3STLC

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3stlC00
4X89A 3ZJZA 2WLIB 4PA4A 3SPGA 3AG4C 4TWKA 2Q67A 2WLHA 4PA3A 3ABMC 4F4LA 4PDLA 5B1BC 5EK0A 2WLLB 3X2QC 1ZWIC 2H8PC 2DWEC 4MTOA 3KG2A 1JVMA 3K0DA 3BEHA 4MW3A 3AG1C 4MVRA 3SYPA 4LBEC 4J9ZB 3K08A 3VOUA 4CBCA 2AHYA 3K04A 4GX5A 2DYSC 2EIJC 3SYCA 2ITDC 3HPLC 3R65A 4HYOA 4XDLA 3STLC 1XL4A 3F5WC 3F7VC 5B3SC 1OCCC 1OCRC 4QE7A 4I9WA 2Y69C 3EFFK 3F7YC 2EIMC 4XDKA 4WFEA 3OR7C 4MVZA 4RUFA 3RVZA 2YEVA 2X6AA 3E8BA 1R3KC 5EBWC 3E89A 4KFMA 2NLJC 4LP8A 4XDJA 1R3IC 2OCCC 4PA7A 2ZXWC 4G27B 2IH1C 4BW5A 1LNQA 4WFFA 3LDCA 2K1EA 2EILC 2QTOA 5BZBA 1G4YB 5B1AC 4RAIA 5EBMC 2R9RB 4WFHA 5KUMA 3FB8C 3RVYA 4UUJC 4MVOA 2W0FC 2A0LA 3T4ZA 3PJSK 3ASOC 3LDEA 1K4DC 2IH3C 3LDDA 4MVUA 5EBLC 1M57C 3FB5C 4QE9A 1K4CC 4JTAB 4P2ZA 4PA9A 5EC2C 4PDRA 2BOBC 2HG5C 3SPJA 4JTCB 2A79B 4R50A 2WLMA 2Q68A 4G28B 2P7TC 2HJFC 4GX1A 1M56C 4P30A 1P7BA 3SPHA 2EINC 2Q69A 1V55C 3AG2C 3T4DA 5KUKA 5CBGA 2EIKC 4GX0A 1QLEC 4MTGA 3OUFA 3AG3C 2BOCC 3RW0A 1KKDA 4R8CA 1XL6A 4HZ3A 3STZC 4DXWA 2ZD9A 3SYOA 2ITCC 2WLNA 1R3LC 4EKWA 3TETA 5CBFA 1OCZC 4MSWC 4MW8A 1J95A 5E1AC 2KB1A 2X6CA 3RBZA 3SJQC 3K06A 4MVQA 3SPCA 5CBHA 4PDMA 5J9PC 3E8GA 3OR6C 2DYRC 3T2MA 4MTFA 2Q6AA 5IY5C 1V54C 3TCUA 3ASNC 4J9YB 3ABKC 4PDVA 3UM7A 4JTDB 4MVMA 4MVSA 2HVKC 4R7CA 2WLIA 3K03A 1OCOC 4P9OA 1BL8A 3E8FA 3GB7C 4WFGA 3T1CA 2AHZA 3IFXA 1S5HC 2WLLA 3UKMA 1ORQC 4OXSA 4RO2A 3FB6C 3IGAC 4P9PA 4RUEA 2ATKC 3FB7C 5EC1C 2WLJA 4X8AA 3LNMB 4R6ZA 4X88A 3OUSA 2JK5C 3WG7C 1R3JC 3OGCC 2X6BA 3E8HA 3ZRSA 2QKSA 3LUTB 2HVJC 3E83A 3SYQA 3SPIA 4MS2A 2HFEC 4QNHB 4GX2A 4H37A 2A9HA 4ZBMA 4H33A 3JYCA 4PA6A 3E86A 3K0GA 3ABLC 2DWDC 4LCUC 2WLKA 3SYAA
chains in the Genus database with same CATH superfamily
2JGUA 1I94B 4DRXB 5LBQA 2WSSG 2QTSA 1FAFA 1XDCA 1YCIA 2AHYA 4H0LB 4K0KO 4DV2O 2ZCEA 3JAKA 3T1YO 2HR3A 3E22B 3F7YC 4BIOA 4UB6Z 1OV9A 1Y74A 2ZQMA 1OHHG 1GAXA 4PA7A 3HKDB 4EEQA 4XBFA 5BZBA 3RYCA 4WCEV 3FB8C 4AHCA 1K7DA 2W0FC 3T4ZA 3CCJV 2R9AA 3UCSC 4JTAB 5LMUO 4B3SB 2UXDO 3HKEA 1BQ0A 4DV4B 5LOVA 1HNXB 3RYHA 1SQBH 4LC1A 1NS1A 4DR2B 1QVFU 1FXKB 1IDSA 2HLDG 3RBZA 3SPCA 4U3JB 3D3IA 3E8GA 4FLUA 3P30A 2DYRB 4DW1A 1JX9A 3L74H 1SRYA 2RCVA 4PDVA 3GVMA 1TVKB 2CK3G 4LFAB 2ZNIA 2QGNA 3H1KH 1S0VA 2Q4PA 3A0HZ 2EZPA 2WLJA 2YSUB 1NR1A 2JK5C 1B06A 1FFXB 1XHZA 4IIJA 4QJFB 2AZ2A 1N36O 1THZA 3I5DA 2XAJA 3FKSG 4YHHB 3IC7A 4FMTA 5B1NA 4I0XB 4LCUC 3CWBH 3FAVA 4MT8A 4O2AB 1O9GA 5LMNB 4UB8Z 1WJZA 1G1XB 2QM8A 4DV3B 3BPZA 3S3XA 1IXBA 2JGDA 2QWOB 3JARB 1N33O 4HYOA 3G71V 2EBOA 2GUZA 1QNMA 5IYBO 1Q43A 1BT8A 4MVZA 4O4IB 2QE7G 1SA0B 3OMAB 2R70A 2OCCC 4TT3G 4O2BB 2W6IG 2LGWA 2UXNA 3JAWA 5JH7A 2IM9A 1VQ9V 2A0LA 1M5IA 5IT9N 3ASOB 5JJNB 1M1KW 2ZINA 1M57C 5EBLC 2P5OA 1DGSA 3B77A 5EC2C 3SPJA 2IJHA 1EBOA 4KHPO 4BAYA 2A3QA 4X65B 1WN7A 3K58A 1CP9A 2Y69B 3OEEG 2FB5A 5IDJA 4LF8B 3SPHA 2Y4UA 2YS8A 2ZKOA 2PI5A 2JRIA 3H1HH 4QGPA 1EM1A 3STZC 2WLNA 1KYOF 1W0JG 4OPAA 5J9PC 3U10A 4JI5B 3ZRXA 2N74A 3HKBA 1YVWA 1AR4A 4I55B 1H2MA 2UUCB 5BR8O 1BZKA 3QVNA 1VQ6V 3B2EE 3K3WA 3GWKC 4AILC 1Y4MA 1N34B 4TV8B 2D2CB 4DV0O 5A9GA 2Y0PA 1OJHA 5IYZB 2QKAA 1GTOA 3VQXA 4NXMO 3CC7V 1NKDA 2LJ2A 4K8XA 1TAEA 4E4EA 2WLIB 4PA4A 4MTXA 4TSFG 3ABMC 1F7YA 3HKCB 1HWYA 3KG2A 3SJBC 4KUMA 3G67A 5CA3A 2R72A 2ITDC 1KC8W 4QIWF 5CMUA 3F5WC 4I9WA 1K5QA 1Q3EA 3FD9A 2F4VB 5L3CA 3UO2A 3SJAC 2LFRA 3P32A 3BA8A 4BW5A 1LNQA 1U96A 3JD0A 2K1EA 5LYJA 3OW2U 4OX9B 4X1YA 3CCMV 1AVMA 4Q20A 3BHPA 1M9NA 5GW7A 1N32B 2QWQB 3L73H 2AXTZ 4JYAO 1IBMO 1M4UA 4O4LB 5LGNA 2YEVB 3T4DA 1HP8A 5CBGA 1KQSU 5JCOC 5E79Z 3DXRA 1VQ5V 3OT7A 5KAIZ 4IYHA 1S5JA 4JZ2A 2RNBA 4DR4O 5H5NA 1JOYA 2OT5A 1Q6HA 1H8HG 3OM3B 1IBLO 1QR9A 5IY5B 3ASNC 2C2AA 2JVDA 5C8YB 2XHBA 4UCRA 4CC5A 4TUYA 2XAQA 1R1BA 2F43G 1GK9A 3CCRV 2YI9A 1BMFG 3TJTA 1TUBA 4AQYO 1NVPB 2UXBO 4QNHB 2GHYA 4I5SA 1B04A 1B6QA 4ZBMA 4PA6A 1BHBA 4TWKA 3SYAA 4DR1O 4X89A 1P84F 3SPGA 1RSOB 3OMIB 2HHHO 4JI1O 3ABUA 1D2DA 4PDLA 2FKXA 2Q73A 4X20A 5EIBC 2Q0AA 3LNNA 3K04A 2Z5UA 1ZUQA 1W2BU 3CMEV 2L6LA 5B3SC 4JI7O 1MMMA 5GONB 4PI2A 3CCEV 4I50A 1IVSA 5ITZB 2PF4E 2QDOA 1PL0A 5KUMA 1V9PA 4D7TA 4IHJB 4UUJC 1E1RG 1VQMV 2HEPA 3LDDA 4CS3A 3CXCU 2DE0X 3VQWA 1K34A 1KU9A 5JJJB 3OTOB 1NZ6A 4FIPC 2EINC 2DMXA 1QLEC 5B1OA 3P3NA 1NH2D 4JI6O 3ZMZA 2LO1A 4G2KA 4LF6O 4DR5B 1NJIW 5IJ0A 1WNSA 3K06A 1GM8A 3THOA 1YIJV 3JCUZ 5JQGA 1XBLA 3T2MA 1WA8B 3JALB 2BSKA 1AROP 4B3TB 4X64O 3UT5B 2V7QG 1YXBA 2XAFA 3AK3A 3RYIB 4YJ2A 4UV9A 5FNVA 1COWG 3GB7C 4LR3A 1XNRO 1T5EA 4J42A 3Q4HB 3UKMA 3FB7C 3BVOA 4X88A 4GLXA 4O4JA 1Q81W 1BS3A 1YJWV 4ZOLB 1YJNV 2X6BA 1JJ2U 4LF9B 4ZHQB 3AEIA 4GKKB 1Y66A 4O4HA 4FZ0A 4JI8O 4FFBA 1PNKA 3I56V 3QF7A 4TV9A 3ETEA 3RT3C 1ZWIC 1NTKH 4MW3A 1AI7A 3K08A 1IXMA 4KL1A 3CXHF 3SYCA 2Y0IA 2CH7A 3HPLC 4WF9V 3CD6V 3L9DA 3F7VC 3W7TA 4FM0A 3EFFK 5DEDA 4PELA 2KQXA 2OYQA 4FLWA 2DOSA 1Q86W 3ABTA 1XILA 2E5LO 1H2LA 1R3IC 2OCCB 2ADPA 3JATA 3RVYA 1GO3F 3X2QB 3MDSA 1H8EG 4BW9A 4DR3O 1RPRA 1Y6XA 1AI5A 1M57B 1F4MA 2DYSB 3JAKB 1K8AW 4PI0A 2OIGA 2VWJA 4P30A 4X1KA 3C90A 2ODMA 1Y74B 4GX0A 1HW7A 4NTXA 2ZXWB 3ZN1A 1QVGU 1KP2A 3B4SA 4ZIBA 1URFA 1P4RA 4X62O 3U0ZA 4QPJA 1TA8A 3FYEB 3HKEB 1MNGA 2HVKC 3ZHRA 5LOVB 4J41A 1G8MA 3RYHB 3CRMA 3IFXA 1MABG 3B8MA 4UVAA 3R66A 3SGIA 5CB4A 3WU2Z 2CTRA 4K0KB 3N2GA 3E83A 1SQGA 3D36C 1PNMA 2IW5A 3U11A 2E75B 1EN6A 1O9HA 2RMKB 3K0GA 2ZDIC 4YXWG 2E74B 4JGSA 2IU3A 4K35A 5IWAB 3ABMB 5EK0A 4EFBA 1XREA 1L0LH 3AG1C 5LHIA 2QWNB 4W4LA 4TQFA 2CTQA 4IIJB 3UO3A 2YUAA 2K9PA 3OFNG 4UCUA 1D5AA 3QO7A 2LP7A 1GN4A 5D5QA 1F51A 1DK1A 3NXSA 3RVZA 5KLVH 1R3KC 3ABLB 4CH4A 3E89A 5JVDA 2NLJC 2IBZH 3FAVB 5BMVA 1L1FA 4JI3O 1PD3A 2VQEO 3CC2V 3RYFA 4RAIA 1XNQB 2JIZG 1PM9A 1MZEA 4HNAA 4PA9A 2JGDB 2O57A 2LW7A 2WA4A 3OEHG 4FK5C 1VQPV 2F95B 2GUZB 1KB9F 2HJFC 1EZJA 4B7KA 1M56C 1GN2A 1P7BA 5EYPA 1JR9A 4BR6A 3N2KB 2BOCC 2PUSA 3JAWB 3VQYA 3ZIAG 5JH7B 2IU0A 2GTSA 5LA6A 4DV6B 3K5LA 4LF7B 4PDMA 3ZN0A 2UU9B 3NR7A 1N0NA 1HDJA 4NXNO 1U97A 4Z1VA 4B3RO 4CH3A 1I7FA 1EN4A 1IBKO 1F23A 3E35A 2N05A 1X59A 3IGAC 1XMOB 1N33B 2L35A 1NTMH 4FLTA 2Q5ZA 3SPIA 4UV8A 1GN6A 1H2NA 3SR2C 2A9HA 1ZL8A 3HKBB 1R73A 4LF5B 2ZNJA 1TGOA 4X1IA 4DR7O 3ZHUA 1VP7A 4C7UA 2CGOA 4A5UB 1I94O 3KZIZ 3CC4V 1BHAA 3BEHA 3SYPA 1YSCA 3VOUA 2WA3A 3H1JH 3DC5A 4FZ1A 2OIEA 4KHPB 3BCCH 1SC5B 3G80A 4QE7A 5B3SB 4X66B 2Y4TA 3OE7G 3AK1A 1E79G 1GMGA 4EFEA 1JPXA 4GKJO 1LUWA 4UCVA 4DUZB 1S3JA 4YY3O 4FM1A 4WFFA 3CRRA 2DW4A 3PN1A 2FL4A 4MVOA 3LDEA 3LSUA 5EZYA 2B1IA 3KKYA 5L3FA 3BAAA 1RP3B 2A79B 4B3SO 1MSWD 3W7XA 4IL6Z 4DV4O 3H01A 2CAZC 1FXHA 2IJJA 2JEXA 3QNEA 1V55C 2EINB 2VS0A 3AG2C 5JCOA 3ZHVA 4MTGA 1QLEB 4J10A 3JASA 1KKDA 5LYJB 4DR2O 3B40A 1XEQA 5CBFA 4DV0B 3ICXA 1AI6A 4X1YB 4MVQA 4DV1B 3K5MA 1HNWB 4I4TA 1PPJH 4WFAV 1L0NH 1KMIZ 5LHGA 4CS2A 4LFAO 2HJDA 1Z5VA 4F6RA 1HNZB 1SZTA 4Q6GA 5J2TA 4RUEA 3MHHC 5H6QA 1KECA 3L71H 1LUVA 3DXRB 1NBMG 1WB7A 2VQFO 3OUSA 4LH6A 3ZRSA 3RFRA 1GM9A 1NH2B 2IJKA 5KA6A 4DV7B 1WAZA 3JSLA 1AR5A 3CPWU 3CS5A 4TUYB 3EXAA 4JPRA 2Q67A 4TQDA 3ZHQA 1UJWB 4RWUA 2OTJV 4N23A 3L70H 1MG1A 4B3MB 4GX5A 5FPOA 1TUBB 1UPGA 3R65A 1OCCC 2BCCH 1IBMB 3FYIB 1SKVA 2QJ1A 3O9OA 3UQ8A 1MSDA 1YDXA 3BA9A 1VQ4V 3K79A 2V4DA 4XDJA 4G27B 2CTWA 3AG4B 2JJ2G 5IYDO 4LFBB 1KBHA 4X20B 3B09A 2JEUA 1K4CC 2HG5C 2P4KA 4GUNA 2GTAA 4GX1A 1DTOA 5KMGA 2Q69A 3O65A 4LF8O 3ZS8C 2EIKC 3S3WA 2Q7GA 2W6JG 4I50B 2PGGA 3AG3C 1N0JA 2FMLA 2Q9LA 3TETA 3WB0A 1S76D 3C3TA 1J95A 2UXBB 1XMQO 3W7UA 4JI5O 4GT1A 1YITV 1Y76A 2Q8VA 2YXHA 5DN6G 2Z3YA 4JAUA 3ABKC 3LSSA 4JTDB 4DR1B 1VARA 1WP8A 1FPOA 2HHHB 4LFCB 2UUCO 2JS5A 2WLLA 4JAAA 4U7OA 2XOKG 1EZVH 3JSNA 5CA0A 1IZ3A 4DUYB 1R3JC 2QKSA 5IJ0B 3IJ4A 4UCTA 2HVJC 2PZSA 4E2LA 4JI7B 2HFEC 2Z0AA 5JQGB 4OGQB 2BSKB 4NB5A 1YTFD 4YIPA 2OTLV 4YJ2B 2RQ6A 1QU7A 5FNVB 4PD4F 5EIBD 5H6RA 5KA5A 3RWRD 4MTOA 2UXXA 5KAFZ 1PKXA 1KKCA 1SZXA 1Z2GA 3F5TA 3J7AU 4O4JB 4CBCA 2P06A 5KHHA 3CE2A 3ZMVA 2CE4A 4DR6O 2Y48A 2KSDA 1XL4A 2AZ0A 4O4HB 3I55V 3WFVA 4FLVA 4BWAA 4FFBB 4RUFA 2X6AA 1XHXA 4LP8A 3QO8A 4TV9B 2IH1C 4LF6B 2P4VA 2QR4A 5KHGA 2AGAA 1WB8A 4ICGA 3ZBHA 3RN4A 2IH3C 4MVUA 4JYCA 4ZKIA 1VF7A 2BOBC 2CH7B 4X64B 2ZM6O 1RPOA 1XI1A 3E2EA 4AI8A 4ASUG 1XNRB 1VQ8V 3EHBB 5JJEB 4Z1MG 4DO2A 3CRQA 3JATB 1L8DA 2LW1A 1F4NA 4NR1A 2GSMB 4JI8B 3ZEDA 1WP7A 4J9YB 4WBNA 2XASA 2BTQA 2YIBA 4OPHA 2ADQB 3K03A 1OCOC 3E8FA 2UUAB 1MA1A 4X1KB 1S5HC 5BXZA 1FJGB 1AJNA 1N8RW 1J5EO 1HR0O 3G4SV 3L75H 2B1GA 3D36A 1ZTEA 4CH5A 4BIZA 1CPYA 3SJCC 3H1LH 1JJOA 2H94A 2PY5A 2ZDIA 4UCOA 3L72H 1A32A 1H38A 3T1HB 2ILMA 3MHSC 3APQA 2A06H 3H9VA 4F4LA 3K9SA 2H8PC 3D3QA 5CB4B 4J9ZB 3HB3B 2XNDG 5J2UA 2ZIOA 1OCRC 5KHJA 2Y69C 3M8AA 4ZI7A 3JD3A 4UXNA 3E8BA 3A0RA 1XUQA 3KCXA 4FM2A 4LNUA 3CYOA 2FTKA 1H2KA 1CEZA 4X62B 5D5PA 4P2ZA 2YXLA 4PV1B 2XT9A 4R50A 4CS4A 2Q68A 1RM1C 2F1MA 5IJ9A 5H9CA 3M99B 5JVDB 5BMVB 3OUFA 1JFFA 1GH6A 1SQXH 5KX5A 4JI0B 3QTCA 4MW8A 4DR5O 2HP8A 2YIBD 3QG5A 4JV5O 4HNAB 5DECA 4MTFA 2UUBO 4B3TO 2FYUH 3W7WA 2BE3A 1NI8A 1X4TA 4DV5B 3T1CA 1US6A 1Q82W 2M6YA 5EYPB 1DF4A 5LGUA 3LNMB 3CCVV 1VEWA 3RYCB 1FS0G 2YICA 3DC6A 4FFKA 2XTAA 3AG7A 5LA6B 4LF9O 1JMKC 4GKKO 2XUMA 4LF4O 2CUGA 4YJ3A 3JYCA 4JI3B 1GM7A 1XOUA 2IJIA 4U3FH 1JVMA 3K0DA 2KG7A 2RDCA 2ETNA 2RJZA 2Q7HA 4DV2B 2ZT9B 3J80N 3T1YB 1Q90D 1OCCB 3H1IH 4JYYA 2UXCO 4KXRA 2EIMC 1ZL8B 3K9AA 3K57A 5CA1A 4X1IB 4QPKA 1S5LZ 4NTWA 3K5NA 4NXNB 4PHZA 5LMUB 1DF5A 2UXDB 1K97A 4B3RB 1B3QA 4LH7A 2JJ1G 3BY6A 4FPPA 4JI2O 2ARHA 5B66Z 1GN3A 4HBNA 4ABMA 5KHKA 1VQLV 4N21A 1IURA 2QA4V 3TXQA 2M7WA 1R3LC 3CJHA 4TOIA 4KP4A 4MSWC 3ZHSA 5EZYB 2QWRB 4UVBA 4DW0A 2Q6AA 1R6TA 1VMGA 2CGNA 5AG2A 4NKGB 5B5EZ 3ABKB 4MVMA 4DR7B 4P9OA 2VWKA 1I0HA 1K92A 4RO2A 1YEWA 3JASB 3CCSV 2ZR2A 5LXTA 1N36B 2OCHA 2Q0OC 4JASA 5K1PA 3SYQA 2KKWA 4JI4O 4Z2WA 3TGUH 4UVCA 4I4TB 4JF3A 3SDLA 1R6NA 4H37A 3ASNB 1K5SA 4GKJB 2DWDC 4YY3B 5H2FZ 4L87A 1K3EA 1S77D 5B1BC 4F6RB 5IWAO 2F93B 5LP6A 5J2TB 1TUEB 1WPXA 1VF6A 3WB1A 4EB6A 3ZCCA 4CZZA 3ZMSA 1W59A 2EIJC 2P67A 1Z5WA 3M7MX 1QR8A 3A8TA 2EX3A 1QCEA 5KHIA 1EN5A 4NTYA 3ZRWA 1BGYH 4CC6A 1RFYA 4B08A 3K59A 1W0KG 1YTFB 5B1AC 2PYJA 3BFRA 1JCHA 1XNQO 3IAYA 1Q6UA 2JS3A 1BQZA 3HR0A 1PP9H 2X0LA 2WLMA 3ETDA 4BIUA 2F66C 1QBZA 2ZE7A 1YHQV 3RW0A 2VQFB 3OAAG 3IC9A 1OCZC 2JDIG 2X6CA 3SJQC 3ZRVA 5HFMA 3OD4A 4DV6O 4LF7O 4LWSA 2UU9O 3OR6C 1VQ7V 1VQKV 4CH6A 1HNXO 1OCOB 5BR8B 4DRXA 5KMGB 1ORQC 1AB3A 4YIOA 1SF9A 4FVMA 1XMOO 4NVPA 4GX2A 2P6JA 3E22A 4NXMB 1Y76B 4J11A 4LF5O 2E3CA 3HKDA 3J81N 1WLEA 3N2KA 2QSAA 3EVKA 2WLLB 3X2QC 2YIDA 4MVRA 3G6BA 5CA0B 2DQ3A 1UFIA 4F6EA 2PI4A 2DYSC 5FPRA 1K33A 2ZE5A 4JZGA 5BY1A 1OCRB 4YHHO 4X66O 2B9ZA 2D3OW 3OR7C 2E76B 3ML0A 4KFMA 1FXVA 2ZXWC 4DUZO 1AILA 2EILC 5LMNO 1G4YB 1FXKA 2N04A 4J7JA 4WFHA 5LP6C 1P7GA 4U3JA 1VF6C 1XMQB 1PV0A 5GTHZ 4DV3O 1AR1B 3CCQV 4PDRA 3OMNB 2QM7A 3DGEA 4HAMA 4JYAB 1TVKA 2P7TC 1M93A 1RM1B 4NYKA 3TXSA 4I7ZB 5L3DA 1SQFA 1VF5B 2G38A 3VQVA 5JWPA 4R8CA 1XL6A 4UCSA 2ZD9A 1FFXA 2ITCC 1LR1A 4GCZA 4DR4B 4DV1O 4IT5A 1IBLB 3OGIB 1HNWO 3N27A 2XAGA 1V54C 4J7ZA 4I0XA 4D7SA 1NR7A 1GKFA 1H2GA 4MVSA 1SS3A 4X65O 4O2AA 1NU1H 1BL8A 1EFRG 1HNZO 1ZX3A 5LHHA 4DYLA 1E1QG 1YJ9V 1S72V 3WG7C 4AQYB 1BCCH 1DLBA 3JARA 4DR6B 2ZIMA 2YIAA 3B8NA 1FYJA 1CXZB 1AP5A 4O4IA 4DV7O 1SA0A 3MAQA 4X9QA 3ABLC 4WBNB 2BTQB 2WLKA 3JCZA 4JI1B 2Q7EA 4O2BA 4IYIA 5F2VO 1I08A 3FFQA 2H3OA 1N34O 1I5XA 4B3MO 1YF2A 2ZM6B 4I9QA 1KUQA 2EIMB 2NNUA 2W0XA 3VBBA 3A0BZ 1VQNV 1NTZH 2V1DA 1JA8A 4LFBO 1FD9A 3AG1B 5GTIZ 3FB5C 2EJ7A 2A7WA 5J2UB 4D6TH 4JTCB 5FL7G 2LGQA 4I55A 3CMAV 4ZI7B 2QKCA 2F4VO 4K3AA 3ZMUA 3KCYA 4JI6B 4LNUB 1J5EB 4TV8A 1HR0B 1FXKC 4EKWA 4OX9O 2WAMA 5IYZA 5L3EA 1KP3A 3JAMN 2DYRC 3TCUA 1N32O 2ZE8A 3AK2A 1BSMA 1PL4A 4WFBV 2WLIA 3ETQA 4H13B 2EULA 4WFGA 1M56B 5IJ9B 2MK3A 2AHZA 4LFCO 1ZSPA 1N4CA 2DQ0A 3HKCA 1FFTB 1SQQH 1JFFB 5KX5B 4DUYO 3OGCC 3E8HA 4GZRB 4H44B 2RN9A 1VIBA 3CP1A 2NR5A 1AP6A 5L3BA 3WB2A 4H33A 4RQEA 1QHTA 2YC0A 1D5NA 4PA3A 2X7RB 1AJQA 5B1BB 3CRAA 2DWEC 5LGTA 1SQVH 2GBOA 4LBEC 1M90W 1AI4A 4GYCB 2DJVA 4UFZA 1G6UA 2EIJB 3STLC 1ENVA 3A2FA 4JYBA 4XDKA 4WFEA 4YJ3B 4O4LA 2YEVA 5EBWC 2E5LB 1SESA 3LDCA 3CHXA 1Q5OA 5EBMC 1K73W 5B1AB 4DR3B 3CCUV 1QQCA 2KG7B 4JV5B 3ASOC 2LFSA 1K4DC 3N2GB 2BTOA 4J7KA 2VRZA 2UUBB 2GDSA 1JQ0A 5C8YA 5FLXN 5IYCO 3DTUB 2CTPA 3CB2A 5CN0A 5CA1B 2EZOA 2YI8A 2OWOA 4L8JA 1IX9A 2ZE6A 5LL6Y 2PYLA 3SYOA 2LQTA 3JD1A 1K9MW 1FKAO 1OCZB 5CBHA 4LF4B 1XQ8A 4FLXA 4DK0A 3W7SA 3UM7A 1YI2V 3OTOO 1PNLA 1H2SB 1RSOA 4U7NA 2UUAO 4B7EA 1V55B 3AG2B 4P9PA 1FJGO 2WPDG 4X8AA 4R6ZA 2QM4A 5IE9A 3RYFB 3CJHB 3QO5A 3P3PA 1AJPA 4MS2A 4K8ZA 2XAHA 5A2QN 2UXCB 1SQPH 4J80A 4FLYA 5GONA 3E86A 1R6KA 2MW2B 3D8CA 2HKOA 3JD2A 3TK1A 4PJ0Z 3ZJZA 5ITZA 3T1HO 2QEXV 3AG4C 3CCLV 2WLHA 2YXYA 4IHJA 3CX5F 3ETGA 5LXTB 3CSXA 4XDLA 1Q7YW 1WPBA 2DN9A 3CEIA 3RGBA 2B5UA 3JD4A 4JI2B 2EJRA 3BABA 3LSQA 1KD1W 1Q8IA 1GRJA 2VQEB 1BE3H 5TISZ 2QTOA 3ZMTA 3MD0A 2EILB 2R9RB 3CRCA 3ZHTA 1YZBA 2F23A 2GV9A 5LP6B 4FJCC 1P49A 3PJSK 1MZFA 4EB6B 5L3GA 3ZX6A 4QE9A 1WA8A 3JALA 1Y67A 2P22C 3UT5A 2QWPB 4JAVA 4G28B 3RYIA 4DK1A 2PTMA 2P90A 3APOA 2R9IA 5KUKA 1ZLZA 3Q4HA 1NVPD 1OZ0A 3C3SA 3K5OA 3ZRWB 3DSQA 3GWOA 4HZ3A 5K1XA 4DXWA 4FLZA 4JI0O 4ZOLA 1SETA 1NQTA 2CDYA 2WWWA 5E1AC 2KB1A 4ZHQA 3BRCA 4JI4B 1ROPA 2ZR3A 5IY5C 1NT2B 1V54B 3G6EV 1IBKB 4R7CA 1SERA 4DV5O 1VQOV 2EIKB 4OXSA 1MOFA 3FB6C 2ATKC 2YDEA 5EC1C 2AW9A 1QLNA 3AG3B 4RQFA 5C93A 3WG7B 4W4KA 1Q6IA 3LUTB 3FX7A 1ZAUA 3OTFA 4IGGA 5HFLA 5DM6V 4LWSB 1I5YA 2NN4A
chains in the Genus database with same CATH topology
5H6RA 1WLEA 3ETEA 5LBQA 2WSSG 2WLLB 3X2QC 1ZWIC 5KA5A 4MTOA 2UXXA 4MW3A 4MVRA 1AI7A 1PKXA 2DQ3A 3K08A 1IXMA 4CBCA 2AHYA 2PI4A 2DYSC 3SYCA 3ZMVA 4WF9V 3HPLC 1K33A 3CD6V 2Y48A 1XL4A 3F7VC 3W7TA 2HR3A 1OCRB 3I55V 3WFVA 3EFFK 3F7YC 4PELA 2D3OW 3OR7C 4RUFA 2X6AA 3ML0A 2ZQMA 1OHHG 1Q86W 4KFMA 3ABTA 4LP8A 1FXVA 1R3IC 3QO8A 4PA7A 2OCCB 2ZXWC 2IH1C 4XBFA 2EILC 5BZBA 1G4YB 1FXKA 4WFHA 1GO3F 3RVYA 3FB8C 3X2QB 4WCEV 1H8EG 1K7DA 2W0FC 3T4ZA 1RPRA 3CCJV 1AI5A 2IH3C 4MVUA 4JYCA 1AR1B 1M57B 1F4MA 4JTAB 4ZKIA 3CCQV 4PDRA 2BOBC 2DYSB 2QM7A 3OMNB 3DGEA 1K8AW 4HAMA 1RPOA 2P7TC 1RM1B 4P30A 3E2EA 4ASUG 5L3DA 1VQ8V 3EHBB 4GX0A 4Z1MG 4LC1A 4DO2A 2ZXWB 3ZN1A 4R8CA 1XL6A 1QVFU 2ZD9A 2ITCC 1QVGU 1KP2A 4GCZA 1FXKB 2HLDG 1F4NA 3RBZA 3SPCA 3D3IA 2GSMB 1P4RA 3E8GA 3P30A 2DYRB 4QPJA 2XAGA 1V54C 3FYEB 1JX9A 1NR7A 1GKFA 1H2GA 4J9YB 1SRYA 4PDVA 2XASA 4MVSA 2HVKC 2CK3G 3K03A 1G8MA 1OCOC 1BL8A 3E8FA 3IFXA 1MABG 3B8MA 4UVAA 1S5HC 1S0VA 1EFRG 1AJNA 2EZPA 5LHHA 2WLJA 2YSUB 1E1QG 1N8RW 1YJ9V 1NR1A 2JK5C 1S72V 3WG7C 1DLBA 3G4SV 4QJFB 2B1GA 1THZA 3E83A 3D36A 3B8NA 2XAJA 3FKSG 1PNMA 2IW5A 4BIZA 1CPYA 3IC7A 4FMTA 5B1NA 2H94A 3K0GA 3ABLC 2ZDIC 2WLKA 2ZDIA 3JCZA 4LCUC 4YXWG 1H38A 4MT8A 3MHSC 4JGSA 2IU3A 4F4LA 3ABMB 5EK0A 2H8PC 2QM8A 3AG1C 5LHIA 4J9ZB 3HB3B 1I5XA 2XNDG 3OFNG 4HYOA 3G71V 3QO7A 1OCRC 2EBOA 5IYBO 2Y69C 2LP7A 3JD3A 1F51A 2EIMB 4MVZA 3NXSA 4UXNA 3RVZA 2QE7G 3E8BA 2NNUA 1R3KC 3ABLB 3OMAB 3E89A 3VBBA 2NLJC 3A0RA 1VQNV 2OCCC 1L1FA 4TT3G 1PD3A 3CYOA 3CC2V 2W6IG 2V1DA 2UXNA 4RAIA 2FTKA 1VQ9V 2A0LA 3AG1B 2JIZG 3ASOB 1M1KW 1CEZA 5EBLC 1M57C 3FB5C 4P2ZA 3B77A 4PA9A 5EC2C 3SPJA 2IJHA 4JTCB 1EBOA 3OEHG 4FK5C 4R50A 5FL7G 4BAYA 2Q68A 1VQPV 1RM1C 1CP9A 2HJFC 1EZJA 2Y69B 3CMAV 3OEEG 1M56C 1P7BA 5H9CA 3SPHA 5IDJA 3M99B 3ZMUA 2PI5A 3OUFA 2BOCC 3STZC 1FXKC 2WLNA 4EKWA 3ZIAG 1W0JG 2WAMA 4MW8A 2IU0A 5J9PC 4PDMA 3ZN0A 5L3EA 1KP3A 2DYRC 3ZRXA 4MTFA 3TCUA 3W7WA 1F23A 4WFBV 2WLIA 4WFGA 1M56B 3E35A 3T1CA 2MK3A 2AHZA 1Q82W 1VQ6V 3K3WA 1DF4A 2DQ0A 1FFTB 3IGAC 5LGUA 1Y4MA 3LNMB 3CCVV 1FS0G 3OGCC 3E8HA 3CP1A 3SPIA 4UV8A 1GTOA 5L3BA 2A9HA 3CC7V 4H33A 3JYCA 4RQEA 1NKDA 1R73A 2WLIB 4PA4A 1GM7A 4MTXA 4TSFG 4PA3A 3ABMC 2X7RB 1AJQA 5B1BB 1BHAA 2IJIA 2DWEC 3CC4V 3KG2A 1HWYA 1JVMA 3K0DA 3BEHA 5LGTA 4KUMA 3SYPA 4LBEC 1M90W 1YSCA 3VOUA 5CA3A 1AI4A 2ITDC 2EIJB 3STLC 1KC8W 1ENVA 4QIWF 5CMUA 3F5WC 4QE7A 5B3SB 1OCCB 4I9WA 1K5QA 4JYBA 3OE7G 1E79G 2EIMC 4XDKA 4WFEA 3K9AA 5L3CA 1GMGA 2YEVA 1JPXA 5EBWC 1SESA 2LFRA 3P32A 1S3JA 4QPKA 4BW5A 1LNQA 4WFFA 3JD0A 3LDCA 2K1EA 3OW2U 5EBMC 2DW4A 1K73W 5B1AB 4MVOA 3CCUV 3ASOC 3CCMV 3LDEA 2LFSA 1K4DC 4Q20A 2B1IA 1M9NA 5L3FA 1DF5A 5GW7A 1K97A 2A79B 1JQ0A 1MSWD 3W7XA 2JJ1G 5IYCO 3BY6A 4FPPA 3H01A 3DTUB 1FXHA 2IJJA 2JEXA 3QNEA 5LGNA 1V55C 2EINB 3AG2C 2YEVB 5CN0A 3T4DA 2EZOA 5CBGA 1KQSU 4MTGA 1QLEB 1VQLV 4N21A 1KKDA 2QA4V 1VQ5V 3SYOA 2M7WA 1R3LC 3JD1A 4KP4A 5CBFA 4MSWC 1K9MW 1OCZB 1AI6A 5CBHA 4MVQA 1JOYA 2OT5A 1H8HG 4UVBA 3OM3B 2Q6AA 1QR9A 4WFAV 5IY5B 3ASNC 2C2AA 3W7SA 3UM7A 3ABKB 4MVMA 1YI2V 5LHGA 2XAQA 1PNLA 4P9OA 4U7NA 1V55B 3AG2B 1K92A 1SZTA 2F43G 4RO2A 4P9PA 4RUEA 2WPDG 3MHHC 1KECA 5H6QA 4X8AA 1GK9A 4R6ZA 3CCRV 1NBMG 3OUSA 1BMFG 3QO5A 3CCSV 2ZR2A 3ZRSA 1NVPB 4JASA 1GM9A 1AJPA 3SYQA 4MS2A 2XAHA 4QNHB 1NH2B 2GHYA 4UVCA 4I5SA 4JF3A 2IJKA 1R6NA 5KA6A 4H37A 1B6QA 4ZBMA 3ASNB 1K5SA 4PA6A 3E86A 1R6KA 3CPWU 2DWDC 3JD2A 2HKOA 4TWKA 3SYAA 3TK1A 1BHBA 4X89A 3ZJZA 4JPRA 3SPGA 2QEXV 3AG4C 2Q67A 3OMIB 1K3EA 2WLHA 4L87A 3ABUA 3CCLV 1S77D 4PDLA 5B1BC 1UJWB 1TUEB 2OTJV 1WPXA 4N23A 1MG1A 3ZCCA 3ETGA 3K04A 3ZMSA 4CZZA 4GX5A 2EIJC 2P67A 3R65A 2Z5UA 1W2BU 4XDLA 1Q7YW 3CMEV 5B3SC 1OCCC 3FYIB 2B5UA 3JD4A 1QR8A 2EJRA 1QCEA 1VQ4V 3LSQA 3CCEV 3K79A 1KD1W 4XDJA 3ZRWA 4G27B 3AG4B 2JJ2G 5IYDO 1W0KG 2QTOA 3ZMTA 3MD0A 1YTFB 2EILB 5B1AC 1PL0A 2R9RB 5KUMA 1JCHA 4UUJC 1E1RG 4FJCC 3PJSK 1VQMV 2JEUA 3LDDA 5L3GA 4QE9A 3CXCU 1K4CC 1K34A 2HG5C 2X0LA 2WLMA 4JAVA 4G28B 3ETDA 4BIUA 4GX1A 2P90A 1DTOA 4FIPC 1QBZA 2EINC 2Q69A 2R9IA 5KUKA 1NVPD 1OZ0A 2EIKC 1QLEC 5B1OA 2W6JG 3ZRWB 3AG3C 1YHQV 3RW0A 1NH2D 3GWOA 4HZ3A 4G2KA 3OAAG 3ZMZA 4DXWA 3TETA 1SETA 1NQTA 1NJIW 2WWWA 1OCZC 2JDIG 1S76D 1J95A 5E1AC 2KB1A 2X6CA 3SJQC 3ZRVA 3K06A 5HFMA 1GM8A 1YIJV 1ROPA 3W7UA 2ZR3A 3OR6C 3T2MA 4GT1A 1YITV 1AROP 5IY5C 5DN6G 1V54B 2Z3YA 4JAUA 3ABKC 3LSSA 3G6EV 4JTDB 2V7QG 2XAFA 4R7CA 1VQ7V 1VQKV 4UV9A 1SERA 1COWG 1OCOB 3GB7C 2WLLA 1VQOV 3UKMA 1ORQC 4U7OA 2EIKB 4OXSA 1MOFA 2XOKG 3FB6C 2ATKC 3FB7C 5EC1C 1QLNA 3AG3B 4X88A 4RQFA 1Q81W 1YJWV 5C93A 1YJNV 1R3JC 2X6BA 3WG7B 2QKSA 1JJ2U 3LUTB 2HVJC 3AEIA 5HFLA 4E2LA 5DM6V 1Y66A 2HFEC 4GX2A 1I5YA 2P6JA 1YTFD 1PNKA 3I56V 2OTLV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X89 A;  3ZJZ A;  2WLI B;  4PA4 A;  3SPG A;  3AG4 C;  4TWK A;  2Q67 A;  2WLH A;  4PA3 A;  3ABM C;  4F4L A;  4PDL A;  5B1B C;  5EK0 A;  2WLL B;  3X2Q C;  1ZWI C;  2H8P C;  2DWE C;  4MTO A;  3KG2 A;  1JVM A;  3K0D A;  3BEH A;  4MW3 A;  3AG1 C;  4MVR A;  3SYP A;  4LBE C;  4J9Z B;  3K08 A;  3VOU A;  4CBC A;  2AHY A;  3K04 A;  4GX5 A;  2DYS C;  2EIJ C;  3SYC A;  2ITD C;  3HPL C;  3R65 A;  4HYO A;  4XDL A;  3STL C;  1XL4 A;  3F5W C;  3F7V C;  5B3S C;  1OCC C;  1OCR C;  4QE7 A;  4I9W A;  2Y69 C;  3EFF K;  3F7Y C;  2EIM C;  4XDK A;  4WFE A;  3OR7 C;  4MVZ A;  4RUF A;  3RVZ A;  2YEV A;  2X6A A;  3E8B A;  1R3K C;  5EBW C;  3E89 A;  4KFM A;  2NLJ C;  4LP8 A;  4XDJ A;  1R3I C;  2OCC C;  4PA7 A;  2ZXW C;  4G27 B;  2IH1 C;  4BW5 A;  1LNQ A;  4WFF A;  3LDC A;  2K1E A;  2EIL C;  2QTO A;  5BZB A;  1G4Y B;  5B1A C;  4RAI A;  5EBM C;  2R9R B;  4WFH A;  5KUM A;  3FB8 C;  3RVY A;  4UUJ C;  4MVO A;  2W0F C;  2A0L A;  3T4Z A;  3PJS K;  3ASO C;  3LDE A;  1K4D C;  2IH3 C;  3LDD A;  4MVU A;  5EBL C;  1M57 C;  3FB5 C;  4QE9 A;  1K4C C;  4JTA B;  4P2Z A;  4PA9 A;  5EC2 C;  4PDR A;  2BOB C;  2HG5 C;  3SPJ A;  4JTC B;  2A79 B;  4R50 A;  2WLM A;  2Q68 A;  4G28 B;  2P7T C;  2HJF C;  4GX1 A;  1M56 C;  4P30 A;  1P7B A;  3SPH A;  2EIN C;  2Q69 A;  1V55 C;  3AG2 C;  3T4D A;  5KUK A;  5CBG A;  2EIK C;  4GX0 A;  1QLE C;  4MTG A;  3OUF A;  3AG3 C;  2BOC C;  3RW0 A;  1KKD A;  4R8C A;  1XL6 A;  4HZ3 A;  3STZ C;  4DXW A;  2ZD9 A;  3SYO A;  2ITC C;  2WLN A;  1R3L C;  4EKW A;  3TET A;  5CBF A;  1OCZ C;  4MSW C;  4MW8 A;  1J95 A;  5E1A C;  2KB1 A;  2X6C A;  3RBZ A;  3SJQ C;  3K06 A;  4MVQ A;  3SPC A;  5CBH A;  4PDM A;  5J9P C;  3E8G A;  3OR6 C;  2DYR C;  3T2M A;  4MTF A;  2Q6A A;  5IY5 C;  1V54 C;  3TCU A;  3ASN C;  4J9Y B;  3ABK C;  4PDV A;  3UM7 A;  4JTD B;  4MVM A;  4MVS A;  2HVK C;  4R7C A;  2WLI A;  3K03 A;  1OCO C;  4P9O A;  1BL8 A;  3E8F A;  3GB7 C;  4WFG A;  3T1C A;  2AHZ A;  3IFX A;  1S5H C;  2WLL A;  3UKM A;  1ORQ C;  4OXS A;  4RO2 A;  3FB6 C;  3IGA C;  4P9P A;  4RUE A;  2ATK C;  3FB7 C;  5EC1 C;  2WLJ A;  4X8A A;  3LNM B;  4R6Z A;  4X88 A;  3OUS A;  2JK5 C;  3WG7 C;  1R3J C;  3OGC C;  2X6B A;  3E8H A;  3ZRS A;  2QKS A;  3LUT B;  2HVJ C;  3E83 A;  3SYQ A;  3SPI A;  4MS2 A;  2HFE C;  4QNH B;  4GX2 A;  4H37 A;  2A9H A;  4ZBM A;  4H33 A;  3JYC A;  4PA6 A;  3E86 A;  3K0G A;  3ABL C;  2DWD C;  4LCU C;  2WLK A;  3SYA A; 
#chains in the Genus database with same CATH topology
 2JGU A;  1I94 B;  4DRX B;  5LBQ A;  2WSS G;  2QTS A;  1FAF A;  1XDC A;  1YCI A;  2AHY A;  4H0L B;  4K0K O;  4DV2 O;  2ZCE A;  3JAK A;  3T1Y O;  2HR3 A;  3E22 B;  3F7Y C;  4BIO A;  4UB6 Z;  1OV9 A;  1Y74 A;  2ZQM A;  1OHH G;  1GAX A;  4PA7 A;  3HKD B;  4EEQ A;  4XBF A;  5BZB A;  3RYC A;  4WCE V;  3FB8 C;  4AHC A;  1K7D A;  2W0F C;  3T4Z A;  3CCJ V;  2R9A A;  3UCS C;  4JTA B;  5LMU O;  4B3S B;  2UXD O;  3HKE A;  1BQ0 A;  4DV4 B;  5LOV A;  1HNX B;  3RYH A;  1SQB H;  4LC1 A;  1NS1 A;  4DR2 B;  1QVF U;  1FXK B;  1IDS A;  2HLD G;  3RBZ A;  3SPC A;  4U3J B;  3D3I A;  3E8G A;  4FLU A;  3P30 A;  2DYR B;  4DW1 A;  1JX9 A;  3L74 H;  1SRY A;  2RCV A;  4PDV A;  3GVM A;  1TVK B;  2CK3 G;  4LFA B;  2ZNI A;  2QGN A;  3H1K H;  1S0V A;  2Q4P A;  3A0H Z;  2EZP A;  2WLJ A;  2YSU B;  1NR1 A;  2JK5 C;  1B06 A;  1FFX B;  1XHZ A;  4IIJ A;  4QJF B;  2AZ2 A;  1N36 O;  1THZ A;  3I5D A;  2XAJ A;  3FKS G;  4YHH B;  3IC7 A;  4FMT A;  5B1N A;  4I0X B;  4LCU C;  3CWB H;  3FAV A;  4MT8 A;  4O2A B;  1O9G A;  5LMN B;  4UB8 Z;  1WJZ A;  1G1X B;  2QM8 A;  4DV3 B;  3BPZ A;  3S3X A;  1IXB A;  2JGD A;  2QWO B;  3JAR B;  1N33 O;  4HYO A;  3G71 V;  2EBO A;  2GUZ A;  1QNM A;  5IYB O;  1Q43 A;  1BT8 A;  4MVZ A;  4O4I B;  2QE7 G;  1SA0 B;  3OMA B;  2R70 A;  2OCC C;  4TT3 G;  4O2B B;  2W6I G;  2LGW A;  2UXN A;  3JAW A;  5JH7 A;  2IM9 A;  1VQ9 V;  2A0L A;  1M5I A;  5IT9 N;  3ASO B;  5JJN B;  1M1K W;  2ZIN A;  1M57 C;  5EBL C;  2P5O A;  1DGS A;  3B77 A;  5EC2 C;  3SPJ A;  2IJH A;  1EBO A;  4KHP O;  4BAY A;  2A3Q A;  4X65 B;  1WN7 A;  3K58 A;  1CP9 A;  2Y69 B;  3OEE G;  2FB5 A;  5IDJ A;  4LF8 B;  3SPH A;  2Y4U A;  2YS8 A;  2ZKO A;  2PI5 A;  2JRI A;  3H1H H;  4QGP A;  1EM1 A;  3STZ C;  2WLN A;  1KYO F;  1W0J G;  4OPA A;  5J9P C;  3U10 A;  4JI5 B;  3ZRX A;  2N74 A;  3HKB A;  1YVW A;  1AR4 A;  4I55 B;  1H2M A;  2UUC B;  5BR8 O;  1BZK A;  3QVN A;  1VQ6 V;  3B2E E;  3K3W A;  3GWK C;  4AIL C;  1Y4M A;  1N34 B;  4TV8 B;  2D2C B;  4DV0 O;  5A9G A;  2Y0P A;  1OJH A;  5IYZ B;  2QKA A;  1GTO A;  3VQX A;  4NXM O;  3CC7 V;  1NKD A;  2LJ2 A;  4K8X A;  1TAE A;  4E4E A;  2WLI B;  4PA4 A;  4MTX A;  4TSF G;  3ABM C;  1F7Y A;  3HKC B;  1HWY A;  3KG2 A;  3SJB C;  4KUM A;  3G67 A;  5CA3 A;  2R72 A;  2ITD C;  1KC8 W;  4QIW F;  5CMU A;  3F5W C;  4I9W A;  1K5Q A;  1Q3E A;  3FD9 A;  2F4V B;  5L3C A;  3UO2 A;  3SJA C;  2LFR A;  3P32 A;  3BA8 A;  4BW5 A;  1LNQ A;  1U96 A;  3JD0 A;  2K1E A;  5LYJ A;  3OW2 U;  4OX9 B;  4X1Y A;  3CCM V;  1AVM A;  4Q20 A;  3BHP A;  1M9N A;  5GW7 A;  1N32 B;  2QWQ B;  3L73 H;  2AXT Z;  4JYA O;  1IBM O;  1M4U A;  4O4L B;  5LGN A;  2YEV B;  3T4D A;  1HP8 A;  5CBG A;  1KQS U;  5JCO C;  5E79 Z;  3DXR A;  1VQ5 V;  3OT7 A;  5KAI Z;  4IYH A;  1S5J A;  4JZ2 A;  2RNB A;  4DR4 O;  5H5N A;  1JOY A;  2OT5 A;  1Q6H A;  1H8H G;  3OM3 B;  1IBL O;  1QR9 A;  5IY5 B;  3ASN C;  2C2A A;  2JVD A;  5C8Y B;  2XHB A;  4UCR A;  4CC5 A;  4TUY A;  2XAQ A;  1R1B A;  2F43 G;  1GK9 A;  3CCR V;  2YI9 A;  1BMF G;  3TJT A;  1TUB A;  4AQY O;  1NVP B;  2UXB O;  4QNH B;  2GHY A;  4I5S A;  1B04 A;  1B6Q A;  4ZBM A;  4PA6 A;  1BHB A;  4TWK A;  3SYA A;  4DR1 O;  4X89 A;  1P84 F;  3SPG A;  1RSO B;  3OMI B;  2HHH O;  4JI1 O;  3ABU A;  1D2D A;  4PDL A;  2FKX A;  2Q73 A;  4X20 A;  5EIB C;  2Q0A A;  3LNN A;  3K04 A;  2Z5U A;  1ZUQ A;  1W2B U;  3CME V;  2L6L A;  5B3S C;  4JI7 O;  1MMM A;  5GON B;  4PI2 A;  3CCE V;  4I50 A;  1IVS A;  5ITZ B;  2PF4 E;  2QDO A;  1PL0 A;  5KUM A;  1V9P A;  4D7T A;  4IHJ B;  4UUJ C;  1E1R G;  1VQM V;  2HEP A;  3LDD A;  4CS3 A;  3CXC U;  2DE0 X;  3VQW A;  1K34 A;  1KU9 A;  5JJJ B;  3OTO B;  1NZ6 A;  4FIP C;  2EIN C;  2DMX A;  1QLE C;  5B1O A;  3P3N A;  1NH2 D;  4JI6 O;  3ZMZ A;  2LO1 A;  4G2K A;  4LF6 O;  4DR5 B;  1NJI W;  5IJ0 A;  1WNS A;  3K06 A;  1GM8 A;  3THO A;  1YIJ V;  3JCU Z;  5JQG A;  1XBL A;  3T2M A;  1WA8 B;  3JAL B;  2BSK A;  1ARO P;  4B3T B;  4X64 O;  3UT5 B;  2V7Q G;  1YXB A;  2XAF A;  3AK3 A;  3RYI B;  4YJ2 A;  4UV9 A;  5FNV A;  1COW G;  3GB7 C;  4LR3 A;  1XNR O;  1T5E A;  4J42 A;  3Q4H B;  3UKM A;  3FB7 C;  3BVO A;  4X88 A;  4GLX A;  4O4J A;  1Q81 W;  1BS3 A;  1YJW V;  4ZOL B;  1YJN V;  2X6B A;  1JJ2 U;  4LF9 B;  4ZHQ B;  3AEI A;  4GKK B;  1Y66 A;  4O4H A;  4FZ0 A;  4JI8 O;  4FFB A;  1PNK A;  3I56 V;  3QF7 A;  4TV9 A;  3ETE A;  3RT3 C;  1ZWI C;  1NTK H;  4MW3 A;  1AI7 A;  3K08 A;  1IXM A;  4KL1 A;  3CXH F;  3SYC A;  2Y0I A;  2CH7 A;  3HPL C;  4WF9 V;  3CD6 V;  3L9D A;  3F7V C;  3W7T A;  4FM0 A;  3EFF K;  5DED A;  4PEL A;  2KQX A;  2OYQ A;  4FLW A;  2DOS A;  1Q86 W;  3ABT A;  1XIL A;  2E5L O;  1H2L A;  1R3I C;  2OCC B;  2ADP A;  3JAT A;  3RVY A;  1GO3 F;  3X2Q B;  3MDS A;  1H8E G;  4BW9 A;  4DR3 O;  1RPR A;  1Y6X A;  1AI5 A;  1M57 B;  1F4M A;  2DYS B;  3JAK B;  1K8A W;  4PI0 A;  2OIG A;  2VWJ A;  4P30 A;  4X1K A;  3C90 A;  2ODM A;  1Y74 B;  4GX0 A;  1HW7 A;  4NTX A;  2ZXW B;  3ZN1 A;  1QVG U;  1KP2 A;  3B4S A;  4ZIB A;  1URF A;  1P4R A;  4X62 O;  3U0Z A;  4QPJ A;  1TA8 A;  3FYE B;  3HKE B;  1MNG A;  2HVK C;  3ZHR A;  5LOV B;  4J41 A;  1G8M A;  3RYH B;  3CRM A;  3IFX A;  1MAB G;  3B8M A;  4UVA A;  3R66 A;  3SGI A;  5CB4 A;  3WU2 Z;  2CTR A;  4K0K B;  3N2G A;  3E83 A;  1SQG A;  3D36 C;  1PNM A;  2IW5 A;  3U11 A;  2E75 B;  1EN6 A;  1O9H A;  2RMK B;  3K0G A;  2ZDI C;  4YXW G;  2E74 B;  4JGS A;  2IU3 A;  4K35 A;  5IWA B;  3ABM B;  5EK0 A;  4EFB A;  1XRE A;  1L0L H;  3AG1 C;  5LHI A;  2QWN B;  4W4L A;  4TQF A;  2CTQ A;  4IIJ B;  3UO3 A;  2YUA A;  2K9P A;  3OFN G;  4UCU A;  1D5A A;  3QO7 A;  2LP7 A;  1GN4 A;  5D5Q A;  1F51 A;  1DK1 A;  3NXS A;  3RVZ A;  5KLV H;  1R3K C;  3ABL B;  4CH4 A;  3E89 A;  5JVD A;  2NLJ C;  2IBZ H;  3FAV B;  5BMV A;  1L1F A;  4JI3 O;  1PD3 A;  2VQE O;  3CC2 V;  3RYF A;  4RAI A;  1XNQ B;  2JIZ G;  1PM9 A;  1MZE A;  4HNA A;  4PA9 A;  2JGD B;  2O57 A;  2LW7 A;  2WA4 A;  3OEH G;  4FK5 C;  1VQP V;  2F95 B;  2GUZ B;  1KB9 F;  2HJF C;  1EZJ A;  4B7K A;  1M56 C;  1GN2 A;  1P7B A;  5EYP A;  1JR9 A;  4BR6 A;  3N2K B;  2BOC C;  2PUS A;  3JAW B;  3VQY A;  3ZIA G;  5JH7 B;  2IU0 A;  2GTS A;  5LA6 A;  4DV6 B;  3K5L A;  4LF7 B;  4PDM A;  3ZN0 A;  2UU9 B;  3NR7 A;  1N0N A;  1HDJ A;  4NXN O;  1U97 A;  4Z1V A;  4B3R O;  4CH3 A;  1I7F A;  1EN4 A;  1IBK O;  1F23 A;  3E35 A;  2N05 A;  1X59 A;  3IGA C;  1XMO B;  1N33 B;  2L35 A;  1NTM H;  4FLT A;  2Q5Z A;  3SPI A;  4UV8 A;  1GN6 A;  1H2N A;  3SR2 C;  2A9H A;  1ZL8 A;  3HKB B;  1R73 A;  4LF5 B;  2ZNJ A;  1TGO A;  4X1I A;  4DR7 O;  3ZHU A;  1VP7 A;  4C7U A;  2CGO A;  4A5U B;  1I94 O;  3KZI Z;  3CC4 V;  1BHA A;  3BEH A;  3SYP A;  1YSC A;  3VOU A;  2WA3 A;  3H1J H;  3DC5 A;  4FZ1 A;  2OIE A;  4KHP B;  3BCC H;  1SC5 B;  3G80 A;  4QE7 A;  5B3S B;  4X66 B;  2Y4T A;  3OE7 G;  3AK1 A;  1E79 G;  1GMG A;  4EFE A;  1JPX A;  4GKJ O;  1LUW A;  4UCV A;  4DUZ B;  1S3J A;  4YY3 O;  4FM1 A;  4WFF A;  3CRR A;  2DW4 A;  3PN1 A;  2FL4 A;  4MVO A;  3LDE A;  3LSU A;  5EZY A;  2B1I A;  3KKY A;  5L3F A;  3BAA A;  1RP3 B;  2A79 B;  4B3S O;  1MSW D;  3W7X A;  4IL6 Z;  4DV4 O;  3H01 A;  2CAZ C;  1FXH A;  2IJJ A;  2JEX A;  3QNE A;  1V55 C;  2EIN B;  2VS0 A;  3AG2 C;  5JCO A;  3ZHV A;  4MTG A;  1QLE B;  4J10 A;  3JAS A;  1KKD A;  5LYJ B;  4DR2 O;  3B40 A;  1XEQ A;  5CBF A;  4DV0 B;  3ICX A;  1AI6 A;  4X1Y B;  4MVQ A;  4DV1 B;  3K5M A;  1HNW B;  4I4T A;  1PPJ H;  4WFA V;  1L0N H;  1KMI Z;  5LHG A;  4CS2 A;  4LFA O;  2HJD A;  1Z5V A;  4F6R A;  1HNZ B;  1SZT A;  4Q6G A;  5J2T A;  4RUE A;  3MHH C;  5H6Q A;  1KEC A;  3L71 H;  1LUV A;  3DXR B;  1NBM G;  1WB7 A;  2VQF O;  3OUS A;  4LH6 A;  3ZRS A;  3RFR A;  1GM9 A;  1NH2 B;  2IJK A;  5KA6 A;  4DV7 B;  1WAZ A;  3JSL A;  1AR5 A;  3CPW U;  3CS5 A;  4TUY B;  3EXA A;  4JPR A;  2Q67 A;  4TQD A;  3ZHQ A;  1UJW B;  4RWU A;  2OTJ V;  4N23 A;  3L70 H;  1MG1 A;  4B3M B;  4GX5 A;  5FPO A;  1TUB B;  1UPG A;  3R65 A;  1OCC C;  2BCC H;  1IBM B;  3FYI B;  1SKV A;  2QJ1 A;  3O9O A;  3UQ8 A;  1MSD A;  1YDX A;  3BA9 A;  1VQ4 V;  3K79 A;  2V4D A;  4XDJ A;  4G27 B;  2CTW A;  3AG4 B;  2JJ2 G;  5IYD O;  4LFB B;  1KBH A;  4X20 B;  3B09 A;  2JEU A;  1K4C C;  2HG5 C;  2P4K A;  4GUN A;  2GTA A;  4GX1 A;  1DTO A;  5KMG A;  2Q69 A;  3O65 A;  4LF8 O;  3ZS8 C;  2EIK C;  3S3W A;  2Q7G A;  2W6J G;  4I50 B;  2PGG A;  3AG3 C;  1N0J A;  2FML A;  2Q9L A;  3TET A;  3WB0 A;  1S76 D;  3C3T A;  1J95 A;  2UXB B;  1XMQ O;  3W7U A;  4JI5 O;  4GT1 A;  1YIT V;  1Y76 A;  2Q8V A;  2YXH A;  5DN6 G;  2Z3Y A;  4JAU A;  3ABK C;  3LSS A;  4JTD B;  4DR1 B;  1VAR A;  1WP8 A;  1FPO A;  2HHH B;  4LFC B;  2UUC O;  2JS5 A;  2WLL A;  4JAA A;  4U7O A;  2XOK G;  1EZV H;  3JSN A;  5CA0 A;  1IZ3 A;  4DUY B;  1R3J C;  2QKS A;  5IJ0 B;  3IJ4 A;  4UCT A;  2HVJ C;  2PZS A;  4E2L A;  4JI7 B;  2HFE C;  2Z0A A;  5JQG B;  4OGQ B;  2BSK B;  4NB5 A;  1YTF D;  4YIP A;  2OTL V;  4YJ2 B;  2RQ6 A;  1QU7 A;  5FNV B;  4PD4 F;  5EIB D;  5H6R A;  5KA5 A;  3RWR D;  4MTO A;  2UXX A;  5KAF Z;  1PKX A;  1KKC A;  1SZX A;  1Z2G A;  3F5T A;  3J7A U;  4O4J B;  4CBC A;  2P06 A;  5KHH A;  3CE2 A;  3ZMV A;  2CE4 A;  4DR6 O;  2Y48 A;  2KSD A;  1XL4 A;  2AZ0 A;  4O4H B;  3I55 V;  3WFV A;  4FLV A;  4BWA A;  4FFB B;  4RUF A;  2X6A A;  1XHX A;  4LP8 A;  3QO8 A;  4TV9 B;  2IH1 C;  4LF6 B;  2P4V A;  2QR4 A;  5KHG A;  2AGA A;  1WB8 A;  4ICG A;  3ZBH A;  3RN4 A;  2IH3 C;  4MVU A;  4JYC A;  4ZKI A;  1VF7 A;  2BOB C;  2CH7 B;  4X64 B;  2ZM6 O;  1RPO A;  1XI1 A;  3E2E A;  4AI8 A;  4ASU G;  1XNR B;  1VQ8 V;  3EHB B;  5JJE B;  4Z1M G;  4DO2 A;  3CRQ A;  3JAT B;  1L8D A;  2LW1 A;  1F4N A;  4NR1 A;  2GSM B;  4JI8 B;  3ZED A;  1WP7 A;  4J9Y B;  4WBN A;  2XAS A;  2BTQ A;  2YIB A;  4OPH A;  2ADQ B;  3K03 A;  1OCO C;  3E8F A;  2UUA B;  1MA1 A;  4X1K B;  1S5H C;  5BXZ A;  1FJG B;  1AJN A;  1N8R W;  1J5E O;  1HR0 O;  3G4S V;  3L75 H;  2B1G A;  3D36 A;  1ZTE A;  4CH5 A;  4BIZ A;  1CPY A;  3SJC C;  3H1L H;  1JJO A;  2H94 A;  2PY5 A;  2ZDI A;  4UCO A;  3L72 H;  1A32 A;  1H38 A;  3T1H B;  2ILM A;  3MHS C;  3APQ A;  2A06 H;  3H9V A;  4F4L A;  3K9S A;  2H8P C;  3D3Q A;  5CB4 B;  4J9Z B;  3HB3 B;  2XND G;  5J2U A;  2ZIO A;  1OCR C;  5KHJ A;  2Y69 C;  3M8A A;  4ZI7 A;  3JD3 A;  4UXN A;  3E8B A;  3A0R A;  1XUQ A;  3KCX A;  4FM2 A;  4LNU A;  3CYO A;  2FTK A;  1H2K A;  1CEZ A;  4X62 B;  5D5P A;  4P2Z A;  2YXL A;  4PV1 B;  2XT9 A;  4R50 A;  4CS4 A;  2Q68 A;  1RM1 C;  2F1M A;  5IJ9 A;  5H9C A;  3M99 B;  5JVD B;  5BMV B;  3OUF A;  1JFF A;  1GH6 A;  1SQX H;  5KX5 A;  4JI0 B;  3QTC A;  4MW8 A;  4DR5 O;  2HP8 A;  2YIB D;  3QG5 A;  4JV5 O;  4HNA B;  5DEC A;  4MTF A;  2UUB O;  4B3T O;  2FYU H;  3W7W A;  2BE3 A;  1NI8 A;  1X4T A;  4DV5 B;  3T1C A;  1US6 A;  1Q82 W;  2M6Y A;  5EYP B;  1DF4 A;  5LGU A;  3LNM B;  3CCV V;  1VEW A;  3RYC B;  1FS0 G;  2YIC A;  3DC6 A;  4FFK A;  2XTA A;  3AG7 A;  5LA6 B;  4LF9 O;  1JMK C;  4GKK O;  2XUM A;  4LF4 O;  2CUG A;  4YJ3 A;  3JYC A;  4JI3 B;  1GM7 A;  1XOU A;  2IJI A;  4U3F H;  1JVM A;  3K0D A;  2KG7 A;  2RDC A;  2ETN A;  2RJZ A;  2Q7H A;  4DV2 B;  2ZT9 B;  3J80 N;  3T1Y B;  1Q90 D;  1OCC B;  3H1I H;  4JYY A;  2UXC O;  4KXR A;  2EIM C;  1ZL8 B;  3K9A A;  3K57 A;  5CA1 A;  4X1I B;  4QPK A;  1S5L Z;  4NTW A;  3K5N A;  4NXN B;  4PHZ A;  5LMU B;  1DF5 A;  2UXD B;  1K97 A;  4B3R B;  1B3Q A;  4LH7 A;  2JJ1 G;  3BY6 A;  4FPP A;  4JI2 O;  2ARH A;  5B66 Z;  1GN3 A;  4HBN A;  4ABM A;  5KHK A;  1VQL V;  4N21 A;  1IUR A;  2QA4 V;  3TXQ A;  2M7W A;  1R3L C;  3CJH A;  4TOI A;  4KP4 A;  4MSW C;  3ZHS A;  5EZY B;  2QWR B;  4UVB A;  4DW0 A;  2Q6A A;  1R6T A;  1VMG A;  2CGN A;  5AG2 A;  4NKG B;  5B5E Z;  3ABK B;  4MVM A;  4DR7 B;  4P9O A;  2VWK A;  1I0H A;  1K92 A;  4RO2 A;  1YEW A;  3JAS B;  3CCS V;  2ZR2 A;  5LXT A;  1N36 B;  2OCH A;  2Q0O C;  4JAS A;  5K1P A;  3SYQ A;  2KKW A;  4JI4 O;  4Z2W A;  3TGU H;  4UVC A;  4I4T B;  4JF3 A;  3SDL A;  1R6N A;  4H37 A;  3ASN B;  1K5S A;  4GKJ B;  2DWD C;  4YY3 B;  5H2F Z;  4L87 A;  1K3E A;  1S77 D;  5B1B C;  4F6R B;  5IWA O;  2F93 B;  5LP6 A;  5J2T B;  1TUE B;  1WPX A;  1VF6 A;  3WB1 A;  4EB6 A;  3ZCC A;  4CZZ A;  3ZMS A;  1W59 A;  2EIJ C;  2P67 A;  1Z5W A;  3M7M X;  1QR8 A;  3A8T A;  2EX3 A;  1QCE A;  5KHI A;  1EN5 A;  4NTY A;  3ZRW A;  1BGY H;  4CC6 A;  1RFY A;  4B08 A;  3K59 A;  1W0K G;  1YTF B;  5B1A C;  2PYJ A;  3BFR A;  1JCH A;  1XNQ O;  3IAY A;  1Q6U A;  2JS3 A;  1BQZ A;  3HR0 A;  1PP9 H;  2X0L A;  2WLM A;  3ETD A;  4BIU A;  2F66 C;  1QBZ A;  2ZE7 A;  1YHQ V;  3RW0 A;  2VQF B;  3OAA G;  3IC9 A;  1OCZ C;  2JDI G;  2X6C A;  3SJQ C;  3ZRV A;  5HFM A;  3OD4 A;  4DV6 O;  4LF7 O;  4LWS A;  2UU9 O;  3OR6 C;  1VQ7 V;  1VQK V;  4CH6 A;  1HNX O;  1OCO B;  5BR8 B;  4DRX A;  5KMG B;  1ORQ C;  1AB3 A;  4YIO A;  1SF9 A;  4FVM A;  1XMO O;  4NVP A;  4GX2 A;  2P6J A;  3E22 A;  4NXM B;  1Y76 B;  4J11 A;  4LF5 O;  2E3C A;  3HKD A;  3J81 N;  1WLE A;  3N2K A;  2QSA A;  3EVK A;  2WLL B;  3X2Q C;  2YID A;  4MVR A;  3G6B A;  5CA0 B;  2DQ3 A;  1UFI A;  4F6E A;  2PI4 A;  2DYS C;  5FPR A;  1K33 A;  2ZE5 A;  4JZG A;  5BY1 A;  1OCR B;  4YHH O;  4X66 O;  2B9Z A;  2D3O W;  3OR7 C;  2E76 B;  3ML0 A;  4KFM A;  1FXV A;  2ZXW C;  4DUZ O;  1AIL A;  2EIL C;  5LMN O;  1G4Y B;  1FXK A;  2N04 A;  4J7J A;  4WFH A;  5LP6 C;  1P7G A;  4U3J A;  1VF6 C;  1XMQ B;  1PV0 A;  5GTH Z;  4DV3 O;  1AR1 B;  3CCQ V;  4PDR A;  3OMN B;  2QM7 A;  3DGE A;  4HAM A;  4JYA B;  1TVK A;  2P7T C;  1M93 A;  1RM1 B;  4NYK A;  3TXS A;  4I7Z B;  5L3D A;  1SQF A;  1VF5 B;  2G38 A;  3VQV A;  5JWP A;  4R8C A;  1XL6 A;  4UCS A;  2ZD9 A;  1FFX A;  2ITC C;  1LR1 A;  4GCZ A;  4DR4 B;  4DV1 O;  4IT5 A;  1IBL B;  3OGI B;  1HNW O;  3N27 A;  2XAG A;  1V54 C;  4J7Z A;  4I0X A;  4D7S A;  1NR7 A;  1GKF A;  1H2G A;  4MVS A;  1SS3 A;  4X65 O;  4O2A A;  1NU1 H;  1BL8 A;  1EFR G;  1HNZ O;  1ZX3 A;  5LHH A;  4DYL A;  1E1Q G;  1YJ9 V;  1S72 V;  3WG7 C;  4AQY B;  1BCC H;  1DLB A;  3JAR A;  4DR6 B;  2ZIM A;  2YIA A;  3B8N A;  1FYJ A;  1CXZ B;  1AP5 A;  4O4I A;  4DV7 O;  1SA0 A;  3MAQ A;  4X9Q A;  3ABL C;  4WBN B;  2BTQ B;  2WLK A;  3JCZ A;  4JI1 B;  2Q7E A;  4O2B A;  4IYI A;  5F2V O;  1I08 A;  3FFQ A;  2H3O A;  1N34 O;  1I5X A;  4B3M O;  1YF2 A;  2ZM6 B;  4I9Q A;  1KUQ A;  2EIM B;  2NNU A;  2W0X A;  3VBB A;  3A0B Z;  1VQN V;  1NTZ H;  2V1D A;  1JA8 A;  4LFB O;  1FD9 A;  3AG1 B;  5GTI Z;  3FB5 C;  2EJ7 A;  2A7W A;  5J2U B;  4D6T H;  4JTC B;  5FL7 G;  2LGQ A;  4I55 A;  3CMA V;  4ZI7 B;  2QKC A;  2F4V O;  4K3A A;  3ZMU A;  3KCY A;  4JI6 B;  4LNU B;  1J5E B;  4TV8 A;  1HR0 B;  1FXK C;  4EKW A;  4OX9 O;  2WAM A;  5IYZ A;  5L3E A;  1KP3 A;  3JAM N;  2DYR C;  3TCU A;  1N32 O;  2ZE8 A;  3AK2 A;  1BSM A;  1PL4 A;  4WFB V;  2WLI A;  3ETQ A;  4H13 B;  2EUL A;  4WFG A;  1M56 B;  5IJ9 B;  2MK3 A;  2AHZ A;  4LFC O;  1ZSP A;  1N4C A;  2DQ0 A;  3HKC A;  1FFT B;  1SQQ H;  1JFF B;  5KX5 B;  4DUY O;  3OGC C;  3E8H A;  4GZR B;  4H44 B;  2RN9 A;  1VIB A;  3CP1 A;  2NR5 A;  1AP6 A;  5L3B A;  3WB2 A;  4H33 A;  4RQE A;  1QHT A;  2YC0 A;  1D5N A;  4PA3 A;  2X7R B;  1AJQ A;  5B1B B;  3CRA A;  2DWE C;  5LGT A;  1SQV H;  2GBO A;  4LBE C;  1M90 W;  1AI4 A;  4GYC B;  2DJV A;  4UFZ A;  1G6U A;  2EIJ B;  3STL C;  1ENV A;  3A2F A;  4JYB A;  4XDK A;  4WFE A;  4YJ3 B;  4O4L A;  2YEV A;  5EBW C;  2E5L B;  1SES A;  3LDC A;  3CHX A;  1Q5O A;  5EBM C;  1K73 W;  5B1A B;  4DR3 B;  3CCU V;  1QQC A;  2KG7 B;  4JV5 B;  3ASO C;  2LFS A;  1K4D C;  3N2G B;  2BTO A;  4J7K A;  2VRZ A;  2UUB B;  2GDS A;  1JQ0 A;  5C8Y A;  5FLX N;  5IYC O;  3DTU B;  2CTP A;  3CB2 A;  5CN0 A;  5CA1 B;  2EZO A;  2YI8 A;  2OWO A;  4L8J A;  1IX9 A;  2ZE6 A;  5LL6 Y;  2PYL A;  3SYO A;  2LQT A;  3JD1 A;  1K9M W;  1FKA O;  1OCZ B;  5CBH A;  4LF4 B;  1XQ8 A;  4FLX A;  4DK0 A;  3W7S A;  3UM7 A;  1YI2 V;  3OTO O;  1PNL A;  1H2S B;  1RSO A;  4U7N A;  2UUA O;  4B7E A;  1V55 B;  3AG2 B;  4P9P A;  1FJG O;  2WPD G;  4X8A A;  4R6Z A;  2QM4 A;  5IE9 A;  3RYF B;  3CJH B;  3QO5 A;  3P3P A;  1AJP A;  4MS2 A;  4K8Z A;  2XAH A;  5A2Q N;  2UXC B;  1SQP H;  4J80 A;  4FLY A;  5GON A;  3E86 A;  1R6K A;  2MW2 B;  3D8C A;  2HKO A;  3JD2 A;  3TK1 A;  4PJ0 Z;  3ZJZ A;  5ITZ A;  3T1H O;  2QEX V;  3AG4 C;  3CCL V;  2WLH A;  2YXY A;  4IHJ A;  3CX5 F;  3ETG A;  5LXT B;  3CSX A;  4XDL A;  1Q7Y W;  1WPB A;  2DN9 A;  3CEI A;  3RGB A;  2B5U A;  3JD4 A;  4JI2 B;  2EJR A;  3BAB A;  3LSQ A;  1KD1 W;  1Q8I A;  1GRJ A;  2VQE B;  1BE3 H;  5TIS Z;  2QTO A;  3ZMT A;  3MD0 A;  2EIL B;  2R9R B;  3CRC A;  3ZHT A;  1YZB A;  2F23 A;  2GV9 A;  5LP6 B;  4FJC C;  1P49 A;  3PJS K;  1MZF A;  4EB6 B;  5L3G A;  3ZX6 A;  4QE9 A;  1WA8 A;  3JAL A;  1Y67 A;  2P22 C;  3UT5 A;  2QWP B;  4JAV A;  4G28 B;  3RYI A;  4DK1 A;  2PTM A;  2P90 A;  3APO A;  2R9I A;  5KUK A;  1ZLZ A;  3Q4H A;  1NVP D;  1OZ0 A;  3C3S A;  3K5O A;  3ZRW B;  3DSQ A;  3GWO A;  4HZ3 A;  5K1X A;  4DXW A;  4FLZ A;  4JI0 O;  4ZOL A;  1SET A;  1NQT A;  2CDY A;  2WWW A;  5E1A C;  2KB1 A;  4ZHQ A;  3BRC A;  4JI4 B;  1ROP A;  2ZR3 A;  5IY5 C;  1NT2 B;  1V54 B;  3G6E V;  1IBK B;  4R7C A;  1SER A;  4DV5 O;  1VQO V;  2EIK B;  4OXS A;  1MOF A;  3FB6 C;  2ATK C;  2YDE A;  5EC1 C;  2AW9 A;  1QLN A;  3AG3 B;  4RQF A;  5C93 A;  3WG7 B;  4W4K A;  1Q6I A;  3LUT B;  3FX7 A;  1ZAU A;  3OTF A;  4IGG A;  5HFL A;  5DM6 V;  4LWS B;  1I5Y A;  2NN4 A; 
#chains in the Genus database with same CATH homology
 5H6R A;  1WLE A;  3ETE A;  5LBQ A;  2WSS G;  2WLL B;  3X2Q C;  1ZWI C;  5KA5 A;  4MTO A;  2UXX A;  4MW3 A;  4MVR A;  1AI7 A;  1PKX A;  2DQ3 A;  3K08 A;  1IXM A;  4CBC A;  2AHY A;  2PI4 A;  2DYS C;  3SYC A;  3ZMV A;  4WF9 V;  3HPL C;  1K33 A;  3CD6 V;  2Y48 A;  1XL4 A;  3F7V C;  3W7T A;  2HR3 A;  1OCR B;  3I55 V;  3WFV A;  3EFF K;  3F7Y C;  4PEL A;  2D3O W;  3OR7 C;  4RUF A;  2X6A A;  3ML0 A;  2ZQM A;  1OHH G;  1Q86 W;  4KFM A;  3ABT A;  4LP8 A;  1FXV A;  1R3I C;  3QO8 A;  4PA7 A;  2OCC B;  2ZXW C;  2IH1 C;  4XBF A;  2EIL C;  5BZB A;  1G4Y B;  1FXK A;  4WFH A;  1GO3 F;  3RVY A;  3FB8 C;  3X2Q B;  4WCE V;  1H8E G;  1K7D A;  2W0F C;  3T4Z A;  1RPR A;  3CCJ V;  1AI5 A;  2IH3 C;  4MVU A;  4JYC A;  1AR1 B;  1M57 B;  1F4M A;  4JTA B;  4ZKI A;  3CCQ V;  4PDR A;  2BOB C;  2DYS B;  2QM7 A;  3OMN B;  3DGE A;  1K8A W;  4HAM A;  1RPO A;  2P7T C;  1RM1 B;  4P30 A;  3E2E A;  4ASU G;  5L3D A;  1VQ8 V;  3EHB B;  4GX0 A;  4Z1M G;  4LC1 A;  4DO2 A;  2ZXW B;  3ZN1 A;  4R8C A;  1XL6 A;  1QVF U;  2ZD9 A;  2ITC C;  1QVG U;  1KP2 A;  4GCZ A;  1FXK B;  2HLD G;  1F4N A;  3RBZ A;  3SPC A;  3D3I A;  2GSM B;  1P4R A;  3E8G A;  3P30 A;  2DYR B;  4QPJ A;  2XAG A;  1V54 C;  3FYE B;  1JX9 A;  1NR7 A;  1GKF A;  1H2G A;  4J9Y B;  1SRY A;  4PDV A;  2XAS A;  4MVS A;  2HVK C;  2CK3 G;  3K03 A;  1G8M A;  1OCO C;  1BL8 A;  3E8F A;  3IFX A;  1MAB G;  3B8M A;  4UVA A;  1S5H C;  1S0V A;  1EFR G;  1AJN A;  2EZP A;  5LHH A;  2WLJ A;  2YSU B;  1E1Q G;  1N8R W;  1YJ9 V;  1NR1 A;  2JK5 C;  1S72 V;  3WG7 C;  1DLB A;  3G4S V;  4QJF B;  2B1G A;  1THZ A;  3E83 A;  3D36 A;  3B8N A;  2XAJ A;  3FKS G;  1PNM A;  2IW5 A;  4BIZ A;  1CPY A;  3IC7 A;  4FMT A;  5B1N A;  2H94 A;  3K0G A;  3ABL C;  2ZDI C;  2WLK A;  2ZDI A;  3JCZ A;  4LCU C;  4YXW G;  1H38 A;  4MT8 A;  3MHS C;  4JGS A;  2IU3 A;  4F4L A;  3ABM B;  5EK0 A;  2H8P C;  2QM8 A;  3AG1 C;  5LHI A;  4J9Z B;  3HB3 B;  1I5X A;  2XND G;  3OFN G;  4HYO A;  3G71 V;  3QO7 A;  1OCR C;  2EBO A;  5IYB O;  2Y69 C;  2LP7 A;  3JD3 A;  1F51 A;  2EIM B;  4MVZ A;  3NXS A;  4UXN A;  3RVZ A;  2QE7 G;  3E8B A;  2NNU A;  1R3K C;  3ABL B;  3OMA B;  3E89 A;  3VBB A;  2NLJ C;  3A0R A;  1VQN V;  2OCC C;  1L1F A;  4TT3 G;  1PD3 A;  3CYO A;  3CC2 V;  2W6I G;  2V1D A;  2UXN A;  4RAI A;  2FTK A;  1VQ9 V;  2A0L A;  3AG1 B;  2JIZ G;  3ASO B;  1M1K W;  1CEZ A;  5EBL C;  1M57 C;  3FB5 C;  4P2Z A;  3B77 A;  4PA9 A;  5EC2 C;  3SPJ A;  2IJH A;  4JTC B;  1EBO A;  3OEH G;  4FK5 C;  4R50 A;  5FL7 G;  4BAY A;  2Q68 A;  1VQP V;  1RM1 C;  1CP9 A;  2HJF C;  1EZJ A;  2Y69 B;  3CMA V;  3OEE G;  1M56 C;  1P7B A;  5H9C A;  3SPH A;  5IDJ A;  3M99 B;  3ZMU A;  2PI5 A;  3OUF A;  2BOC C;  3STZ C;  1FXK C;  2WLN A;  4EKW A;  3ZIA G;  1W0J G;  2WAM A;  4MW8 A;  2IU0 A;  5J9P C;  4PDM A;  3ZN0 A;  5L3E A;  1KP3 A;  2DYR C;  3ZRX A;  4MTF A;  3TCU A;  3W7W A;  1F23 A;  4WFB V;  2WLI A;  4WFG A;  1M56 B;  3E35 A;  3T1C A;  2MK3 A;  2AHZ A;  1Q82 W;  1VQ6 V;  3K3W A;  1DF4 A;  2DQ0 A;  1FFT B;  3IGA C;  5LGU A;  1Y4M A;  3LNM B;  3CCV V;  1FS0 G;  3OGC C;  3E8H A;  3CP1 A;  3SPI A;  4UV8 A;  1GTO A;  5L3B A;  2A9H A;  3CC7 V;  4H33 A;  3JYC A;  4RQE A;  1NKD A;  1R73 A;  2WLI B;  4PA4 A;  1GM7 A;  4MTX A;  4TSF G;  4PA3 A;  3ABM C;  2X7R B;  1AJQ A;  5B1B B;  1BHA A;  2IJI A;  2DWE C;  3CC4 V;  3KG2 A;  1HWY A;  1JVM A;  3K0D A;  3BEH A;  5LGT A;  4KUM A;  3SYP A;  4LBE C;  1M90 W;  1YSC A;  3VOU A;  5CA3 A;  1AI4 A;  2ITD C;  2EIJ B;  3STL C;  1KC8 W;  1ENV A;  4QIW F;  5CMU A;  3F5W C;  4QE7 A;  5B3S B;  1OCC B;  4I9W A;  1K5Q A;  4JYB A;  3OE7 G;  1E79 G;  2EIM C;  4XDK A;  4WFE A;  3K9A A;  5L3C A;  1GMG A;  2YEV A;  1JPX A;  5EBW C;  1SES A;  2LFR A;  3P32 A;  1S3J A;  4QPK A;  4BW5 A;  1LNQ A;  4WFF A;  3JD0 A;  3LDC A;  2K1E A;  3OW2 U;  5EBM C;  2DW4 A;  1K73 W;  5B1A B;  4MVO A;  3CCU V;  3ASO C;  3CCM V;  3LDE A;  2LFS A;  1K4D C;  4Q20 A;  2B1I A;  1M9N A;  5L3F A;  1DF5 A;  5GW7 A;  1K97 A;  2A79 B;  1JQ0 A;  1MSW D;  3W7X A;  2JJ1 G;  5IYC O;  3BY6 A;  4FPP A;  3H01 A;  3DTU B;  1FXH A;  2IJJ A;  2JEX A;  3QNE A;  5LGN A;  1V55 C;  2EIN B;  3AG2 C;  2YEV B;  5CN0 A;  3T4D A;  2EZO A;  5CBG A;  1KQS U;  4MTG A;  1QLE B;  1VQL V;  4N21 A;  1KKD A;  2QA4 V;  1VQ5 V;  3SYO A;  2M7W A;  1R3L C;  3JD1 A;  4KP4 A;  5CBF A;  4MSW C;  1K9M W;  1OCZ B;  1AI6 A;  5CBH A;  4MVQ A;  1JOY A;  2OT5 A;  1H8H G;  4UVB A;  3OM3 B;  2Q6A A;  1QR9 A;  4WFA V;  5IY5 B;  3ASN C;  2C2A A;  3W7S A;  3UM7 A;  3ABK B;  4MVM A;  1YI2 V;  5LHG A;  2XAQ A;  1PNL A;  4P9O A;  4U7N A;  1V55 B;  3AG2 B;  1K92 A;  1SZT A;  2F43 G;  4RO2 A;  4P9P A;  4RUE A;  2WPD G;  3MHH C;  1KEC A;  5H6Q A;  4X8A A;  1GK9 A;  4R6Z A;  3CCR V;  1NBM G;  3OUS A;  1BMF G;  3QO5 A;  3CCS V;  2ZR2 A;  3ZRS A;  1NVP B;  4JAS A;  1GM9 A;  1AJP A;  3SYQ A;  4MS2 A;  2XAH A;  4QNH B;  1NH2 B;  2GHY A;  4UVC A;  4I5S A;  4JF3 A;  2IJK A;  1R6N A;  5KA6 A;  4H37 A;  1B6Q A;  4ZBM A;  3ASN B;  1K5S A;  4PA6 A;  3E86 A;  1R6K A;  3CPW U;  2DWD C;  3JD2 A;  2HKO A;  4TWK A;  3SYA A;  3TK1 A;  1BHB A;  4X89 A;  3ZJZ A;  4JPR A;  3SPG A;  2QEX V;  3AG4 C;  2Q67 A;  3OMI B;  1K3E A;  2WLH A;  4L87 A;  3ABU A;  3CCL V;  1S77 D;  4PDL A;  5B1B C;  1UJW B;  1TUE B;  2OTJ V;  1WPX A;  4N23 A;  1MG1 A;  3ZCC A;  3ETG A;  3K04 A;  3ZMS A;  4CZZ A;  4GX5 A;  2EIJ C;  2P67 A;  3R65 A;  2Z5U A;  1W2B U;  4XDL A;  1Q7Y W;  3CME V;  5B3S C;  1OCC C;  3FYI B;  2B5U A;  3JD4 A;  1QR8 A;  2EJR A;  1QCE A;  1VQ4 V;  3LSQ A;  3CCE V;  3K79 A;  1KD1 W;  4XDJ A;  3ZRW A;  4G27 B;  3AG4 B;  2JJ2 G;  5IYD O;  1W0K G;  2QTO A;  3ZMT A;  3MD0 A;  1YTF B;  2EIL B;  5B1A C;  1PL0 A;  2R9R B;  5KUM A;  1JCH A;  4UUJ C;  1E1R G;  4FJC C;  3PJS K;  1VQM V;  2JEU A;  3LDD A;  5L3G A;  4QE9 A;  3CXC U;  1K4C C;  1K34 A;  2HG5 C;  2X0L A;  2WLM A;  4JAV A;  4G28 B;  3ETD A;  4BIU A;  4GX1 A;  2P90 A;  1DTO A;  4FIP C;  1QBZ A;  2EIN C;  2Q69 A;  2R9I A;  5KUK A;  1NVP D;  1OZ0 A;  2EIK C;  1QLE C;  5B1O A;  2W6J G;  3ZRW B;  3AG3 C;  1YHQ V;  3RW0 A;  1NH2 D;  3GWO A;  4HZ3 A;  4G2K A;  3OAA G;  3ZMZ A;  4DXW A;  3TET A;  1SET A;  1NQT A;  1NJI W;  2WWW A;  1OCZ C;  2JDI G;  1S76 D;  1J95 A;  5E1A C;  2KB1 A;  2X6C A;  3SJQ C;  3ZRV A;  3K06 A;  5HFM A;  1GM8 A;  1YIJ V;  1ROP A;  3W7U A;  2ZR3 A;  3OR6 C;  3T2M A;  4GT1 A;  1YIT V;  1ARO P;  5IY5 C;  5DN6 G;  1V54 B;  2Z3Y A;  4JAU A;  3ABK C;  3LSS A;  3G6E V;  4JTD B;  2V7Q G;  2XAF A;  4R7C A;  1VQ7 V;  1VQK V;  4UV9 A;  1SER A;  1COW G;  1OCO B;  3GB7 C;  2WLL A;  1VQO V;  3UKM A;  1ORQ C;  4U7O A;  2EIK B;  4OXS A;  1MOF A;  2XOK G;  3FB6 C;  2ATK C;  3FB7 C;  5EC1 C;  1QLN A;  3AG3 B;  4X88 A;  4RQF A;  1Q81 W;  1YJW V;  5C93 A;  1YJN V;  1R3J C;  2X6B A;  3WG7 B;  2QKS A;  1JJ2 U;  3LUT B;  2HVJ C;  3AEI A;  5HFL A;  4E2L A;  5DM6 V;  1Y66 A;  2HFE C;  4GX2 A;  1I5Y A;  2P6J A;  1YTF D;  1PNK A;  3I56 V;  2OTL V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...