3STLC

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3stlC00
1S5HC 3IGAC 4MVUA 5BZBA 4WFEA 3E8BA 2WLMA 2X6BA 3K08A 3FB7C 2W0FC 3UKMA 1J95A 2R9RB 2DYSC 3SYOA 2ITDC 4MW8A 4R6ZA 4MVQA 2Q68A 4JTCB 4QE9A 3VOUA 4RUFA 3FB5C 2A79B 2WLJA 5CBFA 1XL6A 3E86A 3K06A 5E1AC 1V55C 5EC2C 2ZD9A 3F5WC 3RW0A 2KB1A 3R65A 4GX1A 4PA7A 2NLJC 2QKSA 3E89A 3E8FA 4TWKA 5B1BC 4F4LA 1BL8A 3AG4C 2HG5C 2ZXWC 3JYCA 2ATKC 2DYRC 4LP8A 4WFGA 4X8AA 2X6AA 2AHZA 3OR6C 3X2QC 3LDEA 5EBMC 1OCCC 2Q67A 4DXWA 4LCUC 5KUKA 2EINC 3E8GA 4RAIA 3SPJA 4GX2A 3OR7C 2H8PC 4JTDB 4MVZA 3BEHA 4LBEC 4XDKA 4ZBMA 2WLIA 3SYQA 1R3JC 1OCZC 3ABMC 4G28B 4MS2A 4PDVA 3ABKC 3TETA 4MVOA 3SPCA 4PDLA 2BOBC 3SYPA 1ZWIC 3FB6C 5KUMA 3E83A 3RVZA 3EFFK 2BOCC 1V54C 4PA6A 3F7YC 3T4ZA 4XDJA 1KKDA 3KG2A 2WLHA 4MVMA 4GX5A 4JTAB 3ASNC 2WLLB 1ORQC 4R50A 4PA4A 3SJQC 4H33A 3GB7C 3K03A 3E8HA 4PDMA 4R8CA 3STZC 4MVRA 2DWDC 3FB8C 3PJSK 2EIMC 4P9PA 4QE7A 2WLNA 4X88A 5EK0A 2HVKC 3SPIA 3STLC 3UM7A 2JK5C 4RUEA 4XDLA 1QLEC 3OUFA 4HYOA 3SYAA 3ZRSA 2EILC 2Y69C 2HFEC 1P7BA 2K1EA 4J9YB 4MTFA 2WLLA 4MTGA 4PA3A 3SPGA 2HJFC 3LDDA 4X89A 2ITCC 4MTOA 2IH1C 2YEVA 5EC1C 3RBZA 2Q69A 3OGCC 4G27B 4HZ3A 4P2ZA 2A0LA 3T4DA 2AHYA 4QNHB 3SYCA 3K04A 1G4YB 3TCUA 3LDCA 4RO2A 2OCCC 1JVMA 2DWEC 3LUTB 4PA9A 4WFHA 3T2MA 2A9HA 4H37A 3K0DA 1K4DC 1K4CC 3AG2C 5EBWC 3ZJZA 3SPHA 2HVJC 3AG1C 3HPLC 3LNMB 4R7CA 5B1AC 4MSWC 1R3IC 2P7TC 5CBGA 5CBHA 2Q6AA 3K0GA 4MW3A 4P9OA 1OCRC 1M56C 3AG3C 2QTOA 4BW5A 4I9WA 1LNQA 1XL4A 4J9ZB 3RVYA 3OUSA 2X6CA 5EBLC 3ASOC 2IH3C 4P30A 4WFFA 5B3SC 4EKWA 3F7VC 1OCOC 3T1CA 5J9PC 2WLKA 3ABLC 3WG7C 5IY5C 2EIJC 1R3LC 4OXSA 3IFXA 2EIKC 4CBCA 1R3KC 1M57C 4GX0A 4KFMA 2WLIB 4PDRA 4UUJC 4MVSA
chains in the Genus database with same CATH superfamily
3B40A 4MVUA 3FD9A 2UXCB 4UVAA 4DR4O 3BHPA 3ZS8C 2P6JA 1Z5WA 3VOUA 1WNSA 1KU9A 2EILB 2FMLA 3K06A 4NXNO 5AG2A 1RFYA 3LSQA 1S5LZ 5L3BA 1Y76B 2ZD9A 3F5TA 4PA7A 4JI1O 4ZOLB 2F43G 4JI6B 5B1BC 3W7UA 2UXBB 2CH7B 3FAVA 4O4JB 1XNRB 4IHJA 5KX5A 4GYCB 3QO8A 1ROPA 2JIZG 1FJGO 2CTPA 3H1LH 5B1OA 1OCRB 3RYIA 3BEHA 4FVMA 4LBEC 2Y48A 5B3SB 2KG7A 4FIPC 3SYPA 1ZWIC 3ZCCA 4DR5B 3RYCA 1FXKC 1V54C 1AI7A 1N36B 2PY5A 4MVMA 1NI8A 4R50A 3N2GB 4PA4A 4H33A 4PDMA 2ADQB 2QEXV 1H2MA 1NVPD 1KYOF 2Z3YA 2UUAO 4ZIBA 2XAGA 3ETQA 1QLEC 4HYOA 1GRJA 4EB6B 5KMGA 1RPOA 1DK1A 4C7UA 4JI7B 3W7XA 1M93A 5FNVA 2ITCC 2YEVA 4KXRA 2YIDA 4I4TA 1PNMA 3SYCA 3MD0A 2OCCC 4IGGA 4WFHA 2HHHO 3HKCB 2DJVA 1J5EO 1QVGU 3AG2C 4UCSA 2EINB 4DUZB 3CYOA 4B3RB 3ABUA 3UO2A 3K5LA 2IH3C 3B8MA 3ABLC 4DR4B 5IY5C 1D5NA 1Y74B 4KFMA 4TOIA 2PF4E 4I55A 3DC6A 1YJNV 2VS0A 2EULA 3BA9A 3ZMUA 1VF5B 1MA1A 2Q68A 2Q4PA 3R66A 1R1BA 1X59A 1NTKH 2QKSA 4KUMA 4K8ZA 3HKBB 4DO2A 1SA0B 1SQXH 2ATKC 2Y0PA 1DGSA 1K34A 3KCXA 2OIEA 1K33A 2LJ2A 1I7FA 5JCOC 2JDIG 2RNBA 3H1HH 2WLIA 4PD4F 4DR7O 4NR1A 5BR8B 2RJZA 3JD1A 3G6BA 1XNQB 1DTOA 2D3OW 3E83A 2UUAB 5H9CA 3KG2A 3K58A 2BSKB 3D3IA 1PNKA 5LP6A 4LH7A 4JYYA 2GSMB 1WLEA 4LF5B 4CC5A 3CPWU 1GTOA 4CZZA 4TQFA 4JI0B 2IJIA 2BCCH 2YICA 1H38A 1JFFB 2AHYA 2P22C 1NTZH 1G4YB 2M7WA 5DM6V 3FX7A 3QVNA 4NVPA 3G67A 1B06A 3X2QB 5KA6A 1VEWA 3JARB 1G6UA 3BCCH 3LSUA 1Q82W 3AG3C 4H44B 3VQXA 1AVMA 2QDOA 3G6EV 1HNWB 3OUSA 1M90W 2FKXA 5GONB 3E22B 2ZT9B 4UB6Z 5J9PC 1VF6A 1IBKB 3CWBH 1XEQA 1R6KA 2KSDA 2E5LB 1D2DA 4MVSA 1IZ3A 2QKAA 2CDYA 4DUYO 1VQ7V 2Q0AA 4U7NA 1KC8W 3JALA 2IU0A 3IC9A 2Y69B 2YS8A 2EZPA 2BTQB 1H2KA 2GBOA 3Q4HA 3K9SA 2NLJC 5LXTB 5F2VO 1JPXA 5JJNB 3JYCA 4RQFA 1FXKB 1V54B 4X20A 4YY3O 2X6AA 4WFBV 1OZ0A 1SETA 3H1IH 3K57A 1SS3A 2AZ2A 3K5MA 2FB5A 3SPJA 1ENVA 1H8HG 4G2KA 1XHZA 4MS2A 1F51A 4MVOA 3AK3A 4J41A 1WN7A 3SPCA 3CCUV 4Z1VA 1XMOO 2EIJB 5EYPB 4NTWA 2ZR2A 1LR1A 2L35A 1IBMO 2QA4V 2OCCB 4ZI7A 3UT5A 5H2FZ 3SJQC 3AG2B 1BQZA 1IXMA 1MMMA 2LGWA 5LMUB 2M6YA 2WLNA 3UM7A 3SGIA 2ZM6O 1NH2B 1EBOA 2WLLA 1EFRG 4PA3A 2IH1C 4O4LA 3ABLB 4DK1A 2UU9O 5IY5B 4B7KA 5KAIZ 3LDCA 3HKDA 1WA8A 3LSSA 3K0DA 4B3SO 4HNAB 4IYHA 1LUVA 4TV8B 5LYJA 1XHXA 4OX9B 3FAVB 3N2KA 1XDCA 3JD4A 5LMNO 4IHJB 3ICXA 5KX5B 4P30A 1YF2A 1FFXA 4EKWA 3F7VC 4JI5B 1U96A 1NQTA 3RYIB 4U7OA 3KZIZ 2CGOA 2ADPA 1NR1A 2JEXA 5B5EZ 1F23A 4I50A 2KQXA 2R9RB 2DMXA 4YJ2B 4LFBO 3A0HZ 4J7ZA 4DRXA 1BQ0A 2WLJA 5J2UB 2P4KA 1V55C 4FJCC 5DEDA 3F5WC 3DSQA 3VQYA 2XNDG 4AQYB 2E75B 4ZHQA 2R9AA 4FLYA 5FNVB 1E1RG 3ZMTA 3JATA 2P90A 3CB2A 4I4TB 4LCUC 1YTFB 3JASA 2UUBB 1OCZC 4QPKA 2ZDIC 5IYZB 5LA6A 1VQ8V 5KUMA 5J2TA 3ZX6A 2RQ6A 1FYJA 1N32O 1SZXA 4PA6A 3F7YC 2ZM6B 3L73H 4JI2O 1QLNA 4FLUA 1P49A 1AI5A 4BW9A 3OTOO 2GUZA 4UXNA 2DYSB 3SJAC 3DXRA 1GO3F 3AEIA 1H8EG 2EILC 3ZMVA 5K1XA 5EC1C 4YIOA 2Q7HA 2HP8A 2ILMA 4DV3B 4X65O 4TUYB 5BMVA 4LF8B 4CH6A 4B3TO 5CA1B 5LMNB 4B7EA 2FTKA 1SERA 1HR0O 1JR9A 2IJJA 4PHZA 1OCRC 5CA0B 5CN0A 1ZX3A 1K5SA 3K79A 4X9QA 2X6CA 5B3SC 1VQMV 1D5AA 3T1CA 3ZHTA 4LF6B 3JD2A 4W4KA 5BY1A 1RM1B 4AI8A 5JH7A 3VQVA 2WLIB 3FFQA 4KHPB 2XTAA 2QM8A 1NT2B 3FB7C 1SQPH 5H5NA 1Y67A 3TGUH 2WSSG 5C8YA 2Y4TA 3FB5C 2JEUA 1V9PA 5LP6B 2JJ1G 1QBZA 2OTLV 3SDLA 4LF7B 2R70A 3C90A 4NTYA 4X66O 4UVCA 2V1DA 3HKEA 1GM9A 5EZYA 2C2AA 3PN1A 1CXZB 1Q90D 2EINC 4LH6A 4GX2A 4Q6GA 4YJ3A 5FL7G 4ZBMA 1N32B 1R3JC 4JI2B 2NR5A 2XOKG 4QIWF 4B3MO 3JCUZ 2ZE8A 4LWSA 2OCHA 4ICGA 2RMKB 3D36A 1EN4A 3STZC 1NVPB 4U3JA 4P9PA 4X88A 3ZRXA 1VQPV 3JCZA 3OUFA 4JYBA 4X65B 2HR3A 3ZRWA 1GN3A 3FYIB 4B3TB 4K3AA 2YC0A 3CRRA 3SPGA 1IVSA 2LQTA 4PV1B 3AK2A 4GKJB 2JS5A 5ITZB 1HR0B 5IWAO 3K04A 1H2GA 3JALB 2VWJA 3T2MA 3WB1A 4JZGA 1FXVA 3T1YB 1Q86W 4I5SA 3I5DA 4P9OA 1W2BU 4X20B 1P7GA 5KA5A 3CCMV 1WPXA 5LGTA 2QR4A 4DK0A 5L3GA 5IYCO 2L6LA 2P06A 3ABKB 2JJ2G 3BABA 1V55B 4JASA 4O4HB 1N34O 4JGSA 4FM0A 1YHQV 4LR3A 1BHBA 3IC7A 2EIMB 2Z0AA 3SYOA 1JA8A 4O2AB 3UT5B 2B1GA 1AR4A 4IL6Z 1OCZB 3CXHF 3ZHQA 4LFCO 2W6IG 1SQFA 1QVFU 5B1NA 3JAWB 4DV7O 4I0XA 4B08A 4DV5O 1PD3A 3E2EA 2AHZA 4O4LB 5GTHZ 3X2QC 1MG1A 4GLXA 3AG1B 4RWUA 4NXMO 1OCCC 5CMUA 4B3MB 2QSAA 4RAIA 1NZ6A 2ODMA 4X1KA 4BR6A 4AHCA 4JF3A 4FLTA 3CC2V 2ARHA 2LFRA 3D8CA 4G28B 3U10A 3CCQV 3WG7B 4MT8A 4CH3A 5IJ9A 1A32A 5LYJB 2RCVA 4JV5O 1GN4A 4XDJA 1HNZO 1FFXB 1XILA 1KQSU 1PL4A 2ZR3A 4WF9V 2QJ1A 1HW7A 3AK1A 5EK0A 1IBLO 4JPRA 2JK5C 5LOVA 4DR2B 1G1XB 2Y69C 2IJKA 2YDEA 4I50B 4TSFG 4RQEA 3H9VA 2ZCEA 1KD1W 2Q69A 1FFTB 2XAQA 4HZ3A 4DRXB 5FPRA 3AG4B 3THOA 4H37A 2DQ3A 2VQFB 2RN9A 2YIAA 4MW3A 1VMGA 1SQQH 4ZHQB 1I94B 3DGEA 1LNQA 1Q8IA 3OEEG 1XL4A 3JATB 3ABMB 4UCRA 3HR0A 4FFKA 2EIJC 3ML0A 4TQDA 1M57C 1F4NA 3RYHA 1M1KW 5JJEB 3P30A 4DR6O 2Y0IA 1S5HC 3ASNB 4WFEA 2WLMA 5LA6B 1URFA 3I55V 2DN9A 4X1YB 2LP7A 2LW7A 1YSCA 1ZL8A 2EBOA 1M9NA 1TAEA 2KB1A 4W4LA 3DXRB 3E89A 1KP2A 1BL8A 2JGUA 4LP8A 3OT7A 4JI4O 3CEIA 2QM7A 1BHAA 3JSNA 2ZE5A 4NXNB 4DXWA 1I5XA 2X7RB 4JI1B 1QHTA 1AR5A 5BMVB 1TVKA 1HNZB 4DYLA 4JI3O 1IDSA 5EIBD 3MDSA 5IT9N 1THZA 1IBLB 4CH5A 2Q0OC 1FJGB 2OT5A 1YXBA 2Q5ZA 4N23A 4O2BA 1N0JA 1RSOB 4D7SA 4K0KO 2CUGA 5KAFZ 2F1MA 4IIJA 1XREA 2XUMA 1TA8A 4F6RB 4ZKIA 2HFEC 2K1EA 2QWRB 4J9YB 3O9OA 1HWYA 2IJHA 4MTOA 5C8YB 1AJNA 2FYUH 2R72A 3WB2A 3N27A 2NNUA 3SPHA 3FKSG 3BPZA 3KKYA 1JCHA 2UUCO 2AW9A 4X1IA 2ZINA 1Y6XA 3CD6V 4L87A 2XHBA 2HHHB 5EBLC 5EZYB 2RDCA 2GTAA 1J5EB 3CC7V 5KHKA 1CEZA 2VWKA 2EIKC 4YXWG 4YJ3B 5JQGB 3CC4V 4BIZA 1N4CA 3CRCA 1ZSPA 1OCCB 2DYSC 4FFBA 4DV4O 1VQNV 4Z2WA 1L0LH 4JYAO 1K9MW 1TUEB 2YXHA 3BA8A 4FPPA 1AILA 5CB4B 2UXDO 2B9ZA 1HNXO 4FMTA 1VQ5V 2Y4UA 3APOA 3MHSC 4PJ0Z 2PZSA 1CP9A 3WFVA 1K8AW 2N74A 1OCOB 3JAKA 2BOBC 4K0KB 1RM1C 5K1PA 2E74B 3RVZA 1OHHG 4TV9A 4DR7B 3CCLV 3E8HA 1AROP 1WAZA 5JVDA 3EVKA 4MTFA 5LP6C 3U11A 3OMIB 5CA3A 4AILC 1R73A 4O4IB 3ZIAG 2YIBA 1E1QG 2ZXWB 1GN2A 1M57B 4YHHO 2OTJV 3OM3B 1N0NA 2PI5A 3B77A 3LNMB 4MSWC 2O57A 4I0XB 1GK9A 4J42A 1VQ6V 4BW5A 2F4VO 1W59A 3IFXA 1S0VA 2N04A 4GKKO 1Q6HA 4LF4O 3QO5A 4ASUG 1VF6C 3RGBA 1MABG 3RWRD 2ZDIA 3SR2C 3A0BZ 3CCEV 4MVQA 3RYFA 1WP7A 2UXDB 4RUFA 1P4RA 3SJBC 5TISZ 1YVWA 4EFEA 4DUYB 5LOVB 4JAAA 3CP1A 4WFGA 1EZJA 3BY6A 1QU7A 1IURA 2KG7B 1ZAUA 3L72H 5H6RA 3QTCA 4J7JA 1F4MA 2G38A 1Y76A 3ZHRA 4JI8O 2Q7GA 2IM9A 2AZ0A 5L3EA 3RYCB 1M56B 2DOSA 4NKGB 3ABKC 4O4JA 4YY3B 3J81N 1WPBA 4GT1A 5KMGB 1B3QA 1WJZA 4JTAB 1BSMA 1G8MA 2QTSA 1BS3A 2YEVB 3CRAA 2EIMC 3STLC 3RYHB 1XMOB 3K9AA 3E35A 5A9GA 2F95B 4YHHB 5EIBC 1IBMB 3H1JH 3OTFA 1SQGA 2A0LA 2JS3A 1NTMH 2EIKB 3TCUA 4FLZA 1JVMA 4DR3O 3CE2A 2A9HA 4EB6A 1ZL8B 2W6JG 3ZJZA 1K4CC 2F4VB 3AG1C 5L3FA 1JJ2U 3K5OA 5CBHA 2VRZA 3CJHA 3G4SV 1B04A 2UU9B 3B09A 2P4VA 2F23A 4DV1O 4I55B 3HKCA 2YI8A 1NR7A 4TT3G 4B3SB 3WG7C 1N8RW 1R3LC 2GDSA 3H1KH 1COWG 2A3QA 3IGAC 5BZBA 4KP4A 1PKXA 2ETNA 1GM8A 2W0FC 1J95A 3DTUB 1NJIW 4LNUA 1XQ8A 4QE9A 3CXCU 1Y74A 4O2BB 2HLDG 1XOUA 1QNMA 4UCUA 3RW0A 3R65A 2ZKOA 4CH4A 1AJPA 4F4LA 3AG4C 3FYEB 4LFBB 1Z2GA 3CRMA 2XASA 3LDEA 1NKDA 3OR7C 1SA0A 2CTWA 3ABMC 1K5QA 2LO1A 2QGNA 3BVOA 2XT9A 1BZKA 3A2FA 2LW1A 1GMGA 3KCYA 3U0ZA 2BOCC 2N05A 1IX9A 3ASNC 1K92A 4IYIA 5D5PA 5KHHA 4MVRA 3PJSK 4QE7A 4F6EA 1XMQO 4EEQA 4BAYA 4DR3B 3L9DA 1QR9A 3CRQA 5DECA 4EFBA 1Q5OA 2QWPB 3T4DA 3OTOB 4J10A 4RO2A 4DV1B 1JX9A 1Q81W 1JJOA 2HVJC 4X62O 2WAMA 5IYDO 4K8XA 4PI0A 2XAJA 1M5IA 2UXCO 4J9ZB 5IDJA 4GUNA 2ZE7A 4WBNA 4PI2A 3S3WA 1GKFA 1Q43A 3W7SA 4LF9O 3Q4HB 4JI6O 2ITDC 2UXBO 5H6QA 2A79B 1XNRO 1SQBH 1F7YA 5EC2C 1K7DA 5JVDB 1IXBA 3OEHG 2DE0X 3CHXA 4X8AA 3ZRVA 2JRIA 1L1FA 1SRYA 4DR5O 1N36O 5LXTA 2JVDA 1N33O 1WB8A 1YJ9V 4MVZA 4ZI7B 1FXKA 4Q20A 4X66B 3TETA 4I7ZB 3HB3B 4PDLA 2MK3A 4UB8Z 5IE9A 1XMQB 3QNEA 4JI7O 4BIOA 5LHIA 2WLLB 2VQEO 3GB7C 2BE3A 1YJWV 1FS0G 1WB7A 4CC6A 5LHGA 2KKWA 3DC5A 4XDLA 2GTSA 2QM4A 3HKDB 4X64O 3ZRSA 1JMKC 1WA8B 3ZEDA 4HAMA 2ZNJA 3L70H 4DUZO 3N2KB 2DYRB 5EBWC 3B4SA 1W0KG 3HPLC 4R7CA 4LC1A 1CPYA 5IWAB 1I08A 1S5JA 3JSLA 1Q6UA 1EM1A 4WFFA 2LGQA 1YIJV 2YI9A 4HNAA 2CE4A 1OCOC 1HDJA 3QO7A 1U97A 5L3CA 2MW2B 4LF9B 4H13B 2PTMA 5FLXN 2Q9LA 4TV8A 2Q73A 4GX0A 2HJDA 2DW4A 2ZQMA 5FPOA 1UJWB 1VF7A 1Y66A 3GVMA 4JTCB 2AGAA 1N34B 3LNNA 1XL6A 3EHBB 4NYKA 2QWNB 2YXLA 5E1AC 3UCSC 2Z5UA 1K3EA 4DR1O 4TWKA 1N33B 4YJ2A 3JASB 1DLBA 3C3TA 2HG5C 2ZIMA 2ZXWC 5BR8O 3RN4A 1YI2V 5J2UA 5JCOA 1XNQO 2EX3A 3OR6C 1L8DA 1SZTA 5EBMC 4UCOA 2X0LA 5KUKA 4LFCB 2WWWA 5J2TB 2IBZH 4DV7B 4XDKA 4DV5B 3UQ8A 4FLWA 3ASOB 2VQEB 3G80A 4LF5O 2GUZB 2OYQA 2CAZC 3CJHB 2XAFA 4NXMB 3OD4A 2IU3A 4PELA 3T4ZA 3J80N 4JI0O 4X64B 5IYZA 4R8CA 3FB8C 1FD9A 3CCSV 3SPIA 2HVKC 5C93A 4RUEA 3MHHC 3SYAA 3JD0A 4JV5B 2YIBD 1KBHA 2HJFC 3L75H 4J80A 4WFAV 3OGCC 4LNUB 3CCVV 5IJ0A 1PNLA 1HNWO 5A2QN 2DWEC 3L74H 3RFRA 3J7AU 1FPOA 5B1AC 1IBKO 2E5LO 5JH7B 3APQA 1M56C 4TUYA 1GN6A 4MTXA 4JYCA 5CA1A 1YZBA 2PUSA 4QJFB 2WLKA 4GCZA 4L8JA 5E79Z 1RP3B 2ZIOA 2JGDA 1BT8A 3W7TA 5CA0A 3NXSA 4K35A 1GAXA 2V4DA 4BIUA 2Q8VA 4DR1B 1I0HA 3AG7A 1QCEA 1VQ9V 1R6TA 4A5UB 2CGNA 3E86A 3HKEB 4DV6O 4DR6B 3P32A 3K5NA 3E8FA 3OMAB 3TXQA 3OAAG 2UXNA 1TUBA 4FM1A 1ZLZA 3ZN0A 3OGIB 1PP9H 5LHHA 3IJ4A 4LWSB 3CCJV 1UFIA 4JTDB 3CCRV 4FLVA 2EZOA 3OMNB 1DF4A 2P5OA 4D7TA 4JI4B 5LMUO 4U3JB 1K97A 2DQ0A 1PPJH 3WB0A 3QF7A 3B2EE 3ZRWB 2FL4A 4YIPA 4WBNB 4JI3B 1Q3EA 1Q6IA 4DW0A 4UCTA 1S72V 1VIBA 2CTQA 4LFAO 4MTGA 1X4TA 3RBZA 3LDDA 1S3JA 4OX9O 4QNHB 3CS5A 2NN4A 2YXYA 4GZRB 3BFRA 5B1BB 5GTIZ 4PA9A 5HFMA 2E76B 1KB9F 4UV8A 3P3NA 3UO3A 4JI5O 1MOFA 2QWQB 4OPAA 1R3IC 1VQLV 2B5UA 5ITZA 2HKOA 1KP3A 1O9HA 2GV9A 3I56V 3TXSA 3G71V 4OPHA 2OWOA 3NR7A 4UUJC 2UUCB 5KLVH 4DV6B 4AQYO 3K59A 3IAYA 3K08A 1HP8A 1NS1A 1W0JG 2UXXA 3ETDA 4O4HA 5LGUA 2BTOA 2WA3A 2CK3G 1QLEB 3OFNG 1BGYH 1MZEA 3ABTA 4NB5A 1AP6A 5B66Z 4X1KB 2UUBO 1AI4A 4O2AA 4DV4B 1S77D 3L71H 2AXTZ 4JAUA 4JYAB 2Q67A 1OJHA 5IJ9B 4I9QA 1K73W 2XAHA 3JAWA 3SYQA 1HNXB 2PI4A 3C3SA 5LBQA 4FZ1A 5L3DA 1MZFA 5BXZA 1LUWA 4UVBA 4DV0O 2WLHA 4J7KA 4LFAB 1H2NA 4DV3O 5B1AB 4UFZA 1KECA 2K9PA 4HBNA 4ZOLA 4LF8O 4OGQB 2PGGA 3K3WA 2H94A 4D6TH 3T1HO 1GM7A 2CH7A 2E3CA 3P3PA 5LGNA 1Q7YW 1SESA 1XI1A 4FM2A 4J11A 5LL6Y 2R9IA 3H01A 3LUTB 1YITV 4CS2A 1K4DC 5DN6G 1I5YA 4LF6O 1JOYA 4CS4A 5KHIA 3K0GA 2WA4A 4KHPO 1MSDA 3O65A 1JQ0A 4FZ0A 4I9WA 1Y4MA 2YUAA 3RVYA 3VQWA 1KUQA 1KMIZ 4H0LB 1DF5A 3CSXA 4JZ2A 3M8AA 3N2GA 4KL1A 3A0RA 1TGOA 2QE7G 4CBCA 1VQKV 2H3OA 2F66C 1L0NH 4LF7O 3E8BA 2X6BA 3TJTA 1AJQA 1WP8A 4MW8A 4R6ZA 2QWOB 4E2LA 4GKKB 4UCVA 5CBFA 4LF4B 1AP5A 4FLXA 3VBBA 2PYJA 3QG5A 1PV0A 5HFLA 1VARA 1SKVA 2W0XA 4X1YA 3D3QA 2EJRA 2DYRC 1QR8A 1TVKB 1MSWD 3A8TA 5IJ0B 1XBLA 3E8GA 5IYBO 3AG3B 4WCEV 3EXAA 1NBMG 3M99B 4DV0B 1FAFA 3FB6C 1PM9A 4IIJB 4JI8B 2ZNIA 3S3XA 3T1HB 2CTRA 3B8NA 4GKJO 2OIGA 1EN6A 2DWDC 2LFSA 2JGDB 1H2SB 4DV2O 1EZVH 1NU1H 3TK1A 3HKBA 4QGPA 1UPGA 1SC5B 3SJCC 1NH2D 2ZE6A 3T1YO 4QPJA 1RSOA 1H2LA 4G27B 1PL0A 4P2ZA 3WU2Z 1SF9A 4X1IB 4JAVA 4F6RA 2YSUB 3ZMSA 3W7WA 3GWKC 1FXHA 2D2CB 1O9GA 4UV9A 1B6QA 2Q6AA 1VQ4V 3GWOA 1TUBB 3CMAV 3ASOC 2BSKA 1R6NA 2GHYA 4FFBB 1GH6A 1S76D 4DW1A 5JWPA 4PDRA 1P84F 4IT5A 3UKMA 1OV9A 1ZUQA 3RT3C 3JAMN 1ZTEA 1JFFA 3OE7G 5JQGA 5KHJA 4XBFA 2B1IA 2V7QG 4GX1A 1QQCA 2F93B 1BCCH 3ZHUA 3JARA 1YEWA 3ZMZA 1AI6A 1YDXA 1KKCA 1AB3A 3JAKB 5GONA 3E22A 1E79G 1FKAO 3ZN1A 1BMFG 1YTFD 2H8PC 5CB4A 1VP7A 4TV9B 4PDVA 1XUQA 1M4UA 2QKCA 4DR2O 4DV2B 3EFFK 4N21A 2PYLA 1Z5VA 1KKDA 4GX5A 1ORQC 1T5EA 2HEPA 2BTQA 1YCIA 3K03A 1US6A 1RPRA 1SQVH 3ZBHA 1P7BA 3M7MX 3ZHSA 4CS3A 2VQFO 2A06H 4X89A 5D5QA 5GW7A 1I94O 2A7WA 4U3FH 1BE3H 1MNGA 4E4EA 4Z1MG 3JD3A 3ETGA 3BAAA 2P7TC 5CBGA 1EN5A 4O4IA 5KHGA 1AR1B 3OW2U 5JJJB 2P67A 3D36C 5EYPA 3MAQA 2QTOA 2Q7EA 2IW5A 4FK5C 1VQOV 4BWAA 3BRCA 4X62B 3ZHVA 4OXSA 4B3RO 1R3KC 3RYFB 2WPDG 4NTXA 3ETEA 3CMEV 3CX5F 4ABMA 2EJ7A
chains in the Genus database with same CATH topology
3QO5A 4MVUA 2QM8A 4ASUG 4UVAA 1MABG 2ZDIA 4BIUA 3FB7C 2WSSG 3CCEV 4MVQA 2P6JA 1QCEA 3VOUA 4RUFA 3FB5C 1P4RA 1VQ9V 2EILB 2JEUA 3E86A 3K06A 2JJ1G 1QBZA 3LSQA 3P32A 2OTLV 5L3BA 2ZD9A 4PA7A 2F43G 3E8FA 3CP1A 3OMAB 5B1BC 3W7UA 3OAAG 4WFGA 4UVCA 1EZJA 2UXNA 2V1DA 3BY6A 1GM9A 3ZN0A 2C2AA 3QO8A 5H6RA 1F4MA 1ROPA 5LHHA 2JIZG 2EINC 4GX2A 3CCJV 5L3EA 1OCRB 1M56B 4JTDB 5B1OA 2EZOA 3CCRV 3BEHA 3OMNB 4LBEC 5FL7G 4ZBMA 1DF4A 1R3JC 2Y48A 3ABKC 5B3SB 2XOKG 4QIWF 1K97A 2DQ0A 4FIPC 3SYPA 1ZWIC 3ZCCA 4GT1A 1FXKC 1V54C 1AI7A 3D36A 3ZRWB 4MVMA 4JTAB 1G8MA 4R50A 4PA4A 4H33A 3STZC 2YEVB 4PDMA 1NVPB 4P9PA 2QEXV 2EIMC 4X88A 1NVPD 2Z3YA 3ZRXA 3STLC 2XAGA 1VQPV 3JCZA 1QLEC 3OUFA 4HYOA 4JYBA 3K9AA 1S72V 2HR3A 3E35A 3ZRWA 1RPOA 3FYIB 3W7XA 4MTGA 3SPGA 3RBZA 3LDDA 2ITCC 2YEVA 1S3JA 2A0LA 4QNHB 1PNMA 3SYCA 3K04A 1H2GA 2EIKB 5B1BB 3MD0A 3TCUA 2OCCC 1JVMA 4WFHA 3T2MA 4PA9A 5HFMA 2A9HA 4UV8A 2W6JG 1QVGU 3ZJZA 3AG2C 1K4CC 1FXVA 3AG1C 1MOFA 5L3FA 1Q86W 1JJ2U 1R3IC 1VQLV 4I5SA 5CBHA 2B5UA 2EINB 4P9OA 3CYOA 3G4SV 2HKOA 1W2BU 3ABUA 5KA5A 1KP3A 3CCMV 1WPXA 5LGTA 5L3GA 5IYCO 2IH3C 3ABKB 1NR7A 2JJ2G 3B8MA 3ABLC 4TT3G 3WG7C 1V55B 4JASA 3I56V 1N8RW 5IY5C 1R3LC 3G71V 4JGSA 4KFMA 4UUJC 1YHQV 1COWG 1YJNV 3IGAC 5BZBA 4KP4A 1PKXA 1GM8A 1BHBA 3K08A 2W0FC 3IC7A 3ZMUA 1W0JG 2EIMB 1J95A 2UXXA 3DTUB 3ETDA 3SYOA 1NJIW 5LGUA 2CK3G 2Q68A 1QLEB 3OFNG 4QE9A 3CXCU 2B1GA 2HLDG 3ABTA 1OCZB 2W6IG 3RW0A 3R65A 2QKSA 4KUMA 1QVFU 5B1NA 4DO2A 1AJPA 4F4LA 3AG4C 1AI4A 2ATKC 3FYEB 1K34A 1PD3A 1S77D 3E2EA 2AHZA 2XASA 4JAUA 3X2QC 1MG1A 3LDEA 3AG1B 1OCCC 1K33A 2Q67A 5CMUA 1K73W 4RAIA 2XAHA 1NKDA 4JF3A 3OR7C 2JDIG 3CC2V 2WLIA 3SYQA 2LFRA 3ABMC 1K5QA 4G28B 2PI4A 3JD1A 3CCQV 5LBQA 3WG7B 4MT8A 5L3DA 1DTOA 2D3OW 1GMGA 3E83A 2BOCC 4UVBA 4XDJA 5H9CA 3KG2A 2WLHA 3ASNC 3D3IA 1KQSU 1K92A 1PNKA 2ZR3A 4WF9V 4MVRA 3PJSK 4QE7A 2GSMB 5EK0A 5B1AB 1WLEA 1KECA 4JPRA 2JK5C 3CPWU 3K3WA 2H94A 4BAYA 1GTOA 2Y69C 1GM7A 2IJKA 4CZZA 5LGNA 1Q7YW 2IJIA 1SESA 4TSFG 4RQEA 1QR9A 1KD1W 2Q69A 1FFTB 1H38A 2XAQA 4HZ3A 3T4DA 2AHYA 1G4YB 3AG4B 2R9IA 3H01A 3LUTB 4RO2A 2M7WA 1YITV 5DM6V 1JX9A 2DQ3A 4H37A 1Q81W 1K4DC 5DN6G 1I5YA 1JOYA 3X2QB 2HVJC 2WAMA 5KA6A 3K0GA 4MW3A 5IYDO 1Q82W 3AG3C 3DGEA 2XAJA 1JQ0A 4I9WA 3G6EV 1LNQA 3OEEG 1XL4A 1Y4MA 4J9ZB 3OUSA 3RVYA 5IDJA 1M90W 3ABMB 1DF5A 5J9PC 3A0RA 2EIJC 2QE7G 1GKFA 3ML0A 4CBCA 1M57C 1F4NA 1R6KA 1M1KW 1VQKV 3P30A 3W7SA 4MVSA 1S5HC 3ASNB 4WFEA 3E8BA 2WLMA 2X6BA 3I55V 1VQ7V 1AJQA 2ITDC 4MW8A 4R6ZA 4U7NA 1KC8W 5H6QA 4E2LA 2LP7A 2IU0A 2A79B 1YSCA 5CBFA 2Y69B 2EZPA 3VBBA 2EBOA 1M9NA 5EC2C 5HFLA 2KB1A 2NLJC 1K7DA 3E89A 1JPXA 1KP2A 3OEHG 1BL8A 2EJRA 3JYCA 4RQFA 2DYRC 4LP8A 1FXKB 1QR8A 1V54B 4X8AA 2X6AA 2QM7A 1MSWD 1BHAA 4WFBV 1OZ0A 1SETA 3ZRVA 4DXWA 1L1FA 1I5XA 1SRYA 3E8GA 2X7RB 3SPJA 5IYBO 1ENVA 1YJ9V 1H8HG 3AG3B 4G2KA 4MVZA 4WCEV 1FXKA 1NBMG 3M99B 4Q20A 4MS2A 1F51A 3TETA 4MVOA 3HB3B 3SPCA 4PDLA 3CCUV 1THZA 2EIJB 3FB6C 2MK3A 2ZR2A 2OT5A 3QNEA 2QA4V 4N23A 2OCCB 5LHIA 2WLLB 3SJQC 3AG2B 3B8NA 3GB7C 1IXMA 1YJWV 1FS0G 2DWDC 2LFSA 2WLNA 5LHGA 3UM7A 4XDLA 3TK1A 3ZRSA 4ZKIA 1NH2B 2HFEC 1EBOA 2K1EA 4J9YB 1NH2D 2WLLA 1EFRG 1HWYA 4HAMA 2IJHA 4PA3A 4QPJA 4MTOA 2IH1C 3ABLB 4G27B 1PL0A 4P2ZA 5IY5B 3LDCA 1AJNA 4JAVA 2DYRB 2YSUB 3ZMSA 3LSSA 3W7WA 3K0DA 5EBWC 1FXHA 2NNUA 3SPHA 3FKSG 1W0KG 3HPLC 4UV9A 4R7CA 1B6QA 4LC1A 2Q6AA 1JCHA 1VQ4V 1CPYA 3GWOA 3CD6V 3JD4A 4L87A 3CMAV 5EBLC 3ASOC 4P30A 4WFFA 1YIJV 4EKWA 3F7VC 1OCOC 3CC7V 1R6NA 3QO7A 2GHYA 5L3CA 1CEZA 1S76D 1NQTA 2EIKC 4YXWG 4U7OA 4GX0A 4PDRA 3CC4V 4BIZA 1NR1A 2DW4A 2JEXA 1F23A 2ZQMA 1UJWB 3UKMA 1Y66A 1OCCB 2R9RB 2DYSC 3OE7G 1VQNV 4JTCB 2WLJA 1XL6A 3EHBB 4XBFA 2B1IA 5E1AC 1K9MW 1V55C 2Z5UA 1K3EA 1TUEB 2V7QG 4FJCC 3F5WC 2XNDG 4GX1A 4TWKA 4FPPA 1DLBA 2HG5C 2ZXWC 1YI2V 3ZMZA 1AI6A 1E1RG 3ZMTA 2P90A 3OR6C 4FMTA 1E79G 1SZTA 5EBMC 2X0LA 4LCUC 5KUKA 1YTFB 2WWWA 3ZN1A 1VQ5V 1BMFG 1YTFD 2H8PC 3MHSC 4XDKA 1OCZC 4QPKA 3ASOB 4PDVA 1CP9A 2ZDIC 3WFVA 1K8AW 1OCOB 2BOBC 2XAFA 5KUMA 1VQ8V 1RM1C 2IU3A 3RVZA 3EFFK 4N21A 4PA6A 3F7YC 1OHHG 4PELA 3T4ZA 1KKDA 4GX5A 1QLNA 1ORQC 1AI5A 3CCLV 3K03A 3E8HA 1RPRA 1AROP 4R8CA 3FB8C 3CCSV 4UXNA 3SPIA 2HVKC 2DYSB 5C93A 1GO3F 4RUEA 3AEIA 3MHHC 3SYAA 1H8EG 3JD0A 2EILC 1P7BA 4MTFA 3OMIB 5CA3A 3ZMVA 2HJFC 4X89A 5EC1C 1R73A 5GW7A 3OGCC 4WFAV 3CCVV 3ZIAG 1PNLA 1E1QG 2ZXWB 1M57B 2DWEC 2OTJV 4Z1MG 3JD3A 3ETGA 3OM3B 2PI5A 5B1AC 3B77A 3LNMB 4MSWC 2P7TC 2FTKA 5CBGA 1SERA 1GK9A 2IJJA 1AR1B 1OCRC 1M56C 2P67A 3OW2U 1VQ6V 2QTOA 5CN0A 4BW5A 1K5SA 3K79A 2IW5A 4MTXA 2X6CA 4JYCA 4FK5C 5B3SC 1VQMV 4QJFB 3T1CA 1VQOV 2WLKA 4GCZA 3JD2A 4OXSA 3IFXA 1S0VA 1RM1B 1R3KC 2WPDG 3W7TA 3ETEA 2WLIB 3NXSA 3CMEV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5H C;  3IGA C;  4MVU A;  5BZB A;  4WFE A;  3E8B A;  2WLM A;  2X6B A;  3K08 A;  3FB7 C;  2W0F C;  3UKM A;  1J95 A;  2R9R B;  2DYS C;  3SYO A;  2ITD C;  4MW8 A;  4R6Z A;  4MVQ A;  2Q68 A;  4JTC B;  4QE9 A;  3VOU A;  4RUF A;  3FB5 C;  2A79 B;  2WLJ A;  5CBF A;  1XL6 A;  3E86 A;  3K06 A;  5E1A C;  1V55 C;  5EC2 C;  2ZD9 A;  3F5W C;  3RW0 A;  2KB1 A;  3R65 A;  4GX1 A;  4PA7 A;  2NLJ C;  2QKS A;  3E89 A;  3E8F A;  4TWK A;  5B1B C;  4F4L A;  1BL8 A;  3AG4 C;  2HG5 C;  2ZXW C;  3JYC A;  2ATK C;  2DYR C;  4LP8 A;  4WFG A;  4X8A A;  2X6A A;  2AHZ A;  3OR6 C;  3X2Q C;  3LDE A;  5EBM C;  1OCC C;  2Q67 A;  4DXW A;  4LCU C;  5KUK A;  2EIN C;  3E8G A;  4RAI A;  3SPJ A;  4GX2 A;  3OR7 C;  2H8P C;  4JTD B;  4MVZ A;  3BEH A;  4LBE C;  4XDK A;  4ZBM A;  2WLI A;  3SYQ A;  1R3J C;  1OCZ C;  3ABM C;  4G28 B;  4MS2 A;  4PDV A;  3ABK C;  3TET A;  4MVO A;  3SPC A;  4PDL A;  2BOB C;  3SYP A;  1ZWI C;  3FB6 C;  5KUM A;  3E83 A;  3RVZ A;  3EFF K;  2BOC C;  1V54 C;  4PA6 A;  3F7Y C;  3T4Z A;  4XDJ A;  1KKD A;  3KG2 A;  2WLH A;  4MVM A;  4GX5 A;  4JTA B;  3ASN C;  2WLL B;  1ORQ C;  4R50 A;  4PA4 A;  3SJQ C;  4H33 A;  3GB7 C;  3K03 A;  3E8H A;  4PDM A;  4R8C A;  3STZ C;  4MVR A;  2DWD C;  3FB8 C;  3PJS K;  2EIM C;  4P9P A;  4QE7 A;  2WLN A;  4X88 A;  5EK0 A;  2HVK C;  3SPI A;  3STL C;  3UM7 A;  2JK5 C;  4RUE A;  4XDL A;  1QLE C;  3OUF A;  4HYO A;  3SYA A;  3ZRS A;  2EIL C;  2Y69 C;  2HFE C;  1P7B A;  2K1E A;  4J9Y B;  4MTF A;  2WLL A;  4MTG A;  4PA3 A;  3SPG A;  2HJF C;  3LDD A;  4X89 A;  2ITC C;  4MTO A;  2IH1 C;  2YEV A;  5EC1 C;  3RBZ A;  2Q69 A;  3OGC C;  4G27 B;  4HZ3 A;  4P2Z A;  2A0L A;  3T4D A;  2AHY A;  4QNH B;  3SYC A;  3K04 A;  1G4Y B;  3TCU A;  3LDC A;  4RO2 A;  2OCC C;  1JVM A;  2DWE C;  3LUT B;  4PA9 A;  4WFH A;  3T2M A;  2A9H A;  4H37 A;  3K0D A;  1K4D C;  1K4C C;  3AG2 C;  5EBW C;  3ZJZ A;  3SPH A;  2HVJ C;  3AG1 C;  3HPL C;  3LNM B;  4R7C A;  5B1A C;  4MSW C;  1R3I C;  2P7T C;  5CBG A;  5CBH A;  2Q6A A;  3K0G A;  4MW3 A;  4P9O A;  1OCR C;  1M56 C;  3AG3 C;  2QTO A;  4BW5 A;  4I9W A;  1LNQ A;  1XL4 A;  4J9Z B;  3RVY A;  3OUS A;  2X6C A;  5EBL C;  3ASO C;  2IH3 C;  4P30 A;  4WFF A;  5B3S C;  4EKW A;  3F7V C;  1OCO C;  3T1C A;  5J9P C;  2WLK A;  3ABL C;  3WG7 C;  5IY5 C;  2EIJ C;  1R3L C;  4OXS A;  3IFX A;  2EIK C;  4CBC A;  1R3K C;  1M57 C;  4GX0 A;  4KFM A;  2WLI B;  4PDR A;  4UUJ C;  4MVS A; 
#chains in the Genus database with same CATH topology
 3B40 A;  4MVU A;  3FD9 A;  2UXC B;  4UVA A;  4DR4 O;  3BHP A;  3ZS8 C;  2P6J A;  1Z5W A;  3VOU A;  1WNS A;  1KU9 A;  2EIL B;  2FML A;  3K06 A;  4NXN O;  5AG2 A;  1RFY A;  3LSQ A;  1S5L Z;  5L3B A;  1Y76 B;  2ZD9 A;  3F5T A;  4PA7 A;  4JI1 O;  4ZOL B;  2F43 G;  4JI6 B;  5B1B C;  3W7U A;  2UXB B;  2CH7 B;  3FAV A;  4O4J B;  1XNR B;  4IHJ A;  5KX5 A;  4GYC B;  3QO8 A;  1ROP A;  2JIZ G;  1FJG O;  2CTP A;  3H1L H;  5B1O A;  1OCR B;  3RYI A;  3BEH A;  4FVM A;  4LBE C;  2Y48 A;  5B3S B;  2KG7 A;  4FIP C;  3SYP A;  1ZWI C;  3ZCC A;  4DR5 B;  3RYC A;  1FXK C;  1V54 C;  1AI7 A;  1N36 B;  2PY5 A;  4MVM A;  1NI8 A;  4R50 A;  3N2G B;  4PA4 A;  4H33 A;  4PDM A;  2ADQ B;  2QEX V;  1H2M A;  1NVP D;  1KYO F;  2Z3Y A;  2UUA O;  4ZIB A;  2XAG A;  3ETQ A;  1QLE C;  4HYO A;  1GRJ A;  4EB6 B;  5KMG A;  1RPO A;  1DK1 A;  4C7U A;  4JI7 B;  3W7X A;  1M93 A;  5FNV A;  2ITC C;  2YEV A;  4KXR A;  2YID A;  4I4T A;  1PNM A;  3SYC A;  3MD0 A;  2OCC C;  4IGG A;  4WFH A;  2HHH O;  3HKC B;  2DJV A;  1J5E O;  1QVG U;  3AG2 C;  4UCS A;  2EIN B;  4DUZ B;  3CYO A;  4B3R B;  3ABU A;  3UO2 A;  3K5L A;  2IH3 C;  3B8M A;  3ABL C;  4DR4 B;  5IY5 C;  1D5N A;  1Y74 B;  4KFM A;  4TOI A;  2PF4 E;  4I55 A;  3DC6 A;  1YJN V;  2VS0 A;  2EUL A;  3BA9 A;  3ZMU A;  1VF5 B;  1MA1 A;  2Q68 A;  2Q4P A;  3R66 A;  1R1B A;  1X59 A;  1NTK H;  2QKS A;  4KUM A;  4K8Z A;  3HKB B;  4DO2 A;  1SA0 B;  1SQX H;  2ATK C;  2Y0P A;  1DGS A;  1K34 A;  3KCX A;  2OIE A;  1K33 A;  2LJ2 A;  1I7F A;  5JCO C;  2JDI G;  2RNB A;  3H1H H;  2WLI A;  4PD4 F;  4DR7 O;  4NR1 A;  5BR8 B;  2RJZ A;  3JD1 A;  3G6B A;  1XNQ B;  1DTO A;  2D3O W;  3E83 A;  2UUA B;  5H9C A;  3KG2 A;  3K58 A;  2BSK B;  3D3I A;  1PNK A;  5LP6 A;  4LH7 A;  4JYY A;  2GSM B;  1WLE A;  4LF5 B;  4CC5 A;  3CPW U;  1GTO A;  4CZZ A;  4TQF A;  4JI0 B;  2IJI A;  2BCC H;  2YIC A;  1H38 A;  1JFF B;  2AHY A;  2P22 C;  1NTZ H;  1G4Y B;  2M7W A;  5DM6 V;  3FX7 A;  3QVN A;  4NVP A;  3G67 A;  1B06 A;  3X2Q B;  5KA6 A;  1VEW A;  3JAR B;  1G6U A;  3BCC H;  3LSU A;  1Q82 W;  3AG3 C;  4H44 B;  3VQX A;  1AVM A;  2QDO A;  3G6E V;  1HNW B;  3OUS A;  1M90 W;  2FKX A;  5GON B;  3E22 B;  2ZT9 B;  4UB6 Z;  5J9P C;  1VF6 A;  1IBK B;  3CWB H;  1XEQ A;  1R6K A;  2KSD A;  2E5L B;  1D2D A;  4MVS A;  1IZ3 A;  2QKA A;  2CDY A;  4DUY O;  1VQ7 V;  2Q0A A;  4U7N A;  1KC8 W;  3JAL A;  2IU0 A;  3IC9 A;  2Y69 B;  2YS8 A;  2EZP A;  2BTQ B;  1H2K A;  2GBO A;  3Q4H A;  3K9S A;  2NLJ C;  5LXT B;  5F2V O;  1JPX A;  5JJN B;  3JYC A;  4RQF A;  1FXK B;  1V54 B;  4X20 A;  4YY3 O;  2X6A A;  4WFB V;  1OZ0 A;  1SET A;  3H1I H;  3K57 A;  1SS3 A;  2AZ2 A;  3K5M A;  2FB5 A;  3SPJ A;  1ENV A;  1H8H G;  4G2K A;  1XHZ A;  4MS2 A;  1F51 A;  4MVO A;  3AK3 A;  4J41 A;  1WN7 A;  3SPC A;  3CCU V;  4Z1V A;  1XMO O;  2EIJ B;  5EYP B;  4NTW A;  2ZR2 A;  1LR1 A;  2L35 A;  1IBM O;  2QA4 V;  2OCC B;  4ZI7 A;  3UT5 A;  5H2F Z;  3SJQ C;  3AG2 B;  1BQZ A;  1IXM A;  1MMM A;  2LGW A;  5LMU B;  2M6Y A;  2WLN A;  3UM7 A;  3SGI A;  2ZM6 O;  1NH2 B;  1EBO A;  2WLL A;  1EFR G;  4PA3 A;  2IH1 C;  4O4L A;  3ABL B;  4DK1 A;  2UU9 O;  5IY5 B;  4B7K A;  5KAI Z;  3LDC A;  3HKD A;  1WA8 A;  3LSS A;  3K0D A;  4B3S O;  4HNA B;  4IYH A;  1LUV A;  4TV8 B;  5LYJ A;  1XHX A;  4OX9 B;  3FAV B;  3N2K A;  1XDC A;  3JD4 A;  5LMN O;  4IHJ B;  3ICX A;  5KX5 B;  4P30 A;  1YF2 A;  1FFX A;  4EKW A;  3F7V C;  4JI5 B;  1U96 A;  1NQT A;  3RYI B;  4U7O A;  3KZI Z;  2CGO A;  2ADP A;  1NR1 A;  2JEX A;  5B5E Z;  1F23 A;  4I50 A;  2KQX A;  2R9R B;  2DMX A;  4YJ2 B;  4LFB O;  3A0H Z;  4J7Z A;  4DRX A;  1BQ0 A;  2WLJ A;  5J2U B;  2P4K A;  1V55 C;  4FJC C;  5DED A;  3F5W C;  3DSQ A;  3VQY A;  2XND G;  4AQY B;  2E75 B;  4ZHQ A;  2R9A A;  4FLY A;  5FNV B;  1E1R G;  3ZMT A;  3JAT A;  2P90 A;  3CB2 A;  4I4T B;  4LCU C;  1YTF B;  3JAS A;  2UUB B;  1OCZ C;  4QPK A;  2ZDI C;  5IYZ B;  5LA6 A;  1VQ8 V;  5KUM A;  5J2T A;  3ZX6 A;  2RQ6 A;  1FYJ A;  1N32 O;  1SZX A;  4PA6 A;  3F7Y C;  2ZM6 B;  3L73 H;  4JI2 O;  1QLN A;  4FLU A;  1P49 A;  1AI5 A;  4BW9 A;  3OTO O;  2GUZ A;  4UXN A;  2DYS B;  3SJA C;  3DXR A;  1GO3 F;  3AEI A;  1H8E G;  2EIL C;  3ZMV A;  5K1X A;  5EC1 C;  4YIO A;  2Q7H A;  2HP8 A;  2ILM A;  4DV3 B;  4X65 O;  4TUY B;  5BMV A;  4LF8 B;  4CH6 A;  4B3T O;  5CA1 B;  5LMN B;  4B7E A;  2FTK A;  1SER A;  1HR0 O;  1JR9 A;  2IJJ A;  4PHZ A;  1OCR C;  5CA0 B;  5CN0 A;  1ZX3 A;  1K5S A;  3K79 A;  4X9Q A;  2X6C A;  5B3S C;  1VQM V;  1D5A A;  3T1C A;  3ZHT A;  4LF6 B;  3JD2 A;  4W4K A;  5BY1 A;  1RM1 B;  4AI8 A;  5JH7 A;  3VQV A;  2WLI B;  3FFQ A;  4KHP B;  2XTA A;  2QM8 A;  1NT2 B;  3FB7 C;  1SQP H;  5H5N A;  1Y67 A;  3TGU H;  2WSS G;  5C8Y A;  2Y4T A;  3FB5 C;  2JEU A;  1V9P A;  5LP6 B;  2JJ1 G;  1QBZ A;  2OTL V;  3SDL A;  4LF7 B;  2R70 A;  3C90 A;  4NTY A;  4X66 O;  4UVC A;  2V1D A;  3HKE A;  1GM9 A;  5EZY A;  2C2A A;  3PN1 A;  1CXZ B;  1Q90 D;  2EIN C;  4LH6 A;  4GX2 A;  4Q6G A;  4YJ3 A;  5FL7 G;  4ZBM A;  1N32 B;  1R3J C;  4JI2 B;  2NR5 A;  2XOK G;  4QIW F;  4B3M O;  3JCU Z;  2ZE8 A;  4LWS A;  2OCH A;  4ICG A;  2RMK B;  3D36 A;  1EN4 A;  3STZ C;  1NVP B;  4U3J A;  4P9P A;  4X88 A;  3ZRX A;  1VQP V;  3JCZ A;  3OUF A;  4JYB A;  4X65 B;  2HR3 A;  3ZRW A;  1GN3 A;  3FYI B;  4B3T B;  4K3A A;  2YC0 A;  3CRR A;  3SPG A;  1IVS A;  2LQT A;  4PV1 B;  3AK2 A;  4GKJ B;  2JS5 A;  5ITZ B;  1HR0 B;  5IWA O;  3K04 A;  1H2G A;  3JAL B;  2VWJ A;  3T2M A;  3WB1 A;  4JZG A;  1FXV A;  3T1Y B;  1Q86 W;  4I5S A;  3I5D A;  4P9O A;  1W2B U;  4X20 B;  1P7G A;  5KA5 A;  3CCM V;  1WPX A;  5LGT A;  2QR4 A;  4DK0 A;  5L3G A;  5IYC O;  2L6L A;  2P06 A;  3ABK B;  2JJ2 G;  3BAB A;  1V55 B;  4JAS A;  4O4H B;  1N34 O;  4JGS A;  4FM0 A;  1YHQ V;  4LR3 A;  1BHB A;  3IC7 A;  2EIM B;  2Z0A A;  3SYO A;  1JA8 A;  4O2A B;  3UT5 B;  2B1G A;  1AR4 A;  4IL6 Z;  1OCZ B;  3CXH F;  3ZHQ A;  4LFC O;  2W6I G;  1SQF A;  1QVF U;  5B1N A;  3JAW B;  4DV7 O;  4I0X A;  4B08 A;  4DV5 O;  1PD3 A;  3E2E A;  2AHZ A;  4O4L B;  5GTH Z;  3X2Q C;  1MG1 A;  4GLX A;  3AG1 B;  4RWU A;  4NXM O;  1OCC C;  5CMU A;  4B3M B;  2QSA A;  4RAI A;  1NZ6 A;  2ODM A;  4X1K A;  4BR6 A;  4AHC A;  4JF3 A;  4FLT A;  3CC2 V;  2ARH A;  2LFR A;  3D8C A;  4G28 B;  3U10 A;  3CCQ V;  3WG7 B;  4MT8 A;  4CH3 A;  5IJ9 A;  1A32 A;  5LYJ B;  2RCV A;  4JV5 O;  1GN4 A;  4XDJ A;  1HNZ O;  1FFX B;  1XIL A;  1KQS U;  1PL4 A;  2ZR3 A;  4WF9 V;  2QJ1 A;  1HW7 A;  3AK1 A;  5EK0 A;  1IBL O;  4JPR A;  2JK5 C;  5LOV A;  4DR2 B;  1G1X B;  2Y69 C;  2IJK A;  2YDE A;  4I50 B;  4TSF G;  4RQE A;  3H9V A;  2ZCE A;  1KD1 W;  2Q69 A;  1FFT B;  2XAQ A;  4HZ3 A;  4DRX B;  5FPR A;  3AG4 B;  3THO A;  4H37 A;  2DQ3 A;  2VQF B;  2RN9 A;  2YIA A;  4MW3 A;  1VMG A;  1SQQ H;  4ZHQ B;  1I94 B;  3DGE A;  1LNQ A;  1Q8I A;  3OEE G;  1XL4 A;  3JAT B;  3ABM B;  4UCR A;  3HR0 A;  4FFK A;  2EIJ C;  3ML0 A;  4TQD A;  1M57 C;  1F4N A;  3RYH A;  1M1K W;  5JJE B;  3P30 A;  4DR6 O;  2Y0I A;  1S5H C;  3ASN B;  4WFE A;  2WLM A;  5LA6 B;  1URF A;  3I55 V;  2DN9 A;  4X1Y B;  2LP7 A;  2LW7 A;  1YSC A;  1ZL8 A;  2EBO A;  1M9N A;  1TAE A;  2KB1 A;  4W4L A;  3DXR B;  3E89 A;  1KP2 A;  1BL8 A;  2JGU A;  4LP8 A;  3OT7 A;  4JI4 O;  3CEI A;  2QM7 A;  1BHA A;  3JSN A;  2ZE5 A;  4NXN B;  4DXW A;  1I5X A;  2X7R B;  4JI1 B;  1QHT A;  1AR5 A;  5BMV B;  1TVK A;  1HNZ B;  4DYL A;  4JI3 O;  1IDS A;  5EIB D;  3MDS A;  5IT9 N;  1THZ A;  1IBL B;  4CH5 A;  2Q0O C;  1FJG B;  2OT5 A;  1YXB A;  2Q5Z A;  4N23 A;  4O2B A;  1N0J A;  1RSO B;  4D7S A;  4K0K O;  2CUG A;  5KAF Z;  2F1M A;  4IIJ A;  1XRE A;  2XUM A;  1TA8 A;  4F6R B;  4ZKI A;  2HFE C;  2K1E A;  2QWR B;  4J9Y B;  3O9O A;  1HWY A;  2IJH A;  4MTO A;  5C8Y B;  1AJN A;  2FYU H;  2R72 A;  3WB2 A;  3N27 A;  2NNU A;  3SPH A;  3FKS G;  3BPZ A;  3KKY A;  1JCH A;  2UUC O;  2AW9 A;  4X1I A;  2ZIN A;  1Y6X A;  3CD6 V;  4L87 A;  2XHB A;  2HHH B;  5EBL C;  5EZY B;  2RDC A;  2GTA A;  1J5E B;  3CC7 V;  5KHK A;  1CEZ A;  2VWK A;  2EIK C;  4YXW G;  4YJ3 B;  5JQG B;  3CC4 V;  4BIZ A;  1N4C A;  3CRC A;  1ZSP A;  1OCC B;  2DYS C;  4FFB A;  4DV4 O;  1VQN V;  4Z2W A;  1L0L H;  4JYA O;  1K9M W;  1TUE B;  2YXH A;  3BA8 A;  4FPP A;  1AIL A;  5CB4 B;  2UXD O;  2B9Z A;  1HNX O;  4FMT A;  1VQ5 V;  2Y4U A;  3APO A;  3MHS C;  4PJ0 Z;  2PZS A;  1CP9 A;  3WFV A;  1K8A W;  2N74 A;  1OCO B;  3JAK A;  2BOB C;  4K0K B;  1RM1 C;  5K1P A;  2E74 B;  3RVZ A;  1OHH G;  4TV9 A;  4DR7 B;  3CCL V;  3E8H A;  1ARO P;  1WAZ A;  5JVD A;  3EVK A;  4MTF A;  5LP6 C;  3U11 A;  3OMI B;  5CA3 A;  4AIL C;  1R73 A;  4O4I B;  3ZIA G;  2YIB A;  1E1Q G;  2ZXW B;  1GN2 A;  1M57 B;  4YHH O;  2OTJ V;  3OM3 B;  1N0N A;  2PI5 A;  3B77 A;  3LNM B;  4MSW C;  2O57 A;  4I0X B;  1GK9 A;  4J42 A;  1VQ6 V;  4BW5 A;  2F4V O;  1W59 A;  3IFX A;  1S0V A;  2N04 A;  4GKK O;  1Q6H A;  4LF4 O;  3QO5 A;  4ASU G;  1VF6 C;  3RGB A;  1MAB G;  3RWR D;  2ZDI A;  3SR2 C;  3A0B Z;  3CCE V;  4MVQ A;  3RYF A;  1WP7 A;  2UXD B;  4RUF A;  1P4R A;  3SJB C;  5TIS Z;  1YVW A;  4EFE A;  4DUY B;  5LOV B;  4JAA A;  3CP1 A;  4WFG A;  1EZJ A;  3BY6 A;  1QU7 A;  1IUR A;  2KG7 B;  1ZAU A;  3L72 H;  5H6R A;  3QTC A;  4J7J A;  1F4M A;  2G38 A;  1Y76 A;  3ZHR A;  4JI8 O;  2Q7G A;  2IM9 A;  2AZ0 A;  5L3E A;  3RYC B;  1M56 B;  2DOS A;  4NKG B;  3ABK C;  4O4J A;  4YY3 B;  3J81 N;  1WPB A;  4GT1 A;  5KMG B;  1B3Q A;  1WJZ A;  4JTA B;  1BSM A;  1G8M A;  2QTS A;  1BS3 A;  2YEV B;  3CRA A;  2EIM C;  3STL C;  3RYH B;  1XMO B;  3K9A A;  3E35 A;  5A9G A;  2F95 B;  4YHH B;  5EIB C;  1IBM B;  3H1J H;  3OTF A;  1SQG A;  2A0L A;  2JS3 A;  1NTM H;  2EIK B;  3TCU A;  4FLZ A;  1JVM A;  4DR3 O;  3CE2 A;  2A9H A;  4EB6 A;  1ZL8 B;  2W6J G;  3ZJZ A;  1K4C C;  2F4V B;  3AG1 C;  5L3F A;  1JJ2 U;  3K5O A;  5CBH A;  2VRZ A;  3CJH A;  3G4S V;  1B04 A;  2UU9 B;  3B09 A;  2P4V A;  2F23 A;  4DV1 O;  4I55 B;  3HKC A;  2YI8 A;  1NR7 A;  4TT3 G;  4B3S B;  3WG7 C;  1N8R W;  1R3L C;  2GDS A;  3H1K H;  1COW G;  2A3Q A;  3IGA C;  5BZB A;  4KP4 A;  1PKX A;  2ETN A;  1GM8 A;  2W0F C;  1J95 A;  3DTU B;  1NJI W;  4LNU A;  1XQ8 A;  4QE9 A;  3CXC U;  1Y74 A;  4O2B B;  2HLD G;  1XOU A;  1QNM A;  4UCU A;  3RW0 A;  3R65 A;  2ZKO A;  4CH4 A;  1AJP A;  4F4L A;  3AG4 C;  3FYE B;  4LFB B;  1Z2G A;  3CRM A;  2XAS A;  3LDE A;  1NKD A;  3OR7 C;  1SA0 A;  2CTW A;  3ABM C;  1K5Q A;  2LO1 A;  2QGN A;  3BVO A;  2XT9 A;  1BZK A;  3A2F A;  2LW1 A;  1GMG A;  3KCY A;  3U0Z A;  2BOC C;  2N05 A;  1IX9 A;  3ASN C;  1K92 A;  4IYI A;  5D5P A;  5KHH A;  4MVR A;  3PJS K;  4QE7 A;  4F6E A;  1XMQ O;  4EEQ A;  4BAY A;  4DR3 B;  3L9D A;  1QR9 A;  3CRQ A;  5DEC A;  4EFB A;  1Q5O A;  2QWP B;  3T4D A;  3OTO B;  4J10 A;  4RO2 A;  4DV1 B;  1JX9 A;  1Q81 W;  1JJO A;  2HVJ C;  4X62 O;  2WAM A;  5IYD O;  4K8X A;  4PI0 A;  2XAJ A;  1M5I A;  2UXC O;  4J9Z B;  5IDJ A;  4GUN A;  2ZE7 A;  4WBN A;  4PI2 A;  3S3W A;  1GKF A;  1Q43 A;  3W7S A;  4LF9 O;  3Q4H B;  4JI6 O;  2ITD C;  2UXB O;  5H6Q A;  2A79 B;  1XNR O;  1SQB H;  1F7Y A;  5EC2 C;  1K7D A;  5JVD B;  1IXB A;  3OEH G;  2DE0 X;  3CHX A;  4X8A A;  3ZRV A;  2JRI A;  1L1F A;  1SRY A;  4DR5 O;  1N36 O;  5LXT A;  2JVD A;  1N33 O;  1WB8 A;  1YJ9 V;  4MVZ A;  4ZI7 B;  1FXK A;  4Q20 A;  4X66 B;  3TET A;  4I7Z B;  3HB3 B;  4PDL A;  2MK3 A;  4UB8 Z;  5IE9 A;  1XMQ B;  3QNE A;  4JI7 O;  4BIO A;  5LHI A;  2WLL B;  2VQE O;  3GB7 C;  2BE3 A;  1YJW V;  1FS0 G;  1WB7 A;  4CC6 A;  5LHG A;  2KKW A;  3DC5 A;  4XDL A;  2GTS A;  2QM4 A;  3HKD B;  4X64 O;  3ZRS A;  1JMK C;  1WA8 B;  3ZED A;  4HAM A;  2ZNJ A;  3L70 H;  4DUZ O;  3N2K B;  2DYR B;  5EBW C;  3B4S A;  1W0K G;  3HPL C;  4R7C A;  4LC1 A;  1CPY A;  5IWA B;  1I08 A;  1S5J A;  3JSL A;  1Q6U A;  1EM1 A;  4WFF A;  2LGQ A;  1YIJ V;  2YI9 A;  4HNA A;  2CE4 A;  1OCO C;  1HDJ A;  3QO7 A;  1U97 A;  5L3C A;  2MW2 B;  4LF9 B;  4H13 B;  2PTM A;  5FLX N;  2Q9L A;  4TV8 A;  2Q73 A;  4GX0 A;  2HJD A;  2DW4 A;  2ZQM A;  5FPO A;  1UJW B;  1VF7 A;  1Y66 A;  3GVM A;  4JTC B;  2AGA A;  1N34 B;  3LNN A;  1XL6 A;  3EHB B;  4NYK A;  2QWN B;  2YXL A;  5E1A C;  3UCS C;  2Z5U A;  1K3E A;  4DR1 O;  4TWK A;  1N33 B;  4YJ2 A;  3JAS B;  1DLB A;  3C3T A;  2HG5 C;  2ZIM A;  2ZXW C;  5BR8 O;  3RN4 A;  1YI2 V;  5J2U A;  5JCO A;  1XNQ O;  2EX3 A;  3OR6 C;  1L8D A;  1SZT A;  5EBM C;  4UCO A;  2X0L A;  5KUK A;  4LFC B;  2WWW A;  5J2T B;  2IBZ H;  4DV7 B;  4XDK A;  4DV5 B;  3UQ8 A;  4FLW A;  3ASO B;  2VQE B;  3G80 A;  4LF5 O;  2GUZ B;  2OYQ A;  2CAZ C;  3CJH B;  2XAF A;  4NXM B;  3OD4 A;  2IU3 A;  4PEL A;  3T4Z A;  3J80 N;  4JI0 O;  4X64 B;  5IYZ A;  4R8C A;  3FB8 C;  1FD9 A;  3CCS V;  3SPI A;  2HVK C;  5C93 A;  4RUE A;  3MHH C;  3SYA A;  3JD0 A;  4JV5 B;  2YIB D;  1KBH A;  2HJF C;  3L75 H;  4J80 A;  4WFA V;  3OGC C;  4LNU B;  3CCV V;  5IJ0 A;  1PNL A;  1HNW O;  5A2Q N;  2DWE C;  3L74 H;  3RFR A;  3J7A U;  1FPO A;  5B1A C;  1IBK O;  2E5L O;  5JH7 B;  3APQ A;  1M56 C;  4TUY A;  1GN6 A;  4MTX A;  4JYC A;  5CA1 A;  1YZB A;  2PUS A;  4QJF B;  2WLK A;  4GCZ A;  4L8J A;  5E79 Z;  1RP3 B;  2ZIO A;  2JGD A;  1BT8 A;  3W7T A;  5CA0 A;  3NXS A;  4K35 A;  1GAX A;  2V4D A;  4BIU A;  2Q8V A;  4DR1 B;  1I0H A;  3AG7 A;  1QCE A;  1VQ9 V;  1R6T A;  4A5U B;  2CGN A;  3E86 A;  3HKE B;  4DV6 O;  4DR6 B;  3P32 A;  3K5N A;  3E8F A;  3OMA B;  3TXQ A;  3OAA G;  2UXN A;  1TUB A;  4FM1 A;  1ZLZ A;  3ZN0 A;  3OGI B;  1PP9 H;  5LHH A;  3IJ4 A;  4LWS B;  3CCJ V;  1UFI A;  4JTD B;  3CCR V;  4FLV A;  2EZO A;  3OMN B;  1DF4 A;  2P5O A;  4D7T A;  4JI4 B;  5LMU O;  4U3J B;  1K97 A;  2DQ0 A;  1PPJ H;  3WB0 A;  3QF7 A;  3B2E E;  3ZRW B;  2FL4 A;  4YIP A;  4WBN B;  4JI3 B;  1Q3E A;  1Q6I A;  4DW0 A;  4UCT A;  1S72 V;  1VIB A;  2CTQ A;  4LFA O;  4MTG A;  1X4T A;  3RBZ A;  3LDD A;  1S3J A;  4OX9 O;  4QNH B;  3CS5 A;  2NN4 A;  2YXY A;  4GZR B;  3BFR A;  5B1B B;  5GTI Z;  4PA9 A;  5HFM A;  2E76 B;  1KB9 F;  4UV8 A;  3P3N A;  3UO3 A;  4JI5 O;  1MOF A;  2QWQ B;  4OPA A;  1R3I C;  1VQL V;  2B5U A;  5ITZ A;  2HKO A;  1KP3 A;  1O9H A;  2GV9 A;  3I56 V;  3TXS A;  3G71 V;  4OPH A;  2OWO A;  3NR7 A;  4UUJ C;  2UUC B;  5KLV H;  4DV6 B;  4AQY O;  3K59 A;  3IAY A;  3K08 A;  1HP8 A;  1NS1 A;  1W0J G;  2UXX A;  3ETD A;  4O4H A;  5LGU A;  2BTO A;  2WA3 A;  2CK3 G;  1QLE B;  3OFN G;  1BGY H;  1MZE A;  3ABT A;  4NB5 A;  1AP6 A;  5B66 Z;  4X1K B;  2UUB O;  1AI4 A;  4O2A A;  4DV4 B;  1S77 D;  3L71 H;  2AXT Z;  4JAU A;  4JYA B;  2Q67 A;  1OJH A;  5IJ9 B;  4I9Q A;  1K73 W;  2XAH A;  3JAW A;  3SYQ A;  1HNX B;  2PI4 A;  3C3S A;  5LBQ A;  4FZ1 A;  5L3D A;  1MZF A;  5BXZ A;  1LUW A;  4UVB A;  4DV0 O;  2WLH A;  4J7K A;  4LFA B;  1H2N A;  4DV3 O;  5B1A B;  4UFZ A;  1KEC A;  2K9P A;  4HBN A;  4ZOL A;  4LF8 O;  4OGQ B;  2PGG A;  3K3W A;  2H94 A;  4D6T H;  3T1H O;  1GM7 A;  2CH7 A;  2E3C A;  3P3P A;  5LGN A;  1Q7Y W;  1SES A;  1XI1 A;  4FM2 A;  4J11 A;  5LL6 Y;  2R9I A;  3H01 A;  3LUT B;  1YIT V;  4CS2 A;  1K4D C;  5DN6 G;  1I5Y A;  4LF6 O;  1JOY A;  4CS4 A;  5KHI A;  3K0G A;  2WA4 A;  4KHP O;  1MSD A;  3O65 A;  1JQ0 A;  4FZ0 A;  4I9W A;  1Y4M A;  2YUA A;  3RVY A;  3VQW A;  1KUQ A;  1KMI Z;  4H0L B;  1DF5 A;  3CSX A;  4JZ2 A;  3M8A A;  3N2G A;  4KL1 A;  3A0R A;  1TGO A;  2QE7 G;  4CBC A;  1VQK V;  2H3O A;  2F66 C;  1L0N H;  4LF7 O;  3E8B A;  2X6B A;  3TJT A;  1AJQ A;  1WP8 A;  4MW8 A;  4R6Z A;  2QWO B;  4E2L A;  4GKK B;  4UCV A;  5CBF A;  4LF4 B;  1AP5 A;  4FLX A;  3VBB A;  2PYJ A;  3QG5 A;  1PV0 A;  5HFL A;  1VAR A;  1SKV A;  2W0X A;  4X1Y A;  3D3Q A;  2EJR A;  2DYR C;  1QR8 A;  1TVK B;  1MSW D;  3A8T A;  5IJ0 B;  1XBL A;  3E8G A;  5IYB O;  3AG3 B;  4WCE V;  3EXA A;  1NBM G;  3M99 B;  4DV0 B;  1FAF A;  3FB6 C;  1PM9 A;  4IIJ B;  4JI8 B;  2ZNI A;  3S3X A;  3T1H B;  2CTR A;  3B8N A;  4GKJ O;  2OIG A;  1EN6 A;  2DWD C;  2LFS A;  2JGD B;  1H2S B;  4DV2 O;  1EZV H;  1NU1 H;  3TK1 A;  3HKB A;  4QGP A;  1UPG A;  1SC5 B;  3SJC C;  1NH2 D;  2ZE6 A;  3T1Y O;  4QPJ A;  1RSO A;  1H2L A;  4G27 B;  1PL0 A;  4P2Z A;  3WU2 Z;  1SF9 A;  4X1I B;  4JAV A;  4F6R A;  2YSU B;  3ZMS A;  3W7W A;  3GWK C;  1FXH A;  2D2C B;  1O9G A;  4UV9 A;  1B6Q A;  2Q6A A;  1VQ4 V;  3GWO A;  1TUB B;  3CMA V;  3ASO C;  2BSK A;  1R6N A;  2GHY A;  4FFB B;  1GH6 A;  1S76 D;  4DW1 A;  5JWP A;  4PDR A;  1P84 F;  4IT5 A;  3UKM A;  1OV9 A;  1ZUQ A;  3RT3 C;  3JAM N;  1ZTE A;  1JFF A;  3OE7 G;  5JQG A;  5KHJ A;  4XBF A;  2B1I A;  2V7Q G;  4GX1 A;  1QQC A;  2F93 B;  1BCC H;  3ZHU A;  3JAR A;  1YEW A;  3ZMZ A;  1AI6 A;  1YDX A;  1KKC A;  1AB3 A;  3JAK B;  5GON A;  3E22 A;  1E79 G;  1FKA O;  3ZN1 A;  1BMF G;  1YTF D;  2H8P C;  5CB4 A;  1VP7 A;  4TV9 B;  4PDV A;  1XUQ A;  1M4U A;  2QKC A;  4DR2 O;  4DV2 B;  3EFF K;  4N21 A;  2PYL A;  1Z5V A;  1KKD A;  4GX5 A;  1ORQ C;  1T5E A;  2HEP A;  2BTQ A;  1YCI A;  3K03 A;  1US6 A;  1RPR A;  1SQV H;  3ZBH A;  1P7B A;  3M7M X;  3ZHS A;  4CS3 A;  2VQF O;  2A06 H;  4X89 A;  5D5Q A;  5GW7 A;  1I94 O;  2A7W A;  4U3F H;  1BE3 H;  1MNG A;  4E4E A;  4Z1M G;  3JD3 A;  3ETG A;  3BAA A;  2P7T C;  5CBG A;  1EN5 A;  4O4I A;  5KHG A;  1AR1 B;  3OW2 U;  5JJJ B;  2P67 A;  3D36 C;  5EYP A;  3MAQ A;  2QTO A;  2Q7E A;  2IW5 A;  4FK5 C;  1VQO V;  4BWA A;  3BRC A;  4X62 B;  3ZHV A;  4OXS A;  4B3R O;  1R3K C;  3RYF B;  2WPD G;  4NTX A;  3ETE A;  3CME V;  3CX5 F;  4ABM A;  2EJ7 A; 
#chains in the Genus database with same CATH homology
 3QO5 A;  4MVU A;  2QM8 A;  4ASU G;  4UVA A;  1MAB G;  2ZDI A;  4BIU A;  3FB7 C;  2WSS G;  3CCE V;  4MVQ A;  2P6J A;  1QCE A;  3VOU A;  4RUF A;  3FB5 C;  1P4R A;  1VQ9 V;  2EIL B;  2JEU A;  3E86 A;  3K06 A;  2JJ1 G;  1QBZ A;  3LSQ A;  3P32 A;  2OTL V;  5L3B A;  2ZD9 A;  4PA7 A;  2F43 G;  3E8F A;  3CP1 A;  3OMA B;  5B1B C;  3W7U A;  3OAA G;  4WFG A;  4UVC A;  1EZJ A;  2UXN A;  2V1D A;  3BY6 A;  1GM9 A;  3ZN0 A;  2C2A A;  3QO8 A;  5H6R A;  1F4M A;  1ROP A;  5LHH A;  2JIZ G;  2EIN C;  4GX2 A;  3CCJ V;  5L3E A;  1OCR B;  1M56 B;  4JTD B;  5B1O A;  2EZO A;  3CCR V;  3BEH A;  3OMN B;  4LBE C;  5FL7 G;  4ZBM A;  1DF4 A;  1R3J C;  2Y48 A;  3ABK C;  5B3S B;  2XOK G;  4QIW F;  1K97 A;  2DQ0 A;  4FIP C;  3SYP A;  1ZWI C;  3ZCC A;  4GT1 A;  1FXK C;  1V54 C;  1AI7 A;  3D36 A;  3ZRW B;  4MVM A;  4JTA B;  1G8M A;  4R50 A;  4PA4 A;  4H33 A;  3STZ C;  2YEV B;  4PDM A;  1NVP B;  4P9P A;  2QEX V;  2EIM C;  4X88 A;  1NVP D;  2Z3Y A;  3ZRX A;  3STL C;  2XAG A;  1VQP V;  3JCZ A;  1QLE C;  3OUF A;  4HYO A;  4JYB A;  3K9A A;  1S72 V;  2HR3 A;  3E35 A;  3ZRW A;  1RPO A;  3FYI B;  3W7X A;  4MTG A;  3SPG A;  3RBZ A;  3LDD A;  2ITC C;  2YEV A;  1S3J A;  2A0L A;  4QNH B;  1PNM A;  3SYC A;  3K04 A;  1H2G A;  2EIK B;  5B1B B;  3MD0 A;  3TCU A;  2OCC C;  1JVM A;  4WFH A;  3T2M A;  4PA9 A;  5HFM A;  2A9H A;  4UV8 A;  2W6J G;  1QVG U;  3ZJZ A;  3AG2 C;  1K4C C;  1FXV A;  3AG1 C;  1MOF A;  5L3F A;  1Q86 W;  1JJ2 U;  1R3I C;  1VQL V;  4I5S A;  5CBH A;  2B5U A;  2EIN B;  4P9O A;  3CYO A;  3G4S V;  2HKO A;  1W2B U;  3ABU A;  5KA5 A;  1KP3 A;  3CCM V;  1WPX A;  5LGT A;  5L3G A;  5IYC O;  2IH3 C;  3ABK B;  1NR7 A;  2JJ2 G;  3B8M A;  3ABL C;  4TT3 G;  3WG7 C;  1V55 B;  4JAS A;  3I56 V;  1N8R W;  5IY5 C;  1R3L C;  3G71 V;  4JGS A;  4KFM A;  4UUJ C;  1YHQ V;  1COW G;  1YJN V;  3IGA C;  5BZB A;  4KP4 A;  1PKX A;  1GM8 A;  1BHB A;  3K08 A;  2W0F C;  3IC7 A;  3ZMU A;  1W0J G;  2EIM B;  1J95 A;  2UXX A;  3DTU B;  3ETD A;  3SYO A;  1NJI W;  5LGU A;  2CK3 G;  2Q68 A;  1QLE B;  3OFN G;  4QE9 A;  3CXC U;  2B1G A;  2HLD G;  3ABT A;  1OCZ B;  2W6I G;  3RW0 A;  3R65 A;  2QKS A;  4KUM A;  1QVF U;  5B1N A;  4DO2 A;  1AJP A;  4F4L A;  3AG4 C;  1AI4 A;  2ATK C;  3FYE B;  1K34 A;  1PD3 A;  1S77 D;  3E2E A;  2AHZ A;  2XAS A;  4JAU A;  3X2Q C;  1MG1 A;  3LDE A;  3AG1 B;  1OCC C;  1K33 A;  2Q67 A;  5CMU A;  1K73 W;  4RAI A;  2XAH A;  1NKD A;  4JF3 A;  3OR7 C;  2JDI G;  3CC2 V;  2WLI A;  3SYQ A;  2LFR A;  3ABM C;  1K5Q A;  4G28 B;  2PI4 A;  3JD1 A;  3CCQ V;  5LBQ A;  3WG7 B;  4MT8 A;  5L3D A;  1DTO A;  2D3O W;  1GMG A;  3E83 A;  2BOC C;  4UVB A;  4XDJ A;  5H9C A;  3KG2 A;  2WLH A;  3ASN C;  3D3I A;  1KQS U;  1K92 A;  1PNK A;  2ZR3 A;  4WF9 V;  4MVR A;  3PJS K;  4QE7 A;  2GSM B;  5EK0 A;  5B1A B;  1WLE A;  1KEC A;  4JPR A;  2JK5 C;  3CPW U;  3K3W A;  2H94 A;  4BAY A;  1GTO A;  2Y69 C;  1GM7 A;  2IJK A;  4CZZ A;  5LGN A;  1Q7Y W;  2IJI A;  1SES A;  4TSF G;  4RQE A;  1QR9 A;  1KD1 W;  2Q69 A;  1FFT B;  1H38 A;  2XAQ A;  4HZ3 A;  3T4D A;  2AHY A;  1G4Y B;  3AG4 B;  2R9I A;  3H01 A;  3LUT B;  4RO2 A;  2M7W A;  1YIT V;  5DM6 V;  1JX9 A;  2DQ3 A;  4H37 A;  1Q81 W;  1K4D C;  5DN6 G;  1I5Y A;  1JOY A;  3X2Q B;  2HVJ C;  2WAM A;  5KA6 A;  3K0G A;  4MW3 A;  5IYD O;  1Q82 W;  3AG3 C;  3DGE A;  2XAJ A;  1JQ0 A;  4I9W A;  3G6E V;  1LNQ A;  3OEE G;  1XL4 A;  1Y4M A;  4J9Z B;  3OUS A;  3RVY A;  5IDJ A;  1M90 W;  3ABM B;  1DF5 A;  5J9P C;  3A0R A;  2EIJ C;  2QE7 G;  1GKF A;  3ML0 A;  4CBC A;  1M57 C;  1F4N A;  1R6K A;  1M1K W;  1VQK V;  3P30 A;  3W7S A;  4MVS A;  1S5H C;  3ASN B;  4WFE A;  3E8B A;  2WLM A;  2X6B A;  3I55 V;  1VQ7 V;  1AJQ A;  2ITD C;  4MW8 A;  4R6Z A;  4U7N A;  1KC8 W;  5H6Q A;  4E2L A;  2LP7 A;  2IU0 A;  2A79 B;  1YSC A;  5CBF A;  2Y69 B;  2EZP A;  3VBB A;  2EBO A;  1M9N A;  5EC2 C;  5HFL A;  2KB1 A;  2NLJ C;  1K7D A;  3E89 A;  1JPX A;  1KP2 A;  3OEH G;  1BL8 A;  2EJR A;  3JYC A;  4RQF A;  2DYR C;  4LP8 A;  1FXK B;  1QR8 A;  1V54 B;  4X8A A;  2X6A A;  2QM7 A;  1MSW D;  1BHA A;  4WFB V;  1OZ0 A;  1SET A;  3ZRV A;  4DXW A;  1L1F A;  1I5X A;  1SRY A;  3E8G A;  2X7R B;  3SPJ A;  5IYB O;  1ENV A;  1YJ9 V;  1H8H G;  3AG3 B;  4G2K A;  4MVZ A;  4WCE V;  1FXK A;  1NBM G;  3M99 B;  4Q20 A;  4MS2 A;  1F51 A;  3TET A;  4MVO A;  3HB3 B;  3SPC A;  4PDL A;  3CCU V;  1THZ A;  2EIJ B;  3FB6 C;  2MK3 A;  2ZR2 A;  2OT5 A;  3QNE A;  2QA4 V;  4N23 A;  2OCC B;  5LHI A;  2WLL B;  3SJQ C;  3AG2 B;  3B8N A;  3GB7 C;  1IXM A;  1YJW V;  1FS0 G;  2DWD C;  2LFS A;  2WLN A;  5LHG A;  3UM7 A;  4XDL A;  3TK1 A;  3ZRS A;  4ZKI A;  1NH2 B;  2HFE C;  1EBO A;  2K1E A;  4J9Y B;  1NH2 D;  2WLL A;  1EFR G;  1HWY A;  4HAM A;  2IJH A;  4PA3 A;  4QPJ A;  4MTO A;  2IH1 C;  3ABL B;  4G27 B;  1PL0 A;  4P2Z A;  5IY5 B;  3LDC A;  1AJN A;  4JAV A;  2DYR B;  2YSU B;  3ZMS A;  3LSS A;  3W7W A;  3K0D A;  5EBW C;  1FXH A;  2NNU A;  3SPH A;  3FKS G;  1W0K G;  3HPL C;  4UV9 A;  4R7C A;  1B6Q A;  4LC1 A;  2Q6A A;  1JCH A;  1VQ4 V;  1CPY A;  3GWO A;  3CD6 V;  3JD4 A;  4L87 A;  3CMA V;  5EBL C;  3ASO C;  4P30 A;  4WFF A;  1YIJ V;  4EKW A;  3F7V C;  1OCO C;  3CC7 V;  1R6N A;  3QO7 A;  2GHY A;  5L3C A;  1CEZ A;  1S76 D;  1NQT A;  2EIK C;  4YXW G;  4U7O A;  4GX0 A;  4PDR A;  3CC4 V;  4BIZ A;  1NR1 A;  2DW4 A;  2JEX A;  1F23 A;  2ZQM A;  1UJW B;  3UKM A;  1Y66 A;  1OCC B;  2R9R B;  2DYS C;  3OE7 G;  1VQN V;  4JTC B;  2WLJ A;  1XL6 A;  3EHB B;  4XBF A;  2B1I A;  5E1A C;  1K9M W;  1V55 C;  2Z5U A;  1K3E A;  1TUE B;  2V7Q G;  4FJC C;  3F5W C;  2XND G;  4GX1 A;  4TWK A;  4FPP A;  1DLB A;  2HG5 C;  2ZXW C;  1YI2 V;  3ZMZ A;  1AI6 A;  1E1R G;  3ZMT A;  2P90 A;  3OR6 C;  4FMT A;  1E79 G;  1SZT A;  5EBM C;  2X0L A;  4LCU C;  5KUK A;  1YTF B;  2WWW A;  3ZN1 A;  1VQ5 V;  1BMF G;  1YTF D;  2H8P C;  3MHS C;  4XDK A;  1OCZ C;  4QPK A;  3ASO B;  4PDV A;  1CP9 A;  2ZDI C;  3WFV A;  1K8A W;  1OCO B;  2BOB C;  2XAF A;  5KUM A;  1VQ8 V;  1RM1 C;  2IU3 A;  3RVZ A;  3EFF K;  4N21 A;  4PA6 A;  3F7Y C;  1OHH G;  4PEL A;  3T4Z A;  1KKD A;  4GX5 A;  1QLN A;  1ORQ C;  1AI5 A;  3CCL V;  3K03 A;  3E8H A;  1RPR A;  1ARO P;  4R8C A;  3FB8 C;  3CCS V;  4UXN A;  3SPI A;  2HVK C;  2DYS B;  5C93 A;  1GO3 F;  4RUE A;  3AEI A;  3MHH C;  3SYA A;  1H8E G;  3JD0 A;  2EIL C;  1P7B A;  4MTF A;  3OMI B;  5CA3 A;  3ZMV A;  2HJF C;  4X89 A;  5EC1 C;  1R73 A;  5GW7 A;  3OGC C;  4WFA V;  3CCV V;  3ZIA G;  1PNL A;  1E1Q G;  2ZXW B;  1M57 B;  2DWE C;  2OTJ V;  4Z1M G;  3JD3 A;  3ETG A;  3OM3 B;  2PI5 A;  5B1A C;  3B77 A;  3LNM B;  4MSW C;  2P7T C;  2FTK A;  5CBG A;  1SER A;  1GK9 A;  2IJJ A;  1AR1 B;  1OCR C;  1M56 C;  2P67 A;  3OW2 U;  1VQ6 V;  2QTO A;  5CN0 A;  4BW5 A;  1K5S A;  3K79 A;  2IW5 A;  4MTX A;  2X6C A;  4JYC A;  4FK5 C;  5B3S C;  1VQM V;  4QJF B;  3T1C A;  1VQO V;  2WLK A;  4GCZ A;  3JD2 A;  4OXS A;  3IFX A;  1S0V A;  1RM1 B;  1R3K C;  2WPD G;  3W7T A;  3ETE A;  2WLI B;  3NXS A;  3CME V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...