3CCJV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 20
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccjV00
3CCQV 1VQ7V 1KQSU 1QVGU 1Q82W 1N8RW 1YI2V 1M1KW 2QA4V 1VQNV 1VQ6V 1R73A 2OTLV 3OW2U 1K9MW 4WFBV 1K73W 1VQ4V 3CPWU 2OTJV 4WCEV 3CCLV 4WFAV 3CCVV 3CMAV 1NJIW 3CD6V 1KC8W 1YITV 3CC4V 3CCEV 3G4SV 3I55V 3G6EV 3I56V 1YHQV 3CC7V 2D3OW 3CCRV 1JJ2U 3CC2V 1VQOV 1W2BU 3CMEV 1YJWV 1YJNV 1VQPV 1QVFU 2QEXV 1S72V 3CCUV 1Q7YW 1VQMV 1KD1W 1VQ8V 4WF9V 1YIJV 1YJ9V 1Q81W 1Q86W 1M90W 1VQ9V 5DM6V 1VQLV 3CCJV 3CCSV 1K8AW 1VQ5V 1VQKV 3CXCU 3G71V 3CCMV
chains in the Genus database with same CATH superfamily
3JARA 2L35A 3UKMA 2E3CA 3GWKC 3CRMA 4J9YB 2EIKC 2GV9A 1MMMA 3KZIZ 1SF9A 1M57B 3ETDA 2YXHA 2BSKB 3P3NA 4HNAB 1D2DA 4PDMA 1QR9A 1XL4A 4LFAO 1DF4A 1Y74A 4J42A 2QR4A 4I7ZB 5GONB 4WFBV 5E79Z 3E8HA 3JAWB 1R3JC 3ABMC 1JMKC 1WB7A 4GCZA 3BCCH 3P3PA 3G80A 4X64B 2QEXV 2DJVA 4NKGB 1YEWA 2W0XA 2P90A 3A8TA 1BHAA 4PELA 1K4DC 4P9OA 5KAFZ 4FVMA 5E1AC 3QNEA 2Q4PA 5CA0B 2FKXA 1NZ6A 1MSWD 2Q9LA 2QKCA 4I0XA 2Q8VA 4LF4O 1BMFG 2XOKG 4MVMA 4YJ3B 3RVYA 3AG7A 1F4MA 4I50B 1Q90D 1N32B 1JPXA 3R66A 1K9MW 2CTPA 4E4EA 4X65O 4WCEV 4TOIA 4GX0A 3ZMUA 1SQPH 1GM8A 2ZE5A 2R9AA 3ABTA 4J80A 1FFTB 2GTSA 3ZHUA 3ABKC 1BT8A 3VOUA 1AILA 4J41A 4LF9O 5FNVA 2LFRA 1COWG 1SA0B 3H9VA 4NYKA 1ENVA 4NVPA 2X7RB 4O4IB 1S76D 1SETA 3CCVV 3JALB 1AJPA 2ZDIA 3B77A 3ASOC 1Q3EA 4O4HA 1XHXA 3H01A 4WFFA 5J2TB 3JALA 3LSQA 4B3SB 1P7GA 4IYHA 5J2TA 1SQVH 2YXYA 2EJRA 3D8CA 5LP6B 3L70H 1HW7A 2H8PC 3E8BA 2EJ7A 5LMNB 3MD0A 1BQ0A 4UCUA 3CRAA 4CH6A 3K5NA 4ZKIA 4H0LB 1MZFA 2CUGA 5CA0A 4ASUG 5CB4A 4I5SA 4G27B 3D36A 4GX1A 1JQ0A 3ZEDA 2OWOA 5LMUB 1PNKA 2VWKA 3KCXA 2ZIOA 4JPRA 2F1MA 3H1JH 2YI8A 1RFYA 4DXWA 4EKWA 4O2AA 4ZIBA 1R3IC 3JYCA 2DN9A 1Q43A 2EILB 1XI1A 3PN1A 5KUKA 4FK5C 3K03A 3T1HO 4JI2O 2DYRB 1FD9A 1YCIA 3TJTA 2L6LA 5LA6B 2AZ2A 1K97A 5L3DA 2KB1A 4JZ2A 4U7OA 2VQEB 1OCZC 2LW7A 1HR0B 3SPCA 1K3EA 4WBNA 4ZHQB 1WLEA 3G71V 4LP8A 3TETA 3HKCB 2RN9A 3X2QC 3CSXA 3LUTB 5IJ9B 4DUZB 1D5NA 3UQ8A 2ZR2A 1IZ3A 4OGQB 3I55V 2WA4A 2P7TC 1GN6A 3J81N 2Q7EA 5BR8B 1VQMV 2ZXWB 3RYCB 1M90W 3STZC 1XHZA 4BIZA 1MNGA 2X0LA 2CDYA 3ZN1A 1BHBA 3MDSA 5IYDO 1J5EO 3D36C 1PKXA 2Z5UA 1JX9A 2ADPA 4MVUA 5EIBD 5JCOA 4AHCA 1XMOB 4LF6B 4IIJA 2ZE7A 3DXRB 1TA8A 1VF5B 3WB2A 3A0HZ 4DW0A 4D6TH 3KCYA 2AXTZ 4UVCA 5ITZB 2QDOA 5LOVB 4K3AA 4I55B 1XUQA 5LOVA 4PI2A 1FS0G 1FXKB 1DF5A 4QGPA 5CA1A 1LUWA 3B40A 1V54B 3CYOA 4LCUC 3ZRWB 3I5DA 3ZX6A 1MA1A 1SESA 1VP7A 1N34O 4YHHB 3CCSV 1EZVH 4Z1VA 3B09A 1XNRB 5IWAB 5K1PA 2Y0PA 2F66C 3B8MA 4KFMA 4LC1A 1I94O 3CXHF 5JJNB 4KUMA 4X62O 4UVAA 4O4LA 4DR6B 2ZM6B 4DV5O 4OXSA 1Z5WA 3T1YB 4LWSB 1XOUA 3M99B 2JS5A 1I7FA 3FAVA 4QIWF 4YXWG 4X1YA 4OX9O 3RYCA 4GKJB 1XNQB 4X1KA 4QNHB 4ZI7A 1SS3A 1L0LH 2Q5ZA 2DYRC 4DV3O 3K9SA 1H2NA 3OTOB 1J95A 1NVPB 3S3XA 4PV1B 4NXMB 5IJ9A 3CP1A 4K35A 3AG1C 4LF5O 3CJHA 3SPGA 1JJOA 4WBNB 1JFFA 2QA4V 2Y4UA 1NTKH 2ADQB 3ETEA 4YIPA 2YEVA 4DV4O 1OCOB 4DR4B 2O57A 3K5OA 5A2QN 3HKDA 2HFEC 2EX3A 4GX2A 1ORQC 3JATA 2QWOB 1R6KA 3JD3A 1YJWV 2BE3A 2QE7G 1NR1A 1PL4A 1EBOA 4UV9A 2K1EA 3JCZA 4JI4O 4R8CA 3CHXA 4CH5A 1WPXA 1XMQB 1SQBH 5HFLA 3WB0A 4Q6GA 1N33O 4DR3B 2BCCH 2XAFA 2ZNJA 3E8FA 1GN4A 1W0KG 4PHZA 4GKKO 2W0FC 4LFBO 3VQXA 4P2ZA 4HYOA 1TVKB 5EC1C 3SPHA 1BGYH 3AEIA 3AG2C 1WAZA 2IH1C 4JI1B 3BFRA 1SKVA 4FPPA 5D5PA 2YS8A 4W4KA 1IBLO 1IBLB 3BRCA 3CCEV 1ZWIC 1ZL8B 4JYAB 1QCEA 2F93B 4BWAA 4JI1O 3W7SA 1IX9A 1OCRC 5KHKA 1H8EG 4ABMA 5DM6V 3CCJV 3E35A 1NI8A 4KL1A 1TUBA 2YIDA 2QWPB 3JAKA 4TWKA 4GKKB 5LGTA 3CMAV 1Z5VA 2OT5A 1AR1B 2MK3A 3ABKB 2Q0OC 1N33B 2DYSC 1F4NA 3G6BA 3K5MA 3N2GA 4N21A 1P84F 2EINB 3BA9A 1KYOF 3FB8C 4B3MB 3UT5A 2ZNIA 3IGAC 1LNQA 2QJ1A 5C8YB 4J7KA 2YICA 2QSAA 4FLZA 2DYSB 4JI3O 5AG2A 4MS2A 5JVDA 1AP5A 1F23A 2WLHA 3ZIAG 4UCRA 1NT2B 1Y66A 3JD4A 3E22B 1HNZB 3N27A 3CCUV 2JRIA 2M6YA 4L8JA 1YVWA 4XDKA 5B1AB 5B1AC 1K92A 4DR5B 1MABG 1XBLA 3OTOO 2BOCC 4J9ZB 2ZT9B 1K7DA 3AG2B 4JI8B 1H2SB 2AHYA 4DW1A 3K3WA 4TQFA 3APOA 2Q7HA 4X8AA 3ZS8C 1L0NH 3RYFA 4OX9B 1HDJA 2GDSA 4FMTA 2P5OA 3EFFK 3HKDB 3C90A 5F2VO 2P4KA 1VQLV 5EZYB 2CTRA 2IJHA 3UCSC 3OFNG 2ZM6O 1EFRG 2VQFO 4FLXA 3TK1A 3ZN0A 1US6A 1GAXA 1FPOA 3TGUH 1I94B 2G38A 1M57C 1KB9F 4P30A 4JGSA 1NTMH 2QKSA 1RPOA 5L3BA 2GUZA 4YHHO 4I9WA 4JI6O 4O2BA 5B3SB 2PF4E 3AG4B 2OCCB 1NS1A 2QKAA 2XTAA 5LA6A 4OPAA 4X1KB 5TISZ 3LDDA 1AI5A 2ZIMA 1MG1A 4Z2WA 1QNMA 4IYIA 4MVRA 1DK1A 1NVPD 1QVGU 3E22A 5EBWC 3MHHC 4LF6O 3HKEA 4JASA 3ZMVA 3OMNB 1XMOO 1TUBB 3JD1A 4LH6A 3IFXA 2ZXWC 1AROP 1KC8W 2PY5A 4IT5A 1G8MA 1N0JA 1J5EB 4MW8A 2QM7A 4IHJA 4UCOA 1GM9A 2ODMA 4QE9A 4DR2B 4K0KO 1P7BA 4GUNA 2EZPA 2C2AA 4TT3G 1YZBA 1YF2A 2UU9B 4AQYO 3IC9A 5IY5C 3APQA 3K59A 1M56B 3H1HH 2HVKC 1KQSU 1TGOA 1M1KW 4MVQA 4B7KA 1AR5A 4JTDB 1QLEC 1WA8A 1FXKC 1N4CA 4DV1O 2LGWA 3H1KH 3SPIA 3K9AA 2PZSA 2KKWA 2OIEA 3BY6A 4F6RA 4HNAA 4X9QA 1SA0A 3LSSA 3T1CA 1HR0O 2UXCO 1N36O 4TV8B 4NTXA 2VQEO 2F95B 2Z0AA 4LFCB 3OEHG 5EBMC 5IE9A 1K5QA 4FM2A 3R65A 4FM0A 4O4HB 2HLDG 5BMVB 3DXRA 4TV9A 2WA3A 4R7CA 5CBFA 1B06A 2RNBA 3VQWA 3BA8A 3CMEV 4JI2B 2Y48A 3K57A 3T1HB 1VEWA 3OGCC 4QPJA 2OCHA 1R6NA 4X1IA 4RQFA 2N04A 2VS0A 2Q69A 2NNUA 3K58A 5LHGA 5DEDA 1YXBA 3LSUA 4PI0A 5GTIZ 5CA3A 3OAAG 4X20B 3OR6C 1YHQV 1B04A 2UUCB 3HKEB 4I9QA 3AK1A 2JK5C 4NB5A 2F4VO 2HKOA 3K79A 1EM1A 1YJ9V 4Q20A 5GW7A 2IU0A 2M7WA 1V55B 1GK9A 3FAVB 5LMNO 4O4LB 3G67A 4LR3A 2V7QG 3J80N 2LQTA 1PNLA 2CGNA 2XUMA 4JYYA 3ZCCA 4HAMA 2YC0A 4MTGA 2UXNA 4X89A 4B3RO 4G2KA 2QWRB 1IURA 4TUYA 3SGIA 4B3TB 1U96A 2QTSA 3QTCA 5J2UA 4UB6Z 2WSSG 4WFEA 3ZRVA 1BS3A 2D2CB 1VIBA 4LF9B 1Z2GA 4X66O 2B9ZA 2VWJA 5JQGA 3VBBA 1GKFA 1XDCA 2OTLV 4QE7A 4L87A 3LDEA 3DGEA 1OCCB 4X65B 3RYHA 4EFEA 3K06A 5FLXN 3E86A 2FMLA 2A0LA 4CS2A 1N32O 1S72V 1KMIZ 4X66B 3SYAA 1AVMA 3U0ZA 1IDSA 2WPDG 1OCCC 1NH2B 4AILC 2WLIA 3ZMSA 2IW5A 2DW4A 3BAAA 5CBGA 3W7UA 2YXLA 4B3TO 2WAMA 4UVBA 5LGNA 4IIJB 2Y0IA 1MSDA 3G4SV 2E75B 5JH7A 4NTYA 4B3RB 1JOYA 4DRXA 2RCVA 4N23A 1VF6C 4O4JA 1H2GA 4TSFG 3E89A 2YIBA 1H2MA 4DRXB 1VQ5V 1NU1H 1BSMA 3KKYA 2W6JG 3OMIB 2FYUH 1O9HA 4FFKA 4WFAV 3OR7C 2DOSA 4LFAB 4CC5A 1YSCA 2DWEC 4LWSA 3CX5F 5EC2C 1N0NA 2RDCA 2F4VB 5J9PC 1F7YA 1IXBA 2UUCO 2DQ3A 1AP6A 4YJ3A 1Q6IA 1FXVA 4MW3A 2A3QA 2DQ0A 2RMKB 3WU2Z 5BZBA 4CBCA 1B3QA 2PI4A 4DK0A 1VQPV 1IVSA 5JVDB 4ZOLB 4I4TB 4ZBMA 3SYOA 4K8XA 5D5QA 5H6QA 5KHGA 1S5LZ 2JJ1G 2N74A 4DV6B 3SYCA 1MZEA 1PNMA 3LDCA 3RBZA 2Q67A 1GN2A 5KX5A 2IU3A 1GRJA 2WLKA 3EHBB 4MT8A 1GTOA 4I50A 1Y4MA 4LFCO 1I08A 1N36B 2UXCB 1Y6XA 2H94A 3JD0A 3U11A 5EIBC 3L73H 3T2MA 3RVZA 1TUEB 1VARA 3OW2U 3WFVA 4DV1B 2EINC 4BAYA 1UJWB 4W4LA 4PDLA 4FM1A 1WP8A 5B3SC 4GLXA 2V4DA 3AG3C 5BXZA 2HHHB 3BHPA 3ABLB 2JGUA 4AQYB 2XAGA 2UU9O 3B2EE 4EFBA 4DR2O 4K0KB 3JAWA 1CPYA 4H13B 1VQNV 1S5JA 2P6JA 1O9GA 4JI7O 4HZ3A 4H33A 2FTKA 2UXDO 1GN3A 1OZ0A 5BMVA 4DUYO 2GUZB 1DTOA 4LBEC 4Z1MG 4RUEA 3O9OA 5B1BC 1SQFA 4O4JB 2BOBC 4DR7O 2UXBO 3FFQA 2GTAA 4WFHA 4BW9A 3SJCC 1DGSA 3EVKA 1YTFD 4TUYB 4GT1A 5LHIA 4JI6B 2B1GA 5KX5B 3ETGA 1UPGA 4I0XB 1TAEA 4R50A 2DWDC 3ZRSA 5FPRA 3OUFA 1JFFB 4DV7O 2ITCC 3M8AA 2XASA 4JI5B 3CPWU 3ABMB 1NQTA 3CD6V 3CS5A 3Q4HB 1QQCA 3I56V 2VQFB 4ICGA 3DTUB 1URFA 2PUSA 5JJEB 1IBMB 1WB8A 2A7WA 3MHSC 3EXAA 2ILMA 3FYIB 5B5EZ 1HWYA 3CWBH 3FX7A 1ZAUA 3KG2A 1XILA 3IJ4A 3OT7A 4JI8O 1R3KC 4K8ZA 4F6RB 5IDJA 3VQYA 1EN6A 1I0HA 4TV9B 1P49A 3HKBB 5LGUA 5IYBO 4DR5O 4IL6Z 1R1BA 5JCOC 5LP6A 5BY1A 1THZA 5KMGA 1HNZO 1YDXA 2BTQA 4PA3A 3RT3C 3IC7A 5IYCO 5KHIA 3ZHVA 3QF7A 5JQGB 2YUAA 4JI3B 1B6QA 1K4CC 2B1IA 1KP2A 1FJGB 4B3MO 3L9DA 3TXQA 1IBKO 5EZYA 4OPHA 2JJ2G 1G1XB 4D7SA 5C93A 1Y76B 3K0GA 3DC5A 1OV9A 3JAKB 5H2FZ 1FFXA 5L3CA 4PD4F 2N05A 3CRQA 1I5XA 3A0BZ 3L74H 1HNXB 3K08A 2R9RB 2NLJC 5IYZB 1KD1W 1Q81W 1WP7A 3ZHSA 5CMUA 3UT5B 2F43G 4YY3B 4JYAO 2P67A 2PYLA 5EYPA 2ARHA 2YIBD 3ZRXA 3CB2A 4GYCB 1FAFA 4KXRA 2KG7B 3ZHTA 1ROPA 2GBOA 1RM1B 1YIJV 1Q86W 1CEZA 3F5WC 3FB7C 3SR2C 2HEPA 4LFBB 1MOFA 1YI2V 5JJJB 2YDEA 1M56C 2QM4A 4ZHQA 1AB3A 4B7EA 1H38A 1BE3H 2RQ6A 3JARB 4DR3O 5J2UB 4JTCB 5LYJA 5B1OA 4YIOA 2ITDC 3HPLC 3FD9A 3FB6C 1XMQO 3B8NA 1PM9A 3QO8A 2UUBB 5IJ0A 3BPZA 1FXHA 4JI4B 4H44B 2UUAB 1SQQH 3L72H 1H8HG 4PA7A 4JF3A 2XHBA 1R73A 3ZHRA 4CS4A 4KHPB 3SYQA 2PI5A 4DR4O 3NXSA 4DV4B 3HR0A 1AI4A 3OUSA 1PL0A 3GVMA 3O65A 4LH7A 1S77D 1ZLZA 2LFSA 4JAAA 3RFRA 3GB7C 4LF5B 3D3QA 3UO3A 2CTWA 4O2AB 1JA8A 2LJ2A 1EN5A 4NXMO 3K0DA 1LR1A 4UCTA 3OE7G 1BCCH 4PA6A 3JASB 4DV3B 2ZE6A 3BABA 4FLTA 1E1RG 2JVDA 1XNQO 5KHHA 2YI9A 1AJQA 4GKJO 2ZQMA 2ZR3A 3S3WA 1M4UA 3L75H 1XQ8A 3DSQA 3ETQA 4CS3A 1WPBA 5JWPA 3BVOA 5CN0A 5CBHA 1SQXH 1RP3B 3T1YO 4DV5B 4DR6O 4X62B 2Y69C 5GTHZ 2GSMB 2JIZG 3STLC 4MTXA 1WJZA 4X20A 1S0VA 2LP7A 4J7ZA 1NBMG 1SRYA 2XNDG 5K1XA 4MTFA 4DV2O 3ZMZA 2QM8A 3H1IH 3UM7A 1G4YB 1VF7A 5IWAO 1XNRO 1BQZA 2Q0AA 1N34B 4ZOLA 2WLLB 2HJFC 1QLNA 4MVZA 1HNWB 3ASOB 3J7AU 2A79B 4X1YB 2ZE8A 3CC2V 4JZGA 3P32A 2X6BA 2E74B 1VF6A 5LBQA 1PV0A 1BL8A 3K04A 2P06A 2ZDIC 2WLMA 5LYJB 2ZINA 2HP8A 3JD2A 3JAMN 4AI8A 3OM3B 2P4VA 3ICXA 3OD4A 1X4TA 2EBOA 2HVJC 2EZOA 3OMAB 5L3EA 1W59A 3JASA 1H2LA 5KA5A 2W6IG 1FXKA 4NXNO 4XDJA 1CXZB 1KKCA 4PJ0Z 5BR8O 1NTZH 2R9IA 1JVMA 1GO3F 2WWWA 3MAQA 1Q82W 3CE2A 1DLBA 2GHYA 1EZJA 4MTOA 1AR4A 1NJIW 4PA4A 2X6AA 4DUZO 3CC4V 4NR1A 1PP9H 2IBZH 4TV8A 3SPJA 1D5AA 5KHJA 1VQ9V 1RPRA 4CH4A 3THOA 2A06H 3W7WA 2QWQB 1M5IA 2ZD9A 2IM9A 5EBLC 1BZKA 3GWOA 2YSUB 2LW1A 1RSOB 4U3FH 4LNUB 2AGAA 4J7JA 5LP6C 1M9NA 5HFMA 3QVNA 3OTFA 4UFZA 4LNUA 5LL6Y 3FYEB 1K73W 1K34A 3AG4C 1N8RW 4R6ZA 1FFXB 4U3JB 1M93A 1SZXA 4C7UA 1JJ2U 4MVOA 2Q68A 5LMUO 4U3JA 1K5SA 2P22C 4E2LA 1NR7A 5C8YA 4MSWC 4NXNB 2FB5A 4XBFA 2CH7A 1L1FA 4RQEA 2Z3YA 2OTJV 5A9GA 3A0RA 3RYIB 2IJKA 3SJAC 5DN6G 3CJHB 4ZI7B 4FLYA 1QHTA 2CAZC 1WA8B 1Y67A 4A5UB 4B3SO 2WLIB 4UUJC 5KAIZ 2NN4A 3JATB 4D7TA 1EN4A 1GH6A 1YTFB 1WN7A 2CE4A 3JSLA 2XT9A 1HNWO 1SERA 1VQOV 2DMXA 1Q7YW 2ATKC 1A32A 2JDIG 4BR6A 2OCCC 4U7NA 5IJ0B 4KP4A 3RGBA 4DV2B 2NR5A 4MVSA 2PTMA 3JCUZ 3SJBC 2CTQA 3F7VC 2AZ0A 4F4LA 3AK2A 2BSKA 2OYQA 1AI6A 3LNNA 1PD3A 1VQ8V 1OCOC 1FKAO 5GONA 3OEEG 1JR9A 4LF4B 3AG1B 2JGDB 4RUFA 1SZTA 5EYPB 1CP9A 5CA1B 3CC7V 4X1IB 4CC6A 2HG5C 1KUQA 5LHHA 2A9HA 1VMGA 2KG7A 3ZMTA 4X64O 4JAVA 4FLVA 5EK0A 3FB5C 2AHZA 3IAYA 4FFBB 3WG7C 2AW9A 4JYBA 2LGQA 3ASNC 4CH3A 4KHPO 3B4SA 3G6EV 3RN4A 1X59A 1R6TA 1H2KA 2UUAO 5H5NA 4RWUA 4J11A 3TCUA 2UUBO 3N2GB 4FZ0A 5KUMA 3T4DA 1P4RA 1XL6A 4WFGA 3RYIA 2HJDA 3T4ZA 2DE0X 2UXXA 5LXTA 3TXSA 1VQ4V 3SYPA 4UV8A 1OCZB 4O4IA 3N2KA 1YITV 5B1NA 3AG3B 4CZZA 3HB3B 3RW0A 5LXTB 1KU9A 5L3FA 2Y69B 3C3TA 1KBHA 5FNVB 3A2FA 3RYHB 2JEUA 4FIPC 1Y74B 1T5EA 1VQ7V 1ZSPA 2IJIA 5FPOA 4I55A 1W0JG 2YEVB 2EILC 1OCRB 4DYLA 3CCRV 1AJNA 1UFIA 2FL4A 2CK3G 3U10A 5ITZA 4DR1O 2JGDA 4YY3O 2Q73A 5KMGB 2QWNB 5H9CA 1VQKV 3CCMV 1QR8A 1OHHG 3E2EA 1KKDA 2Y4TA 3RWRD 1HNXO 4PDVA 4P9PA 1R3LC 3OGIB 3CCLV 4YJ2A 4FJCC 3UO2A 4JTAB 2JEXA 4JI0B 4FLWA 5KLVH 4DV0B 4FFBA 3P30A 3W7XA 1SQGA 1GMGA 4RO2A 1NH2D 4JV5B 2B5UA 2EIJC 4GZRB 4RAIA 4UXNA 3CXCU 1IBKB 1V54C 2F23A 2V1DA 5JH7B 1FJGO 1FYJA 4QJFB 1Q6HA 4O2BB 1NKDA 3E83A 1KP3A 3ML0A 3CRRA 3ZHQA 1I5YA 2PGGA 2EULA 3C3SA 1OJHA 3H1LH 4PA9A 2IH3C 3L71H 3LNMB 3QO5A 3K5LA 2E5LO 4HBNA 2Q7GA 3ZJZA 4LF8O 3M7MX 3SJQC 2R72A 1L8DA 4EB6A 1G6UA 1QU7A 4B08A 5KA6A 1SC5B 5IY5B 3VQVA 3HKCA 3RYFB 4JYCA 2VRZA 2E76B 1IBMO 5B66Z 2K9PA 3ZBHA 4LF7O 3W7TA 1Q6UA 1U97A 1V55C 2WLJA 3CEIA 5IT9N 2KQXA 1Q8IA 2XAHA 4GX5A 3WB1A 4I4TA 2MW2B 3BEHA 4BW5A 3F7YC 4JI5O 2EIJB 3QO7A 3N2KB 4LF7B 4DV7B 2RJZA 4BIUA 3AK3A 2R70A 3F5TA 1WNSA 1TVKA 4BIOA 4NTWA 1HP8A 1F51A 5H6RA 3NR7A 4PDRA 4FZ1A 1GM7A 2UXBB 4FLUA 4DR7B 3E8GA 5IYZA 4F6EA 1KECA 2QGNA 4JAUA 1ZL8A 4LF8B 5DECA 1LUVA 4H37A 5L3GA 1ZX3A 2E5LB 4YJ2B 3PJSK 3CCQV 1RM1C 3DC6A 4DUYB 3ABUA 1VQ6V 1S3JA 1K33A 2UXDB 2XAJA 1RSOA 1ZTEA 2ZKOA 3ZRWA 5CB4B 4JI7B 1E1QG 3QG5A 1JCHA 2KSDA 1Y76A 4DO2A 2JS3A 2OIGA 1S5HC 1YJNV 2EIKB 4EB6B 4J10A 2BTOA 4WF9V 1ZUQA 4IHJB 3CRCA 2HHHO 4IGGA 3SDLA 1XREA 1QLEB 4JV5O 4QPKA 4DV0O 2WLLA 4DK1A 4JI0O 3Q4HA 1V9PA 4UCVA 2ETNA 3ASNB 1Q5OA 3WG7B 3FKSG 2XAQA 2Q6AA 1AI7A 2PYJA 2D3OW 1W2BU 4UCSA 1QVFU 1IXMA 5FL7G 2EIMC 4XDLA 2ZCEA 2CH7B 3D3IA 4UB8Z 4DR1B 2CGOA 4G28B 4TQDA 3X2QB 1E79G 1QBZA 5B1BB 2H3OA 2EIMB 2X6CA 1PPJH 2LO1A 3HKBA 2HR3A 4DV6O 1XEQA 3ABLC 3JSNA 4X88A 2WLNA 2YIAA 2QTOA 2BTQB 2IJJA 4EEQA 1K8AW
chains in the Genus database with same CATH topology
3JD0A 1K34A 3AG4C 1N8RW 3T2MA 3RVZA 4TWKA 1TUEB 4R6ZA 3UKMA 3OW2U 3WFVA 5LGTA 3CMAV 2EINC 2OT5A 4BAYA 1AR1B 1UJWB 4J9YB 2EIKC 2MK3A 3ABKB 4PDLA 2DYSC 1JJ2U 1F4NA 4MVOA 4N21A 2Q68A 5B3SC 1K5SA 4E2LA 1NR7A 2EINB 1M57B 3ETDA 3AG3C 3ABLB 4MSWC 2XAGA 3FB8C 4PDMA 1QR9A 1XL4A 1DF4A 4XBFA 1CPYA 1LNQA 3IGAC 1VQNV 2P6JA 1L1FA 4RQEA 2Z3YA 4WFBV 2DYSB 4HZ3A 2OTJV 4H33A 2FTKA 3E8HA 4MS2A 1R3JC 3ABMC 1OZ0A 3A0RA 2IJKA 4GCZA 5DN6G 1F23A 2WLHA 3ZIAG 1Y66A 3JD4A 1DTOA 2QEXV 3CCUV 4LBEC 4Z1MG 5B1AB 4RUEA 5B1AC 4XDKA 1K92A 5B1BC 2P90A 1MABG 2WLIB 1BHAA 4PELA 1K4DC 4UUJC 2BOCC 4J9ZB 4P9OA 1K7DA 2BOBC 3AG2B 5E1AC 3QNEA 2AHYA 1YTFB 3K3WA 1MSWD 4WFHA 4X8AA 1YTFD 4FMTA 1VQOV 1SERA 3EFFK 4GT1A 5LHIA 1BMFG 2B1GA 3ETGA 2ATKC 1Q7YW 2XOKG 4MVMA 3RVYA 2JDIG 4R50A 2DWDC 1VQLV 3ZRSA 1F4MA 3OUFA 2IJHA 2OCCC 4U7NA 1JPXA 2ITCC 4KP4A 3OFNG 1EFRG 2XASA 4MVSA 1K9MW 3TK1A 3ZN0A 3CPWU 3ABMB 4WCEV 1NQTA 4GX0A 3F7VC 3ZMUA 3CD6V 1M57C 1GM8A 4F4LA 4P30A 3I56V 3ABTA 4JGSA 1FFTB 3STLC 2QKSA 3DTUB 1AI6A 1RPOA 1PD3A 3ABKC 5L3BA 1VQ8V 3VOUA 1OCOC 3MHSC 4I9WA 2LFRA 1COWG 3OEEG 3FYIB 5B3SB 1ENVA 3AG4B 1HWYA 2X7RB 3AG1B 2OCCB 1S76D 4RUFA 1SZTA 1SETA 3KG2A 3CCVV 1AJPA 2ZDIA 3B77A 1CP9A 3ASOC 1R3KC 3CC7V 5IDJA 2HG5C 3H01A 4WFFA 5LHHA 3LDDA 3LSQA 1AI5A 2A9HA 5LGUA 5IYBO 1MG1A 3ZMTA 4MVRA 1THZA 1NVPD 4JAVA 1QVGU 5EK0A 3FB5C 5EBWC 4PA3A 2EJRA 2AHZA 3MHHC 4JASA 3ZMVA 3OMNB 3IC7A 5IYCO 3JD1A 3WG7C 2H8PC 4JYBA 3E8BA 3ASNC 3IFXA 2ZXWC 1B6QA 1AROP 3MD0A 1K4CC 1KC8W 2B1IA 1G8MA 3G6EV 1KP2A 4MW8A 2QM7A 4ZKIA 1GM9A 4QE9A 1P7BA 2EZPA 2C2AA 4TT3G 4ASUG 2JJ2G 4I5SA 4G27B 3D36A 5C93A 3TCUA 3K0GA 4GX1A 5IY5C 1JQ0A 5KUMA 1M56B 3T4DA 1P4RA 2HVKC 1KQSU 1XL6A 1PNKA 4WFGA 3T4ZA 1M1KW 4JPRA 2UXXA 4MVQA 4JTDB 1QLEC 1VQ4V 3SYPA 1FXKC 4UV8A 5L3CA 1OCZB 3SPIA 5B1NA 4DXWA 1I5XA 3AG3B 3HB3B 4CZZA 3K9AA 4EKWA 1YITV 3RW0A 1R3IC 5L3FA 3JYCA 2Y69B 3K08A 2EILB 2R9RB 3BY6A 2NLJC 5KUKA 3LSSA 3T1CA 1KD1W 1Q81W 4FK5C 2JEUA 3K03A 4FIPC 5CMUA 2F43G 1VQ7V 3OEHG 2DYRB 5EBMC 2P67A 2IJIA 1K5QA 3R65A 3ZRXA 2HLDG 1W0JG 2YEVB 1K97A 2EILC 1OCRB 4R7CA 3CCRV 1AJNA 5CBFA 2CK3G 5L3DA 3CMEV 2KB1A 2Y48A 1ROPA 4U7OA 1RM1B 1OCZC 1YIJV 1Q86W 3OGCC 1CEZA 3F5WC 3SPCA 1K3EA 3FB7C 5H9CA 4QPJA 1VQKV 1R6NA 1WLEA 4RQFA 3G71V 3CCMV 4LP8A 1QR8A 3TETA 1OHHG 3X2QC 3E2EA 1KKDA 1MOFA 2Q69A 1YI2V 2NNUA 1M56C 3LUTB 5LHGA 4PDVA 4P9PA 1R3LC 3CCLV 1H38A 5CA3A 2ZR2A 4FJCC 3OAAG 3I55V 4JTAB 3OR6C 2JEXA 4JTCB 1YHQV 2P7TC 5B1OA 3W7XA 3P30A 2ITDC 3HPLC 1GMGA 2JK5C 3FB6C 4RO2A 2B5UA 1NH2D 2EIJC 2HKOA 1VQMV 2ZXWB 3B8NA 3K79A 3STZC 1YJ9V 3QO8A 4RAIA 4BIZA 1M90W 4Q20A 1FXHA 4UXNA 5GW7A 2X0LA 3CXCU 2IU0A 3ZN1A 1BHBA 1V54C 2V1DA 2M7WA 1V55B 1H8HG 4PA7A 4JF3A 4QJFB 5IYDO 1GK9A 1R73A 1PKXA 2Z5UA 3SYQA 1JX9A 1NKDA 4MVUA 2PI5A 3E83A 1KP3A 3NXSA 3ML0A 1I5YA 1AI4A 2V7QG 4PA9A 2IH3C 1PNLA 3OUSA 1PL0A 3LNMB 1S77D 2LFSA 3GB7C 3QO5A 4UVCA 3ZJZA 3K0DA 3ZCCA 4HAMA 3OE7G 4MTGA 3SJQC 4PA6A 2UXNA 4X89A 4G2KA 1FS0G 1E1RG 1FXKB 1DF5A 1AJQA 2ZQMA 2ZR3A 1V54B 3CYOA 4LCUC 3ZRWB 5KA6A 2WSSG 5IY5B 4WFEA 3ZRVA 1SESA 5CN0A 5CBHA 4JYCA 3CCSV 3W7TA 1V55C 3VBBA 1GKFA 2WLJA 2Y69C 3B8MA 2OTLV 2GSMB 2JIZG 4KFMA 4MTXA 4L87A 3LDEA 4LC1A 4QE7A 2LP7A 2XAHA 1NBMG 1OCCB 1SRYA 2XNDG 3DGEA 4GX5A 3BEHA 4BW5A 3F7YC 3K06A 2EIJB 3QO7A 4KUMA 4UVAA 3E86A 4MTFA 4OXSA 3ZMZA 2A0LA 2QM8A 1S72V 4BIUA 3UM7A 1G4YB 3SYAA 3M99B 2WPDG 1OCCC 2WLLB 1NH2B 4QIWF 2HJFC 2WLIA 3ZMSA 1QLNA 4MVZA 1F51A 3ASOB 5H6RA 4YXWG 2IW5A 2DW4A 5CBGA 3W7UA 4PDRA 2WAMA 4UVBA 5LGNA 4QNHB 2A79B 1GM7A 3G4SV 2DYRC 1JOYA 3E8GA 3CC2V 3P32A 4N23A 1KECA 4JAUA 1J95A 1NVPB 2X6BA 1H2GA 4TSFG 3E89A 4H37A 5L3GA 5LBQA 3CP1A 1BL8A 1VQ5V 3AG1C 3PJSK 3K04A 3CCQV 1RM1C 2ZDIC 3SPGA 2WLMA 3ABUA 2QA4V 1VQ6V 3ETEA 1S3JA 1K33A 3JD2A 2YEVA 2W6JG 3OMIB 2XAJA 3OM3B 1OCOB 4WFAV 3ZRWA 1E1QG 2EBOA 2HVJC 2EZOA 2HFEC 3OMAB 1JCHA 5L3EA 4GX2A 4DO2A 1ORQC 1R6KA 3JD3A 1YJWV 1S5HC 5KA5A 3OR7C 1YJNV 2QE7G 1S0VA 2EIKB 2W6IG 1FXKA 1NR1A 1YSCA 1EBOA 4UV9A 2K1EA 3JCZA 4XDJA 4R8CA 2DWEC 4WF9V 5EC2C 1WPXA 1QLEB 2R9IA 5J9PC 1JVMA 1GO3F 2WWWA 5HFLA 4QPKA 1Q82W 2WLLA 1DLBA 2DQ3A 1FXVA 2GHYA 1EZJA 3ASNB 4MTOA 2XAFA 4MW3A 3WG7B 3FKSG 2DQ0A 2XAQA 3E8FA 2Q6AA 4PA4A 2X6AA 1NJIW 1W0KG 3CC4V 1AI7A 5BZBA 4CBCA 2D3OW 2W0FC 1W2BU 2PI4A 3SPJA 1VQPV 1QVFU 1IXMA 4P2ZA 5FL7G 4HYOA 4ZBMA 2EIMC 4XDLA 5EC1C 3SPHA 1VQ9V 3SYOA 5H6QA 3AEIA 3AG2C 1RPRA 2IH1C 2JJ1G 3D3IA 4G28B 3SYCA 3X2QB 3W7WA 1E79G 1QBZA 1PNMA 3LDCA 4FPPA 3RBZA 2Q67A 2ZD9A 5B1BB 5EBLC 2IU3A 3GWOA 2EIMB 2YSUB 2X6CA 3CCEV 1ZWIC 2WLKA 3EHBB 4MT8A 1GTOA 1QCEA 1Y4MA 2HR3A 1M9NA 5HFMA 3W7SA 3ABLC 1OCRC 4X88A 1H8EG 2WLNA 2H94A 2QTOA 5DM6V 3CCJV 3E35A 2IJJA 3FYEB 1K73W 1K8AW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ V;  1VQ7 V;  1KQS U;  1QVG U;  1Q82 W;  1N8R W;  1YI2 V;  1M1K W;  2QA4 V;  1VQN V;  1VQ6 V;  1R73 A;  2OTL V;  3OW2 U;  1K9M W;  4WFB V;  1K73 W;  1VQ4 V;  3CPW U;  2OTJ V;  4WCE V;  3CCL V;  4WFA V;  3CCV V;  3CMA V;  1NJI W;  3CD6 V;  1KC8 W;  1YIT V;  3CC4 V;  3CCE V;  3G4S V;  3I55 V;  3G6E V;  3I56 V;  1YHQ V;  3CC7 V;  2D3O W;  3CCR V;  1JJ2 U;  3CC2 V;  1VQO V;  1W2B U;  3CME V;  1YJW V;  1YJN V;  1VQP V;  1QVF U;  2QEX V;  1S72 V;  3CCU V;  1Q7Y W;  1VQM V;  1KD1 W;  1VQ8 V;  4WF9 V;  1YIJ V;  1YJ9 V;  1Q81 W;  1Q86 W;  1M90 W;  1VQ9 V;  5DM6 V;  1VQL V;  3CCJ V;  3CCS V;  1K8A W;  1VQ5 V;  1VQK V;  3CXC U;  3G71 V;  3CCM V; 
#chains in the Genus database with same CATH topology
 3JAR A;  2L35 A;  3UKM A;  2E3C A;  3GWK C;  3CRM A;  4J9Y B;  2EIK C;  2GV9 A;  1MMM A;  3KZI Z;  1SF9 A;  1M57 B;  3ETD A;  2YXH A;  2BSK B;  3P3N A;  4HNA B;  1D2D A;  4PDM A;  1QR9 A;  1XL4 A;  4LFA O;  1DF4 A;  1Y74 A;  4J42 A;  2QR4 A;  4I7Z B;  5GON B;  4WFB V;  5E79 Z;  3E8H A;  3JAW B;  1R3J C;  3ABM C;  1JMK C;  1WB7 A;  4GCZ A;  3BCC H;  3P3P A;  3G80 A;  4X64 B;  2QEX V;  2DJV A;  4NKG B;  1YEW A;  2W0X A;  2P90 A;  3A8T A;  1BHA A;  4PEL A;  1K4D C;  4P9O A;  5KAF Z;  4FVM A;  5E1A C;  3QNE A;  2Q4P A;  5CA0 B;  2FKX A;  1NZ6 A;  1MSW D;  2Q9L A;  2QKC A;  4I0X A;  2Q8V A;  4LF4 O;  1BMF G;  2XOK G;  4MVM A;  4YJ3 B;  3RVY A;  3AG7 A;  1F4M A;  4I50 B;  1Q90 D;  1N32 B;  1JPX A;  3R66 A;  1K9M W;  2CTP A;  4E4E A;  4X65 O;  4WCE V;  4TOI A;  4GX0 A;  3ZMU A;  1SQP H;  1GM8 A;  2ZE5 A;  2R9A A;  3ABT A;  4J80 A;  1FFT B;  2GTS A;  3ZHU A;  3ABK C;  1BT8 A;  3VOU A;  1AIL A;  4J41 A;  4LF9 O;  5FNV A;  2LFR A;  1COW G;  1SA0 B;  3H9V A;  4NYK A;  1ENV A;  4NVP A;  2X7R B;  4O4I B;  1S76 D;  1SET A;  3CCV V;  3JAL B;  1AJP A;  2ZDI A;  3B77 A;  3ASO C;  1Q3E A;  4O4H A;  1XHX A;  3H01 A;  4WFF A;  5J2T B;  3JAL A;  3LSQ A;  4B3S B;  1P7G A;  4IYH A;  5J2T A;  1SQV H;  2YXY A;  2EJR A;  3D8C A;  5LP6 B;  3L70 H;  1HW7 A;  2H8P C;  3E8B A;  2EJ7 A;  5LMN B;  3MD0 A;  1BQ0 A;  4UCU A;  3CRA A;  4CH6 A;  3K5N A;  4ZKI A;  4H0L B;  1MZF A;  2CUG A;  5CA0 A;  4ASU G;  5CB4 A;  4I5S A;  4G27 B;  3D36 A;  4GX1 A;  1JQ0 A;  3ZED A;  2OWO A;  5LMU B;  1PNK A;  2VWK A;  3KCX A;  2ZIO A;  4JPR A;  2F1M A;  3H1J H;  2YI8 A;  1RFY A;  4DXW A;  4EKW A;  4O2A A;  4ZIB A;  1R3I C;  3JYC A;  2DN9 A;  1Q43 A;  2EIL B;  1XI1 A;  3PN1 A;  5KUK A;  4FK5 C;  3K03 A;  3T1H O;  4JI2 O;  2DYR B;  1FD9 A;  1YCI A;  3TJT A;  2L6L A;  5LA6 B;  2AZ2 A;  1K97 A;  5L3D A;  2KB1 A;  4JZ2 A;  4U7O A;  2VQE B;  1OCZ C;  2LW7 A;  1HR0 B;  3SPC A;  1K3E A;  4WBN A;  4ZHQ B;  1WLE A;  3G71 V;  4LP8 A;  3TET A;  3HKC B;  2RN9 A;  3X2Q C;  3CSX A;  3LUT B;  5IJ9 B;  4DUZ B;  1D5N A;  3UQ8 A;  2ZR2 A;  1IZ3 A;  4OGQ B;  3I55 V;  2WA4 A;  2P7T C;  1GN6 A;  3J81 N;  2Q7E A;  5BR8 B;  1VQM V;  2ZXW B;  3RYC B;  1M90 W;  3STZ C;  1XHZ A;  4BIZ A;  1MNG A;  2X0L A;  2CDY A;  3ZN1 A;  1BHB A;  3MDS A;  5IYD O;  1J5E O;  3D36 C;  1PKX A;  2Z5U A;  1JX9 A;  2ADP A;  4MVU A;  5EIB D;  5JCO A;  4AHC A;  1XMO B;  4LF6 B;  4IIJ A;  2ZE7 A;  3DXR B;  1TA8 A;  1VF5 B;  3WB2 A;  3A0H Z;  4DW0 A;  4D6T H;  3KCY A;  2AXT Z;  4UVC A;  5ITZ B;  2QDO A;  5LOV B;  4K3A A;  4I55 B;  1XUQ A;  5LOV A;  4PI2 A;  1FS0 G;  1FXK B;  1DF5 A;  4QGP A;  5CA1 A;  1LUW A;  3B40 A;  1V54 B;  3CYO A;  4LCU C;  3ZRW B;  3I5D A;  3ZX6 A;  1MA1 A;  1SES A;  1VP7 A;  1N34 O;  4YHH B;  3CCS V;  1EZV H;  4Z1V A;  3B09 A;  1XNR B;  5IWA B;  5K1P A;  2Y0P A;  2F66 C;  3B8M A;  4KFM A;  4LC1 A;  1I94 O;  3CXH F;  5JJN B;  4KUM A;  4X62 O;  4UVA A;  4O4L A;  4DR6 B;  2ZM6 B;  4DV5 O;  4OXS A;  1Z5W A;  3T1Y B;  4LWS B;  1XOU A;  3M99 B;  2JS5 A;  1I7F A;  3FAV A;  4QIW F;  4YXW G;  4X1Y A;  4OX9 O;  3RYC A;  4GKJ B;  1XNQ B;  4X1K A;  4QNH B;  4ZI7 A;  1SS3 A;  1L0L H;  2Q5Z A;  2DYR C;  4DV3 O;  3K9S A;  1H2N A;  3OTO B;  1J95 A;  1NVP B;  3S3X A;  4PV1 B;  4NXM B;  5IJ9 A;  3CP1 A;  4K35 A;  3AG1 C;  4LF5 O;  3CJH A;  3SPG A;  1JJO A;  4WBN B;  1JFF A;  2QA4 V;  2Y4U A;  1NTK H;  2ADQ B;  3ETE A;  4YIP A;  2YEV A;  4DV4 O;  1OCO B;  4DR4 B;  2O57 A;  3K5O A;  5A2Q N;  3HKD A;  2HFE C;  2EX3 A;  4GX2 A;  1ORQ C;  3JAT A;  2QWO B;  1R6K A;  3JD3 A;  1YJW V;  2BE3 A;  2QE7 G;  1NR1 A;  1PL4 A;  1EBO A;  4UV9 A;  2K1E A;  3JCZ A;  4JI4 O;  4R8C A;  3CHX A;  4CH5 A;  1WPX A;  1XMQ B;  1SQB H;  5HFL A;  3WB0 A;  4Q6G A;  1N33 O;  4DR3 B;  2BCC H;  2XAF A;  2ZNJ A;  3E8F A;  1GN4 A;  1W0K G;  4PHZ A;  4GKK O;  2W0F C;  4LFB O;  3VQX A;  4P2Z A;  4HYO A;  1TVK B;  5EC1 C;  3SPH A;  1BGY H;  3AEI A;  3AG2 C;  1WAZ A;  2IH1 C;  4JI1 B;  3BFR A;  1SKV A;  4FPP A;  5D5P A;  2YS8 A;  4W4K A;  1IBL O;  1IBL B;  3BRC A;  3CCE V;  1ZWI C;  1ZL8 B;  4JYA B;  1QCE A;  2F93 B;  4BWA A;  4JI1 O;  3W7S A;  1IX9 A;  1OCR C;  5KHK A;  1H8E G;  4ABM A;  5DM6 V;  3CCJ V;  3E35 A;  1NI8 A;  4KL1 A;  1TUB A;  2YID A;  2QWP B;  3JAK A;  4TWK A;  4GKK B;  5LGT A;  3CMA V;  1Z5V A;  2OT5 A;  1AR1 B;  2MK3 A;  3ABK B;  2Q0O C;  1N33 B;  2DYS C;  1F4N A;  3G6B A;  3K5M A;  3N2G A;  4N21 A;  1P84 F;  2EIN B;  3BA9 A;  1KYO F;  3FB8 C;  4B3M B;  3UT5 A;  2ZNI A;  3IGA C;  1LNQ A;  2QJ1 A;  5C8Y B;  4J7K A;  2YIC A;  2QSA A;  4FLZ A;  2DYS B;  4JI3 O;  5AG2 A;  4MS2 A;  5JVD A;  1AP5 A;  1F23 A;  2WLH A;  3ZIA G;  4UCR A;  1NT2 B;  1Y66 A;  3JD4 A;  3E22 B;  1HNZ B;  3N27 A;  3CCU V;  2JRI A;  2M6Y A;  4L8J A;  1YVW A;  4XDK A;  5B1A B;  5B1A C;  1K92 A;  4DR5 B;  1MAB G;  1XBL A;  3OTO O;  2BOC C;  4J9Z B;  2ZT9 B;  1K7D A;  3AG2 B;  4JI8 B;  1H2S B;  2AHY A;  4DW1 A;  3K3W A;  4TQF A;  3APO A;  2Q7H A;  4X8A A;  3ZS8 C;  1L0N H;  3RYF A;  4OX9 B;  1HDJ A;  2GDS A;  4FMT A;  2P5O A;  3EFF K;  3HKD B;  3C90 A;  5F2V O;  2P4K A;  1VQL V;  5EZY B;  2CTR A;  2IJH A;  3UCS C;  3OFN G;  2ZM6 O;  1EFR G;  2VQF O;  4FLX A;  3TK1 A;  3ZN0 A;  1US6 A;  1GAX A;  1FPO A;  3TGU H;  1I94 B;  2G38 A;  1M57 C;  1KB9 F;  4P30 A;  4JGS A;  1NTM H;  2QKS A;  1RPO A;  5L3B A;  2GUZ A;  4YHH O;  4I9W A;  4JI6 O;  4O2B A;  5B3S B;  2PF4 E;  3AG4 B;  2OCC B;  1NS1 A;  2QKA A;  2XTA A;  5LA6 A;  4OPA A;  4X1K B;  5TIS Z;  3LDD A;  1AI5 A;  2ZIM A;  1MG1 A;  4Z2W A;  1QNM A;  4IYI A;  4MVR A;  1DK1 A;  1NVP D;  1QVG U;  3E22 A;  5EBW C;  3MHH C;  4LF6 O;  3HKE A;  4JAS A;  3ZMV A;  3OMN B;  1XMO O;  1TUB B;  3JD1 A;  4LH6 A;  3IFX A;  2ZXW C;  1ARO P;  1KC8 W;  2PY5 A;  4IT5 A;  1G8M A;  1N0J A;  1J5E B;  4MW8 A;  2QM7 A;  4IHJ A;  4UCO A;  1GM9 A;  2ODM A;  4QE9 A;  4DR2 B;  4K0K O;  1P7B A;  4GUN A;  2EZP A;  2C2A A;  4TT3 G;  1YZB A;  1YF2 A;  2UU9 B;  4AQY O;  3IC9 A;  5IY5 C;  3APQ A;  3K59 A;  1M56 B;  3H1H H;  2HVK C;  1KQS U;  1TGO A;  1M1K W;  4MVQ A;  4B7K A;  1AR5 A;  4JTD B;  1QLE C;  1WA8 A;  1FXK C;  1N4C A;  4DV1 O;  2LGW A;  3H1K H;  3SPI A;  3K9A A;  2PZS A;  2KKW A;  2OIE A;  3BY6 A;  4F6R A;  4HNA A;  4X9Q A;  1SA0 A;  3LSS A;  3T1C A;  1HR0 O;  2UXC O;  1N36 O;  4TV8 B;  4NTX A;  2VQE O;  2F95 B;  2Z0A A;  4LFC B;  3OEH G;  5EBM C;  5IE9 A;  1K5Q A;  4FM2 A;  3R65 A;  4FM0 A;  4O4H B;  2HLD G;  5BMV B;  3DXR A;  4TV9 A;  2WA3 A;  4R7C A;  5CBF A;  1B06 A;  2RNB A;  3VQW A;  3BA8 A;  3CME V;  4JI2 B;  2Y48 A;  3K57 A;  3T1H B;  1VEW A;  3OGC C;  4QPJ A;  2OCH A;  1R6N A;  4X1I A;  4RQF A;  2N04 A;  2VS0 A;  2Q69 A;  2NNU A;  3K58 A;  5LHG A;  5DED A;  1YXB A;  3LSU A;  4PI0 A;  5GTI Z;  5CA3 A;  3OAA G;  4X20 B;  3OR6 C;  1YHQ V;  1B04 A;  2UUC B;  3HKE B;  4I9Q A;  3AK1 A;  2JK5 C;  4NB5 A;  2F4V O;  2HKO A;  3K79 A;  1EM1 A;  1YJ9 V;  4Q20 A;  5GW7 A;  2IU0 A;  2M7W A;  1V55 B;  1GK9 A;  3FAV B;  5LMN O;  4O4L B;  3G67 A;  4LR3 A;  2V7Q G;  3J80 N;  2LQT A;  1PNL A;  2CGN A;  2XUM A;  4JYY A;  3ZCC A;  4HAM A;  2YC0 A;  4MTG A;  2UXN A;  4X89 A;  4B3R O;  4G2K A;  2QWR B;  1IUR A;  4TUY A;  3SGI A;  4B3T B;  1U96 A;  2QTS A;  3QTC A;  5J2U A;  4UB6 Z;  2WSS G;  4WFE A;  3ZRV A;  1BS3 A;  2D2C B;  1VIB A;  4LF9 B;  1Z2G A;  4X66 O;  2B9Z A;  2VWJ A;  5JQG A;  3VBB A;  1GKF A;  1XDC A;  2OTL V;  4QE7 A;  4L87 A;  3LDE A;  3DGE A;  1OCC B;  4X65 B;  3RYH A;  4EFE A;  3K06 A;  5FLX N;  3E86 A;  2FML A;  2A0L A;  4CS2 A;  1N32 O;  1S72 V;  1KMI Z;  4X66 B;  3SYA A;  1AVM A;  3U0Z A;  1IDS A;  2WPD G;  1OCC C;  1NH2 B;  4AIL C;  2WLI A;  3ZMS A;  2IW5 A;  2DW4 A;  3BAA A;  5CBG A;  3W7U A;  2YXL A;  4B3T O;  2WAM A;  4UVB A;  5LGN A;  4IIJ B;  2Y0I A;  1MSD A;  3G4S V;  2E75 B;  5JH7 A;  4NTY A;  4B3R B;  1JOY A;  4DRX A;  2RCV A;  4N23 A;  1VF6 C;  4O4J A;  1H2G A;  4TSF G;  3E89 A;  2YIB A;  1H2M A;  4DRX B;  1VQ5 V;  1NU1 H;  1BSM A;  3KKY A;  2W6J G;  3OMI B;  2FYU H;  1O9H A;  4FFK A;  4WFA V;  3OR7 C;  2DOS A;  4LFA B;  4CC5 A;  1YSC A;  2DWE C;  4LWS A;  3CX5 F;  5EC2 C;  1N0N A;  2RDC A;  2F4V B;  5J9P C;  1F7Y A;  1IXB A;  2UUC O;  2DQ3 A;  1AP6 A;  4YJ3 A;  1Q6I A;  1FXV A;  4MW3 A;  2A3Q A;  2DQ0 A;  2RMK B;  3WU2 Z;  5BZB A;  4CBC A;  1B3Q A;  2PI4 A;  4DK0 A;  1VQP V;  1IVS A;  5JVD B;  4ZOL B;  4I4T B;  4ZBM A;  3SYO A;  4K8X A;  5D5Q A;  5H6Q A;  5KHG A;  1S5L Z;  2JJ1 G;  2N74 A;  4DV6 B;  3SYC A;  1MZE A;  1PNM A;  3LDC A;  3RBZ A;  2Q67 A;  1GN2 A;  5KX5 A;  2IU3 A;  1GRJ A;  2WLK A;  3EHB B;  4MT8 A;  1GTO A;  4I50 A;  1Y4M A;  4LFC O;  1I08 A;  1N36 B;  2UXC B;  1Y6X A;  2H94 A;  3JD0 A;  3U11 A;  5EIB C;  3L73 H;  3T2M A;  3RVZ A;  1TUE B;  1VAR A;  3OW2 U;  3WFV A;  4DV1 B;  2EIN C;  4BAY A;  1UJW B;  4W4L A;  4PDL A;  4FM1 A;  1WP8 A;  5B3S C;  4GLX A;  2V4D A;  3AG3 C;  5BXZ A;  2HHH B;  3BHP A;  3ABL B;  2JGU A;  4AQY B;  2XAG A;  2UU9 O;  3B2E E;  4EFB A;  4DR2 O;  4K0K B;  3JAW A;  1CPY A;  4H13 B;  1VQN V;  1S5J A;  2P6J A;  1O9G A;  4JI7 O;  4HZ3 A;  4H33 A;  2FTK A;  2UXD O;  1GN3 A;  1OZ0 A;  5BMV A;  4DUY O;  2GUZ B;  1DTO A;  4LBE C;  4Z1M G;  4RUE A;  3O9O A;  5B1B C;  1SQF A;  4O4J B;  2BOB C;  4DR7 O;  2UXB O;  3FFQ A;  2GTA A;  4WFH A;  4BW9 A;  3SJC C;  1DGS A;  3EVK A;  1YTF D;  4TUY B;  4GT1 A;  5LHI A;  4JI6 B;  2B1G A;  5KX5 B;  3ETG A;  1UPG A;  4I0X B;  1TAE A;  4R50 A;  2DWD C;  3ZRS A;  5FPR A;  3OUF A;  1JFF B;  4DV7 O;  2ITC C;  3M8A A;  2XAS A;  4JI5 B;  3CPW U;  3ABM B;  1NQT A;  3CD6 V;  3CS5 A;  3Q4H B;  1QQC A;  3I56 V;  2VQF B;  4ICG A;  3DTU B;  1URF A;  2PUS A;  5JJE B;  1IBM B;  1WB8 A;  2A7W A;  3MHS C;  3EXA A;  2ILM A;  3FYI B;  5B5E Z;  1HWY A;  3CWB H;  3FX7 A;  1ZAU A;  3KG2 A;  1XIL A;  3IJ4 A;  3OT7 A;  4JI8 O;  1R3K C;  4K8Z A;  4F6R B;  5IDJ A;  3VQY A;  1EN6 A;  1I0H A;  4TV9 B;  1P49 A;  3HKB B;  5LGU A;  5IYB O;  4DR5 O;  4IL6 Z;  1R1B A;  5JCO C;  5LP6 A;  5BY1 A;  1THZ A;  5KMG A;  1HNZ O;  1YDX A;  2BTQ A;  4PA3 A;  3RT3 C;  3IC7 A;  5IYC O;  5KHI A;  3ZHV A;  3QF7 A;  5JQG B;  2YUA A;  4JI3 B;  1B6Q A;  1K4C C;  2B1I A;  1KP2 A;  1FJG B;  4B3M O;  3L9D A;  3TXQ A;  1IBK O;  5EZY A;  4OPH A;  2JJ2 G;  1G1X B;  4D7S A;  5C93 A;  1Y76 B;  3K0G A;  3DC5 A;  1OV9 A;  3JAK B;  5H2F Z;  1FFX A;  5L3C A;  4PD4 F;  2N05 A;  3CRQ A;  1I5X A;  3A0B Z;  3L74 H;  1HNX B;  3K08 A;  2R9R B;  2NLJ C;  5IYZ B;  1KD1 W;  1Q81 W;  1WP7 A;  3ZHS A;  5CMU A;  3UT5 B;  2F43 G;  4YY3 B;  4JYA O;  2P67 A;  2PYL A;  5EYP A;  2ARH A;  2YIB D;  3ZRX A;  3CB2 A;  4GYC B;  1FAF A;  4KXR A;  2KG7 B;  3ZHT A;  1ROP A;  2GBO A;  1RM1 B;  1YIJ V;  1Q86 W;  1CEZ A;  3F5W C;  3FB7 C;  3SR2 C;  2HEP A;  4LFB B;  1MOF A;  1YI2 V;  5JJJ B;  2YDE A;  1M56 C;  2QM4 A;  4ZHQ A;  1AB3 A;  4B7E A;  1H38 A;  1BE3 H;  2RQ6 A;  3JAR B;  4DR3 O;  5J2U B;  4JTC B;  5LYJ A;  5B1O A;  4YIO A;  2ITD C;  3HPL C;  3FD9 A;  3FB6 C;  1XMQ O;  3B8N A;  1PM9 A;  3QO8 A;  2UUB B;  5IJ0 A;  3BPZ A;  1FXH A;  4JI4 B;  4H44 B;  2UUA B;  1SQQ H;  3L72 H;  1H8H G;  4PA7 A;  4JF3 A;  2XHB A;  1R73 A;  3ZHR A;  4CS4 A;  4KHP B;  3SYQ A;  2PI5 A;  4DR4 O;  3NXS A;  4DV4 B;  3HR0 A;  1AI4 A;  3OUS A;  1PL0 A;  3GVM A;  3O65 A;  4LH7 A;  1S77 D;  1ZLZ A;  2LFS A;  4JAA A;  3RFR A;  3GB7 C;  4LF5 B;  3D3Q A;  3UO3 A;  2CTW A;  4O2A B;  1JA8 A;  2LJ2 A;  1EN5 A;  4NXM O;  3K0D A;  1LR1 A;  4UCT A;  3OE7 G;  1BCC H;  4PA6 A;  3JAS B;  4DV3 B;  2ZE6 A;  3BAB A;  4FLT A;  1E1R G;  2JVD A;  1XNQ O;  5KHH A;  2YI9 A;  1AJQ A;  4GKJ O;  2ZQM A;  2ZR3 A;  3S3W A;  1M4U A;  3L75 H;  1XQ8 A;  3DSQ A;  3ETQ A;  4CS3 A;  1WPB A;  5JWP A;  3BVO A;  5CN0 A;  5CBH A;  1SQX H;  1RP3 B;  3T1Y O;  4DV5 B;  4DR6 O;  4X62 B;  2Y69 C;  5GTH Z;  2GSM B;  2JIZ G;  3STL C;  4MTX A;  1WJZ A;  4X20 A;  1S0V A;  2LP7 A;  4J7Z A;  1NBM G;  1SRY A;  2XND G;  5K1X A;  4MTF A;  4DV2 O;  3ZMZ A;  2QM8 A;  3H1I H;  3UM7 A;  1G4Y B;  1VF7 A;  5IWA O;  1XNR O;  1BQZ A;  2Q0A A;  1N34 B;  4ZOL A;  2WLL B;  2HJF C;  1QLN A;  4MVZ A;  1HNW B;  3ASO B;  3J7A U;  2A79 B;  4X1Y B;  2ZE8 A;  3CC2 V;  4JZG A;  3P32 A;  2X6B A;  2E74 B;  1VF6 A;  5LBQ A;  1PV0 A;  1BL8 A;  3K04 A;  2P06 A;  2ZDI C;  2WLM A;  5LYJ B;  2ZIN A;  2HP8 A;  3JD2 A;  3JAM N;  4AI8 A;  3OM3 B;  2P4V A;  3ICX A;  3OD4 A;  1X4T A;  2EBO A;  2HVJ C;  2EZO A;  3OMA B;  5L3E A;  1W59 A;  3JAS A;  1H2L A;  5KA5 A;  2W6I G;  1FXK A;  4NXN O;  4XDJ A;  1CXZ B;  1KKC A;  4PJ0 Z;  5BR8 O;  1NTZ H;  2R9I A;  1JVM A;  1GO3 F;  2WWW A;  3MAQ A;  1Q82 W;  3CE2 A;  1DLB A;  2GHY A;  1EZJ A;  4MTO A;  1AR4 A;  1NJI W;  4PA4 A;  2X6A A;  4DUZ O;  3CC4 V;  4NR1 A;  1PP9 H;  2IBZ H;  4TV8 A;  3SPJ A;  1D5A A;  5KHJ A;  1VQ9 V;  1RPR A;  4CH4 A;  3THO A;  2A06 H;  3W7W A;  2QWQ B;  1M5I A;  2ZD9 A;  2IM9 A;  5EBL C;  1BZK A;  3GWO A;  2YSU B;  2LW1 A;  1RSO B;  4U3F H;  4LNU B;  2AGA A;  4J7J A;  5LP6 C;  1M9N A;  5HFM A;  3QVN A;  3OTF A;  4UFZ A;  4LNU A;  5LL6 Y;  3FYE B;  1K73 W;  1K34 A;  3AG4 C;  1N8R W;  4R6Z A;  1FFX B;  4U3J B;  1M93 A;  1SZX A;  4C7U A;  1JJ2 U;  4MVO A;  2Q68 A;  5LMU O;  4U3J A;  1K5S A;  2P22 C;  4E2L A;  1NR7 A;  5C8Y A;  4MSW C;  4NXN B;  2FB5 A;  4XBF A;  2CH7 A;  1L1F A;  4RQE A;  2Z3Y A;  2OTJ V;  5A9G A;  3A0R A;  3RYI B;  2IJK A;  3SJA C;  5DN6 G;  3CJH B;  4ZI7 B;  4FLY A;  1QHT A;  2CAZ C;  1WA8 B;  1Y67 A;  4A5U B;  4B3S O;  2WLI B;  4UUJ C;  5KAI Z;  2NN4 A;  3JAT B;  4D7T A;  1EN4 A;  1GH6 A;  1YTF B;  1WN7 A;  2CE4 A;  3JSL A;  2XT9 A;  1HNW O;  1SER A;  1VQO V;  2DMX A;  1Q7Y W;  2ATK C;  1A32 A;  2JDI G;  4BR6 A;  2OCC C;  4U7N A;  5IJ0 B;  4KP4 A;  3RGB A;  4DV2 B;  2NR5 A;  4MVS A;  2PTM A;  3JCU Z;  3SJB C;  2CTQ A;  3F7V C;  2AZ0 A;  4F4L A;  3AK2 A;  2BSK A;  2OYQ A;  1AI6 A;  3LNN A;  1PD3 A;  1VQ8 V;  1OCO C;  1FKA O;  5GON A;  3OEE G;  1JR9 A;  4LF4 B;  3AG1 B;  2JGD B;  4RUF A;  1SZT A;  5EYP B;  1CP9 A;  5CA1 B;  3CC7 V;  4X1I B;  4CC6 A;  2HG5 C;  1KUQ A;  5LHH A;  2A9H A;  1VMG A;  2KG7 A;  3ZMT A;  4X64 O;  4JAV A;  4FLV A;  5EK0 A;  3FB5 C;  2AHZ A;  3IAY A;  4FFB B;  3WG7 C;  2AW9 A;  4JYB A;  2LGQ A;  3ASN C;  4CH3 A;  4KHP O;  3B4S A;  3G6E V;  3RN4 A;  1X59 A;  1R6T A;  1H2K A;  2UUA O;  5H5N A;  4RWU A;  4J11 A;  3TCU A;  2UUB O;  3N2G B;  4FZ0 A;  5KUM A;  3T4D A;  1P4R A;  1XL6 A;  4WFG A;  3RYI A;  2HJD A;  3T4Z A;  2DE0 X;  2UXX A;  5LXT A;  3TXS A;  1VQ4 V;  3SYP A;  4UV8 A;  1OCZ B;  4O4I A;  3N2K A;  1YIT V;  5B1N A;  3AG3 B;  4CZZ A;  3HB3 B;  3RW0 A;  5LXT B;  1KU9 A;  5L3F A;  2Y69 B;  3C3T A;  1KBH A;  5FNV B;  3A2F A;  3RYH B;  2JEU A;  4FIP C;  1Y74 B;  1T5E A;  1VQ7 V;  1ZSP A;  2IJI A;  5FPO A;  4I55 A;  1W0J G;  2YEV B;  2EIL C;  1OCR B;  4DYL A;  3CCR V;  1AJN A;  1UFI A;  2FL4 A;  2CK3 G;  3U10 A;  5ITZ A;  4DR1 O;  2JGD A;  4YY3 O;  2Q73 A;  5KMG B;  2QWN B;  5H9C A;  1VQK V;  3CCM V;  1QR8 A;  1OHH G;  3E2E A;  1KKD A;  2Y4T A;  3RWR D;  1HNX O;  4PDV A;  4P9P A;  1R3L C;  3OGI B;  3CCL V;  4YJ2 A;  4FJC C;  3UO2 A;  4JTA B;  2JEX A;  4JI0 B;  4FLW A;  5KLV H;  4DV0 B;  4FFB A;  3P30 A;  3W7X A;  1SQG A;  1GMG A;  4RO2 A;  1NH2 D;  4JV5 B;  2B5U A;  2EIJ C;  4GZR B;  4RAI A;  4UXN A;  3CXC U;  1IBK B;  1V54 C;  2F23 A;  2V1D A;  5JH7 B;  1FJG O;  1FYJ A;  4QJF B;  1Q6H A;  4O2B B;  1NKD A;  3E83 A;  1KP3 A;  3ML0 A;  3CRR A;  3ZHQ A;  1I5Y A;  2PGG A;  2EUL A;  3C3S A;  1OJH A;  3H1L H;  4PA9 A;  2IH3 C;  3L71 H;  3LNM B;  3QO5 A;  3K5L A;  2E5L O;  4HBN A;  2Q7G A;  3ZJZ A;  4LF8 O;  3M7M X;  3SJQ C;  2R72 A;  1L8D A;  4EB6 A;  1G6U A;  1QU7 A;  4B08 A;  5KA6 A;  1SC5 B;  5IY5 B;  3VQV A;  3HKC A;  3RYF B;  4JYC A;  2VRZ A;  2E76 B;  1IBM O;  5B66 Z;  2K9P A;  3ZBH A;  4LF7 O;  3W7T A;  1Q6U A;  1U97 A;  1V55 C;  2WLJ A;  3CEI A;  5IT9 N;  2KQX A;  1Q8I A;  2XAH A;  4GX5 A;  3WB1 A;  4I4T A;  2MW2 B;  3BEH A;  4BW5 A;  3F7Y C;  4JI5 O;  2EIJ B;  3QO7 A;  3N2K B;  4LF7 B;  4DV7 B;  2RJZ A;  4BIU A;  3AK3 A;  2R70 A;  3F5T A;  1WNS A;  1TVK A;  4BIO A;  4NTW A;  1HP8 A;  1F51 A;  5H6R A;  3NR7 A;  4PDR A;  4FZ1 A;  1GM7 A;  2UXB B;  4FLU A;  4DR7 B;  3E8G A;  5IYZ A;  4F6E A;  1KEC A;  2QGN A;  4JAU A;  1ZL8 A;  4LF8 B;  5DEC A;  1LUV A;  4H37 A;  5L3G A;  1ZX3 A;  2E5L B;  4YJ2 B;  3PJS K;  3CCQ V;  1RM1 C;  3DC6 A;  4DUY B;  3ABU A;  1VQ6 V;  1S3J A;  1K33 A;  2UXD B;  2XAJ A;  1RSO A;  1ZTE A;  2ZKO A;  3ZRW A;  5CB4 B;  4JI7 B;  1E1Q G;  3QG5 A;  1JCH A;  2KSD A;  1Y76 A;  4DO2 A;  2JS3 A;  2OIG A;  1S5H C;  1YJN V;  2EIK B;  4EB6 B;  4J10 A;  2BTO A;  4WF9 V;  1ZUQ A;  4IHJ B;  3CRC A;  2HHH O;  4IGG A;  3SDL A;  1XRE A;  1QLE B;  4JV5 O;  4QPK A;  4DV0 O;  2WLL A;  4DK1 A;  4JI0 O;  3Q4H A;  1V9P A;  4UCV A;  2ETN A;  3ASN B;  1Q5O A;  3WG7 B;  3FKS G;  2XAQ A;  2Q6A A;  1AI7 A;  2PYJ A;  2D3O W;  1W2B U;  4UCS A;  1QVF U;  1IXM A;  5FL7 G;  2EIM C;  4XDL A;  2ZCE A;  2CH7 B;  3D3I A;  4UB8 Z;  4DR1 B;  2CGO A;  4G28 B;  4TQD A;  3X2Q B;  1E79 G;  1QBZ A;  5B1B B;  2H3O A;  2EIM B;  2X6C A;  1PPJ H;  2LO1 A;  3HKB A;  2HR3 A;  4DV6 O;  1XEQ A;  3ABL C;  3JSN A;  4X88 A;  2WLN A;  2YIA A;  2QTO A;  2BTQ B;  2IJJ A;  4EEQ A;  1K8A W; 
#chains in the Genus database with same CATH homology
 3JD0 A;  1K34 A;  3AG4 C;  1N8R W;  3T2M A;  3RVZ A;  4TWK A;  1TUE B;  4R6Z A;  3UKM A;  3OW2 U;  3WFV A;  5LGT A;  3CMA V;  2EIN C;  2OT5 A;  4BAY A;  1AR1 B;  1UJW B;  4J9Y B;  2EIK C;  2MK3 A;  3ABK B;  4PDL A;  2DYS C;  1JJ2 U;  1F4N A;  4MVO A;  4N21 A;  2Q68 A;  5B3S C;  1K5S A;  4E2L A;  1NR7 A;  2EIN B;  1M57 B;  3ETD A;  3AG3 C;  3ABL B;  4MSW C;  2XAG A;  3FB8 C;  4PDM A;  1QR9 A;  1XL4 A;  1DF4 A;  4XBF A;  1CPY A;  1LNQ A;  3IGA C;  1VQN V;  2P6J A;  1L1F A;  4RQE A;  2Z3Y A;  4WFB V;  2DYS B;  4HZ3 A;  2OTJ V;  4H33 A;  2FTK A;  3E8H A;  4MS2 A;  1R3J C;  3ABM C;  1OZ0 A;  3A0R A;  2IJK A;  4GCZ A;  5DN6 G;  1F23 A;  2WLH A;  3ZIA G;  1Y66 A;  3JD4 A;  1DTO A;  2QEX V;  3CCU V;  4LBE C;  4Z1M G;  5B1A B;  4RUE A;  5B1A C;  4XDK A;  1K92 A;  5B1B C;  2P90 A;  1MAB G;  2WLI B;  1BHA A;  4PEL A;  1K4D C;  4UUJ C;  2BOC C;  4J9Z B;  4P9O A;  1K7D A;  2BOB C;  3AG2 B;  5E1A C;  3QNE A;  2AHY A;  1YTF B;  3K3W A;  1MSW D;  4WFH A;  4X8A A;  1YTF D;  4FMT A;  1VQO V;  1SER A;  3EFF K;  4GT1 A;  5LHI A;  1BMF G;  2B1G A;  3ETG A;  2ATK C;  1Q7Y W;  2XOK G;  4MVM A;  3RVY A;  2JDI G;  4R50 A;  2DWD C;  1VQL V;  3ZRS A;  1F4M A;  3OUF A;  2IJH A;  2OCC C;  4U7N A;  1JPX A;  2ITC C;  4KP4 A;  3OFN G;  1EFR G;  2XAS A;  4MVS A;  1K9M W;  3TK1 A;  3ZN0 A;  3CPW U;  3ABM B;  4WCE V;  1NQT A;  4GX0 A;  3F7V C;  3ZMU A;  3CD6 V;  1M57 C;  1GM8 A;  4F4L A;  4P30 A;  3I56 V;  3ABT A;  4JGS A;  1FFT B;  3STL C;  2QKS A;  3DTU B;  1AI6 A;  1RPO A;  1PD3 A;  3ABK C;  5L3B A;  1VQ8 V;  3VOU A;  1OCO C;  3MHS C;  4I9W A;  2LFR A;  1COW G;  3OEE G;  3FYI B;  5B3S B;  1ENV A;  3AG4 B;  1HWY A;  2X7R B;  3AG1 B;  2OCC B;  1S76 D;  4RUF A;  1SZT A;  1SET A;  3KG2 A;  3CCV V;  1AJP A;  2ZDI A;  3B77 A;  1CP9 A;  3ASO C;  1R3K C;  3CC7 V;  5IDJ A;  2HG5 C;  3H01 A;  4WFF A;  5LHH A;  3LDD A;  3LSQ A;  1AI5 A;  2A9H A;  5LGU A;  5IYB O;  1MG1 A;  3ZMT A;  4MVR A;  1THZ A;  1NVP D;  4JAV A;  1QVG U;  5EK0 A;  3FB5 C;  5EBW C;  4PA3 A;  2EJR A;  2AHZ A;  3MHH C;  4JAS A;  3ZMV A;  3OMN B;  3IC7 A;  5IYC O;  3JD1 A;  3WG7 C;  2H8P C;  4JYB A;  3E8B A;  3ASN C;  3IFX A;  2ZXW C;  1B6Q A;  1ARO P;  3MD0 A;  1K4C C;  1KC8 W;  2B1I A;  1G8M A;  3G6E V;  1KP2 A;  4MW8 A;  2QM7 A;  4ZKI A;  1GM9 A;  4QE9 A;  1P7B A;  2EZP A;  2C2A A;  4TT3 G;  4ASU G;  2JJ2 G;  4I5S A;  4G27 B;  3D36 A;  5C93 A;  3TCU A;  3K0G A;  4GX1 A;  5IY5 C;  1JQ0 A;  5KUM A;  1M56 B;  3T4D A;  1P4R A;  2HVK C;  1KQS U;  1XL6 A;  1PNK A;  4WFG A;  3T4Z A;  1M1K W;  4JPR A;  2UXX A;  4MVQ A;  4JTD B;  1QLE C;  1VQ4 V;  3SYP A;  1FXK C;  4UV8 A;  5L3C A;  1OCZ B;  3SPI A;  5B1N A;  4DXW A;  1I5X A;  3AG3 B;  3HB3 B;  4CZZ A;  3K9A A;  4EKW A;  1YIT V;  3RW0 A;  1R3I C;  5L3F A;  3JYC A;  2Y69 B;  3K08 A;  2EIL B;  2R9R B;  3BY6 A;  2NLJ C;  5KUK A;  3LSS A;  3T1C A;  1KD1 W;  1Q81 W;  4FK5 C;  2JEU A;  3K03 A;  4FIP C;  5CMU A;  2F43 G;  1VQ7 V;  3OEH G;  2DYR B;  5EBM C;  2P67 A;  2IJI A;  1K5Q A;  3R65 A;  3ZRX A;  2HLD G;  1W0J G;  2YEV B;  1K97 A;  2EIL C;  1OCR B;  4R7C A;  3CCR V;  1AJN A;  5CBF A;  2CK3 G;  5L3D A;  3CME V;  2KB1 A;  2Y48 A;  1ROP A;  4U7O A;  1RM1 B;  1OCZ C;  1YIJ V;  1Q86 W;  3OGC C;  1CEZ A;  3F5W C;  3SPC A;  1K3E A;  3FB7 C;  5H9C A;  4QPJ A;  1VQK V;  1R6N A;  1WLE A;  4RQF A;  3G71 V;  3CCM V;  4LP8 A;  1QR8 A;  3TET A;  1OHH G;  3X2Q C;  3E2E A;  1KKD A;  1MOF A;  2Q69 A;  1YI2 V;  2NNU A;  1M56 C;  3LUT B;  5LHG A;  4PDV A;  4P9P A;  1R3L C;  3CCL V;  1H38 A;  5CA3 A;  2ZR2 A;  4FJC C;  3OAA G;  3I55 V;  4JTA B;  3OR6 C;  2JEX A;  4JTC B;  1YHQ V;  2P7T C;  5B1O A;  3W7X A;  3P30 A;  2ITD C;  3HPL C;  1GMG A;  2JK5 C;  3FB6 C;  4RO2 A;  2B5U A;  1NH2 D;  2EIJ C;  2HKO A;  1VQM V;  2ZXW B;  3B8N A;  3K79 A;  3STZ C;  1YJ9 V;  3QO8 A;  4RAI A;  4BIZ A;  1M90 W;  4Q20 A;  1FXH A;  4UXN A;  5GW7 A;  2X0L A;  3CXC U;  2IU0 A;  3ZN1 A;  1BHB A;  1V54 C;  2V1D A;  2M7W A;  1V55 B;  1H8H G;  4PA7 A;  4JF3 A;  4QJF B;  5IYD O;  1GK9 A;  1R73 A;  1PKX A;  2Z5U A;  3SYQ A;  1JX9 A;  1NKD A;  4MVU A;  2PI5 A;  3E83 A;  1KP3 A;  3NXS A;  3ML0 A;  1I5Y A;  1AI4 A;  2V7Q G;  4PA9 A;  2IH3 C;  1PNL A;  3OUS A;  1PL0 A;  3LNM B;  1S77 D;  2LFS A;  3GB7 C;  3QO5 A;  4UVC A;  3ZJZ A;  3K0D A;  3ZCC A;  4HAM A;  3OE7 G;  4MTG A;  3SJQ C;  4PA6 A;  2UXN A;  4X89 A;  4G2K A;  1FS0 G;  1E1R G;  1FXK B;  1DF5 A;  1AJQ A;  2ZQM A;  2ZR3 A;  1V54 B;  3CYO A;  4LCU C;  3ZRW B;  5KA6 A;  2WSS G;  5IY5 B;  4WFE A;  3ZRV A;  1SES A;  5CN0 A;  5CBH A;  4JYC A;  3CCS V;  3W7T A;  1V55 C;  3VBB A;  1GKF A;  2WLJ A;  2Y69 C;  3B8M A;  2OTL V;  2GSM B;  2JIZ G;  4KFM A;  4MTX A;  4L87 A;  3LDE A;  4LC1 A;  4QE7 A;  2LP7 A;  2XAH A;  1NBM G;  1OCC B;  1SRY A;  2XND G;  3DGE A;  4GX5 A;  3BEH A;  4BW5 A;  3F7Y C;  3K06 A;  2EIJ B;  3QO7 A;  4KUM A;  4UVA A;  3E86 A;  4MTF A;  4OXS A;  3ZMZ A;  2A0L A;  2QM8 A;  1S72 V;  4BIU A;  3UM7 A;  1G4Y B;  3SYA A;  3M99 B;  2WPD G;  1OCC C;  2WLL B;  1NH2 B;  4QIW F;  2HJF C;  2WLI A;  3ZMS A;  1QLN A;  4MVZ A;  1F51 A;  3ASO B;  5H6R A;  4YXW G;  2IW5 A;  2DW4 A;  5CBG A;  3W7U A;  4PDR A;  2WAM A;  4UVB A;  5LGN A;  4QNH B;  2A79 B;  1GM7 A;  3G4S V;  2DYR C;  1JOY A;  3E8G A;  3CC2 V;  3P32 A;  4N23 A;  1KEC A;  4JAU A;  1J95 A;  1NVP B;  2X6B A;  1H2G A;  4TSF G;  3E89 A;  4H37 A;  5L3G A;  5LBQ A;  3CP1 A;  1BL8 A;  1VQ5 V;  3AG1 C;  3PJS K;  3K04 A;  3CCQ V;  1RM1 C;  2ZDI C;  3SPG A;  2WLM A;  3ABU A;  2QA4 V;  1VQ6 V;  3ETE A;  1S3J A;  1K33 A;  3JD2 A;  2YEV A;  2W6J G;  3OMI B;  2XAJ A;  3OM3 B;  1OCO B;  4WFA V;  3ZRW A;  1E1Q G;  2EBO A;  2HVJ C;  2EZO A;  2HFE C;  3OMA B;  1JCH A;  5L3E A;  4GX2 A;  4DO2 A;  1ORQ C;  1R6K A;  3JD3 A;  1YJW V;  1S5H C;  5KA5 A;  3OR7 C;  1YJN V;  2QE7 G;  1S0V A;  2EIK B;  2W6I G;  1FXK A;  1NR1 A;  1YSC A;  1EBO A;  4UV9 A;  2K1E A;  3JCZ A;  4XDJ A;  4R8C A;  2DWE C;  4WF9 V;  5EC2 C;  1WPX A;  1QLE B;  2R9I A;  5J9P C;  1JVM A;  1GO3 F;  2WWW A;  5HFL A;  4QPK A;  1Q82 W;  2WLL A;  1DLB A;  2DQ3 A;  1FXV A;  2GHY A;  1EZJ A;  3ASN B;  4MTO A;  2XAF A;  4MW3 A;  3WG7 B;  3FKS G;  2DQ0 A;  2XAQ A;  3E8F A;  2Q6A A;  4PA4 A;  2X6A A;  1NJI W;  1W0K G;  3CC4 V;  1AI7 A;  5BZB A;  4CBC A;  2D3O W;  2W0F C;  1W2B U;  2PI4 A;  3SPJ A;  1VQP V;  1QVF U;  1IXM A;  4P2Z A;  5FL7 G;  4HYO A;  4ZBM A;  2EIM C;  4XDL A;  5EC1 C;  3SPH A;  1VQ9 V;  3SYO A;  5H6Q A;  3AEI A;  3AG2 C;  1RPR A;  2IH1 C;  2JJ1 G;  3D3I A;  4G28 B;  3SYC A;  3X2Q B;  3W7W A;  1E79 G;  1QBZ A;  1PNM A;  3LDC A;  4FPP A;  3RBZ A;  2Q67 A;  2ZD9 A;  5B1B B;  5EBL C;  2IU3 A;  3GWO A;  2EIM B;  2YSU B;  2X6C A;  3CCE V;  1ZWI C;  2WLK A;  3EHB B;  4MT8 A;  1GTO A;  1QCE A;  1Y4M A;  2HR3 A;  1M9N A;  5HFM A;  3W7S A;  3ABL C;  1OCR C;  4X88 A;  1H8E G;  2WLN A;  2H94 A;  2QTO A;  5DM6 V;  3CCJ V;  3E35 A;  2IJJ A;  3FYE B;  1K73 W;  1K8A W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...