3CCJV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 20
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccjV00
1M1KW 1VQKV 4WF9V 3CPWU 1YJ9V 1VQPV 1NJIW 1Q82W 3G4SV 3CMAV 1KD1W 1VQ4V 4WCEV 1N8RW 4WFAV 3CCVV 1VQ6V 3CMEV 2QA4V 3OW2U 1Q81W 3CCMV 1S72V 1K8AW 5DM6V 1JJ2U 3I55V 3G6EV 2OTLV 3CC2V 1QVFU 1YITV 2OTJV 1VQ8V 1Q86W 3CC7V 1VQMV 1VQ7V 1VQ5V 3CC4V 1Q7YW 1K73W 1YI2V 3CCJV 1R73A 3CCSV 3G71V 1YIJV 1QVGU 1KC8W 1VQLV 1VQNV 1VQOV 2D3OW 3CCUV 1M90W 3CCEV 3CCRV 1YJNV 1KQSU 3CD6V 3CCQV 4WFBV 3I56V 1YJWV 3CCLV 1W2BU 2QEXV 3CXCU 1YHQV 1K9MW 1VQ9V
chains in the Genus database with same CATH superfamily
4DV4B 2KG7B 1H2LA 4KHPO 2WA4A 4UV8A 3SJBC 1LUVA 4EKWA 1PNKA 2YIDA 4NR1A 3EVKA 3FX7A 4LH7A 4ZKIA 4UCTA 3A8TA 1KP3A 3WB2A 2CGNA 4RQFA 5ITZB 1PM9A 4FFKA 1K4DC 1FJGO 2DYSB 1K92A 1MG1A 3KZIZ 3E8GA 1XL6A 3SYAA 1RP3B 1KKCA 2EIJC 1QBZA 1SZTA 2UXBO 1QR8A 4KUMA 1NZ6A 1R3JC 3APOA 1ZL8B 1K34A 3K79A 5DECA 4I0XA 3SR2C 2P4KA 4X8AA 4JI6B 1W0KG 2DE0X 1SC5B 5EBLC 3ZMSA 3WFVA 1O9GA 1FXVA 4DV6O 4FLWA 4YJ2B 2VQEO 4ZIBA 3CRQA 3HKEB 4DUZO 5CA0B 2HVKC 4MW8A 4PDVA 4X20B 2QEXV 3APQA 1VMGA 1WLEA 2EZOA 3SJQC 1L0NH 4TV8A 5KA5A 2IBZH 4F4LA 3NR7A 4B3RB 5KLVH 2EILB 4KXRA 1B6QA 2WLKA 1OV9A 5LOVA 1FPOA 2ZE6A 2YI9A 1BQZA 1XNQB 4PD4F 3E8HA 4QIWF 1FFXB 3OEHG 1P84F 3JD2A 2RQ6A 4P2ZA 3L71H 4F6RB 2UU9B 2QWRB 2P22C 4FM2A 3CC7V 4ABMA 1XOUA 4Z1MG 2JGDB 2IM9A 1IBMO 5LHGA 3H1LH 5BR8B 2YEVA 4JI7B 1DF4A 3H9VA 3AK1A 4CS2A 4UCUA 4LWSA 1NVPD 1WP7A 3OE7G 3ETGA 4TSFG 1H2MA 1K4CC 5KX5A 1N36B 2Q73A 3LSSA 5C8YB 1NVPB 2P06A 1ZUQA 1K7DA 3J80N 3EXAA 1N33O 4IHJB 3OTOB 4X1YA 4HBNA 5FL7G 3T1YO 1GN6A 2EJRA 1B06A 1MNGA 1QCEA 2OIGA 4KL1A 2Q7HA 3CRAA 1ZLZA 1ZTEA 5EIBD 3JAKB 3X2QB 1R73A 1VIBA 1E1QG 4LF5B 4DR1O 3DTUB 4X9QA 4I50A 4GUNA 3EHBB 3U0ZA 3ZHTA 1HNZB 4ZI7B 5HFMA 4JV5O 3LNMB 3RN4A 4QE7A 1TUBB 1HP8A 3CYOA 3KG2A 4H44B 4DV7B 1IXBA 1VF5B 4CS3A 1I94O 1GAXA 1XL4A 4LP8A 1SQXH 2LJ2A 1KECA 3SGIA 1Q43A 3OR6C 2DYSC 2XUMA 2UXCB 4O4IB 5IYZB 2GV9A 1M56B 3C3TA 3GVMA 3KKYA 5JVDA 2JDIG 4LFAO 1N34O 2Q67A 4LF9B 1N32B 4AHCA 4YIOA 1FAFA 3OUFA 1Y76B 1NT2B 1BT8A 1R3IC 4DK0A 2QDOA 4I4TA 1I0HA 2EJ7A 3BCCH 5L3EA 4X64B 3HKBB 5D5PA 3JALB 1YEWA 2CTWA 1M57C 4WFAV 1XMQO 1XHZA 1GN4A 2JS3A 4CH6A 1QVFU 5ITZA 3JASB 1WP8A 3C90A 2XOKG 4XDJA 4FLYA 1QLEB 3HKCB 3W7SA 1KMIZ 4GLXA 2JGUA 1VF7A 2EILC 2M6YA 1ZL8A 3TXSA 3CMAV 3K3WA 4DV5O 1MOFA 4B3SB 5J2UB 4WFFA 4YY3B 3JATB 1AJQA 3L75H 3Q4HB 3AK3A 2HVJC 5EBMC 4HZ3A 2VWJA 4DV3B 1M90W 3HPLC 1VP7A 4KHPB 5JWPA 3HKEA 2Q7GA 4FLXA 4O4JB 2P5OA 4X20A 4WCEV 2CH7A 4QPJA 1U96A 1IBKO 3SPCA 5IT9N 3ABLB 1G4YB 1Q5OA 1GH6A 2FMLA 1EN4A 3CRCA 5DEDA 4GX2A 2YUAA 5LGNA 1M4UA 2PY5A 5HFLA 5EYPB 1SQGA 1M93A 4X66O 2ITDC 3OMIB 4B3MB 1H2KA 3P3NA 1XMOB 1FJGB 1NR7A 3A0HZ 2P6JA 5BY1A 2LFSA 1JFFA 3HR0A 2YIBA 2BOBC 1UFIA 2UXBB 3AG3B 3O65A 1ZWIC 4IYIA 3QVNA 1M5IA 2EULA 1Q3EA 1Y67A 2QKSA 4PHZA 2A9HA 5JJJB 5IYBO 3X2QC 3JARB 3RT3C 4DV6B 2B1GA 3PN1A 5EIBC 1AILA 1WPXA 3D8CA 4LF6B 4DUZB 1NS1A 2HFEC 5C8YA 4JF3A 4BW9A 4B3RO 1P4RA 2XAHA 3NXSA 3QO5A 3JSNA 4LF7O 1WAZA 4IHJA 3E8FA 1XI1A 3F7VC 5LP6B 3BRCA 3D36C 3E83A 1U97A 2W0FC 2ZR2A 2GTSA 1VQ5V 4J7ZA 1M56C 3JSLA 3JAKA 3CCUV 1GMGA 2AGAA 2JEUA 4CBCA 3K5NA 3FAVB 3ZHSA 2AW9A 3ZMUA 5J2TB 3CPWU 1DK1A 2PYLA 2ZXWB 4ZI7A 2NNUA 3CCMV 4JYCA 3SJCC 5IDJA 3B77A 1K5SA 1IBMB 3K5LA 4LFBO 1TUBA 2QKAA 3E22B 4L87A 4TUYB 3CCSV 1IURA 1IZ3A 1KUQA 3RVYA 5CBGA 3RYCB 1R6KA 3D36A 2HJFC 1ZSPA 3CXCU 1F51A 2DQ3A 1Y74A 3K0DA 1QLEC 2XTAA 4O4IA 4QJFB 1IBLO 4JZGA 2B5UA 1B04A 4UCOA 1N33B 3OAAG 4H33A 4J42A 3T1YB 4UVCA 3ZJZA 2A7WA 4MTGA 1N4CA 1DTOA 2QTOA 1VQ4V 2CK3G 2L6LA 3HKBA 3VQVA 2UUBO 3JALA 3IC7A 2QWOB 2OIEA 4LF4O 3BA9A 2PI5A 3ABTA 4EB6B 4DK1A 3JASA 3ZS8C 4X1KB 3KCXA 3FB8C 2WWWA 3ABLC 2WLMA 3HKCA 2HHHO 4OPAA 3WG7B 4N21A 1Z2GA 3SJAC 4JV5B 4AI8A 1N0NA 1MMMA 1P49A 4AILC 1JVMA 4PDRA 4B3TO 4W4KA 3HKDB 1NQTA 1HWYA 2A0LA 3LDCA 4TQDA 3TETA 5J2UA 4UCSA 1I94B 4UB8Z 1LR1A 1Q7YW 1MABG 1TA8A 4DR7B 3RWRD 3Q4HA 4UCRA 4JI3O 2QWNB 4DXWA 4JI0B 3U11A 4GX1A 4PDMA 2YDEA 4LFAB 1Q82W 4MVSA 1N8RW 3AG3C 1SQVH 5IE9A 4O4JA 4DR5O 4X64O 3OMNB 3SPGA 1QNMA 2GDSA 3LNNA 3FFQA 3CB2A 4IIJB 4FMTA 2QWPB 2AZ0A 5BXZA 4MVUA 5EYPA 5JJNB 1K97A 2PTMA 2CDYA 4OX9O 2N04A 2ZE5A 3ZRXA 1XHXA 2ZCEA 3RYHB 1XDCA 2ZR3A 4DV1O 3K06A 1KU9A 1HNXO 3JAWB 2GUZA 4I9WA 1URFA 5LP6C 4JI4O 3T4DA 5E1AC 3ZIAG 4NTYA 3STLC 3CCRV 5KUMA 4DV5B 3D3QA 1VF6C 5CA1B 2UXNA 1VQ9V 1SQPH 3ZX6A 1S0VA 2E74B 1S5LZ 4E4EA 3JARA 1AR1B 1WNSA 4O4LB 2DW4A 4X88A 2YXHA 4UCVA 3O9OA 3T4ZA 2YSUB 3UO2A 2ZXWC 1W59A 1MZFA 4LF8O 1IBKB 1SKVA 1CXZB 4RUEA 2EIKB 1JMKC 4OXSA 4XDKA 4B3MO 4K8XA 3AG1C 5LP6A 1EN5A 4WFGA 1XMOO 1JOYA 5CBFA 2N05A 4X66B 1VF6A 1UJWB 4UVBA 3CS5A 1DLBA 3A0RA 1L1FA 4QNHB 2Y4TA 3JD0A 5FNVB 5LHIA 3WB0A 2Z0AA 4FVMA 3OTFA 4X62O 3FAVA 5L3FA 5J2TA 3AG2B 2KSDA 2OTLV 3M99B 3DXRB 1L8DA 2HLDG 5IY5C 2KKWA 1TVKB 2GSMB 1PPJH 3ZRSA 4R7CA 4LF6O 4TUYA 1GRJA 3K08A 4NKGB 1DF5A 5KHKA 4J41A 5IWAO 4RWUA 1R3LC 1CP9A 4LNUA 2EX3A 2QE7G 1BL8A 3MDSA 1IDSA 4ZOLA 3JD1A 1YVWA 3W7WA 2Q8VA 3WG7C 5KHJA 1QU7A 5H2FZ 4LF7B 5IJ9A 2DN9A 3RYIB 2DYRB 4RUFA 1S3JA 2QWQB 2PGGA 4J11A 2ADPA 5GW7A 1JA8A 2VRZA 4CH3A 5K1XA 5CN0A 2ZNIA 4GKJO 4U3JB 4QPKA 1Q8IA 1EBOA 4EB6A 2EIMB 2CTPA 2R9RB 4K0KO 1GKFA 3CE2A 2WLNA 1HR0O 4X1KA 3P3PA 1OCOB 1M1KW 2WLIB 2XAFA 3RYFB 1E79G 5LGUA 2CTRA 4LFBB 4HAMA 3J81N 5IJ0A 4FLVA 5LGTA 5JQGB 4J7JA 4DR3O 4HNAA 3OM3B 5LMUB 3CCEV 2WSSG 4O4HB 1BSMA 5LMNB 2V4DA 4FM1A 1H2SB 2KB1A 2XAGA 2FKXA 3L74H 5BZBA 1IBLB 1AI5A 1AVMA 3BY6A 5EC2C 1HDJA 3OT7A 4G27B 3U10A 1TGOA 2JRIA 3VQYA 2OYQA 1O9HA 2AHZA 1Q86W 4JI1O 3MHHC 4J9ZB 1K73W 2A3QA 5EZYA 1H8HG 3G71V 2YICA 4ZHQB 3FB7C 3I56V 2UUBB 3CCLV 1SRYA 3RFRA 3LUTB 1G8MA 1KQSU 4LF4B 2JIZG 5BMVB 3H01A 1PD3A 4GX0A 3E86A 4MVMA 2WLLB 3A2FA 3FYIB 4YJ3B 2X7RB 1V54B 3RYHA 2HHHB 2F4VO 2EIKC 5KAIZ 3WB1A 1YI2V 2IJIA 1OHHG 3AK2A 3W7TA 2PF4E 3JAWA 1EM1A 4B3TB 4PV1B 4DR7O 1CPYA 4UVAA 4UUJC 2PYJA 5CA1A 1JQ0A 4JI0O 3CXHF 2KG7A 1GN3A 4N23A 3H1HH 4JI3B 1BCCH 2DOSA 4O4LA 1XBLA 2F23A 3F5WC 1AI4A 2GBOA 4BIZA 4RQEA 2AZ2A 3AG2C 1I5YA 4NTXA 3GB7C 2AXTZ 4MSWC 4DR5B 3CP1A 1THZA 3FB5C 3CWBH 2IW5A 5B5EZ 1CEZA 3KCYA 3N2KB 1AJPA 4DR2O 4J80A 5IYCO 3ZHRA 3CC4V 1MSWD 3ABKB 1SZXA 4TQFA 2IJKA 3TJTA 4OX9B 5LA6B 3HB3B 2CGOA 4FJCC 2RDCA 3F7YC 1PP9H 1SA0B 4CH4A 5FNVA 3K9AA 4DV1B 1OCZB 4FZ1A 2QA4V 5L3CA 2F95B 1S76D 1JJ2U 3H1IH 1HNXB 2DYRC 1VQ8V 1GM7A 4JI4B 2DWEC 2R9IA 2PZSA 1NI8A 1VQOV 4JTAB 1XEQA 4D7SA 4YJ2A 1TVKA 3VBBA 1KBHA 3PJSK 2QKCA 5CA0A 2WLHA 2C2AA 3CJHB 3S3XA 2EIMC 3QTCA 5EC1C 2DMXA 3CC2V 1SETA 1R6NA 2RMKB 4JTDB 1OCOC 4LF8B 3SYCA 3K5OA 1NTZH 2ZM6B 3ZMZA 4GX5A 3SPIA 2W6IG 3RYIA 4K8ZA 5KAFZ 1VQPV 1YSCA 1KYOF 1FFXA 4BIUA 2A06H 4RO2A 4F6RA 4Z1VA 3M8AA 5JCOC 4WBNB 4YHHO 2LP7A 1BHAA 2P7TC 2PUSA 4JTCB 1QLNA 4PJ0Z 1R1BA 2UXXA 4YIPA 3SPHA 2RCVA 1F4NA 3ZEDA 5D5QA 2Q68A 4X62B 3CHXA 3IAYA 2Q7EA 1DGSA 2JGDA 2JVDA 5KHHA 4PELA 2GHYA 3ZN0A 4BW5A 2YS8A 4FLZA 1K8AW 4I9QA 3ZRVA 3DGEA 2ZE7A 4LFCB 2ARHA 4MVOA 3B8MA 1OCRB 4DR4O 4JAVA 5CBHA 4MS2A 4KP4A 5IWAB 3CSXA 3N27A 3ASOB 5JCOA 1QHTA 4O4HA 1X59A 1V54C 3B8NA 3MHSC 3TXQA 4FFBB 2R9AA 5LBQA 2ZQMA 1H8EG 2ODMA 4LR3A 4QE9A 4LBEC 1F4MA 1AR5A 3CD6V 4LCUC 4U7OA 5CMUA 4ZHQA 1AJNA 2HR3A 3CX5F 4IL6Z 4GKJB 3TK1A 1VQ6V 2CTQA 5B3SB 5BMVA 2EINB 3LDEA 1AI7A 2OT5A 4K0KB 2BCCH 2WLLA 1HR0B 4B7KA 3FYEB 1VQ7V 4NXMB 4YJ3A 1MSDA 4GZRB 1YCIA 3T1CA 1Y4MA 4I0XB 4J9YB 5H6RA 1FD9A 3ZCCA 2ETNA 2H8PC 5EK0A 5LMUO 1NBMG 5LMNO 4OPHA 3ZHUA 4CS4A 3ABMB 5LL6Y 5IYZA 1COWG 3H1JH 2DWDC 4DR3B 3OFNG 3RBZA 1H2GA 2YXLA 4MT8A 1Y76A 1OCZC 3N2GB 5TISZ 1OCCB 2CAZC 1XQ8A 2ZNJA 5IYDO 4JPRA 3OGIB 3JD4A 2Z5UA 3ZHVA 1WPBA 2X6AA 2YI8A 1S5HC 3JCZA 4JI1B 3E89A 2B9ZA 2UXDO 3OEEG 4TOIA 4DR6B 1R3KC 3N2KA 3K59A 4K3AA 2CUGA 1YF2A 2K1EA 5B1OA 1H38A 1Q6HA 4UB6Z 1K9MW 2QJ1A 1AI6A 3TCUA 1SA0A 2F4VB 1SESA 2P90A 4XDLA 3T1HO 2ZIOA 3BAAA 1VQMV 1WN7A 2YEVB 2OCHA 1IXMA 4GCZA 4NTWA 3JATA 3MD0A 5B66Z 2RNBA 2VS0A 1YJWV 4A5UB 4JAAA 5J9PC 1YDXA 3JCUZ 4KFMA 2QGNA 3CJHA 2Q0OC 3GWOA 3L70H 4L8JA 1NTMH 5CB4B 2ZKOA 4X89A 3UO3A 2FTKA 3WU2Z 5JH7B 2LQTA 1I08A 2F43G 3A0BZ 1ZAUA 1VQNV 4JI2O 1SERA 4DUYB 5JJEB 1RPOA 1SQFA 1W2BU 1OCRC 1AROP 1Y66A 3M7MX 3QO8A 2Y0IA 4DR2B 4MVZA 4PA3A 1FS0G 2F93B 1JPXA 4PA9A 4JZ2A 2WAMA 5FLXN 4JYAB 1K33A 1WB8A 2LGQA 3ASOC 1Z5WA 4X1IB 3ZMTA 1A32A 4I50B 2Y0PA 4FPPA 3AG4B 1XNRB 2YC0A 4G28B 1ENVA 4EFBA 4PDLA 5H6QA 3B4SA 1H2NA 1S5JA 3P30A 1ZX3A 2Y48A 4DV0O 5GONB 4O2BB 3QF7A 2QTSA 4I55B 3JYCA 1YJNV 4R50A 3R65A 3L72H 5B3SC 2EINC 1X4TA 1YHQV 3QG5A 3FKSG 4JGSA 5JVDB 2ZM6O 1NR1A 3LDDA 1B3QA 4JI8O 4UFZA 3BHPA 5KHIA 4FFBA 4I4TB 1JJOA 4MTXA 3ZMVA 5H9CA 2YIAA 3L9DA 3RGBA 2ADQB 3DSQA 4UXNA 1AP6A 3ABMC 4PI2A 4PA6A 1YXBA 1RM1B 1I5XA 2K9PA 1SQBH 4YHHB 4K35A 1KP2A 2IU3A 2WA3A 1OCCC 2ITCC 4Z2WA 1AP5A 2F66C 2NLJC 2Z3YA 3ML0A 1YIJV 1KC8W 3W7UA 1OJHA 4DW1A 4LFCO 4UV9A 1T5EA 1V55B 3E22A 2WLJA 2BSKB 3JD3A 2HEPA 1VARA 3RYCA 1P7BA 2JK5C 2X6CA 3ABUA 3AG7A 4DR4B 2XT9A 1EZJA 1Y6XA 1M57B 1PL0A 2Q4PA 4IYHA 2WPDG 2IU0A 1SS3A 3R66A 1AB3A 5L3GA 3IC9A 4FM0A 4EFEA 4O2AB 2CH7B 3N2GA 3CCVV 3G6BA 3B09A 5DM6V 3ZBHA 1J5EB 2OTJV 1P7GA 2QR4A 2E3CA 3E35A 3ETEA 2YIBD 5KA6A 2FYUH 1GM9A 3ICXA 4FIPC 4NXMO 1D5AA 1JFFB 2XNDG 2QM7A 4ZBMA 2ATKC 3G80A 3IJ4A 4EEQA 1G6UA 5EBWC 3VQWA 3I55V 3HKDA 3OR7C 2R70A 4F6EA 1EFRG 2Q69A 2BE3A 1VEWA 5B1BB 4WFBV 2ZT9B 4BAYA 2IJHA 3K03A 5FPOA 2W6JG 3I5DA 2NN4A 2MK3A 1KD1W 3BABA 3CRRA 4U7NA 5L3DA 2X0LA 3AG4C 4CZZA 4DV2O 4H13B 1K5QA 1YTFD 1GK9A 4NXNO 5CB4A 3K5MA 2H94A 2RJZA 5JH7A 4DR6O 1PKXA 2O57A 1PL4A 1YTFB 2FL4A 1GTOA 4IIJA 4BIOA 3D3IA 1S77D 2HKOA 3UKMA 4WF9V 5FPRA 1LNQA 2UXDB 3ZRWB 5A9GA 3B40A 1PNMA 1PNLA 2NR5A 3CMEV 3OW2U 4X65O 2B1IA 2VQFO 4FZ0A 4NB5A 3S3WA 3E8BA 2E76B 2JS5A 2JEXA 4CH5A 4BWAA 3THOA 1VQLV 4TV9B 1BE3H 4X1IA 1D2DA 4P9PA 3SYPA 2EZPA 1QQCA 4CC5A 3CRMA 1VQKV 1N0JA 5C93A 3T1HB 4GKKO 1S72V 2QM4A 4NVPA 2E5LO 4IGGA 1RM1C 1HNWB 4JI5B 4CC6A 5GONA 4O2BA 2Y69B 5LXTB 1F23A 3UT5B 2ZD9A 4GYCB 1LUWA 1R6TA 4I55A 1Y74B 4B08A 2UUCB 4DRXB 3ZN1A 1YZBA 2W0XA 2UUAO 4DUYO 2LW1A 4JASA 1WA8B 3UM7A 1V55C 1TAEA 4PA4A 1GN2A 1IVSA 3G67A 1GM8A 4JI2B 3OUSA 4JYAO 3CEIA 1GO3F 3DC5A 2ZIMA 4D6TH 1BMFG 1ORQC 3G4SV 4J7KA 1XNRO 3BVOA 5LYJB 3T2MA 4PA7A 3AEIA 2G38A 3DXRA 5KMGB 1WB7A 1HW7A 2XAJA 4AQYO 2L35A 1AR4A 4DV0B 1JX9A 2BSKA 4FLTA 3E2EA 5GTHZ 5F2VO 2OCCB 2DJVA 4DV4O 1FKAO 5LHHA 1XREA 4XBFA 4DO2A 1RSOB 1M9NA 3IGAC 1EZVH 4DYLA 3EFFK 1KKDA 4R8CA 4BR6A 4U3FH 4JI8B 4MVQA 1NJIW 4O2AA 2M7WA 1OZ0A 3F5TA 2BTOA 5B1BC 5K1PA 2JJ2G 1SQQH 2Q9LA 4JYBA 1NU1H 3ZHQA 1FXHA 2QM8A 3GWKC 2F1MA 3RVZA 2IH1C 3CCJV 1XILA 4NYKA 4U3JA 4FK5C 2Y4UA 1FYJA 3BEHA 1F7YA 5B1AB 1BQ0A 2BTQB 3VOUA 5A2QN 2LO1A 2WLIA 3ETQA 2AHYA 4WFEA 3RYFA 5KHGA 2GUZB 4JI6O 1Z5VA 3SDLA 1FXKB 1V9PA 5JQGA 2D3OW 4OGQB 4Q20A 2KQXA 3K0GA 2HG5C 2V7QG 4P9OA 4W4LA 3UQ8A 4I7ZB 2JJ1G 2VQEB 5E79Z 2HP8A 1JCHA 4JAUA 1E1RG 1J5EO 4R6ZA 1QVGU 4MTFA 2XASA 2FB5A 1NTKH 1XNQO 3ASNB 2OWOA 3UCSC 2D2CB 3K57A 3C3SA 2Y69C 1BGYH 3ZRWA 3STZC 2X6BA 1YITV 3BPZA 2UU9O 2Q6AA 3K58A 2GTAA 5KUKA 2EBOA 1ROPA 4GT1A 2PI4A 5AG2A 3CCQV 1XUQA 3RW0A 2RN9A 1I7FA 4TV9A 5GTIZ 5BR8O 4RAIA 4JI7O 4D7TA 1TUEB 2Q5ZA 3ABKC 2P4VA 1RPRA 2CE4A 4LC1A 3J7AU 1RFYA 3SPJA 1UPGA 2LW7A 1W0JG 1N36O 3AG1B 3L73H 3QO7A 5LXTA 3UT5A 4LNUB 2R72A 4TV8B 3B2EE 2EIJB 4DV2B 1YJ9V 4ZOLB 4DRXA 3OTOO 1Q81W 4NXNB 1NH2D 5LOVB 5IJ9B 1WA8A 2ILMA 3OMAB 2DQ0A 1PV0A 1BHBA 2LGWA 3K04A 1NH2B 3ETDA 2OCCC 4TWKA 5H5NA 1BZKA 1WJZA 2BOCC 3VQXA 4B7EA 2A79B 5B1NA 4X65B 5IY5B 2VQFB 4LF5O 3MAQA 3P32A 5LA6A 4DW0A 1Q6UA 5DN6G 1KB9F 3JAMN 2YXYA 1HNZO 4ASUG 4J10A 3G6EV 4DR1B 2ZINA 4MTOA 2XAQA 4PI0A 5LYJA 3H1KH 3DC6A 1FFTB 1IX9A 4LWSB 4DV7O 1HNWO 2V1DA 5KMGA 1MZEA 2LFRA 4GKKB 4JI5O 5L3BA 5IJ0B 5KX5B 2E5LB 2UXCO 2UUCO 2IH3C 4Q6GA 4HNAB 5B1AC 3SYOA 4MW3A 1QR9A 3BFRA 4TT3G 2HJDA 3BA8A 4LF9O 1N32O 4C7UA 1RSOA 4QGPA 2ZDIC 4X1YB 2UUAB 4YXWG 3IFXA 3FD9A 4E2LA 1K3EA 3QNEA 1N34B 2Q0AA 1FXKC 4MVRA 3SYQA 4H0LB 1Q90D 1EN6A 5EZYB 3LSQA 1JR9A 2XHBA 2IJJA 4WBNA 1MA1A 4P30A 2P67A 4FLUA 4LH6A 2H3OA 2VWKA 3W7XA 4H37A 1XMQB 1BS3A 1J95A 1G1XB 1L0LH 4IT5A 2ZE8A 2N74A 4I5SA 2BTQA 4WFHA 4G2KA 3K9SA 2MW2B 1Q6IA 3OGCC 2ZDIA 2QSAA 3TGUH 4HYOA 4B3SO 4AQYB 1US6A 4JYYA 3ASNC 3FB6C 4YY3O 4ICGA 2E75B 3OD4A 1NKDA 1FXKA 3LSUA 5CA3A 1SF9A 1D5NA 4DV3O
chains in the Genus database with same CATH topology
1F51A 2MK3A 2C2AA 2DQ3A 2WLHA 3K0DA 1KD1W 1QLEC 4UV8A 2EIMC 4U7NA 5L3DA 4QJFB 2X0LA 3AG4C 5EC1C 4CZZA 4EKWA 3CC2V 1SETA 1PNKA 1K5QA 2B5UA 1R6NA 4JTDB 1GK9A 1YTFD 1OCOC 3SYCA 2H94A 3OAAG 4ZKIA 4H33A 3ZMZA 1KP3A 4GX5A 4UVCA 3SPIA 2W6IG 3ZJZA 1PKXA 1YTFB 4MTGA 1GTOA 3D3IA 1S77D 4RQFA 2HKOA 3UKMA 1DTOA 2QTOA 4WF9V 1VQPV 1LNQA 1YSCA 2CK3G 1VQ4V 3ZRWB 1PNMA 1PNLA 3CMEV 3OW2U 4BIUA 3IC7A 4RO2A 2B1IA 2PI5A 3E8BA 1K4DC 3ABTA 2DYSB 1K92A 1MG1A 2JEXA 2LP7A 1BHAA 2P7TC 3E8GA 4JTCB 1QLNA 1XL6A 3SYAA 2UXXA 2EIJC 3SPHA 1F4NA 1VQLV 3FB8C 1QBZA 1SZTA 2WWWA 3ABLC 2Q68A 2WLMA 4P9PA 3SYPA 1QR8A 2EZPA 4KUMA 1R3JC 4N21A 3WG7B 1K34A 3K79A 1VQKV 4PELA 2GHYA 5C93A 3ZN0A 4X8AA 1JVMA 4PDRA 1W0KG 4BW5A 1S72V 1K8AW 5EBLC 3ZRVA 1NQTA 1HWYA 3DGEA 2A0LA 3LDCA 3ZMSA 3TETA 3WFVA 4MVOA 3B8MA 1OCRB 1FXVA 1RM1C 1Q7YW 1MABG 4JAVA 2Y69B 5CBHA 1F23A 4MS2A 2ZD9A 2HVKC 4DXWA 4KP4A 4MW8A 4PDVA 3ASOB 4GX1A 2QEXV 4PDMA 3ZN1A 1V54C 1WLEA 3SJQC 2EZOA 1Q82W 4MVSA 1N8RW 3AG3C 3B8NA 3MHSC 5KA5A 4F4LA 5LBQA 4JASA 3OMNB 3UM7A 3SPGA 1V55C 4PA4A 2EILB 2ZQMA 1B6QA 1GM8A 1H8EG 2WLKA 4QE9A 4LBEC 3OUSA 1F4MA 3CD6V 4FMTA 4LCUC 4U7OA 5CMUA 4MVUA 1GO3F 3E8HA 4QIWF 1AJNA 1K97A 2HR3A 3OEHG 3JD2A 4P2ZA 1BMFG 1ORQC 3G4SV 3ZRXA 3TK1A 1VQ6V 3CXCU 5B3SB 2EINB 3LDEA 2ZR3A 1AI7A 2OT5A 2WLLA 3CC7V 3K06A 3FYEB 3T2MA 1VQ7V 4PA7A 3AEIA 4Z1MG 3T1CA 1Y4MA 4I9WA 3T4DA 5E1AC 3ZIAG 5LHGA 2YEVA 4J9YB 3STLC 3CCRV 5KUMA 2XAJA 1DF4A 5H6RA 3ZCCA 2H8PC 2UXNA 5EK0A 1JX9A 1VQ9V 1NVPD 1NBMG 3E2EA 3OE7G 2OCCB 3ETGA 3ABMB 4TSFG 1K4CC 1COWG 5LHHA 1S0VA 2DWDC 3LSSA 3OFNG 1NVPB 3RBZA 1AR1B 2DW4A 4X88A 4XBFA 4DO2A 1H2GA 4MT8A 1M9NA 3T4ZA 3IGAC 1K7DA 3EFFK 1KKDA 2YSUB 1OCZC 2ZXWC 4R8CA 1OCCB 5IYDO 4JPRA 4MVQA 4RUEA 5FL7G 3JD4A 2EIKB 1NJIW 2EJRA 2Z5UA 2M7WA 1OZ0A 4OXSA 1QCEA 2X6AA 4XDKA 5B1BC 1S5HC 3JCZA 3AG1C 2JJ2G 3E89A 4WFGA 4JYBA 1JOYA 3OEEG 1FXHA 1R3KC 2QM8A 5CBFA 3RVZA 2IH1C 1UJWB 3X2QB 3CCJV 1R73A 4UVBA 1E1QG 1DLBA 3A0RA 4FK5C 3DTUB 1L1FA 2K1EA 3BEHA 5B1AB 5B1OA 1H38A 4QNHB 3EHBB 3JD0A 3VOUA 5LHIA 1K9MW 5HFMA 1AI6A 5L3FA 3TCUA 2WLIA 3AG2B 2AHYA 3LNMB 4WFEA 1SESA 2OTLV 2P90A 4QE7A 4XDLA 3M99B 1VQMV 2YEVB 3CYOA 3KG2A 2HLDG 5IY5C 1FXKB 1IXMA 2GSMB 4GCZA 2D3OW 1XL4A 4LP8A 3MD0A 3ZRSA 4R7CA 1YJWV 3K08A 1KECA 4Q20A 3OR6C 2DYSC 3K0GA 2HG5C 5J9PC 2V7QG 4P9OA 1DF5A 1M56B 2JJ1G 1R3LC 1CP9A 4KFMA 3GWOA 2JDIG 2QE7G 1BL8A 2Q67A 4X89A 3JD1A 3W7WA 3WG7C 3OUFA 1JCHA 2FTKA 4JAUA 1R3IC 1E1RG 4R6ZA 2F43G 1QVGU 4MTFA 1VQNV 2DYRB 2XASA 1SERA 1RPOA 5L3EA 1W2BU 4RUFA 1S3JA 1OCRC 1AROP 3ASNB 1Y66A 1M57C 5GW7A 3QO8A 4WFAV 2Y69C 4MVZA 4PA3A 1FS0G 3ZRWA 1QVFU 3STZC 1JPXA 2X6BA 4PA9A 5CN0A 1YITV 2WAMA 2XOKG 1K33A 3ASOC 4QPKA 4XDJA 2Q6AA 1EBOA 1QLEB 3ZMTA 2EIMB 5KUKA 3W7SA 4FPPA 2EBOA 3AG4B 1ROPA 2R9RB 1GKFA 4GT1A 2WLNA 2PI4A 3CCQV 3RW0A 4G28B 1ENVA 4PDLA 5H6QA 1OCOB 1M1KW 2WLIB 2XAFA 2EILC 1E79G 4RAIA 3CMAV 5LGUA 3K3WA 1MOFA 1TUEB 4HAMA 3ABKC 3P30A 2Y48A 4WFFA 4LC1A 1RPRA 3SPJA 5LGTA 1AJQA 2HVJC 1W0JG 5EBMC 4HZ3A 3AG1B 3OM3B 3JYCA 1M90W 3CCEV 2WSSG 4R50A 1YJNV 3HPLC 3R65A 3QO7A 5B3SC 2KB1A 2EINC 2XAGA 1YHQV 3FKSG 5BZBA 4JGSA 2EIJB 1YJ9V 1AI5A 4WCEV 4QPJA 1NR1A 3LDDA 3BY6A 3SPCA 5EC2C 1Q81W 3ABLB 4G27B 1NH2D 1G4YB 2AHZA 1Q86W 4MTXA 3OMAB 4GX2A 3ZMVA 2DQ0A 3MHHC 5H9CA 4J9ZB 5LGNA 1K73W 1BHBA 1H8HG 3K04A 5HFLA 3ETDA 3G71V 1NH2B 4UXNA 2OCCC 4TWKA 3ABMC 2ITDC 3FB7C 3OMIB 3I56V 3CCLV 2BOCC 1SRYA 4PA6A 2A79B 1G8MA 3LUTB 5B1NA 1RM1B 5IY5B 1KQSU 1I5XA 3P32A 1NR7A 2JIZG 2P6JA 3H01A 1PD3A 5DN6G 2LFSA 4GX0A 3E86A 4MVMA 1KP2A 2IU3A 2WLLB 4ASUG 2BOBC 1OCCC 3G6EV 3FYIB 2ITCC 2X7RB 1V54B 4MTOA 2XAQA 3AG3B 2NLJC 2EIKC 1YI2V 2Z3YA 3ML0A 1ZWIC 1YIJV 2IJIA 3W7UA 1KC8W 1OHHG 1FFTB 3W7TA 4UV9A 2QKSA 1V55B 2WLJA 2V1DA 2LFRA 2A9HA 3JD3A 1CPYA 4UVAA 5IYBO 5L3BA 4UUJC 1JQ0A 3X2QC 1P7BA 2JK5C 2B1GA 2X6CA 3ABUA 4N23A 2IH3C 5B1AC 1EZJA 1WPXA 3SYOA 1M57B 1PL0A 4MW3A 1QR9A 2WPDG 4TT3G 2HFEC 2IU0A 3F5WC 4JF3A 1AI4A 2ZDIC 4BIZA 4RQEA 1P4RA 5L3GA 4YXWG 2XAHA 3AG2C 1I5YA 3IFXA 3GB7C 3NXSA 3QO5A 4MSWC 4E2LA 1K3EA 3QNEA 3CP1A 1THZA 3E8FA 3FB5C 3F7VC 3CCVV 1FXKC 2IW5A 4MVRA 3SYQA 5DM6V 1CEZA 3E83A 2OTJV 1AJPA 3LSQA 3E35A 2W0FC 2ZR2A 5IYCO 1VQ5V 3ETEA 3CC4V 2IJJA 1MSWD 3ABKB 1M56C 4P30A 2IJKA 5KA6A 2P67A 3CCUV 1GM9A 1GMGA 3HB3B 4FIPC 4FJCC 2JEUA 4H37A 3W7XA 4CBCA 1J95A 2XNDG 3ZMUA 3F7YC 3CPWU 4I5SA 3K9AA 4WFHA 2QM7A 4ZBMA 2ATKC 1OCZB 2ZXWB 4G2KA 2QA4V 2NNUA 5L3CA 3CCMV 4JYCA 1S76D 1JJ2U 5IDJA 5EBWC 3B77A 3OGCC 2ZDIA 3I55V 1K5SA 2DYRC 1VQ8V 1GM7A 4HYOA 3OR7C 2DWEC 1EFRG 2Q69A 2R9IA 4L87A 3ASNC 3CCSV 3FB6C 5B1BB 1VQOV 4JTAB 1NKDA 1FXKA 5CA3A 3VBBA 4WFBV 3RVYA 5CBGA 4BAYA 2IJHA 3K03A 1R6KA 2W6JG 3D36A 2HJFC 3PJSK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K W;  1VQK V;  4WF9 V;  3CPW U;  1YJ9 V;  1VQP V;  1NJI W;  1Q82 W;  3G4S V;  3CMA V;  1KD1 W;  1VQ4 V;  4WCE V;  1N8R W;  4WFA V;  3CCV V;  1VQ6 V;  3CME V;  2QA4 V;  3OW2 U;  1Q81 W;  3CCM V;  1S72 V;  1K8A W;  5DM6 V;  1JJ2 U;  3I55 V;  3G6E V;  2OTL V;  3CC2 V;  1QVF U;  1YIT V;  2OTJ V;  1VQ8 V;  1Q86 W;  3CC7 V;  1VQM V;  1VQ7 V;  1VQ5 V;  3CC4 V;  1Q7Y W;  1K73 W;  1YI2 V;  3CCJ V;  1R73 A;  3CCS V;  3G71 V;  1YIJ V;  1QVG U;  1KC8 W;  1VQL V;  1VQN V;  1VQO V;  2D3O W;  3CCU V;  1M90 W;  3CCE V;  3CCR V;  1YJN V;  1KQS U;  3CD6 V;  3CCQ V;  4WFB V;  3I56 V;  1YJW V;  3CCL V;  1W2B U;  2QEX V;  3CXC U;  1YHQ V;  1K9M W;  1VQ9 V; 
#chains in the Genus database with same CATH topology
 4DV4 B;  2KG7 B;  1H2L A;  4KHP O;  2WA4 A;  4UV8 A;  3SJB C;  1LUV A;  4EKW A;  1PNK A;  2YID A;  4NR1 A;  3EVK A;  3FX7 A;  4LH7 A;  4ZKI A;  4UCT A;  3A8T A;  1KP3 A;  3WB2 A;  2CGN A;  4RQF A;  5ITZ B;  1PM9 A;  4FFK A;  1K4D C;  1FJG O;  2DYS B;  1K92 A;  1MG1 A;  3KZI Z;  3E8G A;  1XL6 A;  3SYA A;  1RP3 B;  1KKC A;  2EIJ C;  1QBZ A;  1SZT A;  2UXB O;  1QR8 A;  4KUM A;  1NZ6 A;  1R3J C;  3APO A;  1ZL8 B;  1K34 A;  3K79 A;  5DEC A;  4I0X A;  3SR2 C;  2P4K A;  4X8A A;  4JI6 B;  1W0K G;  2DE0 X;  1SC5 B;  5EBL C;  3ZMS A;  3WFV A;  1O9G A;  1FXV A;  4DV6 O;  4FLW A;  4YJ2 B;  2VQE O;  4ZIB A;  3CRQ A;  3HKE B;  4DUZ O;  5CA0 B;  2HVK C;  4MW8 A;  4PDV A;  4X20 B;  2QEX V;  3APQ A;  1VMG A;  1WLE A;  2EZO A;  3SJQ C;  1L0N H;  4TV8 A;  5KA5 A;  2IBZ H;  4F4L A;  3NR7 A;  4B3R B;  5KLV H;  2EIL B;  4KXR A;  1B6Q A;  2WLK A;  1OV9 A;  5LOV A;  1FPO A;  2ZE6 A;  2YI9 A;  1BQZ A;  1XNQ B;  4PD4 F;  3E8H A;  4QIW F;  1FFX B;  3OEH G;  1P84 F;  3JD2 A;  2RQ6 A;  4P2Z A;  3L71 H;  4F6R B;  2UU9 B;  2QWR B;  2P22 C;  4FM2 A;  3CC7 V;  4ABM A;  1XOU A;  4Z1M G;  2JGD B;  2IM9 A;  1IBM O;  5LHG A;  3H1L H;  5BR8 B;  2YEV A;  4JI7 B;  1DF4 A;  3H9V A;  3AK1 A;  4CS2 A;  4UCU A;  4LWS A;  1NVP D;  1WP7 A;  3OE7 G;  3ETG A;  4TSF G;  1H2M A;  1K4C C;  5KX5 A;  1N36 B;  2Q73 A;  3LSS A;  5C8Y B;  1NVP B;  2P06 A;  1ZUQ A;  1K7D A;  3J80 N;  3EXA A;  1N33 O;  4IHJ B;  3OTO B;  4X1Y A;  4HBN A;  5FL7 G;  3T1Y O;  1GN6 A;  2EJR A;  1B06 A;  1MNG A;  1QCE A;  2OIG A;  4KL1 A;  2Q7H A;  3CRA A;  1ZLZ A;  1ZTE A;  5EIB D;  3JAK B;  3X2Q B;  1R73 A;  1VIB A;  1E1Q G;  4LF5 B;  4DR1 O;  3DTU B;  4X9Q A;  4I50 A;  4GUN A;  3EHB B;  3U0Z A;  3ZHT A;  1HNZ B;  4ZI7 B;  5HFM A;  4JV5 O;  3LNM B;  3RN4 A;  4QE7 A;  1TUB B;  1HP8 A;  3CYO A;  3KG2 A;  4H44 B;  4DV7 B;  1IXB A;  1VF5 B;  4CS3 A;  1I94 O;  1GAX A;  1XL4 A;  4LP8 A;  1SQX H;  2LJ2 A;  1KEC A;  3SGI A;  1Q43 A;  3OR6 C;  2DYS C;  2XUM A;  2UXC B;  4O4I B;  5IYZ B;  2GV9 A;  1M56 B;  3C3T A;  3GVM A;  3KKY A;  5JVD A;  2JDI G;  4LFA O;  1N34 O;  2Q67 A;  4LF9 B;  1N32 B;  4AHC A;  4YIO A;  1FAF A;  3OUF A;  1Y76 B;  1NT2 B;  1BT8 A;  1R3I C;  4DK0 A;  2QDO A;  4I4T A;  1I0H A;  2EJ7 A;  3BCC H;  5L3E A;  4X64 B;  3HKB B;  5D5P A;  3JAL B;  1YEW A;  2CTW A;  1M57 C;  4WFA V;  1XMQ O;  1XHZ A;  1GN4 A;  2JS3 A;  4CH6 A;  1QVF U;  5ITZ A;  3JAS B;  1WP8 A;  3C90 A;  2XOK G;  4XDJ A;  4FLY A;  1QLE B;  3HKC B;  3W7S A;  1KMI Z;  4GLX A;  2JGU A;  1VF7 A;  2EIL C;  2M6Y A;  1ZL8 A;  3TXS A;  3CMA V;  3K3W A;  4DV5 O;  1MOF A;  4B3S B;  5J2U B;  4WFF A;  4YY3 B;  3JAT B;  1AJQ A;  3L75 H;  3Q4H B;  3AK3 A;  2HVJ C;  5EBM C;  4HZ3 A;  2VWJ A;  4DV3 B;  1M90 W;  3HPL C;  1VP7 A;  4KHP B;  5JWP A;  3HKE A;  2Q7G A;  4FLX A;  4O4J B;  2P5O A;  4X20 A;  4WCE V;  2CH7 A;  4QPJ A;  1U96 A;  1IBK O;  3SPC A;  5IT9 N;  3ABL B;  1G4Y B;  1Q5O A;  1GH6 A;  2FML A;  1EN4 A;  3CRC A;  5DED A;  4GX2 A;  2YUA A;  5LGN A;  1M4U A;  2PY5 A;  5HFL A;  5EYP B;  1SQG A;  1M93 A;  4X66 O;  2ITD C;  3OMI B;  4B3M B;  1H2K A;  3P3N A;  1XMO B;  1FJG B;  1NR7 A;  3A0H Z;  2P6J A;  5BY1 A;  2LFS A;  1JFF A;  3HR0 A;  2YIB A;  2BOB C;  1UFI A;  2UXB B;  3AG3 B;  3O65 A;  1ZWI C;  4IYI A;  3QVN A;  1M5I A;  2EUL A;  1Q3E A;  1Y67 A;  2QKS A;  4PHZ A;  2A9H A;  5JJJ B;  5IYB O;  3X2Q C;  3JAR B;  3RT3 C;  4DV6 B;  2B1G A;  3PN1 A;  5EIB C;  1AIL A;  1WPX A;  3D8C A;  4LF6 B;  4DUZ B;  1NS1 A;  2HFE C;  5C8Y A;  4JF3 A;  4BW9 A;  4B3R O;  1P4R A;  2XAH A;  3NXS A;  3QO5 A;  3JSN A;  4LF7 O;  1WAZ A;  4IHJ A;  3E8F A;  1XI1 A;  3F7V C;  5LP6 B;  3BRC A;  3D36 C;  3E83 A;  1U97 A;  2W0F C;  2ZR2 A;  2GTS A;  1VQ5 V;  4J7Z A;  1M56 C;  3JSL A;  3JAK A;  3CCU V;  1GMG A;  2AGA A;  2JEU A;  4CBC A;  3K5N A;  3FAV B;  3ZHS A;  2AW9 A;  3ZMU A;  5J2T B;  3CPW U;  1DK1 A;  2PYL A;  2ZXW B;  4ZI7 A;  2NNU A;  3CCM V;  4JYC A;  3SJC C;  5IDJ A;  3B77 A;  1K5S A;  1IBM B;  3K5L A;  4LFB O;  1TUB A;  2QKA A;  3E22 B;  4L87 A;  4TUY B;  3CCS V;  1IUR A;  1IZ3 A;  1KUQ A;  3RVY A;  5CBG A;  3RYC B;  1R6K A;  3D36 A;  2HJF C;  1ZSP A;  3CXC U;  1F51 A;  2DQ3 A;  1Y74 A;  3K0D A;  1QLE C;  2XTA A;  4O4I A;  4QJF B;  1IBL O;  4JZG A;  2B5U A;  1B04 A;  4UCO A;  1N33 B;  3OAA G;  4H33 A;  4J42 A;  3T1Y B;  4UVC A;  3ZJZ A;  2A7W A;  4MTG A;  1N4C A;  1DTO A;  2QTO A;  1VQ4 V;  2CK3 G;  2L6L A;  3HKB A;  3VQV A;  2UUB O;  3JAL A;  3IC7 A;  2QWO B;  2OIE A;  4LF4 O;  3BA9 A;  2PI5 A;  3ABT A;  4EB6 B;  4DK1 A;  3JAS A;  3ZS8 C;  4X1K B;  3KCX A;  3FB8 C;  2WWW A;  3ABL C;  2WLM A;  3HKC A;  2HHH O;  4OPA A;  3WG7 B;  4N21 A;  1Z2G A;  3SJA C;  4JV5 B;  4AI8 A;  1N0N A;  1MMM A;  1P49 A;  4AIL C;  1JVM A;  4PDR A;  4B3T O;  4W4K A;  3HKD B;  1NQT A;  1HWY A;  2A0L A;  3LDC A;  4TQD A;  3TET A;  5J2U A;  4UCS A;  1I94 B;  4UB8 Z;  1LR1 A;  1Q7Y W;  1MAB G;  1TA8 A;  4DR7 B;  3RWR D;  3Q4H A;  4UCR A;  4JI3 O;  2QWN B;  4DXW A;  4JI0 B;  3U11 A;  4GX1 A;  4PDM A;  2YDE A;  4LFA B;  1Q82 W;  4MVS A;  1N8R W;  3AG3 C;  1SQV H;  5IE9 A;  4O4J A;  4DR5 O;  4X64 O;  3OMN B;  3SPG A;  1QNM A;  2GDS A;  3LNN A;  3FFQ A;  3CB2 A;  4IIJ B;  4FMT A;  2QWP B;  2AZ0 A;  5BXZ A;  4MVU A;  5EYP A;  5JJN B;  1K97 A;  2PTM A;  2CDY A;  4OX9 O;  2N04 A;  2ZE5 A;  3ZRX A;  1XHX A;  2ZCE A;  3RYH B;  1XDC A;  2ZR3 A;  4DV1 O;  3K06 A;  1KU9 A;  1HNX O;  3JAW B;  2GUZ A;  4I9W A;  1URF A;  5LP6 C;  4JI4 O;  3T4D A;  5E1A C;  3ZIA G;  4NTY A;  3STL C;  3CCR V;  5KUM A;  4DV5 B;  3D3Q A;  1VF6 C;  5CA1 B;  2UXN A;  1VQ9 V;  1SQP H;  3ZX6 A;  1S0V A;  2E74 B;  1S5L Z;  4E4E A;  3JAR A;  1AR1 B;  1WNS A;  4O4L B;  2DW4 A;  4X88 A;  2YXH A;  4UCV A;  3O9O A;  3T4Z A;  2YSU B;  3UO2 A;  2ZXW C;  1W59 A;  1MZF A;  4LF8 O;  1IBK B;  1SKV A;  1CXZ B;  4RUE A;  2EIK B;  1JMK C;  4OXS A;  4XDK A;  4B3M O;  4K8X A;  3AG1 C;  5LP6 A;  1EN5 A;  4WFG A;  1XMO O;  1JOY A;  5CBF A;  2N05 A;  4X66 B;  1VF6 A;  1UJW B;  4UVB A;  3CS5 A;  1DLB A;  3A0R A;  1L1F A;  4QNH B;  2Y4T A;  3JD0 A;  5FNV B;  5LHI A;  3WB0 A;  2Z0A A;  4FVM A;  3OTF A;  4X62 O;  3FAV A;  5L3F A;  5J2T A;  3AG2 B;  2KSD A;  2OTL V;  3M99 B;  3DXR B;  1L8D A;  2HLD G;  5IY5 C;  2KKW A;  1TVK B;  2GSM B;  1PPJ H;  3ZRS A;  4R7C A;  4LF6 O;  4TUY A;  1GRJ A;  3K08 A;  4NKG B;  1DF5 A;  5KHK A;  4J41 A;  5IWA O;  4RWU A;  1R3L C;  1CP9 A;  4LNU A;  2EX3 A;  2QE7 G;  1BL8 A;  3MDS A;  1IDS A;  4ZOL A;  3JD1 A;  1YVW A;  3W7W A;  2Q8V A;  3WG7 C;  5KHJ A;  1QU7 A;  5H2F Z;  4LF7 B;  5IJ9 A;  2DN9 A;  3RYI B;  2DYR B;  4RUF A;  1S3J A;  2QWQ B;  2PGG A;  4J11 A;  2ADP A;  5GW7 A;  1JA8 A;  2VRZ A;  4CH3 A;  5K1X A;  5CN0 A;  2ZNI A;  4GKJ O;  4U3J B;  4QPK A;  1Q8I A;  1EBO A;  4EB6 A;  2EIM B;  2CTP A;  2R9R B;  4K0K O;  1GKF A;  3CE2 A;  2WLN A;  1HR0 O;  4X1K A;  3P3P A;  1OCO B;  1M1K W;  2WLI B;  2XAF A;  3RYF B;  1E79 G;  5LGU A;  2CTR A;  4LFB B;  4HAM A;  3J81 N;  5IJ0 A;  4FLV A;  5LGT A;  5JQG B;  4J7J A;  4DR3 O;  4HNA A;  3OM3 B;  5LMU B;  3CCE V;  2WSS G;  4O4H B;  1BSM A;  5LMN B;  2V4D A;  4FM1 A;  1H2S B;  2KB1 A;  2XAG A;  2FKX A;  3L74 H;  5BZB A;  1IBL B;  1AI5 A;  1AVM A;  3BY6 A;  5EC2 C;  1HDJ A;  3OT7 A;  4G27 B;  3U10 A;  1TGO A;  2JRI A;  3VQY A;  2OYQ A;  1O9H A;  2AHZ A;  1Q86 W;  4JI1 O;  3MHH C;  4J9Z B;  1K73 W;  2A3Q A;  5EZY A;  1H8H G;  3G71 V;  2YIC A;  4ZHQ B;  3FB7 C;  3I56 V;  2UUB B;  3CCL V;  1SRY A;  3RFR A;  3LUT B;  1G8M A;  1KQS U;  4LF4 B;  2JIZ G;  5BMV B;  3H01 A;  1PD3 A;  4GX0 A;  3E86 A;  4MVM A;  2WLL B;  3A2F A;  3FYI B;  4YJ3 B;  2X7R B;  1V54 B;  3RYH A;  2HHH B;  2F4V O;  2EIK C;  5KAI Z;  3WB1 A;  1YI2 V;  2IJI A;  1OHH G;  3AK2 A;  3W7T A;  2PF4 E;  3JAW A;  1EM1 A;  4B3T B;  4PV1 B;  4DR7 O;  1CPY A;  4UVA A;  4UUJ C;  2PYJ A;  5CA1 A;  1JQ0 A;  4JI0 O;  3CXH F;  2KG7 A;  1GN3 A;  4N23 A;  3H1H H;  4JI3 B;  1BCC H;  2DOS A;  4O4L A;  1XBL A;  2F23 A;  3F5W C;  1AI4 A;  2GBO A;  4BIZ A;  4RQE A;  2AZ2 A;  3AG2 C;  1I5Y A;  4NTX A;  3GB7 C;  2AXT Z;  4MSW C;  4DR5 B;  3CP1 A;  1THZ A;  3FB5 C;  3CWB H;  2IW5 A;  5B5E Z;  1CEZ A;  3KCY A;  3N2K B;  1AJP A;  4DR2 O;  4J80 A;  5IYC O;  3ZHR A;  3CC4 V;  1MSW D;  3ABK B;  1SZX A;  4TQF A;  2IJK A;  3TJT A;  4OX9 B;  5LA6 B;  3HB3 B;  2CGO A;  4FJC C;  2RDC A;  3F7Y C;  1PP9 H;  1SA0 B;  4CH4 A;  5FNV A;  3K9A A;  4DV1 B;  1OCZ B;  4FZ1 A;  2QA4 V;  5L3C A;  2F95 B;  1S76 D;  1JJ2 U;  3H1I H;  1HNX B;  2DYR C;  1VQ8 V;  1GM7 A;  4JI4 B;  2DWE C;  2R9I A;  2PZS A;  1NI8 A;  1VQO V;  4JTA B;  1XEQ A;  4D7S A;  4YJ2 A;  1TVK A;  3VBB A;  1KBH A;  3PJS K;  2QKC A;  5CA0 A;  2WLH A;  2C2A A;  3CJH B;  3S3X A;  2EIM C;  3QTC A;  5EC1 C;  2DMX A;  3CC2 V;  1SET A;  1R6N A;  2RMK B;  4JTD B;  1OCO C;  4LF8 B;  3SYC A;  3K5O A;  1NTZ H;  2ZM6 B;  3ZMZ A;  4GX5 A;  3SPI A;  2W6I G;  3RYI A;  4K8Z A;  5KAF Z;  1VQP V;  1YSC A;  1KYO F;  1FFX A;  4BIU A;  2A06 H;  4RO2 A;  4F6R A;  4Z1V A;  3M8A A;  5JCO C;  4WBN B;  4YHH O;  2LP7 A;  1BHA A;  2P7T C;  2PUS A;  4JTC B;  1QLN A;  4PJ0 Z;  1R1B A;  2UXX A;  4YIP A;  3SPH A;  2RCV A;  1F4N A;  3ZED A;  5D5Q A;  2Q68 A;  4X62 B;  3CHX A;  3IAY A;  2Q7E A;  1DGS A;  2JGD A;  2JVD A;  5KHH A;  4PEL A;  2GHY A;  3ZN0 A;  4BW5 A;  2YS8 A;  4FLZ A;  1K8A W;  4I9Q A;  3ZRV A;  3DGE A;  2ZE7 A;  4LFC B;  2ARH A;  4MVO A;  3B8M A;  1OCR B;  4DR4 O;  4JAV A;  5CBH A;  4MS2 A;  4KP4 A;  5IWA B;  3CSX A;  3N27 A;  3ASO B;  5JCO A;  1QHT A;  4O4H A;  1X59 A;  1V54 C;  3B8N A;  3MHS C;  3TXQ A;  4FFB B;  2R9A A;  5LBQ A;  2ZQM A;  1H8E G;  2ODM A;  4LR3 A;  4QE9 A;  4LBE C;  1F4M A;  1AR5 A;  3CD6 V;  4LCU C;  4U7O A;  5CMU A;  4ZHQ A;  1AJN A;  2HR3 A;  3CX5 F;  4IL6 Z;  4GKJ B;  3TK1 A;  1VQ6 V;  2CTQ A;  5B3S B;  5BMV A;  2EIN B;  3LDE A;  1AI7 A;  2OT5 A;  4K0K B;  2BCC H;  2WLL A;  1HR0 B;  4B7K A;  3FYE B;  1VQ7 V;  4NXM B;  4YJ3 A;  1MSD A;  4GZR B;  1YCI A;  3T1C A;  1Y4M A;  4I0X B;  4J9Y B;  5H6R A;  1FD9 A;  3ZCC A;  2ETN A;  2H8P C;  5EK0 A;  5LMU O;  1NBM G;  5LMN O;  4OPH A;  3ZHU A;  4CS4 A;  3ABM B;  5LL6 Y;  5IYZ A;  1COW G;  3H1J H;  2DWD C;  4DR3 B;  3OFN G;  3RBZ A;  1H2G A;  2YXL A;  4MT8 A;  1Y76 A;  1OCZ C;  3N2G B;  5TIS Z;  1OCC B;  2CAZ C;  1XQ8 A;  2ZNJ A;  5IYD O;  4JPR A;  3OGI B;  3JD4 A;  2Z5U A;  3ZHV A;  1WPB A;  2X6A A;  2YI8 A;  1S5H C;  3JCZ A;  4JI1 B;  3E89 A;  2B9Z A;  2UXD O;  3OEE G;  4TOI A;  4DR6 B;  1R3K C;  3N2K A;  3K59 A;  4K3A A;  2CUG A;  1YF2 A;  2K1E A;  5B1O A;  1H38 A;  1Q6H A;  4UB6 Z;  1K9M W;  2QJ1 A;  1AI6 A;  3TCU A;  1SA0 A;  2F4V B;  1SES A;  2P90 A;  4XDL A;  3T1H O;  2ZIO A;  3BAA A;  1VQM V;  1WN7 A;  2YEV B;  2OCH A;  1IXM A;  4GCZ A;  4NTW A;  3JAT A;  3MD0 A;  5B66 Z;  2RNB A;  2VS0 A;  1YJW V;  4A5U B;  4JAA A;  5J9P C;  1YDX A;  3JCU Z;  4KFM A;  2QGN A;  3CJH A;  2Q0O C;  3GWO A;  3L70 H;  4L8J A;  1NTM H;  5CB4 B;  2ZKO A;  4X89 A;  3UO3 A;  2FTK A;  3WU2 Z;  5JH7 B;  2LQT A;  1I08 A;  2F43 G;  3A0B Z;  1ZAU A;  1VQN V;  4JI2 O;  1SER A;  4DUY B;  5JJE B;  1RPO A;  1SQF A;  1W2B U;  1OCR C;  1ARO P;  1Y66 A;  3M7M X;  3QO8 A;  2Y0I A;  4DR2 B;  4MVZ A;  4PA3 A;  1FS0 G;  2F93 B;  1JPX A;  4PA9 A;  4JZ2 A;  2WAM A;  5FLX N;  4JYA B;  1K33 A;  1WB8 A;  2LGQ A;  3ASO C;  1Z5W A;  4X1I B;  3ZMT A;  1A32 A;  4I50 B;  2Y0P A;  4FPP A;  3AG4 B;  1XNR B;  2YC0 A;  4G28 B;  1ENV A;  4EFB A;  4PDL A;  5H6Q A;  3B4S A;  1H2N A;  1S5J A;  3P30 A;  1ZX3 A;  2Y48 A;  4DV0 O;  5GON B;  4O2B B;  3QF7 A;  2QTS A;  4I55 B;  3JYC A;  1YJN V;  4R50 A;  3R65 A;  3L72 H;  5B3S C;  2EIN C;  1X4T A;  1YHQ V;  3QG5 A;  3FKS G;  4JGS A;  5JVD B;  2ZM6 O;  1NR1 A;  3LDD A;  1B3Q A;  4JI8 O;  4UFZ A;  3BHP A;  5KHI A;  4FFB A;  4I4T B;  1JJO A;  4MTX A;  3ZMV A;  5H9C A;  2YIA A;  3L9D A;  3RGB A;  2ADQ B;  3DSQ A;  4UXN A;  1AP6 A;  3ABM C;  4PI2 A;  4PA6 A;  1YXB A;  1RM1 B;  1I5X A;  2K9P A;  1SQB H;  4YHH B;  4K35 A;  1KP2 A;  2IU3 A;  2WA3 A;  1OCC C;  2ITC C;  4Z2W A;  1AP5 A;  2F66 C;  2NLJ C;  2Z3Y A;  3ML0 A;  1YIJ V;  1KC8 W;  3W7U A;  1OJH A;  4DW1 A;  4LFC O;  4UV9 A;  1T5E A;  1V55 B;  3E22 A;  2WLJ A;  2BSK B;  3JD3 A;  2HEP A;  1VAR A;  3RYC A;  1P7B A;  2JK5 C;  2X6C A;  3ABU A;  3AG7 A;  4DR4 B;  2XT9 A;  1EZJ A;  1Y6X A;  1M57 B;  1PL0 A;  2Q4P A;  4IYH A;  2WPD G;  2IU0 A;  1SS3 A;  3R66 A;  1AB3 A;  5L3G A;  3IC9 A;  4FM0 A;  4EFE A;  4O2A B;  2CH7 B;  3N2G A;  3CCV V;  3G6B A;  3B09 A;  5DM6 V;  3ZBH A;  1J5E B;  2OTJ V;  1P7G A;  2QR4 A;  2E3C A;  3E35 A;  3ETE A;  2YIB D;  5KA6 A;  2FYU H;  1GM9 A;  3ICX A;  4FIP C;  4NXM O;  1D5A A;  1JFF B;  2XND G;  2QM7 A;  4ZBM A;  2ATK C;  3G80 A;  3IJ4 A;  4EEQ A;  1G6U A;  5EBW C;  3VQW A;  3I55 V;  3HKD A;  3OR7 C;  2R70 A;  4F6E A;  1EFR G;  2Q69 A;  2BE3 A;  1VEW A;  5B1B B;  4WFB V;  2ZT9 B;  4BAY A;  2IJH A;  3K03 A;  5FPO A;  2W6J G;  3I5D A;  2NN4 A;  2MK3 A;  1KD1 W;  3BAB A;  3CRR A;  4U7N A;  5L3D A;  2X0L A;  3AG4 C;  4CZZ A;  4DV2 O;  4H13 B;  1K5Q A;  1YTF D;  1GK9 A;  4NXN O;  5CB4 A;  3K5M A;  2H94 A;  2RJZ A;  5JH7 A;  4DR6 O;  1PKX A;  2O57 A;  1PL4 A;  1YTF B;  2FL4 A;  1GTO A;  4IIJ A;  4BIO A;  3D3I A;  1S77 D;  2HKO A;  3UKM A;  4WF9 V;  5FPR A;  1LNQ A;  2UXD B;  3ZRW B;  5A9G A;  3B40 A;  1PNM A;  1PNL A;  2NR5 A;  3CME V;  3OW2 U;  4X65 O;  2B1I A;  2VQF O;  4FZ0 A;  4NB5 A;  3S3W A;  3E8B A;  2E76 B;  2JS5 A;  2JEX A;  4CH5 A;  4BWA A;  3THO A;  1VQL V;  4TV9 B;  1BE3 H;  4X1I A;  1D2D A;  4P9P A;  3SYP A;  2EZP A;  1QQC A;  4CC5 A;  3CRM A;  1VQK V;  1N0J A;  5C93 A;  3T1H B;  4GKK O;  1S72 V;  2QM4 A;  4NVP A;  2E5L O;  4IGG A;  1RM1 C;  1HNW B;  4JI5 B;  4CC6 A;  5GON A;  4O2B A;  2Y69 B;  5LXT B;  1F23 A;  3UT5 B;  2ZD9 A;  4GYC B;  1LUW A;  1R6T A;  4I55 A;  1Y74 B;  4B08 A;  2UUC B;  4DRX B;  3ZN1 A;  1YZB A;  2W0X A;  2UUA O;  4DUY O;  2LW1 A;  4JAS A;  1WA8 B;  3UM7 A;  1V55 C;  1TAE A;  4PA4 A;  1GN2 A;  1IVS A;  3G67 A;  1GM8 A;  4JI2 B;  3OUS A;  4JYA O;  3CEI A;  1GO3 F;  3DC5 A;  2ZIM A;  4D6T H;  1BMF G;  1ORQ C;  3G4S V;  4J7K A;  1XNR O;  3BVO A;  5LYJ B;  3T2M A;  4PA7 A;  3AEI A;  2G38 A;  3DXR A;  5KMG B;  1WB7 A;  1HW7 A;  2XAJ A;  4AQY O;  2L35 A;  1AR4 A;  4DV0 B;  1JX9 A;  2BSK A;  4FLT A;  3E2E A;  5GTH Z;  5F2V O;  2OCC B;  2DJV A;  4DV4 O;  1FKA O;  5LHH A;  1XRE A;  4XBF A;  4DO2 A;  1RSO B;  1M9N A;  3IGA C;  1EZV H;  4DYL A;  3EFF K;  1KKD A;  4R8C A;  4BR6 A;  4U3F H;  4JI8 B;  4MVQ A;  1NJI W;  4O2A A;  2M7W A;  1OZ0 A;  3F5T A;  2BTO A;  5B1B C;  5K1P A;  2JJ2 G;  1SQQ H;  2Q9L A;  4JYB A;  1NU1 H;  3ZHQ A;  1FXH A;  2QM8 A;  3GWK C;  2F1M A;  3RVZ A;  2IH1 C;  3CCJ V;  1XIL A;  4NYK A;  4U3J A;  4FK5 C;  2Y4U A;  1FYJ A;  3BEH A;  1F7Y A;  5B1A B;  1BQ0 A;  2BTQ B;  3VOU A;  5A2Q N;  2LO1 A;  2WLI A;  3ETQ A;  2AHY A;  4WFE A;  3RYF A;  5KHG A;  2GUZ B;  4JI6 O;  1Z5V A;  3SDL A;  1FXK B;  1V9P A;  5JQG A;  2D3O W;  4OGQ B;  4Q20 A;  2KQX A;  3K0G A;  2HG5 C;  2V7Q G;  4P9O A;  4W4L A;  3UQ8 A;  4I7Z B;  2JJ1 G;  2VQE B;  5E79 Z;  2HP8 A;  1JCH A;  4JAU A;  1E1R G;  1J5E O;  4R6Z A;  1QVG U;  4MTF A;  2XAS A;  2FB5 A;  1NTK H;  1XNQ O;  3ASN B;  2OWO A;  3UCS C;  2D2C B;  3K57 A;  3C3S A;  2Y69 C;  1BGY H;  3ZRW A;  3STZ C;  2X6B A;  1YIT V;  3BPZ A;  2UU9 O;  2Q6A A;  3K58 A;  2GTA A;  5KUK A;  2EBO A;  1ROP A;  4GT1 A;  2PI4 A;  5AG2 A;  3CCQ V;  1XUQ A;  3RW0 A;  2RN9 A;  1I7F A;  4TV9 A;  5GTI Z;  5BR8 O;  4RAI A;  4JI7 O;  4D7T A;  1TUE B;  2Q5Z A;  3ABK C;  2P4V A;  1RPR A;  2CE4 A;  4LC1 A;  3J7A U;  1RFY A;  3SPJ A;  1UPG A;  2LW7 A;  1W0J G;  1N36 O;  3AG1 B;  3L73 H;  3QO7 A;  5LXT A;  3UT5 A;  4LNU B;  2R72 A;  4TV8 B;  3B2E E;  2EIJ B;  4DV2 B;  1YJ9 V;  4ZOL B;  4DRX A;  3OTO O;  1Q81 W;  4NXN B;  1NH2 D;  5LOV B;  5IJ9 B;  1WA8 A;  2ILM A;  3OMA B;  2DQ0 A;  1PV0 A;  1BHB A;  2LGW A;  3K04 A;  1NH2 B;  3ETD A;  2OCC C;  4TWK A;  5H5N A;  1BZK A;  1WJZ A;  2BOC C;  3VQX A;  4B7E A;  2A79 B;  5B1N A;  4X65 B;  5IY5 B;  2VQF B;  4LF5 O;  3MAQ A;  3P32 A;  5LA6 A;  4DW0 A;  1Q6U A;  5DN6 G;  1KB9 F;  3JAM N;  2YXY A;  1HNZ O;  4ASU G;  4J10 A;  3G6E V;  4DR1 B;  2ZIN A;  4MTO A;  2XAQ A;  4PI0 A;  5LYJ A;  3H1K H;  3DC6 A;  1FFT B;  1IX9 A;  4LWS B;  4DV7 O;  1HNW O;  2V1D A;  5KMG A;  1MZE A;  2LFR A;  4GKK B;  4JI5 O;  5L3B A;  5IJ0 B;  5KX5 B;  2E5L B;  2UXC O;  2UUC O;  2IH3 C;  4Q6G A;  4HNA B;  5B1A C;  3SYO A;  4MW3 A;  1QR9 A;  3BFR A;  4TT3 G;  2HJD A;  3BA8 A;  4LF9 O;  1N32 O;  4C7U A;  1RSO A;  4QGP A;  2ZDI C;  4X1Y B;  2UUA B;  4YXW G;  3IFX A;  3FD9 A;  4E2L A;  1K3E A;  3QNE A;  1N34 B;  2Q0A A;  1FXK C;  4MVR A;  3SYQ A;  4H0L B;  1Q90 D;  1EN6 A;  5EZY B;  3LSQ A;  1JR9 A;  2XHB A;  2IJJ A;  4WBN A;  1MA1 A;  4P30 A;  2P67 A;  4FLU A;  4LH6 A;  2H3O A;  2VWK A;  3W7X A;  4H37 A;  1XMQ B;  1BS3 A;  1J95 A;  1G1X B;  1L0L H;  4IT5 A;  2ZE8 A;  2N74 A;  4I5S A;  2BTQ A;  4WFH A;  4G2K A;  3K9S A;  2MW2 B;  1Q6I A;  3OGC C;  2ZDI A;  2QSA A;  3TGU H;  4HYO A;  4B3S O;  4AQY B;  1US6 A;  4JYY A;  3ASN C;  3FB6 C;  4YY3 O;  4ICG A;  2E75 B;  3OD4 A;  1NKD A;  1FXK A;  3LSU A;  5CA3 A;  1SF9 A;  1D5N A;  4DV3 O; 
#chains in the Genus database with same CATH homology
 1F51 A;  2MK3 A;  2C2A A;  2DQ3 A;  2WLH A;  3K0D A;  1KD1 W;  1QLE C;  4UV8 A;  2EIM C;  4U7N A;  5L3D A;  4QJF B;  2X0L A;  3AG4 C;  5EC1 C;  4CZZ A;  4EKW A;  3CC2 V;  1SET A;  1PNK A;  1K5Q A;  2B5U A;  1R6N A;  4JTD B;  1GK9 A;  1YTF D;  1OCO C;  3SYC A;  2H94 A;  3OAA G;  4ZKI A;  4H33 A;  3ZMZ A;  1KP3 A;  4GX5 A;  4UVC A;  3SPI A;  2W6I G;  3ZJZ A;  1PKX A;  1YTF B;  4MTG A;  1GTO A;  3D3I A;  1S77 D;  4RQF A;  2HKO A;  3UKM A;  1DTO A;  2QTO A;  4WF9 V;  1VQP V;  1LNQ A;  1YSC A;  2CK3 G;  1VQ4 V;  3ZRW B;  1PNM A;  1PNL A;  3CME V;  3OW2 U;  4BIU A;  3IC7 A;  4RO2 A;  2B1I A;  2PI5 A;  3E8B A;  1K4D C;  3ABT A;  2DYS B;  1K92 A;  1MG1 A;  2JEX A;  2LP7 A;  1BHA A;  2P7T C;  3E8G A;  4JTC B;  1QLN A;  1XL6 A;  3SYA A;  2UXX A;  2EIJ C;  3SPH A;  1F4N A;  1VQL V;  3FB8 C;  1QBZ A;  1SZT A;  2WWW A;  3ABL C;  2Q68 A;  2WLM A;  4P9P A;  3SYP A;  1QR8 A;  2EZP A;  4KUM A;  1R3J C;  4N21 A;  3WG7 B;  1K34 A;  3K79 A;  1VQK V;  4PEL A;  2GHY A;  5C93 A;  3ZN0 A;  4X8A A;  1JVM A;  4PDR A;  1W0K G;  4BW5 A;  1S72 V;  1K8A W;  5EBL C;  3ZRV A;  1NQT A;  1HWY A;  3DGE A;  2A0L A;  3LDC A;  3ZMS A;  3TET A;  3WFV A;  4MVO A;  3B8M A;  1OCR B;  1FXV A;  1RM1 C;  1Q7Y W;  1MAB G;  4JAV A;  2Y69 B;  5CBH A;  1F23 A;  4MS2 A;  2ZD9 A;  2HVK C;  4DXW A;  4KP4 A;  4MW8 A;  4PDV A;  3ASO B;  4GX1 A;  2QEX V;  4PDM A;  3ZN1 A;  1V54 C;  1WLE A;  3SJQ C;  2EZO A;  1Q82 W;  4MVS A;  1N8R W;  3AG3 C;  3B8N A;  3MHS C;  5KA5 A;  4F4L A;  5LBQ A;  4JAS A;  3OMN B;  3UM7 A;  3SPG A;  1V55 C;  4PA4 A;  2EIL B;  2ZQM A;  1B6Q A;  1GM8 A;  1H8E G;  2WLK A;  4QE9 A;  4LBE C;  3OUS A;  1F4M A;  3CD6 V;  4FMT A;  4LCU C;  4U7O A;  5CMU A;  4MVU A;  1GO3 F;  3E8H A;  4QIW F;  1AJN A;  1K97 A;  2HR3 A;  3OEH G;  3JD2 A;  4P2Z A;  1BMF G;  1ORQ C;  3G4S V;  3ZRX A;  3TK1 A;  1VQ6 V;  3CXC U;  5B3S B;  2EIN B;  3LDE A;  2ZR3 A;  1AI7 A;  2OT5 A;  2WLL A;  3CC7 V;  3K06 A;  3FYE B;  3T2M A;  1VQ7 V;  4PA7 A;  3AEI A;  4Z1M G;  3T1C A;  1Y4M A;  4I9W A;  3T4D A;  5E1A C;  3ZIA G;  5LHG A;  2YEV A;  4J9Y B;  3STL C;  3CCR V;  5KUM A;  2XAJ A;  1DF4 A;  5H6R A;  3ZCC A;  2H8P C;  2UXN A;  5EK0 A;  1JX9 A;  1VQ9 V;  1NVP D;  1NBM G;  3E2E A;  3OE7 G;  2OCC B;  3ETG A;  3ABM B;  4TSF G;  1K4C C;  1COW G;  5LHH A;  1S0V A;  2DWD C;  3LSS A;  3OFN G;  1NVP B;  3RBZ A;  1AR1 B;  2DW4 A;  4X88 A;  4XBF A;  4DO2 A;  1H2G A;  4MT8 A;  1M9N A;  3T4Z A;  3IGA C;  1K7D A;  3EFF K;  1KKD A;  2YSU B;  1OCZ C;  2ZXW C;  4R8C A;  1OCC B;  5IYD O;  4JPR A;  4MVQ A;  4RUE A;  5FL7 G;  3JD4 A;  2EIK B;  1NJI W;  2EJR A;  2Z5U A;  2M7W A;  1OZ0 A;  4OXS A;  1QCE A;  2X6A A;  4XDK A;  5B1B C;  1S5H C;  3JCZ A;  3AG1 C;  2JJ2 G;  3E89 A;  4WFG A;  4JYB A;  1JOY A;  3OEE G;  1FXH A;  1R3K C;  2QM8 A;  5CBF A;  3RVZ A;  2IH1 C;  1UJW B;  3X2Q B;  3CCJ V;  1R73 A;  4UVB A;  1E1Q G;  1DLB A;  3A0R A;  4FK5 C;  3DTU B;  1L1F A;  2K1E A;  3BEH A;  5B1A B;  5B1O A;  1H38 A;  4QNH B;  3EHB B;  3JD0 A;  3VOU A;  5LHI A;  1K9M W;  5HFM A;  1AI6 A;  5L3F A;  3TCU A;  2WLI A;  3AG2 B;  2AHY A;  3LNM B;  4WFE A;  1SES A;  2OTL V;  2P90 A;  4QE7 A;  4XDL A;  3M99 B;  1VQM V;  2YEV B;  3CYO A;  3KG2 A;  2HLD G;  5IY5 C;  1FXK B;  1IXM A;  2GSM B;  4GCZ A;  2D3O W;  1XL4 A;  4LP8 A;  3MD0 A;  3ZRS A;  4R7C A;  1YJW V;  3K08 A;  1KEC A;  4Q20 A;  3OR6 C;  2DYS C;  3K0G A;  2HG5 C;  5J9P C;  2V7Q G;  4P9O A;  1DF5 A;  1M56 B;  2JJ1 G;  1R3L C;  1CP9 A;  4KFM A;  3GWO A;  2JDI G;  2QE7 G;  1BL8 A;  2Q67 A;  4X89 A;  3JD1 A;  3W7W A;  3WG7 C;  3OUF A;  1JCH A;  2FTK A;  4JAU A;  1R3I C;  1E1R G;  4R6Z A;  2F43 G;  1QVG U;  4MTF A;  1VQN V;  2DYR B;  2XAS A;  1SER A;  1RPO A;  5L3E A;  1W2B U;  4RUF A;  1S3J A;  1OCR C;  1ARO P;  3ASN B;  1Y66 A;  1M57 C;  5GW7 A;  3QO8 A;  4WFA V;  2Y69 C;  4MVZ A;  4PA3 A;  1FS0 G;  3ZRW A;  1QVF U;  3STZ C;  1JPX A;  2X6B A;  4PA9 A;  5CN0 A;  1YIT V;  2WAM A;  2XOK G;  1K33 A;  3ASO C;  4QPK A;  4XDJ A;  2Q6A A;  1EBO A;  1QLE B;  3ZMT A;  2EIM B;  5KUK A;  3W7S A;  4FPP A;  2EBO A;  3AG4 B;  1ROP A;  2R9R B;  1GKF A;  4GT1 A;  2WLN A;  2PI4 A;  3CCQ V;  3RW0 A;  4G28 B;  1ENV A;  4PDL A;  5H6Q A;  1OCO B;  1M1K W;  2WLI B;  2XAF A;  2EIL C;  1E79 G;  4RAI A;  3CMA V;  5LGU A;  3K3W A;  1MOF A;  1TUE B;  4HAM A;  3ABK C;  3P30 A;  2Y48 A;  4WFF A;  4LC1 A;  1RPR A;  3SPJ A;  5LGT A;  1AJQ A;  2HVJ C;  1W0J G;  5EBM C;  4HZ3 A;  3AG1 B;  3OM3 B;  3JYC A;  1M90 W;  3CCE V;  2WSS G;  4R50 A;  1YJN V;  3HPL C;  3R65 A;  3QO7 A;  5B3S C;  2KB1 A;  2EIN C;  2XAG A;  1YHQ V;  3FKS G;  5BZB A;  4JGS A;  2EIJ B;  1YJ9 V;  1AI5 A;  4WCE V;  4QPJ A;  1NR1 A;  3LDD A;  3BY6 A;  3SPC A;  5EC2 C;  1Q81 W;  3ABL B;  4G27 B;  1NH2 D;  1G4Y B;  2AHZ A;  1Q86 W;  4MTX A;  3OMA B;  4GX2 A;  3ZMV A;  2DQ0 A;  3MHH C;  5H9C A;  4J9Z B;  5LGN A;  1K73 W;  1BHB A;  1H8H G;  3K04 A;  5HFL A;  3ETD A;  3G71 V;  1NH2 B;  4UXN A;  2OCC C;  4TWK A;  3ABM C;  2ITD C;  3FB7 C;  3OMI B;  3I56 V;  3CCL V;  2BOC C;  1SRY A;  4PA6 A;  2A79 B;  1G8M A;  3LUT B;  5B1N A;  1RM1 B;  5IY5 B;  1KQS U;  1I5X A;  3P32 A;  1NR7 A;  2JIZ G;  2P6J A;  3H01 A;  1PD3 A;  5DN6 G;  2LFS A;  4GX0 A;  3E86 A;  4MVM A;  1KP2 A;  2IU3 A;  2WLL B;  4ASU G;  2BOB C;  1OCC C;  3G6E V;  3FYI B;  2ITC C;  2X7R B;  1V54 B;  4MTO A;  2XAQ A;  3AG3 B;  2NLJ C;  2EIK C;  1YI2 V;  2Z3Y A;  3ML0 A;  1ZWI C;  1YIJ V;  2IJI A;  3W7U A;  1KC8 W;  1OHH G;  1FFT B;  3W7T A;  4UV9 A;  2QKS A;  1V55 B;  2WLJ A;  2V1D A;  2LFR A;  2A9H A;  3JD3 A;  1CPY A;  4UVA A;  5IYB O;  5L3B A;  4UUJ C;  1JQ0 A;  3X2Q C;  1P7B A;  2JK5 C;  2B1G A;  2X6C A;  3ABU A;  4N23 A;  2IH3 C;  5B1A C;  1EZJ A;  1WPX A;  3SYO A;  1M57 B;  1PL0 A;  4MW3 A;  1QR9 A;  2WPD G;  4TT3 G;  2HFE C;  2IU0 A;  3F5W C;  4JF3 A;  1AI4 A;  2ZDI C;  4BIZ A;  4RQE A;  1P4R A;  5L3G A;  4YXW G;  2XAH A;  3AG2 C;  1I5Y A;  3IFX A;  3GB7 C;  3NXS A;  3QO5 A;  4MSW C;  4E2L A;  1K3E A;  3QNE A;  3CP1 A;  1THZ A;  3E8F A;  3FB5 C;  3F7V C;  3CCV V;  1FXK C;  2IW5 A;  4MVR A;  3SYQ A;  5DM6 V;  1CEZ A;  3E83 A;  2OTJ V;  1AJP A;  3LSQ A;  3E35 A;  2W0F C;  2ZR2 A;  5IYC O;  1VQ5 V;  3ETE A;  3CC4 V;  2IJJ A;  1MSW D;  3ABK B;  1M56 C;  4P30 A;  2IJK A;  5KA6 A;  2P67 A;  3CCU V;  1GM9 A;  1GMG A;  3HB3 B;  4FIP C;  4FJC C;  2JEU A;  4H37 A;  3W7X A;  4CBC A;  1J95 A;  2XND G;  3ZMU A;  3F7Y C;  3CPW U;  4I5S A;  3K9A A;  4WFH A;  2QM7 A;  4ZBM A;  2ATK C;  1OCZ B;  2ZXW B;  4G2K A;  2QA4 V;  2NNU A;  5L3C A;  3CCM V;  4JYC A;  1S76 D;  1JJ2 U;  5IDJ A;  5EBW C;  3B77 A;  3OGC C;  2ZDI A;  3I55 V;  1K5S A;  2DYR C;  1VQ8 V;  1GM7 A;  4HYO A;  3OR7 C;  2DWE C;  1EFR G;  2Q69 A;  2R9I A;  4L87 A;  3ASN C;  3CCS V;  3FB6 C;  5B1B B;  1VQO V;  4JTA B;  1NKD A;  1FXK A;  5CA3 A;  3VBB A;  4WFB V;  3RVY A;  5CBG A;  4BAY A;  2IJH A;  3K03 A;  1R6K A;  2W6J G;  3D36 A;  2HJF C;  3PJS K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...