3STLC

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3stlC00
5KUMA 4MVMA 4RUEA 3SYQA 3LDCA 2DWEC 4MVUA 3E8BA 4MVOA 4F4LA 3K06A 4JTDB 1G4YB 2Y69C 2OCCC 3AG3C 4XDLA 3SYAA 3T2MA 2WLLB 3R65A 1R3LC 4GX2A 3JYCA 1S5HC 3AG2C 2BOCC 3IGAC 4UUJC 3RBZA 2X6CA 4G28B 4MTOA 3RVZA 3OR6C 2IH1C 1K4CC 2WLJA 3EFFK 2X6BA 2WLLA 2WLKA 1XL4A 3K08A 2HVKC 4H33A 2Q67A 5EBMC 5B3SC 2ITCC 2A79B 1R3JC 2EILC 4MVQA 3F7VC 4R7CA 4X88A 2P7TC 2WLIA 4WFGA 1JVMA 2ATKC 4MVSA 3ASOC 5KUKA 2EIJC 4R6ZA 4R8CA 4DXWA 3K0GA 3OGCC 4LP8A 2WLIB 3OUSA 3E8FA 3FB5C 1V55C 4I9WA 1V54C 5IY5C 3LNMB 1BL8A 2X6AA 3K0DA 1LNQA 3T4DA 4J9YB 1K4DC 4GX5A 4QE9A 3SPCA 2A0LA 3E86A 2HFEC 4P2ZA 4P30A 3SYCA 2YEVA 3WG7C 1J95A 2EIKC 4PA9A 4P9OA 3TCUA 5CBFA 1QLEC 3F7YC 3SYPA 2NLJC 3LDDA 4ZBMA 2HG5C 2W0FC 3SPIA 4LBEC 3SJQC 2ZD9A 3FB6C 4P9PA 4TWKA 5EBWC 3VOUA 1ORQC 5CBHA 4PA4A 1OCOC 5B1BC 2IH3C 3E83A 2JK5C 3E8HA 3GB7C 4WFEA 2R9RB 3STZC 4GX1A 4XDKA 3HPLC 3OR7C 3PJSK 1OCZC 3ABKC 4MS2A 4MW3A 3ZRSA 2EINC 2EIMC 3FB7C 4PA7A 3SPGA 4CBCA 3AG1C 5CBGA 4JTCB 4KFMA 3ASNC 4PDVA 2Q68A 4X8AA 1OCRC 4LCUC 3UKMA 4PDRA 2QKSA 5EBLC 3FB8C 2DYSC 4OXSA 3X2QC 5BZBA 3UM7A 3RVYA 5EK0A 3ABLC 2Q69A 3E89A 3K03A 4MTFA 3SYOA 3ABMC 2HJFC 5EC2C 1OCCC 4R50A 2ITDC 5EC1C 4GX0A 2WLNA 4XDJA 2DYRC 4MVRA 4RAIA 4MVZA 4MW8A 1KKDA 4QE7A 3SPHA 4PA3A 3BEHA 4MTGA 4H37A 2WLHA 1P7BA 4MSWC 4WFHA 2DWDC 1XL6A 2HVJC 3T4ZA 2AHZA 4PA6A 1ZWIC 4HZ3A 4J9ZB 2A9HA 4JTAB 5E1AC 3K04A 3SPJA 3TETA 3OUFA 4BW5A 4RUFA 4RO2A 1R3IC 4X89A 3AG4C 3T1CA 4PDMA 3E8GA 4WFFA 3ZJZA 2BOBC 4HYOA 3LUTB 2H8PC 3LDEA 1R3KC 3IFXA 2KB1A 2ZXWC 3KG2A 4EKWA 1M57C 4G27B 3F5WC 4QNHB 5J9PC 2WLMA 2Q6AA 4PDLA 2AHYA 5B1AC 3RW0A 3STLC 2K1EA 1M56C 2QTOA
chains in the Genus database with same CATH superfamily
5FPRA 4B08A 2W6JG 4YJ3B 3SR2C 2OCCC 1MA1A 2YI8A 3L75H 3T1YO 2P6JA 2CDYA 2BOCC 3IGAC 1K97A 2N74A 2HVKC 3IC7A 3K5LA 2DYSB 1O9GA 3LSUA 5FNVB 3ZHRA 5KHKA 1ZSPA 2ATKC 2IM9A 1G8MA 3FB5C 4JI4B 2MW2B 1W59A 1JQ0A 1QVFU 3QO5A 1PL4A 3G80A 4ZHQA 2YEVA 4TOIA 1J95A 3TCUA 4H0LB 4QJFB 1FJGB 1M4UA 4IYHA 1M90W 5EZYA 2W0XA 4ABMA 4EB6A 1SZTA 2NNUA 3LDDA 1AB3A 3CXCU 4JYCA 3SJQC 3G4SV 4TWKA 3VOUA 1P7GA 1X4TA 4OPAA 3UT5A 4UCUA 1H8HG 5JJNB 4MW3A 4DV3O 1J5EO 3DSQA 3CYOA 4RQFA 1IVSA 4EEQA 3G71V 1VP7A 2P5OA 2Q69A 4JI6O 3UCSC 2LGWA 4TT3G 4JI6B 1I08A 4BW9A 1ZWIC 2ZR3A 2M7WA 4IYIA 4JTAB 1R6KA 3SPJA 4X1IB 3M8AA 4AI8A 1N32O 5LYJA 4DK0A 4JI5B 1VIBA 3B4SA 1VQ9V 1I5XA 5L3GA 4JI5O 3L72H 1JMKC 4I0XB 4X66B 2IJIA 4MVUA 4JTDB 5B1BB 2YICA 4PELA 2D2CB 3RN4A 2ODMA 1KD1W 1JJ2U 4G28B 2EIKB 3U10A 5JQGA 4PJ0Z 3WFVA 1ROPA 1PNLA 1Q8IA 4PD4F 3CHXA 1TAEA 3A0BZ 5B1OA 5H6RA 2X6AA 3ZBHA 4NTXA 1G6UA 1YI2V 1Y74A 1KB9F 1N34O 2UXNA 3AG4B 5KLVH 5KX5B 1SKVA 2BTOA 3JD2A 4P9PA 2RQ6A 1V9PA 3GWOA 5K1PA 4LR3A 1H2NA 2EULA 3ZCCA 4HNAB 1JCHA 3L73H 3CPWU 2UXXA 1NVPD 1QU7A 2YXYA 1O9HA 5B3SB 1YTFB 3RT3C 1S5LZ 2CAZC 1KBHA 1BT8A 1GN4A 1NTMH 3RYFA 1TUEB 4K8XA 1IBLO 5E1AC 5KA5A 5CA1A 1F51A 3TETA 4ZOLB 1SQBH 4FZ0A 5LMUB 2BTQB 1YHQV 4LH6A 4UB8Z 2LGQA 3E35A 3LUTB 4JPRA 1R3KC 2R72A 4QNHB 2OTJV 4DV6B 1FFXB 1SQVH 1BMFG 3E8BA 4DR4O 5J2TA 1NZ6A 5H9CA 1UJWB 1QBZA 1M56B 4GX2A 3R65A 1R3LC 4G2KA 4LFAO 1S5HC 4DO2A 4DR7B 4LF6O 1CXZB 4MTOA 1NI8A 4B3SB 4LNUA 1FKAO 2WWWA 3ETQA 4AILC 5CA0A 5LMNB 2X6BA 4DR5O 3ML0A 4ICGA 1X59A 3OE7G 2Q67A 3TXSA 1SERA 1I0HA 4MTXA 4O4HA 3N2GB 2V4DA 2B9ZA 4L8JA 3OUSA 1V54C 1Z5WA 1PL0A 4BR6A 4FZ1A 2YIAA 1IX9A 3JASB 5GONA 3VQVA 2PY5A 2YUAA 4J80A 2A0LA 3APQA 1YJ9V 1SF9A 1S0VA 1QCEA 3M99B 1GN6A 3AEIA 1VF6A 3FB6C 2ZIOA 2FMLA 3GB7C 2L6LA 3P32A 5GONB 3RYCA 1QNMA 4WBNA 2HP8A 1KKCA 4LF9B 2EX3A 4LCUC 2H94A 3ABLC 3JD3A 5IYZB 4JI3B 1SC5B 2LJ2A 4FFBB 1RFYA 5IE9A 4X1YA 1HR0O 5LOVB 2K9PA 1D5AA 4BIOA 4WFHA 5FL7G 3VQWA 3ABKB 3OAAG 4PA6A 1GO3F 1EBOA 2XAQA 5J2TB 2XNDG 5DN6G 2B1GA 4K8ZA 2P4VA 3SJAC 1FFXA 3CRQA 2ZQMA 2IW5A 2YIDA 2BOBC 4FIPC 4HYOA 5IYBO 4JZGA 1CEZA 1IXBA 4J7KA 1DK1A 5CA0B 3M7MX 2Z5UA 5IY5B 4LF5B 4AQYB 2X7RB 4TQDA 4F4LA 2QWRB 3RWRD 2UU9B 1I5YA 3CJHA 2WLLB 4ZI7B 1NH2D 5JH7B 2E5LO 2P06A 3JAKB 1K4CC 2E74B 1H2SB 5KMGB 3ETDA 2BE3A 2ITCC 4MVSA 1RP3B 4DXWA 2V7QG 4LP8A 3FYEB 4LFBO 3NXSA 3K5MA 4DR5B 2PUSA 1XQ8A 4IL6Z 3W7XA 3KCYA 2UUCB 1IDSA 4FM2A 3JALA 2IH3C 1WJZA 2OIGA 3B8MA 5A9GA 1Y6XA 4UVAA 2AXTZ 2C2AA 3FB7C 3A8TA 2V1DA 3HKEB 5LGTA 3RVYA 5EK0A 3RGBA 3OTOO 2RN9A 1R73A 1FXKA 3OTOB 3SPHA 5BXZA 2QWNB 1V54B 5GW7A 4LF9O 1H38A 3EHBB 1MMMA 2ZM6B 1Q6IA 3ABMB 2FB5A 2DN9A 4RO2A 2QA4V 1Y67A 3BA8A 3ZJZA 1XMQO 4UCVA 3I55V 4DUYO 5IYCO 2JGDB 3H1KH 1XUQA 2GTSA 4A5UB 3ZIAG 1WAZA 4IGGA 4LF7B 4RUEA 5CB4B 4H13B 5CMUA 1EN6A 5H2FZ 4LF7O 1FXHA 1W0KG 3H1LH 3CXHF 4UUJC 3G6EV 2X6CA 3RVZA 2LO1A 2OTLV 4LF5O 1TVKA 1WNSA 4MVQA 4R7CA 2ZINA 1L1FA 4GKKO 4DV7B 3ASOC 5KUKA 2WLIB 3B77A 1P49A 3QTCA 2WAMA 4CH4A 1BCCH 3MHSC 4O2AA 1GH6A 3UT5B 4JASA 2ETNA 1AI6A 3OT7A 1RM1C 4NB5A 5JCOA 2HLDG 3WG7B 2HG5C 2W0FC 3D8CA 3SPIA 1YEWA 1JOYA 4J7ZA 2Y69B 1MABG 2N04A 1OV9A 3CRRA 1AI5A 1FXVA 1VF5B 2A7WA 3TGUH 4X8AA 2WSSG 2PZSA 3Q4HB 4OXSA 1ZL8B 1SA0B 3LSSA 3SYOA 3E89A 1QVGU 2HJFC 4U3FH 2ZCEA 5LP6B 2ITDC 4YXWG 4RAIA 1KMIZ 4MW8A 5D5QA 3HKCB 4JV5B 4O4IB 1VEWA 1P7BA 4MSWC 2A3QA 3HKDB 4EFEA 1XL6A 2AZ2A 5GTHZ 3VBBA 4UB6Z 2IBZH 1XHZA 3G67A 5LXTA 2ZXWC 1YIJV 2QDOA 1QR8A 3OR6C 2B1IA 2OCHA 4DV4B 3L9DA 4DR6O 5C93A 3AG3C 2E3CA 5KX5A 1CP9A 1Q82W 3I56V 1PPJH 2MK3A 3E22A 1K5SA 3W7WA 2ZIMA 4HBNA 3CRCA 1YCIA 4CZZA 3ABLB 1XL4A 4TUYB 3O65A 1ENVA 4LH7A 2OT5A 2Q9LA 3ZRWB 1GAXA 4Q6GA 4DV5O 2M6YA 5JJEB 1VARA 1VQPV 3GWKC 1COWG 5LGNA 1H2MA 5CA3A 2CUGA 1NH2B 1LNQA 5TISZ 3CD6V 4DV7O 3ETGA 3D36A 3D3QA 1EN5A 1AI7A 3F7YC 1GN2A 2CK3G 3OM3B 3CC4V 1IZ3A 4DR3O 1XHXA 4FMTA 5HFMA 1XNRO 4XDKA 1OCZC 4FLZA 4FLXA 5LL6Y 2YIBA 1AI4A 1XNRB 3C3TA 1TUBA 4JI0B 3Q4HA 3X2QC 2Q7HA 1RSOA 1MNGA 3AK2A 1OCRB 4JZ2A 2AW9A 2EZOA 2ZDIA 2O57A 2QJ1A 4OX9O 3DXRA 1W2BU 1M93A 3T1HB 5IJ9B 5B66Z 1VQNV 1H2KA 1YF2A 1XMQB 4JI3O 1SS3A 2JS3A 4J42A 3N2GA 1PNMA 1Q81W 2GUZB 4O2AB 2ILMA 4OGQB 2LW1A 4EKWA 2GUZA 2ZE5A 3VQXA 1NR1A 2KKWA 1I94O 2Q5ZA 4FVMA 5IWAO 3IAYA 4GLXA 2Y69C 2JJ1G 1YJNV 3H9VA 4CH3A 4FPPA 3QVNA 1FD9A 5IWAB 5HFLA 4BAYA 3RBZA 3ZHUA 2JEUA 2ZXWB 3CCVV 3B40A 3EFFK 2AZ0A 5IDJA 2F43G 4FLWA 5IYDO 2UXCO 4KUMA 1JVMA 2HKOA 3E8FA 1K92A 3G6BA 3ZHSA 2L35A 2PI5A 4Z1MG 3LNMB 2UUBO 2UXDO 4B3RO 4GX5A 4FM1A 4O4IA 2UUBB 3UQ8A 3TK1A 2CGNA 4PA9A 2QM4A 1B06A 4UXNA 4DV5B 1L0NH 2NLJC 1PD3A 3OGIB 4FK5C 1N0NA 1RPRA 5EBWC 3MDSA 1OCZB 3K5NA 4DRXB 1U96A 4CS2A 2EIMC 3AG1C 5CBGA 2EIJB 3ASNC 1IBKB 1WLEA 1VMGA 4DR3B 3A0HZ 3ABMC 4DV2O 4I50A 4IHJA 3CCUV 4MVRA 3W7TA 4FLTA 5F2VO 1N36O 1Y74B 1K7DA 3P3PA 1RPOA 2HVJC 4O2BA 3CCLV 5EZYB 3SGIA 4X9QA 4D6TH 4UCOA 3A2FA 2F66C 4ZKIA 2HEPA 3E8GA 5JQGB 4DR7O 4UVCA 2Q0OC 3H01A 4B3MO 4DV0O 5ITZA 1K8AW 4J41A 5B1AC 2K1EA 3KZIZ 2FKXA 5C8YB 3L71H 1NTZH 1VF7A 4B3MB 1K5QA 1ZAUA 1I7FA 3JATB 1OJHA 5CB4A 1Z2GA 5KMGA 5CN0A 3JYCA 4JI1B 2ZE8A 1KP3A 1HNZB 3AK3A 4LF8O 5LHHA 1NR7A 4JI1O 4U7OA 4I5SA 3LNNA 2WLLA 4ZI7A 2XAGA 2R9AA 3JASA 2XAFA 5L3CA 3OMNB 4NXNB 1R3JC 4LF8B 4MT8A 4YJ3A 1YZBA 3FFQA 3QG5A 2EIJC 4R8CA 2ZE7A 2Q7GA 3WU2Z 4I9WA 4RQEA 3O9OA 5IY5C 3H1IH 1Q43A 2WPDG 2YC0A 1HNXO 1VQOV 1KQSU 5KAFZ 1M57B 4KXRA 2EZPA 1K4DC 4ASUG 2JDIG 1Y76A 4P2ZA 2EBOA 3H1JH 3SYPA 1K3EA 5IJ9A 4GUNA 1ZX3A 1OCOC 4F6RB 4WFEA 5H5NA 1ZTEA 3L70H 1SQXH 4O4JB 3ZRSA 1HNWO 4PA7A 3BPZA 5LGUA 2YS8A 3CC2V 3MAQA 1WA8A 3QNEA 2DJVA 5B5EZ 4I55A 4NYKA 5EC2C 2AGAA 3JSLA 2PYLA 1XDCA 1VQ7V 5IT9N 2F4VO 1XILA 4UCTA 1FXKC 1QQCA 2AHZA 3CMEV 1GM7A 1LUVA 2HR3A 2Y4TA 4DR2B 4XBFA 1Q3EA 1IBLB 5ITZB 5BMVA 2UXBO 2KG7A 3APOA 2ARHA 1I94B 3F5WC 3SJBC 2P90A 4UVBA 5KUMA 3SYQA 3CJHB 1BS3A 4PV1B 4JI2B 3JARA 2ZE6A 2JJ2G 2JRIA 4JI2O 3AG2C 2EILB 1K33A 3HB3B 5EYPA 3CC7V 1B6QA 1SRYA 4DV1O 4I9QA 3K59A 4DR6B 3OEHG 1K73W 3N2KA 1H2LA 1S3JA 4WFGA 4E4EA 1PM9A 4JI4O 4IIJB 3OGCC 1HNZO 1BHBA 3WB1A 2DW4A 1K34A 2KG7B 3EXAA 4QE9A 3ABUA 1AILA 2P4KA 5EYPB 2HFEC 4P30A 3SYCA 1LUWA 4P9OA 3ZS8C 3JD0A 4TSFG 2Q73A 4ZOLA 4GKJB 4ZBMA 5E79Z 4YIOA 4LBEC 2LQTA 1URFA 4DV3B 5B1BC 3BY6A 4WF9V 1XI1A 3OEEG 4I7ZB 4KL1A 3OMAB 1QHTA 1MOFA 1GRJA 5KHHA 1WPBA 2UUAO 5LBQA 1M1KW 2D3OW 3CCQV 2VQFB 1SA0A 1WA8B 2QKSA 1J5EB 1EN4A 1PNKA 1GM9A 2JIZG 1SETA 2DYRC 2XHBA 2DQ0A 1JX9A 4F6EA 3CRMA 2WLHA 3CCJV 1NT2B 4GCZA 2A9HA 2R70A 1ZUQA 1Q6UA 2ZNJA 4GYCB 1MSWD 1R3IC 2IU0A 1N8RW 3T1HO 4G27B 1BHAA 4B3SO 3STLC 4DR2O 1DTOA 5FLXN 1MZFA 3LDCA 2DWEC 3K06A 3JCUZ 4GKKB 4U3JB 4UV8A 3JAWB 3K9SA 2ZR2A 4KHPB 2Q7EA 2PGGA 1VF6C 4QPKA 5JVDA 1HDJA 3JATA 3FX7A 3K3WA 2GV9A 2BSKA 4X88A 1H2GA 1S72V 3T1YB 3K9AA 1M5IA 2BCCH 1HNXB 4I0XA 1TUBB 1Q6HA 4WBNB 3OD4A 3JD1A 3RYCB 1AJQA 3BA9A 4FJCC 5LA6A 3HKDA 1W0JG 2CH7B 5GTIZ 1AP6A 1QR9A 3E86A 5JJJB 2IJHA 3WG7C 2EIKC 3ABTA 4NR1A 5CBFA 4J10A 5LP6A 4X20A 2XAJA 3D3IA 4LFCO 3CS5A 1ZL8A 5C8YA 4J7JA 4B3RB 2UXDB 1EZVH 5CBHA 4LWSB 4PA4A 2VQEB 2QM7A 1YXBA 2OCCB 4DYLA 3ABKC 4UFZA 3AK1A 3SPGA 4CBCA 1NKDA 3B8NA 5L3DA 4LF4B 1N4CA 1WB7A 3K03A 3BRCA 4TUYA 5EC1C 1KECA 4X1KB 4E2LA 1KKDA 4QE7A 1EM1A 3J80N 2UUAB 4MTGA 4H37A 1GN3A 5KHGA 1NJIW 1M9NA 1BQ0A 3HKBA 3C3SA 2ZNIA 5LMUO 1PP9H 1NU1H 3JARB 3OUFA 3MD0A 2XT9A 2CTPA 2XAHA 1VQ5V 4FM0A 3J7AU 2F23A 3CCSV 5J9PC 3RW0A 1F23A 5L3FA 1MZEA 1YTFD 4HAMA 3IJ4A 3ZRXA 3CCRV 3FAVB 3SYAA 3CB2A 3MHHC 2XOKG 2CH7A 2CGOA 3ZMZA 3N27A 2JGDA 2Y0PA 1R1BA 1Z5VA 4I55B 2EILC 4NXMO 3DC5A 3AG1B 1MG1A 4X1IA 1XOUA 2NR5A 1Y66A 1BL8A 4RWUA 4OPHA 2Z0AA 1KP2A 3DGEA 3CP1A 1GMGA 1ORQC 3E83A 2JK5C 1N34B 1YJWV 3HPLC 4IT5A 3ZHQA 4U7NA 3D36C 4O4LA 3WB0A 4C7UA 1OCRC 4LFCB 2LP7A 4CS3A 2DYSC 3CE2A 1KC8W 1TVKB 2QR4A 4GX0A 1HNWB 4XDJA 4DUZO 3IC9A 1A32A 1TA8A 1CPYA 3BEHA 4B7EA 1NBMG 1P4RA 4X65B 3BABA 1SQPH 3P3NA 1V55B 1BE3H 3FAVA 2NN4A 3ICXA 1JA8A 2B5UA 2LW7A 1THZA 1L8DA 4PDMA 1YSCA 5FNVA 2KB1A 2CTQA 4DR1B 3KG2A 3U11A 2W6IG 3ZHVA 5A2QN 3ZMVA 3B2EE 2PTMA 4D7SA 1DF5A 3FD9A 4O4HB 2X0LA 1BSMA 2UXBB 4DV4O 2Q4PA 4X62O 2GDSA 2QWPB 2IH1C 1BZKA 3JD4A 2WLKA 1JFFB 4I50B 4JI8B 4DR4B 2EIMB 4JAVA 2Y0IA 3K0GA 3HKEA 4YHHB 3ZX6A 4JYYA 1AR5A 4NVPA 4FFKA 1LR1A 3JALB 1MSDA 2QSAA 3BCCH 4L87A 4NTYA 5IYZA 3UO3A 4K3AA 5H6QA 2A06H 4EB6B 4B3TB 2UUCO 3ASNB 3FYIB 2ZD9A 2OWOA 1BGYH 2Y4UA 4FLUA 1AR1B 3STZC 1JJOA 2R9RB 3HKCA 3OR7C 1PKXA 2EINC 5J2UB 1NVPB 1TGOA 1U97A 1IXMA 1OHHG 2HHHB 3ZMUA 5EBLC 2LFSA 3UM7A 2H3OA 4MTFA 5L3EA 1OCCC 4N21A 5J2UA 1Q86W 1XNQO 5D5PA 3A0RA 4CH6A 1NTKH 4W4LA 4PI2A 5BR8B 3JAKA 2CTRA 4GZRB 4JAAA 1ZLZA 1VQKV 1SZXA 5BR8O 4JGSA 4BW5A 4DK1A 2DOSA 3T1CA 4JI7B 4DUZB 1HR0B 2OIEA 2BSKB 4WFFA 2ZKOA 1GKFA 1YITV 3CCEV 1M57C 4QPJA 4PDLA 4UV9A 2F95B 5LHGA 3CRAA 3CMAV 3OFNG 2Y48A 1JFFA 3T2MA 1T5EA 1S76D 1IURA 2WLJA 4NXMB 1RM1B 2BTQA 2P7TC 1RSOB 2IJJA 3NR7A 2E5LB 2UXCB 1D5NA 1S77D 4WFBV 3RYFB 1OZ0A 4ZIBA 4JI8O 2CE4A 2DYRB 2VRZA 1F4NA 4WFAV 3BFRA 4NTWA 4YHHO 2VWJA 1E79G 3X2QB 3QF7A 1Q90D 1AJNA 4BIZA 3JAMN 2YIBD 4CC5A 1UPGA 1US6A 5EIBC 2GBOA 3ZMSA 3K57A 4I4TA 2E75B 2KSDA 4OX9B 3TJTA 1QLNA 4B3TO 3LSQA 3DTUB 4O4LB 1K9MW 3ZHTA 1Q7YW 3AG2B 3KCXA 4DW0A 1DGSA 3JSNA 4DV2B 5DECA 5IJ0B 3E22B 1F7YA 1HWYA 4LF4O 2DWDC 3T4ZA 3OMIB 3BAAA 3RYIB 1IBMO 4IHJB 4J9ZB 1N36B 2YXLA 3K04A 4Z2WA 3ZN1A 1GTOA 1AP5A 1XNQB 1N33O 2GTAA 3N2KB 4ZHQB 4K35A 3BHPA 1KUQA 1G1XB 1P84F 1FPOA 4H44B 1R6TA 3JCZA 4Q20A 2IU3A 4LWSA 3SPCA 2ZM6O 2Q8VA 2PYJA 2CTWA 4CH5A 4BIUA 1OCOB 4MVOA 5LHIA 3TXQA 3W7UA 5CA1B 4X62B 2N05A 4QGPA 2P22C 2ZDIC 1VQ8V 2XASA 4YY3O 1AROP 3ZN0A 4YJ2B 5JH7A 4FLVA 1SQFA 1SQQH 5FPOA 1EZJA 5EBMC 2RCVA 3H1HH 4LFBB 4EFBA 3F7VC 4AHCA 2ADPA 2JS5A 2QE7G 4B7KA 4LFAB 3ZRVA 1V55C 4NXNO 3S3WA 4LF6B 1HP8A 5LMNO 2F93B 4O4JA 3T4DA 1B04A 1SESA 1YDXA 2QM8A 3S3XA 3CX5F 4U3JA 1QLEC 3BVOA 3HKBB 4TQFA 1AVMA 5AG2A 4CS4A 4K0KO 4X1YB 4N23A 1DLBA 2FL4A 3FKSG 4JTCB 2FYUH 1UFIA 2KQXA 3C90A 4PDVA 2Q68A 2YXHA 3UKMA 4PDRA 1H8EG 2OYQA 1WN7A 1VQMV 2JGUA 1E1RG 4JI0O 5B1NA 1HW7A 1R6NA 1Y76B 4PA3A 5LOVA 4FFBA 3CCMV 5B1AB 2Q0AA 2R9IA 4JI7O 4X64O 4TV8B 2P67A 4QIWF 4X66O 2JVDA 1D2DA 3DC6A 1XMOB 4X64B 5K1XA 2H8PC 1XMOO 5LA6B 1FAFA 4YJ2A 4KHPO 2Q6AA 3OTFA 4JYAB 2QTOA 5BY1A 1Y4MA 1Q5OA 1JPXA 1G4YB 1DF4A 4TV8A 4JYAO 1WPXA 4YIPA 3ASOB 5JVDB 1WB8A 1F4MA 2QGNA 3RYHA 4JYBA 4GT1A 4LNUB 5KHIA 5L3BA 5DEDA 1VQLV 2QEXV 2JEXA 4AQYO 3K08A 3PN1A 4H33A 1YVWA 3R66A 3W7SA 4BWAA 2UU9O 5DM6V 3ZRWA 2RDCA 4O2BB 2DE0X 2GSMB 3OW2U 3K0DA 3RYIA 3K58A 2ADQB 4X1KA 1KU9A 4D7TA 2YDEA 1KYOF 1JR9A 1FYJA 1FJGO 3B09A 1PV0A 3J81N 4GKJO 4I4TB 3AG3B 3PJSK 4LC1A 4MS2A 3U0ZA 2FTKA 2EJ7A 3F5TA 5LP6C 4WCEV 4KFMA 4W4KA 1QLEB 2EJRA 2VS0A 5KA6A 5BZBA 2Z3YA 1GM8A 4X20B 2QKAA 2WLNA 3CWBH 3HR0A 3KKYA 4TV9A 1IBMB 3CSXA 4HNAA 1FFTB 1NQTA 2HHHO 4JAUA 2VWKA 4UCSA 2QWOB 1N33B 2HJDA 3SJCC 4DV6O 5KAIZ 3I5DA 1WP7A 2XUMA 3AG4C 1E1QG 3THOA 3K79A 4DV0B 1VQ6V 4PHZA 1N32B 2QWQB 1B3QA 1XBLA 3QO7A 1VQ4V 3ZMTA 2DMXA 2WLMA 4F6RA 3JAWA 4DV1B 4MVMA 4YY3B 4XDLA 4PI0A 3AG7A 4NKGB 4DUYB 1AR4A 3WB2A 2ZT9B 4KP4A 3EVKA 5IJ0A 2DQ3A 4Z1VA 5KHJA 2RJZA 2XTAA 3RYHB 3L74H 5B3SC 2A79B 3CEIA 2F1MA 3ZEDA 2WLIA 3VQYA 4R6ZA 2QTSA 2YI9A 3QO8A 2GHYA 1N0JA 3E2EA 3DXRB 4J9YB 5LYJB 5BMVB 5EIBD 4TV9B 1OCCB 3RFRA 1BQZA 2RMKB 4K0KB 2PI4A 1FS0G 2VQFO 2G38A 3K5OA 1EFRG 3E8HA 2EINB 1AJPA 4GX1A 2IJKA 2PF4E 2VQEO 4JF3A 3SDLA 1L0LH 2E76B 1S5JA 4X65O 3FB8C 1XEQA 4UCRA 3ETEA 1GK9A 3UO2A 2WA3A 4R50A 4FLYA 2QKCA 4MVZA 3P30A 1NS1A 1IBKO 1SQGA 2WA4A 2F4VB 4DR1O 1FXKB 4CC6A 4HZ3A 2YSUB 1WP8A 2LFRA 4IIJA 3GVMA 4RUFA 2YEVB 4X89A 4JV5O 4J11A 5JCOC 3LDEA 2RNBA 3IFXA 5LXTB 1XREA 4DRXA 4DW1A 2AHYA 5JWPA 1M56C
chains in the Genus database with same CATH topology
5KUMA 4RUEA 3SYQA 5CMUA 2W6JG 5LHGA 3CMAV 3OFNG 2OCCC 2Y48A 2JJ2G 1FXHA 1W0KG 2P6JA 3T2MA 1S76D 3AG2C 2BOCC 2EILB 3IGAC 1K33A 3HB3B 4UUJC 3G6EV 2X6CA 1K97A 3RVZA 3CC7V 1B6QA 1SRYA 2OTLV 2WLJA 1RM1B 2HVKC 3IC7A 2DYSB 4MVQA 4R7CA 3OEHG 1K73W 1S3JA 2P7TC 4WFGA 1L1FA 2ATKC 3ASOC 5KUKA 2IJJA 3OGCC 2WLIB 1G8MA 3B77A 3FB5C 1BHBA 2DW4A 2WAMA 1K34A 1S77D 4WFBV 4QE9A 3ABUA 3MHSC 1OZ0A 1JQ0A 1QVFU 3QO5A 2HFEC 2DYRB 4P30A 3SYCA 2YEVA 4JASA 1J95A 4P9OA 3TCUA 4QJFB 1AI6A 1F4NA 4WFAV 1M90W 3JD0A 1RM1C 4TSFG 2HLDG 1SZTA 2NNUA 1E79G 3LDDA 4ZBMA 2HG5C 2W0FC 3WG7B 3X2QB 3CXCU 3SPIA 4LBEC 1JOYA 4JYCA 3SJQC 3G4SV 4TWKA 2Y69B 3VOUA 1MABG 5B1BC 1AJNA 4BIZA 3BY6A 4WF9V 1H8HG 3OEEG 1AI5A 1FXVA 3OMAB 4MW3A 1MOFA 3ZMSA 5LBQA 1M1KW 2D3OW 3CCQV 3CYOA 1QLNA 4RQFA 4X8AA 3LSQA 2QKSA 2WSSG 3G71V 4OXSA 3DTUB 3LSSA 1K9MW 1PNKA 2Q69A 3E89A 1GM9A 2JIZG 3SYOA 1QVGU 1Q7YW 2HJFC 3AG2B 2ITDC 4YXWG 1SETA 2DYRC 4RAIA 2DQ0A 1JX9A 4MW8A 4TT3G 2WLHA 1P7BA 4MSWC 1HWYA 3CCJV 2DWDC 1XL6A 3OMIB 3T4ZA 1ZWIC 2ZR3A 4GCZA 4J9ZB 2A9HA 2M7WA 4JTAB 3VBBA 3K04A 1R6KA 3SPJA 3ZN1A 1GTOA 1MSWD 1R3IC 2IU0A 4Q20A 1N8RW 1VQ9V 3JCZA 2ZXWC 4G27B 1I5XA 1YIJV 1BHAA 2IU3A 3STLC 5L3GA 3SPCA 1QR8A 3OR6C 1DTOA 2B1IA 3LDCA 2IJIA 2DWEC 4MVUA 4BIUA 1OCOB 4MVOA 3K06A 5LHIA 4JTDB 5C93A 3W7UA 3AG3C 5B1BB 2ZDIC 1VQ8V 2XASA 1CP9A 1Q82W 4PELA 4UV8A 2MK3A 3I56V 1AROP 2ZR2A 1K5SA 3W7WA 1KD1W 1JJ2U 4G28B 3ZN0A 2EIKB 4CZZA 4QPKA 3ABLB 1XL4A 1EZJA 3WFVA 5EBMC 3K3WA 1ENVA 1ROPA 2OT5A 1PNLA 3F7VC 1H2GA 4X88A 3ZRWB 1S72V 3K9AA 2QE7G 3ZRVA 1V55C 1VQPV 5B1OA 1COWG 5H6RA 5LGNA 3JD1A 2X6AA 5CA3A 1AJQA 4FJCC 1YI2V 1NH2B 1LNQA 1W0JG 3T4DA 1SESA 1QR9A 3E86A 2QM8A 2IJHA 3CD6V 3WG7C 2EIKC 2UXNA 3ABTA 3AG4B 3ETGA 5CBFA 3D36A 1QLEC 1AI7A 2XAJA 3D3IA 3F7YC 2CK3G 3JD2A 3OM3B 3CC4V 4P9PA 3GWOA 4FMTA 4PA4A 5CBHA 5HFMA 2QM7A 2OCCB 4XDKA 3ZCCA 1OCZC 3ABKC 1JCHA 3CPWU 2UXXA 3SPGA 4CBCA 1NKDA 1DLBA 1AI4A 3B8NA 3FKSG 4JTCB 4N23A 5L3DA 1NVPD 4PDVA 2Q68A 3UKMA 4PDRA 3X2QC 1H8EG 5B3SB 1YTFB 3K03A 1VQMV 1OCRB 1E1RG 5EC1C 5B1NA 1KECA 1R6NA 4E2LA 1KKDA 4QE7A 2EZOA 2ZDIA 4PA3A 4MTGA 4H37A 1W2BU 1TUEB 1NJIW 1M9NA 3CCMV 5B1AB 2R9IA 5E1AC 2P67A 5KA5A 1F51A 3TETA 1VQNV 4QIWF 3OUFA 3MD0A 2XAHA 1VQ5V 1PNMA 1Q81W 1YHQV 3E35A 3LUTB 2H8PC 4JPRA 1R3KC 4EKWA 3CCSV 4QNHB 5J9PC 2OTJV 2Q6AA 3RW0A 1F23A 2QTOA 1NR1A 1Y4MA 1BMFG 1JPXA 5L3FA 1YTFD 4HAMA 3E8BA 3ZRXA 3CCRV 1G4YB 2Y69C 1DF4A 5H9CA 2JJ1G 1UJWB 1YJNV 3SYAA 1QBZA 1M56B 1WPXA 3R65A 1R3LC 3ASOB 4FPPA 4G2KA 4GX2A 1S5HC 1F4MA 5HFLA 4BAYA 3MHHC 4JYBA 4GT1A 2XOKG 3RBZA 4DO2A 5L3BA 2JEUA 2ZXWB 4MTOA 1VQLV 3ZMZA 3CCVV 2WWWA 3EFFK 2QEXV 2JEXA 2X6BA 3ML0A 3K08A 3OE7G 2Q67A 4H33A 5IDJA 2F43G 2EILC 5IYDO 4MTXA 1SERA 4KUMA 1JVMA 3W7SA 5DM6V 3AG1B 1MG1A 3ZRWA 2HKOA 3OUSA 3E8FA 1V54C 1K92A 1PL0A 2PI5A 2GSMB 3OW2U 1Y66A 3LNMB 4Z1MG 1BL8A 3K0DA 4GX5A 1KP2A 2A0LA 3TK1A 4PA9A 1YJ9V 1S0VA 3DGEA 4UXNA 1QCEA 3CP1A 3M99B 1GMGA 2NLJC 1PD3A 3AEIA 4FK5C 1RPRA 3FB6C 5EBWC 1OCZB 1ORQC 3E83A 2JK5C 3GB7C 3AG3B 1YJWV 3HPLC 3PJSK 4LC1A 3P32A 4MS2A 2FTKA 2EIMC 3AG1C 4U7NA 5CBGA 2EIJB 4WCEV 4KFMA 3ASNC 1QLEB 2EJRA 1OCRC 1WLEA 2LP7A 4LCUC 2H94A 2DYSC 5BZBA 5KA6A 2Z3YA 3ABLC 1GM8A 3JD3A 3ABMC 1KC8W 4GX0A 2WLNA 4XDJA 3CCUV 4MVRA 3W7TA 1CPYA 3BEHA 1FFTB 1NQTA 1NBMG 1P4RA 4WFHA 1K7DA 5FL7G 1RPOA 2HVJC 3ABKB 3OAAG 4PA6A 4JAUA 1GO3F 1EBOA 1V55B 2XAQA 3CCLV 2XNDG 5DN6G 2B1GA 2B5UA 1THZA 3AG4C 4PDMA 2ZQMA 1E1QG 2IW5A 1YSCA 3E8GA 3K79A 4ZKIA 2BOBC 4FIPC 4HYOA 1VQ6V 5IYBO 1CEZA 2KB1A 3QO7A 3KG2A 4UVCA 1VQ4V 3H01A 2Z5UA 2W6IG 3ZMTA 1K8AW 2WLMA 5B1AC 2K1EA 5IY5B 3ZMVA 4MVMA 2X7RB 4F4LA 1DF5A 1K5QA 4XDLA 2X0LA 1I5YA 2WLLB 1NH2D 5CN0A 3JYCA 1KP3A 4KP4A 2DQ3A 2IH1C 5LHHA 1K4CC 1NR7A 4U7OA 3JD4A 4I5SA 2WLLA 2WLKA 2XAGA 2XAFA 5L3CA 3ETDA 5B3SC 3OMNB 2ITCC 2A79B 1R3JC 4MT8A 2EIMB 4JAVA 2WLIA 4MVSA 2EIJC 4R6ZA 4R8CA 4DXWA 2V7QG 3K0GA 4LP8A 3FYEB 4I9WA 4RQEA 5IY5C 3NXSA 3QO8A 2WPDG 2GHYA 1VQOV 1KQSU 3E2EA 1M57B 2EZPA 4J9YB 1K4DC 4ASUG 2JDIG 4P2ZA 3W7XA 2EBOA 1OCCB 4L87A 5H6QA 3SYPA 2PI4A 1FS0G 1K3EA 3ASNB 3FYIB 2ZD9A 1OCOC 2IH3C 1EFRG 3E8HA 4WFEA 2EINB 1AJPA 3B8MA 2R9RB 3STZC 4GX1A 2IJKA 1AR1B 4UVAA 3OR7C 3ZRSA 2C2AA 1PKXA 2EINC 4JF3A 3FB7C 4PA7A 1NVPB 5LGUA 1IXMA 2V1DA 1OHHG 3CC2V 3ZMUA 5EBLC 2LFSA 3FB8C 3QNEA 5LGTA 3UM7A 3RVYA 5EK0A 3ETEA 1GK9A 4MTFA 5EC2C 1OCCC 1R73A 5L3EA 4N21A 4R50A 1VQ7V 1Q86W 1FXKA 4MVZA 3P30A 3SPHA 3A0RA 1FXKC 1V54B 5GW7A 1H38A 1FXKB 2AHZA 3CMEV 1GM7A 4HZ3A 1VQKV 2HR3A 3EHBB 2YSUB 4JGSA 4XBFA 2LFRA 4BW5A 3ABMB 4RUFA 4RO2A 2YEVB 4X89A 3T1CA 2QA4V 4WFFA 3ZJZA 1GKFA 3I55V 5IYCO 3LDEA 1YITV 3IFXA 3CCEV 1M57C 4QPJA 3F5WC 2P90A 4PDLA 4UV9A 2AHYA 4UVBA 3ZIAG 1M56C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KUM A;  4MVM A;  4RUE A;  3SYQ A;  3LDC A;  2DWE C;  4MVU A;  3E8B A;  4MVO A;  4F4L A;  3K06 A;  4JTD B;  1G4Y B;  2Y69 C;  2OCC C;  3AG3 C;  4XDL A;  3SYA A;  3T2M A;  2WLL B;  3R65 A;  1R3L C;  4GX2 A;  3JYC A;  1S5H C;  3AG2 C;  2BOC C;  3IGA C;  4UUJ C;  3RBZ A;  2X6C A;  4G28 B;  4MTO A;  3RVZ A;  3OR6 C;  2IH1 C;  1K4C C;  2WLJ A;  3EFF K;  2X6B A;  2WLL A;  2WLK A;  1XL4 A;  3K08 A;  2HVK C;  4H33 A;  2Q67 A;  5EBM C;  5B3S C;  2ITC C;  2A79 B;  1R3J C;  2EIL C;  4MVQ A;  3F7V C;  4R7C A;  4X88 A;  2P7T C;  2WLI A;  4WFG A;  1JVM A;  2ATK C;  4MVS A;  3ASO C;  5KUK A;  2EIJ C;  4R6Z A;  4R8C A;  4DXW A;  3K0G A;  3OGC C;  4LP8 A;  2WLI B;  3OUS A;  3E8F A;  3FB5 C;  1V55 C;  4I9W A;  1V54 C;  5IY5 C;  3LNM B;  1BL8 A;  2X6A A;  3K0D A;  1LNQ A;  3T4D A;  4J9Y B;  1K4D C;  4GX5 A;  4QE9 A;  3SPC A;  2A0L A;  3E86 A;  2HFE C;  4P2Z A;  4P30 A;  3SYC A;  2YEV A;  3WG7 C;  1J95 A;  2EIK C;  4PA9 A;  4P9O A;  3TCU A;  5CBF A;  1QLE C;  3F7Y C;  3SYP A;  2NLJ C;  3LDD A;  4ZBM A;  2HG5 C;  2W0F C;  3SPI A;  4LBE C;  3SJQ C;  2ZD9 A;  3FB6 C;  4P9P A;  4TWK A;  5EBW C;  3VOU A;  1ORQ C;  5CBH A;  4PA4 A;  1OCO C;  5B1B C;  2IH3 C;  3E83 A;  2JK5 C;  3E8H A;  3GB7 C;  4WFE A;  2R9R B;  3STZ C;  4GX1 A;  4XDK A;  3HPL C;  3OR7 C;  3PJS K;  1OCZ C;  3ABK C;  4MS2 A;  4MW3 A;  3ZRS A;  2EIN C;  2EIM C;  3FB7 C;  4PA7 A;  3SPG A;  4CBC A;  3AG1 C;  5CBG A;  4JTC B;  4KFM A;  3ASN C;  4PDV A;  2Q68 A;  4X8A A;  1OCR C;  4LCU C;  3UKM A;  4PDR A;  2QKS A;  5EBL C;  3FB8 C;  2DYS C;  4OXS A;  3X2Q C;  5BZB A;  3UM7 A;  3RVY A;  5EK0 A;  3ABL C;  2Q69 A;  3E89 A;  3K03 A;  4MTF A;  3SYO A;  3ABM C;  2HJF C;  5EC2 C;  1OCC C;  4R50 A;  2ITD C;  5EC1 C;  4GX0 A;  2WLN A;  4XDJ A;  2DYR C;  4MVR A;  4RAI A;  4MVZ A;  4MW8 A;  1KKD A;  4QE7 A;  3SPH A;  4PA3 A;  3BEH A;  4MTG A;  4H37 A;  2WLH A;  1P7B A;  4MSW C;  4WFH A;  2DWD C;  1XL6 A;  2HVJ C;  3T4Z A;  2AHZ A;  4PA6 A;  1ZWI C;  4HZ3 A;  4J9Z B;  2A9H A;  4JTA B;  5E1A C;  3K04 A;  3SPJ A;  3TET A;  3OUF A;  4BW5 A;  4RUF A;  4RO2 A;  1R3I C;  4X89 A;  3AG4 C;  3T1C A;  4PDM A;  3E8G A;  4WFF A;  3ZJZ A;  2BOB C;  4HYO A;  3LUT B;  2H8P C;  3LDE A;  1R3K C;  3IFX A;  2KB1 A;  2ZXW C;  3KG2 A;  4EKW A;  1M57 C;  4G27 B;  3F5W C;  4QNH B;  5J9P C;  2WLM A;  2Q6A A;  4PDL A;  2AHY A;  5B1A C;  3RW0 A;  3STL C;  2K1E A;  1M56 C;  2QTO A; 
#chains in the Genus database with same CATH topology
 5FPR A;  4B08 A;  2W6J G;  4YJ3 B;  3SR2 C;  2OCC C;  1MA1 A;  2YI8 A;  3L75 H;  3T1Y O;  2P6J A;  2CDY A;  2BOC C;  3IGA C;  1K97 A;  2N74 A;  2HVK C;  3IC7 A;  3K5L A;  2DYS B;  1O9G A;  3LSU A;  5FNV B;  3ZHR A;  5KHK A;  1ZSP A;  2ATK C;  2IM9 A;  1G8M A;  3FB5 C;  4JI4 B;  2MW2 B;  1W59 A;  1JQ0 A;  1QVF U;  3QO5 A;  1PL4 A;  3G80 A;  4ZHQ A;  2YEV A;  4TOI A;  1J95 A;  3TCU A;  4H0L B;  4QJF B;  1FJG B;  1M4U A;  4IYH A;  1M90 W;  5EZY A;  2W0X A;  4ABM A;  4EB6 A;  1SZT A;  2NNU A;  3LDD A;  1AB3 A;  3CXC U;  4JYC A;  3SJQ C;  3G4S V;  4TWK A;  3VOU A;  1P7G A;  1X4T A;  4OPA A;  3UT5 A;  4UCU A;  1H8H G;  5JJN B;  4MW3 A;  4DV3 O;  1J5E O;  3DSQ A;  3CYO A;  4RQF A;  1IVS A;  4EEQ A;  3G71 V;  1VP7 A;  2P5O A;  2Q69 A;  4JI6 O;  3UCS C;  2LGW A;  4TT3 G;  4JI6 B;  1I08 A;  4BW9 A;  1ZWI C;  2ZR3 A;  2M7W A;  4IYI A;  4JTA B;  1R6K A;  3SPJ A;  4X1I B;  3M8A A;  4AI8 A;  1N32 O;  5LYJ A;  4DK0 A;  4JI5 B;  1VIB A;  3B4S A;  1VQ9 V;  1I5X A;  5L3G A;  4JI5 O;  3L72 H;  1JMK C;  4I0X B;  4X66 B;  2IJI A;  4MVU A;  4JTD B;  5B1B B;  2YIC A;  4PEL A;  2D2C B;  3RN4 A;  2ODM A;  1KD1 W;  1JJ2 U;  4G28 B;  2EIK B;  3U10 A;  5JQG A;  4PJ0 Z;  3WFV A;  1ROP A;  1PNL A;  1Q8I A;  4PD4 F;  3CHX A;  1TAE A;  3A0B Z;  5B1O A;  5H6R A;  2X6A A;  3ZBH A;  4NTX A;  1G6U A;  1YI2 V;  1Y74 A;  1KB9 F;  1N34 O;  2UXN A;  3AG4 B;  5KLV H;  5KX5 B;  1SKV A;  2BTO A;  3JD2 A;  4P9P A;  2RQ6 A;  1V9P A;  3GWO A;  5K1P A;  4LR3 A;  1H2N A;  2EUL A;  3ZCC A;  4HNA B;  1JCH A;  3L73 H;  3CPW U;  2UXX A;  1NVP D;  1QU7 A;  2YXY A;  1O9H A;  5B3S B;  1YTF B;  3RT3 C;  1S5L Z;  2CAZ C;  1KBH A;  1BT8 A;  1GN4 A;  1NTM H;  3RYF A;  1TUE B;  4K8X A;  1IBL O;  5E1A C;  5KA5 A;  5CA1 A;  1F51 A;  3TET A;  4ZOL B;  1SQB H;  4FZ0 A;  5LMU B;  2BTQ B;  1YHQ V;  4LH6 A;  4UB8 Z;  2LGQ A;  3E35 A;  3LUT B;  4JPR A;  1R3K C;  2R72 A;  4QNH B;  2OTJ V;  4DV6 B;  1FFX B;  1SQV H;  1BMF G;  3E8B A;  4DR4 O;  5J2T A;  1NZ6 A;  5H9C A;  1UJW B;  1QBZ A;  1M56 B;  4GX2 A;  3R65 A;  1R3L C;  4G2K A;  4LFA O;  1S5H C;  4DO2 A;  4DR7 B;  4LF6 O;  1CXZ B;  4MTO A;  1NI8 A;  4B3S B;  4LNU A;  1FKA O;  2WWW A;  3ETQ A;  4AIL C;  5CA0 A;  5LMN B;  2X6B A;  4DR5 O;  3ML0 A;  4ICG A;  1X59 A;  3OE7 G;  2Q67 A;  3TXS A;  1SER A;  1I0H A;  4MTX A;  4O4H A;  3N2G B;  2V4D A;  2B9Z A;  4L8J A;  3OUS A;  1V54 C;  1Z5W A;  1PL0 A;  4BR6 A;  4FZ1 A;  2YIA A;  1IX9 A;  3JAS B;  5GON A;  3VQV A;  2PY5 A;  2YUA A;  4J80 A;  2A0L A;  3APQ A;  1YJ9 V;  1SF9 A;  1S0V A;  1QCE A;  3M99 B;  1GN6 A;  3AEI A;  1VF6 A;  3FB6 C;  2ZIO A;  2FML A;  3GB7 C;  2L6L A;  3P32 A;  5GON B;  3RYC A;  1QNM A;  4WBN A;  2HP8 A;  1KKC A;  4LF9 B;  2EX3 A;  4LCU C;  2H94 A;  3ABL C;  3JD3 A;  5IYZ B;  4JI3 B;  1SC5 B;  2LJ2 A;  4FFB B;  1RFY A;  5IE9 A;  4X1Y A;  1HR0 O;  5LOV B;  2K9P A;  1D5A A;  4BIO A;  4WFH A;  5FL7 G;  3VQW A;  3ABK B;  3OAA G;  4PA6 A;  1GO3 F;  1EBO A;  2XAQ A;  5J2T B;  2XND G;  5DN6 G;  2B1G A;  4K8Z A;  2P4V A;  3SJA C;  1FFX A;  3CRQ A;  2ZQM A;  2IW5 A;  2YID A;  2BOB C;  4FIP C;  4HYO A;  5IYB O;  4JZG A;  1CEZ A;  1IXB A;  4J7K A;  1DK1 A;  5CA0 B;  3M7M X;  2Z5U A;  5IY5 B;  4LF5 B;  4AQY B;  2X7R B;  4TQD A;  4F4L A;  2QWR B;  3RWR D;  2UU9 B;  1I5Y A;  3CJH A;  2WLL B;  4ZI7 B;  1NH2 D;  5JH7 B;  2E5L O;  2P06 A;  3JAK B;  1K4C C;  2E74 B;  1H2S B;  5KMG B;  3ETD A;  2BE3 A;  2ITC C;  4MVS A;  1RP3 B;  4DXW A;  2V7Q G;  4LP8 A;  3FYE B;  4LFB O;  3NXS A;  3K5M A;  4DR5 B;  2PUS A;  1XQ8 A;  4IL6 Z;  3W7X A;  3KCY A;  2UUC B;  1IDS A;  4FM2 A;  3JAL A;  2IH3 C;  1WJZ A;  2OIG A;  3B8M A;  5A9G A;  1Y6X A;  4UVA A;  2AXT Z;  2C2A A;  3FB7 C;  3A8T A;  2V1D A;  3HKE B;  5LGT A;  3RVY A;  5EK0 A;  3RGB A;  3OTO O;  2RN9 A;  1R73 A;  1FXK A;  3OTO B;  3SPH A;  5BXZ A;  2QWN B;  1V54 B;  5GW7 A;  4LF9 O;  1H38 A;  3EHB B;  1MMM A;  2ZM6 B;  1Q6I A;  3ABM B;  2FB5 A;  2DN9 A;  4RO2 A;  2QA4 V;  1Y67 A;  3BA8 A;  3ZJZ A;  1XMQ O;  4UCV A;  3I55 V;  4DUY O;  5IYC O;  2JGD B;  3H1K H;  1XUQ A;  2GTS A;  4A5U B;  3ZIA G;  1WAZ A;  4IGG A;  4LF7 B;  4RUE A;  5CB4 B;  4H13 B;  5CMU A;  1EN6 A;  5H2F Z;  4LF7 O;  1FXH A;  1W0K G;  3H1L H;  3CXH F;  4UUJ C;  3G6E V;  2X6C A;  3RVZ A;  2LO1 A;  2OTL V;  4LF5 O;  1TVK A;  1WNS A;  4MVQ A;  4R7C A;  2ZIN A;  1L1F A;  4GKK O;  4DV7 B;  3ASO C;  5KUK A;  2WLI B;  3B77 A;  1P49 A;  3QTC A;  2WAM A;  4CH4 A;  1BCC H;  3MHS C;  4O2A A;  1GH6 A;  3UT5 B;  4JAS A;  2ETN A;  1AI6 A;  3OT7 A;  1RM1 C;  4NB5 A;  5JCO A;  2HLD G;  3WG7 B;  2HG5 C;  2W0F C;  3D8C A;  3SPI A;  1YEW A;  1JOY A;  4J7Z A;  2Y69 B;  1MAB G;  2N04 A;  1OV9 A;  3CRR A;  1AI5 A;  1FXV A;  1VF5 B;  2A7W A;  3TGU H;  4X8A A;  2WSS G;  2PZS A;  3Q4H B;  4OXS A;  1ZL8 B;  1SA0 B;  3LSS A;  3SYO A;  3E89 A;  1QVG U;  2HJF C;  4U3F H;  2ZCE A;  5LP6 B;  2ITD C;  4YXW G;  4RAI A;  1KMI Z;  4MW8 A;  5D5Q A;  3HKC B;  4JV5 B;  4O4I B;  1VEW A;  1P7B A;  4MSW C;  2A3Q A;  3HKD B;  4EFE A;  1XL6 A;  2AZ2 A;  5GTH Z;  3VBB A;  4UB6 Z;  2IBZ H;  1XHZ A;  3G67 A;  5LXT A;  2ZXW C;  1YIJ V;  2QDO A;  1QR8 A;  3OR6 C;  2B1I A;  2OCH A;  4DV4 B;  3L9D A;  4DR6 O;  5C93 A;  3AG3 C;  2E3C A;  5KX5 A;  1CP9 A;  1Q82 W;  3I56 V;  1PPJ H;  2MK3 A;  3E22 A;  1K5S A;  3W7W A;  2ZIM A;  4HBN A;  3CRC A;  1YCI A;  4CZZ A;  3ABL B;  1XL4 A;  4TUY B;  3O65 A;  1ENV A;  4LH7 A;  2OT5 A;  2Q9L A;  3ZRW B;  1GAX A;  4Q6G A;  4DV5 O;  2M6Y A;  5JJE B;  1VAR A;  1VQP V;  3GWK C;  1COW G;  5LGN A;  1H2M A;  5CA3 A;  2CUG A;  1NH2 B;  1LNQ A;  5TIS Z;  3CD6 V;  4DV7 O;  3ETG A;  3D36 A;  3D3Q A;  1EN5 A;  1AI7 A;  3F7Y C;  1GN2 A;  2CK3 G;  3OM3 B;  3CC4 V;  1IZ3 A;  4DR3 O;  1XHX A;  4FMT A;  5HFM A;  1XNR O;  4XDK A;  1OCZ C;  4FLZ A;  4FLX A;  5LL6 Y;  2YIB A;  1AI4 A;  1XNR B;  3C3T A;  1TUB A;  4JI0 B;  3Q4H A;  3X2Q C;  2Q7H A;  1RSO A;  1MNG A;  3AK2 A;  1OCR B;  4JZ2 A;  2AW9 A;  2EZO A;  2ZDI A;  2O57 A;  2QJ1 A;  4OX9 O;  3DXR A;  1W2B U;  1M93 A;  3T1H B;  5IJ9 B;  5B66 Z;  1VQN V;  1H2K A;  1YF2 A;  1XMQ B;  4JI3 O;  1SS3 A;  2JS3 A;  4J42 A;  3N2G A;  1PNM A;  1Q81 W;  2GUZ B;  4O2A B;  2ILM A;  4OGQ B;  2LW1 A;  4EKW A;  2GUZ A;  2ZE5 A;  3VQX A;  1NR1 A;  2KKW A;  1I94 O;  2Q5Z A;  4FVM A;  5IWA O;  3IAY A;  4GLX A;  2Y69 C;  2JJ1 G;  1YJN V;  3H9V A;  4CH3 A;  4FPP A;  3QVN A;  1FD9 A;  5IWA B;  5HFL A;  4BAY A;  3RBZ A;  3ZHU A;  2JEU A;  2ZXW B;  3CCV V;  3B40 A;  3EFF K;  2AZ0 A;  5IDJ A;  2F43 G;  4FLW A;  5IYD O;  2UXC O;  4KUM A;  1JVM A;  2HKO A;  3E8F A;  1K92 A;  3G6B A;  3ZHS A;  2L35 A;  2PI5 A;  4Z1M G;  3LNM B;  2UUB O;  2UXD O;  4B3R O;  4GX5 A;  4FM1 A;  4O4I A;  2UUB B;  3UQ8 A;  3TK1 A;  2CGN A;  4PA9 A;  2QM4 A;  1B06 A;  4UXN A;  4DV5 B;  1L0N H;  2NLJ C;  1PD3 A;  3OGI B;  4FK5 C;  1N0N A;  1RPR A;  5EBW C;  3MDS A;  1OCZ B;  3K5N A;  4DRX B;  1U96 A;  4CS2 A;  2EIM C;  3AG1 C;  5CBG A;  2EIJ B;  3ASN C;  1IBK B;  1WLE A;  1VMG A;  4DR3 B;  3A0H Z;  3ABM C;  4DV2 O;  4I50 A;  4IHJ A;  3CCU V;  4MVR A;  3W7T A;  4FLT A;  5F2V O;  1N36 O;  1Y74 B;  1K7D A;  3P3P A;  1RPO A;  2HVJ C;  4O2B A;  3CCL V;  5EZY B;  3SGI A;  4X9Q A;  4D6T H;  4UCO A;  3A2F A;  2F66 C;  4ZKI A;  2HEP A;  3E8G A;  5JQG B;  4DR7 O;  4UVC A;  2Q0O C;  3H01 A;  4B3M O;  4DV0 O;  5ITZ A;  1K8A W;  4J41 A;  5B1A C;  2K1E A;  3KZI Z;  2FKX A;  5C8Y B;  3L71 H;  1NTZ H;  1VF7 A;  4B3M B;  1K5Q A;  1ZAU A;  1I7F A;  3JAT B;  1OJH A;  5CB4 A;  1Z2G A;  5KMG A;  5CN0 A;  3JYC A;  4JI1 B;  2ZE8 A;  1KP3 A;  1HNZ B;  3AK3 A;  4LF8 O;  5LHH A;  1NR7 A;  4JI1 O;  4U7O A;  4I5S A;  3LNN A;  2WLL A;  4ZI7 A;  2XAG A;  2R9A A;  3JAS A;  2XAF A;  5L3C A;  3OMN B;  4NXN B;  1R3J C;  4LF8 B;  4MT8 A;  4YJ3 A;  1YZB A;  3FFQ A;  3QG5 A;  2EIJ C;  4R8C A;  2ZE7 A;  2Q7G A;  3WU2 Z;  4I9W A;  4RQE A;  3O9O A;  5IY5 C;  3H1I H;  1Q43 A;  2WPD G;  2YC0 A;  1HNX O;  1VQO V;  1KQS U;  5KAF Z;  1M57 B;  4KXR A;  2EZP A;  1K4D C;  4ASU G;  2JDI G;  1Y76 A;  4P2Z A;  2EBO A;  3H1J H;  3SYP A;  1K3E A;  5IJ9 A;  4GUN A;  1ZX3 A;  1OCO C;  4F6R B;  4WFE A;  5H5N A;  1ZTE A;  3L70 H;  1SQX H;  4O4J B;  3ZRS A;  1HNW O;  4PA7 A;  3BPZ A;  5LGU A;  2YS8 A;  3CC2 V;  3MAQ A;  1WA8 A;  3QNE A;  2DJV A;  5B5E Z;  4I55 A;  4NYK A;  5EC2 C;  2AGA A;  3JSL A;  2PYL A;  1XDC A;  1VQ7 V;  5IT9 N;  2F4V O;  1XIL A;  4UCT A;  1FXK C;  1QQC A;  2AHZ A;  3CME V;  1GM7 A;  1LUV A;  2HR3 A;  2Y4T A;  4DR2 B;  4XBF A;  1Q3E A;  1IBL B;  5ITZ B;  5BMV A;  2UXB O;  2KG7 A;  3APO A;  2ARH A;  1I94 B;  3F5W C;  3SJB C;  2P90 A;  4UVB A;  5KUM A;  3SYQ A;  3CJH B;  1BS3 A;  4PV1 B;  4JI2 B;  3JAR A;  2ZE6 A;  2JJ2 G;  2JRI A;  4JI2 O;  3AG2 C;  2EIL B;  1K33 A;  3HB3 B;  5EYP A;  3CC7 V;  1B6Q A;  1SRY A;  4DV1 O;  4I9Q A;  3K59 A;  4DR6 B;  3OEH G;  1K73 W;  3N2K A;  1H2L A;  1S3J A;  4WFG A;  4E4E A;  1PM9 A;  4JI4 O;  4IIJ B;  3OGC C;  1HNZ O;  1BHB A;  3WB1 A;  2DW4 A;  1K34 A;  2KG7 B;  3EXA A;  4QE9 A;  3ABU A;  1AIL A;  2P4K A;  5EYP B;  2HFE C;  4P30 A;  3SYC A;  1LUW A;  4P9O A;  3ZS8 C;  3JD0 A;  4TSF G;  2Q73 A;  4ZOL A;  4GKJ B;  4ZBM A;  5E79 Z;  4YIO A;  4LBE C;  2LQT A;  1URF A;  4DV3 B;  5B1B C;  3BY6 A;  4WF9 V;  1XI1 A;  3OEE G;  4I7Z B;  4KL1 A;  3OMA B;  1QHT A;  1MOF A;  1GRJ A;  5KHH A;  1WPB A;  2UUA O;  5LBQ A;  1M1K W;  2D3O W;  3CCQ V;  2VQF B;  1SA0 A;  1WA8 B;  2QKS A;  1J5E B;  1EN4 A;  1PNK A;  1GM9 A;  2JIZ G;  1SET A;  2DYR C;  2XHB A;  2DQ0 A;  1JX9 A;  4F6E A;  3CRM A;  2WLH A;  3CCJ V;  1NT2 B;  4GCZ A;  2A9H A;  2R70 A;  1ZUQ A;  1Q6U A;  2ZNJ A;  4GYC B;  1MSW D;  1R3I C;  2IU0 A;  1N8R W;  3T1H O;  4G27 B;  1BHA A;  4B3S O;  3STL C;  4DR2 O;  1DTO A;  5FLX N;  1MZF A;  3LDC A;  2DWE C;  3K06 A;  3JCU Z;  4GKK B;  4U3J B;  4UV8 A;  3JAW B;  3K9S A;  2ZR2 A;  4KHP B;  2Q7E A;  2PGG A;  1VF6 C;  4QPK A;  5JVD A;  1HDJ A;  3JAT A;  3FX7 A;  3K3W A;  2GV9 A;  2BSK A;  4X88 A;  1H2G A;  1S72 V;  3T1Y B;  3K9A A;  1M5I A;  2BCC H;  1HNX B;  4I0X A;  1TUB B;  1Q6H A;  4WBN B;  3OD4 A;  3JD1 A;  3RYC B;  1AJQ A;  3BA9 A;  4FJC C;  5LA6 A;  3HKD A;  1W0J G;  2CH7 B;  5GTI Z;  1AP6 A;  1QR9 A;  3E86 A;  5JJJ B;  2IJH A;  3WG7 C;  2EIK C;  3ABT A;  4NR1 A;  5CBF A;  4J10 A;  5LP6 A;  4X20 A;  2XAJ A;  3D3I A;  4LFC O;  3CS5 A;  1ZL8 A;  5C8Y A;  4J7J A;  4B3R B;  2UXD B;  1EZV H;  5CBH A;  4LWS B;  4PA4 A;  2VQE B;  2QM7 A;  1YXB A;  2OCC B;  4DYL A;  3ABK C;  4UFZ A;  3AK1 A;  3SPG A;  4CBC A;  1NKD A;  3B8N A;  5L3D A;  4LF4 B;  1N4C A;  1WB7 A;  3K03 A;  3BRC A;  4TUY A;  5EC1 C;  1KEC A;  4X1K B;  4E2L A;  1KKD A;  4QE7 A;  1EM1 A;  3J80 N;  2UUA B;  4MTG A;  4H37 A;  1GN3 A;  5KHG A;  1NJI W;  1M9N A;  1BQ0 A;  3HKB A;  3C3S A;  2ZNI A;  5LMU O;  1PP9 H;  1NU1 H;  3JAR B;  3OUF A;  3MD0 A;  2XT9 A;  2CTP A;  2XAH A;  1VQ5 V;  4FM0 A;  3J7A U;  2F23 A;  3CCS V;  5J9P C;  3RW0 A;  1F23 A;  5L3F A;  1MZE A;  1YTF D;  4HAM A;  3IJ4 A;  3ZRX A;  3CCR V;  3FAV B;  3SYA A;  3CB2 A;  3MHH C;  2XOK G;  2CH7 A;  2CGO A;  3ZMZ A;  3N27 A;  2JGD A;  2Y0P A;  1R1B A;  1Z5V A;  4I55 B;  2EIL C;  4NXM O;  3DC5 A;  3AG1 B;  1MG1 A;  4X1I A;  1XOU A;  2NR5 A;  1Y66 A;  1BL8 A;  4RWU A;  4OPH A;  2Z0A A;  1KP2 A;  3DGE A;  3CP1 A;  1GMG A;  1ORQ C;  3E83 A;  2JK5 C;  1N34 B;  1YJW V;  3HPL C;  4IT5 A;  3ZHQ A;  4U7N A;  3D36 C;  4O4L A;  3WB0 A;  4C7U A;  1OCR C;  4LFC B;  2LP7 A;  4CS3 A;  2DYS C;  3CE2 A;  1KC8 W;  1TVK B;  2QR4 A;  4GX0 A;  1HNW B;  4XDJ A;  4DUZ O;  3IC9 A;  1A32 A;  1TA8 A;  1CPY A;  3BEH A;  4B7E A;  1NBM G;  1P4R A;  4X65 B;  3BAB A;  1SQP H;  3P3N A;  1V55 B;  1BE3 H;  3FAV A;  2NN4 A;  3ICX A;  1JA8 A;  2B5U A;  2LW7 A;  1THZ A;  1L8D A;  4PDM A;  1YSC A;  5FNV A;  2KB1 A;  2CTQ A;  4DR1 B;  3KG2 A;  3U11 A;  2W6I G;  3ZHV A;  5A2Q N;  3ZMV A;  3B2E E;  2PTM A;  4D7S A;  1DF5 A;  3FD9 A;  4O4H B;  2X0L A;  1BSM A;  2UXB B;  4DV4 O;  2Q4P A;  4X62 O;  2GDS A;  2QWP B;  2IH1 C;  1BZK A;  3JD4 A;  2WLK A;  1JFF B;  4I50 B;  4JI8 B;  4DR4 B;  2EIM B;  4JAV A;  2Y0I A;  3K0G A;  3HKE A;  4YHH B;  3ZX6 A;  4JYY A;  1AR5 A;  4NVP A;  4FFK A;  1LR1 A;  3JAL B;  1MSD A;  2QSA A;  3BCC H;  4L87 A;  4NTY A;  5IYZ A;  3UO3 A;  4K3A A;  5H6Q A;  2A06 H;  4EB6 B;  4B3T B;  2UUC O;  3ASN B;  3FYI B;  2ZD9 A;  2OWO A;  1BGY H;  2Y4U A;  4FLU A;  1AR1 B;  3STZ C;  1JJO A;  2R9R B;  3HKC A;  3OR7 C;  1PKX A;  2EIN C;  5J2U B;  1NVP B;  1TGO A;  1U97 A;  1IXM A;  1OHH G;  2HHH B;  3ZMU A;  5EBL C;  2LFS A;  3UM7 A;  2H3O A;  4MTF A;  5L3E A;  1OCC C;  4N21 A;  5J2U A;  1Q86 W;  1XNQ O;  5D5P A;  3A0R A;  4CH6 A;  1NTK H;  4W4L A;  4PI2 A;  5BR8 B;  3JAK A;  2CTR A;  4GZR B;  4JAA A;  1ZLZ A;  1VQK V;  1SZX A;  5BR8 O;  4JGS A;  4BW5 A;  4DK1 A;  2DOS A;  3T1C A;  4JI7 B;  4DUZ B;  1HR0 B;  2OIE A;  2BSK B;  4WFF A;  2ZKO A;  1GKF A;  1YIT V;  3CCE V;  1M57 C;  4QPJ A;  4PDL A;  4UV9 A;  2F95 B;  5LHG A;  3CRA A;  3CMA V;  3OFN G;  2Y48 A;  1JFF A;  3T2M A;  1T5E A;  1S76 D;  1IUR A;  2WLJ A;  4NXM B;  1RM1 B;  2BTQ A;  2P7T C;  1RSO B;  2IJJ A;  3NR7 A;  2E5L B;  2UXC B;  1D5N A;  1S77 D;  4WFB V;  3RYF B;  1OZ0 A;  4ZIB A;  4JI8 O;  2CE4 A;  2DYR B;  2VRZ A;  1F4N A;  4WFA V;  3BFR A;  4NTW A;  4YHH O;  2VWJ A;  1E79 G;  3X2Q B;  3QF7 A;  1Q90 D;  1AJN A;  4BIZ A;  3JAM N;  2YIB D;  4CC5 A;  1UPG A;  1US6 A;  5EIB C;  2GBO A;  3ZMS A;  3K57 A;  4I4T A;  2E75 B;  2KSD A;  4OX9 B;  3TJT A;  1QLN A;  4B3T O;  3LSQ A;  3DTU B;  4O4L B;  1K9M W;  3ZHT A;  1Q7Y W;  3AG2 B;  3KCX A;  4DW0 A;  1DGS A;  3JSN A;  4DV2 B;  5DEC A;  5IJ0 B;  3E22 B;  1F7Y A;  1HWY A;  4LF4 O;  2DWD C;  3T4Z A;  3OMI B;  3BAA A;  3RYI B;  1IBM O;  4IHJ B;  4J9Z B;  1N36 B;  2YXL A;  3K04 A;  4Z2W A;  3ZN1 A;  1GTO A;  1AP5 A;  1XNQ B;  1N33 O;  2GTA A;  3N2K B;  4ZHQ B;  4K35 A;  3BHP A;  1KUQ A;  1G1X B;  1P84 F;  1FPO A;  4H44 B;  1R6T A;  3JCZ A;  4Q20 A;  2IU3 A;  4LWS A;  3SPC A;  2ZM6 O;  2Q8V A;  2PYJ A;  2CTW A;  4CH5 A;  4BIU A;  1OCO B;  4MVO A;  5LHI A;  3TXQ A;  3W7U A;  5CA1 B;  4X62 B;  2N05 A;  4QGP A;  2P22 C;  2ZDI C;  1VQ8 V;  2XAS A;  4YY3 O;  1ARO P;  3ZN0 A;  4YJ2 B;  5JH7 A;  4FLV A;  1SQF A;  1SQQ H;  5FPO A;  1EZJ A;  5EBM C;  2RCV A;  3H1H H;  4LFB B;  4EFB A;  3F7V C;  4AHC A;  2ADP A;  2JS5 A;  2QE7 G;  4B7K A;  4LFA B;  3ZRV A;  1V55 C;  4NXN O;  3S3W A;  4LF6 B;  1HP8 A;  5LMN O;  2F93 B;  4O4J A;  3T4D A;  1B04 A;  1SES A;  1YDX A;  2QM8 A;  3S3X A;  3CX5 F;  4U3J A;  1QLE C;  3BVO A;  3HKB B;  4TQF A;  1AVM A;  5AG2 A;  4CS4 A;  4K0K O;  4X1Y B;  4N23 A;  1DLB A;  2FL4 A;  3FKS G;  4JTC B;  2FYU H;  1UFI A;  2KQX A;  3C90 A;  4PDV A;  2Q68 A;  2YXH A;  3UKM A;  4PDR A;  1H8E G;  2OYQ A;  1WN7 A;  1VQM V;  2JGU A;  1E1R G;  4JI0 O;  5B1N A;  1HW7 A;  1R6N A;  1Y76 B;  4PA3 A;  5LOV A;  4FFB A;  3CCM V;  5B1A B;  2Q0A A;  2R9I A;  4JI7 O;  4X64 O;  4TV8 B;  2P67 A;  4QIW F;  4X66 O;  2JVD A;  1D2D A;  3DC6 A;  1XMO B;  4X64 B;  5K1X A;  2H8P C;  1XMO O;  5LA6 B;  1FAF A;  4YJ2 A;  4KHP O;  2Q6A A;  3OTF A;  4JYA B;  2QTO A;  5BY1 A;  1Y4M A;  1Q5O A;  1JPX A;  1G4Y B;  1DF4 A;  4TV8 A;  4JYA O;  1WPX A;  4YIP A;  3ASO B;  5JVD B;  1WB8 A;  1F4M A;  2QGN A;  3RYH A;  4JYB A;  4GT1 A;  4LNU B;  5KHI A;  5L3B A;  5DED A;  1VQL V;  2QEX V;  2JEX A;  4AQY O;  3K08 A;  3PN1 A;  4H33 A;  1YVW A;  3R66 A;  3W7S A;  4BWA A;  2UU9 O;  5DM6 V;  3ZRW A;  2RDC A;  4O2B B;  2DE0 X;  2GSM B;  3OW2 U;  3K0D A;  3RYI A;  3K58 A;  2ADQ B;  4X1K A;  1KU9 A;  4D7T A;  2YDE A;  1KYO F;  1JR9 A;  1FYJ A;  1FJG O;  3B09 A;  1PV0 A;  3J81 N;  4GKJ O;  4I4T B;  3AG3 B;  3PJS K;  4LC1 A;  4MS2 A;  3U0Z A;  2FTK A;  2EJ7 A;  3F5T A;  5LP6 C;  4WCE V;  4KFM A;  4W4K A;  1QLE B;  2EJR A;  2VS0 A;  5KA6 A;  5BZB A;  2Z3Y A;  1GM8 A;  4X20 B;  2QKA A;  2WLN A;  3CWB H;  3HR0 A;  3KKY A;  4TV9 A;  1IBM B;  3CSX A;  4HNA A;  1FFT B;  1NQT A;  2HHH O;  4JAU A;  2VWK A;  4UCS A;  2QWO B;  1N33 B;  2HJD A;  3SJC C;  4DV6 O;  5KAI Z;  3I5D A;  1WP7 A;  2XUM A;  3AG4 C;  1E1Q G;  3THO A;  3K79 A;  4DV0 B;  1VQ6 V;  4PHZ A;  1N32 B;  2QWQ B;  1B3Q A;  1XBL A;  3QO7 A;  1VQ4 V;  3ZMT A;  2DMX A;  2WLM A;  4F6R A;  3JAW A;  4DV1 B;  4MVM A;  4YY3 B;  4XDL A;  4PI0 A;  3AG7 A;  4NKG B;  4DUY B;  1AR4 A;  3WB2 A;  2ZT9 B;  4KP4 A;  3EVK A;  5IJ0 A;  2DQ3 A;  4Z1V A;  5KHJ A;  2RJZ A;  2XTA A;  3RYH B;  3L74 H;  5B3S C;  2A79 B;  3CEI A;  2F1M A;  3ZED A;  2WLI A;  3VQY A;  4R6Z A;  2QTS A;  2YI9 A;  3QO8 A;  2GHY A;  1N0J A;  3E2E A;  3DXR B;  4J9Y B;  5LYJ B;  5BMV B;  5EIB D;  4TV9 B;  1OCC B;  3RFR A;  1BQZ A;  2RMK B;  4K0K B;  2PI4 A;  1FS0 G;  2VQF O;  2G38 A;  3K5O A;  1EFR G;  3E8H A;  2EIN B;  1AJP A;  4GX1 A;  2IJK A;  2PF4 E;  2VQE O;  4JF3 A;  3SDL A;  1L0L H;  2E76 B;  1S5J A;  4X65 O;  3FB8 C;  1XEQ A;  4UCR A;  3ETE A;  1GK9 A;  3UO2 A;  2WA3 A;  4R50 A;  4FLY A;  2QKC A;  4MVZ A;  3P30 A;  1NS1 A;  1IBK O;  1SQG A;  2WA4 A;  2F4V B;  4DR1 O;  1FXK B;  4CC6 A;  4HZ3 A;  2YSU B;  1WP8 A;  2LFR A;  4IIJ A;  3GVM A;  4RUF A;  2YEV B;  4X89 A;  4JV5 O;  4J11 A;  5JCO C;  3LDE A;  2RNB A;  3IFX A;  5LXT B;  1XRE A;  4DRX A;  4DW1 A;  2AHY A;  5JWP A;  1M56 C; 
#chains in the Genus database with same CATH homology
 5KUM A;  4RUE A;  3SYQ A;  5CMU A;  2W6J G;  5LHG A;  3CMA V;  3OFN G;  2OCC C;  2Y48 A;  2JJ2 G;  1FXH A;  1W0K G;  2P6J A;  3T2M A;  1S76 D;  3AG2 C;  2BOC C;  2EIL B;  3IGA C;  1K33 A;  3HB3 B;  4UUJ C;  3G6E V;  2X6C A;  1K97 A;  3RVZ A;  3CC7 V;  1B6Q A;  1SRY A;  2OTL V;  2WLJ A;  1RM1 B;  2HVK C;  3IC7 A;  2DYS B;  4MVQ A;  4R7C A;  3OEH G;  1K73 W;  1S3J A;  2P7T C;  4WFG A;  1L1F A;  2ATK C;  3ASO C;  5KUK A;  2IJJ A;  3OGC C;  2WLI B;  1G8M A;  3B77 A;  3FB5 C;  1BHB A;  2DW4 A;  2WAM A;  1K34 A;  1S77 D;  4WFB V;  4QE9 A;  3ABU A;  3MHS C;  1OZ0 A;  1JQ0 A;  1QVF U;  3QO5 A;  2HFE C;  2DYR B;  4P30 A;  3SYC A;  2YEV A;  4JAS A;  1J95 A;  4P9O A;  3TCU A;  4QJF B;  1AI6 A;  1F4N A;  4WFA V;  1M90 W;  3JD0 A;  1RM1 C;  4TSF G;  2HLD G;  1SZT A;  2NNU A;  1E79 G;  3LDD A;  4ZBM A;  2HG5 C;  2W0F C;  3WG7 B;  3X2Q B;  3CXC U;  3SPI A;  4LBE C;  1JOY A;  4JYC A;  3SJQ C;  3G4S V;  4TWK A;  2Y69 B;  3VOU A;  1MAB G;  5B1B C;  1AJN A;  4BIZ A;  3BY6 A;  4WF9 V;  1H8H G;  3OEE G;  1AI5 A;  1FXV A;  3OMA B;  4MW3 A;  1MOF A;  3ZMS A;  5LBQ A;  1M1K W;  2D3O W;  3CCQ V;  3CYO A;  1QLN A;  4RQF A;  4X8A A;  3LSQ A;  2QKS A;  2WSS G;  3G71 V;  4OXS A;  3DTU B;  3LSS A;  1K9M W;  1PNK A;  2Q69 A;  3E89 A;  1GM9 A;  2JIZ G;  3SYO A;  1QVG U;  1Q7Y W;  2HJF C;  3AG2 B;  2ITD C;  4YXW G;  1SET A;  2DYR C;  4RAI A;  2DQ0 A;  1JX9 A;  4MW8 A;  4TT3 G;  2WLH A;  1P7B A;  4MSW C;  1HWY A;  3CCJ V;  2DWD C;  1XL6 A;  3OMI B;  3T4Z A;  1ZWI C;  2ZR3 A;  4GCZ A;  4J9Z B;  2A9H A;  2M7W A;  4JTA B;  3VBB A;  3K04 A;  1R6K A;  3SPJ A;  3ZN1 A;  1GTO A;  1MSW D;  1R3I C;  2IU0 A;  4Q20 A;  1N8R W;  1VQ9 V;  3JCZ A;  2ZXW C;  4G27 B;  1I5X A;  1YIJ V;  1BHA A;  2IU3 A;  3STL C;  5L3G A;  3SPC A;  1QR8 A;  3OR6 C;  1DTO A;  2B1I A;  3LDC A;  2IJI A;  2DWE C;  4MVU A;  4BIU A;  1OCO B;  4MVO A;  3K06 A;  5LHI A;  4JTD B;  5C93 A;  3W7U A;  3AG3 C;  5B1B B;  2ZDI C;  1VQ8 V;  2XAS A;  1CP9 A;  1Q82 W;  4PEL A;  4UV8 A;  2MK3 A;  3I56 V;  1ARO P;  2ZR2 A;  1K5S A;  3W7W A;  1KD1 W;  1JJ2 U;  4G28 B;  3ZN0 A;  2EIK B;  4CZZ A;  4QPK A;  3ABL B;  1XL4 A;  1EZJ A;  3WFV A;  5EBM C;  3K3W A;  1ENV A;  1ROP A;  2OT5 A;  1PNL A;  3F7V C;  1H2G A;  4X88 A;  3ZRW B;  1S72 V;  3K9A A;  2QE7 G;  3ZRV A;  1V55 C;  1VQP V;  5B1O A;  1COW G;  5H6R A;  5LGN A;  3JD1 A;  2X6A A;  5CA3 A;  1AJQ A;  4FJC C;  1YI2 V;  1NH2 B;  1LNQ A;  1W0J G;  3T4D A;  1SES A;  1QR9 A;  3E86 A;  2QM8 A;  2IJH A;  3CD6 V;  3WG7 C;  2EIK C;  2UXN A;  3ABT A;  3AG4 B;  3ETG A;  5CBF A;  3D36 A;  1QLE C;  1AI7 A;  2XAJ A;  3D3I A;  3F7Y C;  2CK3 G;  3JD2 A;  3OM3 B;  3CC4 V;  4P9P A;  3GWO A;  4FMT A;  4PA4 A;  5CBH A;  5HFM A;  2QM7 A;  2OCC B;  4XDK A;  3ZCC A;  1OCZ C;  3ABK C;  1JCH A;  3CPW U;  2UXX A;  3SPG A;  4CBC A;  1NKD A;  1DLB A;  1AI4 A;  3B8N A;  3FKS G;  4JTC B;  4N23 A;  5L3D A;  1NVP D;  4PDV A;  2Q68 A;  3UKM A;  4PDR A;  3X2Q C;  1H8E G;  5B3S B;  1YTF B;  3K03 A;  1VQM V;  1OCR B;  1E1R G;  5EC1 C;  5B1N A;  1KEC A;  1R6N A;  4E2L A;  1KKD A;  4QE7 A;  2EZO A;  2ZDI A;  4PA3 A;  4MTG A;  4H37 A;  1W2B U;  1TUE B;  1NJI W;  1M9N A;  3CCM V;  5B1A B;  2R9I A;  5E1A C;  2P67 A;  5KA5 A;  1F51 A;  3TET A;  1VQN V;  4QIW F;  3OUF A;  3MD0 A;  2XAH A;  1VQ5 V;  1PNM A;  1Q81 W;  1YHQ V;  3E35 A;  3LUT B;  2H8P C;  4JPR A;  1R3K C;  4EKW A;  3CCS V;  4QNH B;  5J9P C;  2OTJ V;  2Q6A A;  3RW0 A;  1F23 A;  2QTO A;  1NR1 A;  1Y4M A;  1BMF G;  1JPX A;  5L3F A;  1YTF D;  4HAM A;  3E8B A;  3ZRX A;  3CCR V;  1G4Y B;  2Y69 C;  1DF4 A;  5H9C A;  2JJ1 G;  1UJW B;  1YJN V;  3SYA A;  1QBZ A;  1M56 B;  1WPX A;  3R65 A;  1R3L C;  3ASO B;  4FPP A;  4G2K A;  4GX2 A;  1S5H C;  1F4M A;  5HFL A;  4BAY A;  3MHH C;  4JYB A;  4GT1 A;  2XOK G;  3RBZ A;  4DO2 A;  5L3B A;  2JEU A;  2ZXW B;  4MTO A;  1VQL V;  3ZMZ A;  3CCV V;  2WWW A;  3EFF K;  2QEX V;  2JEX A;  2X6B A;  3ML0 A;  3K08 A;  3OE7 G;  2Q67 A;  4H33 A;  5IDJ A;  2F43 G;  2EIL C;  5IYD O;  4MTX A;  1SER A;  4KUM A;  1JVM A;  3W7S A;  5DM6 V;  3AG1 B;  1MG1 A;  3ZRW A;  2HKO A;  3OUS A;  3E8F A;  1V54 C;  1K92 A;  1PL0 A;  2PI5 A;  2GSM B;  3OW2 U;  1Y66 A;  3LNM B;  4Z1M G;  1BL8 A;  3K0D A;  4GX5 A;  1KP2 A;  2A0L A;  3TK1 A;  4PA9 A;  1YJ9 V;  1S0V A;  3DGE A;  4UXN A;  1QCE A;  3CP1 A;  3M99 B;  1GMG A;  2NLJ C;  1PD3 A;  3AEI A;  4FK5 C;  1RPR A;  3FB6 C;  5EBW C;  1OCZ B;  1ORQ C;  3E83 A;  2JK5 C;  3GB7 C;  3AG3 B;  1YJW V;  3HPL C;  3PJS K;  4LC1 A;  3P32 A;  4MS2 A;  2FTK A;  2EIM C;  3AG1 C;  4U7N A;  5CBG A;  2EIJ B;  4WCE V;  4KFM A;  3ASN C;  1QLE B;  2EJR A;  1OCR C;  1WLE A;  2LP7 A;  4LCU C;  2H94 A;  2DYS C;  5BZB A;  5KA6 A;  2Z3Y A;  3ABL C;  1GM8 A;  3JD3 A;  3ABM C;  1KC8 W;  4GX0 A;  2WLN A;  4XDJ A;  3CCU V;  4MVR A;  3W7T A;  1CPY A;  3BEH A;  1FFT B;  1NQT A;  1NBM G;  1P4R A;  4WFH A;  1K7D A;  5FL7 G;  1RPO A;  2HVJ C;  3ABK B;  3OAA G;  4PA6 A;  4JAU A;  1GO3 F;  1EBO A;  1V55 B;  2XAQ A;  3CCL V;  2XND G;  5DN6 G;  2B1G A;  2B5U A;  1THZ A;  3AG4 C;  4PDM A;  2ZQM A;  1E1Q G;  2IW5 A;  1YSC A;  3E8G A;  3K79 A;  4ZKI A;  2BOB C;  4FIP C;  4HYO A;  1VQ6 V;  5IYB O;  1CEZ A;  2KB1 A;  3QO7 A;  3KG2 A;  4UVC A;  1VQ4 V;  3H01 A;  2Z5U A;  2W6I G;  3ZMT A;  1K8A W;  2WLM A;  5B1A C;  2K1E A;  5IY5 B;  3ZMV A;  4MVM A;  2X7R B;  4F4L A;  1DF5 A;  1K5Q A;  4XDL A;  2X0L A;  1I5Y A;  2WLL B;  1NH2 D;  5CN0 A;  3JYC A;  1KP3 A;  4KP4 A;  2DQ3 A;  2IH1 C;  5LHH A;  1K4C C;  1NR7 A;  4U7O A;  3JD4 A;  4I5S A;  2WLL A;  2WLK A;  2XAG A;  2XAF A;  5L3C A;  3ETD A;  5B3S C;  3OMN B;  2ITC C;  2A79 B;  1R3J C;  4MT8 A;  2EIM B;  4JAV A;  2WLI A;  4MVS A;  2EIJ C;  4R6Z A;  4R8C A;  4DXW A;  2V7Q G;  3K0G A;  4LP8 A;  3FYE B;  4I9W A;  4RQE A;  5IY5 C;  3NXS A;  3QO8 A;  2WPD G;  2GHY A;  1VQO V;  1KQS U;  3E2E A;  1M57 B;  2EZP A;  4J9Y B;  1K4D C;  4ASU G;  2JDI G;  4P2Z A;  3W7X A;  2EBO A;  1OCC B;  4L87 A;  5H6Q A;  3SYP A;  2PI4 A;  1FS0 G;  1K3E A;  3ASN B;  3FYI B;  2ZD9 A;  1OCO C;  2IH3 C;  1EFR G;  3E8H A;  4WFE A;  2EIN B;  1AJP A;  3B8M A;  2R9R B;  3STZ C;  4GX1 A;  2IJK A;  1AR1 B;  4UVA A;  3OR7 C;  3ZRS A;  2C2A A;  1PKX A;  2EIN C;  4JF3 A;  3FB7 C;  4PA7 A;  1NVP B;  5LGU A;  1IXM A;  2V1D A;  1OHH G;  3CC2 V;  3ZMU A;  5EBL C;  2LFS A;  3FB8 C;  3QNE A;  5LGT A;  3UM7 A;  3RVY A;  5EK0 A;  3ETE A;  1GK9 A;  4MTF A;  5EC2 C;  1OCC C;  1R73 A;  5L3E A;  4N21 A;  4R50 A;  1VQ7 V;  1Q86 W;  1FXK A;  4MVZ A;  3P30 A;  3SPH A;  3A0R A;  1FXK C;  1V54 B;  5GW7 A;  1H38 A;  1FXK B;  2AHZ A;  3CME V;  1GM7 A;  4HZ3 A;  1VQK V;  2HR3 A;  3EHB B;  2YSU B;  4JGS A;  4XBF A;  2LFR A;  4BW5 A;  3ABM B;  4RUF A;  4RO2 A;  2YEV B;  4X89 A;  3T1C A;  2QA4 V;  4WFF A;  3ZJZ A;  1GKF A;  3I55 V;  5IYC O;  3LDE A;  1YIT V;  3IFX A;  3CCE V;  1M57 C;  4QPJ A;  3F5W C;  2P90 A;  4PDL A;  4UV9 A;  2AHY A;  4UVB A;  3ZIA G;  1M56 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...