2HFEC

Rb+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords FAB Heavy Chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hfeC00
2WLJA 4WFFA 4ZBMA 5EC1C 4MTFA 3E8GA 4MVOA 3OGCC 5KUMA 4JTDB 4UUJC 3SPCA 3AG4C 3SPHA 4WFGA 1OCOC 2QTOA 2EILC 1OCZC 2K1EA 2QKSA 3ABKC 3FB7C 2IH1C 1P7BA 3OUFA 2H8PC 4H33A 4MSWC 5E1AC 2EINC 3ASOC 4MTOA 3T4ZA 5IY5C 2R9RB 3IGAC 4XDJA 2Q6AA 5CBHA 3LNMB 4G28B 3E8BA 3SYQA 2HVJC 3F7YC 4HZ3A 1OCCC 3VOUA 4MVUA 2A79B 5CBGA 3T4DA 3BEHA 3K08A 4PDVA 4RO2A 4RUEA 1KKDA 2ITCC 2X6BA 1XL6A 1BL8A 4XDLA 5BZBA 3FB5C 4GX0A 4F4LA 4R8CA 3SYPA 1V54C 3K04A 2WLHA 1R3LC 3LUTB 1OCRC 4P2ZA 4X8AA 4PA7A 4MVSA 2DYRC 2HFEC 3FB8C 4G27B 4P30A 3TETA 3IFXA 1S5HC 2DYSC 3SYOA 5KUKA 2EIJC 3LDCA 3T1CA 2HJFC 2ITDC 4EKWA 2WLLB 3SPJA 5J9PC 3SYAA 2Q68A 1R3KC 4GX2A 2ZXWC 2HVKC 2X6CA 4PDLA 1ZWIC 4MW8A 2WLIB 2A9HA 3ASNC 4J9YB 3LDDA 4P9PA 4R7CA 4R50A 1K4DC 4PA9A 4PA3A 3K0DA 2Q69A 3SPIA 3F5WC 1J95A 4PDMA 1M57C 1ORQC 3UKMA 3RVZA 3WG7C 1QLEC 2Q67A 5B3SC 4JTCB 3JYCA 3GB7C 4OXSA 4RAIA 4XDKA 2Y69C 4JTAB 3SYCA 3AG3C 4WFEA 3RW0A 3KG2A 3OR6C 2YEVA 1JVMA 3ZJZA 4RUFA 4TWKA 2A0LA 1R3JC 3ZRSA 3K03A 5CBFA 3PJSK 3E8HA 3K06A 3T2MA 3X2QC 2ATKC 4QE7A 4GX1A 3E8FA 2WLMA 4MVMA 4P9OA 4MTGA 3EFFK 4R6ZA 1M56C 3ABMC 2BOBC 3RBZA 5EC2C 1XL4A 3F7VC 4PA6A 3SJQC 5EBLC 3OR7C 2HG5C 4PDRA 2W0FC 2WLLA 3UM7A 1K4CC 1G4YB 4H37A 3HPLC 5EBWC 4QNHB 2X6AA 2DWDC 4MVQA 4WFHA 2OCCC 2WLIA 4LCUC 5EK0A 2AHYA 4MVRA 2KB1A 2BOCC 1R3IC 4J9ZB 4MS2A 1V55C 2AHZA 3SPGA 4MW3A 4CBCA 3OUSA 3R65A 2EIMC 1LNQA 4GX5A 4X89A 3STLC 4MVZA 4QE9A 5B1AC 2NLJC 2WLNA 4DXWA 2WLKA 4X88A 2DWEC 3LDEA 4LBEC 3ABLC 5EBMC 4HYOA 3E83A 3RVYA 4PA4A 4I9WA 4KFMA 3AG1C 3STZC 3K0GA 2IH3C 3AG2C 3TCUA 2P7TC 3E86A 2ZD9A 3E89A 4BW5A 4LP8A 2EIKC 3FB6C 2JK5C 5B1BC
chains in the Genus database with same CATH superfamily
2WLJA 1D2DA 3ZN1A 3IAYA 2ZM6O 1FXKB 1R6TA 1Y76B 4MSWC 2ZM6B 4MTOA 1EZJA 2OTJV 3SYQA 5KHHA 3VOUA 3WG7B 4LC1A 4FFBB 4F6RB 4XDLA 1H2SB 2OIGA 2HP8A 5LGTA 4CH5A 1WAZA 1NZ6A 1VQOV 3MDSA 4U7NA 1SC5B 4NXMO 4CS3A 5IJ0A 5CB4A 5J9PC 1R3KC 4NXMB 4O2BB 4WBNB 2HVKC 3CX5F 4MW8A 3D36A 1WB8A 5GONA 1YIJV 4UCTA 5TISZ 2Y69C 1X4TA 1P49A 4EB6B 5FPOA 4YJ2A 3OR6C 3OMNB 1IBLO 1I5XA 4TWKA 1VQ6V 3WU2Z 1IBLB 2QKAA 4GX1A 3E35A 2E75B 2Y4UA 1VF6A 2OYQA 4WCEV 1K9MW 3K9SA 1I08A 3H1HH 4IHJA 3U11A 2XASA 2D2CB 5LP6C 2XAHA 4DV7O 4DV7B 2KG7A 1OCZB 3R65A 4QE9A 3QG5A 3S3WA 1SKVA 4U3JA 1RM1B 1THZA 3N27A 1IDSA 3JD3A 3BFRA 2HHHO 4J7ZA 2PUSA 5BMVA 2HHHB 3FD9A 1FPOA 4WFFA 4UB6Z 4FLXA 1TUBB 2ZE8A 3RYHA 5K1XA 5E1AC 3Q4HB 3JAMN 4X9QA 5LOVA 2O57A 3E8BA 4I7ZB 2Y0PA 5CBGA 2A79B 3W7XA 1KKDA 2ITCC 2ZNIA 5FLXN 3DXRA 2IU0A 1L1FA 2HJFC 3JD2A 4JAAA 2ADPA 4YJ3A 2W6IG 1BZKA 3F5WC 2QE7G 4A5UB 1B04A 4XDKA 1XUQA 3KG2A 1P84F 4FM2A 3P30A 4IIJB 2YXYA 4ZI7B 2Z0AA 4BIUA 1VARA 3KCYA 3ZRSA 3JALB 2QWOB 3K06A 1VEWA 1YXBA 4MVMA 4KXRA 4ZOLA 2ZE6A 4X65O 2R9IA 4I50A 4PA6A 4X65B 1XMOO 2FKXA 1XMOB 4TV9B 3JD4A 2F23A 4RWUA 4H0LB 1G8MA 2JEUA 4OGQB 1AI4A 1B6QA 1KP2A 2X7RB 4E4EA 4TQDA 3CCMV 2CH7B 1GH6A 1OCCB 4W4KA 4I9WA 1AP5A 2XAGA 5GW7A 3H1LH 4MTFA 2IJKA 2CTPA 4UUJC 3SPHA 2VRZA 2EILC 1P7BA 2RMKB 1PP9H 2EINC 3ASOC 3H1JH 1NH2B 2ZIMA 1QR8A 1FXVA 1EN4A 1QR9A 1F7YA 3OTOO 4JI0O 3R66A 3OTOB 4JI0B 4JYYA 2ILMA 3P32A 1LUVA 4PD4F 1OHHG 4LF8O 1HNXO 3OTFA 5AG2A 1NR7A 4LF8B 1WJZA 1HNXB 2QR4A 3SYOA 4LF5O 2EIJC 2LFSA 3SPJA 1FXKC 3SYAA 4LF5B 5LMUO 5LHGA 3CD6V 5LMUB 4AILC 4I4TA 2GBOA 3WG7C 1QCEA 5KA6A 3JYCA 4RAIA 1QQCA 2DW4A 1Q3EA 3M7MX 5LBQA 3JSNA 5EIBD 3B40A 5BXZA 1R3JC 3HKDB 3K03A 1VF7A 1AJPA 5LHHA 4P9OA 1N0NA 3FYIB 4JAUA 3G80A 2EX3A 2OT5A 3JAWA 1PNLA 4CC5A 1K4CC 1FXKA 5D5PA 1Y76A 2P4VA 3HPLC 2OCCC 2PGGA 1U96A 1V55C 4B7KA 1SQQH 4HBNA 4FFBA 4ZIBA 3ZRWA 3QNEA 4FLZA 1XREA 4UCVA 4AHCA 1D5AA 1H38A 1FKAO 2UXNA 5B1OA 1K8AW 1NR1A 4BR6A 5IJ0B 4BW5A 2XAJA 3QF7A 2L6LA 4WBNA 2DYRB 2KSDA 1YJWV 5L3CA 1NH2D 1IZ3A 2ZE7A 1SETA 4JTDB 2YIDA 3CRQA 5DM6V 3NXSA 4WFGA 4KHPO 3K0DA 1OCZC 4IYHA 1AVMA 3VQVA 3K5NA 2P5OA 3K57A 4KHPB 1YEWA 2ZXWB 5DN6G 2FYUH 1M5IA 1RM1C 3L74H 5H2FZ 3AK1A 2XT9A 1DGSA 1CPYA 2HKOA 1JJ2U 4FLYA 4PJ0Z 4QGPA 2RQ6A 4JYBA 4P30A 4FLWA 4JI3O 3L72H 3JSLA 1DK1A 2W0XA 4IHJB 4JI3B 2QSAA 5DEDA 1J5EO 4XBFA 2VWJA 2UXXA 3SPIA 1J5EB 2KG7B 3GWKC 2JEXA 4TV8B 4EFBA 2ZQMA 2VWKA 1FFTB 1XMQO 3SYCA 1AR4A 4U3JB 1XMQB 5C8YB 5KAFZ 5L3DA 3ABKB 2KQXA 4O4LA 5BMVB 1Q6HA 2P90A 2JIZG 2JDIG 1U97A 2P67A 2HG5C 3RYHB 4I9QA 1TUBA 3Q4HA 5LOVB 4MVQA 5B1BB 2WLIA 5IYBO 2AXTZ 2VQEO 2Z3YA 2IBZH 2P06A 2VQEB 3E2EA 4JPRA 2IJJA 4AI8A 3C3SA 4Z2WA 3QTCA 1PPJH 1VQKV 2CTRA 4DV4O 2F66C 2ZD9A 1V54B 4K35A 4DV4B 2IU3A 4YJ3B 2RNBA 1K73W 2PF4E 3OGCC 3KZIZ 2R70A 2F4VO 1SERA 1SQFA 4XDJA 1FXHA 2F4VB 1OCCC 5JJJB 2PYLA 5H5NA 2W6JG 4ZI7A 1Y6XA 3QO5A 1BL8A 4R8CA 2M6YA 3ETQA 4ZOLB 2JJ2G 3RFRA 4I50B 3TETA 1AJNA 1PL0A 3WB2A 4TV9A 1LUWA 4GCZA 4DV0O 4FIPC 1GTOA 3LDDA 1JCHA 4IT5A 4JASA 4PA3A 5J2TA 5IJ9A 1US6A 2CGOA 2P6JA 1HW7A 4KUMA 4DV3O 1Q81W 1Y67A 3ZRVA 1JVMA 4DV3B 2EBOA 4NR1A 4DR2O 4DR1O 1S0VA 3PJSK 1HDJA 2NN4A 2L35A 4DR2B 4DR1B 5D5QA 5IT9N 4NVPA 1BHBA 2BOBC 2FB5A 2V7QG 1SA0A 1VQLV 1SQVH 5E79Z 4H37A 5JH7B 3CCVV 1RP3B 1ZX3A 2DJVA 3ZMVA 2ZCEA 1LNQA 2OTLV 1FYJA 3RT3C 3E22B 1UJWB 1KYOF 3ZHUA 2JGUA 4ICGA 2IH3C 2YXHA 3ML0A 3L71H 1KBHA 4I4TB 3HKCA 5KUMA 5KHJA 2RCVA 1R6NA 2K1EA 2IJIA 2UXBO 3U0ZA 4JI6O 4NTYA 4FJCC 1XOUA 3ASNB 4B3RB 3F7YC 4MVUA 4JI6B 5LXTB 3ABTA 1M57B 4DW1A 2YXLA 3PN1A 1W0JG 2WLHA 4DR4O 4DR4B 2DYRC 3D36C 2JJ1G 2M7WA 3JAWB 2N74A 4YIOA 2ZXWC 1ZWIC 2A9HA 2GTSA 2N05A 4H44B 2ETNA 3ZMZA 3AG2B 4C7UA 5C93A 3OAAG 2QM8A 4LFCO 2NNUA 1PL4A 3ZRWB 4KP4A 1YSCA 3GB7C 4OXSA 4YHHO 2EJ7A 4LFCB 3A0RA 4YXWG 4YHHB 1V9PA 1NTZH 3CE2A 3CCQV 4BWAA 1VF6C 1RSOA 1VMGA 1S5JA 5IY5B 2LGWA 5B1AB 2WLMA 2CTWA 1TVKA 3ZHSA 4J7JA 3VQYA 1S77D 2QM4A 4DR7O 2F43G 3K9AA 4J11A 4DR7B 3C3TA 1RFYA 5EK0A 2AHYA 4MVRA 2BOCC 3MHHC 5EYPA 5IYCO 1PM9A 3LSSA 2YS8A 4IGGA 2ZDIC 3FAVA 5EZYB 3LSQA 3DSQA 3F5TA 1ROPA 3E86A 3E89A 3FB6C 5B1BC 4NYKA 1S3JA 4X20B 2E76B 1I7FA 4GUNA 1Q7YW 1DF5A 4FLUA 3T1YO 1ENVA 4TV8A 3T1YB 3LNMB 4L8JA 4UVCA 3OEHG 4N23A 2B5UA 1W59A 2NR5A 4FLTA 5C8YA 3BEHA 4PDVA 5LYJB 4O4LB 1V54C 2ZDIA 3H01A 1VQ7V 3BHPA 4KL1A 1NKDA 2HFEC 4MVSA 1N8RW 3SJBC 1VP7A 1YCIA 1FAFA 4GX2A 2X6CA 5FPRA 2WLIB 1Z5VA 5IYZB 1BCCH 4UCOA 2WA4A 1MZFA 1GRJA 4CZZA 4IYIA 1I5YA 3RW0A 1JX9A 3AG4B 2CTQA 5H6QA 3BRCA 3CC4V 4U3FH 1K97A 4O4IB 3TGUH 1WNSA 2MK3A 2UUBO 1K92A 2JGDB 4X62O 4R6ZA 3CCJV 2UUBB 3F7VC 4J10A 5CA3A 1I0HA 3OR7C 2BTQB 3CRRA 2WLLA 4NKGB 4DO2A 2DQ3A 3EVKA 4UCSA 1PNKA 2DYSB 4Z1VA 3TXQA 1NBMG 4WFBV 2AGAA 2V4DA 5JQGA 3K79A 3LDEA 3OM3B 3E83A 3RVYA 4BAYA 1M93A 4LFAO 3ETEA 4JGSA 5L3GA 4LFAB 4JI4O 2JVDA 4D7SA 5J2TB 3W7UA 4ZBMA 4DV6O 4CH6A 1JFFA 2QKCA 5IJ9B 1M4UA 4DV6B 4FM0A 2QTOA 4LH6A 3BAAA 2IH1C 3QO8A 1YJ9V 1CEZA 3O9OA 1R73A 4G28B 4FZ1A 1N32O 1KMIZ 3ZRXA 4LH7A 1N32B 2X6BA 1QLEB 1AP6A 4QJFB 1N34O 3SYPA 1Q90D 2LJ2A 5IDJA 3CMEV 3MD0A 4X8AA 1SA0B 2PY5A 3T1CA 2GUZB 2ZR3A 2XUMA 2RN9A 3ASNC 4J9YB 5JH7A 4R50A 1XBLA 5LL6Y 1J95A 1M57C 2Q67A 5B3SC 2DOSA 4JTCB 3CRMA 1VQPV 3FYEB 1AI6A 4TOIA 5JCOC 1TAEA 3E22A 1E1RG 1JJOA 5A9GA 2YSUB 4DRXA 3JATB 4DK1A 1K33A 1NVPD 2EIMB 1BT8A 5CBFA 1Y4MA 4QE7A 3VQXA 2P4KA 1SQXH 3CXHF 4Q20A 3HKCB 3SJQC 5JWPA 5L3BA 1XI1A 2Y48A 3KKYA 4PDRA 3ZIAG 1JQ0A 1MSWD 4MS2A 2AHZA 3FKSG 1Q8IA 2YIAA 2HEPA 1OCOB 4MW3A 5LXTA 2HJDA 4JYCA 5B1AC 5F2VO 5JCOA 4EFEA 3ZHRA 3ZS8C 1BGYH 4UFZA 3RYCA 2P7TC 1YZBA 1H2LA 2MW2B 1HR0O 1MA1A 3I55V 4I5SA 2JK5C 4DUZO 1HR0B 2Q7HA 4PI0A 4LR3A 4DUZB 3SPCA 2Y0IA 3FFQA 4DW0A 2QKSA 1PV0A 2H8PC 2LQTA 1BQ0A 4UV8A 1RSOB 1XL6A 3OFNG 2CAZC 4GX0A 4B3TO 4B3TB 1TVKB 3TXSA 2ZNJA 3G6BA 3IFXA 2ZKOA 1Z5WA 3K3WA 3X2QB 4K0KO 1EZVH 4K0KB 2Q69A 3DGEA 1Q43A 5EYPB 3FAVB 4NTWA 4WFEA 1S72V 3P3PA 2YUAA 1KC8W 3JD0A 5EZYA 2XAQA 4RUFA 1IBMO 2ZE5A 1IBMB 3B4SA 1YVWA 1QBZA 3UT5A 4OX9O 3AG1B 1XL4A 5EC2C 1OJHA 5KHIA 4OX9B 4X20A 3MHSC 2UXDO 1F4MA 1H2GA 4WFHA 2DWDC 1YJNV 1PD3A 4LCUC 1R1BA 5H6RA 1XILA 2G38A 2EJRA 1H2KA 5LYJA 5KLVH 3IC7A 2DWEC 4B08A 2Q8VA 3STZC 2GSMB 3K0GA 3B09A 1B3QA 3BVOA 2BE3A 2F95B 4LP8A 1E1QG 1PNMA 2F93B 2ARHA 4FM1A 3UCSC 2GHYA 1UFIA 2QJ1A 2WPDG 4F6EA 3D8CA 3AG7A 1YTFD 1SQPH 5IYZA 2CDYA 1AI5A 5JJEB 2R9RB 5CBHA 5EIBC 3RWRD 2Q73A 1K34A 1EBOA 3DTUB 4RO2A 4LF4O 4O4IA 1FD9A 3OE7G 3FB5C 4DV2O 4LF4B 3HKBA 3OMAB 4FZ0A 2JGDA 5A2QN 1BQZA 3W7SA 2P22C 1N4CA 3RYFB 3CC7V 2PI4A 2YC0A 1SF9A 4EKWA 2ITDC 2BTQA 2WLLB 3ETDA 4DR3O 4PDLA 4G2KA 5B66Z 4DR3B 1S5LZ 1K4DC 3ZBHA 3UKMA 1QLEC 4LF7O 1JR9A 2RJZA 5JQGB 5JJNB 4LF7B 1I94O 3D3IA 2WSSG 3N2KB 1I94B 3RN4A 3BCCH 2A0LA 4B7EA 3J81N 3OMIB 1DTOA 3ABLB 1WN7A 4DV0B 2C2AA 3BA9A 4MT8A 1JFFB 3G71V 1FFXA 4GYCB 4LFBO 2OCHA 2IM9A 3CEIA 4WF9V 4LFBB 1XHZA 4UB8Z 3DC6A 3G67A 4K8ZA 1YDXA 2B1IA 2EIMC 1MZEA 1M1KW 3CSXA 2IJHA 1HNZO 4HYOA 4UXNA 2QWRB 1K7DA 2PTMA 1HNZB 4UCRA 2UUCO 5FL7G 2UXCO 3JASB 3CB2A 3ZMSA 2UUCB 2UXCB 4NXNO 4LNUB 1OCRB 2GUZA 5J2UB 4NXNB 2Q9LA 5EC1C 4MVOA 1CP9A 3NR7A 1SS3A 1OCOC 5KHKA 4QIWF 3CYOA 1H2NA 3VBBA 1VQNV 1FS0G 1WA8A 4DRXB 1BHAA 3AEIA 3CRCA 3JATA 2EULA 3RYIB 3O65A 3WB1A 2ZINA 1G1XB 3I56V 5H9CA 3DC5A 4H13B 3SJAC 1S5HC 5KUKA 4JYAO 1VQMV 3K59A 1KD1W 1NT2B 3HR0A 4O2AB 3CMAV 4JYAB 3CP1A 2FL4A 2WAMA 3CCUV 1IBKO 4PA9A 2UXBB 1K3EA 2ZR2A 1IBKB 3ZEDA 4ZKIA 4PHZA 2BCCH 1AI7A 2VQFO 3CJHB 1BE3H 2VQFB 5KA5A 2AZ2A 1LR1A 1B06A 3RYCB 3HB3B 1VIBA 3T2MA 3X2QC 1KUQA 5CA0A 5HFMA 1QLNA 5EBLC 3BPZA 1NI8A 4X1YA 5FNVA 1AJQA 2EIKB 4ABMA 3ZHQA 1QVFU 2ODMA 2QTSA 3APOA 2DE0X 4O4HA 4CS4A 4J9ZB 2EIJB 1GO3F 1GM7A 3OT7A 3B2EE 2BSKA 3N2GA 5LA6B 3OW2U 2HR3A 2NLJC 2Q0OC 4OPAA 4DXWA 2YEVB 1MMMA 3K5MA 3AG1C 4YIPA 3H1IH 1SZXA 3ZMTA 1E79G 4DV5O 4FVMA 4JI2O 2LW1A 4DV5B 4FK5C 1SQGA 1FJGO 4JI2B 2FMLA 4X1KB 4J42A 3ABKC 1FJGB 1H2MA 2Q6AA 4PI2A 4JI1O 3K5LA 4I0XA 3A2FA 1VF5B 4JI1B 5IWAO 3K08A 4E2LA 4QPJA 1EFRG 1O9HA 1UPGA 4EEQA 2RDCA 5IWAB 1BSMA 3RGBA 4L87A 2OCCB 3LUTB 1Z2GA 1IXMA 3UT5B 3L75H 1V55B 4DK0A 3UO3A 1N33O 2Q68A 4PELA 1WP8A 5LMNO 1N33B 2D3OW 3ABMB 3SJCC 5LMNB 3JARB 1WP7A 3RVZA 2YIBD 5GTHZ 1QNMA 4TT3G 3APQA 1IX9A 3GVMA 4X66O 2XAFA 2ZIOA 1NTKH 1MABG 4WFAV 4X66B 1KECA 3MAQA 3CCEV 1W2BU 1AILA 1GKFA 1KKCA 2ATKC 3E8FA 4JAVA 3CCRV 2XTAA 4MTGA 1VQ9V 3AK3A 5JVDB 1MNGA 5L3EA 2Q5ZA 1PKXA 1SZTA 5HFLA 3BY6A 4DV1O 4GT1A 4X1IB 2W0FC 1JA8A 2K9PA 4ZHQA 2LO1A 4DV1B 1WPXA 4NTXA 1TGOA 1MG1A 1R3IC 3JAKA 3ICXA 4D6TH 4TUYA 4GX5A 4UVBA 3WB0A 4MVZA 1GN6A 4B3MO 1QU7A 3HKBB 5LP6A 5LGNA 2CUGA 3ABLC 4B3MB 1Y74B 1NU1H 4X62B 1URFA 1NVPB 3H1KH 3RYFA 1F4NA 3TCUA 5CMUA 1NJIW 4YY3O 1OV9A 5K1PA 4YY3B 1SQBH 3OUFA 5ITZA 4LWSA 2LGQA 3A8TA 4IL6Z 2LFRA 1T5EA 1YHQV 2H94A 3T4DA 2VS0A 2QM7A 3N2KA 3W7WA 5B1NA 4N21A 3G6EV 5BZBA 3VQWA 2A06H 3I5DA 1OCRC 2EZPA 1K5QA 4JI4B 1MSDA 5KMGA 1N0JA 1FFXB 3LDCA 3L73H 2Y4TA 1ZL8A 4FLVA 1M56B 2Z5UA 4I55B 1JMKC 2UU9O 4QPKA 1R6KA 4J80A 2YI8A 4AQYO 2UU9B 4AQYB 4O4JA 1M9NA 1N34B 2B9ZA 3ETGA 1H8HG 3ZJZA 2JS5A 3JASA 4LF9O 4LNUA 1ZTEA 1SESA 4LF9B 5J2UA 1DF4A 3LSUA 2CK3G 1XNRO 1QHTA 5LHIA 2R9AA 5IE9A 1XNRB 3M8AA 3TJTA 1WA8B 4CH4A 4B3SO 2GTAA 4B3SB 4CBCA 3OUSA 2UUAO 3RYIA 4X89A 2UUAB 1GM8A 3EXAA 4Z1MG 5EBMC 2FTKA 5CA1B 4HNAA 5DECA 1NTMH 3AG2C 3OGIB 2EIKC 1AR1B 4O2AA 1AR5A 4H33A 3CXCU 2E3CA 5IY5C 3T4ZA 3W7TA 2XOKG 1KP3A 3CJHA 3K58A 4K8XA 3OEEG 4HZ3A 1W0KG 3IJ4A 2YIBA 4X64O 4RUEA 4JI5O 5BY1A 1GK9A 3HKEA 4JI5B 4X64B 2QGNA 3AG3B 4GZRB 4JV5O 2CGNA 5CA0B 2WA3A 3FB8C 4G27B 3GWOA 4JV5B 2AW9A 3J80N 5KX5B 4CC6A 4X1YB 5FNVB 3B8NA 3OD4A 2QWPB 3FX7A 2BTOA 2F1MA 1XNQO 1BS3A 4P9PA 5CN0A 5L3FA 1M90W 1YTFB 2LP7A 4O4HB 5B5EZ 1XNQB 2WWWA 3ABUA 4PDMA 4BIZA 4CH3A 2BSKB 3N2GB 4JTAB 4TQFA 5LA6A 2IW5A 2V1DA 5LGUA 4DR6O 2YEVA 4JF3A 1IXBA 2XHBA 4DR6B 1MOFA 4F6RA 4FMTA 3E8HA 4JZGA 4PV1B 1F23A 4JI7O 3U10A 1AB3A 1ZUQA 4JI7B 3ABMC 3T1HO 3RBZA 3C90A 1OZ0A 5BR8O 3T1HB 4X1KA 5CB4B 1N36O 5BR8B 4O2BA 5EBWC 2X6AA 1N36B 3BA8A 4I0XB 2KB1A 3LNNA 5GONB 2ADQB 3D3QA 1WB7A 2E74B 5GTIZ 2WLNA 1D5NA 4YJ2B 4EB6A 4LBEC 5IYDO 4GLXA 4RQFA 4ASUG 4PA4A 4Q6GA 4D7TA 1GMGA 2R72A 4OPHA 1P4RA 1O9GA 4W4LA 4NB5A 2PZSA 1EM1A 2UXDB 3ZHTA 3E8GA 1IURA 2GDSA 3AG4C 4RQEA 3JARA 3L70H 3FB7C 1JOYA 4FPPA 1KU9A 3IGAC 3EHBB 3JCUZ 1WPBA 2HVJC 3SGIA 2QEXV 3THOA 3ZX6A 4F4LA 1GM9A 2Y69B 1R3LC 1WLEA 4P2ZA 4HAMA 4PA7A 5JVDA 1GN2A 2DYSC 2E5LO 4X1IA 4ZHQB 1ZLZA 1GN4A 2E5LB 1X59A 2XNDG 1KB9F 4K3AA 3IC9A 4UV9A 4R7CA 1ZSPA 3JAKB 1ORQC 2OIEA 4FFKA 3JCZA 3BABA 4TUYB 1F51A 4J41A 2PYJA 1HP8A 3A0BZ 5LP6B 4BW9A 4DV2B 1VQ5V 3KCXA 3QO7A 1Y74A 2DQ0A 2LW7A 1QVGU 3ZHVA 1RPOA 3EFFK 3CCSV 4TSFG 3SDLA 1M56C 3DXRB 2Q0AA 3M99B 2A7WA 1KQSU 3K5OA 2DN9A 1XHXA 3UM7A 5ITZB 4LWSB 4DUYO 2Q7EA 1G4YB 4CS2A 2Q7GA 4DUYB 1NS1A 1IVSA 1S76D 3B8MA 2ZT9B 3SPGA 1JPXA 3S3XA 3WFVA 4DR5O 3QVNA 3UO2A 2WLKA 1XDCA 4DR5B 1Q6UA 1XQ8A 4IIJA 5KMGB 2AZ0A 4J7KA 4LF6O 3JALA 3JD1A 4LF6B 1ZL8B 4KFMA 1HNWO 1AROP 4JZ2A 1HNWB 4I55A 2GV9A 1YI2V 1L0NH 1NQTA 1A32A 2DMXA 4MTXA 3STLC 3CHXA 2JS3A 1TUEB 2YDEA 4O4JB 1RPRA 2B1GA 2QDOA 1HWYA 1K5SA 2N04A 3L9DA 2JRIA 3H9VA 1TA8A 2CE4A 4GKKO 1COWG 2KKWA 1XEQA 3AK2A 4GKKB 3UQ8A 2QA4V 1H8EG 3K04A 3CWBH 2CH7A 1YITV 3CS5A 1BMFG 4JI8O 2YI9A 1Q5OA 3B77A 1VQ4V 2A3QA 1YF2A 4JI8B 2YICA 1G6UA 3CC2V 3J7AU 1P7GA 3ZN0A 5KHGA 4BIOA 1CXZB 2X0LA 4GKJO 1L8DA 4GKJB 3AG3C 1EN6A 1VQ8V 5CA1A 2PI5A 4HNAB 2EZOA 5KAIZ 1L0LH 1ZAUA 3SR2C 1EN5A 2Q4PA 3CRAA 3P3NA 3CCLV 2OWOA 4QNHB 4UVAA 1Q6IA 1Q82W 1GN3A 2QWQB 2QWNB 3ZMUA 2EILB 3TK1A 1Y66A 3HKEB 4U7OA 2EINB 3ASOB 4B3RO 3A0HZ 3ZCCA 1SRYA 4X88A 1DLBA 4DYLA 5B3SB 4UCUA 3HKDA 1Q86W 5KX5A 2H3OA 2HLDG 3CPWU 1GAXA 3G4SV
chains in the Genus database with same CATH topology
2WLJA 1K73W 3ZN1A 3OGCC 3SPCA 2QKSA 3OUFA 1FXKB 2H8PC 4MSWC 4MTOA 1SERA 2LFRA 1EZJA 4XDJA 2OTJV 3SYQA 1FXHA 1OCCC 3VOUA 1YHQV 2H94A 3T4DA 4UV8A 3WG7B 2W6JG 2QM7A 3W7WA 4LC1A 5B1NA 1XL6A 3OFNG 1BL8A 3QO5A 4N21A 4XDLA 5BZBA 3G6EV 4GX0A 4R8CA 1OCRC 5LGTA 2EZPA 1K5QA 2JJ2G 3TETA 3IFXA 1VQOV 4U7NA 1AJNA 1PL0A 3LDCA 3K3WA 5J9PC 3X2QB 4GCZA 1R3KC 2HVKC 4FIPC 4MW8A 1GTOA 1M56B 3D36A 1JCHA 2Z5UA 3LDDA 4JASA 4PA3A 2Q69A 4QPKA 3DGEA 1R6KA 1YIJV 3G4SV 2Y69C 2P6JA 4WFEA 1M9NA 1S72V 4KUMA 3OR6C 1Q81W 3OMNB 3JD0A 1KC8W 3ZRVA 3ETGA 1JVMA 1H8HG 1I5XA 3ZJZA 2XAQA 2EBOA 4RUFA 4TWKA 1VQ6V 1S0VA 3PJSK 4GX1A 3E35A 1QBZA 1SESA 1BHBA 2BOBC 1DF4A 2V7QG 3AG1B 1XL4A 5EC2C 2CK3G 4WCEV 1VQLV 1K9MW 3MHSC 5LHIA 1F4MA 1H2GA 2XASA 4H37A 4WFHA 2DWDC 1YJNV 1PD3A 3CCVV 4LCUC 2XAHA 5H6RA 2EJRA 4CBCA 3OUSA 1OCZB 3R65A 3ZMVA 1LNQA 2OTLV 4X89A 4QE9A 1GM8A 4Z1MG 3IC7A 2DWEC 1UJWB 1RM1B 5EBMC 2FTKA 3STZC 2GSMB 3K0GA 1THZA 2IH3C 3AG2C 3JD3A 3ML0A 4LP8A 1E1QG 2EIKC 1PNMA 1AR1B 2GHYA 4WFFA 2WPDG 5KUMA 1YTFD 1R6NA 1AI5A 2K1EA 5E1AC 4H33A 3CXCU 5IY5C 2IJIA 3T4ZA 2R9RB 5CBHA 3E8BA 3W7TA 2XOKG 1KP3A 4FJCC 3ASNB 3F7YC 3OEEG 4HZ3A 5CBGA 4MVUA 2A79B 1W0KG 3W7XA 1K34A 1EBOA 3DTUB 3ABTA 1M57B 4RO2A 1KKDA 4RUEA 2ITCC 1GK9A 3OE7G 3FB5C 1W0JG 2WLHA 3AG3B 3OMAB 2DYRC 3FB8C 4G27B 3GWOA 3W7SA 2JJ1G 2IU0A 2M7WA 1L1FA 3CC7V 2PI4A 2HJFC 2ITDC 4EKWA 2WLLB 3ETDA 3JD2A 3B8NA 2ZXWC 4PDLA 1ZWIC 4G2KA 2A9HA 4P9PA 5CN0A 5L3FA 1M90W 1YTFB 1K4DC 2LP7A 2W6IG 3F5WC 2QE7G 3AG2B 3ZMZA 2WWWA 3ABUA 4PDMA 3OAAG 3UKMA 5C93A 1QLEC 2QM8A 2NNUA 3ZRWB 4BIZA 4KP4A 1YSCA 3GB7C 4OXSA 4XDKA 4JTAB 2IW5A 3A0RA 4YXWG 3KG2A 2V1DA 5LGUA 2YEVA 3CCQV 4JF3A 3D3IA 2WSSG 3P30A 4BIUA 1MOFA 2A0LA 3ZRSA 4FMTA 5IY5B 3E8HA 3K06A 1F23A 3OMIB 5B1AB 2WLMA 4MVMA 1DTOA 3ABLB 2R9IA 3ABMC 2C2AA 4MT8A 3RBZA 4PA6A 1OZ0A 3G71V 1S77D 3JD4A 2F43G 3K9AA 5EBWC 1G8MA 2JEUA 2X6AA 4WF9V 5EK0A 2AHYA 4MVRA 2KB1A 1AI4A 2BOCC 1B6QA 3MHHC 1KP2A 2B1IA 2EIMC 5IYCO 3LSSA 2X7RB 2ZDIC 1M1KW 2WLNA 3CCMV 4LBEC 2IJHA 4HYOA 1OCCB 5IYDO 4UXNA 4RQFA 4ASUG 4PA4A 4I9WA 1K7DA 3LSQA 1GMGA 1P4RA 5FL7G 1ROPA 2XAGA 3E86A 3ZMSA 3E89A 1OCRB 3FB6C 5GW7A 5B1BC 5EC1C 4MTFA 3E8GA 2IJKA 4MVOA 1CP9A 1S3JA 3AG4C 4UUJC 1Q7YW 4RQEA 3SPHA 1DF5A 1OCOC 2EILC 3FB7C 4FPPA 1JOYA 1ENVA 1P7BA 4QIWF 2EINC 3ASOC 3CYOA 3VBBA 3IGAC 3EHBB 1NH2B 1VQNV 3LNMB 4UVCA 1FS0G 1QR8A 1FXVA 1QR9A 3OEHG 4N23A 2HVJC 2B5UA 1BHAA 3AEIA 2QEXV 3BEHA 4PDVA 4F4LA 1GM9A 1V54C 2Y69B 3I56V 1R3LC 2ZDIA 3P32A 1WLEA 3H01A 5H9CA 1VQ7V 4P2ZA 1OHHG 4HAMA 4PA7A 1NKDA 2HFEC 4MVSA 1NR7A 1S5HC 1N8RW 2DYSC 3SYOA 5KUKA 2EIJC 2LFSA 3SPJA 1FXKC 1VQMV 1KD1W 3SYAA 5LHGA 4GX2A 2XNDG 3CMAV 2X6CA 3CP1A 3CD6V 2WLIB 4UV9A 2WAMA 4R7CA 3CCUV 4PA9A 1K3EA 2ZR2A 3WG7C 1ORQC 1QCEA 4ZKIA 5KA6A 3JCZA 3JYCA 1F51A 1AI7A 4RAIA 4CZZA 2DW4A 5LBQA 1I5YA 3RW0A 1JX9A 1VQ5V 3AG4B 3QO7A 5KA5A 5H6QA 3CC4V 1K97A 1R3JC 3HB3B 3K03A 2DQ0A 3T2MA 1AJPA 5LHHA 3X2QC 2MK3A 1QVGU 1K92A 1RPOA 4P9OA 3FYIB 3EFFK 3CCSV 4R6ZA 4JAUA 3CCJV 5HFMA 4TSFG 1QLNA 1M56C 3F7VC 2OT5A 3M99B 1KQSU 5EBLC 5CA3A 3OR7C 1PNLA 3UM7A 2WLLA 1K4CC 1FXKA 1AJQA 1G4YB 2EIKB 1QVFU 4DO2A 2DQ3A 3HPLC 2OCCC 1S76D 1PNKA 2DYSB 3B8MA 4J9ZB 2EIJB 1V55C 3SPGA 1GO3F 1GM7A 1JPXA 1NBMG 3ZRWA 4WFBV 3WFVA 3OW2U 2HR3A 2NLJC 4DXWA 2WLKA 3K79A 3LDEA 3QNEA 2YEVB 3OM3B 3E83A 3RVYA 4BAYA 3AG1C 1H38A 3ETEA 2UXNA 5B1OA 4JGSA 5L3GA 1K8AW 1NR1A 3JD1A 4BW5A 3ZMTA 1E79G 2XAJA 4KFMA 1AROP 2DYRB 1YJWV 5L3CA 4ZBMA 3W7UA 1NH2D 1SETA 4FK5C 4JTDB 5DM6V 3NXSA 1YI2V 4WFGA 1NQTA 3K0DA 2QTOA 1OCZC 3ABKC 4MTXA 3STLC 2IH1C 3QO8A 1YJ9V 1TUEB 1CEZA 2ZXWB 2Q6AA 1R73A 5DN6G 1RPRA 4G28B 2B1GA 1RM1C 1HWYA 1K5SA 3ZRXA 3K08A 4E2LA 4QPJA 1EFRG 1QLEB 2X6BA 1COWG 1CPYA 2HKOA 1JJ2U 4QJFB 2QA4V 3SYPA 1H8EG 4L87A 3K04A 2OCCB 5IDJA 3LUTB 3CMEV 3MD0A 4X8AA 1IXMA 4JYBA 1YITV 1V55B 4P30A 1BMFG 3T1CA 3B77A 1VQ4V 2Q68A 4PELA 2ZR3A 3CC2V 2D3OW 3ABMB 3ASNC 4J9YB 4XBFA 3ZN0A 4R50A 2UXXA 2X0LA 3SPIA 1J95A 1M57C 3RVZA 2Q67A 5B3SC 2JEXA 4JTCB 2ZQMA 1VQPV 3FYEB 4TT3G 1AI6A 1FFTB 3SYCA 3AG3C 1E1RG 2XAFA 2YSUB 1K33A 1MABG 4WFAV 1VQ8V 1KECA 3CCEV 5L3DA 1W2BU 1NVPD 3ABKB 2PI5A 2EIMB 5CBFA 2EZOA 1GKFA 1Y4MA 2ATKC 4QE7A 3E8FA 4JAVA 3CCRV 1VQ9V 4MTGA 2P90A 2JIZG 2JDIG 4Q20A 5L3EA 1PKXA 1SZTA 5HFLA 3SJQC 2P67A 5L3BA 2Y48A 3BY6A 2HG5C 4GT1A 4PDRA 2W0FC 3ZIAG 1WPXA 3CCLV 4QNHB 4MVQA 4UVAA 1JQ0A 5B1BB 1MSWD 2WLIA 1Q82W 1MG1A 5IYBO 1R3IC 4MS2A 2Z3YA 2AHZA 3ZMUA 3FKSG 4MW3A 1OCOB 2EILB 3TK1A 1Y66A 3E2EA 4U7OA 4GX5A 4UVBA 2EINB 2IJJA 3ASOB 4JPRA 4JYCA 4MVZA 3ZCCA 5B1AC 1SRYA 4X88A 5LGNA 3ABLC 1DLBA 1NVPB 1F4NA 5B3SB 3TCUA 1VQKV 1Q86W 2P7TC 2HLDG 2ZD9A 1V54B 5CMUA 3I55V 3CPWU 1NJIW 2IU3A 4I5SA 2JK5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLJ A;  4WFF A;  4ZBM A;  5EC1 C;  4MTF A;  3E8G A;  4MVO A;  3OGC C;  5KUM A;  4JTD B;  4UUJ C;  3SPC A;  3AG4 C;  3SPH A;  4WFG A;  1OCO C;  2QTO A;  2EIL C;  1OCZ C;  2K1E A;  2QKS A;  3ABK C;  3FB7 C;  2IH1 C;  1P7B A;  3OUF A;  2H8P C;  4H33 A;  4MSW C;  5E1A C;  2EIN C;  3ASO C;  4MTO A;  3T4Z A;  5IY5 C;  2R9R B;  3IGA C;  4XDJ A;  2Q6A A;  5CBH A;  3LNM B;  4G28 B;  3E8B A;  3SYQ A;  2HVJ C;  3F7Y C;  4HZ3 A;  1OCC C;  3VOU A;  4MVU A;  2A79 B;  5CBG A;  3T4D A;  3BEH A;  3K08 A;  4PDV A;  4RO2 A;  4RUE A;  1KKD A;  2ITC C;  2X6B A;  1XL6 A;  1BL8 A;  4XDL A;  5BZB A;  3FB5 C;  4GX0 A;  4F4L A;  4R8C A;  3SYP A;  1V54 C;  3K04 A;  2WLH A;  1R3L C;  3LUT B;  1OCR C;  4P2Z A;  4X8A A;  4PA7 A;  4MVS A;  2DYR C;  2HFE C;  3FB8 C;  4G27 B;  4P30 A;  3TET A;  3IFX A;  1S5H C;  2DYS C;  3SYO A;  5KUK A;  2EIJ C;  3LDC A;  3T1C A;  2HJF C;  2ITD C;  4EKW A;  2WLL B;  3SPJ A;  5J9P C;  3SYA A;  2Q68 A;  1R3K C;  4GX2 A;  2ZXW C;  2HVK C;  2X6C A;  4PDL A;  1ZWI C;  4MW8 A;  2WLI B;  2A9H A;  3ASN C;  4J9Y B;  3LDD A;  4P9P A;  4R7C A;  4R50 A;  1K4D C;  4PA9 A;  4PA3 A;  3K0D A;  2Q69 A;  3SPI A;  3F5W C;  1J95 A;  4PDM A;  1M57 C;  1ORQ C;  3UKM A;  3RVZ A;  3WG7 C;  1QLE C;  2Q67 A;  5B3S C;  4JTC B;  3JYC A;  3GB7 C;  4OXS A;  4RAI A;  4XDK A;  2Y69 C;  4JTA B;  3SYC A;  3AG3 C;  4WFE A;  3RW0 A;  3KG2 A;  3OR6 C;  2YEV A;  1JVM A;  3ZJZ A;  4RUF A;  4TWK A;  2A0L A;  1R3J C;  3ZRS A;  3K03 A;  5CBF A;  3PJS K;  3E8H A;  3K06 A;  3T2M A;  3X2Q C;  2ATK C;  4QE7 A;  4GX1 A;  3E8F A;  2WLM A;  4MVM A;  4P9O A;  4MTG A;  3EFF K;  4R6Z A;  1M56 C;  3ABM C;  2BOB C;  3RBZ A;  5EC2 C;  1XL4 A;  3F7V C;  4PA6 A;  3SJQ C;  5EBL C;  3OR7 C;  2HG5 C;  4PDR A;  2W0F C;  2WLL A;  3UM7 A;  1K4C C;  1G4Y B;  4H37 A;  3HPL C;  5EBW C;  4QNH B;  2X6A A;  2DWD C;  4MVQ A;  4WFH A;  2OCC C;  2WLI A;  4LCU C;  5EK0 A;  2AHY A;  4MVR A;  2KB1 A;  2BOC C;  1R3I C;  4J9Z B;  4MS2 A;  1V55 C;  2AHZ A;  3SPG A;  4MW3 A;  4CBC A;  3OUS A;  3R65 A;  2EIM C;  1LNQ A;  4GX5 A;  4X89 A;  3STL C;  4MVZ A;  4QE9 A;  5B1A C;  2NLJ C;  2WLN A;  4DXW A;  2WLK A;  4X88 A;  2DWE C;  3LDE A;  4LBE C;  3ABL C;  5EBM C;  4HYO A;  3E83 A;  3RVY A;  4PA4 A;  4I9W A;  4KFM A;  3AG1 C;  3STZ C;  3K0G A;  2IH3 C;  3AG2 C;  3TCU A;  2P7T C;  3E86 A;  2ZD9 A;  3E89 A;  4BW5 A;  4LP8 A;  2EIK C;  3FB6 C;  2JK5 C;  5B1B C; 
#chains in the Genus database with same CATH topology
 2WLJ A;  1D2D A;  3ZN1 A;  3IAY A;  2ZM6 O;  1FXK B;  1R6T A;  1Y76 B;  4MSW C;  2ZM6 B;  4MTO A;  1EZJ A;  2OTJ V;  3SYQ A;  5KHH A;  3VOU A;  3WG7 B;  4LC1 A;  4FFB B;  4F6R B;  4XDL A;  1H2S B;  2OIG A;  2HP8 A;  5LGT A;  4CH5 A;  1WAZ A;  1NZ6 A;  1VQO V;  3MDS A;  4U7N A;  1SC5 B;  4NXM O;  4CS3 A;  5IJ0 A;  5CB4 A;  5J9P C;  1R3K C;  4NXM B;  4O2B B;  4WBN B;  2HVK C;  3CX5 F;  4MW8 A;  3D36 A;  1WB8 A;  5GON A;  1YIJ V;  4UCT A;  5TIS Z;  2Y69 C;  1X4T A;  1P49 A;  4EB6 B;  5FPO A;  4YJ2 A;  3OR6 C;  3OMN B;  1IBL O;  1I5X A;  4TWK A;  1VQ6 V;  3WU2 Z;  1IBL B;  2QKA A;  4GX1 A;  3E35 A;  2E75 B;  2Y4U A;  1VF6 A;  2OYQ A;  4WCE V;  1K9M W;  3K9S A;  1I08 A;  3H1H H;  4IHJ A;  3U11 A;  2XAS A;  2D2C B;  5LP6 C;  2XAH A;  4DV7 O;  4DV7 B;  2KG7 A;  1OCZ B;  3R65 A;  4QE9 A;  3QG5 A;  3S3W A;  1SKV A;  4U3J A;  1RM1 B;  1THZ A;  3N27 A;  1IDS A;  3JD3 A;  3BFR A;  2HHH O;  4J7Z A;  2PUS A;  5BMV A;  2HHH B;  3FD9 A;  1FPO A;  4WFF A;  4UB6 Z;  4FLX A;  1TUB B;  2ZE8 A;  3RYH A;  5K1X A;  5E1A C;  3Q4H B;  3JAM N;  4X9Q A;  5LOV A;  2O57 A;  3E8B A;  4I7Z B;  2Y0P A;  5CBG A;  2A79 B;  3W7X A;  1KKD A;  2ITC C;  2ZNI A;  5FLX N;  3DXR A;  2IU0 A;  1L1F A;  2HJF C;  3JD2 A;  4JAA A;  2ADP A;  4YJ3 A;  2W6I G;  1BZK A;  3F5W C;  2QE7 G;  4A5U B;  1B04 A;  4XDK A;  1XUQ A;  3KG2 A;  1P84 F;  4FM2 A;  3P30 A;  4IIJ B;  2YXY A;  4ZI7 B;  2Z0A A;  4BIU A;  1VAR A;  3KCY A;  3ZRS A;  3JAL B;  2QWO B;  3K06 A;  1VEW A;  1YXB A;  4MVM A;  4KXR A;  4ZOL A;  2ZE6 A;  4X65 O;  2R9I A;  4I50 A;  4PA6 A;  4X65 B;  1XMO O;  2FKX A;  1XMO B;  4TV9 B;  3JD4 A;  2F23 A;  4RWU A;  4H0L B;  1G8M A;  2JEU A;  4OGQ B;  1AI4 A;  1B6Q A;  1KP2 A;  2X7R B;  4E4E A;  4TQD A;  3CCM V;  2CH7 B;  1GH6 A;  1OCC B;  4W4K A;  4I9W A;  1AP5 A;  2XAG A;  5GW7 A;  3H1L H;  4MTF A;  2IJK A;  2CTP A;  4UUJ C;  3SPH A;  2VRZ A;  2EIL C;  1P7B A;  2RMK B;  1PP9 H;  2EIN C;  3ASO C;  3H1J H;  1NH2 B;  2ZIM A;  1QR8 A;  1FXV A;  1EN4 A;  1QR9 A;  1F7Y A;  3OTO O;  4JI0 O;  3R66 A;  3OTO B;  4JI0 B;  4JYY A;  2ILM A;  3P32 A;  1LUV A;  4PD4 F;  1OHH G;  4LF8 O;  1HNX O;  3OTF A;  5AG2 A;  1NR7 A;  4LF8 B;  1WJZ A;  1HNX B;  2QR4 A;  3SYO A;  4LF5 O;  2EIJ C;  2LFS A;  3SPJ A;  1FXK C;  3SYA A;  4LF5 B;  5LMU O;  5LHG A;  3CD6 V;  5LMU B;  4AIL C;  4I4T A;  2GBO A;  3WG7 C;  1QCE A;  5KA6 A;  3JYC A;  4RAI A;  1QQC A;  2DW4 A;  1Q3E A;  3M7M X;  5LBQ A;  3JSN A;  5EIB D;  3B40 A;  5BXZ A;  1R3J C;  3HKD B;  3K03 A;  1VF7 A;  1AJP A;  5LHH A;  4P9O A;  1N0N A;  3FYI B;  4JAU A;  3G80 A;  2EX3 A;  2OT5 A;  3JAW A;  1PNL A;  4CC5 A;  1K4C C;  1FXK A;  5D5P A;  1Y76 A;  2P4V A;  3HPL C;  2OCC C;  2PGG A;  1U96 A;  1V55 C;  4B7K A;  1SQQ H;  4HBN A;  4FFB A;  4ZIB A;  3ZRW A;  3QNE A;  4FLZ A;  1XRE A;  4UCV A;  4AHC A;  1D5A A;  1H38 A;  1FKA O;  2UXN A;  5B1O A;  1K8A W;  1NR1 A;  4BR6 A;  5IJ0 B;  4BW5 A;  2XAJ A;  3QF7 A;  2L6L A;  4WBN A;  2DYR B;  2KSD A;  1YJW V;  5L3C A;  1NH2 D;  1IZ3 A;  2ZE7 A;  1SET A;  4JTD B;  2YID A;  3CRQ A;  5DM6 V;  3NXS A;  4WFG A;  4KHP O;  3K0D A;  1OCZ C;  4IYH A;  1AVM A;  3VQV A;  3K5N A;  2P5O A;  3K57 A;  4KHP B;  1YEW A;  2ZXW B;  5DN6 G;  2FYU H;  1M5I A;  1RM1 C;  3L74 H;  5H2F Z;  3AK1 A;  2XT9 A;  1DGS A;  1CPY A;  2HKO A;  1JJ2 U;  4FLY A;  4PJ0 Z;  4QGP A;  2RQ6 A;  4JYB A;  4P30 A;  4FLW A;  4JI3 O;  3L72 H;  3JSL A;  1DK1 A;  2W0X A;  4IHJ B;  4JI3 B;  2QSA A;  5DED A;  1J5E O;  4XBF A;  2VWJ A;  2UXX A;  3SPI A;  1J5E B;  2KG7 B;  3GWK C;  2JEX A;  4TV8 B;  4EFB A;  2ZQM A;  2VWK A;  1FFT B;  1XMQ O;  3SYC A;  1AR4 A;  4U3J B;  1XMQ B;  5C8Y B;  5KAF Z;  5L3D A;  3ABK B;  2KQX A;  4O4L A;  5BMV B;  1Q6H A;  2P90 A;  2JIZ G;  2JDI G;  1U97 A;  2P67 A;  2HG5 C;  3RYH B;  4I9Q A;  1TUB A;  3Q4H A;  5LOV B;  4MVQ A;  5B1B B;  2WLI A;  5IYB O;  2AXT Z;  2VQE O;  2Z3Y A;  2IBZ H;  2P06 A;  2VQE B;  3E2E A;  4JPR A;  2IJJ A;  4AI8 A;  3C3S A;  4Z2W A;  3QTC A;  1PPJ H;  1VQK V;  2CTR A;  4DV4 O;  2F66 C;  2ZD9 A;  1V54 B;  4K35 A;  4DV4 B;  2IU3 A;  4YJ3 B;  2RNB A;  1K73 W;  2PF4 E;  3OGC C;  3KZI Z;  2R70 A;  2F4V O;  1SER A;  1SQF A;  4XDJ A;  1FXH A;  2F4V B;  1OCC C;  5JJJ B;  2PYL A;  5H5N A;  2W6J G;  4ZI7 A;  1Y6X A;  3QO5 A;  1BL8 A;  4R8C A;  2M6Y A;  3ETQ A;  4ZOL B;  2JJ2 G;  3RFR A;  4I50 B;  3TET A;  1AJN A;  1PL0 A;  3WB2 A;  4TV9 A;  1LUW A;  4GCZ A;  4DV0 O;  4FIP C;  1GTO A;  3LDD A;  1JCH A;  4IT5 A;  4JAS A;  4PA3 A;  5J2T A;  5IJ9 A;  1US6 A;  2CGO A;  2P6J A;  1HW7 A;  4KUM A;  4DV3 O;  1Q81 W;  1Y67 A;  3ZRV A;  1JVM A;  4DV3 B;  2EBO A;  4NR1 A;  4DR2 O;  4DR1 O;  1S0V A;  3PJS K;  1HDJ A;  2NN4 A;  2L35 A;  4DR2 B;  4DR1 B;  5D5Q A;  5IT9 N;  4NVP A;  1BHB A;  2BOB C;  2FB5 A;  2V7Q G;  1SA0 A;  1VQL V;  1SQV H;  5E79 Z;  4H37 A;  5JH7 B;  3CCV V;  1RP3 B;  1ZX3 A;  2DJV A;  3ZMV A;  2ZCE A;  1LNQ A;  2OTL V;  1FYJ A;  3RT3 C;  3E22 B;  1UJW B;  1KYO F;  3ZHU A;  2JGU A;  4ICG A;  2IH3 C;  2YXH A;  3ML0 A;  3L71 H;  1KBH A;  4I4T B;  3HKC A;  5KUM A;  5KHJ A;  2RCV A;  1R6N A;  2K1E A;  2IJI A;  2UXB O;  3U0Z A;  4JI6 O;  4NTY A;  4FJC C;  1XOU A;  3ASN B;  4B3R B;  3F7Y C;  4MVU A;  4JI6 B;  5LXT B;  3ABT A;  1M57 B;  4DW1 A;  2YXL A;  3PN1 A;  1W0J G;  2WLH A;  4DR4 O;  4DR4 B;  2DYR C;  3D36 C;  2JJ1 G;  2M7W A;  3JAW B;  2N74 A;  4YIO A;  2ZXW C;  1ZWI C;  2A9H A;  2GTS A;  2N05 A;  4H44 B;  2ETN A;  3ZMZ A;  3AG2 B;  4C7U A;  5C93 A;  3OAA G;  2QM8 A;  4LFC O;  2NNU A;  1PL4 A;  3ZRW B;  4KP4 A;  1YSC A;  3GB7 C;  4OXS A;  4YHH O;  2EJ7 A;  4LFC B;  3A0R A;  4YXW G;  4YHH B;  1V9P A;  1NTZ H;  3CE2 A;  3CCQ V;  4BWA A;  1VF6 C;  1RSO A;  1VMG A;  1S5J A;  5IY5 B;  2LGW A;  5B1A B;  2WLM A;  2CTW A;  1TVK A;  3ZHS A;  4J7J A;  3VQY A;  1S77 D;  2QM4 A;  4DR7 O;  2F43 G;  3K9A A;  4J11 A;  4DR7 B;  3C3T A;  1RFY A;  5EK0 A;  2AHY A;  4MVR A;  2BOC C;  3MHH C;  5EYP A;  5IYC O;  1PM9 A;  3LSS A;  2YS8 A;  4IGG A;  2ZDI C;  3FAV A;  5EZY B;  3LSQ A;  3DSQ A;  3F5T A;  1ROP A;  3E86 A;  3E89 A;  3FB6 C;  5B1B C;  4NYK A;  1S3J A;  4X20 B;  2E76 B;  1I7F A;  4GUN A;  1Q7Y W;  1DF5 A;  4FLU A;  3T1Y O;  1ENV A;  4TV8 A;  3T1Y B;  3LNM B;  4L8J A;  4UVC A;  3OEH G;  4N23 A;  2B5U A;  1W59 A;  2NR5 A;  4FLT A;  5C8Y A;  3BEH A;  4PDV A;  5LYJ B;  4O4L B;  1V54 C;  2ZDI A;  3H01 A;  1VQ7 V;  3BHP A;  4KL1 A;  1NKD A;  2HFE C;  4MVS A;  1N8R W;  3SJB C;  1VP7 A;  1YCI A;  1FAF A;  4GX2 A;  2X6C A;  5FPR A;  2WLI B;  1Z5V A;  5IYZ B;  1BCC H;  4UCO A;  2WA4 A;  1MZF A;  1GRJ A;  4CZZ A;  4IYI A;  1I5Y A;  3RW0 A;  1JX9 A;  3AG4 B;  2CTQ A;  5H6Q A;  3BRC A;  3CC4 V;  4U3F H;  1K97 A;  4O4I B;  3TGU H;  1WNS A;  2MK3 A;  2UUB O;  1K92 A;  2JGD B;  4X62 O;  4R6Z A;  3CCJ V;  2UUB B;  3F7V C;  4J10 A;  5CA3 A;  1I0H A;  3OR7 C;  2BTQ B;  3CRR A;  2WLL A;  4NKG B;  4DO2 A;  2DQ3 A;  3EVK A;  4UCS A;  1PNK A;  2DYS B;  4Z1V A;  3TXQ A;  1NBM G;  4WFB V;  2AGA A;  2V4D A;  5JQG A;  3K79 A;  3LDE A;  3OM3 B;  3E83 A;  3RVY A;  4BAY A;  1M93 A;  4LFA O;  3ETE A;  4JGS A;  5L3G A;  4LFA B;  4JI4 O;  2JVD A;  4D7S A;  5J2T B;  3W7U A;  4ZBM A;  4DV6 O;  4CH6 A;  1JFF A;  2QKC A;  5IJ9 B;  1M4U A;  4DV6 B;  4FM0 A;  2QTO A;  4LH6 A;  3BAA A;  2IH1 C;  3QO8 A;  1YJ9 V;  1CEZ A;  3O9O A;  1R73 A;  4G28 B;  4FZ1 A;  1N32 O;  1KMI Z;  3ZRX A;  4LH7 A;  1N32 B;  2X6B A;  1QLE B;  1AP6 A;  4QJF B;  1N34 O;  3SYP A;  1Q90 D;  2LJ2 A;  5IDJ A;  3CME V;  3MD0 A;  4X8A A;  1SA0 B;  2PY5 A;  3T1C A;  2GUZ B;  2ZR3 A;  2XUM A;  2RN9 A;  3ASN C;  4J9Y B;  5JH7 A;  4R50 A;  1XBL A;  5LL6 Y;  1J95 A;  1M57 C;  2Q67 A;  5B3S C;  2DOS A;  4JTC B;  3CRM A;  1VQP V;  3FYE B;  1AI6 A;  4TOI A;  5JCO C;  1TAE A;  3E22 A;  1E1R G;  1JJO A;  5A9G A;  2YSU B;  4DRX A;  3JAT B;  4DK1 A;  1K33 A;  1NVP D;  2EIM B;  1BT8 A;  5CBF A;  1Y4M A;  4QE7 A;  3VQX A;  2P4K A;  1SQX H;  3CXH F;  4Q20 A;  3HKC B;  3SJQ C;  5JWP A;  5L3B A;  1XI1 A;  2Y48 A;  3KKY A;  4PDR A;  3ZIA G;  1JQ0 A;  1MSW D;  4MS2 A;  2AHZ A;  3FKS G;  1Q8I A;  2YIA A;  2HEP A;  1OCO B;  4MW3 A;  5LXT A;  2HJD A;  4JYC A;  5B1A C;  5F2V O;  5JCO A;  4EFE A;  3ZHR A;  3ZS8 C;  1BGY H;  4UFZ A;  3RYC A;  2P7T C;  1YZB A;  1H2L A;  2MW2 B;  1HR0 O;  1MA1 A;  3I55 V;  4I5S A;  2JK5 C;  4DUZ O;  1HR0 B;  2Q7H A;  4PI0 A;  4LR3 A;  4DUZ B;  3SPC A;  2Y0I A;  3FFQ A;  4DW0 A;  2QKS A;  1PV0 A;  2H8P C;  2LQT A;  1BQ0 A;  4UV8 A;  1RSO B;  1XL6 A;  3OFN G;  2CAZ C;  4GX0 A;  4B3T O;  4B3T B;  1TVK B;  3TXS A;  2ZNJ A;  3G6B A;  3IFX A;  2ZKO A;  1Z5W A;  3K3W A;  3X2Q B;  4K0K O;  1EZV H;  4K0K B;  2Q69 A;  3DGE A;  1Q43 A;  5EYP B;  3FAV B;  4NTW A;  4WFE A;  1S72 V;  3P3P A;  2YUA A;  1KC8 W;  3JD0 A;  5EZY A;  2XAQ A;  4RUF A;  1IBM O;  2ZE5 A;  1IBM B;  3B4S A;  1YVW A;  1QBZ A;  3UT5 A;  4OX9 O;  3AG1 B;  1XL4 A;  5EC2 C;  1OJH A;  5KHI A;  4OX9 B;  4X20 A;  3MHS C;  2UXD O;  1F4M A;  1H2G A;  4WFH A;  2DWD C;  1YJN V;  1PD3 A;  4LCU C;  1R1B A;  5H6R A;  1XIL A;  2G38 A;  2EJR A;  1H2K A;  5LYJ A;  5KLV H;  3IC7 A;  2DWE C;  4B08 A;  2Q8V A;  3STZ C;  2GSM B;  3K0G A;  3B09 A;  1B3Q A;  3BVO A;  2BE3 A;  2F95 B;  4LP8 A;  1E1Q G;  1PNM A;  2F93 B;  2ARH A;  4FM1 A;  3UCS C;  2GHY A;  1UFI A;  2QJ1 A;  2WPD G;  4F6E A;  3D8C A;  3AG7 A;  1YTF D;  1SQP H;  5IYZ A;  2CDY A;  1AI5 A;  5JJE B;  2R9R B;  5CBH A;  5EIB C;  3RWR D;  2Q73 A;  1K34 A;  1EBO A;  3DTU B;  4RO2 A;  4LF4 O;  4O4I A;  1FD9 A;  3OE7 G;  3FB5 C;  4DV2 O;  4LF4 B;  3HKB A;  3OMA B;  4FZ0 A;  2JGD A;  5A2Q N;  1BQZ A;  3W7S A;  2P22 C;  1N4C A;  3RYF B;  3CC7 V;  2PI4 A;  2YC0 A;  1SF9 A;  4EKW A;  2ITD C;  2BTQ A;  2WLL B;  3ETD A;  4DR3 O;  4PDL A;  4G2K A;  5B66 Z;  4DR3 B;  1S5L Z;  1K4D C;  3ZBH A;  3UKM A;  1QLE C;  4LF7 O;  1JR9 A;  2RJZ A;  5JQG B;  5JJN B;  4LF7 B;  1I94 O;  3D3I A;  2WSS G;  3N2K B;  1I94 B;  3RN4 A;  3BCC H;  2A0L A;  4B7E A;  3J81 N;  3OMI B;  1DTO A;  3ABL B;  1WN7 A;  4DV0 B;  2C2A A;  3BA9 A;  4MT8 A;  1JFF B;  3G71 V;  1FFX A;  4GYC B;  4LFB O;  2OCH A;  2IM9 A;  3CEI A;  4WF9 V;  4LFB B;  1XHZ A;  4UB8 Z;  3DC6 A;  3G67 A;  4K8Z A;  1YDX A;  2B1I A;  2EIM C;  1MZE A;  1M1K W;  3CSX A;  2IJH A;  1HNZ O;  4HYO A;  4UXN A;  2QWR B;  1K7D A;  2PTM A;  1HNZ B;  4UCR A;  2UUC O;  5FL7 G;  2UXC O;  3JAS B;  3CB2 A;  3ZMS A;  2UUC B;  2UXC B;  4NXN O;  4LNU B;  1OCR B;  2GUZ A;  5J2U B;  4NXN B;  2Q9L A;  5EC1 C;  4MVO A;  1CP9 A;  3NR7 A;  1SS3 A;  1OCO C;  5KHK A;  4QIW F;  3CYO A;  1H2N A;  3VBB A;  1VQN V;  1FS0 G;  1WA8 A;  4DRX B;  1BHA A;  3AEI A;  3CRC A;  3JAT A;  2EUL A;  3RYI B;  3O65 A;  3WB1 A;  2ZIN A;  1G1X B;  3I56 V;  5H9C A;  3DC5 A;  4H13 B;  3SJA C;  1S5H C;  5KUK A;  4JYA O;  1VQM V;  3K59 A;  1KD1 W;  1NT2 B;  3HR0 A;  4O2A B;  3CMA V;  4JYA B;  3CP1 A;  2FL4 A;  2WAM A;  3CCU V;  1IBK O;  4PA9 A;  2UXB B;  1K3E A;  2ZR2 A;  1IBK B;  3ZED A;  4ZKI A;  4PHZ A;  2BCC H;  1AI7 A;  2VQF O;  3CJH B;  1BE3 H;  2VQF B;  5KA5 A;  2AZ2 A;  1LR1 A;  1B06 A;  3RYC B;  3HB3 B;  1VIB A;  3T2M A;  3X2Q C;  1KUQ A;  5CA0 A;  5HFM A;  1QLN A;  5EBL C;  3BPZ A;  1NI8 A;  4X1Y A;  5FNV A;  1AJQ A;  2EIK B;  4ABM A;  3ZHQ A;  1QVF U;  2ODM A;  2QTS A;  3APO A;  2DE0 X;  4O4H A;  4CS4 A;  4J9Z B;  2EIJ B;  1GO3 F;  1GM7 A;  3OT7 A;  3B2E E;  2BSK A;  3N2G A;  5LA6 B;  3OW2 U;  2HR3 A;  2NLJ C;  2Q0O C;  4OPA A;  4DXW A;  2YEV B;  1MMM A;  3K5M A;  3AG1 C;  4YIP A;  3H1I H;  1SZX A;  3ZMT A;  1E79 G;  4DV5 O;  4FVM A;  4JI2 O;  2LW1 A;  4DV5 B;  4FK5 C;  1SQG A;  1FJG O;  4JI2 B;  2FML A;  4X1K B;  4J42 A;  3ABK C;  1FJG B;  1H2M A;  2Q6A A;  4PI2 A;  4JI1 O;  3K5L A;  4I0X A;  3A2F A;  1VF5 B;  4JI1 B;  5IWA O;  3K08 A;  4E2L A;  4QPJ A;  1EFR G;  1O9H A;  1UPG A;  4EEQ A;  2RDC A;  5IWA B;  1BSM A;  3RGB A;  4L87 A;  2OCC B;  3LUT B;  1Z2G A;  1IXM A;  3UT5 B;  3L75 H;  1V55 B;  4DK0 A;  3UO3 A;  1N33 O;  2Q68 A;  4PEL A;  1WP8 A;  5LMN O;  1N33 B;  2D3O W;  3ABM B;  3SJC C;  5LMN B;  3JAR B;  1WP7 A;  3RVZ A;  2YIB D;  5GTH Z;  1QNM A;  4TT3 G;  3APQ A;  1IX9 A;  3GVM A;  4X66 O;  2XAF A;  2ZIO A;  1NTK H;  1MAB G;  4WFA V;  4X66 B;  1KEC A;  3MAQ A;  3CCE V;  1W2B U;  1AIL A;  1GKF A;  1KKC A;  2ATK C;  3E8F A;  4JAV A;  3CCR V;  2XTA A;  4MTG A;  1VQ9 V;  3AK3 A;  5JVD B;  1MNG A;  5L3E A;  2Q5Z A;  1PKX A;  1SZT A;  5HFL A;  3BY6 A;  4DV1 O;  4GT1 A;  4X1I B;  2W0F C;  1JA8 A;  2K9P A;  4ZHQ A;  2LO1 A;  4DV1 B;  1WPX A;  4NTX A;  1TGO A;  1MG1 A;  1R3I C;  3JAK A;  3ICX A;  4D6T H;  4TUY A;  4GX5 A;  4UVB A;  3WB0 A;  4MVZ A;  1GN6 A;  4B3M O;  1QU7 A;  3HKB B;  5LP6 A;  5LGN A;  2CUG A;  3ABL C;  4B3M B;  1Y74 B;  1NU1 H;  4X62 B;  1URF A;  1NVP B;  3H1K H;  3RYF A;  1F4N A;  3TCU A;  5CMU A;  1NJI W;  4YY3 O;  1OV9 A;  5K1P A;  4YY3 B;  1SQB H;  3OUF A;  5ITZ A;  4LWS A;  2LGQ A;  3A8T A;  4IL6 Z;  2LFR A;  1T5E A;  1YHQ V;  2H94 A;  3T4D A;  2VS0 A;  2QM7 A;  3N2K A;  3W7W A;  5B1N A;  4N21 A;  3G6E V;  5BZB A;  3VQW A;  2A06 H;  3I5D A;  1OCR C;  2EZP A;  1K5Q A;  4JI4 B;  1MSD A;  5KMG A;  1N0J A;  1FFX B;  3LDC A;  3L73 H;  2Y4T A;  1ZL8 A;  4FLV A;  1M56 B;  2Z5U A;  4I55 B;  1JMK C;  2UU9 O;  4QPK A;  1R6K A;  4J80 A;  2YI8 A;  4AQY O;  2UU9 B;  4AQY B;  4O4J A;  1M9N A;  1N34 B;  2B9Z A;  3ETG A;  1H8H G;  3ZJZ A;  2JS5 A;  3JAS A;  4LF9 O;  4LNU A;  1ZTE A;  1SES A;  4LF9 B;  5J2U A;  1DF4 A;  3LSU A;  2CK3 G;  1XNR O;  1QHT A;  5LHI A;  2R9A A;  5IE9 A;  1XNR B;  3M8A A;  3TJT A;  1WA8 B;  4CH4 A;  4B3S O;  2GTA A;  4B3S B;  4CBC A;  3OUS A;  2UUA O;  3RYI A;  4X89 A;  2UUA B;  1GM8 A;  3EXA A;  4Z1M G;  5EBM C;  2FTK A;  5CA1 B;  4HNA A;  5DEC A;  1NTM H;  3AG2 C;  3OGI B;  2EIK C;  1AR1 B;  4O2A A;  1AR5 A;  4H33 A;  3CXC U;  2E3C A;  5IY5 C;  3T4Z A;  3W7T A;  2XOK G;  1KP3 A;  3CJH A;  3K58 A;  4K8X A;  3OEE G;  4HZ3 A;  1W0K G;  3IJ4 A;  2YIB A;  4X64 O;  4RUE A;  4JI5 O;  5BY1 A;  1GK9 A;  3HKE A;  4JI5 B;  4X64 B;  2QGN A;  3AG3 B;  4GZR B;  4JV5 O;  2CGN A;  5CA0 B;  2WA3 A;  3FB8 C;  4G27 B;  3GWO A;  4JV5 B;  2AW9 A;  3J80 N;  5KX5 B;  4CC6 A;  4X1Y B;  5FNV B;  3B8N A;  3OD4 A;  2QWP B;  3FX7 A;  2BTO A;  2F1M A;  1XNQ O;  1BS3 A;  4P9P A;  5CN0 A;  5L3F A;  1M90 W;  1YTF B;  2LP7 A;  4O4H B;  5B5E Z;  1XNQ B;  2WWW A;  3ABU A;  4PDM A;  4BIZ A;  4CH3 A;  2BSK B;  3N2G B;  4JTA B;  4TQF A;  5LA6 A;  2IW5 A;  2V1D A;  5LGU A;  4DR6 O;  2YEV A;  4JF3 A;  1IXB A;  2XHB A;  4DR6 B;  1MOF A;  4F6R A;  4FMT A;  3E8H A;  4JZG A;  4PV1 B;  1F23 A;  4JI7 O;  3U10 A;  1AB3 A;  1ZUQ A;  4JI7 B;  3ABM C;  3T1H O;  3RBZ A;  3C90 A;  1OZ0 A;  5BR8 O;  3T1H B;  4X1K A;  5CB4 B;  1N36 O;  5BR8 B;  4O2B A;  5EBW C;  2X6A A;  1N36 B;  3BA8 A;  4I0X B;  2KB1 A;  3LNN A;  5GON B;  2ADQ B;  3D3Q A;  1WB7 A;  2E74 B;  5GTI Z;  2WLN A;  1D5N A;  4YJ2 B;  4EB6 A;  4LBE C;  5IYD O;  4GLX A;  4RQF A;  4ASU G;  4PA4 A;  4Q6G A;  4D7T A;  1GMG A;  2R72 A;  4OPH A;  1P4R A;  1O9G A;  4W4L A;  4NB5 A;  2PZS A;  1EM1 A;  2UXD B;  3ZHT A;  3E8G A;  1IUR A;  2GDS A;  3AG4 C;  4RQE A;  3JAR A;  3L70 H;  3FB7 C;  1JOY A;  4FPP A;  1KU9 A;  3IGA C;  3EHB B;  3JCU Z;  1WPB A;  2HVJ C;  3SGI A;  2QEX V;  3THO A;  3ZX6 A;  4F4L A;  1GM9 A;  2Y69 B;  1R3L C;  1WLE A;  4P2Z A;  4HAM A;  4PA7 A;  5JVD A;  1GN2 A;  2DYS C;  2E5L O;  4X1I A;  4ZHQ B;  1ZLZ A;  1GN4 A;  2E5L B;  1X59 A;  2XND G;  1KB9 F;  4K3A A;  3IC9 A;  4UV9 A;  4R7C A;  1ZSP A;  3JAK B;  1ORQ C;  2OIE A;  4FFK A;  3JCZ A;  3BAB A;  4TUY B;  1F51 A;  4J41 A;  2PYJ A;  1HP8 A;  3A0B Z;  5LP6 B;  4BW9 A;  4DV2 B;  1VQ5 V;  3KCX A;  3QO7 A;  1Y74 A;  2DQ0 A;  2LW7 A;  1QVG U;  3ZHV A;  1RPO A;  3EFF K;  3CCS V;  4TSF G;  3SDL A;  1M56 C;  3DXR B;  2Q0A A;  3M99 B;  2A7W A;  1KQS U;  3K5O A;  2DN9 A;  1XHX A;  3UM7 A;  5ITZ B;  4LWS B;  4DUY O;  2Q7E A;  1G4Y B;  4CS2 A;  2Q7G A;  4DUY B;  1NS1 A;  1IVS A;  1S76 D;  3B8M A;  2ZT9 B;  3SPG A;  1JPX A;  3S3X A;  3WFV A;  4DR5 O;  3QVN A;  3UO2 A;  2WLK A;  1XDC A;  4DR5 B;  1Q6U A;  1XQ8 A;  4IIJ A;  5KMG B;  2AZ0 A;  4J7K A;  4LF6 O;  3JAL A;  3JD1 A;  4LF6 B;  1ZL8 B;  4KFM A;  1HNW O;  1ARO P;  4JZ2 A;  1HNW B;  4I55 A;  2GV9 A;  1YI2 V;  1L0N H;  1NQT A;  1A32 A;  2DMX A;  4MTX A;  3STL C;  3CHX A;  2JS3 A;  1TUE B;  2YDE A;  4O4J B;  1RPR A;  2B1G A;  2QDO A;  1HWY A;  1K5S A;  2N04 A;  3L9D A;  2JRI A;  3H9V A;  1TA8 A;  2CE4 A;  4GKK O;  1COW G;  2KKW A;  1XEQ A;  3AK2 A;  4GKK B;  3UQ8 A;  2QA4 V;  1H8E G;  3K04 A;  3CWB H;  2CH7 A;  1YIT V;  3CS5 A;  1BMF G;  4JI8 O;  2YI9 A;  1Q5O A;  3B77 A;  1VQ4 V;  2A3Q A;  1YF2 A;  4JI8 B;  2YIC A;  1G6U A;  3CC2 V;  3J7A U;  1P7G A;  3ZN0 A;  5KHG A;  4BIO A;  1CXZ B;  2X0L A;  4GKJ O;  1L8D A;  4GKJ B;  3AG3 C;  1EN6 A;  1VQ8 V;  5CA1 A;  2PI5 A;  4HNA B;  2EZO A;  5KAI Z;  1L0L H;  1ZAU A;  3SR2 C;  1EN5 A;  2Q4P A;  3CRA A;  3P3N A;  3CCL V;  2OWO A;  4QNH B;  4UVA A;  1Q6I A;  1Q82 W;  1GN3 A;  2QWQ B;  2QWN B;  3ZMU A;  2EIL B;  3TK1 A;  1Y66 A;  3HKE B;  4U7O A;  2EIN B;  3ASO B;  4B3R O;  3A0H Z;  3ZCC A;  1SRY A;  4X88 A;  1DLB A;  4DYL A;  5B3S B;  4UCU A;  3HKD A;  1Q86 W;  5KX5 A;  2H3O A;  2HLD G;  3CPW U;  1GAX A;  3G4S V; 
#chains in the Genus database with same CATH homology
 2WLJ A;  1K73 W;  3ZN1 A;  3OGC C;  3SPC A;  2QKS A;  3OUF A;  1FXK B;  2H8P C;  4MSW C;  4MTO A;  1SER A;  2LFR A;  1EZJ A;  4XDJ A;  2OTJ V;  3SYQ A;  1FXH A;  1OCC C;  3VOU A;  1YHQ V;  2H94 A;  3T4D A;  4UV8 A;  3WG7 B;  2W6J G;  2QM7 A;  3W7W A;  4LC1 A;  5B1N A;  1XL6 A;  3OFN G;  1BL8 A;  3QO5 A;  4N21 A;  4XDL A;  5BZB A;  3G6E V;  4GX0 A;  4R8C A;  1OCR C;  5LGT A;  2EZP A;  1K5Q A;  2JJ2 G;  3TET A;  3IFX A;  1VQO V;  4U7N A;  1AJN A;  1PL0 A;  3LDC A;  3K3W A;  5J9P C;  3X2Q B;  4GCZ A;  1R3K C;  2HVK C;  4FIP C;  4MW8 A;  1GTO A;  1M56 B;  3D36 A;  1JCH A;  2Z5U A;  3LDD A;  4JAS A;  4PA3 A;  2Q69 A;  4QPK A;  3DGE A;  1R6K A;  1YIJ V;  3G4S V;  2Y69 C;  2P6J A;  4WFE A;  1M9N A;  1S72 V;  4KUM A;  3OR6 C;  1Q81 W;  3OMN B;  3JD0 A;  1KC8 W;  3ZRV A;  3ETG A;  1JVM A;  1H8H G;  1I5X A;  3ZJZ A;  2XAQ A;  2EBO A;  4RUF A;  4TWK A;  1VQ6 V;  1S0V A;  3PJS K;  4GX1 A;  3E35 A;  1QBZ A;  1SES A;  1BHB A;  2BOB C;  1DF4 A;  2V7Q G;  3AG1 B;  1XL4 A;  5EC2 C;  2CK3 G;  4WCE V;  1VQL V;  1K9M W;  3MHS C;  5LHI A;  1F4M A;  1H2G A;  2XAS A;  4H37 A;  4WFH A;  2DWD C;  1YJN V;  1PD3 A;  3CCV V;  4LCU C;  2XAH A;  5H6R A;  2EJR A;  4CBC A;  3OUS A;  1OCZ B;  3R65 A;  3ZMV A;  1LNQ A;  2OTL V;  4X89 A;  4QE9 A;  1GM8 A;  4Z1M G;  3IC7 A;  2DWE C;  1UJW B;  1RM1 B;  5EBM C;  2FTK A;  3STZ C;  2GSM B;  3K0G A;  1THZ A;  2IH3 C;  3AG2 C;  3JD3 A;  3ML0 A;  4LP8 A;  1E1Q G;  2EIK C;  1PNM A;  1AR1 B;  2GHY A;  4WFF A;  2WPD G;  5KUM A;  1YTF D;  1R6N A;  1AI5 A;  2K1E A;  5E1A C;  4H33 A;  3CXC U;  5IY5 C;  2IJI A;  3T4Z A;  2R9R B;  5CBH A;  3E8B A;  3W7T A;  2XOK G;  1KP3 A;  4FJC C;  3ASN B;  3F7Y C;  3OEE G;  4HZ3 A;  5CBG A;  4MVU A;  2A79 B;  1W0K G;  3W7X A;  1K34 A;  1EBO A;  3DTU B;  3ABT A;  1M57 B;  4RO2 A;  1KKD A;  4RUE A;  2ITC C;  1GK9 A;  3OE7 G;  3FB5 C;  1W0J G;  2WLH A;  3AG3 B;  3OMA B;  2DYR C;  3FB8 C;  4G27 B;  3GWO A;  3W7S A;  2JJ1 G;  2IU0 A;  2M7W A;  1L1F A;  3CC7 V;  2PI4 A;  2HJF C;  2ITD C;  4EKW A;  2WLL B;  3ETD A;  3JD2 A;  3B8N A;  2ZXW C;  4PDL A;  1ZWI C;  4G2K A;  2A9H A;  4P9P A;  5CN0 A;  5L3F A;  1M90 W;  1YTF B;  1K4D C;  2LP7 A;  2W6I G;  3F5W C;  2QE7 G;  3AG2 B;  3ZMZ A;  2WWW A;  3ABU A;  4PDM A;  3OAA G;  3UKM A;  5C93 A;  1QLE C;  2QM8 A;  2NNU A;  3ZRW B;  4BIZ A;  4KP4 A;  1YSC A;  3GB7 C;  4OXS A;  4XDK A;  4JTA B;  2IW5 A;  3A0R A;  4YXW G;  3KG2 A;  2V1D A;  5LGU A;  2YEV A;  3CCQ V;  4JF3 A;  3D3I A;  2WSS G;  3P30 A;  4BIU A;  1MOF A;  2A0L A;  3ZRS A;  4FMT A;  5IY5 B;  3E8H A;  3K06 A;  1F23 A;  3OMI B;  5B1A B;  2WLM A;  4MVM A;  1DTO A;  3ABL B;  2R9I A;  3ABM C;  2C2A A;  4MT8 A;  3RBZ A;  4PA6 A;  1OZ0 A;  3G71 V;  1S77 D;  3JD4 A;  2F43 G;  3K9A A;  5EBW C;  1G8M A;  2JEU A;  2X6A A;  4WF9 V;  5EK0 A;  2AHY A;  4MVR A;  2KB1 A;  1AI4 A;  2BOC C;  1B6Q A;  3MHH C;  1KP2 A;  2B1I A;  2EIM C;  5IYC O;  3LSS A;  2X7R B;  2ZDI C;  1M1K W;  2WLN A;  3CCM V;  4LBE C;  2IJH A;  4HYO A;  1OCC B;  5IYD O;  4UXN A;  4RQF A;  4ASU G;  4PA4 A;  4I9W A;  1K7D A;  3LSQ A;  1GMG A;  1P4R A;  5FL7 G;  1ROP A;  2XAG A;  3E86 A;  3ZMS A;  3E89 A;  1OCR B;  3FB6 C;  5GW7 A;  5B1B C;  5EC1 C;  4MTF A;  3E8G A;  2IJK A;  4MVO A;  1CP9 A;  1S3J A;  3AG4 C;  4UUJ C;  1Q7Y W;  4RQE A;  3SPH A;  1DF5 A;  1OCO C;  2EIL C;  3FB7 C;  4FPP A;  1JOY A;  1ENV A;  1P7B A;  4QIW F;  2EIN C;  3ASO C;  3CYO A;  3VBB A;  3IGA C;  3EHB B;  1NH2 B;  1VQN V;  3LNM B;  4UVC A;  1FS0 G;  1QR8 A;  1FXV A;  1QR9 A;  3OEH G;  4N23 A;  2HVJ C;  2B5U A;  1BHA A;  3AEI A;  2QEX V;  3BEH A;  4PDV A;  4F4L A;  1GM9 A;  1V54 C;  2Y69 B;  3I56 V;  1R3L C;  2ZDI A;  3P32 A;  1WLE A;  3H01 A;  5H9C A;  1VQ7 V;  4P2Z A;  1OHH G;  4HAM A;  4PA7 A;  1NKD A;  2HFE C;  4MVS A;  1NR7 A;  1S5H C;  1N8R W;  2DYS C;  3SYO A;  5KUK A;  2EIJ C;  2LFS A;  3SPJ A;  1FXK C;  1VQM V;  1KD1 W;  3SYA A;  5LHG A;  4GX2 A;  2XND G;  3CMA V;  2X6C A;  3CP1 A;  3CD6 V;  2WLI B;  4UV9 A;  2WAM A;  4R7C A;  3CCU V;  4PA9 A;  1K3E A;  2ZR2 A;  3WG7 C;  1ORQ C;  1QCE A;  4ZKI A;  5KA6 A;  3JCZ A;  3JYC A;  1F51 A;  1AI7 A;  4RAI A;  4CZZ A;  2DW4 A;  5LBQ A;  1I5Y A;  3RW0 A;  1JX9 A;  1VQ5 V;  3AG4 B;  3QO7 A;  5KA5 A;  5H6Q A;  3CC4 V;  1K97 A;  1R3J C;  3HB3 B;  3K03 A;  2DQ0 A;  3T2M A;  1AJP A;  5LHH A;  3X2Q C;  2MK3 A;  1QVG U;  1K92 A;  1RPO A;  4P9O A;  3FYI B;  3EFF K;  3CCS V;  4R6Z A;  4JAU A;  3CCJ V;  5HFM A;  4TSF G;  1QLN A;  1M56 C;  3F7V C;  2OT5 A;  3M99 B;  1KQS U;  5EBL C;  5CA3 A;  3OR7 C;  1PNL A;  3UM7 A;  2WLL A;  1K4C C;  1FXK A;  1AJQ A;  1G4Y B;  2EIK B;  1QVF U;  4DO2 A;  2DQ3 A;  3HPL C;  2OCC C;  1S76 D;  1PNK A;  2DYS B;  3B8M A;  4J9Z B;  2EIJ B;  1V55 C;  3SPG A;  1GO3 F;  1GM7 A;  1JPX A;  1NBM G;  3ZRW A;  4WFB V;  3WFV A;  3OW2 U;  2HR3 A;  2NLJ C;  4DXW A;  2WLK A;  3K79 A;  3LDE A;  3QNE A;  2YEV B;  3OM3 B;  3E83 A;  3RVY A;  4BAY A;  3AG1 C;  1H38 A;  3ETE A;  2UXN A;  5B1O A;  4JGS A;  5L3G A;  1K8A W;  1NR1 A;  3JD1 A;  4BW5 A;  3ZMT A;  1E79 G;  2XAJ A;  4KFM A;  1ARO P;  2DYR B;  1YJW V;  5L3C A;  4ZBM A;  3W7U A;  1NH2 D;  1SET A;  4FK5 C;  4JTD B;  5DM6 V;  3NXS A;  1YI2 V;  4WFG A;  1NQT A;  3K0D A;  2QTO A;  1OCZ C;  3ABK C;  4MTX A;  3STL C;  2IH1 C;  3QO8 A;  1YJ9 V;  1TUE B;  1CEZ A;  2ZXW B;  2Q6A A;  1R73 A;  5DN6 G;  1RPR A;  4G28 B;  2B1G A;  1RM1 C;  1HWY A;  1K5S A;  3ZRX A;  3K08 A;  4E2L A;  4QPJ A;  1EFR G;  1QLE B;  2X6B A;  1COW G;  1CPY A;  2HKO A;  1JJ2 U;  4QJF B;  2QA4 V;  3SYP A;  1H8E G;  4L87 A;  3K04 A;  2OCC B;  5IDJ A;  3LUT B;  3CME V;  3MD0 A;  4X8A A;  1IXM A;  4JYB A;  1YIT V;  1V55 B;  4P30 A;  1BMF G;  3T1C A;  3B77 A;  1VQ4 V;  2Q68 A;  4PEL A;  2ZR3 A;  3CC2 V;  2D3O W;  3ABM B;  3ASN C;  4J9Y B;  4XBF A;  3ZN0 A;  4R50 A;  2UXX A;  2X0L A;  3SPI A;  1J95 A;  1M57 C;  3RVZ A;  2Q67 A;  5B3S C;  2JEX A;  4JTC B;  2ZQM A;  1VQP V;  3FYE B;  4TT3 G;  1AI6 A;  1FFT B;  3SYC A;  3AG3 C;  1E1R G;  2XAF A;  2YSU B;  1K33 A;  1MAB G;  4WFA V;  1VQ8 V;  1KEC A;  3CCE V;  5L3D A;  1W2B U;  1NVP D;  3ABK B;  2PI5 A;  2EIM B;  5CBF A;  2EZO A;  1GKF A;  1Y4M A;  2ATK C;  4QE7 A;  3E8F A;  4JAV A;  3CCR V;  1VQ9 V;  4MTG A;  2P90 A;  2JIZ G;  2JDI G;  4Q20 A;  5L3E A;  1PKX A;  1SZT A;  5HFL A;  3SJQ C;  2P67 A;  5L3B A;  2Y48 A;  3BY6 A;  2HG5 C;  4GT1 A;  4PDR A;  2W0F C;  3ZIA G;  1WPX A;  3CCL V;  4QNH B;  4MVQ A;  4UVA A;  1JQ0 A;  5B1B B;  1MSW D;  2WLI A;  1Q82 W;  1MG1 A;  5IYB O;  1R3I C;  4MS2 A;  2Z3Y A;  2AHZ A;  3ZMU A;  3FKS G;  4MW3 A;  1OCO B;  2EIL B;  3TK1 A;  1Y66 A;  3E2E A;  4U7O A;  4GX5 A;  4UVB A;  2EIN B;  2IJJ A;  3ASO B;  4JPR A;  4JYC A;  4MVZ A;  3ZCC A;  5B1A C;  1SRY A;  4X88 A;  5LGN A;  3ABL C;  1DLB A;  1NVP B;  1F4N A;  5B3S B;  3TCU A;  1VQK V;  1Q86 W;  2P7T C;  2HLD G;  2ZD9 A;  1V54 B;  5CMU A;  3I55 V;  3CPW U;  1NJI W;  2IU3 A;  4I5S A;  2JK5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...