2ZKOA

Structural basis for dsrna recognition by ns1 protein of human influenza virus a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
70
structure length
70
Chain Sequence
MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for dsRNA recognition by NS1 protein of influenza A virus
pubmed doi rcsb
source organism Influenza a virus
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(P*AP*GP*AP*CP*AP*GP*CP*AP*UP*UP*AP*UP*GP*CP*UP*GP*
total genus 30
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2zkoA00
4GKJO 4X62O 1I94O 1XNQO 1N36O 1N34O 1FYJA 3RT3C 4KHPO 4JI1O 4JI2O 2UUAO 2E5LO 1NS1A 2HHHO 4DR6O 4B3SO 4DV2O 5LMNO 4JI4O 3M8AA 4X66O 1FJGO 5LMUO 1HR0O 1N32O 1D2DA 1HNWO 2UUCO 1X59A 4DR4O 3OTOO 3T1HO 3T1YO 1DK1A 1IBLO 4DV5O 4B3MO 4NXNO 1HNXO 3J7AU 4YY3O 4DV0O 4JI0O 5IWAO 2LW7A 4LF6O 2ZKOA 3J80N 4DV1O 4DR7O 4DUYO 1F7YA 1XNRO 5A2QN 2ZM6O 3R66A 1R6TA 2F4VO 4JI3O 3SDLA 1HNZO 3O65A 4LF5O 2FKXA 4JYAO 4DV6O 1N33O 4JI8O 2UXBO 1KUQA 3J81N 4JI7O 1A32A 5LL6Y 1XMOO 2VQFO 5IT9N 4A5UB 4OPAA 4LF7O 4DR5O 4JI6O 4DR2O 1XEQA 4LF9O 1FKAO 2UXDO 4JV5O 4B3TO 4LF4O 1R1BA 4OPHA 2DJVA 1XMQO 4K0KO 1G1XB 5FLXN 4DR3O 4DV7O 4AQYO 2JRIA 2N74A 4DUZO 5BY1A 1IBKO 2AGAA 1J5EO 1AILA 4LF8O 2VQEO 2UUBO 3F5TA 2DOSA 5BR8O 4X64O 4LFBO 2Z0AA 2UU9O 4LFCO 1AB3A 4B3RO 4YHHO 4NXMO 2UXCO 4JI5O 4DV3O 1YZBA 4LFAO 4OX9O 4DR1O 4X65O 4GKKO 5H5NA 4DV4O 5BXZA 3JAMN 1IBMO
chains in the Genus database with same CATH superfamily
3FKSG 1SA0B 1NTZH 5B1OA 2R70A 5GONA 5CN0A 2BOBC 1EN6A 4DR6O 2PF4E 2Q0AA 3AK2A 4DR6B 5LMNO 2F4VB 2P5OA 1FJGO 1K33A 2PY5A 1D2DA 1M93A 4UV9A 4YJ2A 4RAIA 3HKBA 3ABTA 1B06A 1R3KC 3T1HO 2Q4PA 3RWRD 3W7XA 1I0HA 4JZGA 5KMGA 2PZSA 1R73A 3ZX6A 2ZNIA 2IM9A 3RYHB 4DV1O 3H9VA 3STLC 2IJHA 4FIPC 1T5EA 4ZHQA 2YS8A 5ITZA 2VWJA 2QEXV 1BZKA 4MVOA 4UV8A 1P84F 1K5SA 1BGYH 4PHZA 1PL4A 4IIJA 3AG2C 5JJNB 1GM7A 4ZI7B 4PI0A 1K4CC 4DUZB 3CCJV 3CRCA 4PA4A 3CC7V 1Y4MA 2CK3G 3H01A 1ZTEA 4D6TH 4IGGA 1VQ8V 1ENVA 2WA3A 5LGTA 3F5WC 4OXSA 1ZL8B 2WLLA 1MA1A 5F2VO 1E1QG 1PPJH 2AHZA 2JEXA 4LFAO 3CJHB 4NYKA 1OCRC 2QWNB 2ZNJA 2ATKC 4U3FH 1U97A 1N34O 3APQA 2RNBA 1SKVA 3ZIAG 4X66B 1FXVA 2E5LO 1AI4A 4FFBB 4O4IA 5EIBD 4YHHB 1IURA 2HG5C 1AI5A 2JIZG 4K3AA 4F6RA 2EIJC 4DR4O 5L3CA 4WCEV 1TGOA 3E22A 2HJFC 2YC0A 5L3BA 3ABLB 3UKMA 2P4KA 1IXMA 2B9ZA 3A0HZ 4JYCA 1F7YA 2QSAA 4LR3A 2QTOA 1BL8A 4H13B 4DW1A 3O65A 3CCEV 4JI5B 2FKXA 5H9CA 4FVMA 4LF9B 4FZ0A 2F1MA 2KG7A 4WF9V 1V54C 3WB0A 2CGNA 5J9PC 3Q4HB 1SERA 4A5UB 3G4SV 3CCSV 2IU3A 1XEQA 4JZ2A 5A9GA 4B3TO 4FJCC 1K34A 2WLIA 4NXMB 2PI5A 2B5UA 4GX5A 5BY1A 4PA3A 4F4LA 1XL6A 3E8HA 4GX0A 3VOUA 4X64O 4FFBA 4LNUB 1ORQC 1KECA 1NQTA 1SQVH 5LXTA 5H6RA 2F95B 3SYAA 2JGDB 2Q7GA 3IAYA 1ZSPA 5LOVA 5LHHA 4TOIA 4GLXA 4B7KA 4FK5C 3ZRWB 4H44B 5D5PA 2UU9B 2CE4A 3AG2B 1UPGA 1M1KW 4J9YB 1FYJA 1FAFA 3KG2A 1AJPA 3L72H 3WG7C 4WFEA 1N8RW 3VQXA 3TK1A 2KKWA 2DYRB 4PDVA 1B3QA 2K9PA 4UCVA 4FZ1A 4JV5B 2PUSA 1HR0O 3WB1A 5IE9A 4FM0A 4GYCB 4I0XB 3JCUZ 2UUCO 4JI1B 1DK1A 3CB2A 3ABUA 4YY3O 1G4YB 2QWQB 3MD0A 1VMGA 1BMFG 4X9QA 3TCUA 1L8DA 5GONB 4LF8B 3RBZA 3L75H 4RQFA 2A9HA 3HPLC 3SPHA 3CP1A 4JI3O 5CA0B 4FFKA 1D5NA 4JI2B 1S76D 2JDIG 2UXBO 1EZJA 3ETDA 1I7FA 3IC7A 1GN4A 2BE3A 2Z3YA 1RFYA 3VQVA 3CC4V 4LF4O 2DJVA 3K08A 4RUEA 1M4UA 4DV7O 2ZXWB 1IBKO 3ICXA 2ARHA 3B40A 4LF8O 3CE2A 3RFRA 2WLKA 4NXNB 4TWKA 1QLEC 3E8BA 4MVMA 1THZA 1URFA 1XL4A 2ILMA 4QJFB 4LC1A 1OCCB 1K8AW 2CGOA 4PV1B 1FD9A 5KHHA 1YEWA 3OTFA 1YZBA 4OX9O 4NR1A 1PNLA 3ABMC 2GSMB 1EM1A 1BCCH 1Y76A 1JR9A 2YICA 3RYCA 1N36B 1XUQA 2DQ0A 1EN4A 1XBLA 1IDSA 1QNMA 4MVSA 2Q69A 1HP8A 1NS1A 4DXWA 1AR5A 2WA4A 1M90W 4B3SO 4DV2O 2XUMA 2XTAA 1YDXA 2WWWA 2ZIOA 4LFBB 1JJOA 4J7ZA 5EBMC 3OM3B 3FX7A 1YJ9V 4DV0O 1PD3A 1H8HG 4WFFA 1SQGA 1XQ8A 2R9RB 2NLJC 2JJ2G 5A2QN 4P9OA 3BA8A 4ZOLA 3ETGA 4YIPA 5EZYA 5FNVB 4UCSA 3AG7A 4BAYA 1MZEA 4Z1MG 4J42A 1XREA 4TV9A 3UCSC 2HVJC 3JARA 3LUTB 3JATA 1RSOA 3OUSA 3C3TA 4H0LB 5L3GA 5KMGB 4N21A 2OTJV 3CCVV 1QVFU 5KX5B 5BMVA 4JI6B 2CH7B 2ZE6A 4JTDB 2N05A 3JALB 3S3XA 3CEIA 2PYJA 1QR9A 4W4LA 3GB7C 2MK3A 3HKCA 1WPBA 4DV6B 2K1EA 1G8MA 4K8XA 4KUMA 5IYZB 4DV7B 4BIZA 4DV3O 1SA0A 1VF5B 3QO7A 1Z5WA 2UXCB 5E79Z 4J7KA 1MSDA 4GKKO 3KKYA 3VQYA 4DV4O 1JQ0A 1PV0A 2GDSA 5LP6A 2CAZC 4UCOA 2AHYA 2FMLA 1WB7A 5LYJB 3B8MA 1KP3A 2UXNA 2JS3A 1WPXA 4WFHA 1N34B 3G67A 1Y74A 4O2AB 3BY6A 4HZ3A 2EULA 3OR6C 4MSWC 4G27B 4FLYA 1BQ0A 1KP2A 3CCMV 5FPOA 1RM1C 3JAWA 3LSUA 1OCOC 1Q5OA 2F93B 3LDDA 2PI4A 1U96A 4UXNA 4DV5O 2RN9A 4MTOA 4TUYA 1S0VA 1UFIA 3CRAA 1FFXA 3AG1B 4FLXA 2LW7A 4O4HA 4LF6O 3J80N 4R8CA 2AZ0A 2Y4UA 4WBNB 1XILA 4DUYO 3JARB 4DV2B 4L87A 4X89A 2ZD9A 3AG3C 1VQ6V 2YXLA 1JFFB 3L70H 4YXWG 2E75B 3D36A 5JQGA 2A7WA 4UVCA 3PN1A 2W6IG 3SGIA 2WLLB 2RCVA 1K92A 1Q6UA 2PGGA 5DM6V 4AHCA 5FLXN 1Q7YW 2IH1C 5EBLC 2ODMA 2N74A 3K59A 1AILA 1JVMA 3K5LA 3E22B 2DE0X 2V7QG 1OZ0A 4CC6A 4KHPB 2EINC 4X64B 5CBFA 2P90A 2C2AA 2KG7B 3ASOC 4HBNA 5EYPA 5KHGA 5D5QA 4O2BA 3RYCB 1I5XA 2WSSG 3T1CA 4J7JA 4FLUA 3LDCA 2O57A 3RT3C 1OV9A 5HFLA 4UB8Z 4JI2O 4TQFA 1Y6XA 2WPDG 4TSFG 4QNHB 3IFXA 1PNKA 1YXBA 3AG4B 5C8YB 2AZ2A 3E8GA 1S3JA 1HW7A 4FMTA 4E4EA 2GBOA 3ZN1A 1HR0B 2ZKOA 3A8TA 2M7WA 4TQDA 3QG5A 4FLVA 5J2TB 1NT2B 1VQ7V 3JD0A 2WLIB 3CWBH 3FFQA 4FLTA 2ZR3A 5B1BC 2E5LB 4X1KA 4CH3A 3W7SA 4J80A 4JPRA 1IBLB 4BIOA 1A32A 1TUBB 3X2QB 4Z2WA 2JGUA 2EILB 3NR7A 3CMEV 4CS2A 2YI9A 3SPIA 3E8FA 3HR0A 2XHBA 1R1BA 2Q73A 5LP6C 3H1LH 4LFAB 3L71H 1H2NA 4WBNA 1M57B 2Y69C 1M9NA 2GTAA 5LBQA 1GAXA 1MMMA 3OGCC 4LFBO 2VQFB 4PJ0Z 1Z2GA 4XDLA 4I4TB 3ZMUA 3N2GA 1N33B 2CTQA 4NXMO 3P3PA 5ITZB 2DMXA 1KD1W 3DTUB 2PTMA 3RGBA 1NJIW 4DR1O 4EEQA 1FXKC 4KP4A 3W7TA 1SZXA 1WA8A 1IBMO 3ZRWA 2B1IA 3TXQA 5LA6A 4ZIBA 2P67A 1N36O 4CBCA 1QHTA 1AR1B 3LSSA 2ZT9B 1BQZA 3APOA 1G6UA 2R72A 2UUAO 2OWOA 1NBMG 4R6ZA 2HHHO 4TUYB 4GX2A 4UVBA 1FPOA 4O4LB 1WJZA 1TA8A 4IHJB 5LMUO 1AR4A 5TISZ 4Z1VA 5B5EZ 2ZQMA 4HYOA 3G80A 2XAFA 4DR4B 1K4DC 4NXNO 5C93A 2YIDA 2OTLV 4JI8B 1PNMA 2LGQA 2Q6AA 3I56V 2ZDIA 2BCCH 2DWDC 4DR1B 1FJGB 5LMNB 2F4VO 3P32A 1NVPD 4GX1A 4LP8A 1TVKB 4IIJB 1KUQA 5EK0A 4TV8B 3T1YB 2GUZA 2XAGA 1VQOV 2VQFO 2Q0OC 4GUNA 5IT9N 2UXBB 4NB5A 4DK1A 1AP6A 1P4RA 3D8CA 1EFRG 3QF7A 4K0KO 1NTKH 4HNAB 4PD4F 1M56B 3OGIB 3H1KH 2XNDG 2CUGA 2H8PC 4F6RB 3C90A 1LUWA 4EB6B 5E1AC 2R9IA 5BR8O 3FAVB 3KCXA 3M7MX 3SPJA 2WLJA 3GWKC 3OMAB 4DO2A 2HP8A 3B2EE 2RJZA 4XDJA 3SJQC 4CS4A 1UJWB 1Y74B 4O2AA 3LNMB 3F7VC 1JOYA 2AW9A 3A2FA 3HKEA 3TGUH 5B1NA 2YIBA 1K97A 4JAVA 4GT1A 4BW9A 1VEWA 1MZFA 2UXDB 1MG1A 3B4SA 3G6BA 1XNQO 5JH7B 4KXRA 2XASA 4WFGA 1S5JA 3CCLV 2CTWA 2FB5A 1F23A 1S5LZ 4K0KB 1W0JG 3EXAA 1VQKV 1N32O 1GN2A 4I50A 1O9GA 3OT7A 3BVOA 4R50A 3R65A 3K57A 1NU1H 2ZCEA 3HKDA 3I55V 1E1RG 3CRQA 1BT8A 5KA6A 4X1YB 1JA8A 1KKCA 4J11A 1FXHA 3FB6C 4G2KA 5IJ0A 2QGNA 4JYAO 1E79G 3BHPA 4FM2A 1SQBH 4ZHQB 4W4KA 2HKOA 4PA7A 2W0XA 3JD3A 3BEHA 1H2GA 1TUEB 2L6LA 4UB6Z 1H38A 3DGEA 1K3EA 2JK5C 4LF9O 3RYHA 1SQPH 1D5AA 4U3JB 2Q9LA 4LNUA 4I9WA 2XAHA 4D7TA 2OIEA 4CC5A 2EX3A 2F43G 3UQ8A 5AG2A 1Q3EA 2DOSA 1YCIA 4JAAA 1XNQB 4FPPA 2EIMC 2HLDG 3JYCA 4YHHO 1QU7A 2YDEA 5KUMA 4X8AA 2IU0A 1V55C 4UCTA 1OCRB 1FXKB 3ZMSA 5JCOA 4K8ZA 4DR2B 5BR8B 3K5NA 1QLEB 2R9AA 5J2TA 2VRZA 4GKJB 1GO3F 1Y76B 1YTFD 3FB8C 1HNZB 3HKEB 5KHJA 3AEIA 4IHJA 1AROP 2W6JG 1WAZA 2JGDA 1VQ4V 3QO5A 1KQSU 4D7SA 3ABKB 4X20B 2DYSB 4MTGA 3OTOO 3T1YO 1GM9A 2ZE5A 3G6EV 3BAAA 1MNGA 2EIKC 3UT5B 3JSNA 1J5EB 1XNRO 1K9MW 4ICGA 5JJEB 4GKKB 4CZZA 4DRXA 3TJTA 3WG7B 1W2BU 1TVKA 5EBWC 5JCOC 5IDJA 4JI8O 4WFAV 4XBFA 2ITCC 2FTKA 5IJ0B 1XHXA 2GUZB 3E83A 4I4TA 4ZOLB 2H3OA 1JX9A 1AI7A 3GVMA 2G38A 4C7UA 4YJ3B 4H37A 1Q6IA 4CS3A 5KA5A 5IY5B 2H94A 4L8JA 4LBEC 5L3EA 1N4CA 2IJJA 3SYOA 1M57C 2Y69B 1IBMB 2Y4TA 3Q4HA 3T4ZA 2Y48A 1R3IC 3K9AA 3NXSA 2E76B 5DEDA 2VQEB 2Y0IA 3O9OA 1OCZB 1ZWIC 2KQXA 5EIBC 1XMQB 4AQYB 1VF6A 3S3WA 1AI6A 4DYLA 2AXTZ 2BTQA 1XOUA 1H2SB 1PL0A 3EFFK 3IC9A 5BXZA 1GN3A 5LA6B 4KHPO 3DXRB 3DC6A 3UT5A 5C8YA 1FFXB 2QM4A 3CRMA 1BSMA 1JJ2U 3SJBC 4MVZA 1ZL8A 3OAAG 4UVAA 3N2KA 5GTHZ 2IJKA 5B3SB 5IYBO 2OIGA 5IWAB 1IBLO 4B3MO 3BRCA 4KL1A 1WNSA 1YVWA 2OCHA 3DC5A 1J95A 5KLVH 2ADPA 3U11A 1YJWV 3ETQA 2X6AA 3K79A 3R66A 3CS5A 4PDLA 5EYPB 3RYFA 5B1BB 2DQ3A 1OCOB 5B1AB 1B6QA 4QGPA 4MT8A 5LXTB 1WN7A 1VIBA 4BIUA 2NR5A 2YIBD 1JFFA 5CBGA 1OCCC 1KB9F 1LR1A 1VQMV 2RQ6A 2JEUA 2EJRA 1IBKB 4HAMA 3ABKC 4RQEA 1VARA 2NNUA 4P30A 3E2EA 3RVZA 4O4HB 2YSUB 4DR7B 3T2MA 4TT3G 2UUBO 5L3DA 3FD9A 1SETA 2KB1A 1S5HC 3LDEA 1IX9A 1B04A 2GTSA 3EVKA 2ZIMA 5B3SC 1WP8A 1BE3H 1DGSA 3JSLA 4XDKA 3ASNB 4IT5A 1WA8B 1Q81W 1N0JA 5EC1C 2L35A 4X62B 3K5OA 5B1AC 2LGWA 4JYYA 1IVSA 4JI1O 2D3OW 2Q5ZA 1RP3B 2UUCB 1SF9A 2DW4A 1Z5VA 3JAWB 3ZHQA 1QBZA 3BA9A 2QE7G 3FYIB 4O4IB 1GH6A 3M8AA 4AI8A 2UUAB 3K03A 3A0BZ 1QLNA 2Q7HA 4ZKIA 5CA3A 1WLEA 1HNWO 3JD4A 2DYSC 5CMUA 3P3NA 3K0GA 3ZEDA 2EJ7A 1KC8W 2XOKG 1AJNA 2YEVA 2BSKB 4I55B 3WFVA 2V1DA 1DTOA 3QNEA 1DLBA 1R6TA 5JH7A 5LHGA 4DUYB 5LYJA 3G71V 1R3LC 5LHIA 2FL4A 1Y67A 3ZHRA 4LF6B 1N33O 2GHYA 1XI1A 3AG4C 4NKGB 1VQPV 3J81N 4JI7O 4DV5B 3ZRXA 4TV9B 1MOFA 4X1IB 5LL6Y 2LP7A 2P6JA 3ETEA 1VF6C 1XDCA 3QVNA 4PDMA 4DR5O 1NVPB 1I94B 2HR3A 4BWAA 3U0ZA 1YJNV 1L0LH 2M6YA 1M56C 3CRRA 3FAVA 5GTIZ 4Q20A 1P7BA 4J9ZB 4B3SB 1NR1A 4OGQB 5BMVB 5CBHA 4B3TB 4K35A 2Q8VA 4MTFA 4PI2A 1F4MA 1BHBA 2ZDIC 4U3JA 3UO3A 1SESA 3CSXA 3IJ4A 4DK0A 1YHQV 4GZRB 2UXCO 4DV3B 3DXRA 4JI5O 4OX9B 2V4DA 4UCUA 3ZHVA 3L9DA 3K58A 5H5NA 2UXXA 4BR6A 1X4TA 2ETNA 4MVUA 4MVQA 4O2BB 3BABA 1IZ3A 5EZYB 1H2MA 4KFMA 1F51A 3U10A 4NTYA 3D3IA 1OJHA 1NR7A 1HDJA 3HKBB 5BZBA 2Z5UA 5DN6G 1SZTA 4JI4O 5KAFZ 1CP9A 2MW2B 3UO2A 3QO8A 4FLWA 1HNXB 3ZJZA 1EBOA 4IYIA 1VQLV 2EIMB 2QKCA 4EB6A 3CXCU 3CXHF 4JYBA 1YITV 4O4JB 4E2LA 4WFBV 2OT5A 4DR7O 2F23A 2E74B 2CTPA 3RN4A 1Y66A 1AJQA 4JI4B 1Q82W 5JQGB 3JATB 2GV9A 1YIJV 3OEHG 4DV0B 1GKFA 1VP7A 1RPRA 3ML0A 5LGNA 2KSDA 1BHAA 1KMIZ 2QTSA 4OPAA 1N0NA 3OR7C 2YIAA 3K9SA 4NTXA 2ADQB 1CEZA 1CPYA 1S72V 5IY5C 5CA0A 4J10A 4CH4A 2Q67A 3PJSK 2W0FC 2IH3C 1COWG 3FYEB 4DUZO 1QCEA 2ZR2A 2BSKA 3K04A 4QE7A 1GTOA 3F5TA 1O9HA 2ZXWC 1R3JC 2QWPB 4HNAA 1AVMA 3STZC 1JPXA 4UUJC 1GK9A 2JVDA 4JTAB 4N23A 1H8EG 4FM1A 2QJ1A 4ASUG 4B7EA 3AK1A 3I5DA 3RW0A 2ZINA 3MDSA 1GRJA 2WLMA 2IW5A 5JVDA 4DV1B 1PP9H 2YUAA 3CCUV 1I94O 4UFZA 1QQCA 5IYZA 3CCRV 5KHKA 4H33A 2QM8A 3ZRVA 3HKCB 5DECA 2D2CB 4LF4B 2RDCA 1NH2D 3DSQA 3CD6V 1YTFB 1HNXO 2WLNA 4JI0O 4F6EA 4DV4B 3JASB 1HNWB 3K5MA 4ABMA 3CC2V 1SQFA 4FLZA 3JCZA 5LOVB 5GW7A 4MTXA 4DV6O 1TAEA 4YY3B 2XAQA 5JJJB 2VWKA 5FNVA 3M99B 3MHSC 1US6A 1Q90D 4JI6O 1SRYA 2LFSA 1FKAO 4JV5O 3GWOA 3IGAC 2YEVB 4OPHA 5B66Z 3AK3A 1KU9A 2QDOA 5FL7G 2N04A 1QVGU 1K73W 2EIJB 4DR3O 2JRIA 3JD2A 1I5YA 5KAIZ 4IL6Z 1J5EO 1I08A 4JI0B 1MSWD 4EFBA 5CB4A 5KUKA 4O4LA 2IBZH 3OEEG 2UU9O 1PM9A 3E86A 2VS0A 2P22C 3F7YC 4PDRA 3H1JH 5IYCO 4P2ZA 1V54B 4I5SA 1JMKC 4DR5B 2P7TC 3JAMN 4GKJO 2HFEC 5IYDO 3BPZA 4B08A 4G28B 4JF3A 4I0XA 3CX5F 1R6NA 4MW8A 1VQ9V 4CH6A 5K1XA 3ABLC 4LWSB 3D3QA 3N2KB 2LJ2A 4EFEA 1SC5B 2OYQA 3CHXA 3OFNG 3EHBB 1X59A 1K7DA 2EZOA 1ZLZA 4LH6A 3E89A 4U7OA 1LNQA 1WB8A 2QM7A 5EC2C 3T4DA 1V9PA 3J7AU 4PA6A 1GMGA 5IWAO 3KZIZ 3BCCH 4JAUA 4U7NA 2OCCB 1EZVH 3MAQA 2BTQB 4ZBMA 2EZPA 1OHHG 4X1IA 4TV8A 3A0RA 4LF5O 5IJ9A 4Q6GA 4PA9A 5LP6B 3AG3B 3ZHSA 3CJHA 2P4VA 2YXYA 5J2UA 2X7RB 2CTRA 1TUBA 2LFRA 3RYFB 1S77D 2IJIA 3LNNA 1XMOO 3ZMVA 2DYRC 3ZCCA 5CB4B 1RPOA 2EIKB 4NTWA 3AG1C 3HB3B 5IJ9B 3OUFA 3B77A 4RUFA 3UM7A 2CDYA 4I55A 2X6BA 1G1XB 1ZAUA 4AQYO 1KYOF 4MS2A 3ZN0A 2VQEO 2E3CA 1ROPA 2HVKC 1P7GA 3SPCA 4ZI7A 1JCHA 4LF7B 4LWSA 4RO2A 2Z0AA 2UUBB 5CA1A 1H2KA 2QKAA 2DWEC 4JASA 5JWPA 5H6QA 4JI3B 2A79B 1ZUQA 2WLHA 3ZMZA 3SJAC 3ASNC 2HJDA 2HEPA 1VQ5V 1BS3A 4X65O 2LQTA 2A3QA 2RMKB 3KCYA 1ZX3A 1FS0G 3JASA 3H1IH 4B3RB 3W7UA 1WP7A 4X1YA 3SJCC 4AILC 5HFMA 2F66C 2A0LA 4X20A 4YJ2B 2OCCC 3N2GB 3ZMTA 3K06A 5CA1B 2ZE8A 2X6CA 2BOCC 1Q86W 4QPJA 1FFTB 3N27A 4LCUC 1H2LA 3W7WA 3CPWU 2QA4V 1M5IA 3VBBA 1W0KG 1NZ6A 2DN9A 2A06H 2EINB 3ZHTA 3JALA 1QR8A 3THOA 4JTCB 3OTOB 1CXZB 3FB5C 1RM1B 3ABMB 1Q43A 3WU2Z 4RWUA 2XT9A 2QR4A 3L74H 4X65B 4YIOA 3ZRSA 3BFRA 4PELA 2XAJA 1HWYA 5LGUA 3L73H 2P06A 4X1KB 4GCZA 3FB7C 3T1HB 4JI7B 2QKSA 4QPKA 4LF7O 2B1GA 4DR2O 3TXSA 4X88A 2CH7A 3LSQA 1P49A 3CMAV 1KBHA 2Q7EA 3SYPA 1V55B 1XMQO 2WAMA 3P30A 1W59A 4YJ3A 4O4JA 1VF7A 4MVRA 2LO1A 3RYIB 1PKXA 3X2QC 4I50B 3OW2U 1YF2A 1Q8IA 3QTCA 5L3FA 1LUVA 1XMOB 4I9QA 1IXBA 1RSOB 4LFCO 1AB3A 2FYUH 3RVYA 2PYLA 3JAKA 2JS5A 4I7ZB 5LMUB 4LF5B 2Q68A 3VQWA 3CYOA 1DF5A 3OE7G 3MHHC 3CCQV 3SYCA 1AP5A 2HHHB 2ZE7A 1R6KA 1GN6A 4CH5A 3TETA 4X62O 3ZBHA 1SQXH 5FPRA 3K3WA 1L1FA 3SYQA 1FXKA 2QWOB 5K1PA 1NI8A 4QE9A 3K0DA 3SPGA 4DW0A 1MABG 4JYAB 3ZS8C 1XNRB 4X66O 1YSCA 3ASOB 2QWRB 3OD4A 2EBOA 2JJ1G 1EN5A 1VQNV 3ZHUA 1KKDA 5KX5A 2X0LA 5JVDB 1N32B 2ZM6O 2ZM6B 3SDLA 1HNZO 4EKWA 2Y0PA 4MW3A 1F4NA 3JAKB 1YI2V 2LW1A 2YI8A 4JGSA 4DRXB 4R7CA 3B09A 2UXDO 1GM8A 1L0NH 2YXHA 5KHIA 4UCRA 1SS3A 3WB2A 4DR3B 4BW5A 3RYIA 1K5QA 4IYHA 3C3SA 2BTOA 3D36C 1XHZA 2AGAA 2EILC 4LH7A 4J41A 4B3MB 4QIWF 4P9PA 3H1HH 1SQQH 1OCZC 2ITDC 3OMNB 1NKDA 4NVPA 4B3RO 1NH2B 1DF4A 3E35A 2NN4A 3SR2C 1NTMH 5J2UB 1Q6HA 3OMIB 5H2FZ 3HKDB 4LFCB 3JD1A 3B8NA
chains in the Genus database with same CATH topology
4GKJO 4X62O 1I94O 1XNQO 1N36O 1N34O 1FYJA 3RT3C 4KHPO 4JI1O 4JI2O 2UUAO 2E5LO 1NS1A 2HHHO 4DR6O 4B3SO 4DV2O 5LMNO 4JI4O 3M8AA 4X66O 1FJGO 5LMUO 1HR0O 1N32O 1D2DA 1HNWO 2UUCO 1X59A 4DR4O 3OTOO 3T1HO 3T1YO 1DK1A 1IBLO 4DV5O 4B3MO 4NXNO 1HNXO 3J7AU 4YY3O 4DV0O 4JI0O 5IWAO 2LW7A 4LF6O 2ZKOA 3J80N 4DV1O 4DR7O 4DUYO 1F7YA 1XNRO 5A2QN 2ZM6O 3R66A 1R6TA 2F4VO 4JI3O 3SDLA 1HNZO 3O65A 4LF5O 2FKXA 4JYAO 4DV6O 1N33O 4JI8O 2UXBO 1KUQA 3J81N 4JI7O 1A32A 5LL6Y 1XMOO 2VQFO 5IT9N 4A5UB 4OPAA 4LF7O 4DR5O 4JI6O 4DR2O 1XEQA 4LF9O 1FKAO 2UXDO 4JV5O 4B3TO 4LF4O 1R1BA 4OPHA 2DJVA 1XMQO 4K0KO 1G1XB 5FLXN 4DR3O 4DV7O 4AQYO 2JRIA 2N74A 4DUZO 5BY1A 1IBKO 2AGAA 1J5EO 1AILA 4LF8O 2VQEO 2UUBO 3F5TA 2DOSA 5BR8O 4X64O 4LFBO 2Z0AA 2UU9O 4LFCO 1AB3A 4B3RO 4YHHO 4NXMO 2UXCO 4JI5O 4DV3O 1YZBA 4LFAO 4OX9O 4DR1O 4X65O 4GKKO 5H5NA 4DV4O 5BXZA 3JAMN 1IBMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ O;  4X62 O;  1I94 O;  1XNQ O;  1N36 O;  1N34 O;  1FYJ A;  3RT3 C;  4KHP O;  4JI1 O;  4JI2 O;  2UUA O;  2E5L O;  1NS1 A;  2HHH O;  4DR6 O;  4B3S O;  4DV2 O;  5LMN O;  4JI4 O;  3M8A A;  4X66 O;  1FJG O;  5LMU O;  1HR0 O;  1N32 O;  1D2D A;  1HNW O;  2UUC O;  1X59 A;  4DR4 O;  3OTO O;  3T1H O;  3T1Y O;  1DK1 A;  1IBL O;  4DV5 O;  4B3M O;  4NXN O;  1HNX O;  3J7A U;  4YY3 O;  4DV0 O;  4JI0 O;  5IWA O;  2LW7 A;  4LF6 O;  2ZKO A;  3J80 N;  4DV1 O;  4DR7 O;  4DUY O;  1F7Y A;  1XNR O;  5A2Q N;  2ZM6 O;  3R66 A;  1R6T A;  2F4V O;  4JI3 O;  3SDL A;  1HNZ O;  3O65 A;  4LF5 O;  2FKX A;  4JYA O;  4DV6 O;  1N33 O;  4JI8 O;  2UXB O;  1KUQ A;  3J81 N;  4JI7 O;  1A32 A;  5LL6 Y;  1XMO O;  2VQF O;  5IT9 N;  4A5U B;  4OPA A;  4LF7 O;  4DR5 O;  4JI6 O;  4DR2 O;  1XEQ A;  4LF9 O;  1FKA O;  2UXD O;  4JV5 O;  4B3T O;  4LF4 O;  1R1B A;  4OPH A;  2DJV A;  1XMQ O;  4K0K O;  1G1X B;  5FLX N;  4DR3 O;  4DV7 O;  4AQY O;  2JRI A;  2N74 A;  4DUZ O;  5BY1 A;  1IBK O;  2AGA A;  1J5E O;  1AIL A;  4LF8 O;  2VQE O;  2UUB O;  3F5T A;  2DOS A;  5BR8 O;  4X64 O;  4LFB O;  2Z0A A;  2UU9 O;  4LFC O;  1AB3 A;  4B3R O;  4YHH O;  4NXM O;  2UXC O;  4JI5 O;  4DV3 O;  1YZB A;  4LFA O;  4OX9 O;  4DR1 O;  4X65 O;  4GKK O;  5H5N A;  4DV4 O;  5BXZ A;  3JAM N;  1IBM O; 
#chains in the Genus database with same CATH topology
 3FKS G;  1SA0 B;  1NTZ H;  5B1O A;  2R70 A;  5GON A;  5CN0 A;  2BOB C;  1EN6 A;  4DR6 O;  2PF4 E;  2Q0A A;  3AK2 A;  4DR6 B;  5LMN O;  2F4V B;  2P5O A;  1FJG O;  1K33 A;  2PY5 A;  1D2D A;  1M93 A;  4UV9 A;  4YJ2 A;  4RAI A;  3HKB A;  3ABT A;  1B06 A;  1R3K C;  3T1H O;  2Q4P A;  3RWR D;  3W7X A;  1I0H A;  4JZG A;  5KMG A;  2PZS A;  1R73 A;  3ZX6 A;  2ZNI A;  2IM9 A;  3RYH B;  4DV1 O;  3H9V A;  3STL C;  2IJH A;  4FIP C;  1T5E A;  4ZHQ A;  2YS8 A;  5ITZ A;  2VWJ A;  2QEX V;  1BZK A;  4MVO A;  4UV8 A;  1P84 F;  1K5S A;  1BGY H;  4PHZ A;  1PL4 A;  4IIJ A;  3AG2 C;  5JJN B;  1GM7 A;  4ZI7 B;  4PI0 A;  1K4C C;  4DUZ B;  3CCJ V;  3CRC A;  4PA4 A;  3CC7 V;  1Y4M A;  2CK3 G;  3H01 A;  1ZTE A;  4D6T H;  4IGG A;  1VQ8 V;  1ENV A;  2WA3 A;  5LGT A;  3F5W C;  4OXS A;  1ZL8 B;  2WLL A;  1MA1 A;  5F2V O;  1E1Q G;  1PPJ H;  2AHZ A;  2JEX A;  4LFA O;  3CJH B;  4NYK A;  1OCR C;  2QWN B;  2ZNJ A;  2ATK C;  4U3F H;  1U97 A;  1N34 O;  3APQ A;  2RNB A;  1SKV A;  3ZIA G;  4X66 B;  1FXV A;  2E5L O;  1AI4 A;  4FFB B;  4O4I A;  5EIB D;  4YHH B;  1IUR A;  2HG5 C;  1AI5 A;  2JIZ G;  4K3A A;  4F6R A;  2EIJ C;  4DR4 O;  5L3C A;  4WCE V;  1TGO A;  3E22 A;  2HJF C;  2YC0 A;  5L3B A;  3ABL B;  3UKM A;  2P4K A;  1IXM A;  2B9Z A;  3A0H Z;  4JYC A;  1F7Y A;  2QSA A;  4LR3 A;  2QTO A;  1BL8 A;  4H13 B;  4DW1 A;  3O65 A;  3CCE V;  4JI5 B;  2FKX A;  5H9C A;  4FVM A;  4LF9 B;  4FZ0 A;  2F1M A;  2KG7 A;  4WF9 V;  1V54 C;  3WB0 A;  2CGN A;  5J9P C;  3Q4H B;  1SER A;  4A5U B;  3G4S V;  3CCS V;  2IU3 A;  1XEQ A;  4JZ2 A;  5A9G A;  4B3T O;  4FJC C;  1K34 A;  2WLI A;  4NXM B;  2PI5 A;  2B5U A;  4GX5 A;  5BY1 A;  4PA3 A;  4F4L A;  1XL6 A;  3E8H A;  4GX0 A;  3VOU A;  4X64 O;  4FFB A;  4LNU B;  1ORQ C;  1KEC A;  1NQT A;  1SQV H;  5LXT A;  5H6R A;  2F95 B;  3SYA A;  2JGD B;  2Q7G A;  3IAY A;  1ZSP A;  5LOV A;  5LHH A;  4TOI A;  4GLX A;  4B7K A;  4FK5 C;  3ZRW B;  4H44 B;  5D5P A;  2UU9 B;  2CE4 A;  3AG2 B;  1UPG A;  1M1K W;  4J9Y B;  1FYJ A;  1FAF A;  3KG2 A;  1AJP A;  3L72 H;  3WG7 C;  4WFE A;  1N8R W;  3VQX A;  3TK1 A;  2KKW A;  2DYR B;  4PDV A;  1B3Q A;  2K9P A;  4UCV A;  4FZ1 A;  4JV5 B;  2PUS A;  1HR0 O;  3WB1 A;  5IE9 A;  4FM0 A;  4GYC B;  4I0X B;  3JCU Z;  2UUC O;  4JI1 B;  1DK1 A;  3CB2 A;  3ABU A;  4YY3 O;  1G4Y B;  2QWQ B;  3MD0 A;  1VMG A;  1BMF G;  4X9Q A;  3TCU A;  1L8D A;  5GON B;  4LF8 B;  3RBZ A;  3L75 H;  4RQF A;  2A9H A;  3HPL C;  3SPH A;  3CP1 A;  4JI3 O;  5CA0 B;  4FFK A;  1D5N A;  4JI2 B;  1S76 D;  2JDI G;  2UXB O;  1EZJ A;  3ETD A;  1I7F A;  3IC7 A;  1GN4 A;  2BE3 A;  2Z3Y A;  1RFY A;  3VQV A;  3CC4 V;  4LF4 O;  2DJV A;  3K08 A;  4RUE A;  1M4U A;  4DV7 O;  2ZXW B;  1IBK O;  3ICX A;  2ARH A;  3B40 A;  4LF8 O;  3CE2 A;  3RFR A;  2WLK A;  4NXN B;  4TWK A;  1QLE C;  3E8B A;  4MVM A;  1THZ A;  1URF A;  1XL4 A;  2ILM A;  4QJF B;  4LC1 A;  1OCC B;  1K8A W;  2CGO A;  4PV1 B;  1FD9 A;  5KHH A;  1YEW A;  3OTF A;  1YZB A;  4OX9 O;  4NR1 A;  1PNL A;  3ABM C;  2GSM B;  1EM1 A;  1BCC H;  1Y76 A;  1JR9 A;  2YIC A;  3RYC A;  1N36 B;  1XUQ A;  2DQ0 A;  1EN4 A;  1XBL A;  1IDS A;  1QNM A;  4MVS A;  2Q69 A;  1HP8 A;  1NS1 A;  4DXW A;  1AR5 A;  2WA4 A;  1M90 W;  4B3S O;  4DV2 O;  2XUM A;  2XTA A;  1YDX A;  2WWW A;  2ZIO A;  4LFB B;  1JJO A;  4J7Z A;  5EBM C;  3OM3 B;  3FX7 A;  1YJ9 V;  4DV0 O;  1PD3 A;  1H8H G;  4WFF A;  1SQG A;  1XQ8 A;  2R9R B;  2NLJ C;  2JJ2 G;  5A2Q N;  4P9O A;  3BA8 A;  4ZOL A;  3ETG A;  4YIP A;  5EZY A;  5FNV B;  4UCS A;  3AG7 A;  4BAY A;  1MZE A;  4Z1M G;  4J42 A;  1XRE A;  4TV9 A;  3UCS C;  2HVJ C;  3JAR A;  3LUT B;  3JAT A;  1RSO A;  3OUS A;  3C3T A;  4H0L B;  5L3G A;  5KMG B;  4N21 A;  2OTJ V;  3CCV V;  1QVF U;  5KX5 B;  5BMV A;  4JI6 B;  2CH7 B;  2ZE6 A;  4JTD B;  2N05 A;  3JAL B;  3S3X A;  3CEI A;  2PYJ A;  1QR9 A;  4W4L A;  3GB7 C;  2MK3 A;  3HKC A;  1WPB A;  4DV6 B;  2K1E A;  1G8M A;  4K8X A;  4KUM A;  5IYZ B;  4DV7 B;  4BIZ A;  4DV3 O;  1SA0 A;  1VF5 B;  3QO7 A;  1Z5W A;  2UXC B;  5E79 Z;  4J7K A;  1MSD A;  4GKK O;  3KKY A;  3VQY A;  4DV4 O;  1JQ0 A;  1PV0 A;  2GDS A;  5LP6 A;  2CAZ C;  4UCO A;  2AHY A;  2FML A;  1WB7 A;  5LYJ B;  3B8M A;  1KP3 A;  2UXN A;  2JS3 A;  1WPX A;  4WFH A;  1N34 B;  3G67 A;  1Y74 A;  4O2A B;  3BY6 A;  4HZ3 A;  2EUL A;  3OR6 C;  4MSW C;  4G27 B;  4FLY A;  1BQ0 A;  1KP2 A;  3CCM V;  5FPO A;  1RM1 C;  3JAW A;  3LSU A;  1OCO C;  1Q5O A;  2F93 B;  3LDD A;  2PI4 A;  1U96 A;  4UXN A;  4DV5 O;  2RN9 A;  4MTO A;  4TUY A;  1S0V A;  1UFI A;  3CRA A;  1FFX A;  3AG1 B;  4FLX A;  2LW7 A;  4O4H A;  4LF6 O;  3J80 N;  4R8C A;  2AZ0 A;  2Y4U A;  4WBN B;  1XIL A;  4DUY O;  3JAR B;  4DV2 B;  4L87 A;  4X89 A;  2ZD9 A;  3AG3 C;  1VQ6 V;  2YXL A;  1JFF B;  3L70 H;  4YXW G;  2E75 B;  3D36 A;  5JQG A;  2A7W A;  4UVC A;  3PN1 A;  2W6I G;  3SGI A;  2WLL B;  2RCV A;  1K92 A;  1Q6U A;  2PGG A;  5DM6 V;  4AHC A;  5FLX N;  1Q7Y W;  2IH1 C;  5EBL C;  2ODM A;  2N74 A;  3K59 A;  1AIL A;  1JVM A;  3K5L A;  3E22 B;  2DE0 X;  2V7Q G;  1OZ0 A;  4CC6 A;  4KHP B;  2EIN C;  4X64 B;  5CBF A;  2P90 A;  2C2A A;  2KG7 B;  3ASO C;  4HBN A;  5EYP A;  5KHG A;  5D5Q A;  4O2B A;  3RYC B;  1I5X A;  2WSS G;  3T1C A;  4J7J A;  4FLU A;  3LDC A;  2O57 A;  3RT3 C;  1OV9 A;  5HFL A;  4UB8 Z;  4JI2 O;  4TQF A;  1Y6X A;  2WPD G;  4TSF G;  4QNH B;  3IFX A;  1PNK A;  1YXB A;  3AG4 B;  5C8Y B;  2AZ2 A;  3E8G A;  1S3J A;  1HW7 A;  4FMT A;  4E4E A;  2GBO A;  3ZN1 A;  1HR0 B;  2ZKO A;  3A8T A;  2M7W A;  4TQD A;  3QG5 A;  4FLV A;  5J2T B;  1NT2 B;  1VQ7 V;  3JD0 A;  2WLI B;  3CWB H;  3FFQ A;  4FLT A;  2ZR3 A;  5B1B C;  2E5L B;  4X1K A;  4CH3 A;  3W7S A;  4J80 A;  4JPR A;  1IBL B;  4BIO A;  1A32 A;  1TUB B;  3X2Q B;  4Z2W A;  2JGU A;  2EIL B;  3NR7 A;  3CME V;  4CS2 A;  2YI9 A;  3SPI A;  3E8F A;  3HR0 A;  2XHB A;  1R1B A;  2Q73 A;  5LP6 C;  3H1L H;  4LFA B;  3L71 H;  1H2N A;  4WBN A;  1M57 B;  2Y69 C;  1M9N A;  2GTA A;  5LBQ A;  1GAX A;  1MMM A;  3OGC C;  4LFB O;  2VQF B;  4PJ0 Z;  1Z2G A;  4XDL A;  4I4T B;  3ZMU A;  3N2G A;  1N33 B;  2CTQ A;  4NXM O;  3P3P A;  5ITZ B;  2DMX A;  1KD1 W;  3DTU B;  2PTM A;  3RGB A;  1NJI W;  4DR1 O;  4EEQ A;  1FXK C;  4KP4 A;  3W7T A;  1SZX A;  1WA8 A;  1IBM O;  3ZRW A;  2B1I A;  3TXQ A;  5LA6 A;  4ZIB A;  2P67 A;  1N36 O;  4CBC A;  1QHT A;  1AR1 B;  3LSS A;  2ZT9 B;  1BQZ A;  3APO A;  1G6U A;  2R72 A;  2UUA O;  2OWO A;  1NBM G;  4R6Z A;  2HHH O;  4TUY B;  4GX2 A;  4UVB A;  1FPO A;  4O4L B;  1WJZ A;  1TA8 A;  4IHJ B;  5LMU O;  1AR4 A;  5TIS Z;  4Z1V A;  5B5E Z;  2ZQM A;  4HYO A;  3G80 A;  2XAF A;  4DR4 B;  1K4D C;  4NXN O;  5C93 A;  2YID A;  2OTL V;  4JI8 B;  1PNM A;  2LGQ A;  2Q6A A;  3I56 V;  2ZDI A;  2BCC H;  2DWD C;  4DR1 B;  1FJG B;  5LMN B;  2F4V O;  3P32 A;  1NVP D;  4GX1 A;  4LP8 A;  1TVK B;  4IIJ B;  1KUQ A;  5EK0 A;  4TV8 B;  3T1Y B;  2GUZ A;  2XAG A;  1VQO V;  2VQF O;  2Q0O C;  4GUN A;  5IT9 N;  2UXB B;  4NB5 A;  4DK1 A;  1AP6 A;  1P4R A;  3D8C A;  1EFR G;  3QF7 A;  4K0K O;  1NTK H;  4HNA B;  4PD4 F;  1M56 B;  3OGI B;  3H1K H;  2XND G;  2CUG A;  2H8P C;  4F6R B;  3C90 A;  1LUW A;  4EB6 B;  5E1A C;  2R9I A;  5BR8 O;  3FAV B;  3KCX A;  3M7M X;  3SPJ A;  2WLJ A;  3GWK C;  3OMA B;  4DO2 A;  2HP8 A;  3B2E E;  2RJZ A;  4XDJ A;  3SJQ C;  4CS4 A;  1UJW B;  1Y74 B;  4O2A A;  3LNM B;  3F7V C;  1JOY A;  2AW9 A;  3A2F A;  3HKE A;  3TGU H;  5B1N A;  2YIB A;  1K97 A;  4JAV A;  4GT1 A;  4BW9 A;  1VEW A;  1MZF A;  2UXD B;  1MG1 A;  3B4S A;  3G6B A;  1XNQ O;  5JH7 B;  4KXR A;  2XAS A;  4WFG A;  1S5J A;  3CCL V;  2CTW A;  2FB5 A;  1F23 A;  1S5L Z;  4K0K B;  1W0J G;  3EXA A;  1VQK V;  1N32 O;  1GN2 A;  4I50 A;  1O9G A;  3OT7 A;  3BVO A;  4R50 A;  3R65 A;  3K57 A;  1NU1 H;  2ZCE A;  3HKD A;  3I55 V;  1E1R G;  3CRQ A;  1BT8 A;  5KA6 A;  4X1Y B;  1JA8 A;  1KKC A;  4J11 A;  1FXH A;  3FB6 C;  4G2K A;  5IJ0 A;  2QGN A;  4JYA O;  1E79 G;  3BHP A;  4FM2 A;  1SQB H;  4ZHQ B;  4W4K A;  2HKO A;  4PA7 A;  2W0X A;  3JD3 A;  3BEH A;  1H2G A;  1TUE B;  2L6L A;  4UB6 Z;  1H38 A;  3DGE A;  1K3E A;  2JK5 C;  4LF9 O;  3RYH A;  1SQP H;  1D5A A;  4U3J B;  2Q9L A;  4LNU A;  4I9W A;  2XAH A;  4D7T A;  2OIE A;  4CC5 A;  2EX3 A;  2F43 G;  3UQ8 A;  5AG2 A;  1Q3E A;  2DOS A;  1YCI A;  4JAA A;  1XNQ B;  4FPP A;  2EIM C;  2HLD G;  3JYC A;  4YHH O;  1QU7 A;  2YDE A;  5KUM A;  4X8A A;  2IU0 A;  1V55 C;  4UCT A;  1OCR B;  1FXK B;  3ZMS A;  5JCO A;  4K8Z A;  4DR2 B;  5BR8 B;  3K5N A;  1QLE B;  2R9A A;  5J2T A;  2VRZ A;  4GKJ B;  1GO3 F;  1Y76 B;  1YTF D;  3FB8 C;  1HNZ B;  3HKE B;  5KHJ A;  3AEI A;  4IHJ A;  1ARO P;  2W6J G;  1WAZ A;  2JGD A;  1VQ4 V;  3QO5 A;  1KQS U;  4D7S A;  3ABK B;  4X20 B;  2DYS B;  4MTG A;  3OTO O;  3T1Y O;  1GM9 A;  2ZE5 A;  3G6E V;  3BAA A;  1MNG A;  2EIK C;  3UT5 B;  3JSN A;  1J5E B;  1XNR O;  1K9M W;  4ICG A;  5JJE B;  4GKK B;  4CZZ A;  4DRX A;  3TJT A;  3WG7 B;  1W2B U;  1TVK A;  5EBW C;  5JCO C;  5IDJ A;  4JI8 O;  4WFA V;  4XBF A;  2ITC C;  2FTK A;  5IJ0 B;  1XHX A;  2GUZ B;  3E83 A;  4I4T A;  4ZOL B;  2H3O A;  1JX9 A;  1AI7 A;  3GVM A;  2G38 A;  4C7U A;  4YJ3 B;  4H37 A;  1Q6I A;  4CS3 A;  5KA5 A;  5IY5 B;  2H94 A;  4L8J A;  4LBE C;  5L3E A;  1N4C A;  2IJJ A;  3SYO A;  1M57 C;  2Y69 B;  1IBM B;  2Y4T A;  3Q4H A;  3T4Z A;  2Y48 A;  1R3I C;  3K9A A;  3NXS A;  2E76 B;  5DED A;  2VQE B;  2Y0I A;  3O9O A;  1OCZ B;  1ZWI C;  2KQX A;  5EIB C;  1XMQ B;  4AQY B;  1VF6 A;  3S3W A;  1AI6 A;  4DYL A;  2AXT Z;  2BTQ A;  1XOU A;  1H2S B;  1PL0 A;  3EFF K;  3IC9 A;  5BXZ A;  1GN3 A;  5LA6 B;  4KHP O;  3DXR B;  3DC6 A;  3UT5 A;  5C8Y A;  1FFX B;  2QM4 A;  3CRM A;  1BSM A;  1JJ2 U;  3SJB C;  4MVZ A;  1ZL8 A;  3OAA G;  4UVA A;  3N2K A;  5GTH Z;  2IJK A;  5B3S B;  5IYB O;  2OIG A;  5IWA B;  1IBL O;  4B3M O;  3BRC A;  4KL1 A;  1WNS A;  1YVW A;  2OCH A;  3DC5 A;  1J95 A;  5KLV H;  2ADP A;  3U11 A;  1YJW V;  3ETQ A;  2X6A A;  3K79 A;  3R66 A;  3CS5 A;  4PDL A;  5EYP B;  3RYF A;  5B1B B;  2DQ3 A;  1OCO B;  5B1A B;  1B6Q A;  4QGP A;  4MT8 A;  5LXT B;  1WN7 A;  1VIB A;  4BIU A;  2NR5 A;  2YIB D;  1JFF A;  5CBG A;  1OCC C;  1KB9 F;  1LR1 A;  1VQM V;  2RQ6 A;  2JEU A;  2EJR A;  1IBK B;  4HAM A;  3ABK C;  4RQE A;  1VAR A;  2NNU A;  4P30 A;  3E2E A;  3RVZ A;  4O4H B;  2YSU B;  4DR7 B;  3T2M A;  4TT3 G;  2UUB O;  5L3D A;  3FD9 A;  1SET A;  2KB1 A;  1S5H C;  3LDE A;  1IX9 A;  1B04 A;  2GTS A;  3EVK A;  2ZIM A;  5B3S C;  1WP8 A;  1BE3 H;  1DGS A;  3JSL A;  4XDK A;  3ASN B;  4IT5 A;  1WA8 B;  1Q81 W;  1N0J A;  5EC1 C;  2L35 A;  4X62 B;  3K5O A;  5B1A C;  2LGW A;  4JYY A;  1IVS A;  4JI1 O;  2D3O W;  2Q5Z A;  1RP3 B;  2UUC B;  1SF9 A;  2DW4 A;  1Z5V A;  3JAW B;  3ZHQ A;  1QBZ A;  3BA9 A;  2QE7 G;  3FYI B;  4O4I B;  1GH6 A;  3M8A A;  4AI8 A;  2UUA B;  3K03 A;  3A0B Z;  1QLN A;  2Q7H A;  4ZKI A;  5CA3 A;  1WLE A;  1HNW O;  3JD4 A;  2DYS C;  5CMU A;  3P3N A;  3K0G A;  3ZED A;  2EJ7 A;  1KC8 W;  2XOK G;  1AJN A;  2YEV A;  2BSK B;  4I55 B;  3WFV A;  2V1D A;  1DTO A;  3QNE A;  1DLB A;  1R6T A;  5JH7 A;  5LHG A;  4DUY B;  5LYJ A;  3G71 V;  1R3L C;  5LHI A;  2FL4 A;  1Y67 A;  3ZHR A;  4LF6 B;  1N33 O;  2GHY A;  1XI1 A;  3AG4 C;  4NKG B;  1VQP V;  3J81 N;  4JI7 O;  4DV5 B;  3ZRX A;  4TV9 B;  1MOF A;  4X1I B;  5LL6 Y;  2LP7 A;  2P6J A;  3ETE A;  1VF6 C;  1XDC A;  3QVN A;  4PDM A;  4DR5 O;  1NVP B;  1I94 B;  2HR3 A;  4BWA A;  3U0Z A;  1YJN V;  1L0L H;  2M6Y A;  1M56 C;  3CRR A;  3FAV A;  5GTI Z;  4Q20 A;  1P7B A;  4J9Z B;  4B3S B;  1NR1 A;  4OGQ B;  5BMV B;  5CBH A;  4B3T B;  4K35 A;  2Q8V A;  4MTF A;  4PI2 A;  1F4M A;  1BHB A;  2ZDI C;  4U3J A;  3UO3 A;  1SES A;  3CSX A;  3IJ4 A;  4DK0 A;  1YHQ V;  4GZR B;  2UXC O;  4DV3 B;  3DXR A;  4JI5 O;  4OX9 B;  2V4D A;  4UCU A;  3ZHV A;  3L9D A;  3K58 A;  5H5N A;  2UXX A;  4BR6 A;  1X4T A;  2ETN A;  4MVU A;  4MVQ A;  4O2B B;  3BAB A;  1IZ3 A;  5EZY B;  1H2M A;  4KFM A;  1F51 A;  3U10 A;  4NTY A;  3D3I A;  1OJH A;  1NR7 A;  1HDJ A;  3HKB B;  5BZB A;  2Z5U A;  5DN6 G;  1SZT A;  4JI4 O;  5KAF Z;  1CP9 A;  2MW2 B;  3UO2 A;  3QO8 A;  4FLW A;  1HNX B;  3ZJZ A;  1EBO A;  4IYI A;  1VQL V;  2EIM B;  2QKC A;  4EB6 A;  3CXC U;  3CXH F;  4JYB A;  1YIT V;  4O4J B;  4E2L A;  4WFB V;  2OT5 A;  4DR7 O;  2F23 A;  2E74 B;  2CTP A;  3RN4 A;  1Y66 A;  1AJQ A;  4JI4 B;  1Q82 W;  5JQG B;  3JAT B;  2GV9 A;  1YIJ V;  3OEH G;  4DV0 B;  1GKF A;  1VP7 A;  1RPR A;  3ML0 A;  5LGN A;  2KSD A;  1BHA A;  1KMI Z;  2QTS A;  4OPA A;  1N0N A;  3OR7 C;  2YIA A;  3K9S A;  4NTX A;  2ADQ B;  1CEZ A;  1CPY A;  1S72 V;  5IY5 C;  5CA0 A;  4J10 A;  4CH4 A;  2Q67 A;  3PJS K;  2W0F C;  2IH3 C;  1COW G;  3FYE B;  4DUZ O;  1QCE A;  2ZR2 A;  2BSK A;  3K04 A;  4QE7 A;  1GTO A;  3F5T A;  1O9H A;  2ZXW C;  1R3J C;  2QWP B;  4HNA A;  1AVM A;  3STZ C;  1JPX A;  4UUJ C;  1GK9 A;  2JVD A;  4JTA B;  4N23 A;  1H8E G;  4FM1 A;  2QJ1 A;  4ASU G;  4B7E A;  3AK1 A;  3I5D A;  3RW0 A;  2ZIN A;  3MDS A;  1GRJ A;  2WLM A;  2IW5 A;  5JVD A;  4DV1 B;  1PP9 H;  2YUA A;  3CCU V;  1I94 O;  4UFZ A;  1QQC A;  5IYZ A;  3CCR V;  5KHK A;  4H33 A;  2QM8 A;  3ZRV A;  3HKC B;  5DEC A;  2D2C B;  4LF4 B;  2RDC A;  1NH2 D;  3DSQ A;  3CD6 V;  1YTF B;  1HNX O;  2WLN A;  4JI0 O;  4F6E A;  4DV4 B;  3JAS B;  1HNW B;  3K5M A;  4ABM A;  3CC2 V;  1SQF A;  4FLZ A;  3JCZ A;  5LOV B;  5GW7 A;  4MTX A;  4DV6 O;  1TAE A;  4YY3 B;  2XAQ A;  5JJJ B;  2VWK A;  5FNV A;  3M99 B;  3MHS C;  1US6 A;  1Q90 D;  4JI6 O;  1SRY A;  2LFS A;  1FKA O;  4JV5 O;  3GWO A;  3IGA C;  2YEV B;  4OPH A;  5B66 Z;  3AK3 A;  1KU9 A;  2QDO A;  5FL7 G;  2N04 A;  1QVG U;  1K73 W;  2EIJ B;  4DR3 O;  2JRI A;  3JD2 A;  1I5Y A;  5KAI Z;  4IL6 Z;  1J5E O;  1I08 A;  4JI0 B;  1MSW D;  4EFB A;  5CB4 A;  5KUK A;  4O4L A;  2IBZ H;  3OEE G;  2UU9 O;  1PM9 A;  3E86 A;  2VS0 A;  2P22 C;  3F7Y C;  4PDR A;  3H1J H;  5IYC O;  4P2Z A;  1V54 B;  4I5S A;  1JMK C;  4DR5 B;  2P7T C;  3JAM N;  4GKJ O;  2HFE C;  5IYD O;  3BPZ A;  4B08 A;  4G28 B;  4JF3 A;  4I0X A;  3CX5 F;  1R6N A;  4MW8 A;  1VQ9 V;  4CH6 A;  5K1X A;  3ABL C;  4LWS B;  3D3Q A;  3N2K B;  2LJ2 A;  4EFE A;  1SC5 B;  2OYQ A;  3CHX A;  3OFN G;  3EHB B;  1X59 A;  1K7D A;  2EZO A;  1ZLZ A;  4LH6 A;  3E89 A;  4U7O A;  1LNQ A;  1WB8 A;  2QM7 A;  5EC2 C;  3T4D A;  1V9P A;  3J7A U;  4PA6 A;  1GMG A;  5IWA O;  3KZI Z;  3BCC H;  4JAU A;  4U7N A;  2OCC B;  1EZV H;  3MAQ A;  2BTQ B;  4ZBM A;  2EZP A;  1OHH G;  4X1I A;  4TV8 A;  3A0R A;  4LF5 O;  5IJ9 A;  4Q6G A;  4PA9 A;  5LP6 B;  3AG3 B;  3ZHS A;  3CJH A;  2P4V A;  2YXY A;  5J2U A;  2X7R B;  2CTR A;  1TUB A;  2LFR A;  3RYF B;  1S77 D;  2IJI A;  3LNN A;  1XMO O;  3ZMV A;  2DYR C;  3ZCC A;  5CB4 B;  1RPO A;  2EIK B;  4NTW A;  3AG1 C;  3HB3 B;  5IJ9 B;  3OUF A;  3B77 A;  4RUF A;  3UM7 A;  2CDY A;  4I55 A;  2X6B A;  1G1X B;  1ZAU A;  4AQY O;  1KYO F;  4MS2 A;  3ZN0 A;  2VQE O;  2E3C A;  1ROP A;  2HVK C;  1P7G A;  3SPC A;  4ZI7 A;  1JCH A;  4LF7 B;  4LWS A;  4RO2 A;  2Z0A A;  2UUB B;  5CA1 A;  1H2K A;  2QKA A;  2DWE C;  4JAS A;  5JWP A;  5H6Q A;  4JI3 B;  2A79 B;  1ZUQ A;  2WLH A;  3ZMZ A;  3SJA C;  3ASN C;  2HJD A;  2HEP A;  1VQ5 V;  1BS3 A;  4X65 O;  2LQT A;  2A3Q A;  2RMK B;  3KCY A;  1ZX3 A;  1FS0 G;  3JAS A;  3H1I H;  4B3R B;  3W7U A;  1WP7 A;  4X1Y A;  3SJC C;  4AIL C;  5HFM A;  2F66 C;  2A0L A;  4X20 A;  4YJ2 B;  2OCC C;  3N2G B;  3ZMT A;  3K06 A;  5CA1 B;  2ZE8 A;  2X6C A;  2BOC C;  1Q86 W;  4QPJ A;  1FFT B;  3N27 A;  4LCU C;  1H2L A;  3W7W A;  3CPW U;  2QA4 V;  1M5I A;  3VBB A;  1W0K G;  1NZ6 A;  2DN9 A;  2A06 H;  2EIN B;  3ZHT A;  3JAL A;  1QR8 A;  3THO A;  4JTC B;  3OTO B;  1CXZ B;  3FB5 C;  1RM1 B;  3ABM B;  1Q43 A;  3WU2 Z;  4RWU A;  2XT9 A;  2QR4 A;  3L74 H;  4X65 B;  4YIO A;  3ZRS A;  3BFR A;  4PEL A;  2XAJ A;  1HWY A;  5LGU A;  3L73 H;  2P06 A;  4X1K B;  4GCZ A;  3FB7 C;  3T1H B;  4JI7 B;  2QKS A;  4QPK A;  4LF7 O;  2B1G A;  4DR2 O;  3TXS A;  4X88 A;  2CH7 A;  3LSQ A;  1P49 A;  3CMA V;  1KBH A;  2Q7E A;  3SYP A;  1V55 B;  1XMQ O;  2WAM A;  3P30 A;  1W59 A;  4YJ3 A;  4O4J A;  1VF7 A;  4MVR A;  2LO1 A;  3RYI B;  1PKX A;  3X2Q C;  4I50 B;  3OW2 U;  1YF2 A;  1Q8I A;  3QTC A;  5L3F A;  1LUV A;  1XMO B;  4I9Q A;  1IXB A;  1RSO B;  4LFC O;  1AB3 A;  2FYU H;  3RVY A;  2PYL A;  3JAK A;  2JS5 A;  4I7Z B;  5LMU B;  4LF5 B;  2Q68 A;  3VQW A;  3CYO A;  1DF5 A;  3OE7 G;  3MHH C;  3CCQ V;  3SYC A;  1AP5 A;  2HHH B;  2ZE7 A;  1R6K A;  1GN6 A;  4CH5 A;  3TET A;  4X62 O;  3ZBH A;  1SQX H;  5FPR A;  3K3W A;  1L1F A;  3SYQ A;  1FXK A;  2QWO B;  5K1P A;  1NI8 A;  4QE9 A;  3K0D A;  3SPG A;  4DW0 A;  1MAB G;  4JYA B;  3ZS8 C;  1XNR B;  4X66 O;  1YSC A;  3ASO B;  2QWR B;  3OD4 A;  2EBO A;  2JJ1 G;  1EN5 A;  1VQN V;  3ZHU A;  1KKD A;  5KX5 A;  2X0L A;  5JVD B;  1N32 B;  2ZM6 O;  2ZM6 B;  3SDL A;  1HNZ O;  4EKW A;  2Y0P A;  4MW3 A;  1F4N A;  3JAK B;  1YI2 V;  2LW1 A;  2YI8 A;  4JGS A;  4DRX B;  4R7C A;  3B09 A;  2UXD O;  1GM8 A;  1L0N H;  2YXH A;  5KHI A;  4UCR A;  1SS3 A;  3WB2 A;  4DR3 B;  4BW5 A;  3RYI A;  1K5Q A;  4IYH A;  3C3S A;  2BTO A;  3D36 C;  1XHZ A;  2AGA A;  2EIL C;  4LH7 A;  4J41 A;  4B3M B;  4QIW F;  4P9P A;  3H1H H;  1SQQ H;  1OCZ C;  2ITD C;  3OMN B;  1NKD A;  4NVP A;  4B3R O;  1NH2 B;  1DF4 A;  3E35 A;  2NN4 A;  3SR2 C;  1NTM H;  5J2U B;  1Q6H A;  3OMI B;  5H2F Z;  3HKD B;  4LFC B;  3JD1 A;  3B8N A; 
#chains in the Genus database with same CATH homology
 4GKJ O;  4X62 O;  1I94 O;  1XNQ O;  1N36 O;  1N34 O;  1FYJ A;  3RT3 C;  4KHP O;  4JI1 O;  4JI2 O;  2UUA O;  2E5L O;  1NS1 A;  2HHH O;  4DR6 O;  4B3S O;  4DV2 O;  5LMN O;  4JI4 O;  3M8A A;  4X66 O;  1FJG O;  5LMU O;  1HR0 O;  1N32 O;  1D2D A;  1HNW O;  2UUC O;  1X59 A;  4DR4 O;  3OTO O;  3T1H O;  3T1Y O;  1DK1 A;  1IBL O;  4DV5 O;  4B3M O;  4NXN O;  1HNX O;  3J7A U;  4YY3 O;  4DV0 O;  4JI0 O;  5IWA O;  2LW7 A;  4LF6 O;  2ZKO A;  3J80 N;  4DV1 O;  4DR7 O;  4DUY O;  1F7Y A;  1XNR O;  5A2Q N;  2ZM6 O;  3R66 A;  1R6T A;  2F4V O;  4JI3 O;  3SDL A;  1HNZ O;  3O65 A;  4LF5 O;  2FKX A;  4JYA O;  4DV6 O;  1N33 O;  4JI8 O;  2UXB O;  1KUQ A;  3J81 N;  4JI7 O;  1A32 A;  5LL6 Y;  1XMO O;  2VQF O;  5IT9 N;  4A5U B;  4OPA A;  4LF7 O;  4DR5 O;  4JI6 O;  4DR2 O;  1XEQ A;  4LF9 O;  1FKA O;  2UXD O;  4JV5 O;  4B3T O;  4LF4 O;  1R1B A;  4OPH A;  2DJV A;  1XMQ O;  4K0K O;  1G1X B;  5FLX N;  4DR3 O;  4DV7 O;  4AQY O;  2JRI A;  2N74 A;  4DUZ O;  5BY1 A;  1IBK O;  2AGA A;  1J5E O;  1AIL A;  4LF8 O;  2VQE O;  2UUB O;  3F5T A;  2DOS A;  5BR8 O;  4X64 O;  4LFB O;  2Z0A A;  2UU9 O;  4LFC O;  1AB3 A;  4B3R O;  4YHH O;  4NXM O;  2UXC O;  4JI5 O;  4DV3 O;  1YZB A;  4LFA O;  4OX9 O;  4DR1 O;  4X65 O;  4GKK O;  5H5N A;  4DV4 O;  5BXZ A;  3JAM N;  1IBM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...