2HFEC

Rb+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hfeC00
2K1EA 4BW5A 4GX5A 4HYOA 2OCCC 1K4CC 1OCCC 2IH1C 2A0LA 3K0DA 3F7VC 4UUJC 3F7YC 3ZJZA 1R3IC 3K04A 3KG2A 4P9PA 3SPHA 2ITCC 3SYPA 4X88A 4RAIA 2EIJC 4J9YB 4P2ZA 3E8FA 2BOBC 5EC1C 1V54C 4LCUC 2HFEC 2DYSC 2HG5C 1ZWIC 2WLMA 2X6CA 3LDEA 4GX0A 4PA7A 2X6BA 4QE7A 5EBWC 3FB6C 2Q68A 3PJSK 4I9WA 4G28B 3VOUA 5CBGA 2AHYA 3BEHA 5KUMA 3AG4C 2ITDC 4X8AA 2YEVA 2WLNA 2WLIA 3T4DA 3RW0A 1XL6A 3ABLC 3LDCA 3WG7C 3FB5C 4F4LA 2WLLB 1V55C 4PDVA 4JTDB 3TCUA 4MTGA 3E86A 4OXSA 4J9ZB 4LP8A 3T2MA 1JVMA 2Y69C 3TETA 2HJFC 4H37A 2Q6AA 3IFXA 4MVRA 3X2QC 3SPIA 5CBFA 2P7TC 2ATKC 2A9HA 4P9OA 4PDLA 4HZ3A 5CBHA 3E89A 1KKDA 2HVKC 2EILC 1R3LC 2DWDC 2DYRC 4R8CA 3R65A 4TWKA 2BOCC 4GX2A 4MSWC 4MVZA 3E8GA 3FB7C 4MTOA 3JYCA 1M57C 3OGCC 3UKMA 2Q67A 2ZD9A 1OCZC 4X89A 3RBZA 2DWEC 1ORQC 2R9RB 4PA9A 4XDLA 3E8HA 1R3KC 3OR6C 3K06A 3SYQA 2WLIB 2NLJC 2WLJA 4XDJA 3SYCA 3K08A 4MTFA 3K03A 3LDDA 5B3SC 3OR7C 1M56C 5BZBA 1XL4A 4P30A 3T4ZA 4MS2A 3SPCA 3SPGA 3UM7A 4EKWA 5IY5C 2IH3C 1R3JC 1QLEC 4MVMA 2EIMC 4R7CA 4KFMA 3T1CA 3GB7C 3SJQC 4G27B 2X6AA 3RVZA 4MW3A 4MVQA 3IGAC 1J95A 3LUTB 4PDMA 4MVSA 5E1AC 4DXWA 3ASOC 2JK5C 2W0FC 3HPLC 4RUFA 3AG1C 5J9PC 3SYOA 5EK0A 4WFEA 4QNHB 2H8PC 2WLHA 3STLC 4MVOA 1S5HC 1G4YB 2EIKC 3EFFK 5B1AC 2KB1A 2QTOA 1OCRC 5EC2C 3AG2C 3STZC 4PA6A 3RVYA 1P7BA 3LNMB 4R6ZA 3ZRSA 2QKSA 3FB8C 4MVUA 4ZBMA 4JTCB 2EINC 2WLKA 2A79B 3SPJA 5EBMC 3E83A 3ABKC 3OUFA 1LNQA 4JTAB 3K0GA 4PA3A 5KUKA 4PDRA 4GX1A 5EBLC 4QE9A 4WFGA 4WFFA 4LBEC 4PA4A 4RUEA 4WFHA 1OCOC 4R50A 2AHZA 3OUSA 1K4DC 3ABMC 5B1BC 4H33A 3E8BA 2HVJC 4RO2A 2WLLA 3SYAA 4XDKA 4CBCA 3AG3C 1BL8A 3F5WC 3ASNC 4MW8A 2ZXWC 2Q69A
chains in the Genus database with same CATH superfamily
4BW5A 1GKFA 3DXRB 2LGQA 3OMAB 2PF4E 1NH2D 1K5SA 1VF5B 3W7XA 2EZPA 4WCEV 1BSMA 4QJFB 2GUZA 4BIUA 3RGBA 2V7QG 1KBHA 2WLNA 3CX5F 3T4DA 3QF7A 3ABLB 3Q4HB 4WFAV 2EJRA 2JEXA 3KKYA 4FLXA 2Y69C 5H6RA 1FYJA 4MVRA 2K9PA 4DR3B 2P7TC 5CBHA 3W7WA 2PYLA 4JYAO 1QR9A 4HBNA 1OJHA 3E8GA 5JJJB 3OGCC 3OW2U 1AI6A 3U11A 2P06A 1SQPH 4UVAA 4NXMB 3MHHC 2B1GA 5DM6V 2YI9A 4NXNB 2KKWA 2Q73A 1HNWB 1BZKA 3E22A 3T1CA 5IY5B 4DR1B 3KZIZ 4EFEA 3L73H 1XMQO 1FXKA 1Y6XA 1OHHG 4QNHB 3STLC 2HP8A 1R6TA 5KA5A 2QWNB 1W0JG 1Q81W 1KP3A 1P7BA 4JI8O 2B5UA 1F4MA 3IC9A 5BMVB 2QDOA 5LA6A 1FFXB 4NTWA 1Y76B 2ZE6A 2LP7A 2QM7A 1AB3A 4JZ2A 4WFFA 4JGSA 4R50A 5ITZB 4DV6O 3U10A 4GZRB 3APOA 4RO2A 4XDKA 2D2CB 2XAHA 3TXSA 2RCVA 2QKAA 5LXTA 2EZOA 2XT9A 4LNUB 1JCHA 4WBNB 5D5QA 1YJWV 4KHPB 4BAYA 1YXBA 4YJ3A 4DUZB 2Y4TA 3PJSK 5EYPB 5A2QN 2JEUA 1AILA 4X8AA 4LF6B 3DTUB 1XL6A 1YVWA 3JAMN 4ZKIA 4X62O 4DO2A 2HKOA 1N4CA 3K9AA 4LP8A 3B77A 4FZ1A 1I08A 3WU2Z 3OD4A 2ZE5A 4J7ZA 1PPJH 2YI8A 3N27A 1AR1B 2BOCC 3JD2A 4FIPC 4DRXB 2DYRB 2A7WA 3B09A 1M57B 1ORQC 5BR8O 5IJ9A 2JGUA 5B1AB 3RN4A 4IIJB 5LP6C 5IWAO 5EIBC 4MTFA 1RFYA 5BXZA 2VS0A 3OT7A 1SA0B 2YXLA 2YIBA 1U97A 1Q90D 1R3JC 3C3TA 1KC8W 2YC0A 4NTXA 4W4KA 4B7EA 4G27B 2AZ0A 4RUFA 3K5MA 3ETEA 4DV5O 4U3JA 3JARA 2WLHA 4I7ZB 2KB1A 5L3CA 2CGOA 2YEVB 5C93A 4X1IB 2NN4A 1JA8A 3K79A 1UJWB 2F4VO 5H5NA 2Q7EA 4ICGA 3JASB 3BA8A 2DYSB 3OEHG 3N2KA 2VQEO 4H33A 3SYAA 3D3IA 3F5WC 2UXDB 2Q69A 3CD6V 4AQYO 2CTRA 4DR7B 2CK3G 3BPZA 4PV1B 5KX5A 1V55B 1GO3F 5DN6G 5J2UA 3K0DA 2YIBD 3I55V 2M6YA 3CCEV 1OCCB 2PUSA 1I94O 2EIJC 3BHPA 5LYJA 3M7MX 2BOBC 1IZ3A 3G6BA 4JF3A 3SJBC 3B4SA 3T1HO 1BS3A 1G8MA 1URFA 3VOUA 1PNLA 2CGNA 3L71H 4LFAB 2WLIA 3RW0A 1DLBA 4DR4B 4YJ2B 2VRZA 3JATB 1M93A 2RJZA 4X1KA 3TGUH 3CWBH 3TJTA 4QGPA 5E79Z 4EB6B 5IJ0A 5KHJA 3R65A 4GX2A 1PL4A 1H2LA 4L87A 2HEPA 4JI1B 3CCLV 3OAAG 1WPBA 2UUCB 3OMIB 4FMTA 1JFFB 5B1NA 4DK0A 1K3EA 3ZHSA 4GLXA 4OPHA 2IH3C 4NTYA 2EIMC 1BHAA 2FKXA 4MVQA 2QEXV 1AI5A 4JI7O 2RNBA 1ZUQA 4ZHQB 3ABTA 1S5HC 3SJAC 2QA4V 1OCRC 2QTOA 5JJNB 4DV2O 1NI8A 4AILC 1HP8A 1M4UA 3CYOA 4UB6Z 1TUBA 3P3NA 1KMIZ 4D7SA 2OWOA 4PELA 1XHXA 5KUKA 4YY3B 3THOA 4PI2A 3OMNB 1AJQA 3CJHA 3ABMC 1QCEA 4OPAA 3U0ZA 4O4LB 3RT3C 3RYFA 1IVSA 1K7DA 4LF7B 1XOUA 1LUVA 4YIPA 5GONA 2OCCC 1Y74B 4B3RB 2L35A 4JI0O 3OTOO 2CH7B 2R72A 3EXAA 4GKKO 2LW7A 3D3QA 4ZIBA 3LSUA 2CTWA 3BCCH 4B7KA 2CDYA 4FZ0A 4O4HB 2YICA 4B3TO 3CCUV 2FYUH 1HW7A 2W6JG 3AG4C 2BTQB 4U7NA 5JWPA 3AK1A 2Q9LA 1E79G 3ABLC 1WP7A 3WFVA 5KHGA 1S76D 3ETGA 4QPKA 4JI3B 1IX9A 1MMMA 4LFCO 4TV8B 4B3MB 5L3EA 3FKSG 4X66B 1Z5VA 2QGNA 1SZXA 1WB8A 4CC5A 3G80A 1QQCA 1FD9A 5KHHA 1K5QA 1NR7A 3GWKC 1XQ8A 5KLVH 1COWG 1W59A 3ZN1A 1J5EB 4J10A 4TV9B 2OTJV 1M56B 2H3OA 5IY5C 1NR1A 2FMLA 1RP3B 4I4TA 4LFBO 3SJQC 2XAQA 1Y4MA 4DV1O 4F6RB 5EK0A 4DV7O 1VQ7V 2ZIMA 3ABUA 4PI0A 2EIKC 2KG7A 1QVFU 1JPXA 4ABMA 4C7UA 4DR5O 3RVYA 4R6ZA 4ZBMA 2EINC 4PJ0Z 1SQBH 4X20B 3RYCB 4WFGA 4D7TA 5J2TA 4DUYO 4FLYA 1TUEB 1L0LH 3OE7G 5JVDB 1VIBA 2WLLA 3O9OA 3VQXA 1NH2B 4MTXA 3HKBB 4JZGA 1SKVA 5JH7A 1NJIW 1AP5A 2UUAO 1YI2V 2GV9A 4UUJC 3G4SV 2W6IG 1GM9A 3ICXA 3A0BZ 3VBBA 2ETNA 4QE7A 1RPOA 5EBWC 1L1FA 2E75B 1MABG 5LMUO 2BE3A 3BRCA 1KD1W 1AI4A 4DUYB 2HHHB 1HNXO 4B3SO 1GN3A 1RSOA 4JYYA 1JVMA 1EBOA 2A9HA 4DR2B 1YF2A 1N8RW 2FTKA 1RPRA 5TISZ 2DYRC 3WB1A 3ZHUA 2RN9A 2EILB 5CB4A 1MSDA 1M57C 2XAJA 2GUZB 3JCUZ 2ZD9A 3ZHRA 1XI1A 2G38A 3BA9A 3VQVA 1M90W 4F6EA 2Y4UA 1MG1A 1FS0G 1NKDA 4QIWF 1IBKO 4FLWA 1KB9F 3HKDB 1GM8A 2OIEA 4JI5B 2O57A 1Q6UA 4TOIA 2UXCB 3HKCA 1K8AW 3ASOB 5IYCO 1IDSA 2AXTZ 1K9MW 2Y48A 3B40A 1YDXA 1ENVA 1N34O 4BWAA 2QKSA 4JTCB 3H1JH 1XEQA 5F2VO 1SQGA 5EZYB 1GH6A 4FLZA 4Q6GA 2OCHA 3RWRD 2F95B 2Z3YA 1Y67A 1XDCA 2D3OW 5K1PA 3E22B 2ZXWC 2IW5A 1FXKB 2UXNA 1EZVH 1VQ8V 1ZX3A 3OGIB 4K0KO 1OCCC 1O9HA 2DJVA 4X88A 2HJDA 1NTKH 1VP7A 2E5LB 2CUGA 2F1MA 5AG2A 2HG5C 2IM9A 4PA7A 1YTFD 1PP9H 5CBGA 3H1IH 4DR3O 3CXCU 2F66C 4PD4F 4F4LA 3A0HZ 3UO3A 1VQMV 3MD0A 1CEZA 3JD3A 4UV9A 5B1OA 4CZZA 3NR7A 4JYCA 4DV4B 4PHZA 5LXTB 4JI6O 2V4DA 4PDLA 4RQEA 2A3QA 4GUNA 2HVKC 4YJ3B 4NXMO 4K0KB 1TAEA 1NBMG 3JYCA 4DV0B 2GBOA 1VF7A 5EIBD 1M5IA 2DQ3A 3LSQA 2ZNJA 4PA9A 4JYBA 1TA8A 3G67A 4NXNO 1HNWO 1BCCH 3CP1A 3T1YB 4IGGA 4DR1O 1SQXH 4YIOA 4CS4A 4R7CA 2R9IA 1UPGA 3WB0A 1AR4A 3H9VA 4DV3B 3LUTB 4MVSA 2W0FC 3HPLC 4IL6Z 4JI6B 1Q7YW 2XHBA 1BGYH 5C8YA 3K5LA 4O4IA 1HNZB 4JI2B 4MVUA 3K3WA 3SJCC 5IJ9B 2JVDA 1B6QA 3S3WA 3J7AU 2P5OA 2ADQB 4YXWG 4I50A 3I5DA 2F93B 4LF9B 1IURA 2IJKA 1Q6HA 3CRCA 4LWSB 2QWRB 4KHPO 3CPWU 3AG3C 2LQTA 4MW8A 4GKJB 2Q0OC 4DUZO 4U3JB 3JARB 3K5NA 2BCCH 2A0LA 3IAYA 1R3IC 2EX3A 2GTAA 1SS3A 4LF6O 4AHCA 1AJNA 2WLMA 2X6CA 1T5EA 4U3FH 2DQ0A 1YITV 2W0XA 3FAVA 2BSKA 1OV9A 3TK1A 1BQZA 1LUWA 5KX5B 2P90A 4I0XB 4TUYB 1K97A 2ATKC 1VQ4V 5CA0A 1F23A 1KU9A 3J80N 5LYJB 4I55A 3N2GA 4X65B 2RQ6A 3UKMA 1GK9A 3CE2A 1GN2A 2C2AA 1N0JA 2XTAA 4XBFA 2WLIB 2WLJA 3CSXA 1D2DA 1QVGU 2QM8A 1M56C 2DW4A 3C90A 5BZBA 1VQ5V 5B3SB 3M8AA 1E1RG 1SRYA 1XREA 4KFMA 2GTSA 5DECA 5E1AC 3D36C 5IJ0B 3EHBB 2H8PC 1Q6IA 3EFFK 2IU3A 1US6A 3JD1A 4PA6A 1YJNV 1H2NA 1I7FA 3FB8C 5LGTA 2OTLV 2IBZH 1FJGB 5FPOA 1GM7A 1XUQA 1GMGA 4JTAB 2BTOA 1HWYA 2UXDO 5FNVA 1FKAO 4DR7O 4PA4A 1S72V 4WFHA 1H8EG 4LF4B 1X4TA 1OCOB 3B8NA 3E8BA 4LR3A 2ZNIA 1FXHA 5B1BB 1BL8A 4J7KA 2RMKB 3WG7B 1JJOA 3ZJZA 1R6NA 4LFAO 2ITCC 1N36B 4JV5B 4J9YB 4J11A 4GX0A 4DR4O 3L74H 2ZDIC 4GYCB 4ZOLA 4FM1A 1AVMA 2ADPA 5KHKA 2N05A 1WNSA 3CJHB 4X9QA 3ZMVA 1SERA 2UU9B 3UT5B 3RYFB 1Y76A 1WP8A 4H37A 2Q6AA 4JI1O 1IBMB 4U7OA 5LHIA 1I0HA 2UUCO 1N32B 2EILC 2WA4A 4Z1MG 3K5OA 2WAMA 3DSQA 1EN6A 1PV0A 2V1DA 1R1BA 2R9RB 2F43G 2FB5A 1TGOA 5HFLA 2NLJC 4IT5A 3CMAV 4UCSA 4O4JA 2Q7GA 2ZE8A 2Q4PA 3T4ZA 4MVMA 1VQ6V 2X6AA 4W4LA 1SC5B 3HB3B 3ZRWA 2VWKA 4DXWA 4DR6B 2IJJA 3ASOC 1Q8IA 2ZR3A 1QNMA 3MHSC 1EN4A 4NR1A 5KAFZ 4YY3O 3STZC 2LFRA 2X0LA 1NS1A 4UVCA 1VQLV 1B04A 3OUFA 3HKEA 5KMGA 1JJ2U 4X1YA 2CTQA 1GN4A 4LF7O 2Z5UA 5LGUA 1L8DA 4KXRA 4B3RO 2HVJC 4CH6A 5B5EZ 3JD4A 2UXBB 4FLVA 4Z2WA 3K58A 4JPRA 2JJ2G 1GRJA 1K4CC 1K33A 2VQFB 3VQYA 3DC5A 3LDEA 3FD9A 3JSNA 4LF8B 4H44B 2WWWA 2AHYA 2ZIOA 1K73W 3ZEDA 5J2TB 3CB2A 2YEVA 3JAWB 4JI3O 4L8JA 4B3MO 1B3QA 2WLLB 2ZM6B 4OXSA 1JX9A 4X66O 4CH3A 1H2MA 5JH7B 4N23A 1ROPA 3W7TA 5IYDO 3GVMA 1BMFG 3C3SA 5LMNB 1J5EO 2DWEC 2ILMA 5H2FZ 2KSDA 4HNAA 2QE7G 4LH6A 4O2AA 1BQ0A 1P4RA 1RSOB 1XL4A 5CA1B 3UM7A 4FJCC 5IYZA 4TSFG 4JI4O 1J95A 2RDCA 1MA1A 2QR4A 3RFRA 3JALA 3BY6A 3IJ4A 3LNMB 1V9PA 3QG5A 2QM4A 2Y0IA 3VQWA 4FLTA 4EB6A 5EBMC 4AI8A 1G1XB 3K0GA 3IC7A 4GX1A 3E35A 2PY5A 4O2BA 4JASA 1E1QG 2IU0A 1VEWA 1AP6A 1QLNA 2DN9A 5GTHZ 4CBCA 1PD3A 3QO5A 4I9QA 3HKCB 3CRMA 1YTFB 4JI4B 1YHQV 3OTFA 3JCZA 4UV8A 5LOVA 1H38A 4I5SA 1BE3H 3K59A 1SQFA 1Q43A 2HFEC 1B06A 1V54B 4Z1VA 2HHHO 1VARA 1CPYA 4J42A 4G28B 1YJ9V 1CXZB 2P22C 5GTIZ 3RYHB 4G2KA 4J80A 1HR0B 1PKXA 4OX9B 3JAKA 2KQXA 4DR2O 5CA3A 3UCSC 1NTZH 3L72H 3NXSA 4TT3G 3T2MA 4DK1A 1N33B 2ZE7A 2YXHA 3LSSA 5CBFA 2QWQB 2YS8A 4NYKA 4YHHB 2ZINA 1XMOO 1IBLB 1D5AA 4WF9V 1TVKA 1WLEA 1UFIA 4J41A 1YCIA 4CH4A 2XUMA 1ZSPA 1F7YA 5JQGA 2JIZG 3DGEA 4JI5O 1LR1A 3LDDA 5B3SC 5LHGA 3B8MA 2UXCO 4O4HA 3ZRXA 3SPGA 2QJ1A 3ZX6A 3MDSA 1QLEB 1Q5OA 2GDSA 1XILA 2YDEA 1FPOA 4LH7A 1XNQB 1M1KW 1XMOB 5B1AC 4ZI7A 4TV8A 2OIGA 5D5PA 1DF4A 2E3CA 2IJHA 3ABKB 1YIJV 1KP2A 1OCOC 2AHZA 1K4DC 3OFNG 5B1BC 1JR9A 2E5LO 4FFBA 5KHIA 2IH1C 4JAUA 2LFSA 3F7VC 4UVBA 3ZHQA 2NNUA 4UCRA 4RAIA 5EC1C 1WB7A 2JGDA 2DYSC 2CE4A 4X64B 1S0VA 1WA8A 1VF6C 1ZAUA 1W0KG 2GHYA 4DV4O 3AK3A 2N04A 4QPJA 5LP6A 1V55C 3A2FA 3SGIA 4MTGA 4X20A 2YXYA 3RYCA 2QTSA 3MAQA 4K8ZA 2HJFC 3H01A 4DV0O 2XOKG 3A0RA 3ZCCA 1R3LC 5LA6B 1Q3EA 1XNRB 3HKBA 3FYEB 4FPPA 3T1YO 1XBLA 1R73A 2UUBO 4H13B 1MZEA 1F51A 1OCZB 1R3KC 3OR6C 1OCRB 2HLDG 2YIDA 2P4VA 3K08A 3FAVB 4DV3O 1DTOA 2YIAA 2BSKB 3CHXA 3CCVV 1YZBA 2ZDIA 1QR8A 1X59A 2IJIA 5FL7G 1HNZO 3UO2A 4JI2O 4KUMA 3M99B 3D8CA 3N2GB 4FFKA 3HR0A 4BIZA 2JJ1G 4B08A 2H94A 2OCCB 2R9AA 4MT8A 4K35A 4LF9O 2A79B 1IXMA 2UUBB 4KP4A 1LNQA 4LF5B 4FM0A 4QE9A 4GKJO 3CC4V 4IHJA 4RUEA 3W7SA 3OUSA 3EVKA 3AG4B 5L3GA 1L0NH 1KUQA 2Q5ZA 3ZRSA 2JS3A 3LNNA 4DW0A 2K1EA 4GX5A 2PI5A 3HKDA 4NB5A 3KG2A 5LGNA 5CMUA 3KCYA 3CC7V 2EULA 1GAXA 3R66A 3CRRA 2LJ2A 5DEDA 2Q68A 4Q20A 5KUMA 2ITDC 5FNVB 5CN0A 1BT8A 3LDCA 1Q86W 2R70A 2FL4A 4JAVA 5EZYA 5LL6Y 4X65O 1KKDA 4MVZA 4J7JA 3I56V 2ZCEA 3QNEA 3RYIA 4ZOLB 2UXXA 4JYAB 3N2KB 4XDLA 1K34A 3APQA 2P6JA 2EIKB 3K06A 2LGWA 3TXQA 1VQPV 1ZL8A 2L6LA 3SR2C 2DOSA 2EINB 3CCSV 5J2UB 4N21A 3ZN0A 2LO1A 2JRIA 3L70H 3G6EV 1AR5A 5FPRA 3SYOA 2YSUB 1FJGO 3DXRA 3FFQA 3AG1B 1VQOV 3O65A 2QKCA 2ZKOA 3JSLA 1WAZA 3ZS8C 3CMEV 3B2EE 3GWOA 4LF4O 1XMQB 3CCJV 2WLKA 3SDLA 3SPJA 2F23A 1WJZA 4UCTA 1NVPD 4O4JB 1MNGA 4PDRA 4JI8B 1QU7A 4LBEC 4X1KB 1NT2B 3BVOA 3ZMTA 1DF5A 3L75H 3Q4HA 1GTOA 3ETQA 3ZRWB 1N36O 4LC1A 4JV5O 1FXVA 3TETA 4DV6B 3ASNB 3ZRVA 2Z0AA 3P32A 3F7YC 1DK1A 4P9PA 4EFBA 1AJPA 3E8FA 1V54C 1JMKC 1ZWIC 1S5LZ 2X6BA 3W7UA 2UU9O 1H2KA 3HKEB 4UB8Z 5KMGB 2N74A 2M7WA 2ZR2A 3BABA 3CRQA 4X1YB 5GW7A 1IBMO 2HR3A 1H2GA 1N32O 5JCOC 3E86A 3PN1A 4IYHA 3BAAA 2DMXA 3SPIA 4X62B 2EJ7A 4IYIA 3X2QB 4H0LB 4LWSA 2PGGA 3QTCA 1P49A 1TUBB 4MSWC 5IE9A 3FB7C 4MTOA 3G71V 1QHTA 1S77D 1RM1B 1QBZA 3S3XA 5BMVA 1FFXA 3CC2V 3SYCA 1A32A 2PYJA 3L9DA 5KA6A 1ZTEA 4DR6O 5BR8B 2QWOB 5ITZA 5GONB 4P30A 1QLEC 1VQNV 5IWAB 3GB7C 1PNKA 2B9ZA 5H9CA 4NKGB 2AZ2A 5L3FA 1JOYA 4LNUA 3ZIAG 4WBNA 1GN6A 2ZXWB 1CP9A 4I0XA 4TUYA 1Y66A 3AG2B 2ARHA 4DV5B 4FK5C 1I5XA 4HNAB 3ABKC 4A5UB 3CCQV 2UXBO 5EYPA 5IYBO 3UQ8A 4O2AB 3QVNA 1P7GA 1EM1A 5IYZB 2F4VB 4JAAA 2VQFO 3K57A 2VQEB 3JALB 4LF8O 3SYPA 2Q0AA 4FVMA 2GSMB 1Z2GA 4AQYB 4DRXA 3OM3B 4CC6A 3FX7A 5IDJA 2ZM6O 2P67A 3BEHA 4O2BB 5LBQA 1I94B 1D5NA 4I4TB 4IIJA 4HAMA 1FXKC 1Q82W 3JD0A 3T1HB 4BW9A 4JTDB 1SA0A 2KG7B 1VMGA 5A9GA 2Y69B 5LMNO 5LOVB 4UFZA 4R8CA 1PNMA 1NU1H 3CRAA 3H1KH 4RQFA 1FFTB 2MK3A 2Q67A 1OCZC 4X89A 3OEEG 2CTPA 4DYLA 4X1IA 4ASUG 3P3PA 3JAKB 4XDJA 4OGQB 2PTMA 3CS5A 2NR5A 3JASA 1DGSA 4EEQA 2EBOA 5FLXN 2E74B 1VF6A 3RVZA 5H6QA 4FLUA 3IGAC 2Y0PA 4PDMA 2JK5C 3UT5A 3ZHVA 4WFEA 3FYIB 1TVKB 5L3DA 1EFRG 3AG3B 2E76B 1I5YA 1KKCA 5JQGB 4JI7B 1G6UA 1ZLZA 3CEIA 2YUAA 1EZJA 4DV2B 1O9GA 3ZHTA 5L3BA 1THZA 4GCZA 1R6KA 1PL0A 4YJ2A 4TQFA 4BIOA 4NVPA 1NZ6A 5CB4B 3JATA 4GT1A 1S5JA 3K04A 4ZI7B 1HR0O 1BHBA 2VWJA 4OX9O 4D6TH 1P84F 3QO7A 4K3AA 3P30A 4I9WA 3OTOB 4JI0B 2AGAA 1N33O 4GKKB 4UCOA 1JFFA 2WSSG 3FB5C 4YHHO 1IBLO 2ODMA 1MSWD 5KAIZ 4B3TB 2ZT9B 4J9ZB 4RWUA 4FFBB 4P9OA 2MW2B 3H1LH 3E89A 1KQSU 3CCRV 3DC6A 4TWKA 4ZHQA 2DE0X 2JGDB 2Q7HA 4LFCB 3CCMV 3RBZA 1F4NA 1WA8B 1NQTA 4UCVA 3E8HA 2LW1A 2XAGA 1KYOF 1IXBA 2JDIG 5LP6B 1XNQO 1U96A 5K1XA 3F5TA 3AEIA 1PM9A 4MS2A 4E2LA 2OYQA 3JAWA 4O4LA 1AI7A 1H2SB 2P4KA 3AG1C 5J9PC 1Y74A 2Q8VA 3BFRA 1G4YB 1EN5A 4LFBB 5EC2C 4CS3A 5IT9N 2CH7A 4BR6A 1XHZA 4DV1B 4DV7B 3E83A 1VQ9V 4PA3A 5EBLC 2WA3A 4DR5B 1MZFA 2BTQA 2XAFA 2PZSA 3KCXA 1S3JA 3ZMUA 2OT5A 4DW1A 3ASNC 3ZMSA 3AG7A 1SQVH 3H1HH 4HYOA 3K9SA 5CA1A 1SF9A 4X64O 3SPHA 4CS2A 2QWPB 2JS5A 4P2ZA 2AW9A 3ZBHA 1FAFA 5BY1A 2EIJB 4LCUC 2UUAB 3ML0A 3FB6C 1SESA 1Z5WA 4IHJB 2XASA 3WG7C 4PDVA 3TCUA 4TV9A 1XNRO 5C8YB 2A06H 5HFMA 1K92A 3IFXA 5LHHA 3X2QC 4O4IB 5LMUB 1VQKV 4HZ3A 3QO8A 1HNXB 4F6RA 2DWDC 4B3SB 1SZTA 2B1IA 5JJEB 3D36A 1RM1C 4I50B 4KL1A 1MOFA 1W2BU 3SYQA 3J81N 3ETDA 1N0NA 1WPXA 3K03A 3OR7C 4TQDA 4UCUA 2QSAA 3WB2A 3SPCA 1AROP 4EKWA 1M9NA 1SQQH 3RYHA 2PI4A 5JVDA 3A8TA 1YSCA 2EIMB 4MW3A 2X7RB 1NTMH 1KECA 1IBKB 1OZ0A 1NVPB 4MVOA 5JCOA 3E2EA 4LF5O 3AG2C 3AK2A 4UXNA 2ZQMA 3RYIB 2XNDG 3ZMZA 1HDJA 1H8HG 1YEWA 2WPDG 1SETA 1WN7A 4CH5A 1ZL8B 1N34B 1JQ0A 4K8XA 3CXHF 5B66Z 5CA0B 2CAZC 3ABMB 4E4EA 4WFBV 4FM2A 4I55B
chains in the Genus database with same CATH topology
3ASNB 4BW5A 1GKFA 1NJIW 1K4CC 3ZRVA 1YI2V 4UUJC 3P32A 3F7YC 1K33A 3OMAB 3G4SV 4P9PA 1NH2D 1AJPA 3E8FA 2W6IG 1K5SA 1V54C 1GM9A 3W7XA 2EZPA 3LDEA 4WCEV 1ZWIC 3VBBA 4QJFB 2X6BA 4QE7A 3W7UA 1RPOA 5EBWC 4BIUA 2V7QG 1L1FA 2WWWA 2AHYA 1K73W 2M7WA 2ZR2A 1MABG 2YEVA 2WLNA 3T4DA 5GW7A 2HR3A 1H2GA 2WLLB 1AI4A 3ABLB 1KD1W 4WFAV 2EJRA 2JEXA 3E86A 4OXSA 1JX9A 1JVMA 1EBOA 2Y69C 5H6RA 4MVRA 4N23A 3SPIA 2P7TC 1ROPA 3W7TA 2A9HA 5CBHA 3W7WA 5IYDO 3X2QB 1QR9A 1N8RW 1BMFG 1RPRA 2FTKA 2DYRC 2EILB 4MSWC 3E8GA 3FB7C 4MTOA 3G71V 1M57C 2XAJA 3OGCC 3OW2U 1S77D 1AI6A 2ZD9A 1RM1B 1QBZA 2DWEC 4UVAA 1M90W 3MHHC 2QE7G 3CC2V 3SYCA 2B1GA 1MG1A 1FS0G 1NKDA 4QIWF 5DM6V 5KA6A 1P4RA 1XL4A 4P30A 3UM7A 1GM8A 1QLEC 1VQNV 4FJCC 3T1CA 3GB7C 4TSFG 5IY5B 1PNKA 5H9CA 1J95A 1FXKA 5L3FA 1OHHG 1K8AW 4QNHB 3ASOB 1JOYA 3STLC 5IYCO 3BY6A 5KA5A 3ZIAG 2Y48A 1K9MW 1W0JG 1Q81W 1ENVA 2ZXWB 1CP9A 1KP3A 1P7BA 3LNMB 1Y66A 2QKSA 3AG2B 2B5UA 4JTCB 1F4MA 4FK5C 5EBMC 1I5XA 3ABKC 3CCQV 3K0GA 3IC7A 4GX1A 3E35A 5IYBO 2LP7A 2QM7A 4JASA 4WFFA 4JGSA 2Z3YA 4R50A 1E1QG 2IU0A 2D3OW 1QLNA 4RO2A 4XDKA 4CBCA 1PD3A 2XAHA 2ZXWC 2IW5A 1FXKB 2UXNA 3QO5A 2EZOA 1YTFB 1VQ8V 1YHQV 1JCHA 1OCCC 3JCZA 4UV8A 1YJWV 1H38A 4I5SA 4BAYA 3SYPA 4X88A 2GSMB 3OM3B 2HFEC 2HG5C 4PA7A 1V54B 5IDJA 3PJSK 1CPYA 1YJ9V 4G28B 1YTFD 2P67A 5CBGA 2JEUA 3BEHA 4X8AA 4G2KA 5LBQA 3DTUB 1PKXA 3CXCU 1XL6A 4ZKIA 4HAMA 1FXKC 1Q82W 3JD0A 4DO2A 4F4LA 5CA3A 1VQMV 3MD0A 4JTDB 1CEZA 3JD3A 2HKOA 4UV9A 5B1OA 4CZZA 3NXSA 3K9AA 4LP8A 4JYCA 3B77A 4TT3G 3T2MA 3LSSA 5CBFA 2Y69B 4PDLA 4RQEA 4WF9V 2HVKC 4R8CA 1AR1B 1PNMA 2BOCC 3JD2A 4FIPC 4RQFA 1NBMG 1FFTB 2DYRB 3JYCA 1WLEA 2MK3A 2Q67A 2DQ3A 1OCZC 4X89A 3LSQA 1M57B 1ORQC 3OEEG 4PA9A 4JYBA 2JIZG 5B1AB 3CP1A 3DGEA 4ASUG 4XDJA 4MTFA 3LDDA 5B3SC 5LHGA 3B8MA 2EBOA 3ZRXA 3SPGA 4R7CA 1R3JC 2R9IA 1KC8W 4G27B 1QLEB 5H6QA 3RVZA 3IGAC 3LUTB 4PDMA 4MVSA 2JK5C 2W0FC 3HPLC 4RUFA 1M1KW 3ETEA 4WFEA 1Q7YW 3FYIB 2WLHA 5L3DA 1EFRG 5B1AC 2KB1A 3AG3B 5L3CA 2YEVB 5C93A 1I5YA 4MVUA 3K3WA 1DF4A 2IJHA 1B6QA 3K79A 1UJWB 1EZJA 3ABKB 5L3BA 1YIJV 4YXWG 1THZA 1KP2A 4GCZA 2DYSB 1OCOC 3OEHG 1R6KA 2AHZA 1K4DC 3OFNG 5B1BC 2IJKA 4H33A 1PL0A 3SYAA 3D3IA 3CPWU 3AG3C 3F5WC 4MW8A 2Q69A 3CD6V 2CK3G 1V55B 1GO3F 5DN6G 4GT1A 2IH1C 2A0LA 2LFSA 3F7VC 3K0DA 4JAUA 3I55V 1R3IC 3K04A 4UVBA 3CCEV 2NNUA 1OCCB 4RAIA 2EIJC 1BHBA 2BOBC 5EC1C 1AJNA 2DYSC 2WLMA 2X6CA 4JF3A 1G8MA 3QO7A 3P30A 1S0VA 3VOUA 4I9WA 1PNLA 1W0KG 2GHYA 2WLIA 3RW0A 2DQ0A 2WSSG 4QPJA 1DLBA 3FB5C 1YITV 1V55C 1MSWD 4MTGA 4J9ZB 3TK1A 2HJFC 3H01A 2P90A 1K97A 2XOKG 2ATKC 4P9OA 3A0RA 3E89A 1KQSU 3ZCCA 1VQ4V 1R3LC 1F23A 3CCRV 3R65A 4TWKA 4GX2A 3FYEB 4FPPA 4L87A 3UKMA 1R73A 3CCLV 1GK9A 3OAAG 3RBZA 1F4NA 3CCMV 3OMIB 1NQTA 1F51A 2C2AA 1OCZB 3E8HA 4FMTA 1R3KC 3OR6C 4XBFA 2XAGA 1OCRB 2WLIB 2HLDG 2WLJA 2JDIG 3K08A 5B1NA 1QVGU 2QM8A 1K3EA 1DTOA 1M56C 2DW4A 5BZBA 3CCVV 1VQ5V 5B3SB 3AEIA 4MS2A 4E2LA 2ZDIA 1E1RG 2IH3C 1SRYA 2EIMC 1QR8A 1BHAA 4KFMA 1AI7A 2IJIA 4MVQA 5FL7G 5E1AC 2QEXV 1AI5A 4KUMA 3AG1C 5J9PC 3M99B 3EHBB 3ABTA 2H8PC 1S5HC 1G4YB 3EFFK 2IU3A 4BIZA 1OCRC 2QTOA 5EC2C 2QA4V 2JJ1G 3JD1A 4PA6A 1YJNV 5LGTA 3FB8C 2OTLV 2H94A 3CYOA 2OCCB 4MT8A 2A79B 1IXMA 3E83A 1GM7A 4KP4A 1LNQA 1GMGA 4PELA 4JTAB 1VQ9V 4PA3A 5KUKA 1HWYA 5EBLC 4QE9A 3CC4V 4RUEA 4PA4A 1S72V 4WFHA 1H8EG 3OMNB 2XAFA 3W7SA 3OUSA 1AJQA 3ABMC 1QCEA 1OCOB 3B8NA 3E8BA 1S3JA 3ZMUA 3AG4B 1FXHA 5B1BB 5L3GA 2OT5A 1BL8A 3ASNC 3ZRSA 1K7DA 3WG7B 3ZMSA 2K1EA 4GX5A 2PI5A 4HYOA 2OCCC 3ZJZA 1R6NA 3KG2A 3SPHA 2ITCC 5LGNA 4J9YB 4P2ZA 5CMUA 3CC7V 2EIJB 4GX0A 4LCUC 2ZDIC 3ML0A 3FB6C 2Q68A 4Q20A 5KUMA 1SESA 3CCUV 3AG4C 2ITDC 2W6JG 5CN0A 4U7NA 1E79G 3ABLC 2XASA 3LDCA 3WG7C 3ZMVA 1SERA 1Q86W 4PDVA 3TCUA 4JAVA 3WFVA 1S76D 4H37A 5HFMA 1K92A 2Q6AA 3ETGA 3IFXA 3X2QC 4QPKA 5LHHA 1VQKV 4HZ3A 4U7OA 5LHIA 1KKDA 5L3EA 3QO8A 2EILC 3FKSG 2DWDC 4Z1MG 1SZTA 2B1IA 2WAMA 4MVZA 3D36A 3I56V 1RM1C 3QNEA 2V1DA 2UXXA 2R9RB 2F43G 4XDLA 1K34A 1MOFA 1W2BU 2P6JA 2EIKB 5HFLA 3K06A 3SYQA 3ETDA 1K5QA 2NLJC 3CMAV 1NR7A 1WPXA 3K03A 1VQPV 1COWG 3OR7C 3ZN1A 2EINB 2OTJV 3T4ZA 3CCSV 1M56B 3SPCA 1AROP 4EKWA 1M9NA 5IY5C 1NR1A 2PI4A 4MVMA 1VQ6V 1YSCA 2XAQA 3SJQC 2X6AA 4N21A 3ZN0A 2EIMB 3HB3B 2X7RB 4MW3A 3ZRWA 4DXWA 1Y4MA 3G6EV 2IJJA 3ASOC 1KECA 3SYOA 2YSUB 5EK0A 2ZR3A 1OZ0A 1NVPB 1VQ7V 3MHSC 3AG1B 3ABUA 4MVOA 1VQOV 2EIKC 3E2EA 1QVFU 1JPXA 3AG2C 4UXNA 2ZQMA 3STZC 3RVYA 4R6ZA 2XNDG 3CMEV 4ZBMA 3GWOA 3ZMZA 2LFRA 3CCJV 2EINC 2WLKA 2X0LA 3SPJA 1H8HG 4UVCA 1VQLV 3OUFA 1NVPD 2WPDG 1SETA 1JJ2U 4PDRA 4WFGA 1JQ0A 4LBEC 1TUEB 2Z5UA 5LGUA 3OE7G 3ZMTA 2HVJC 2WLLA 1DF5A 3JD4A 3ABMB 1NH2B 1GTOA 4WFBV 3ZRWB 4MTXA 4LC1A 4JPRA 1FXVA 3TETA 2JJ2G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1E A;  4BW5 A;  4GX5 A;  4HYO A;  2OCC C;  1K4C C;  1OCC C;  2IH1 C;  2A0L A;  3K0D A;  3F7V C;  4UUJ C;  3F7Y C;  3ZJZ A;  1R3I C;  3K04 A;  3KG2 A;  4P9P A;  3SPH A;  2ITC C;  3SYP A;  4X88 A;  4RAI A;  2EIJ C;  4J9Y B;  4P2Z A;  3E8F A;  2BOB C;  5EC1 C;  1V54 C;  4LCU C;  2HFE C;  2DYS C;  2HG5 C;  1ZWI C;  2WLM A;  2X6C A;  3LDE A;  4GX0 A;  4PA7 A;  2X6B A;  4QE7 A;  5EBW C;  3FB6 C;  2Q68 A;  3PJS K;  4I9W A;  4G28 B;  3VOU A;  5CBG A;  2AHY A;  3BEH A;  5KUM A;  3AG4 C;  2ITD C;  4X8A A;  2YEV A;  2WLN A;  2WLI A;  3T4D A;  3RW0 A;  1XL6 A;  3ABL C;  3LDC A;  3WG7 C;  3FB5 C;  4F4L A;  2WLL B;  1V55 C;  4PDV A;  4JTD B;  3TCU A;  4MTG A;  3E86 A;  4OXS A;  4J9Z B;  4LP8 A;  3T2M A;  1JVM A;  2Y69 C;  3TET A;  2HJF C;  4H37 A;  2Q6A A;  3IFX A;  4MVR A;  3X2Q C;  3SPI A;  5CBF A;  2P7T C;  2ATK C;  2A9H A;  4P9O A;  4PDL A;  4HZ3 A;  5CBH A;  3E89 A;  1KKD A;  2HVK C;  2EIL C;  1R3L C;  2DWD C;  2DYR C;  4R8C A;  3R65 A;  4TWK A;  2BOC C;  4GX2 A;  4MSW C;  4MVZ A;  3E8G A;  3FB7 C;  4MTO A;  3JYC A;  1M57 C;  3OGC C;  3UKM A;  2Q67 A;  2ZD9 A;  1OCZ C;  4X89 A;  3RBZ A;  2DWE C;  1ORQ C;  2R9R B;  4PA9 A;  4XDL A;  3E8H A;  1R3K C;  3OR6 C;  3K06 A;  3SYQ A;  2WLI B;  2NLJ C;  2WLJ A;  4XDJ A;  3SYC A;  3K08 A;  4MTF A;  3K03 A;  3LDD A;  5B3S C;  3OR7 C;  1M56 C;  5BZB A;  1XL4 A;  4P30 A;  3T4Z A;  4MS2 A;  3SPC A;  3SPG A;  3UM7 A;  4EKW A;  5IY5 C;  2IH3 C;  1R3J C;  1QLE C;  4MVM A;  2EIM C;  4R7C A;  4KFM A;  3T1C A;  3GB7 C;  3SJQ C;  4G27 B;  2X6A A;  3RVZ A;  4MW3 A;  4MVQ A;  3IGA C;  1J95 A;  3LUT B;  4PDM A;  4MVS A;  5E1A C;  4DXW A;  3ASO C;  2JK5 C;  2W0F C;  3HPL C;  4RUF A;  3AG1 C;  5J9P C;  3SYO A;  5EK0 A;  4WFE A;  4QNH B;  2H8P C;  2WLH A;  3STL C;  4MVO A;  1S5H C;  1G4Y B;  2EIK C;  3EFF K;  5B1A C;  2KB1 A;  2QTO A;  1OCR C;  5EC2 C;  3AG2 C;  3STZ C;  4PA6 A;  3RVY A;  1P7B A;  3LNM B;  4R6Z A;  3ZRS A;  2QKS A;  3FB8 C;  4MVU A;  4ZBM A;  4JTC B;  2EIN C;  2WLK A;  2A79 B;  3SPJ A;  5EBM C;  3E83 A;  3ABK C;  3OUF A;  1LNQ A;  4JTA B;  3K0G A;  4PA3 A;  5KUK A;  4PDR A;  4GX1 A;  5EBL C;  4QE9 A;  4WFG A;  4WFF A;  4LBE C;  4PA4 A;  4RUE A;  4WFH A;  1OCO C;  4R50 A;  2AHZ A;  3OUS A;  1K4D C;  3ABM C;  5B1B C;  4H33 A;  3E8B A;  2HVJ C;  4RO2 A;  2WLL A;  3SYA A;  4XDK A;  4CBC A;  3AG3 C;  1BL8 A;  3F5W C;  3ASN C;  4MW8 A;  2ZXW C;  2Q69 A; 
#chains in the Genus database with same CATH topology
 4BW5 A;  1GKF A;  3DXR B;  2LGQ A;  3OMA B;  2PF4 E;  1NH2 D;  1K5S A;  1VF5 B;  3W7X A;  2EZP A;  4WCE V;  1BSM A;  4QJF B;  2GUZ A;  4BIU A;  3RGB A;  2V7Q G;  1KBH A;  2WLN A;  3CX5 F;  3T4D A;  3QF7 A;  3ABL B;  3Q4H B;  4WFA V;  2EJR A;  2JEX A;  3KKY A;  4FLX A;  2Y69 C;  5H6R A;  1FYJ A;  4MVR A;  2K9P A;  4DR3 B;  2P7T C;  5CBH A;  3W7W A;  2PYL A;  4JYA O;  1QR9 A;  4HBN A;  1OJH A;  3E8G A;  5JJJ B;  3OGC C;  3OW2 U;  1AI6 A;  3U11 A;  2P06 A;  1SQP H;  4UVA A;  4NXM B;  3MHH C;  2B1G A;  5DM6 V;  2YI9 A;  4NXN B;  2KKW A;  2Q73 A;  1HNW B;  1BZK A;  3E22 A;  3T1C A;  5IY5 B;  4DR1 B;  3KZI Z;  4EFE A;  3L73 H;  1XMQ O;  1FXK A;  1Y6X A;  1OHH G;  4QNH B;  3STL C;  2HP8 A;  1R6T A;  5KA5 A;  2QWN B;  1W0J G;  1Q81 W;  1KP3 A;  1P7B A;  4JI8 O;  2B5U A;  1F4M A;  3IC9 A;  5BMV B;  2QDO A;  5LA6 A;  1FFX B;  4NTW A;  1Y76 B;  2ZE6 A;  2LP7 A;  2QM7 A;  1AB3 A;  4JZ2 A;  4WFF A;  4JGS A;  4R50 A;  5ITZ B;  4DV6 O;  3U10 A;  4GZR B;  3APO A;  4RO2 A;  4XDK A;  2D2C B;  2XAH A;  3TXS A;  2RCV A;  2QKA A;  5LXT A;  2EZO A;  2XT9 A;  4LNU B;  1JCH A;  4WBN B;  5D5Q A;  1YJW V;  4KHP B;  4BAY A;  1YXB A;  4YJ3 A;  4DUZ B;  2Y4T A;  3PJS K;  5EYP B;  5A2Q N;  2JEU A;  1AIL A;  4X8A A;  4LF6 B;  3DTU B;  1XL6 A;  1YVW A;  3JAM N;  4ZKI A;  4X62 O;  4DO2 A;  2HKO A;  1N4C A;  3K9A A;  4LP8 A;  3B77 A;  4FZ1 A;  1I08 A;  3WU2 Z;  3OD4 A;  2ZE5 A;  4J7Z A;  1PPJ H;  2YI8 A;  3N27 A;  1AR1 B;  2BOC C;  3JD2 A;  4FIP C;  4DRX B;  2DYR B;  2A7W A;  3B09 A;  1M57 B;  1ORQ C;  5BR8 O;  5IJ9 A;  2JGU A;  5B1A B;  3RN4 A;  4IIJ B;  5LP6 C;  5IWA O;  5EIB C;  4MTF A;  1RFY A;  5BXZ A;  2VS0 A;  3OT7 A;  1SA0 B;  2YXL A;  2YIB A;  1U97 A;  1Q90 D;  1R3J C;  3C3T A;  1KC8 W;  2YC0 A;  4NTX A;  4W4K A;  4B7E A;  4G27 B;  2AZ0 A;  4RUF A;  3K5M A;  3ETE A;  4DV5 O;  4U3J A;  3JAR A;  2WLH A;  4I7Z B;  2KB1 A;  5L3C A;  2CGO A;  2YEV B;  5C93 A;  4X1I B;  2NN4 A;  1JA8 A;  3K79 A;  1UJW B;  2F4V O;  5H5N A;  2Q7E A;  4ICG A;  3JAS B;  3BA8 A;  2DYS B;  3OEH G;  3N2K A;  2VQE O;  4H33 A;  3SYA A;  3D3I A;  3F5W C;  2UXD B;  2Q69 A;  3CD6 V;  4AQY O;  2CTR A;  4DR7 B;  2CK3 G;  3BPZ A;  4PV1 B;  5KX5 A;  1V55 B;  1GO3 F;  5DN6 G;  5J2U A;  3K0D A;  2YIB D;  3I55 V;  2M6Y A;  3CCE V;  1OCC B;  2PUS A;  1I94 O;  2EIJ C;  3BHP A;  5LYJ A;  3M7M X;  2BOB C;  1IZ3 A;  3G6B A;  4JF3 A;  3SJB C;  3B4S A;  3T1H O;  1BS3 A;  1G8M A;  1URF A;  3VOU A;  1PNL A;  2CGN A;  3L71 H;  4LFA B;  2WLI A;  3RW0 A;  1DLB A;  4DR4 B;  4YJ2 B;  2VRZ A;  3JAT B;  1M93 A;  2RJZ A;  4X1K A;  3TGU H;  3CWB H;  3TJT A;  4QGP A;  5E79 Z;  4EB6 B;  5IJ0 A;  5KHJ A;  3R65 A;  4GX2 A;  1PL4 A;  1H2L A;  4L87 A;  2HEP A;  4JI1 B;  3CCL V;  3OAA G;  1WPB A;  2UUC B;  3OMI B;  4FMT A;  1JFF B;  5B1N A;  4DK0 A;  1K3E A;  3ZHS A;  4GLX A;  4OPH A;  2IH3 C;  4NTY A;  2EIM C;  1BHA A;  2FKX A;  4MVQ A;  2QEX V;  1AI5 A;  4JI7 O;  2RNB A;  1ZUQ A;  4ZHQ B;  3ABT A;  1S5H C;  3SJA C;  2QA4 V;  1OCR C;  2QTO A;  5JJN B;  4DV2 O;  1NI8 A;  4AIL C;  1HP8 A;  1M4U A;  3CYO A;  4UB6 Z;  1TUB A;  3P3N A;  1KMI Z;  4D7S A;  2OWO A;  4PEL A;  1XHX A;  5KUK A;  4YY3 B;  3THO A;  4PI2 A;  3OMN B;  1AJQ A;  3CJH A;  3ABM C;  1QCE A;  4OPA A;  3U0Z A;  4O4L B;  3RT3 C;  3RYF A;  1IVS A;  1K7D A;  4LF7 B;  1XOU A;  1LUV A;  4YIP A;  5GON A;  2OCC C;  1Y74 B;  4B3R B;  2L35 A;  4JI0 O;  3OTO O;  2CH7 B;  2R72 A;  3EXA A;  4GKK O;  2LW7 A;  3D3Q A;  4ZIB A;  3LSU A;  2CTW A;  3BCC H;  4B7K A;  2CDY A;  4FZ0 A;  4O4H B;  2YIC A;  4B3T O;  3CCU V;  2FYU H;  1HW7 A;  2W6J G;  3AG4 C;  2BTQ B;  4U7N A;  5JWP A;  3AK1 A;  2Q9L A;  1E79 G;  3ABL C;  1WP7 A;  3WFV A;  5KHG A;  1S76 D;  3ETG A;  4QPK A;  4JI3 B;  1IX9 A;  1MMM A;  4LFC O;  4TV8 B;  4B3M B;  5L3E A;  3FKS G;  4X66 B;  1Z5V A;  2QGN A;  1SZX A;  1WB8 A;  4CC5 A;  3G80 A;  1QQC A;  1FD9 A;  5KHH A;  1K5Q A;  1NR7 A;  3GWK C;  1XQ8 A;  5KLV H;  1COW G;  1W59 A;  3ZN1 A;  1J5E B;  4J10 A;  4TV9 B;  2OTJ V;  1M56 B;  2H3O A;  5IY5 C;  1NR1 A;  2FML A;  1RP3 B;  4I4T A;  4LFB O;  3SJQ C;  2XAQ A;  1Y4M A;  4DV1 O;  4F6R B;  5EK0 A;  4DV7 O;  1VQ7 V;  2ZIM A;  3ABU A;  4PI0 A;  2EIK C;  2KG7 A;  1QVF U;  1JPX A;  4ABM A;  4C7U A;  4DR5 O;  3RVY A;  4R6Z A;  4ZBM A;  2EIN C;  4PJ0 Z;  1SQB H;  4X20 B;  3RYC B;  4WFG A;  4D7T A;  5J2T A;  4DUY O;  4FLY A;  1TUE B;  1L0L H;  3OE7 G;  5JVD B;  1VIB A;  2WLL A;  3O9O A;  3VQX A;  1NH2 B;  4MTX A;  3HKB B;  4JZG A;  1SKV A;  5JH7 A;  1NJI W;  1AP5 A;  2UUA O;  1YI2 V;  2GV9 A;  4UUJ C;  3G4S V;  2W6I G;  1GM9 A;  3ICX A;  3A0B Z;  3VBB A;  2ETN A;  4QE7 A;  1RPO A;  5EBW C;  1L1F A;  2E75 B;  1MAB G;  5LMU O;  2BE3 A;  3BRC A;  1KD1 W;  1AI4 A;  4DUY B;  2HHH B;  1HNX O;  4B3S O;  1GN3 A;  1RSO A;  4JYY A;  1JVM A;  1EBO A;  2A9H A;  4DR2 B;  1YF2 A;  1N8R W;  2FTK A;  1RPR A;  5TIS Z;  2DYR C;  3WB1 A;  3ZHU A;  2RN9 A;  2EIL B;  5CB4 A;  1MSD A;  1M57 C;  2XAJ A;  2GUZ B;  3JCU Z;  2ZD9 A;  3ZHR A;  1XI1 A;  2G38 A;  3BA9 A;  3VQV A;  1M90 W;  4F6E A;  2Y4U A;  1MG1 A;  1FS0 G;  1NKD A;  4QIW F;  1IBK O;  4FLW A;  1KB9 F;  3HKD B;  1GM8 A;  2OIE A;  4JI5 B;  2O57 A;  1Q6U A;  4TOI A;  2UXC B;  3HKC A;  1K8A W;  3ASO B;  5IYC O;  1IDS A;  2AXT Z;  1K9M W;  2Y48 A;  3B40 A;  1YDX A;  1ENV A;  1N34 O;  4BWA A;  2QKS A;  4JTC B;  3H1J H;  1XEQ A;  5F2V O;  1SQG A;  5EZY B;  1GH6 A;  4FLZ A;  4Q6G A;  2OCH A;  3RWR D;  2F95 B;  2Z3Y A;  1Y67 A;  1XDC A;  2D3O W;  5K1P A;  3E22 B;  2ZXW C;  2IW5 A;  1FXK B;  2UXN A;  1EZV H;  1VQ8 V;  1ZX3 A;  3OGI B;  4K0K O;  1OCC C;  1O9H A;  2DJV A;  4X88 A;  2HJD A;  1NTK H;  1VP7 A;  2E5L B;  2CUG A;  2F1M A;  5AG2 A;  2HG5 C;  2IM9 A;  4PA7 A;  1YTF D;  1PP9 H;  5CBG A;  3H1I H;  4DR3 O;  3CXC U;  2F66 C;  4PD4 F;  4F4L A;  3A0H Z;  3UO3 A;  1VQM V;  3MD0 A;  1CEZ A;  3JD3 A;  4UV9 A;  5B1O A;  4CZZ A;  3NR7 A;  4JYC A;  4DV4 B;  4PHZ A;  5LXT B;  4JI6 O;  2V4D A;  4PDL A;  4RQE A;  2A3Q A;  4GUN A;  2HVK C;  4YJ3 B;  4NXM O;  4K0K B;  1TAE A;  1NBM G;  3JYC A;  4DV0 B;  2GBO A;  1VF7 A;  5EIB D;  1M5I A;  2DQ3 A;  3LSQ A;  2ZNJ A;  4PA9 A;  4JYB A;  1TA8 A;  3G67 A;  4NXN O;  1HNW O;  1BCC H;  3CP1 A;  3T1Y B;  4IGG A;  4DR1 O;  1SQX H;  4YIO A;  4CS4 A;  4R7C A;  2R9I A;  1UPG A;  3WB0 A;  1AR4 A;  3H9V A;  4DV3 B;  3LUT B;  4MVS A;  2W0F C;  3HPL C;  4IL6 Z;  4JI6 B;  1Q7Y W;  2XHB A;  1BGY H;  5C8Y A;  3K5L A;  4O4I A;  1HNZ B;  4JI2 B;  4MVU A;  3K3W A;  3SJC C;  5IJ9 B;  2JVD A;  1B6Q A;  3S3W A;  3J7A U;  2P5O A;  2ADQ B;  4YXW G;  4I50 A;  3I5D A;  2F93 B;  4LF9 B;  1IUR A;  2IJK A;  1Q6H A;  3CRC A;  4LWS B;  2QWR B;  4KHP O;  3CPW U;  3AG3 C;  2LQT A;  4MW8 A;  4GKJ B;  2Q0O C;  4DUZ O;  4U3J B;  3JAR B;  3K5N A;  2BCC H;  2A0L A;  3IAY A;  1R3I C;  2EX3 A;  2GTA A;  1SS3 A;  4LF6 O;  4AHC A;  1AJN A;  2WLM A;  2X6C A;  1T5E A;  4U3F H;  2DQ0 A;  1YIT V;  2W0X A;  3FAV A;  2BSK A;  1OV9 A;  3TK1 A;  1BQZ A;  1LUW A;  5KX5 B;  2P90 A;  4I0X B;  4TUY B;  1K97 A;  2ATK C;  1VQ4 V;  5CA0 A;  1F23 A;  1KU9 A;  3J80 N;  5LYJ B;  4I55 A;  3N2G A;  4X65 B;  2RQ6 A;  3UKM A;  1GK9 A;  3CE2 A;  1GN2 A;  2C2A A;  1N0J A;  2XTA A;  4XBF A;  2WLI B;  2WLJ A;  3CSX A;  1D2D A;  1QVG U;  2QM8 A;  1M56 C;  2DW4 A;  3C90 A;  5BZB A;  1VQ5 V;  5B3S B;  3M8A A;  1E1R G;  1SRY A;  1XRE A;  4KFM A;  2GTS A;  5DEC A;  5E1A C;  3D36 C;  5IJ0 B;  3EHB B;  2H8P C;  1Q6I A;  3EFF K;  2IU3 A;  1US6 A;  3JD1 A;  4PA6 A;  1YJN V;  1H2N A;  1I7F A;  3FB8 C;  5LGT A;  2OTL V;  2IBZ H;  1FJG B;  5FPO A;  1GM7 A;  1XUQ A;  1GMG A;  4JTA B;  2BTO A;  1HWY A;  2UXD O;  5FNV A;  1FKA O;  4DR7 O;  4PA4 A;  1S72 V;  4WFH A;  1H8E G;  4LF4 B;  1X4T A;  1OCO B;  3B8N A;  3E8B A;  4LR3 A;  2ZNI A;  1FXH A;  5B1B B;  1BL8 A;  4J7K A;  2RMK B;  3WG7 B;  1JJO A;  3ZJZ A;  1R6N A;  4LFA O;  2ITC C;  1N36 B;  4JV5 B;  4J9Y B;  4J11 A;  4GX0 A;  4DR4 O;  3L74 H;  2ZDI C;  4GYC B;  4ZOL A;  4FM1 A;  1AVM A;  2ADP A;  5KHK A;  2N05 A;  1WNS A;  3CJH B;  4X9Q A;  3ZMV A;  1SER A;  2UU9 B;  3UT5 B;  3RYF B;  1Y76 A;  1WP8 A;  4H37 A;  2Q6A A;  4JI1 O;  1IBM B;  4U7O A;  5LHI A;  1I0H A;  2UUC O;  1N32 B;  2EIL C;  2WA4 A;  4Z1M G;  3K5O A;  2WAM A;  3DSQ A;  1EN6 A;  1PV0 A;  2V1D A;  1R1B A;  2R9R B;  2F43 G;  2FB5 A;  1TGO A;  5HFL A;  2NLJ C;  4IT5 A;  3CMA V;  4UCS A;  4O4J A;  2Q7G A;  2ZE8 A;  2Q4P A;  3T4Z A;  4MVM A;  1VQ6 V;  2X6A A;  4W4L A;  1SC5 B;  3HB3 B;  3ZRW A;  2VWK A;  4DXW A;  4DR6 B;  2IJJ A;  3ASO C;  1Q8I A;  2ZR3 A;  1QNM A;  3MHS C;  1EN4 A;  4NR1 A;  5KAF Z;  4YY3 O;  3STZ C;  2LFR A;  2X0L A;  1NS1 A;  4UVC A;  1VQL V;  1B04 A;  3OUF A;  3HKE A;  5KMG A;  1JJ2 U;  4X1Y A;  2CTQ A;  1GN4 A;  4LF7 O;  2Z5U A;  5LGU A;  1L8D A;  4KXR A;  4B3R O;  2HVJ C;  4CH6 A;  5B5E Z;  3JD4 A;  2UXB B;  4FLV A;  4Z2W A;  3K58 A;  4JPR A;  2JJ2 G;  1GRJ A;  1K4C C;  1K33 A;  2VQF B;  3VQY A;  3DC5 A;  3LDE A;  3FD9 A;  3JSN A;  4LF8 B;  4H44 B;  2WWW A;  2AHY A;  2ZIO A;  1K73 W;  3ZED A;  5J2T B;  3CB2 A;  2YEV A;  3JAW B;  4JI3 O;  4L8J A;  4B3M O;  1B3Q A;  2WLL B;  2ZM6 B;  4OXS A;  1JX9 A;  4X66 O;  4CH3 A;  1H2M A;  5JH7 B;  4N23 A;  1ROP A;  3W7T A;  5IYD O;  3GVM A;  1BMF G;  3C3S A;  5LMN B;  1J5E O;  2DWE C;  2ILM A;  5H2F Z;  2KSD A;  4HNA A;  2QE7 G;  4LH6 A;  4O2A A;  1BQ0 A;  1P4R A;  1RSO B;  1XL4 A;  5CA1 B;  3UM7 A;  4FJC C;  5IYZ A;  4TSF G;  4JI4 O;  1J95 A;  2RDC A;  1MA1 A;  2QR4 A;  3RFR A;  3JAL A;  3BY6 A;  3IJ4 A;  3LNM B;  1V9P A;  3QG5 A;  2QM4 A;  2Y0I A;  3VQW A;  4FLT A;  4EB6 A;  5EBM C;  4AI8 A;  1G1X B;  3K0G A;  3IC7 A;  4GX1 A;  3E35 A;  2PY5 A;  4O2B A;  4JAS A;  1E1Q G;  2IU0 A;  1VEW A;  1AP6 A;  1QLN A;  2DN9 A;  5GTH Z;  4CBC A;  1PD3 A;  3QO5 A;  4I9Q A;  3HKC B;  3CRM A;  1YTF B;  4JI4 B;  1YHQ V;  3OTF A;  3JCZ A;  4UV8 A;  5LOV A;  1H38 A;  4I5S A;  1BE3 H;  3K59 A;  1SQF A;  1Q43 A;  2HFE C;  1B06 A;  1V54 B;  4Z1V A;  2HHH O;  1VAR A;  1CPY A;  4J42 A;  4G28 B;  1YJ9 V;  1CXZ B;  2P22 C;  5GTI Z;  3RYH B;  4G2K A;  4J80 A;  1HR0 B;  1PKX A;  4OX9 B;  3JAK A;  2KQX A;  4DR2 O;  5CA3 A;  3UCS C;  1NTZ H;  3L72 H;  3NXS A;  4TT3 G;  3T2M A;  4DK1 A;  1N33 B;  2ZE7 A;  2YXH A;  3LSS A;  5CBF A;  2QWQ B;  2YS8 A;  4NYK A;  4YHH B;  2ZIN A;  1XMO O;  1IBL B;  1D5A A;  4WF9 V;  1TVK A;  1WLE A;  1UFI A;  4J41 A;  1YCI A;  4CH4 A;  2XUM A;  1ZSP A;  1F7Y A;  5JQG A;  2JIZ G;  3DGE A;  4JI5 O;  1LR1 A;  3LDD A;  5B3S C;  5LHG A;  3B8M A;  2UXC O;  4O4H A;  3ZRX A;  3SPG A;  2QJ1 A;  3ZX6 A;  3MDS A;  1QLE B;  1Q5O A;  2GDS A;  1XIL A;  2YDE A;  1FPO A;  4LH7 A;  1XNQ B;  1M1K W;  1XMO B;  5B1A C;  4ZI7 A;  4TV8 A;  2OIG A;  5D5P A;  1DF4 A;  2E3C A;  2IJH A;  3ABK B;  1YIJ V;  1KP2 A;  1OCO C;  2AHZ A;  1K4D C;  3OFN G;  5B1B C;  1JR9 A;  2E5L O;  4FFB A;  5KHI A;  2IH1 C;  4JAU A;  2LFS A;  3F7V C;  4UVB A;  3ZHQ A;  2NNU A;  4UCR A;  4RAI A;  5EC1 C;  1WB7 A;  2JGD A;  2DYS C;  2CE4 A;  4X64 B;  1S0V A;  1WA8 A;  1VF6 C;  1ZAU A;  1W0K G;  2GHY A;  4DV4 O;  3AK3 A;  2N04 A;  4QPJ A;  5LP6 A;  1V55 C;  3A2F A;  3SGI A;  4MTG A;  4X20 A;  2YXY A;  3RYC A;  2QTS A;  3MAQ A;  4K8Z A;  2HJF C;  3H01 A;  4DV0 O;  2XOK G;  3A0R A;  3ZCC A;  1R3L C;  5LA6 B;  1Q3E A;  1XNR B;  3HKB A;  3FYE B;  4FPP A;  3T1Y O;  1XBL A;  1R73 A;  2UUB O;  4H13 B;  1MZE A;  1F51 A;  1OCZ B;  1R3K C;  3OR6 C;  1OCR B;  2HLD G;  2YID A;  2P4V A;  3K08 A;  3FAV B;  4DV3 O;  1DTO A;  2YIA A;  2BSK B;  3CHX A;  3CCV V;  1YZB A;  2ZDI A;  1QR8 A;  1X59 A;  2IJI A;  5FL7 G;  1HNZ O;  3UO2 A;  4JI2 O;  4KUM A;  3M99 B;  3D8C A;  3N2G B;  4FFK A;  3HR0 A;  4BIZ A;  2JJ1 G;  4B08 A;  2H94 A;  2OCC B;  2R9A A;  4MT8 A;  4K35 A;  4LF9 O;  2A79 B;  1IXM A;  2UUB B;  4KP4 A;  1LNQ A;  4LF5 B;  4FM0 A;  4QE9 A;  4GKJ O;  3CC4 V;  4IHJ A;  4RUE A;  3W7S A;  3OUS A;  3EVK A;  3AG4 B;  5L3G A;  1L0N H;  1KUQ A;  2Q5Z A;  3ZRS A;  2JS3 A;  3LNN A;  4DW0 A;  2K1E A;  4GX5 A;  2PI5 A;  3HKD A;  4NB5 A;  3KG2 A;  5LGN A;  5CMU A;  3KCY A;  3CC7 V;  2EUL A;  1GAX A;  3R66 A;  3CRR A;  2LJ2 A;  5DED A;  2Q68 A;  4Q20 A;  5KUM A;  2ITD C;  5FNV B;  5CN0 A;  1BT8 A;  3LDC A;  1Q86 W;  2R70 A;  2FL4 A;  4JAV A;  5EZY A;  5LL6 Y;  4X65 O;  1KKD A;  4MVZ A;  4J7J A;  3I56 V;  2ZCE A;  3QNE A;  3RYI A;  4ZOL B;  2UXX A;  4JYA B;  3N2K B;  4XDL A;  1K34 A;  3APQ A;  2P6J A;  2EIK B;  3K06 A;  2LGW A;  3TXQ A;  1VQP V;  1ZL8 A;  2L6L A;  3SR2 C;  2DOS A;  2EIN B;  3CCS V;  5J2U B;  4N21 A;  3ZN0 A;  2LO1 A;  2JRI A;  3L70 H;  3G6E V;  1AR5 A;  5FPR A;  3SYO A;  2YSU B;  1FJG O;  3DXR A;  3FFQ A;  3AG1 B;  1VQO V;  3O65 A;  2QKC A;  2ZKO A;  3JSL A;  1WAZ A;  3ZS8 C;  3CME V;  3B2E E;  3GWO A;  4LF4 O;  1XMQ B;  3CCJ V;  2WLK A;  3SDL A;  3SPJ A;  2F23 A;  1WJZ A;  4UCT A;  1NVP D;  4O4J B;  1MNG A;  4PDR A;  4JI8 B;  1QU7 A;  4LBE C;  4X1K B;  1NT2 B;  3BVO A;  3ZMT A;  1DF5 A;  3L75 H;  3Q4H A;  1GTO A;  3ETQ A;  3ZRW B;  1N36 O;  4LC1 A;  4JV5 O;  1FXV A;  3TET A;  4DV6 B;  3ASN B;  3ZRV A;  2Z0A A;  3P32 A;  3F7Y C;  1DK1 A;  4P9P A;  4EFB A;  1AJP A;  3E8F A;  1V54 C;  1JMK C;  1ZWI C;  1S5L Z;  2X6B A;  3W7U A;  2UU9 O;  1H2K A;  3HKE B;  4UB8 Z;  5KMG B;  2N74 A;  2M7W A;  2ZR2 A;  3BAB A;  3CRQ A;  4X1Y B;  5GW7 A;  1IBM O;  2HR3 A;  1H2G A;  1N32 O;  5JCO C;  3E86 A;  3PN1 A;  4IYH A;  3BAA A;  2DMX A;  3SPI A;  4X62 B;  2EJ7 A;  4IYI A;  3X2Q B;  4H0L B;  4LWS A;  2PGG A;  3QTC A;  1P49 A;  1TUB B;  4MSW C;  5IE9 A;  3FB7 C;  4MTO A;  3G71 V;  1QHT A;  1S77 D;  1RM1 B;  1QBZ A;  3S3X A;  5BMV A;  1FFX A;  3CC2 V;  3SYC A;  1A32 A;  2PYJ A;  3L9D A;  5KA6 A;  1ZTE A;  4DR6 O;  5BR8 B;  2QWO B;  5ITZ A;  5GON B;  4P30 A;  1QLE C;  1VQN V;  5IWA B;  3GB7 C;  1PNK A;  2B9Z A;  5H9C A;  4NKG B;  2AZ2 A;  5L3F A;  1JOY A;  4LNU A;  3ZIA G;  4WBN A;  1GN6 A;  2ZXW B;  1CP9 A;  4I0X A;  4TUY A;  1Y66 A;  3AG2 B;  2ARH A;  4DV5 B;  4FK5 C;  1I5X A;  4HNA B;  3ABK C;  4A5U B;  3CCQ V;  2UXB O;  5EYP A;  5IYB O;  3UQ8 A;  4O2A B;  3QVN A;  1P7G A;  1EM1 A;  5IYZ B;  2F4V B;  4JAA A;  2VQF O;  3K57 A;  2VQE B;  3JAL B;  4LF8 O;  3SYP A;  2Q0A A;  4FVM A;  2GSM B;  1Z2G A;  4AQY B;  4DRX A;  3OM3 B;  4CC6 A;  3FX7 A;  5IDJ A;  2ZM6 O;  2P67 A;  3BEH A;  4O2B B;  5LBQ A;  1I94 B;  1D5N A;  4I4T B;  4IIJ A;  4HAM A;  1FXK C;  1Q82 W;  3JD0 A;  3T1H B;  4BW9 A;  4JTD B;  1SA0 A;  2KG7 B;  1VMG A;  5A9G A;  2Y69 B;  5LMN O;  5LOV B;  4UFZ A;  4R8C A;  1PNM A;  1NU1 H;  3CRA A;  3H1K H;  4RQF A;  1FFT B;  2MK3 A;  2Q67 A;  1OCZ C;  4X89 A;  3OEE G;  2CTP A;  4DYL A;  4X1I A;  4ASU G;  3P3P A;  3JAK B;  4XDJ A;  4OGQ B;  2PTM A;  3CS5 A;  2NR5 A;  3JAS A;  1DGS A;  4EEQ A;  2EBO A;  5FLX N;  2E74 B;  1VF6 A;  3RVZ A;  5H6Q A;  4FLU A;  3IGA C;  2Y0P A;  4PDM A;  2JK5 C;  3UT5 A;  3ZHV A;  4WFE A;  3FYI B;  1TVK B;  5L3D A;  1EFR G;  3AG3 B;  2E76 B;  1I5Y A;  1KKC A;  5JQG B;  4JI7 B;  1G6U A;  1ZLZ A;  3CEI A;  2YUA A;  1EZJ A;  4DV2 B;  1O9G A;  3ZHT A;  5L3B A;  1THZ A;  4GCZ A;  1R6K A;  1PL0 A;  4YJ2 A;  4TQF A;  4BIO A;  4NVP A;  1NZ6 A;  5CB4 B;  3JAT A;  4GT1 A;  1S5J A;  3K04 A;  4ZI7 B;  1HR0 O;  1BHB A;  2VWJ A;  4OX9 O;  4D6T H;  1P84 F;  3QO7 A;  4K3A A;  3P30 A;  4I9W A;  3OTO B;  4JI0 B;  2AGA A;  1N33 O;  4GKK B;  4UCO A;  1JFF A;  2WSS G;  3FB5 C;  4YHH O;  1IBL O;  2ODM A;  1MSW D;  5KAI Z;  4B3T B;  2ZT9 B;  4J9Z B;  4RWU A;  4FFB B;  4P9O A;  2MW2 B;  3H1L H;  3E89 A;  1KQS U;  3CCR V;  3DC6 A;  4TWK A;  4ZHQ A;  2DE0 X;  2JGD B;  2Q7H A;  4LFC B;  3CCM V;  3RBZ A;  1F4N A;  1WA8 B;  1NQT A;  4UCV A;  3E8H A;  2LW1 A;  2XAG A;  1KYO F;  1IXB A;  2JDI G;  5LP6 B;  1XNQ O;  1U96 A;  5K1X A;  3F5T A;  3AEI A;  1PM9 A;  4MS2 A;  4E2L A;  2OYQ A;  3JAW A;  4O4L A;  1AI7 A;  1H2S B;  2P4K A;  3AG1 C;  5J9P C;  1Y74 A;  2Q8V A;  3BFR A;  1G4Y B;  1EN5 A;  4LFB B;  5EC2 C;  4CS3 A;  5IT9 N;  2CH7 A;  4BR6 A;  1XHZ A;  4DV1 B;  4DV7 B;  3E83 A;  1VQ9 V;  4PA3 A;  5EBL C;  2WA3 A;  4DR5 B;  1MZF A;  2BTQ A;  2XAF A;  2PZS A;  3KCX A;  1S3J A;  3ZMU A;  2OT5 A;  4DW1 A;  3ASN C;  3ZMS A;  3AG7 A;  1SQV H;  3H1H H;  4HYO A;  3K9S A;  5CA1 A;  1SF9 A;  4X64 O;  3SPH A;  4CS2 A;  2QWP B;  2JS5 A;  4P2Z A;  2AW9 A;  3ZBH A;  1FAF A;  5BY1 A;  2EIJ B;  4LCU C;  2UUA B;  3ML0 A;  3FB6 C;  1SES A;  1Z5W A;  4IHJ B;  2XAS A;  3WG7 C;  4PDV A;  3TCU A;  4TV9 A;  1XNR O;  5C8Y B;  2A06 H;  5HFM A;  1K92 A;  3IFX A;  5LHH A;  3X2Q C;  4O4I B;  5LMU B;  1VQK V;  4HZ3 A;  3QO8 A;  1HNX B;  4F6R A;  2DWD C;  4B3S B;  1SZT A;  2B1I A;  5JJE B;  3D36 A;  1RM1 C;  4I50 B;  4KL1 A;  1MOF A;  1W2B U;  3SYQ A;  3J81 N;  3ETD A;  1N0N A;  1WPX A;  3K03 A;  3OR7 C;  4TQD A;  4UCU A;  2QSA A;  3WB2 A;  3SPC A;  1ARO P;  4EKW A;  1M9N A;  1SQQ H;  3RYH A;  2PI4 A;  5JVD A;  3A8T A;  1YSC A;  2EIM B;  4MW3 A;  2X7R B;  1NTM H;  1KEC A;  1IBK B;  1OZ0 A;  1NVP B;  4MVO A;  5JCO A;  3E2E A;  4LF5 O;  3AG2 C;  3AK2 A;  4UXN A;  2ZQM A;  3RYI B;  2XND G;  3ZMZ A;  1HDJ A;  1H8H G;  1YEW A;  2WPD G;  1SET A;  1WN7 A;  4CH5 A;  1ZL8 B;  1N34 B;  1JQ0 A;  4K8X A;  3CXH F;  5B66 Z;  5CA0 B;  2CAZ C;  3ABM B;  4E4E A;  4WFB V;  4FM2 A;  4I55 B; 
#chains in the Genus database with same CATH homology
 3ASN B;  4BW5 A;  1GKF A;  1NJI W;  1K4C C;  3ZRV A;  1YI2 V;  4UUJ C;  3P32 A;  3F7Y C;  1K33 A;  3OMA B;  3G4S V;  4P9P A;  1NH2 D;  1AJP A;  3E8F A;  2W6I G;  1K5S A;  1V54 C;  1GM9 A;  3W7X A;  2EZP A;  3LDE A;  4WCE V;  1ZWI C;  3VBB A;  4QJF B;  2X6B A;  4QE7 A;  3W7U A;  1RPO A;  5EBW C;  4BIU A;  2V7Q G;  1L1F A;  2WWW A;  2AHY A;  1K73 W;  2M7W A;  2ZR2 A;  1MAB G;  2YEV A;  2WLN A;  3T4D A;  5GW7 A;  2HR3 A;  1H2G A;  2WLL B;  1AI4 A;  3ABL B;  1KD1 W;  4WFA V;  2EJR A;  2JEX A;  3E86 A;  4OXS A;  1JX9 A;  1JVM A;  1EBO A;  2Y69 C;  5H6R A;  4MVR A;  4N23 A;  3SPI A;  2P7T C;  1ROP A;  3W7T A;  2A9H A;  5CBH A;  3W7W A;  5IYD O;  3X2Q B;  1QR9 A;  1N8R W;  1BMF G;  1RPR A;  2FTK A;  2DYR C;  2EIL B;  4MSW C;  3E8G A;  3FB7 C;  4MTO A;  3G71 V;  1M57 C;  2XAJ A;  3OGC C;  3OW2 U;  1S77 D;  1AI6 A;  2ZD9 A;  1RM1 B;  1QBZ A;  2DWE C;  4UVA A;  1M90 W;  3MHH C;  2QE7 G;  3CC2 V;  3SYC A;  2B1G A;  1MG1 A;  1FS0 G;  1NKD A;  4QIW F;  5DM6 V;  5KA6 A;  1P4R A;  1XL4 A;  4P30 A;  3UM7 A;  1GM8 A;  1QLE C;  1VQN V;  4FJC C;  3T1C A;  3GB7 C;  4TSF G;  5IY5 B;  1PNK A;  5H9C A;  1J95 A;  1FXK A;  5L3F A;  1OHH G;  1K8A W;  4QNH B;  3ASO B;  1JOY A;  3STL C;  5IYC O;  3BY6 A;  5KA5 A;  3ZIA G;  2Y48 A;  1K9M W;  1W0J G;  1Q81 W;  1ENV A;  2ZXW B;  1CP9 A;  1KP3 A;  1P7B A;  3LNM B;  1Y66 A;  2QKS A;  3AG2 B;  2B5U A;  4JTC B;  1F4M A;  4FK5 C;  5EBM C;  1I5X A;  3ABK C;  3CCQ V;  3K0G A;  3IC7 A;  4GX1 A;  3E35 A;  5IYB O;  2LP7 A;  2QM7 A;  4JAS A;  4WFF A;  4JGS A;  2Z3Y A;  4R50 A;  1E1Q G;  2IU0 A;  2D3O W;  1QLN A;  4RO2 A;  4XDK A;  4CBC A;  1PD3 A;  2XAH A;  2ZXW C;  2IW5 A;  1FXK B;  2UXN A;  3QO5 A;  2EZO A;  1YTF B;  1VQ8 V;  1YHQ V;  1JCH A;  1OCC C;  3JCZ A;  4UV8 A;  1YJW V;  1H38 A;  4I5S A;  4BAY A;  3SYP A;  4X88 A;  2GSM B;  3OM3 B;  2HFE C;  2HG5 C;  4PA7 A;  1V54 B;  5IDJ A;  3PJS K;  1CPY A;  1YJ9 V;  4G28 B;  1YTF D;  2P67 A;  5CBG A;  2JEU A;  3BEH A;  4X8A A;  4G2K A;  5LBQ A;  3DTU B;  1PKX A;  3CXC U;  1XL6 A;  4ZKI A;  4HAM A;  1FXK C;  1Q82 W;  3JD0 A;  4DO2 A;  4F4L A;  5CA3 A;  1VQM V;  3MD0 A;  4JTD B;  1CEZ A;  3JD3 A;  2HKO A;  4UV9 A;  5B1O A;  4CZZ A;  3NXS A;  3K9A A;  4LP8 A;  4JYC A;  3B77 A;  4TT3 G;  3T2M A;  3LSS A;  5CBF A;  2Y69 B;  4PDL A;  4RQE A;  4WF9 V;  2HVK C;  4R8C A;  1AR1 B;  1PNM A;  2BOC C;  3JD2 A;  4FIP C;  4RQF A;  1NBM G;  1FFT B;  2DYR B;  3JYC A;  1WLE A;  2MK3 A;  2Q67 A;  2DQ3 A;  1OCZ C;  4X89 A;  3LSQ A;  1M57 B;  1ORQ C;  3OEE G;  4PA9 A;  4JYB A;  2JIZ G;  5B1A B;  3CP1 A;  3DGE A;  4ASU G;  4XDJ A;  4MTF A;  3LDD A;  5B3S C;  5LHG A;  3B8M A;  2EBO A;  3ZRX A;  3SPG A;  4R7C A;  1R3J C;  2R9I A;  1KC8 W;  4G27 B;  1QLE B;  5H6Q A;  3RVZ A;  3IGA C;  3LUT B;  4PDM A;  4MVS A;  2JK5 C;  2W0F C;  3HPL C;  4RUF A;  1M1K W;  3ETE A;  4WFE A;  1Q7Y W;  3FYI B;  2WLH A;  5L3D A;  1EFR G;  5B1A C;  2KB1 A;  3AG3 B;  5L3C A;  2YEV B;  5C93 A;  1I5Y A;  4MVU A;  3K3W A;  1DF4 A;  2IJH A;  1B6Q A;  3K79 A;  1UJW B;  1EZJ A;  3ABK B;  5L3B A;  1YIJ V;  4YXW G;  1THZ A;  1KP2 A;  4GCZ A;  2DYS B;  1OCO C;  3OEH G;  1R6K A;  2AHZ A;  1K4D C;  3OFN G;  5B1B C;  2IJK A;  4H33 A;  1PL0 A;  3SYA A;  3D3I A;  3CPW U;  3AG3 C;  3F5W C;  4MW8 A;  2Q69 A;  3CD6 V;  2CK3 G;  1V55 B;  1GO3 F;  5DN6 G;  4GT1 A;  2IH1 C;  2A0L A;  2LFS A;  3F7V C;  3K0D A;  4JAU A;  3I55 V;  1R3I C;  3K04 A;  4UVB A;  3CCE V;  2NNU A;  1OCC B;  4RAI A;  2EIJ C;  1BHB A;  2BOB C;  5EC1 C;  1AJN A;  2DYS C;  2WLM A;  2X6C A;  4JF3 A;  1G8M A;  3QO7 A;  3P30 A;  1S0V A;  3VOU A;  4I9W A;  1PNL A;  1W0K G;  2GHY A;  2WLI A;  3RW0 A;  2DQ0 A;  2WSS G;  4QPJ A;  1DLB A;  3FB5 C;  1YIT V;  1V55 C;  1MSW D;  4MTG A;  4J9Z B;  3TK1 A;  2HJF C;  3H01 A;  2P90 A;  1K97 A;  2XOK G;  2ATK C;  4P9O A;  3A0R A;  3E89 A;  1KQS U;  3ZCC A;  1VQ4 V;  1R3L C;  1F23 A;  3CCR V;  3R65 A;  4TWK A;  4GX2 A;  3FYE B;  4FPP A;  4L87 A;  3UKM A;  1R73 A;  3CCL V;  1GK9 A;  3OAA G;  3RBZ A;  1F4N A;  3CCM V;  3OMI B;  1NQT A;  1F51 A;  2C2A A;  1OCZ B;  3E8H A;  4FMT A;  1R3K C;  3OR6 C;  4XBF A;  2XAG A;  1OCR B;  2WLI B;  2HLD G;  2WLJ A;  2JDI G;  3K08 A;  5B1N A;  1QVG U;  2QM8 A;  1K3E A;  1DTO A;  1M56 C;  2DW4 A;  5BZB A;  3CCV V;  1VQ5 V;  5B3S B;  3AEI A;  4MS2 A;  4E2L A;  2ZDI A;  1E1R G;  2IH3 C;  1SRY A;  2EIM C;  1QR8 A;  1BHA A;  4KFM A;  1AI7 A;  2IJI A;  4MVQ A;  5FL7 G;  5E1A C;  2QEX V;  1AI5 A;  4KUM A;  3AG1 C;  5J9P C;  3M99 B;  3EHB B;  3ABT A;  2H8P C;  1S5H C;  1G4Y B;  3EFF K;  2IU3 A;  4BIZ A;  1OCR C;  2QTO A;  5EC2 C;  2QA4 V;  2JJ1 G;  3JD1 A;  4PA6 A;  1YJN V;  5LGT A;  3FB8 C;  2OTL V;  2H94 A;  3CYO A;  2OCC B;  4MT8 A;  2A79 B;  1IXM A;  3E83 A;  1GM7 A;  4KP4 A;  1LNQ A;  1GMG A;  4PEL A;  4JTA B;  1VQ9 V;  4PA3 A;  5KUK A;  1HWY A;  5EBL C;  4QE9 A;  3CC4 V;  4RUE A;  4PA4 A;  1S72 V;  4WFH A;  1H8E G;  3OMN B;  2XAF A;  3W7S A;  3OUS A;  1AJQ A;  3ABM C;  1QCE A;  1OCO B;  3B8N A;  3E8B A;  1S3J A;  3ZMU A;  3AG4 B;  1FXH A;  5B1B B;  5L3G A;  2OT5 A;  1BL8 A;  3ASN C;  3ZRS A;  1K7D A;  3WG7 B;  3ZMS A;  2K1E A;  4GX5 A;  2PI5 A;  4HYO A;  2OCC C;  3ZJZ A;  1R6N A;  3KG2 A;  3SPH A;  2ITC C;  5LGN A;  4J9Y B;  4P2Z A;  5CMU A;  3CC7 V;  2EIJ B;  4GX0 A;  4LCU C;  2ZDI C;  3ML0 A;  3FB6 C;  2Q68 A;  4Q20 A;  5KUM A;  1SES A;  3CCU V;  3AG4 C;  2ITD C;  2W6J G;  5CN0 A;  4U7N A;  1E79 G;  3ABL C;  2XAS A;  3LDC A;  3WG7 C;  3ZMV A;  1SER A;  1Q86 W;  4PDV A;  3TCU A;  4JAV A;  3WFV A;  1S76 D;  4H37 A;  5HFM A;  1K92 A;  2Q6A A;  3ETG A;  3IFX A;  3X2Q C;  4QPK A;  5LHH A;  1VQK V;  4HZ3 A;  4U7O A;  5LHI A;  1KKD A;  5L3E A;  3QO8 A;  2EIL C;  3FKS G;  2DWD C;  4Z1M G;  1SZT A;  2B1I A;  2WAM A;  4MVZ A;  3D36 A;  3I56 V;  1RM1 C;  3QNE A;  2V1D A;  2UXX A;  2R9R B;  2F43 G;  4XDL A;  1K34 A;  1MOF A;  1W2B U;  2P6J A;  2EIK B;  5HFL A;  3K06 A;  3SYQ A;  3ETD A;  1K5Q A;  2NLJ C;  3CMA V;  1NR7 A;  1WPX A;  3K03 A;  1VQP V;  1COW G;  3OR7 C;  3ZN1 A;  2EIN B;  2OTJ V;  3T4Z A;  3CCS V;  1M56 B;  3SPC A;  1ARO P;  4EKW A;  1M9N A;  5IY5 C;  1NR1 A;  2PI4 A;  4MVM A;  1VQ6 V;  1YSC A;  2XAQ A;  3SJQ C;  2X6A A;  4N21 A;  3ZN0 A;  2EIM B;  3HB3 B;  2X7R B;  4MW3 A;  3ZRW A;  4DXW A;  1Y4M A;  3G6E V;  2IJJ A;  3ASO C;  1KEC A;  3SYO A;  2YSU B;  5EK0 A;  2ZR3 A;  1OZ0 A;  1NVP B;  1VQ7 V;  3MHS C;  3AG1 B;  3ABU A;  4MVO A;  1VQO V;  2EIK C;  3E2E A;  1QVF U;  1JPX A;  3AG2 C;  4UXN A;  2ZQM A;  3STZ C;  3RVY A;  4R6Z A;  2XND G;  3CME V;  4ZBM A;  3GWO A;  3ZMZ A;  2LFR A;  3CCJ V;  2EIN C;  2WLK A;  2X0L A;  3SPJ A;  1H8H G;  4UVC A;  1VQL V;  3OUF A;  1NVP D;  2WPD G;  1SET A;  1JJ2 U;  4PDR A;  4WFG A;  1JQ0 A;  4LBE C;  1TUE B;  2Z5U A;  5LGU A;  3OE7 G;  3ZMT A;  2HVJ C;  2WLL A;  1DF5 A;  3JD4 A;  3ABM B;  1NH2 B;  1GTO A;  4WFB V;  3ZRW B;  4MTX A;  4LC1 A;  4JPR A;  1FXV A;  3TET A;  2JJ2 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...