2HFEC

Rb+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hfeC00
3VOUA 2NLJC 3FB5C 4MVOA 3ABMC 2A0LA 5EBLC 1K4DC 5B1BC 2HVJC 4PDRA 4MTFA 1V55C 2WLKA 4JTAB 1BL8A 4RAIA 4RO2A 2YEVA 3OR6C 2QTOA 1R3JC 3WG7C 5IY5C 4WFFA 1R3KC 2EILC 2IH1C 2X6BA 3K06A 2DYRC 4MVZA 4WFGA 2EIKC 5BZBA 3SPHA 4G27B 4LBEC 3OUSA 3K03A 3RVYA 3ZRSA 3ABLC 4QE7A 2Q67A 2ITCC 2W0FC 3F7VC 4CBCA 2AHYA 4H37A 3AG2C 4DXWA 3SYPA 1JVMA 4TWKA 2EINC 2HJFC 5J9PC 3SPCA 2Y69C 3R65A 4GX2A 4GX1A 4P2ZA 5CBHA 3LNMB 3LDDA 3T4ZA 3TETA 4JTCB 2BOCC 3STLC 4LCUC 5EK0A 4MSWC 3ASNC 4XDKA 3TCUA 3LDEA 4RUEA 4P9PA 2WLJA 3E8BA 2WLHA 1M57C 2H8PC 4MVSA 4PA9A 3E8FA 3SYOA 3RW0A 4PDVA 3RBZA 4H33A 2K1EA 2X6AA 4KFMA 4MTGA 2WLMA 3UKMA 4EKWA 2ATKC 3OR7C 1V54C 3FB8C 5KUMA 3T4DA 4MVMA 3FB7C 4F4LA 3PJSK 2WLIA 5B1AC 1J95A 4G28B 3LUTB 3FB6C 5B3SC 2DYSC 4X88A 2WLIB 5KUKA 4MS2A 4OXSA 4X8AA 2P7TC 3SPIA 4GX5A 4PA7A 3T2MA 4R8CA 5EC1C 2X6CA 3E8HA 2BOBC 4XDJA 2ITDC 5CBFA 3AG4C 3SYAA 1OCZC 3T1CA 3E86A 2ZXWC 4WFEA 4QNHB 3K0GA 3F5WC 5CBGA 1R3LC 1XL6A 3RVZA 3SYCA 3SYQA 4MTOA 1ZWIC 5EBWC 2HFEC 2OCCC 3F7YC 1R3IC 3AG1C 4MVUA 4X89A 3OUFA 2Q68A 3IFXA 4MW3A 4QE9A 3AG3C 3KG2A 4R6ZA 4WFHA 3SPGA 4PA3A 4J9ZB 4PA6A 3STZC 5EBMC 3UM7A 4MW8A 4HZ3A 2WLLA 2KB1A 1G4YB 2QKSA 2AHZA 2EIJC 4BW5A 4PA4A 3E89A 4R7CA 2JK5C 2DWDC 3ABKC 2HVKC 3K04A 1LNQA 2WLLB 2ZD9A 3OGCC 4XDLA 3ZJZA 2A9HA 1M56C 4P9OA 4UUJC 3EFFK 4RUFA 4PDLA 2A79B 3SPJA 3K0DA 2R9RB 3E83A 2EIMC 4LP8A 4P30A 2WLNA 3HPLC 1P7BA 4JTDB 1OCOC 1OCRC 3K08A 1ORQC 1K4CC 3E8GA 3GB7C 5EC2C 4I9WA 1OCCC 2HG5C 1XL4A 2DWEC 4PDMA 5E1AC 2Q69A 3SJQC 3IGAC 2IH3C 4HYOA 1KKDA 1S5HC 3JYCA 4MVRA 4MVQA 4R50A 4ZBMA 3X2QC 1QLEC 4J9YB 2Q6AA 4GX0A 3LDCA 3BEHA 3ASOC
chains in the Genus database with same CATH superfamily
1QU7A 2HHHB 1D2DA 1N34B 3J81N 1VQNV 4G2KA 2RCVA 1ZL8A 3MHHC 2IH1C 4FZ1A 1AVMA 3ABLC 2YIAA 2AHYA 2Q0OC 4H37A 4TWKA 4E4EA 5L3CA 5J2TB 4JI1B 5GONA 1CP9A 4LF4B 5CBHA 1XOUA 4B3MB 4B08A 1MSWD 4GKKO 5JH7A 2GTAA 2PF4E 3SJAC 3PJSK 3ZEDA 2Y4UA 3WFVA 5CA1B 5H9CA 2VS0A 4UCOA 4DR2B 4X88A 2WLIB 1DTOA 4MS2A 4OXSA 2P7TC 1H2NA 1PL4A 1DK1A 2M6YA 3JD4A 2YXHA 5JJJB 5FPRA 1I94B 1NBMG 2KG7B 3F5WC 1EN5A 4W4KA 3SYCA 1YIJV 4O4JA 1NVPD 4AQYO 3DXRA 3F7YC 3ZHTA 3ZRVA 4PA6A 2DE0X 1K92A 2YDEA 4LWSB 3AK2A 3SJCC 2LO1A 3B8MA 1K5QA 2HLDG 4UUJC 2UXCO 5HFMA 5B1OA 2UUAB 1XUQA 2JVDA 1HW7A 2UUCB 5H2FZ 3SJBC 1PNMA 2XTAA 1K8AW 2OTLV 1HDJA 4GX0A 5IYCO 3ASOC 3F5TA 2NLJC 4NYKA 4PDRA 3OW2U 2E74B 2AGAA 4IHJA 1I5YA 2ILMA 2YIBA 4LH7A 2KKWA 4WFFA 3CXHF 2WA4A 3T1HB 4WF9V 4JI6O 1WLEA 2DN9A 1PP9H 4AQYB 4DO2A 5AG2A 2ODMA 1NKDA 3LDDA 4F6EA 2IU0A 4UXNA 4X64O 4DR1O 4X65O 3RYFB 4KXRA 3EVKA 2OWOA 1KB9F 2K1EA 2IJIA 5IDJA 2UXCB 1WA8B 2ATKC 5FNVB 4BIOA 3OGIB 3CRRA 2YI9A 1YDXA 3CJHA 4GKJO 4R8CA 4DV1O 2JEXA 3JASA 2UXBB 2ZXWC 3L9DA 1KC8W 3ZRWB 4LF7O 2A7WA 4K8XA 2D3OW 2YXLA 4FLZA 2GUZA 4I5SA 1KMIZ 4X9QA 1P4RA 4YHHB 1FXHA 2DQ3A 2JDIG 3BAAA 4MW3A 1N36O 3DC5A 1VQPV 4IYHA 3H1IH 3K5OA 1QR8A 3K04A 2QR4A 3CC2V 1R1BA 1NVPB 1ENVA 4UV8A 2P67A 4X64B 1VMGA 3UO2A 5KLVH 3CPWU 4QPJA 4X65B 4DR1B 1XBLA 4NXMO 5B1NA 1YJNV 2RN9A 3G71V 1XNRB 3ML0A 4I55B 4B7EA 3FB5C 1YEWA 5EBLC 2ZM6O 2O57A 4J7KA 1BL8A 2FKXA 4GKJB 4DR6B 4DV1B 5JCOA 2QTOA 3HKCB 1KP3A 5CMUA 1WNSA 1IBKO 5KHKA 4LF8O 2ITCC 1H2LA 1N36B 1CEZA 3T4ZA 4X1YA 2XAFA 3CCQV 2WLJA 4JYAO 4ZI7B 3K5LA 1OV9A 2IU3A 4MVSA 1RPOA 4DR4O 1QQCA 1IZ3A 4H33A 3C90A 5KHHA 4IIJA 4DV6O 1VF5B 1WPXA 5FLXN 4NXMB 4L8JA 3OD4A 2EJRA 4ZHQB 5FL7G 1NJIW 5CB4B 1YJWV 4TQFA 1TUBA 2DJVA 4Q6GA 2QA4V 1N4CA 4LNUA 1XILA 4UB8Z 4X1IB 1QNMA 4AILC 4N21A 4DR7O 2EULA 4TV9B 4JV5O 1IBKB 2IJKA 1FKAO 1FJGO 2QKSA 3OGCC 3ZJZA 4YJ2A 4XDLA 2A9HA 1K73W 2ZIOA 2A79B 1S76D 2WLNA 1JJOA 4JYAB 1H8EG 1VQLV 4DR4B 3QO8A 2HG5C 4IT5A 2FYUH 1GM8A 4KHPO 4FLYA 3MD0A 3VOUA 3HR0A 2QWPB 4Z1MG 1RSOA 1SRYA 5IE9A 2OCCB 1Y74A 3ZHRA 2YEVB 1Q43A 3CSXA 3T1YO 4I0XB 1MG1A 3B8NA 3M99B 3ZRSA 1WB8A 3RYIB 4FLXA 5ITZA 1M56B 4B3RB 3IJ4A 2CGNA 1AP5A 4DR7B 1ZX3A 1XMOB 5EK0A 3G6EV 3LDEA 1FJGB 3AG1B 2F23A 2WLHA 3HKBA 2QTSA 4UV9A 1N0NA 1DLBA 4N23A 5LL6Y 3JCUZ 4KFMA 2VWJA 3ICXA 4J80A 4QGPA 3MHSC 3BFRA 1EFRG 4TUYA 3CRCA 1SQXH 3BA8A 4WCEV 1IVSA 1LUVA 5CBFA 4EB6A 4QPKA 1HNXB 2PI5A 3Q4HA 3WB1A 2Y0PA 4WFAV 5KX5B 3N2KA 1HR0B 4FLTA 2XAGA 4JI5O 3B09A 3ASNB 2CTPA 5KMGB 1Q5OA 4NB5A 1EM1A 3BA9A 2ZD9A 3A0BZ 3CWBH 2ZDIA 2UXXA 3CC7V 2GTSA 1WN7A 1WP8A 3K0DA 3ZN0A 2BSKB 4J7JA 1GN3A 1VQ6V 1R6KA 4D6TH 4UVCA 5E1AC 3GWOA 1TUEB 3X2QC 4JAUA 4J9YB 3BPZA 5LA6A 2E3CA 1TVKA 3K3WA 4DR5O 3RYHB 4ABMA 1XHXA 1VQ4V 5CA0A 2ZCEA 2XOKG 1AI5A 3VQXA 4TSFG 4PHZA 3QNEA 4G27B 2WPDG 1FFTB 1G6UA 1JA8A 1N33B 5LOVB 2IW5A 3R66A 3I56V 5C8YB 2PYLA 4FM1A 3N2GB 1KU9A 4TT3G 1RFYA 1PNLA 1E1RG 1NTKH 4CS2A 3BVOA 4X20A 5GTIZ 3TJTA 1GH6A 2GSMB 5L3BA 1XNQB 3JALB 3ZMTA 1I0HA 1Q3EA 4DV4O 2EIJB 5LMUO 1JPXA 1FPOA 1MOFA 4TQDA 1XQ8A 3CCLV 1NZ6A 4PA7A 1JR9A 1OCZC 1F4NA 4X1KB 4DUZO 4PI0A 3DGEA 1TAEA 1IBLO 3FAVA 5LMNO 3RVZA 4I4TA 4DR5B 4U3JB 1Q86W 1QVFU 4JGSA 3VQWA 4K0KO 3KCXA 3H1JH 3AG1C 1QLEB 2F43G 3CEIA 2YIBD 2L6LA 3ZX6A 4DRXA 3AG3C 1GO3F 4FFBB 4J9ZB 5LXTA 1S72V 2ADPA 3ETGA 1GTOA 5IY5B 4YXWG 3D36C 4YJ3B 3UT5B 1NS1A 3QG5A 2VWKA 3EFFK 3AK3A 3PN1A 3JARA 3DTUB 4YY3O 4IYIA 1ZL8B 4BIUA 1B3QA 3JATA 2R72A 3HKDB 1KECA 1OCCC 4QIWF 3CP1A 4JI1O 4K35A 4OPHA 4LF4O 4DV4B 4HNAA 4ZBMA 3J7AU 1SQFA 5LMUB 5CBGA 2ZT9B 2A0LA 3O9OA 2C2AA 3G67A 4JF3A 4RAIA 2FTKA 4DUZB 3JAKA 4MTXA 2LW1A 1RM1B 1FFXB 4I50B 5B3SB 2QM7A 5CN0A 4DR2O 3OAAG 4K0KB 1Z5VA 2ZR2A 4DW1A 3SYPA 1HNWO 4FVMA 4GX2A 3LNMB 1I94O 4DR3B 2CE4A 2YIDA 2VQEO 1OCRB 1Y76B 2H8PC 1N8RW 4CZZA 1AR4A 4YY3B 4JI7B 4O2AA 1CPYA 1BS3A 3RFRA 2LGWA 2LQTA 4WBNA 4O4IB 4K3AA 4O4LB 1MABG 3SPIA 4B3SO 1VQMV 3E86A 4J41A 3A0RA 2UUAO 5EBWC 1VQ5V 2UUCO 1AR1B 4FLVA 5JVDA 3LSQA 5IT9N 4R6ZA 1SQVH 3ZCCA 2WLLA 2EIJC 1HNWB 1SA0B 3IAYA 3P32A 2PTMA 4YIOA 2VQEB 3T1HO 4X62B 4LP8A 4CH4A 3G4SV 2GHYA 4JTDB 2LW7A 4O4HA 3ZHUA 4RQEA 2GDSA 2WWWA 1SQQH 2NN4A 3G80A 2UXNA 4LR3A 3DC6A 1EBOA 2XHBA 3CCMV 1QLEC 1JOYA 4F6RB 1M57B 1Y67A 2ZQMA 4MTFA 1SZXA 1NH2D 4DUYO 4B3SB 3ETEA 2IJHA 5IY5C 2QDOA 3L74H 2DYRC 1URFA 2HP8A 2EIKC 4YIPA 2Q67A 3OMAB 3CCRV 2OCHA 2Y69C 2K9PA 3ETQA 5EIBD 2UXBO 4BR6A 2BOCC 2L35A 3STLC 5LHGA 2YUAA 3RYCA 3L73H 1M90W 1S77D 4PD4F 4B3TB 2LGQA 1H38A 4YHHO 2GUZB 3P3NA 5CA1A 3W7UA 5BMVB 5K1XA 2WLIA 4BAYA 2MK3A 4KL1A 1QHTA 1RM1C 1J95A 5B3SC 2KG7A 2YS8A 1KD1W 1V9PA 1YTFD 1DGSA 4Z2WA 4DUYB 3QO5A 2Z3YA 2XUMA 2CH7A 3JD2A 2Q68A 1XNRO 5B1BB 2BE3A 2R9IA 1S3JA 3CCJV 2AW9A 4LWSA 2FB5A 1X59A 3WG7B 2A3QA 5K1PA 4DR6O 3A8TA 1JMKC 1GN6A 2D2CB 2ZNJA 1VQ7V 4NKGB 1AI7A 3K58A 1UJWB 2LP7A 2Q7HA 4PDMA 4NTYA 4UCRA 2IH3C 3JCZA 4DV0B 3CD6V 3IC9A 3JAWA 5JWPA 2UU9O 5BXZA 2WLKA 2DW4A 4FJCC 4CH6A 4CC6A 2YC0A 2HKOA 2YI8A 3B77A 4LF5O 4DV2O 2G38A 4LBEC 1H2GA 4IIJB 4IL6Z 1QCEA 3CB2A 5D5PA 2CDYA 1HP8A 2W0FC 3F7VC 4AI8A 2PUSA 4DXWA 2V4DA 5B5EZ 3W7WA 5KHIA 3QO7A 3RYFA 5IJ0A 3CYOA 4Z1VA 1M57C 1H8HG 2GBOA 1WA8A 1N32O 4GUNA 5FNVA 2F1MA 3SGIA 1BCCH 5A9GA 3IC7A 4NTXA 3K9SA 5J2UA 4GZRB 4LH6A 2BCCH 5DECA 2HJDA 3D3QA 2IM9A 2X6CA 2EILB 4XDJA 2EIMB 2ITDC 3ZRWA 4A5UB 4TV8B 1BSMA 1OCOB 2UU9B 1VARA 4MTOA 5IJ9B 2CGOA 2E75B 2QM4A 1ZTEA 1JCHA 3CMAV 4FLWA 4QE9A 3TXQA 3SPGA 1IDSA 4DV2B 4WFBV 4LF5B 1V55B 2BTQB 1MA1A 4DK0A 1E1QG 3OM3B 1S5LZ 4J42A 3BCCH 2YICA 4RUFA 1Q6HA 4EEQA 4EFBA 4P30A 4ZKIA 3L71H 2JGDA 3OTOB 4UFZA 3ZS8C 1ORQC 2V7QG 5EC2C 1N32B 4B3RO 2N05A 4D7SA 5B66Z 2P90A 2Q8VA 2ETNA 1XMOO 1AILA 4GX1A 5B1BC 2VRZA 3AK1A 1V54B 3WG7C 1FXKB 1Q6UA 5DM6V 1NTZH 5LHIA 3AG4B 1IURA 3TK1A 4LF9B 4JAVA 4ZOLA 2PI4A 1SQGA 1HNXO 4TUYB 3QF7A 1B6QA 4ZI7A 3AG7A 4RUEA 1U97A 3E8BA 4JPRA 1HR0O 1K5SA 5L3FA 2QGNA 2ZNIA 3N2KB 5IYZB 1ZLZA 5KA6A 4PELA 2RJZA 1PPJH 2JJ2G 4Q20A 1JFFA 3CX5F 3E2EA 5KUKA 4ZHQA 1EN6A 5CB4A 4BW9A 3K59A 5JJEB 4QNHB 1MSDA 5BR8B 1ZSPA 3CRMA 1O9HA 4FM0A 2HFEC 2Q7EA 3AG2B 4RQFA 1R3IC 4MVUA 2XT9A 4TV9A 2CUGA 5CA3A 4TOIA 2QSAA 5EBMC 2JEUA 1M5IA 4HZ3A 4NVPA 3FFQA 2AHZA 5LGNA 4PA4A 4R7CA 3MDSA 2EIMC 3FX7A 4LC1A 4UCTA 1OCOC 3A0HZ 5KA5A 1N33O 3C3TA 4FM2A 1Z2GA 2Q69A 1E79G 1FAFA 4R50A 4MVQA 1K9MW 3M7MX 3BEHA 1A32A 5LP6B 1V55C 1NR1A 2B5UA 3HB3B 3LNNA 1I08A 4RO2A 2YEVA 2Y0IA 1XNQO 1IX9A 1JJ2U 4WFGA 3RYIA 2DYSB 3SPHA 3UO3A 3NR7A 1PM9A 4CBCA 3FYIB 5GTHZ 1JVMA 4LFCO 3H9VA 3B2EE 5EZYB 3TCUA 2OYQA 3ZMVA 4I9QA 2ZR3A 1LUWA 2ZE7A 2NNUA 4I4TB 2KQXA 4HBNA 5LGUA 1V54C 4JZ2A 1SQPH 3D36A 3FB8C 1WP7A 3KZIZ 1MZFA 3DSQA 5LYJB 4G28B 1FXKC 1R6TA 1M9NA 1VF6C 1WPBA 4X8AA 5LXTB 4JI3O 2BOBC 3AG4C 4CH3A 5KX5A 3K9AA 3BY6A 3QTCA 1RPRA 1XL6A 3L70H 3E22B 1L0LH 2E76B 1D5NA 2OCCC 4UB6Z 3OUFA 5KMGA 1ZUQA 1VQOV 4PA3A 2RDCA 5JQGB 1PNKA 3ZMSA 1DF5A 4LFCB 2P4VA 2BSKA 3RT3C 1M56C 1AR5A 1K3EA 3OTFA 2OT5A 3SPJA 2R9RB 3HKEB 3ZHVA 3E83A 5EYPB 1KKCA 3JAKB 1FXVA 3MAQA 1K4CC 3K79A 2XAJA 2DWEC 2HEPA 3FKSG 4O2BA 2VQFB 4DR3O 4DYLA 2KB1A 3RYHA 2EZOA 3JAMN 4MVOA 3JD0A 4PI2A 4JTAB 4JI3B 1Z5WA 4UCSA 4GLXA 1WB7A 1BHAA 4JI7O 4AHCA 4FK5C 1MNGA 3BABA 3L72H 2Y48A 4ICGA 5BY1A 4O2AB 1U96A 2LJ2A 3A2FA 4NTWA 2CAZC 5C8YA 1JX9A 5DN6G 5C93A 1BZKA 1VQ9V 3N2GA 3CXCU 1GM7A 1XEQA 5GONB 3ASNC 1AP6A 4PV1B 3JALA 5LP6C 4JASA 4D7TA 5JH7B 1VIBA 4F4LA 3JSLA 2JRIA 4JI0O 3ABKB 3FB6C 2DYSC 3RGBA 4X1KA 3S3XA 1SETA 2ZE6A 3T1CA 3I55V 4U3JA 5LGTA 1KBHA 4X62O 3ZHQA 1G1XB 4KP4A 1ZWIC 4FIPC 3OMIB 1AI6A 2WSSG 4FFBA 4LF6B 4O4JB 3W7XA 3DXRB 1GN2A 4O4HB 3O65A 5A2QN 3B4SA 1BHBA 3EXAA 4YJ3A 3UT5A 1LNQA 1BQZA 1T5EA 4PDLA 2QE7G 3SR2C 3HKDA 3ZMZA 2OTJV 4X66B 4XBFA 4NXNB 2ZXWB 2XASA 1S5HC 4JI0B 2RQ6A 1L0NH 3CCVV 2YXYA 4B3TO 1H2SB 4OPAA 3OR6C 1FFXA 1R3JC 1Y66A 4I50A 3RYCB 1HNZB 4IHJB 2DQ0A 1SC5B 5BZBA 1VQKV 3EHBB 3CCEV 3K03A 2XNDG 1BT8A 1PL0A 2HJFC 5J9PC 2H94A 1NR7A 3R65A 2F66C 1Y76A 4MSWC 4U3FH 4XDKA 2QWQB 2RNBA 3ZN1A 3JSNA 1P7GA 4PDVA 4GT1A 1Y6XA 1M1KW 3N27A 5LBQA 5IYBO 5KAIZ 1I5XA 5KUMA 3U10A 3FB7C 2QKCA 5J2TA 4O4IA 4O4LA 2CH7B 1ROPA 3ZIAG 3LUTB 3BHPA 5L3EA 3D3IA 1XREA 3CJHB 4I7ZB 2EJ7A 4IGGA 3JASB 3CMEV 1BQ0A 4J11A 4GKKB 3OT7A 4DW0A 1CXZB 3ZMUA 4DV0O 4WFHA 3STZC 2QM8A 1WAZA 3JD1A 4BW5A 4JYCA 1SA0A 4LFAO 3E89A 3JAWB 3ABKC 3OEHG 2F95B 4P9OA 3WB0A 2MW2B 1LR1A 1OCRC 2EINB 2R9AA 1Q82W 4JAAA 1XL4A 5H5NA 3LSSA 5LHHA 4F6RA 4MVRA 1N0JA 3LDCA 1W59A 1GAXA 2HVJC 1FD9A 2QWRB 5IJ0B 1W0JG 2B1IA 2DOSA 2M7WA 1WJZA 1BE3H 1NI8A 2Z5UA 1R6NA 5B1AB 3J80N 1GMGA 3CHXA 3OUSA 3H1HH 4QE7A 5J2UB 1FS0G 2ARHA 3TGUH 1KUQA 4P2ZA 3CCSV 2JIZG 4LFBO 4P9PA 1XI1A 4LFAB 4X1YB 4CS3A 3VBBA 3CRAA 3E8FA 1UPGA 2X6AA 4J10A 5BMVA 2XAHA 2WA3A 4GCZA 4EKWA 1L1FA 3OR7C 4BIZA 1H2KA 1S5JA 3T4DA 4JI4O 4JI6B 1W0KG 2QKAA 4JI2O 4UVBA 1IBMO 1NQTA 2F4VO 1AJQA 4U7OA 3H1LH 3KKYA 1RP3B 1NH2B 1S0VA 1PV0A 3ZBHA 2Q73A 3K0GA 1O9GA 4OGQB 3ZRXA 3OTOO 2PYJA 1SF9A 2Q4PA 1QLNA 1TUBB 2JGDB 1GK9A 1QVGU 2B1GA 4H44B 4LNUB 2EX3A 1NT2B 4B7KA 1EZJA 1D5AA 3ETDA 1UFIA 2HVKC 5GW7A 3OMNB 1Q90D 4YJ2B 4LFBB 4JYYA 1AJNA 1KYOF 1YCIA 3H01A 4LF7B 1P7BA 1QR9A 2KSDA 1ZAUA 2JGUA 4LF9O 4DV7O 5D5QA 1Q6IA 4JI4B 1YVWA 3JYCA 1EN4A 3ABTA 5FPOA 4JI2B 3OFNG 3OEEG 4ZOLB 3K5NA 1IBMB 1K4DC 3SDLA 4PJ0Z 2F4VB 1YTFB 1F23A 1J5EO 3UCSC 2EBOA 1W2BU 2ZINA 1RSOB 3UQ8A 1THZA 1YZBA 4MVZA 1OHHG 1Y74B 2P06A 3ZHSA 3RN4A 3RVYA 3W7TA 2OIGA 2FL4A 4I55A 2EINC 1EZVH 2N74A 1JFFB 5ITZB 4UVAA 5KAFZ 5JJNB 5BR8O 1P84F 2Q9LA 2PGGA 2ZM6B 3HKCA 3SYOA 3RW0A 3ABUA 2Q7GA 1L8DA 4QJFB 3HKBB 2WLMA 3P3PA 3UKMA 1BMFG 1XMQO 3X2QB 1SESA 1NTMH 4MVMA 2P4KA 3P30A 3LSUA 5JCOC 5B1AC 5IYDO 3L75H 4LF8B 2ZKOA 4DV7B 4TV8A 2E5LO 1SERA 4GX5A 5H6RA 3E8HA 1VP7A 2BTOA 5IJ9A 2UXDO 4W4LA 4E2LA 4EB6B 4L87A 5KHJA 2AXTZ 1OZ0A 4FZ0A 3SYQA 1J5EB 3Q4HB 5KHGA 2Q5ZA 1YF2A 3KCYA 3IFXA 2BTQA 3ABMB 4DV6B 1F7YA 1PD3A 2LFSA 5E79Z 5F2VO 2QWNB 1G4YB 1YJ9V 2DMXA 1TA8A 2DWDC 4UCUA 1JQ0A 2X0LA 2ZE8A 4FFKA 4RWUA 4J7ZA 2XAQA 2PY5A 3HPLC 2ADQB 3M8AA 3AEIA 4X1IA 2W6JG 3K08A 3E8GA 3QVNA 1KP2A 1XMQB 2IJJA 1OCZB 1SS3A 4MT8A 1KKDA 1BGYH 3E35A 2Q6AA 1VEWA 4JV5B 1I7FA 5L3GA 3GWKC 5EIBC 4GYCB 1GRJA 2E5LB 4UCVA 5LA6B 1TVKB 3AG3B 1FXKA 2WAMA 2P22C 5L3DA 1VF7A 3K57A 2UXDB 1R3KC 2EILC 5CA0B 1VF6A 1US6A 2JS3A 2B9ZA 2F93B 4JYBA 1Q7YW 1HWYA 2UUBO 4DV3O 1OJHA 2OIEA 1YITV 2R70A 3H1KH 4KHPB 3W7SA 4K8ZA 4CS4A 1OCCB 2W6IG 5IYZA 2Y4TA 4OX9O 4I0XA 1K34A 1M4UA 4MTGA 4X20B 3T1YB 2W0XA 3D8CA 4KUMA 1R73A 1FYJA 2V1DA 2P5OA 3K5MA 2QEXV 1X4TA 2JJ1G 3CS5A 5EC1C 3T2MA 3U0ZA 2ZE5A 3SYAA 1KQSU 2CTWA 4EFEA 5DEDA 5IWAO 1K33A 1P49A 3FAVB 2YSUB 4CC5A 1IXBA 1GM9A 3VQVA 1YSCA 3I5DA 2X7RB 4U7NA 2VQFO 4DV5O 3C3SA 3KG2A 4BWAA 4O2BB 4DRXB 2JK5C 2JS5A 2UUBB 4DV3B 1M93A 2Z0AA 1YXBA 3RWRD 1IXMA 3ABLB 2Q0AA 3JARB 4OX9B 3GB7C 3APOA 4DK1A 2QWOB 4I9WA 3WU2Z 3U11A 2A06H 3JATB 1YI2V 3IGAC 4JI5B 5LP6A 3NXSA 3ABMC 4HNAB 1K7DA 1K97A 2LFRA 4H0LB 5IWAB 4NR1A 1COWG 1Q8IA 2CTRA 4FPPA 2X6BA 3K06A 3VQYA 2ZDIC 3S3WA 2ZIMA 2P6JA 3CRQA 3AG2C 2NR5A 1PKXA 1Y4MA 5EZYA 3SPCA 4DV5B 2AZ2A 3WB2A 1SKVA 3TETA 3BRCA 4JTCB 2PZSA 4LCUC 3CC4V 1MZEA 4JI8O 1H2MA 1MMMA 3THOA 4FLUA 1SQBH 4PA9A 2N04A 2AZ0A 1AROP 3RBZA 4LF6O 1AJPA 2CTQA 5TISZ 2HR3A 3B40A 1B06A 1B04A 5LYJA 3CCUV 1Q81W 4C7UA 4ASUG 5LOVA 2HHHO 4JZGA 1GN4A 1TGOA 3FD9A 5H6QA 1N34O 1AB3A 2RMKB 1F4MA 3TXSA 4WBNB 4ZIBA 1G8MA 2DYRB 4WFEA 2EIKB 3E22A 3FYEB 1R3LC 4X66O 1XHZA 3G6BA 4HAMA 2Y69B 4FMTA 1GKFA 3GVMA 4X89A 4NXNO 1QBZA 5JQGA 1AI4A 3ASOB 3OE7G 5JVDB 3JD3A 3UM7A 4MW8A 1XDCA 4B3MO 1NU1H 2CK3G 2WLLB 5HFLA 1F51A 3HKEA 1HNZO 5EYPA 2QJ1A 1IBLB 1DF4A 2IBZH 1SZTA 5LMNB 4JI8B 2GV9A 4H13B 3CE2A 2FMLA 2EZPA 4CH5A 1YHQV 3SJQC 2H3OA 1VQ8V 4HYOA 3APQA
chains in the Genus database with same CATH topology
5B1BC 2HVJC 3K3WA 1VQNV 1VQ4V 4G2KA 1V54B 1W0JG 2B1IA 3MHHC 2M7WA 3WG7C 2XOKG 1AI5A 2Z5UA 1R6NA 2IH1C 4TSFG 5B1AB 1FXKB 1GMGA 3QNEA 4G27B 3OUSA 2WPDG 5DM6V 1FFTB 3ABLC 4QE7A 5LHIA 2AHYA 1FS0G 3AG4B 4H37A 3TK1A 4TWKA 5L3CA 4JAVA 1CP9A 2PI4A 2IW5A 3I56V 4P2ZA 5CBHA 3CCSV 1B6QA 2JIZG 4RUEA 4P9PA 4TT3G 3E8BA 4JPRA 1PNLA 1E1RG 3VBBA 1MSWD 3E8FA 1K5SA 2GSMB 5L3FA 5L3BA 2X6AA 2XAHA 4GCZA 4EKWA 1L1FA 3OR7C 3ZMTA 4BIZA 5KA6A 4PELA 3T4DA 2EIJB 1W0KG 3PJSK 1JPXA 2JJ2G 4Q20A 1MOFA 3WFVA 5H9CA 4UVBA 1NQTA 3E2EA 4X88A 2WLIB 1AJQA 1DTOA 4MS2A 4OXSA 4U7OA 2P7TC 5KUKA 3CCLV 4PA7A 1NH2B 3JD4A 1S0VA 1OCZC 1F4NA 3DGEA 4QNHB 1NBMG 3K0GA 3F5WC 3RVZA 3ZRXA 3SYCA 2HFEC 1YIJV 1NVPD 1Q86W 1QVFU 3AG2B 4JGSA 4RQFA 1QLNA 3F7YC 1R3IC 3AG1C 2F43G 1GK9A 1QLEB 2B1GA 4MVUA 1QVGU 5CA3A 3AG3C 1GO3F 3ZRVA 4PA6A 4J9ZB 5EBMC 2JEUA 4HZ3A 1K92A 1S72V 1EZJA 2AHZA 3ETGA 1GTOA 3ETDA 4PA4A 4R7CA 5IY5B 5LGNA 4YXWG 2HVKC 5GW7A 3B8MA 1K5QA 2HLDG 3OMNB 4UUJC 3EFFK 3DTUB 5HFMA 2EIMC 5B1OA 1AJNA 3H01A 4LC1A 4BIUA 1P7BA 1QR9A 1OCOC 1KECA 1OCCC 4QIWF 5KA5A 3CP1A 1PNMA 1K8AW 2Q69A 1E79G 3JYCA 4R50A 4MVQA 2OTLV 4ZBMA 1K9MW 5CBGA 3ABTA 4GX0A 5IYCO 3BEHA 3ASOC 3OFNG 3OEEG 2NLJC 2A0LA 1K4DC 4PDRA 3OW2U 1YTFB 2C2AA 1F23A 1V55C 4JF3A 1NR1A 2B5UA 3HB3B 2EBOA 1W2BU 4RAIA 4RO2A 1I5YA 2YEVA 2FTKA 1JJ2U 4WFFA 1THZA 4MTXA 1RM1B 4MVZA 4WFGA 5B3SB 1OHHG 4WF9V 2DYSB 3SPHA 1WLEA 2QM7A 5CN0A 3RVYA 3OAAG 2ZR2A 3W7TA 4CBCA 3FYIB 4DO2A 3SYPA 1JVMA 2EINC 1NKDA 4GX2A 3LNMB 3LDDA 4UVAA 2IU0A 3TCUA 4UXNA 1OCRB 3ZMVA 2H8PC 2ZR3A 3SYOA 3RW0A 3ABUA 1N8RW 4CZZA 2NNUA 2K1EA 4QJFB 2IJIA 5LGUA 2WLMA 5IDJA 3UKMA 1BMFG 2ATKC 3X2QB 1V54C 3FB8C 3D36A 1SESA 4MVMA 1CPYA 3P30A 5B1AC 5IYDO 4G28B 1FXKC 1M9NA 1MABG 4X8AA 3SPIA 1SERA 4GX5A 5H6RA 4R8CA 3E8HA 2BOBC 3AG4C 2JEXA 1VQMV 3E86A 2ZXWC 4E2LA 3K9AA 3BY6A 4L87A 1RPRA 3ZRWB 1XL6A 1OZ0A 3A0RA 1KC8W 3SYQA 5EBWC 2D3OW 1VQ5V 1AR1B 4I5SA 2OCCC 1P4RA 3LSQA 3OUFA 1FXHA 2DQ3A 2JDIG 3IFXA 4MW3A 4R6ZA 3ABMB 1VQOV 4PA3A 1PD3A 1PNKA 2LFSA 3ZMSA 3ZCCA 2WLLA 1G4YB 1YJ9V 2EIJC 1VQPV 1DF5A 2DWDC 1QR8A 3K04A 3CC2V 3P32A 1NVPB 1M56C 1ENVA 1JQ0A 1K3EA 2P67A 2X0LA 2OT5A 4UV8A 3SPJA 2R9RB 3E83A 4LP8A 2XAQA 3CPWU 3G4SV 3HPLC 4QPJA 2GHYA 3AEIA 4JTDB 1FXVA 2W6JG 3K08A 1K4CC 3E8GA 3K79A 2XAJA 2DWEC 3FKSG 4RQEA 1KP2A 2WWWA 5B1NA 2IJJA 1OCZB 1YJNV 3G71V 4MT8A 2UXNA 1KKDA 1EBOA 3E35A 3CCMV 1QLEC 1JOYA 3ML0A 2Q6AA 2KB1A 1M57B 2EZOA 5L3GA 4MVOA 3FB5C 3JD0A 5EBLC 2ZQMA 4MTFA 4JTAB 1BL8A 1NH2D 3ETEA 2IJHA 2QTOA 3AG3B 1FXKA 5IY5C 2WAMA 5L3DA 1BHAA 1KP3A 1R3KC 2EILC 5CMUA 4FK5C 2DYRC 2EIKC 2Y48A 2Q67A 2ITCC 3OMAB 4JYBA 3CCRV 1Q7YW 1HWYA 1JX9A 2Y69C 5DN6G 5C93A 1CEZA 1VQ9V 1YITV 3T4ZA 2BOCC 1GM7A 3STLC 3CXCU 3W7SA 3ASNC 2XAFA 3CCQV 2WLJA 5LHGA 1M90W 1S77D 2IU3A 1OCCB 2W6IG 4MVSA 1RPOA 4JASA 1K34A 4H33A 1H38A 4MTGA 3W7UA 4F4LA 2WLIA 4BAYA 2MK3A 4KUMA 3ABKB 1R73A 1RM1C 1J95A 2V1DA 5B3SC 1WPXA 3FB6C 2QEXV 2DYSC 2JJ1G 3T2MA 5EC1C 1SETA 2EJRA 3SYAA 1KQSU 3T1CA 5FL7G 3I55V 1NJIW 1KD1W 5LGTA 1YJWV 1K33A 1YTFD 4KP4A 1ZWIC 4FIPC 2QA4V 2YSUB 3OMIB 3QO5A 2Z3YA 1AI6A 2WSSG 1GM9A 1YSCA 3JD2A 3W7XA 2X7RB 4U7NA 2Q68A 3KG2A 5B1BB 2R9IA 1S3JA 4N21A 3CCJV 2IJKA 2QKSA 1BHBA 3WG7B 2JK5C 1LNQA 3OGCC 3ZJZA 4XDLA 2A9HA 1K73W 4PDLA 2A79B 1S76D 2QE7G 1IXMA 3ABLB 2WLNA 1H8EG 1VQ7V 3ZMZA 2OTJV 1VQLV 1AI7A 3GB7C 1UJWB 4I9WA 3QO8A 2HG5C 2LP7A 4PDMA 4XBFA 1YI2V 2ZXWB 3IGAC 2IH3C 3JCZA 2XASA 1S5HC 3CD6V 1GM8A 3NXSA 3MD0A 3VOUA 3ABMC 3CCVV 4Z1MG 1SRYA 1K7DA 2WLKA 2OCCB 1K97A 2DW4A 3OR6C 1R3JC 1Y66A 2LFRA 4FJCC 1COWG 2YEVB 2DQ0A 2HKOA 4FPPA 2X6BA 3B77A 3K06A 1MG1A 5BZBA 1VQKV 3B8NA 1H2GA 3EHBB 4LBEC 3CCEV 3K03A 3M99B 3ZRSA 2XNDG 2ZDIC 1QCEA 2P6JA 2W0FC 1PL0A 3F7VC 4DXWA 3AG2C 1PKXA 1Y4MA 1M56B 2HJFC 5J9PC 3SPCA 2H94A 1NR7A 3R65A 3TETA 4JTCB 3W7WA 4LCUC 3QO7A 4MSWC 5EK0A 3CYOA 4XDKA 3LDEA 3G6EV 3CC4V 3AG1B 2WLHA 1M57C 3ZN1A 1H8HG 4PA9A 4PDVA 4GT1A 4UV9A 1DLBA 1AROP 1M1KW 4N23A 3RBZA 5LBQA 5IYBO 1AJPA 2HR3A 4KFMA 3CCUV 3IC7A 1I5XA 5KUMA 3MHSC 1Q81W 3FB7C 4ASUG 1ROPA 1EFRG 3ZIAG 3LUTB 5H6QA 4WCEV 1F4MA 5L3EA 2X6CA 2EILB 3D3IA 4XDJA 2EIMB 2ITDC 3ZRWA 5CBFA 4QPKA 1G8MA 2PI5A 2DYRB 4WFEA 2EIKB 1OCOB 3FYEB 4WFAV 1R3LC 4MTOA 3CMEV 4HAMA 2Y69B 4FMTA 1GKFA 4X89A 1JCHA 3CMAV 2XAGA 1QBZA 1AI4A 3ASOB 4QE9A 3ZMUA 4WFHA 3OE7G 3ASNB 3SPGA 3STZC 4WFBV 2QM8A 1V55B 3JD3A 3UM7A 4MW8A 3JD1A 4BW5A 4JYCA 1E1QG 3E89A 3OM3B 3ABKC 2CK3G 2WLLB 2ZD9A 5HFLA 3OEHG 1F51A 2ZDIA 2UXXA 4P9OA 4RUFA 3CC7V 3ZN0A 3K0DA 1DF4A 4P30A 4ZKIA 1SZTA 1VQ6V 1OCRC 2EINB 1R6KA 1ORQC 2V7QG 5EC2C 1Q82W 1XL4A 3LSSA 4UVCA 5LHHA 5E1AC 2EZPA 1YHQV 3SJQC 1VQ8V 4HYOA 3GWOA 4MVRA 1TUEB 2P90A 3X2QC 4JAUA 4J9YB 3LDCA 4GX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOU A;  2NLJ C;  3FB5 C;  4MVO A;  3ABM C;  2A0L A;  5EBL C;  1K4D C;  5B1B C;  2HVJ C;  4PDR A;  4MTF A;  1V55 C;  2WLK A;  4JTA B;  1BL8 A;  4RAI A;  4RO2 A;  2YEV A;  3OR6 C;  2QTO A;  1R3J C;  3WG7 C;  5IY5 C;  4WFF A;  1R3K C;  2EIL C;  2IH1 C;  2X6B A;  3K06 A;  2DYR C;  4MVZ A;  4WFG A;  2EIK C;  5BZB A;  3SPH A;  4G27 B;  4LBE C;  3OUS A;  3K03 A;  3RVY A;  3ZRS A;  3ABL C;  4QE7 A;  2Q67 A;  2ITC C;  2W0F C;  3F7V C;  4CBC A;  2AHY A;  4H37 A;  3AG2 C;  4DXW A;  3SYP A;  1JVM A;  4TWK A;  2EIN C;  2HJF C;  5J9P C;  3SPC A;  2Y69 C;  3R65 A;  4GX2 A;  4GX1 A;  4P2Z A;  5CBH A;  3LNM B;  3LDD A;  3T4Z A;  3TET A;  4JTC B;  2BOC C;  3STL C;  4LCU C;  5EK0 A;  4MSW C;  3ASN C;  4XDK A;  3TCU A;  3LDE A;  4RUE A;  4P9P A;  2WLJ A;  3E8B A;  2WLH A;  1M57 C;  2H8P C;  4MVS A;  4PA9 A;  3E8F A;  3SYO A;  3RW0 A;  4PDV A;  3RBZ A;  4H33 A;  2K1E A;  2X6A A;  4KFM A;  4MTG A;  2WLM A;  3UKM A;  4EKW A;  2ATK C;  3OR7 C;  1V54 C;  3FB8 C;  5KUM A;  3T4D A;  4MVM A;  3FB7 C;  4F4L A;  3PJS K;  2WLI A;  5B1A C;  1J95 A;  4G28 B;  3LUT B;  3FB6 C;  5B3S C;  2DYS C;  4X88 A;  2WLI B;  5KUK A;  4MS2 A;  4OXS A;  4X8A A;  2P7T C;  3SPI A;  4GX5 A;  4PA7 A;  3T2M A;  4R8C A;  5EC1 C;  2X6C A;  3E8H A;  2BOB C;  4XDJ A;  2ITD C;  5CBF A;  3AG4 C;  3SYA A;  1OCZ C;  3T1C A;  3E86 A;  2ZXW C;  4WFE A;  4QNH B;  3K0G A;  3F5W C;  5CBG A;  1R3L C;  1XL6 A;  3RVZ A;  3SYC A;  3SYQ A;  4MTO A;  1ZWI C;  5EBW C;  2HFE C;  2OCC C;  3F7Y C;  1R3I C;  3AG1 C;  4MVU A;  4X89 A;  3OUF A;  2Q68 A;  3IFX A;  4MW3 A;  4QE9 A;  3AG3 C;  3KG2 A;  4R6Z A;  4WFH A;  3SPG A;  4PA3 A;  4J9Z B;  4PA6 A;  3STZ C;  5EBM C;  3UM7 A;  4MW8 A;  4HZ3 A;  2WLL A;  2KB1 A;  1G4Y B;  2QKS A;  2AHZ A;  2EIJ C;  4BW5 A;  4PA4 A;  3E89 A;  4R7C A;  2JK5 C;  2DWD C;  3ABK C;  2HVK C;  3K04 A;  1LNQ A;  2WLL B;  2ZD9 A;  3OGC C;  4XDL A;  3ZJZ A;  2A9H A;  1M56 C;  4P9O A;  4UUJ C;  3EFF K;  4RUF A;  4PDL A;  2A79 B;  3SPJ A;  3K0D A;  2R9R B;  3E83 A;  2EIM C;  4LP8 A;  4P30 A;  2WLN A;  3HPL C;  1P7B A;  4JTD B;  1OCO C;  1OCR C;  3K08 A;  1ORQ C;  1K4C C;  3E8G A;  3GB7 C;  5EC2 C;  4I9W A;  1OCC C;  2HG5 C;  1XL4 A;  2DWE C;  4PDM A;  5E1A C;  2Q69 A;  3SJQ C;  3IGA C;  2IH3 C;  4HYO A;  1KKD A;  1S5H C;  3JYC A;  4MVR A;  4MVQ A;  4R50 A;  4ZBM A;  3X2Q C;  1QLE C;  4J9Y B;  2Q6A A;  4GX0 A;  3LDC A;  3BEH A;  3ASO C; 
#chains in the Genus database with same CATH topology
 1QU7 A;  2HHH B;  1D2D A;  1N34 B;  3J81 N;  1VQN V;  4G2K A;  2RCV A;  1ZL8 A;  3MHH C;  2IH1 C;  4FZ1 A;  1AVM A;  3ABL C;  2YIA A;  2AHY A;  2Q0O C;  4H37 A;  4TWK A;  4E4E A;  5L3C A;  5J2T B;  4JI1 B;  5GON A;  1CP9 A;  4LF4 B;  5CBH A;  1XOU A;  4B3M B;  4B08 A;  1MSW D;  4GKK O;  5JH7 A;  2GTA A;  2PF4 E;  3SJA C;  3PJS K;  3ZED A;  2Y4U A;  3WFV A;  5CA1 B;  5H9C A;  2VS0 A;  4UCO A;  4DR2 B;  4X88 A;  2WLI B;  1DTO A;  4MS2 A;  4OXS A;  2P7T C;  1H2N A;  1PL4 A;  1DK1 A;  2M6Y A;  3JD4 A;  2YXH A;  5JJJ B;  5FPR A;  1I94 B;  1NBM G;  2KG7 B;  3F5W C;  1EN5 A;  4W4K A;  3SYC A;  1YIJ V;  4O4J A;  1NVP D;  4AQY O;  3DXR A;  3F7Y C;  3ZHT A;  3ZRV A;  4PA6 A;  2DE0 X;  1K92 A;  2YDE A;  4LWS B;  3AK2 A;  3SJC C;  2LO1 A;  3B8M A;  1K5Q A;  2HLD G;  4UUJ C;  2UXC O;  5HFM A;  5B1O A;  2UUA B;  1XUQ A;  2JVD A;  1HW7 A;  2UUC B;  5H2F Z;  3SJB C;  1PNM A;  2XTA A;  1K8A W;  2OTL V;  1HDJ A;  4GX0 A;  5IYC O;  3ASO C;  3F5T A;  2NLJ C;  4NYK A;  4PDR A;  3OW2 U;  2E74 B;  2AGA A;  4IHJ A;  1I5Y A;  2ILM A;  2YIB A;  4LH7 A;  2KKW A;  4WFF A;  3CXH F;  2WA4 A;  3T1H B;  4WF9 V;  4JI6 O;  1WLE A;  2DN9 A;  1PP9 H;  4AQY B;  4DO2 A;  5AG2 A;  2ODM A;  1NKD A;  3LDD A;  4F6E A;  2IU0 A;  4UXN A;  4X64 O;  4DR1 O;  4X65 O;  3RYF B;  4KXR A;  3EVK A;  2OWO A;  1KB9 F;  2K1E A;  2IJI A;  5IDJ A;  2UXC B;  1WA8 B;  2ATK C;  5FNV B;  4BIO A;  3OGI B;  3CRR A;  2YI9 A;  1YDX A;  3CJH A;  4GKJ O;  4R8C A;  4DV1 O;  2JEX A;  3JAS A;  2UXB B;  2ZXW C;  3L9D A;  1KC8 W;  3ZRW B;  4LF7 O;  2A7W A;  4K8X A;  2D3O W;  2YXL A;  4FLZ A;  2GUZ A;  4I5S A;  1KMI Z;  4X9Q A;  1P4R A;  4YHH B;  1FXH A;  2DQ3 A;  2JDI G;  3BAA A;  4MW3 A;  1N36 O;  3DC5 A;  1VQP V;  4IYH A;  3H1I H;  3K5O A;  1QR8 A;  3K04 A;  2QR4 A;  3CC2 V;  1R1B A;  1NVP B;  1ENV A;  4UV8 A;  2P67 A;  4X64 B;  1VMG A;  3UO2 A;  5KLV H;  3CPW U;  4QPJ A;  4X65 B;  4DR1 B;  1XBL A;  4NXM O;  5B1N A;  1YJN V;  2RN9 A;  3G71 V;  1XNR B;  3ML0 A;  4I55 B;  4B7E A;  3FB5 C;  1YEW A;  5EBL C;  2ZM6 O;  2O57 A;  4J7K A;  1BL8 A;  2FKX A;  4GKJ B;  4DR6 B;  4DV1 B;  5JCO A;  2QTO A;  3HKC B;  1KP3 A;  5CMU A;  1WNS A;  1IBK O;  5KHK A;  4LF8 O;  2ITC C;  1H2L A;  1N36 B;  1CEZ A;  3T4Z A;  4X1Y A;  2XAF A;  3CCQ V;  2WLJ A;  4JYA O;  4ZI7 B;  3K5L A;  1OV9 A;  2IU3 A;  4MVS A;  1RPO A;  4DR4 O;  1QQC A;  1IZ3 A;  4H33 A;  3C90 A;  5KHH A;  4IIJ A;  4DV6 O;  1VF5 B;  1WPX A;  5FLX N;  4NXM B;  4L8J A;  3OD4 A;  2EJR A;  4ZHQ B;  5FL7 G;  1NJI W;  5CB4 B;  1YJW V;  4TQF A;  1TUB A;  2DJV A;  4Q6G A;  2QA4 V;  1N4C A;  4LNU A;  1XIL A;  4UB8 Z;  4X1I B;  1QNM A;  4AIL C;  4N21 A;  4DR7 O;  2EUL A;  4TV9 B;  4JV5 O;  1IBK B;  2IJK A;  1FKA O;  1FJG O;  2QKS A;  3OGC C;  3ZJZ A;  4YJ2 A;  4XDL A;  2A9H A;  1K73 W;  2ZIO A;  2A79 B;  1S76 D;  2WLN A;  1JJO A;  4JYA B;  1H8E G;  1VQL V;  4DR4 B;  3QO8 A;  2HG5 C;  4IT5 A;  2FYU H;  1GM8 A;  4KHP O;  4FLY A;  3MD0 A;  3VOU A;  3HR0 A;  2QWP B;  4Z1M G;  1RSO A;  1SRY A;  5IE9 A;  2OCC B;  1Y74 A;  3ZHR A;  2YEV B;  1Q43 A;  3CSX A;  3T1Y O;  4I0X B;  1MG1 A;  3B8N A;  3M99 B;  3ZRS A;  1WB8 A;  3RYI B;  4FLX A;  5ITZ A;  1M56 B;  4B3R B;  3IJ4 A;  2CGN A;  1AP5 A;  4DR7 B;  1ZX3 A;  1XMO B;  5EK0 A;  3G6E V;  3LDE A;  1FJG B;  3AG1 B;  2F23 A;  2WLH A;  3HKB A;  2QTS A;  4UV9 A;  1N0N A;  1DLB A;  4N23 A;  5LL6 Y;  3JCU Z;  4KFM A;  2VWJ A;  3ICX A;  4J80 A;  4QGP A;  3MHS C;  3BFR A;  1EFR G;  4TUY A;  3CRC A;  1SQX H;  3BA8 A;  4WCE V;  1IVS A;  1LUV A;  5CBF A;  4EB6 A;  4QPK A;  1HNX B;  2PI5 A;  3Q4H A;  3WB1 A;  2Y0P A;  4WFA V;  5KX5 B;  3N2K A;  1HR0 B;  4FLT A;  2XAG A;  4JI5 O;  3B09 A;  3ASN B;  2CTP A;  5KMG B;  1Q5O A;  4NB5 A;  1EM1 A;  3BA9 A;  2ZD9 A;  3A0B Z;  3CWB H;  2ZDI A;  2UXX A;  3CC7 V;  2GTS A;  1WN7 A;  1WP8 A;  3K0D A;  3ZN0 A;  2BSK B;  4J7J A;  1GN3 A;  1VQ6 V;  1R6K A;  4D6T H;  4UVC A;  5E1A C;  3GWO A;  1TUE B;  3X2Q C;  4JAU A;  4J9Y B;  3BPZ A;  5LA6 A;  2E3C A;  1TVK A;  3K3W A;  4DR5 O;  3RYH B;  4ABM A;  1XHX A;  1VQ4 V;  5CA0 A;  2ZCE A;  2XOK G;  1AI5 A;  3VQX A;  4TSF G;  4PHZ A;  3QNE A;  4G27 B;  2WPD G;  1FFT B;  1G6U A;  1JA8 A;  1N33 B;  5LOV B;  2IW5 A;  3R66 A;  3I56 V;  5C8Y B;  2PYL A;  4FM1 A;  3N2G B;  1KU9 A;  4TT3 G;  1RFY A;  1PNL A;  1E1R G;  1NTK H;  4CS2 A;  3BVO A;  4X20 A;  5GTI Z;  3TJT A;  1GH6 A;  2GSM B;  5L3B A;  1XNQ B;  3JAL B;  3ZMT A;  1I0H A;  1Q3E A;  4DV4 O;  2EIJ B;  5LMU O;  1JPX A;  1FPO A;  1MOF A;  4TQD A;  1XQ8 A;  3CCL V;  1NZ6 A;  4PA7 A;  1JR9 A;  1OCZ C;  1F4N A;  4X1K B;  4DUZ O;  4PI0 A;  3DGE A;  1TAE A;  1IBL O;  3FAV A;  5LMN O;  3RVZ A;  4I4T A;  4DR5 B;  4U3J B;  1Q86 W;  1QVF U;  4JGS A;  3VQW A;  4K0K O;  3KCX A;  3H1J H;  3AG1 C;  1QLE B;  2F43 G;  3CEI A;  2YIB D;  2L6L A;  3ZX6 A;  4DRX A;  3AG3 C;  1GO3 F;  4FFB B;  4J9Z B;  5LXT A;  1S72 V;  2ADP A;  3ETG A;  1GTO A;  5IY5 B;  4YXW G;  3D36 C;  4YJ3 B;  3UT5 B;  1NS1 A;  3QG5 A;  2VWK A;  3EFF K;  3AK3 A;  3PN1 A;  3JAR A;  3DTU B;  4YY3 O;  4IYI A;  1ZL8 B;  4BIU A;  1B3Q A;  3JAT A;  2R72 A;  3HKD B;  1KEC A;  1OCC C;  4QIW F;  3CP1 A;  4JI1 O;  4K35 A;  4OPH A;  4LF4 O;  4DV4 B;  4HNA A;  4ZBM A;  3J7A U;  1SQF A;  5LMU B;  5CBG A;  2ZT9 B;  2A0L A;  3O9O A;  2C2A A;  3G67 A;  4JF3 A;  4RAI A;  2FTK A;  4DUZ B;  3JAK A;  4MTX A;  2LW1 A;  1RM1 B;  1FFX B;  4I50 B;  5B3S B;  2QM7 A;  5CN0 A;  4DR2 O;  3OAA G;  4K0K B;  1Z5V A;  2ZR2 A;  4DW1 A;  3SYP A;  1HNW O;  4FVM A;  4GX2 A;  3LNM B;  1I94 O;  4DR3 B;  2CE4 A;  2YID A;  2VQE O;  1OCR B;  1Y76 B;  2H8P C;  1N8R W;  4CZZ A;  1AR4 A;  4YY3 B;  4JI7 B;  4O2A A;  1CPY A;  1BS3 A;  3RFR A;  2LGW A;  2LQT A;  4WBN A;  4O4I B;  4K3A A;  4O4L B;  1MAB G;  3SPI A;  4B3S O;  1VQM V;  3E86 A;  4J41 A;  3A0R A;  2UUA O;  5EBW C;  1VQ5 V;  2UUC O;  1AR1 B;  4FLV A;  5JVD A;  3LSQ A;  5IT9 N;  4R6Z A;  1SQV H;  3ZCC A;  2WLL A;  2EIJ C;  1HNW B;  1SA0 B;  3IAY A;  3P32 A;  2PTM A;  4YIO A;  2VQE B;  3T1H O;  4X62 B;  4LP8 A;  4CH4 A;  3G4S V;  2GHY A;  4JTD B;  2LW7 A;  4O4H A;  3ZHU A;  4RQE A;  2GDS A;  2WWW A;  1SQQ H;  2NN4 A;  3G80 A;  2UXN A;  4LR3 A;  3DC6 A;  1EBO A;  2XHB A;  3CCM V;  1QLE C;  1JOY A;  4F6R B;  1M57 B;  1Y67 A;  2ZQM A;  4MTF A;  1SZX A;  1NH2 D;  4DUY O;  4B3S B;  3ETE A;  2IJH A;  5IY5 C;  2QDO A;  3L74 H;  2DYR C;  1URF A;  2HP8 A;  2EIK C;  4YIP A;  2Q67 A;  3OMA B;  3CCR V;  2OCH A;  2Y69 C;  2K9P A;  3ETQ A;  5EIB D;  2UXB O;  4BR6 A;  2BOC C;  2L35 A;  3STL C;  5LHG A;  2YUA A;  3RYC A;  3L73 H;  1M90 W;  1S77 D;  4PD4 F;  4B3T B;  2LGQ A;  1H38 A;  4YHH O;  2GUZ B;  3P3N A;  5CA1 A;  3W7U A;  5BMV B;  5K1X A;  2WLI A;  4BAY A;  2MK3 A;  4KL1 A;  1QHT A;  1RM1 C;  1J95 A;  5B3S C;  2KG7 A;  2YS8 A;  1KD1 W;  1V9P A;  1YTF D;  1DGS A;  4Z2W A;  4DUY B;  3QO5 A;  2Z3Y A;  2XUM A;  2CH7 A;  3JD2 A;  2Q68 A;  1XNR O;  5B1B B;  2BE3 A;  2R9I A;  1S3J A;  3CCJ V;  2AW9 A;  4LWS A;  2FB5 A;  1X59 A;  3WG7 B;  2A3Q A;  5K1P A;  4DR6 O;  3A8T A;  1JMK C;  1GN6 A;  2D2C B;  2ZNJ A;  1VQ7 V;  4NKG B;  1AI7 A;  3K58 A;  1UJW B;  2LP7 A;  2Q7H A;  4PDM A;  4NTY A;  4UCR A;  2IH3 C;  3JCZ A;  4DV0 B;  3CD6 V;  3IC9 A;  3JAW A;  5JWP A;  2UU9 O;  5BXZ A;  2WLK A;  2DW4 A;  4FJC C;  4CH6 A;  4CC6 A;  2YC0 A;  2HKO A;  2YI8 A;  3B77 A;  4LF5 O;  4DV2 O;  2G38 A;  4LBE C;  1H2G A;  4IIJ B;  4IL6 Z;  1QCE A;  3CB2 A;  5D5P A;  2CDY A;  1HP8 A;  2W0F C;  3F7V C;  4AI8 A;  2PUS A;  4DXW A;  2V4D A;  5B5E Z;  3W7W A;  5KHI A;  3QO7 A;  3RYF A;  5IJ0 A;  3CYO A;  4Z1V A;  1M57 C;  1H8H G;  2GBO A;  1WA8 A;  1N32 O;  4GUN A;  5FNV A;  2F1M A;  3SGI A;  1BCC H;  5A9G A;  3IC7 A;  4NTX A;  3K9S A;  5J2U A;  4GZR B;  4LH6 A;  2BCC H;  5DEC A;  2HJD A;  3D3Q A;  2IM9 A;  2X6C A;  2EIL B;  4XDJ A;  2EIM B;  2ITD C;  3ZRW A;  4A5U B;  4TV8 B;  1BSM A;  1OCO B;  2UU9 B;  1VAR A;  4MTO A;  5IJ9 B;  2CGO A;  2E75 B;  2QM4 A;  1ZTE A;  1JCH A;  3CMA V;  4FLW A;  4QE9 A;  3TXQ A;  3SPG A;  1IDS A;  4DV2 B;  4WFB V;  4LF5 B;  1V55 B;  2BTQ B;  1MA1 A;  4DK0 A;  1E1Q G;  3OM3 B;  1S5L Z;  4J42 A;  3BCC H;  2YIC A;  4RUF A;  1Q6H A;  4EEQ A;  4EFB A;  4P30 A;  4ZKI A;  3L71 H;  2JGD A;  3OTO B;  4UFZ A;  3ZS8 C;  1ORQ C;  2V7Q G;  5EC2 C;  1N32 B;  4B3R O;  2N05 A;  4D7S A;  5B66 Z;  2P90 A;  2Q8V A;  2ETN A;  1XMO O;  1AIL A;  4GX1 A;  5B1B C;  2VRZ A;  3AK1 A;  1V54 B;  3WG7 C;  1FXK B;  1Q6U A;  5DM6 V;  1NTZ H;  5LHI A;  3AG4 B;  1IUR A;  3TK1 A;  4LF9 B;  4JAV A;  4ZOL A;  2PI4 A;  1SQG A;  1HNX O;  4TUY B;  3QF7 A;  1B6Q A;  4ZI7 A;  3AG7 A;  4RUE A;  1U97 A;  3E8B A;  4JPR A;  1HR0 O;  1K5S A;  5L3F A;  2QGN A;  2ZNI A;  3N2K B;  5IYZ B;  1ZLZ A;  5KA6 A;  4PEL A;  2RJZ A;  1PPJ H;  2JJ2 G;  4Q20 A;  1JFF A;  3CX5 F;  3E2E A;  5KUK A;  4ZHQ A;  1EN6 A;  5CB4 A;  4BW9 A;  3K59 A;  5JJE B;  4QNH B;  1MSD A;  5BR8 B;  1ZSP A;  3CRM A;  1O9H A;  4FM0 A;  2HFE C;  2Q7E A;  3AG2 B;  4RQF A;  1R3I C;  4MVU A;  2XT9 A;  4TV9 A;  2CUG A;  5CA3 A;  4TOI A;  2QSA A;  5EBM C;  2JEU A;  1M5I A;  4HZ3 A;  4NVP A;  3FFQ A;  2AHZ A;  5LGN A;  4PA4 A;  4R7C A;  3MDS A;  2EIM C;  3FX7 A;  4LC1 A;  4UCT A;  1OCO C;  3A0H Z;  5KA5 A;  1N33 O;  3C3T A;  4FM2 A;  1Z2G A;  2Q69 A;  1E79 G;  1FAF A;  4R50 A;  4MVQ A;  1K9M W;  3M7M X;  3BEH A;  1A32 A;  5LP6 B;  1V55 C;  1NR1 A;  2B5U A;  3HB3 B;  3LNN A;  1I08 A;  4RO2 A;  2YEV A;  2Y0I A;  1XNQ O;  1IX9 A;  1JJ2 U;  4WFG A;  3RYI A;  2DYS B;  3SPH A;  3UO3 A;  3NR7 A;  1PM9 A;  4CBC A;  3FYI B;  5GTH Z;  1JVM A;  4LFC O;  3H9V A;  3B2E E;  5EZY B;  3TCU A;  2OYQ A;  3ZMV A;  4I9Q A;  2ZR3 A;  1LUW A;  2ZE7 A;  2NNU A;  4I4T B;  2KQX A;  4HBN A;  5LGU A;  1V54 C;  4JZ2 A;  1SQP H;  3D36 A;  3FB8 C;  1WP7 A;  3KZI Z;  1MZF A;  3DSQ A;  5LYJ B;  4G28 B;  1FXK C;  1R6T A;  1M9N A;  1VF6 C;  1WPB A;  4X8A A;  5LXT B;  4JI3 O;  2BOB C;  3AG4 C;  4CH3 A;  5KX5 A;  3K9A A;  3BY6 A;  3QTC A;  1RPR A;  1XL6 A;  3L70 H;  3E22 B;  1L0L H;  2E76 B;  1D5N A;  2OCC C;  4UB6 Z;  3OUF A;  5KMG A;  1ZUQ A;  1VQO V;  4PA3 A;  2RDC A;  5JQG B;  1PNK A;  3ZMS A;  1DF5 A;  4LFC B;  2P4V A;  2BSK A;  3RT3 C;  1M56 C;  1AR5 A;  1K3E A;  3OTF A;  2OT5 A;  3SPJ A;  2R9R B;  3HKE B;  3ZHV A;  3E83 A;  5EYP B;  1KKC A;  3JAK B;  1FXV A;  3MAQ A;  1K4C C;  3K79 A;  2XAJ A;  2DWE C;  2HEP A;  3FKS G;  4O2B A;  2VQF B;  4DR3 O;  4DYL A;  2KB1 A;  3RYH A;  2EZO A;  3JAM N;  4MVO A;  3JD0 A;  4PI2 A;  4JTA B;  4JI3 B;  1Z5W A;  4UCS A;  4GLX A;  1WB7 A;  1BHA A;  4JI7 O;  4AHC A;  4FK5 C;  1MNG A;  3BAB A;  3L72 H;  2Y48 A;  4ICG A;  5BY1 A;  4O2A B;  1U96 A;  2LJ2 A;  3A2F A;  4NTW A;  2CAZ C;  5C8Y A;  1JX9 A;  5DN6 G;  5C93 A;  1BZK A;  1VQ9 V;  3N2G A;  3CXC U;  1GM7 A;  1XEQ A;  5GON B;  3ASN C;  1AP6 A;  4PV1 B;  3JAL A;  5LP6 C;  4JAS A;  4D7T A;  5JH7 B;  1VIB A;  4F4L A;  3JSL A;  2JRI A;  4JI0 O;  3ABK B;  3FB6 C;  2DYS C;  3RGB A;  4X1K A;  3S3X A;  1SET A;  2ZE6 A;  3T1C A;  3I55 V;  4U3J A;  5LGT A;  1KBH A;  4X62 O;  3ZHQ A;  1G1X B;  4KP4 A;  1ZWI C;  4FIP C;  3OMI B;  1AI6 A;  2WSS G;  4FFB A;  4LF6 B;  4O4J B;  3W7X A;  3DXR B;  1GN2 A;  4O4H B;  3O65 A;  5A2Q N;  3B4S A;  1BHB A;  3EXA A;  4YJ3 A;  3UT5 A;  1LNQ A;  1BQZ A;  1T5E A;  4PDL A;  2QE7 G;  3SR2 C;  3HKD A;  3ZMZ A;  2OTJ V;  4X66 B;  4XBF A;  4NXN B;  2ZXW B;  2XAS A;  1S5H C;  4JI0 B;  2RQ6 A;  1L0N H;  3CCV V;  2YXY A;  4B3T O;  1H2S B;  4OPA A;  3OR6 C;  1FFX A;  1R3J C;  1Y66 A;  4I50 A;  3RYC B;  1HNZ B;  4IHJ B;  2DQ0 A;  1SC5 B;  5BZB A;  1VQK V;  3EHB B;  3CCE V;  3K03 A;  2XND G;  1BT8 A;  1PL0 A;  2HJF C;  5J9P C;  2H94 A;  1NR7 A;  3R65 A;  2F66 C;  1Y76 A;  4MSW C;  4U3F H;  4XDK A;  2QWQ B;  2RNB A;  3ZN1 A;  3JSN A;  1P7G A;  4PDV A;  4GT1 A;  1Y6X A;  1M1K W;  3N27 A;  5LBQ A;  5IYB O;  5KAI Z;  1I5X A;  5KUM A;  3U10 A;  3FB7 C;  2QKC A;  5J2T A;  4O4I A;  4O4L A;  2CH7 B;  1ROP A;  3ZIA G;  3LUT B;  3BHP A;  5L3E A;  3D3I A;  1XRE A;  3CJH B;  4I7Z B;  2EJ7 A;  4IGG A;  3JAS B;  3CME V;  1BQ0 A;  4J11 A;  4GKK B;  3OT7 A;  4DW0 A;  1CXZ B;  3ZMU A;  4DV0 O;  4WFH A;  3STZ C;  2QM8 A;  1WAZ A;  3JD1 A;  4BW5 A;  4JYC A;  1SA0 A;  4LFA O;  3E89 A;  3JAW B;  3ABK C;  3OEH G;  2F95 B;  4P9O A;  3WB0 A;  2MW2 B;  1LR1 A;  1OCR C;  2EIN B;  2R9A A;  1Q82 W;  4JAA A;  1XL4 A;  5H5N A;  3LSS A;  5LHH A;  4F6R A;  4MVR A;  1N0J A;  3LDC A;  1W59 A;  1GAX A;  2HVJ C;  1FD9 A;  2QWR B;  5IJ0 B;  1W0J G;  2B1I A;  2DOS A;  2M7W A;  1WJZ A;  1BE3 H;  1NI8 A;  2Z5U A;  1R6N A;  5B1A B;  3J80 N;  1GMG A;  3CHX A;  3OUS A;  3H1H H;  4QE7 A;  5J2U B;  1FS0 G;  2ARH A;  3TGU H;  1KUQ A;  4P2Z A;  3CCS V;  2JIZ G;  4LFB O;  4P9P A;  1XI1 A;  4LFA B;  4X1Y B;  4CS3 A;  3VBB A;  3CRA A;  3E8F A;  1UPG A;  2X6A A;  4J10 A;  5BMV A;  2XAH A;  2WA3 A;  4GCZ A;  4EKW A;  1L1F A;  3OR7 C;  4BIZ A;  1H2K A;  1S5J A;  3T4D A;  4JI4 O;  4JI6 B;  1W0K G;  2QKA A;  4JI2 O;  4UVB A;  1IBM O;  1NQT A;  2F4V O;  1AJQ A;  4U7O A;  3H1L H;  3KKY A;  1RP3 B;  1NH2 B;  1S0V A;  1PV0 A;  3ZBH A;  2Q73 A;  3K0G A;  1O9G A;  4OGQ B;  3ZRX A;  3OTO O;  2PYJ A;  1SF9 A;  2Q4P A;  1QLN A;  1TUB B;  2JGD B;  1GK9 A;  1QVG U;  2B1G A;  4H44 B;  4LNU B;  2EX3 A;  1NT2 B;  4B7K A;  1EZJ A;  1D5A A;  3ETD A;  1UFI A;  2HVK C;  5GW7 A;  3OMN B;  1Q90 D;  4YJ2 B;  4LFB B;  4JYY A;  1AJN A;  1KYO F;  1YCI A;  3H01 A;  4LF7 B;  1P7B A;  1QR9 A;  2KSD A;  1ZAU A;  2JGU A;  4LF9 O;  4DV7 O;  5D5Q A;  1Q6I A;  4JI4 B;  1YVW A;  3JYC A;  1EN4 A;  3ABT A;  5FPO A;  4JI2 B;  3OFN G;  3OEE G;  4ZOL B;  3K5N A;  1IBM B;  1K4D C;  3SDL A;  4PJ0 Z;  2F4V B;  1YTF B;  1F23 A;  1J5E O;  3UCS C;  2EBO A;  1W2B U;  2ZIN A;  1RSO B;  3UQ8 A;  1THZ A;  1YZB A;  4MVZ A;  1OHH G;  1Y74 B;  2P06 A;  3ZHS A;  3RN4 A;  3RVY A;  3W7T A;  2OIG A;  2FL4 A;  4I55 A;  2EIN C;  1EZV H;  2N74 A;  1JFF B;  5ITZ B;  4UVA A;  5KAF Z;  5JJN B;  5BR8 O;  1P84 F;  2Q9L A;  2PGG A;  2ZM6 B;  3HKC A;  3SYO A;  3RW0 A;  3ABU A;  2Q7G A;  1L8D A;  4QJF B;  3HKB B;  2WLM A;  3P3P A;  3UKM A;  1BMF G;  1XMQ O;  3X2Q B;  1SES A;  1NTM H;  4MVM A;  2P4K A;  3P30 A;  3LSU A;  5JCO C;  5B1A C;  5IYD O;  3L75 H;  4LF8 B;  2ZKO A;  4DV7 B;  4TV8 A;  2E5L O;  1SER A;  4GX5 A;  5H6R A;  3E8H A;  1VP7 A;  2BTO A;  5IJ9 A;  2UXD O;  4W4L A;  4E2L A;  4EB6 B;  4L87 A;  5KHJ A;  2AXT Z;  1OZ0 A;  4FZ0 A;  3SYQ A;  1J5E B;  3Q4H B;  5KHG A;  2Q5Z A;  1YF2 A;  3KCY A;  3IFX A;  2BTQ A;  3ABM B;  4DV6 B;  1F7Y A;  1PD3 A;  2LFS A;  5E79 Z;  5F2V O;  2QWN B;  1G4Y B;  1YJ9 V;  2DMX A;  1TA8 A;  2DWD C;  4UCU A;  1JQ0 A;  2X0L A;  2ZE8 A;  4FFK A;  4RWU A;  4J7Z A;  2XAQ A;  2PY5 A;  3HPL C;  2ADQ B;  3M8A A;  3AEI A;  4X1I A;  2W6J G;  3K08 A;  3E8G A;  3QVN A;  1KP2 A;  1XMQ B;  2IJJ A;  1OCZ B;  1SS3 A;  4MT8 A;  1KKD A;  1BGY H;  3E35 A;  2Q6A A;  1VEW A;  4JV5 B;  1I7F A;  5L3G A;  3GWK C;  5EIB C;  4GYC B;  1GRJ A;  2E5L B;  4UCV A;  5LA6 B;  1TVK B;  3AG3 B;  1FXK A;  2WAM A;  2P22 C;  5L3D A;  1VF7 A;  3K57 A;  2UXD B;  1R3K C;  2EIL C;  5CA0 B;  1VF6 A;  1US6 A;  2JS3 A;  2B9Z A;  2F93 B;  4JYB A;  1Q7Y W;  1HWY A;  2UUB O;  4DV3 O;  1OJH A;  2OIE A;  1YIT V;  2R70 A;  3H1K H;  4KHP B;  3W7S A;  4K8Z A;  4CS4 A;  1OCC B;  2W6I G;  5IYZ A;  2Y4T A;  4OX9 O;  4I0X A;  1K34 A;  1M4U A;  4MTG A;  4X20 B;  3T1Y B;  2W0X A;  3D8C A;  4KUM A;  1R73 A;  1FYJ A;  2V1D A;  2P5O A;  3K5M A;  2QEX V;  1X4T A;  2JJ1 G;  3CS5 A;  5EC1 C;  3T2M A;  3U0Z A;  2ZE5 A;  3SYA A;  1KQS U;  2CTW A;  4EFE A;  5DED A;  5IWA O;  1K33 A;  1P49 A;  3FAV B;  2YSU B;  4CC5 A;  1IXB A;  1GM9 A;  3VQV A;  1YSC A;  3I5D A;  2X7R B;  4U7N A;  2VQF O;  4DV5 O;  3C3S A;  3KG2 A;  4BWA A;  4O2B B;  4DRX B;  2JK5 C;  2JS5 A;  2UUB B;  4DV3 B;  1M93 A;  2Z0A A;  1YXB A;  3RWR D;  1IXM A;  3ABL B;  2Q0A A;  3JAR B;  4OX9 B;  3GB7 C;  3APO A;  4DK1 A;  2QWO B;  4I9W A;  3WU2 Z;  3U11 A;  2A06 H;  3JAT B;  1YI2 V;  3IGA C;  4JI5 B;  5LP6 A;  3NXS A;  3ABM C;  4HNA B;  1K7D A;  1K97 A;  2LFR A;  4H0L B;  5IWA B;  4NR1 A;  1COW G;  1Q8I A;  2CTR A;  4FPP A;  2X6B A;  3K06 A;  3VQY A;  2ZDI C;  3S3W A;  2ZIM A;  2P6J A;  3CRQ A;  3AG2 C;  2NR5 A;  1PKX A;  1Y4M A;  5EZY A;  3SPC A;  4DV5 B;  2AZ2 A;  3WB2 A;  1SKV A;  3TET A;  3BRC A;  4JTC B;  2PZS A;  4LCU C;  3CC4 V;  1MZE A;  4JI8 O;  1H2M A;  1MMM A;  3THO A;  4FLU A;  1SQB H;  4PA9 A;  2N04 A;  2AZ0 A;  1ARO P;  3RBZ A;  4LF6 O;  1AJP A;  2CTQ A;  5TIS Z;  2HR3 A;  3B40 A;  1B06 A;  1B04 A;  5LYJ A;  3CCU V;  1Q81 W;  4C7U A;  4ASU G;  5LOV A;  2HHH O;  4JZG A;  1GN4 A;  1TGO A;  3FD9 A;  5H6Q A;  1N34 O;  1AB3 A;  2RMK B;  1F4M A;  3TXS A;  4WBN B;  4ZIB A;  1G8M A;  2DYR B;  4WFE A;  2EIK B;  3E22 A;  3FYE B;  1R3L C;  4X66 O;  1XHZ A;  3G6B A;  4HAM A;  2Y69 B;  4FMT A;  1GKF A;  3GVM A;  4X89 A;  4NXN O;  1QBZ A;  5JQG A;  1AI4 A;  3ASO B;  3OE7 G;  5JVD B;  3JD3 A;  3UM7 A;  4MW8 A;  1XDC A;  4B3M O;  1NU1 H;  2CK3 G;  2WLL B;  5HFL A;  1F51 A;  3HKE A;  1HNZ O;  5EYP A;  2QJ1 A;  1IBL B;  1DF4 A;  2IBZ H;  1SZT A;  5LMN B;  4JI8 B;  2GV9 A;  4H13 B;  3CE2 A;  2FML A;  2EZP A;  4CH5 A;  1YHQ V;  3SJQ C;  2H3O A;  1VQ8 V;  4HYO A;  3APQ A; 
#chains in the Genus database with same CATH homology
 5B1B C;  2HVJ C;  3K3W A;  1VQN V;  1VQ4 V;  4G2K A;  1V54 B;  1W0J G;  2B1I A;  3MHH C;  2M7W A;  3WG7 C;  2XOK G;  1AI5 A;  2Z5U A;  1R6N A;  2IH1 C;  4TSF G;  5B1A B;  1FXK B;  1GMG A;  3QNE A;  4G27 B;  3OUS A;  2WPD G;  5DM6 V;  1FFT B;  3ABL C;  4QE7 A;  5LHI A;  2AHY A;  1FS0 G;  3AG4 B;  4H37 A;  3TK1 A;  4TWK A;  5L3C A;  4JAV A;  1CP9 A;  2PI4 A;  2IW5 A;  3I56 V;  4P2Z A;  5CBH A;  3CCS V;  1B6Q A;  2JIZ G;  4RUE A;  4P9P A;  4TT3 G;  3E8B A;  4JPR A;  1PNL A;  1E1R G;  3VBB A;  1MSW D;  3E8F A;  1K5S A;  2GSM B;  5L3F A;  5L3B A;  2X6A A;  2XAH A;  4GCZ A;  4EKW A;  1L1F A;  3OR7 C;  3ZMT A;  4BIZ A;  5KA6 A;  4PEL A;  3T4D A;  2EIJ B;  1W0K G;  3PJS K;  1JPX A;  2JJ2 G;  4Q20 A;  1MOF A;  3WFV A;  5H9C A;  4UVB A;  1NQT A;  3E2E A;  4X88 A;  2WLI B;  1AJQ A;  1DTO A;  4MS2 A;  4OXS A;  4U7O A;  2P7T C;  5KUK A;  3CCL V;  4PA7 A;  1NH2 B;  3JD4 A;  1S0V A;  1OCZ C;  1F4N A;  3DGE A;  4QNH B;  1NBM G;  3K0G A;  3F5W C;  3RVZ A;  3ZRX A;  3SYC A;  2HFE C;  1YIJ V;  1NVP D;  1Q86 W;  1QVF U;  3AG2 B;  4JGS A;  4RQF A;  1QLN A;  3F7Y C;  1R3I C;  3AG1 C;  2F43 G;  1GK9 A;  1QLE B;  2B1G A;  4MVU A;  1QVG U;  5CA3 A;  3AG3 C;  1GO3 F;  3ZRV A;  4PA6 A;  4J9Z B;  5EBM C;  2JEU A;  4HZ3 A;  1K92 A;  1S72 V;  1EZJ A;  2AHZ A;  3ETG A;  1GTO A;  3ETD A;  4PA4 A;  4R7C A;  5IY5 B;  5LGN A;  4YXW G;  2HVK C;  5GW7 A;  3B8M A;  1K5Q A;  2HLD G;  3OMN B;  4UUJ C;  3EFF K;  3DTU B;  5HFM A;  2EIM C;  5B1O A;  1AJN A;  3H01 A;  4LC1 A;  4BIU A;  1P7B A;  1QR9 A;  1OCO C;  1KEC A;  1OCC C;  4QIW F;  5KA5 A;  3CP1 A;  1PNM A;  1K8A W;  2Q69 A;  1E79 G;  3JYC A;  4R50 A;  4MVQ A;  2OTL V;  4ZBM A;  1K9M W;  5CBG A;  3ABT A;  4GX0 A;  5IYC O;  3BEH A;  3ASO C;  3OFN G;  3OEE G;  2NLJ C;  2A0L A;  1K4D C;  4PDR A;  3OW2 U;  1YTF B;  2C2A A;  1F23 A;  1V55 C;  4JF3 A;  1NR1 A;  2B5U A;  3HB3 B;  2EBO A;  1W2B U;  4RAI A;  4RO2 A;  1I5Y A;  2YEV A;  2FTK A;  1JJ2 U;  4WFF A;  1THZ A;  4MTX A;  1RM1 B;  4MVZ A;  4WFG A;  5B3S B;  1OHH G;  4WF9 V;  2DYS B;  3SPH A;  1WLE A;  2QM7 A;  5CN0 A;  3RVY A;  3OAA G;  2ZR2 A;  3W7T A;  4CBC A;  3FYI B;  4DO2 A;  3SYP A;  1JVM A;  2EIN C;  1NKD A;  4GX2 A;  3LNM B;  3LDD A;  4UVA A;  2IU0 A;  3TCU A;  4UXN A;  1OCR B;  3ZMV A;  2H8P C;  2ZR3 A;  3SYO A;  3RW0 A;  3ABU A;  1N8R W;  4CZZ A;  2NNU A;  2K1E A;  4QJF B;  2IJI A;  5LGU A;  2WLM A;  5IDJ A;  3UKM A;  1BMF G;  2ATK C;  3X2Q B;  1V54 C;  3FB8 C;  3D36 A;  1SES A;  4MVM A;  1CPY A;  3P30 A;  5B1A C;  5IYD O;  4G28 B;  1FXK C;  1M9N A;  1MAB G;  4X8A A;  3SPI A;  1SER A;  4GX5 A;  5H6R A;  4R8C A;  3E8H A;  2BOB C;  3AG4 C;  2JEX A;  1VQM V;  3E86 A;  2ZXW C;  4E2L A;  3K9A A;  3BY6 A;  4L87 A;  1RPR A;  3ZRW B;  1XL6 A;  1OZ0 A;  3A0R A;  1KC8 W;  3SYQ A;  5EBW C;  2D3O W;  1VQ5 V;  1AR1 B;  4I5S A;  2OCC C;  1P4R A;  3LSQ A;  3OUF A;  1FXH A;  2DQ3 A;  2JDI G;  3IFX A;  4MW3 A;  4R6Z A;  3ABM B;  1VQO V;  4PA3 A;  1PD3 A;  1PNK A;  2LFS A;  3ZMS A;  3ZCC A;  2WLL A;  1G4Y B;  1YJ9 V;  2EIJ C;  1VQP V;  1DF5 A;  2DWD C;  1QR8 A;  3K04 A;  3CC2 V;  3P32 A;  1NVP B;  1M56 C;  1ENV A;  1JQ0 A;  1K3E A;  2P67 A;  2X0L A;  2OT5 A;  4UV8 A;  3SPJ A;  2R9R B;  3E83 A;  4LP8 A;  2XAQ A;  3CPW U;  3G4S V;  3HPL C;  4QPJ A;  2GHY A;  3AEI A;  4JTD B;  1FXV A;  2W6J G;  3K08 A;  1K4C C;  3E8G A;  3K79 A;  2XAJ A;  2DWE C;  3FKS G;  4RQE A;  1KP2 A;  2WWW A;  5B1N A;  2IJJ A;  1OCZ B;  1YJN V;  3G71 V;  4MT8 A;  2UXN A;  1KKD A;  1EBO A;  3E35 A;  3CCM V;  1QLE C;  1JOY A;  3ML0 A;  2Q6A A;  2KB1 A;  1M57 B;  2EZO A;  5L3G A;  4MVO A;  3FB5 C;  3JD0 A;  5EBL C;  2ZQM A;  4MTF A;  4JTA B;  1BL8 A;  1NH2 D;  3ETE A;  2IJH A;  2QTO A;  3AG3 B;  1FXK A;  5IY5 C;  2WAM A;  5L3D A;  1BHA A;  1KP3 A;  1R3K C;  2EIL C;  5CMU A;  4FK5 C;  2DYR C;  2EIK C;  2Y48 A;  2Q67 A;  2ITC C;  3OMA B;  4JYB A;  3CCR V;  1Q7Y W;  1HWY A;  1JX9 A;  2Y69 C;  5DN6 G;  5C93 A;  1CEZ A;  1VQ9 V;  1YIT V;  3T4Z A;  2BOC C;  1GM7 A;  3STL C;  3CXC U;  3W7S A;  3ASN C;  2XAF A;  3CCQ V;  2WLJ A;  5LHG A;  1M90 W;  1S77 D;  2IU3 A;  1OCC B;  2W6I G;  4MVS A;  1RPO A;  4JAS A;  1K34 A;  4H33 A;  1H38 A;  4MTG A;  3W7U A;  4F4L A;  2WLI A;  4BAY A;  2MK3 A;  4KUM A;  3ABK B;  1R73 A;  1RM1 C;  1J95 A;  2V1D A;  5B3S C;  1WPX A;  3FB6 C;  2QEX V;  2DYS C;  2JJ1 G;  3T2M A;  5EC1 C;  1SET A;  2EJR A;  3SYA A;  1KQS U;  3T1C A;  5FL7 G;  3I55 V;  1NJI W;  1KD1 W;  5LGT A;  1YJW V;  1K33 A;  1YTF D;  4KP4 A;  1ZWI C;  4FIP C;  2QA4 V;  2YSU B;  3OMI B;  3QO5 A;  2Z3Y A;  1AI6 A;  2WSS G;  1GM9 A;  1YSC A;  3JD2 A;  3W7X A;  2X7R B;  4U7N A;  2Q68 A;  3KG2 A;  5B1B B;  2R9I A;  1S3J A;  4N21 A;  3CCJ V;  2IJK A;  2QKS A;  1BHB A;  3WG7 B;  2JK5 C;  1LNQ A;  3OGC C;  3ZJZ A;  4XDL A;  2A9H A;  1K73 W;  4PDL A;  2A79 B;  1S76 D;  2QE7 G;  1IXM A;  3ABL B;  2WLN A;  1H8E G;  1VQ7 V;  3ZMZ A;  2OTJ V;  1VQL V;  1AI7 A;  3GB7 C;  1UJW B;  4I9W A;  3QO8 A;  2HG5 C;  2LP7 A;  4PDM A;  4XBF A;  1YI2 V;  2ZXW B;  3IGA C;  2IH3 C;  3JCZ A;  2XAS A;  1S5H C;  3CD6 V;  1GM8 A;  3NXS A;  3MD0 A;  3VOU A;  3ABM C;  3CCV V;  4Z1M G;  1SRY A;  1K7D A;  2WLK A;  2OCC B;  1K97 A;  2DW4 A;  3OR6 C;  1R3J C;  1Y66 A;  2LFR A;  4FJC C;  1COW G;  2YEV B;  2DQ0 A;  2HKO A;  4FPP A;  2X6B A;  3B77 A;  3K06 A;  1MG1 A;  5BZB A;  1VQK V;  3B8N A;  1H2G A;  3EHB B;  4LBE C;  3CCE V;  3K03 A;  3M99 B;  3ZRS A;  2XND G;  2ZDI C;  1QCE A;  2P6J A;  2W0F C;  1PL0 A;  3F7V C;  4DXW A;  3AG2 C;  1PKX A;  1Y4M A;  1M56 B;  2HJF C;  5J9P C;  3SPC A;  2H94 A;  1NR7 A;  3R65 A;  3TET A;  4JTC B;  3W7W A;  4LCU C;  3QO7 A;  4MSW C;  5EK0 A;  3CYO A;  4XDK A;  3LDE A;  3G6E V;  3CC4 V;  3AG1 B;  2WLH A;  1M57 C;  3ZN1 A;  1H8H G;  4PA9 A;  4PDV A;  4GT1 A;  4UV9 A;  1DLB A;  1ARO P;  1M1K W;  4N23 A;  3RBZ A;  5LBQ A;  5IYB O;  1AJP A;  2HR3 A;  4KFM A;  3CCU V;  3IC7 A;  1I5X A;  5KUM A;  3MHS C;  1Q81 W;  3FB7 C;  4ASU G;  1ROP A;  1EFR G;  3ZIA G;  3LUT B;  5H6Q A;  4WCE V;  1F4M A;  5L3E A;  2X6C A;  2EIL B;  3D3I A;  4XDJ A;  2EIM B;  2ITD C;  3ZRW A;  5CBF A;  4QPK A;  1G8M A;  2PI5 A;  2DYR B;  4WFE A;  2EIK B;  1OCO B;  3FYE B;  4WFA V;  1R3L C;  4MTO A;  3CME V;  4HAM A;  2Y69 B;  4FMT A;  1GKF A;  4X89 A;  1JCH A;  3CMA V;  2XAG A;  1QBZ A;  1AI4 A;  3ASO B;  4QE9 A;  3ZMU A;  4WFH A;  3OE7 G;  3ASN B;  3SPG A;  3STZ C;  4WFB V;  2QM8 A;  1V55 B;  3JD3 A;  3UM7 A;  4MW8 A;  3JD1 A;  4BW5 A;  4JYC A;  1E1Q G;  3E89 A;  3OM3 B;  3ABK C;  2CK3 G;  2WLL B;  2ZD9 A;  5HFL A;  3OEH G;  1F51 A;  2ZDI A;  2UXX A;  4P9O A;  4RUF A;  3CC7 V;  3ZN0 A;  3K0D A;  1DF4 A;  4P30 A;  4ZKI A;  1SZT A;  1VQ6 V;  1OCR C;  2EIN B;  1R6K A;  1ORQ C;  2V7Q G;  5EC2 C;  1Q82 W;  1XL4 A;  3LSS A;  4UVC A;  5LHH A;  5E1A C;  2EZP A;  1YHQ V;  3SJQ C;  1VQ8 V;  4HYO A;  3GWO A;  4MVR A;  1TUE B;  2P90 A;  3X2Q C;  4JAU A;  4J9Y B;  3LDC A;  4GX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...