3CCJV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccjV00
1YJWV 3CC4V 3CMEV 1VQKV 1K8AW 3CCMV 1VQLV 2QA4V 1KD1W 1VQ4V 1QVFU 1Q82W 1QVGU 1R73A 3CCRV 3CC7V 1YJ9V 1KC8W 3CD6V 1VQ7V 2OTJV 3CCLV 3CCSV 1YHQV 1VQ6V 3CCVV 2D3OW 1YJNV 1YITV 4WF9V 3G6EV 1VQOV 3CXCU 3G4SV 1Q86W 1M90W 3OW2U 1VQ8V 1VQ9V 3CCJV 1JJ2U 3CCEV 1W2BU 3CPWU 1YI2V 3G71V 1VQPV 4WCEV 1S72V 3I55V 3CCQV 1VQMV 1Q7YW 1K73W 1NJIW 1N8RW 1KQSU 2OTLV 4WFBV 3CMAV 1VQNV 4WFAV 1Q81W 1M1KW 3CC2V 1YIJV 5DM6V 3I56V 1VQ5V 1K9MW 2QEXV 3CCUV
chains in the Genus database with same CATH superfamily
4LNUA 3ZRXA 4XDKA 2OCCC 3ZMZA 4DK0A 4PHZA 4W4KA 3VOUA 4GX0A 2YIBD 1I7FA 2VQEB 2LO1A 3B8NA 2XAHA 2XOKG 5F2VO 1B04A 4AILC 4JI7O 1NZ6A 1SESA 5KHIA 4PJ0Z 1Y74A 1BHBA 1FFXB 2ZIOA 3BA9A 2X6BA 2FTKA 2P06A 4J80A 2HKOA 5IT9N 4X1IB 4DRXB 2PTMA 3G67A 1QVGU 4UB6Z 4JI7B 2LQTA 1RM1C 2K9PA 1N32B 1VF7A 3RGBA 3EFFK 1HW7A 2ZNIA 1IBLB 4KUMA 5E79Z 2QGNA 3NXSA 3BRCA 2GSMB 1W0JG 2ATKC 4O4HA 4J7KA 1WA8B 1NS1A 1NTZH 4UFZA 2A06H 3IGAC 4MVOA 3B09A 2EJRA 5C8YB 2WAMA 4H33A 5IE9A 3JD3A 5JWPA 2WLJA 3ZMTA 4B7EA 1LUWA 1QHTA 2X6CA 1SQXH 1KECA 3K79A 3TCUA 4X66O 3CC2V 3LNNA 4DV2O 2EILB 1V55B 3E86A 1M57C 1AI5A 2EIKC 3JYCA 4LC1A 2W6JG 3ZRVA 4JI6B 2EZPA 1GRJA 2Q9LA 3CX5F 5CBFA 1NH2B 5B5EZ 3OEHG 2LFRA 1GN2A 2GTAA 2V1DA 3UT5B 1WAZA 1KQSU 1ZTEA 3TXQA 3JARA 2W0XA 1N34O 4PI0A 3SPJA 1ZUQA 4IIJA 4K8XA 2WSSG 2XUMA 3AG3B 1MZEA 1Q3EA 3OUFA 4F6RB 3SJQC 5LMUB 4NTYA 3HKBB 4JI1B 5LOVB 2FL4A 4LCUC 2RJZA 1W2BU 4GKKO 3FB8C 2RMKB 4O4LB 2HR3A 2P7TC 3E8HA 2E76B 4ZI7B 3RYCA 4UXNA 1NR7A 3OUSA 4BIOA 1N4CA 4NTXA 4B7KA 3N27A 5DN6G 3CRRA 1GM8A 2Q6AA 4J9YB 2YXYA 1SC5B 2WLKA 1I5YA 1AI7A 1AR1B 4J11A 1R3KC 3A8TA 5IJ9B 2P90A 5EC2C 4TQDA 2DYRC 3BAAA 4FLXA 1THZA 3AG7A 1CXZB 2FKXA 4L87A 4F6RA 3OMAB 1AR5A 2EX3A 3HKEB 4F6EA 2ETNA 2NNUA 2ZDIC 4OPHA 3UCSC 4O4LA 3RN4A 1G1XB 1B06A 3ABUA 1KB9F 3JD1A 3D36A 5C93A 1YCIA 3ABKB 5LP6A 5J2TA 4CH3A 2RN9A 2LGQA 4IT5A 2P5OA 2QWPB 1SETA 4HAMA 4KFMA 2OCCB 2QWNB 1BMFG 4U3JB 1VQ7V 1F7YA 3ABTA 3OD4A 4WFEA 4LF8O 3E2EA 3W7SA 3CRCA 1IURA 1VQ9V 4OX9B 4WCEV 4XBFA 2GDSA 3J81N 4W4LA 1MNGA 3H9VA 3OGCC 4LF9O 1N33B 4GX1A 2P22C 4FPPA 1S0VA 1RM1B 4JAVA 1YHQV 2ZINA 5IWAO 3A0RA 2F4VO 4WBNA 3RYFB 5IJ0A 4AI8A 4I0XA 4LF9B 1R3LC 2QKCA 2YS8A 3WU2Z 4O4JB 3BPZA 1CEZA 5DEDA 5JCOA 1XL4A 2KKWA 2Q8VA 1K97A 5JVDB 4Z1MG 1EFRG 2DWDC 4ZHQA 1FXKC 1XL6A 5EBMC 1NH2D 4NXNB 3DSQA 4DV1B 4FMTA 5KAIZ 1T5EA 2DMXA 4H0LB 1GM7A 5IYCO 1TUEB 4GKJO 4KHPB 3P3PA 5E1AC 2DQ0A 1M57B 2PUSA 3RYFA 2EIKB 5AG2A 1R6TA 3OEEG 3CWBH 4LWSA 1G8MA 2XAGA 3EXAA 4I50B 5BMVB 1IX9A 2NR5A 4GLXA 4RWUA 3CEIA 4LF6O 1XMOO 3SYCA 4WFHA 1M9NA 1Z5WA 2UUAO 3ZN0A 1FJGB 3DTUB 4FZ0A 4MTXA 2YDEA 1L0NH 2EIMC 4WFGA 2Y48A 3G6EV 4JI4O 4FFBB 3IC7A 3ZHSA 2AZ0A 2ZM6O 2UXDO 1IBMO 3SJAC 1TA8A 1H8EG 3RFRA 3TETA 2WA4A 1QU7A 5BMVA 1AJQA 2KSDA 4O2BB 3L70H 4H44B 3OMIB 3H1KH 1JFFB 1LUVA 1MABG 1W59A 2W6IG 2DYRB 2UUCO 3HKCA 4I7ZB 4UCUA 1I08A 3C90A 3JSNA 1YJWV 2O57A 3K58A 3A0HZ 1XEQA 4LF4O 1QVFU 3SGIA 4RQFA 2Q4PA 4QIWF 3AG4C 1M5IA 2OT5A 4GX2A 2IU3A 2P6JA 4K0KB 1OZ0A 3E8BA 3OW2U 2AZ2A 4X1YB 3K04A 4X8AA 3QO5A 5GTHZ 5EC1C 5B66Z 2F93B 3CHXA 3JALA 1JFFA 1JVMA 3CJHA 3ZIAG 4QE9A 4ICGA 2Q69A 1AR4A 1NTMH 4B3SO 1BHAA 2IJIA 1YITV 2A79B 5IYDO 3JCUZ 3G4SV 3L75H 4LFBO 1GTOA 1S5JA 1D2DA 2P67A 3LSSA 4OGQB 4JAUA 5KMGA 2RQ6A 2WLLA 1VQKV 2DWEC 5L3DA 3T4ZA 4MTOA 1OCOC 5CBHA 3TGUH 2ADPA 5LGTA 3EHBB 4DR7O 1CP9A 3B8MA 1LR1A 3IC9A 1FXKB 3ZRWA 2HVJC 1Y67A 4BAYA 4DR6B 1RSOB 2Y0PA 4BW5A 4LF5O 2A9HA 2V7QG 1VF6A 3UKMA 4DV5O 1KP3A 3WB1A 4HZ3A 3OTOO 1PM9A 1KMIZ 2ITCC 4J10A 4B3TO 4YHHO 2UXCB 2DW4A 4TUYB 3ABLC 4PA9A 3CYOA 3J80N 4FM2A 2IH3C 1NBMG 4UCVA 3K06A 5EYPA 3OR7C 2HVKC 2QWOB 2Q7GA 4MVSA 2WLIA 1HWYA 3N2GB 4DV3O 1HR0O 1SS3A 1S3JA 1OCCC 1XMQO 1S77D 4MSWC 1WP8A 3ETEA 1SQQH 2AXTZ 2CH7A 3I56V 1GH6A 1MSDA 4DR1B 1TUBA 3F5TA 1JQ0A 2GBOA 1EN5A 1HR0B 2EIMB 2ZE7A 1BE3H 1LNQA 4TUYA 3H1LH 4XDJA 2IBZH 4O2AB 1SZTA 3NR7A 1WJZA 3IFXA 3FB6C 4JYAO 1S76D 2VS0A 1Q81W 2QTSA 2VRZA 2Z3YA 1BQZA 3RVZA 4WFFA 1SA0A 5CA1B 1WPBA 2M7WA 3E89A 1HNZO 1NU1H 4IYIA 1YVWA 1D5NA 3K08A 5LP6C 2YXHA 5KX5B 2Z0AA 3SJCC 4P30A 5KAFZ 2V4DA 3CXCU 2QWRB 4PDVA 4LNUB 3CE2A 1KUQA 4KXRA 1R6NA 4DW0A 1ZAUA 1PKXA 4DW1A 4X65B 3EVKA 1UFIA 4DR5B 1Q82W 3RW0A 1EZJA 3JSLA 4PV1B 2F43G 3AG4B 3ZHUA 4BR6A 3CCVV 4ZKIA 4CS3A 2ILMA 2E5LO 5BR8O 1XHXA 2XTAA 2YIDA 4HBNA 2QDOA 3W7TA 5ITZA 2ODMA 1PL0A 2NN4A 2OIEA 3P32A 1Q6UA 5J9PC 1I94B 1WNSA 4B3MB 4EFEA 4H37A 3FB5C 3CD6V 4O4HB 2XAFA 4X1KA 5JCOC 2EJ7A 3ABMC 3CCJV 1KKDA 3K9SA 3ML0A 4TOIA 4JI0O 1AP5A 1TVKA 5H6RA 1ZX3A 4FLVA 5FLXN 3SJBC 1XNRO 3RYHA 1EN4A 1VMGA 2AHYA 3W7XA 4JI2O 1XDCA 1OCOB 1VQ6V 5FL7G 2JGUA 2GTSA 1X59A 1AJPA 1GN6A 4CH6A 5IY5C 3BVOA 3L9DA 1K73W 2OTLV 1NT2B 4DV4O 4QJFB 3OE7G 2N74A 5B1AC 1YXBA 2X7RB 2CAZC 4R8CA 3HKDB 3RYIA 5B1OA 1R3JC 3JARB 4LR3A 4DV0O 4D7TA 1N0NA 2WPDG 4JYCA 1YZBA 4FLWA 4IIJB 3VBBA 2C2AA 4EEQA 2OCHA 1S72V 1SQVH 1DLBA 3CRQA 5BZBA 5LBQA 1SQGA 3ABLB 3ZHTA 3IJ4A 1V54C 2ZE6A 5D5PA 3RYCB 5LMNO 3ETQA 4X66B 3R65A 1IZ3A 4DV2B 2E3CA 1OCCB 2QTOA 1RP3B 4TV9A 2OIGA 4YIOA 2D2CB 3HKDA 3GVMA 5FNVB 2HJFC 2PGGA 1Q90D 1KU9A 4DR3O 2GHYA 3TXSA 3STZC 1XQ8A 2HFEC 5LXTA 1YJ9V 4O4IA 3KCYA 1R3IC 3U0ZA 1PP9H 1N34B 2HHHO 4FIPC 3KZIZ 1MZFA 4PA7A 2Q7HA 4DR2O 4DO2A 4WFAV 3L71H 4JGSA 3AK1A 1YDXA 4LFAO 3ICXA 1FPOA 4X9QA 1BGYH 1XOUA 3ETGA 1Y6XA 5LP6B 5J2TB 4GKKB 5FNVA 1BSMA 4I4TA 3WFVA 1RPRA 3MHSC 4MVQA 5HFLA 4U7OA 1FXHA 1GAXA 2DE0X 3ZHQA 1F4NA 1Q6HA 3ASNC 3RVYA 1G4YB 1NKDA 4LP8A 1TGOA 5LHHA 1HNWO 4UUJC 1AROP 4Q6GA 1UJWB 3KKYA 3QVNA 5LHIA 1D5AA 3AK3A 1MOFA 4NYKA 1WLEA 2PZSA 2ZXWC 4X62O 1Z2GA 4WBNB 1IVSA 5IJ0B 4I0XB 2R9RB 2FB5A 4UCSA 5KA6A 3AEIA 1VARA 2Q73A 3U11A 4K3AA 3ABMB 2X0LA 4ZHQB 2ZE8A 1KYOF 3KCXA 4LF7O 4J7JA 2UXXA 4MW3A 1G6UA 2F23A 1VF6C 4LF8B 2DYSC 1SZXA 4E4EA 4P2ZA 3O65A 1PV0A 1QCEA 2DJVA 3D3IA 3DGEA 2QM8A 3CS5A 5IY5B 3CPWU 5JJEB 2HEPA 4LWSB 1VEWA 3BCCH 5K1XA 2CTQA 1GN3A 2WLMA 4FLUA 1DF5A 4RAIA 5B1AB 4F4LA 1QR8A 4CH5A 5LHGA 5IWAB 2QEXV 3CCUV 3T1YO 2F4VB 1P7GA 4OXSA 3SYPA 4JV5O 2QKSA 4LH6A 3K0GA 5KHGA 1F51A 2ZD9A 2YICA 1PNLA 3M7MX 1NTKH 4JTCB 2ZT9B 3CP1A 4GCZA 3SDLA 4FVMA 1QLEC 1V54B 1YSCA 4GZRB 2LGWA 2Q0AA 2LJ2A 2OTJV 5KHKA 1H2LA 2CK3G 1JA8A 1P7BA 4GKJB 2IM9A 1BT8A 1OCRC 4RUEA 4KL1A 1IBKO 1SQPH 4K8ZA 3VQWA 2W0FC 4NXMO 2JJ1G 3JASA 3A0BZ 1K92A 3ZBHA 4JI5O 2M6YA 2QA4V 2JDIG 3HKCB 5LGNA 4LF6B 2HP8A 4DUYO 1XMOB 3TK1A 1FFTB 1Q43A 3ZRSA 2UUAB 2VQFO 1ENVA 5GW7A 4JI5B 1V9PA 1WB8A 4BW9A 3K3WA 3WB2A 3E8GA 4JI4B 4LFCO 4FZ1A 2EIJC 4MVRA 2XASA 2ZM6B 2UXDB 1IBMB 1NR1A 3H1IH 4QNHB 3JALB 1Q8IA 4HYOA 3GB7C 1R6KA 3CJHB 5LGUA 1JX9A 4PA3A 3ASNB 3LNMB 2XNDG 1YF2A 1XI1A 4CBCA 3K5MA 3R66A 4HNAA 2IJHA 3BY6A 1VQLV 3OT7A 1AP6A 1F4MA 3S3XA 4JI3O 2UUCB 4ASUG 4FJCC 5KMGB 3UM7A 1EBOA 2NLJC 2WLLB 2Y4UA 4X64O 5FPRA 5EK0A 3M99B 3JCZA 3UQ8A 4PDMA 4DK1A 4LF4B 2HJDA 4CS2A 2ZXWB 4PA4A 4IL6Z 4FM0A 4D7SA 5H9CA 1O9HA 1XREA 1AVMA 4R50A 4MT8A 1JOYA 2P4KA 1YEWA 3W7WA 4N23A 3T1HO 2YI8A 5CA3A 3E35A 4AQYO 4QE7A 4YJ3B 1QLNA 2IH1C 3B77A 4A5UB 5D5QA 3ZRWB 4YY3O 2RNBA 2X6AA 2MK3A 4UV9A 3OAAG 3H01A 4B3SB 1ORQC 4GUNA 3RWRD 2YIAA 1KD1W 2DYSB 3OFNG 4FFKA 1ROPA 4LFBB 1K7DA 2BOCC 1ZSPA 1JCHA 1CPYA 4DUZO 2JGDB 3H1HH 3LDDA 3U10A 1O9GA 4QGPA 5JH7A 4B3RO 1K5QA 5EZYB 5J2UB 3JD0A 5EYPB 1M4UA 2IJKA 2WLIB 4YJ3A 2N04A 2GV9A 4I9WA 4NB5A 4EKWA 4YIPA 3SYOA 3CCRV 4DR7B 2LFSA 5CB4A 4Z1VA 2CUGA 4TV8A 3K59A 2CH7B 1EN6A 1P84F 1TUBB 2ITDC 2XAQA 1YI2V 4DV7O 1E1RG 3ZCCA 1PNKA 1XHZA 2QKAA 1E79G 3ETDA 2L35A 4X20A 4LF5B 1QLEB 2Y0IA 1P4RA 2JGDA 3E22B 1MMMA 3E83A 4DV5B 2UUBO 5EZYA 3OTOB 1ZLZA 5LYJA 1OCRB 5J2UA 1YJNV 4E2LA 1SA0B 4B3TB 4YHHB 2HLDG 5JQGA 1Y76A 1BS3A 3G71V 1URFA 4GYCB 3TJTA 4JI8O 3CMAV 1WP7A 3H1JH 3JATA 2YIBA 2G38A 3CC7V 4DV3B 2CTRA 1XMQB 2E74B 4G28B 1NQTA 4NTWA 2KG7B 2QE7G 1M90W 4MTFA 1XBLA 4DR4O 3E22A 1Q6IA 1HP8A 3SPIA 2VWJA 3SYAA 2CE4A 3LSQA 1K9MW 1BCCH 2BSKB 2JRIA 3JD2A 4J42A 4JYBA 2ZKOA 2EIJB 2QWQB 5ITZB 4GT1A 3SYQA 1GN4A 4JYAB 4I9QA 2RCVA 3CCQV 5GONA 4CC5A 1HNZB 4G2KA 2LW7A 2PY5A 1L1FA 4X1KB 2JJ2G 4DV6O 1F23A 2KG7A 3HPLC 3AG1C 4RUFA 2PF4E 1YTFB 4YJ2A 3WG7C 1OJHA 3CCLV 3VQYA 4I55A 1N36O 1TVKB 1JJOA 1Q86W 3FB7C 2EULA 4YXWG 4DV6B 2BSKA 3F7YC 3RYHB 2FMLA 1FYJA 1OCZC 4PDRA 4RO2A 3L73H 4U3FH 2XAJA 2E5LB 5BR8B 4LBEC 4UV8A 3P3NA 4I5SA 1J5EO 2CTWA 4MW8A 1XNQO 2Q0OC 3FX7A 4WF9V 1MG1A 2YSUB 1Y66A 3QO8A 2AHZA 5CA0A 4JF3A 1JJ2U 2VQEO 3RYIB 2B5UA 1K3EA 1KBHA 1K4CC 1ZL8A 2ZE5A 1VQ4V 1U96A 1U97A 4PD4F 3JD4A 4XDLA 5KHJA 4Z2WA 2OWOA 4ZOLB 2XHBA 4JI0B 1N32O 1VQMV 1XNRB 1IBLO 5IYZA 3FD9A 1YIJV 4CH4A 4JI2B 2B9ZA 5KLVH 1BQ0A 3QTCA 3JAWB 3N2KA 1OHHG 4TV9B 3DXRB 3ZHVA 2CGNA 3OM3B 4QPJA 4KP4A 2QM7A 3J7AU 1ZWIC 4DV4B 3KG2A 2B1GA 1GK9A 5LXTB 3ZHRA 5EBWC 4O4IB 4J41A 1K34A 1Q5OA 3B2EE 4DV0B 4ZOLA 1K8AW 1TAEA 2BOBC 1PPJH 2L6LA 1FFXA 5A2QN 3Q4HB 1US6A 4X1IA 4JI6O 4DRXA 1AJNA 2UXBO 3JAWA 2CTPA 1NJIW 3DXRA 3K03A 1B3QA 4I4TB 4MS2A 5B3SC 2RDCA 2EZOA 3G80A 5LMNB 3L72H 2MW2B 3P30A 1L8DA 2UXBB 5CMUA 2Q67A 4IHJB 4NKGB 1WA8A 5LA6B 3FAVB 2VWKA 4MVUA 2JK5C 2ZIMA 1VQOV 4ZBMA 3K9AA 4DR3B 5LMUO 1VQNV 2QJ1A 2BTOA 4JI1O 5C8YA 1YTFD 5H6QA 3Q4HA 3AG2C 3S3WA 4JTDB 3C3TA 3QNEA 1M93A 4EFBA 1H2NA 5K1PA 1FS0G 2HHHB 4PI2A 1IXMA 2DN9A 1AB3A 1A32A 2F66C 1M56C 3ZX6A 4DR2B 2IJJA 3LDCA 4LFAB 1VQPV 4IHJA 5EBLC 5LA6A 3FAVA 1VF5B 3FYIB 1J95A 3AG1B 3CXHF 2AW9A 2JVDA 1DGSA 4CZZA 3UT5A 3WG7B 3BA8A 2PYLA 4PELA 4P9PA 1OCZB 1I5XA 2Q5ZA 5EIBC 2IW5A 4AHCA 1HNWB 1X4TA 2YEVB 2ZCEA 3APQA 3I5DA 2WWWA 4PA6A 1H2GA 3HKBA 1OV9A 5LOVA 2LW1A 4JASA 1SQBH 3ZN1A 4MVMA 2YXLA 2Y4TA 4ZI7A 3G6BA 1GMGA 3K5OA 4X62B 5CBGA 4UCRA 5IDJA 3E8FA 3GWKC 4DXWA 3JAMN 3QF7A 1DTOA 4FM1A 1VIBA 4OX9O 5IJ9A 3CC4V 4JTAB 1R73A 1KC8W 3SPGA 5FPOA 1FAFA 1S5LZ 1SKVA 4CC6A 5KUKA 2F1MA 1EM1A 2YEVA 4LF7B 2YI9A 1N33O 1PNMA 3HKEA 3ZEDA 4H13B 4MTGA 1SQFA 2JS5A 4FLZA 1AILA 4LH7A 2UXNA 3CMEV 2WA3A 1FD9A 2JEUA 3JASB 3DC6A 3FFQA 4NXNO 4BIUA 4OPAA 4DV1O 4JAAA 3T1YB 3OMNB 4U3JA 4PDLA 4JV5B 1K5SA 1COWG 2R70A 2FYUH 2ZR2A 2CDYA 2ZQMA 4C7UA 3CCMV 4TT3G 4KHPO 2A3QA 2ZR3A 3GWOA 3CCSV 5BXZA 1FXVA 5GTIZ 4J9ZB 1Y4MA 4RQEA 2PYJA 5B3SB 1SERA 5H2FZ 2ADQB 3BABA 1VP7A 1FJGO 1IBKB 4O4JA 4NXMB 1QQCA 3VQXA 1QNMA 4HNAB 1H2KA 2EINC 5JVDA 4FLTA 2QSAA 1BZKA 3L74H 3FYEB 1M1KW 4J7ZA 1FKAO 4DUYB 5L3BA 3AG2B 4UVBA 1B6QA 4ABMA 1R1BA 3X2QC 2VQFB 2JS3A 1WN7A 1MSWD 4FK5C 1M56B 1KKCA 3ZS8C 3B40A 4X88A 3THOA 3BHPA 4G27B 4LFCB 1GO3F 4I50A 4JYYA 3OGIB 2R9IA 4U7NA 1JR9A 1W0KG 2BCCH 5BY1A 1IXBA 1QR9A 5KA5A 3PN1A 2E75B 1NI8A 3ZMSA 3SPCA 3W7UA 2IU0A 3CCEV 2LP7A 4WFBV 1AI6A 2Y69C 4K0KO 4UCOA 2Z5UA 2AGAA 4JI3B 4D6TH 2ZNJA 3UO2A 4FFBA 4X89A 3OR6C 5JH7B 4X64B 3ASOC 3F7VC 2WLHA 1WB7A 1H8HG 2Q68A 5B1BC 4L8JA 5HFMA 1NVPB 3JAKB 4IGGA 4P9OA 4O2BA 2CGOA 1Q7YW 5CB4B 2PI5A 4TV8B 5L3EA 3CRAA 3T1HB 4AQYB 3FKSG 4YY3B 1AI4A 1KP2A 3MDSA 3PJSK 3IAYA 4X20B 3ZJZA 1DF4A 1UPGA 4BIZA 4TWKA 2R72A 1XUQA 2ZDIA 1MA1A 3MAQA 5LYJB 1H38A 4BWAA 2B1IA 3M8AA 2Q7EA 1VQ8V 2A0LA 3BEHA 5JQGB 1Y76B 2XT9A 4X1YA 3JAKA 1EZVH 4DUZB 5TISZ 3ZMVA 4B3RB 2BTQB 2YC0A 1K33A 3HB3B 4FLYA 5L3GA 3JATB 3MD0A 4DR6O 4UVCA 2K1EA 2H8PC 3I55V 4B08A 2A7WA 4EB6B 3D8CA 3T2MA 4TQFA 1IDSA 4QPKA 4JPRA 3RBZA 2UXCO 3C3SA 1PD3A 3BFRA 4DV7B 2WLNA 2JIZG 2D3OW 3WB0A 2OYQA 1PL4A 2KB1A 2N05A 3UO3A 1BL8A 3B4SA 3K5LA 2R9AA 2GUZB 5JJNB 2UUBB 2BTQA 3APOA 2EILC 1V55C 3HR0A 3STLC 1HDJA 1K4DC 5GONB 2DOSA 3SPHA 4DR1O 2H94A 4EB6A 4JI8B 3VQVA 2EBOA 3RT3C 2EINB 4NR1A 1Z5VA 1RFYA 1FXKA 4UCTA 4YJ2B 1WPXA 3DC5A 3F5WC 3CRMA 4TSFG 1RSOA 4I55B 1SRYA 1SF9A 5LL6Y 3QO7A 4JZGA 4N21A 3CB2A 3X2QB 2ARHA 1L0LH 4DYLA 4MVZA 1DK1A 5L3CA 3AG3C 4DR4B 3O9OA 4K35A 3LSUA 5JJJB 1H2SB 3ZMUA 5EIBD 2GUZA 1HNXO 2YUAA 1JMKC 1E1QG 4R7CA 2P4VA 5L3FA 1N8RW 3A2FA 1S5HC 4Q20A 1P49A 3D36C 2QM4A 5H5NA 3N2GA 1HNXB 5CA0B 2QR4A 3QG5A 1H2MA 4R6ZA 3T4DA 4UB8Z 1NVPD 4X65O 3OTFA 1ZL8B 4DR5O 3K0DA 3MHHC 1N0JA 3LDEA 3D3QA 2H3OA 2HG5C 1GM9A 1XILA 2Y69B 2PI4A 5CN0A 3SR2C 2F95B 2UU9O 2DQ3A 5DM6V 1VQ5V 4CS4A 3K5NA 2BE3A 3CSXA 4NVPA 2JEXA 4O2AA 4UVAA 4GX5A 5IYBO 3K57A 1N36B 1I0HA 1QBZA 1Y74B 3ASOB 5KUMA 3LUTB 5IYZB 5B1NA 5B1BB 1I94O 2UU9B 5DECA 4B3MO 5CA1A 1RPOA 4JZ2A 2KQXA 3N2KB 1JPXA 3AK2A 5A9GA 3ABKC 4ZIBA 1GKFA 5KX5A 5KHHA 3T1CA 1J5EB 1XNQB 4IYHA
chains in the Genus database with same CATH topology
3ZRXA 3FYIB 1J95A 3AG1B 1FXKB 4XDKA 3ZRWA 2QA4V 2JDIG 4CZZA 2OCCC 2HVJC 3WG7B 5LGNA 4BAYA 3ZMZA 3VOUA 4GX0A 4BW5A 3TK1A 2A9HA 3B8NA 2V7QG 2XAHA 2XOKG 1FFTB 3ZRSA 1ENVA 3UKMA 4PELA 1KP3A 5GW7A 4P9PA 1OCZB 1SESA 1I5XA 4HZ3A 2IW5A 1BHBA 2ITCC 2YEVB 3K3WA 2X6BA 2DW4A 2FTKA 2HKOA 2WWWA 3ABLC 4PA6A 1H2GA 3E8GA 4PA9A 3CYOA 4JASA 1QVGU 2EIJC 2IH3C 1NBMG 4MVRA 4MVMA 2XASA 3ZN1A 3K06A 1RM1C 1GMGA 1NR1A 3OR7C 3EFFK 4QNHB 2HVKC 4HYOA 3GB7C 4MVSA 2WLIA 1R6KA 5LGUA 1HWYA 4KUMA 3NXSA 2GSMB 1S3JA 1OCCC 1JX9A 1W0JG 4PA3A 3ASNB 5CBGA 1S77D 2ATKC 4MSWC 3LNMB 5IDJA 3E8FA 4DXWA 3ETEA 2XNDG 1DTOA 4CBCA 3I56V 3IGAC 2IJHA 3CC4V 1JQ0A 3BY6A 4JTAB 1VQLV 1F4MA 1R73A 4MVOA 2EIMB 1KC8W 3SPGA 5KUKA 2EJRA 4ASUG 4FJCC 1LNQA 2YEVA 3UM7A 2WAMA 1PNMA 1EBOA 2NLJC 2WLLB 4H33A 3JD3A 4XDJA 2WLJA 3ZMTA 1SZTA 4MTGA 3IFXA 5EK0A 3M99B 2X6CA 3FB6C 3JCZA 4PDMA 1S76D 2ZXWB 1KECA 3K79A 3TCUA 1Q81W 4PA4A 3CC2V 2Z3YA 3RVZA 5H9CA 2EILB 1V55B 3E86A 4WFFA 1M57C 2UXNA 1AI5A 4R50A 3CMEV 2JEUA 2EIKC 2M7WA 3E89A 3JYCA 4LC1A 4MT8A 1JOYA 2W6JG 3ZRVA 2EZPA 3W7WA 3K08A 4N23A 5CBFA 5CA3A 3E35A 1NH2B 3OEHG 4QE7A 2LFRA 4P30A 3CXCU 1QLNA 2IH1C 3B77A 4PDVA 3ZRWB 4BIUA 2V1DA 2X6AA 2MK3A 1R6NA 3OMNB 1KQSU 4UV9A 1PKXA 4PDLA 3OAAG 3H01A 1K5SA 1COWG 1ORQC 2ZR2A 3SPJA 2ZQMA 3CCMV 4TT3G 2DYSB 1KD1W 3OFNG 2ZR3A 1Q82W 3RW0A 2WSSG 1EZJA 1ROPA 3AG3B 3GWOA 3CCSV 2F43G 3AG4B 1K7DA 3CCVV 3OUFA 2BOCC 4ZKIA 1FXVA 3SJQC 1JCHA 1CPYA 3LDDA 4LCUC 4J9ZB 1W2BU 1Y4MA 4RQEA 3FB8C 1K5QA 2HR3A 2P7TC 3W7TA 3E8HA 3JD0A 4UXNA 5B3SB 2IJKA 1PL0A 1NR7A 1SERA 2WLIB 3OUSA 3P32A 4I9WA 5DN6G 5J9PC 4EKWA 1GM8A 2Q6AA 4J9YB 3SYOA 4H37A 3CCRV 3FB5C 3CD6V 2WLKA 2LFSA 1I5YA 2XAFA 1AI7A 1AR1B 3ABMC 1R3KC 2EINC 2P90A 5EC2C 2ITDC 3CCJV 2XAQA 2DYRC 1YI2V 1E1RG 1THZA 1KKDA 3ML0A 1PNKA 3ZCCA 1E79G 3FYEB 1M1KW 3ETDA 4L87A 5L3BA 3AG2B 4UVBA 1QLEB 3OMAB 5H6RA 1P4RA 1B6QA 3X2QC 2NNUA 2AHYA 3E83A 2ZDIC 3W7XA 1OCOB 1VQ6V 5FL7G 1MSWD 4FK5C 1M56B 1OCRB 1YJNV 4E2LA 3ABUA 3JD1A 4X88A 3D36A 5C93A 2HLDG 1AJPA 5IY5C 3G71V 3ABKB 1K73W 2OTLV 4G27B 1GO3F 3CMAV 4QJFB 3OE7G 5B1AC 2R9IA 4U7NA 2X7RB 1SETA 1W0KG 4HAMA 4KFMA 2OCCB 4R8CA 3CC7V 1BMFG 5B1OA 1R3JC 1VQ7V 1QR9A 3ABTA 5KA5A 2WPDG 4JYCA 4G28B 1NQTA 4WFEA 3E2EA 3W7SA 2QE7G 1M90W 4MTFA 3VBBA 1VQ9V 2C2AA 3ZMSA 3CCEV 3SPCA 3W7UA 2IU0A 4WCEV 1S72V 2LP7A 1DLBA 3SPIA 4XBFA 4WFBV 1AI6A 2Y69C 5BZBA 2Z5UA 5LBQA 3SYAA 3ABLB 3LSQA 1K9MW 3OGCC 3JD2A 1V54C 4JYBA 4GX1A 4X89A 4FPPA 1S0VA 3OR6C 2EIJB 3ASOC 3F7VC 2WLHA 1H8HG 4GT1A 4JAVA 1RM1B 1YHQV 3SYQA 2Q68A 3A0RA 5B1BC 5HFMA 1NVPB 3R65A 1OCCB 2QTOA 4P9OA 1Q7YW 1R3LC 3CCQV 1CEZA 2HJFC 4G2KA 2PI5A 1L1FA 1XL4A 2JJ2G 5L3EA 1K97A 2GHYA 3STZC 1F23A 4Z1MG 3FKSG 1EFRG 2DWDC 3HPLC 3AG1C 1FXKC 1XL6A 2HFEC 4RUFA 5EBMC 1NH2D 1YTFB 1YJ9V 3WG7C 1AI4A 1KP2A 3PJSK 3CCLV 4FMTA 1R3IC 3ZJZA 1GM7A 1Q86W 3FB7C 1DF4A 1TUEB 5IYCO 4BIZA 4FIPC 4YXWG 3F7YC 4TWKA 1OCZC 2ZDIA 4PA7A 4PDRA 4RO2A 4DO2A 4WFAV 1H38A 4JGSA 2B1IA 5E1AC 2DQ0A 1VQ8V 1M57B 2A0LA 2EIKB 3BEHA 2XAJA 3ETGA 3ZMVA 3OEEG 1G8MA 4LBEC 4UV8A 2XAGA 4I5SA 4MW8A 3WFVA 1RPRA 1K33A 3HB3B 3MHSC 4MVQA 5HFLA 4U7OA 4WF9V 1MG1A 2YSUB 1FXHA 5L3GA 1Y66A 3QO8A 2AHZA 1YITV 3MD0A 4JF3A 1JJ2U 4UVCA 2K1EA 2H8PC 3SYCA 3I55V 1F4NA 3ASNC 4WFHA 2B5UA 1K3EA 3RVYA 1G4YB 1NKDA 1M9NA 3ZN0A 3DTUB 1K4CC 4MTXA 3T2MA 4LP8A 1VQ4V 5LHHA 4QPKA 1AROP 4UUJC 1UJWB 4JPRA 3JD4A 3RBZA 5LHIA 2EIMC 4XDLA 4WFGA 1PD3A 2Y48A 2WLNA 2JIZG 2D3OW 3G6EV 3IC7A 2KB1A 1MOFA 1VQMV 1WLEA 1BL8A 1H8EG 2ZXWC 1YIJV 3TETA 2EILC 1V55C 1AJQA 3STLC 1OHHG 2R9RB 1K4DC 3OM3B 3SPHA 4QPJA 5KA6A 4KP4A 3AEIA 3OMIB 2H94A 2QM7A 1ZWIC 3ABMB 1MABG 2EBOA 2B1GA 3KG2A 2EINB 2X0LA 1GK9A 1FXKA 2W6IG 2DYRB 1WPXA 2UXXA 3F5WC 5EBWC 4TSFG 1SRYA 1K34A 3QO7A 4MW3A 1YJWV 4N21A 1K8AW 3X2QB 2BOBC 1QVFU 2DYSC 4RQFA 4MVZA 5L3CA 4P2ZA 3AG3C 4QIWF 1QCEA 3AG4C 3D3IA 2OT5A 3ZMUA 3DGEA 4GX2A 2IU3A 2P6JA 2QM8A 1OZ0A 3E8BA 3OW2U 1AJNA 5IY5B 3CPWU 1E1QG 1NJIW 3K04A 4R7CA 1N8RW 5L3FA 2WLMA 3K03A 1S5HC 4X8AA 1DF5A 3QO5A 4RAIA 5B1AB 5EC1C 4MS2A 4Q20A 1QR8A 4F4LA 5B3SC 5LHGA 2QEXV 1JVMA 3CCUV 3ZIAG 2EZOA 4OXSA 3SYPA 4R6ZA 3P30A 4QE9A 3T4DA 2Q69A 5CMUA 1NVPD 2QKSA 1BHAA 2Q67A 2IJIA 4MVUA 3K0GA 2JK5C 1F51A 2A79B 2ZD9A 3K0DA 3MHHC 4ZBMA 5IYDO 3G4SV 1VQOV 3LDEA 3K9AA 2HG5C 1PNLA 1GM9A 1GTOA 2Y69B 1VQNV 4JTCB 2PI4A 2P67A 3LSSA 5CN0A 2DQ3A 1YTFD 3CP1A 4JAUA 5H6QA 5DM6V 1VQ5V 4GCZA 2WLLA 3AG2C 1QLEC 1VQKV 1V54B 1YSCA 2JEXA 4UVAA 4GX5A 5IYBO 2DWEC 4JTDB 5L3DA 3QNEA 1QBZA 3ASOB 3T4ZA 1FS0G 4MTOA 2OTJV 1IXMA 5KUMA 3LUTB 1OCOC 5B1NA 2CK3G 5B1BB 1P7BA 1M56C 5CBHA 1OCRC 2IJJA 3LDCA 5LGTA 3EHBB 1RPOA 4RUEA 1CP9A 1VQPV 2W0FC 3B8MA 2JJ1G 1JPXA 3ABKC 1GKFA 5EBLC 3T1CA 1K92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW V;  3CC4 V;  3CME V;  1VQK V;  1K8A W;  3CCM V;  1VQL V;  2QA4 V;  1KD1 W;  1VQ4 V;  1QVF U;  1Q82 W;  1QVG U;  1R73 A;  3CCR V;  3CC7 V;  1YJ9 V;  1KC8 W;  3CD6 V;  1VQ7 V;  2OTJ V;  3CCL V;  3CCS V;  1YHQ V;  1VQ6 V;  3CCV V;  2D3O W;  1YJN V;  1YIT V;  4WF9 V;  3G6E V;  1VQO V;  3CXC U;  3G4S V;  1Q86 W;  1M90 W;  3OW2 U;  1VQ8 V;  1VQ9 V;  3CCJ V;  1JJ2 U;  3CCE V;  1W2B U;  3CPW U;  1YI2 V;  3G71 V;  1VQP V;  4WCE V;  1S72 V;  3I55 V;  3CCQ V;  1VQM V;  1Q7Y W;  1K73 W;  1NJI W;  1N8R W;  1KQS U;  2OTL V;  4WFB V;  3CMA V;  1VQN V;  4WFA V;  1Q81 W;  1M1K W;  3CC2 V;  1YIJ V;  5DM6 V;  3I56 V;  1VQ5 V;  1K9M W;  2QEX V;  3CCU V; 
#chains in the Genus database with same CATH topology
 4LNU A;  3ZRX A;  4XDK A;  2OCC C;  3ZMZ A;  4DK0 A;  4PHZ A;  4W4K A;  3VOU A;  4GX0 A;  2YIB D;  1I7F A;  2VQE B;  2LO1 A;  3B8N A;  2XAH A;  2XOK G;  5F2V O;  1B04 A;  4AIL C;  4JI7 O;  1NZ6 A;  1SES A;  5KHI A;  4PJ0 Z;  1Y74 A;  1BHB A;  1FFX B;  2ZIO A;  3BA9 A;  2X6B A;  2FTK A;  2P06 A;  4J80 A;  2HKO A;  5IT9 N;  4X1I B;  4DRX B;  2PTM A;  3G67 A;  1QVG U;  4UB6 Z;  4JI7 B;  2LQT A;  1RM1 C;  2K9P A;  1N32 B;  1VF7 A;  3RGB A;  3EFF K;  1HW7 A;  2ZNI A;  1IBL B;  4KUM A;  5E79 Z;  2QGN A;  3NXS A;  3BRC A;  2GSM B;  1W0J G;  2ATK C;  4O4H A;  4J7K A;  1WA8 B;  1NS1 A;  1NTZ H;  4UFZ A;  2A06 H;  3IGA C;  4MVO A;  3B09 A;  2EJR A;  5C8Y B;  2WAM A;  4H33 A;  5IE9 A;  3JD3 A;  5JWP A;  2WLJ A;  3ZMT A;  4B7E A;  1LUW A;  1QHT A;  2X6C A;  1SQX H;  1KEC A;  3K79 A;  3TCU A;  4X66 O;  3CC2 V;  3LNN A;  4DV2 O;  2EIL B;  1V55 B;  3E86 A;  1M57 C;  1AI5 A;  2EIK C;  3JYC A;  4LC1 A;  2W6J G;  3ZRV A;  4JI6 B;  2EZP A;  1GRJ A;  2Q9L A;  3CX5 F;  5CBF A;  1NH2 B;  5B5E Z;  3OEH G;  2LFR A;  1GN2 A;  2GTA A;  2V1D A;  3UT5 B;  1WAZ A;  1KQS U;  1ZTE A;  3TXQ A;  3JAR A;  2W0X A;  1N34 O;  4PI0 A;  3SPJ A;  1ZUQ A;  4IIJ A;  4K8X A;  2WSS G;  2XUM A;  3AG3 B;  1MZE A;  1Q3E A;  3OUF A;  4F6R B;  3SJQ C;  5LMU B;  4NTY A;  3HKB B;  4JI1 B;  5LOV B;  2FL4 A;  4LCU C;  2RJZ A;  1W2B U;  4GKK O;  3FB8 C;  2RMK B;  4O4L B;  2HR3 A;  2P7T C;  3E8H A;  2E76 B;  4ZI7 B;  3RYC A;  4UXN A;  1NR7 A;  3OUS A;  4BIO A;  1N4C A;  4NTX A;  4B7K A;  3N27 A;  5DN6 G;  3CRR A;  1GM8 A;  2Q6A A;  4J9Y B;  2YXY A;  1SC5 B;  2WLK A;  1I5Y A;  1AI7 A;  1AR1 B;  4J11 A;  1R3K C;  3A8T A;  5IJ9 B;  2P90 A;  5EC2 C;  4TQD A;  2DYR C;  3BAA A;  4FLX A;  1THZ A;  3AG7 A;  1CXZ B;  2FKX A;  4L87 A;  4F6R A;  3OMA B;  1AR5 A;  2EX3 A;  3HKE B;  4F6E A;  2ETN A;  2NNU A;  2ZDI C;  4OPH A;  3UCS C;  4O4L A;  3RN4 A;  1G1X B;  1B06 A;  3ABU A;  1KB9 F;  3JD1 A;  3D36 A;  5C93 A;  1YCI A;  3ABK B;  5LP6 A;  5J2T A;  4CH3 A;  2RN9 A;  2LGQ A;  4IT5 A;  2P5O A;  2QWP B;  1SET A;  4HAM A;  4KFM A;  2OCC B;  2QWN B;  1BMF G;  4U3J B;  1VQ7 V;  1F7Y A;  3ABT A;  3OD4 A;  4WFE A;  4LF8 O;  3E2E A;  3W7S A;  3CRC A;  1IUR A;  1VQ9 V;  4OX9 B;  4WCE V;  4XBF A;  2GDS A;  3J81 N;  4W4L A;  1MNG A;  3H9V A;  3OGC C;  4LF9 O;  1N33 B;  4GX1 A;  2P22 C;  4FPP A;  1S0V A;  1RM1 B;  4JAV A;  1YHQ V;  2ZIN A;  5IWA O;  3A0R A;  2F4V O;  4WBN A;  3RYF B;  5IJ0 A;  4AI8 A;  4I0X A;  4LF9 B;  1R3L C;  2QKC A;  2YS8 A;  3WU2 Z;  4O4J B;  3BPZ A;  1CEZ A;  5DED A;  5JCO A;  1XL4 A;  2KKW A;  2Q8V A;  1K97 A;  5JVD B;  4Z1M G;  1EFR G;  2DWD C;  4ZHQ A;  1FXK C;  1XL6 A;  5EBM C;  1NH2 D;  4NXN B;  3DSQ A;  4DV1 B;  4FMT A;  5KAI Z;  1T5E A;  2DMX A;  4H0L B;  1GM7 A;  5IYC O;  1TUE B;  4GKJ O;  4KHP B;  3P3P A;  5E1A C;  2DQ0 A;  1M57 B;  2PUS A;  3RYF A;  2EIK B;  5AG2 A;  1R6T A;  3OEE G;  3CWB H;  4LWS A;  1G8M A;  2XAG A;  3EXA A;  4I50 B;  5BMV B;  1IX9 A;  2NR5 A;  4GLX A;  4RWU A;  3CEI A;  4LF6 O;  1XMO O;  3SYC A;  4WFH A;  1M9N A;  1Z5W A;  2UUA O;  3ZN0 A;  1FJG B;  3DTU B;  4FZ0 A;  4MTX A;  2YDE A;  1L0N H;  2EIM C;  4WFG A;  2Y48 A;  3G6E V;  4JI4 O;  4FFB B;  3IC7 A;  3ZHS A;  2AZ0 A;  2ZM6 O;  2UXD O;  1IBM O;  3SJA C;  1TA8 A;  1H8E G;  3RFR A;  3TET A;  2WA4 A;  1QU7 A;  5BMV A;  1AJQ A;  2KSD A;  4O2B B;  3L70 H;  4H44 B;  3OMI B;  3H1K H;  1JFF B;  1LUV A;  1MAB G;  1W59 A;  2W6I G;  2DYR B;  2UUC O;  3HKC A;  4I7Z B;  4UCU A;  1I08 A;  3C90 A;  3JSN A;  1YJW V;  2O57 A;  3K58 A;  3A0H Z;  1XEQ A;  4LF4 O;  1QVF U;  3SGI A;  4RQF A;  2Q4P A;  4QIW F;  3AG4 C;  1M5I A;  2OT5 A;  4GX2 A;  2IU3 A;  2P6J A;  4K0K B;  1OZ0 A;  3E8B A;  3OW2 U;  2AZ2 A;  4X1Y B;  3K04 A;  4X8A A;  3QO5 A;  5GTH Z;  5EC1 C;  5B66 Z;  2F93 B;  3CHX A;  3JAL A;  1JFF A;  1JVM A;  3CJH A;  3ZIA G;  4QE9 A;  4ICG A;  2Q69 A;  1AR4 A;  1NTM H;  4B3S O;  1BHA A;  2IJI A;  1YIT V;  2A79 B;  5IYD O;  3JCU Z;  3G4S V;  3L75 H;  4LFB O;  1GTO A;  1S5J A;  1D2D A;  2P67 A;  3LSS A;  4OGQ B;  4JAU A;  5KMG A;  2RQ6 A;  2WLL A;  1VQK V;  2DWE C;  5L3D A;  3T4Z A;  4MTO A;  1OCO C;  5CBH A;  3TGU H;  2ADP A;  5LGT A;  3EHB B;  4DR7 O;  1CP9 A;  3B8M A;  1LR1 A;  3IC9 A;  1FXK B;  3ZRW A;  2HVJ C;  1Y67 A;  4BAY A;  4DR6 B;  1RSO B;  2Y0P A;  4BW5 A;  4LF5 O;  2A9H A;  2V7Q G;  1VF6 A;  3UKM A;  4DV5 O;  1KP3 A;  3WB1 A;  4HZ3 A;  3OTO O;  1PM9 A;  1KMI Z;  2ITC C;  4J10 A;  4B3T O;  4YHH O;  2UXC B;  2DW4 A;  4TUY B;  3ABL C;  4PA9 A;  3CYO A;  3J80 N;  4FM2 A;  2IH3 C;  1NBM G;  4UCV A;  3K06 A;  5EYP A;  3OR7 C;  2HVK C;  2QWO B;  2Q7G A;  4MVS A;  2WLI A;  1HWY A;  3N2G B;  4DV3 O;  1HR0 O;  1SS3 A;  1S3J A;  1OCC C;  1XMQ O;  1S77 D;  4MSW C;  1WP8 A;  3ETE A;  1SQQ H;  2AXT Z;  2CH7 A;  3I56 V;  1GH6 A;  1MSD A;  4DR1 B;  1TUB A;  3F5T A;  1JQ0 A;  2GBO A;  1EN5 A;  1HR0 B;  2EIM B;  2ZE7 A;  1BE3 H;  1LNQ A;  4TUY A;  3H1L H;  4XDJ A;  2IBZ H;  4O2A B;  1SZT A;  3NR7 A;  1WJZ A;  3IFX A;  3FB6 C;  4JYA O;  1S76 D;  2VS0 A;  1Q81 W;  2QTS A;  2VRZ A;  2Z3Y A;  1BQZ A;  3RVZ A;  4WFF A;  1SA0 A;  5CA1 B;  1WPB A;  2M7W A;  3E89 A;  1HNZ O;  1NU1 H;  4IYI A;  1YVW A;  1D5N A;  3K08 A;  5LP6 C;  2YXH A;  5KX5 B;  2Z0A A;  3SJC C;  4P30 A;  5KAF Z;  2V4D A;  3CXC U;  2QWR B;  4PDV A;  4LNU B;  3CE2 A;  1KUQ A;  4KXR A;  1R6N A;  4DW0 A;  1ZAU A;  1PKX A;  4DW1 A;  4X65 B;  3EVK A;  1UFI A;  4DR5 B;  1Q82 W;  3RW0 A;  1EZJ A;  3JSL A;  4PV1 B;  2F43 G;  3AG4 B;  3ZHU A;  4BR6 A;  3CCV V;  4ZKI A;  4CS3 A;  2ILM A;  2E5L O;  5BR8 O;  1XHX A;  2XTA A;  2YID A;  4HBN A;  2QDO A;  3W7T A;  5ITZ A;  2ODM A;  1PL0 A;  2NN4 A;  2OIE A;  3P32 A;  1Q6U A;  5J9P C;  1I94 B;  1WNS A;  4B3M B;  4EFE A;  4H37 A;  3FB5 C;  3CD6 V;  4O4H B;  2XAF A;  4X1K A;  5JCO C;  2EJ7 A;  3ABM C;  3CCJ V;  1KKD A;  3K9S A;  3ML0 A;  4TOI A;  4JI0 O;  1AP5 A;  1TVK A;  5H6R A;  1ZX3 A;  4FLV A;  5FLX N;  3SJB C;  1XNR O;  3RYH A;  1EN4 A;  1VMG A;  2AHY A;  3W7X A;  4JI2 O;  1XDC A;  1OCO B;  1VQ6 V;  5FL7 G;  2JGU A;  2GTS A;  1X59 A;  1AJP A;  1GN6 A;  4CH6 A;  5IY5 C;  3BVO A;  3L9D A;  1K73 W;  2OTL V;  1NT2 B;  4DV4 O;  4QJF B;  3OE7 G;  2N74 A;  5B1A C;  1YXB A;  2X7R B;  2CAZ C;  4R8C A;  3HKD B;  3RYI A;  5B1O A;  1R3J C;  3JAR B;  4LR3 A;  4DV0 O;  4D7T A;  1N0N A;  2WPD G;  4JYC A;  1YZB A;  4FLW A;  4IIJ B;  3VBB A;  2C2A A;  4EEQ A;  2OCH A;  1S72 V;  1SQV H;  1DLB A;  3CRQ A;  5BZB A;  5LBQ A;  1SQG A;  3ABL B;  3ZHT A;  3IJ4 A;  1V54 C;  2ZE6 A;  5D5P A;  3RYC B;  5LMN O;  3ETQ A;  4X66 B;  3R65 A;  1IZ3 A;  4DV2 B;  2E3C A;  1OCC B;  2QTO A;  1RP3 B;  4TV9 A;  2OIG A;  4YIO A;  2D2C B;  3HKD A;  3GVM A;  5FNV B;  2HJF C;  2PGG A;  1Q90 D;  1KU9 A;  4DR3 O;  2GHY A;  3TXS A;  3STZ C;  1XQ8 A;  2HFE C;  5LXT A;  1YJ9 V;  4O4I A;  3KCY A;  1R3I C;  3U0Z A;  1PP9 H;  1N34 B;  2HHH O;  4FIP C;  3KZI Z;  1MZF A;  4PA7 A;  2Q7H A;  4DR2 O;  4DO2 A;  4WFA V;  3L71 H;  4JGS A;  3AK1 A;  1YDX A;  4LFA O;  3ICX A;  1FPO A;  4X9Q A;  1BGY H;  1XOU A;  3ETG A;  1Y6X A;  5LP6 B;  5J2T B;  4GKK B;  5FNV A;  1BSM A;  4I4T A;  3WFV A;  1RPR A;  3MHS C;  4MVQ A;  5HFL A;  4U7O A;  1FXH A;  1GAX A;  2DE0 X;  3ZHQ A;  1F4N A;  1Q6H A;  3ASN C;  3RVY A;  1G4Y B;  1NKD A;  4LP8 A;  1TGO A;  5LHH A;  1HNW O;  4UUJ C;  1ARO P;  4Q6G A;  1UJW B;  3KKY A;  3QVN A;  5LHI A;  1D5A A;  3AK3 A;  1MOF A;  4NYK A;  1WLE A;  2PZS A;  2ZXW C;  4X62 O;  1Z2G A;  4WBN B;  1IVS A;  5IJ0 B;  4I0X B;  2R9R B;  2FB5 A;  4UCS A;  5KA6 A;  3AEI A;  1VAR A;  2Q73 A;  3U11 A;  4K3A A;  3ABM B;  2X0L A;  4ZHQ B;  2ZE8 A;  1KYO F;  3KCX A;  4LF7 O;  4J7J A;  2UXX A;  4MW3 A;  1G6U A;  2F23 A;  1VF6 C;  4LF8 B;  2DYS C;  1SZX A;  4E4E A;  4P2Z A;  3O65 A;  1PV0 A;  1QCE A;  2DJV A;  3D3I A;  3DGE A;  2QM8 A;  3CS5 A;  5IY5 B;  3CPW U;  5JJE B;  2HEP A;  4LWS B;  1VEW A;  3BCC H;  5K1X A;  2CTQ A;  1GN3 A;  2WLM A;  4FLU A;  1DF5 A;  4RAI A;  5B1A B;  4F4L A;  1QR8 A;  4CH5 A;  5LHG A;  5IWA B;  2QEX V;  3CCU V;  3T1Y O;  2F4V B;  1P7G A;  4OXS A;  3SYP A;  4JV5 O;  2QKS A;  4LH6 A;  3K0G A;  5KHG A;  1F51 A;  2ZD9 A;  2YIC A;  1PNL A;  3M7M X;  1NTK H;  4JTC B;  2ZT9 B;  3CP1 A;  4GCZ A;  3SDL A;  4FVM A;  1QLE C;  1V54 B;  1YSC A;  4GZR B;  2LGW A;  2Q0A A;  2LJ2 A;  2OTJ V;  5KHK A;  1H2L A;  2CK3 G;  1JA8 A;  1P7B A;  4GKJ B;  2IM9 A;  1BT8 A;  1OCR C;  4RUE A;  4KL1 A;  1IBK O;  1SQP H;  4K8Z A;  3VQW A;  2W0F C;  4NXM O;  2JJ1 G;  3JAS A;  3A0B Z;  1K92 A;  3ZBH A;  4JI5 O;  2M6Y A;  2QA4 V;  2JDI G;  3HKC B;  5LGN A;  4LF6 B;  2HP8 A;  4DUY O;  1XMO B;  3TK1 A;  1FFT B;  1Q43 A;  3ZRS A;  2UUA B;  2VQF O;  1ENV A;  5GW7 A;  4JI5 B;  1V9P A;  1WB8 A;  4BW9 A;  3K3W A;  3WB2 A;  3E8G A;  4JI4 B;  4LFC O;  4FZ1 A;  2EIJ C;  4MVR A;  2XAS A;  2ZM6 B;  2UXD B;  1IBM B;  1NR1 A;  3H1I H;  4QNH B;  3JAL B;  1Q8I A;  4HYO A;  3GB7 C;  1R6K A;  3CJH B;  5LGU A;  1JX9 A;  4PA3 A;  3ASN B;  3LNM B;  2XND G;  1YF2 A;  1XI1 A;  4CBC A;  3K5M A;  3R66 A;  4HNA A;  2IJH A;  3BY6 A;  1VQL V;  3OT7 A;  1AP6 A;  1F4M A;  3S3X A;  4JI3 O;  2UUC B;  4ASU G;  4FJC C;  5KMG B;  3UM7 A;  1EBO A;  2NLJ C;  2WLL B;  2Y4U A;  4X64 O;  5FPR A;  5EK0 A;  3M99 B;  3JCZ A;  3UQ8 A;  4PDM A;  4DK1 A;  4LF4 B;  2HJD A;  4CS2 A;  2ZXW B;  4PA4 A;  4IL6 Z;  4FM0 A;  4D7S A;  5H9C A;  1O9H A;  1XRE A;  1AVM A;  4R50 A;  4MT8 A;  1JOY A;  2P4K A;  1YEW A;  3W7W A;  4N23 A;  3T1H O;  2YI8 A;  5CA3 A;  3E35 A;  4AQY O;  4QE7 A;  4YJ3 B;  1QLN A;  2IH1 C;  3B77 A;  4A5U B;  5D5Q A;  3ZRW B;  4YY3 O;  2RNB A;  2X6A A;  2MK3 A;  4UV9 A;  3OAA G;  3H01 A;  4B3S B;  1ORQ C;  4GUN A;  3RWR D;  2YIA A;  1KD1 W;  2DYS B;  3OFN G;  4FFK A;  1ROP A;  4LFB B;  1K7D A;  2BOC C;  1ZSP A;  1JCH A;  1CPY A;  4DUZ O;  2JGD B;  3H1H H;  3LDD A;  3U10 A;  1O9G A;  4QGP A;  5JH7 A;  4B3R O;  1K5Q A;  5EZY B;  5J2U B;  3JD0 A;  5EYP B;  1M4U A;  2IJK A;  2WLI B;  4YJ3 A;  2N04 A;  2GV9 A;  4I9W A;  4NB5 A;  4EKW A;  4YIP A;  3SYO A;  3CCR V;  4DR7 B;  2LFS A;  5CB4 A;  4Z1V A;  2CUG A;  4TV8 A;  3K59 A;  2CH7 B;  1EN6 A;  1P84 F;  1TUB B;  2ITD C;  2XAQ A;  1YI2 V;  4DV7 O;  1E1R G;  3ZCC A;  1PNK A;  1XHZ A;  2QKA A;  1E79 G;  3ETD A;  2L35 A;  4X20 A;  4LF5 B;  1QLE B;  2Y0I A;  1P4R A;  2JGD A;  3E22 B;  1MMM A;  3E83 A;  4DV5 B;  2UUB O;  5EZY A;  3OTO B;  1ZLZ A;  5LYJ A;  1OCR B;  5J2U A;  1YJN V;  4E2L A;  1SA0 B;  4B3T B;  4YHH B;  2HLD G;  5JQG A;  1Y76 A;  1BS3 A;  3G71 V;  1URF A;  4GYC B;  3TJT A;  4JI8 O;  3CMA V;  1WP7 A;  3H1J H;  3JAT A;  2YIB A;  2G38 A;  3CC7 V;  4DV3 B;  2CTR A;  1XMQ B;  2E74 B;  4G28 B;  1NQT A;  4NTW A;  2KG7 B;  2QE7 G;  1M90 W;  4MTF A;  1XBL A;  4DR4 O;  3E22 A;  1Q6I A;  1HP8 A;  3SPI A;  2VWJ A;  3SYA A;  2CE4 A;  3LSQ A;  1K9M W;  1BCC H;  2BSK B;  2JRI A;  3JD2 A;  4J42 A;  4JYB A;  2ZKO A;  2EIJ B;  2QWQ B;  5ITZ B;  4GT1 A;  3SYQ A;  1GN4 A;  4JYA B;  4I9Q A;  2RCV A;  3CCQ V;  5GON A;  4CC5 A;  1HNZ B;  4G2K A;  2LW7 A;  2PY5 A;  1L1F A;  4X1K B;  2JJ2 G;  4DV6 O;  1F23 A;  2KG7 A;  3HPL C;  3AG1 C;  4RUF A;  2PF4 E;  1YTF B;  4YJ2 A;  3WG7 C;  1OJH A;  3CCL V;  3VQY A;  4I55 A;  1N36 O;  1TVK B;  1JJO A;  1Q86 W;  3FB7 C;  2EUL A;  4YXW G;  4DV6 B;  2BSK A;  3F7Y C;  3RYH B;  2FML A;  1FYJ A;  1OCZ C;  4PDR A;  4RO2 A;  3L73 H;  4U3F H;  2XAJ A;  2E5L B;  5BR8 B;  4LBE C;  4UV8 A;  3P3N A;  4I5S A;  1J5E O;  2CTW A;  4MW8 A;  1XNQ O;  2Q0O C;  3FX7 A;  4WF9 V;  1MG1 A;  2YSU B;  1Y66 A;  3QO8 A;  2AHZ A;  5CA0 A;  4JF3 A;  1JJ2 U;  2VQE O;  3RYI B;  2B5U A;  1K3E A;  1KBH A;  1K4C C;  1ZL8 A;  2ZE5 A;  1VQ4 V;  1U96 A;  1U97 A;  4PD4 F;  3JD4 A;  4XDL A;  5KHJ A;  4Z2W A;  2OWO A;  4ZOL B;  2XHB A;  4JI0 B;  1N32 O;  1VQM V;  1XNR B;  1IBL O;  5IYZ A;  3FD9 A;  1YIJ V;  4CH4 A;  4JI2 B;  2B9Z A;  5KLV H;  1BQ0 A;  3QTC A;  3JAW B;  3N2K A;  1OHH G;  4TV9 B;  3DXR B;  3ZHV A;  2CGN A;  3OM3 B;  4QPJ A;  4KP4 A;  2QM7 A;  3J7A U;  1ZWI C;  4DV4 B;  3KG2 A;  2B1G A;  1GK9 A;  5LXT B;  3ZHR A;  5EBW C;  4O4I B;  4J41 A;  1K34 A;  1Q5O A;  3B2E E;  4DV0 B;  4ZOL A;  1K8A W;  1TAE A;  2BOB C;  1PPJ H;  2L6L A;  1FFX A;  5A2Q N;  3Q4H B;  1US6 A;  4X1I A;  4JI6 O;  4DRX A;  1AJN A;  2UXB O;  3JAW A;  2CTP A;  1NJI W;  3DXR A;  3K03 A;  1B3Q A;  4I4T B;  4MS2 A;  5B3S C;  2RDC A;  2EZO A;  3G80 A;  5LMN B;  3L72 H;  2MW2 B;  3P30 A;  1L8D A;  2UXB B;  5CMU A;  2Q67 A;  4IHJ B;  4NKG B;  1WA8 A;  5LA6 B;  3FAV B;  2VWK A;  4MVU A;  2JK5 C;  2ZIM A;  1VQO V;  4ZBM A;  3K9A A;  4DR3 B;  5LMU O;  1VQN V;  2QJ1 A;  2BTO A;  4JI1 O;  5C8Y A;  1YTF D;  5H6Q A;  3Q4H A;  3AG2 C;  3S3W A;  4JTD B;  3C3T A;  3QNE A;  1M93 A;  4EFB A;  1H2N A;  5K1P A;  1FS0 G;  2HHH B;  4PI2 A;  1IXM A;  2DN9 A;  1AB3 A;  1A32 A;  2F66 C;  1M56 C;  3ZX6 A;  4DR2 B;  2IJJ A;  3LDC A;  4LFA B;  1VQP V;  4IHJ A;  5EBL C;  5LA6 A;  3FAV A;  1VF5 B;  3FYI B;  1J95 A;  3AG1 B;  3CXH F;  2AW9 A;  2JVD A;  1DGS A;  4CZZ A;  3UT5 A;  3WG7 B;  3BA8 A;  2PYL A;  4PEL A;  4P9P A;  1OCZ B;  1I5X A;  2Q5Z A;  5EIB C;  2IW5 A;  4AHC A;  1HNW B;  1X4T A;  2YEV B;  2ZCE A;  3APQ A;  3I5D A;  2WWW A;  4PA6 A;  1H2G A;  3HKB A;  1OV9 A;  5LOV A;  2LW1 A;  4JAS A;  1SQB H;  3ZN1 A;  4MVM A;  2YXL A;  2Y4T A;  4ZI7 A;  3G6B A;  1GMG A;  3K5O A;  4X62 B;  5CBG A;  4UCR A;  5IDJ A;  3E8F A;  3GWK C;  4DXW A;  3JAM N;  3QF7 A;  1DTO A;  4FM1 A;  1VIB A;  4OX9 O;  5IJ9 A;  3CC4 V;  4JTA B;  1R73 A;  1KC8 W;  3SPG A;  5FPO A;  1FAF A;  1S5L Z;  1SKV A;  4CC6 A;  5KUK A;  2F1M A;  1EM1 A;  2YEV A;  4LF7 B;  2YI9 A;  1N33 O;  1PNM A;  3HKE A;  3ZED A;  4H13 B;  4MTG A;  1SQF A;  2JS5 A;  4FLZ A;  1AIL A;  4LH7 A;  2UXN A;  3CME V;  2WA3 A;  1FD9 A;  2JEU A;  3JAS B;  3DC6 A;  3FFQ A;  4NXN O;  4BIU A;  4OPA A;  4DV1 O;  4JAA A;  3T1Y B;  3OMN B;  4U3J A;  4PDL A;  4JV5 B;  1K5S A;  1COW G;  2R70 A;  2FYU H;  2ZR2 A;  2CDY A;  2ZQM A;  4C7U A;  3CCM V;  4TT3 G;  4KHP O;  2A3Q A;  2ZR3 A;  3GWO A;  3CCS V;  5BXZ A;  1FXV A;  5GTI Z;  4J9Z B;  1Y4M A;  4RQE A;  2PYJ A;  5B3S B;  1SER A;  5H2F Z;  2ADQ B;  3BAB A;  1VP7 A;  1FJG O;  1IBK B;  4O4J A;  4NXM B;  1QQC A;  3VQX A;  1QNM A;  4HNA B;  1H2K A;  2EIN C;  5JVD A;  4FLT A;  2QSA A;  1BZK A;  3L74 H;  3FYE B;  1M1K W;  4J7Z A;  1FKA O;  4DUY B;  5L3B A;  3AG2 B;  4UVB A;  1B6Q A;  4ABM A;  1R1B A;  3X2Q C;  2VQF B;  2JS3 A;  1WN7 A;  1MSW D;  4FK5 C;  1M56 B;  1KKC A;  3ZS8 C;  3B40 A;  4X88 A;  3THO A;  3BHP A;  4G27 B;  4LFC B;  1GO3 F;  4I50 A;  4JYY A;  3OGI B;  2R9I A;  4U7N A;  1JR9 A;  1W0K G;  2BCC H;  5BY1 A;  1IXB A;  1QR9 A;  5KA5 A;  3PN1 A;  2E75 B;  1NI8 A;  3ZMS A;  3SPC A;  3W7U A;  2IU0 A;  3CCE V;  2LP7 A;  4WFB V;  1AI6 A;  2Y69 C;  4K0K O;  4UCO A;  2Z5U A;  2AGA A;  4JI3 B;  4D6T H;  2ZNJ A;  3UO2 A;  4FFB A;  4X89 A;  3OR6 C;  5JH7 B;  4X64 B;  3ASO C;  3F7V C;  2WLH A;  1WB7 A;  1H8H G;  2Q68 A;  5B1B C;  4L8J A;  5HFM A;  1NVP B;  3JAK B;  4IGG A;  4P9O A;  4O2B A;  2CGO A;  1Q7Y W;  5CB4 B;  2PI5 A;  4TV8 B;  5L3E A;  3CRA A;  3T1H B;  4AQY B;  3FKS G;  4YY3 B;  1AI4 A;  1KP2 A;  3MDS A;  3PJS K;  3IAY A;  4X20 B;  3ZJZ A;  1DF4 A;  1UPG A;  4BIZ A;  4TWK A;  2R72 A;  1XUQ A;  2ZDI A;  1MA1 A;  3MAQ A;  5LYJ B;  1H38 A;  4BWA A;  2B1I A;  3M8A A;  2Q7E A;  1VQ8 V;  2A0L A;  3BEH A;  5JQG B;  1Y76 B;  2XT9 A;  4X1Y A;  3JAK A;  1EZV H;  4DUZ B;  5TIS Z;  3ZMV A;  4B3R B;  2BTQ B;  2YC0 A;  1K33 A;  3HB3 B;  4FLY A;  5L3G A;  3JAT B;  3MD0 A;  4DR6 O;  4UVC A;  2K1E A;  2H8P C;  3I55 V;  4B08 A;  2A7W A;  4EB6 B;  3D8C A;  3T2M A;  4TQF A;  1IDS A;  4QPK A;  4JPR A;  3RBZ A;  2UXC O;  3C3S A;  1PD3 A;  3BFR A;  4DV7 B;  2WLN A;  2JIZ G;  2D3O W;  3WB0 A;  2OYQ A;  1PL4 A;  2KB1 A;  2N05 A;  3UO3 A;  1BL8 A;  3B4S A;  3K5L A;  2R9A A;  2GUZ B;  5JJN B;  2UUB B;  2BTQ A;  3APO A;  2EIL C;  1V55 C;  3HR0 A;  3STL C;  1HDJ A;  1K4D C;  5GON B;  2DOS A;  3SPH A;  4DR1 O;  2H94 A;  4EB6 A;  4JI8 B;  3VQV A;  2EBO A;  3RT3 C;  2EIN B;  4NR1 A;  1Z5V A;  1RFY A;  1FXK A;  4UCT A;  4YJ2 B;  1WPX A;  3DC5 A;  3F5W C;  3CRM A;  4TSF G;  1RSO A;  4I55 B;  1SRY A;  1SF9 A;  5LL6 Y;  3QO7 A;  4JZG A;  4N21 A;  3CB2 A;  3X2Q B;  2ARH A;  1L0L H;  4DYL A;  4MVZ A;  1DK1 A;  5L3C A;  3AG3 C;  4DR4 B;  3O9O A;  4K35 A;  3LSU A;  5JJJ B;  1H2S B;  3ZMU A;  5EIB D;  2GUZ A;  1HNX O;  2YUA A;  1JMK C;  1E1Q G;  4R7C A;  2P4V A;  5L3F A;  1N8R W;  3A2F A;  1S5H C;  4Q20 A;  1P49 A;  3D36 C;  2QM4 A;  5H5N A;  3N2G A;  1HNX B;  5CA0 B;  2QR4 A;  3QG5 A;  1H2M A;  4R6Z A;  3T4D A;  4UB8 Z;  1NVP D;  4X65 O;  3OTF A;  1ZL8 B;  4DR5 O;  3K0D A;  3MHH C;  1N0J A;  3LDE A;  3D3Q A;  2H3O A;  2HG5 C;  1GM9 A;  1XIL A;  2Y69 B;  2PI4 A;  5CN0 A;  3SR2 C;  2F95 B;  2UU9 O;  2DQ3 A;  5DM6 V;  1VQ5 V;  4CS4 A;  3K5N A;  2BE3 A;  3CSX A;  4NVP A;  2JEX A;  4O2A A;  4UVA A;  4GX5 A;  5IYB O;  3K57 A;  1N36 B;  1I0H A;  1QBZ A;  1Y74 B;  3ASO B;  5KUM A;  3LUT B;  5IYZ B;  5B1N A;  5B1B B;  1I94 O;  2UU9 B;  5DEC A;  4B3M O;  5CA1 A;  1RPO A;  4JZ2 A;  2KQX A;  3N2K B;  1JPX A;  3AK2 A;  5A9G A;  3ABK C;  4ZIB A;  1GKF A;  5KX5 A;  5KHH A;  3T1C A;  1J5E B;  1XNQ B;  4IYH A; 
#chains in the Genus database with same CATH homology
 3ZRX A;  3FYI B;  1J95 A;  3AG1 B;  1FXK B;  4XDK A;  3ZRW A;  2QA4 V;  2JDI G;  4CZZ A;  2OCC C;  2HVJ C;  3WG7 B;  5LGN A;  4BAY A;  3ZMZ A;  3VOU A;  4GX0 A;  4BW5 A;  3TK1 A;  2A9H A;  3B8N A;  2V7Q G;  2XAH A;  2XOK G;  1FFT B;  3ZRS A;  1ENV A;  3UKM A;  4PEL A;  1KP3 A;  5GW7 A;  4P9P A;  1OCZ B;  1SES A;  1I5X A;  4HZ3 A;  2IW5 A;  1BHB A;  2ITC C;  2YEV B;  3K3W A;  2X6B A;  2DW4 A;  2FTK A;  2HKO A;  2WWW A;  3ABL C;  4PA6 A;  1H2G A;  3E8G A;  4PA9 A;  3CYO A;  4JAS A;  1QVG U;  2EIJ C;  2IH3 C;  1NBM G;  4MVR A;  4MVM A;  2XAS A;  3ZN1 A;  3K06 A;  1RM1 C;  1GMG A;  1NR1 A;  3OR7 C;  3EFF K;  4QNH B;  2HVK C;  4HYO A;  3GB7 C;  4MVS A;  2WLI A;  1R6K A;  5LGU A;  1HWY A;  4KUM A;  3NXS A;  2GSM B;  1S3J A;  1OCC C;  1JX9 A;  1W0J G;  4PA3 A;  3ASN B;  5CBG A;  1S77 D;  2ATK C;  4MSW C;  3LNM B;  5IDJ A;  3E8F A;  4DXW A;  3ETE A;  2XND G;  1DTO A;  4CBC A;  3I56 V;  3IGA C;  2IJH A;  3CC4 V;  1JQ0 A;  3BY6 A;  4JTA B;  1VQL V;  1F4M A;  1R73 A;  4MVO A;  2EIM B;  1KC8 W;  3SPG A;  5KUK A;  2EJR A;  4ASU G;  4FJC C;  1LNQ A;  2YEV A;  3UM7 A;  2WAM A;  1PNM A;  1EBO A;  2NLJ C;  2WLL B;  4H33 A;  3JD3 A;  4XDJ A;  2WLJ A;  3ZMT A;  1SZT A;  4MTG A;  3IFX A;  5EK0 A;  3M99 B;  2X6C A;  3FB6 C;  3JCZ A;  4PDM A;  1S76 D;  2ZXW B;  1KEC A;  3K79 A;  3TCU A;  1Q81 W;  4PA4 A;  3CC2 V;  2Z3Y A;  3RVZ A;  5H9C A;  2EIL B;  1V55 B;  3E86 A;  4WFF A;  1M57 C;  2UXN A;  1AI5 A;  4R50 A;  3CME V;  2JEU A;  2EIK C;  2M7W A;  3E89 A;  3JYC A;  4LC1 A;  4MT8 A;  1JOY A;  2W6J G;  3ZRV A;  2EZP A;  3W7W A;  3K08 A;  4N23 A;  5CBF A;  5CA3 A;  3E35 A;  1NH2 B;  3OEH G;  4QE7 A;  2LFR A;  4P30 A;  3CXC U;  1QLN A;  2IH1 C;  3B77 A;  4PDV A;  3ZRW B;  4BIU A;  2V1D A;  2X6A A;  2MK3 A;  1R6N A;  3OMN B;  1KQS U;  4UV9 A;  1PKX A;  4PDL A;  3OAA G;  3H01 A;  1K5S A;  1COW G;  1ORQ C;  2ZR2 A;  3SPJ A;  2ZQM A;  3CCM V;  4TT3 G;  2DYS B;  1KD1 W;  3OFN G;  2ZR3 A;  1Q82 W;  3RW0 A;  2WSS G;  1EZJ A;  1ROP A;  3AG3 B;  3GWO A;  3CCS V;  2F43 G;  3AG4 B;  1K7D A;  3CCV V;  3OUF A;  2BOC C;  4ZKI A;  1FXV A;  3SJQ C;  1JCH A;  1CPY A;  3LDD A;  4LCU C;  4J9Z B;  1W2B U;  1Y4M A;  4RQE A;  3FB8 C;  1K5Q A;  2HR3 A;  2P7T C;  3W7T A;  3E8H A;  3JD0 A;  4UXN A;  5B3S B;  2IJK A;  1PL0 A;  1NR7 A;  1SER A;  2WLI B;  3OUS A;  3P32 A;  4I9W A;  5DN6 G;  5J9P C;  4EKW A;  1GM8 A;  2Q6A A;  4J9Y B;  3SYO A;  4H37 A;  3CCR V;  3FB5 C;  3CD6 V;  2WLK A;  2LFS A;  1I5Y A;  2XAF A;  1AI7 A;  1AR1 B;  3ABM C;  1R3K C;  2EIN C;  2P90 A;  5EC2 C;  2ITD C;  3CCJ V;  2XAQ A;  2DYR C;  1YI2 V;  1E1R G;  1THZ A;  1KKD A;  3ML0 A;  1PNK A;  3ZCC A;  1E79 G;  3FYE B;  1M1K W;  3ETD A;  4L87 A;  5L3B A;  3AG2 B;  4UVB A;  1QLE B;  3OMA B;  5H6R A;  1P4R A;  1B6Q A;  3X2Q C;  2NNU A;  2AHY A;  3E83 A;  2ZDI C;  3W7X A;  1OCO B;  1VQ6 V;  5FL7 G;  1MSW D;  4FK5 C;  1M56 B;  1OCR B;  1YJN V;  4E2L A;  3ABU A;  3JD1 A;  4X88 A;  3D36 A;  5C93 A;  2HLD G;  1AJP A;  5IY5 C;  3G71 V;  3ABK B;  1K73 W;  2OTL V;  4G27 B;  1GO3 F;  3CMA V;  4QJF B;  3OE7 G;  5B1A C;  2R9I A;  4U7N A;  2X7R B;  1SET A;  1W0K G;  4HAM A;  4KFM A;  2OCC B;  4R8C A;  3CC7 V;  1BMF G;  5B1O A;  1R3J C;  1VQ7 V;  1QR9 A;  3ABT A;  5KA5 A;  2WPD G;  4JYC A;  4G28 B;  1NQT A;  4WFE A;  3E2E A;  3W7S A;  2QE7 G;  1M90 W;  4MTF A;  3VBB A;  1VQ9 V;  2C2A A;  3ZMS A;  3CCE V;  3SPC A;  3W7U A;  2IU0 A;  4WCE V;  1S72 V;  2LP7 A;  1DLB A;  3SPI A;  4XBF A;  4WFB V;  1AI6 A;  2Y69 C;  5BZB A;  2Z5U A;  5LBQ A;  3SYA A;  3ABL B;  3LSQ A;  1K9M W;  3OGC C;  3JD2 A;  1V54 C;  4JYB A;  4GX1 A;  4X89 A;  4FPP A;  1S0V A;  3OR6 C;  2EIJ B;  3ASO C;  3F7V C;  2WLH A;  1H8H G;  4GT1 A;  4JAV A;  1RM1 B;  1YHQ V;  3SYQ A;  2Q68 A;  3A0R A;  5B1B C;  5HFM A;  1NVP B;  3R65 A;  1OCC B;  2QTO A;  4P9O A;  1Q7Y W;  1R3L C;  3CCQ V;  1CEZ A;  2HJF C;  4G2K A;  2PI5 A;  1L1F A;  1XL4 A;  2JJ2 G;  5L3E A;  1K97 A;  2GHY A;  3STZ C;  1F23 A;  4Z1M G;  3FKS G;  1EFR G;  2DWD C;  3HPL C;  3AG1 C;  1FXK C;  1XL6 A;  2HFE C;  4RUF A;  5EBM C;  1NH2 D;  1YTF B;  1YJ9 V;  3WG7 C;  1AI4 A;  1KP2 A;  3PJS K;  3CCL V;  4FMT A;  1R3I C;  3ZJZ A;  1GM7 A;  1Q86 W;  3FB7 C;  1DF4 A;  1TUE B;  5IYC O;  4BIZ A;  4FIP C;  4YXW G;  3F7Y C;  4TWK A;  1OCZ C;  2ZDI A;  4PA7 A;  4PDR A;  4RO2 A;  4DO2 A;  4WFA V;  1H38 A;  4JGS A;  2B1I A;  5E1A C;  2DQ0 A;  1VQ8 V;  1M57 B;  2A0L A;  2EIK B;  3BEH A;  2XAJ A;  3ETG A;  3ZMV A;  3OEE G;  1G8M A;  4LBE C;  4UV8 A;  2XAG A;  4I5S A;  4MW8 A;  3WFV A;  1RPR A;  1K33 A;  3HB3 B;  3MHS C;  4MVQ A;  5HFL A;  4U7O A;  4WF9 V;  1MG1 A;  2YSU B;  1FXH A;  5L3G A;  1Y66 A;  3QO8 A;  2AHZ A;  1YIT V;  3MD0 A;  4JF3 A;  1JJ2 U;  4UVC A;  2K1E A;  2H8P C;  3SYC A;  3I55 V;  1F4N A;  3ASN C;  4WFH A;  2B5U A;  1K3E A;  3RVY A;  1G4Y B;  1NKD A;  1M9N A;  3ZN0 A;  3DTU B;  1K4C C;  4MTX A;  3T2M A;  4LP8 A;  1VQ4 V;  5LHH A;  4QPK A;  1ARO P;  4UUJ C;  1UJW B;  4JPR A;  3JD4 A;  3RBZ A;  5LHI A;  2EIM C;  4XDL A;  4WFG A;  1PD3 A;  2Y48 A;  2WLN A;  2JIZ G;  2D3O W;  3G6E V;  3IC7 A;  2KB1 A;  1MOF A;  1VQM V;  1WLE A;  1BL8 A;  1H8E G;  2ZXW C;  1YIJ V;  3TET A;  2EIL C;  1V55 C;  1AJQ A;  3STL C;  1OHH G;  2R9R B;  1K4D C;  3OM3 B;  3SPH A;  4QPJ A;  5KA6 A;  4KP4 A;  3AEI A;  3OMI B;  2H94 A;  2QM7 A;  1ZWI C;  3ABM B;  1MAB G;  2EBO A;  2B1G A;  3KG2 A;  2EIN B;  2X0L A;  1GK9 A;  1FXK A;  2W6I G;  2DYR B;  1WPX A;  2UXX A;  3F5W C;  5EBW C;  4TSF G;  1SRY A;  1K34 A;  3QO7 A;  4MW3 A;  1YJW V;  4N21 A;  1K8A W;  3X2Q B;  2BOB C;  1QVF U;  2DYS C;  4RQF A;  4MVZ A;  5L3C A;  4P2Z A;  3AG3 C;  4QIW F;  1QCE A;  3AG4 C;  3D3I A;  2OT5 A;  3ZMU A;  3DGE A;  4GX2 A;  2IU3 A;  2P6J A;  2QM8 A;  1OZ0 A;  3E8B A;  3OW2 U;  1AJN A;  5IY5 B;  3CPW U;  1E1Q G;  1NJI W;  3K04 A;  4R7C A;  1N8R W;  5L3F A;  2WLM A;  3K03 A;  1S5H C;  4X8A A;  1DF5 A;  3QO5 A;  4RAI A;  5B1A B;  5EC1 C;  4MS2 A;  4Q20 A;  1QR8 A;  4F4L A;  5B3S C;  5LHG A;  2QEX V;  1JVM A;  3CCU V;  3ZIA G;  2EZO A;  4OXS A;  3SYP A;  4R6Z A;  3P30 A;  4QE9 A;  3T4D A;  2Q69 A;  5CMU A;  1NVP D;  2QKS A;  1BHA A;  2Q67 A;  2IJI A;  4MVU A;  3K0G A;  2JK5 C;  1F51 A;  2A79 B;  2ZD9 A;  3K0D A;  3MHH C;  4ZBM A;  5IYD O;  3G4S V;  1VQO V;  3LDE A;  3K9A A;  2HG5 C;  1PNL A;  1GM9 A;  1GTO A;  2Y69 B;  1VQN V;  4JTC B;  2PI4 A;  2P67 A;  3LSS A;  5CN0 A;  2DQ3 A;  1YTF D;  3CP1 A;  4JAU A;  5H6Q A;  5DM6 V;  1VQ5 V;  4GCZ A;  2WLL A;  3AG2 C;  1QLE C;  1VQK V;  1V54 B;  1YSC A;  2JEX A;  4UVA A;  4GX5 A;  5IYB O;  2DWE C;  4JTD B;  5L3D A;  3QNE A;  1QBZ A;  3ASO B;  3T4Z A;  1FS0 G;  4MTO A;  2OTJ V;  1IXM A;  5KUM A;  3LUT B;  1OCO C;  5B1N A;  2CK3 G;  5B1B B;  1P7B A;  1M56 C;  5CBH A;  1OCR C;  2IJJ A;  3LDC A;  5LGT A;  3EHB B;  1RPO A;  4RUE A;  1CP9 A;  1VQP V;  2W0F C;  3B8M A;  2JJ1 G;  1JPX A;  3ABK C;  1GKF A;  5EBL C;  3T1C A;  1K92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...