3STLC

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3stlC00
3OUFA 3T4ZA 5EBLC 3F5WC 1K4CC 5EC2C 2HVKC 2X6CA 2BOBC 4R50A 3GB7C 5EK0A 4DXWA 2EILC 1XL6A 3RVYA 3EFFK 2WLIA 1M56C 2JK5C 2DYRC 3X2QC 3BEHA 4LP8A 2HG5C 3E8HA 3K08A 4LBEC 4MTGA 1V54C 4MW3A 4R6ZA 4XDKA 4R8CA 4MSWC 4MS2A 2X6BA 2DYSC 1KKDA 2BOCC 4EKWA 3LNMB 4G27B 3SYPA 5CBGA 4MVQA 2EIMC 2W0FC 3IGAC 3FB6C 4P2ZA 3SYOA 4MVMA 4RO2A 4GX1A 4WFFA 3UKMA 3ZRSA 3RW0A 4J9YB 3VOUA 2Y69C 3E8FA 3K06A 2ZD9A 4GX0A 4MVSA 3RBZA 1R3LC 4JTCB 4PDVA 5EBWC 2EINC 2Q67A 4GX2A 4PA7A 2HFEC 3ZJZA 2IH3C 4HZ3A 2WLLA 3K04A 3UM7A 3LUTB 4PA6A 4PDMA 5B1BC 2P7TC 4X88A 2NLJC 3OR7C 3E8GA 4MTFA 4WFHA 3SYQA 2HJFC 1K4DC 3AG1C 4I9WA 2A9HA 2WLMA 3TETA 4X8AA 4CBCA 2WLJA 4KFMA 2A0LA 4MW8A 3SPGA 2Q6AA 1OCOC 2WLKA 5EBMC 3SYCA 1XL4A 3ABKC 3AG4C 5J9PC 4WFEA 1P7BA 4PDLA 1OCCC 2ITCC 1QLEC 4GX5A 3IFXA 4MVRA 2Q69A 4UUJC 5B1AC 5KUMA 3WG7C 1OCZC 4PA3A 2WLNA 2R9RB 3E83A 4MTOA 4PA9A 4RUFA 4P9OA 3STZC 4H33A 2YEVA 3SYAA 3OR6C 3E8BA 3HPLC 3ABMC 4LCUC 4HYOA 4QNHB 1R3IC 5CBHA 1R3JC 4G28B 2ITDC 3K03A 5EC1C 2A79B 2Q68A 2H8PC 3AG3C 3E89A 4R7CA 2ZXWC 2OCCC 3RVZA 4BW5A 3OUSA 4QE7A 3ASOC 4JTDB 4WFGA 3OGCC 4MVUA 4ZBMA 4X89A 3JYCA 4P30A 4F4LA 3PJSK 4RUEA 1V55C 3LDEA 3SPHA 4PA4A 3ASNC 3FB7C 3LDCA 2WLHA 2IH1C 3SJQC 1J95A 5E1AC 1BL8A 2HVJC 3ABLC 4OXSA 2WLIB 3SPJA 3STLC 3T4DA 2DWEC 2WLLB 2EIKC 1R3KC 4MVZA 1M57C 5BZBA 5CBFA 2DWDC 3SPCA 3T1CA 2ATKC 3K0GA 3AG2C 4H37A 2X6AA 3F7VC 2AHYA 1OCRC 1ORQC 3FB8C 4TWKA 5B3SC 1ZWIC 3TCUA 2KB1A 3R65A 2QKSA 4J9ZB 2EIJC 4P9PA 1JVMA 4RAIA 3T2MA 1LNQA 3FB5C 4XDLA 5IY5C 2QTOA 4XDJA 3LDDA 4JTAB 2K1EA 4QE9A 5KUKA 3E86A 1S5HC 4PDRA 3SPIA 2AHZA 3K0DA 1G4YB 3F7YC 4MVOA 3KG2A
chains in the Genus database with same CATH superfamily
3OUFA 4CH3A 3K5LA 2WA4A 1NTMH 2F1MA 2VQEB 5EK0A 2IJKA 2HHHO 1Y76B 1LUVA 1XNRO 5LGUA 5KAIZ 5GONA 4E2LA 2XASA 4UV8A 4UXNA 5JH7B 2L6LA 3LNMB 2E3CA 4DV3O 2E5LO 2KSDA 3IGAC 3E35A 2MK3A 4MTXA 1O9GA 1P84F 5LXTB 2ZM6B 4DK1A 3MHHC 1ROPA 3B09A 1HNZB 3CCUV 2JEXA 4H0LB 4U3JB 5C8YA 2Q67A 2HFEC 5B5EZ 3DXRA 2JS3A 1K4DC 4I9WA 4DV2B 2ZE6A 3JD4A 2WLJA 2A0LA 1XL4A 4TT3G 4UUJC 4PA9A 1IVSA 1KECA 3OT7A 4PJ0Z 3QO8A 1I5YA 2CTRA 1N34O 2N74A 2UUAB 4WFGA 4FVMA 3ZN0A 4OXSA 2UU9O 3BABA 1YI2V 4WF9V 2VQFO 4FIPC 2LP7A 1A32A 4I4TB 2WWWA 2P22C 1IXMA 4B3SB 4NXNB 5EZYA 3N2GA 1VQLV 1G8MA 3B77A 4I5SA 2UUBO 3IC7A 3G67A 5JQGA 3E2EA 5F2VO 1NKDA 4QPJA 3ZHTA 4O4IA 2YDEA 2JK5C 5B1NA 1K33A 2Q7EA 2ZNIA 2ZR3A 1N33B 5JVDA 4JYBA 1PNMA 1NQTA 3AG1B 2YIBD 1WP8A 1Y66A 4I0XA 3L9DA 1FXKB 4JTCB 4X20B 4JI4B 4X88A 4J80A 4H13B 1Q5OA 2FYUH 1PPJH 4B3MO 3OEHG 5J9PC 3OTOB 1ZL8B 2Q69A 3F5TA 3C3SA 4KHPB 3O65A 3E83A 2Y4UA 4DR3O 3E22B 4IYHA 2B5UA 3HB3B 2DE0X 4JI5O 1R3IC 4U3FH 4CH4A 1XNQB 1SESA 3QO7A 1PNKA 4YIOA 1Q3EA 3ZMTA 3ASOC 4DV1O 3G4SV 5JCOC 1K3EA 3LDCA 3SJQC 1JFFB 2QE7G 5E1AC 2HVJC 3RYCB 3JALB 4LNUB 2DWEC 3RYFB 5LXTA 5LMUB 1UPGA 1GM7A 2ZNJA 2Q4PA 2AHYA 1ZUQA 4QPKA 1YF2A 4O2AB 1IBLB 5L3GA 1EN5A 1SA0B 1KU9A 1BGYH 1ZTEA 1YITV 1DF4A 2Z3YA 4XDJA 2AGAA 1AP5A 1SETA 3JCUZ 5HFMA 3EXAA 2EIJB 5IDJA 4DXWA 1GTOA 2DYRC 2HG5C 5KHJA 3J80N 3U11A 4WBNB 1W2BU 2EILB 4DR2O 1M56B 3K3WA 4AI8A 5C93A 5KHHA 1NTKH 3ICXA 4JYCA 2RJZA 4JI0O 2JGDB 3ZRXA 4TV8A 5L3CA 2QWRB 1EFRG 1N8RW 1NU1H 3UT5B 4IT5A 1SQQH 1KD1W 4YIPA 2HJFC 5H2FZ 2UXCB 3CCJV 2JDIG 3WU2Z 2EINB 2F4VO 1IDSA 2GUZB 1S0VA 4IIJB 5LA6B 3STZC 3D36C 3CMAV 4DV0O 4FLYA 1E1RG 3ETQA 3A2FA 1OCCB 4I50B 2QA4V 3ZN1A 1OCZB 2LO1A 2XAQA 1CXZB 3RYHB 5J2UB 2LJ2A 3HKEB 2PY5A 1FFTB 4BR6A 2WLIB 3SPJA 4B7KA 1Q6UA 3BA9A 1R3KC 1RP3B 5BZBA 2IBZH 3BCCH 1P4RA 1Q90D 4UCOA 4X20A 3ASNB 3ZIAG 1Q86W 2YXLA 2LFSA 2EIKB 2DOSA 4DV7B 1FJGO 2QTOA 1UJWB 4D7TA 3HKCB 1Q6HA 5L3BA 4IGGA 1G4YB 3OGIB 5LL6Y 1SKVA 3ZRVA 2ZT9B 5EBLC 4GYCB 2OTLV 4LF4O 5CB4A 3CC2V 3BVOA 1NVPD 5EIBC 1R6KA 1B3QA 3CEIA 3H9VA 2RN9A 3E22A 4GKKO 2EBOA 4EB6B 4R8CA 1JA8A 2DYSC 3SYPA 5LGTA 1KMIZ 2EIMC 4QIWF 2EX3A 3I56V 5KA6A 3CCSV 3R66A 1D5NA 1R6NA 4J9YB 5KHIA 2Y69C 1D5AA 3APOA 3RBZA 4DUZO 4DR6B 4B3TB 1JFFA 3RYCA 4PA7A 3ZJZA 3ZRWB 4PDMA 4FLXA 3AK2A 4RQEA 1XDCA 2R72A 3CMEV 4OPHA 1RSOB 5JWPA 2XHBA 2XTAA 1SA0A 2Q6AA 3ABKC 5LHIA 2QM8A 3FKSG 2CGNA 2QJ1A 1JOYA 2UUCO 4RUFA 4LCUC 3ZS8C 3RYIB 1V9PA 2ITDC 5FNVA 2ZKOA 2F93B 5CA1B 4DUYB 5KLVH 1XMOB 3PJSK 3K79A 5LOVA 4B3RB 2HR3A 2A7WA 2YIBA 1HP8A 4MVZA 1L0LH 1K34A 1Q8IA 5GTIZ 4OX9O 1OJHA 4K35A 5GONB 4DV5O 1J5EB 2ZIMA 2P67A 4LF9B 4JI1B 1KYOF 1MSDA 2Q5ZA 3LDDA 3D3IA 4QE9A 4JI7B 1FS0G 1F51A 1Z2GA 1NVPB 2AHZA 4UB6Z 1FXVA 1IURA 4NTXA 2RQ6A 3F5WC 1YTFD 5EC2C 5C8YB 5DN6G 4LF8O 2GUZA 1H2NA 5IWAO 2X0LA 2VWKA 2F43G 2MW2B 1HDJA 4XDKA 4DR4O 4MSWC 3CS5A 1BHAA 1SS3A 4KL1A 5LP6C 3I55V 1VQOV 4RO2A 3CXCU 3RYHA 5J2UA 3HKEA 1DF5A 2OIEA 1NR1A 4QJFB 1BSMA 4X65B 4K0KO 3TK1A 2HKOA 2IH3C 3JD0A 1WB7A 3H1HH 4LFBB 2R70A 4LFCO 1GK9A 3L73H 3TETA 1S72V 1I94O 5D5QA 1VARA 5B1OA 3AG4C 1P7BA 1GN2A 4P9OA 4H33A 2Y48A 4JAAA 3JAWB 2UXNA 3LSSA 4X9QA 2ILMA 3B8MA 1VQ5V 1VQ4V 4JI3O 4BW9A 1YHQV 1FKAO 3FD9A 2QM7A 1JQ0A 3ETDA 4DR7O 5EZYB 3M8AA 2QM4A 3N2GB 3SDLA 1EN4A 2F23A 4AQYB 4X89A 4EFBA 5KAFZ 2DW4A 4WCEV 4Q20A 1YIJV 1J95A 1BL8A 3ABLC 1IBKB 1YCIA 3MDSA 4TOIA 1KUQA 4NVPA 5KA5A 3K0GA 3FFQA 3BFRA 2ADQB 5H6RA 2Q9LA 2RDCA 4P9PA 3ZRWA 3T2MA 1N32O 2M7WA 4XDLA 5EIBD 2DYRB 2PI5A 5KUKA 3OMAB 2VWJA 3GWKC 1DK1A 1QHTA 2ZCEA 2UXXA 2W6IG 4LP8A 1EZVH 3KCYA 1H2MA 4Z1MG 3VQYA 5KHKA 1VF6C 1ENVA 1N0NA 2HHHB 2OWOA 1VP7A 1XUQA 1AVMA 5LHHA 2QWPB 4DV3B 2E5LB 2ZE7A 4N21A 1O9HA 2IM9A 4UCTA 1BHBA 1P7GA 1SC5B 2ZE8A 1SERA 1K7DA 5BMVB 2WLMA 2UXDO 2V7QG 4JZGA 1TAEA 3N27A 4FK5C 2WLKA 4L87A 4X1YA 4ABMA 4AHCA 1T5EA 1Y6XA 3ZMVA 3AK3A 1WPBA 2XAFA 1NS1A 1G6UA 2QKCA 4ICGA 2OIGA 4WFAV 4R7CA 2ZXWC 3QTCA 3OTFA 2PYLA 3CSXA 2OCCC 4PV1B 2Q8VA 2GDSA 4ZOLA 2ODMA 2R9IA 1N34B 4F4LA 3LDEA 2JS5A 3J7AU 5H9CA 1R73A 2BCCH 5CBFA 4A5UB 2HLDG 1ZSPA 3K9AA 3SJAC 4RQFA 1AI7A 4O2BA 2UU9B 2DN9A 3C3TA 4FFBA 2PZSA 5L3FA 5D5PA 4J10A 1OZ0A 3B4SA 5K1PA 1HNWO 2DYSB 1JPXA 3ZMZA 4TV8B 2YXHA 1H2LA 2Q0AA 1D2DA 2EIMB 2CUGA 3CRCA 3RVYA 4BIUA 2CE4A 2Y69B 3JAWA 3ML0A 5JCOA 4YJ3B 3B2EE 1XHXA 4CS2A 3CE2A 4UCSA 1K5QA 4FPPA 1GAXA 3OFNG 4LC1A 3K58A 1WP7A 4X66O 3WB1A 2IU0A 4CH6A 5KX5B 4HNAB 3ABKB 4TV9A 2ZIOA 2V4DA 2QDOA 4CC6A 1WN7A 2YXYA 3SYQA 4X62O 1Y67A 2QGNA 4ZIBA 4X8AA 4CBCA 3EHBB 1OCOC 2WAMA 3CHXA 4J41A 3IFXA 1NZ6A 4B3SO 4NXNO 2WLNA 4B3MB 4CC5A 2CTQA 1TUBA 3E8BA 3HPLC 3SJBC 3U0ZA 3ZHQA 1H8EG 3AG3C 4DR3B 1BCCH 3E89A 4H44B 4LF6O 3BY6A 1SZXA 2KG7A 1MOFA 5EYPA 4P30A 5CB4B 1N0JA 3SR2C 4IHJB 1S77D 4B08A 2LQTA 4DV1B 1AR1B 4KP4A 5K1XA 4JPRA 4XBFA 1HW7A 2R9AA 2X6AA 1OCRC 2BTOA 3CCRV 3TXSA 4O4HB 3JAKB 1RPRA 3BHPA 4W4LA 2K1EA 5BMVA 3D36A 5CBGA 3JD1A 3T1YO 3THOA 2D3OW 1HWYA 5A2QN 2GTAA 3L74H 3TJTA 2BOCC 3FYIB 4KHPO 2CH7B 4J11A 4YXWG 5IE9A 3LSQA 4MVMA 2K9PA 1FFXA 2ZQMA 1YJWV 1I7FA 2FMLA 3G6BA 3UO2A 1G1XB 3RWRD 1DTOA 4CS3A 5EBWC 5FNVB 4N23A 3ZCCA 4CH5A 1H38A 3E8GA 1SQVH 4JI0B 3ZHVA 4JI2B 5LMUO 4MW8A 5LOVB 4DR1O 2OT5A 2NR5A 1QLEC 5B1BB 4JASA 5IYCO 3G80A 3ZMSA 1P49A 2F4VB 2YUAA 2N04A 2WA3A 4G28B 4OGQB 1H2KA 3WG7B 1LUWA 1W0KG 2PF4E 4J7ZA 3CCLV 1MZEA 4DV0B 4YJ3A 3OUSA 2XAJA 3JARA 2N05A 1V55C 3SPHA 5JJNB 1AROP 2CTWA 4ASUG 5KX5A 3AG2C 5B3SC 1AR5A 4X64O 3FB8C 4HNAA 4NTWA 1MG1A 3PN1A 4DR5O 3R65A 3MHSC 4LH6A 2JVDA 3FYEB 3N2KA 2CTPA 3UCSC 1XMQO 1M57B 3FB5C 3CD6V 2WSSG 1F4NA 3IJ4A 4LF5O 4G2KA 3JD2A 3F7YC 4GCZA 5IJ9A 1NH2D 1UFIA 2HVKC 1FJGB 1WB8A 3WFVA 4U7NA 1VF7A 1S3JA 5IYZA 4LF4B 2LW7A 2Y0IA 3HKDB 1YJNV 2FTKA 2NNUA 2UXBB 1US6A 3FB6C 4GKKB 2QR4A 1H2GA 3RN4A 2P6JA 2AZ2A 4GX0A 1AI6A 4E4EA 4IHJA 2VRZA 5E79Z 1X4TA 2H3OA 2ARHA 1M90W 4Z1VA 2XOKG 2EZPA 4DUZB 2Z0AA 3I5DA 4Q6GA 3CRMA 2AZ0A 4JYAO 5J2TB 4BIOA 3OMNB 4O4HA 3JAKA 4F6RA 5HFLA 1NTZH 2OCCB 2X7RB 1N36B 3ABMC 4HYOA 1QU7A 5H6QA 1TVKB 5LP6A 2UUCB 1F4MA 5EC1C 4J42A 3CWBH 1K73W 4DO2A 4JV5O 3OD4A 3NR7A 2QWOB 1Y74A 4I55B 3K57A 4K8XA 1BQ0A 1YDXA 5B66Z 1GO3F 2CH7A 2WPDG 4MT8A 1M5IA 3S3WA 2AW9A 2WLLB 4NB5A 3SPCA 3WB2A 1VQPV 2B1IA 1AJNA 1QVGU 1I5XA 3VQXA 4YHHB 3T1HB 1KBHA 4OX9B 5IY5C 4DV5B 1L0NH 4B3TO 2CK3G 3CRRA 3EFFK 4GLXA 1SQFA 4DK0A 1SQXH 2Y0PA 1V54C 4NXMO 4LF8B 4ZI7A 2X6BA 3CPWU 2JJ1G 2YS8A 5IWAB 5GW7A 1QBZA 4MVQA 1FXKC 4X1YB 3Q4HA 3J81N 4DR4B 4I9QA 2E74B 2AXTZ 4DV6O 3QG5A 1U96A 5DEDA 2ZD9A 3QO5A 3JASA 3L70H 1OCOB 1HNXO 3LUTB 2P7TC 1VQNV 4ZOLB 4K0KB 1URFA 2LFRA 3RFRA 3IAYA 2ADPA 1R1BA 3H1IH 1W0JG 4LFCB 4KUMA 5BXZA 3ZBHA 1NI8A 4FLTA 1GN6A 5KMGB 1I94B 4EFEA 1QR9A 5DECA 2V1DA 4GKJO 1M4UA 1VF6A 1VIBA 4UVAA 3FX7A 1FAFA 4JI7O 4O2BB 5CA0B 3BPZA 4FFBB 3U10A 1IBMO 4LFAB 4BAYA 3HKDA 1WA8A 2O57A 4RUEA 1H2SB 1ZLZA 4DW1A 3CC4V 3ASOB 5BR8B 3OE7G 1QR8A 3F7VC 1F23A 1XOUA 1SRYA 1K97A 2EIJC 4WFBV 1CPYA 4X65O 4LH7A 2PYJA 4JI8O 1S5HC 5J2TA 3BRCA 4YY3O 2YEVB 4FZ1A 2BTQA 2X6CA 4R50A 2ZDIC 2EILC 5TISZ 4TV9B 1R6TA 1M56C 3E8HA 4R6ZA 4MS2A 3B40A 1TVKA 2XNDG 1KKDA 2GSMB 3H1KH 3H1JH 1JCHA 1AJQA 4I55A 1AP6A 3JATB 1YTFB 3VOUA 2PGGA 1TUBB 3E8FA 1FPOA 2LW1A 1YEWA 4BWAA 4PDVA 2EINC 2WLLA 4UCUA 3K04A 2B9ZA 2BSKA 3B8NA 1IBKO 1MSWD 2KG7B 5EYPB 4NKGB 1XREA 1YSCA 3SPGA 2IJIA 3K9SA 1XNRB 2OTJV 1OCCC 4GX5A 3UO3A 5B1AC 1FYJA 1YZBA 4DV4O 1OCZC 4JYYA 2IJHA 2R9RB 4FLVA 1MA1A 2Q7GA 3CRAA 2Q7HA 3APQA 4JGSA 5LHGA 1V55B 1SZTA 1H8HG 1OHHG 3K03A 2A79B 4UVBA 4K3AA 2GBOA 1KP3A 1XQ8A 5DM6V 1EZJA 3CCMV 1K5SA 1K8AW 1VQ8V 4O4JB 1HR0O 5LBQA 5LMNO 4JI6O 4UB8Z 5ITZB 3ASNC 3FB7C 2F66C 1WJZA 4PI2A 3CJHA 2EIKC 5IYBO 1AJPA 2ZINA 2QSAA 4AILC 3M99B 3T1HO 4D7SA 4LF7O 2HP8A 2A3QA 4PELA 4FM1A 2VQEO 5JJEB 1B06A 1FFXB 5BY1A 1NBMG 1AILA 4MVOA 3KG2A 1K92A 1B04A 1MMMA 2BOBC 3GB7C 3LSUA 1Q7YW 3SGIA 5KMGA 3X2QC 1HNWB 3A8TA 3K08A 1YVWA 5FPOA 3W7XA 2ZM6O 5CA0A 1HNZO 2VQFB 4P2ZA 3CP1A 3SYOA 4JF3A 4WFFA 1I0HA 2RMKB 5LYJA 1PL4A 5FL7G 4YJ2A 3OW2U 4HBNA 4DV2O 1QLNA 1M93A 3ABUA 3CCVV 2UUBB 5IT9N 1GN4A 2D2CB 4X66B 3AEIA 2CGOA 3HR0A 4MTFA 5L3EA 1VQ9V 2EULA 4DRXB 2JGUA 3ABMB 3GVMA 2KKWA 2JRIA 3JARB 2P4VA 4Z2WA 3CCEV 1YJ9V 4TQFA 4WFEA 4PDLA 1IX9A 5FPRA 4X62B 2YEVA 4D6TH 2UUAO 3O9OA 4F6EA 4QNHB 3BA8A 5CBHA 1VMGA 2H94A 2YI9A 3N2KB 1ZAUA 3P30A 5IJ0B 3S3XA 1DGSA 1RM1C 4QE7A 4CZZA 4ZBMA 2FKXA 3CXHF 5IJ9B 1IXBA 4LF6B 4X1KA 5IY5B 3JATA 3M7MX 1PNLA 3UQ8A 2DWDC 5H5NA 5KHGA 1SQPH 5IYZB 3EVKA 1AR4A 2ATKC 1WAZA 5GTHZ 3KKYA 3DTUB 4TWKA 1PL0A 3TCUA 4K8ZA 3MAQA 3ZEDA 2QKSA 2NN4A 3H01A 3L71H 1PKXA 4FLUA 4FZ0A 3CRQA 4JI5B 1GM8A 2PTMA 4O4LA 1FD9A 4JTAB 1BT8A 2JJ2G 1V54B 1WLEA 2KQXA 1GM9A 1K4CC 2C2AA 1JJOA 1JJ2U 1BE3H 1TA8A 1N33O 1XL6A 3DSQA 1LR1A 3BEHA 1I08A 2RCVA 1AI5A 4MTGA 3HKBA 3L72H 3T1YB 3K5MA 2P06A 4IL6Z 4ZHQA 4F6RB 2E75B 4DYLA 5FLXN 3W7WA 3OM3B 4GX1A 1QNMA 3ZRSA 4JI4O 1VQ6V 4O4JA 1IZ3A 1Q82W 4FJCC 5CA3A 5ITZA 5LP6B 2A06H 2OYQA 4UCRA 1M9NA 1RFYA 1Y76A 3OTOO 4U7OA 3OR7C 1Y74B 1S76D 5JH7A 1AB3A 3RGBA 4DW0A 4LWSB 1KB9F 3AG7A 3LNNA 1XNQO 2L35A 4MVRA 1PV0A 3QNEA 3TGUH 2DJVA 3G6EV 1XILA 3SYAA 1MABG 4DR2B 4DR1B 3OEEG 3AG4B 4U3JA 1CEZA 2P5OA 4UCVA 3CB2A 3TXQA 1COWG 3OGCC 2ZE5A 3JYCA 4TQDA 4J7KA 3VQWA 1IBLO 1PM9A 1JR9A 1Y4MA 3WB0A 4ZI7B 3VBBA 4X1IB 4NYKA 3A0RA 2QEXV 3RT3C 3ABLB 2KB1A 1S5LZ 3Q4HB 2XUMA 4RAIA 2DMXA 3DGEA 3G71V 1XI1A 2B1GA 1N4CA 3C90A 4DRXA 4X64B 4FM0A 1GKFA 4DR5B 3JASB 1XMQB 4LR3A 1PD3A 3ZHRA 4JI2O 4LF5B 3FAVB 1GRJA 3W7SA 2Z5UA 4MW3A 4I4TA 1U97A 4EKWA 1EBOA 1KP2A 4JZ2A 2QWQB 3A0BZ 5IJ0A 2YC0A 2EJRA 3JSNA 1GH6A 1JX9A 1ZX3A 4JAVA 4MVSA 1X59A 4TUYB 2UXCO 3ABTA 1BS3A 5B1AB 3UM7A 1QCEA 3W7UA 4WFHA 1MNGA 2A9HA 1WA8B 3P32A 2W6JG 1GMGA 4KFMA 3ETEA 1OV9A 1KC8W 3CYOA 5EBMC 2GHYA 2ITCC 5KUMA 3DC5A 5LGNA 4JYAB 2EJ7A 3CC7V 4EEQA 2IU3A 1KQSU 2LGWA 3P3NA 4FLWA 4B7EA 2LGQA 4RWUA 1FXKA 1KKCA 2H8PC 1BQZA 2Y4TA 3OMIB 2GTSA 1L8DA 2BTQB 1Q43A 2EZOA 4JV5B 1E79G 2ZXWB 5JJJB 1ZL8A 3DC6A 4DV7O 2UXBO 2RNBA 3QVNA 3ZHSA 3K5OA 2OCHA 3D3QA 3D8CA 1SQGA 3H1LH 3X2QB 2YIAA 4PDRA 4FLZA 1M1KW 2IJJA 3T4ZA 4LWSA 1S5JA 2W0XA 3MD0A 4TSFG 5AG2A 3JALA 4LNUA 4GT1A 3RYFA 2BSKB 1NR7A 1F7YA 2Q0OC 1SQBH 4PI0A 4O2AA 1BMFG 1Z5WA 4DR6O 1N36O 4NXMB 3JCZA 1NH2B 3RW0A 1BZKA 4UV9A 1GN3A 1YXBA 4J7JA 1R3LC 4GX2A 1TUEB 3JAMN 4C7UA 4HZ3A 3K59A 4DV6B 3QF7A 4NR1A 3VQVA 5CMUA 4KXRA 1B6QA 3AG1C 2ZR2A 4X1IA 3BAAA 4WBNA 1K9MW 2ZDIA 1HNXB 3ZHUA 3ZX6A 2JEUA 3L75H 1SF9A 4QGPA 2IW5A 3CJHB 4PA3A 1RM1B 4YHHO 4MTOA 3AK1A 4FFKA 3OR6C 2E76B 1EN6A 2JGDA 3CCQV 1R3JC 4DUYO 1E1QG 4JAUA 1XMOO 3FAVA 3UT5A 4GKJB 1Z5VA 4B3RO 3SJCC 1AI4A 4MVUA 1XBLA 5IYDO 1J5EO 2DQ0A 3AG3B 4LF9O 4JI1O 1IBMB 3T4DA 3STLC 2PUSA 1W59A 4IIJA 4OPAA 3IC9A 5LA6A 3DXRB 4TUYA 4H37A 1ORQC 1Q6IA 4FMTA 2M6YA 4J9ZB 4I50A 4I7ZB 1JVMA 3CX5F 1VF5B 1EM1A 5CA1A 4JI3B 5LYJB 1OCRB 2HEPA 4YJ2B 2XAHA 5CN0A 3K0DA 4HAMA 1XHZA 2G38A 4DR7B 3OAAG 2VS0A 3NXSA 4GUNA 1NT2B 2WLIA 4JI8B 2QTSA 1MZFA 4YY3B 4LBEC 3ZMUA 5A9GA 1PP9H 4G27B 1QQCA 4GZRB 1TGOA 2W0FC 1Q81W 3JD3A 2XT9A 4IYIA 2P4KA 3UKMA 2FL4A 3K5NA 3HKCA 3K06A 4LFBO 1N32B 2QWNB 3JSLA 2BE3A 2XAGA 4LFAO 2ETNA 4W4KA 2FB5A 1DLBA 4PHZA 4NTYA 4PA6A 5B1BC 1NJIW 4FM2A 2DQ3A 2NLJC 1XEQA 1FXHA 4EB6A 3KZIZ 1VQ7V 5BR8O 1WNSA 3SYCA 5JQGB 3W7TA 3ETGA 2P90A 4X1KB 2JIZG 1QVFU 3WG7C 3KCXA 4O4IB 1VQKV 4BIZA 2YIDA 4AQYO 1QLEB 4DV4B 2PI4A 2Q68A 2GV9A 2YI8A 5JVDB 4O4LB 3RVZA 2CDYA 4BW5A 4JTDB 3P3PA 4L8JA 2F95B 1RSOA 2Q73A 2YSUB 2YICA 4PA4A 1WPXA 4I0XB 2WLHA 2IH1C 2CAZC 2UXDB 1M57C 3T1CA 1HR0B 5LMNB 3HKBB 4JI6B 1VQMV 5L3DA 4CS4A 3RYIA 3GWOA 1ZWIC 1VEWA 4ZHQB 4PD4F 1CP9A 4ZKIA 3A0HZ 1THZA 4UFZA 1LNQA 2QKAA 1RPOA 3AG2B 3E86A 5B3SB 1L1FA 3SPIA 1JMKC 4UVCA 4LF7B 2HJDA
chains in the Genus database with same CATH topology
3OUFA 4GCZA 1GM9A 3F5WC 1NH2D 1YTFD 1K4CC 5EC2C 2HVKC 2C2AA 5DN6G 1JJ2U 3WFVA 5EK0A 4U7NA 1XL6A 2IJKA 2X0LA 1S3JA 3BEHA 2F43G 5LGUA 1AI5A 4MTGA 4XDKA 4MSWC 4E2LA 2XASA 2FTKA 4UV8A 4UXNA 1YJNV 1BHAA 3LNMB 3IGAC 2NNUA 3I55V 3FB6C 1H2GA 2MK3A 3E35A 4MTXA 4RO2A 3OM3B 4GX1A 3W7WA 1VQOV 3ZRSA 3CXCU 2P6JA 3MHHC 1VQ6V 1ROPA 1DF5A 4GX0A 1AI6A 1NR1A 3CCUV 1Q82W 4QJFB 2JEXA 4FJCC 5CA3A 2Q67A 3TK1A 2HKOA 2HFEC 2IH3C 3JD0A 1M90W 1M9NA 2XOKG 4U7OA 2EZPA 3OR7C 1K4DC 1GK9A 4I9WA 3TETA 1S72V 1S76D 3JD4A 3OMNB 2WLJA 2A0LA 5B1OA 1XL4A 5HFLA 3AG4C 4TT3G 1P7BA 4UUJC 4MVRA 3QNEA 3G6EV 2OCCB 4PA9A 4P9OA 4H33A 2X7RB 1KECA 2Y48A 1MABG 3SYAA 3ABMC 2UXNA 4HYOA 3LSSA 3QO8A 1I5YA 3OEEG 5H6QA 3B8MA 3AG4B 1VQ5V 1VQ4V 1F4MA 1YHQV 5EC1C 1K73W 2QM7A 1JQ0A 3ETDA 4DO2A 1CEZA 4WFGA 1COWG 3OGCC 1GO3F 4X89A 2WPDG 3JYCA 3ZN0A 4MT8A 2DW4A 4WCEV 4Q20A 1YIJV 1J95A 1BL8A 3ABLC 4OXSA 2WLLB 1YI2V 3SPCA 1VQPV 2B1IA 4WF9V 1Y4MA 5KA5A 4FIPC 2LP7A 3K0GA 1AJNA 2WWWA 5H6RA 1I5XA 1QVGU 1IXMA 3VBBA 3A0RA 2QEXV 3ABLB 2KB1A 4P9PA 3ZRWA 3T2MA 4RAIA 2M7WA 3DGEA 4XDLA 5IY5C 3G71V 1VQLV 2B1GA 2DYRB 2PI5A 2CK3G 5KUKA 1G8MA 3B77A 4I5SA 3IC7A 3OMAB 1GKFA 3E2EA 1PD3A 1NKDA 4QPJA 3EFFK 2JK5C 5B1NA 2UXXA 2W6IG 4LP8A 3W7SA 1K33A 2Z5UA 1V54C 4MW3A 4Z1MG 1ENVA 2X6BA 2ZR3A 2JJ1G 3CPWU 4EKWA 5GW7A 1EBOA 1QBZA 4MVQA 1FXKC 1KP2A 4JYBA 1PNMA 1NQTA 2EJRA 5LHHA 3AG1B 4JAVA 1JX9A 2ZD9A 3QO5A 4MVSA 1Y66A 1FXKB 4JTCB 1OCOB 3ABTA 4N21A 5B3SB 5B1AB 1BHBA 3UM7A 3LUTB 2P7TC 4X88A 1QCEA 1SERA 3W7UA 1K7DA 4WFHA 1VQNV 2A9HA 2WLMA 3P32A 2LFRA 2V7QG 2W6JG 1GMGA 4KFMA 3ETEA 4FK5C 1KC8W 2WLKA 3CYOA 5EBMC 3OEHG 2GHYA 4L87A 5J9PC 1W0JG 2ITCC 2Q69A 4KUMA 5KUMA 5LGNA 3E83A 3CC7V 1QR9A 3ZMVA 2V1DA 2IU3A 2XAFA 2B5UA 1KQSU 3HB3B 4UVAA 1R3IC 1FXKA 1SESA 3QO7A 1PNKA 2H8PC 4WFAV 4R7CA 2ZXWC 3ZMTA 3OMIB 2OCCC 3ASOC 4BAYA 2R9IA 3G4SV 2EZOA 4F4LA 1K3EA 4RUEA 3LDEA 3LDCA 1E79G 2ZXWB 3SJQC 2QE7G 5E1AC 5H9CA 2HVJC 3CC4V 1R73A 2DWEC 3ASOB 5CBFA 1GM7A 2HLDG 3OE7G 1QR8A 3K9AA 3F7VC 1F23A 2AHYA 4QPKA 1SRYA 4RQFA 1AI7A 1K97A 5L3GA 2EIJC 4WFBV 1CPYA 1YITV 3X2QB 1DF4A 2Z3YA 4XDJA 5L3FA 1OZ0A 1S5HC 4PDRA 2YEVB 1M1KW 1SETA 2IJJA 5HFMA 2DYSB 3T4ZA 1JPXA 3ZMZA 2EIJB 5IDJA 2X6CA 2EIMB 4R50A 3MD0A 4DXWA 4TSFG 2ZDIC 2EILC 1GTOA 3RVYA 4BIUA 4GT1A 1M56C 2DYRC 2HG5C 3E8HA 1NR7A 2Y69B 3ML0A 4R6ZA 4MS2A 2XNDG 1KKDA 1BMFG 2GSMB 1W2BU 2EILB 1M56B 1JCHA 3K3WA 1K5QA 4FPPA 5C93A 3OFNG 1AJQA 3JCZA 4LC1A 1NH2B 1YTFB 3RW0A 3VOUA 3E8FA 4UV9A 2IU0A 4JYCA 3ZRXA 1R3LC 4PDVA 5L3CA 2EINC 4GX2A 1TUEB 1EFRG 3ABKB 1N8RW 4HZ3A 2WLLA 3K04A 1KD1W 5CMUA 3SYQA 2HJFC 1B6QA 3B8NA 3AG1C 3CCJV 2JDIG 2ZR2A 1MSWD 4X8AA 2EINB 1YSCA 4CBCA 3EHBB 3SPGA 1K9MW 1OCOC 2WAMA 2ZDIA 2IJIA 2OTJV 2JEUA 1OCCC 4GX5A 2IW5A 3IFXA 5B1AC 1S0VA 1OCZC 4PA3A 2IJHA 1RM1B 2WLNA 2R9RB 4MTOA 3STZC 3OR6C 3E8BA 3HPLC 3CMAV 4JGSA 1E1RG 5LHGA 3CCQV 1V55B 1R3JC 1SZTA 1H8HG 1E1QG 1OCCB 1OHHG 3K03A 4JAUA 2A79B 4UVBA 2QA4V 3ZN1A 1H8EG 1KP3A 1OCZB 3AG3C 3E89A 5DM6V 1EZJA 3CCMV 1K5SA 1K8AW 1VQ8V 2XAQA 3BY6A 1AI4A 4MVUA 1MOFA 4P30A 5LBQA 1FFTB 5IYDO 2DQ0A 3AG3B 3ASNC 3FB7C 1S77D 2WLIB 3SPJA 3STLC 3T4DA 2EIKC 1R3KC 5IYBO 5BZBA 1AJPA 1AR1B 4KP4A 1P4RA 4JPRA 4XBFA 3M99B 4H37A 2X6AA 1OCRC 1ORQC 3ASNB 3ZIAG 3CCRV 4FMTA 1Q86W 4J9ZB 4PELA 2LFSA 2EIKB 1JVMA 2QTOA 1RPRA 2K1EA 1UJWB 3D36A 5L3BA 1OCRB 1NBMG 3K0DA 2XAHA 1G4YB 4HAMA 4MVOA 5CN0A 5CBGA 3KG2A 3ZRVA 3OAAG 5EBLC 2OTLV 3CC2V 3JD1A 1NVPD 3NXSA 1K92A 2BOBC 3GB7C 2D3OW 1HWYA 2WLIA 1Q7YW 1R6KA 3X2QC 3K08A 4LBEC 2EBOA 3ZMUA 4R8CA 3W7XA 2DYSC 2BOCC 3FYIB 3SYPA 4G27B 4YXWG 5LGTA 2EIMC 2W0FC 1Q81W 4QIWF 3JD3A 3JD2A 3LSQA 3CP1A 4P2ZA 3SYOA 4MVMA 3I56V 4JF3A 4WFFA 5KA6A 3UKMA 3CCSV 1R6NA 2ZQMA 4J9YB 1YJWV 2Y69C 3K06A 5FL7G 3RBZA 3OW2U 1DTOA 2XAGA 5EBWC 1QLNA 3ABUA 4PA7A 3CCVV 3ZJZA 1DLBA 4N23A 3ZRWB 3ZCCA 4PA6A 4PDMA 5B1BC 1NJIW 1H38A 2DQ3A 2NLJC 3AEIA 3E8GA 4MTFA 5L3EA 1VQ9V 1FXHA 4RQEA 3ABMB 3CMEV 1VQ7V 4MW8A 2Q6AA 3SYCA 3CCEV 1YJ9V 3ABKC 2OT5A 5LHIA 2QM8A 3FKSG 3ETGA 2P90A 4PDLA 1QLEC 4WFEA 5B1BB 3W7TA 2JIZG 4JASA 1QVFU 1JOYA 3WG7C 5IYCO 3ZMSA 4RUFA 1VQKV 2YEVA 4LCUC 4QNHB 4BIZA 5CBHA 4G28B 1QLEB 2ITDC 2PI4A 2H94A 2Q68A 3WG7B 1W0KG 3CCLV 3P30A 1RM1C 3RVZA 4BW5A 3OUSA 4QE7A 4JTDB 4CZZA 4ZBMA 2XAJA 2YSUB 3PJSK 1V55C 3K79A 3SPHA 4PA4A 1AROP 1WPXA 2WLHA 2IH1C 2HR3A 4ASUG 5IY5B 4MVZA 1M57C 1PNLA 1K34A 2DWDC 3T1CA 2ATKC 1VQMV 5L3DA 3AG2C 5B3SC 3DTUB 4TWKA 2P67A 3FB8C 3GWOA 1ZWIC 1PL0A 1MG1A 3TCUA 1CP9A 3MHSC 2QKSA 3R65A 3H01A 3FYEB 4ZKIA 1THZA 1M57B 1LNQA 1PKXA 3FB5C 3CD6V 1GM8A 2WSSG 3LDDA 2JJ2G 3D3IA 4JTAB 4QE9A 1RPOA 3AG2B 1F4NA 1FS0G 1V54B 1F51A 1WLEA 3E86A 4G2KA 1L1FA 2AHZA 3SPIA 1FXVA 4UVCA 3F7YC 1NVPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OUF A;  3T4Z A;  5EBL C;  3F5W C;  1K4C C;  5EC2 C;  2HVK C;  2X6C A;  2BOB C;  4R50 A;  3GB7 C;  5EK0 A;  4DXW A;  2EIL C;  1XL6 A;  3RVY A;  3EFF K;  2WLI A;  1M56 C;  2JK5 C;  2DYR C;  3X2Q C;  3BEH A;  4LP8 A;  2HG5 C;  3E8H A;  3K08 A;  4LBE C;  4MTG A;  1V54 C;  4MW3 A;  4R6Z A;  4XDK A;  4R8C A;  4MSW C;  4MS2 A;  2X6B A;  2DYS C;  1KKD A;  2BOC C;  4EKW A;  3LNM B;  4G27 B;  3SYP A;  5CBG A;  4MVQ A;  2EIM C;  2W0F C;  3IGA C;  3FB6 C;  4P2Z A;  3SYO A;  4MVM A;  4RO2 A;  4GX1 A;  4WFF A;  3UKM A;  3ZRS A;  3RW0 A;  4J9Y B;  3VOU A;  2Y69 C;  3E8F A;  3K06 A;  2ZD9 A;  4GX0 A;  4MVS A;  3RBZ A;  1R3L C;  4JTC B;  4PDV A;  5EBW C;  2EIN C;  2Q67 A;  4GX2 A;  4PA7 A;  2HFE C;  3ZJZ A;  2IH3 C;  4HZ3 A;  2WLL A;  3K04 A;  3UM7 A;  3LUT B;  4PA6 A;  4PDM A;  5B1B C;  2P7T C;  4X88 A;  2NLJ C;  3OR7 C;  3E8G A;  4MTF A;  4WFH A;  3SYQ A;  2HJF C;  1K4D C;  3AG1 C;  4I9W A;  2A9H A;  2WLM A;  3TET A;  4X8A A;  4CBC A;  2WLJ A;  4KFM A;  2A0L A;  4MW8 A;  3SPG A;  2Q6A A;  1OCO C;  2WLK A;  5EBM C;  3SYC A;  1XL4 A;  3ABK C;  3AG4 C;  5J9P C;  4WFE A;  1P7B A;  4PDL A;  1OCC C;  2ITC C;  1QLE C;  4GX5 A;  3IFX A;  4MVR A;  2Q69 A;  4UUJ C;  5B1A C;  5KUM A;  3WG7 C;  1OCZ C;  4PA3 A;  2WLN A;  2R9R B;  3E83 A;  4MTO A;  4PA9 A;  4RUF A;  4P9O A;  3STZ C;  4H33 A;  2YEV A;  3SYA A;  3OR6 C;  3E8B A;  3HPL C;  3ABM C;  4LCU C;  4HYO A;  4QNH B;  1R3I C;  5CBH A;  1R3J C;  4G28 B;  2ITD C;  3K03 A;  5EC1 C;  2A79 B;  2Q68 A;  2H8P C;  3AG3 C;  3E89 A;  4R7C A;  2ZXW C;  2OCC C;  3RVZ A;  4BW5 A;  3OUS A;  4QE7 A;  3ASO C;  4JTD B;  4WFG A;  3OGC C;  4MVU A;  4ZBM A;  4X89 A;  3JYC A;  4P30 A;  4F4L A;  3PJS K;  4RUE A;  1V55 C;  3LDE A;  3SPH A;  4PA4 A;  3ASN C;  3FB7 C;  3LDC A;  2WLH A;  2IH1 C;  3SJQ C;  1J95 A;  5E1A C;  1BL8 A;  2HVJ C;  3ABL C;  4OXS A;  2WLI B;  3SPJ A;  3STL C;  3T4D A;  2DWE C;  2WLL B;  2EIK C;  1R3K C;  4MVZ A;  1M57 C;  5BZB A;  5CBF A;  2DWD C;  3SPC A;  3T1C A;  2ATK C;  3K0G A;  3AG2 C;  4H37 A;  2X6A A;  3F7V C;  2AHY A;  1OCR C;  1ORQ C;  3FB8 C;  4TWK A;  5B3S C;  1ZWI C;  3TCU A;  2KB1 A;  3R65 A;  2QKS A;  4J9Z B;  2EIJ C;  4P9P A;  1JVM A;  4RAI A;  3T2M A;  1LNQ A;  3FB5 C;  4XDL A;  5IY5 C;  2QTO A;  4XDJ A;  3LDD A;  4JTA B;  2K1E A;  4QE9 A;  5KUK A;  3E86 A;  1S5H C;  4PDR A;  3SPI A;  2AHZ A;  3K0D A;  1G4Y B;  3F7Y C;  4MVO A;  3KG2 A; 
#chains in the Genus database with same CATH topology
 3OUF A;  4CH3 A;  3K5L A;  2WA4 A;  1NTM H;  2F1M A;  2VQE B;  5EK0 A;  2IJK A;  2HHH O;  1Y76 B;  1LUV A;  1XNR O;  5LGU A;  5KAI Z;  5GON A;  4E2L A;  2XAS A;  4UV8 A;  4UXN A;  5JH7 B;  2L6L A;  3LNM B;  2E3C A;  4DV3 O;  2E5L O;  2KSD A;  3IGA C;  3E35 A;  2MK3 A;  4MTX A;  1O9G A;  1P84 F;  5LXT B;  2ZM6 B;  4DK1 A;  3MHH C;  1ROP A;  3B09 A;  1HNZ B;  3CCU V;  2JEX A;  4H0L B;  4U3J B;  5C8Y A;  2Q67 A;  2HFE C;  5B5E Z;  3DXR A;  2JS3 A;  1K4D C;  4I9W A;  4DV2 B;  2ZE6 A;  3JD4 A;  2WLJ A;  2A0L A;  1XL4 A;  4TT3 G;  4UUJ C;  4PA9 A;  1IVS A;  1KEC A;  3OT7 A;  4PJ0 Z;  3QO8 A;  1I5Y A;  2CTR A;  1N34 O;  2N74 A;  2UUA B;  4WFG A;  4FVM A;  3ZN0 A;  4OXS A;  2UU9 O;  3BAB A;  1YI2 V;  4WF9 V;  2VQF O;  4FIP C;  2LP7 A;  1A32 A;  4I4T B;  2WWW A;  2P22 C;  1IXM A;  4B3S B;  4NXN B;  5EZY A;  3N2G A;  1VQL V;  1G8M A;  3B77 A;  4I5S A;  2UUB O;  3IC7 A;  3G67 A;  5JQG A;  3E2E A;  5F2V O;  1NKD A;  4QPJ A;  3ZHT A;  4O4I A;  2YDE A;  2JK5 C;  5B1N A;  1K33 A;  2Q7E A;  2ZNI A;  2ZR3 A;  1N33 B;  5JVD A;  4JYB A;  1PNM A;  1NQT A;  3AG1 B;  2YIB D;  1WP8 A;  1Y66 A;  4I0X A;  3L9D A;  1FXK B;  4JTC B;  4X20 B;  4JI4 B;  4X88 A;  4J80 A;  4H13 B;  1Q5O A;  2FYU H;  1PPJ H;  4B3M O;  3OEH G;  5J9P C;  3OTO B;  1ZL8 B;  2Q69 A;  3F5T A;  3C3S A;  4KHP B;  3O65 A;  3E83 A;  2Y4U A;  4DR3 O;  3E22 B;  4IYH A;  2B5U A;  3HB3 B;  2DE0 X;  4JI5 O;  1R3I C;  4U3F H;  4CH4 A;  1XNQ B;  1SES A;  3QO7 A;  1PNK A;  4YIO A;  1Q3E A;  3ZMT A;  3ASO C;  4DV1 O;  3G4S V;  5JCO C;  1K3E A;  3LDC A;  3SJQ C;  1JFF B;  2QE7 G;  5E1A C;  2HVJ C;  3RYC B;  3JAL B;  4LNU B;  2DWE C;  3RYF B;  5LXT A;  5LMU B;  1UPG A;  1GM7 A;  2ZNJ A;  2Q4P A;  2AHY A;  1ZUQ A;  4QPK A;  1YF2 A;  4O2A B;  1IBL B;  5L3G A;  1EN5 A;  1SA0 B;  1KU9 A;  1BGY H;  1ZTE A;  1YIT V;  1DF4 A;  2Z3Y A;  4XDJ A;  2AGA A;  1AP5 A;  1SET A;  3JCU Z;  5HFM A;  3EXA A;  2EIJ B;  5IDJ A;  4DXW A;  1GTO A;  2DYR C;  2HG5 C;  5KHJ A;  3J80 N;  3U11 A;  4WBN B;  1W2B U;  2EIL B;  4DR2 O;  1M56 B;  3K3W A;  4AI8 A;  5C93 A;  5KHH A;  1NTK H;  3ICX A;  4JYC A;  2RJZ A;  4JI0 O;  2JGD B;  3ZRX A;  4TV8 A;  5L3C A;  2QWR B;  1EFR G;  1N8R W;  1NU1 H;  3UT5 B;  4IT5 A;  1SQQ H;  1KD1 W;  4YIP A;  2HJF C;  5H2F Z;  2UXC B;  3CCJ V;  2JDI G;  3WU2 Z;  2EIN B;  2F4V O;  1IDS A;  2GUZ B;  1S0V A;  4IIJ B;  5LA6 B;  3STZ C;  3D36 C;  3CMA V;  4DV0 O;  4FLY A;  1E1R G;  3ETQ A;  3A2F A;  1OCC B;  4I50 B;  2QA4 V;  3ZN1 A;  1OCZ B;  2LO1 A;  2XAQ A;  1CXZ B;  3RYH B;  5J2U B;  2LJ2 A;  3HKE B;  2PY5 A;  1FFT B;  4BR6 A;  2WLI B;  3SPJ A;  4B7K A;  1Q6U A;  3BA9 A;  1R3K C;  1RP3 B;  5BZB A;  2IBZ H;  3BCC H;  1P4R A;  1Q90 D;  4UCO A;  4X20 A;  3ASN B;  3ZIA G;  1Q86 W;  2YXL A;  2LFS A;  2EIK B;  2DOS A;  4DV7 B;  1FJG O;  2QTO A;  1UJW B;  4D7T A;  3HKC B;  1Q6H A;  5L3B A;  4IGG A;  1G4Y B;  3OGI B;  5LL6 Y;  1SKV A;  3ZRV A;  2ZT9 B;  5EBL C;  4GYC B;  2OTL V;  4LF4 O;  5CB4 A;  3CC2 V;  3BVO A;  1NVP D;  5EIB C;  1R6K A;  1B3Q A;  3CEI A;  3H9V A;  2RN9 A;  3E22 A;  4GKK O;  2EBO A;  4EB6 B;  4R8C A;  1JA8 A;  2DYS C;  3SYP A;  5LGT A;  1KMI Z;  2EIM C;  4QIW F;  2EX3 A;  3I56 V;  5KA6 A;  3CCS V;  3R66 A;  1D5N A;  1R6N A;  4J9Y B;  5KHI A;  2Y69 C;  1D5A A;  3APO A;  3RBZ A;  4DUZ O;  4DR6 B;  4B3T B;  1JFF A;  3RYC A;  4PA7 A;  3ZJZ A;  3ZRW B;  4PDM A;  4FLX A;  3AK2 A;  4RQE A;  1XDC A;  2R72 A;  3CME V;  4OPH A;  1RSO B;  5JWP A;  2XHB A;  2XTA A;  1SA0 A;  2Q6A A;  3ABK C;  5LHI A;  2QM8 A;  3FKS G;  2CGN A;  2QJ1 A;  1JOY A;  2UUC O;  4RUF A;  4LCU C;  3ZS8 C;  3RYI B;  1V9P A;  2ITD C;  5FNV A;  2ZKO A;  2F93 B;  5CA1 B;  4DUY B;  5KLV H;  1XMO B;  3PJS K;  3K79 A;  5LOV A;  4B3R B;  2HR3 A;  2A7W A;  2YIB A;  1HP8 A;  4MVZ A;  1L0L H;  1K34 A;  1Q8I A;  5GTI Z;  4OX9 O;  1OJH A;  4K35 A;  5GON B;  4DV5 O;  1J5E B;  2ZIM A;  2P67 A;  4LF9 B;  4JI1 B;  1KYO F;  1MSD A;  2Q5Z A;  3LDD A;  3D3I A;  4QE9 A;  4JI7 B;  1FS0 G;  1F51 A;  1Z2G A;  1NVP B;  2AHZ A;  4UB6 Z;  1FXV A;  1IUR A;  4NTX A;  2RQ6 A;  3F5W C;  1YTF D;  5EC2 C;  5C8Y B;  5DN6 G;  4LF8 O;  2GUZ A;  1H2N A;  5IWA O;  2X0L A;  2VWK A;  2F43 G;  2MW2 B;  1HDJ A;  4XDK A;  4DR4 O;  4MSW C;  3CS5 A;  1BHA A;  1SS3 A;  4KL1 A;  5LP6 C;  3I55 V;  1VQO V;  4RO2 A;  3CXC U;  3RYH A;  5J2U A;  3HKE A;  1DF5 A;  2OIE A;  1NR1 A;  4QJF B;  1BSM A;  4X65 B;  4K0K O;  3TK1 A;  2HKO A;  2IH3 C;  3JD0 A;  1WB7 A;  3H1H H;  4LFB B;  2R70 A;  4LFC O;  1GK9 A;  3L73 H;  3TET A;  1S72 V;  1I94 O;  5D5Q A;  1VAR A;  5B1O A;  3AG4 C;  1P7B A;  1GN2 A;  4P9O A;  4H33 A;  2Y48 A;  4JAA A;  3JAW B;  2UXN A;  3LSS A;  4X9Q A;  2ILM A;  3B8M A;  1VQ5 V;  1VQ4 V;  4JI3 O;  4BW9 A;  1YHQ V;  1FKA O;  3FD9 A;  2QM7 A;  1JQ0 A;  3ETD A;  4DR7 O;  5EZY B;  3M8A A;  2QM4 A;  3N2G B;  3SDL A;  1EN4 A;  2F23 A;  4AQY B;  4X89 A;  4EFB A;  5KAF Z;  2DW4 A;  4WCE V;  4Q20 A;  1YIJ V;  1J95 A;  1BL8 A;  3ABL C;  1IBK B;  1YCI A;  3MDS A;  4TOI A;  1KUQ A;  4NVP A;  5KA5 A;  3K0G A;  3FFQ A;  3BFR A;  2ADQ B;  5H6R A;  2Q9L A;  2RDC A;  4P9P A;  3ZRW A;  3T2M A;  1N32 O;  2M7W A;  4XDL A;  5EIB D;  2DYR B;  2PI5 A;  5KUK A;  3OMA B;  2VWJ A;  3GWK C;  1DK1 A;  1QHT A;  2ZCE A;  2UXX A;  2W6I G;  4LP8 A;  1EZV H;  3KCY A;  1H2M A;  4Z1M G;  3VQY A;  5KHK A;  1VF6 C;  1ENV A;  1N0N A;  2HHH B;  2OWO A;  1VP7 A;  1XUQ A;  1AVM A;  5LHH A;  2QWP B;  4DV3 B;  2E5L B;  2ZE7 A;  4N21 A;  1O9H A;  2IM9 A;  4UCT A;  1BHB A;  1P7G A;  1SC5 B;  2ZE8 A;  1SER A;  1K7D A;  5BMV B;  2WLM A;  2UXD O;  2V7Q G;  4JZG A;  1TAE A;  3N27 A;  4FK5 C;  2WLK A;  4L87 A;  4X1Y A;  4ABM A;  4AHC A;  1T5E A;  1Y6X A;  3ZMV A;  3AK3 A;  1WPB A;  2XAF A;  1NS1 A;  1G6U A;  2QKC A;  4ICG A;  2OIG A;  4WFA V;  4R7C A;  2ZXW C;  3QTC A;  3OTF A;  2PYL A;  3CSX A;  2OCC C;  4PV1 B;  2Q8V A;  2GDS A;  4ZOL A;  2ODM A;  2R9I A;  1N34 B;  4F4L A;  3LDE A;  2JS5 A;  3J7A U;  5H9C A;  1R73 A;  2BCC H;  5CBF A;  4A5U B;  2HLD G;  1ZSP A;  3K9A A;  3SJA C;  4RQF A;  1AI7 A;  4O2B A;  2UU9 B;  2DN9 A;  3C3T A;  4FFB A;  2PZS A;  5L3F A;  5D5P A;  4J10 A;  1OZ0 A;  3B4S A;  5K1P A;  1HNW O;  2DYS B;  1JPX A;  3ZMZ A;  4TV8 B;  2YXH A;  1H2L A;  2Q0A A;  1D2D A;  2EIM B;  2CUG A;  3CRC A;  3RVY A;  4BIU A;  2CE4 A;  2Y69 B;  3JAW A;  3ML0 A;  5JCO A;  4YJ3 B;  3B2E E;  1XHX A;  4CS2 A;  3CE2 A;  4UCS A;  1K5Q A;  4FPP A;  1GAX A;  3OFN G;  4LC1 A;  3K58 A;  1WP7 A;  4X66 O;  3WB1 A;  2IU0 A;  4CH6 A;  5KX5 B;  4HNA B;  3ABK B;  4TV9 A;  2ZIO A;  2V4D A;  2QDO A;  4CC6 A;  1WN7 A;  2YXY A;  3SYQ A;  4X62 O;  1Y67 A;  2QGN A;  4ZIB A;  4X8A A;  4CBC A;  3EHB B;  1OCO C;  2WAM A;  3CHX A;  4J41 A;  3IFX A;  1NZ6 A;  4B3S O;  4NXN O;  2WLN A;  4B3M B;  4CC5 A;  2CTQ A;  1TUB A;  3E8B A;  3HPL C;  3SJB C;  3U0Z A;  3ZHQ A;  1H8E G;  3AG3 C;  4DR3 B;  1BCC H;  3E89 A;  4H44 B;  4LF6 O;  3BY6 A;  1SZX A;  2KG7 A;  1MOF A;  5EYP A;  4P30 A;  5CB4 B;  1N0J A;  3SR2 C;  4IHJ B;  1S77 D;  4B08 A;  2LQT A;  4DV1 B;  1AR1 B;  4KP4 A;  5K1X A;  4JPR A;  4XBF A;  1HW7 A;  2R9A A;  2X6A A;  1OCR C;  2BTO A;  3CCR V;  3TXS A;  4O4H B;  3JAK B;  1RPR A;  3BHP A;  4W4L A;  2K1E A;  5BMV A;  3D36 A;  5CBG A;  3JD1 A;  3T1Y O;  3THO A;  2D3O W;  1HWY A;  5A2Q N;  2GTA A;  3L74 H;  3TJT A;  2BOC C;  3FYI B;  4KHP O;  2CH7 B;  4J11 A;  4YXW G;  5IE9 A;  3LSQ A;  4MVM A;  2K9P A;  1FFX A;  2ZQM A;  1YJW V;  1I7F A;  2FML A;  3G6B A;  3UO2 A;  1G1X B;  3RWR D;  1DTO A;  4CS3 A;  5EBW C;  5FNV B;  4N23 A;  3ZCC A;  4CH5 A;  1H38 A;  3E8G A;  1SQV H;  4JI0 B;  3ZHV A;  4JI2 B;  5LMU O;  4MW8 A;  5LOV B;  4DR1 O;  2OT5 A;  2NR5 A;  1QLE C;  5B1B B;  4JAS A;  5IYC O;  3G80 A;  3ZMS A;  1P49 A;  2F4V B;  2YUA A;  2N04 A;  2WA3 A;  4G28 B;  4OGQ B;  1H2K A;  3WG7 B;  1LUW A;  1W0K G;  2PF4 E;  4J7Z A;  3CCL V;  1MZE A;  4DV0 B;  4YJ3 A;  3OUS A;  2XAJ A;  3JAR A;  2N05 A;  1V55 C;  3SPH A;  5JJN B;  1ARO P;  2CTW A;  4ASU G;  5KX5 A;  3AG2 C;  5B3S C;  1AR5 A;  4X64 O;  3FB8 C;  4HNA A;  4NTW A;  1MG1 A;  3PN1 A;  4DR5 O;  3R65 A;  3MHS C;  4LH6 A;  2JVD A;  3FYE B;  3N2K A;  2CTP A;  3UCS C;  1XMQ O;  1M57 B;  3FB5 C;  3CD6 V;  2WSS G;  1F4N A;  3IJ4 A;  4LF5 O;  4G2K A;  3JD2 A;  3F7Y C;  4GCZ A;  5IJ9 A;  1NH2 D;  1UFI A;  2HVK C;  1FJG B;  1WB8 A;  3WFV A;  4U7N A;  1VF7 A;  1S3J A;  5IYZ A;  4LF4 B;  2LW7 A;  2Y0I A;  3HKD B;  1YJN V;  2FTK A;  2NNU A;  2UXB B;  1US6 A;  3FB6 C;  4GKK B;  2QR4 A;  1H2G A;  3RN4 A;  2P6J A;  2AZ2 A;  4GX0 A;  1AI6 A;  4E4E A;  4IHJ A;  2VRZ A;  5E79 Z;  1X4T A;  2H3O A;  2ARH A;  1M90 W;  4Z1V A;  2XOK G;  2EZP A;  4DUZ B;  2Z0A A;  3I5D A;  4Q6G A;  3CRM A;  2AZ0 A;  4JYA O;  5J2T B;  4BIO A;  3OMN B;  4O4H A;  3JAK A;  4F6R A;  5HFL A;  1NTZ H;  2OCC B;  2X7R B;  1N36 B;  3ABM C;  4HYO A;  1QU7 A;  5H6Q A;  1TVK B;  5LP6 A;  2UUC B;  1F4M A;  5EC1 C;  4J42 A;  3CWB H;  1K73 W;  4DO2 A;  4JV5 O;  3OD4 A;  3NR7 A;  2QWO B;  1Y74 A;  4I55 B;  3K57 A;  4K8X A;  1BQ0 A;  1YDX A;  5B66 Z;  1GO3 F;  2CH7 A;  2WPD G;  4MT8 A;  1M5I A;  3S3W A;  2AW9 A;  2WLL B;  4NB5 A;  3SPC A;  3WB2 A;  1VQP V;  2B1I A;  1AJN A;  1QVG U;  1I5X A;  3VQX A;  4YHH B;  3T1H B;  1KBH A;  4OX9 B;  5IY5 C;  4DV5 B;  1L0N H;  4B3T O;  2CK3 G;  3CRR A;  3EFF K;  4GLX A;  1SQF A;  4DK0 A;  1SQX H;  2Y0P A;  1V54 C;  4NXM O;  4LF8 B;  4ZI7 A;  2X6B A;  3CPW U;  2JJ1 G;  2YS8 A;  5IWA B;  5GW7 A;  1QBZ A;  4MVQ A;  1FXK C;  4X1Y B;  3Q4H A;  3J81 N;  4DR4 B;  4I9Q A;  2E74 B;  2AXT Z;  4DV6 O;  3QG5 A;  1U96 A;  5DED A;  2ZD9 A;  3QO5 A;  3JAS A;  3L70 H;  1OCO B;  1HNX O;  3LUT B;  2P7T C;  1VQN V;  4ZOL B;  4K0K B;  1URF A;  2LFR A;  3RFR A;  3IAY A;  2ADP A;  1R1B A;  3H1I H;  1W0J G;  4LFC B;  4KUM A;  5BXZ A;  3ZBH A;  1NI8 A;  4FLT A;  1GN6 A;  5KMG B;  1I94 B;  4EFE A;  1QR9 A;  5DEC A;  2V1D A;  4GKJ O;  1M4U A;  1VF6 A;  1VIB A;  4UVA A;  3FX7 A;  1FAF A;  4JI7 O;  4O2B B;  5CA0 B;  3BPZ A;  4FFB B;  3U10 A;  1IBM O;  4LFA B;  4BAY A;  3HKD A;  1WA8 A;  2O57 A;  4RUE A;  1H2S B;  1ZLZ A;  4DW1 A;  3CC4 V;  3ASO B;  5BR8 B;  3OE7 G;  1QR8 A;  3F7V C;  1F23 A;  1XOU A;  1SRY A;  1K97 A;  2EIJ C;  4WFB V;  1CPY A;  4X65 O;  4LH7 A;  2PYJ A;  4JI8 O;  1S5H C;  5J2T A;  3BRC A;  4YY3 O;  2YEV B;  4FZ1 A;  2BTQ A;  2X6C A;  4R50 A;  2ZDI C;  2EIL C;  5TIS Z;  4TV9 B;  1R6T A;  1M56 C;  3E8H A;  4R6Z A;  4MS2 A;  3B40 A;  1TVK A;  2XND G;  1KKD A;  2GSM B;  3H1K H;  3H1J H;  1JCH A;  1AJQ A;  4I55 A;  1AP6 A;  3JAT B;  1YTF B;  3VOU A;  2PGG A;  1TUB B;  3E8F A;  1FPO A;  2LW1 A;  1YEW A;  4BWA A;  4PDV A;  2EIN C;  2WLL A;  4UCU A;  3K04 A;  2B9Z A;  2BSK A;  3B8N A;  1IBK O;  1MSW D;  2KG7 B;  5EYP B;  4NKG B;  1XRE A;  1YSC A;  3SPG A;  2IJI A;  3K9S A;  1XNR B;  2OTJ V;  1OCC C;  4GX5 A;  3UO3 A;  5B1A C;  1FYJ A;  1YZB A;  4DV4 O;  1OCZ C;  4JYY A;  2IJH A;  2R9R B;  4FLV A;  1MA1 A;  2Q7G A;  3CRA A;  2Q7H A;  3APQ A;  4JGS A;  5LHG A;  1V55 B;  1SZT A;  1H8H G;  1OHH G;  3K03 A;  2A79 B;  4UVB A;  4K3A A;  2GBO A;  1KP3 A;  1XQ8 A;  5DM6 V;  1EZJ A;  3CCM V;  1K5S A;  1K8A W;  1VQ8 V;  4O4J B;  1HR0 O;  5LBQ A;  5LMN O;  4JI6 O;  4UB8 Z;  5ITZ B;  3ASN C;  3FB7 C;  2F66 C;  1WJZ A;  4PI2 A;  3CJH A;  2EIK C;  5IYB O;  1AJP A;  2ZIN A;  2QSA A;  4AIL C;  3M99 B;  3T1H O;  4D7S A;  4LF7 O;  2HP8 A;  2A3Q A;  4PEL A;  4FM1 A;  2VQE O;  5JJE B;  1B06 A;  1FFX B;  5BY1 A;  1NBM G;  1AIL A;  4MVO A;  3KG2 A;  1K92 A;  1B04 A;  1MMM A;  2BOB C;  3GB7 C;  3LSU A;  1Q7Y W;  3SGI A;  5KMG A;  3X2Q C;  1HNW B;  3A8T A;  3K08 A;  1YVW A;  5FPO A;  3W7X A;  2ZM6 O;  5CA0 A;  1HNZ O;  2VQF B;  4P2Z A;  3CP1 A;  3SYO A;  4JF3 A;  4WFF A;  1I0H A;  2RMK B;  5LYJ A;  1PL4 A;  5FL7 G;  4YJ2 A;  3OW2 U;  4HBN A;  4DV2 O;  1QLN A;  1M93 A;  3ABU A;  3CCV V;  2UUB B;  5IT9 N;  1GN4 A;  2D2C B;  4X66 B;  3AEI A;  2CGO A;  3HR0 A;  4MTF A;  5L3E A;  1VQ9 V;  2EUL A;  4DRX B;  2JGU A;  3ABM B;  3GVM A;  2KKW A;  2JRI A;  3JAR B;  2P4V A;  4Z2W A;  3CCE V;  1YJ9 V;  4TQF A;  4WFE A;  4PDL A;  1IX9 A;  5FPR A;  4X62 B;  2YEV A;  4D6T H;  2UUA O;  3O9O A;  4F6E A;  4QNH B;  3BA8 A;  5CBH A;  1VMG A;  2H94 A;  2YI9 A;  3N2K B;  1ZAU A;  3P30 A;  5IJ0 B;  3S3X A;  1DGS A;  1RM1 C;  4QE7 A;  4CZZ A;  4ZBM A;  2FKX A;  3CXH F;  5IJ9 B;  1IXB A;  4LF6 B;  4X1K A;  5IY5 B;  3JAT A;  3M7M X;  1PNL A;  3UQ8 A;  2DWD C;  5H5N A;  5KHG A;  1SQP H;  5IYZ B;  3EVK A;  1AR4 A;  2ATK C;  1WAZ A;  5GTH Z;  3KKY A;  3DTU B;  4TWK A;  1PL0 A;  3TCU A;  4K8Z A;  3MAQ A;  3ZED A;  2QKS A;  2NN4 A;  3H01 A;  3L71 H;  1PKX A;  4FLU A;  4FZ0 A;  3CRQ A;  4JI5 B;  1GM8 A;  2PTM A;  4O4L A;  1FD9 A;  4JTA B;  1BT8 A;  2JJ2 G;  1V54 B;  1WLE A;  2KQX A;  1GM9 A;  1K4C C;  2C2A A;  1JJO A;  1JJ2 U;  1BE3 H;  1TA8 A;  1N33 O;  1XL6 A;  3DSQ A;  1LR1 A;  3BEH A;  1I08 A;  2RCV A;  1AI5 A;  4MTG A;  3HKB A;  3L72 H;  3T1Y B;  3K5M A;  2P06 A;  4IL6 Z;  4ZHQ A;  4F6R B;  2E75 B;  4DYL A;  5FLX N;  3W7W A;  3OM3 B;  4GX1 A;  1QNM A;  3ZRS A;  4JI4 O;  1VQ6 V;  4O4J A;  1IZ3 A;  1Q82 W;  4FJC C;  5CA3 A;  5ITZ A;  5LP6 B;  2A06 H;  2OYQ A;  4UCR A;  1M9N A;  1RFY A;  1Y76 A;  3OTO O;  4U7O A;  3OR7 C;  1Y74 B;  1S76 D;  5JH7 A;  1AB3 A;  3RGB A;  4DW0 A;  4LWS B;  1KB9 F;  3AG7 A;  3LNN A;  1XNQ O;  2L35 A;  4MVR A;  1PV0 A;  3QNE A;  3TGU H;  2DJV A;  3G6E V;  1XIL A;  3SYA A;  1MAB G;  4DR2 B;  4DR1 B;  3OEE G;  3AG4 B;  4U3J A;  1CEZ A;  2P5O A;  4UCV A;  3CB2 A;  3TXQ A;  1COW G;  3OGC C;  2ZE5 A;  3JYC A;  4TQD A;  4J7K A;  3VQW A;  1IBL O;  1PM9 A;  1JR9 A;  1Y4M A;  3WB0 A;  4ZI7 B;  3VBB A;  4X1I B;  4NYK A;  3A0R A;  2QEX V;  3RT3 C;  3ABL B;  2KB1 A;  1S5L Z;  3Q4H B;  2XUM A;  4RAI A;  2DMX A;  3DGE A;  3G71 V;  1XI1 A;  2B1G A;  1N4C A;  3C90 A;  4DRX A;  4X64 B;  4FM0 A;  1GKF A;  4DR5 B;  3JAS B;  1XMQ B;  4LR3 A;  1PD3 A;  3ZHR A;  4JI2 O;  4LF5 B;  3FAV B;  1GRJ A;  3W7S A;  2Z5U A;  4MW3 A;  4I4T A;  1U97 A;  4EKW A;  1EBO A;  1KP2 A;  4JZ2 A;  2QWQ B;  3A0B Z;  5IJ0 A;  2YC0 A;  2EJR A;  3JSN A;  1GH6 A;  1JX9 A;  1ZX3 A;  4JAV A;  4MVS A;  1X59 A;  4TUY B;  2UXC O;  3ABT A;  1BS3 A;  5B1A B;  3UM7 A;  1QCE A;  3W7U A;  4WFH A;  1MNG A;  2A9H A;  1WA8 B;  3P32 A;  2W6J G;  1GMG A;  4KFM A;  3ETE A;  1OV9 A;  1KC8 W;  3CYO A;  5EBM C;  2GHY A;  2ITC C;  5KUM A;  3DC5 A;  5LGN A;  4JYA B;  2EJ7 A;  3CC7 V;  4EEQ A;  2IU3 A;  1KQS U;  2LGW A;  3P3N A;  4FLW A;  4B7E A;  2LGQ A;  4RWU A;  1FXK A;  1KKC A;  2H8P C;  1BQZ A;  2Y4T A;  3OMI B;  2GTS A;  1L8D A;  2BTQ B;  1Q43 A;  2EZO A;  4JV5 B;  1E79 G;  2ZXW B;  5JJJ B;  1ZL8 A;  3DC6 A;  4DV7 O;  2UXB O;  2RNB A;  3QVN A;  3ZHS A;  3K5O A;  2OCH A;  3D3Q A;  3D8C A;  1SQG A;  3H1L H;  3X2Q B;  2YIA A;  4PDR A;  4FLZ A;  1M1K W;  2IJJ A;  3T4Z A;  4LWS A;  1S5J A;  2W0X A;  3MD0 A;  4TSF G;  5AG2 A;  3JAL A;  4LNU A;  4GT1 A;  3RYF A;  2BSK B;  1NR7 A;  1F7Y A;  2Q0O C;  1SQB H;  4PI0 A;  4O2A A;  1BMF G;  1Z5W A;  4DR6 O;  1N36 O;  4NXM B;  3JCZ A;  1NH2 B;  3RW0 A;  1BZK A;  4UV9 A;  1GN3 A;  1YXB A;  4J7J A;  1R3L C;  4GX2 A;  1TUE B;  3JAM N;  4C7U A;  4HZ3 A;  3K59 A;  4DV6 B;  3QF7 A;  4NR1 A;  3VQV A;  5CMU A;  4KXR A;  1B6Q A;  3AG1 C;  2ZR2 A;  4X1I A;  3BAA A;  4WBN A;  1K9M W;  2ZDI A;  1HNX B;  3ZHU A;  3ZX6 A;  2JEU A;  3L75 H;  1SF9 A;  4QGP A;  2IW5 A;  3CJH B;  4PA3 A;  1RM1 B;  4YHH O;  4MTO A;  3AK1 A;  4FFK A;  3OR6 C;  2E76 B;  1EN6 A;  2JGD A;  3CCQ V;  1R3J C;  4DUY O;  1E1Q G;  4JAU A;  1XMO O;  3FAV A;  3UT5 A;  4GKJ B;  1Z5V A;  4B3R O;  3SJC C;  1AI4 A;  4MVU A;  1XBL A;  5IYD O;  1J5E O;  2DQ0 A;  3AG3 B;  4LF9 O;  4JI1 O;  1IBM B;  3T4D A;  3STL C;  2PUS A;  1W59 A;  4IIJ A;  4OPA A;  3IC9 A;  5LA6 A;  3DXR B;  4TUY A;  4H37 A;  1ORQ C;  1Q6I A;  4FMT A;  2M6Y A;  4J9Z B;  4I50 A;  4I7Z B;  1JVM A;  3CX5 F;  1VF5 B;  1EM1 A;  5CA1 A;  4JI3 B;  5LYJ B;  1OCR B;  2HEP A;  4YJ2 B;  2XAH A;  5CN0 A;  3K0D A;  4HAM A;  1XHZ A;  2G38 A;  4DR7 B;  3OAA G;  2VS0 A;  3NXS A;  4GUN A;  1NT2 B;  2WLI A;  4JI8 B;  2QTS A;  1MZF A;  4YY3 B;  4LBE C;  3ZMU A;  5A9G A;  1PP9 H;  4G27 B;  1QQC A;  4GZR B;  1TGO A;  2W0F C;  1Q81 W;  3JD3 A;  2XT9 A;  4IYI A;  2P4K A;  3UKM A;  2FL4 A;  3K5N A;  3HKC A;  3K06 A;  4LFB O;  1N32 B;  2QWN B;  3JSL A;  2BE3 A;  2XAG A;  4LFA O;  2ETN A;  4W4K A;  2FB5 A;  1DLB A;  4PHZ A;  4NTY A;  4PA6 A;  5B1B C;  1NJI W;  4FM2 A;  2DQ3 A;  2NLJ C;  1XEQ A;  1FXH A;  4EB6 A;  3KZI Z;  1VQ7 V;  5BR8 O;  1WNS A;  3SYC A;  5JQG B;  3W7T A;  3ETG A;  2P90 A;  4X1K B;  2JIZ G;  1QVF U;  3WG7 C;  3KCX A;  4O4I B;  1VQK V;  4BIZ A;  2YID A;  4AQY O;  1QLE B;  4DV4 B;  2PI4 A;  2Q68 A;  2GV9 A;  2YI8 A;  5JVD B;  4O4L B;  3RVZ A;  2CDY A;  4BW5 A;  4JTD B;  3P3P A;  4L8J A;  2F95 B;  1RSO A;  2Q73 A;  2YSU B;  2YIC A;  4PA4 A;  1WPX A;  4I0X B;  2WLH A;  2IH1 C;  2CAZ C;  2UXD B;  1M57 C;  3T1C A;  1HR0 B;  5LMN B;  3HKB B;  4JI6 B;  1VQM V;  5L3D A;  4CS4 A;  3RYI A;  3GWO A;  1ZWI C;  1VEW A;  4ZHQ B;  4PD4 F;  1CP9 A;  4ZKI A;  3A0H Z;  1THZ A;  4UFZ A;  1LNQ A;  2QKA A;  1RPO A;  3AG2 B;  3E86 A;  5B3S B;  1L1F A;  3SPI A;  1JMK C;  4UVC A;  4LF7 B;  2HJD A; 
#chains in the Genus database with same CATH homology
 3OUF A;  4GCZ A;  1GM9 A;  3F5W C;  1NH2 D;  1YTF D;  1K4C C;  5EC2 C;  2HVK C;  2C2A A;  5DN6 G;  1JJ2 U;  3WFV A;  5EK0 A;  4U7N A;  1XL6 A;  2IJK A;  2X0L A;  1S3J A;  3BEH A;  2F43 G;  5LGU A;  1AI5 A;  4MTG A;  4XDK A;  4MSW C;  4E2L A;  2XAS A;  2FTK A;  4UV8 A;  4UXN A;  1YJN V;  1BHA A;  3LNM B;  3IGA C;  2NNU A;  3I55 V;  3FB6 C;  1H2G A;  2MK3 A;  3E35 A;  4MTX A;  4RO2 A;  3OM3 B;  4GX1 A;  3W7W A;  1VQO V;  3ZRS A;  3CXC U;  2P6J A;  3MHH C;  1VQ6 V;  1ROP A;  1DF5 A;  4GX0 A;  1AI6 A;  1NR1 A;  3CCU V;  1Q82 W;  4QJF B;  2JEX A;  4FJC C;  5CA3 A;  2Q67 A;  3TK1 A;  2HKO A;  2HFE C;  2IH3 C;  3JD0 A;  1M90 W;  1M9N A;  2XOK G;  4U7O A;  2EZP A;  3OR7 C;  1K4D C;  1GK9 A;  4I9W A;  3TET A;  1S72 V;  1S76 D;  3JD4 A;  3OMN B;  2WLJ A;  2A0L A;  5B1O A;  1XL4 A;  5HFL A;  3AG4 C;  4TT3 G;  1P7B A;  4UUJ C;  4MVR A;  3QNE A;  3G6E V;  2OCC B;  4PA9 A;  4P9O A;  4H33 A;  2X7R B;  1KEC A;  2Y48 A;  1MAB G;  3SYA A;  3ABM C;  2UXN A;  4HYO A;  3LSS A;  3QO8 A;  1I5Y A;  3OEE G;  5H6Q A;  3B8M A;  3AG4 B;  1VQ5 V;  1VQ4 V;  1F4M A;  1YHQ V;  5EC1 C;  1K73 W;  2QM7 A;  1JQ0 A;  3ETD A;  4DO2 A;  1CEZ A;  4WFG A;  1COW G;  3OGC C;  1GO3 F;  4X89 A;  2WPD G;  3JYC A;  3ZN0 A;  4MT8 A;  2DW4 A;  4WCE V;  4Q20 A;  1YIJ V;  1J95 A;  1BL8 A;  3ABL C;  4OXS A;  2WLL B;  1YI2 V;  3SPC A;  1VQP V;  2B1I A;  4WF9 V;  1Y4M A;  5KA5 A;  4FIP C;  2LP7 A;  3K0G A;  1AJN A;  2WWW A;  5H6R A;  1I5X A;  1QVG U;  1IXM A;  3VBB A;  3A0R A;  2QEX V;  3ABL B;  2KB1 A;  4P9P A;  3ZRW A;  3T2M A;  4RAI A;  2M7W A;  3DGE A;  4XDL A;  5IY5 C;  3G71 V;  1VQL V;  2B1G A;  2DYR B;  2PI5 A;  2CK3 G;  5KUK A;  1G8M A;  3B77 A;  4I5S A;  3IC7 A;  3OMA B;  1GKF A;  3E2E A;  1PD3 A;  1NKD A;  4QPJ A;  3EFF K;  2JK5 C;  5B1N A;  2UXX A;  2W6I G;  4LP8 A;  3W7S A;  1K33 A;  2Z5U A;  1V54 C;  4MW3 A;  4Z1M G;  1ENV A;  2X6B A;  2ZR3 A;  2JJ1 G;  3CPW U;  4EKW A;  5GW7 A;  1EBO A;  1QBZ A;  4MVQ A;  1FXK C;  1KP2 A;  4JYB A;  1PNM A;  1NQT A;  2EJR A;  5LHH A;  3AG1 B;  4JAV A;  1JX9 A;  2ZD9 A;  3QO5 A;  4MVS A;  1Y66 A;  1FXK B;  4JTC B;  1OCO B;  3ABT A;  4N21 A;  5B3S B;  5B1A B;  1BHB A;  3UM7 A;  3LUT B;  2P7T C;  4X88 A;  1QCE A;  1SER A;  3W7U A;  1K7D A;  4WFH A;  1VQN V;  2A9H A;  2WLM A;  3P32 A;  2LFR A;  2V7Q G;  2W6J G;  1GMG A;  4KFM A;  3ETE A;  4FK5 C;  1KC8 W;  2WLK A;  3CYO A;  5EBM C;  3OEH G;  2GHY A;  4L87 A;  5J9P C;  1W0J G;  2ITC C;  2Q69 A;  4KUM A;  5KUM A;  5LGN A;  3E83 A;  3CC7 V;  1QR9 A;  3ZMV A;  2V1D A;  2IU3 A;  2XAF A;  2B5U A;  1KQS U;  3HB3 B;  4UVA A;  1R3I C;  1FXK A;  1SES A;  3QO7 A;  1PNK A;  2H8P C;  4WFA V;  4R7C A;  2ZXW C;  3ZMT A;  3OMI B;  2OCC C;  3ASO C;  4BAY A;  2R9I A;  3G4S V;  2EZO A;  4F4L A;  1K3E A;  4RUE A;  3LDE A;  3LDC A;  1E79 G;  2ZXW B;  3SJQ C;  2QE7 G;  5E1A C;  5H9C A;  2HVJ C;  3CC4 V;  1R73 A;  2DWE C;  3ASO B;  5CBF A;  1GM7 A;  2HLD G;  3OE7 G;  1QR8 A;  3K9A A;  3F7V C;  1F23 A;  2AHY A;  4QPK A;  1SRY A;  4RQF A;  1AI7 A;  1K97 A;  5L3G A;  2EIJ C;  4WFB V;  1CPY A;  1YIT V;  3X2Q B;  1DF4 A;  2Z3Y A;  4XDJ A;  5L3F A;  1OZ0 A;  1S5H C;  4PDR A;  2YEV B;  1M1K W;  1SET A;  2IJJ A;  5HFM A;  2DYS B;  3T4Z A;  1JPX A;  3ZMZ A;  2EIJ B;  5IDJ A;  2X6C A;  2EIM B;  4R50 A;  3MD0 A;  4DXW A;  4TSF G;  2ZDI C;  2EIL C;  1GTO A;  3RVY A;  4BIU A;  4GT1 A;  1M56 C;  2DYR C;  2HG5 C;  3E8H A;  1NR7 A;  2Y69 B;  3ML0 A;  4R6Z A;  4MS2 A;  2XND G;  1KKD A;  1BMF G;  2GSM B;  1W2B U;  2EIL B;  1M56 B;  1JCH A;  3K3W A;  1K5Q A;  4FPP A;  5C93 A;  3OFN G;  1AJQ A;  3JCZ A;  4LC1 A;  1NH2 B;  1YTF B;  3RW0 A;  3VOU A;  3E8F A;  4UV9 A;  2IU0 A;  4JYC A;  3ZRX A;  1R3L C;  4PDV A;  5L3C A;  2EIN C;  4GX2 A;  1TUE B;  1EFR G;  3ABK B;  1N8R W;  4HZ3 A;  2WLL A;  3K04 A;  1KD1 W;  5CMU A;  3SYQ A;  2HJF C;  1B6Q A;  3B8N A;  3AG1 C;  3CCJ V;  2JDI G;  2ZR2 A;  1MSW D;  4X8A A;  2EIN B;  1YSC A;  4CBC A;  3EHB B;  3SPG A;  1K9M W;  1OCO C;  2WAM A;  2ZDI A;  2IJI A;  2OTJ V;  2JEU A;  1OCC C;  4GX5 A;  2IW5 A;  3IFX A;  5B1A C;  1S0V A;  1OCZ C;  4PA3 A;  2IJH A;  1RM1 B;  2WLN A;  2R9R B;  4MTO A;  3STZ C;  3OR6 C;  3E8B A;  3HPL C;  3CMA V;  4JGS A;  1E1R G;  5LHG A;  3CCQ V;  1V55 B;  1R3J C;  1SZT A;  1H8H G;  1E1Q G;  1OCC B;  1OHH G;  3K03 A;  4JAU A;  2A79 B;  4UVB A;  2QA4 V;  3ZN1 A;  1H8E G;  1KP3 A;  1OCZ B;  3AG3 C;  3E89 A;  5DM6 V;  1EZJ A;  3CCM V;  1K5S A;  1K8A W;  1VQ8 V;  2XAQ A;  3BY6 A;  1AI4 A;  4MVU A;  1MOF A;  4P30 A;  5LBQ A;  1FFT B;  5IYD O;  2DQ0 A;  3AG3 B;  3ASN C;  3FB7 C;  1S77 D;  2WLI B;  3SPJ A;  3STL C;  3T4D A;  2EIK C;  1R3K C;  5IYB O;  5BZB A;  1AJP A;  1AR1 B;  4KP4 A;  1P4R A;  4JPR A;  4XBF A;  3M99 B;  4H37 A;  2X6A A;  1OCR C;  1ORQ C;  3ASN B;  3ZIA G;  3CCR V;  4FMT A;  1Q86 W;  4J9Z B;  4PEL A;  2LFS A;  2EIK B;  1JVM A;  2QTO A;  1RPR A;  2K1E A;  1UJW B;  3D36 A;  5L3B A;  1OCR B;  1NBM G;  3K0D A;  2XAH A;  1G4Y B;  4HAM A;  4MVO A;  5CN0 A;  5CBG A;  3KG2 A;  3ZRV A;  3OAA G;  5EBL C;  2OTL V;  3CC2 V;  3JD1 A;  1NVP D;  3NXS A;  1K92 A;  2BOB C;  3GB7 C;  2D3O W;  1HWY A;  2WLI A;  1Q7Y W;  1R6K A;  3X2Q C;  3K08 A;  4LBE C;  2EBO A;  3ZMU A;  4R8C A;  3W7X A;  2DYS C;  2BOC C;  3FYI B;  3SYP A;  4G27 B;  4YXW G;  5LGT A;  2EIM C;  2W0F C;  1Q81 W;  4QIW F;  3JD3 A;  3JD2 A;  3LSQ A;  3CP1 A;  4P2Z A;  3SYO A;  4MVM A;  3I56 V;  4JF3 A;  4WFF A;  5KA6 A;  3UKM A;  3CCS V;  1R6N A;  2ZQM A;  4J9Y B;  1YJW V;  2Y69 C;  3K06 A;  5FL7 G;  3RBZ A;  3OW2 U;  1DTO A;  2XAG A;  5EBW C;  1QLN A;  3ABU A;  4PA7 A;  3CCV V;  3ZJZ A;  1DLB A;  4N23 A;  3ZRW B;  3ZCC A;  4PA6 A;  4PDM A;  5B1B C;  1NJI W;  1H38 A;  2DQ3 A;  2NLJ C;  3AEI A;  3E8G A;  4MTF A;  5L3E A;  1VQ9 V;  1FXH A;  4RQE A;  3ABM B;  3CME V;  1VQ7 V;  4MW8 A;  2Q6A A;  3SYC A;  3CCE V;  1YJ9 V;  3ABK C;  2OT5 A;  5LHI A;  2QM8 A;  3FKS G;  3ETG A;  2P90 A;  4PDL A;  1QLE C;  4WFE A;  5B1B B;  3W7T A;  2JIZ G;  4JAS A;  1QVF U;  1JOY A;  3WG7 C;  5IYC O;  3ZMS A;  4RUF A;  1VQK V;  2YEV A;  4LCU C;  4QNH B;  4BIZ A;  5CBH A;  4G28 B;  1QLE B;  2ITD C;  2PI4 A;  2H94 A;  2Q68 A;  3WG7 B;  1W0K G;  3CCL V;  3P30 A;  1RM1 C;  3RVZ A;  4BW5 A;  3OUS A;  4QE7 A;  4JTD B;  4CZZ A;  4ZBM A;  2XAJ A;  2YSU B;  3PJS K;  1V55 C;  3K79 A;  3SPH A;  4PA4 A;  1ARO P;  1WPX A;  2WLH A;  2IH1 C;  2HR3 A;  4ASU G;  5IY5 B;  4MVZ A;  1M57 C;  1PNL A;  1K34 A;  2DWD C;  3T1C A;  2ATK C;  1VQM V;  5L3D A;  3AG2 C;  5B3S C;  3DTU B;  4TWK A;  2P67 A;  3FB8 C;  3GWO A;  1ZWI C;  1PL0 A;  1MG1 A;  3TCU A;  1CP9 A;  3MHS C;  2QKS A;  3R65 A;  3H01 A;  3FYE B;  4ZKI A;  1THZ A;  1M57 B;  1LNQ A;  1PKX A;  3FB5 C;  3CD6 V;  1GM8 A;  2WSS G;  3LDD A;  2JJ2 G;  3D3I A;  4JTA B;  4QE9 A;  1RPO A;  3AG2 B;  1F4N A;  1FS0 G;  1V54 B;  1F51 A;  1WLE A;  3E86 A;  4G2K A;  1L1F A;  2AHZ A;  3SPI A;  1FXV A;  4UVC A;  3F7Y C;  1NVP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...