3CCJV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccjV00
3G4SV 4WCEV 1VQKV 3CCLV 1KC8W 1N8RW 3CCMV 1M90W 2OTLV 3G6EV 4WFAV 1Q7YW 1VQNV 3I56V 1YITV 1KD1W 4WFBV 3CCRV 1YJ9V 5DM6V 1R73A 3CCVV 1Q81W 1Q82W 1VQLV 1VQ4V 3CCEV 1VQ5V 3I55V 3CCSV 1YJNV 1YJWV 2D3OW 3CCUV 1K9MW 1VQ8V 3CC7V 2OTJV 1YI2V 3CMEV 3CCJV 1VQPV 1VQ7V 1JJ2U 2QEXV 3CXCU 1VQ9V 1S72V 1W2BU 1NJIW 3CC4V 1VQ6V 4WF9V 1YIJV 1Q86W 1K73W 3G71V 1VQMV 3CPWU 1QVFU 3CD6V 1YHQV 1QVGU 3CCQV 1M1KW 3CC2V 2QA4V 1KQSU 1K8AW 1VQOV 3OW2U 3CMAV
chains in the Genus database with same CATH superfamily
1COWG 4X88A 3JALA 1D5AA 3OT7A 1S0VA 3SYOA 4PHZA 2ZNJA 4P9OA 2XHBA 1N33B 1V9PA 2KG7A 1KP2A 1K97A 2XTAA 4B3SB 3CCUV 2EINB 1GK9A 1W2BU 1NJIW 3OR7C 1Q86W 4UV9A 4IL6Z 3HKEA 4J41A 4X1IB 4JYAO 4EB6B 1X59A 5LGTA 2HJDA 2JDIG 4FVMA 3EXAA 3ZHTA 1K92A 1HW7A 4TUYA 4X66O 2ZXWB 2Q0OC 1PD3A 3AG3C 1SETA 3P30A 3WB1A 4LBEC 1JFFB 2UXXA 2DYSC 2QR4A 2RDCA 1Y74B 3MHSC 2QSAA 4O2BA 1KP3A 3WFVA 2XAQA 4MTOA 4X62O 4X65O 1NBMG 4GX2A 3CCSV 5JJEB 4YIPA 4JAVA 3E22A 1JQ0A 3BFRA 1QCEA 5JWPA 2KB1A 2CDYA 2A9HA 3ML0A 2YIAA 1HNZO 4DR3B 3IFXA 3AG7A 1CXZB 4K8XA 1FXHA 3W7SA 2QDOA 1OJHA 2X6CA 3BEHA 2EBOA 1FD9A 3FX7A 4B08A 2EX3A 4I4TB 1XHZA 2XAJA 4ICGA 5KX5A 2C2AA 4D7TA 3W7XA 4LF4B 3OR6C 3EVKA 4WBNB 3IGAC 3HKBA 4X64O 5EZYB 3ETQA 5B1NA 4CS3A 1XILA 1Y76B 4QNHB 2GSMB 1HNWO 3HB3B 5JVDB 2P4VA 1H8HG 3CHXA 5KUKA 2XASA 4PV1B 5EYPA 1SESA 5IJ0A 2WLIB 5F2VO 5EBMC 4FLWA 5LP6B 4BAYA 4MVZA 4JTDB 4FZ0A 4TOIA 5ITZB 1OCZB 4F6RB 1QLNA 4QE9A 4LF7B 4JASA 1DGSA 4DR6B 1ZL8B 5B1BC 4BIOA 3RYIB 4JI7O 4JZ2A 2FL4A 1AI6A 4F4LA 4CC5A 3NR7A 3CCEV 3A0HZ 5LXTB 1ZLZA 1G6UA 5LA6B 2OTJV 1KECA 2JEUA 1NKDA 1GTOA 4FFBA 3T4ZA 5LYJB 5L3FA 1PM9A 3HR0A 1AI5A 1GM9A 3CB2A 2W0FC 1NQTA 4DW0A 1YEWA 3CE2A 2W0XA 3SPJA 1I0HA 1FS0G 1KUQA 4HBNA 1TGOA 2WLKA 5B5EZ 1B3QA 1OCRC 3JD4A 4X1KB 2ZE8A 3AK2A 3ABKB 4L8JA 1S77D 5KUMA 3Q4HA 4B3RB 3LNMB 1L0NH 1VP7A 5EIBC 1FFXA 1ZAUA 4JI1B 1YXBA 4J7ZA 3EHBB 4MVUA 2AHZA 2ZM6O 4B3MO 1MG1A 3ZMZA 2WAMA 4NTYA 1AROP 1EN4A 2Q7GA 1M56B 3RYCB 1DTOA 1Y66A 3UT5B 3A0BZ 1H2GA 1CPYA 2E3CA 5K1PA 5KHIA 3T1HO 3FYIB 4G27B 3ASNB 4OXSA 4J42A 4LNUA 3LDEA 2E74B 4DR4B 4U3FH 2IBZH 3FB7C 4U3JB 2Y48A 1G4YB 1XNRB 4MW8A 2PZSA 2A3QA 2QM8A 1FXKB 2ZQMA 4FLUA 1ZWIC 4LFAB 3VQVA 2QTSA 1H2SB 4JI3O 3F5WC 4O4JB 1HDJA 1P4RA 4N23A 2ZE6A 4DV3B 2UUAO 3JCZA 3TETA 1HR0B 3AG2B 2HEPA 1WLEA 4PELA 3JD1A 4U7NA 1G8MA 3CD6V 4FMTA 4GKJB 4DRXB 1OCOC 1M1KW 4YHHO 3E8BA 4CH3A 5AG2A 1DLBA 2EILC 3UKMA 5DM6V 2JJ2G 3SYPA 2WLNA 2ADPA 1TVKB 1YF2A 4JAAA 3P3PA 3X2QC 1T5EA 3WU2Z 4X1YA 3ZMVA 5J2TA 5IYBO 4YJ2B 1QLEC 4BIZA 3N2GA 2L6LA 2OT5A 3K08A 1R3KC 5E1AC 1KKDA 3A8TA 1Y6XA 1K9MW 1QQCA 4O2AB 4ZBMA 1Z5WA 4A5UB 4JI2B 2CH7A 2P5OA 4OPAA 3CC2V 2XOKG 3T4DA 2YXYA 4FK5C 1Q7YW 4NXNB 4GYCB 4JTCB 4JI8O 1Q81W 3GB7C 2Q67A 1TUEB 3KCXA 5LMNO 2RQ6A 1F51A 2HVKC 4P30A 4MVMA 2CGOA 4X9QA 4PDVA 4QJFB 3L75H 1AILA 4DV1B 5IE9A 4YY3B 1QVGU 2A7WA 2E5LO 2FMLA 2MW2B 1IBLB 1YDXA 4JYBA 4LF6B 4LR3A 4PDLA 4NXMB 3B4SA 4DV7B 2YI9A 2PYJA 1KB9F 2FKXA 4ZI7B 3L9DA 2WSSG 3BA9A 1LUVA 1BZKA 1Q90D 2BTQA 2QWRB 2M6YA 4K3AA 2AW9A 1Q3EA 4UB8Z 4DO2A 4PI0A 4OX9B 4O4LB 1JVMA 2OWOA 4JI6B 3CCJV 4JZGA 3CXCU 1VQ9V 2HHHB 2UXCO 4X1IA 4EB6A 3HKDB 1YVWA 2YI8A 2F4VO 1VQ5V 4CS4A 4WFGA 3OGIB 4MSWC 3ETGA 4CZZA 1URFA 2Q73A 4F6EA 1Z5VA 2B1GA 3I56V 1VF5B 2VQEO 2XT9A 2F1MA 5EC1C 3OUFA 4AILC 1BSMA 4DR2B 1ZX3A 5FNVA 3ZN1A 1GAXA 4LFCO 1THZA 3ABLC 4LF8B 1IXBA 4DUZO 4QPJA 3ZMSA 3CMAV 1BQ0A 4ZHQB 5JH7B 1K4CC 4ASUG 2H8PC 3RFRA 4BR6A 4NTWA 1IBKB 1L0LH 4NR1A 2XAHA 2EZPA 3RWRD 2N04A 1K8AW 5H5NA 2V1DA 4X20B 2ZE5A 2IH3C 4XDJA 4KHPB 2QWNB 1K5SA 3AG4B 1GM7A 1UPGA 3UO2A 3GWOA 4PA9A 4I4TA 3RT3C 3FAVB 3K04A 2P06A 4ZKIA 4WBNA 3G71V 1R6TA 2UUCB 4GKKB 2E75B 2GUZB 4RUEA 5H6QA 4H33A 5EZYA 2ZKOA 4MVRA 4YIOA 1KU9A 3OEHG 4AQYB 1Y76A 3AG1B 3CJHB 4JI0B 1P49A 3CXHF 1SA0A 4EFEA 1EZJA 2YEVB 4JI5B 5CB4B 4FLVA 2FTKA 2YICA 3RN4A 1YIJV 4JI4B 3ETEA 5DECA 1WPBA 3CWBH 1D5NA 3OW2U 3L72H 4MVOA 1MSWD 4XBFA 5IJ9B 3QG5A 5ITZA 3G6EV 1TUBB 4HYOA 5L3BA 4Z2WA 4DR3O 2JGDB 4J80A 1GKFA 3VQYA 1YI2V 3K9SA 4JGSA 4WFHA 2IJIA 1ZL8A 3RYIA 4RWUA 1RSOB 4CC6A 1FJGB 2IJKA 4R8CA 3SPGA 2XNDG 5LXTA 4DR1O 4NTXA 5LA6A 3JD0A 4LF4O 2ZXWC 1NTMH 1N36B 2D2CB 1NTZH 3DC5A 4LF9B 3WG7C 2UXBO 2UUBB 2IU3A 1QVFU 1UJWB 4OGQB 1NR1A 5JJJB 4YJ3A 3FKSG 2QM4A 1M57B 4MS2A 4HNAA 4MTXA 4DK1A 5GTHZ 2E76B 1SZTA 1GMGA 2FYUH 2HVJC 3B8MA 3KCYA 3JCUZ 4HAMA 1S5JA 3SGIA 3SDLA 4CS2A 4H0LB 4IHJB 2QTOA 3ZHSA 5BMVA 2V4DA 4DV5B 1V54B 1TA8A 4MTGA 4J9YB 2B1IA 3ZHVA 5CBHA 3BRCA 1XI1A 1S72V 1BL8A 1K33A 4LF7O 1XNQB 3UT5A 1LR1A 3J80N 1ORQC 1E79G 4DR6O 4LF5B 5KMGB 1NH2B 3ZRWB 5LMUB 3ABMB 3E8GA 4QIWF 2JRIA 4KFMA 3OMIB 3FB6C 2VQFB 3A0RA 4J11A 3TCUA 2YC0A 2N05A 1VIBA 4O4HA 3CCMV 3RGBA 5KHJA 5B1AB 3CSXA 1RM1C 2UXDO 2VWJA 4PA3A 2HFEC 1KMIZ 2PY5A 4B3TB 4Z1VA 4DV4B 4O4JA 4B3RO 3EFFK 2DYSB 1VMGA 2A79B 1BS3A 3RVZA 3I5DA 4DXWA 2HKOA 2OTLV 1HNXB 2H94A 5GONA 2YIBD 1MNGA 1YTFB 3I55V 3JAWB 1OCZC 2UXNA 2R9IA 2DWDC 2QWOB 2IJJA 2Y4UA 4UCOA 2Q4PA 5JQGB 3SJAC 1Q8IA 2YSUB 3CCLV 1IBMB 1TVKA 4LWSA 1F4NA 2M7WA 4I5SA 5L3EA 1Z2GA 2IW5A 1PPJH 3BCCH 2X0LA 5D5QA 2K9PA 1Q82W 4TSFG 1VQ4V 5GW7A 1XMQB 1EZVH 1JX9A 1GRJA 3MDSA 2ZIOA 3UQ8A 2Y69C 1O9GA 4DR4O 4JYAB 4DUYO 3MD0A 1KKCA 1RP3B 1EN6A 2VS0A 4HZ3A 5IYCO 1OHHG 3K3WA 3ZJZA 1PL0A 4O2AA 5TISZ 3ZHQA 2A0LA 4ABMA 1P7BA 4RAIA 3FYEB 3BVOA 3BA8A 2AXTZ 1VF6A 4FLZA 1WA8B 1SERA 4Q20A 3DXRB 2KQXA 4CH6A 5CA0B 5KAFZ 2QA4V 1FKAO 4X65B 5B3SC 1Y4MA 4H44B 1XEQA 4R7CA 2EIKB 2QJ1A 3N2KB 4DR7O 1QNMA 1M5IA 3ZHUA 4GKJO 4WFAV 5J2UB 1M56C 1VF7A 3JSLA 2QKSA 5IYDO 1HNZB 4UVAA 1R1BA 4W4KA 2F23A 3B40A 1JPXA 1N34B 5CN0A 4LP8A 5IWAB 3OEEG 5LL6Y 2DQ3A 2Z0AA 3ASNC 2P22C 5BR8O 5IDJA 5KHGA 3HKEB 3W7WA 3CCVV 4JYCA 3OTFA 5FPOA 4JAUA 3LDDA 1BE3H 3CMEV 2ITDC 3J7AU 1FXKC 2ZD9A 1SF9A 4TV8B 4X64B 3ZBHA 5H9CA 1SQFA 2NR5A 4KP4A 1MZEA 3G4SV 4JI2O 4K0KO 1SQGA 1HNWB 2ADQB 3GWKC 3L71H 4PD4F 2DWEC 4DV6O 5IY5C 3HKDA 4PDRA 1ZTEA 2LGWA 2CTPA 1NH2D 2LQTA 2OYQA 1OV9A 3SJQC 3E89A 4CBCA 4NKGB 2HP8A 4WFFA 4DV1O 4YY3O 3UM7A 3QO7A 5EK0A 1N32O 4LF6O 2WLJA 2RNBA 3B2EE 4NXMO 4DV2O 3OTOO 3CRCA 5E79Z 1IX9A 5LHIA 4E4EA 4JI7B 3CPWU 4ZHQA 5JH7A 3DTUB 1GN4A 3BAAA 4JF3A 3JARB 2NN4A 3M99B 1H2LA 5KX5B 1HP8A 2V7QG 3SR2C 1Q5OA 2BOCC 4XDKA 2YIBA 1AI7A 2P4KA 1XL6A 4ZOLB 3ZMTA 3C3SA 4FLYA 1YTFD 2ZT9B 4JI6O 3RBZA 1VF6C 2HHHO 3SYAA 1PNKA 1H2NA 1H38A 2Q5ZA 4K8ZA 2R70A 3RW0A 5EYPB 3K5MA 3B77A 3ZS8C 3CCRV 1KD1W 5IJ0B 3CS5A 4UCVA 1K34A 1XMOB 5LOVB 2Q6AA 1SQQH 4B3MB 1H2KA 1OCOB 3CJHA 2CE4A 4GT1A 3OAAG 4MVQA 4LF8O 2EILB 2YEVA 2LFRA 5CB4A 3T1HB 1KBHA 4R50A 3JASA 4UUJC 3WB0A 5K1XA 1VQ8V 3K03A 4U7OA 3H1JH 2P6JA 3ABTA 4MTFA 1J5EO 5IJ9A 2VRZA 1K4DC 3MHHC 4I55B 4FFBB 3CRQA 5H2FZ 2DQ0A 1VQOV 1IBKO 4LH7A 2QWQB 4JV5B 1NT2B 4QPKA 2JGDA 1V55C 2AZ0A 4LCUC 4DR5B 2W6JG 2QGNA 1K3EA 4K35A 2GBOA 5J9PC 3KG2A 1RSOA 2LGQA 4KHPO 1NI8A 3ABUA 1VQ7V 5HFLA 3MAQA 3ASOB 1U97A 3G6BA 4PDMA 3RYHB 4CH4A 5A9GA 3CCQV 1YHQV 2UUAB 4ZIBA 2H3OA 2JJ1G 1HWYA 3K06A 3DC6A 1FFXB 2IU0A 2OIEA 5C8YB 2UUCO 1OCCB 3D3IA 2Y4TA 2F95B 3CX5F 5FLXN 1N0JA 2DYRB 2EULA 2IJHA 3E35A 4YHHB 2QEXV 1GN2A 3ZIAG 5FL7G 1NR7A 1Y67A 4JI4O 4PA6A 4I50B 1IVSA 2LP7A 3FB5C 3H1LH 1FXVA 4LNUB 2PGGA 3LDCA 5CBFA 1D2DA 1JFFA 3U10A 1VQMV 2BCCH 1I5XA 1Y74A 1AR4A 5KMGA 2W6IG 1R6KA 2Y0PA 3TXSA 1I94B 4QGPA 5EIBD 4UXNA 1Q43A 4FLTA 1FJGO 5JCOA 2EIJC 4NYKA 1L8DA 1GN6A 4KUMA 3BY6A 5L3DA 1N33O 5DEDA 1AR5A 1K5QA 3D3QA 4B3SO 3K79A 4JI8B 1M90W 5LMNB 5IYZB 4LF9O 3K57A 3CRAA 2QKCA 3HKCB 2DW4A 3AG1C 3LSSA 4UFZA 1WJZA 2CAZC 2OCCB 2JS5A 4IGGA 1SRYA 1LNQA 2MK3A 5CBGA 1GH6A 4DV0B 4PI2A 1K73W 3P3NA 2P7TC 3K59A 5HFMA 3RVYA 3E2EA 1J95A 3JAWA 1PV0A 4UB6Z 3JATB 4X1YB 4DV5O 1AI4A 5J2TB 5LGUA 1DK1A 2WLLB 3STLC 1WNSA 4P9PA 4I0XB 1XNQO 2GV9A 1SQPH 2ZR3A 2WA4A 4Q6GA 5JVDA 3N2GB 2XAGA 2ZR2A 2EIMB 1AVMA 2ZE7A 5LMUO 2AHYA 4J10A 1M93A 3IJ4A 2WLIA 4BW9A 1XREA 4LFBB 5LP6A 2ATKC 4KXRA 2QM7A 4MT8A 1QBZA 3IC7A 1X4TA 4F6RA 2UXCB 2FB5A 1EM1A 4IIJB 2PUSA 4L87A 3SJCC 4XDLA 2EZOA 2UU9B 1JCHA 1F23A 3T1YB 2EINC 3TK1A 3SYCA 2VQEB 2JEXA 4RUFA 2BTOA 2CTRA 3LSQA 1E1QG 3QTCA 4E2LA 1EN5A 4B3TO 2Q69A 5CA1B 3L74H 4LFCB 3THOA 5EBLC 5B1OA 3JAKB 4FM2A 3ZX6A 3DXRA 4DUZB 4TQDA 5LYJA 1HNXO 1XUQA 1I5YA 2Q0AA 3CC4V 2WA3A 3N2KA 2XAFA 1V54C 3OUSA 4CH5A 3O65A 5LHGA 5J2UA 1MABG 1XL4A 3N27A 4X1KA 1W0JG 2DOSA 2RJZA 2BTQB 2R9RB 3ABMC 1ZSPA 5CMUA 1IBMO 3M8AA 2PYLA 4G28B 5JCOC 2JK5C 1MA1A 1QU7A 2JS3A 2XUMA 1XMQO 1ZUQA 5LHHA 1N0NA 1KQSU 4TV9B 2PTMA 1JR9A 3G80A 3RYCA 1N8RW 5B1AC 1AJNA 1VARA 1SQVH 4DK0A 4TV8A 1VQPV 1S3JA 1WAZA 3WG7B 1TAEA 2CGNA 4BWAA 2JGUA 4GX0A 5FNVB 2ZIMA 3OD4A 3BPZA 3CP1A 4RQEA 1DF5A 1PNMA 3ICXA 1LUWA 4U3JA 3D36A 3J81N 2R9AA 1FFTB 2G38A 2PF4E 1BMFG 1FXKA 3AG3B 2B5UA 2DE0X 3RYFB 4RO2A 1XQ8A 2P90A 5JJNB 4QE7A 3VQXA 4YXWG 3GVMA 5KLVH 3R65A 5KA6A 1N34O 1S5HC 5IWAO 4JI1O 5BZBA 3W7TA 5LP6C 1H8EG 1VQLV 1Q6UA 4B7KA 5L3CA 4DRXA 3JARA 1MMMA 4KL1A 4DR1B 3M7MX 3LUTB 3TJTA 4B7EA 3O9OA 1F4MA 3G67A 2WLMA 5H6RA 1K7DA 4NVPA 1RM1B 2UXBB 4ZOLA 3FB8C 1SS3A 1XBLA 1YJWV 3CC7V 4PA7A 1ENVA 4YJ2A 1SA0B 2BSKB 2ETNA 4H13B 2EIKC 4X66B 4GCZA 1XNRO 3ZMUA 3SPHA 1E1RG 2Y0IA 1FYJA 3PN1A 2BE3A 5LOVA 4LFAO 4DYLA 3ABKC 3E8FA 1XDCA 2CTWA 5LGNA 4NB5A 4DV3O 1SQBH 2JIZG 3FFQA 1HR0O 1XHXA 4X62B 1US6A 4O4IB 3VQWA 4LC1A 1DF4A 2K1EA 2Z5UA 2NLJC 4JPRA 4I9QA 4PA4A 1YZBA 3K5LA 4FLXA 2GDSA 3JALB 4LH6A 4EFBA 4I55A 2QWPB 2Y69B 2Q8VA 2KG7B 1IZ3A 4FIPC 2P67A 2Q68A 4TWKA 4BIUA 2UXDB 5B1BB 4ZI7A 2OIGA 1WP7A 4YJ3B 2CTQA 1O9HA 1IDSA 4X89A 2KKWA 4HNAB 3RYHA 1WP8A 1L1FA 3D36C 1A32A 2GTAA 3BHPA 4IT5A 5IT9N 4TUYB 1EFRG 5C8YA 3ETDA 3P32A 3E86A 2ITCC 3K0DA 4X8AA 5BXZA 5B3SB 2D3OW 2PI4A 1XMOO 3TGUH 5BMVB 1KC8W 4P2ZA 4O4LA 2F43G 1NTKH 2DN9A 3B8NA 1Q6IA 1R3JC 1GM8A 1OCRB 2Q7HA 3AG2C 1AJQA 1JMKC 4O2BB 3LSUA 3UO3A 2N74A 2R72A 4NXNO 3SPCA 4WF9V 4MW3A 4UCUA 3ZCCA 4FZ1A 4I50A 5EC2C 3K58A 3E22B 1WPXA 4UV8A 1B04A 1U96A 2CUGA 5KAIZ 3KKYA 3VBBA 4GLXA 3OM3B 1NU1H 2X6BA 4DUYB 4O4HB 1IBLO 4JV5O 2Q7EA 3C3TA 3K9AA 4DR5O 2LJ2A 5A2QN 3OE7G 4DV7O 4J7JA 3H1KH 2F66C 4W4LA 1RPRA 2RCVA 1P84F 4EEQA 1N4CA 4WCEV 3H1HH 1GO3F 5KA5A 3S3WA 1AJPA 3H1IH 1BQZA 4WFBV 1NVPB 2F93B 4IYIA 3ZN0A 3VOUA 5IY5B 3ZRXA 5GONB 3HKBB 4DR7B 3D8CA 5IYZA 5C93A 4X20A 1FPOA 2RN9A 3LNNA 4OX9O 3HKCA 1JJOA 3E8HA 4D6TH 1M9NA 2B9ZA 2HLDG 2GTSA 1MSDA 3ZRVA 4JTAB 1B06A 2EJRA 1SKVA 3FAVA 1F7YA 4R6ZA 4J7KA 3R66A 4LWSB 3T2MA 4OPHA 4DW1A 2GUZA 1JJ2U 5BR8B 4GX1A 2ZM6B 4FM0A 1GN3A 3JATA 3W7UA 3JYCA 2WLLA 2WLHA 3OMAB 4DR2O 1SZXA 4I0XA 2ODMA 1PKXA 3H9VA 5B66Z 2ZINA 3DGEA 1SC5B 2ZDIA 1I94O 1YJNV 3UCSC 2GHYA 3STZC 4K0KB 1VQ6V 2AGAA 1I08A 3ASOC 1ROPA 3SJBC 3X2QB 1R6NA 1TUBA 3QO8A 4DV6B 3H01A 3A2FA 3BABA 2YUAA 4IIJA 1S76D 1OCCC 1QLEB 1YJ9V 1R73A 1CEZA 2ARHA 3JD2A 2JVDA 3ZRSA 3F7YC 2BOBC 1PP9H 2DYRC 1P7GA 1XOUA 5EBWC 4MVSA 2LFSA 1Q6HA 3SYQA 4JI3B 3E83A 1N32B 5CA1A 3Q4HB 4G2KA 4GUNA 4UCSA 3JAKA 3B09A 4DV0O 4DV2B 1PL4A 4H37A 3OTOB 1FAFA 1AP6A 2RMKB 4GKKO 3K5OA 3CRRA 1M4UA 3K0GA 4FFKA 2HJFC 4I9WA 1MOFA 1UFIA 4AQYO 1RPOA 3HPLC 4BW5A 4JI0O 3DSQA 3K5NA 2EJ7A 1AR1B 4JI5O 3AK1A 4TQFA 1V55B 1AB3A 1BHAA 3PJSK 1PNLA 2O57A 5GTIZ 2PI5A 2NNUA 4IHJA 5L3GA 4LFBO 1I7FA 1RFYA 3NXSA 3CEIA 4Z1MG 4TV9A 4RQFA 2IH1C 2YXHA 1YSCA 4D7SA 2OCHA 3U11A 2UU9O 3C90A 2YDEA 3T1YO 3ZRWA 1VQKV 1QR8A 2HR3A 3QNEA 2A06H 3OGCC 4PJ0Z 3AG4C 2WPDG 5DN6G 1WB7A 3AK3A 2OCCC 1CP9A 1IXMA 1WN7A 4C7UA 3L73H 3T1CA 1KYOF 1NS1A 2YIDA 1H2MA 4UCTA 3WB2A 1W59A 1N36O 4GZRB 5FPRA 4FJCC 4UVCA 1BGYH 2UUBO 2LW1A 1J5EB 3OFNG 2ZCEA 2ILMA 2KSDA 1SQXH 5KHHA 3RYFA 2HG5C 3KZIZ 3JD3A 4WFEA 3JAMN 1W0KG 2E5LB 2EIMC 5BY1A 3SPIA 2IM9A 2ZDIC 1WB8A 1QR9A 2DMXA 1NVPD 3ABLB 3U0ZA 2AZ2A 2LW7A 3IC9A 2L35A 1JA8A 4FM1A 2CK3G 2Q9LA 2VWKA 1YITV 4TT3G 2EIJB 4GX5A 4N21A 2YS8A 3FD9A 4I7ZB 3CRMA 1VEWA 4JYYA 5JQGA 3QO5A 4LF5O 1NZ6A 3TXQA 1IURA 1AP5A 2CH7B 2YXLA 2Z3YA 3F5TA 4EKWA 4AI8A 2VQFO 1G1XB 3AEIA 3QF7A 2DJVA 1QHTA 4AHCA 4IYHA 2F4VB 2BSKA 5LBQA 3IAYA 4UCRA 1BT8A 3APOA 3CYOA 3JASB 1BCCH 3S3XA 1YCIA 2WWWA 4FPPA 4J9ZB 2QKAA 5CA3A 1JOYA 1OZ0A 1R3IC 1B6QA 3OMNB 3ZHRA 1M57C 1S5LZ 2X7RB 2LO1A 1VQNV 2ZNIA 4DV4O 3L70H 1EBOA 1MZFA 3QVNA 3F7VC 1WA8A 3JSNA 5CA0A 5KHKA 2QE7G 1BHBA 4O4IA 2X6AA 3ZEDA 1R3LC 3APQA 4UVBA 5D5PA
chains in the Genus database with same CATH topology
2EIKC 1COWG 3M99B 4GCZA 4WFGA 4X88A 4MSWC 3ETGA 3ZMUA 1S0VA 3SYOA 3SPHA 1E1RG 4CZZA 4P9OA 2V7QG 3I56V 2B1GA 2BOCC 1KP2A 1K97A 4XDKA 5EC1C 3CCUV 3OUFA 3ABKC 1AI7A 3E8FA 5LGNA 1XL6A 2EINB 1GK9A 3ZN1A 1W2BU 1NJIW 3ZMTA 3OR7C 1Q86W 1THZA 1YTFD 2JIZG 3ABLC 4UV9A 3RBZA 4QPJA 3ZMSA 3CMAV 4LC1A 1DF4A 2K1EA 1PNKA 3SYAA 2JDIG 5LGTA 1H38A 3RW0A 2Z5UA 1K4CC 2NLJC 4JPRA 4ASUG 3B77A 3CCRV 1KD1W 4PA4A 1K92A 2H8PC 2ZXWB 1PD3A 1K34A 2Y69B 3AG3C 1SETA 2Q6AA 3P30A 4FIPC 2XAHA 2EZPA 2P67A 2Q68A 4TWKA 1OCOB 4BIUA 1K8AW 4LBEC 2V1DA 2UXXA 2DYSC 5B1BB 4GT1A 3MHSC 3W7UA 3OAAG 2IH3C 4XDJA 4MVQA 1KP3A 1K5SA 2EILB 3AG4B 2YEVA 2LFRA 4X89A 3WFVA 1GM7A 2XAQA 4MTOA 3GWOA 1NBMG 4GX2A 4PA9A 3CCSV 4R50A 4UUJC 1VQ8V 4JAVA 3K03A 3K04A 4U7OA 1JQ0A 1L1FA 2P6JA 3ABTA 4MTFA 4ZKIA 3G71V 1EFRG 1QCEA 3ETDA 3P32A 3E86A 2ITCC 2KB1A 3K0DA 3MHHC 1K4DC 4X8AA 2A9HA 3ML0A 4RUEA 5B3SB 2DQ0A 1VQOV 2D3OW 2PI4A 5H6QA 4H33A 1KC8W 4P2ZA 4QPKA 4MVRA 1V55C 2F43G 4LCUC 3IFXA 3OEHG 3AG1B 3B8NA 2W6JG 1FXHA 1K3EA 1R3JC 3W7SA 1GM8A 5J9PC 1OCRB 3KG2A 3AG2C 1AJQA 1EZJA 2YEVB 2X6CA 3ABUA 1VQ7V 3BEHA 2EBOA 2FTKA 5HFLA 3SPCA 4WF9V 4MW3A 1YIJV 3ETEA 3ASOB 3ZCCA 4PDMA 1YHQV 3CCQV 2XAJA 5EC2C 2C2AA 1WPXA 3W7XA 3OW2U 4UV8A 3OR6C 2JJ1G 1HWYA 3K06A 4MVOA 2IU0A 4XBFA 3VBBA 1MSWD 3IGAC 3G6EV 1OCCB 3OM3B 4HYOA 2X6BA 3D3IA 5L3BA 5B1NA 1GKFA 3K9AA 2DYRB 4QNHB 1YI2V 4JGSA 2GSMB 4WFHA 3OE7G 2IJIA 2IJHA 3E35A 2QEXV 3HB3B 3ZIAG 5FL7G 1NR7A 1H8HG 2IJKA 1RPRA 2XASA 4R8CA 5KUKA 3SPGA 4WCEV 1SESA 2XNDG 2WLIB 1GO3F 5KA5A 4PA6A 1AJPA 5EBMC 2LP7A 3JD0A 4WFBV 1NVPB 4BAYA 3FB5C 2ZXWC 3ZN0A 4MVZA 1FXVA 3VOUA 5IY5B 3ZRXA 3LDCA 4JTDB 1OCZB 5CBFA 1QLNA 4QE9A 4JASA 3WG7C 5C93A 2IU3A 1VQMV 1I5XA 1QVFU 1UJWB 1NR1A 3E8HA 1M9NA 3FKSG 2W6IG 1R6KA 2HLDG 5B1BC 3ZRVA 1M57B 4MS2A 4MTXA 4JTAB 2EJRA 1AI6A 1SZTA 1GMGA 4UXNA 4F4LA 2HVJC 3B8MA 2EIJC 4HAMA 4R6ZA 3CCEV 3T2MA 2OTJV 1KECA 2JEUA 4KUMA 1NKDA 1JJ2U 1GTOA 3BY6A 4GX1A 5L3DA 3T4ZA 2QTOA 1K5QA 1V54B 5L3FA 3K79A 4MTGA 3JYCA 1AI5A 1GM9A 2B1IA 4J9YB 5CBHA 2WLLA 2WLHA 3OMAB 2W0FC 1M90W 1S72V 1BL8A 1K33A 1NQTA 1PKXA 2DW4A 1ORQC 3AG1C 1E79G 3LSSA 3SPJA 1NH2B 1FS0G 2WLKA 3ZRWB 3DGEA 3ABMB 2ZDIA 1OCRC 1YJNV 3JD4A 2OCCB 2GHYA 3ABKB 3E8GA 1S77D 5KUMA 1SRYA 1LNQA 2MK3A 3STZC 4QIWF 3LNMB 5CBGA 1VQ6V 4KFMA 1K73W 3ASOC 3OMIB 1ROPA 2P7TC 3FB6C 3X2QB 5HFMA 3RVYA 3A0RA 1R6NA 3QO8A 3TCUA 3EHBB 3H01A 1J95A 4MVUA 3E2EA 2AHZA 1S76D 1MG1A 3ZMZA 2WAMA 3CCMV 1AROP 1OCCC 1AI4A 1QLEB 5LGUA 5B1AB 2WLLB 1RM1C 1YJ9V 3STLC 1R73A 1CEZA 1M56B 4P9PA 3JD2A 3ZRSA 1DTOA 1Y66A 2ZR3A 3F7YC 2BOBC 2DYRC 1H2GA 4PA3A 2XAGA 2HFEC 2ZR2A 1CPYA 2EIMB 4MVSA 5EBWC 2LFSA 3SYQA 2AHYA 3E83A 3FYIB 2WLIA 4G2KA 3EFFK 4G27B 2DYSB 3ASNB 2A79B 2ATKC 4OXSA 3RVZA 4DXWA 2HKOA 2OTLV 2QM7A 4H37A 3LDEA 2H94A 4MT8A 1QBZA 3IC7A 1YTFB 3K0GA 3I55V 2HJFC 4I9WA 4L87A 1OCZC 3FB7C 4XDLA 2EZOA 2UXNA 2Y48A 1MOFA 2R9IA 2DWDC 1G4YB 1JCHA 1F23A 1RPOA 2EINC 3TK1A 2IJJA 3HPLC 4MW8A 4BW5A 3SYCA 2JEXA 2QM8A 1FXKB 4RUFA 2ZQMA 3LSQA 1E1QG 1ZWIC 2YSUB 1AR1B 4E2LA 3CCLV 1V55B 1BHAA 3F5WC 2Q69A 1F4NA 1P4RA 2M7WA 3PJSK 4I5SA 4N23A 5L3EA 1PNLA 2IW5A 2X0LA 3JCZA 3TETA 1Q82W 5EBLC 5B1OA 4TSFG 1VQ4V 2NNUA 5GW7A 5L3GA 2PI5A 1JX9A 3AG2B 3NXSA 4Z1MG 2Y69C 1WLEA 4RQFA 4PELA 1I5YA 2IH1C 3JD1A 3CC4V 4U7NA 1G8MA 2XAFA 3MD0A 1V54C 3OUSA 1YSCA 3CD6V 4FMTA 1OCOC 5LHGA 1M1KW 4HZ3A 1MABG 1XL4A 5IYCO 3ZRWA 3E8BA 1VQKV 1QR8A 1OHHG 2HR3A 3K3WA 3QNEA 3ZJZA 1W0JG 1DLBA 1PL0A 3OGCC 2EILC 3AG4C 2R9RB 2WPDG 3ABMC 3UKMA 5DM6V 5DN6G 2JJ2G 2A0LA 5CMUA 3SYPA 2WLNA 1P7BA 2OCCC 1CP9A 1IXMA 3FYEB 4RAIA 4G28B 2JK5C 3T1CA 3X2QC 1SERA 4Q20A 5LHHA 2QA4V 1KQSU 3ZMVA 5B3SC 1Y4MA 5IYBO 4R7CA 2EIKB 4FJCC 4UVCA 1N8RW 1QLEC 5B1AC 4WFAV 4BIZA 1AJNA 1M56C 2OT5A 3K08A 3OFNG 1R3KC 5E1AC 1KKDA 2HG5C 4WFEA 3JD3A 2QKSA 1W0KG 1K9MW 5IYDO 4UVAA 2EIMC 4ZBMA 3SPIA 1VQPV 1S3JA 2ZDIC 3WG7B 1JPXA 1QR9A 1NVPD 5CN0A 3ABLB 4LP8A 3CC2V 3OEEG 4GX0A 2DQ3A 3ASNC 2XOKG 3T4DA 3CP1A 5IDJA 4RQEA 1DF5A 4FK5C 1PNMA 2CK3G 1Q7YW 1YITV 4TT3G 2EIJB 4JTCB 3W7WA 3CCVV 4GX5A 3GB7C 4JYCA 1Q81W 4N21A 3D36A 2Q67A 1TUEB 1FFTB 4JAUA 1F51A 2HVKC 3LDDA 4P30A 1BMFG 4MVMA 3CMEV 4PDVA 2ITDC 1FXKA 3AG3B 4QJFB 3QO5A 2B5UA 4RO2A 2P90A 4QE7A 1FXKC 2ZD9A 1QVGU 5H9CA 4YXWG 4KP4A 4JYBA 2Z3YA 3G4SV 3R65A 5KA6A 4PDLA 1S5HC 4EKWA 5BZBA 3W7TA 1H8EG 1VQLV 3AEIA 2DWEC 5IY5C 4PDRA 5L3CA 5LBQA 2WSSG 3CYOA 1NH2D 3SJQC 3LUTB 2WWWA 3E89A 4FPPA 4J9ZB 4CBCA 5CA3A 1JOYA 1OZ0A 1R3IC 1B6QA 3OMNB 1M57C 1F4MA 2X7RB 4WFFA 2WLMA 5H6RA 1VQNV 3UM7A 1K7DA 3QO7A 5EK0A 1RM1B 4DO2A 1EBOA 3FB8C 3F7VC 1JVMA 1YJWV 2WLJA 3CC7V 4PA7A 3CCJV 2QE7G 3CXCU 1VQ9V 1BHBA 1ENVA 5LHIA 3CPWU 2X6AA 3DTUB 1R3LC 4UVBA 1VQ5V 4JF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S V;  4WCE V;  1VQK V;  3CCL V;  1KC8 W;  1N8R W;  3CCM V;  1M90 W;  2OTL V;  3G6E V;  4WFA V;  1Q7Y W;  1VQN V;  3I56 V;  1YIT V;  1KD1 W;  4WFB V;  3CCR V;  1YJ9 V;  5DM6 V;  1R73 A;  3CCV V;  1Q81 W;  1Q82 W;  1VQL V;  1VQ4 V;  3CCE V;  1VQ5 V;  3I55 V;  3CCS V;  1YJN V;  1YJW V;  2D3O W;  3CCU V;  1K9M W;  1VQ8 V;  3CC7 V;  2OTJ V;  1YI2 V;  3CME V;  3CCJ V;  1VQP V;  1VQ7 V;  1JJ2 U;  2QEX V;  3CXC U;  1VQ9 V;  1S72 V;  1W2B U;  1NJI W;  3CC4 V;  1VQ6 V;  4WF9 V;  1YIJ V;  1Q86 W;  1K73 W;  3G71 V;  1VQM V;  3CPW U;  1QVF U;  3CD6 V;  1YHQ V;  1QVG U;  3CCQ V;  1M1K W;  3CC2 V;  2QA4 V;  1KQS U;  1K8A W;  1VQO V;  3OW2 U;  3CMA V; 
#chains in the Genus database with same CATH topology
 1COW G;  4X88 A;  3JAL A;  1D5A A;  3OT7 A;  1S0V A;  3SYO A;  4PHZ A;  2ZNJ A;  4P9O A;  2XHB A;  1N33 B;  1V9P A;  2KG7 A;  1KP2 A;  1K97 A;  2XTA A;  4B3S B;  3CCU V;  2EIN B;  1GK9 A;  1W2B U;  1NJI W;  3OR7 C;  1Q86 W;  4UV9 A;  4IL6 Z;  3HKE A;  4J41 A;  4X1I B;  4JYA O;  4EB6 B;  1X59 A;  5LGT A;  2HJD A;  2JDI G;  4FVM A;  3EXA A;  3ZHT A;  1K92 A;  1HW7 A;  4TUY A;  4X66 O;  2ZXW B;  2Q0O C;  1PD3 A;  3AG3 C;  1SET A;  3P30 A;  3WB1 A;  4LBE C;  1JFF B;  2UXX A;  2DYS C;  2QR4 A;  2RDC A;  1Y74 B;  3MHS C;  2QSA A;  4O2B A;  1KP3 A;  3WFV A;  2XAQ A;  4MTO A;  4X62 O;  4X65 O;  1NBM G;  4GX2 A;  3CCS V;  5JJE B;  4YIP A;  4JAV A;  3E22 A;  1JQ0 A;  3BFR A;  1QCE A;  5JWP A;  2KB1 A;  2CDY A;  2A9H A;  3ML0 A;  2YIA A;  1HNZ O;  4DR3 B;  3IFX A;  3AG7 A;  1CXZ B;  4K8X A;  1FXH A;  3W7S A;  2QDO A;  1OJH A;  2X6C A;  3BEH A;  2EBO A;  1FD9 A;  3FX7 A;  4B08 A;  2EX3 A;  4I4T B;  1XHZ A;  2XAJ A;  4ICG A;  5KX5 A;  2C2A A;  4D7T A;  3W7X A;  4LF4 B;  3OR6 C;  3EVK A;  4WBN B;  3IGA C;  3HKB A;  4X64 O;  5EZY B;  3ETQ A;  5B1N A;  4CS3 A;  1XIL A;  1Y76 B;  4QNH B;  2GSM B;  1HNW O;  3HB3 B;  5JVD B;  2P4V A;  1H8H G;  3CHX A;  5KUK A;  2XAS A;  4PV1 B;  5EYP A;  1SES A;  5IJ0 A;  2WLI B;  5F2V O;  5EBM C;  4FLW A;  5LP6 B;  4BAY A;  4MVZ A;  4JTD B;  4FZ0 A;  4TOI A;  5ITZ B;  1OCZ B;  4F6R B;  1QLN A;  4QE9 A;  4LF7 B;  4JAS A;  1DGS A;  4DR6 B;  1ZL8 B;  5B1B C;  4BIO A;  3RYI B;  4JI7 O;  4JZ2 A;  2FL4 A;  1AI6 A;  4F4L A;  4CC5 A;  3NR7 A;  3CCE V;  3A0H Z;  5LXT B;  1ZLZ A;  1G6U A;  5LA6 B;  2OTJ V;  1KEC A;  2JEU A;  1NKD A;  1GTO A;  4FFB A;  3T4Z A;  5LYJ B;  5L3F A;  1PM9 A;  3HR0 A;  1AI5 A;  1GM9 A;  3CB2 A;  2W0F C;  1NQT A;  4DW0 A;  1YEW A;  3CE2 A;  2W0X A;  3SPJ A;  1I0H A;  1FS0 G;  1KUQ A;  4HBN A;  1TGO A;  2WLK A;  5B5E Z;  1B3Q A;  1OCR C;  3JD4 A;  4X1K B;  2ZE8 A;  3AK2 A;  3ABK B;  4L8J A;  1S77 D;  5KUM A;  3Q4H A;  4B3R B;  3LNM B;  1L0N H;  1VP7 A;  5EIB C;  1FFX A;  1ZAU A;  4JI1 B;  1YXB A;  4J7Z A;  3EHB B;  4MVU A;  2AHZ A;  2ZM6 O;  4B3M O;  1MG1 A;  3ZMZ A;  2WAM A;  4NTY A;  1ARO P;  1EN4 A;  2Q7G A;  1M56 B;  3RYC B;  1DTO A;  1Y66 A;  3UT5 B;  3A0B Z;  1H2G A;  1CPY A;  2E3C A;  5K1P A;  5KHI A;  3T1H O;  3FYI B;  4G27 B;  3ASN B;  4OXS A;  4J42 A;  4LNU A;  3LDE A;  2E74 B;  4DR4 B;  4U3F H;  2IBZ H;  3FB7 C;  4U3J B;  2Y48 A;  1G4Y B;  1XNR B;  4MW8 A;  2PZS A;  2A3Q A;  2QM8 A;  1FXK B;  2ZQM A;  4FLU A;  1ZWI C;  4LFA B;  3VQV A;  2QTS A;  1H2S B;  4JI3 O;  3F5W C;  4O4J B;  1HDJ A;  1P4R A;  4N23 A;  2ZE6 A;  4DV3 B;  2UUA O;  3JCZ A;  3TET A;  1HR0 B;  3AG2 B;  2HEP A;  1WLE A;  4PEL A;  3JD1 A;  4U7N A;  1G8M A;  3CD6 V;  4FMT A;  4GKJ B;  4DRX B;  1OCO C;  1M1K W;  4YHH O;  3E8B A;  4CH3 A;  5AG2 A;  1DLB A;  2EIL C;  3UKM A;  5DM6 V;  2JJ2 G;  3SYP A;  2WLN A;  2ADP A;  1TVK B;  1YF2 A;  4JAA A;  3P3P A;  3X2Q C;  1T5E A;  3WU2 Z;  4X1Y A;  3ZMV A;  5J2T A;  5IYB O;  4YJ2 B;  1QLE C;  4BIZ A;  3N2G A;  2L6L A;  2OT5 A;  3K08 A;  1R3K C;  5E1A C;  1KKD A;  3A8T A;  1Y6X A;  1K9M W;  1QQC A;  4O2A B;  4ZBM A;  1Z5W A;  4A5U B;  4JI2 B;  2CH7 A;  2P5O A;  4OPA A;  3CC2 V;  2XOK G;  3T4D A;  2YXY A;  4FK5 C;  1Q7Y W;  4NXN B;  4GYC B;  4JTC B;  4JI8 O;  1Q81 W;  3GB7 C;  2Q67 A;  1TUE B;  3KCX A;  5LMN O;  2RQ6 A;  1F51 A;  2HVK C;  4P30 A;  4MVM A;  2CGO A;  4X9Q A;  4PDV A;  4QJF B;  3L75 H;  1AIL A;  4DV1 B;  5IE9 A;  4YY3 B;  1QVG U;  2A7W A;  2E5L O;  2FML A;  2MW2 B;  1IBL B;  1YDX A;  4JYB A;  4LF6 B;  4LR3 A;  4PDL A;  4NXM B;  3B4S A;  4DV7 B;  2YI9 A;  2PYJ A;  1KB9 F;  2FKX A;  4ZI7 B;  3L9D A;  2WSS G;  3BA9 A;  1LUV A;  1BZK A;  1Q90 D;  2BTQ A;  2QWR B;  2M6Y A;  4K3A A;  2AW9 A;  1Q3E A;  4UB8 Z;  4DO2 A;  4PI0 A;  4OX9 B;  4O4L B;  1JVM A;  2OWO A;  4JI6 B;  3CCJ V;  4JZG A;  3CXC U;  1VQ9 V;  2HHH B;  2UXC O;  4X1I A;  4EB6 A;  3HKD B;  1YVW A;  2YI8 A;  2F4V O;  1VQ5 V;  4CS4 A;  4WFG A;  3OGI B;  4MSW C;  3ETG A;  4CZZ A;  1URF A;  2Q73 A;  4F6E A;  1Z5V A;  2B1G A;  3I56 V;  1VF5 B;  2VQE O;  2XT9 A;  2F1M A;  5EC1 C;  3OUF A;  4AIL C;  1BSM A;  4DR2 B;  1ZX3 A;  5FNV A;  3ZN1 A;  1GAX A;  4LFC O;  1THZ A;  3ABL C;  4LF8 B;  1IXB A;  4DUZ O;  4QPJ A;  3ZMS A;  3CMA V;  1BQ0 A;  4ZHQ B;  5JH7 B;  1K4C C;  4ASU G;  2H8P C;  3RFR A;  4BR6 A;  4NTW A;  1IBK B;  1L0L H;  4NR1 A;  2XAH A;  2EZP A;  3RWR D;  2N04 A;  1K8A W;  5H5N A;  2V1D A;  4X20 B;  2ZE5 A;  2IH3 C;  4XDJ A;  4KHP B;  2QWN B;  1K5S A;  3AG4 B;  1GM7 A;  1UPG A;  3UO2 A;  3GWO A;  4PA9 A;  4I4T A;  3RT3 C;  3FAV B;  3K04 A;  2P06 A;  4ZKI A;  4WBN A;  3G71 V;  1R6T A;  2UUC B;  4GKK B;  2E75 B;  2GUZ B;  4RUE A;  5H6Q A;  4H33 A;  5EZY A;  2ZKO A;  4MVR A;  4YIO A;  1KU9 A;  3OEH G;  4AQY B;  1Y76 A;  3AG1 B;  3CJH B;  4JI0 B;  1P49 A;  3CXH F;  1SA0 A;  4EFE A;  1EZJ A;  2YEV B;  4JI5 B;  5CB4 B;  4FLV A;  2FTK A;  2YIC A;  3RN4 A;  1YIJ V;  4JI4 B;  3ETE A;  5DEC A;  1WPB A;  3CWB H;  1D5N A;  3OW2 U;  3L72 H;  4MVO A;  1MSW D;  4XBF A;  5IJ9 B;  3QG5 A;  5ITZ A;  3G6E V;  1TUB B;  4HYO A;  5L3B A;  4Z2W A;  4DR3 O;  2JGD B;  4J80 A;  1GKF A;  3VQY A;  1YI2 V;  3K9S A;  4JGS A;  4WFH A;  2IJI A;  1ZL8 A;  3RYI A;  4RWU A;  1RSO B;  4CC6 A;  1FJG B;  2IJK A;  4R8C A;  3SPG A;  2XND G;  5LXT A;  4DR1 O;  4NTX A;  5LA6 A;  3JD0 A;  4LF4 O;  2ZXW C;  1NTM H;  1N36 B;  2D2C B;  1NTZ H;  3DC5 A;  4LF9 B;  3WG7 C;  2UXB O;  2UUB B;  2IU3 A;  1QVF U;  1UJW B;  4OGQ B;  1NR1 A;  5JJJ B;  4YJ3 A;  3FKS G;  2QM4 A;  1M57 B;  4MS2 A;  4HNA A;  4MTX A;  4DK1 A;  5GTH Z;  2E76 B;  1SZT A;  1GMG A;  2FYU H;  2HVJ C;  3B8M A;  3KCY A;  3JCU Z;  4HAM A;  1S5J A;  3SGI A;  3SDL A;  4CS2 A;  4H0L B;  4IHJ B;  2QTO A;  3ZHS A;  5BMV A;  2V4D A;  4DV5 B;  1V54 B;  1TA8 A;  4MTG A;  4J9Y B;  2B1I A;  3ZHV A;  5CBH A;  3BRC A;  1XI1 A;  1S72 V;  1BL8 A;  1K33 A;  4LF7 O;  1XNQ B;  3UT5 A;  1LR1 A;  3J80 N;  1ORQ C;  1E79 G;  4DR6 O;  4LF5 B;  5KMG B;  1NH2 B;  3ZRW B;  5LMU B;  3ABM B;  3E8G A;  4QIW F;  2JRI A;  4KFM A;  3OMI B;  3FB6 C;  2VQF B;  3A0R A;  4J11 A;  3TCU A;  2YC0 A;  2N05 A;  1VIB A;  4O4H A;  3CCM V;  3RGB A;  5KHJ A;  5B1A B;  3CSX A;  1RM1 C;  2UXD O;  2VWJ A;  4PA3 A;  2HFE C;  1KMI Z;  2PY5 A;  4B3T B;  4Z1V A;  4DV4 B;  4O4J A;  4B3R O;  3EFF K;  2DYS B;  1VMG A;  2A79 B;  1BS3 A;  3RVZ A;  3I5D A;  4DXW A;  2HKO A;  2OTL V;  1HNX B;  2H94 A;  5GON A;  2YIB D;  1MNG A;  1YTF B;  3I55 V;  3JAW B;  1OCZ C;  2UXN A;  2R9I A;  2DWD C;  2QWO B;  2IJJ A;  2Y4U A;  4UCO A;  2Q4P A;  5JQG B;  3SJA C;  1Q8I A;  2YSU B;  3CCL V;  1IBM B;  1TVK A;  4LWS A;  1F4N A;  2M7W A;  4I5S A;  5L3E A;  1Z2G A;  2IW5 A;  1PPJ H;  3BCC H;  2X0L A;  5D5Q A;  2K9P A;  1Q82 W;  4TSF G;  1VQ4 V;  5GW7 A;  1XMQ B;  1EZV H;  1JX9 A;  1GRJ A;  3MDS A;  2ZIO A;  3UQ8 A;  2Y69 C;  1O9G A;  4DR4 O;  4JYA B;  4DUY O;  3MD0 A;  1KKC A;  1RP3 B;  1EN6 A;  2VS0 A;  4HZ3 A;  5IYC O;  1OHH G;  3K3W A;  3ZJZ A;  1PL0 A;  4O2A A;  5TIS Z;  3ZHQ A;  2A0L A;  4ABM A;  1P7B A;  4RAI A;  3FYE B;  3BVO A;  3BA8 A;  2AXT Z;  1VF6 A;  4FLZ A;  1WA8 B;  1SER A;  4Q20 A;  3DXR B;  2KQX A;  4CH6 A;  5CA0 B;  5KAF Z;  2QA4 V;  1FKA O;  4X65 B;  5B3S C;  1Y4M A;  4H44 B;  1XEQ A;  4R7C A;  2EIK B;  2QJ1 A;  3N2K B;  4DR7 O;  1QNM A;  1M5I A;  3ZHU A;  4GKJ O;  4WFA V;  5J2U B;  1M56 C;  1VF7 A;  3JSL A;  2QKS A;  5IYD O;  1HNZ B;  4UVA A;  1R1B A;  4W4K A;  2F23 A;  3B40 A;  1JPX A;  1N34 B;  5CN0 A;  4LP8 A;  5IWA B;  3OEE G;  5LL6 Y;  2DQ3 A;  2Z0A A;  3ASN C;  2P22 C;  5BR8 O;  5IDJ A;  5KHG A;  3HKE B;  3W7W A;  3CCV V;  4JYC A;  3OTF A;  5FPO A;  4JAU A;  3LDD A;  1BE3 H;  3CME V;  2ITD C;  3J7A U;  1FXK C;  2ZD9 A;  1SF9 A;  4TV8 B;  4X64 B;  3ZBH A;  5H9C A;  1SQF A;  2NR5 A;  4KP4 A;  1MZE A;  3G4S V;  4JI2 O;  4K0K O;  1SQG A;  1HNW B;  2ADQ B;  3GWK C;  3L71 H;  4PD4 F;  2DWE C;  4DV6 O;  5IY5 C;  3HKD A;  4PDR A;  1ZTE A;  2LGW A;  2CTP A;  1NH2 D;  2LQT A;  2OYQ A;  1OV9 A;  3SJQ C;  3E89 A;  4CBC A;  4NKG B;  2HP8 A;  4WFF A;  4DV1 O;  4YY3 O;  3UM7 A;  3QO7 A;  5EK0 A;  1N32 O;  4LF6 O;  2WLJ A;  2RNB A;  3B2E E;  4NXM O;  4DV2 O;  3OTO O;  3CRC A;  5E79 Z;  1IX9 A;  5LHI A;  4E4E A;  4JI7 B;  3CPW U;  4ZHQ A;  5JH7 A;  3DTU B;  1GN4 A;  3BAA A;  4JF3 A;  3JAR B;  2NN4 A;  3M99 B;  1H2L A;  5KX5 B;  1HP8 A;  2V7Q G;  3SR2 C;  1Q5O A;  2BOC C;  4XDK A;  2YIB A;  1AI7 A;  2P4K A;  1XL6 A;  4ZOL B;  3ZMT A;  3C3S A;  4FLY A;  1YTF D;  2ZT9 B;  4JI6 O;  3RBZ A;  1VF6 C;  2HHH O;  3SYA A;  1PNK A;  1H2N A;  1H38 A;  2Q5Z A;  4K8Z A;  2R70 A;  3RW0 A;  5EYP B;  3K5M A;  3B77 A;  3ZS8 C;  3CCR V;  1KD1 W;  5IJ0 B;  3CS5 A;  4UCV A;  1K34 A;  1XMO B;  5LOV B;  2Q6A A;  1SQQ H;  4B3M B;  1H2K A;  1OCO B;  3CJH A;  2CE4 A;  4GT1 A;  3OAA G;  4MVQ A;  4LF8 O;  2EIL B;  2YEV A;  2LFR A;  5CB4 A;  3T1H B;  1KBH A;  4R50 A;  3JAS A;  4UUJ C;  3WB0 A;  5K1X A;  1VQ8 V;  3K03 A;  4U7O A;  3H1J H;  2P6J A;  3ABT A;  4MTF A;  1J5E O;  5IJ9 A;  2VRZ A;  1K4D C;  3MHH C;  4I55 B;  4FFB B;  3CRQ A;  5H2F Z;  2DQ0 A;  1VQO V;  1IBK O;  4LH7 A;  2QWQ B;  4JV5 B;  1NT2 B;  4QPK A;  2JGD A;  1V55 C;  2AZ0 A;  4LCU C;  4DR5 B;  2W6J G;  2QGN A;  1K3E A;  4K35 A;  2GBO A;  5J9P C;  3KG2 A;  1RSO A;  2LGQ A;  4KHP O;  1NI8 A;  3ABU A;  1VQ7 V;  5HFL A;  3MAQ A;  3ASO B;  1U97 A;  3G6B A;  4PDM A;  3RYH B;  4CH4 A;  5A9G A;  3CCQ V;  1YHQ V;  2UUA B;  4ZIB A;  2H3O A;  2JJ1 G;  1HWY A;  3K06 A;  3DC6 A;  1FFX B;  2IU0 A;  2OIE A;  5C8Y B;  2UUC O;  1OCC B;  3D3I A;  2Y4T A;  2F95 B;  3CX5 F;  5FLX N;  1N0J A;  2DYR B;  2EUL A;  2IJH A;  3E35 A;  4YHH B;  2QEX V;  1GN2 A;  3ZIA G;  5FL7 G;  1NR7 A;  1Y67 A;  4JI4 O;  4PA6 A;  4I50 B;  1IVS A;  2LP7 A;  3FB5 C;  3H1L H;  1FXV A;  4LNU B;  2PGG A;  3LDC A;  5CBF A;  1D2D A;  1JFF A;  3U10 A;  1VQM V;  2BCC H;  1I5X A;  1Y74 A;  1AR4 A;  5KMG A;  2W6I G;  1R6K A;  2Y0P A;  3TXS A;  1I94 B;  4QGP A;  5EIB D;  4UXN A;  1Q43 A;  4FLT A;  1FJG O;  5JCO A;  2EIJ C;  4NYK A;  1L8D A;  1GN6 A;  4KUM A;  3BY6 A;  5L3D A;  1N33 O;  5DED A;  1AR5 A;  1K5Q A;  3D3Q A;  4B3S O;  3K79 A;  4JI8 B;  1M90 W;  5LMN B;  5IYZ B;  4LF9 O;  3K57 A;  3CRA A;  2QKC A;  3HKC B;  2DW4 A;  3AG1 C;  3LSS A;  4UFZ A;  1WJZ A;  2CAZ C;  2OCC B;  2JS5 A;  4IGG A;  1SRY A;  1LNQ A;  2MK3 A;  5CBG A;  1GH6 A;  4DV0 B;  4PI2 A;  1K73 W;  3P3N A;  2P7T C;  3K59 A;  5HFM A;  3RVY A;  3E2E A;  1J95 A;  3JAW A;  1PV0 A;  4UB6 Z;  3JAT B;  4X1Y B;  4DV5 O;  1AI4 A;  5J2T B;  5LGU A;  1DK1 A;  2WLL B;  3STL C;  1WNS A;  4P9P A;  4I0X B;  1XNQ O;  2GV9 A;  1SQP H;  2ZR3 A;  2WA4 A;  4Q6G A;  5JVD A;  3N2G B;  2XAG A;  2ZR2 A;  2EIM B;  1AVM A;  2ZE7 A;  5LMU O;  2AHY A;  4J10 A;  1M93 A;  3IJ4 A;  2WLI A;  4BW9 A;  1XRE A;  4LFB B;  5LP6 A;  2ATK C;  4KXR A;  2QM7 A;  4MT8 A;  1QBZ A;  3IC7 A;  1X4T A;  4F6R A;  2UXC B;  2FB5 A;  1EM1 A;  4IIJ B;  2PUS A;  4L87 A;  3SJC C;  4XDL A;  2EZO A;  2UU9 B;  1JCH A;  1F23 A;  3T1Y B;  2EIN C;  3TK1 A;  3SYC A;  2VQE B;  2JEX A;  4RUF A;  2BTO A;  2CTR A;  3LSQ A;  1E1Q G;  3QTC A;  4E2L A;  1EN5 A;  4B3T O;  2Q69 A;  5CA1 B;  3L74 H;  4LFC B;  3THO A;  5EBL C;  5B1O A;  3JAK B;  4FM2 A;  3ZX6 A;  3DXR A;  4DUZ B;  4TQD A;  5LYJ A;  1HNX O;  1XUQ A;  1I5Y A;  2Q0A A;  3CC4 V;  2WA3 A;  3N2K A;  2XAF A;  1V54 C;  3OUS A;  4CH5 A;  3O65 A;  5LHG A;  5J2U A;  1MAB G;  1XL4 A;  3N27 A;  4X1K A;  1W0J G;  2DOS A;  2RJZ A;  2BTQ B;  2R9R B;  3ABM C;  1ZSP A;  5CMU A;  1IBM O;  3M8A A;  2PYL A;  4G28 B;  5JCO C;  2JK5 C;  1MA1 A;  1QU7 A;  2JS3 A;  2XUM A;  1XMQ O;  1ZUQ A;  5LHH A;  1N0N A;  1KQS U;  4TV9 B;  2PTM A;  1JR9 A;  3G80 A;  3RYC A;  1N8R W;  5B1A C;  1AJN A;  1VAR A;  1SQV H;  4DK0 A;  4TV8 A;  1VQP V;  1S3J A;  1WAZ A;  3WG7 B;  1TAE A;  2CGN A;  4BWA A;  2JGU A;  4GX0 A;  5FNV B;  2ZIM A;  3OD4 A;  3BPZ A;  3CP1 A;  4RQE A;  1DF5 A;  1PNM A;  3ICX A;  1LUW A;  4U3J A;  3D36 A;  3J81 N;  2R9A A;  1FFT B;  2G38 A;  2PF4 E;  1BMF G;  1FXK A;  3AG3 B;  2B5U A;  2DE0 X;  3RYF B;  4RO2 A;  1XQ8 A;  2P90 A;  5JJN B;  4QE7 A;  3VQX A;  4YXW G;  3GVM A;  5KLV H;  3R65 A;  5KA6 A;  1N34 O;  1S5H C;  5IWA O;  4JI1 O;  5BZB A;  3W7T A;  5LP6 C;  1H8E G;  1VQL V;  1Q6U A;  4B7K A;  5L3C A;  4DRX A;  3JAR A;  1MMM A;  4KL1 A;  4DR1 B;  3M7M X;  3LUT B;  3TJT A;  4B7E A;  3O9O A;  1F4M A;  3G67 A;  2WLM A;  5H6R A;  1K7D A;  4NVP A;  1RM1 B;  2UXB B;  4ZOL A;  3FB8 C;  1SS3 A;  1XBL A;  1YJW V;  3CC7 V;  4PA7 A;  1ENV A;  4YJ2 A;  1SA0 B;  2BSK B;  2ETN A;  4H13 B;  2EIK C;  4X66 B;  4GCZ A;  1XNR O;  3ZMU A;  3SPH A;  1E1R G;  2Y0I A;  1FYJ A;  3PN1 A;  2BE3 A;  5LOV A;  4LFA O;  4DYL A;  3ABK C;  3E8F A;  1XDC A;  2CTW A;  5LGN A;  4NB5 A;  4DV3 O;  1SQB H;  2JIZ G;  3FFQ A;  1HR0 O;  1XHX A;  4X62 B;  1US6 A;  4O4I B;  3VQW A;  4LC1 A;  1DF4 A;  2K1E A;  2Z5U A;  2NLJ C;  4JPR A;  4I9Q A;  4PA4 A;  1YZB A;  3K5L A;  4FLX A;  2GDS A;  3JAL B;  4LH6 A;  4EFB A;  4I55 A;  2QWP B;  2Y69 B;  2Q8V A;  2KG7 B;  1IZ3 A;  4FIP C;  2P67 A;  2Q68 A;  4TWK A;  4BIU A;  2UXD B;  5B1B B;  4ZI7 A;  2OIG A;  1WP7 A;  4YJ3 B;  2CTQ A;  1O9H A;  1IDS A;  4X89 A;  2KKW A;  4HNA B;  3RYH A;  1WP8 A;  1L1F A;  3D36 C;  1A32 A;  2GTA A;  3BHP A;  4IT5 A;  5IT9 N;  4TUY B;  1EFR G;  5C8Y A;  3ETD A;  3P32 A;  3E86 A;  2ITC C;  3K0D A;  4X8A A;  5BXZ A;  5B3S B;  2D3O W;  2PI4 A;  1XMO O;  3TGU H;  5BMV B;  1KC8 W;  4P2Z A;  4O4L A;  2F43 G;  1NTK H;  2DN9 A;  3B8N A;  1Q6I A;  1R3J C;  1GM8 A;  1OCR B;  2Q7H A;  3AG2 C;  1AJQ A;  1JMK C;  4O2B B;  3LSU A;  3UO3 A;  2N74 A;  2R72 A;  4NXN O;  3SPC A;  4WF9 V;  4MW3 A;  4UCU A;  3ZCC A;  4FZ1 A;  4I50 A;  5EC2 C;  3K58 A;  3E22 B;  1WPX A;  4UV8 A;  1B04 A;  1U96 A;  2CUG A;  5KAI Z;  3KKY A;  3VBB A;  4GLX A;  3OM3 B;  1NU1 H;  2X6B A;  4DUY B;  4O4H B;  1IBL O;  4JV5 O;  2Q7E A;  3C3T A;  3K9A A;  4DR5 O;  2LJ2 A;  5A2Q N;  3OE7 G;  4DV7 O;  4J7J A;  3H1K H;  2F66 C;  4W4L A;  1RPR A;  2RCV A;  1P84 F;  4EEQ A;  1N4C A;  4WCE V;  3H1H H;  1GO3 F;  5KA5 A;  3S3W A;  1AJP A;  3H1I H;  1BQZ A;  4WFB V;  1NVP B;  2F93 B;  4IYI A;  3ZN0 A;  3VOU A;  5IY5 B;  3ZRX A;  5GON B;  3HKB B;  4DR7 B;  3D8C A;  5IYZ A;  5C93 A;  4X20 A;  1FPO A;  2RN9 A;  3LNN A;  4OX9 O;  3HKC A;  1JJO A;  3E8H A;  4D6T H;  1M9N A;  2B9Z A;  2HLD G;  2GTS A;  1MSD A;  3ZRV A;  4JTA B;  1B06 A;  2EJR A;  1SKV A;  3FAV A;  1F7Y A;  4R6Z A;  4J7K A;  3R66 A;  4LWS B;  3T2M A;  4OPH A;  4DW1 A;  2GUZ A;  1JJ2 U;  5BR8 B;  4GX1 A;  2ZM6 B;  4FM0 A;  1GN3 A;  3JAT A;  3W7U A;  3JYC A;  2WLL A;  2WLH A;  3OMA B;  4DR2 O;  1SZX A;  4I0X A;  2ODM A;  1PKX A;  3H9V A;  5B66 Z;  2ZIN A;  3DGE A;  1SC5 B;  2ZDI A;  1I94 O;  1YJN V;  3UCS C;  2GHY A;  3STZ C;  4K0K B;  1VQ6 V;  2AGA A;  1I08 A;  3ASO C;  1ROP A;  3SJB C;  3X2Q B;  1R6N A;  1TUB A;  3QO8 A;  4DV6 B;  3H01 A;  3A2F A;  3BAB A;  2YUA A;  4IIJ A;  1S76 D;  1OCC C;  1QLE B;  1YJ9 V;  1R73 A;  1CEZ A;  2ARH A;  3JD2 A;  2JVD A;  3ZRS A;  3F7Y C;  2BOB C;  1PP9 H;  2DYR C;  1P7G A;  1XOU A;  5EBW C;  4MVS A;  2LFS A;  1Q6H A;  3SYQ A;  4JI3 B;  3E83 A;  1N32 B;  5CA1 A;  3Q4H B;  4G2K A;  4GUN A;  4UCS A;  3JAK A;  3B09 A;  4DV0 O;  4DV2 B;  1PL4 A;  4H37 A;  3OTO B;  1FAF A;  1AP6 A;  2RMK B;  4GKK O;  3K5O A;  3CRR A;  1M4U A;  3K0G A;  4FFK A;  2HJF C;  4I9W A;  1MOF A;  1UFI A;  4AQY O;  1RPO A;  3HPL C;  4BW5 A;  4JI0 O;  3DSQ A;  3K5N A;  2EJ7 A;  1AR1 B;  4JI5 O;  3AK1 A;  4TQF A;  1V55 B;  1AB3 A;  1BHA A;  3PJS K;  1PNL A;  2O57 A;  5GTI Z;  2PI5 A;  2NNU A;  4IHJ A;  5L3G A;  4LFB O;  1I7F A;  1RFY A;  3NXS A;  3CEI A;  4Z1M G;  4TV9 A;  4RQF A;  2IH1 C;  2YXH A;  1YSC A;  4D7S A;  2OCH A;  3U11 A;  2UU9 O;  3C90 A;  2YDE A;  3T1Y O;  3ZRW A;  1VQK V;  1QR8 A;  2HR3 A;  3QNE A;  2A06 H;  3OGC C;  4PJ0 Z;  3AG4 C;  2WPD G;  5DN6 G;  1WB7 A;  3AK3 A;  2OCC C;  1CP9 A;  1IXM A;  1WN7 A;  4C7U A;  3L73 H;  3T1C A;  1KYO F;  1NS1 A;  2YID A;  1H2M A;  4UCT A;  3WB2 A;  1W59 A;  1N36 O;  4GZR B;  5FPR A;  4FJC C;  4UVC A;  1BGY H;  2UUB O;  2LW1 A;  1J5E B;  3OFN G;  2ZCE A;  2ILM A;  2KSD A;  1SQX H;  5KHH A;  3RYF A;  2HG5 C;  3KZI Z;  3JD3 A;  4WFE A;  3JAM N;  1W0K G;  2E5L B;  2EIM C;  5BY1 A;  3SPI A;  2IM9 A;  2ZDI C;  1WB8 A;  1QR9 A;  2DMX A;  1NVP D;  3ABL B;  3U0Z A;  2AZ2 A;  2LW7 A;  3IC9 A;  2L35 A;  1JA8 A;  4FM1 A;  2CK3 G;  2Q9L A;  2VWK A;  1YIT V;  4TT3 G;  2EIJ B;  4GX5 A;  4N21 A;  2YS8 A;  3FD9 A;  4I7Z B;  3CRM A;  1VEW A;  4JYY A;  5JQG A;  3QO5 A;  4LF5 O;  1NZ6 A;  3TXQ A;  1IUR A;  1AP5 A;  2CH7 B;  2YXL A;  2Z3Y A;  3F5T A;  4EKW A;  4AI8 A;  2VQF O;  1G1X B;  3AEI A;  3QF7 A;  2DJV A;  1QHT A;  4AHC A;  4IYH A;  2F4V B;  2BSK A;  5LBQ A;  3IAY A;  4UCR A;  1BT8 A;  3APO A;  3CYO A;  3JAS B;  1BCC H;  3S3X A;  1YCI A;  2WWW A;  4FPP A;  4J9Z B;  2QKA A;  5CA3 A;  1JOY A;  1OZ0 A;  1R3I C;  1B6Q A;  3OMN B;  3ZHR A;  1M57 C;  1S5L Z;  2X7R B;  2LO1 A;  1VQN V;  2ZNI A;  4DV4 O;  3L70 H;  1EBO A;  1MZF A;  3QVN A;  3F7V C;  1WA8 A;  3JSN A;  5CA0 A;  5KHK A;  2QE7 G;  1BHB A;  4O4I A;  2X6A A;  3ZED A;  1R3L C;  3APQ A;  4UVB A;  5D5P A; 
#chains in the Genus database with same CATH homology
 2EIK C;  1COW G;  3M99 B;  4GCZ A;  4WFG A;  4X88 A;  4MSW C;  3ETG A;  3ZMU A;  1S0V A;  3SYO A;  3SPH A;  1E1R G;  4CZZ A;  4P9O A;  2V7Q G;  3I56 V;  2B1G A;  2BOC C;  1KP2 A;  1K97 A;  4XDK A;  5EC1 C;  3CCU V;  3OUF A;  3ABK C;  1AI7 A;  3E8F A;  5LGN A;  1XL6 A;  2EIN B;  1GK9 A;  3ZN1 A;  1W2B U;  1NJI W;  3ZMT A;  3OR7 C;  1Q86 W;  1THZ A;  1YTF D;  2JIZ G;  3ABL C;  4UV9 A;  3RBZ A;  4QPJ A;  3ZMS A;  3CMA V;  4LC1 A;  1DF4 A;  2K1E A;  1PNK A;  3SYA A;  2JDI G;  5LGT A;  1H38 A;  3RW0 A;  2Z5U A;  1K4C C;  2NLJ C;  4JPR A;  4ASU G;  3B77 A;  3CCR V;  1KD1 W;  4PA4 A;  1K92 A;  2H8P C;  2ZXW B;  1PD3 A;  1K34 A;  2Y69 B;  3AG3 C;  1SET A;  2Q6A A;  3P30 A;  4FIP C;  2XAH A;  2EZP A;  2P67 A;  2Q68 A;  4TWK A;  1OCO B;  4BIU A;  1K8A W;  4LBE C;  2V1D A;  2UXX A;  2DYS C;  5B1B B;  4GT1 A;  3MHS C;  3W7U A;  3OAA G;  2IH3 C;  4XDJ A;  4MVQ A;  1KP3 A;  1K5S A;  2EIL B;  3AG4 B;  2YEV A;  2LFR A;  4X89 A;  3WFV A;  1GM7 A;  2XAQ A;  4MTO A;  3GWO A;  1NBM G;  4GX2 A;  4PA9 A;  3CCS V;  4R50 A;  4UUJ C;  1VQ8 V;  4JAV A;  3K03 A;  3K04 A;  4U7O A;  1JQ0 A;  1L1F A;  2P6J A;  3ABT A;  4MTF A;  4ZKI A;  3G71 V;  1EFR G;  1QCE A;  3ETD A;  3P32 A;  3E86 A;  2ITC C;  2KB1 A;  3K0D A;  3MHH C;  1K4D C;  4X8A A;  2A9H A;  3ML0 A;  4RUE A;  5B3S B;  2DQ0 A;  1VQO V;  2D3O W;  2PI4 A;  5H6Q A;  4H33 A;  1KC8 W;  4P2Z A;  4QPK A;  4MVR A;  1V55 C;  2F43 G;  4LCU C;  3IFX A;  3OEH G;  3AG1 B;  3B8N A;  2W6J G;  1FXH A;  1K3E A;  1R3J C;  3W7S A;  1GM8 A;  5J9P C;  1OCR B;  3KG2 A;  3AG2 C;  1AJQ A;  1EZJ A;  2YEV B;  2X6C A;  3ABU A;  1VQ7 V;  3BEH A;  2EBO A;  2FTK A;  5HFL A;  3SPC A;  4WF9 V;  4MW3 A;  1YIJ V;  3ETE A;  3ASO B;  3ZCC A;  4PDM A;  1YHQ V;  3CCQ V;  2XAJ A;  5EC2 C;  2C2A A;  1WPX A;  3W7X A;  3OW2 U;  4UV8 A;  3OR6 C;  2JJ1 G;  1HWY A;  3K06 A;  4MVO A;  2IU0 A;  4XBF A;  3VBB A;  1MSW D;  3IGA C;  3G6E V;  1OCC B;  3OM3 B;  4HYO A;  2X6B A;  3D3I A;  5L3B A;  5B1N A;  1GKF A;  3K9A A;  2DYR B;  4QNH B;  1YI2 V;  4JGS A;  2GSM B;  4WFH A;  3OE7 G;  2IJI A;  2IJH A;  3E35 A;  2QEX V;  3HB3 B;  3ZIA G;  5FL7 G;  1NR7 A;  1H8H G;  2IJK A;  1RPR A;  2XAS A;  4R8C A;  5KUK A;  3SPG A;  4WCE V;  1SES A;  2XND G;  2WLI B;  1GO3 F;  5KA5 A;  4PA6 A;  1AJP A;  5EBM C;  2LP7 A;  3JD0 A;  4WFB V;  1NVP B;  4BAY A;  3FB5 C;  2ZXW C;  3ZN0 A;  4MVZ A;  1FXV A;  3VOU A;  5IY5 B;  3ZRX A;  3LDC A;  4JTD B;  1OCZ B;  5CBF A;  1QLN A;  4QE9 A;  4JAS A;  3WG7 C;  5C93 A;  2IU3 A;  1VQM V;  1I5X A;  1QVF U;  1UJW B;  1NR1 A;  3E8H A;  1M9N A;  3FKS G;  2W6I G;  1R6K A;  2HLD G;  5B1B C;  3ZRV A;  1M57 B;  4MS2 A;  4MTX A;  4JTA B;  2EJR A;  1AI6 A;  1SZT A;  1GMG A;  4UXN A;  4F4L A;  2HVJ C;  3B8M A;  2EIJ C;  4HAM A;  4R6Z A;  3CCE V;  3T2M A;  2OTJ V;  1KEC A;  2JEU A;  4KUM A;  1NKD A;  1JJ2 U;  1GTO A;  3BY6 A;  4GX1 A;  5L3D A;  3T4Z A;  2QTO A;  1K5Q A;  1V54 B;  5L3F A;  3K79 A;  4MTG A;  3JYC A;  1AI5 A;  1GM9 A;  2B1I A;  4J9Y B;  5CBH A;  2WLL A;  2WLH A;  3OMA B;  2W0F C;  1M90 W;  1S72 V;  1BL8 A;  1K33 A;  1NQT A;  1PKX A;  2DW4 A;  1ORQ C;  3AG1 C;  1E79 G;  3LSS A;  3SPJ A;  1NH2 B;  1FS0 G;  2WLK A;  3ZRW B;  3DGE A;  3ABM B;  2ZDI A;  1OCR C;  1YJN V;  3JD4 A;  2OCC B;  2GHY A;  3ABK B;  3E8G A;  1S77 D;  5KUM A;  1SRY A;  1LNQ A;  2MK3 A;  3STZ C;  4QIW F;  3LNM B;  5CBG A;  1VQ6 V;  4KFM A;  1K73 W;  3ASO C;  3OMI B;  1ROP A;  2P7T C;  3FB6 C;  3X2Q B;  5HFM A;  3RVY A;  3A0R A;  1R6N A;  3QO8 A;  3TCU A;  3EHB B;  3H01 A;  1J95 A;  4MVU A;  3E2E A;  2AHZ A;  1S76 D;  1MG1 A;  3ZMZ A;  2WAM A;  3CCM V;  1ARO P;  1OCC C;  1AI4 A;  1QLE B;  5LGU A;  5B1A B;  2WLL B;  1RM1 C;  1YJ9 V;  3STL C;  1R73 A;  1CEZ A;  1M56 B;  4P9P A;  3JD2 A;  3ZRS A;  1DTO A;  1Y66 A;  2ZR3 A;  3F7Y C;  2BOB C;  2DYR C;  1H2G A;  4PA3 A;  2XAG A;  2HFE C;  2ZR2 A;  1CPY A;  2EIM B;  4MVS A;  5EBW C;  2LFS A;  3SYQ A;  2AHY A;  3E83 A;  3FYI B;  2WLI A;  4G2K A;  3EFF K;  4G27 B;  2DYS B;  3ASN B;  2A79 B;  2ATK C;  4OXS A;  3RVZ A;  4DXW A;  2HKO A;  2OTL V;  2QM7 A;  4H37 A;  3LDE A;  2H94 A;  4MT8 A;  1QBZ A;  3IC7 A;  1YTF B;  3K0G A;  3I55 V;  2HJF C;  4I9W A;  4L87 A;  1OCZ C;  3FB7 C;  4XDL A;  2EZO A;  2UXN A;  2Y48 A;  1MOF A;  2R9I A;  2DWD C;  1G4Y B;  1JCH A;  1F23 A;  1RPO A;  2EIN C;  3TK1 A;  2IJJ A;  3HPL C;  4MW8 A;  4BW5 A;  3SYC A;  2JEX A;  2QM8 A;  1FXK B;  4RUF A;  2ZQM A;  3LSQ A;  1E1Q G;  1ZWI C;  2YSU B;  1AR1 B;  4E2L A;  3CCL V;  1V55 B;  1BHA A;  3F5W C;  2Q69 A;  1F4N A;  1P4R A;  2M7W A;  3PJS K;  4I5S A;  4N23 A;  5L3E A;  1PNL A;  2IW5 A;  2X0L A;  3JCZ A;  3TET A;  1Q82 W;  5EBL C;  5B1O A;  4TSF G;  1VQ4 V;  2NNU A;  5GW7 A;  5L3G A;  2PI5 A;  1JX9 A;  3AG2 B;  3NXS A;  4Z1M G;  2Y69 C;  1WLE A;  4RQF A;  4PEL A;  1I5Y A;  2IH1 C;  3JD1 A;  3CC4 V;  4U7N A;  1G8M A;  2XAF A;  3MD0 A;  1V54 C;  3OUS A;  1YSC A;  3CD6 V;  4FMT A;  1OCO C;  5LHG A;  1M1K W;  4HZ3 A;  1MAB G;  1XL4 A;  5IYC O;  3ZRW A;  3E8B A;  1VQK V;  1QR8 A;  1OHH G;  2HR3 A;  3K3W A;  3QNE A;  3ZJZ A;  1W0J G;  1DLB A;  1PL0 A;  3OGC C;  2EIL C;  3AG4 C;  2R9R B;  2WPD G;  3ABM C;  3UKM A;  5DM6 V;  5DN6 G;  2JJ2 G;  2A0L A;  5CMU A;  3SYP A;  2WLN A;  1P7B A;  2OCC C;  1CP9 A;  1IXM A;  3FYE B;  4RAI A;  4G28 B;  2JK5 C;  3T1C A;  3X2Q C;  1SER A;  4Q20 A;  5LHH A;  2QA4 V;  1KQS U;  3ZMV A;  5B3S C;  1Y4M A;  5IYB O;  4R7C A;  2EIK B;  4FJC C;  4UVC A;  1N8R W;  1QLE C;  5B1A C;  4WFA V;  4BIZ A;  1AJN A;  1M56 C;  2OT5 A;  3K08 A;  3OFN G;  1R3K C;  5E1A C;  1KKD A;  2HG5 C;  4WFE A;  3JD3 A;  2QKS A;  1W0K G;  1K9M W;  5IYD O;  4UVA A;  2EIM C;  4ZBM A;  3SPI A;  1VQP V;  1S3J A;  2ZDI C;  3WG7 B;  1JPX A;  1QR9 A;  1NVP D;  5CN0 A;  3ABL B;  4LP8 A;  3CC2 V;  3OEE G;  4GX0 A;  2DQ3 A;  3ASN C;  2XOK G;  3T4D A;  3CP1 A;  5IDJ A;  4RQE A;  1DF5 A;  4FK5 C;  1PNM A;  2CK3 G;  1Q7Y W;  1YIT V;  4TT3 G;  2EIJ B;  4JTC B;  3W7W A;  3CCV V;  4GX5 A;  3GB7 C;  4JYC A;  1Q81 W;  4N21 A;  3D36 A;  2Q67 A;  1TUE B;  1FFT B;  4JAU A;  1F51 A;  2HVK C;  3LDD A;  4P30 A;  1BMF G;  4MVM A;  3CME V;  4PDV A;  2ITD C;  1FXK A;  3AG3 B;  4QJF B;  3QO5 A;  2B5U A;  4RO2 A;  2P90 A;  4QE7 A;  1FXK C;  2ZD9 A;  1QVG U;  5H9C A;  4YXW G;  4KP4 A;  4JYB A;  2Z3Y A;  3G4S V;  3R65 A;  5KA6 A;  4PDL A;  1S5H C;  4EKW A;  5BZB A;  3W7T A;  1H8E G;  1VQL V;  3AEI A;  2DWE C;  5IY5 C;  4PDR A;  5L3C A;  5LBQ A;  2WSS G;  3CYO A;  1NH2 D;  3SJQ C;  3LUT B;  2WWW A;  3E89 A;  4FPP A;  4J9Z B;  4CBC A;  5CA3 A;  1JOY A;  1OZ0 A;  1R3I C;  1B6Q A;  3OMN B;  1M57 C;  1F4M A;  2X7R B;  4WFF A;  2WLM A;  5H6R A;  1VQN V;  3UM7 A;  1K7D A;  3QO7 A;  5EK0 A;  1RM1 B;  4DO2 A;  1EBO A;  3FB8 C;  3F7V C;  1JVM A;  1YJW V;  2WLJ A;  3CC7 V;  4PA7 A;  3CCJ V;  2QE7 G;  3CXC U;  1VQ9 V;  1BHB A;  1ENV A;  5LHI A;  3CPW U;  2X6A A;  3DTU B;  1R3L C;  4UVB A;  1VQ5 V;  4JF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...