ABM B;  3OEE G;  3K0D A;  2IU0 A;  2JK5 C;  2ZXW C;  5B1A B;  2M7W A;  3M99 B;  1E1R G;  1Q7Y W;  1I5Y A;  2QTO A;  1S5H C;  1GK9 A;  2WLI B;  2A9H A;  3CP1 A;  2XAG A;  4KFM A;  2V1D A;  3CYO A;  3AG2 C;  4PA4 A;  5EC1 C;  2ZDI C;  4QE7 A;  3K04 A;  3RVY A;  2P6J A;  2ZQM A;  3EFF K;  2X6C A;  5EBM C;  1K4D C;  3SPJ A;  3ZMT A;  3HB3 B;  3UM7 A;  1GMG A;  2ITD C;  5HFM A;  1W0J G;  5J9P C;  4OXS A;  4BIU A;  3CXC U;  3ML0 A;  3MD0 A;  5LBQ A;  3CMA V;  2LFR A;  5B1B C;  4JAU A;  4QE9 A;  4R50 A;  1JQ0 A;  2QKS A;  3ABU A;  2R9I A;  1JPX A;  1QVG U;  1QR9 A;  2WWW A;  3SYA A;  4CBC A;  5L3C A;  4PA9 A;  3JCZ A;  3ZMZ A;  4EKW A;  2ZDI A;  2IJH A;  5L3F A;  4J9Z B;  2XND G;  3LDE A;  3ZRS A;  4PDR A;  4RAI A;  2OT5 A;  2XAH A;  2WLL B;  3OMN B;  3A0R A;  4H33 A;  1OHH G;  3IGA C;  4WFA V;  2IH1 C;  3EHB B;  3P32 A;  1L1F A;  2IW5 A;  3AG1 B;  4KUM A;  1FFT B;  3TK1 A;  4JAS A;  3DGE A;  2OTJ V;  3SYO A;  2XAQ A;  1K92 A;  1R3K C;  1Q86 W;  4MSW C;  1YIJ V;  4ZBM A;  3OM3 B;  1WLE A;  1QBZ A;  2P90 A;  4PDL A;  3LDD A;  5CA3 A;  1VQK V;  3AG3 C;  2YEV B;  4QPK A;  1OCR C;  3FB5 C;  2X7R B;  2DYR B;  3D3I A;  1OCO C;  5IY5 C;  5EBW C;  4QNH B;  2LP7 A;  1V55 C;  3ETG A;  4PA6 A;  4ZKI A;  2WPD G;  3WG7 B;  5KUK A;  1J95 A;  2JEX A;  5BZB A;  1PL0 A;  2WLJ A;  4QPJ A;  2QM8 A;  4MVQ A;  3STL C;  3X2Q B;  1YSC A;  2D3O W;  1EBO A;  1G8M A;  4Q20 A;  5B1A C;  3E86 A;  2AHZ A;  1I5X A;  3SYP A;  3WFV A;  1OCZ B;  4L87 A;  2EIN C;  3OUF A;  1NH2 D;  1KP2 A;  1K7D A;  2DYS B;  5B1O A;  3ZMV A;  1E1Q G;  2WLH A;  4PDM A;  1KEC A;  5EK0 A;  1E79 G;  4GX5 A;  2DQ3 A;  3W7S A;  4UVC A;  1FS0 G;  2V7Q G;  3CC7 V;  3K9A A;  4XDK A;  3JD1 A;  1H8E G;  4P9P A;  4WFE A;  3QO5 A;  3DTU B;  3T4D A;  4P30 A;  3MHS C;  2WAM A;  2X0L A;  3WG7 C;  4UVB A;  1K4C C;  1JOY A;  3I56 V;  5LGU A;  5LHH A;  1VQ5 V;  1HWY A;  4TSF G;  1MSW D;  1V54 B;  3E89 A;  4G27 B;  1RPO A;  2B1G A;  5EBL C;  2WLI A;  3NXS A;  2EIK C;  3K06 A;  2HR3 A;  3ASN B;  5L3G A;  3I55 V;  3CCR V;  1B6Q A;  2DYS C;  3E8H A;  3K3W A;  5E1A C;  3ZJZ A;  2Y69 B;  4GX0 A;  1N8R W;  4JPR A;  3G4S V;  4QJF B;  4DO2 A;  1M90 W;  5CMU A;  3T1C A;  1R3J C;  3HPL C;  2DQ0 A;  1MG1 A;  3VBB A;  1PD3 A;  4QIW F;  1M57 B;  4WF9 V;  2PI5 A;  2HKO A;  2EBO A;  3CCM V;  1AR1 B;  4RQF A;  4UV9 A;  3AG4 B;  1OCO B;  2YEV A;  5IY5 B;  3W7W A;  3SJQ C;  2HLD G;  3ASO C;  1AI4 A;  1OCR B;  1ORQ C;  1ROP A;  4MTG A;  3B8N A;  2DWE C;  4P9O A;  4UUJ C;  2HJF C;  3OMI B;  3T4Z A;  3FKS G;  1COW G;  4WCE V;  3CD6 V;  1M56 B;  3ZRX A;  5DM6 V;  4GX2 A;  2BOC C;  3AG3 B;  1VQM V;  1R6K A;  4TWK A;  1R3L C;  1S77 D;  3ZIA G;  1K5S A;  4R8C A;  3BY6 A;  4R7C A;  4WFB V;  3MHH C;  5B1B B;  3SPG A;  3UKM A;  5LGN A;  1NKD A;  2IJK A;  3CPW U;  5CN0 A;  1VQ6 V;  5FL7 G;  1CEZ A;  4FMT A;  5EC2 C;  4RQE A;  4MW8 A;  2HVJ C;  3SPI A;  4MW3 A;  2QEX V;  3E2E A;  4KP4 A;  1ARO P;  5LHI A;  2ITC C;  2P67 A;  4LBE C;  1NVP D;  3JD3 A;  1F51 A;  4XDL A;  3LDC A;  3OGC C;  1VQN V;  4N23 A;  2XAF A;  3ETE A;  1NVP B;  1NQT A;  4WFH A;  3JD4 A;  1VQ8 V;  1QLN A;  3IC7 A;  4HYO A;  1SRY A;  4MVU A;  5HFL A;  5B3S B;  2FTK A;  4ASU G;  3CME V;  1K9M W;  2EIL B;  1TUE B;  3F5W C;  2QA4 V;  3RW0 A;  3E8F A;  3OE7 G;  1YI2 V;  3CC2 V;  2MK3 A;  1KQS U;  1YJ9 V;  3ABT A;  1BL8 A;  2ZR3 A;  3ASO B;  1FXH A;  1RM1 B;  1VQ9 V;  5L3D A;  1AJQ A;  2Y48 A;  4I5S A;  2OTL V;  3OR7 C;  1K5Q A;  3AG2 B;  4N21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...