2ZKOA

Structural basis for dsrna recognition by ns1 protein of human influenza virus a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
70
structure length
70
Chain Sequence
MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(P*AP*GP*AP*CP*AP*GP*CP*AP*UP*UP*AP*UP*GP*CP*UP*GP*
publication title Structural basis for dsRNA recognition by NS1 protein of influenza A virus
pubmed doi rcsb
source organism Influenza a virus
molecule tags Rna binding protein/rna
total genus 30
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2zkoA00
4GKJO 2DOSA 1D2DA 1F7YA 4DUZO 3J7AU 4JI4O 1IBMO 4X65O 4JI0O 2UXBO 5LL6Y 1HNWO 2JRIA 1HNZO 1HNXO 1G1XB 4DR4O 5LMUO 4JI8O 2VQFO 4JI5O 5H5NA 4JI7O 4LF8O 4DR1O 4A5UB 1X59A 4B3RO 5IWAO 4DR3O 4AQYO 4DV2O 4YY3O 5LMNO 4B3TO 1N32O 2VQEO 3O65A 4NXMO 5BY1A 4DV1O 1YZBA 2E5LO 4JI3O 4DV4O 1N33O 1XNQO 5A2QN 3J81N 4JI1O 2UUAO 4OPAA 2HHHO 2N74A 1XMOO 1IBKO 5FLXN 1I94O 4JYAO 4LF7O 1XNRO 4LF5O 1FYJA 4KHPO 1N36O 1R6TA 4OPHA 1NS1A 4DV6O 4B3SO 3M8AA 2UU9O 4LFBO 3R66A 1FKAO 4DV3O 1A32A 2UUBO 1IBLO 4LF4O 2FKXA 2AGAA 3OTOO 4X66O 4JI2O 1XEQA 1J5EO 2F4VO 2UXDO 4DV7O 4K0KO 2DJVA 3J80N 4GKKO 5BXZA 1AB3A 5IT9N 3T1HO 3T1YO 4DR2O 4DV0O 4NXNO 4OX9O 4DR7O 3SDLA 2UXCO 3RT3C 4DR5O 4B3MO 4YHHO 1XMQO 1HR0O 4LFAO 2UUCO 2ZM6O 4X64O 3JAMN 4JI6O 1DK1A 1AILA 4LF6O 4LF9O 2LW7A 1N34O 1R1BA 4LFCO 3F5TA 4JV5O 5BR8O 4DR6O 2ZKOA 2Z0AA 4X62O 4DUYO 4DV5O 1KUQA 1FJGO
chains in the Genus database with same CATH superfamily
3AG2B 4J9ZB 3D36A 4Z2WA 1QR8A 2ZM6B 2DWEC 3BHPA 2FMLA 3RFRA 2Q0AA 1OJHA 2YXHA 5KUMA 1HNWO 3CPWU 1WB8A 3NXSA 3MHSC 5LP6C 4DRXA 2FL4A 1RFYA 5B66Z 4R6ZA 3JSLA 2CGNA 4PDMA 1XL6A 1Q7YW 1FAFA 1H8EG 5B5EZ 1N32O 2VQFB 1J95A 2IJIA 4JI7B 2E74B 2BE3A 2GV9A 4EKWA 5LP6B 3L71H 3X2QC 4UVCA 1N8RW 4IHJA 2BCCH 4MVUA 3DTUB 3CEIA 3T4DA 1NH2B 4W4LA 1BHAA 2H94A 3GB7C 1L0LH 4PI2A 3ABLC 1LUWA 4P30A 2Q6AA 4JI3B 3PN1A 3IFXA 4WFHA 3R66A 5L3EA 3QO5A 1IBLO 1S0VA 2Q4PA 4JYAB 3X2QB 5FL7G 2CTPA 2AXTZ 2ZT9B 4O2BA 2ATKC 3K5OA 1TUBA 3J80N 3ABLB 5BXZA 1OCCC 3OTOB 2R70A 2HR3A 2HKOA 1ZX3A 3TGUH 3MD0A 2W0FC 1GAXA 5H6QA 3U10A 5IYCO 1VF6A 3E22B 4NVPA 2WLIB 2ZXWC 1PP9H 3K03A 2LW7A 1OCCB 4LFCO 5LHGA 2W6JG 1M90W 2LQTA 2WLMA 3CWBH 4EFBA 2ZKOA 2Z0AA 3OR7C 4PHZA 1VF5B 3OTFA 3T2MA 5LXTA 3L72H 4LF9B 2ZXWB 2YUAA 1B04A 3RN4A 2Q73A 4L87A 1GMGA 4I50B 2RNBA 2YXYA 5KHIA 5J9PC 4A5UB 3QO8A 4XDKA 3RW0A 2UXCB 4DR5B 4AQYO 1HNXB 2E76B 1FS0G 5BY1A 1BE3H 4JI5B 3G4SV 3FX7A 4JASA 4DV4O 4LWSB 2OT5A 2MK3A 4HBNA 4PA9A 4JF3A 1AR5A 1AVMA 5LA6A 1FYJA 4JYBA 1LNQA 1H2KA 2QDOA 2JGDB 1N33B 3AK1A 3K3WA 3T1CA 4RUFA 4TQDA 1U97A 1W0JG 2WLLB 3CJHA 5EK0A 4DV7O 1AI4A 2GDSA 2X6BA 4PV1B 1IDSA 2IH1C 3FB8C 5JVDA 5JH7B 2V7QG 1AP6A 3P3NA 2IU0A 2EJ7A 4UB6Z 3F7VC 3H1KH 2X6CA 3U0ZA 1K34A 4IIJA 3SPCA 1L0NH 1SETA 1ENVA 4FM0A 5LOVA 1R1BA 4JI2B 3TJTA 2QTSA 3UCSC 1PKXA 1YSCA 1S77D 5CMUA 2QWOB 3SPGA 4I55B 2X6AA 1Y74B 1JVMA 3L9DA 4I4TB 5EBWC 2OWOA 2PY5A 5H5NA 1MMMA 2G38A 3JD2A 4DR2B 4O4LB 1QCEA 1ZL8B 2H3OA 3D8CA 4O2AB 4DK1A 1VMGA 1LUVA 4JPRA 2JJ2G 1QVFU 1Q3EA 1YZBA 2CK3G 2PGGA 1VQ9V 3QF7A 4TV8A 3TCUA 5L3CA 2DWDC 1CPYA 4X1YA 1VQKV 1URFA 3RYFA 4J11A 2YEVA 1AR4A 4KHPO 1S76D 4LFBO 3CSXA 1NBMG 4CBCA 1GO3F 5IJ0B 4X66O 3FAVB 5EBLC 1P7GA 4PDVA 1SA0B 1OCZC 2JK5C 2WLKA 1QU7A 3L75H 1N36B 4TV9A 3ABMC 2RCVA 3ZEDA 4LR3A 3E83A 4C7UA 2YICA 1XL4A 3T4ZA 1AB3A 4GYCB 3RVYA 3T1HO 2JDIG 3HB3B 1WP8A 1H2GA 1OCZB 4K0KB 2UXCO 3A0RA 4GX5A 4DR5O 3K59A 2JVDA 1Q90D 4CC6A 5C93A 4ICGA 3AK3A 3N2GB 4NR1A 4RAIA 3EFFK 3CCEV 4MSWC 3SGIA 1NTZH 4H37A 4LH6A 1BQ0A 1FJGO 5FNVB 1AJNA 3CXHF 3SJBC 2Z3YA 3JATA 1F7YA 3J7AU 3JCZA 2UXDB 4N23A 5CA1A 1WA8B 1KP3A 3BEHA 1YXBA 2F93B 1E1RG 1L8DA 2ILMA 1PV0A 4I50A 4FZ1A 3TETA 4LC1A 2X0LA 2OCCC 4XDLA 2WA4A 1NQTA 1E79G 3ETDA 4DRXB 1SQFA 4PA4A 3G71V 3ZHVA 1XNQO 5LHIA 1NT2B 2K1EA 2Y48A 4LF7O 1GRJA 1JR9A 2DQ0A 4OPHA 2ZQMA 1YVWA 1GM8A 5KA6A 1KKCA 5JJEB 2FKXA 4JI1B 1VQMV 4JI2O 3LDDA 3O9OA 3K5MA 2HHHB 2NR5A 4IHJB 1JMKC 1OCRC 4YXWG 1MA1A 1YF2A 4DV6B 1B06A 2M7WA 3VQXA 2WLLA 2QE7G 2P7TC 5LBQA 4N21A 1BL8A 1SQPH 1SQXH 2XAFA 2IH3C 4DR2O 5L3BA 4DV0O 3FB5C 4OX9O 1XDCA 3OUFA 4NTYA 1M5IA 5JCOA 5TISZ 3RYIB 3LDEA 1OCRB 1VF6C 2XUMA 4G2KA 1YTFB 2LJ2A 4O2BB 1I94B 4LP8A 1Y4MA 2VS0A 1QLEB 1TUBB 2D2CB 2HVKC 1EZJA 2Q7GA 4XDJA 5HFLA 1B3QA 1F4NA 5GTIZ 1HW7A 4I5SA 2JJ1G 2DOSA 4BIUA 3OMNB 3WB1A 2XT9A 4WBNA 5EC2C 3K06A 2ADPA 2VWJA 5LYJA 1FD9A 5HFMA 4DUYB 3JCUZ 5H9CA 4LF8O 1BMFG 3AG7A 4FK5C 3OD4A 2ZCEA 4I55A 3E8HA 2C2AA 1X59A 4KL1A 4H44B 1FXHA 4YIPA 1K9MW 4Z1VA 3A0BZ 4DR3O 4YY3O 4B3TO 4O2AA 4FMTA 2A7WA 3AK2A 5JJNB 1JJ2U 1H8HG 1HDJA 3RBZA 3F7YC 4PJ0Z 2N74A 3AG3C 1Y6XA 4GKJB 3CCLV 3E35A 2Y4UA 1Q6UA 2PI5A 2JS3A 3TXSA 4X65B 1JQ0A 1QLNA 5B1AC 3K9SA 3D3QA 4UCUA 4CH4A 4BAYA 2UXDO 5IJ0A 4HNAA 3L70H 4B3SB 1DF4A 3E8FA 1R3LC 3BFRA 3UM7A 3LDCA 1O9HA 5LMNB 1M56C 3GWKC 1FPOA 2ZINA 2GTSA 4BW5A 3K57A 1F4MA 2P4VA 3CJHB 3CP1A 2XOKG 1ORQC 3JSNA 5CBGA 1Q6IA 3B77A 4NXNB 1EZVH 1M56B 2UUBB 3S3WA 4MVMA 3JYCA 2Q68A 2YIDA 2WA3A 1UJWB 3JD1A 1V54C 1G6UA 1IBMO 2QM7A 4IIJB 3CX5F 2BTQA 5FNVA 4JI6B 2D3OW 4UXNA 3SJCC 1K5SA 3OR6C 4JV5B 4CH5A 3EVKA 5LOVB 2Y0PA 4MVRA 4WFFA 4D7SA 4JI8O 1XBLA 3CCVV 2W0XA 4PELA 4IT5A 2GSMB 1WA8A 1NVPD 1AI6A 2LGQA 3STLC 3ZN1A 4P9OA 4JI0B 2UXBB 1V54B 2IU3A 4B7EA 3F5WC 1JPXA 1SRYA 4E4EA 1IZ3A 1AI5A 4MVSA 3BA9A 4UCTA 3I56V 1GK9A 1VQOV 3FB6C 1H2SB 1I94O 4DV2B 4LF5O 1EM1A 3RYCA 4NXMB 1NS1A 2GUZB 1YHQV 4R7CA 1BGYH 2RMKB 4DR4B 1YI2V 2HEPA 4TV8B 2KSDA 1THZA 3FKSG 4X1YB 3OFNG 2XAGA 3RYFB 1VQNV 4TOIA 2ZR3A 4P9PA 2PI4A 4RQEA 3W7WA 2YEVB 1KD1W 3OMAB 2R9AA 3FFQA 3BRCA 2PUSA 4U3JB 3NR7A 4DV3B 1H2NA 5B3SC 2DMXA 4GX2A 3GVMA 1GN4A 2Q5ZA 2P90A 1NTKH 1WLEA 4K35A 4X20A 4FJCC 2ZD9A 4TV9B 2QWQB 2UUCO 4UV9A 3CC4V 3ZMVA 1WPBA 2UXNA 3RYIA 3Q4HA 1AILA 1OZ0A 5B3SB 3P30A 1XREA 4JAUA 2ITDC 5JWPA 1RM1C 4GKJO 1HR0B 2IBZH 4WFEA 4JI4O 2CTWA 2QWPB 4X65O 2RJZA 4PDLA 5LL6Y 1N0JA 3HKBA 1VQ8V 5H2FZ 1N34B 1Y66A 4MW3A 2ADQB 4OGQB 4DYLA 1PL4A 5DECA 2FTKA 4J7KA 5IYZA 1RM1B 2A79B 1AR1B 3JATB 1PNLA 1BHBA 2IJKA 3CCMV 1WB7A 3UO2A 4ZIBA 5CA1B 2Q0OC 5LMNO 4FLTA 3U11A 3OEHG 4UCRA 2N04A 3CRMA 1DTOA 3OT7A 1SZTA 3G6BA 2P22C 2Q67A 4O4IA 4O4HA 5IWAB 4GUNA 4FLYA 5CB4A 2VQEB 4FM1A 1Z5WA 4PA7A 4MT8A 1FKAO 3DSQA 2UUBO 4PI0A 3I5DA 3K0DA 3M7MX 2WLJA 3P3PA 3KCXA 4CH6A 3B2EE 2XTAA 4DR1B 4DK0A 1FXKA 1RSOB 1P84F 4FLZA 4FM2A 1K73W 4ZOLA 1QBZA 1EBOA 4LF4B 1S72V 5IT9N 4EEQA 1QNMA 3HKDA 5ITZB 5JCOC 1Y76A 1KKDA 3CCQV 2OTJV 1FFTB 2ZM6O 1K5QA 1NVPB 1XNRB 5KAIZ 2EIMC 1DK1A 2DW4A 2V4DA 3ZMSA 3F5TA 3LNNA 3SYQA 1VF7A 3CCJV 1AROP 2EILC 4B3MB 4EB6B 4OXSA 5B1OA 1Z5VA 1WPXA 1MZFA 4X88A 2Z5UA 1WJZA 5IYBO 1VQPV 1HP8A 1P4RA 2EIMB 4DR4O 3JD0A 2XAHA 2DN9A 2VQFO 5L3GA 3BVOA 4JI7O 2EILB 1VQ6V 3GWOA 1L1FA 5LGTA 4DR7B 4WBNB 1KYOF 3HPLC 5EBMC 3E86A 1HNZB 5LYJB 2KB1A 4JI3O 3RWRD 2WWWA 3OM3B 4DV5B 3JD4A 3DGEA 3LSUA 4JYAO 2EULA 3ABKC 4UUJC 1XHZA 3VQYA 4YJ3A 1Q82W 1R6TA 1P7BA 3ZBHA 1EN5A 1V55B 2N05A 3OGIB 1NI8A 4UCVA 3MDSA 2ODMA 3OTOO 5LMUB 1QQCA 2GUZA 3ETQA 3CD6V 2ARHA 2YC0A 3ABKB 3A0HZ 3FD9A 2EBOA 4FVMA 4B3RB 3B09A 4J80A 4LH7A 1S5LZ 5KHGA 2PTMA 4HAMA 1R6NA 2XASA 4U3JA 5GONA 3G6EV 1IXMA 2ZE5A 3N27A 2QSAA 3K5LA 4HNAB 1BT8A 1US6A 2QJ1A 5KA5A 3ETEA 2Q9LA 3JAMN 4MW8A 3H1HH 1BZKA 4LF9O 3QTCA 3ZMTA 2P5OA 2QKSA 2B5UA 1I5YA 5KMGA 2HVJC 1K4CC 2F95B 1RPRA 1CP9A 5KHHA 4LF6B 5BR8B 1HNXO 4JI5O 1M4UA 1R3KC 4KXRA 1JFFA 5CA3A 4DUZB 1MNGA 1KC8W 4DR1O 1SZXA 4DW1A 4J7ZA 2BTQB 3VQVA 5K1XA 3W7XA 2PYJA 3IC9A 1O9GA 4I0XA 1N33O 4DR6B 2DQ3A 4D6TH 2X7RB 2AZ2A 2KQXA 1AJPA 1XNRO 1M9NA 4CS2A 2LP7A 3B8MA 3ABTA 4Q20A 3LNMB 2UUAB 1EN6A 2W6IG 1F51A 4LNUB 3BPZA 1W0KG 3SJQC 4LBEC 3SYAA 1ROPA 3RYCB 3APOA 4MVQA 1K8AW 4J42A 2P6JA 1G4YB 2XAQA 1RSOA 2LO1A 1TVKB 5DN6G 4HZ3A 1WNSA 2ZDIC 4FPPA 4ZKIA 4YJ2A 4X8AA 2EZPA 2HLDG 4DR7O 1VARA 2FYUH 4WFGA 5ITZA 4GKKB 5JJJB 1NR7A 1TUEB 3CCUV 2ZE6A 1FXVA 1QLEC 2EIJB 3ZRXA 2P06A 1KU9A 4DV5O 4ZHQB 4LFAB 4X20B 2WAMA 3P32A 3CCRV 3G80A 2EX3A 2F23A 3W7TA 1Q86W 2ITCC 4TUYA 1GN3A 4EB6A 1GKFA 3K08A 3Q4HB 4QPKA 2RQ6A 3THOA 4CS4A 5LMUO 3HKEA 2JS5A 4F4LA 1GM7A 2OTLV 3OW2U 1YEWA 4B3RO 2GHYA 3HKBB 2CE4A 2IW5A 2B9ZA 2XAJA 1VEWA 2Q8VA 1YCIA 4R8CA 5IYZB 5CN0A 4IYIA 1YJ9V 4H13B 4MTGA 3BCCH 2R9IA 1N32B 1R6KA 3ASOC 5GTHZ 3MAQA 1N36O 1ZTEA 3ABUA 3VBBA 3M8AA 1SKVA 2AHZA 4R50A 3KKYA 2ZR2A 1MABG 2KG7A 4U7OA 1XEQA 1YDXA 4O4IB 3BY6A 1R3IC 4O4HB 1FXKC 5CB4B 4K0KO 3ASOB 3RYHA 4H33A 2CAZC 3JAKB 2E3CA 2HJDA 3ZMUA 1IBLB 1K97A 3JD3A 3RGBA 3BAAA 3CRQA 1DF5A 2GBOA 3C3SA 4WFBV 2LFRA 4KFMA 5KHJA 4FLUA 1FXKB 3H9VA 1XMOB 1KBHA 3CHXA 3H01A 1MSWD 2PF4E 4ZOLB 1I0HA 1OHHG 2UU9B 1S3JA 1D5AA 1OCOC 3APQA 4DR6O 3HKDB 4GLXA 2Y69C 1Y76B 3OGCC 4Z1MG 1D2DA 5LGNA 2L6LA 3WG7C 1N4CA 4J41A 4LFCB 1UPGA 1ZLZA 5FPOA 4MTFA 1GH6A 4E2LA 3E8GA 2HP8A 1OCOB 3UT5A 1JX9A 5B1BC 2IM9A 3ZRWB 2Y69B 1FFXA 4MS2A 5KAFZ 5FPRA 3WG7B 2PZSA 5EYPB 2F66C 2EZOA 4O4JB 1XMQB 4X64B 3ETGA 1CXZB 2CTRA 4JTAB 3N2KA 5B1BB 3H1LH 2V1DA 3W7SA 3JASA 4JI1O 4HYOA 2HHHO 4AQYB 4GT1A 3I55V 1NJIW 3CRAA 4DV6O 2QM8A 1MOFA 4IYHA 4KP4A 4FLXA 2OIEA 3C90A 3WU2Z 2QWRB 1SC5B 1ZAUA 1COWG 2AZ0A 5C8YB 5IDJA 4BW9A 1R73A 4YJ3B 4LNUA 2A06H 4FLWA 3ZHSA 1X4TA 1JA8A 2E5LB 2NLJC 5E79Z 2BOCC 3JARA 2OIGA 1TVKA 4DV7B 2WPDG 4MVOA 1S5JA 5DEDA 2AW9A 3SPJA 3BA8A 3KG2A 1XI1A 3BABA 4DXWA 5GONB 5KHKA 3WB2A 1W59A 4DUYO 1SERA 1Q5OA 4CC5A 2QGNA 2ZE7A 4UV8A 3OMIB 3B8NA 4ZHQA 2ZDIA 5J2TA 1YIJV 4H0LB 2Q7EA 3ZJZA 2JEXA 4ZI7A 2ZIOA 4NKGB 4X1KB 3OAAG 1VP7A 3IC7A 3T1YB 4IL6Z 4I9WA 5KMGB 2VRZA 4TSFG 3STZC 1I5XA 1NKDA 3D3IA 3KCYA 4YHHB 2O57A 5D5PA 1GN6A 1U96A 3K79A 4QE7A 1S5HC 1RPOA 3SYOA 3ICXA 3A2FA 1JFFB 1XILA 4X62B 3S3XA 1XQ8A 2R72A 1NTMH 1V9PA 1XMOO 3RVZA 1WN7A 3MHHC 4B3SO 4I0XB 3FYIB 2UU9O 3ZHQA 2BSKB 2IJJA 3K58A 3SPHA 3B40A 3K5NA 4KHPB 3K9AA 1ZUQA 1YJNV 3SR2C 3IAYA 2BOBC 2F43G 2Y4TA 4LFBB 2CH7A 3ZMZA 5KX5A 1EFRG 1BQZA 2YXLA 3H1IH 1WAZA 4X66B 4K8XA 4G27B 4UCOA 5F2VO 4DV1B 2A0LA 5CA0A 4NXNO 3JAKA 2A9HA 2MW2B 2CUGA 1H2MA 2QWNB 2JGUA 1XMQO 1B6QA 1IBKB 4GZRB 4LCUC 4X64O 4TWKA 2ZNIA 4UVAA 4JI6O 3T1HB 5CBFA 1IURA 2Q7HA 4JV5O 4FIPC 2HG5C 4NB5A 4YJ2B 2WLHA 4D7TA 1WP7A 4CH3A 3L73H 4AILC 2ETNA 1PL0A 4DW0A 3QNEA 3ZIAG 4RQFA 3A8TA 1IX9A 4JI0O 2UXBO 1BS3A 3KZIZ 1G1XB 3JAWB 4BR6A 2NN4A 1FJGB 5J2UA 2QEXV 4JZGA 1Q43A 2L35A 2PYLA 2GTAA 1XOUA 3JALA 4TUYB 4DV2O 3ZRWA 2FB5A 4NXMO 2DE0X 2E5LO 5EYPA 3HKEB 4O4JA 1IVSA 4K3AA 4JZ2A 3EXAA 1D5NA 4PDRA 4FFBA 4PD4F 2QR4A 4FFKA 4BWAA 5EZYA 4CZZA 2YI9A 3UQ8A 1Q81W 4DV3O 3OEEG 1XNQB 4RUEA 2AGAA 2QTOA 1PM9A 1V55C 4LF7B 1VQ7V 3CMAV 3C3TA 4F6RA 1N0NA 3CXCU 3CMEV 5C8YA 2B1GA 3VOUA 1Q8IA 4GX0A 3T1YO 1XUQA 2KG7B 1K33A 2YIAA 3SPIA 2YS8A 5BZBA 1KMIZ 3SDLA 4UB8Z 4YHHO 1GM9A 3FYEB 1HR0O 4Q6GA 3QG5A 1I7FA 4EFEA 3DXRB 3RYHB 1YTFD 3VQWA 4DV0B 4FZ0A 1N34O 4OX9B 2KKWA 2P67A 5B1NA 5IE9A 4NTXA 2QA4V 3FB7C 1K4DC 4X62O 1KUQA 4JAVA 1CEZA 4J10A 5JQGB 2A3QA 1KP2A 4QIWF 4TQFA 3CB2A 1DGSA 2ZNJA 1PPJH 4WFAV 3PJSK 4GX1A 2XNDG 5AG2A 2JRIA 4TT3G 1K7DA 2EINC 3OE7G 4JYYA 3UO3A 3ZS8C 1QR9A 3IJ4A 1PNMA 4JYCA 5LP6A 2JIZG 4X1KA 3WB0A 5IWAO 5EC1C 4JTCB 5LGUA 2P4KA 1P49A 1W2BU 4RO2A 3O65A 2VQEO 5CBHA 4DV1O 2EJRA 4X89A 4LF8B 5IJ9B 2EINB 4J9YB 3UT5B 1NU1H 3HKCB 3ZHRA 1VQ4V 3ZCCA 4BIOA 4NYKA 1FFXB 2F1MA 1PNKA 3ZRSA 4DR3B 1IBKO 4L8JA 5FLXN 4YY3B 4B3TB 1IXBA 1A32A 4AI8A 2DYRC 5GW7A 4LF4O 3CC7V 3WFVA 3N2KB 4B7KA 4JGSA 4QE9A 5BMVB 3JASB 4P2ZA 3ZHTA 3ABMB 1QHTA 2BSKA 4U7NA 2OYQA 1KB9F 2DYSC 1VQLV 3AG1C 5K1PA 3E22A 2K9PA 2WLIA 1M57C 4QNHB 1I08A 3G67A 1AI7A 3K0GA 2CGOA 4MTXA 3D36C 2CDYA 3DC6A 2DYRB 1HWYA 3QO7A 4X1IB 5A9GA 3W7UA 1RP3B 2Y0IA 3RT3C 4B3MO 2DYSB 3AG1B 2YIBA 1ZWIC 1M57B 1MSDA 3OUSA 4UFZA 1SESA 3UKMA 5KLVH 5DM6V 3JARB 4MVZA 2EIJC 4YIOA 1TAEA 1J5EB 2F4VB 3CE2A 4WCEV 3CC2V 1GN2A 4B08A 3CCSV 1HNZO 4DO2A 4NTWA 1SS3A 4ASUG 1K3EA 3EHBB 2E75B 5IYDO 1JCHA 2XHBA 4LWSA 2AHYA 3JAWA 1IBMB 4ABMA 4AHCA 3E8BA 2OCCB 1AJQA 1SQVH 3ZX6A 4RWUA 2NNUA 5J2TB 3H1JH 4JI8B 4ZI7B 2JGDA 3TK1A 5EIBD 3SYPA 2RN9A 3SJAC 2YDEA 1NR1A 2M6YA 4FLVA 4W4KA 4I7ZB 3M99B 1R3JC 4J7JA 1SQGA 1HNWB 3B4SA 1KQSU 4UCSA 4QPJA 2IJHA 5JH7A 3HR0A 2WLNA 3TXQA 3CS5A 4WF9V 4LF5B 4G28B 1M93A 1G8MA 1T5EA 1M1KW 1JOYA 3LSSA 2WSSG 1NH2D 3AG4C 2HFEC 5L3DA 3QVNA 4QJFB 1TGOA 4F6EA 2CH7B 5KX5B 1Q6HA 4IGGA 4LF6O 4U3FH 1Y74A 5BR8O 3ML0A 3DXRA 2YSUB 4I4TA 5CA0B 5LXTB 4GCZA 3ASNC 5E1AC 3E89A 5H6RA 1SQBH 4X9QA 3AG4B 1ZL8A 3R65A 3L74H 4O4LA 2UUCB 4DUZO 4PA6A 2LFSA 4XBFA 5JQGA 2R9RB 2QM4A 3LUTB 4JTDB 2YI8A 1OV9A 4QGPA 5IY5C 2H8PC 3ASNB 4JI4B 4K8ZA 1UFIA 2HJFC 2B1IA 4BIZA 1LR1A 1F23A 1KECA 1Z2GA 1MZEA 1AP5A 5J2UB 2JEUA 3CRCA 3AG3B 3FAVA 5A2QN 5LA6B 2EIKC 5IY5B 3J81N 1SA0A 2YIBD 4OPAA 2UUAO 5IJ9A 1BSMA 1NZ6A 3JALB 3ZHUA 3HKCA 1VIBA 1BCCH 3E2EA 2ZIMA 1PD3A 5B1AB 1K92A 5LHHA 4UVBA 5KUKA 3IGAC 2LGWA 2BTOA 1SF9A 1GTOA 4I9QA 4PA3A 1EN4A 1J5EO 2F4VO 2EIKB 3SYCA 2QKCA 1ZSPA 3ZN0A 1VQ5V 2QKAA 3K04A 5D5QA 5JVDB 3CRRA 5BMVA 4FFBB 2DJVA 1DLBA 4GKKO 1XHXA 5EZYB 3N2GA 4MTOA 2CTQA 2RDCA 3ZRVA 5L3FA 2LW1A 3CYOA 3DC5A 4DV4B 4CS3A 1YITV 5EIBC 3AG2C 1TA8A 2OCHA 1QVGU 2ZE8A 3LSQA 1MG1A 4LFAO 4F6RB 1Y67A 4X1IA 4JAAA 2VWKA 4ZBMA 4KUMA 1E1QG 1H2LA 2Q69A 1JJOA 1YJWV 1H38A 1SQQH 2UXXA 3AEIA
chains in the Genus database with same CATH topology
4GKJO 2DOSA 1D2DA 1F7YA 4DUZO 3J7AU 4JI4O 1IBMO 4X65O 4JI0O 2UXBO 5LL6Y 1HNWO 2JRIA 1HNZO 1HNXO 1G1XB 4DR4O 5LMUO 4JI8O 2VQFO 4JI5O 5H5NA 4JI7O 4LF8O 4DR1O 4A5UB 1X59A 4B3RO 5IWAO 4DR3O 4AQYO 4DV2O 4YY3O 5LMNO 4B3TO 1N32O 2VQEO 3O65A 4NXMO 5BY1A 4DV1O 1YZBA 2E5LO 4JI3O 4DV4O 1N33O 1XNQO 5A2QN 3J81N 4JI1O 2UUAO 4OPAA 2HHHO 2N74A 1XMOO 1IBKO 5FLXN 1I94O 4JYAO 4LF7O 1XNRO 4LF5O 1FYJA 4KHPO 1N36O 1R6TA 4OPHA 1NS1A 4DV6O 4B3SO 3M8AA 2UU9O 4LFBO 3R66A 1FKAO 4DV3O 1A32A 2UUBO 1IBLO 4LF4O 2FKXA 2AGAA 3OTOO 4X66O 4JI2O 1XEQA 1J5EO 2F4VO 2UXDO 4DV7O 4K0KO 2DJVA 3J80N 4GKKO 5BXZA 1AB3A 5IT9N 3T1HO 3T1YO 4DR2O 4DV0O 4NXNO 4OX9O 4DR7O 3SDLA 2UXCO 3RT3C 4DR5O 4B3MO 4YHHO 1XMQO 1HR0O 4LFAO 2UUCO 2ZM6O 4X64O 3JAMN 4JI6O 1DK1A 1AILA 4LF6O 4LF9O 2LW7A 1N34O 1R1BA 4LFCO 3F5TA 4JV5O 5BR8O 4DR6O 2ZKOA 2Z0AA 4X62O 4DUYO 4DV5O 1KUQA 1FJGO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ O;  2DOS A;  1D2D A;  1F7Y A;  4DUZ O;  3J7A U;  4JI4 O;  1IBM O;  4X65 O;  4JI0 O;  2UXB O;  5LL6 Y;  1HNW O;  2JRI A;  1HNZ O;  1HNX O;  1G1X B;  4DR4 O;  5LMU O;  4JI8 O;  2VQF O;  4JI5 O;  5H5N A;  4JI7 O;  4LF8 O;  4DR1 O;  4A5U B;  1X59 A;  4B3R O;  5IWA O;  4DR3 O;  4AQY O;  4DV2 O;  4YY3 O;  5LMN O;  4B3T O;  1N32 O;  2VQE O;  3O65 A;  4NXM O;  5BY1 A;  4DV1 O;  1YZB A;  2E5L O;  4JI3 O;  4DV4 O;  1N33 O;  1XNQ O;  5A2Q N;  3J81 N;  4JI1 O;  2UUA O;  4OPA A;  2HHH O;  2N74 A;  1XMO O;  1IBK O;  5FLX N;  1I94 O;  4JYA O;  4LF7 O;  1XNR O;  4LF5 O;  1FYJ A;  4KHP O;  1N36 O;  1R6T A;  4OPH A;  1NS1 A;  4DV6 O;  4B3S O;  3M8A A;  2UU9 O;  4LFB O;  3R66 A;  1FKA O;  4DV3 O;  1A32 A;  2UUB O;  1IBL O;  4LF4 O;  2FKX A;  2AGA A;  3OTO O;  4X66 O;  4JI2 O;  1XEQ A;  1J5E O;  2F4V O;  2UXD O;  4DV7 O;  4K0K O;  2DJV A;  3J80 N;  4GKK O;  5BXZ A;  1AB3 A;  5IT9 N;  3T1H O;  3T1Y O;  4DR2 O;  4DV0 O;  4NXN O;  4OX9 O;  4DR7 O;  3SDL A;  2UXC O;  3RT3 C;  4DR5 O;  4B3M O;  4YHH O;  1XMQ O;  1HR0 O;  4LFA O;  2UUC O;  2ZM6 O;  4X64 O;  3JAM N;  4JI6 O;  1DK1 A;  1AIL A;  4LF6 O;  4LF9 O;  2LW7 A;  1N34 O;  1R1B A;  4LFC O;  3F5T A;  4JV5 O;  5BR8 O;  4DR6 O;  2ZKO A;  2Z0A A;  4X62 O;  4DUY O;  4DV5 O;  1KUQ A;  1FJG O; 
#chains in the Genus database with same CATH topology
 3AG2 B;  4J9Z B;  3D36 A;  4Z2W A;  1QR8 A;  2ZM6 B;  2DWE C;  3BHP A;  2FML A;  3RFR A;  2Q0A A;  1OJH A;  2YXH A;  5KUM A;  1HNW O;  3CPW U;  1WB8 A;  3NXS A;  3MHS C;  5LP6 C;  4DRX A;  2FL4 A;  1RFY A;  5B66 Z;  4R6Z A;  3JSL A;  2CGN A;  4PDM A;  1XL6 A;  1Q7Y W;  1FAF A;  1H8E G;  5B5E Z;  1N32 O;  2VQF B;  1J95 A;  2IJI A;  4JI7 B;  2E74 B;  2BE3 A;  2GV9 A;  4EKW A;  5LP6 B;  3L71 H;  3X2Q C;  4UVC A;  1N8R W;  4IHJ A;  2BCC H;  4MVU A;  3DTU B;  3CEI A;  3T4D A;  1NH2 B;  4W4L A;  1BHA A;  2H94 A;  3GB7 C;  1L0L H;  4PI2 A;  3ABL C;  1LUW A;  4P30 A;  2Q6A A;  4JI3 B;  3PN1 A;  3IFX A;  4WFH A;  3R66 A;  5L3E A;  3QO5 A;  1IBL O;  1S0V A;  2Q4P A;  4JYA B;  3X2Q B;  5FL7 G;  2CTP A;  2AXT Z;  2ZT9 B;  4O2B A;  2ATK C;  3K5O A;  1TUB A;  3J80 N;  3ABL B;  5BXZ A;  1OCC C;  3OTO B;  2R70 A;  2HR3 A;  2HKO A;  1ZX3 A;  3TGU H;  3MD0 A;  2W0F C;  1GAX A;  5H6Q A;  3U10 A;  5IYC O;  1VF6 A;  3E22 B;  4NVP A;  2WLI B;  2ZXW C;  1PP9 H;  3K03 A;  2LW7 A;  1OCC B;  4LFC O;  5LHG A;  2W6J G;  1M90 W;  2LQT A;  2WLM A;  3CWB H;  4EFB A;  2ZKO A;  2Z0A A;  3OR7 C;  4PHZ A;  1VF5 B;  3OTF A;  3T2M A;  5LXT A;  3L72 H;  4LF9 B;  2ZXW B;  2YUA A;  1B04 A;  3RN4 A;  2Q73 A;  4L87 A;  1GMG A;  4I50 B;  2RNB A;  2YXY A;  5KHI A;  5J9P C;  4A5U B;  3QO8 A;  4XDK A;  3RW0 A;  2UXC B;  4DR5 B;  4AQY O;  1HNX B;  2E76 B;  1FS0 G;  5BY1 A;  1BE3 H;  4JI5 B;  3G4S V;  3FX7 A;  4JAS A;  4DV4 O;  4LWS B;  2OT5 A;  2MK3 A;  4HBN A;  4PA9 A;  4JF3 A;  1AR5 A;  1AVM A;  5LA6 A;  1FYJ A;  4JYB A;  1LNQ A;  1H2K A;  2QDO A;  2JGD B;  1N33 B;  3AK1 A;  3K3W A;  3T1C A;  4RUF A;  4TQD A;  1U97 A;  1W0J G;  2WLL B;  3CJH A;  5EK0 A;  4DV7 O;  1AI4 A;  2GDS A;  2X6B A;  4PV1 B;  1IDS A;  2IH1 C;  3FB8 C;  5JVD A;  5JH7 B;  2V7Q G;  1AP6 A;  3P3N A;  2IU0 A;  2EJ7 A;  4UB6 Z;  3F7V C;  3H1K H;  2X6C A;  3U0Z A;  1K34 A;  4IIJ A;  3SPC A;  1L0N H;  1SET A;  1ENV A;  4FM0 A;  5LOV A;  1R1B A;  4JI2 B;  3TJT A;  2QTS A;  3UCS C;  1PKX A;  1YSC A;  1S77 D;  5CMU A;  2QWO B;  3SPG A;  4I55 B;  2X6A A;  1Y74 B;  1JVM A;  3L9D A;  4I4T B;  5EBW C;  2OWO A;  2PY5 A;  5H5N A;  1MMM A;  2G38 A;  3JD2 A;  4DR2 B;  4O4L B;  1QCE A;  1ZL8 B;  2H3O A;  3D8C A;  4O2A B;  4DK1 A;  1VMG A;  1LUV A;  4JPR A;  2JJ2 G;  1QVF U;  1Q3E A;  1YZB A;  2CK3 G;  2PGG A;  1VQ9 V;  3QF7 A;  4TV8 A;  3TCU A;  5L3C A;  2DWD C;  1CPY A;  4X1Y A;  1VQK V;  1URF A;  3RYF A;  4J11 A;  2YEV A;  1AR4 A;  4KHP O;  1S76 D;  4LFB O;  3CSX A;  1NBM G;  4CBC A;  1GO3 F;  5IJ0 B;  4X66 O;  3FAV B;  5EBL C;  1P7G A;  4PDV A;  1SA0 B;  1OCZ C;  2JK5 C;  2WLK A;  1QU7 A;  3L75 H;  1N36 B;  4TV9 A;  3ABM C;  2RCV A;  3ZED A;  4LR3 A;  3E83 A;  4C7U A;  2YIC A;  1XL4 A;  3T4Z A;  1AB3 A;  4GYC B;  3RVY A;  3T1H O;  2JDI G;  3HB3 B;  1WP8 A;  1H2G A;  1OCZ B;  4K0K B;  2UXC O;  3A0R A;  4GX5 A;  4DR5 O;  3K59 A;  2JVD A;  1Q90 D;  4CC6 A;  5C93 A;  4ICG A;  3AK3 A;  3N2G B;  4NR1 A;  4RAI A;  3EFF K;  3CCE V;  4MSW C;  3SGI A;  1NTZ H;  4H37 A;  4LH6 A;  1BQ0 A;  1FJG O;  5FNV B;  1AJN A;  3CXH F;  3SJB C;  2Z3Y A;  3JAT A;  1F7Y A;  3J7A U;  3JCZ A;  2UXD B;  4N23 A;  5CA1 A;  1WA8 B;  1KP3 A;  3BEH A;  1YXB A;  2F93 B;  1E1R G;  1L8D A;  2ILM A;  1PV0 A;  4I50 A;  4FZ1 A;  3TET A;  4LC1 A;  2X0L A;  2OCC C;  4XDL A;  2WA4 A;  1NQT A;  1E79 G;  3ETD A;  4DRX B;  1SQF A;  4PA4 A;  3G71 V;  3ZHV A;  1XNQ O;  5LHI A;  1NT2 B;  2K1E A;  2Y48 A;  4LF7 O;  1GRJ A;  1JR9 A;  2DQ0 A;  4OPH A;  2ZQM A;  1YVW A;  1GM8 A;  5KA6 A;  1KKC A;  5JJE B;  2FKX A;  4JI1 B;  1VQM V;  4JI2 O;  3LDD A;  3O9O A;  3K5M A;  2HHH B;  2NR5 A;  4IHJ B;  1JMK C;  1OCR C;  4YXW G;  1MA1 A;  1YF2 A;  4DV6 B;  1B06 A;  2M7W A;  3VQX A;  2WLL A;  2QE7 G;  2P7T C;  5LBQ A;  4N21 A;  1BL8 A;  1SQP H;  1SQX H;  2XAF A;  2IH3 C;  4DR2 O;  5L3B A;  4DV0 O;  3FB5 C;  4OX9 O;  1XDC A;  3OUF A;  4NTY A;  1M5I A;  5JCO A;  5TIS Z;  3RYI B;  3LDE A;  1OCR B;  1VF6 C;  2XUM A;  4G2K A;  1YTF B;  2LJ2 A;  4O2B B;  1I94 B;  4LP8 A;  1Y4M A;  2VS0 A;  1QLE B;  1TUB B;  2D2C B;  2HVK C;  1EZJ A;  2Q7G A;  4XDJ A;  5HFL A;  1B3Q A;  1F4N A;  5GTI Z;  1HW7 A;  4I5S A;  2JJ1 G;  2DOS A;  4BIU A;  3OMN B;  3WB1 A;  2XT9 A;  4WBN A;  5EC2 C;  3K06 A;  2ADP A;  2VWJ A;  5LYJ A;  1FD9 A;  5HFM A;  4DUY B;  3JCU Z;  5H9C A;  4LF8 O;  1BMF G;  3AG7 A;  4FK5 C;  3OD4 A;  2ZCE A;  4I55 A;  3E8H A;  2C2A A;  1X59 A;  4KL1 A;  4H44 B;  1FXH A;  4YIP A;  1K9M W;  4Z1V A;  3A0B Z;  4DR3 O;  4YY3 O;  4B3T O;  4O2A A;  4FMT A;  2A7W A;  3AK2 A;  5JJN B;  1JJ2 U;  1H8H G;  1HDJ A;  3RBZ A;  3F7Y C;  4PJ0 Z;  2N74 A;  3AG3 C;  1Y6X A;  4GKJ B;  3CCL V;  3E35 A;  2Y4U A;  1Q6U A;  2PI5 A;  2JS3 A;  3TXS A;  4X65 B;  1JQ0 A;  1QLN A;  5B1A C;  3K9S A;  3D3Q A;  4UCU A;  4CH4 A;  4BAY A;  2UXD O;  5IJ0 A;  4HNA A;  3L70 H;  4B3S B;  1DF4 A;  3E8F A;  1R3L C;  3BFR A;  3UM7 A;  3LDC A;  1O9H A;  5LMN B;  1M56 C;  3GWK C;  1FPO A;  2ZIN A;  2GTS A;  4BW5 A;  3K57 A;  1F4M A;  2P4V A;  3CJH B;  3CP1 A;  2XOK G;  1ORQ C;  3JSN A;  5CBG A;  1Q6I A;  3B77 A;  4NXN B;  1EZV H;  1M56 B;  2UUB B;  3S3W A;  4MVM A;  3JYC A;  2Q68 A;  2YID A;  2WA3 A;  1UJW B;  3JD1 A;  1V54 C;  1G6U A;  1IBM O;  2QM7 A;  4IIJ B;  3CX5 F;  2BTQ A;  5FNV A;  4JI6 B;  2D3O W;  4UXN A;  3SJC C;  1K5S A;  3OR6 C;  4JV5 B;  4CH5 A;  3EVK A;  5LOV B;  2Y0P A;  4MVR A;  4WFF A;  4D7S A;  4JI8 O;  1XBL A;  3CCV V;  2W0X A;  4PEL A;  4IT5 A;  2GSM B;  1WA8 A;  1NVP D;  1AI6 A;  2LGQ A;  3STL C;  3ZN1 A;  4P9O A;  4JI0 B;  2UXB B;  1V54 B;  2IU3 A;  4B7E A;  3F5W C;  1JPX A;  1SRY A;  4E4E A;  1IZ3 A;  1AI5 A;  4MVS A;  3BA9 A;  4UCT A;  3I56 V;  1GK9 A;  1VQO V;  3FB6 C;  1H2S B;  1I94 O;  4DV2 B;  4LF5 O;  1EM1 A;  3RYC A;  4NXM B;  1NS1 A;  2GUZ B;  1YHQ V;  4R7C A;  1BGY H;  2RMK B;  4DR4 B;  1YI2 V;  2HEP A;  4TV8 B;  2KSD A;  1THZ A;  3FKS G;  4X1Y B;  3OFN G;  2XAG A;  3RYF B;  1VQN V;  4TOI A;  2ZR3 A;  4P9P A;  2PI4 A;  4RQE A;  3W7W A;  2YEV B;  1KD1 W;  3OMA B;  2R9A A;  3FFQ A;  3BRC A;  2PUS A;  4U3J B;  3NR7 A;  4DV3 B;  1H2N A;  5B3S C;  2DMX A;  4GX2 A;  3GVM A;  1GN4 A;  2Q5Z A;  2P90 A;  1NTK H;  1WLE A;  4K35 A;  4X20 A;  4FJC C;  2ZD9 A;  4TV9 B;  2QWQ B;  2UUC O;  4UV9 A;  3CC4 V;  3ZMV A;  1WPB A;  2UXN A;  3RYI A;  3Q4H A;  1AIL A;  1OZ0 A;  5B3S B;  3P30 A;  1XRE A;  4JAU A;  2ITD C;  5JWP A;  1RM1 C;  4GKJ O;  1HR0 B;  2IBZ H;  4WFE A;  4JI4 O;  2CTW A;  2QWP B;  4X65 O;  2RJZ A;  4PDL A;  5LL6 Y;  1N0J A;  3HKB A;  1VQ8 V;  5H2F Z;  1N34 B;  1Y66 A;  4MW3 A;  2ADQ B;  4OGQ B;  4DYL A;  1PL4 A;  5DEC A;  2FTK A;  4J7K A;  5IYZ A;  1RM1 B;  2A79 B;  1AR1 B;  3JAT B;  1PNL A;  1BHB A;  2IJK A;  3CCM V;  1WB7 A;  3UO2 A;  4ZIB A;  5CA1 B;  2Q0O C;  5LMN O;  4FLT A;  3U11 A;  3OEH G;  4UCR A;  2N04 A;  3CRM A;  1DTO A;  3OT7 A;  1SZT A;  3G6B A;  2P22 C;  2Q67 A;  4O4I A;  4O4H A;  5IWA B;  4GUN A;  4FLY A;  5CB4 A;  2VQE B;  4FM1 A;  1Z5W A;  4PA7 A;  4MT8 A;  1FKA O;  3DSQ A;  2UUB O;  4PI0 A;  3I5D A;  3K0D A;  3M7M X;  2WLJ A;  3P3P A;  3KCX A;  4CH6 A;  3B2E E;  2XTA A;  4DR1 B;  4DK0 A;  1FXK A;  1RSO B;  1P84 F;  4FLZ A;  4FM2 A;  1K73 W;  4ZOL A;  1QBZ A;  1EBO A;  4LF4 B;  1S72 V;  5IT9 N;  4EEQ A;  1QNM A;  3HKD A;  5ITZ B;  5JCO C;  1Y76 A;  1KKD A;  3CCQ V;  2OTJ V;  1FFT B;  2ZM6 O;  1K5Q A;  1NVP B;  1XNR B;  5KAI Z;  2EIM C;  1DK1 A;  2DW4 A;  2V4D A;  3ZMS A;  3F5T A;  3LNN A;  3SYQ A;  1VF7 A;  3CCJ V;  1ARO P;  2EIL C;  4B3M B;  4EB6 B;  4OXS A;  5B1O A;  1Z5V A;  1WPX A;  1MZF A;  4X88 A;  2Z5U A;  1WJZ A;  5IYB O;  1VQP V;  1HP8 A;  1P4R A;  2EIM B;  4DR4 O;  3JD0 A;  2XAH A;  2DN9 A;  2VQF O;  5L3G A;  3BVO A;  4JI7 O;  2EIL B;  1VQ6 V;  3GWO A;  1L1F A;  5LGT A;  4DR7 B;  4WBN B;  1KYO F;  3HPL C;  5EBM C;  3E86 A;  1HNZ B;  5LYJ B;  2KB1 A;  4JI3 O;  3RWR D;  2WWW A;  3OM3 B;  4DV5 B;  3JD4 A;  3DGE A;  3LSU A;  4JYA O;  2EUL A;  3ABK C;  4UUJ C;  1XHZ A;  3VQY A;  4YJ3 A;  1Q82 W;  1R6T A;  1P7B A;  3ZBH A;  1EN5 A;  1V55 B;  2N05 A;  3OGI B;  1NI8 A;  4UCV A;  3MDS A;  2ODM A;  3OTO O;  5LMU B;  1QQC A;  2GUZ A;  3ETQ A;  3CD6 V;  2ARH A;  2YC0 A;  3ABK B;  3A0H Z;  3FD9 A;  2EBO A;  4FVM A;  4B3R B;  3B09 A;  4J80 A;  4LH7 A;  1S5L Z;  5KHG A;  2PTM A;  4HAM A;  1R6N A;  2XAS A;  4U3J A;  5GON A;  3G6E V;  1IXM A;  2ZE5 A;  3N27 A;  2QSA A;  3K5L A;  4HNA B;  1BT8 A;  1US6 A;  2QJ1 A;  5KA5 A;  3ETE A;  2Q9L A;  3JAM N;  4MW8 A;  3H1H H;  1BZK A;  4LF9 O;  3QTC A;  3ZMT A;  2P5O A;  2QKS A;  2B5U A;  1I5Y A;  5KMG A;  2HVJ C;  1K4C C;  2F95 B;  1RPR A;  1CP9 A;  5KHH A;  4LF6 B;  5BR8 B;  1HNX O;  4JI5 O;  1M4U A;  1R3K C;  4KXR A;  1JFF A;  5CA3 A;  4DUZ B;  1MNG A;  1KC8 W;  4DR1 O;  1SZX A;  4DW1 A;  4J7Z A;  2BTQ B;  3VQV A;  5K1X A;  3W7X A;  2PYJ A;  3IC9 A;  1O9G A;  4I0X A;  1N33 O;  4DR6 B;  2DQ3 A;  4D6T H;  2X7R B;  2AZ2 A;  2KQX A;  1AJP A;  1XNR O;  1M9N A;  4CS2 A;  2LP7 A;  3B8M A;  3ABT A;  4Q20 A;  3LNM B;  2UUA B;  1EN6 A;  2W6I G;  1F51 A;  4LNU B;  3BPZ A;  1W0K G;  3SJQ C;  4LBE C;  3SYA A;  1ROP A;  3RYC B;  3APO A;  4MVQ A;  1K8A W;  4J42 A;  2P6J A;  1G4Y B;  2XAQ A;  1RSO A;  2LO1 A;  1TVK B;  5DN6 G;  4HZ3 A;  1WNS A;  2ZDI C;  4FPP A;  4ZKI A;  4YJ2 A;  4X8A A;  2EZP A;  2HLD G;  4DR7 O;  1VAR A;  2FYU H;  4WFG A;  5ITZ A;  4GKK B;  5JJJ B;  1NR7 A;  1TUE B;  3CCU V;  2ZE6 A;  1FXV A;  1QLE C;  2EIJ B;  3ZRX A;  2P06 A;  1KU9 A;  4DV5 O;  4ZHQ B;  4LFA B;  4X20 B;  2WAM A;  3P32 A;  3CCR V;  3G80 A;  2EX3 A;  2F23 A;  3W7T A;  1Q86 W;  2ITC C;  4TUY A;  1GN3 A;  4EB6 A;  1GKF A;  3K08 A;  3Q4H B;  4QPK A;  2RQ6 A;  3THO A;  4CS4 A;  5LMU O;  3HKE A;  2JS5 A;  4F4L A;  1GM7 A;  2OTL V;  3OW2 U;  1YEW A;  4B3R O;  2GHY A;  3HKB B;  2CE4 A;  2IW5 A;  2B9Z A;  2XAJ A;  1VEW A;  2Q8V A;  1YCI A;  4R8C A;  5IYZ B;  5CN0 A;  4IYI A;  1YJ9 V;  4H13 B;  4MTG A;  3BCC H;  2R9I A;  1N32 B;  1R6K A;  3ASO C;  5GTH Z;  3MAQ A;  1N36 O;  1ZTE A;  3ABU A;  3VBB A;  3M8A A;  1SKV A;  2AHZ A;  4R50 A;  3KKY A;  2ZR2 A;  1MAB G;  2KG7 A;  4U7O A;  1XEQ A;  1YDX A;  4O4I B;  3BY6 A;  1R3I C;  4O4H B;  1FXK C;  5CB4 B;  4K0K O;  3ASO B;  3RYH A;  4H33 A;  2CAZ C;  3JAK B;  2E3C A;  2HJD A;  3ZMU A;  1IBL B;  1K97 A;  3JD3 A;  3RGB A;  3BAA A;  3CRQ A;  1DF5 A;  2GBO A;  3C3S A;  4WFB V;  2LFR A;  4KFM A;  5KHJ A;  4FLU A;  1FXK B;  3H9V A;  1XMO B;  1KBH A;  3CHX A;  3H01 A;  1MSW D;  2PF4 E;  4ZOL B;  1I0H A;  1OHH G;  2UU9 B;  1S3J A;  1D5A A;  1OCO C;  3APQ A;  4DR6 O;  3HKD B;  4GLX A;  2Y69 C;  1Y76 B;  3OGC C;  4Z1M G;  1D2D A;  5LGN A;  2L6L A;  3WG7 C;  1N4C A;  4J41 A;  4LFC B;  1UPG A;  1ZLZ A;  5FPO A;  4MTF A;  1GH6 A;  4E2L A;  3E8G A;  2HP8 A;  1OCO B;  3UT5 A;  1JX9 A;  5B1B C;  2IM9 A;  3ZRW B;  2Y69 B;  1FFX A;  4MS2 A;  5KAF Z;  5FPR A;  3WG7 B;  2PZS A;  5EYP B;  2F66 C;  2EZO A;  4O4J B;  1XMQ B;  4X64 B;  3ETG A;  1CXZ B;  2CTR A;  4JTA B;  3N2K A;  5B1B B;  3H1L H;  2V1D A;  3W7S A;  3JAS A;  4JI1 O;  4HYO A;  2HHH O;  4AQY B;  4GT1 A;  3I55 V;  1NJI W;  3CRA A;  4DV6 O;  2QM8 A;  1MOF A;  4IYH A;  4KP4 A;  4FLX A;  2OIE A;  3C90 A;  3WU2 Z;  2QWR B;  1SC5 B;  1ZAU A;  1COW G;  2AZ0 A;  5C8Y B;  5IDJ A;  4BW9 A;  1R73 A;  4YJ3 B;  4LNU A;  2A06 H;  4FLW A;  3ZHS A;  1X4T A;  1JA8 A;  2E5L B;  2NLJ C;  5E79 Z;  2BOC C;  3JAR A;  2OIG A;  1TVK A;  4DV7 B;  2WPD G;  4MVO A;  1S5J A;  5DED A;  2AW9 A;  3SPJ A;  3BA8 A;  3KG2 A;  1XI1 A;  3BAB A;  4DXW A;  5GON B;  5KHK A;  3WB2 A;  1W59 A;  4DUY O;  1SER A;  1Q5O A;  4CC5 A;  2QGN A;  2ZE7 A;  4UV8 A;  3OMI B;  3B8N A;  4ZHQ A;  2ZDI A;  5J2T A;  1YIJ V;  4H0L B;  2Q7E A;  3ZJZ A;  2JEX A;  4ZI7 A;  2ZIO A;  4NKG B;  4X1K B;  3OAA G;  1VP7 A;  3IC7 A;  3T1Y B;  4IL6 Z;  4I9W A;  5KMG B;  2VRZ A;  4TSF G;  3STZ C;  1I5X A;  1NKD A;  3D3I A;  3KCY A;  4YHH B;  2O57 A;  5D5P A;  1GN6 A;  1U96 A;  3K79 A;  4QE7 A;  1S5H C;  1RPO A;  3SYO A;  3ICX A;  3A2F A;  1JFF B;  1XIL A;  4X62 B;  3S3X A;  1XQ8 A;  2R72 A;  1NTM H;  1V9P A;  1XMO O;  3RVZ A;  1WN7 A;  3MHH C;  4B3S O;  4I0X B;  3FYI B;  2UU9 O;  3ZHQ A;  2BSK B;  2IJJ A;  3K58 A;  3SPH A;  3B40 A;  3K5N A;  4KHP B;  3K9A A;  1ZUQ A;  1YJN V;  3SR2 C;  3IAY A;  2BOB C;  2F43 G;  2Y4T A;  4LFB B;  2CH7 A;  3ZMZ A;  5KX5 A;  1EFR G;  1BQZ A;  2YXL A;  3H1I H;  1WAZ A;  4X66 B;  4K8X A;  4G27 B;  4UCO A;  5F2V O;  4DV1 B;  2A0L A;  5CA0 A;  4NXN O;  3JAK A;  2A9H A;  2MW2 B;  2CUG A;  1H2M A;  2QWN B;  2JGU A;  1XMQ O;  1B6Q A;  1IBK B;  4GZR B;  4LCU C;  4X64 O;  4TWK A;  2ZNI A;  4UVA A;  4JI6 O;  3T1H B;  5CBF A;  1IUR A;  2Q7H A;  4JV5 O;  4FIP C;  2HG5 C;  4NB5 A;  4YJ2 B;  2WLH A;  4D7T A;  1WP7 A;  4CH3 A;  3L73 H;  4AIL C;  2ETN A;  1PL0 A;  4DW0 A;  3QNE A;  3ZIA G;  4RQF A;  3A8T A;  1IX9 A;  4JI0 O;  2UXB O;  1BS3 A;  3KZI Z;  1G1X B;  3JAW B;  4BR6 A;  2NN4 A;  1FJG B;  5J2U A;  2QEX V;  4JZG A;  1Q43 A;  2L35 A;  2PYL A;  2GTA A;  1XOU A;  3JAL A;  4TUY B;  4DV2 O;  3ZRW A;  2FB5 A;  4NXM O;  2DE0 X;  2E5L O;  5EYP A;  3HKE B;  4O4J A;  1IVS A;  4K3A A;  4JZ2 A;  3EXA A;  1D5N A;  4PDR A;  4FFB A;  4PD4 F;  2QR4 A;  4FFK A;  4BWA A;  5EZY A;  4CZZ A;  2YI9 A;  3UQ8 A;  1Q81 W;  4DV3 O;  3OEE G;  1XNQ B;  4RUE A;  2AGA A;  2QTO A;  1PM9 A;  1V55 C;  4LF7 B;  1VQ7 V;  3CMA V;  3C3T A;  4F6R A;  1N0N A;  3CXC U;  3CME V;  5C8Y A;  2B1G A;  3VOU A;  1Q8I A;  4GX0 A;  3T1Y O;  1XUQ A;  2KG7 B;  1K33 A;  2YIA A;  3SPI A;  2YS8 A;  5BZB A;  1KMI Z;  3SDL A;  4UB8 Z;  4YHH O;  1GM9 A;  3FYE B;  1HR0 O;  4Q6G A;  3QG5 A;  1I7F A;  4EFE A;  3DXR B;  3RYH B;  1YTF D;  3VQW A;  4DV0 B;  4FZ0 A;  1N34 O;  4OX9 B;  2KKW A;  2P67 A;  5B1N A;  5IE9 A;  4NTX A;  2QA4 V;  3FB7 C;  1K4D C;  4X62 O;  1KUQ A;  4JAV A;  1CEZ A;  4J10 A;  5JQG B;  2A3Q A;  1KP2 A;  4QIW F;  4TQF A;  3CB2 A;  1DGS A;  2ZNJ A;  1PPJ H;  4WFA V;  3PJS K;  4GX1 A;  2XND G;  5AG2 A;  2JRI A;  4TT3 G;  1K7D A;  2EIN C;  3OE7 G;  4JYY A;  3UO3 A;  3ZS8 C;  1QR9 A;  3IJ4 A;  1PNM A;  4JYC A;  5LP6 A;  2JIZ G;  4X1K A;  3WB0 A;  5IWA O;  5EC1 C;  4JTC B;  5LGU A;  2P4K A;  1P49 A;  1W2B U;  4RO2 A;  3O65 A;  2VQE O;  5CBH A;  4DV1 O;  2EJR A;  4X89 A;  4LF8 B;  5IJ9 B;  2EIN B;  4J9Y B;  3UT5 B;  1NU1 H;  3HKC B;  3ZHR A;  1VQ4 V;  3ZCC A;  4BIO A;  4NYK A;  1FFX B;  2F1M A;  1PNK A;  3ZRS A;  4DR3 B;  1IBK O;  4L8J A;  5FLX N;  4YY3 B;  4B3T B;  1IXB A;  1A32 A;  4AI8 A;  2DYR C;  5GW7 A;  4LF4 O;  3CC7 V;  3WFV A;  3N2K B;  4B7K A;  4JGS A;  4QE9 A;  5BMV B;  3JAS B;  4P2Z A;  3ZHT A;  3ABM B;  1QHT A;  2BSK A;  4U7N A;  2OYQ A;  1KB9 F;  2DYS C;  1VQL V;  3AG1 C;  5K1P A;  3E22 A;  2K9P A;  2WLI A;  1M57 C;  4QNH B;  1I08 A;  3G67 A;  1AI7 A;  3K0G A;  2CGO A;  4MTX A;  3D36 C;  2CDY A;  3DC6 A;  2DYR B;  1HWY A;  3QO7 A;  4X1I B;  5A9G A;  3W7U A;  1RP3 B;  2Y0I A;  3RT3 C;  4B3M O;  2DYS B;  3AG1 B;  2YIB A;  1ZWI C;  1M57 B;  1MSD A;  3OUS A;  4UFZ A;  1SES A;  3UKM A;  5KLV H;  5DM6 V;  3JAR B;  4MVZ A;  2EIJ C;  4YIO A;  1TAE A;  1J5E B;  2F4V B;  3CE2 A;  4WCE V;  3CC2 V;  1GN2 A;  4B08 A;  3CCS V;  1HNZ O;  4DO2 A;  4NTW A;  1SS3 A;  4ASU G;  1K3E A;  3EHB B;  2E75 B;  5IYD O;  1JCH A;  2XHB A;  4LWS A;  2AHY A;  3JAW A;  1IBM B;  4ABM A;  4AHC A;  3E8B A;  2OCC B;  1AJQ A;  1SQV H;  3ZX6 A;  4RWU A;  2NNU A;  5J2T B;  3H1J H;  4JI8 B;  4ZI7 B;  2JGD A;  3TK1 A;  5EIB D;  3SYP A;  2RN9 A;  3SJA C;  2YDE A;  1NR1 A;  2M6Y A;  4FLV A;  4W4K A;  4I7Z B;  3M99 B;  1R3J C;  4J7J A;  1SQG A;  1HNW B;  3B4S A;  1KQS U;  4UCS A;  4QPJ A;  2IJH A;  5JH7 A;  3HR0 A;  2WLN A;  3TXQ A;  3CS5 A;  4WF9 V;  4LF5 B;  4G28 B;  1M93 A;  1G8M A;  1T5E A;  1M1K W;  1JOY A;  3LSS A;  2WSS G;  1NH2 D;  3AG4 C;  2HFE C;  5L3D A;  3QVN A;  4QJF B;  1TGO A;  4F6E A;  2CH7 B;  5KX5 B;  1Q6H A;  4IGG A;  4LF6 O;  4U3F H;  1Y74 A;  5BR8 O;  3ML0 A;  3DXR A;  2YSU B;  4I4T A;  5CA0 B;  5LXT B;  4GCZ A;  3ASN C;  5E1A C;  3E89 A;  5H6R A;  1SQB H;  4X9Q A;  3AG4 B;  1ZL8 A;  3R65 A;  3L74 H;  4O4L A;  2UUC B;  4DUZ O;  4PA6 A;  2LFS A;  4XBF A;  5JQG A;  2R9R B;  2QM4 A;  3LUT B;  4JTD B;  2YI8 A;  1OV9 A;  4QGP A;  5IY5 C;  2H8P C;  3ASN B;  4JI4 B;  4K8Z A;  1UFI A;  2HJF C;  2B1I A;  4BIZ A;  1LR1 A;  1F23 A;  1KEC A;  1Z2G A;  1MZE A;  1AP5 A;  5J2U B;  2JEU A;  3CRC A;  3AG3 B;  3FAV A;  5A2Q N;  5LA6 B;  2EIK C;  5IY5 B;  3J81 N;  1SA0 A;  2YIB D;  4OPA A;  2UUA O;  5IJ9 A;  1BSM A;  1NZ6 A;  3JAL B;  3ZHU A;  3HKC A;  1VIB A;  1BCC H;  3E2E A;  2ZIM A;  1PD3 A;  5B1A B;  1K92 A;  5LHH A;  4UVB A;  5KUK A;  3IGA C;  2LGW A;  2BTO A;  1SF9 A;  1GTO A;  4I9Q A;  4PA3 A;  1EN4 A;  1J5E O;  2F4V O;  2EIK B;  3SYC A;  2QKC A;  1ZSP A;  3ZN0 A;  1VQ5 V;  2QKA A;  3K04 A;  5D5Q A;  5JVD B;  3CRR A;  5BMV A;  4FFB B;  2DJV A;  1DLB A;  4GKK O;  1XHX A;  5EZY B;  3N2G A;  4MTO A;  2CTQ A;  2RDC A;  3ZRV A;  5L3F A;  2LW1 A;  3CYO A;  3DC5 A;  4DV4 B;  4CS3 A;  1YIT V;  5EIB C;  3AG2 C;  1TA8 A;  2OCH A;  1QVG U;  2ZE8 A;  3LSQ A;  1MG1 A;  4LFA O;  4F6R B;  1Y67 A;  4X1I A;  4JAA A;  2VWK A;  4ZBM A;  4KUM A;  1E1Q G;  1H2L A;  2Q69 A;  1JJO A;  1YJW V;  1H38 A;  1SQQ H;  2UXX A;  3AEI A; 
#chains in the Genus database with same CATH homology
 4GKJ O;  2DOS A;  1D2D A;  1F7Y A;  4DUZ O;  3J7A U;  4JI4 O;  1IBM O;  4X65 O;  4JI0 O;  2UXB O;  5LL6 Y;  1HNW O;  2JRI A;  1HNZ O;  1HNX O;  1G1X B;  4DR4 O;  5LMU O;  4JI8 O;  2VQF O;  4JI5 O;  5H5N A;  4JI7 O;  4LF8 O;  4DR1 O;  4A5U B;  1X59 A;  4B3R O;  5IWA O;  4DR3 O;  4AQY O;  4DV2 O;  4YY3 O;  5LMN O;  4B3T O;  1N32 O;  2VQE O;  3O65 A;  4NXM O;  5BY1 A;  4DV1 O;  1YZB A;  2E5L O;  4JI3 O;  4DV4 O;  1N33 O;  1XNQ O;  5A2Q N;  3J81 N;  4JI1 O;  2UUA O;  4OPA A;  2HHH O;  2N74 A;  1XMO O;  1IBK O;  5FLX N;  1I94 O;  4JYA O;  4LF7 O;  1XNR O;  4LF5 O;  1FYJ A;  4KHP O;  1N36 O;  1R6T A;  4OPH A;  1NS1 A;  4DV6 O;  4B3S O;  3M8A A;  2UU9 O;  4LFB O;  3R66 A;  1FKA O;  4DV3 O;  1A32 A;  2UUB O;  1IBL O;  4LF4 O;  2FKX A;  2AGA A;  3OTO O;  4X66 O;  4JI2 O;  1XEQ A;  1J5E O;  2F4V O;  2UXD O;  4DV7 O;  4K0K O;  2DJV A;  3J80 N;  4GKK O;  5BXZ A;  1AB3 A;  5IT9 N;  3T1H O;  3T1Y O;  4DR2 O;  4DV0 O;  4NXN O;  4OX9 O;  4DR7 O;  3SDL A;  2UXC O;  3RT3 C;  4DR5 O;  4B3M O;  4YHH O;  1XMQ O;  1HR0 O;  4LFA O;  2UUC O;  2ZM6 O;  4X64 O;  3JAM N;  4JI6 O;  1DK1 A;  1AIL A;  4LF6 O;  4LF9 O;  2LW7 A;  1N34 O;  1R1B A;  4LFC O;  3F5T A;  4JV5 O;  5BR8 O;  4DR6 O;  2ZKO A;  2Z0A A;  4X62 O;  4DUY O;  4DV5 O;  1KUQ A;  1FJG O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...