2HFEC

Rb+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords FAB Heavy Chain
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hfeC00
4MW3A 2HG5C 4WFEA 2W0FC 4PA4A 2K1EA 4MVRA 3RVYA 3SPCA 4BW5A 3RVZA 5EBMC 5CBHA 3LUTB 3OUSA 4I9WA 2WLIB 5EBWC 1OCOC 3RW0A 1R3JC 3AG3C 3FB8C 3K04A 3ABKC 4PA9A 5CBFA 5B3SC 4R6ZA 2DYSC 5J9PC 3K03A 3LNMB 3F7YC 4JTCB 1J95A 4PA6A 4RO2A 3SPJA 4DXWA 4MTOA 3T4ZA 3E8FA 3LDCA 4MVZA 3AG2C 3FB6C 2WLKA 3OR7C 3SPGA 4P2ZA 5B1AC 4MVUA 4P30A 5KUMA 3SJQC 4F4LA 4RUEA 3E8BA 4H37A 1JVMA 3E86A 1LNQA 4QE7A 5B1BC 1OCCC 4PDRA 2HJFC 3ABLC 2AHYA 4GX0A 2HFEC 2Q68A 4R50A 5E1AC 3LDEA 4PDMA 4TWKA 3SPHA 3SYOA 4HYOA 3ABMC 4OXSA 4UUJC 4R8CA 3SYQA 2A9HA 1OCRC 4MSWC 3RBZA 4P9PA 2QTOA 2WLJA 3E8GA 4LBEC 3TETA 2DWEC 4PA3A 5EK0A 2P7TC 2Q6AA 4QNHB 3E8HA 3OUFA 4RAIA 4G28B 3K0GA 4XDLA 4ZBMA 3TCUA 3OR6C 1S5HC 4MVQA 2H8PC 2Q67A 4QE9A 3R65A 2A79B 5EC2C 5IY5C 3IGAC 1OCZC 4MVMA 4X8AA 3WG7C 4MVSA 3STZC 3STLC 1K4DC 5CBGA 1V54C 1M57C 4MTFA 2X6AA 4PDVA 4P9OA 4X89A 4HZ3A 3T1CA 2R9RB 5KUKA 5EC1C 3T2MA 2KB1A 2ZD9A 3SPIA 2DWDC 2OCCC 4RUFA 4LCUC 4X88A 2NLJC 3SYAA 3HPLC 5EBLC 2EIJC 3SYPA 1BL8A 4MVOA 2WLHA 3F5WC 3IFXA 2WLIA 2HVKC 4MS2A 2X6BA 1XL6A 3AG4C 4G27B 3AG1C 4GX5A 1V55C 4H33A 4J9ZB 3GB7C 4R7CA 1QLEC 4J9YB 1G4YB 2WLNA 3K0DA 2BOCC 4PA7A 2JK5C 4JTDB 4GX2A 1ORQC 3K08A 1P7BA 4JTAB 3ASNC 2WLLB 2X6CA 4WFHA 2DYRC 3T4DA 2IH1C 2ZXWC 3BEHA 4KFMA 4XDKA 4WFFA 5BZBA 2AHZA 2EIKC 2ITCC 2QKSA 2ITDC 3FB5C 1M56C 4WFGA 4PDLA 4XDJA 3UKMA 3VOUA 3E83A 2WLLA 4MTGA 3X2QC 2EIMC 2Y69C 2WLMA 3F7VC 4MW8A 3FB7C 4GX1A 3OGCC 2EILC 3ZJZA 1KKDA 2ATKC 3JYCA 1R3KC 3UM7A 2YEVA 3K06A 3PJSK 1K4CC 2IH3C 2A0LA 1ZWIC 3SYCA 2Q69A 2BOBC 3LDDA 1R3IC 3ASOC 1R3LC 3EFFK 3KG2A 1XL4A 4EKWA 3E89A 2HVJC 4LP8A 4CBCA 3ZRSA 2EINC
chains in the Genus database with same CATH superfamily
3AK1A 4X65O 5LP6B 3U10A 2F23A 5EBWC 5IYZB 4N23A 3IJ4A 3UCSC 4CS4A 3BAAA 1CPYA 2XAHA 2JJ2G 1K9MW 2Q8VA 1GK9A 1XILA 4UVBA 1H2GA 2ZM6B 4RQFA 1I94B 3C3TA 1RSOA 4O4JA 4TV9B 2WA3A 4AQYB 3SPHA 2KG7B 5BXZA 1Y67A 2D3OW 3BVOA 2QTOA 3ZRWB 1NQTA 4PA3A 1L8DA 3UQ8A 5LXTA 4LC1A 4LF8O 4XDLA 4MVQA 3L9DA 3OTFA 3QO5A 2Q67A 4JPRA 4HBNA 4UFZA 1H2MA 2YXYA 4MVSA 2BTOA 4X1YB 4HAMA 2OIGA 2X6AA 1TUEB 4P9OA 4DYLA 2ETNA 3CE2A 2M6YA 3T1CA 2R9RB 5EC1C 4LCUC 4O4LB 5D5PA 3J81N 1N33B 2ZR3A 3L74H 1O9GA 1ENVA 3NXSA 1OCZB 4TT3G 4UB6Z 1H8HG 4B3RB 4NTWA 3K9SA 3UO3A 3LSQA 1TGOA 4Z2WA 1KC8W 2WA4A 5LYJA 2HP8A 3QO8A 4JZ2A 5LHIA 3ZN1A 1VQ5V 2Q4PA 4Z1VA 2EIKC 2PTMA 2P90A 3G71V 3E83A 2EIMC 1R6KA 2EULA 2ATKC 4QPJA 1P84F 3ABUA 4JI5B 2CH7B 4YIPA 2KG7A 3WG7B 2ZIMA 3VQYA 1W0JG 3SJBC 4LNUA 4BAYA 1XDCA 1XL4A 2HVJC 2CTRA 3RVZA 3IAYA 1X4TA 3A0HZ 1AILA 4I0XB 3ZHRA 2DJVA 1BQZA 1Q81W 3JATA 2Q0OC 4AI8A 2P6JA 2CTPA 3OAAG 1SQPH 2HJFC 4ABMA 3MHSC 1WB7A 1SZTA 4DV4O 4K8XA 3L73H 1GN4A 2NR5A 4FMTA 1RM1B 4I7ZB 4P9PA 1NU1H 3TETA 1KBHA 3RYHB 4QIWF 5EK0A 2FL4A 4PI2A 5CMUA 4QNHB 2ZE8A 1G6UA 3HKCB 3K0GA 4DUYO 2ZDIA 4UB8Z 2UUBO 2YUAA 1M9NA 1YZBA 3R65A 4GYCB 4JI2O 1NBMG 5CBGA 4MTXA 4EB6B 2K9PA 3CC2V 4DR4O 5JVDA 3FD9A 1EN5A 4TV9A 4DR3O 2N74A 5JH7A 4Z1MG 1XL6A 5DEDA 3AG1C 4J9ZB 1QLEC 4UCOA 3L70H 1FJGB 4DR6B 1ORQC 4WFHA 2P4VA 2E3CA 4XDJA 4OGQB 3FB5C 4X20A 5DN6G 3VQVA 3AEIA 5L3BA 1M5IA 2JGUA 3P3NA 3B4SA 1K4CC 3CCEV 2LFRA 3ZMSA 4LH7A 5LMUO 5KHJA 4LP8A 1H38A 4DV3O 2Z3YA 4JI3B 5GONB 2W0FC 1SQFA 1YI2V 2JIZG 1OCRB 4DV3B 1F51A 2RQ6A 3H9VA 2B5UA 1QQCA 1EBOA 4JGSA 3FAVB 1IBLB 1HNXB 1AR4A 1ZX3A 1NZ6A 1QR9A 1PD3A 1NVPD 5KHGA 3E8FA 4P2ZA 2CTWA 4F4LA 1S0VA 3A8TA 4JI1B 5H2FZ 2CGNA 2P67A 2HFEC 4DRXA 4TWKA 1VQOV 5IYCO 1MOFA 2ADQB 3JALA 2F1MA 3W7XA 1HP8A 1FXKC 1YF2A 3ZEDA 4BR6A 2VWJA 2Q7GA 2Y4TA 1FYJA 5IY5C 2JS5A 3AG7A 2VQFO 1N0JA 1JX9A 2GBOA 4UV8A 2PZSA 4CH5A 4NB5A 5JVDB 2WLIA 3WU2Z 2WSSG 2YS8A 3FYIB 3H1KH 3K5MA 1DGSA 1LUVA 4JTDB 4U7OA 2XT9A 1UJWB 1QHTA 1SC5B 3T4DA 1B06A 4X1IA 4LF4O 2IJHA 1MA1A 2PY5A 4WFGA 2H3OA 4DV4B 3X2QC 4YJ3A 4DV1B 3E22A 3CWBH 3S3XA 1M93A 3OT7A 2DMXA 5L3CA 3S3WA 1Q6IA 1NI8A 1HW7A 1PM9A 4F6RA 2BOBC 1J5EB 3E89A 3GVMA 4FPPA 4IHJB 5CBHA 2QGNA 3ABTA 4U3JA 3F7YC 4PA6A 2UUAB 3R66A 4DV0B 2HKOA 3SJQC 3MHHC 4BIZA 2F4VO 3E86A 4YJ2A 4O4IA 1ZTEA 3ZHVA 3CXHF 1RFYA 1VQ7V 2P06A 3PN1A 2EIMB 5HFMA 1AR1B 1OCRC 5FNVA 1M90W 3JAWA 1LUWA 1XREA 2MW2B 4RAIA 2E76B 3CMAV 4JI4B 5JQGB 1S5HC 4OX9B 1X59A 5KMGB 1SQBH 4NXMB 2HLDG 2FTKA 1BS3A 4O2AB 5KUKA 1P7GA 2UXXA 4DV7O 2LGWA 3M99B 2DWDC 2Y4UA 2W0XA 1EN6A 1MZFA 4DV0O 3SJAC 3QVNA 4ZOLB 3OTOO 1IBMO 4NXNB 4IGGA 1MSWD 2Q7EA 1G4YB 1NH2B 4JI4O 3HB3B 3G80A 3VQWA 4X65B 3U0ZA 2UXDO 1Q86W 4DV2O 1XMQO 3JD1A 3RFRA 4RWUA 1S5JA 4PDLA 2Y69C 3ZBHA 4PV1B 4F6EA 4JV5B 1KYOF 4LR3A 4ZIBA 2YIBA 2QJ1A 1URFA 2A0LA 2LFSA 2PGGA 1BHAA 3ZRSA 5H9CA 2GSMB 1AJPA 1AI7A 1HNWB 4FFKA 2R72A 1H2LA 2JGDB 1SF9A 3APQA 1US6A 4PELA 5LXTB 5J9PC 5LP6A 2W6IG 4ZHQB 5B1OA 4DXWA 5KLVH 5LHHA 3T4ZA 4GKKO 2LP7A 4ZI7A 5B1AC 2C2AA 3JASB 4RUEA 1V55B 1VIBA 3O9OA 2JVDA 2JGDA 4LF6B 1FXHA 4JI1O 2B1IA 5B1AB 2JEUA 4O4HB 1H2KA 2YXHA 3FAVA 2QDOA 3N2GB 4U3FH 3QO7A 3RYIA 5LGNA 5EYPB 2CUGA 5L3DA 1G8MA 4CH6A 3UO2A 4WFAV 1F7YA 1XOUA 1ZL8B 1P4RA 3G4SV 1S5LZ 2OCHA 1CXZB 2RDCA 4B3SB 1I5YA 4LNUB 3CMEV 2CK3G 5TISZ 1AI6A 1QLNA 2YEVB 2WLHA 4I55B 1JOYA 5EYPA 5EZYB 3AG4C 2KKWA 5F2VO 3APOA 4DR1O 2EBOA 1VF7A 3N2GA 3A0BZ 1DF5A 4DR4B 1Q43A 4GX2A 4RQEA 2QM7A 3AK2A 4IYIA 5JWPA 5GTIZ 1VF6C 4UXNA 4XDKA 4W4KA 4UV9A 4TQDA 2KQXA 1M56C 3OD4A 4TSFG 1WJZA 1TUBB 5KMGA 2WLMA 2EILC 2CE4A 2LJ2A 1KUQA 3JYCA 3OMNB 1MSDA 4LF9B 2UU9B 1KMIZ 3O65A 2RMKB 2XAGA 2JDIG 2YI8A 5KHHA 3OEHG 1YITV 1S76D 5J2TB 4DR2B 1MNGA 1SQGA 1TVKA 4UCUA 2QM8A 1R3JC 3ABKC 4MT8A 3RYHA 5FLXN 4DUYB 2XTAA 1NJIW 5L3FA 1AR5A 5EIBC 4YY3B 2QTSA 3JAWB 2ZKOA 1I0HA 1VQKV 2Y0PA 3I5DA 2RN9A 4DR7O 1LNQA 5B1BC 5IT9N 3SDLA 4KL1A 1F23A 4R50A 2YSUB 1WLEA 3BHPA 3WB0A 2UXNA 3BPZA 3RWRD 3ABMB 3CHXA 2A9HA 3OM3B 5LP6C 3E8GA 4I0XA 2CTQA 4YJ2B 3CCJV 3VBBA 4GLXA 5B1BB 3H1HH 1FKAO 1UFIA 3ASOB 4LF6O 4YY3O 4GUNA 5AG2A 1WA8A 4FLWA 2ILMA 1V54C 3JAMN 2MK3A 4F6RB 4LFCB 1RP3B 1PKXA 1M1KW 3D3IA 4TV8A 2NLJC 2RJZA 1XNQB 2EIJC 1BGYH 4GKJO 3CCVV 2P22C 3IFXA 1YIJV 2AGAA 3CRCA 1WNSA 2N05A 1T5EA 4NTYA 2ZDIC 1H2NA 4PHZA 1NR7A 3K08A 5FNVB 3DC6A 2GTAA 1ZAUA 2AHZA 2ITCC 3CRQA 3ZN0A 4MTGA 1EM1A 1OV9A 4X62O 1SESA 1N34O 4K0KB 3LNNA 4JYYA 2IU3A 2IH3C 3L72H 2Z5UA 4J41A 1AI5A 1VF6A 1Q7YW 4MW3A 4ASUG 2K1EA 4K3AA 1PL0A 1JJ2U 4JASA 2Q5ZA 1YTFD 1GO3F 3ZX6A 1KKCA 5IWAO 4FM2A 3OGIB 4O4HA 1GN3A 4JYAO 4B3TB 3RYFB 3ABLB 3SPJA 4G2KA 5B5EZ 3RYCA 2V4DA 3ZS8C 3CCLV 3W7WA 4B3SO 1OJHA 5E1AC 2YDEA 3LDEA 4JZGA 1THZA 1Z5VA 4NR1A 1XMOO 2A3QA 5IYZA 1FXKB 4ICGA 1GN2A 4DV1O 4JI0B 1FFXA 2H8PC 4AHCA 1B3QA 2IJIA 4MVMA 2UU9O 3GWOA 4H0LB 4LWSA 5IE9A 4LFBO 2KB1A 3SPIA 4YIOA 2OWOA 5E79Z 3SR2C 1GN6A 3TGUH 4CC6A 1XI1A 4MS2A 4LF7O 4Q6GA 3B8NA 3K5NA 4WF9V 1BMFG 4YHHB 3K0DA 4D7SA 5JH7B 2CAZC 4UCTA 1K33A 5LA6A 1P7BA 2EJ7A 4PJ0Z 1BE3H 3Q4HA 2ZXWC 3B09A 1L1FA 1VF5B 3D36A 1NTMH 1EN4A 2ITDC 4I50A 3UKMA 3EVKA 1HDJA 3OGCC 1CEZA 3TXSA 1BQ0A 1R3KC 2Y0IA 2P5OA 1N33O 2QWOB 1VARA 1E79G 2IJKA 1ZWIC 5LYJB 2E5LB 1R6NA 3KG2A 2UUBB 1LR1A 2ZT9B 4IL6Z 2EINC 4HNAA 2GHYA 3RN4A 4W4LA 1VQ4V 5C93A 4B7KA 4I5SA 1N36B 4R6ZA 3F5TA 5J2UB 4BWAA 4LF5O 4A5UB 4DUZO 2QE7G 4BIOA 2VRZA 1B6QA 1SETA 1YVWA 1AI4A 4DV7B 3BRCA 2BCCH 4JI7O 3ZMTA 1V9PA 2XOKG 4R8CA 3RBZA 4FM1A 4U3JB 1IXBA 2P7TC 4J42A 3E8HA 3JSNA 4G28B 5BR8O 1U96A 3JD4A 4UVCA 4X62B 4DR2O 3JARB 4LFCO 4B3RO 4QGPA 1PNKA 1WP7A 2QKAA 5KX5A 3K58A 4DR1B 1E1QG 2ARHA 4HZ3A 3ML0A 1XHXA 4EB6A 1WA8B 3ICXA 1YJWV 2PF4E 1I7FA 2F4VB 3WB1A 1K5SA 1V55C 2UXDB 2XUMA 3CD6V 4JI3O 2WLNA 2CH7A 2IU0A 3CP1A 1L0NH 2QKSA 4EEQA 3RT3C 4AQYO 3FB7C 3QTCA 4J7JA 4FVMA 3CS5A 2IBZH 3OFNG 4JI6B 2XNDG 3K06A 3PJSK 5LMNO 4B3MO 2V7QG 1FXVA 1EZVH 3W7TA 4D7TA 2EILB 1K8AW 2VQFB 1OCOC 2FMLA 3RW0A 3K04A 1RPRA 3B77A 4PA9A 4LF9O 1Y76B 4TQFA 1GAXA 1K97A 2PUSA 4D6TH 3Q4HB 3G6EV 1W2BU 2E74B 4Q20A 3T1HO 4CH3A 3BFRA 1VQLV 2RNBA 1DF4A 3ASNB 1AROP 2YIBD 1XNRB 5IY5B 1VQMV 5LOVA 1SQXH 5BMVA 4X64B 2UXCO 1IBKB 4K35A 3AK3A 1GMGA 4EFBA 3ZRVA 1TAEA 4ZI7B 1ZL8A 2XAJA 5H6QA 2NNUA 5KA6A 1YSCA 2DQ3A 1XEQA 1K73W 1IZ3A 2A79B 4X8AA 3STLC 3H1JH 1SA0A 5IDJA 4DK1A 2ZD9A 3K5OA 5EZYA 3GWKC 4X88A 4I9QA 3HPLC 4KXRA 4X20B 3JCUZ 4JYCA 1HR0B 3DGEA 4G27B 4UCSA 5D5QA 2ZNIA 3RYIB 4X66O 2W6JG 1RPOA 1ZSPA 4LFAO 1ROPA 2PI4A 4YHHO 1EZJA 4KFMA 2YIAA 4GX1A 2BSKA 1WAZA 3BY6A 1Z5WA 2CDYA 1JMKC 3G6BA 4UCRA 4TOIA 2ZE5A 3UM7A 5GONA 2Q69A 4DV2B 1XMQB 4X1KB 3EFFK 1P49A 2KSDA 3K59A 4OX9O 3VQXA 4MVRA 3RVYA 4BW5A 5KAIZ 1Q90D 1SERA 2QWPB 1D5AA 3M7MX 1JQ0A 5ITZB 3HKEA 1I08A 1K5QA 1VQ6V 2ZQMA 2ODMA 4J11A 2B9ZA 3AG2C 3FB6C 3LSUA 5JJEB 1XBLA 3H01A 2QEXV 1Y74A 1SS3A 2ZXWB 2FKXA 2WAMA 4FIPC 1K3EA 4DR3B 1L0LH 2AHYA 1JR9A 4PDMA 1XNQO 3CX5F 1DK1A 2OCCB 5DECA 4MSWC 4B3TO 2WLJA 2XAQA 2DWEC 1QU7A 4L87A 4TV8B 2AZ0A 2A06H 2YXLA 3T1HB 5KA5A 2XAFA 1JPXA 4J10A 4PD4F 3STZC 4X66B 5L3EA 1IX9A 2UXCB 2X7RB 1YXBA 2QWRB 3ZMVA 5KHIA 3D3QA 5LL6Y 2JRIA 5FPRA 3SYPA 3CEIA 3ZHUA 4JAAA 1PPJH 5JJJB 2Q0AA 3FYEB 4R7CA 1QR8A 4B08A 4OPHA 2OTJV 4JAVA 5KX5B 3AG1B 3ASNC 1NH2D 2IH1C 3K79A 2V1DA 4WFFA 5JQGA 2GTSA 1QBZA 1PNMA 1MZEA 1Y66A 4FLZA 1N34B 2DW4A 2ZINA 4O4LA 2HR3A 3ZHQA 2XASA 3OMIB 5IJ0A 1N32B 4JI2B 1XQ8A 1PL4A 1G1XB 3OTOB 3SYCA 3OMAB 4UVAA 1PP9H 1FAFA 2P4KA 2JS3A 4X1IB 1NR1A 4NVPA 3IC9A 5IJ9B 3HKDB 4YJ3B 3FB8C 5FPOA 3MAQA 2DYSC 1R6TA 1KECA 1F4NA 3ABKB 2WLKA 5L3GA 4MVUA 1N0NA 3P3PA 3E22B 4QE7A 5LBQA 1OCCB 2JJ1G 2ZM6O 4HYOA 1B04A 3T1YB 4NYKA 5IYBO 4FLVA 3CXCU 1N8RW 3HKBB 1AJNA 3HKDA 3CJHA 2DN9A 3CC4V 5C8YA 1M56B 5EC2C 4LF8B 3IGAC 4DV6B 4FFBA 2N04A 5ITZA 3WG7C 3CCMV 2ADPA 4NKGB 1K4DC 4LFBB 4MTFA 1MG1A 4WCEV 3T2MA 1I94O 1K92A 3H1LH 1S3JA 4RUFA 4MVOA 2HJDA 1Q8IA 3F5WC 2X6BA 4DR5B 5B3SB 2EJRA 1Q82W 4LF7B 4PA7A 2JK5C 4CS3A 3JALB 1N36O 4I4TA 4DR7B 2GUZA 1IURA 1XHZA 4DO2A 5JJNB 2EIJB 3JAKB 4I50B 1KU9A 4X1KA 3C90A 1J5EO 5IWAB 3E35A 3N2KB 1MABG 4X9QA 3FKSG 4YXWG 1NTKH 1DLBA 1K34A 4JI8B 3RYCB 5CA0A 2QR4A 1U97A 4IIJA 4LFAB 1K7DA 2WLIB 3M8AA 1YTFB 4LF4B 4FLTA 4DK0A 1NTZH 3KCXA 1FFXB 4CH4A 4JTCB 3CJHB 3G67A 3MDSA 3WB2A 3ZMUA 4MTOA 2Y48A 3KKYA 4FM0A 4O2BA 1BSMA 1MMMA 4J7ZA 1DTOA 3E8BA 1AJQA 5BMVB 4JI0O 3ZHSA 3K5LA 1WPBA 4GX0A 3A2FA 3CRMA 4DR6O 1S72V 1VQNV 3SYOA 1SA0B 1RM1C 5CN0A 3SYQA 5A9GA 3DXRA 4FZ1A 2EIKB 1BHBA 1SQQH 2LO1A 1OHHG 3ETGA 3RYFA 4O2AA 1GTOA 2O57A 3UT5B 4QE9A 3AG2B 5IJ9A 2CGOA 4WBNA 3CYOA 2YICA 4PI0A 1GM7A 1XMOB 3JD2A 1QNMA 2JEXA 3CC7V 1AP5A 2OCCC 3ZCCA 5EBLC 3N27A 2F66C 1M4UA 1VP7A 1GM9A 2FB5A 4GX5A 2R9AA 4J9YB 1F4MA 2L6LA 5IYDO 2D2CB 2EINB 2NN4A 2WLLB 2X6CA 1HNZB 3QG5A 1R1BA 1OCOB 3J7AU 3HKCA 3ZRXA 3VOUA 3F7VC 4WFBV 4DR5O 4GKKB 4DV5B 3T1YO 2ZE6A 5LMUB 3J80N 4J80A 4ZOLA 1YCIA 3ETEA 1GM8A 3ZRWA 1R3IC 2QWNB 2PYLA 2DYSB 4PA4A 3OUSA 5B66Z 1WP8A 3CRRA 1TUBA 2AXTZ 4NTXA 1YJNV 4X1YA 3LNMB 4AILC 1VQPV 1FJGO 3I56V 4RO2A 5LGUA 5H6RA 2BE3A 1VMGA 5CA1A 4WBNB 5BY1A 1HWYA 2X0LA 1QCEA 2Q68A 1FD9A 3TXQA 3SGIA 1JJOA 2HHHB 2G38A 1Y76A 4E4EA 3OUFA 2HHHO 1JCHA 5CA1B 3B8MA 1JFFA 4KP4A 2H94A 1PNLA 4JI7B 2IW5A 2ZIOA 4PDVA 2F95B 2ZNJA 2DQ0A 5GW7A 5J2TA 5J2UA 4B7EA 3JD0A 2EZOA 1BL8A 2HVKC 3DTUB 1GRJA 4TUYB 3ZIAG 5JCOA 2DE0X 1Z2GA 2QSAA 4XBFA 1HR0O 1IDSA 2Q73A 5CA3A 2WPDG 3JD3A 2DYRC 4DW0A 1YJ9V 3JAKA 5LA6B 5KHKA 3DSQA 3BCCH 2WLLA 2LQTA 1AP6A 2EX3A 2A7WA 2LW1A 3H1IH 1I5XA 3FX7A 3L71H 2YEVA 4I55A 3P32A 4E2LA 5BR8B 3P30A 1RSOB 4O4JB 3LDDA 2QA4V 1H8EG 4O2BB 3SPCA 5EBMC 1EFRG 3KCYA 3FFQA 4ZKIA 3AG3C 1XNRO 5CBFA 4FLXA 3CSXA 2ZR2A 1J95A 3K57A 4LWSB 3QF7A 4MVZA 1AB3A 1FXKA 3D8CA 1W59A 3K3WA 2DYRB 4H37A 3U11A 3TK1A 1XUQA 4FFBB 1VEWA 3A0RA 2ZCEA 4PDRA 3EXAA 3ABLC 3CCQV 3DXRB 1SZXA 2WWWA 1KP3A 4BW9A 5DM6V 3HKEB 4GT1A 3N2KA 3I55V 1ZLZA 3TCUA 1FFTB 3OR6C 4HNAB 4JV5O 1IVSA 2OTLV 2Q7HA 3B2EE 5CA0B 1VQ9V 1Q5OA 1TA8A 1OCZC 4DUZB 1M57C 5CB4B 1WN7A 3EHBB 4X89A 1D2DA 1KD1W 1H2SB 5LOVB 1IBKO 4DRXB 1QLEB 3BA8A 1JA8A 2ZE7A 3D36C 2UUAO 4C7UA 2PI5A 1CP9A 5FL7G 4U7NA 4DV6O 2Y69B 4I4TB 3W7SA 5LGTA 2HEPA 4IYHA 3CPWU 2RCVA 1WPXA 4CS2A 4JTAB 4FJCC 1NVPB 4LH6A 3LSSA 3BEHA 4N21A 1YEWA 1YDXA 1UPGA 1Y4MA 2R9IA 5JCOC 4X64O 2VQEO 4GCZA 3X2QB 4KUMA 1R73A 4JF3A 2R70A 3ASOC 4QJFB 4EKWA 1FS0G 1N4CA 4WFEA 3JSLA 2UXBO 3LUTB 4I9WA 1KP2A 1BCCH 4FLUA 3AG4B 3RGBA 5B3SC 1OZ0A 1QVFU 3K03A 5A2QN 3C3SA 3OEEG 3LDCA 3OR7C 2GDSA 2E75B 4CC5A 4JYAB 5KAFZ 1BT8A 5B1NA 1HNZO 1N32O 3OE7G 1OCCC 2GUZB 1Q3EA 1COWG 2LW7A 4B3MB 1NKDA 5GTHZ 2IM9A 4OXSA 3MD0A 3B40A 4LBEC 2XHBA 5C8YB 3JARA 2IJJA 3CB2A 1AVMA 3JATB 4CZZA 3HKBA 4GKJB 3ZHTA 5HFLA 2OIEA 4UCVA 1Y74B 2B1GA 4FZ0A 1S77D 1PV0A 3OW2U 1JFFB 1Q6UA 2FYUH 2Z0AA 3THOA 4O4IB 4JI5O 2GV9A 5K1PA 2YIDA 3K9AA 4EFEA 2QWQB 2QM4A 4H33A 3BABA 1Y6XA 2VWKA 4JI8O 4DV5O 5IJ0B 2BOCC 3CCUV 5EIBD 4K0KO 3TJTA 4IHJA 5CB4A 1KB9F 4QPKA 4DW1A 4NXNO 2YI9A 3WFVA 4MW8A 1KKDA 3ETQA 1NT2B 4KHPB 4H13B 1SQVH 3JCZA 4JYBA 1SKVA 2Q9LA 4KHPO 4J7KA 1QVGU 1R3LC 3ZMZA 4CBCA 2E5LO 2HG5C 3KZIZ 4OPAA 1KQSU 3HR0A 4FK5C 2VQEB 1GH6A 1V54B 1O9HA 3SPGA 2EZPA 4BIUA 1BZKA 4P30A 5KUMA 2M7WA 3ETDA 1JVMA 2UXBB 2L35A 2LGQA 1VQ8V 2UUCO 2DOSA 1IXMA 3ABMC 1A32A 4UUJC 3IC7A 2UUCB 4GZRB 5LHGA 2OT5A 2Q6AA 4IT5A 1M57B 3CCRV 4ZBMA 1D5NA 4NXMO 1FPOA 4ZHQA 2VS0A 1YHQV 1TVKB 2PYJA 5H5NA 4JAUA 1ZUQA 3BA9A 3NR7A 3UT5A 2F43G 2AZ2A 3L75H 3E2EA 3AG3B 3QNEA 1IBMB 4H44B 1WB8A 3SYAA 2BSKB 4JI6O 2AW9A 5K1XA 1GKFA 1SRYA 2BTQA 3CCSV 3GB7C 3W7UA 4K8ZA 4L8JA 1HNWO 3CRAA 2OYQA 4FLYA 2F93B 1HNXO 1IBLO 5BZBA 3SJCC 2YC0A 1E1RG 1NS1A 3ZJZA 1Q6HA 2QKCA 5LMNB 4IIJB 3DC5A 2BTQB 4LF5B 4TUYA 3JASA 1W0KG
chains in the Genus database with same CATH topology
2DYSB 4PA4A 1AJPA 1AI7A 2EILB 1K8AW 3OUSA 5EBWC 1OCOC 3RW0A 4PELA 3K04A 1RPRA 3B77A 4PA9A 4N23A 1YJNV 5H9CA 5J9PC 3LNMB 2W6IG 5B1OA 1K97A 1VQPV 3I56V 1CPYA 2XAHA 2JJ2G 4RO2A 4DXWA 5LHHA 1W2BU 3T4ZA 5LGUA 3G6EV 2LP7A 5H6RA 1K9MW 4Q20A 5B1AC 1GK9A 4UVBA 2C2AA 1H2GA 4RUEA 1VQLV 1V55B 1DF4A 3ASNB 1HWYA 2X0LA 4RQFA 1FXHA 1AROP 1QCEA 2Q68A 5IY5B 1VQMV 3SPHA 2B1IA 5B1AB 2JEUA 2D3OW 2QTOA 3ZRWB 1NQTA 4PA3A 3OUFA 4LC1A 1GMGA 1JCHA 3B8MA 3QO7A 4XDLA 4KP4A 3ZRVA 5LGNA 2XAJA 3QO5A 4MVQA 2NNUA 2Q67A 4JPRA 5H6QA 1YSCA 2DQ3A 5KA6A 2H94A 5L3DA 1PNLA 1K73W 1G8MA 2A79B 4WFAV 4X8AA 4MVSA 3STLC 2IW5A 1P4RA 4HAMA 2X6AA 1TUEB 4PDVA 4P9OA 3G4SV 5GW7A 2DQ0A 3T1CA 2R9RB 5EC1C 5IDJA 2ZD9A 1I5YA 3CMEV 3JD0A 2CK3G 4LCUC 4X88A 1AI6A 2EZOA 3HPLC 1QLNA 1BL8A 2ZR3A 2YEVB 2WLHA 1JOYA 2HVKC 4JYCA 3DTUB 3AG4C 1ENVA 3NXSA 1OCZB 3DGEA 4G27B 1H8HG 4TT3G 3ZIAG 2EBOA 3LSQA 2W6JG 4XBFA 1DF5A 1RPOA 4RQEA 4GX2A 1ROPA 2QM7A 1KC8W 2PI4A 5CA3A 2WPDG 3JD3A 3QO8A 1EZJA 5LHIA 2DYRC 3ZN1A 4KFMA 4UXNA 4XDKA 1VQ5V 4UV9A 1YJ9V 2EIKC 2P90A 1M56C 3G71V 3E83A 2WLLA 4TSFG 2EIMC 1R6KA 2WLMA 4GX1A 2EILC 3BY6A 1I5XA 2ATKC 4QPJA 3JYCA 3OMNB 3ABUA 3UM7A 2YEVA 3WG7B 3P32A 4E2LA 2XAGA 1W0JG 2JDIG 2Q69A 3P30A 3OEHG 3LDDA 2QA4V 1YITV 4BAYA 3EFFK 1S76D 1XL4A 1W0KG 2HVJC 1H8EG 4MVRA 3RVYA 3SPCA 4BW5A 3RVZA 5EBMC 1EFRG 1SERA 2QM8A 4ZKIA 1JQ0A 1R3JC 3AG3C 3ABKC 4MT8A 5CBFA 1NJIW 5L3FA 2ZR2A 1Q81W 1J95A 1K5QA 1VQ6V 2ZQMA 1VQKV 4MVZA 3AG2C 3FB6C 1FXKA 3K3WA 2DYRB 2P6JA 3H01A 4H37A 3TK1A 2QEXV 2ZXWB 1LNQA 3A0RA 2WAMA 3OAAG 4FIPC 4PDRA 2HJFC 1K3EA 3ABLC 3MHSC 3CCQV 2AHYA 1SZTA 1F23A 4R50A 2YSUB 2WWWA 4PDMA 1WLEA 2UXNA 1KP3A 5B1BC 2OCCB 4FMTA 3ABMB 1RM1B 2A9HA 3OM3B 4MSWC 4P9PA 2WLJA 2XAQA 3E8GA 5DM6V 3TETA 2DWEC 4GT1A 4L87A 4QIWF 5EK0A 4QNHB 5CMUA 3CCJV 3I55V 3K0GA 3VBBA 3TCUA 5B1BB 1FFTB 2ZDIA 3OR6C 5KA5A 3ASOB 1M9NA 2OTLV 1VQ9V 3R65A 2XAFA 1JPXA 1OCZC 3STZC 1NBMG 5CBGA 1V54C 1M57C 4MTXA 2MK3A 3CC2V 3EHBB 4X89A 5L3EA 1PKXA 1KD1W 2X7RB 1M1KW 3D3IA 3ZMVA 1QLEB 2NLJC 2EIJC 3SYPA 4Z1MG 3CCVV 3IFXA 2PI5A 1XL6A 1CP9A 5FL7G 1YIJV 4U7NA 3FYEB 3AG1C 2Y69B 4J9ZB 3W7SA 4R7CA 1QLEC 5LGTA 1QR8A 2ZDIC 2OTJV 1ORQC 4JAVA 1NR7A 3CPWU 3AG1B 3K08A 1WPXA 4JTAB 3ASNC 4FJCC 4WFHA 1NH2D 1NVPB 2IH1C 3K79A 3LSSA 2V1DA 3BEHA 4WFFA 4N21A 2AHZA 2ITCC 4XDJA 1QBZA 3FB5C 1PNMA 1Y4MA 1Y66A 3ZN0A 2DW4A 2R9IA 4MTGA 5DN6G 3AEIA 2HR3A 5L3BA 1SESA 2XASA 3OMIB 4GCZA 3X2QB 2IU3A 1K4CC 2IH3C 2LFRA 3ZMSA 3CCEV 2Z5UA 3OMAB 4UVAA 3SYCA 4KUMA 1R73A 4JF3A 3ASOC 4QJFB 1AI5A 4EKWA 4LP8A 1H38A 1FS0G 2Z3YA 1Q7YW 4MW3A 4ASUG 4WFEA 1NR1A 2W0FC 2K1EA 1PL0A 1YI2V 1JJ2U 4JASA 2JIZG 1OCRB 3LUTB 1F51A 4I9WA 1KP2A 3FB8C 1YTFD 2B5UA 3AG4B 1EBOA 4JGSA 1GO3F 5B3SC 1OZ0A 2DYSC 1QVFU 3K03A 1KECA 1QR9A 3ABLB 1PD3A 3SPJA 4G2KA 1NVPD 3OEEG 3E8FA 3LDCA 1F4NA 3ABKB 3OR7C 2WLKA 5L3GA 4P2ZA 4F4LA 4MVUA 1S0VA 5B1NA 3OE7G 4QE7A 1OCCC 5LBQA 1OCCB 3CCLV 3W7WA 1COWG 1NKDA 2P67A 2HFEC 2JJ1G 3LDEA 4TWKA 5E1AC 4HYOA 4OXSA 1VQOV 3MD0A 1MOFA 1THZA 5IYCO 3W7XA 4LBEC 5IYBO 3CXCU 1N8RW 1FXKB 1AJNA 1FXKC 2IJJA 4CZZA 3CC4V 2H8PC 1M56B 5HFLA 5EC2C 2IJIA 5IY5C 3IGAC 2B1GA 4MVMA 3WG7C 3CCMV 1K4DC 3GWOA 1S77D 4MTFA 3OW2U 1JX9A 1MG1A 4UV8A 4WCEV 3T2MA 2KB1A 1K92A 3SPIA 1S3JA 4RUFA 4MVOA 3K9AA 3F5WC 2WLIA 4MS2A 2X6BA 2WSSG 3B8NA 4H33A 5B3SB 3FYIB 2EJRA 4WF9V 1BMFG 1Q82W 3K0DA 2BOCC 4PA7A 3CCUV 2JK5C 4JTDB 1K33A 4U7OA 1UJWB 1P7BA 3T4DA 2IJHA 2ZXWC 1L1FA 3D36A 2ITDC 4QPKA 4WFGA 3UKMA 3WFVA 3X2QC 4DO2A 4MW8A 1KKDA 3OGCC 1CEZA 2EIJB 5L3CA 1R3KC 1E79G 3E35A 2IJKA 3JCZA 1MABG 1ZWIC 1R6NA 4JYBA 2BOBC 3FKSG 1QVGU 1R3LC 3ZMZA 3KG2A 3E89A 4YXWG 1DLBA 4CBCA 1K34A 4FPPA 2EINC 2HG5C 5CBHA 1K7DA 2GHYA 1KQSU 2WLIB 1VQ4V 1YTFB 5C93A 4I5SA 3ABTA 4FK5C 4R6ZA 1V54B 3F7YC 4JTCB 4PA6A 3ZMUA 4MTOA 2QE7G 2Y48A 3SPGA 2EZPA 4BIUA 2HKOA 4P30A 1B6QA 1SETA 2M7WA 3ETDA 3MHHC 5KUMA 3SJQC 4BIZA 1DTOA 3E8BA 1AJQA 1JVMA 3E86A 1AI4A 1VQ8V 4GX0A 3ZMTA 1VQ7V 1IXMA 1S72V 3SYOA 2EIMB 5HFMA 2XOKG 3ABMC 4UUJC 1AR1B 4R8CA 5CN0A 3SYQA 1RM1C 1OCRC 3RBZA 3IC7A 1M90W 2EIKB 1BHBA 5LHGA 2OT5A 2P7TC 2Q6AA 1OHHG 3E8HA 4RAIA 3ETGA 4G28B 3CMAV 1M57B 3CCRV 4ZBMA 3JD4A 4UVCA 1GTOA 1S5HC 4QE9A 1YHQV 3AG2B 4JAUA 1PNKA 2F43G 1E1QG 2HLDG 3CYOA 2FTKA 1GM7A 3E2EA 4HZ3A 3ML0A 5KUKA 3JD2A 3AG3B 2JEXA 2UXXA 3QNEA 3CC7V 3M99B 2DWDC 2OCCC 3SYAA 3ZCCA 5EBLC 1YJWV 1GKFA 1SRYA 3CCSV 1GM9A 4GX5A 1K5SA 1V55C 1MSWD 3GB7C 3CD6V 4J9YB 3W7UA 1F4MA 1G4YB 2WLNA 1NH2B 3HB3B 5IYDO 2EINB 2IU0A 1Q86W 3CP1A 2WLLB 2X6CA 3JD1A 5BZBA 1OCOB 2QKSA 4PDLA 1VQNV 3ZRXA 3VOUA 3F7VC 1E1RG 2Y69C 3ZJZA 4WFBV 3FB7C 3OFNG 2XNDG 3K06A 3PJSK 2A0LA 3ETEA 2LFSA 2V7QG 1GM8A 3ZRWA 1FXVA 1R3IC 1BHAA 3ZRSA 3W7TA 2GSMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MW3 A;  2HG5 C;  4WFE A;  2W0F C;  4PA4 A;  2K1E A;  4MVR A;  3RVY A;  3SPC A;  4BW5 A;  3RVZ A;  5EBM C;  5CBH A;  3LUT B;  3OUS A;  4I9W A;  2WLI B;  5EBW C;  1OCO C;  3RW0 A;  1R3J C;  3AG3 C;  3FB8 C;  3K04 A;  3ABK C;  4PA9 A;  5CBF A;  5B3S C;  4R6Z A;  2DYS C;  5J9P C;  3K03 A;  3LNM B;  3F7Y C;  4JTC B;  1J95 A;  4PA6 A;  4RO2 A;  3SPJ A;  4DXW A;  4MTO A;  3T4Z A;  3E8F A;  3LDC A;  4MVZ A;  3AG2 C;  3FB6 C;  2WLK A;  3OR7 C;  3SPG A;  4P2Z A;  5B1A C;  4MVU A;  4P30 A;  5KUM A;  3SJQ C;  4F4L A;  4RUE A;  3E8B A;  4H37 A;  1JVM A;  3E86 A;  1LNQ A;  4QE7 A;  5B1B C;  1OCC C;  4PDR A;  2HJF C;  3ABL C;  2AHY A;  4GX0 A;  2HFE C;  2Q68 A;  4R50 A;  5E1A C;  3LDE A;  4PDM A;  4TWK A;  3SPH A;  3SYO A;  4HYO A;  3ABM C;  4OXS A;  4UUJ C;  4R8C A;  3SYQ A;  2A9H A;  1OCR C;  4MSW C;  3RBZ A;  4P9P A;  2QTO A;  2WLJ A;  3E8G A;  4LBE C;  3TET A;  2DWE C;  4PA3 A;  5EK0 A;  2P7T C;  2Q6A A;  4QNH B;  3E8H A;  3OUF A;  4RAI A;  4G28 B;  3K0G A;  4XDL A;  4ZBM A;  3TCU A;  3OR6 C;  1S5H C;  4MVQ A;  2H8P C;  2Q67 A;  4QE9 A;  3R65 A;  2A79 B;  5EC2 C;  5IY5 C;  3IGA C;  1OCZ C;  4MVM A;  4X8A A;  3WG7 C;  4MVS A;  3STZ C;  3STL C;  1K4D C;  5CBG A;  1V54 C;  1M57 C;  4MTF A;  2X6A A;  4PDV A;  4P9O A;  4X89 A;  4HZ3 A;  3T1C A;  2R9R B;  5KUK A;  5EC1 C;  3T2M A;  2KB1 A;  2ZD9 A;  3SPI A;  2DWD C;  2OCC C;  4RUF A;  4LCU C;  4X88 A;  2NLJ C;  3SYA A;  3HPL C;  5EBL C;  2EIJ C;  3SYP A;  1BL8 A;  4MVO A;  2WLH A;  3F5W C;  3IFX A;  2WLI A;  2HVK C;  4MS2 A;  2X6B A;  1XL6 A;  3AG4 C;  4G27 B;  3AG1 C;  4GX5 A;  1V55 C;  4H33 A;  4J9Z B;  3GB7 C;  4R7C A;  1QLE C;  4J9Y B;  1G4Y B;  2WLN A;  3K0D A;  2BOC C;  4PA7 A;  2JK5 C;  4JTD B;  4GX2 A;  1ORQ C;  3K08 A;  1P7B A;  4JTA B;  3ASN C;  2WLL B;  2X6C A;  4WFH A;  2DYR C;  3T4D A;  2IH1 C;  2ZXW C;  3BEH A;  4KFM A;  4XDK A;  4WFF A;  5BZB A;  2AHZ A;  2EIK C;  2ITC C;  2QKS A;  2ITD C;  3FB5 C;  1M56 C;  4WFG A;  4PDL A;  4XDJ A;  3UKM A;  3VOU A;  3E83 A;  2WLL A;  4MTG A;  3X2Q C;  2EIM C;  2Y69 C;  2WLM A;  3F7V C;  4MW8 A;  3FB7 C;  4GX1 A;  3OGC C;  2EIL C;  3ZJZ A;  1KKD A;  2ATK C;  3JYC A;  1R3K C;  3UM7 A;  2YEV A;  3K06 A;  3PJS K;  1K4C C;  2IH3 C;  2A0L A;  1ZWI C;  3SYC A;  2Q69 A;  2BOB C;  3LDD A;  1R3I C;  3ASO C;  1R3L C;  3EFF K;  3KG2 A;  1XL4 A;  4EKW A;  3E89 A;  2HVJ C;  4LP8 A;  4CBC A;  3ZRS A;  2EIN C; 
#chains in the Genus database with same CATH topology
 3AK1 A;  4X65 O;  5LP6 B;  3U10 A;  2F23 A;  5EBW C;  5IYZ B;  4N23 A;  3IJ4 A;  3UCS C;  4CS4 A;  3BAA A;  1CPY A;  2XAH A;  2JJ2 G;  1K9M W;  2Q8V A;  1GK9 A;  1XIL A;  4UVB A;  1H2G A;  2ZM6 B;  4RQF A;  1I94 B;  3C3T A;  1RSO A;  4O4J A;  4TV9 B;  2WA3 A;  4AQY B;  3SPH A;  2KG7 B;  5BXZ A;  1Y67 A;  2D3O W;  3BVO A;  2QTO A;  3ZRW B;  1NQT A;  4PA3 A;  1L8D A;  3UQ8 A;  5LXT A;  4LC1 A;  4LF8 O;  4XDL A;  4MVQ A;  3L9D A;  3OTF A;  3QO5 A;  2Q67 A;  4JPR A;  4HBN A;  4UFZ A;  1H2M A;  2YXY A;  4MVS A;  2BTO A;  4X1Y B;  4HAM A;  2OIG A;  2X6A A;  1TUE B;  4P9O A;  4DYL A;  2ETN A;  3CE2 A;  2M6Y A;  3T1C A;  2R9R B;  5EC1 C;  4LCU C;  4O4L B;  5D5P A;  3J81 N;  1N33 B;  2ZR3 A;  3L74 H;  1O9G A;  1ENV A;  3NXS A;  1OCZ B;  4TT3 G;  4UB6 Z;  1H8H G;  4B3R B;  4NTW A;  3K9S A;  3UO3 A;  3LSQ A;  1TGO A;  4Z2W A;  1KC8 W;  2WA4 A;  5LYJ A;  2HP8 A;  3QO8 A;  4JZ2 A;  5LHI A;  3ZN1 A;  1VQ5 V;  2Q4P A;  4Z1V A;  2EIK C;  2PTM A;  2P90 A;  3G71 V;  3E83 A;  2EIM C;  1R6K A;  2EUL A;  2ATK C;  4QPJ A;  1P84 F;  3ABU A;  4JI5 B;  2CH7 B;  4YIP A;  2KG7 A;  3WG7 B;  2ZIM A;  3VQY A;  1W0J G;  3SJB C;  4LNU A;  4BAY A;  1XDC A;  1XL4 A;  2HVJ C;  2CTR A;  3RVZ A;  3IAY A;  1X4T A;  3A0H Z;  1AIL A;  4I0X B;  3ZHR A;  2DJV A;  1BQZ A;  1Q81 W;  3JAT A;  2Q0O C;  4AI8 A;  2P6J A;  2CTP A;  3OAA G;  1SQP H;  2HJF C;  4ABM A;  3MHS C;  1WB7 A;  1SZT A;  4DV4 O;  4K8X A;  3L73 H;  1GN4 A;  2NR5 A;  4FMT A;  1RM1 B;  4I7Z B;  4P9P A;  1NU1 H;  3TET A;  1KBH A;  3RYH B;  4QIW F;  5EK0 A;  2FL4 A;  4PI2 A;  5CMU A;  4QNH B;  2ZE8 A;  1G6U A;  3HKC B;  3K0G A;  4DUY O;  2ZDI A;  4UB8 Z;  2UUB O;  2YUA A;  1M9N A;  1YZB A;  3R65 A;  4GYC B;  4JI2 O;  1NBM G;  5CBG A;  4MTX A;  4EB6 B;  2K9P A;  3CC2 V;  4DR4 O;  5JVD A;  3FD9 A;  1EN5 A;  4TV9 A;  4DR3 O;  2N74 A;  5JH7 A;  4Z1M G;  1XL6 A;  5DED A;  3AG1 C;  4J9Z B;  1QLE C;  4UCO A;  3L70 H;  1FJG B;  4DR6 B;  1ORQ C;  4WFH A;  2P4V A;  2E3C A;  4XDJ A;  4OGQ B;  3FB5 C;  4X20 A;  5DN6 G;  3VQV A;  3AEI A;  5L3B A;  1M5I A;  2JGU A;  3P3N A;  3B4S A;  1K4C C;  3CCE V;  2LFR A;  3ZMS A;  4LH7 A;  5LMU O;  5KHJ A;  4LP8 A;  1H38 A;  4DV3 O;  2Z3Y A;  4JI3 B;  5GON B;  2W0F C;  1SQF A;  1YI2 V;  2JIZ G;  1OCR B;  4DV3 B;  1F51 A;  2RQ6 A;  3H9V A;  2B5U A;  1QQC A;  1EBO A;  4JGS A;  3FAV B;  1IBL B;  1HNX B;  1AR4 A;  1ZX3 A;  1NZ6 A;  1QR9 A;  1PD3 A;  1NVP D;  5KHG A;  3E8F A;  4P2Z A;  2CTW A;  4F4L A;  1S0V A;  3A8T A;  4JI1 B;  5H2F Z;  2CGN A;  2P67 A;  2HFE C;  4DRX A;  4TWK A;  1VQO V;  5IYC O;  1MOF A;  2ADQ B;  3JAL A;  2F1M A;  3W7X A;  1HP8 A;  1FXK C;  1YF2 A;  3ZED A;  4BR6 A;  2VWJ A;  2Q7G A;  2Y4T A;  1FYJ A;  5IY5 C;  2JS5 A;  3AG7 A;  2VQF O;  1N0J A;  1JX9 A;  2GBO A;  4UV8 A;  2PZS A;  4CH5 A;  4NB5 A;  5JVD B;  2WLI A;  3WU2 Z;  2WSS G;  2YS8 A;  3FYI B;  3H1K H;  3K5M A;  1DGS A;  1LUV A;  4JTD B;  4U7O A;  2XT9 A;  1UJW B;  1QHT A;  1SC5 B;  3T4D A;  1B06 A;  4X1I A;  4LF4 O;  2IJH A;  1MA1 A;  2PY5 A;  4WFG A;  2H3O A;  4DV4 B;  3X2Q C;  4YJ3 A;  4DV1 B;  3E22 A;  3CWB H;  3S3X A;  1M93 A;  3OT7 A;  2DMX A;  5L3C A;  3S3W A;  1Q6I A;  1NI8 A;  1HW7 A;  1PM9 A;  4F6R A;  2BOB C;  1J5E B;  3E89 A;  3GVM A;  4FPP A;  4IHJ B;  5CBH A;  2QGN A;  3ABT A;  4U3J A;  3F7Y C;  4PA6 A;  2UUA B;  3R66 A;  4DV0 B;  2HKO A;  3SJQ C;  3MHH C;  4BIZ A;  2F4V O;  3E86 A;  4YJ2 A;  4O4I A;  1ZTE A;  3ZHV A;  3CXH F;  1RFY A;  1VQ7 V;  2P06 A;  3PN1 A;  2EIM B;  5HFM A;  1AR1 B;  1OCR C;  5FNV A;  1M90 W;  3JAW A;  1LUW A;  1XRE A;  2MW2 B;  4RAI A;  2E76 B;  3CMA V;  4JI4 B;  5JQG B;  1S5H C;  4OX9 B;  1X59 A;  5KMG B;  1SQB H;  4NXM B;  2HLD G;  2FTK A;  1BS3 A;  4O2A B;  5KUK A;  1P7G A;  2UXX A;  4DV7 O;  2LGW A;  3M99 B;  2DWD C;  2Y4U A;  2W0X A;  1EN6 A;  1MZF A;  4DV0 O;  3SJA C;  3QVN A;  4ZOL B;  3OTO O;  1IBM O;  4NXN B;  4IGG A;  1MSW D;  2Q7E A;  1G4Y B;  1NH2 B;  4JI4 O;  3HB3 B;  3G80 A;  3VQW A;  4X65 B;  3U0Z A;  2UXD O;  1Q86 W;  4DV2 O;  1XMQ O;  3JD1 A;  3RFR A;  4RWU A;  1S5J A;  4PDL A;  2Y69 C;  3ZBH A;  4PV1 B;  4F6E A;  4JV5 B;  1KYO F;  4LR3 A;  4ZIB A;  2YIB A;  2QJ1 A;  1URF A;  2A0L A;  2LFS A;  2PGG A;  1BHA A;  3ZRS A;  5H9C A;  2GSM B;  1AJP A;  1AI7 A;  1HNW B;  4FFK A;  2R72 A;  1H2L A;  2JGD B;  1SF9 A;  3APQ A;  1US6 A;  4PEL A;  5LXT B;  5J9P C;  5LP6 A;  2W6I G;  4ZHQ B;  5B1O A;  4DXW A;  5KLV H;  5LHH A;  3T4Z A;  4GKK O;  2LP7 A;  4ZI7 A;  5B1A C;  2C2A A;  3JAS B;  4RUE A;  1V55 B;  1VIB A;  3O9O A;  2JVD A;  2JGD A;  4LF6 B;  1FXH A;  4JI1 O;  2B1I A;  5B1A B;  2JEU A;  4O4H B;  1H2K A;  2YXH A;  3FAV A;  2QDO A;  3N2G B;  4U3F H;  3QO7 A;  3RYI A;  5LGN A;  5EYP B;  2CUG A;  5L3D A;  1G8M A;  4CH6 A;  3UO2 A;  4WFA V;  1F7Y A;  1XOU A;  1ZL8 B;  1P4R A;  3G4S V;  1S5L Z;  2OCH A;  1CXZ B;  2RDC A;  4B3S B;  1I5Y A;  4LNU B;  3CME V;  2CK3 G;  5TIS Z;  1AI6 A;  1QLN A;  2YEV B;  2WLH A;  4I55 B;  1JOY A;  5EYP A;  5EZY B;  3AG4 C;  2KKW A;  5F2V O;  3APO A;  4DR1 O;  2EBO A;  1VF7 A;  3N2G A;  3A0B Z;  1DF5 A;  4DR4 B;  1Q43 A;  4GX2 A;  4RQE A;  2QM7 A;  3AK2 A;  4IYI A;  5JWP A;  5GTI Z;  1VF6 C;  4UXN A;  4XDK A;  4W4K A;  4UV9 A;  4TQD A;  2KQX A;  1M56 C;  3OD4 A;  4TSF G;  1WJZ A;  1TUB B;  5KMG A;  2WLM A;  2EIL C;  2CE4 A;  2LJ2 A;  1KUQ A;  3JYC A;  3OMN B;  1MSD A;  4LF9 B;  2UU9 B;  1KMI Z;  3O65 A;  2RMK B;  2XAG A;  2JDI G;  2YI8 A;  5KHH A;  3OEH G;  1YIT V;  1S76 D;  5J2T B;  4DR2 B;  1MNG A;  1SQG A;  1TVK A;  4UCU A;  2QM8 A;  1R3J C;  3ABK C;  4MT8 A;  3RYH A;  5FLX N;  4DUY B;  2XTA A;  1NJI W;  5L3F A;  1AR5 A;  5EIB C;  4YY3 B;  2QTS A;  3JAW B;  2ZKO A;  1I0H A;  1VQK V;  2Y0P A;  3I5D A;  2RN9 A;  4DR7 O;  1LNQ A;  5B1B C;  5IT9 N;  3SDL A;  4KL1 A;  1F23 A;  4R50 A;  2YSU B;  1WLE A;  3BHP A;  3WB0 A;  2UXN A;  3BPZ A;  3RWR D;  3ABM B;  3CHX A;  2A9H A;  3OM3 B;  5LP6 C;  3E8G A;  4I0X A;  2CTQ A;  4YJ2 B;  3CCJ V;  3VBB A;  4GLX A;  5B1B B;  3H1H H;  1FKA O;  1UFI A;  3ASO B;  4LF6 O;  4YY3 O;  4GUN A;  5AG2 A;  1WA8 A;  4FLW A;  2ILM A;  1V54 C;  3JAM N;  2MK3 A;  4F6R B;  4LFC B;  1RP3 B;  1PKX A;  1M1K W;  3D3I A;  4TV8 A;  2NLJ C;  2RJZ A;  1XNQ B;  2EIJ C;  1BGY H;  4GKJ O;  3CCV V;  2P22 C;  3IFX A;  1YIJ V;  2AGA A;  3CRC A;  1WNS A;  2N05 A;  1T5E A;  4NTY A;  2ZDI C;  1H2N A;  4PHZ A;  1NR7 A;  3K08 A;  5FNV B;  3DC6 A;  2GTA A;  1ZAU A;  2AHZ A;  2ITC C;  3CRQ A;  3ZN0 A;  4MTG A;  1EM1 A;  1OV9 A;  4X62 O;  1SES A;  1N34 O;  4K0K B;  3LNN A;  4JYY A;  2IU3 A;  2IH3 C;  3L72 H;  2Z5U A;  4J41 A;  1AI5 A;  1VF6 A;  1Q7Y W;  4MW3 A;  4ASU G;  2K1E A;  4K3A A;  1PL0 A;  1JJ2 U;  4JAS A;  2Q5Z A;  1YTF D;  1GO3 F;  3ZX6 A;  1KKC A;  5IWA O;  4FM2 A;  3OGI B;  4O4H A;  1GN3 A;  4JYA O;  4B3T B;  3RYF B;  3ABL B;  3SPJ A;  4G2K A;  5B5E Z;  3RYC A;  2V4D A;  3ZS8 C;  3CCL V;  3W7W A;  4B3S O;  1OJH A;  5E1A C;  2YDE A;  3LDE A;  4JZG A;  1THZ A;  1Z5V A;  4NR1 A;  1XMO O;  2A3Q A;  5IYZ A;  1FXK B;  4ICG A;  1GN2 A;  4DV1 O;  4JI0 B;  1FFX A;  2H8P C;  4AHC A;  1B3Q A;  2IJI A;  4MVM A;  2UU9 O;  3GWO A;  4H0L B;  4LWS A;  5IE9 A;  4LFB O;  2KB1 A;  3SPI A;  4YIO A;  2OWO A;  5E79 Z;  3SR2 C;  1GN6 A;  3TGU H;  4CC6 A;  1XI1 A;  4MS2 A;  4LF7 O;  4Q6G A;  3B8N A;  3K5N A;  4WF9 V;  1BMF G;  4YHH B;  3K0D A;  4D7S A;  5JH7 B;  2CAZ C;  4UCT A;  1K33 A;  5LA6 A;  1P7B A;  2EJ7 A;  4PJ0 Z;  1BE3 H;  3Q4H A;  2ZXW C;  3B09 A;  1L1F A;  1VF5 B;  3D36 A;  1NTM H;  1EN4 A;  2ITD C;  4I50 A;  3UKM A;  3EVK A;  1HDJ A;  3OGC C;  1CEZ A;  3TXS A;  1BQ0 A;  1R3K C;  2Y0I A;  2P5O A;  1N33 O;  2QWO B;  1VAR A;  1E79 G;  2IJK A;  1ZWI C;  5LYJ B;  2E5L B;  1R6N A;  3KG2 A;  2UUB B;  1LR1 A;  2ZT9 B;  4IL6 Z;  2EIN C;  4HNA A;  2GHY A;  3RN4 A;  4W4L A;  1VQ4 V;  5C93 A;  4B7K A;  4I5S A;  1N36 B;  4R6Z A;  3F5T A;  5J2U B;  4BWA A;  4LF5 O;  4A5U B;  4DUZ O;  2QE7 G;  4BIO A;  2VRZ A;  1B6Q A;  1SET A;  1YVW A;  1AI4 A;  4DV7 B;  3BRC A;  2BCC H;  4JI7 O;  3ZMT A;  1V9P A;  2XOK G;  4R8C A;  3RBZ A;  4FM1 A;  4U3J B;  1IXB A;  2P7T C;  4J42 A;  3E8H A;  3JSN A;  4G28 B;  5BR8 O;  1U96 A;  3JD4 A;  4UVC A;  4X62 B;  4DR2 O;  3JAR B;  4LFC O;  4B3R O;  4QGP A;  1PNK A;  1WP7 A;  2QKA A;  5KX5 A;  3K58 A;  4DR1 B;  1E1Q G;  2ARH A;  4HZ3 A;  3ML0 A;  1XHX A;  4EB6 A;  1WA8 B;  3ICX A;  1YJW V;  2PF4 E;  1I7F A;  2F4V B;  3WB1 A;  1K5S A;  1V55 C;  2UXD B;  2XUM A;  3CD6 V;  4JI3 O;  2WLN A;  2CH7 A;  2IU0 A;  3CP1 A;  1L0N H;  2QKS A;  4EEQ A;  3RT3 C;  4AQY O;  3FB7 C;  3QTC A;  4J7J A;  4FVM A;  3CS5 A;  2IBZ H;  3OFN G;  4JI6 B;  2XND G;  3K06 A;  3PJS K;  5LMN O;  4B3M O;  2V7Q G;  1FXV A;  1EZV H;  3W7T A;  4D7T A;  2EIL B;  1K8A W;  2VQF B;  1OCO C;  2FML A;  3RW0 A;  3K04 A;  1RPR A;  3B77 A;  4PA9 A;  4LF9 O;  1Y76 B;  4TQF A;  1GAX A;  1K97 A;  2PUS A;  4D6T H;  3Q4H B;  3G6E V;  1W2B U;  2E74 B;  4Q20 A;  3T1H O;  4CH3 A;  3BFR A;  1VQL V;  2RNB A;  1DF4 A;  3ASN B;  1ARO P;  2YIB D;  1XNR B;  5IY5 B;  1VQM V;  5LOV A;  1SQX H;  5BMV A;  4X64 B;  2UXC O;  1IBK B;  4K35 A;  3AK3 A;  1GMG A;  4EFB A;  3ZRV A;  1TAE A;  4ZI7 B;  1ZL8 A;  2XAJ A;  5H6Q A;  2NNU A;  5KA6 A;  1YSC A;  2DQ3 A;  1XEQ A;  1K73 W;  1IZ3 A;  2A79 B;  4X8A A;  3STL C;  3H1J H;  1SA0 A;  5IDJ A;  4DK1 A;  2ZD9 A;  3K5O A;  5EZY A;  3GWK C;  4X88 A;  4I9Q A;  3HPL C;  4KXR A;  4X20 B;  3JCU Z;  4JYC A;  1HR0 B;  3DGE A;  4G27 B;  4UCS A;  5D5Q A;  2ZNI A;  3RYI B;  4X66 O;  2W6J G;  1RPO A;  1ZSP A;  4LFA O;  1ROP A;  2PI4 A;  4YHH O;  1EZJ A;  4KFM A;  2YIA A;  4GX1 A;  2BSK A;  1WAZ A;  3BY6 A;  1Z5W A;  2CDY A;  1JMK C;  3G6B A;  4UCR A;  4TOI A;  2ZE5 A;  3UM7 A;  5GON A;  2Q69 A;  4DV2 B;  1XMQ B;  4X1K B;  3EFF K;  1P49 A;  2KSD A;  3K59 A;  4OX9 O;  3VQX A;  4MVR A;  3RVY A;  4BW5 A;  5KAI Z;  1Q90 D;  1SER A;  2QWP B;  1D5A A;  3M7M X;  1JQ0 A;  5ITZ B;  3HKE A;  1I08 A;  1K5Q A;  1VQ6 V;  2ZQM A;  2ODM A;  4J11 A;  2B9Z A;  3AG2 C;  3FB6 C;  3LSU A;  5JJE B;  1XBL A;  3H01 A;  2QEX V;  1Y74 A;  1SS3 A;  2ZXW B;  2FKX A;  2WAM A;  4FIP C;  1K3E A;  4DR3 B;  1L0L H;  2AHY A;  1JR9 A;  4PDM A;  1XNQ O;  3CX5 F;  1DK1 A;  2OCC B;  5DEC A;  4MSW C;  4B3T O;  2WLJ A;  2XAQ A;  2DWE C;  1QU7 A;  4L87 A;  4TV8 B;  2AZ0 A;  2A06 H;  2YXL A;  3T1H B;  5KA5 A;  2XAF A;  1JPX A;  4J10 A;  4PD4 F;  3STZ C;  4X66 B;  5L3E A;  1IX9 A;  2UXC B;  2X7R B;  1YXB A;  2QWR B;  3ZMV A;  5KHI A;  3D3Q A;  5LL6 Y;  2JRI A;  5FPR A;  3SYP A;  3CEI A;  3ZHU A;  4JAA A;  1PPJ H;  5JJJ B;  2Q0A A;  3FYE B;  4R7C A;  1QR8 A;  4B08 A;  4OPH A;  2OTJ V;  4JAV A;  5KX5 B;  3AG1 B;  3ASN C;  1NH2 D;  2IH1 C;  3K79 A;  2V1D A;  4WFF A;  5JQG A;  2GTS A;  1QBZ A;  1PNM A;  1MZE A;  1Y66 A;  4FLZ A;  1N34 B;  2DW4 A;  2ZIN A;  4O4L A;  2HR3 A;  3ZHQ A;  2XAS A;  3OMI B;  5IJ0 A;  1N32 B;  4JI2 B;  1XQ8 A;  1PL4 A;  1G1X B;  3OTO B;  3SYC A;  3OMA B;  4UVA A;  1PP9 H;  1FAF A;  2P4K A;  2JS3 A;  4X1I B;  1NR1 A;  4NVP A;  3IC9 A;  5IJ9 B;  3HKD B;  4YJ3 B;  3FB8 C;  5FPO A;  3MAQ A;  2DYS C;  1R6T A;  1KEC A;  1F4N A;  3ABK B;  2WLK A;  5L3G A;  4MVU A;  1N0N A;  3P3P A;  3E22 B;  4QE7 A;  5LBQ A;  1OCC B;  2JJ1 G;  2ZM6 O;  4HYO A;  1B04 A;  3T1Y B;  4NYK A;  5IYB O;  4FLV A;  3CXC U;  1N8R W;  3HKB B;  1AJN A;  3HKD A;  3CJH A;  2DN9 A;  3CC4 V;  5C8Y A;  1M56 B;  5EC2 C;  4LF8 B;  3IGA C;  4DV6 B;  4FFB A;  2N04 A;  5ITZ A;  3WG7 C;  3CCM V;  2ADP A;  4NKG B;  1K4D C;  4LFB B;  4MTF A;  1MG1 A;  4WCE V;  3T2M A;  1I94 O;  1K92 A;  3H1L H;  1S3J A;  4RUF A;  4MVO A;  2HJD A;  1Q8I A;  3F5W C;  2X6B A;  4DR5 B;  5B3S B;  2EJR A;  1Q82 W;  4LF7 B;  4PA7 A;  2JK5 C;  4CS3 A;  3JAL B;  1N36 O;  4I4T A;  4DR7 B;  2GUZ A;  1IUR A;  1XHZ A;  4DO2 A;  5JJN B;  2EIJ B;  3JAK B;  4I50 B;  1KU9 A;  4X1K A;  3C90 A;  1J5E O;  5IWA B;  3E35 A;  3N2K B;  1MAB G;  4X9Q A;  3FKS G;  4YXW G;  1NTK H;  1DLB A;  1K34 A;  4JI8 B;  3RYC B;  5CA0 A;  2QR4 A;  1U97 A;  4IIJ A;  4LFA B;  1K7D A;  2WLI B;  3M8A A;  1YTF B;  4LF4 B;  4FLT A;  4DK0 A;  1NTZ H;  3KCX A;  1FFX B;  4CH4 A;  4JTC B;  3CJH B;  3G67 A;  3MDS A;  3WB2 A;  3ZMU A;  4MTO A;  2Y48 A;  3KKY A;  4FM0 A;  4O2B A;  1BSM A;  1MMM A;  4J7Z A;  1DTO A;  3E8B A;  1AJQ A;  5BMV B;  4JI0 O;  3ZHS A;  3K5L A;  1WPB A;  4GX0 A;  3A2F A;  3CRM A;  4DR6 O;  1S72 V;  1VQN V;  3SYO A;  1SA0 B;  1RM1 C;  5CN0 A;  3SYQ A;  5A9G A;  3DXR A;  4FZ1 A;  2EIK B;  1BHB A;  1SQQ H;  2LO1 A;  1OHH G;  3ETG A;  3RYF A;  4O2A A;  1GTO A;  2O57 A;  3UT5 B;  4QE9 A;  3AG2 B;  5IJ9 A;  2CGO A;  4WBN A;  3CYO A;  2YIC A;  4PI0 A;  1GM7 A;  1XMO B;  3JD2 A;  1QNM A;  2JEX A;  3CC7 V;  1AP5 A;  2OCC C;  3ZCC A;  5EBL C;  3N27 A;  2F66 C;  1M4U A;  1VP7 A;  1GM9 A;  2FB5 A;  4GX5 A;  2R9A A;  4J9Y B;  1F4M A;  2L6L A;  5IYD O;  2D2C B;  2EIN B;  2NN4 A;  2WLL B;  2X6C A;  1HNZ B;  3QG5 A;  1R1B A;  1OCO B;  3J7A U;  3HKC A;  3ZRX A;  3VOU A;  3F7V C;  4WFB V;  4DR5 O;  4GKK B;  4DV5 B;  3T1Y O;  2ZE6 A;  5LMU B;  3J80 N;  4J80 A;  4ZOL A;  1YCI A;  3ETE A;  1GM8 A;  3ZRW A;  1R3I C;  2QWN B;  2PYL A;  2DYS B;  4PA4 A;  3OUS A;  5B66 Z;  1WP8 A;  3CRR A;  1TUB A;  2AXT Z;  4NTX A;  1YJN V;  4X1Y A;  3LNM B;  4AIL C;  1VQP V;  1FJG O;  3I56 V;  4RO2 A;  5LGU A;  5H6R A;  2BE3 A;  1VMG A;  5CA1 A;  4WBN B;  5BY1 A;  1HWY A;  2X0L A;  1QCE A;  2Q68 A;  1FD9 A;  3TXQ A;  3SGI A;  1JJO A;  2HHH B;  2G38 A;  1Y76 A;  4E4E A;  3OUF A;  2HHH O;  1JCH A;  5CA1 B;  3B8M A;  1JFF A;  4KP4 A;  2H94 A;  1PNL A;  4JI7 B;  2IW5 A;  2ZIO A;  4PDV A;  2F95 B;  2ZNJ A;  2DQ0 A;  5GW7 A;  5J2T A;  5J2U A;  4B7E A;  3JD0 A;  2EZO A;  1BL8 A;  2HVK C;  3DTU B;  1GRJ A;  4TUY B;  3ZIA G;  5JCO A;  2DE0 X;  1Z2G A;  2QSA A;  4XBF A;  1HR0 O;  1IDS A;  2Q73 A;  5CA3 A;  2WPD G;  3JD3 A;  2DYR C;  4DW0 A;  1YJ9 V;  3JAK A;  5LA6 B;  5KHK A;  3DSQ A;  3BCC H;  2WLL A;  2LQT A;  1AP6 A;  2EX3 A;  2A7W A;  2LW1 A;  3H1I H;  1I5X A;  3FX7 A;  3L71 H;  2YEV A;  4I55 A;  3P32 A;  4E2L A;  5BR8 B;  3P30 A;  1RSO B;  4O4J B;  3LDD A;  2QA4 V;  1H8E G;  4O2B B;  3SPC A;  5EBM C;  1EFR G;  3KCY A;  3FFQ A;  4ZKI A;  3AG3 C;  1XNR O;  5CBF A;  4FLX A;  3CSX A;  2ZR2 A;  1J95 A;  3K57 A;  4LWS B;  3QF7 A;  4MVZ A;  1AB3 A;  1FXK A;  3D8C A;  1W59 A;  3K3W A;  2DYR B;  4H37 A;  3U11 A;  3TK1 A;  1XUQ A;  4FFB B;  1VEW A;  3A0R A;  2ZCE A;  4PDR A;  3EXA A;  3ABL C;  3CCQ V;  3DXR B;  1SZX A;  2WWW A;  1KP3 A;  4BW9 A;  5DM6 V;  3HKE B;  4GT1 A;  3N2K A;  3I55 V;  1ZLZ A;  3TCU A;  1FFT B;  3OR6 C;  4HNA B;  4JV5 O;  1IVS A;  2OTL V;  2Q7H A;  3B2E E;  5CA0 B;  1VQ9 V;  1Q5O A;  1TA8 A;  1OCZ C;  4DUZ B;  1M57 C;  5CB4 B;  1WN7 A;  3EHB B;  4X89 A;  1D2D A;  1KD1 W;  1H2S B;  5LOV B;  1IBK O;  4DRX B;  1QLE B;  3BA8 A;  1JA8 A;  2ZE7 A;  3D36 C;  2UUA O;  4C7U A;  2PI5 A;  1CP9 A;  5FL7 G;  4U7N A;  4DV6 O;  2Y69 B;  4I4T B;  3W7S A;  5LGT A;  2HEP A;  4IYH A;  3CPW U;  2RCV A;  1WPX A;  4CS2 A;  4JTA B;  4FJC C;  1NVP B;  4LH6 A;  3LSS A;  3BEH A;  4N21 A;  1YEW A;  1YDX A;  1UPG A;  1Y4M A;  2R9I A;  5JCO C;  4X64 O;  2VQE O;  4GCZ A;  3X2Q B;  4KUM A;  1R73 A;  4JF3 A;  2R70 A;  3ASO C;  4QJF B;  4EKW A;  1FS0 G;  1N4C A;  4WFE A;  3JSL A;  2UXB O;  3LUT B;  4I9W A;  1KP2 A;  1BCC H;  4FLU A;  3AG4 B;  3RGB A;  5B3S C;  1OZ0 A;  1QVF U;  3K03 A;  5A2Q N;  3C3S A;  3OEE G;  3LDC A;  3OR7 C;  2GDS A;  2E75 B;  4CC5 A;  4JYA B;  5KAF Z;  1BT8 A;  5B1N A;  1HNZ O;  1N32 O;  3OE7 G;  1OCC C;  2GUZ B;  1Q3E A;  1COW G;  2LW7 A;  4B3M B;  1NKD A;  5GTH Z;  2IM9 A;  4OXS A;  3MD0 A;  3B40 A;  4LBE C;  2XHB A;  5C8Y B;  3JAR A;  2IJJ A;  3CB2 A;  1AVM A;  3JAT B;  4CZZ A;  3HKB A;  4GKJ B;  3ZHT A;  5HFL A;  2OIE A;  4UCV A;  1Y74 B;  2B1G A;  4FZ0 A;  1S77 D;  1PV0 A;  3OW2 U;  1JFF B;  1Q6U A;  2FYU H;  2Z0A A;  3THO A;  4O4I B;  4JI5 O;  2GV9 A;  5K1P A;  2YID A;  3K9A A;  4EFE A;  2QWQ B;  2QM4 A;  4H33 A;  3BAB A;  1Y6X A;  2VWK A;  4JI8 O;  4DV5 O;  5IJ0 B;  2BOC C;  3CCU V;  5EIB D;  4K0K O;  3TJT A;  4IHJ A;  5CB4 A;  1KB9 F;  4QPK A;  4DW1 A;  4NXN O;  2YI9 A;  3WFV A;  4MW8 A;  1KKD A;  3ETQ A;  1NT2 B;  4KHP B;  4H13 B;  1SQV H;  3JCZ A;  4JYB A;  1SKV A;  2Q9L A;  4KHP O;  4J7K A;  1QVG U;  1R3L C;  3ZMZ A;  4CBC A;  2E5L O;  2HG5 C;  3KZI Z;  4OPA A;  1KQS U;  3HR0 A;  4FK5 C;  2VQE B;  1GH6 A;  1V54 B;  1O9H A;  3SPG A;  2EZP A;  4BIU A;  1BZK A;  4P30 A;  5KUM A;  2M7W A;  3ETD A;  1JVM A;  2UXB B;  2L35 A;  2LGQ A;  1VQ8 V;  2UUC O;  2DOS A;  1IXM A;  3ABM C;  1A32 A;  4UUJ C;  3IC7 A;  2UUC B;  4GZR B;  5LHG A;  2OT5 A;  2Q6A A;  4IT5 A;  1M57 B;  3CCR V;  4ZBM A;  1D5N A;  4NXM O;  1FPO A;  4ZHQ A;  2VS0 A;  1YHQ V;  1TVK B;  2PYJ A;  5H5N A;  4JAU A;  1ZUQ A;  3BA9 A;  3NR7 A;  3UT5 A;  2F43 G;  2AZ2 A;  3L75 H;  3E2E A;  3AG3 B;  3QNE A;  1IBM B;  4H44 B;  1WB8 A;  3SYA A;  2BSK B;  4JI6 O;  2AW9 A;  5K1X A;  1GKF A;  1SRY A;  2BTQ A;  3CCS V;  3GB7 C;  3W7U A;  4K8Z A;  4L8J A;  1HNW O;  3CRA A;  2OYQ A;  4FLY A;  2F93 B;  1HNX O;  1IBL O;  5BZB A;  3SJC C;  2YC0 A;  1E1R G;  1NS1 A;  3ZJZ A;  1Q6H A;  2QKC A;  5LMN B;  4IIJ B;  3DC5 A;  2BTQ B;  4LF5 B;  4TUY A;  3JAS A;  1W0K G; 
#chains in the Genus database with same CATH homology
 2DYS B;  4PA4 A;  1AJP A;  1AI7 A;  2EIL B;  1K8A W;  3OUS A;  5EBW C;  1OCO C;  3RW0 A;  4PEL A;  3K04 A;  1RPR A;  3B77 A;  4PA9 A;  4N23 A;  1YJN V;  5H9C A;  5J9P C;  3LNM B;  2W6I G;  5B1O A;  1K97 A;  1VQP V;  3I56 V;  1CPY A;  2XAH A;  2JJ2 G;  4RO2 A;  4DXW A;  5LHH A;  1W2B U;  3T4Z A;  5LGU A;  3G6E V;  2LP7 A;  5H6R A;  1K9M W;  4Q20 A;  5B1A C;  1GK9 A;  4UVB A;  2C2A A;  1H2G A;  4RUE A;  1VQL V;  1V55 B;  1DF4 A;  3ASN B;  1HWY A;  2X0L A;  4RQF A;  1FXH A;  1ARO P;  1QCE A;  2Q68 A;  5IY5 B;  1VQM V;  3SPH A;  2B1I A;  5B1A B;  2JEU A;  2D3O W;  2QTO A;  3ZRW B;  1NQT A;  4PA3 A;  3OUF A;  4LC1 A;  1GMG A;  1JCH A;  3B8M A;  3QO7 A;  4XDL A;  4KP4 A;  3ZRV A;  5LGN A;  2XAJ A;  3QO5 A;  4MVQ A;  2NNU A;  2Q67 A;  4JPR A;  5H6Q A;  1YSC A;  2DQ3 A;  5KA6 A;  2H94 A;  5L3D A;  1PNL A;  1K73 W;  1G8M A;  2A79 B;  4WFA V;  4X8A A;  4MVS A;  3STL C;  2IW5 A;  1P4R A;  4HAM A;  2X6A A;  1TUE B;  4PDV A;  4P9O A;  3G4S V;  5GW7 A;  2DQ0 A;  3T1C A;  2R9R B;  5EC1 C;  5IDJ A;  2ZD9 A;  1I5Y A;  3CME V;  3JD0 A;  2CK3 G;  4LCU C;  4X88 A;  1AI6 A;  2EZO A;  3HPL C;  1QLN A;  1BL8 A;  2ZR3 A;  2YEV B;  2WLH A;  1JOY A;  2HVK C;  4JYC A;  3DTU B;  3AG4 C;  1ENV A;  3NXS A;  1OCZ B;  3DGE A;  4G27 B;  1H8H G;  4TT3 G;  3ZIA G;  2EBO A;  3LSQ A;  2W6J G;  4XBF A;  1DF5 A;  1RPO A;  4RQE A;  4GX2 A;  1ROP A;  2QM7 A;  1KC8 W;  2PI4 A;  5CA3 A;  2WPD G;  3JD3 A;  3QO8 A;  1EZJ A;  5LHI A;  2DYR C;  3ZN1 A;  4KFM A;  4UXN A;  4XDK A;  1VQ5 V;  4UV9 A;  1YJ9 V;  2EIK C;  2P90 A;  1M56 C;  3G71 V;  3E83 A;  2WLL A;  4TSF G;  2EIM C;  1R6K A;  2WLM A;  4GX1 A;  2EIL C;  3BY6 A;  1I5X A;  2ATK C;  4QPJ A;  3JYC A;  3OMN B;  3ABU A;  3UM7 A;  2YEV A;  3WG7 B;  3P32 A;  4E2L A;  2XAG A;  1W0J G;  2JDI G;  2Q69 A;  3P30 A;  3OEH G;  3LDD A;  2QA4 V;  1YIT V;  4BAY A;  3EFF K;  1S76 D;  1XL4 A;  1W0K G;  2HVJ C;  1H8E G;  4MVR A;  3RVY A;  3SPC A;  4BW5 A;  3RVZ A;  5EBM C;  1EFR G;  1SER A;  2QM8 A;  4ZKI A;  1JQ0 A;  1R3J C;  3AG3 C;  3ABK C;  4MT8 A;  5CBF A;  1NJI W;  5L3F A;  2ZR2 A;  1Q81 W;  1J95 A;  1K5Q A;  1VQ6 V;  2ZQM A;  1VQK V;  4MVZ A;  3AG2 C;  3FB6 C;  1FXK A;  3K3W A;  2DYR B;  2P6J A;  3H01 A;  4H37 A;  3TK1 A;  2QEX V;  2ZXW B;  1LNQ A;  3A0R A;  2WAM A;  3OAA G;  4FIP C;  4PDR A;  2HJF C;  1K3E A;  3ABL C;  3MHS C;  3CCQ V;  2AHY A;  1SZT A;  1F23 A;  4R50 A;  2YSU B;  2WWW A;  4PDM A;  1WLE A;  2UXN A;  1KP3 A;  5B1B C;  2OCC B;  4FMT A;  3ABM B;  1RM1 B;  2A9H A;  3OM3 B;  4MSW C;  4P9P A;  2WLJ A;  2XAQ A;  3E8G A;  5DM6 V;  3TET A;  2DWE C;  4GT1 A;  4L87 A;  4QIW F;  5EK0 A;  4QNH B;  5CMU A;  3CCJ V;  3I55 V;  3K0G A;  3VBB A;  3TCU A;  5B1B B;  1FFT B;  2ZDI A;  3OR6 C;  5KA5 A;  3ASO B;  1M9N A;  2OTL V;  1VQ9 V;  3R65 A;  2XAF A;  1JPX A;  1OCZ C;  3STZ C;  1NBM G;  5CBG A;  1V54 C;  1M57 C;  4MTX A;  2MK3 A;  3CC2 V;  3EHB B;  4X89 A;  5L3E A;  1PKX A;  1KD1 W;  2X7R B;  1M1K W;  3D3I A;  3ZMV A;  1QLE B;  2NLJ C;  2EIJ C;  3SYP A;  4Z1M G;  3CCV V;  3IFX A;  2PI5 A;  1XL6 A;  1CP9 A;  5FL7 G;  1YIJ V;  4U7N A;  3FYE B;  3AG1 C;  2Y69 B;  4J9Z B;  3W7S A;  4R7C A;  1QLE C;  5LGT A;  1QR8 A;  2ZDI C;  2OTJ V;  1ORQ C;  4JAV A;  1NR7 A;  3CPW U;  3AG1 B;  3K08 A;  1WPX A;  4JTA B;  3ASN C;  4FJC C;  4WFH A;  1NH2 D;  1NVP B;  2IH1 C;  3K79 A;  3LSS A;  2V1D A;  3BEH A;  4WFF A;  4N21 A;  2AHZ A;  2ITC C;  4XDJ A;  1QBZ A;  3FB5 C;  1PNM A;  1Y4M A;  1Y66 A;  3ZN0 A;  2DW4 A;  2R9I A;  4MTG A;  5DN6 G;  3AEI A;  2HR3 A;  5L3B A;  1SES A;  2XAS A;  3OMI B;  4GCZ A;  3X2Q B;  2IU3 A;  1K4C C;  2IH3 C;  2LFR A;  3ZMS A;  3CCE V;  2Z5U A;  3OMA B;  4UVA A;  3SYC A;  4KUM A;  1R73 A;  4JF3 A;  3ASO C;  4QJF B;  1AI5 A;  4EKW A;  4LP8 A;  1H38 A;  1FS0 G;  2Z3Y A;  1Q7Y W;  4MW3 A;  4ASU G;  4WFE A;  1NR1 A;  2W0F C;  2K1E A;  1PL0 A;  1YI2 V;  1JJ2 U;  4JAS A;  2JIZ G;  1OCR B;  3LUT B;  1F51 A;  4I9W A;  1KP2 A;  3FB8 C;  1YTF D;  2B5U A;  3AG4 B;  1EBO A;  4JGS A;  1GO3 F;  5B3S C;  1OZ0 A;  2DYS C;  1QVF U;  3K03 A;  1KEC A;  1QR9 A;  3ABL B;  1PD3 A;  3SPJ A;  4G2K A;  1NVP D;  3OEE G;  3E8F A;  3LDC A;  1F4N A;  3ABK B;  3OR7 C;  2WLK A;  5L3G A;  4P2Z A;  4F4L A;  4MVU A;  1S0V A;  5B1N A;  3OE7 G;  4QE7 A;  1OCC C;  5LBQ A;  1OCC B;  3CCL V;  3W7W A;  1COW G;  1NKD A;  2P67 A;  2HFE C;  2JJ1 G;  3LDE A;  4TWK A;  5E1A C;  4HYO A;  4OXS A;  1VQO V;  3MD0 A;  1MOF A;  1THZ A;  5IYC O;  3W7X A;  4LBE C;  5IYB O;  3CXC U;  1N8R W;  1FXK B;  1AJN A;  1FXK C;  2IJJ A;  4CZZ A;  3CC4 V;  2H8P C;  1M56 B;  5HFL A;  5EC2 C;  2IJI A;  5IY5 C;  3IGA C;  2B1G A;  4MVM A;  3WG7 C;  3CCM V;  1K4D C;  3GWO A;  1S77 D;  4MTF A;  3OW2 U;  1JX9 A;  1MG1 A;  4UV8 A;  4WCE V;  3T2M A;  2KB1 A;  1K92 A;  3SPI A;  1S3J A;  4RUF A;  4MVO A;  3K9A A;  3F5W C;  2WLI A;  4MS2 A;  2X6B A;  2WSS G;  3B8N A;  4H33 A;  5B3S B;  3FYI B;  2EJR A;  4WF9 V;  1BMF G;  1Q82 W;  3K0D A;  2BOC C;  4PA7 A;  3CCU V;  2JK5 C;  4JTD B;  1K33 A;  4U7O A;  1UJW B;  1P7B A;  3T4D A;  2IJH A;  2ZXW C;  1L1F A;  3D36 A;  2ITD C;  4QPK A;  4WFG A;  3UKM A;  3WFV A;  3X2Q C;  4DO2 A;  4MW8 A;  1KKD A;  3OGC C;  1CEZ A;  2EIJ B;  5L3C A;  1R3K C;  1E79 G;  3E35 A;  2IJK A;  3JCZ A;  1MAB G;  1ZWI C;  1R6N A;  4JYB A;  2BOB C;  3FKS G;  1QVG U;  1R3L C;  3ZMZ A;  3KG2 A;  3E89 A;  4YXW G;  1DLB A;  4CBC A;  1K34 A;  4FPP A;  2EIN C;  2HG5 C;  5CBH A;  1K7D A;  2GHY A;  1KQS U;  2WLI B;  1VQ4 V;  1YTF B;  5C93 A;  4I5S A;  3ABT A;  4FK5 C;  4R6Z A;  1V54 B;  3F7Y C;  4JTC B;  4PA6 A;  3ZMU A;  4MTO A;  2QE7 G;  2Y48 A;  3SPG A;  2EZP A;  4BIU A;  2HKO A;  4P30 A;  1B6Q A;  1SET A;  2M7W A;  3ETD A;  3MHH C;  5KUM A;  3SJQ C;  4BIZ A;  1DTO A;  3E8B A;  1AJQ A;  1JVM A;  3E86 A;  1AI4 A;  1VQ8 V;  4GX0 A;  3ZMT A;  1VQ7 V;  1IXM A;  1S72 V;  3SYO A;  2EIM B;  5HFM A;  2XOK G;  3ABM C;  4UUJ C;  1AR1 B;  4R8C A;  5CN0 A;  3SYQ A;  1RM1 C;  1OCR C;  3RBZ A;  3IC7 A;  1M90 W;  2EIK B;  1BHB A;  5LHG A;  2OT5 A;  2P7T C;  2Q6A A;  1OHH G;  3E8H A;  4RAI A;  3ETG A;  4G28 B;  3CMA V;  1M57 B;  3CCR V;  4ZBM A;  3JD4 A;  4UVC A;  1GTO A;  1S5H C;  4QE9 A;  1YHQ V;  3AG2 B;  4JAU A;  1PNK A;  2F43 G;  1E1Q G;  2HLD G;  3CYO A;  2FTK A;  1GM7 A;  3E2E A;  4HZ3 A;  3ML0 A;  5KUK A;  3JD2 A;  3AG3 B;  2JEX A;  2UXX A;  3QNE A;  3CC7 V;  3M99 B;  2DWD C;  2OCC C;  3SYA A;  3ZCC A;  5EBL C;  1YJW V;  1GKF A;  1SRY A;  3CCS V;  1GM9 A;  4GX5 A;  1K5S A;  1V55 C;  1MSW D;  3GB7 C;  3CD6 V;  4J9Y B;  3W7U A;  1F4M A;  1G4Y B;  2WLN A;  1NH2 B;  3HB3 B;  5IYD O;  2EIN B;  2IU0 A;  1Q86 W;  3CP1 A;  2WLL B;  2X6C A;  3JD1 A;  5BZB A;  1OCO B;  2QKS A;  4PDL A;  1VQN V;  3ZRX A;  3VOU A;  3F7V C;  1E1R G;  2Y69 C;  3ZJZ A;  4WFB V;  3FB7 C;  3OFN G;  2XND G;  3K06 A;  3PJS K;  2A0L A;  3ETE A;  2LFS A;  2V7Q G;  1GM8 A;  3ZRW A;  1FXV A;  1R3I C;  1BHA A;  3ZRS A;  3W7T A;  2GSM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...