3STLC

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3stlC00
3ABMC 4OXSA 4ZBMA 2ITCC 3AG4C 3SPCA 3SPGA 1R3IC 4TWKA 4PA7A 3EFFK 3RBZA 4MVUA 5E1AC 3SYPA 3UM7A 3X2QC 2W0FC 5EC2C 2QKSA 4QE9A 3K0GA 3LDDA 3TCUA 3LUTB 2DYSC 3SYAA 1OCZC 3IFXA 2BOCC 3OR6C 4LP8A 2Q68A 4WFHA 2WLJA 3SYCA 2EINC 4EKWA 3OUSA 3BEHA 3E89A 3K06A 3T2MA 3R65A 5EBWC 2A79B 2DWEC 1JVMA 1K4DC 4F4LA 4QE7A 1M57C 4R7CA 4JTDB 2R9RB 4PA9A 4QNHB 2P7TC 2WLHA 3FB5C 4MTOA 4MVQA 5EK0A 4P9PA 2Y69C 2NLJC 4R8CA 2X6CA 4WFFA 3OGCC 1LNQA 4JTCB 1XL6A 4PA3A 3LDCA 2KB1A 2HVJC 3KG2A 4KFMA 3TETA 5CBGA 4WFEA 3RW0A 2Q69A 2HG5C 4MVZA 3T1CA 4CBCA 3ZJZA 4MW8A 2AHZA 5EC1C 3HPLC 2X6AA 4X8AA 2ZD9A 2WLNA 2WLLA 4MVRA 3AG2C 1QLEC 1V55C 4RO2A 1OCOC 2QTOA 5J9PC 2EILC 2EIMC 3IGAC 1OCRC 3ASOC 3SJQC 3OR7C 4G28B 5CBFA 4XDLA 3SYQA 5BZBA 4MW3A 4LBEC 4DXWA 2Q67A 4RUEA 5KUKA 3E8BA 3K0DA 3JYCA 1V54C 3E8HA 2BOBC 2H8PC 3E8GA 3AG1C 4XDKA 2DYRC 4X89A 3SPIA 4MVSA 3VOUA 3F7VC 4H37A 3ABLC 2YEVA 3K04A 5EBLC 5B1BC 4LCUC 4PA4A 5B3SC 3FB8C 3SYOA 3T4ZA 3ZRSA 4HYOA 4MSWC 2JK5C 1S5HC 2AHYA 5B1AC 2DWDC 3K08A 3WG7C 3FB6C 3F7YC 1XL4A 4BW5A 2HVKC 4MS2A 4GX0A 4MTGA 2ITDC 1K4CC 1R3JC 2WLMA 3OUFA 2ZXWC 4H33A 3STZC 3ABKC 2HJFC 3SPJA 3AG3C 5EBMC 1OCCC 3F5WC 2K1EA 3GB7C 3LNMB 4JTAB 4G27B 4MTFA 3FB7C 4MVMA 4P9OA 2WLLB 3E83A 3UKMA 1ZWIC 2IH1C 4PDRA 4P2ZA 4J9YB 4PDVA 1R3LC 4WFGA 5IY5C 1M56C 4GX5A 4I9WA 1G4YB 2A0LA 2WLIA 4MVOA 4R50A 2A9HA 4GX1A 2IH3C 4UUJC 3SPHA 4J9ZB 1KKDA 3K03A 2ATKC 3PJSK 2EIJC 2Q6AA 4P30A 4RAIA 5CBHA 1R3KC 1BL8A 2EIKC 2WLIB 1ORQC 4GX2A 3ASNC 1P7BA 2HFEC 2OCCC 3E8FA 3LDEA 4PDLA 4HZ3A 4PDMA 3RVZA 4R6ZA 3STLC 4RUFA 2WLKA 4X88A 3T4DA 4PA6A 3E86A 5KUMA 1J95A 4XDJA 3RVYA 2X6BA
chains in the Genus database with same CATH superfamily
4OXSA 2YXYA 3DXRA 1N32O 4KHPO 3D36C 4PA7A 2L35A 4GT1A 3AK3A 1GAXA 1PM9A 1ZLZA 1L0NH 4DR5O 3ABTA 2N04A 5FNVA 3DC5A 1EZJA 1ZSPA 4TSFG 1WJZA 4UCUA 4DR1O 4UVAA 3QTCA 3JD2A 4ABMA 3JALA 4MVQA 2IJIA 3JARA 1BHBA 2YIAA 1AVMA 4I9QA 1Q86W 3TK1A 4JTCB 1M1KW 1Q43A 2E74B 4ICGA 1XILA 4D7SA 4NXNO 3VQXA 5BMVB 4DYLA 2WLLA 4GZRB 2E3CA 2EIMC 3IGAC 5B1OA 4LFAO 2P4KA 3J7AU 2N74A 3BPZA 3D3QA 4DR2O 3N2GB 3CP1A 5GONB 5KHGA 1YJNV 1G1XB 4O4LB 1NZ6A 5IJ0A 3RYCA 5B1BC 1NVPD 1KKCA 3ZRSA 1SESA 1S77D 4HYOA 2AHYA 1THZA 2LW7A 4EFBA 5IDJA 4UB6Z 3W7SA 5KHIA 1GMGA 4JI3B 4FFKA 2MK3A 4OPHA 3CC4V 1M9NA 4QJFB 2QWRB 1H8EG 3ABKC 2R72A 4PD4F 1K73W 4DR6B 1K33A 2Z5UA 1N36O 5IY5C 1M56C 4I0XB 3X2QB 4ZOLB 2EIKC 1P7BA 3RYHB 3N2KA 5LBQA 1KMIZ 4L87A 4K0KO 5L3EA 3C3SA 1BGYH 4XDJA 1IBLO 2CTWA 5CB4A 4ZHQA 5FL7G 1GRJA 1BE3H 4MVUA 4HBNA 2W0FC 3W7XA 2R9AA 3B77A 5ITZB 1LR1A 3HKEB 2DYSC 4X66O 2H3OA 4TQDA 1PNKA 3IFXA 4CS2A 1AI5A 4K8ZA 3DTUB 2AZ2A 1OCOB 3BY6A 1JCHA 3K06A 2UXBO 1FXHA 4NTWA 4NTXA 2A79B 2PF4E 2RN9A 1M57C 1MABG 4DV3B 3ZMSA 1XNQB 1VQNV 2ZR2A 2IU3A 4R8CA 1H8HG 1H2GA 3OE7G 3VQYA 3RW0A 1IBMO 1O9GA 2XOKG 5A9GA 3CC7V 4TUYB 1IX9A 3K9AA 1V55C 5J9PC 1M93A 2KG7A 3L74H 4G28B 4I5SA 1SERA 3SYQA 4TV9B 3ZBHA 2W6JG 3VBBA 2UUCO 2BTOA 1JQ0A 1EFRG 2QEXV 1N0NA 2JS5A 4JV5B 4NYKA 4LF9O 4GKJO 4TV8A 3FB8C 3ZX6A 3RFRA 3CMAV 1KYOF 4DV5B 4DRXB 3KZIZ 1YDXA 1SC5B 2ZXWC 4BW9A 4FM1A 1HW7A 5LA6A 5IYBO 4AQYO 4MVMA 3L75H 4X62B 4I4TB 2OYQA 3OMAB 5EIBC 3S3XA 4GX5A 4J9ZB 4JASA 4FLZA 2Q6AA 3ZEDA 3CCVV 3JD1A 2QJ1A 1VQOV 2P6JA 1QVFU 3H1LH 2EINB 2EX3A 1R1BA 1J95A 1J5EB 3A8TA 5K1PA 2XUMA 2H94A 3RBZA 5FPOA 3SYPA 4YY3B 4JAAA 1BSMA 3K0GA 2QM4A 4FIPC 4CS4A 1CXZB 3M8AA 3TXQA 2BE3A 4WF9V 4R7CA 4KL1A 1FAFA 5KMGB 1XOUA 3G80A 1SQGA 1YHQV 3HR0A 4ZIBA 2KKWA 3DXRB 3CCJV 1Y76B 2DE0X 1IZ3A 4X8AA 3HKDA 2ILMA 2YI8A 3AG2C 1K34A 1GN3A 3ASOB 2ZE7A 4LFBO 5KUKA 1XDCA 1GO3F 4DV7O 1Q8IA 4B3SO 1OHHG 1AP6A 2FL4A 3L70H 5B3SC 3P32A 3JALB 4PA4A 3JARB 1S5HC 3K08A 3ZMUA 4QPJA 3BVOA 1XNRB 3AG3C 1OCCC 4WBNA 2WLLB 1SQQH 3E83A 5LYJA 4PDVA 2QWPB 2HHHO 5EYPA 4DV0B 2A0LA 2UXXA 4CH6A 2WA3A 3T1HO 3H01A 1XREA 4O4HA 1YZBA 2DQ3A 5LMNO 3JD3A 4LNUA 3CCQV 1DTOA 2E5LO 3WB2A 2JDIG 3AG7A 1F51A 2LP7A 4B3RO 2CGOA 3ETGA 2IBZH 4FLVA 3JASA 4NVPA 4H13B 4J7KA 3LDDA 3CXCU 1I0HA 3CJHB 1OCZC 3CEIA 4CC5A 1S5JA 4JAUA 5IJ9B 1L0LH 2F4VB 4X64O 3N2KB 3OGIB 3G4SV 2UUBO 1VF6A 3CX5F 1ENVA 4WFFA 4LF5O 1FJGB 5CB4B 4GYCB 1VF6C 3KCYA 4ZHQB 2GTSA 5BMVA 4BR6A 2ZE8A 4GKKB 3CRAA 1NTMH 1QLEB 5JJEB 4F6RB 3BAAA 3B8NA 1W2BU 5CBFA 4LWSA 5GONA 3SR2C 4DV2O 4PELA 4RUEA 1ROPA 2EZPA 3ZHQA 3G6BA 4YJ3B 3A0BZ 5JH7B 4Z2WA 4WFBV 3T1YO 1MZEA 1SQFA 5J2UA 1NH2B 3CCSV 3O65A 2ZDIA 3SJCC 3LSSA 2GDSA 3Q4HB 2N05A 4A5UB 5JVDB 3ZN1A 4I55B 5H6QA 2KG7B 3ETEA 3CCEV 1RPOA 5KHHA 3WB1A 2FMLA 4DUYO 2FB5A 3CCLV 1K5SA 1XMOO 4H44B 2EJ7A 5D5QA 5F2VO 2YIBD 1BL8A 1K3EA 3LNNA 4GX2A 4TV8B 1FD9A 3RWRD 1YJ9V 4BWAA 2UXDO 2ZIOA 2GTAA 1YTFB 1E1RG 1VQPV 3HKEA 4W4LA 4BIOA 5EC2C 5DECA 4E2LA 5CA3A 1GN2A 1F23A 1LUVA 3H1IH 4LFCB 4UCSA 2Q68A 3R66A 4K3AA 2B5UA 1COWG 2F93B 1OCRB 4LF4B 3BCCH 3OTFA 2DWEC 1N34O 1PP9H 3C90A 4QPKA 4P9PA 2M6YA 2RJZA 2Y69C 3QVNA 2CGNA 4X20B 1M5IA 4KFMA 4WFEA 2JS3A 2YC0A 1WLEA 1S3JA 4NKGB 4IHJB 1TAEA 4TV9A 4NR1A 4C7UA 2NNUA 3RYFA 4UV9A 4DW0A 1WP8A 4U3FH 4I7ZB 3NXSA 2P4VA 1VMGA 1SZTA 1E79G 3OTOB 3AG1B 5JQGB 3MHSC 4X89A 3F7VC 2R70A 4DRXA 2ZM6O 3LSQA 2OCCB 2YS8A 4I4TA 2M7WA 1R3JC 4JI6O 3U10A 2K1EA 3CSXA 1AR5A 3HKDB 4FZ1A 2UU9B 5GTIZ 4DV4O 4AHCA 1VQMV 4PI2A 4LH6A 1AR1B 1G4YB 3CC2V 2A9HA 3SPHA 1JX9A 4RAIA 1R3KC 3FX7A 1FXVA 1IBKO 2QTSA 4DK0A 1K92A 4Q20A 4X88A 1P84F 2EJRA 1H2SB 1N32B 4B08A 4JZ2A 2IJKA 1D2DA 5C93A 3AG4B 4JI4O 5JCOA 1R6TA 3EVKA 5JWPA 4FM0A 4UB8Z 1NR7A 4DR5B 5JCOC 1CP9A 3MHHC 5BR8O 4KXRA 1HR0O 4L8JA 5KMGA 5IWAO 2YXHA 2ZNIA 4LF7O 3FD9A 1VQ8V 3ZRWA 2PUSA 1B6QA 1FFTB 3BHPA 4LF8B 3OMNB 1PKXA 2YUAA 1AROP 1Y76A 2KQXA 2KB1A 3OAAG 1O9HA 1NVPB 1KQSU 5EC1C 2GHYA 3JASB 2QGNA 4JYAO 3OMIB 4LFAB 3ASOC 2H8PC 1K5QA 1PD3A 4FLUA 3LSUA 4KP4A 3ZHVA 3K9SA 3A0RA 3QNEA 1PL0A 3U0ZA 4JI0O 2HJFC 3SPJA 3ZHRA 1P7GA 3L72H 3QO7A 5LXTA 4G2KA 3OFNG 1N36B 5H6RA 2A3QA 4J9YB 1R3LC 3G71V 1S72V 4LWSB 1KKDA 5H9CA 5CBHA 1AILA 2E75B 3U11A 2D3OW 4K0KB 1Z5WA 1TA8A 4RUFA 1B3QA 4PA6A 5J2UB 1IBLB 3ABMC 1QNMA 2ITCC 3OEHG 4PV1B 1R3IC 3EFFK 3IJ4A 4I50B 3CJHA 1R6NA 3BA9A 3JAWB 1JFFB 2JEUA 4X66B 4UV8A 5IJ9A 1YJWV 3RT3C 3SYCA 1HNXO 2XAFA 4JAVA 4FJCC 2P5OA 3B40A 1GH6A 2P22C 2JJ1G 2VQEO 1QCEA 3FB5C 5LHHA 3OM3B 2QKAA 3TXSA 1SRYA 2Y4TA 2YIBA 4PA3A 1GN6A 3P30A 3FKSG 2P90A 1IBMB 2PY5A 1V9PA 3ZHUA 2Q7EA 3ZJZA 4F6RA 1GM9A 2QWNB 4JYCA 2JRIA 1QLEC 4CS3A 2VWKA 2K9PA 1HNWO 1JA8A 1PNLA 3H1KH 1WAZA 3JYCA 2UUCB 1V54B 4YJ3A 3UT5B 2X7RB 4OX9O 5JH7A 4EB6B 1Q5OA 2YXLA 4MVSA 4LF9B 4GKJB 5EBLC 1P49A 3ZHTA 4FPPA 3EXAA 1XHXA 4LF6O 5LHIA 4WFAV 3Q4HA 3WG7B 3TJTA 3ZHSA 2GV9A 1XL4A 5JVDA 4I55A 4AQYB 3GWKC 4JTAB 4ASUG 4P2ZA 5D5PA 4I9WA 1EZVH 4MVOA 1WB7A 3E2EA 3RYFB 4FFBA 1Q6UA 2EIJB 2YICA 2WLIB 1XMQO 1QBZA 3E8FA 4ZI7A 1EN6A 2Q0OC 2LFRA 1QLNA 4FLXA 3CCMV 5E79Z 3A0HZ 4W4KA 2EULA 2Y0PA 2UXCB 2OTLV 2QKSA 4X65O 5K1XA 4NXMB 2R9IA 3BFRA 1Q7YW 1SQBH 1N4CA 1AI6A 3KKYA 1EBOA 2F66C 4OPAA 1SETA 1BMFG 1YXBA 1F4NA 4X20A 2HLDG 2WLHA 2E76B 2RDCA 2IW5A 2X6CA 4AI8A 1NKDA 1D5NA 2Q9LA 1YI2V 1Q6HA 4JI5O 2ZNJA 4CBCA 4IHJA 4MW8A 5BY1A 4DV5O 4J42A 2ZD9A 3OD4A 2Y4UA 2QTOA 1ZUQA 4LFBB 2FTKA 2HKOA 5JQGA 4X62O 2Q67A 2LGWA 4O2AB 2ZIMA 4DV7B 3J80N 3AG1C 4B3SB 3ZRWB 3HKBB 1GKFA 1K7DA 3ABLB 3K58A 3RYIA 4UCOA 3SJBC 4NB5A 3FB6C 3E35A 3SGIA 1VQ9V 2G38A 2YIDA 1RP3B 1MZFA 1J5EO 2HHHB 5FLXN 5FPRA 1VARA 1VQKV 1H2NA 1NTKH 3T1HB 3K03A 1Q81W 5LMNB 1VQ7V 4PDLA 2ZINA 4J7ZA 2ETNA 4YJ2A 2WAMA 2Y48A 1VQLV 4H0LB 3PN1A 2E5LB 1EM1A 4B3RB 2OIEA 3AG4C 4YXWG 4IYIA 2YSUB 3UM7A 4BIUA 2OWOA 3ABUA 5LXTB 1XEQA 4IIJB 1JR9A 1S76D 1A32A 3J81N 1BCCH 4YHHO 3QF7A 5KAFZ 2F1MA 3CPWU 2UUAO 2JGUA 3CRCA 4FVMA 5EZYB 4DV1O 4LF5B 2A7WA 1GK9A 1SA0B 5CBGA 2FKXA 4O4JB 1VF5B 4BIZA 1AI4A 2VS0A 5A2QN 4DO2A 2L6LA 3K5OA 2EZOA 2ZCEA 2B1IA 4B3TO 3UQ8A 4O2BA 4DV2B 1P4RA 3K0DA 3E8HA 1H2MA 2BOBC 2ZR3A 5LP6A 1YIJV 5IY5B 5CMUA 2DYRB 4H37A 1XUQA 2LFSA 4FMTA 3T1YB 1W59A 2LGQA 4MTXA 2DWDC 5B1AB 1Q3EA 4FLWA 1XI1A 2XASA 1MG1A 2Z0AA 4RO2A 4P9OA 5HFLA 3CMEV 2CUGA 4DV6O 1KECA 1PPJH 2WWWA 1UJWB 1K8AW 4B7KA 2RNBA 4DUYB 2XAJA 1BS3A 1XMOB 1OZ0A 4EEQA 1UPGA 1RFYA 2ATKC 3ZMZA 2HFEC 3LDEA 3ASNB 5AG2A 4PDMA 3RVZA 5JJNB 4R6ZA 1R73A 3STLC 2P06A 2Q0AA 5LOVB 1WA8B 1HNZB 2UXDB 3JCUZ 1JJOA 1YCIA 4I50A 2X0LA 2DJVA 1KBHA 1KU9A 2ZDIC 3GVMA 1U97A 3JAKA 4U7OA 1DLBA 3JAWA 1JFFA 3NR7A 4TWKA 3X2QC 1FJGO 1H2KA 1FYJA 1XBLA 3L71H 1NT2B 2W6IG 3G67A 3B2EE 4N23A 2GBOA 4FFBB 4JI7O 1Y67A 4JI8O 1TGOA 3H1HH 4Z1MG 4U3JB 1N34B 1L8DA 4ZI7B 2BCCH 3CWBH 5KA6A 1LNQA 3KG2A 1JPXA 3T1CA 4D6TH 2DOSA 1Y74B 2CTQA 4UCVA 2QSAA 1YEWA 1OCOC 3GWOA 4Z1VA 2PYJA 1BT8A 1G6UA 3UT5A 4RQEA 1NR1A 5KHKA 2NR5A 4EB6A 4EFEA 1V54C 3UO2A 2F43G 1U96A 1HWYA 2O57A 4DK1A 5L3CA 3SYOA 2IU0A 2ZM6B 2FYUH 3WG7C 2QA4V 1Y4MA 2RMKB 3DC6A 3CHXA 4B7EA 4JI6B 2LJ2A 3VQVA 3F5WC 3GB7C 4G27B 4DV4B 3CXHF 3FFQA 2WLIA 1S5LZ 4BAYA 3ZN0A 2EIJC 4P30A 1HP8A 3WB0A 2QR4A 1IBKB 1ORQC 2W0XA 4DR3O 1MSDA 5LMUO 4HZ3A 2AZ0A 5KAIZ 3RYIB 2QE7G 2WSSG 4TQFA 2ODMA 5EIBD 2QWQB 3HKCB 1YVWA 4K8XA 2Q4PA 3P3NA 5GW7A 5BR8B 4YIPA 1HR0B 2WLJA 3FAVB 2EINC 4LR3A 4D7TA 5IWAB 3T2MA 4B3MO 3R65A 1PNMA 4JI1O 4ZKIA 4LF7B 3BA8A 5CA1A 1GM7A 4YJ2B 4JI2O 1L1FA 4QNHB 4KHPB 3K79A 2CTRA 3ZMVA 1VQ5V 3D8CA 5DM6V 1I94O 3JD4A 2AXTZ 4X9QA 1I5YA 2ARHA 5CA0B 3CD6V 2D2CB 2JEXA 2HG5C 3A2FA 4MVZA 1SQVH 1NBMG 5LHGA 3SDLA 4AILC 5L3GA 4O2AA 1AP5A 4KUMA 1JOYA 2HR3A 5BZBA 4DR1B 3HKBA 3UCSC 4J80A 2LW1A 1AB3A 1S0VA 3AK2A 3M99B 4XDKA 3ABLC 4DR7O 2F95B 3T4ZA 2JK5C 3APQA 4NXNB 2YEVB 4BW5A 1K9MW 3OW2U 1VP7A 4CH3A 4FK5C 3D36A 1EN5A 1SQPH 2OIGA 4MTFA 1ZWIC 4O2BB 4DR2B 2CTPA 1N8RW 1ZL8B 4CC6A 4DUZO 4GX1A 4UVCA 3I56V 5H2FZ 3PJSK 4MT8A 1RM1B 1N33O 5LP6B 1QHTA 2VQFO 1OCZB 1Q90D 4DR4O 3G6EV 2IJHA 1IXMA 3P3PA 2CAZC 4YIOA 1BQZA 3E86A 1B06A 5B5EZ 2QWOB 3RVYA 4ZBMA 4LF8O 3JD0A 3CE2A 4IIJA 3KCXA 1XQ8A 1IVSA 1NTZH 3TCUA 1AJPA 2BSKA 2V7QG 1HNXB 4RWUA 1I08A 1JJ2U 3QG5A 2CE4A 5IYZA 2VQEB 4F4LA 5EZYA 2R9RB 5J2TB 1SA0A 2MW2B 1UFIA 2CH7A 3H1JH 1AJNA 4O4JA 3JAKB 2Q69A 1SF9A 1D5AA 4NTYA 3JSNA 4WCEV 2WLNA 2YI9A 3APOA 3JCZA 1QVGU 1HNWB 2UXBB 1MOFA 1MMMA 4X1IA 4XDLA 2GUZB 1DK1A 4LBEC 4OX9B 2DYRC 3VOUA 4FM2A 1FKAO 3K04A 4LCUC 4LF6B 4IT5A 5B1AC 4JYYA 2JIZG 3H9VA 2HVKC 4MTGA 4JI3O 3OUFA 1FFXB 4IL6Z 5C8YA 3STZC 4TOIA 1OJHA 1YSCA 5EBMC 3CB2A 3ZCCA 3ZRXA 1SQXH 3UKMA 4CH4A 2IH1C 4DR6O 2YDEA 3FYEB 1G8MA 1IXBA 5IYDO 4FLTA 2BTQB 3K3WA 2ZE6A 1VF7A 1XMQB 5LOVA 4JZGA 1WA8A 3ASNC 1F4MA 3BABA 4JGSA 4U7NA 1CPYA 1FXKB 5KX5B 3E22A 2ADPA 3AK1A 2B9ZA 3BRCA 1YF2A 1TUBA 4J10A 3O9OA 2Y69B 1NQTA 1WP7A 3ZS8C 4X65B 1MSWD 1YITV 2Z3YA 3LUTB 1FPOA 4N21A 3AEIA 4U3JA 3ZRVA 1KD1W 1TVKB 1DGSA 5BXZA 3E89A 1WN7A 1HDJA 3MAQA 2QKCA 1Z2GA 1I7FA 4Q6GA 4OGQB 4DV3O 1XNQO 1KB9F 1RSOB 3OT7A 1PL4A 1Y74A 1RPRA 1VIBA 3TETA 4JI5B 1IDSA 1WB8A 1E1QG 1JMKC 5GTHZ 2QM8A 4HNAA 4CZZA 1IURA 3SJQC 1OCRC 1NU1H 2EILB 3MD0A 4UVBA 3W7UA 4QIWF 1GTOA 3HB3B 5CA1B 3SPIA 3K5MA 4JV5O 1QU7A 1XHZA 3JATA 4JYBA 4X1KA 1AR4A 4MS2A 1AJQA 4H33A 4UFZA 4X1YA 2ZE5A 2LO1A 3CRRA 2UXCO 4R50A 3IC9A 4UUJC 3FYIB 3K59A 4NXMO 1GM8A 2XAHA 2OCCC 1GN4A 1X59A 1Y66A 2JGDB 1M90W 2WLKA 4UCRA 1KP2A 1R6KA 1KC8W 3HKCA 1SS3A 3CCUV 1QR9A 2RQ6A 3SPGA 2RCVA 2WA4A 5LGUA 2CDYA 4FZ0A 4GCZA 4YY3O 2Q7GA 2JJ2G 3FAVA 3F5TA 2Q8VA 4K35A 4PJ0Z 5LGTA 4EKWA 3ZMTA 4YHHB 3ML0A 1NS1A 3QO8A 5FNVB 1K4DC 4RQFA 2XNDG 4PA9A 2UUAB 3IC7A 5CA0A 2CK3G 5EK0A 4DV1B 3CRMA 3UO3A 2XT9A 1NI8A 2PTMA 2Q7HA 3B4SA 3ICXA 2B1GA 4B3TB 3VQWA 4MVRA 3CRQA 2DMXA 4F6EA 2BSKB 3OR7C 2EIMB 3M7MX 4LC1A 5L3FA 4X64B 2UUBB 1QR8A 2UXNA 3E8GA 5IYZB 3QO5A 5L3BA 3EHBB 1VEWA 2YEVA 5B1BB 1ZTEA 2CH7B 3W7TA 1FS0G 4GLXA 5B66Z 4O4IA 5IJ0B 3RYCB 1MA1A 3F7YC 1Y6XA 2ITDC 1K4CC 1K97A 2LQTA 2JVDA 2PGGA 2F23A 1KUQA 3L73H 3ABKB 4J11A 1XNRO 2HP8A 3LNMB 2OTJV 1LUWA 1ZL8A 4DV6B 3ABMB 5KLVH 2ZT9B 2A06H 2DN9A 5TISZ 2KSDA 4WFGA 4X1IB 3THOA 1M56B 4DV0O 1RM1C 1WNSA 3MDSA 5LP6C 2Q73A 2VWJA 3S3WA 1I5XA 2EIKB 5H5NA 5L3DA 1CEZA 2XAQA 1QQCA 4J7JA 1TUEB 2QM7A 3IAYA 3K5NA 3DGEA 5C8YB 3SPCA 4QGPA 5IYCO 1B04A 4IYHA 2DYSB 5KA5A 3OR6C 4LP8A 4JI7B 1X4TA 4JI8B 3OUSA 3BEHA 5J2TA 3N2GA 1JVMA 2ZQMA 2F4VO 4QE7A 4JTDB 1M57B 4O4LA 1BQ0A 2PI5A 4MTOA 3E22B 1Z5VA 1W0KG 2NLJC 1ZX3A 1TUBB 2AW9A 3JSLA 3D3IA 4GKKO 1WPXA 2X6AA 1Q6IA 1EN4A 2Q5ZA 1WPBA 2GUZA 3CS5A 1V55B 3K5LA 2AGAA 4I0XA 2V4DA 4MW3A 4DXWA 3E8BA 1H38A 4ZOLA 2PI4A 5DN6G 4E4EA 3RYHA 4HAMA 5CN0A 1FFXA 1Q82W 3K57A 3L9DA 5DEDA 5B1NA 4GX0A 1M4UA 2WLMA 3SJAC 2ZXWB 2XHBA 1HNZO 4J41A 3FB7C 5ITZA 4HNAB 2BTQA 2Y0IA 2PYLA 5LA6B 1VQ4V 1T5EA 2IH3C 3WU2Z 5IT9N 4CH5A 1NH2D 2OCHA 1BHAA 4DR3B 2GSMB 1FXKA 1SKVA 4GUNA 4PHZA 5KX5A 2DW4A 5LMUB 4UXNA 1FXKC 4JF3A 5JJJB 3JATB 4TT3G 3T4DA 2V1DA 4X1KB 2OT5A 1NJIW 4X1YB 5E1AC 4TUYA 3RGBA 4QE9A 3I5DA 1URFA 1TVKA 3SYAA 2HEPA 3OEEG 2BOCC 4LFCO 4WFHA 4B3MB 1OV9A 3B09A 1N0JA 5EBWC 4JI1B 1RSOA 1YTFD 4LF4O 4JI2B 2ZKOA 1W0JG 3I55V 2P7TC 1I94B 5IE9A 4JI4B 1BZKA 3OGCC 1XL6A 1ZAUA 3LDCA 1DF5A 2HVJC 1AI7A 3B8MA 3N27A 2AHZA 3DSQA 3HPLC 4IGGA 3C3TA 3AG2B 3ZIAG 2DQ0A 2EILC 1H2LA 5KHJA 4XBFA 2PZSA 3ETDA 1VQ6V 1MNGA 3W7WA 3OTOO 4DR7B 1SZXA 5HFMA 2WPDG 1US6A 3TGUH 5B3SB 4MSWC 4LH7A 1F7YA 4FLYA 2IJJA 4UCTA 2XAGA 4JYAB 2P67A 2C2AA 4PI0A 4JPRA 2NN4A 3CCRV 3AG3B 1KP3A 3JAMN 1OCCB 2UU9O 3RN4A 4PDRA 3ETQA 4WBNB 3CYOA 4DUZB 2QDOA 5LL6Y 1DF4A 5LYJB 2IM9A 1N33B 2VRZA 5EYPB 2VQFB 3WFVA 2ADQB 4DW1A 2JGDA 2XTAA 4DR4B 2HJDA 4O4HB 5LGNA 2EBOA 4O4IB 4JI0B 1PV0A 4LNUB 5KUMA 2X6BA
chains in the Genus database with same CATH topology
4OXSA 1YTFB 3AG4C 1E1RG 4YXWG 2Y69B 1VQPV 4PA7A 2YSUB 3UM7A 1NQTA 4BIUA 1MSWD 4GT1A 3ABUA 5EC2C 1YITV 4E2LA 5CA3A 2Z3YA 3LUTB 1F23A 3ABTA 4N21A 2Q68A 3AEIA 1S76D 3ZRVA 1KD1W 2B5UA 1EZJA 1COWG 3E89A 4TSFG 1OCRB 2DWEC 3CPWU 4UVAA 3JD2A 4QPKA 4MVQA 4P9PA 2IJIA 2Y69C 1BHBA 1Q86W 3TK1A 4JTCB 1GK9A 1RPRA 1M1KW 4KFMA 3TETA 5CBGA 4WFEA 4BIZA 1AI4A 1E1QG 4DO2A 1WLEA 2EZOA 2B1IA 1S3JA 2WLLA 2QM8A 4CZZA 2EIMC 3IGAC 1OCRC 2EILB 5B1OA 3SJQC 3MD0A 4UVBA 1P4RA 2NNUA 3W7UA 4UV9A 4QIWF 3K0DA 3E8HA 2BOBC 3NXSA 2ZR3A 3CP1A 1SZTA 1E79G 1GTOA 3HB3B 3AG1B 5IY5B 3MHSC 1YIJV 1YJNV 4X89A 5CMUA 3SPIA 2DYRB 3F7VC 4H37A 1NVPD 5B1BC 2LFSA 4FMTA 3ZRSA 1SESA 1S77D 4HYOA 2AHYA 1THZA 3LSQA 5B1AB 4MTXA 2DWDC 2OCCB 5IDJA 4JYBA 3W7SA 1GMGA 4MS2A 1AJQA 2MK3A 2M7WA 1R3JC 2XASA 1M9NA 3CC4V 4QJFB 4H33A 1H8EG 3ABKC 1MG1A 4RO2A 2K1EA 4P9OA 5HFLA 3CMEV 1K73W 1KECA 2WWWA 1K33A 2Z5UA 1UJWB 1VQMV 1K8AW 5IY5C 1M56C 1AR1B 3X2QB 2XAJA 1G4YB 4R50A 4UUJC 3CC2V 2A9HA 1OZ0A 3SPHA 1JX9A 2ATKC 3FYIB 4RAIA 1R3KC 2EIKC 3ZMZA 1FXVA 1GM8A 1P7BA 2HFEC 2OCCC 2XAHA 3ASNB 3LDEA 4PDMA 1Y66A 3RVZA 4R6ZA 1R73A 4L87A 1K92A 3STLC 5LBQA 4Q20A 2WLKA 4X88A 1M90W 1KP2A 2EJRA 1R6KA 5L3EA 4XDJA 1KC8W 3CCUV 2X0LA 1QR9A 2ZDIC 4U7OA 5FL7G 1DLBA 2IJKA 3SPGA 4TWKA 5C93A 5LGUA 3AG4B 4MVUA 3X2QC 2W0FC 4GCZA 3W7XA 3B77A 2JJ2G 1NR7A 2W6IG 2DYSC 1CP9A 3MHHC 4N23A 5LGTA 1PNKA 3IFXA 1AI5A 3DTUB 4EKWA 1OCOB 3ZMTA 3BY6A 1JCHA 3K06A 3ML0A 3QO8A 1FXHA 2A79B 1K4DC 4Z1MG 1M57C 1MABG 4RQFA 2XNDG 4PA9A 3ZRWA 1VQ8V 1B6QA 3IC7A 1FFTB 3ZMSA 1VQNV 3OMNB 2CK3G 1PKXA 2ZR2A 1AROP 5KA6A 2IU3A 5EK0A 4R8CA 1H8HG 1LNQA 1H2GA 3OE7G 2KB1A 3KG2A 3OAAG 3RW0A 1JPXA 3T1CA 2XOKG 1NVPB 1KQSU 5EC1C 2GHYA 2B1GA 3CC7V 4MVRA 3K9AA 1V55C 3GWOA 1OCOC 5J9PC 3OMIB 3ASOC 3OR7C 2EIMB 4G28B 4I5SA 4LC1A 5L3FA 1SERA 4RQEA 1NR1A 3SYQA 1V54C 1QR8A 2H8PC 2UXNA 2W6JG 3VBBA 3E8GA 1JQ0A 1K5QA 1EFRG 1PD3A 3QO5A 5L3BA 3EHBB 2QEXV 2F43G 2YEVA 1HWYA 5B1BB 4KP4A 5L3CA 3FB8C 3SYOA 1FS0G 2IU0A 3W7TA 3CMAV 3A0RA 3WG7C 3QNEA 2QA4V 1Y4MA 1PL0A 3F7YC 2ITDC 1K4CC 1K97A 2ZXWC 2HJFC 3SPJA 5IYBO 3ABKB 3F5WC 3GB7C 4MVMA 3LNMB 2OTJV 4G27B 3QO7A 3ABMB 3OMAB 4G2KA 3OFNG 5H6RA 4J9YB 4WFGA 1R3LC 3G71V 4GX5A 1M56B 1S72V 2WLIA 1KKDA 4J9ZB 5H9CA 3ZN0A 4JASA 4BAYA 1RM1C 2EIJC 2Q6AA 4P30A 5CBHA 3CCVV 3JD1A 1VQOV 2P6JA 1QVFU 1I5XA 1ORQC 2EIKB 2D3OW 5L3DA 1CEZA 2XAQA 4HZ3A 2EINB 4RUFA 2QE7G 2WSSG 1TUEB 2QM7A 4PA6A 1J95A 3DGEA 3ABMC 2ITCC 3OEHG 3SPCA 1R3IC 2H94A 3EFFK 3RBZA 3SYPA 1R6NA 5IYCO 3K0GA 2JEUA 5GW7A 4UV8A 4FIPC 2DYSB 5KA5A 3OR6C 4LP8A 1YJWV 2WLJA 3SYCA 2EINC 2XAFA 3OUSA 4JAVA 3BEHA 3T2MA 3R65A 1PNMA 4ZKIA 1JVMA 2ZQMA 4FJCC 4WF9V 4QE7A 4R7CA 1GM7A 4JTDB 2JJ1G 1M57B 1QCEA 1L1FA 4QNHB 3FB5C 5LHHA 2PI5A 3K79A 4MTOA 3ZMVA 1VQ5V 3OM3B 5DM6V 1W0KG 2NLJC 1SRYA 3JD4A 1YHQV 1I5YA 4PA3A 3CD6V 3P30A 2JEXA 3FKSG 3CCJV 2P90A 2HG5C 4MVZA 3D3IA 3ZJZA 1WPXA 1NBMG 2X6AA 4X8AA 5LHGA 1GM9A 4JYCA 3AG2C 1QLEC 1K34A 5L3GA 1V55B 3ASOB 1PNLA 4KUMA 1JOYA 2HR3A 4MW3A 4DXWA 5BZBA 5KUKA 1GO3F 3E8BA 3JYCA 1H38A 2PI4A 1V54B 1S0VA 2X7RB 5DN6G 1OHHG 3M99B 4XDKA 4HAMA 4MVSA 3ABLC 5EBLC 5CN0A 5B3SC 3P32A 4PA4A 4FPPA 3T4ZA 2JK5C 1S5HC 5LHIA 1Q82W 3K08A 4WFAV 3ZMUA 4QPJA 2YEVB 3WG7B 1XL4A 4BW5A 5B1NA 1K9MW 4GX0A 3OW2U 2WLMA 4FK5C 2ZXWB 3D36A 3AG3C 1OCCC 4JTAB 4ASUG 4MTFA 3FB7C 2WLLB 3E83A 1ZWIC 1VQ4V 4P2ZA 4PDVA 1N8RW 4I9WA 2A0LA 2UXXA 4MVOA 3E2EA 4GX1A 2IH3C 4UVCA 3I56V 3PJSK 4MT8A 1RM1B 1NH2D 3H01A 2EIJB 1BHAA 2GSMB 2WLIB 1FXKA 2DQ3A 1OCZB 1QBZA 2DW4A 3JD3A 3E8FA 3CCQV 4UXNA 3G6EV 1FXKC 2IJHA 4JF3A 1IXMA 1DTOA 2LFRA 1QLNA 3E86A 4TT3G 2JDIG 3CCMV 3RVYA 3T4DA 1F51A 2V1DA 2LP7A 4ZBMA 2OT5A 1NJIW 3JD0A 3ETGA 5E1AC 2OTLV 2QKSA 4QE9A 3LDDA 3TCUA 3CXCU 2R9IA 1AJPA 2V7QG 3SYAA 3OEEG 1OCZC 2BOCC 1Q7YW 4WFHA 1AI6A 4JAUA 1EBOA 1JJ2U 5EBWC 1SETA 1BMFG 4F4LA 1YTFD 1W0JG 2R9RB 1F4NA 3I55V 3G4SV 2HLDG 2P7TC 2WLHA 2IW5A 1AJNA 1ENVA 2X6CA 4WFFA 3OGCC 1NKDA 1XL6A 3LDCA 1DF5A 2HVJC 1AI7A 3B8MA 1YI2V 2Q69A 4CBCA 4MW8A 2AHZA 3HPLC 4WCEV 2ZD9A 2WLNA 3JCZA 2QTOA 3AG2B 1QLEB 3ZIAG 2DQ0A 1QVGU 2EILC 1MOFA 3B8NA 2FTKA 1W2BU 2HKOA 4XBFA 5CBFA 4XDLA 3ETDA 4LBEC 2Q67A 4PELA 4RUEA 1ROPA 2EZPA 1VQ6V 3AG1C 3W7WA 2DYRC 3VOUA 3ZRWB 1GKFA 5HFMA 1K7DA 3K04A 2WPDG 3ABLB 4LCUC 5B3SB 4MSWC 4WFBV 5B1AC 2JIZG 1NH2B 2IJJA 3FB6C 3CCSV 3E35A 1VQ9V 2XAGA 2HVKC 4MTGA 2P67A 2C2AA 2ZDIA 3OUFA 3LSSA 4JPRA 3STZC 1YSCA 5EBMC 3CCRV 3AG3B 1KP3A 1OCCB 3ZCCA 3ZRXA 3ZN1A 5H6QA 3UKMA 2IH1C 3ETEA 4PDRA 3CCEV 1RPOA 3CYOA 1G8MA 3FYEB 1VQKV 3CCLV 1DF4A 1K5SA 5IYDO 3K03A 3K3WA 1Q81W 3WFVA 1BL8A 1K3EA 1VQ7V 4GX2A 3ASNC 1F4MA 4PDLA 4JGSA 4U7NA 1CPYA 2WAMA 1FXKB 2Y48A 5LGNA 1VQLV 2EBOA 5KUMA 1YJ9V 2X6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABM C;  4OXS A;  4ZBM A;  2ITC C;  3AG4 C;  3SPC A;  3SPG A;  1R3I C;  4TWK A;  4PA7 A;  3EFF K;  3RBZ A;  4MVU A;  5E1A C;  3SYP A;  3UM7 A;  3X2Q C;  2W0F C;  5EC2 C;  2QKS A;  4QE9 A;  3K0G A;  3LDD A;  3TCU A;  3LUT B;  2DYS C;  3SYA A;  1OCZ C;  3IFX A;  2BOC C;  3OR6 C;  4LP8 A;  2Q68 A;  4WFH A;  2WLJ A;  3SYC A;  2EIN C;  4EKW A;  3OUS A;  3BEH A;  3E89 A;  3K06 A;  3T2M A;  3R65 A;  5EBW C;  2A79 B;  2DWE C;  1JVM A;  1K4D C;  4F4L A;  4QE7 A;  1M57 C;  4R7C A;  4JTD B;  2R9R B;  4PA9 A;  4QNH B;  2P7T C;  2WLH A;  3FB5 C;  4MTO A;  4MVQ A;  5EK0 A;  4P9P A;  2Y69 C;  2NLJ C;  4R8C A;  2X6C A;  4WFF A;  3OGC C;  1LNQ A;  4JTC B;  1XL6 A;  4PA3 A;  3LDC A;  2KB1 A;  2HVJ C;  3KG2 A;  4KFM A;  3TET A;  5CBG A;  4WFE A;  3RW0 A;  2Q69 A;  2HG5 C;  4MVZ A;  3T1C A;  4CBC A;  3ZJZ A;  4MW8 A;  2AHZ A;  5EC1 C;  3HPL C;  2X6A A;  4X8A A;  2ZD9 A;  2WLN A;  2WLL A;  4MVR A;  3AG2 C;  1QLE C;  1V55 C;  4RO2 A;  1OCO C;  2QTO A;  5J9P C;  2EIL C;  2EIM C;  3IGA C;  1OCR C;  3ASO C;  3SJQ C;  3OR7 C;  4G28 B;  5CBF A;  4XDL A;  3SYQ A;  5BZB A;  4MW3 A;  4LBE C;  4DXW A;  2Q67 A;  4RUE A;  5KUK A;  3E8B A;  3K0D A;  3JYC A;  1V54 C;  3E8H A;  2BOB C;  2H8P C;  3E8G A;  3AG1 C;  4XDK A;  2DYR C;  4X89 A;  3SPI A;  4MVS A;  3VOU A;  3F7V C;  4H37 A;  3ABL C;  2YEV A;  3K04 A;  5EBL C;  5B1B C;  4LCU C;  4PA4 A;  5B3S C;  3FB8 C;  3SYO A;  3T4Z A;  3ZRS A;  4HYO A;  4MSW C;  2JK5 C;  1S5H C;  2AHY A;  5B1A C;  2DWD C;  3K08 A;  3WG7 C;  3FB6 C;  3F7Y C;  1XL4 A;  4BW5 A;  2HVK C;  4MS2 A;  4GX0 A;  4MTG A;  2ITD C;  1K4C C;  1R3J C;  2WLM A;  3OUF A;  2ZXW C;  4H33 A;  3STZ C;  3ABK C;  2HJF C;  3SPJ A;  3AG3 C;  5EBM C;  1OCC C;  3F5W C;  2K1E A;  3GB7 C;  3LNM B;  4JTA B;  4G27 B;  4MTF A;  3FB7 C;  4MVM A;  4P9O A;  2WLL B;  3E83 A;  3UKM A;  1ZWI C;  2IH1 C;  4PDR A;  4P2Z A;  4J9Y B;  4PDV A;  1R3L C;  4WFG A;  5IY5 C;  1M56 C;  4GX5 A;  4I9W A;  1G4Y B;  2A0L A;  2WLI A;  4MVO A;  4R50 A;  2A9H A;  4GX1 A;  2IH3 C;  4UUJ C;  3SPH A;  4J9Z B;  1KKD A;  3K03 A;  2ATK C;  3PJS K;  2EIJ C;  2Q6A A;  4P30 A;  4RAI A;  5CBH A;  1R3K C;  1BL8 A;  2EIK C;  2WLI B;  1ORQ C;  4GX2 A;  3ASN C;  1P7B A;  2HFE C;  2OCC C;  3E8F A;  3LDE A;  4PDL A;  4HZ3 A;  4PDM A;  3RVZ A;  4R6Z A;  3STL C;  4RUF A;  2WLK A;  4X88 A;  3T4D A;  4PA6 A;  3E86 A;  5KUM A;  1J95 A;  4XDJ A;  3RVY A;  2X6B A; 
#chains in the Genus database with same CATH topology
 4OXS A;  2YXY A;  3DXR A;  1N32 O;  4KHP O;  3D36 C;  4PA7 A;  2L35 A;  4GT1 A;  3AK3 A;  1GAX A;  1PM9 A;  1ZLZ A;  1L0N H;  4DR5 O;  3ABT A;  2N04 A;  5FNV A;  3DC5 A;  1EZJ A;  1ZSP A;  4TSF G;  1WJZ A;  4UCU A;  4DR1 O;  4UVA A;  3QTC A;  3JD2 A;  4ABM A;  3JAL A;  4MVQ A;  2IJI A;  3JAR A;  1BHB A;  2YIA A;  1AVM A;  4I9Q A;  1Q86 W;  3TK1 A;  4JTC B;  1M1K W;  1Q43 A;  2E74 B;  4ICG A;  1XIL A;  4D7S A;  4NXN O;  3VQX A;  5BMV B;  4DYL A;  2WLL A;  4GZR B;  2E3C A;  2EIM C;  3IGA C;  5B1O A;  4LFA O;  2P4K A;  3J7A U;  2N74 A;  3BPZ A;  3D3Q A;  4DR2 O;  3N2G B;  3CP1 A;  5GON B;  5KHG A;  1YJN V;  1G1X B;  4O4L B;  1NZ6 A;  5IJ0 A;  3RYC A;  5B1B C;  1NVP D;  1KKC A;  3ZRS A;  1SES A;  1S77 D;  4HYO A;  2AHY A;  1THZ A;  2LW7 A;  4EFB A;  5IDJ A;  4UB6 Z;  3W7S A;  5KHI A;  1GMG A;  4JI3 B;  4FFK A;  2MK3 A;  4OPH A;  3CC4 V;  1M9N A;  4QJF B;  2QWR B;  1H8E G;  3ABK C;  2R72 A;  4PD4 F;  1K73 W;  4DR6 B;  1K33 A;  2Z5U A;  1N36 O;  5IY5 C;  1M56 C;  4I0X B;  3X2Q B;  4ZOL B;  2EIK C;  1P7B A;  3RYH B;  3N2K A;  5LBQ A;  1KMI Z;  4L87 A;  4K0K O;  5L3E A;  3C3S A;  1BGY H;  4XDJ A;  1IBL O;  2CTW A;  5CB4 A;  4ZHQ A;  5FL7 G;  1GRJ A;  1BE3 H;  4MVU A;  4HBN A;  2W0F C;  3W7X A;  2R9A A;  3B77 A;  5ITZ B;  1LR1 A;  3HKE B;  2DYS C;  4X66 O;  2H3O A;  4TQD A;  1PNK A;  3IFX A;  4CS2 A;  1AI5 A;  4K8Z A;  3DTU B;  2AZ2 A;  1OCO B;  3BY6 A;  1JCH A;  3K06 A;  2UXB O;  1FXH A;  4NTW A;  4NTX A;  2A79 B;  2PF4 E;  2RN9 A;  1M57 C;  1MAB G;  4DV3 B;  3ZMS A;  1XNQ B;  1VQN V;  2ZR2 A;  2IU3 A;  4R8C A;  1H8H G;  1H2G A;  3OE7 G;  3VQY A;  3RW0 A;  1IBM O;  1O9G A;  2XOK G;  5A9G A;  3CC7 V;  4TUY B;  1IX9 A;  3K9A A;  1V55 C;  5J9P C;  1M93 A;  2KG7 A;  3L74 H;  4G28 B;  4I5S A;  1SER A;  3SYQ A;  4TV9 B;  3ZBH A;  2W6J G;  3VBB A;  2UUC O;  2BTO A;  1JQ0 A;  1EFR G;  2QEX V;  1N0N A;  2JS5 A;  4JV5 B;  4NYK A;  4LF9 O;  4GKJ O;  4TV8 A;  3FB8 C;  3ZX6 A;  3RFR A;  3CMA V;  1KYO F;  4DV5 B;  4DRX B;  3KZI Z;  1YDX A;  1SC5 B;  2ZXW C;  4BW9 A;  4FM1 A;  1HW7 A;  5LA6 A;  5IYB O;  4AQY O;  4MVM A;  3L75 H;  4X62 B;  4I4T B;  2OYQ A;  3OMA B;  5EIB C;  3S3X A;  4GX5 A;  4J9Z B;  4JAS A;  4FLZ A;  2Q6A A;  3ZED A;  3CCV V;  3JD1 A;  2QJ1 A;  1VQO V;  2P6J A;  1QVF U;  3H1L H;  2EIN B;  2EX3 A;  1R1B A;  1J95 A;  1J5E B;  3A8T A;  5K1P A;  2XUM A;  2H94 A;  3RBZ A;  5FPO A;  3SYP A;  4YY3 B;  4JAA A;  1BSM A;  3K0G A;  2QM4 A;  4FIP C;  4CS4 A;  1CXZ B;  3M8A A;  3TXQ A;  2BE3 A;  4WF9 V;  4R7C A;  4KL1 A;  1FAF A;  5KMG B;  1XOU A;  3G80 A;  1SQG A;  1YHQ V;  3HR0 A;  4ZIB A;  2KKW A;  3DXR B;  3CCJ V;  1Y76 B;  2DE0 X;  1IZ3 A;  4X8A A;  3HKD A;  2ILM A;  2YI8 A;  3AG2 C;  1K34 A;  1GN3 A;  3ASO B;  2ZE7 A;  4LFB O;  5KUK A;  1XDC A;  1GO3 F;  4DV7 O;  1Q8I A;  4B3S O;  1OHH G;  1AP6 A;  2FL4 A;  3L70 H;  5B3S C;  3P32 A;  3JAL B;  4PA4 A;  3JAR B;  1S5H C;  3K08 A;  3ZMU A;  4QPJ A;  3BVO A;  1XNR B;  3AG3 C;  1OCC C;  4WBN A;  2WLL B;  1SQQ H;  3E83 A;  5LYJ A;  4PDV A;  2QWP B;  2HHH O;  5EYP A;  4DV0 B;  2A0L A;  2UXX A;  4CH6 A;  2WA3 A;  3T1H O;  3H01 A;  1XRE A;  4O4H A;  1YZB A;  2DQ3 A;  5LMN O;  3JD3 A;  4LNU A;  3CCQ V;  1DTO A;  2E5L O;  3WB2 A;  2JDI G;  3AG7 A;  1F51 A;  2LP7 A;  4B3R O;  2CGO A;  3ETG A;  2IBZ H;  4FLV A;  3JAS A;  4NVP A;  4H13 B;  4J7K A;  3LDD A;  3CXC U;  1I0H A;  3CJH B;  1OCZ C;  3CEI A;  4CC5 A;  1S5J A;  4JAU A;  5IJ9 B;  1L0L H;  2F4V B;  4X64 O;  3N2K B;  3OGI B;  3G4S V;  2UUB O;  1VF6 A;  3CX5 F;  1ENV A;  4WFF A;  4LF5 O;  1FJG B;  5CB4 B;  4GYC B;  1VF6 C;  3KCY A;  4ZHQ B;  2GTS A;  5BMV A;  4BR6 A;  2ZE8 A;  4GKK B;  3CRA A;  1NTM H;  1QLE B;  5JJE B;  4F6R B;  3BAA A;  3B8N A;  1W2B U;  5CBF A;  4LWS A;  5GON A;  3SR2 C;  4DV2 O;  4PEL A;  4RUE A;  1ROP A;  2EZP A;  3ZHQ A;  3G6B A;  4YJ3 B;  3A0B Z;  5JH7 B;  4Z2W A;  4WFB V;  3T1Y O;  1MZE A;  1SQF A;  5J2U A;  1NH2 B;  3CCS V;  3O65 A;  2ZDI A;  3SJC C;  3LSS A;  2GDS A;  3Q4H B;  2N05 A;  4A5U B;  5JVD B;  3ZN1 A;  4I55 B;  5H6Q A;  2KG7 B;  3ETE A;  3CCE V;  1RPO A;  5KHH A;  3WB1 A;  2FML A;  4DUY O;  2FB5 A;  3CCL V;  1K5S A;  1XMO O;  4H44 B;  2EJ7 A;  5D5Q A;  5F2V O;  2YIB D;  1BL8 A;  1K3E A;  3LNN A;  4GX2 A;  4TV8 B;  1FD9 A;  3RWR D;  1YJ9 V;  4BWA A;  2UXD O;  2ZIO A;  2GTA A;  1YTF B;  1E1R G;  1VQP V;  3HKE A;  4W4L A;  4BIO A;  5EC2 C;  5DEC A;  4E2L A;  5CA3 A;  1GN2 A;  1F23 A;  1LUV A;  3H1I H;  4LFC B;  4UCS A;  2Q68 A;  3R66 A;  4K3A A;  2B5U A;  1COW G;  2F93 B;  1OCR B;  4LF4 B;  3BCC H;  3OTF A;  2DWE C;  1N34 O;  1PP9 H;  3C90 A;  4QPK A;  4P9P A;  2M6Y A;  2RJZ A;  2Y69 C;  3QVN A;  2CGN A;  4X20 B;  1M5I A;  4KFM A;  4WFE A;  2JS3 A;  2YC0 A;  1WLE A;  1S3J A;  4NKG B;  4IHJ B;  1TAE A;  4TV9 A;  4NR1 A;  4C7U A;  2NNU A;  3RYF A;  4UV9 A;  4DW0 A;  1WP8 A;  4U3F H;  4I7Z B;  3NXS A;  2P4V A;  1VMG A;  1SZT A;  1E79 G;  3OTO B;  3AG1 B;  5JQG B;  3MHS C;  4X89 A;  3F7V C;  2R70 A;  4DRX A;  2ZM6 O;  3LSQ A;  2OCC B;  2YS8 A;  4I4T A;  2M7W A;  1R3J C;  4JI6 O;  3U10 A;  2K1E A;  3CSX A;  1AR5 A;  3HKD B;  4FZ1 A;  2UU9 B;  5GTI Z;  4DV4 O;  4AHC A;  1VQM V;  4PI2 A;  4LH6 A;  1AR1 B;  1G4Y B;  3CC2 V;  2A9H A;  3SPH A;  1JX9 A;  4RAI A;  1R3K C;  3FX7 A;  1FXV A;  1IBK O;  2QTS A;  4DK0 A;  1K92 A;  4Q20 A;  4X88 A;  1P84 F;  2EJR A;  1H2S B;  1N32 B;  4B08 A;  4JZ2 A;  2IJK A;  1D2D A;  5C93 A;  3AG4 B;  4JI4 O;  5JCO A;  1R6T A;  3EVK A;  5JWP A;  4FM0 A;  4UB8 Z;  1NR7 A;  4DR5 B;  5JCO C;  1CP9 A;  3MHH C;  5BR8 O;  4KXR A;  1HR0 O;  4L8J A;  5KMG A;  5IWA O;  2YXH A;  2ZNI A;  4LF7 O;  3FD9 A;  1VQ8 V;  3ZRW A;  2PUS A;  1B6Q A;  1FFT B;  3BHP A;  4LF8 B;  3OMN B;  1PKX A;  2YUA A;  1ARO P;  1Y76 A;  2KQX A;  2KB1 A;  3OAA G;  1O9H A;  1NVP B;  1KQS U;  5EC1 C;  2GHY A;  3JAS B;  2QGN A;  4JYA O;  3OMI B;  4LFA B;  3ASO C;  2H8P C;  1K5Q A;  1PD3 A;  4FLU A;  3LSU A;  4KP4 A;  3ZHV A;  3K9S A;  3A0R A;  3QNE A;  1PL0 A;  3U0Z A;  4JI0 O;  2HJF C;  3SPJ A;  3ZHR A;  1P7G A;  3L72 H;  3QO7 A;  5LXT A;  4G2K A;  3OFN G;  1N36 B;  5H6R A;  2A3Q A;  4J9Y B;  1R3L C;  3G71 V;  1S72 V;  4LWS B;  1KKD A;  5H9C A;  5CBH A;  1AIL A;  2E75 B;  3U11 A;  2D3O W;  4K0K B;  1Z5W A;  1TA8 A;  4RUF A;  1B3Q A;  4PA6 A;  5J2U B;  1IBL B;  3ABM C;  1QNM A;  2ITC C;  3OEH G;  4PV1 B;  1R3I C;  3EFF K;  3IJ4 A;  4I50 B;  3CJH A;  1R6N A;  3BA9 A;  3JAW B;  1JFF B;  2JEU A;  4X66 B;  4UV8 A;  5IJ9 A;  1YJW V;  3RT3 C;  3SYC A;  1HNX O;  2XAF A;  4JAV A;  4FJC C;  2P5O A;  3B40 A;  1GH6 A;  2P22 C;  2JJ1 G;  2VQE O;  1QCE A;  3FB5 C;  5LHH A;  3OM3 B;  2QKA A;  3TXS A;  1SRY A;  2Y4T A;  2YIB A;  4PA3 A;  1GN6 A;  3P30 A;  3FKS G;  2P90 A;  1IBM B;  2PY5 A;  1V9P A;  3ZHU A;  2Q7E A;  3ZJZ A;  4F6R A;  1GM9 A;  2QWN B;  4JYC A;  2JRI A;  1QLE C;  4CS3 A;  2VWK A;  2K9P A;  1HNW O;  1JA8 A;  1PNL A;  3H1K H;  1WAZ A;  3JYC A;  2UUC B;  1V54 B;  4YJ3 A;  3UT5 B;  2X7R B;  4OX9 O;  5JH7 A;  4EB6 B;  1Q5O A;  2YXL A;  4MVS A;  4LF9 B;  4GKJ B;  5EBL C;  1P49 A;  3ZHT A;  4FPP A;  3EXA A;  1XHX A;  4LF6 O;  5LHI A;  4WFA V;  3Q4H A;  3WG7 B;  3TJT A;  3ZHS A;  2GV9 A;  1XL4 A;  5JVD A;  4I55 A;  4AQY B;  3GWK C;  4JTA B;  4ASU G;  4P2Z A;  5D5P A;  4I9W A;  1EZV H;  4MVO A;  1WB7 A;  3E2E A;  3RYF B;  4FFB A;  1Q6U A;  2EIJ B;  2YIC A;  2WLI B;  1XMQ O;  1QBZ A;  3E8F A;  4ZI7 A;  1EN6 A;  2Q0O C;  2LFR A;  1QLN A;  4FLX A;  3CCM V;  5E79 Z;  3A0H Z;  4W4K A;  2EUL A;  2Y0P A;  2UXC B;  2OTL V;  2QKS A;  4X65 O;  5K1X A;  4NXM B;  2R9I A;  3BFR A;  1Q7Y W;  1SQB H;  1N4C A;  1AI6 A;  3KKY A;  1EBO A;  2F66 C;  4OPA A;  1SET A;  1BMF G;  1YXB A;  1F4N A;  4X20 A;  2HLD G;  2WLH A;  2E76 B;  2RDC A;  2IW5 A;  2X6C A;  4AI8 A;  1NKD A;  1D5N A;  2Q9L A;  1YI2 V;  1Q6H A;  4JI5 O;  2ZNJ A;  4CBC A;  4IHJ A;  4MW8 A;  5BY1 A;  4DV5 O;  4J42 A;  2ZD9 A;  3OD4 A;  2Y4U A;  2QTO A;  1ZUQ A;  4LFB B;  2FTK A;  2HKO A;  5JQG A;  4X62 O;  2Q67 A;  2LGW A;  4O2A B;  2ZIM A;  4DV7 B;  3J80 N;  3AG1 C;  4B3S B;  3ZRW B;  3HKB B;  1GKF A;  1K7D A;  3ABL B;  3K58 A;  3RYI A;  4UCO A;  3SJB C;  4NB5 A;  3FB6 C;  3E35 A;  3SGI A;  1VQ9 V;  2G38 A;  2YID A;  1RP3 B;  1MZF A;  1J5E O;  2HHH B;  5FLX N;  5FPR A;  1VAR A;  1VQK V;  1H2N A;  1NTK H;  3T1H B;  3K03 A;  1Q81 W;  5LMN B;  1VQ7 V;  4PDL A;  2ZIN A;  4J7Z A;  2ETN A;  4YJ2 A;  2WAM A;  2Y48 A;  1VQL V;  4H0L B;  3PN1 A;  2E5L B;  1EM1 A;  4B3R B;  2OIE A;  3AG4 C;  4YXW G;  4IYI A;  2YSU B;  3UM7 A;  4BIU A;  2OWO A;  3ABU A;  5LXT B;  1XEQ A;  4IIJ B;  1JR9 A;  1S76 D;  1A32 A;  3J81 N;  1BCC H;  4YHH O;  3QF7 A;  5KAF Z;  2F1M A;  3CPW U;  2UUA O;  2JGU A;  3CRC A;  4FVM A;  5EZY B;  4DV1 O;  4LF5 B;  2A7W A;  1GK9 A;  1SA0 B;  5CBG A;  2FKX A;  4O4J B;  1VF5 B;  4BIZ A;  1AI4 A;  2VS0 A;  5A2Q N;  4DO2 A;  2L6L A;  3K5O A;  2EZO A;  2ZCE A;  2B1I A;  4B3T O;  3UQ8 A;  4O2B A;  4DV2 B;  1P4R A;  3K0D A;  3E8H A;  1H2M A;  2BOB C;  2ZR3 A;  5LP6 A;  1YIJ V;  5IY5 B;  5CMU A;  2DYR B;  4H37 A;  1XUQ A;  2LFS A;  4FMT A;  3T1Y B;  1W59 A;  2LGQ A;  4MTX A;  2DWD C;  5B1A B;  1Q3E A;  4FLW A;  1XI1 A;  2XAS A;  1MG1 A;  2Z0A A;  4RO2 A;  4P9O A;  5HFL A;  3CME V;  2CUG A;  4DV6 O;  1KEC A;  1PPJ H;  2WWW A;  1UJW B;  1K8A W;  4B7K A;  2RNB A;  4DUY B;  2XAJ A;  1BS3 A;  1XMO B;  1OZ0 A;  4EEQ A;  1UPG A;  1RFY A;  2ATK C;  3ZMZ A;  2HFE C;  3LDE A;  3ASN B;  5AG2 A;  4PDM A;  3RVZ A;  5JJN B;  4R6Z A;  1R73 A;  3STL C;  2P06 A;  2Q0A A;  5LOV B;  1WA8 B;  1HNZ B;  2UXD B;  3JCU Z;  1JJO A;  1YCI A;  4I50 A;  2X0L A;  2DJV A;  1KBH A;  1KU9 A;  2ZDI C;  3GVM A;  1U97 A;  3JAK A;  4U7O A;  1DLB A;  3JAW A;  1JFF A;  3NR7 A;  4TWK A;  3X2Q C;  1FJG O;  1H2K A;  1FYJ A;  1XBL A;  3L71 H;  1NT2 B;  2W6I G;  3G67 A;  3B2E E;  4N23 A;  2GBO A;  4FFB B;  4JI7 O;  1Y67 A;  4JI8 O;  1TGO A;  3H1H H;  4Z1M G;  4U3J B;  1N34 B;  1L8D A;  4ZI7 B;  2BCC H;  3CWB H;  5KA6 A;  1LNQ A;  3KG2 A;  1JPX A;  3T1C A;  4D6T H;  2DOS A;  1Y74 B;  2CTQ A;  4UCV A;  2QSA A;  1YEW A;  1OCO C;  3GWO A;  4Z1V A;  2PYJ A;  1BT8 A;  1G6U A;  3UT5 A;  4RQE A;  1NR1 A;  5KHK A;  2NR5 A;  4EB6 A;  4EFE A;  1V54 C;  3UO2 A;  2F43 G;  1U96 A;  1HWY A;  2O57 A;  4DK1 A;  5L3C A;  3SYO A;  2IU0 A;  2ZM6 B;  2FYU H;  3WG7 C;  2QA4 V;  1Y4M A;  2RMK B;  3DC6 A;  3CHX A;  4B7E A;  4JI6 B;  2LJ2 A;  3VQV A;  3F5W C;  3GB7 C;  4G27 B;  4DV4 B;  3CXH F;  3FFQ A;  2WLI A;  1S5L Z;  4BAY A;  3ZN0 A;  2EIJ C;  4P30 A;  1HP8 A;  3WB0 A;  2QR4 A;  1IBK B;  1ORQ C;  2W0X A;  4DR3 O;  1MSD A;  5LMU O;  4HZ3 A;  2AZ0 A;  5KAI Z;  3RYI B;  2QE7 G;  2WSS G;  4TQF A;  2ODM A;  5EIB D;  2QWQ B;  3HKC B;  1YVW A;  4K8X A;  2Q4P A;  3P3N A;  5GW7 A;  5BR8 B;  4YIP A;  1HR0 B;  2WLJ A;  3FAV B;  2EIN C;  4LR3 A;  4D7T A;  5IWA B;  3T2M A;  4B3M O;  3R65 A;  1PNM A;  4JI1 O;  4ZKI A;  4LF7 B;  3BA8 A;  5CA1 A;  1GM7 A;  4YJ2 B;  4JI2 O;  1L1F A;  4QNH B;  4KHP B;  3K79 A;  2CTR A;  3ZMV A;  1VQ5 V;  3D8C A;  5DM6 V;  1I94 O;  3JD4 A;  2AXT Z;  4X9Q A;  1I5Y A;  2ARH A;  5CA0 B;  3CD6 V;  2D2C B;  2JEX A;  2HG5 C;  3A2F A;  4MVZ A;  1SQV H;  1NBM G;  5LHG A;  3SDL A;  4AIL C;  5L3G A;  4O2A A;  1AP5 A;  4KUM A;  1JOY A;  2HR3 A;  5BZB A;  4DR1 B;  3HKB A;  3UCS C;  4J80 A;  2LW1 A;  1AB3 A;  1S0V A;  3AK2 A;  3M99 B;  4XDK A;  3ABL C;  4DR7 O;  2F95 B;  3T4Z A;  2JK5 C;  3APQ A;  4NXN B;  2YEV B;  4BW5 A;  1K9M W;  3OW2 U;  1VP7 A;  4CH3 A;  4FK5 C;  3D36 A;  1EN5 A;  1SQP H;  2OIG A;  4MTF A;  1ZWI C;  4O2B B;  4DR2 B;  2CTP A;  1N8R W;  1ZL8 B;  4CC6 A;  4DUZ O;  4GX1 A;  4UVC A;  3I56 V;  5H2F Z;  3PJS K;  4MT8 A;  1RM1 B;  1N33 O;  5LP6 B;  1QHT A;  2VQF O;  1OCZ B;  1Q90 D;  4DR4 O;  3G6E V;  2IJH A;  1IXM A;  3P3P A;  2CAZ C;  4YIO A;  1BQZ A;  3E86 A;  1B06 A;  5B5E Z;  2QWO B;  3RVY A;  4ZBM A;  4LF8 O;  3JD0 A;  3CE2 A;  4IIJ A;  3KCX A;  1XQ8 A;  1IVS A;  1NTZ H;  3TCU A;  1AJP A;  2BSK A;  2V7Q G;  1HNX B;  4RWU A;  1I08 A;  1JJ2 U;  3QG5 A;  2CE4 A;  5IYZ A;  2VQE B;  4F4L A;  5EZY A;  2R9R B;  5J2T B;  1SA0 A;  2MW2 B;  1UFI A;  2CH7 A;  3H1J H;  1AJN A;  4O4J A;  3JAK B;  2Q69 A;  1SF9 A;  1D5A A;  4NTY A;  3JSN A;  4WCE V;  2WLN A;  2YI9 A;  3APO A;  3JCZ A;  1QVG U;  1HNW B;  2UXB B;  1MOF A;  1MMM A;  4X1I A;  4XDL A;  2GUZ B;  1DK1 A;  4LBE C;  4OX9 B;  2DYR C;  3VOU A;  4FM2 A;  1FKA O;  3K04 A;  4LCU C;  4LF6 B;  4IT5 A;  5B1A C;  4JYY A;  2JIZ G;  3H9V A;  2HVK C;  4MTG A;  4JI3 O;  3OUF A;  1FFX B;  4IL6 Z;  5C8Y A;  3STZ C;  4TOI A;  1OJH A;  1YSC A;  5EBM C;  3CB2 A;  3ZCC A;  3ZRX A;  1SQX H;  3UKM A;  4CH4 A;  2IH1 C;  4DR6 O;  2YDE A;  3FYE B;  1G8M A;  1IXB A;  5IYD O;  4FLT A;  2BTQ B;  3K3W A;  2ZE6 A;  1VF7 A;  1XMQ B;  5LOV A;  4JZG A;  1WA8 A;  3ASN C;  1F4M A;  3BAB A;  4JGS A;  4U7N A;  1CPY A;  1FXK B;  5KX5 B;  3E22 A;  2ADP A;  3AK1 A;  2B9Z A;  3BRC A;  1YF2 A;  1TUB A;  4J10 A;  3O9O A;  2Y69 B;  1NQT A;  1WP7 A;  3ZS8 C;  4X65 B;  1MSW D;  1YIT V;  2Z3Y A;  3LUT B;  1FPO A;  4N21 A;  3AEI A;  4U3J A;  3ZRV A;  1KD1 W;  1TVK B;  1DGS A;  5BXZ A;  3E89 A;  1WN7 A;  1HDJ A;  3MAQ A;  2QKC A;  1Z2G A;  1I7F A;  4Q6G A;  4OGQ B;  4DV3 O;  1XNQ O;  1KB9 F;  1RSO B;  3OT7 A;  1PL4 A;  1Y74 A;  1RPR A;  1VIB A;  3TET A;  4JI5 B;  1IDS A;  1WB8 A;  1E1Q G;  1JMK C;  5GTH Z;  2QM8 A;  4HNA A;  4CZZ A;  1IUR A;  3SJQ C;  1OCR C;  1NU1 H;  2EIL B;  3MD0 A;  4UVB A;  3W7U A;  4QIW F;  1GTO A;  3HB3 B;  5CA1 B;  3SPI A;  3K5M A;  4JV5 O;  1QU7 A;  1XHZ A;  3JAT A;  4JYB A;  4X1K A;  1AR4 A;  4MS2 A;  1AJQ A;  4H33 A;  4UFZ A;  4X1Y A;  2ZE5 A;  2LO1 A;  3CRR A;  2UXC O;  4R50 A;  3IC9 A;  4UUJ C;  3FYI B;  3K59 A;  4NXM O;  1GM8 A;  2XAH A;  2OCC C;  1GN4 A;  1X59 A;  1Y66 A;  2JGD B;  1M90 W;  2WLK A;  4UCR A;  1KP2 A;  1R6K A;  1KC8 W;  3HKC A;  1SS3 A;  3CCU V;  1QR9 A;  2RQ6 A;  3SPG A;  2RCV A;  2WA4 A;  5LGU A;  2CDY A;  4FZ0 A;  4GCZ A;  4YY3 O;  2Q7G A;  2JJ2 G;  3FAV A;  3F5T A;  2Q8V A;  4K35 A;  4PJ0 Z;  5LGT A;  4EKW A;  3ZMT A;  4YHH B;  3ML0 A;  1NS1 A;  3QO8 A;  5FNV B;  1K4D C;  4RQF A;  2XND G;  4PA9 A;  2UUA B;  3IC7 A;  5CA0 A;  2CK3 G;  5EK0 A;  4DV1 B;  3CRM A;  3UO3 A;  2XT9 A;  1NI8 A;  2PTM A;  2Q7H A;  3B4S A;  3ICX A;  2B1G A;  4B3T B;  3VQW A;  4MVR A;  3CRQ A;  2DMX A;  4F6E A;  2BSK B;  3OR7 C;  2EIM B;  3M7M X;  4LC1 A;  5L3F A;  4X64 B;  2UUB B;  1QR8 A;  2UXN A;  3E8G A;  5IYZ B;  3QO5 A;  5L3B A;  3EHB B;  1VEW A;  2YEV A;  5B1B B;  1ZTE A;  2CH7 B;  3W7T A;  1FS0 G;  4GLX A;  5B66 Z;  4O4I A;  5IJ0 B;  3RYC B;  1MA1 A;  3F7Y C;  1Y6X A;  2ITD C;  1K4C C;  1K97 A;  2LQT A;  2JVD A;  2PGG A;  2F23 A;  1KUQ A;  3L73 H;  3ABK B;  4J11 A;  1XNR O;  2HP8 A;  3LNM B;  2OTJ V;  1LUW A;  1ZL8 A;  4DV6 B;  3ABM B;  5KLV H;  2ZT9 B;  2A06 H;  2DN9 A;  5TIS Z;  2KSD A;  4WFG A;  4X1I B;  3THO A;  1M56 B;  4DV0 O;  1RM1 C;  1WNS A;  3MDS A;  5LP6 C;  2Q73 A;  2VWJ A;  3S3W A;  1I5X A;  2EIK B;  5H5N A;  5L3D A;  1CEZ A;  2XAQ A;  1QQC A;  4J7J A;  1TUE B;  2QM7 A;  3IAY A;  3K5N A;  3DGE A;  5C8Y B;  3SPC A;  4QGP A;  5IYC O;  1B04 A;  4IYH A;  2DYS B;  5KA5 A;  3OR6 C;  4LP8 A;  4JI7 B;  1X4T A;  4JI8 B;  3OUS A;  3BEH A;  5J2T A;  3N2G A;  1JVM A;  2ZQM A;  2F4V O;  4QE7 A;  4JTD B;  1M57 B;  4O4L A;  1BQ0 A;  2PI5 A;  4MTO A;  3E22 B;  1Z5V A;  1W0K G;  2NLJ C;  1ZX3 A;  1TUB B;  2AW9 A;  3JSL A;  3D3I A;  4GKK O;  1WPX A;  2X6A A;  1Q6I A;  1EN4 A;  2Q5Z A;  1WPB A;  2GUZ A;  3CS5 A;  1V55 B;  3K5L A;  2AGA A;  4I0X A;  2V4D A;  4MW3 A;  4DXW A;  3E8B A;  1H38 A;  4ZOL A;  2PI4 A;  5DN6 G;  4E4E A;  3RYH A;  4HAM A;  5CN0 A;  1FFX A;  1Q82 W;  3K57 A;  3L9D A;  5DED A;  5B1N A;  4GX0 A;  1M4U A;  2WLM A;  3SJA C;  2ZXW B;  2XHB A;  1HNZ O;  4J41 A;  3FB7 C;  5ITZ A;  4HNA B;  2BTQ A;  2Y0I A;  2PYL A;  5LA6 B;  1VQ4 V;  1T5E A;  2IH3 C;  3WU2 Z;  5IT9 N;  4CH5 A;  1NH2 D;  2OCH A;  1BHA A;  4DR3 B;  2GSM B;  1FXK A;  1SKV A;  4GUN A;  4PHZ A;  5KX5 A;  2DW4 A;  5LMU B;  4UXN A;  1FXK C;  4JF3 A;  5JJJ B;  3JAT B;  4TT3 G;  3T4D A;  2V1D A;  4X1K B;  2OT5 A;  1NJI W;  4X1Y B;  5E1A C;  4TUY A;  3RGB A;  4QE9 A;  3I5D A;  1URF A;  1TVK A;  3SYA A;  2HEP A;  3OEE G;  2BOC C;  4LFC O;  4WFH A;  4B3M B;  1OV9 A;  3B09 A;  1N0J A;  5EBW C;  4JI1 B;  1RSO A;  1YTF D;  4LF4 O;  4JI2 B;  2ZKO A;  1W0J G;  3I55 V;  2P7T C;  1I94 B;  5IE9 A;  4JI4 B;  1BZK A;  3OGC C;  1XL6 A;  1ZAU A;  3LDC A;  1DF5 A;  2HVJ C;  1AI7 A;  3B8M A;  3N27 A;  2AHZ A;  3DSQ A;  3HPL C;  4IGG A;  3C3T A;  3AG2 B;  3ZIA G;  2DQ0 A;  2EIL C;  1H2L A;  5KHJ A;  4XBF A;  2PZS A;  3ETD A;  1VQ6 V;  1MNG A;  3W7W A;  3OTO O;  4DR7 B;  1SZX A;  5HFM A;  2WPD G;  1US6 A;  3TGU H;  5B3S B;  4MSW C;  4LH7 A;  1F7Y A;  4FLY A;  2IJJ A;  4UCT A;  2XAG A;  4JYA B;  2P67 A;  2C2A A;  4PI0 A;  4JPR A;  2NN4 A;  3CCR V;  3AG3 B;  1KP3 A;  3JAM N;  1OCC B;  2UU9 O;  3RN4 A;  4PDR A;  3ETQ A;  4WBN B;  3CYO A;  4DUZ B;  2QDO A;  5LL6 Y;  1DF4 A;  5LYJ B;  2IM9 A;  1N33 B;  2VRZ A;  5EYP B;  2VQF B;  3WFV A;  2ADQ B;  4DW1 A;  2JGD A;  2XTA A;  4DR4 B;  2HJD A;  4O4H B;  5LGN A;  2EBO A;  4O4I B;  4JI0 B;  1PV0 A;  4LNU B;  5KUM A;  2X6B A; 
#chains in the Genus database with same CATH homology
 4OXS A;  1YTF B;  3AG4 C;  1E1R G;  4YXW G;  2Y69 B;  1VQP V;  4PA7 A;  2YSU B;  3UM7 A;  1NQT A;  4BIU A;  1MSW D;  4GT1 A;  3ABU A;  5EC2 C;  1YIT V;  4E2L A;  5CA3 A;  2Z3Y A;  3LUT B;  1F23 A;  3ABT A;  4N21 A;  2Q68 A;  3AEI A;  1S76 D;  3ZRV A;  1KD1 W;  2B5U A;  1EZJ A;  1COW G;  3E89 A;  4TSF G;  1OCR B;  2DWE C;  3CPW U;  4UVA A;  3JD2 A;  4QPK A;  4MVQ A;  4P9P A;  2IJI A;  2Y69 C;  1BHB A;  1Q86 W;  3TK1 A;  4JTC B;  1GK9 A;  1RPR A;  1M1K W;  4KFM A;  3TET A;  5CBG A;  4WFE A;  4BIZ A;  1AI4 A;  1E1Q G;  4DO2 A;  1WLE A;  2EZO A;  2B1I A;  1S3J A;  2WLL A;  2QM8 A;  4CZZ A;  2EIM C;  3IGA C;  1OCR C;  2EIL B;  5B1O A;  3SJQ C;  3MD0 A;  4UVB A;  1P4R A;  2NNU A;  3W7U A;  4UV9 A;  4QIW F;  3K0D A;  3E8H A;  2BOB C;  3NXS A;  2ZR3 A;  3CP1 A;  1SZT A;  1E79 G;  1GTO A;  3HB3 B;  3AG1 B;  5IY5 B;  3MHS C;  1YIJ V;  1YJN V;  4X89 A;  5CMU A;  3SPI A;  2DYR B;  3F7V C;  4H37 A;  1NVP D;  5B1B C;  2LFS A;  4FMT A;  3ZRS A;  1SES A;  1S77 D;  4HYO A;  2AHY A;  1THZ A;  3LSQ A;  5B1A B;  4MTX A;  2DWD C;  2OCC B;  5IDJ A;  4JYB A;  3W7S A;  1GMG A;  4MS2 A;  1AJQ A;  2MK3 A;  2M7W A;  1R3J C;  2XAS A;  1M9N A;  3CC4 V;  4QJF B;  4H33 A;  1H8E G;  3ABK C;  1MG1 A;  4RO2 A;  2K1E A;  4P9O A;  5HFL A;  3CME V;  1K73 W;  1KEC A;  2WWW A;  1K33 A;  2Z5U A;  1UJW B;  1VQM V;  1K8A W;  5IY5 C;  1M56 C;  1AR1 B;  3X2Q B;  2XAJ A;  1G4Y B;  4R50 A;  4UUJ C;  3CC2 V;  2A9H A;  1OZ0 A;  3SPH A;  1JX9 A;  2ATK C;  3FYI B;  4RAI A;  1R3K C;  2EIK C;  3ZMZ A;  1FXV A;  1GM8 A;  1P7B A;  2HFE C;  2OCC C;  2XAH A;  3ASN B;  3LDE A;  4PDM A;  1Y66 A;  3RVZ A;  4R6Z A;  1R73 A;  4L87 A;  1K92 A;  3STL C;  5LBQ A;  4Q20 A;  2WLK A;  4X88 A;  1M90 W;  1KP2 A;  2EJR A;  1R6K A;  5L3E A;  4XDJ A;  1KC8 W;  3CCU V;  2X0L A;  1QR9 A;  2ZDI C;  4U7O A;  5FL7 G;  1DLB A;  2IJK A;  3SPG A;  4TWK A;  5C93 A;  5LGU A;  3AG4 B;  4MVU A;  3X2Q C;  2W0F C;  4GCZ A;  3W7X A;  3B77 A;  2JJ2 G;  1NR7 A;  2W6I G;  2DYS C;  1CP9 A;  3MHH C;  4N23 A;  5LGT A;  1PNK A;  3IFX A;  1AI5 A;  3DTU B;  4EKW A;  1OCO B;  3ZMT A;  3BY6 A;  1JCH A;  3K06 A;  3ML0 A;  3QO8 A;  1FXH A;  2A79 B;  1K4D C;  4Z1M G;  1M57 C;  1MAB G;  4RQF A;  2XND G;  4PA9 A;  3ZRW A;  1VQ8 V;  1B6Q A;  3IC7 A;  1FFT B;  3ZMS A;  1VQN V;  3OMN B;  2CK3 G;  1PKX A;  2ZR2 A;  1ARO P;  5KA6 A;  2IU3 A;  5EK0 A;  4R8C A;  1H8H G;  1LNQ A;  1H2G A;  3OE7 G;  2KB1 A;  3KG2 A;  3OAA G;  3RW0 A;  1JPX A;  3T1C A;  2XOK G;  1NVP B;  1KQS U;  5EC1 C;  2GHY A;  2B1G A;  3CC7 V;  4MVR A;  3K9A A;  1V55 C;  3GWO A;  1OCO C;  5J9P C;  3OMI B;  3ASO C;  3OR7 C;  2EIM B;  4G28 B;  4I5S A;  4LC1 A;  5L3F A;  1SER A;  4RQE A;  1NR1 A;  3SYQ A;  1V54 C;  1QR8 A;  2H8P C;  2UXN A;  2W6J G;  3VBB A;  3E8G A;  1JQ0 A;  1K5Q A;  1EFR G;  1PD3 A;  3QO5 A;  5L3B A;  3EHB B;  2QEX V;  2F43 G;  2YEV A;  1HWY A;  5B1B B;  4KP4 A;  5L3C A;  3FB8 C;  3SYO A;  1FS0 G;  2IU0 A;  3W7T A;  3CMA V;  3A0R A;  3WG7 C;  3QNE A;  2QA4 V;  1Y4M A;  1PL0 A;  3F7Y C;  2ITD C;  1K4C C;  1K97 A;  2ZXW C;  2HJF C;  3SPJ A;  5IYB O;  3ABK B;  3F5W C;  3GB7 C;  4MVM A;  3LNM B;  2OTJ V;  4G27 B;  3QO7 A;  3ABM B;  3OMA B;  4G2K A;  3OFN G;  5H6R A;  4J9Y B;  4WFG A;  1R3L C;  3G71 V;  4GX5 A;  1M56 B;  1S72 V;  2WLI A;  1KKD A;  4J9Z B;  5H9C A;  3ZN0 A;  4JAS A;  4BAY A;  1RM1 C;  2EIJ C;  2Q6A A;  4P30 A;  5CBH A;  3CCV V;  3JD1 A;  1VQO V;  2P6J A;  1QVF U;  1I5X A;  1ORQ C;  2EIK B;  2D3O W;  5L3D A;  1CEZ A;  2XAQ A;  4HZ3 A;  2EIN B;  4RUF A;  2QE7 G;  2WSS G;  1TUE B;  2QM7 A;  4PA6 A;  1J95 A;  3DGE A;  3ABM C;  2ITC C;  3OEH G;  3SPC A;  1R3I C;  2H94 A;  3EFF K;  3RBZ A;  3SYP A;  1R6N A;  5IYC O;  3K0G A;  2JEU A;  5GW7 A;  4UV8 A;  4FIP C;  2DYS B;  5KA5 A;  3OR6 C;  4LP8 A;  1YJW V;  2WLJ A;  3SYC A;  2EIN C;  2XAF A;  3OUS A;  4JAV A;  3BEH A;  3T2M A;  3R65 A;  1PNM A;  4ZKI A;  1JVM A;  2ZQM A;  4FJC C;  4WF9 V;  4QE7 A;  4R7C A;  1GM7 A;  4JTD B;  2JJ1 G;  1M57 B;  1QCE A;  1L1F A;  4QNH B;  3FB5 C;  5LHH A;  2PI5 A;  3K79 A;  4MTO A;  3ZMV A;  1VQ5 V;  3OM3 B;  5DM6 V;  1W0K G;  2NLJ C;  1SRY A;  3JD4 A;  1YHQ V;  1I5Y A;  4PA3 A;  3CD6 V;  3P30 A;  2JEX A;  3FKS G;  3CCJ V;  2P90 A;  2HG5 C;  4MVZ A;  3D3I A;  3ZJZ A;  1WPX A;  1NBM G;  2X6A A;  4X8A A;  5LHG A;  1GM9 A;  4JYC A;  3AG2 C;  1QLE C;  1K34 A;  5L3G A;  1V55 B;  3ASO B;  1PNL A;  4KUM A;  1JOY A;  2HR3 A;  4MW3 A;  4DXW A;  5BZB A;  5KUK A;  1GO3 F;  3E8B A;  3JYC A;  1H38 A;  2PI4 A;  1V54 B;  1S0V A;  2X7R B;  5DN6 G;  1OHH G;  3M99 B;  4XDK A;  4HAM A;  4MVS A;  3ABL C;  5EBL C;  5CN0 A;  5B3S C;  3P32 A;  4PA4 A;  4FPP A;  3T4Z A;  2JK5 C;  1S5H C;  5LHI A;  1Q82 W;  3K08 A;  4WFA V;  3ZMU A;  4QPJ A;  2YEV B;  3WG7 B;  1XL4 A;  4BW5 A;  5B1N A;  1K9M W;  4GX0 A;  3OW2 U;  2WLM A;  4FK5 C;  2ZXW B;  3D36 A;  3AG3 C;  1OCC C;  4JTA B;  4ASU G;  4MTF A;  3FB7 C;  2WLL B;  3E83 A;  1ZWI C;  1VQ4 V;  4P2Z A;  4PDV A;  1N8R W;  4I9W A;  2A0L A;  2UXX A;  4MVO A;  3E2E A;  4GX1 A;  2IH3 C;  4UVC A;  3I56 V;  3PJS K;  4MT8 A;  1RM1 B;  1NH2 D;  3H01 A;  2EIJ B;  1BHA A;  2GSM B;  2WLI B;  1FXK A;  2DQ3 A;  1OCZ B;  1QBZ A;  2DW4 A;  3JD3 A;  3E8F A;  3CCQ V;  4UXN A;  3G6E V;  1FXK C;  2IJH A;  4JF3 A;  1IXM A;  1DTO A;  2LFR A;  1QLN A;  3E86 A;  4TT3 G;  2JDI G;  3CCM V;  3RVY A;  3T4D A;  1F51 A;  2V1D A;  2LP7 A;  4ZBM A;  2OT5 A;  1NJI W;  3JD0 A;  3ETG A;  5E1A C;  2OTL V;  2QKS A;  4QE9 A;  3LDD A;  3TCU A;  3CXC U;  2R9I A;  1AJP A;  2V7Q G;  3SYA A;  3OEE G;  1OCZ C;  2BOC C;  1Q7Y W;  4WFH A;  1AI6 A;  4JAU A;  1EBO A;  1JJ2 U;  5EBW C;  1SET A;  1BMF G;  4F4L A;  1YTF D;  1W0J G;  2R9R B;  1F4N A;  3I55 V;  3G4S V;  2HLD G;  2P7T C;  2WLH A;  2IW5 A;  1AJN A;  1ENV A;  2X6C A;  4WFF A;  3OGC C;  1NKD A;  1XL6 A;  3LDC A;  1DF5 A;  2HVJ C;  1AI7 A;  3B8M A;  1YI2 V;  2Q69 A;  4CBC A;  4MW8 A;  2AHZ A;  3HPL C;  4WCE V;  2ZD9 A;  2WLN A;  3JCZ A;  2QTO A;  3AG2 B;  1QLE B;  3ZIA G;  2DQ0 A;  1QVG U;  2EIL C;  1MOF A;  3B8N A;  2FTK A;  1W2B U;  2HKO A;  4XBF A;  5CBF A;  4XDL A;  3ETD A;  4LBE C;  2Q67 A;  4PEL A;  4RUE A;  1ROP A;  2EZP A;  1VQ6 V;  3AG1 C;  3W7W A;  2DYR C;  3VOU A;  3ZRW B;  1GKF A;  5HFM A;  1K7D A;  3K04 A;  2WPD G;  3ABL B;  4LCU C;  5B3S B;  4MSW C;  4WFB V;  5B1A C;  2JIZ G;  1NH2 B;  2IJJ A;  3FB6 C;  3CCS V;  3E35 A;  1VQ9 V;  2XAG A;  2HVK C;  4MTG A;  2P67 A;  2C2A A;  2ZDI A;  3OUF A;  3LSS A;  4JPR A;  3STZ C;  1YSC A;  5EBM C;  3CCR V;  3AG3 B;  1KP3 A;  1OCC B;  3ZCC A;  3ZRX A;  3ZN1 A;  5H6Q A;  3UKM A;  2IH1 C;  3ETE A;  4PDR A;  3CCE V;  1RPO A;  3CYO A;  1G8M A;  3FYE B;  1VQK V;  3CCL V;  1DF4 A;  1K5S A;  5IYD O;  3K03 A;  3K3W A;  1Q81 W;  3WFV A;  1BL8 A;  1K3E A;  1VQ7 V;  4GX2 A;  3ASN C;  1F4M A;  4PDL A;  4JGS A;  4U7N A;  1CPY A;  2WAM A;  1FXK B;  2Y48 A;  5LGN A;  1VQL V;  2EBO A;  5KUM A;  1YJ9 V;  2X6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...