2HFEC

Rb+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hfeC00
5KUKA 1S5HC 4XDKA 5B3SC 3RBZA 5J9PC 3T2MA 3ABLC 4JTDB 3SPCA 4PDLA 2OCCC 4P9OA 3STLC 3RW0A 4QNHB 4R6ZA 2IH3C 2QTOA 1R3JC 2WLHA 4LBEC 4BW5A 4MSWC 4P2ZA 2Y69C 4GX2A 2HVKC 4PA6A 4R50A 3ABMC 3SJQC 3ABKC 5CBFA 1M57C 4MVRA 4OXSA 4WFHA 1XL6A 4G28B 2DYSC 3FB7C 2ATKC 4LP8A 2HJFC 3FB5C 1R3KC 1P7BA 3TETA 2K1EA 2IH1C 4XDJA 2ZXWC 2R9RB 3E8HA 4JTCB 2ZD9A 4KFMA 4DXWA 3TCUA 3SPJA 3E8GA 4UUJC 2WLMA 2BOBC 4F4LA 5BZBA 3SPGA 3BEHA 3IFXA 2EIJC 3RVYA 1LNQA 1K4DC 1JVMA 4H33A 3LDEA 2JK5C 3ASOC 4GX5A 4QE9A 4JTAB 3F7VC 3SYAA 2W0FC 4MTOA 5EK0A 4WFGA 4P9PA 3SPHA 1XL4A 1OCCC 2WLIA 2QKSA 1OCRC 4QE7A 3LUTB 4GX0A 3FB8C 4RUFA 3VOUA 1J95A 3K04A 4ZBMA 4G27B 2DWDC 2WLLB 3AG2C 2WLIB 3OR7C 3OUSA 5E1AC 2KB1A 5IY5C 2EILC 1OCOC 3E86A 3E83A 2ITDC 3R65A 3UKMA 4MW8A 2BOCC 3ZRSA 4R8CA 1M56C 2A0LA 2X6AA 4MVMA 2NLJC 4LCUC 3RVZA 2WLJA 4TWKA 3FB6C 4P30A 4RUEA 4J9ZB 4WFFA 2HG5C 4PDVA 2HFEC 4RAIA 2EINC 3SYCA 1QLEC 5CBHA 3T1CA 3T4ZA 3UM7A 1V54C 3ZJZA 4H37A 2AHYA 3SYPA 3T4DA 2X6CA 3K06A 3K0DA 4PA7A 3SYQA 4PDRA 2EIKC 3LDDA 3OR6C 3STZC 1ORQC 5EC1C 3AG4C 3EFFK 5EBMC 4MS2A 3LNMB 2WLLA 4EKWA 1OCZC 3K08A 4I9WA 5B1AC 1BL8A 3OGCC 4PDMA 2EIMC 3JYCA 3F5WC 3OUFA 1V55C 2A9HA 3IGAC 5EC2C 3E89A 3E8BA 4GX1A 5B1BC 1ZWIC 3K0GA 3HPLC 3F7YC 5CBGA 2WLKA 4PA4A 3WG7C 3X2QC 2Q68A 4MVSA 4WFEA 5EBWC 4HZ3A 3E8FA 4HYOA 4MTFA 4MVQA 1R3IC 2X6BA 3ASNC 3SPIA 1R3LC 1KKDA 3KG2A 4X8AA 2Q67A 4X89A 4RO2A 3AG3C 3SYOA 2YEVA 4PA3A 4MVUA 2P7TC 4MTGA 4PA9A 3AG1C 1G4YB 2WLNA 3PJSK 2ITCC 5KUMA 4CBCA 2DYRC 1K4CC 4J9YB 4MW3A 3LDCA 2Q6AA 4X88A 4R7CA 2H8PC 2HVJC 2Q69A 2DWEC 3GB7C 2AHZA 4MVZA 3K03A 4XDLA 5EBLC 2A79B 4MVOA
chains in the Genus database with same CATH superfamily
1A32A 2RN9A 3M8AA 2F4VO 5B3SC 4CC6A 1GN3A 4DO2A 1N33O 1ENVA 2ZM6O 2YIAA 1FXVA 3K5OA 3JATA 2CTWA 1AJQA 2PUSA 4BW5A 3O65A 3SGIA 3CS5A 1HW7A 2CAZC 1MNGA 2R9AA 3W7SA 4J7KA 4MVRA 1M57B 1O9GA 2HKOA 2ZE5A 2K1EA 4DXWA 1KKCA 5LMUO 1AP6A 5K1XA 1F4MA 3K57A 4QJFB 5JJEB 2ZQMA 3DTUB 3L74H 4B7EA 4X64O 1H2LA 1Y74B 1HNWO 1NI8A 5HFMA 4FLYA 3QO7A 4JAAA 3RVZA 1OCOB 5IJ9A 2VQEO 3EHBB 3FFQA 5F2VO 2E75B 5H5NA 2JGDA 4X66B 2AHYA 3ZS8C 1U97A 4AQYO 2Z0AA 2BTQB 4B3TB 3AG4C 2C2AA 1BL8A 4PDMA 4AHCA 3CRQA 4XBFA 1JJ2U 5CBGA 1AR5A 2OTLV 1Z2GA 4O2AA 2IM9A 4U3JB 3ZHVA 3O9OA 4LF5B 1R3LC 2Q67A 2ZNIA 3AG3C 4KP4A 1R1BA 4IIJB 2DYRC 4IT5A 1Q81W 4QIWF 3IJ4A 2EJRA 1Q90D 1UJWB 2AHZA 1AI4A 4CS4A 2GTSA 1NZ6A 4UCRA 1SA0A 3ML0A 3STLC 1YSCA 4FFKA 3OM3B 4GX2A 4PA6A 3CJHA 1JMKC 4ZHQA 1JR9A 2Q9LA 3ABKB 3JASB 4X66O 4KFMA 4LFAB 4B3TO 2AXTZ 4H13B 3JALB 4JI0B 1TAEA 2JGUA 5EYPB 3W7TA 2QTSA 3VQYA 1YVWA 2IJJA 3F7VC 4LR3A 5IT9N 1SESA 1NU1H 1PD3A 4TT3G 4UVCA 2ZCEA 4LF5O 3E83A 1N34B 2HFEC 4FMTA 4RAIA 1QLEC 1U96A 3FX7A 3K59A 3G67A 1X4TA 2PZSA 3Q4HB 3E35A 2EIKC 3LDDA 3CCEV 4MS2A 1KBHA 1Y74A 1G6UA 2XTAA 3K08A 2PGGA 1YHQV 1XNQB 2KG7A 2LW1A 5B1AB 2P22C 4TV9B 2B1IA 2UXCB 5EBWC 1YIJV 3BABA 1WN7A 4EEQA 4OPHA 3VQWA 5JQGB 2BTQA 2UXXA 4G2KA 3W7WA 1SS3A 5LA6A 4LFAO 1VQKV 1K8AW 1FKAO 1K4CC 3CXCU 4JI0O 2P90A 4CZZA 3AG1B 4J41A 3FAVB 3IC7A 1BZKA 2BSKB 1TUEB 2YXLA 1S5HC 4PDLA 5B1OA 3H1JH 4D7TA 4Q6GA 1R3JC 1N34O 4DW1A 1DF4A 1M57C 5CA1B 1VQ5V 1N0NA 3ABMB 2HJFC 1B06A 4YY3B 3E8HA 5C8YB 5LOVB 4J10A 1YZBA 5KHKA 3LDEA 5H6RA 3PN1A 1F23A 4JI4B 1XNQO 1M9NA 1R6TA 1B6QA 2UXCO 4QE7A 1AR1B 3K04A 2JRIA 3JASA 2WLIB 3K9AA 1CXZB 3K79A 1OCOC 4ZI7B 4B3MB 3OTFA 2Q0AA 3JD2A 2KSDA 5EYPA 3T4ZA 5FNVB 1Y4MA 3G80A 2X6CA 3K06A 1PNLA 3HKEB 3SYQA 4LF7B 3DXRB 1WJZA 3JSLA 4DRXA 3L9DA 1R73A 4HBNA 3U11A 4X65O 4O2BB 4TV8B 3ZHQA 3X2QC 1TUBB 1V55B 1BS3A 4I5SA 3CC2V 2KKWA 3L75H 3L70H 4O4HB 3D3QA 4FM0A 4YY3O 4JI7B 3ASNB 1IZ3A 4PA9A 2HJDA 2Q0OC 5BY1A 3ETQA 3HKCB 3S3XA 4TV9A 2QM8A 4JI8B 5LGUA 1NH2B 4JI4O 3BPZA 1WP8A 3HR0A 3T2MA 5J9PC 3HKDB 5JQGA 4KHPB 1P49A 3ZHSA 2ZIOA 1I08A 4WF9V 4B3MO 3ABKC 4QPKA 5CBFA 1BSMA 4ABMA 1XL6A 3ZMZA 5LXTB 1SKVA 2Q8VA 4I0XB 3DC5A 3TETA 4XDJA 1H2NA 1XMQB 3CCSV 1XDCA 5A9GA 1FPOA 4NB5A 2MW2B 4LF7O 1KYOF 2FTKA 5D5QA 2JK5C 1ZX3A 1IVSA 2EIJB 2M7WA 1N4CA 3G4SV 3THOA 5CA1A 5L3FA 2CH7B 1JCHA 4PI2A 4ZKIA 3ZHUA 1WLEA 2PI4A 2RQ6A 5C8YA 3UKMA 4D7SA 2FKXA 2X6AA 4DR2B 2ILMA 5GTIZ 2OIEA 1BCCH 3SJAC 2G38A 2ZE7A 3B8MA 2Q4PA 1IXBA 2GUZB 2YI8A 3P3PA 1R6NA 4JI8O 1V54B 2QR4A 2P06A 1URFA 3ZMUA 2EJ7A 1SRYA 2JJ2G 1AROP 5B1AC 1EFRG 2WA4A 4KHPO 2QE7G 1EM1A 3IGAC 1NQTA 2XOKG 2EIMB 1Z5VA 2Q68A 3CXHF 2Q7EA 3F5TA 4JASA 3OE7G 1F4NA 3H9VA 2PI5A 2EBOA 3HKEA 2QWRB 5EIBC 4I50B 1VP7A 2M6YA 1YEWA 3B2EE 2HEPA 2YEVA 4O4JA 1XMQO 1WP7A 1E79G 1UPGA 1VQ4V 3AG1C 3I5DA 4O2BA 4TV8A 3CCLV 3D3IA 4JPRA 3LDCA 1YJNV 1Q7YW 4DV3B 2QM4A 2A79B 4FZ1A 3QO5A 4LF6B 4O4HA 1BQ0A 1H2GA 1N36B 4OX9B 5FL7G 2QKAA 3A0HZ 2WLHA 1VF7A 3JD0A 2IU3A 5CN0A 3JATB 1G8MA 3ABMC 3HKCA 4DR2O 1Y76A 2P6JA 2VWKA 3SR2C 4E4EA 4GZRB 1AJNA 3ZIAG 3BA8A 3HKDA 1Q6UA 5EIBD 4DV2B 2MK3A 3S3WA 3CRMA 1PP9H 4NTYA 2WWWA 5LXTA 3FB8C 1O9HA 3OUSA 3ZRVA 1B3QA 1OCCB 4OPAA 2JS3A 2EILB 3HB3B 1R6KA 1M56B 3CCQV 1QNMA 2L35A 4EFEA 3SYPA 2EINB 1IBMB 1VIBA 4BWAA 2RMKB 4PV1B 1QR9A 3WB2A 1RPOA 5L3CA 4DV3O 2RDCA 4GLXA 3A8TA 3ETGA 2ZR2A 3BRCA 5B5EZ 4LF6O 2Y4TA 3P3NA 1QVGU 3OUFA 1V55C 1AVMA 1N36O 4OX9O 2R72A 1N8RW 3CC7V 4O4LA 2YXHA 2GUZA 5EZYB 1SQFA 3ASNC 5KA5A 4FM1A 4H44B 4O2AB 3EVKA 1SQQH 4DV2O 3HKBB 3LSSA 1K5SA 1P7GA 1Q6HA 4MVZA 1M93A 3GWOA 2OYQA 2ZNJA 4D6TH 2YI9A 1RPRA 1SA0B 4JAUA 3G6EV 2NNUA 2IW5A 5C93A 3TJTA 2JDIG 3RYCA 3QF7A 1XBLA 4W4LA 1JPXA 4ZHQB 1IBMO 2IH1C 2R9RB 2XAQA 1AI5A 3TCUA 1YJ9V 1AP5A 1F7YA 2EIJC 3BY6A 1PNKA 3ASOC 3ZRXA 5LL6Y 2YUAA 1NH2D 1GM7A 3JAKB 4GX0A 3JCZA 5L3DA 3TXQA 3VOUA 3U10A 3ZRWB 2EULA 1W0KG 2P67A 3CHXA 1OCRB 3R65A 3C3TA 3H1IH 3FYEB 4MVMA 2OCHA 2NLJC 2RCVA 4FPPA 5KHJA 2XUMA 4TWKA 4DK0A 4P30A 1SQVH 1MG1A 3UO2A 4DV7O 1V54C 3OMNB 4H37A 3ZMTA 3J80N 1H2KA 2OWOA 4ZOLB 3OR6C 4CC5A 2E3CA 3JSNA 5H2FZ 2ZT9B 4GKJB 2EIMC 2A9HA 2UU9B 5EC2C 3HPLC 4NXNB 4LNUA 2KG7B 3WB1A 3VQXA 3T1HB 3E8FA 2GBOA 3JAWB 4HYOA 4X20B 1SQBH 1NVPB 4K8XA 2HHHB 5H6QA 3CMAV 3OD4A 4DV4B 3SYOA 2W0XA 3CRAA 1HNZB 3RN4A 4YJ3B 2WAMA 3RT3C 5LA6B 1W59A 4MVOA 4LC1A 5EZYA 3RBZA 1BE3H 3RW0A 3ZMVA 3X2QB 1GKFA 4P2ZA 2PF4E 2IJHA 3HKBA 3FB7C 4U3FH 1AJPA 1DK1A 1K5QA 1TVKA 2BOBC 1K97A 1NBMG 1TGOA 4U7NA 5KMGB 3E2EA 4FLXA 4UB8Z 4UVAA 3OMIB 4GKJO 1L1FA 4GX5A 1PL4A 2YS8A 2UU9O 4QE9A 5CA0A 2NN4A 3SYAA 3N2GB 4NXNO 2ZIMA 4P9PA 1OCCC 1WPXA 2UXDB 3T1HO 4ZBMA 5HFLA 5E1AC 2KB1A 2EILC 4C7UA 1XMOB 2HHHO 4JV5B 1BHAA 2DN9A 1M56C 4DV4O 3FB6C 1SQPH 1YTFB 3L72H 1HNZO 2EINC 1YF2A 5CBHA 4HNAB 3T1CA 3DGEA 3J7AU 5BMVB 3ZJZA 1LUWA 5KA6A 5K1PA 1OV9A 3JAKA 3CSXA 1VQPV 3ZRWA 2VS0A 4MTXA 2ARHA 2L6LA 2D2CB 2Y0IA 1VQNV 4GX1A 1MA1A 4DRXB 1H2MA 3H1KH 2NR5A 4HZ3A 2QSAA 2Z5UA 4ZOLA 3ZN0A 2ZE6A 3ZHRA 4OGQB 4MVUA 1RP3B 1QLNA 4CH5A 1S72V 5KX5B 1H2SB 5DN6G 4O4IB 1JFFB 2Q69A 4FLVA 3JAWA 4X20A 2CGOA 4XDKA 3BA9A 4TUYB 5B1NA 2UXDO 1NS1A 4N23A 1XMOO 4JV5O 5L3EA 5ITZB 1OZ0A 4YJ3A 5DEDA 1MABG 1FAFA 2Y69B 3BHPA 3N2KA 2CTRA 4FFBA 1KECA 1MSDA 3K58A 4UV8A 5CMUA 4UUJC 5JH7B 2LO1A 4WFAV 3QG5A 1VF6A 4RQFA 1HDJA 2Q73A 5EK0A 3SPHA 3K5NA 1OCRC 5A2QN 4K0KB 2JEUA 3D8CA 2ZR3A 4FZ0A 2ITDC 2ADQB 4JI6B 2VQFB 2CDYA 5KMGA 2HG5C 4LF8B 3SJCC 1EZVH 3H01A 3CYOA 2V4DA 3FD9A 3N2GA 1Q6IA 5IE9A 5EC1C 5CB4A 4DUZB 5BR8B 3OGCC 1D5AA 1VQ7V 1Q5OA 1SZXA 5LHHA 4WFEA 3CC4V 5B1BB 1YXBA 4HNAA 4YIOA 2LFSA 2EX3A 5BMVA 4Z1VA 2ETNA 3EXAA 1BMFG 3A2FA 2HR3A 2OT5A 2YEVB 1N32B 1XEQA 4O4JB 3RYFA 1Y6XA 1XUQA 2HVJC 4W4KA 1ZWIC 1CPYA 4B7KA 1FYJA 2VRZA 4K0KO 4PI0A 3RYIB 2Q7GA 1FFTB 1VF6C 3L73H 4NR1A 1EN4A 2OCCB 1VEWA 2HVKC 1IBKB 2VQFO 4JI6O 5KX5A 2IBZH 4X1KB 4LF8O 1S77D 4O4IA 2YC0A 5LGTA 1Y76B 1JFFA 1NVPD 2R70A 4TUYA 5JJJB 1HNXB 4CH4A 5BR8O 1QQCA 2E5LB 5ITZA 1JA8A 3ABUA 2W0FC 5LMNB 3W7XA 3K3WA 3LUTB 4JI2B 2RNBA 2WLLB 3AG2C 3OFNG 1GN4A 2AZ0A 5JH7A 1J5EB 2XAHA 3TXSA 4WFFA 1KU9A 2DOSA 3BAAA 1N32O 1JQ0A 3ZX6A 1PM9A 3EFFK 5EBMC 4I9QA 2BE3A 3LNMB 2GDSA 1HWYA 3ASOB 2ODMA 1VARA 3DC6A 4FM2A 3JYCA 1NTZH 4JYBA 2DW4A 1SZTA 1S3JA 4LFBB 4J42A 1IBKO 3JD4A 4GKKB 4JI7O 4DK1A 4RWUA 1VQLV 4O4LB 2X0LA 4TSFG 4UVBA 4JZGA 1YTFD 4CBCA 1HNXO 2FMLA 4CH3A 2V1DA 4Z2WA 4L87A 2E5LO 2DWEC 4DR7B 4LWSA 5LMNO 4BIOA 5LBQA 4JTDB 3MHSC 2FB5A 3SPCA 1M90W 1IBLB 3E22B 4P9OA 4JI2O 2D3OW 1LUVA 1I5YA 3H1HH 2UUCB 1TA8A 4DV6B 2Y69C 3I56V 1K92A 1FD9A 1PKXA 2XNDG 4JGSA 4I4TA 1ZL8A 1J5EO 1Q3EA 3LSQA 2VWJA 3CPWU 3JAMN 4BIZA 3M7MX 3RYCB 4B3SB 1GK9A 3OW2U 5KAFZ 3RYIA 3BEHA 4A5UB 2ZXWB 3MD0A 1AI7A 1AI6A 3M99B 1VQ9V 4LFBO 3LSUA 1ZAUA 3L71H 3N27A 4X1KA 4GKKO 4FLUA 3OAAG 2YSUB 4DR4B 5B66Z 4MW8A 4R8CA 3AK1A 1IX9A 2YXYA 2QDOA 2XASA 3OTOB 4UCVA 4DUYB 2A7WA 4PD4F 1EN5A 4K3AA 1XILA 4X1YB 4DR7O 2WLLA 1L8DA 1G1XB 1OCZC 3C3SA 2ADPA 3F5WC 5B1BC 2UUCO 3CRCA 4TQDA 1AR4A 4LNUB 4PELA 1YDXA 3IC9A 5IJ0A 1SQGA 2DE0X 2LW7A 1VQMV 4F6EA 3SDLA 1DGSA 5FPOA 3SJBC 3QVNA 3FYIB 4B3SO 4ZIBA 2F93B 1QU7A 3T1YB 1I94B 4X88A 2JS5A 5KUKA 1EZJA 2QA4V 2F95B 2OCCC 4K35A 4IL6Z 1W2BU 4R6ZA 4DR4O 1YITV 2QTOA 5J2TA 4YJ2B 1S76D 4ICGA 1N33B 4UFZA 1GTOA 4JI3B 3AK3A 3JD1A 1CP9A 3OTOO 4WFBV 1H38A 4FIPC 5GONA 2B9ZA 3UCSC 1ZUQA 1R3KC 4DUYO 1QVFU 4DV1B 3ZN1A 3DSQA 3SPJA 1TVKB 2BCCH 3E22A 4F4LA 1BHBA 3ETDA 3ABTA 4WBNA 1KUQA 3AG7A 3CRRA 2CGNA 4WFGA 3CEIA 5CA0B 2QKSA 3B8NA 2V7QG 3ZRSA 2YICA 2CE4A 1XQ8A 4N21A 3CCJV 3CX5F 4X64B 1ZSPA 5J2UB 5IYCO 3UM7A 3T1YO 1N0JA 1I94O 4PDRA 2KQXA 1DTOA 2YIBA 3OEHG 1MZEA 1MZFA 1GM8A 4EKWA 1SQXH 1D5NA 3ZHTA 3APQA 1RM1C 1HR0B 1LR1A 2LGWA 4PA4A 1MMMA 2W6JG 3VQVA 4PHZA 1R3IC 4JI3O 3WG7B 4ASUG 1ZTEA 4X1YA 3P30A 1NR1A 1Q43A 4RO2A 1QBZA 3QTCA 2DQ0A 2P7TC 4DV1O 3AK2A 2WLNA 2PTMA 1WB7A 4J9YB 4UCOA 3VBBA 3K03A 5LHIA 1FXHA 1YCIA 2GHYA 1AILA 3G6BA 1WNSA 3H1LH 1GN2A 2P5OA 2LGQA 1SC5B 1QCEA 1S5JA 3NXSA 3D36A 4UB6Z 2N74A 2PY5A 5LP6B 2ATKC 1NT2B 3C90A 5IWAB 1P7BA 2CUGA 2ZXWC 2LQTA 4JTCB 2O57A 4DYLA 3RGBA 3I55V 3N2KB 4FFBB 5LHGA 3IFXA 1B04A 3GVMA 2EZOA 3QO8A 1LNQA 1K4DC 4YJ2A 4UCSA 1WA8B 3NR7A 4JTAB 1HR0O 2QWPB 1XL4A 3KCXA 5DECA 4G27B 3OR7C 3JCUZ 2JJ1G 2Q5ZA 3G71V 3WFVA 4YIPA 1NJIW 1WB8A 4J11A 4CH6A 1NR7A 4Q20A 2Y0PA 2P4VA 2GV9A 5GW7A 5JCOA 5L3BA 3OMAB 2LJ2A 3STZC 1ORQC 3JD3A 1NKDA 2XHBA 5IDJA 5CB4B 1ROPA 4AI8A 4LF4B 3F7YC 2GSMB 3AG2B 4MVSA 5J2UA 3K5LA 3A0RA 2YIBD 3UT5A 2Z3YA 3SPIA 1I7FA 5JJNB 4X8AA 2E76B 5IWAO 4JYYA 3KZIZ 3APOA 3D36C 1F51A 1Q86W 1RFYA 5KHHA 3GWKC 1G4YB 3PJSK 1DF5A 1PPJH 4GT1A 4MT8A 2Q6AA 3K5MA 3OGIB 3RYFB 5IYZB 4XDLA 2H8PC 3GB7C 4DR6O 3CD6V 1T5EA 4YHHB 1M1KW 1NTMH 2DMXA 4FLZA 2IH3C 4UCTA 2F23A 3CMEV 2OIGA 5CA3A 4R50A 1GO3F 4UCUA 1K3EA 4OXSA 4WFHA 4G28B 5D5PA 2DQ3A 2H94A 1WPBA 4LP8A 3FB5C 4NTXA 2DYSB 4X9QA 1IURA 1I5XA 5FLXN 3K9SA 4DV5B 5BZBA 2WA3A 5LYJB 4X62B 5KHIA 4JI5B 4LH7A 1FXKB 5JCOC 2JVDA 3UQ8A 4LF4O 4NTWA 4DW0A 2F1MA 2UUBB 5LP6A 3P32A 1I0HA 1S0VA 2DWDC 4J80A 2BOCC 2A0LA 4LCUC 1EN6A 5IY5B 4RUEA 4J9ZB 3R66A 2JIZG 1WA8A 3FKSG 3T4DA 1P4RA 3ZCCA 5GTHZ 4EFBA 2LP7A 3B40A 1CEZA 3B09A 1RSOB 4YHHO 1GM9A 2IU0A 2A3QA 2AZ2A 3E89A 1VQOV 4KXRA 2R9IA 2WLKA 3J81N 3WG7C 3CB2A 4U3JA 4X65B 4HAMA 2X6BA 1X59A 4JAVA 4JZ2A 4CS3A 4X89A 4IIJA 4F6RB 3B4SA 4DV5O 2ITCC 2OTJV 4X62O 4NVPA 4JI5O 1OJHA 4QGPA 1OCZB 4H0LB 4U7OA 2QEXV 2UUBO 4LWSB 4B3RB 1Z5WA 4QNHB 2ZINA 5IYDO 4BAYA 4K8ZA 3ABLB 2B5UA 1JJOA 4JF3A 1OHHG 2HLDG 5LP6C 4KUMA 3JARB 4IHJB 4TQFA 4PJ0Z 3CCMV 4I4TB 1ZL8B 5IYZA 2UXBB 1MSWD 1L0LH 2UUAB 4DV0B 2P4KA 4E2LA 2ZD9A 1KD1W 3JALA 1W0JG 3LNNA 3SPGA 1FJGB 4IYHA 4GUNA 1BQZA 1WAZA 4JYAB 1XI1A 5AG2A 4RUFA 3OT7A 5E79Z 1KC8W 1BGYH 1COWG 4DR1B 3CWBH 3A0BZ 3MAQA 5LYJA 1M4UA 1FXKA 5JVDB 4DUZO 5DM6V 3Q4HA 1HP8A 2QWOB 1THZA 3AEIA 4B3RO 2FYUH 4YXWG 4X1IB 4B08A 2Y4UA 5TISZ 1H8HG 4MVQA 4DR3B 4FVMA 1KQSU 4LF9B 2UXBO 1KKDA 5IJ0B 1GN6A 2QM7A 2YIDA 2UUAO 3BFRA 5L3GA 4PA3A 4DV0O 5BXZA 1RSOA 2N05A 3QNEA 1FJGO 3B77A 3FAVA 1D2DA 2BSKA 4JI1B 4MW3A 1KB9F 4WCEV 5KLVH 3CCUV 4EB6B 1US6A 1KP3A 1IXMA 4JYAO 1QHTA 4LH6A 1Q82W 1RM1B 2F66C 2XAFA 5B3SB 4DR1O 1VQ8V 3ZBHA 4LBEC 5KHGA 2B1GA 4F6RA 1GAXA 4MSWC 1PL0A 1GH6A 3SJQC 2EZPA 5J2TB 2IJIA 2DYSC 4DR5B 2Y48A 5LOVA 5LGNA 4LFCB 5GONB 3TK1A 1FXKC 1VMGA 4KL1A 1NTKH 3RYHB 1K7DA 1GMGA 1MOFA 1K34A 3ZEDA 3JARA 2ZDIA 4IHJA 4WBNB 2WLIA 2RJZA 3W7UA 2WSSG 4IGGA 2HP8A 1J95A 4FJCC 4ZI7A 4DR3O 5IY5C 2UXNA 3E86A 4LF9O 1PNMA 2CK3G 4I7ZB 5FNVA 2CTPA 1BT8A 1ZLZA 4JI1O 3RWRD 1JX9A 3DXRA 3K0DA 2XT9A 3IAYA 2X7RB 1XHXA 3U0ZA 1FFXB 2AW9A 3AG4B 1XOUA 3KCYA 4RQEA 2F43G 4UV9A 1TUBA 2FL4A 3E8BA 1YJWV 1S5LZ 3K0GA 2QJ1A 3RFRA 3CCVV 1JOYA 3CE2A 4FLWA 5JVDA 4I55B 4MTFA 4TOIA 4IYIA 4DR5O 2PYLA 2A06H 3KG2A 4LFCO 3KKYA 1M5IA 3AG3B 2W6IG 3WU2Z 4BR6A 1IBLO 5H9CA 2PYJA 4L8JA 2DYRB 4X1IA 4GCZA 4DV6O 1KMIZ 1K9MW 2E74B 3ABLC 1AB3A 1K33A 1UFIA 2QKCA 4NXMB 1DLBA 2Q7HA 4GYCB 3CP1A 2ZDIC 4BIUA 1XHZA 4CS2A 4I0XA 4BW9A 1PV0A 1YI2V 2N04A 1H8EG 2LFRA 1E1RG 4EB6A 1XNRB 1KP2A 3UO3A 1VQ6V 4QPJA 1E1QG 1EBOA 3E8GA 2WPDG 4FLTA 2WLMA 1VF5B 1L0NH 2ZKOA 5IJ9B 3MDSA 3RVYA 3ICXA 4H33A 1JVMA 4NYKA 1GRJA 5JWPA 2CH7A 2DJVA 2JGDB 5IYBO 2YDEA 4FK5C 4DR6B 2F4VB 4MTOA 1IDSA 2ZM6B 2JEXA 2QWNB 5FPRA 3BCCH 4NKGB 2WLJA 1SF9A 3RYHA 3OEEG 4PDVA 3SYCA 2GTAA 4JYCA 1SERA 1FS0G 3TGUH 1QLEB 3ZMSA 4PA7A 4J7ZA 4UXNA 5LMUB 2K9PA 4J7JA 2XAJA 4DV7B 2EIKB 4I9WA 2AGAA 4NXMO 4AILC 2XAGA 1XREA 2H3OA 3WB0A 3BVOA 4I50A 1P84F 1HNWB 2ZE8A 1Y67A 2IJKA 3MHHC 3ETEA 4Z1MG 5KAIZ 1XNRO 2BTOA 3UT5B 4MTGA 1FFXA 2VQEB 3CCRV 5KUMA 1K73W 2CTQA 2QWQB 2QGNA 3CJHB 4AQYB 1QR8A 1V9PA 4R7CA 1Q8IA 5EBLC 4I55A 1SETA 1Y66A
chains in the Genus database with same CATH topology
5B3SC 3QO5A 1M1KW 4DO2A 1ENVA 1H2GA 1FXVA 1FFTB 5FL7G 2IH3C 1AJQA 2WLHA 2OCCB 4BW5A 3CMEV 3JD0A 2IU3A 5CN0A 5CA3A 2HVKC 1G8MA 4R50A 3ABMC 1GO3F 3W7SA 1K3EA 2P6JA 4MVRA 4OXSA 4WFHA 4G28B 1S77D 2DQ3A 2H94A 5LGTA 4LP8A 1M57B 1NVPD 1AJNA 2HKOA 3FB5C 2K1EA 2DYSB 3ZIAG 4DXWA 1I5XA 5BZBA 1F4MA 2MK3A 4QJFB 2ZQMA 1FXKB 3DTUB 3ABUA 2W0FC 2WWWA 3W7XA 3K3WA 3LUTB 3FB8C 3P32A 1S0VA 2DWDC 2WLLB 3AG2C 3OUSA 3OFNG 3ZRVA 1OCCB 5HFMA 2BOCC 2A0LA 3QO7A 4LCUC 3RVZA 5IY5B 2XAHA 2EILB 1OCOB 3HB3B 4J9ZB 4RUEA 4WFFA 1R6KA 1M56B 2JIZG 3EHBB 3CCQV 1JQ0A 3FKSG 2AHYA 2EINB 3SYPA 3T4DA 1P4RA 3ZCCA 1QR9A 1RPOA 2LP7A 5L3CA 3AG4C 3EFFK 5EBMC 1CEZA 3LNMB 3ETGA 1HWYA 2C2AA 2ZR2A 3ASOB 1GM9A 1BL8A 4PDMA 2IU0A 1QVGU 3JYCA 3OUFA 1V55C 4XBFA 4JYBA 2DW4A 1SZTA 3E89A 1S3JA 1VQOV 5CBGA 1JJ2U 2R9IA 2WLKA 3WG7C 1N8RW 2OTLV 3JD4A 3CC7V 4HAMA 2X6BA 3ASNC 5KA5A 1VQLV 1R3LC 4JAVA 2Q67A 2X0LA 4X89A 3AG3C 4TSFG 4UVBA 4KP4A 2ITCC 1YTFD 4CBCA 2OTJV 2DYRC 1Q81W 2V1DA 3LSSA 4QIWF 1K5SA 4L87A 2EJRA 1UJWB 1OCZB 2DWEC 4MVZA 2AHZA 4U7OA 1AI4A 3GWOA 2QEXV 5LBQA 4JTDB 1RPRA 3MHSC 3SPCA 1M90W 3ML0A 4P9OA 3STLC 1YSCA 2D3OW 4QNHB 5IYDO 4BAYA 3ABLB 1I5YA 2B5UA 4JF3A 3OM3B 2Y69C 4GX2A 4JAUA 3I56V 3G6EV 1OHHG 1K92A 2HLDG 2NNUA 4PA6A 2IW5A 1PKXA 2XNDG 4JGSA 4KUMA 5C93A 3CCMV 3ABKB 1MSWD 3LSQA 2JDIG 1JPXA 3CPWU 2IH1C 2R9RB 4KFMA 4BIZA 2XAQA 2ZD9A 4E2LA 1KD1W 1AI5A 3TCUA 1W0JG 1YJ9V 1GK9A 3OW2U 3SPGA 3BEHA 2ZXWB 3MD0A 2EIJC 3BY6A 1AI7A 3W7TA 1PNKA 1AI6A 3ASOC 3M99B 2IJJA 1VQ9V 3ZRXA 3F7VC 1NH2D 1GM7A 4RUFA 4GX0A 1SESA 3JCZA 5L3DA 3VOUA 1KC8W 3ZRWB 1PD3A 4TT3G 3OAAG 1W0KG 2P67A 4UVCA 1COWG 1OCRB 3R65A 3E83A 4MW8A 4R8CA 3FYEB 4MVMA 2NLJC 4FPPA 4TWKA 4P30A 2HFEC 4FMTA 4RAIA 1MG1A 2XASA 1QLEC 1FXKA 5DM6V 1V54C 3OMNB 4H37A 3ZMTA 3E35A 2EIKC 3LDDA 3OR6C 3CCEV 4MS2A 2WLLA 1THZA 1OCZC 3K08A 3AEIA 2EIMC 1YHQV 3F5WC 2A9HA 5EC2C 5B1BC 4YXWG 3HPLC 5B1AB 2B1IA 5EBWC 1YIJV 3E8FA 4HYOA 1H8HG 4MVQA 4PELA 1NVPB 1KQSU 5H6QA 3CMAV 1KKDA 1VQMV 2UXXA 2QM7A 3SYOA 5L3GA 4PA3A 4G2KA 3W7WA 3FYIB 1VQKV 1K8AW 3QNEA 2WAMA 3B77A 1K4CC 3CXCU 2P90A 4MW3A 3AG1B 4CZZA 4WCEV 3CCUV 3IC7A 4X88A 1TUEB 1KP3A 4MVOA 1IXMA 5KUKA 1S5HC 1EZJA 4LC1A 3RBZA 2QA4V 1Q82W 1RM1B 4PDLA 2OCCC 5B1OA 3RW0A 3ZMVA 2XAFA 3X2QB 1W2BU 4R6ZA 5B3SB 1YITV 2QTOA 1R3JC 1VQ8V 1GKFA 4LBEC 2B1GA 4MSWC 1PL0A 4P2ZA 1S76D 3SJQC 2EZPA 2IJIA 1DF4A 1M57C 1GTOA 2IJHA 3JD1A 1VQ5V 1CP9A 2DYSC 3ABMB 3FB7C 2Y48A 4WFBV 1H38A 4FIPC 1AJPA 2HJFC 1K5QA 5LGNA 1R3KC 1QVFU 3E8HA 3ZN1A 1CPYA 3SPJA 2BOBC 4F4LA 1K97A 3TK1A 1FXKC 1NBMG 4U7NA 3E2EA 1BHBA 3ETDA 4UVAA 3ABTA 3OMIB 1K7DA 1L1FA 3LDEA 5H6RA 1GMGA 1F23A 4GX5A 1MOFA 4QE9A 1K34A 1M9NA 2ZDIA 3SYAA 1B6QA 4WFGA 4P9PA 2WLIA 1OCCC 2QKSA 1WPXA 4QE7A 3B8NA 2WSSG 2V7QG 3W7UA 1AR1B 1J95A 3K04A 4ZBMA 4FJCC 5HFLA 2WLIB 3K9AA 5E1AC 2KB1A 3K79A 5IY5C 2EILC 1OCOC 2UXNA 3E86A 1BHAA 1PNMA 3ZRSA 1M56C 4N21A 2CK3G 3CCJV 3FB6C 1YTFB 2EINC 3JD2A 5CBHA 3T1CA 3DGEA 3T4ZA 5IYCO 3UM7A 3ZJZA 1Y4MA 5KA6A 1JX9A 2X6CA 3K06A 1PNLA 3K0DA 3SYQA 4PDRA 1DTOA 3OEHG 2X7RB 1VQPV 3ZRWA 1GM8A 4EKWA 4MTXA 1R73A 3AG4B 4RQEA 2F43G 4UV9A 1VQNV 4GX1A 3E8BA 1YJWV 3K0GA 3CCVV 1RM1C 1JOYA 4PA4A 3X2QC 2W6JG 1V55B 4HZ3A 4MTFA 4I5SA 1R3IC 3CC2V 3WG7B 2Z5UA 4ASUG 3ZN0A 3P30A 3KG2A 1NR1A 4RO2A 1QBZA 3ASNB 2DQ0A 2P7TC 4MVUA 4PA9A 1QLNA 2WLNA 3AG3B 1S72V 2W6IG 5DN6G 4J9YB 5H9CA 2QM8A 3VBBA 2DYRB 5LGUA 2Q69A 1NH2B 3K03A 4GCZA 5LHIA 4XDKA 1K9MW 5J9PC 3T2MA 3ABLC 1FXHA 1K33A 2GHYA 5B1NA 1DLBA 3CP1A 4N23A 2ZDIC 4WF9V 4BIUA 5L3EA 1OZ0A 1QCEA 3NXSA 3ABKC 3D36A 4QPKA 5CBFA 1MABG 2Y69B 1XL6A 3ZMZA 1YI2V 1H8EG 2LFRA 1E1RG 2ATKC 1KP2A 1VQ6V 1P7BA 4QPJA 3TETA 1KECA 4XDJA 2ZXWC 3CCSV 4JTCB 1E1QG 3I55V 4UV8A 1EBOA 3E8GA 2WPDG 4UUJC 5CMUA 2WLMA 5LHGA 3IFXA 2FTKA 4WFAV 2EZOA 3QO8A 1LNQA 3RVYA 1K4DC 1JVMA 4H33A 2JK5C 5IYBO 4RQFA 2EIJB 2M7WA 3G4SV 4FK5C 4JTAB 4MTOA 3CD6V 5L3FA 5EK0A 3SPHA 1XL4A 1JCHA 1OCRC 4ZKIA 4G27B 1WLEA 2JEUA 2JEXA 3OR7C 2PI4A 2JJ1G 2ZR3A 3G71V 2ITDC 3UKMA 3WFVA 1NJIW 2X6AA 2WLJA 3OEEG 2HG5C 4PDVA 3SYCA 4JYCA 1NR7A 4Q20A 1SERA 1FS0G 3B8MA 3H01A 3CYOA 5GW7A 3ZMSA 1QLEB 4PA7A 5L3BA 3OMAB 4UXNA 1R6NA 1V54B 3STZC 1ORQC 3ZMUA 5EC1C 1SRYA 3JD3A 1NKDA 5IDJA 2XAJA 2JJ2G 2EIKB 4I9WA 1AROP 5B1AC 1EFRG 3OGCC 2QE7G 1ROPA 1VQ7V 3IGAC 1NQTA 1ZWIC 3F7YC 2XAGA 2GSMB 2XOKG 2EIMB 3AG2B 5LHHA 2Q68A 4MVSA 4WFEA 3CC4V 5B1BB 4JASA 2LFSA 3OE7G 3A0RA 1F4NA 2PI5A 2IJKA 3MHHC 2EBOA 2Z3YA 3ETEA 3SPIA 4Z1MG 4X8AA 1BMFG 2HR3A 2YEVA 1F51A 4MTGA 1E79G 1Q86W 1VQ4V 3AG1C 3CCRV 1G4YB 2OT5A 2YEVB 3PJSK 5KUMA 1DF5A 1K73W 4GT1A 4MT8A 3CCLV 3D3IA 4JPRA 3LDCA 1YJNV 2Q6AA 1Q7YW 1QR8A 4R7CA 2H8PC 2HVJC 3GB7C 4XDLA 5EBLC 2YSUB 1SETA 2A79B 1Y66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KUK A;  1S5H C;  4XDK A;  5B3S C;  3RBZ A;  5J9P C;  3T2M A;  3ABL C;  4JTD B;  3SPC A;  4PDL A;  2OCC C;  4P9O A;  3STL C;  3RW0 A;  4QNH B;  4R6Z A;  2IH3 C;  2QTO A;  1R3J C;  2WLH A;  4LBE C;  4BW5 A;  4MSW C;  4P2Z A;  2Y69 C;  4GX2 A;  2HVK C;  4PA6 A;  4R50 A;  3ABM C;  3SJQ C;  3ABK C;  5CBF A;  1M57 C;  4MVR A;  4OXS A;  4WFH A;  1XL6 A;  4G28 B;  2DYS C;  3FB7 C;  2ATK C;  4LP8 A;  2HJF C;  3FB5 C;  1R3K C;  1P7B A;  3TET A;  2K1E A;  2IH1 C;  4XDJ A;  2ZXW C;  2R9R B;  3E8H A;  4JTC B;  2ZD9 A;  4KFM A;  4DXW A;  3TCU A;  3SPJ A;  3E8G A;  4UUJ C;  2WLM A;  2BOB C;  4F4L A;  5BZB A;  3SPG A;  3BEH A;  3IFX A;  2EIJ C;  3RVY A;  1LNQ A;  1K4D C;  1JVM A;  4H33 A;  3LDE A;  2JK5 C;  3ASO C;  4GX5 A;  4QE9 A;  4JTA B;  3F7V C;  3SYA A;  2W0F C;  4MTO A;  5EK0 A;  4WFG A;  4P9P A;  3SPH A;  1XL4 A;  1OCC C;  2WLI A;  2QKS A;  1OCR C;  4QE7 A;  3LUT B;  4GX0 A;  3FB8 C;  4RUF A;  3VOU A;  1J95 A;  3K04 A;  4ZBM A;  4G27 B;  2DWD C;  2WLL B;  3AG2 C;  2WLI B;  3OR7 C;  3OUS A;  5E1A C;  2KB1 A;  5IY5 C;  2EIL C;  1OCO C;  3E86 A;  3E83 A;  2ITD C;  3R65 A;  3UKM A;  4MW8 A;  2BOC C;  3ZRS A;  4R8C A;  1M56 C;  2A0L A;  2X6A A;  4MVM A;  2NLJ C;  4LCU C;  3RVZ A;  2WLJ A;  4TWK A;  3FB6 C;  4P30 A;  4RUE A;  4J9Z B;  4WFF A;  2HG5 C;  4PDV A;  2HFE C;  4RAI A;  2EIN C;  3SYC A;  1QLE C;  5CBH A;  3T1C A;  3T4Z A;  3UM7 A;  1V54 C;  3ZJZ A;  4H37 A;  2AHY A;  3SYP A;  3T4D A;  2X6C A;  3K06 A;  3K0D A;  4PA7 A;  3SYQ A;  4PDR A;  2EIK C;  3LDD A;  3OR6 C;  3STZ C;  1ORQ C;  5EC1 C;  3AG4 C;  3EFF K;  5EBM C;  4MS2 A;  3LNM B;  2WLL A;  4EKW A;  1OCZ C;  3K08 A;  4I9W A;  5B1A C;  1BL8 A;  3OGC C;  4PDM A;  2EIM C;  3JYC A;  3F5W C;  3OUF A;  1V55 C;  2A9H A;  3IGA C;  5EC2 C;  3E89 A;  3E8B A;  4GX1 A;  5B1B C;  1ZWI C;  3K0G A;  3HPL C;  3F7Y C;  5CBG A;  2WLK A;  4PA4 A;  3WG7 C;  3X2Q C;  2Q68 A;  4MVS A;  4WFE A;  5EBW C;  4HZ3 A;  3E8F A;  4HYO A;  4MTF A;  4MVQ A;  1R3I C;  2X6B A;  3ASN C;  3SPI A;  1R3L C;  1KKD A;  3KG2 A;  4X8A A;  2Q67 A;  4X89 A;  4RO2 A;  3AG3 C;  3SYO A;  2YEV A;  4PA3 A;  4MVU A;  2P7T C;  4MTG A;  4PA9 A;  3AG1 C;  1G4Y B;  2WLN A;  3PJS K;  2ITC C;  5KUM A;  4CBC A;  2DYR C;  1K4C C;  4J9Y B;  4MW3 A;  3LDC A;  2Q6A A;  4X88 A;  4R7C A;  2H8P C;  2HVJ C;  2Q69 A;  2DWE C;  3GB7 C;  2AHZ A;  4MVZ A;  3K03 A;  4XDL A;  5EBL C;  2A79 B;  4MVO A; 
#chains in the Genus database with same CATH topology
 1A32 A;  2RN9 A;  3M8A A;  2F4V O;  5B3S C;  4CC6 A;  1GN3 A;  4DO2 A;  1N33 O;  1ENV A;  2ZM6 O;  2YIA A;  1FXV A;  3K5O A;  3JAT A;  2CTW A;  1AJQ A;  2PUS A;  4BW5 A;  3O65 A;  3SGI A;  3CS5 A;  1HW7 A;  2CAZ C;  1MNG A;  2R9A A;  3W7S A;  4J7K A;  4MVR A;  1M57 B;  1O9G A;  2HKO A;  2ZE5 A;  2K1E A;  4DXW A;  1KKC A;  5LMU O;  1AP6 A;  5K1X A;  1F4M A;  3K57 A;  4QJF B;  5JJE B;  2ZQM A;  3DTU B;  3L74 H;  4B7E A;  4X64 O;  1H2L A;  1Y74 B;  1HNW O;  1NI8 A;  5HFM A;  4FLY A;  3QO7 A;  4JAA A;  3RVZ A;  1OCO B;  5IJ9 A;  2VQE O;  3EHB B;  3FFQ A;  5F2V O;  2E75 B;  5H5N A;  2JGD A;  4X66 B;  2AHY A;  3ZS8 C;  1U97 A;  4AQY O;  2Z0A A;  2BTQ B;  4B3T B;  3AG4 C;  2C2A A;  1BL8 A;  4PDM A;  4AHC A;  3CRQ A;  4XBF A;  1JJ2 U;  5CBG A;  1AR5 A;  2OTL V;  1Z2G A;  4O2A A;  2IM9 A;  4U3J B;  3ZHV A;  3O9O A;  4LF5 B;  1R3L C;  2Q67 A;  2ZNI A;  3AG3 C;  4KP4 A;  1R1B A;  4IIJ B;  2DYR C;  4IT5 A;  1Q81 W;  4QIW F;  3IJ4 A;  2EJR A;  1Q90 D;  1UJW B;  2AHZ A;  1AI4 A;  4CS4 A;  2GTS A;  1NZ6 A;  4UCR A;  1SA0 A;  3ML0 A;  3STL C;  1YSC A;  4FFK A;  3OM3 B;  4GX2 A;  4PA6 A;  3CJH A;  1JMK C;  4ZHQ A;  1JR9 A;  2Q9L A;  3ABK B;  3JAS B;  4X66 O;  4KFM A;  4LFA B;  4B3T O;  2AXT Z;  4H13 B;  3JAL B;  4JI0 B;  1TAE A;  2JGU A;  5EYP B;  3W7T A;  2QTS A;  3VQY A;  1YVW A;  2IJJ A;  3F7V C;  4LR3 A;  5IT9 N;  1SES A;  1NU1 H;  1PD3 A;  4TT3 G;  4UVC A;  2ZCE A;  4LF5 O;  3E83 A;  1N34 B;  2HFE C;  4FMT A;  4RAI A;  1QLE C;  1U96 A;  3FX7 A;  3K59 A;  3G67 A;  1X4T A;  2PZS A;  3Q4H B;  3E35 A;  2EIK C;  3LDD A;  3CCE V;  4MS2 A;  1KBH A;  1Y74 A;  1G6U A;  2XTA A;  3K08 A;  2PGG A;  1YHQ V;  1XNQ B;  2KG7 A;  2LW1 A;  5B1A B;  2P22 C;  4TV9 B;  2B1I A;  2UXC B;  5EBW C;  1YIJ V;  3BAB A;  1WN7 A;  4EEQ A;  4OPH A;  3VQW A;  5JQG B;  2BTQ A;  2UXX A;  4G2K A;  3W7W A;  1SS3 A;  5LA6 A;  4LFA O;  1VQK V;  1K8A W;  1FKA O;  1K4C C;  3CXC U;  4JI0 O;  2P90 A;  4CZZ A;  3AG1 B;  4J41 A;  3FAV B;  3IC7 A;  1BZK A;  2BSK B;  1TUE B;  2YXL A;  1S5H C;  4PDL A;  5B1O A;  3H1J H;  4D7T A;  4Q6G A;  1R3J C;  1N34 O;  4DW1 A;  1DF4 A;  1M57 C;  5CA1 B;  1VQ5 V;  1N0N A;  3ABM B;  2HJF C;  1B06 A;  4YY3 B;  3E8H A;  5C8Y B;  5LOV B;  4J10 A;  1YZB A;  5KHK A;  3LDE A;  5H6R A;  3PN1 A;  1F23 A;  4JI4 B;  1XNQ O;  1M9N A;  1R6T A;  1B6Q A;  2UXC O;  4QE7 A;  1AR1 B;  3K04 A;  2JRI A;  3JAS A;  2WLI B;  3K9A A;  1CXZ B;  3K79 A;  1OCO C;  4ZI7 B;  4B3M B;  3OTF A;  2Q0A A;  3JD2 A;  2KSD A;  5EYP A;  3T4Z A;  5FNV B;  1Y4M A;  3G80 A;  2X6C A;  3K06 A;  1PNL A;  3HKE B;  3SYQ A;  4LF7 B;  3DXR B;  1WJZ A;  3JSL A;  4DRX A;  3L9D A;  1R73 A;  4HBN A;  3U11 A;  4X65 O;  4O2B B;  4TV8 B;  3ZHQ A;  3X2Q C;  1TUB B;  1V55 B;  1BS3 A;  4I5S A;  3CC2 V;  2KKW A;  3L75 H;  3L70 H;  4O4H B;  3D3Q A;  4FM0 A;  4YY3 O;  4JI7 B;  3ASN B;  1IZ3 A;  4PA9 A;  2HJD A;  2Q0O C;  5BY1 A;  3ETQ A;  3HKC B;  3S3X A;  4TV9 A;  2QM8 A;  4JI8 B;  5LGU A;  1NH2 B;  4JI4 O;  3BPZ A;  1WP8 A;  3HR0 A;  3T2M A;  5J9P C;  3HKD B;  5JQG A;  4KHP B;  1P49 A;  3ZHS A;  2ZIO A;  1I08 A;  4WF9 V;  4B3M O;  3ABK C;  4QPK A;  5CBF A;  1BSM A;  4ABM A;  1XL6 A;  3ZMZ A;  5LXT B;  1SKV A;  2Q8V A;  4I0X B;  3DC5 A;  3TET A;  4XDJ A;  1H2N A;  1XMQ B;  3CCS V;  1XDC A;  5A9G A;  1FPO A;  4NB5 A;  2MW2 B;  4LF7 O;  1KYO F;  2FTK A;  5D5Q A;  2JK5 C;  1ZX3 A;  1IVS A;  2EIJ B;  2M7W A;  1N4C A;  3G4S V;  3THO A;  5CA1 A;  5L3F A;  2CH7 B;  1JCH A;  4PI2 A;  4ZKI A;  3ZHU A;  1WLE A;  2PI4 A;  2RQ6 A;  5C8Y A;  3UKM A;  4D7S A;  2FKX A;  2X6A A;  4DR2 B;  2ILM A;  5GTI Z;  2OIE A;  1BCC H;  3SJA C;  2G38 A;  2ZE7 A;  3B8M A;  2Q4P A;  1IXB A;  2GUZ B;  2YI8 A;  3P3P A;  1R6N A;  4JI8 O;  1V54 B;  2QR4 A;  2P06 A;  1URF A;  3ZMU A;  2EJ7 A;  1SRY A;  2JJ2 G;  1ARO P;  5B1A C;  1EFR G;  2WA4 A;  4KHP O;  2QE7 G;  1EM1 A;  3IGA C;  1NQT A;  2XOK G;  2EIM B;  1Z5V A;  2Q68 A;  3CXH F;  2Q7E A;  3F5T A;  4JAS A;  3OE7 G;  1F4N A;  3H9V A;  2PI5 A;  2EBO A;  3HKE A;  2QWR B;  5EIB C;  4I50 B;  1VP7 A;  2M6Y A;  1YEW A;  3B2E E;  2HEP A;  2YEV A;  4O4J A;  1XMQ O;  1WP7 A;  1E79 G;  1UPG A;  1VQ4 V;  3AG1 C;  3I5D A;  4O2B A;  4TV8 A;  3CCL V;  3D3I A;  4JPR A;  3LDC A;  1YJN V;  1Q7Y W;  4DV3 B;  2QM4 A;  2A79 B;  4FZ1 A;  3QO5 A;  4LF6 B;  4O4H A;  1BQ0 A;  1H2G A;  1N36 B;  4OX9 B;  5FL7 G;  2QKA A;  3A0H Z;  2WLH A;  1VF7 A;  3JD0 A;  2IU3 A;  5CN0 A;  3JAT B;  1G8M A;  3ABM C;  3HKC A;  4DR2 O;  1Y76 A;  2P6J A;  2VWK A;  3SR2 C;  4E4E A;  4GZR B;  1AJN A;  3ZIA G;  3BA8 A;  3HKD A;  1Q6U A;  5EIB D;  4DV2 B;  2MK3 A;  3S3W A;  3CRM A;  1PP9 H;  4NTY A;  2WWW A;  5LXT A;  3FB8 C;  1O9H A;  3OUS A;  3ZRV A;  1B3Q A;  1OCC B;  4OPA A;  2JS3 A;  2EIL B;  3HB3 B;  1R6K A;  1M56 B;  3CCQ V;  1QNM A;  2L35 A;  4EFE A;  3SYP A;  2EIN B;  1IBM B;  1VIB A;  4BWA A;  2RMK B;  4PV1 B;  1QR9 A;  3WB2 A;  1RPO A;  5L3C A;  4DV3 O;  2RDC A;  4GLX A;  3A8T A;  3ETG A;  2ZR2 A;  3BRC A;  5B5E Z;  4LF6 O;  2Y4T A;  3P3N A;  1QVG U;  3OUF A;  1V55 C;  1AVM A;  1N36 O;  4OX9 O;  2R72 A;  1N8R W;  3CC7 V;  4O4L A;  2YXH A;  2GUZ A;  5EZY B;  1SQF A;  3ASN C;  5KA5 A;  4FM1 A;  4H44 B;  4O2A B;  3EVK A;  1SQQ H;  4DV2 O;  3HKB B;  3LSS A;  1K5S A;  1P7G A;  1Q6H A;  4MVZ A;  1M93 A;  3GWO A;  2OYQ A;  2ZNJ A;  4D6T H;  2YI9 A;  1RPR A;  1SA0 B;  4JAU A;  3G6E V;  2NNU A;  2IW5 A;  5C93 A;  3TJT A;  2JDI G;  3RYC A;  3QF7 A;  1XBL A;  4W4L A;  1JPX A;  4ZHQ B;  1IBM O;  2IH1 C;  2R9R B;  2XAQ A;  1AI5 A;  3TCU A;  1YJ9 V;  1AP5 A;  1F7Y A;  2EIJ C;  3BY6 A;  1PNK A;  3ASO C;  3ZRX A;  5LL6 Y;  2YUA A;  1NH2 D;  1GM7 A;  3JAK B;  4GX0 A;  3JCZ A;  5L3D A;  3TXQ A;  3VOU A;  3U10 A;  3ZRW B;  2EUL A;  1W0K G;  2P67 A;  3CHX A;  1OCR B;  3R65 A;  3C3T A;  3H1I H;  3FYE B;  4MVM A;  2OCH A;  2NLJ C;  2RCV A;  4FPP A;  5KHJ A;  2XUM A;  4TWK A;  4DK0 A;  4P30 A;  1SQV H;  1MG1 A;  3UO2 A;  4DV7 O;  1V54 C;  3OMN B;  4H37 A;  3ZMT A;  3J80 N;  1H2K A;  2OWO A;  4ZOL B;  3OR6 C;  4CC5 A;  2E3C A;  3JSN A;  5H2F Z;  2ZT9 B;  4GKJ B;  2EIM C;  2A9H A;  2UU9 B;  5EC2 C;  3HPL C;  4NXN B;  4LNU A;  2KG7 B;  3WB1 A;  3VQX A;  3T1H B;  3E8F A;  2GBO A;  3JAW B;  4HYO A;  4X20 B;  1SQB H;  1NVP B;  4K8X A;  2HHH B;  5H6Q A;  3CMA V;  3OD4 A;  4DV4 B;  3SYO A;  2W0X A;  3CRA A;  1HNZ B;  3RN4 A;  4YJ3 B;  2WAM A;  3RT3 C;  5LA6 B;  1W59 A;  4MVO A;  4LC1 A;  5EZY A;  3RBZ A;  1BE3 H;  3RW0 A;  3ZMV A;  3X2Q B;  1GKF A;  4P2Z A;  2PF4 E;  2IJH A;  3HKB A;  3FB7 C;  4U3F H;  1AJP A;  1DK1 A;  1K5Q A;  1TVK A;  2BOB C;  1K97 A;  1NBM G;  1TGO A;  4U7N A;  5KMG B;  3E2E A;  4FLX A;  4UB8 Z;  4UVA A;  3OMI B;  4GKJ O;  1L1F A;  4GX5 A;  1PL4 A;  2YS8 A;  2UU9 O;  4QE9 A;  5CA0 A;  2NN4 A;  3SYA A;  3N2G B;  4NXN O;  2ZIM A;  4P9P A;  1OCC C;  1WPX A;  2UXD B;  3T1H O;  4ZBM A;  5HFL A;  5E1A C;  2KB1 A;  2EIL C;  4C7U A;  1XMO B;  2HHH O;  4JV5 B;  1BHA A;  2DN9 A;  1M56 C;  4DV4 O;  3FB6 C;  1SQP H;  1YTF B;  3L72 H;  1HNZ O;  2EIN C;  1YF2 A;  5CBH A;  4HNA B;  3T1C A;  3DGE A;  3J7A U;  5BMV B;  3ZJZ A;  1LUW A;  5KA6 A;  5K1P A;  1OV9 A;  3JAK A;  3CSX A;  1VQP V;  3ZRW A;  2VS0 A;  4MTX A;  2ARH A;  2L6L A;  2D2C B;  2Y0I A;  1VQN V;  4GX1 A;  1MA1 A;  4DRX B;  1H2M A;  3H1K H;  2NR5 A;  4HZ3 A;  2QSA A;  2Z5U A;  4ZOL A;  3ZN0 A;  2ZE6 A;  3ZHR A;  4OGQ B;  4MVU A;  1RP3 B;  1QLN A;  4CH5 A;  1S72 V;  5KX5 B;  1H2S B;  5DN6 G;  4O4I B;  1JFF B;  2Q69 A;  4FLV A;  3JAW A;  4X20 A;  2CGO A;  4XDK A;  3BA9 A;  4TUY B;  5B1N A;  2UXD O;  1NS1 A;  4N23 A;  1XMO O;  4JV5 O;  5L3E A;  5ITZ B;  1OZ0 A;  4YJ3 A;  5DED A;  1MAB G;  1FAF A;  2Y69 B;  3BHP A;  3N2K A;  2CTR A;  4FFB A;  1KEC A;  1MSD A;  3K58 A;  4UV8 A;  5CMU A;  4UUJ C;  5JH7 B;  2LO1 A;  4WFA V;  3QG5 A;  1VF6 A;  4RQF A;  1HDJ A;  2Q73 A;  5EK0 A;  3SPH A;  3K5N A;  1OCR C;  5A2Q N;  4K0K B;  2JEU A;  3D8C A;  2ZR3 A;  4FZ0 A;  2ITD C;  2ADQ B;  4JI6 B;  2VQF B;  2CDY A;  5KMG A;  2HG5 C;  4LF8 B;  3SJC C;  1EZV H;  3H01 A;  3CYO A;  2V4D A;  3FD9 A;  3N2G A;  1Q6I A;  5IE9 A;  5EC1 C;  5CB4 A;  4DUZ B;  5BR8 B;  3OGC C;  1D5A A;  1VQ7 V;  1Q5O A;  1SZX A;  5LHH A;  4WFE A;  3CC4 V;  5B1B B;  1YXB A;  4HNA A;  4YIO A;  2LFS A;  2EX3 A;  5BMV A;  4Z1V A;  2ETN A;  3EXA A;  1BMF G;  3A2F A;  2HR3 A;  2OT5 A;  2YEV B;  1N32 B;  1XEQ A;  4O4J B;  3RYF A;  1Y6X A;  1XUQ A;  2HVJ C;  4W4K A;  1ZWI C;  1CPY A;  4B7K A;  1FYJ A;  2VRZ A;  4K0K O;  4PI0 A;  3RYI B;  2Q7G A;  1FFT B;  1VF6 C;  3L73 H;  4NR1 A;  1EN4 A;  2OCC B;  1VEW A;  2HVK C;  1IBK B;  2VQF O;  4JI6 O;  5KX5 A;  2IBZ H;  4X1K B;  4LF8 O;  1S77 D;  4O4I A;  2YC0 A;  5LGT A;  1Y76 B;  1JFF A;  1NVP D;  2R70 A;  4TUY A;  5JJJ B;  1HNX B;  4CH4 A;  5BR8 O;  1QQC A;  2E5L B;  5ITZ A;  1JA8 A;  3ABU A;  2W0F C;  5LMN B;  3W7X A;  3K3W A;  3LUT B;  4JI2 B;  2RNB A;  2WLL B;  3AG2 C;  3OFN G;  1GN4 A;  2AZ0 A;  5JH7 A;  1J5E B;  2XAH A;  3TXS A;  4WFF A;  1KU9 A;  2DOS A;  3BAA A;  1N32 O;  1JQ0 A;  3ZX6 A;  1PM9 A;  3EFF K;  5EBM C;  4I9Q A;  2BE3 A;  3LNM B;  2GDS A;  1HWY A;  3ASO B;  2ODM A;  1VAR A;  3DC6 A;  4FM2 A;  3JYC A;  1NTZ H;  4JYB A;  2DW4 A;  1SZT A;  1S3J A;  4LFB B;  4J42 A;  1IBK O;  3JD4 A;  4GKK B;  4JI7 O;  4DK1 A;  4RWU A;  1VQL V;  4O4L B;  2X0L A;  4TSF G;  4UVB A;  4JZG A;  1YTF D;  4CBC A;  1HNX O;  2FML A;  4CH3 A;  2V1D A;  4Z2W A;  4L87 A;  2E5L O;  2DWE C;  4DR7 B;  4LWS A;  5LMN O;  4BIO A;  5LBQ A;  4JTD B;  3MHS C;  2FB5 A;  3SPC A;  1M90 W;  1IBL B;  3E22 B;  4P9O A;  4JI2 O;  2D3O W;  1LUV A;  1I5Y A;  3H1H H;  2UUC B;  1TA8 A;  4DV6 B;  2Y69 C;  3I56 V;  1K92 A;  1FD9 A;  1PKX A;  2XND G;  4JGS A;  4I4T A;  1ZL8 A;  1J5E O;  1Q3E A;  3LSQ A;  2VWJ A;  3CPW U;  3JAM N;  4BIZ A;  3M7M X;  3RYC B;  4B3S B;  1GK9 A;  3OW2 U;  5KAF Z;  3RYI A;  3BEH A;  4A5U B;  2ZXW B;  3MD0 A;  1AI7 A;  1AI6 A;  3M99 B;  1VQ9 V;  4LFB O;  3LSU A;  1ZAU A;  3L71 H;  3N27 A;  4X1K A;  4GKK O;  4FLU A;  3OAA G;  2YSU B;  4DR4 B;  5B66 Z;  4MW8 A;  4R8C A;  3AK1 A;  1IX9 A;  2YXY A;  2QDO A;  2XAS A;  3OTO B;  4UCV A;  4DUY B;  2A7W A;  4PD4 F;  1EN5 A;  4K3A A;  1XIL A;  4X1Y B;  4DR7 O;  2WLL A;  1L8D A;  1G1X B;  1OCZ C;  3C3S A;  2ADP A;  3F5W C;  5B1B C;  2UUC O;  3CRC A;  4TQD A;  1AR4 A;  4LNU B;  4PEL A;  1YDX A;  3IC9 A;  5IJ0 A;  1SQG A;  2DE0 X;  2LW7 A;  1VQM V;  4F6E A;  3SDL A;  1DGS A;  5FPO A;  3SJB C;  3QVN A;  3FYI B;  4B3S O;  4ZIB A;  2F93 B;  1QU7 A;  3T1Y B;  1I94 B;  4X88 A;  2JS5 A;  5KUK A;  1EZJ A;  2QA4 V;  2F95 B;  2OCC C;  4K35 A;  4IL6 Z;  1W2B U;  4R6Z A;  4DR4 O;  1YIT V;  2QTO A;  5J2T A;  4YJ2 B;  1S76 D;  4ICG A;  1N33 B;  4UFZ A;  1GTO A;  4JI3 B;  3AK3 A;  3JD1 A;  1CP9 A;  3OTO O;  4WFB V;  1H38 A;  4FIP C;  5GON A;  2B9Z A;  3UCS C;  1ZUQ A;  1R3K C;  4DUY O;  1QVF U;  4DV1 B;  3ZN1 A;  3DSQ A;  3SPJ A;  1TVK B;  2BCC H;  3E22 A;  4F4L A;  1BHB A;  3ETD A;  3ABT A;  4WBN A;  1KUQ A;  3AG7 A;  3CRR A;  2CGN A;  4WFG A;  3CEI A;  5CA0 B;  2QKS A;  3B8N A;  2V7Q G;  3ZRS A;  2YIC A;  2CE4 A;  1XQ8 A;  4N21 A;  3CCJ V;  3CX5 F;  4X64 B;  1ZSP A;  5J2U B;  5IYC O;  3UM7 A;  3T1Y O;  1N0J A;  1I94 O;  4PDR A;  2KQX A;  1DTO A;  2YIB A;  3OEH G;  1MZE A;  1MZF A;  1GM8 A;  4EKW A;  1SQX H;  1D5N A;  3ZHT A;  3APQ A;  1RM1 C;  1HR0 B;  1LR1 A;  2LGW A;  4PA4 A;  1MMM A;  2W6J G;  3VQV A;  4PHZ A;  1R3I C;  4JI3 O;  3WG7 B;  4ASU G;  1ZTE A;  4X1Y A;  3P30 A;  1NR1 A;  1Q43 A;  4RO2 A;  1QBZ A;  3QTC A;  2DQ0 A;  2P7T C;  4DV1 O;  3AK2 A;  2WLN A;  2PTM A;  1WB7 A;  4J9Y B;  4UCO A;  3VBB A;  3K03 A;  5LHI A;  1FXH A;  1YCI A;  2GHY A;  1AIL A;  3G6B A;  1WNS A;  3H1L H;  1GN2 A;  2P5O A;  2LGQ A;  1SC5 B;  1QCE A;  1S5J A;  3NXS A;  3D36 A;  4UB6 Z;  2N74 A;  2PY5 A;  5LP6 B;  2ATK C;  1NT2 B;  3C90 A;  5IWA B;  1P7B A;  2CUG A;  2ZXW C;  2LQT A;  4JTC B;  2O57 A;  4DYL A;  3RGB A;  3I55 V;  3N2K B;  4FFB B;  5LHG A;  3IFX A;  1B04 A;  3GVM A;  2EZO A;  3QO8 A;  1LNQ A;  1K4D C;  4YJ2 A;  4UCS A;  1WA8 B;  3NR7 A;  4JTA B;  1HR0 O;  2QWP B;  1XL4 A;  3KCX A;  5DEC A;  4G27 B;  3OR7 C;  3JCU Z;  2JJ1 G;  2Q5Z A;  3G71 V;  3WFV A;  4YIP A;  1NJI W;  1WB8 A;  4J11 A;  4CH6 A;  1NR7 A;  4Q20 A;  2Y0P A;  2P4V A;  2GV9 A;  5GW7 A;  5JCO A;  5L3B A;  3OMA B;  2LJ2 A;  3STZ C;  1ORQ C;  3JD3 A;  1NKD A;  2XHB A;  5IDJ A;  5CB4 B;  1ROP A;  4AI8 A;  4LF4 B;  3F7Y C;  2GSM B;  3AG2 B;  4MVS A;  5J2U A;  3K5L A;  3A0R A;  2YIB D;  3UT5 A;  2Z3Y A;  3SPI A;  1I7F A;  5JJN B;  4X8A A;  2E76 B;  5IWA O;  4JYY A;  3KZI Z;  3APO A;  3D36 C;  1F51 A;  1Q86 W;  1RFY A;  5KHH A;  3GWK C;  1G4Y B;  3PJS K;  1DF5 A;  1PPJ H;  4GT1 A;  4MT8 A;  2Q6A A;  3K5M A;  3OGI B;  3RYF B;  5IYZ B;  4XDL A;  2H8P C;  3GB7 C;  4DR6 O;  3CD6 V;  1T5E A;  4YHH B;  1M1K W;  1NTM H;  2DMX A;  4FLZ A;  2IH3 C;  4UCT A;  2F23 A;  3CME V;  2OIG A;  5CA3 A;  4R50 A;  1GO3 F;  4UCU A;  1K3E A;  4OXS A;  4WFH A;  4G28 B;  5D5P A;  2DQ3 A;  2H94 A;  1WPB A;  4LP8 A;  3FB5 C;  4NTX A;  2DYS B;  4X9Q A;  1IUR A;  1I5X A;  5FLX N;  3K9S A;  4DV5 B;  5BZB A;  2WA3 A;  5LYJ B;  4X62 B;  5KHI A;  4JI5 B;  4LH7 A;  1FXK B;  5JCO C;  2JVD A;  3UQ8 A;  4LF4 O;  4NTW A;  4DW0 A;  2F1M A;  2UUB B;  5LP6 A;  3P32 A;  1I0H A;  1S0V A;  2DWD C;  4J80 A;  2BOC C;  2A0L A;  4LCU C;  1EN6 A;  5IY5 B;  4RUE A;  4J9Z B;  3R66 A;  2JIZ G;  1WA8 A;  3FKS G;  3T4D A;  1P4R A;  3ZCC A;  5GTH Z;  4EFB A;  2LP7 A;  3B40 A;  1CEZ A;  3B09 A;  1RSO B;  4YHH O;  1GM9 A;  2IU0 A;  2A3Q A;  2AZ2 A;  3E89 A;  1VQO V;  4KXR A;  2R9I A;  2WLK A;  3J81 N;  3WG7 C;  3CB2 A;  4U3J A;  4X65 B;  4HAM A;  2X6B A;  1X59 A;  4JAV A;  4JZ2 A;  4CS3 A;  4X89 A;  4IIJ A;  4F6R B;  3B4S A;  4DV5 O;  2ITC C;  2OTJ V;  4X62 O;  4NVP A;  4JI5 O;  1OJH A;  4QGP A;  1OCZ B;  4H0L B;  4U7O A;  2QEX V;  2UUB O;  4LWS B;  4B3R B;  1Z5W A;  4QNH B;  2ZIN A;  5IYD O;  4BAY A;  4K8Z A;  3ABL B;  2B5U A;  1JJO A;  4JF3 A;  1OHH G;  2HLD G;  5LP6 C;  4KUM A;  3JAR B;  4IHJ B;  4TQF A;  4PJ0 Z;  3CCM V;  4I4T B;  1ZL8 B;  5IYZ A;  2UXB B;  1MSW D;  1L0L H;  2UUA B;  4DV0 B;  2P4K A;  4E2L A;  2ZD9 A;  1KD1 W;  3JAL A;  1W0J G;  3LNN A;  3SPG A;  1FJG B;  4IYH A;  4GUN A;  1BQZ A;  1WAZ A;  4JYA B;  1XI1 A;  5AG2 A;  4RUF A;  3OT7 A;  5E79 Z;  1KC8 W;  1BGY H;  1COW G;  4DR1 B;  3CWB H;  3A0B Z;  3MAQ A;  5LYJ A;  1M4U A;  1FXK A;  5JVD B;  4DUZ O;  5DM6 V;  3Q4H A;  1HP8 A;  2QWO B;  1THZ A;  3AEI A;  4B3R O;  2FYU H;  4YXW G;  4X1I B;  4B08 A;  2Y4U A;  5TIS Z;  1H8H G;  4MVQ A;  4DR3 B;  4FVM A;  1KQS U;  4LF9 B;  2UXB O;  1KKD A;  5IJ0 B;  1GN6 A;  2QM7 A;  2YID A;  2UUA O;  3BFR A;  5L3G A;  4PA3 A;  4DV0 O;  5BXZ A;  1RSO A;  2N05 A;  3QNE A;  1FJG O;  3B77 A;  3FAV A;  1D2D A;  2BSK A;  4JI1 B;  4MW3 A;  1KB9 F;  4WCE V;  5KLV H;  3CCU V;  4EB6 B;  1US6 A;  1KP3 A;  1IXM A;  4JYA O;  1QHT A;  4LH6 A;  1Q82 W;  1RM1 B;  2F66 C;  2XAF A;  5B3S B;  4DR1 O;  1VQ8 V;  3ZBH A;  4LBE C;  5KHG A;  2B1G A;  4F6R A;  1GAX A;  4MSW C;  1PL0 A;  1GH6 A;  3SJQ C;  2EZP A;  5J2T B;  2IJI A;  2DYS C;  4DR5 B;  2Y48 A;  5LOV A;  5LGN A;  4LFC B;  5GON B;  3TK1 A;  1FXK C;  1VMG A;  4KL1 A;  1NTK H;  3RYH B;  1K7D A;  1GMG A;  1MOF A;  1K34 A;  3ZED A;  3JAR A;  2ZDI A;  4IHJ A;  4WBN B;  2WLI A;  2RJZ A;  3W7U A;  2WSS G;  4IGG A;  2HP8 A;  1J95 A;  4FJC C;  4ZI7 A;  4DR3 O;  5IY5 C;  2UXN A;  3E86 A;  4LF9 O;  1PNM A;  2CK3 G;  4I7Z B;  5FNV A;  2CTP A;  1BT8 A;  1ZLZ A;  4JI1 O;  3RWR D;  1JX9 A;  3DXR A;  3K0D A;  2XT9 A;  3IAY A;  2X7R B;  1XHX A;  3U0Z A;  1FFX B;  2AW9 A;  3AG4 B;  1XOU A;  3KCY A;  4RQE A;  2F43 G;  4UV9 A;  1TUB A;  2FL4 A;  3E8B A;  1YJW V;  1S5L Z;  3K0G A;  2QJ1 A;  3RFR A;  3CCV V;  1JOY A;  3CE2 A;  4FLW A;  5JVD A;  4I55 B;  4MTF A;  4TOI A;  4IYI A;  4DR5 O;  2PYL A;  2A06 H;  3KG2 A;  4LFC O;  3KKY A;  1M5I A;  3AG3 B;  2W6I G;  3WU2 Z;  4BR6 A;  1IBL O;  5H9C A;  2PYJ A;  4L8J A;  2DYR B;  4X1I A;  4GCZ A;  4DV6 O;  1KMI Z;  1K9M W;  2E74 B;  3ABL C;  1AB3 A;  1K33 A;  1UFI A;  2QKC A;  4NXM B;  1DLB A;  2Q7H A;  4GYC B;  3CP1 A;  2ZDI C;  4BIU A;  1XHZ A;  4CS2 A;  4I0X A;  4BW9 A;  1PV0 A;  1YI2 V;  2N04 A;  1H8E G;  2LFR A;  1E1R G;  4EB6 A;  1XNR B;  1KP2 A;  3UO3 A;  1VQ6 V;  4QPJ A;  1E1Q G;  1EBO A;  3E8G A;  2WPD G;  4FLT A;  2WLM A;  1VF5 B;  1L0N H;  2ZKO A;  5IJ9 B;  3MDS A;  3RVY A;  3ICX A;  4H33 A;  1JVM A;  4NYK A;  1GRJ A;  5JWP A;  2CH7 A;  2DJV A;  2JGD B;  5IYB O;  2YDE A;  4FK5 C;  4DR6 B;  2F4V B;  4MTO A;  1IDS A;  2ZM6 B;  2JEX A;  2QWN B;  5FPR A;  3BCC H;  4NKG B;  2WLJ A;  1SF9 A;  3RYH A;  3OEE G;  4PDV A;  3SYC A;  2GTA A;  4JYC A;  1SER A;  1FS0 G;  3TGU H;  1QLE B;  3ZMS A;  4PA7 A;  4J7Z A;  4UXN A;  5LMU B;  2K9P A;  4J7J A;  2XAJ A;  4DV7 B;  2EIK B;  4I9W A;  2AGA A;  4NXM O;  4AIL C;  2XAG A;  1XRE A;  2H3O A;  3WB0 A;  3BVO A;  4I50 A;  1P84 F;  1HNW B;  2ZE8 A;  1Y67 A;  2IJK A;  3MHH C;  3ETE A;  4Z1M G;  5KAI Z;  1XNR O;  2BTO A;  3UT5 B;  4MTG A;  1FFX A;  2VQE B;  3CCR V;  5KUM A;  1K73 W;  2CTQ A;  2QWQ B;  2QGN A;  3CJH B;  4AQY B;  1QR8 A;  1V9P A;  4R7C A;  1Q8I A;  5EBL C;  4I55 A;  1SET A;  1Y66 A; 
#chains in the Genus database with same CATH homology
 5B3S C;  3QO5 A;  1M1K W;  4DO2 A;  1ENV A;  1H2G A;  1FXV A;  1FFT B;  5FL7 G;  2IH3 C;  1AJQ A;  2WLH A;  2OCC B;  4BW5 A;  3CME V;  3JD0 A;  2IU3 A;  5CN0 A;  5CA3 A;  2HVK C;  1G8M A;  4R50 A;  3ABM C;  1GO3 F;  3W7S A;  1K3E A;  2P6J A;  4MVR A;  4OXS A;  4WFH A;  4G28 B;  1S77 D;  2DQ3 A;  2H94 A;  5LGT A;  4LP8 A;  1M57 B;  1NVP D;  1AJN A;  2HKO A;  3FB5 C;  2K1E A;  2DYS B;  3ZIA G;  4DXW A;  1I5X A;  5BZB A;  1F4M A;  2MK3 A;  4QJF B;  2ZQM A;  1FXK B;  3DTU B;  3ABU A;  2W0F C;  2WWW A;  3W7X A;  3K3W A;  3LUT B;  3FB8 C;  3P32 A;  1S0V A;  2DWD C;  2WLL B;  3AG2 C;  3OUS A;  3OFN G;  3ZRV A;  1OCC B;  5HFM A;  2BOC C;  2A0L A;  3QO7 A;  4LCU C;  3RVZ A;  5IY5 B;  2XAH A;  2EIL B;  1OCO B;  3HB3 B;  4J9Z B;  4RUE A;  4WFF A;  1R6K A;  1M56 B;  2JIZ G;  3EHB B;  3CCQ V;  1JQ0 A;  3FKS G;  2AHY A;  2EIN B;  3SYP A;  3T4D A;  1P4R A;  3ZCC A;  1QR9 A;  1RPO A;  2LP7 A;  5L3C A;  3AG4 C;  3EFF K;  5EBM C;  1CEZ A;  3LNM B;  3ETG A;  1HWY A;  2C2A A;  2ZR2 A;  3ASO B;  1GM9 A;  1BL8 A;  4PDM A;  2IU0 A;  1QVG U;  3JYC A;  3OUF A;  1V55 C;  4XBF A;  4JYB A;  2DW4 A;  1SZT A;  3E89 A;  1S3J A;  1VQO V;  5CBG A;  1JJ2 U;  2R9I A;  2WLK A;  3WG7 C;  1N8R W;  2OTL V;  3JD4 A;  3CC7 V;  4HAM A;  2X6B A;  3ASN C;  5KA5 A;  1VQL V;  1R3L C;  4JAV A;  2Q67 A;  2X0L A;  4X89 A;  3AG3 C;  4TSF G;  4UVB A;  4KP4 A;  2ITC C;  1YTF D;  4CBC A;  2OTJ V;  2DYR C;  1Q81 W;  2V1D A;  3LSS A;  4QIW F;  1K5S A;  4L87 A;  2EJR A;  1UJW B;  1OCZ B;  2DWE C;  4MVZ A;  2AHZ A;  4U7O A;  1AI4 A;  3GWO A;  2QEX V;  5LBQ A;  4JTD B;  1RPR A;  3MHS C;  3SPC A;  1M90 W;  3ML0 A;  4P9O A;  3STL C;  1YSC A;  2D3O W;  4QNH B;  5IYD O;  4BAY A;  3ABL B;  1I5Y A;  2B5U A;  4JF3 A;  3OM3 B;  2Y69 C;  4GX2 A;  4JAU A;  3I56 V;  3G6E V;  1OHH G;  1K92 A;  2HLD G;  2NNU A;  4PA6 A;  2IW5 A;  1PKX A;  2XND G;  4JGS A;  4KUM A;  5C93 A;  3CCM V;  3ABK B;  1MSW D;  3LSQ A;  2JDI G;  1JPX A;  3CPW U;  2IH1 C;  2R9R B;  4KFM A;  4BIZ A;  2XAQ A;  2ZD9 A;  4E2L A;  1KD1 W;  1AI5 A;  3TCU A;  1W0J G;  1YJ9 V;  1GK9 A;  3OW2 U;  3SPG A;  3BEH A;  2ZXW B;  3MD0 A;  2EIJ C;  3BY6 A;  1AI7 A;  3W7T A;  1PNK A;  1AI6 A;  3ASO C;  3M99 B;  2IJJ A;  1VQ9 V;  3ZRX A;  3F7V C;  1NH2 D;  1GM7 A;  4RUF A;  4GX0 A;  1SES A;  3JCZ A;  5L3D A;  3VOU A;  1KC8 W;  3ZRW B;  1PD3 A;  4TT3 G;  3OAA G;  1W0K G;  2P67 A;  4UVC A;  1COW G;  1OCR B;  3R65 A;  3E83 A;  4MW8 A;  4R8C A;  3FYE B;  4MVM A;  2NLJ C;  4FPP A;  4TWK A;  4P30 A;  2HFE C;  4FMT A;  4RAI A;  1MG1 A;  2XAS A;  1QLE C;  1FXK A;  5DM6 V;  1V54 C;  3OMN B;  4H37 A;  3ZMT A;  3E35 A;  2EIK C;  3LDD A;  3OR6 C;  3CCE V;  4MS2 A;  2WLL A;  1THZ A;  1OCZ C;  3K08 A;  3AEI A;  2EIM C;  1YHQ V;  3F5W C;  2A9H A;  5EC2 C;  5B1B C;  4YXW G;  3HPL C;  5B1A B;  2B1I A;  5EBW C;  1YIJ V;  3E8F A;  4HYO A;  1H8H G;  4MVQ A;  4PEL A;  1NVP B;  1KQS U;  5H6Q A;  3CMA V;  1KKD A;  1VQM V;  2UXX A;  2QM7 A;  3SYO A;  5L3G A;  4PA3 A;  4G2K A;  3W7W A;  3FYI B;  1VQK V;  1K8A W;  3QNE A;  2WAM A;  3B77 A;  1K4C C;  3CXC U;  2P90 A;  4MW3 A;  3AG1 B;  4CZZ A;  4WCE V;  3CCU V;  3IC7 A;  4X88 A;  1TUE B;  1KP3 A;  4MVO A;  1IXM A;  5KUK A;  1S5H C;  1EZJ A;  4LC1 A;  3RBZ A;  2QA4 V;  1Q82 W;  1RM1 B;  4PDL A;  2OCC C;  5B1O A;  3RW0 A;  3ZMV A;  2XAF A;  3X2Q B;  1W2B U;  4R6Z A;  5B3S B;  1YIT V;  2QTO A;  1R3J C;  1VQ8 V;  1GKF A;  4LBE C;  2B1G A;  4MSW C;  1PL0 A;  4P2Z A;  1S76 D;  3SJQ C;  2EZP A;  2IJI A;  1DF4 A;  1M57 C;  1GTO A;  2IJH A;  3JD1 A;  1VQ5 V;  1CP9 A;  2DYS C;  3ABM B;  3FB7 C;  2Y48 A;  4WFB V;  1H38 A;  4FIP C;  1AJP A;  2HJF C;  1K5Q A;  5LGN A;  1R3K C;  1QVF U;  3E8H A;  3ZN1 A;  1CPY A;  3SPJ A;  2BOB C;  4F4L A;  1K97 A;  3TK1 A;  1FXK C;  1NBM G;  4U7N A;  3E2E A;  1BHB A;  3ETD A;  4UVA A;  3ABT A;  3OMI B;  1K7D A;  1L1F A;  3LDE A;  5H6R A;  1GMG A;  1F23 A;  4GX5 A;  1MOF A;  4QE9 A;  1K34 A;  1M9N A;  2ZDI A;  3SYA A;  1B6Q A;  4WFG A;  4P9P A;  2WLI A;  1OCC C;  2QKS A;  1WPX A;  4QE7 A;  3B8N A;  2WSS G;  2V7Q G;  3W7U A;  1AR1 B;  1J95 A;  3K04 A;  4ZBM A;  4FJC C;  5HFL A;  2WLI B;  3K9A A;  5E1A C;  2KB1 A;  3K79 A;  5IY5 C;  2EIL C;  1OCO C;  2UXN A;  3E86 A;  1BHA A;  1PNM A;  3ZRS A;  1M56 C;  4N21 A;  2CK3 G;  3CCJ V;  3FB6 C;  1YTF B;  2EIN C;  3JD2 A;  5CBH A;  3T1C A;  3DGE A;  3T4Z A;  5IYC O;  3UM7 A;  3ZJZ A;  1Y4M A;  5KA6 A;  1JX9 A;  2X6C A;  3K06 A;  1PNL A;  3K0D A;  3SYQ A;  4PDR A;  1DTO A;  3OEH G;  2X7R B;  1VQP V;  3ZRW A;  1GM8 A;  4EKW A;  4MTX A;  1R73 A;  3AG4 B;  4RQE A;  2F43 G;  4UV9 A;  1VQN V;  4GX1 A;  3E8B A;  1YJW V;  3K0G A;  3CCV V;  1RM1 C;  1JOY A;  4PA4 A;  3X2Q C;  2W6J G;  1V55 B;  4HZ3 A;  4MTF A;  4I5S A;  1R3I C;  3CC2 V;  3WG7 B;  2Z5U A;  4ASU G;  3ZN0 A;  3P30 A;  3KG2 A;  1NR1 A;  4RO2 A;  1QBZ A;  3ASN B;  2DQ0 A;  2P7T C;  4MVU A;  4PA9 A;  1QLN A;  2WLN A;  3AG3 B;  1S72 V;  2W6I G;  5DN6 G;  4J9Y B;  5H9C A;  2QM8 A;  3VBB A;  2DYR B;  5LGU A;  2Q69 A;  1NH2 B;  3K03 A;  4GCZ A;  5LHI A;  4XDK A;  1K9M W;  5J9P C;  3T2M A;  3ABL C;  1FXH A;  1K33 A;  2GHY A;  5B1N A;  1DLB A;  3CP1 A;  4N23 A;  2ZDI C;  4WF9 V;  4BIU A;  5L3E A;  1OZ0 A;  1QCE A;  3NXS A;  3ABK C;  3D36 A;  4QPK A;  5CBF A;  1MAB G;  2Y69 B;  1XL6 A;  3ZMZ A;  1YI2 V;  1H8E G;  2LFR A;  1E1R G;  2ATK C;  1KP2 A;  1VQ6 V;  1P7B A;  4QPJ A;  3TET A;  1KEC A;  4XDJ A;  2ZXW C;  3CCS V;  4JTC B;  1E1Q G;  3I55 V;  4UV8 A;  1EBO A;  3E8G A;  2WPD G;  4UUJ C;  5CMU A;  2WLM A;  5LHG A;  3IFX A;  2FTK A;  4WFA V;  2EZO A;  3QO8 A;  1LNQ A;  3RVY A;  1K4D C;  1JVM A;  4H33 A;  2JK5 C;  5IYB O;  4RQF A;  2EIJ B;  2M7W A;  3G4S V;  4FK5 C;  4JTA B;  4MTO A;  3CD6 V;  5L3F A;  5EK0 A;  3SPH A;  1XL4 A;  1JCH A;  1OCR C;  4ZKI A;  4G27 B;  1WLE A;  2JEU A;  2JEX A;  3OR7 C;  2PI4 A;  2JJ1 G;  2ZR3 A;  3G71 V;  2ITD C;  3UKM A;  3WFV A;  1NJI W;  2X6A A;  2WLJ A;  3OEE G;  2HG5 C;  4PDV A;  3SYC A;  4JYC A;  1NR7 A;  4Q20 A;  1SER A;  1FS0 G;  3B8M A;  3H01 A;  3CYO A;  5GW7 A;  3ZMS A;  1QLE B;  4PA7 A;  5L3B A;  3OMA B;  4UXN A;  1R6N A;  1V54 B;  3STZ C;  1ORQ C;  3ZMU A;  5EC1 C;  1SRY A;  3JD3 A;  1NKD A;  5IDJ A;  2XAJ A;  2JJ2 G;  2EIK B;  4I9W A;  1ARO P;  5B1A C;  1EFR G;  3OGC C;  2QE7 G;  1ROP A;  1VQ7 V;  3IGA C;  1NQT A;  1ZWI C;  3F7Y C;  2XAG A;  2GSM B;  2XOK G;  2EIM B;  3AG2 B;  5LHH A;  2Q68 A;  4MVS A;  4WFE A;  3CC4 V;  5B1B B;  4JAS A;  2LFS A;  3OE7 G;  3A0R A;  1F4N A;  2PI5 A;  2IJK A;  3MHH C;  2EBO A;  2Z3Y A;  3ETE A;  3SPI A;  4Z1M G;  4X8A A;  1BMF G;  2HR3 A;  2YEV A;  1F51 A;  4MTG A;  1E79 G;  1Q86 W;  1VQ4 V;  3AG1 C;  3CCR V;  1G4Y B;  2OT5 A;  2YEV B;  3PJS K;  5KUM A;  1DF5 A;  1K73 W;  4GT1 A;  4MT8 A;  3CCL V;  3D3I A;  4JPR A;  3LDC A;  1YJN V;  2Q6A A;  1Q7Y W;  1QR8 A;  4R7C A;  2H8P C;  2HVJ C;  3GB7 C;  4XDL A;  5EBL C;  2YSU B;  1SET A;  2A79 B;  1Y66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...