2ZKOA

Structural basis for dsrna recognition by ns1 protein of human influenza virus a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
70
structure length
70
Chain Sequence
b'MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(P*AP*GP*AP*CP*AP*GP*CP*AP*UP*UP*AP*UP*GP*CP*UP*GP*
publication title Structural basis for dsRNA recognition by NS1 protein of influenza A virus
pubmed doi rcsb
source organism Influenza a virus
molecule tags Rna binding protein/rna
total genus 30
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2zkoA00
5LMNO 2HHHO 1G1XB 4DR5O 1XNRO 1R6TA 3O65A 2UUCO 4LF5O 4GKJO 2UUBO 4JI1O 4JI3O 1YZBA 5A2QN 1XMQO 4DV5O 2FKXA 3T1HO 5FLXN 1X59A 5BR8O 3SDLA 4DR6O 1AILA 4DV4O 4LFBO 4YY3O 4OPHA 4B3SO 3JAMN 1R1BA 4AQYO 4X62O 1IBLO 4KHPO 2AGAA 5LMUO 1J5EO 4JV5O 3F5TA 2VQEO 1HNWO 2LW7A 2N74A 4DV1O 4DR2O 1I94O 4NXMO 4DR3O 4X66O 4DV2O 1HNXO 2DJVA 4JI0O 1F7YA 3OTOO 2DOSA 4JI7O 4B3TO 4LF7O 1A32A 1N36O 2JRIA 4LF9O 1XNQO 1NS1A 5LL6Y 2UXBO 5IT9N 4YHHO 1HNZO 4JI5O 3RT3C 4OPAA 3R66A 2F4VO 1FJGO 4K0KO 1XMOO 5BXZA 5BY1A 4JI6O 2ZKOA 4LFAO 4DR4O 1XEQA 4DV6O 4B3RO 4DR7O 3T1YO 2Z0AA 1N32O 4DV3O 3J7AU 4X64O 4DV0O 4DV7O 4JI8O 1AB3A 4A5UB 5IWAO 2E5LO 1N34O 1D2DA 2VQFO 4LF6O 1FKAO 4DUZO 3M8AA 4LF4O 4JYAO 3J80N 4OX9O 1FYJA 4JI2O 5H5NA 2UXCO 1N33O 4X65O 3J81N 4DR1O 1IBKO 2UUAO 4LFCO 4JI4O 4DUYO 4LF8O 1HR0O 2UU9O 4B3MO 1DK1A 1IBMO 4NXNO 1KUQA 2UXDO 4GKKO 2ZM6O
chains in the Genus database with same CATH superfamily
4DUYB 4BAYA 2E75B 4EKWA 2UUBO 3BRCA 3X2QC 1M90W 3AG7A 3VOUA 1VEWA 1UFIA 1YJWV 4OPHA 3FYEB 3KCYA 3ZN1A 3OE7G 1AR4A 1W59A 1QVGU 1BL8A 3WFVA 1OJHA 3FKSG 1JX9A 1R3KC 1SRYA 4FLYA 1YTFD 1W2BU 2Y4UA 4FLVA 2B5UA 2LGWA 2DJVA 1MG1A 3BA8A 5KMGA 2O57A 1UJWB 1SQPH 2Y0PA 2Y0IA 1DF5A 3K79A 1I94B 2PYJA 1THZA 2Y69B 3FX7A 1WP8A 3TETA 3K06A 5J9PC 2HJDA 1Q7YW 3K03A 5B1BC 2VQFB 3P3PA 2QWOB 4DR4O 1J95A 2CGNA 2OYQA 4TV8A 4K3AA 2K1EA 1AR1B 5KLVH 4J7JA 1YI2V 4LNUB 2UXXA 1KYOF 1EZJA 3SR2C 4Z1MG 1VQ6V 1VARA 2KSDA 5H5NA 2JJ1G 4MT8A 4I5SA 3QO5A 3AG1C 4PJ0Z 3FB8C 2EULA 1SQGA 3ABLB 4IHJB 3PN1A 1FS0G 2HHHO 1JJOA 1H2KA 4PI2A 3U10A 4BW9A 3CCUV 1K3EA 4F6RA 1AP5A 2WAMA 4JI1O 3MD0A 1MMMA 2V1DA 5A2QN 5EBLC 1Q43A 4NXNB 3LSSA 1S0VA 2ZM6B 1GO3F 4DV4O 1AP6A 4JTCB 1V55B 3JAMN 5KHIA 5LGNA 2RN9A 2Y4TA 3ZS8C 1R1BA 1SQVH 2ARHA 5IJ0B 5JJEB 3CX5F 3H01A 4I55B 3Q4HA 4P2ZA 3OR6C 2OCCB 3ZN0A 3ZIAG 4G27B 3ML0A 3STZC 3TJTA 1H2MA 4JI0O 2YIDA 3JASB 4DR2B 1JPXA 3W7WA 4DR3B 2KB1A 4J10A 1NS1A 2P06A 2JVDA 2WA3A 4PV1B 3T1YB 4YJ3A 1EBOA 1BSMA 5K1PA 5HFLA 2JS5A 1XMOO 3N27A 1TUBB 2OCCC 2ODMA 5ITZA 4P9OA 4DV6O 3RYCA 2LGQA 4CH4A 3SYCA 1L0LH 4JI6B 4PA7A 2AHYA 2Q9LA 2A7WA 4Q6GA 1SS3A 2P7TC 4J80A 4DV3B 2QM4A 4X1IA 4DV0B 1AI5A 2G38A 1IBKO 4GKJB 1GMGA 4DUZB 2BTQA 4JI4O 1Q5OA 1U96A 3VBBA 3HPLC 3N2GB 3NXSA 3I56V 5J2TA 2DYSB 1M9NA 1IURA 3I55V 1O9HA 1RSOA 1R6TA 3ETEA 4LH7A 3LDCA 4CS2A 4JTAB 2DYRB 2CH7A 1LUVA 5H9CA 4JV5B 3UM7A 4X20B 2ZNJA 4CC6A 2JGDB 1US6A 2AW9A 4O2AA 1L1FA 1RPRA 3ZRWB 1YJNV 4QPJA 4RQEA 1G4YB 4DK1A 3E22A 3ZX6A 5JWPA 4NR1A 2EIJB 3F5WC 3T4ZA 3IJ4A 2JJ2G 1OZ0A 2DYSC 1AJNA 1KU9A 1M56B 3DSQA 5DN6G 5LMUB 4LH6A 1VQOV 1YSCA 4EB6B 4NXMB 1D5AA 1M57B 3SPGA 5LHIA 3K5LA 3L71H 2FMLA 1TAEA 5LP6B 1SQFA 4G2KA 2FTKA 3M99B 5CMUA 1H2SB 5JJJB 1BHBA 3CRRA 1YCIA 2PY5A 1OCCC 5FNVB 3ICXA 1MA1A 4TOIA 3JSNA 2Z0AA 1Q6UA 3CYOA 4R6ZA 1WPXA 2VQFO 3N2KA 1N32B 2EILB 5IDJA 4JZ2A 3M8AA 4I4TB 2UXCO 4AHCA 1WB8A 4N21A 5CA1A 1JQ0A 4LF6B 1FXHA 2BTOA 4WFHA 1VQ8V 1JA8A 1ORQC 1H38A 3EFFK 1FXKA 4UCTA 1P7BA 1XBLA 4FMTA 1GN3A 3B09A 5EZYB 4R7CA 1NTMH 3O65A 5LOVB 2UUCO 3GB7C 1QHTA 4MW3A 1IBMB 3E8FA 4MVMA 3SPJA 1NVPD 2B9ZA 4YXWG 5CA0B 5BR8O 5AG2A 4DV1B 5LYJB 1VP7A 4YY3O 2AXTZ 4W4KA 2EINC 2UUBB 3RYHB 2B1IA 3HKEB 4NTXA 4XDLA 2LJ2A 1SERA 4WFGA 1Y74A 2YIBD 4LF9B 3DC6A 3STLC 2W6IG 3WB2A 1FPOA 2LFSA 3G4SV 4YHHB 2YUAA 5H6RA 1A32A 4CZZA 1N36O 2OT5A 3ASOC 1SZXA 4MSWC 1OCOC 1W0JG 4FIPC 4LWSB 3JAKB 1BS3A 5KX5B 2CDYA 1MNGA 3KKYA 3OAAG 5JQGB 3FAVB 5C93A 3RYIB 4UCSA 1E1QG 1TUEB 3HB3B 4TUYA 3QVNA 3VQYA 4DRXB 4DR7O 3T1YO 3CXHF 4HAMA 1GH6A 1K4DC 2R72A 2WLMA 3L74H 4TV9A 1S77D 1HDJA 2YDEA 2IJHA 2GDSA 3AG2B 3K08A 2XT9A 1WJZA 5LHHA 2IU3A 2Q67A 5FPRA 2QM7A 3TXQA 1OCRC 3JD0A 3BA9A 1NJIW 2YI8A 2F23A 5IYZB 1FAFA 5L3DA 3F7VC 4GKJO 3TGUH 3T1CA 2WLJA 2HHHB 5GONB 2E76B 4P30A 4UCRA 2A9HA 4TWKA 3QTCA 4MVOA 2ZIMA 1AVMA 3K0GA 2CK3G 2B1GA 3ETGA 4DV4B 2BSKB 1SESA 3SYOA 1K33A 1J5EO 4JV5O 3AG4B 1R3IC 1AROP 3D36A 1R6NA 1GM8A 1S5HC 4LC1A 4O2BB 3G67A 2CTWA 3QO7A 4EEQA 3H1IH 4LNUA 3BCCH 4WFFA 1S5LZ 3CSXA 4JI0B 4I0XB 2P22C 5IYDO 3BPZA 2ADQB 1N4CA 2P5OA 4I50B 3CWBH 4DO2A 1GN2A 4J7ZA 5BXZA 4J42A 3TCUA 3IAYA 3FB5C 1OCZC 2ZKOA 3ZHVA 1CPYA 4QE7A 4FLWA 1CXZB 2ATKC 2OTLV 1XMOB 2GTSA 4FPPA 3JAWB 1ROPA 2OIEA 4O4HB 4JI8O 1PKXA 4DV6B 4TQFA 2WLIB 2IBZH 2QDOA 4OX9O 2DQ0A 3MHSC 4YIPA 1KBHA 3VQWA 1QNMA 3IFXA 5IJ0A 3C3SA 3EXAA 4BWAA 5JVDB 3DGEA 3SYAA 1NT2B 4I9WA 3LSQA 1EN6A 3X2QB 4QIWF 3W7UA 3JASA 1WNSA 5IYCO 4LF5O 4CBCA 3HR0A 2P6JA 4O4IB 1XMQO 3OT7A 3K5OA 1KQSU 2V4DA 4JZGA 1UPGA 2FB5A 2EZPA 1VF6A 1Z2GA 1VF5B 1RFYA 3P30A 2AGAA 4W4LA 3ZBHA 2QE7G 4PDLA 5KHKA 1HNWO 2IJKA 4D7TA 4LBEC 3VQXA 3K57A 1L8DA 4DV1O 1WN7A 4X66O 1P84F 3FB7C 1H2GA 2HEPA 3OTOO 1NBMG 4RUFA 5GTHZ 2PGGA 3IC9A 4LF9O 4TT3G 3RW0A 2JK5C 1TVKB 1GK9A 2WSSG 4OXSA 5F2VO 4YHHO 5B3SC 3ZHQA 5B1BB 1YJ9V 2Q0OC 1B06A 5KAFZ 3HKBB 5EC2C 3RYFB 2YXYA 4L8JA 2N04A 3N2GA 4H0LB 2AZ2A 2JS3A 4KXRA 3UCSC 3ZCCA 3BHPA 4FJCC 1ZX3A 2P90A 3JD2A 2F43G 2E3CA 1WLEA 5L3FA 1I5YA 4X20A 4ZBMA 1XQ8A 1ZLZA 4JYAO 1FYJA 3AG1B 1DTOA 4JI2O 1EZVH 1JMKC 4CC5A 3NR7A 5EYPB 2AZ0A 3OUSA 4UCUA 4FZ0A 3ZRWA 4LP8A 4IIJB 5CA3A 5CBGA 2UXCB 1HR0O 5CB4B 4B3MO 4EFEA 1VQ4V 4GKKO 1JJ2U 1JOYA 3KCXA 4GX2A 1GTOA 4EB6A 4QNHB 3DC5A 4J11A 5JCOC 2XNDG 4O4LA 2UUCB 3E8HA 5LP6A 3JALB 1P7GA 1WPBA 3THOA 2ZINA 5BR8B 2X0LA 3ETQA 2XOKG 2GSMB 4G28B 4YY3B 2Q6AA 1JFFB 2ZE8A 5FNVA 1Q82W 4O4JB 5E79Z 2QKCA 3SJBC 1LNQA 1EM1A 5IY5C 3UKMA 1FJGB 4UVCA 2ZT9B 3JCZA 5D5QA 1K9MW 2Q69A 3B77A 5LL6Y 1KC8W 4UB8Z 4MVZA 1N36B 2Q4PA 4I4TA 3L9DA 2F4VO 1B6QA 2XAFA 3U11A 2QEXV 3OEEG 4X1YA 1RM1C 2H3OA 5EIBD 1WA8B 4YJ2A 1JR9A 5L3CA 4AILC 3EVKA 2F1MA 2IH1C 2WLLB 3OW2U 5B1OA 3K5NA 1ZL8B 3OEHG 2FYUH 5EZYA 2YSUB 4PI0A 1F51A 3CCQV 2GV9A 1SA0B 1W0KG 2YC0A 4DR7B 2ZCEA 2JEUA 5CA0A 1QBZA 3U0ZA 1Y6XA 3RYHA 1KECA 1URFA 5J2UB 3HKEA 4BIOA 4X65O 1NZ6A 1M1KW 3G71V 2XUMA 2QKAA 3CRCA 4JAAA 4IGGA 3SYPA 3E86A 1IXBA 2X6CA 2ITDC 1IX9A 4QPKA 1Y76B 4JYYA 4NYKA 3A0BZ 5HFMA 4D6TH 3LNMB 3LSUA 1YZBA 1K97A 1OHHG 1R73A 2YXHA 4UUJC 4LWSA 3JAKA 4LFBO 3ZMVA 5KX5A 2W0XA 1OV9A 1BQZA 3GWKC 1H8EG 2ZD9A 1YTFB 4X62O 1IBLO 1JCHA 4MVSA 4FLZA 5JQGA 3FAVA 2BCCH 1NU1H 1YITV 2KG7B 4JI7O 1J5EB 3SJCC 1MZEA 2WLHA 2A79B 3OGCC 4Q20A 4U3JB 3M7MX 4NVPA 4RAIA 1XNQO 2K9PA 4NTWA 5KUMA 3G80A 4UCOA 2H8PC 2UXBO 2NLJC 2F66C 3JATB 1OCCB 3R66A 1VQPV 1V54C 1QU7A 5LHGA 2Z3YA 1KKDA 1PL4A 3FB6C 2VWJA 3OD4A 4H37A 3OMNB 3CP1A 5GTIZ 4PELA 1VMGA 4PDMA 3L70H 5IYZA 2M7WA 1MZFA 3T2MA 2CAZC 5GONA 1NR1A 1KMIZ 2A06H 4ICGA 5E1AC 4LF4O 4ZIBA 3CCSV 4JI8B 2MW2B 4ZOLA 3SJQC 3K5MA 4ASUG 3S3WA 2PUSA 5BMVB 3CCRV 3J81N 1Y67A 1VF7A 1KP3A 4X88A 5EK0A 4UXNA 2BSKA 2VS0A 4OX9B 3AK3A 3BY6A 2ZDIA 2CE4A 3T4DA 4JGSA 4ZHQB 3JD1A 3B8MA 1COWG 4O2BA 3CXCU 3B40A 1VQLV 1PL0A 2GUZB 4JYCA 3ABTA 1R6KA 2XAHA 5KHJA 2EINB 1VQ9V 1K5QA 4I0XA 3AG3C 1X59A 2P4VA 1GM7A 4LF5B 4DV2B 3RVZA 3ZEDA 3ZRXA 4I9QA 1XMQB 4B3TB 4LF7B 2CTQA 4NB5A 2EZOA 4H13B 1DLBA 2EJRA 2KKWA 1B04A 1O9GA 1HNXO 3ASOB 2AHZA 3G6BA 3E2EA 1OCOB 3JAWA 4FFBA 4FM1A 1HNWB 4O4HA 1YEWA 3RBZA 4FLTA 2WLIA 4X66B 3A2FA 1M5IA 3BABA 3OTOB 4IL6Z 4YIOA 4ZKIA 4MVRA 1KKCA 3FYIB 2Z5UA 1FJGO 3F7YC 5LXTA 5EIBC 5JVDA 5IE9A 2E5LB 4TSFG 1SQBH 1XILA 2ZE5A 3K58A 4B3RO 3JARB 3ABMC 5BZBA 2QTSA 4FK5C 4DV7O 4DR1B 1Q6HA 4FVMA 2M6YA 4K8XA 4HZ3A 2ETNA 1MSWD 4RWUA 5LGTA 1OCRB 3K9AA 3CRMA 4TQDA 4X1IB 2JEXA 4LFCO 4JYAB 1GRJA 4JI2B 4F6EA 5FPOA 1ZWIC 1QCEA 1KUQA 2ADPA 5KHGA 1PP9H 5B66Z 2ZE7A 1FFXB 1HR0B 1BGYH 4U7NA 3B4SA 1QR8A 4B3MB 2PTMA 4NTYA 1PD3A 1GN6A 3WB1A 3BEHA 4GKKB 1Q8IA 3T1HO 1BZKA 1RSOB 5FLXN 2XASA 4B3SO 2NNUA 1YXBA 3CJHB 1ENVA 2A3QA 2RNBA 4X1KB 3HKBA 3SPIA 3RYFA 3TXSA 3AEIA 1QQCA 1H2NA 2W0FC 2N74A 3S3XA 1YVWA 4PA6A 2ZIOA 1SQQH 2JRIA 3OR7C 4UVBA 1P4RA 2DMXA 2EIKB 2BOBC 4CH3A 3APOA 2DWDC 2EIMB 1Z5WA 1OCZB 5EYPA 1SC5B 2L6LA 4GUNA 2R9IA 2JDIG 3E8GA 1SZTA 1PPJH 1YF2A 1D5NA 4IIJA 1Q81W 2F4VB 2JGUA 2P67A 1XREA 3D8CA 4B7EA 4E4EA 3ABKC 4LF8B 1N0NA 4UV8A 2EIKC 3LNNA 2XAGA 4GYCB 4KUMA 3JALA 2UXDB 2EIMC 3B2EE 3N2KB 1EN4A 1VIBA 4ABMA 4IHJA 2DN9A 2CGOA 4O4JA 4X65B 2ZR3A 2W6JG 3SPHA 5LMNO 4D7SA 1ZTEA 3K3WA 2EX3A 1NVPB 3CS5A 4R8CA 1QLEC 4IT5A 2RCVA 4JI3O 1NH2D 3W7XA 3L73H 2F93B 4DR6O 5GW7A 5IYBO 4I55A 5JH7B 3A0HZ 3K9SA 4AQYO 2Q8VA 2WLKA 3DTUB 4GZRB 4KHPO 3E83A 4LFBB 1GAXA 5B1AC 2NN4A 2N05A 2WLLA 4X62B 1IBLB 1Y74B 1ZL8A 4DV2O 3IC7A 1FXKC 2DOSA 1KD1W 4B3TO 2HLDG 2Q73A 4LF7O 3JD4A 1SA0A 1XL4A 1BMFG 5B3SB 3CE2A 2PZSA 4JI7B 1JVMA 4J7KA 4GLXA 2LO1A 5K1XA 5IT9N 2QJ1A 1TUBA 1Q3EA 1HNZO 4RO2A 5EBWC 2RJZA 4OPAA 1XNQB 2ZXWB 2ITCC 3SPCA 1DGSA 2UXBB 4RUEA 1I5XA 2OIGA 3CHXA 4JYBA 1CP9A 3E35A 1MABG 3HKDB 1K8AW 1G8MA 1BHAA 1WAZA 1ZUQA 3UQ8A 1Y76A 5KAIZ 3WB0A 4TUYB 5FL7G 2RQ6A 3DXRB 3BAAA 2E5LO 1Q6IA 1N34O 3CC4V 1FXVA 4TV9B 5D5PA 3UO3A 2ILMA 4JTDB 1NTKH 3IGAC 1NQTA 2QKSA 2ZXWC 4DR1O 3MDSA 3FFQA 3GVMA 4LF4B 4DV5B 1NR7A 4RQFA 1Q86W 3LUTB 2DW4A 3CRQA 4FFKA 5C8YB 2YS8A 2HR3A 3ZMZA 4MTFA 4EFBA 2KG7A 4DR5O 1SETA 4MTOA 2XTAA 3EHBB 3CCVV 2P4KA 1K4CC 4U3JA 2JGDA 1U97A 3LDEA 1F23A 3RWRD 3HKCB 4DW1A 3RVYA 2IJIA 4DW0A 3JATA 3E8BA 1TGOA 1QLNA 3JCUZ 4HYOA 4H33A 1Y66A 5L3EA 2QWPB 3F5TA 2VQEO 5IY5B 1IDSA 2Q0AA 2XAJA 2LW7A 1LR1A 3LDDA 2QR4A 1M4UA 5B5EZ 4X9QA 2HVJC 1K34A 3KG2A 2RDCA 2Q7EA 2RMKB 3E89A 1HWYA 1HNXB 3APQA 2R70A 4LFAB 1PM9A 4IYIA 2MK3A 2Y69C 4ZI7B 4JI5O 1RM1B 1BCCH 4PD4F 4WBNB 5BMVA 2EJ7A 3CCMV 2HJFC 1X4TA 5BY1A 4QGPA 1N8RW 4FM0A 3W7TA 1XEQA 4JPRA 1HP8A 1LUWA 3AK1A 3CCEV 2X7RB 3OFNG 5EBMC 4X8AA 4ZHQA 3UO2A 3WU2Z 3D36C 3J7AU 1NH2B 1XUQA 2GUZA 3OGIB 4PHZA 4B3RB 4CS4A 1E1RG 3OUFA 5TISZ 4WCEV 1PV0A 4DV7B 3FD9A 4PA3A 2GBOA 5H6QA 4R50A 5A9GA 2DE0X 3ZHUA 2UUAO 1SKVA 4U7OA 1VQ7V 5IJ9B 4LF8O 4MVUA 2UU9O 5LOVA 4XDJA 1AJPA 2DWEC 2ZQMA 2LFRA 2UXDO 4LFCB 1KB9F 1HW7A 1L0NH 3CCLV 3ABLC 1XNRO 3B8NA 3UT5B 2ZNIA 5LYJA 1XOUA 4MVQA 4MS2A 4BW5A 1S3JA 2YEVB 1QR9A 2QM8A 3G6EV 1RPOA 1WP7A 1XL6A 4BIUA 3T1HB 2D2CB 1PNMA 1V55C 4XDKA 5LA6B 4CH6A 4B3SB 3GWOA 4HNAB 2QTOA 1IVSA 4MTXA 5JJNB 1P49A 4K35A 3JARA 2IH3C 3SGIA 1F7YA 4E2LA 4WFEA 3L72H 1AI6A 3ZRVA 4LR3A 2XHBA 3CC7V 3K59A 1V54B 4K8ZA 2HG5C 1F4MA 3RYIA 3ASNB 4PA4A 4K0KO 1BE3H 1VF6C 2CUGA 5IWAB 1AJQA 4DRXA 5KUKA 2LP7A 3ZHTA 2OTJV 1M93A 2GTAA 1B3QA 4UFZA 3CEIA 1XHXA 4PA9A 2NR5A 1NTZH 3OM3B 5KMGB 4B7KA 1FFXA 4X64O 4JF3A 3C3TA 1VQMV 3CMAV 4QJFB 3JYCA 4OGQB 2HKOA 4XBFA 4FLUA 4FZ1A 1IXMA 2PI5A 3ASNC 2Q5ZA 1N33O 3CJHA 4I7ZB 3WG7B 5L3BA 4WFBV 4X1KA 3ZMTA 4DUYO 3H1JH 4N23A 2YXLA 4TV8B 4BR6A 4GCZA 3O9OA 5KA6A 3AG3B 4P9PA 4HBNA 5H2FZ 1RP3B 4DV5O 4C7UA 2BOCC 3RN4A 2FKXA 5LMNB 3P32A 1AILA 2DYRC 4JI3B 3WG7C 2UXNA 4O4LB 4B08A 1N0JA 2HVKC 4DR6B 2GHYA 3MAQA 1ZSPA 2X6AA 2PI4A 2IM9A 1PNLA 4QE9A 4Z2WA 5B1NA 1PNKA 4AQYB 3H1KH 2DQ3A 1SF9A 3QO8A 1I94O 4KHPB 4JAVA 3KZIZ 3A8TA 2EIJC 4F6RB 1M56C 1TA8A 4PDVA 2BE3A 4J41A 4I50A 3AK2A 5L3GA 1M57C 4J9YB 2Y48A 1K7DA 1AI4A 3L75H 2QWQB 5LP6C 4GX0A 3Q4HB 2QWNB 2Q7HA 1HNZB 1T5EA 3ABMB 4LFAO 3RFRA 2WA4A 1BQ0A 3ETDA 3W7SA 1R3JC 4X1YB 2WPDG 1G6UA 4YJ2B 2HFEC 5KA5A 1VQKV 3ZHRA 5LGUA 1K73W 1S72V 1D2DA 2OCHA 5EC1C 2ZE6A 1Y4MA 3H9VA 2YIBA 4YJ3B 5JH7A 3CD6V 3BVOA 2EILC 3QG5A 1K5SA 1N34B 1S76D 3QF7A 1FD9A 2VWKA 5ITZB 1VQ5V 1KP2A 3RYCB 4NXNO 2ZM6O 4O4IA 2R9AA 4UB6Z 1SQXH 5LBQA 4Z1VA 4DXWA 2LW1A 3CRAA 4X89A 4JASA 4DR5B 4L87A 3SDLA 4AI8A 3CC2V 1DF4A 1S5JA 2V7QG 1WB7A 3OMAB 2QA4V 3ZMSA 1F4NA 1I0HA 2KQXA 2Q68A 2BTQB 3P3NA 4GX5A 2Q7GA 1GN4A 5J2TB 3HKDA 4DR2O 2VRZA 4DR3O 2F95B 2R9RB 1H2LA 5CBHA 1TVKA 2VQEB 1YDXA 2YIAA 3DXRA 2ZR2A 2CH7B 1Q90D 3D3QA 1Z5VA 4DR4B 2JIZG 2FL4A 1EFRG 3JSLA 4O2AB 5DECA 2E74B 1AI7A 4JI6O 5C8YA 3E22B 4JI5B 3QNEA 1BT8A 3A0RA 1R3LC 1NKDA 3ZJZA 3TK1A 2IJJA 3ABKB 4DV3O 5JCOA 2IW5A 4DV0O 3D3IA 1AB3A 4A5UB 5IWAO 4MW8A 3SYQA 3HKCA 2PYLA 4DUZO 2HP8A 3ZRSA 3C90A 1MOFA 3AG2C 4UVAA 1K92A 4WF9V 5CB4A 4JI1B 4ZOLB 2A0LA 4BIZA 4UV9A 4KP4A 3JD3A 3OMIB 4GX1A 4KFMA 4CH5A 2H94A 2QSAA 1QLEB 1AR5A 4F4LA 2UUAB 1GM9A 4U3FH 1G1XB 3PJSK 3CMEV 1GKFA 3CB2A 2UU9B 1IZ3A 2CTPA 4JAUA 2WWWA 2OWOA 3H1LH 1XNRB 1V9PA 4ZI7A 3MHHC 3CCJV 1JFFA 4WBNA 5B1AB 1XHZA 5CA1B 1E79G 2QWRB 2WLNA 3SJAC 3ZMUA 5LMUO 4IYHA 4DYLA 2LQTA 1FXKB 1I08A 3RGBA 5KHHA 3CPWU 4NXMO 4LCUC 1YHQV 2IU0A 3AG4C 2ZDIC 2D3OW 1NI8A 3K04A 2YI9A 2X6BA 3OTFA 1H8HG 3VQVA 1QVFU 3ABUA 4DK0A 5CBFA 4FFBB 4CS3A 1EN5A 4MTGA 3RT3C 1XDCA 1WA8A 2L35A 2CTRA 2PF4E 1YIJV 4UCVA 2C2AA 4NKGB 5IJ9A 5CN0A 5LXTB 2XAQA 1ZAUA 4GT1A 4K0KB 1FFTB 1N32O 4H44B 2QGNA 1CEZA 3UT5A 4FLXA 1IBKB 5DEDA 4JI4B 4J9ZB 4WFAV 2YICA 5J2UA 4LF6O 3ZHSA 2YEVA 4KL1A 1FKAO 5DM6V 3H1HH 3K0DA 1XI1A 3J80N 4X64B 3R65A 1MSDA 4PDRA 4FM2A 2EBOA 5LA6A 1I7FA 3BFRA 4HNAA 1N33B 3I5DA 1DK1A 1IBMO 1VQNV
chains in the Genus database with same CATH topology
5LMNO 2HHHO 1G1XB 4DR5O 1XNRO 1R6TA 3O65A 2UUCO 4LF5O 4GKJO 2UUBO 4JI1O 4JI3O 1YZBA 5A2QN 1XMQO 4DV5O 2FKXA 3T1HO 5FLXN 1X59A 5BR8O 3SDLA 4DR6O 1AILA 4DV4O 4LFBO 4YY3O 4OPHA 4B3SO 3JAMN 1R1BA 4AQYO 4X62O 1IBLO 4KHPO 2AGAA 5LMUO 1J5EO 4JV5O 3F5TA 2VQEO 1HNWO 2LW7A 2N74A 4DV1O 4DR2O 1I94O 4NXMO 4DR3O 4X66O 4DV2O 1HNXO 2DJVA 4JI0O 1F7YA 3OTOO 2DOSA 4JI7O 4B3TO 4LF7O 1A32A 1N36O 2JRIA 4LF9O 1XNQO 1NS1A 5LL6Y 2UXBO 5IT9N 4YHHO 1HNZO 4JI5O 3RT3C 4OPAA 3R66A 2F4VO 1FJGO 4K0KO 1XMOO 5BXZA 5BY1A 4JI6O 2ZKOA 4LFAO 4DR4O 1XEQA 4DV6O 4B3RO 4DR7O 3T1YO 2Z0AA 1N32O 4DV3O 3J7AU 4X64O 4DV0O 4DV7O 4JI8O 1AB3A 4A5UB 5IWAO 2E5LO 1N34O 1D2DA 2VQFO 4LF6O 1FKAO 4DUZO 3M8AA 4LF4O 4JYAO 3J80N 4OX9O 1FYJA 4JI2O 5H5NA 2UXCO 1N33O 4X65O 3J81N 4DR1O 1IBKO 2UUAO 4LFCO 4JI4O 4DUYO 4LF8O 1HR0O 2UU9O 4B3MO 1DK1A 1IBMO 4NXNO 1KUQA 2UXDO 4GKKO 2ZM6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN O;  2HHH O;  1G1X B;  4DR5 O;  1XNR O;  1R6T A;  3O65 A;  2UUC O;  4LF5 O;  4GKJ O;  2UUB O;  4JI1 O;  4JI3 O;  1YZB A;  5A2Q N;  1XMQ O;  4DV5 O;  2FKX A;  3T1H O;  5FLX N;  1X59 A;  5BR8 O;  3SDL A;  4DR6 O;  1AIL A;  4DV4 O;  4LFB O;  4YY3 O;  4OPH A;  4B3S O;  3JAM N;  1R1B A;  4AQY O;  4X62 O;  1IBL O;  4KHP O;  2AGA A;  5LMU O;  1J5E O;  4JV5 O;  3F5T A;  2VQE O;  1HNW O;  2LW7 A;  2N74 A;  4DV1 O;  4DR2 O;  1I94 O;  4NXM O;  4DR3 O;  4X66 O;  4DV2 O;  1HNX O;  2DJV A;  4JI0 O;  1F7Y A;  3OTO O;  2DOS A;  4JI7 O;  4B3T O;  4LF7 O;  1A32 A;  1N36 O;  2JRI A;  4LF9 O;  1XNQ O;  1NS1 A;  5LL6 Y;  2UXB O;  5IT9 N;  4YHH O;  1HNZ O;  4JI5 O;  3RT3 C;  4OPA A;  3R66 A;  2F4V O;  1FJG O;  4K0K O;  1XMO O;  5BXZ A;  5BY1 A;  4JI6 O;  2ZKO A;  4LFA O;  4DR4 O;  1XEQ A;  4DV6 O;  4B3R O;  4DR7 O;  3T1Y O;  2Z0A A;  1N32 O;  4DV3 O;  3J7A U;  4X64 O;  4DV0 O;  4DV7 O;  4JI8 O;  1AB3 A;  4A5U B;  5IWA O;  2E5L O;  1N34 O;  1D2D A;  2VQF O;  4LF6 O;  1FKA O;  4DUZ O;  3M8A A;  4LF4 O;  4JYA O;  3J80 N;  4OX9 O;  1FYJ A;  4JI2 O;  5H5N A;  2UXC O;  1N33 O;  4X65 O;  3J81 N;  4DR1 O;  1IBK O;  2UUA O;  4LFC O;  4JI4 O;  4DUY O;  4LF8 O;  1HR0 O;  2UU9 O;  4B3M O;  1DK1 A;  1IBM O;  4NXN O;  1KUQ A;  2UXD O;  4GKK O;  2ZM6 O; 
#chains in the Genus database with same CATH topology
 4DUY B;  4BAY A;  2E75 B;  4EKW A;  2UUB O;  3BRC A;  3X2Q C;  1M90 W;  3AG7 A;  3VOU A;  1VEW A;  1UFI A;  1YJW V;  4OPH A;  3FYE B;  3KCY A;  3ZN1 A;  3OE7 G;  1AR4 A;  1W59 A;  1QVG U;  1BL8 A;  3WFV A;  1OJH A;  3FKS G;  1JX9 A;  1R3K C;  1SRY A;  4FLY A;  1YTF D;  1W2B U;  2Y4U A;  4FLV A;  2B5U A;  2LGW A;  2DJV A;  1MG1 A;  3BA8 A;  5KMG A;  2O57 A;  1UJW B;  1SQP H;  2Y0P A;  2Y0I A;  1DF5 A;  3K79 A;  1I94 B;  2PYJ A;  1THZ A;  2Y69 B;  3FX7 A;  1WP8 A;  3TET A;  3K06 A;  5J9P C;  2HJD A;  1Q7Y W;  3K03 A;  5B1B C;  2VQF B;  3P3P A;  2QWO B;  4DR4 O;  1J95 A;  2CGN A;  2OYQ A;  4TV8 A;  4K3A A;  2K1E A;  1AR1 B;  5KLV H;  4J7J A;  1YI2 V;  4LNU B;  2UXX A;  1KYO F;  1EZJ A;  3SR2 C;  4Z1M G;  1VQ6 V;  1VAR A;  2KSD A;  5H5N A;  2JJ1 G;  4MT8 A;  4I5S A;  3QO5 A;  3AG1 C;  4PJ0 Z;  3FB8 C;  2EUL A;  1SQG A;  3ABL B;  4IHJ B;  3PN1 A;  1FS0 G;  2HHH O;  1JJO A;  1H2K A;  4PI2 A;  3U10 A;  4BW9 A;  3CCU V;  1K3E A;  4F6R A;  1AP5 A;  2WAM A;  4JI1 O;  3MD0 A;  1MMM A;  2V1D A;  5A2Q N;  5EBL C;  1Q43 A;  4NXN B;  3LSS A;  1S0V A;  2ZM6 B;  1GO3 F;  4DV4 O;  1AP6 A;  4JTC B;  1V55 B;  3JAM N;  5KHI A;  5LGN A;  2RN9 A;  2Y4T A;  3ZS8 C;  1R1B A;  1SQV H;  2ARH A;  5IJ0 B;  5JJE B;  3CX5 F;  3H01 A;  4I55 B;  3Q4H A;  4P2Z A;  3OR6 C;  2OCC B;  3ZN0 A;  3ZIA G;  4G27 B;  3ML0 A;  3STZ C;  3TJT A;  1H2M A;  4JI0 O;  2YID A;  3JAS B;  4DR2 B;  1JPX A;  3W7W A;  4DR3 B;  2KB1 A;  4J10 A;  1NS1 A;  2P06 A;  2JVD A;  2WA3 A;  4PV1 B;  3T1Y B;  4YJ3 A;  1EBO A;  1BSM A;  5K1P A;  5HFL A;  2JS5 A;  1XMO O;  3N27 A;  1TUB B;  2OCC C;  2ODM A;  5ITZ A;  4P9O A;  4DV6 O;  3RYC A;  2LGQ A;  4CH4 A;  3SYC A;  1L0L H;  4JI6 B;  4PA7 A;  2AHY A;  2Q9L A;  2A7W A;  4Q6G A;  1SS3 A;  2P7T C;  4J80 A;  4DV3 B;  2QM4 A;  4X1I A;  4DV0 B;  1AI5 A;  2G38 A;  1IBK O;  4GKJ B;  1GMG A;  4DUZ B;  2BTQ A;  4JI4 O;  1Q5O A;  1U96 A;  3VBB A;  3HPL C;  3N2G B;  3NXS A;  3I56 V;  5J2T A;  2DYS B;  1M9N A;  1IUR A;  3I55 V;  1O9H A;  1RSO A;  1R6T A;  3ETE A;  4LH7 A;  3LDC A;  4CS2 A;  4JTA B;  2DYR B;  2CH7 A;  1LUV A;  5H9C A;  4JV5 B;  3UM7 A;  4X20 B;  2ZNJ A;  4CC6 A;  2JGD B;  1US6 A;  2AW9 A;  4O2A A;  1L1F A;  1RPR A;  3ZRW B;  1YJN V;  4QPJ A;  4RQE A;  1G4Y B;  4DK1 A;  3E22 A;  3ZX6 A;  5JWP A;  4NR1 A;  2EIJ B;  3F5W C;  3T4Z A;  3IJ4 A;  2JJ2 G;  1OZ0 A;  2DYS C;  1AJN A;  1KU9 A;  1M56 B;  3DSQ A;  5DN6 G;  5LMU B;  4LH6 A;  1VQO V;  1YSC A;  4EB6 B;  4NXM B;  1D5A A;  1M57 B;  3SPG A;  5LHI A;  3K5L A;  3L71 H;  2FML A;  1TAE A;  5LP6 B;  1SQF A;  4G2K A;  2FTK A;  3M99 B;  5CMU A;  1H2S B;  5JJJ B;  1BHB A;  3CRR A;  1YCI A;  2PY5 A;  1OCC C;  5FNV B;  3ICX A;  1MA1 A;  4TOI A;  3JSN A;  2Z0A A;  1Q6U A;  3CYO A;  4R6Z A;  1WPX A;  2VQF O;  3N2K A;  1N32 B;  2EIL B;  5IDJ A;  4JZ2 A;  3M8A A;  4I4T B;  2UXC O;  4AHC A;  1WB8 A;  4N21 A;  5CA1 A;  1JQ0 A;  4LF6 B;  1FXH A;  2BTO A;  4WFH A;  1VQ8 V;  1JA8 A;  1ORQ C;  1H38 A;  3EFF K;  1FXK A;  4UCT A;  1P7B A;  1XBL A;  4FMT A;  1GN3 A;  3B09 A;  5EZY B;  4R7C A;  1NTM H;  3O65 A;  5LOV B;  2UUC O;  3GB7 C;  1QHT A;  4MW3 A;  1IBM B;  3E8F A;  4MVM A;  3SPJ A;  1NVP D;  2B9Z A;  4YXW G;  5CA0 B;  5BR8 O;  5AG2 A;  4DV1 B;  5LYJ B;  1VP7 A;  4YY3 O;  2AXT Z;  4W4K A;  2EIN C;  2UUB B;  3RYH B;  2B1I A;  3HKE B;  4NTX A;  4XDL A;  2LJ2 A;  1SER A;  4WFG A;  1Y74 A;  2YIB D;  4LF9 B;  3DC6 A;  3STL C;  2W6I G;  3WB2 A;  1FPO A;  2LFS A;  3G4S V;  4YHH B;  2YUA A;  5H6R A;  1A32 A;  4CZZ A;  1N36 O;  2OT5 A;  3ASO C;  1SZX A;  4MSW C;  1OCO C;  1W0J G;  4FIP C;  4LWS B;  3JAK B;  1BS3 A;  5KX5 B;  2CDY A;  1MNG A;  3KKY A;  3OAA G;  5JQG B;  3FAV B;  5C93 A;  3RYI B;  4UCS A;  1E1Q G;  1TUE B;  3HB3 B;  4TUY A;  3QVN A;  3VQY A;  4DRX B;  4DR7 O;  3T1Y O;  3CXH F;  4HAM A;  1GH6 A;  1K4D C;  2R72 A;  2WLM A;  3L74 H;  4TV9 A;  1S77 D;  1HDJ A;  2YDE A;  2IJH A;  2GDS A;  3AG2 B;  3K08 A;  2XT9 A;  1WJZ A;  5LHH A;  2IU3 A;  2Q67 A;  5FPR A;  2QM7 A;  3TXQ A;  1OCR C;  3JD0 A;  3BA9 A;  1NJI W;  2YI8 A;  2F23 A;  5IYZ B;  1FAF A;  5L3D A;  3F7V C;  4GKJ O;  3TGU H;  3T1C A;  2WLJ A;  2HHH B;  5GON B;  2E76 B;  4P30 A;  4UCR A;  2A9H A;  4TWK A;  3QTC A;  4MVO A;  2ZIM A;  1AVM A;  3K0G A;  2CK3 G;  2B1G A;  3ETG A;  4DV4 B;  2BSK B;  1SES A;  3SYO A;  1K33 A;  1J5E O;  4JV5 O;  3AG4 B;  1R3I C;  1ARO P;  3D36 A;  1R6N A;  1GM8 A;  1S5H C;  4LC1 A;  4O2B B;  3G67 A;  2CTW A;  3QO7 A;  4EEQ A;  3H1I H;  4LNU A;  3BCC H;  4WFF A;  1S5L Z;  3CSX A;  4JI0 B;  4I0X B;  2P22 C;  5IYD O;  3BPZ A;  2ADQ B;  1N4C A;  2P5O A;  4I50 B;  3CWB H;  4DO2 A;  1GN2 A;  4J7Z A;  5BXZ A;  4J42 A;  3TCU A;  3IAY A;  3FB5 C;  1OCZ C;  2ZKO A;  3ZHV A;  1CPY A;  4QE7 A;  4FLW A;  1CXZ B;  2ATK C;  2OTL V;  1XMO B;  2GTS A;  4FPP A;  3JAW B;  1ROP A;  2OIE A;  4O4H B;  4JI8 O;  1PKX A;  4DV6 B;  4TQF A;  2WLI B;  2IBZ H;  2QDO A;  4OX9 O;  2DQ0 A;  3MHS C;  4YIP A;  1KBH A;  3VQW A;  1QNM A;  3IFX A;  5IJ0 A;  3C3S A;  3EXA A;  4BWA A;  5JVD B;  3DGE A;  3SYA A;  1NT2 B;  4I9W A;  3LSQ A;  1EN6 A;  3X2Q B;  4QIW F;  3W7U A;  3JAS A;  1WNS A;  5IYC O;  4LF5 O;  4CBC A;  3HR0 A;  2P6J A;  4O4I B;  1XMQ O;  3OT7 A;  3K5O A;  1KQS U;  2V4D A;  4JZG A;  1UPG A;  2FB5 A;  2EZP A;  1VF6 A;  1Z2G A;  1VF5 B;  1RFY A;  3P30 A;  2AGA A;  4W4L A;  3ZBH A;  2QE7 G;  4PDL A;  5KHK A;  1HNW O;  2IJK A;  4D7T A;  4LBE C;  3VQX A;  3K57 A;  1L8D A;  4DV1 O;  1WN7 A;  4X66 O;  1P84 F;  3FB7 C;  1H2G A;  2HEP A;  3OTO O;  1NBM G;  4RUF A;  5GTH Z;  2PGG A;  3IC9 A;  4LF9 O;  4TT3 G;  3RW0 A;  2JK5 C;  1TVK B;  1GK9 A;  2WSS G;  4OXS A;  5F2V O;  4YHH O;  5B3S C;  3ZHQ A;  5B1B B;  1YJ9 V;  2Q0O C;  1B06 A;  5KAF Z;  3HKB B;  5EC2 C;  3RYF B;  2YXY A;  4L8J A;  2N04 A;  3N2G A;  4H0L B;  2AZ2 A;  2JS3 A;  4KXR A;  3UCS C;  3ZCC A;  3BHP A;  4FJC C;  1ZX3 A;  2P90 A;  3JD2 A;  2F43 G;  2E3C A;  1WLE A;  5L3F A;  1I5Y A;  4X20 A;  4ZBM A;  1XQ8 A;  1ZLZ A;  4JYA O;  1FYJ A;  3AG1 B;  1DTO A;  4JI2 O;  1EZV H;  1JMK C;  4CC5 A;  3NR7 A;  5EYP B;  2AZ0 A;  3OUS A;  4UCU A;  4FZ0 A;  3ZRW A;  4LP8 A;  4IIJ B;  5CA3 A;  5CBG A;  2UXC B;  1HR0 O;  5CB4 B;  4B3M O;  4EFE A;  1VQ4 V;  4GKK O;  1JJ2 U;  1JOY A;  3KCX A;  4GX2 A;  1GTO A;  4EB6 A;  4QNH B;  3DC5 A;  4J11 A;  5JCO C;  2XND G;  4O4L A;  2UUC B;  3E8H A;  5LP6 A;  3JAL B;  1P7G A;  1WPB A;  3THO A;  2ZIN A;  5BR8 B;  2X0L A;  3ETQ A;  2XOK G;  2GSM B;  4G28 B;  4YY3 B;  2Q6A A;  1JFF B;  2ZE8 A;  5FNV A;  1Q82 W;  4O4J B;  5E79 Z;  2QKC A;  3SJB C;  1LNQ A;  1EM1 A;  5IY5 C;  3UKM A;  1FJG B;  4UVC A;  2ZT9 B;  3JCZ A;  5D5Q A;  1K9M W;  2Q69 A;  3B77 A;  5LL6 Y;  1KC8 W;  4UB8 Z;  4MVZ A;  1N36 B;  2Q4P A;  4I4T A;  3L9D A;  2F4V O;  1B6Q A;  2XAF A;  3U11 A;  2QEX V;  3OEE G;  4X1Y A;  1RM1 C;  2H3O A;  5EIB D;  1WA8 B;  4YJ2 A;  1JR9 A;  5L3C A;  4AIL C;  3EVK A;  2F1M A;  2IH1 C;  2WLL B;  3OW2 U;  5B1O A;  3K5N A;  1ZL8 B;  3OEH G;  2FYU H;  5EZY A;  2YSU B;  4PI0 A;  1F51 A;  3CCQ V;  2GV9 A;  1SA0 B;  1W0K G;  2YC0 A;  4DR7 B;  2ZCE A;  2JEU A;  5CA0 A;  1QBZ A;  3U0Z A;  1Y6X A;  3RYH A;  1KEC A;  1URF A;  5J2U B;  3HKE A;  4BIO A;  4X65 O;  1NZ6 A;  1M1K W;  3G71 V;  2XUM A;  2QKA A;  3CRC A;  4JAA A;  4IGG A;  3SYP A;  3E86 A;  1IXB A;  2X6C A;  2ITD C;  1IX9 A;  4QPK A;  1Y76 B;  4JYY A;  4NYK A;  3A0B Z;  5HFM A;  4D6T H;  3LNM B;  3LSU A;  1YZB A;  1K97 A;  1OHH G;  1R73 A;  2YXH A;  4UUJ C;  4LWS A;  3JAK A;  4LFB O;  3ZMV A;  5KX5 A;  2W0X A;  1OV9 A;  1BQZ A;  3GWK C;  1H8E G;  2ZD9 A;  1YTF B;  4X62 O;  1IBL O;  1JCH A;  4MVS A;  4FLZ A;  5JQG A;  3FAV A;  2BCC H;  1NU1 H;  1YIT V;  2KG7 B;  4JI7 O;  1J5E B;  3SJC C;  1MZE A;  2WLH A;  2A79 B;  3OGC C;  4Q20 A;  4U3J B;  3M7M X;  4NVP A;  4RAI A;  1XNQ O;  2K9P A;  4NTW A;  5KUM A;  3G80 A;  4UCO A;  2H8P C;  2UXB O;  2NLJ C;  2F66 C;  3JAT B;  1OCC B;  3R66 A;  1VQP V;  1V54 C;  1QU7 A;  5LHG A;  2Z3Y A;  1KKD A;  1PL4 A;  3FB6 C;  2VWJ A;  3OD4 A;  4H37 A;  3OMN B;  3CP1 A;  5GTI Z;  4PEL A;  1VMG A;  4PDM A;  3L70 H;  5IYZ A;  2M7W A;  1MZF A;  3T2M A;  2CAZ C;  5GON A;  1NR1 A;  1KMI Z;  2A06 H;  4ICG A;  5E1A C;  4LF4 O;  4ZIB A;  3CCS V;  4JI8 B;  2MW2 B;  4ZOL A;  3SJQ C;  3K5M A;  4ASU G;  3S3W A;  2PUS A;  5BMV B;  3CCR V;  3J81 N;  1Y67 A;  1VF7 A;  1KP3 A;  4X88 A;  5EK0 A;  4UXN A;  2BSK A;  2VS0 A;  4OX9 B;  3AK3 A;  3BY6 A;  2ZDI A;  2CE4 A;  3T4D A;  4JGS A;  4ZHQ B;  3JD1 A;  3B8M A;  1COW G;  4O2B A;  3CXC U;  3B40 A;  1VQL V;  1PL0 A;  2GUZ B;  4JYC A;  3ABT A;  1R6K A;  2XAH A;  5KHJ A;  2EIN B;  1VQ9 V;  1K5Q A;  4I0X A;  3AG3 C;  1X59 A;  2P4V A;  1GM7 A;  4LF5 B;  4DV2 B;  3RVZ A;  3ZED A;  3ZRX A;  4I9Q A;  1XMQ B;  4B3T B;  4LF7 B;  2CTQ A;  4NB5 A;  2EZO A;  4H13 B;  1DLB A;  2EJR A;  2KKW A;  1B04 A;  1O9G A;  1HNX O;  3ASO B;  2AHZ A;  3G6B A;  3E2E A;  1OCO B;  3JAW A;  4FFB A;  4FM1 A;  1HNW B;  4O4H A;  1YEW A;  3RBZ A;  4FLT A;  2WLI A;  4X66 B;  3A2F A;  1M5I A;  3BAB A;  3OTO B;  4IL6 Z;  4YIO A;  4ZKI A;  4MVR A;  1KKC A;  3FYI B;  2Z5U A;  1FJG O;  3F7Y C;  5LXT A;  5EIB C;  5JVD A;  5IE9 A;  2E5L B;  4TSF G;  1SQB H;  1XIL A;  2ZE5 A;  3K58 A;  4B3R O;  3JAR B;  3ABM C;  5BZB A;  2QTS A;  4FK5 C;  4DV7 O;  4DR1 B;  1Q6H A;  4FVM A;  2M6Y A;  4K8X A;  4HZ3 A;  2ETN A;  1MSW D;  4RWU A;  5LGT A;  1OCR B;  3K9A A;  3CRM A;  4TQD A;  4X1I B;  2JEX A;  4LFC O;  4JYA B;  1GRJ A;  4JI2 B;  4F6E A;  5FPO A;  1ZWI C;  1QCE A;  1KUQ A;  2ADP A;  5KHG A;  1PP9 H;  5B66 Z;  2ZE7 A;  1FFX B;  1HR0 B;  1BGY H;  4U7N A;  3B4S A;  1QR8 A;  4B3M B;  2PTM A;  4NTY A;  1PD3 A;  1GN6 A;  3WB1 A;  3BEH A;  4GKK B;  1Q8I A;  3T1H O;  1BZK A;  1RSO B;  5FLX N;  2XAS A;  4B3S O;  2NNU A;  1YXB A;  3CJH B;  1ENV A;  2A3Q A;  2RNB A;  4X1K B;  3HKB A;  3SPI A;  3RYF A;  3TXS A;  3AEI A;  1QQC A;  1H2N A;  2W0F C;  2N74 A;  3S3X A;  1YVW A;  4PA6 A;  2ZIO A;  1SQQ H;  2JRI A;  3OR7 C;  4UVB A;  1P4R A;  2DMX A;  2EIK B;  2BOB C;  4CH3 A;  3APO A;  2DWD C;  2EIM B;  1Z5W A;  1OCZ B;  5EYP A;  1SC5 B;  2L6L A;  4GUN A;  2R9I A;  2JDI G;  3E8G A;  1SZT A;  1PPJ H;  1YF2 A;  1D5N A;  4IIJ A;  1Q81 W;  2F4V B;  2JGU A;  2P67 A;  1XRE A;  3D8C A;  4B7E A;  4E4E A;  3ABK C;  4LF8 B;  1N0N A;  4UV8 A;  2EIK C;  3LNN A;  2XAG A;  4GYC B;  4KUM A;  3JAL A;  2UXD B;  2EIM C;  3B2E E;  3N2K B;  1EN4 A;  1VIB A;  4ABM A;  4IHJ A;  2DN9 A;  2CGO A;  4O4J A;  4X65 B;  2ZR3 A;  2W6J G;  3SPH A;  5LMN O;  4D7S A;  1ZTE A;  3K3W A;  2EX3 A;  1NVP B;  3CS5 A;  4R8C A;  1QLE C;  4IT5 A;  2RCV A;  4JI3 O;  1NH2 D;  3W7X A;  3L73 H;  2F93 B;  4DR6 O;  5GW7 A;  5IYB O;  4I55 A;  5JH7 B;  3A0H Z;  3K9S A;  4AQY O;  2Q8V A;  2WLK A;  3DTU B;  4GZR B;  4KHP O;  3E83 A;  4LFB B;  1GAX A;  5B1A C;  2NN4 A;  2N05 A;  2WLL A;  4X62 B;  1IBL B;  1Y74 B;  1ZL8 A;  4DV2 O;  3IC7 A;  1FXK C;  2DOS A;  1KD1 W;  4B3T O;  2HLD G;  2Q73 A;  4LF7 O;  3JD4 A;  1SA0 A;  1XL4 A;  1BMF G;  5B3S B;  3CE2 A;  2PZS A;  4JI7 B;  1JVM A;  4J7K A;  4GLX A;  2LO1 A;  5K1X A;  5IT9 N;  2QJ1 A;  1TUB A;  1Q3E A;  1HNZ O;  4RO2 A;  5EBW C;  2RJZ A;  4OPA A;  1XNQ B;  2ZXW B;  2ITC C;  3SPC A;  1DGS A;  2UXB B;  4RUE A;  1I5X A;  2OIG A;  3CHX A;  4JYB A;  1CP9 A;  3E35 A;  1MAB G;  3HKD B;  1K8A W;  1G8M A;  1BHA A;  1WAZ A;  1ZUQ A;  3UQ8 A;  1Y76 A;  5KAI Z;  3WB0 A;  4TUY B;  5FL7 G;  2RQ6 A;  3DXR B;  3BAA A;  2E5L O;  1Q6I A;  1N34 O;  3CC4 V;  1FXV A;  4TV9 B;  5D5P A;  3UO3 A;  2ILM A;  4JTD B;  1NTK H;  3IGA C;  1NQT A;  2QKS A;  2ZXW C;  4DR1 O;  3MDS A;  3FFQ A;  3GVM A;  4LF4 B;  4DV5 B;  1NR7 A;  4RQF A;  1Q86 W;  3LUT B;  2DW4 A;  3CRQ A;  4FFK A;  5C8Y B;  2YS8 A;  2HR3 A;  3ZMZ A;  4MTF A;  4EFB A;  2KG7 A;  4DR5 O;  1SET A;  4MTO A;  2XTA A;  3EHB B;  3CCV V;  2P4K A;  1K4C C;  4U3J A;  2JGD A;  1U97 A;  3LDE A;  1F23 A;  3RWR D;  3HKC B;  4DW1 A;  3RVY A;  2IJI A;  4DW0 A;  3JAT A;  3E8B A;  1TGO A;  1QLN A;  3JCU Z;  4HYO A;  4H33 A;  1Y66 A;  5L3E A;  2QWP B;  3F5T A;  2VQE O;  5IY5 B;  1IDS A;  2Q0A A;  2XAJ A;  2LW7 A;  1LR1 A;  3LDD A;  2QR4 A;  1M4U A;  5B5E Z;  4X9Q A;  2HVJ C;  1K34 A;  3KG2 A;  2RDC A;  2Q7E A;  2RMK B;  3E89 A;  1HWY A;  1HNX B;  3APQ A;  2R70 A;  4LFA B;  1PM9 A;  4IYI A;  2MK3 A;  2Y69 C;  4ZI7 B;  4JI5 O;  1RM1 B;  1BCC H;  4PD4 F;  4WBN B;  5BMV A;  2EJ7 A;  3CCM V;  2HJF C;  1X4T A;  5BY1 A;  4QGP A;  1N8R W;  4FM0 A;  3W7T A;  1XEQ A;  4JPR A;  1HP8 A;  1LUW A;  3AK1 A;  3CCE V;  2X7R B;  3OFN G;  5EBM C;  4X8A A;  4ZHQ A;  3UO2 A;  3WU2 Z;  3D36 C;  3J7A U;  1NH2 B;  1XUQ A;  2GUZ A;  3OGI B;  4PHZ A;  4B3R B;  4CS4 A;  1E1R G;  3OUF A;  5TIS Z;  4WCE V;  1PV0 A;  4DV7 B;  3FD9 A;  4PA3 A;  2GBO A;  5H6Q A;  4R50 A;  5A9G A;  2DE0 X;  3ZHU A;  2UUA O;  1SKV A;  4U7O A;  1VQ7 V;  5IJ9 B;  4LF8 O;  4MVU A;  2UU9 O;  5LOV A;  4XDJ A;  1AJP A;  2DWE C;  2ZQM A;  2LFR A;  2UXD O;  4LFC B;  1KB9 F;  1HW7 A;  1L0N H;  3CCL V;  3ABL C;  1XNR O;  3B8N A;  3UT5 B;  2ZNI A;  5LYJ A;  1XOU A;  4MVQ A;  4MS2 A;  4BW5 A;  1S3J A;  2YEV B;  1QR9 A;  2QM8 A;  3G6E V;  1RPO A;  1WP7 A;  1XL6 A;  4BIU A;  3T1H B;  2D2C B;  1PNM A;  1V55 C;  4XDK A;  5LA6 B;  4CH6 A;  4B3S B;  3GWO A;  4HNA B;  2QTO A;  1IVS A;  4MTX A;  5JJN B;  1P49 A;  4K35 A;  3JAR A;  2IH3 C;  3SGI A;  1F7Y A;  4E2L A;  4WFE A;  3L72 H;  1AI6 A;  3ZRV A;  4LR3 A;  2XHB A;  3CC7 V;  3K59 A;  1V54 B;  4K8Z A;  2HG5 C;  1F4M A;  3RYI A;  3ASN B;  4PA4 A;  4K0K O;  1BE3 H;  1VF6 C;  2CUG A;  5IWA B;  1AJQ A;  4DRX A;  5KUK A;  2LP7 A;  3ZHT A;  2OTJ V;  1M93 A;  2GTA A;  1B3Q A;  4UFZ A;  3CEI A;  1XHX A;  4PA9 A;  2NR5 A;  1NTZ H;  3OM3 B;  5KMG B;  4B7K A;  1FFX A;  4X64 O;  4JF3 A;  3C3T A;  1VQM V;  3CMA V;  4QJF B;  3JYC A;  4OGQ B;  2HKO A;  4XBF A;  4FLU A;  4FZ1 A;  1IXM A;  2PI5 A;  3ASN C;  2Q5Z A;  1N33 O;  3CJH A;  4I7Z B;  3WG7 B;  5L3B A;  4WFB V;  4X1K A;  3ZMT A;  4DUY O;  3H1J H;  4N23 A;  2YXL A;  4TV8 B;  4BR6 A;  4GCZ A;  3O9O A;  5KA6 A;  3AG3 B;  4P9P A;  4HBN A;  5H2F Z;  1RP3 B;  4DV5 O;  4C7U A;  2BOC C;  3RN4 A;  2FKX A;  5LMN B;  3P32 A;  1AIL A;  2DYR C;  4JI3 B;  3WG7 C;  2UXN A;  4O4L B;  4B08 A;  1N0J A;  2HVK C;  4DR6 B;  2GHY A;  3MAQ A;  1ZSP A;  2X6A A;  2PI4 A;  2IM9 A;  1PNL A;  4QE9 A;  4Z2W A;  5B1N A;  1PNK A;  4AQY B;  3H1K H;  2DQ3 A;  1SF9 A;  3QO8 A;  1I94 O;  4KHP B;  4JAV A;  3KZI Z;  3A8T A;  2EIJ C;  4F6R B;  1M56 C;  1TA8 A;  4PDV A;  2BE3 A;  4J41 A;  4I50 A;  3AK2 A;  5L3G A;  1M57 C;  4J9Y B;  2Y48 A;  1K7D A;  1AI4 A;  3L75 H;  2QWQ B;  5LP6 C;  4GX0 A;  3Q4H B;  2QWN B;  2Q7H A;  1HNZ B;  1T5E A;  3ABM B;  4LFA O;  3RFR A;  2WA4 A;  1BQ0 A;  3ETD A;  3W7S A;  1R3J C;  4X1Y B;  2WPD G;  1G6U A;  4YJ2 B;  2HFE C;  5KA5 A;  1VQK V;  3ZHR A;  5LGU A;  1K73 W;  1S72 V;  1D2D A;  2OCH A;  5EC1 C;  2ZE6 A;  1Y4M A;  3H9V A;  2YIB A;  4YJ3 B;  5JH7 A;  3CD6 V;  3BVO A;  2EIL C;  3QG5 A;  1K5S A;  1N34 B;  1S76 D;  3QF7 A;  1FD9 A;  2VWK A;  5ITZ B;  1VQ5 V;  1KP2 A;  3RYC B;  4NXN O;  2ZM6 O;  4O4I A;  2R9A A;  4UB6 Z;  1SQX H;  5LBQ A;  4Z1V A;  4DXW A;  2LW1 A;  3CRA A;  4X89 A;  4JAS A;  4DR5 B;  4L87 A;  3SDL A;  4AI8 A;  3CC2 V;  1DF4 A;  1S5J A;  2V7Q G;  1WB7 A;  3OMA B;  2QA4 V;  3ZMS A;  1F4N A;  1I0H A;  2KQX A;  2Q68 A;  2BTQ B;  3P3N A;  4GX5 A;  2Q7G A;  1GN4 A;  5J2T B;  3HKD A;  4DR2 O;  2VRZ A;  4DR3 O;  2F95 B;  2R9R B;  1H2L A;  5CBH A;  1TVK A;  2VQE B;  1YDX A;  2YIA A;  3DXR A;  2ZR2 A;  2CH7 B;  1Q90 D;  3D3Q A;  1Z5V A;  4DR4 B;  2JIZ G;  2FL4 A;  1EFR G;  3JSL A;  4O2A B;  5DEC A;  2E74 B;  1AI7 A;  4JI6 O;  5C8Y A;  3E22 B;  4JI5 B;  3QNE A;  1BT8 A;  3A0R A;  1R3L C;  1NKD A;  3ZJZ A;  3TK1 A;  2IJJ A;  3ABK B;  4DV3 O;  5JCO A;  2IW5 A;  4DV0 O;  3D3I A;  1AB3 A;  4A5U B;  5IWA O;  4MW8 A;  3SYQ A;  3HKC A;  2PYL A;  4DUZ O;  2HP8 A;  3ZRS A;  3C90 A;  1MOF A;  3AG2 C;  4UVA A;  1K92 A;  4WF9 V;  5CB4 A;  4JI1 B;  4ZOL B;  2A0L A;  4BIZ A;  4UV9 A;  4KP4 A;  3JD3 A;  3OMI B;  4GX1 A;  4KFM A;  4CH5 A;  2H94 A;  2QSA A;  1QLE B;  1AR5 A;  4F4L A;  2UUA B;  1GM9 A;  4U3F H;  1G1X B;  3PJS K;  3CME V;  1GKF A;  3CB2 A;  2UU9 B;  1IZ3 A;  2CTP A;  4JAU A;  2WWW A;  2OWO A;  3H1L H;  1XNR B;  1V9P A;  4ZI7 A;  3MHH C;  3CCJ V;  1JFF A;  4WBN A;  5B1A B;  1XHZ A;  5CA1 B;  1E79 G;  2QWR B;  2WLN A;  3SJA C;  3ZMU A;  5LMU O;  4IYH A;  4DYL A;  2LQT A;  1FXK B;  1I08 A;  3RGB A;  5KHH A;  3CPW U;  4NXM O;  4LCU C;  1YHQ V;  2IU0 A;  3AG4 C;  2ZDI C;  2D3O W;  1NI8 A;  3K04 A;  2YI9 A;  2X6B A;  3OTF A;  1H8H G;  3VQV A;  1QVF U;  3ABU A;  4DK0 A;  5CBF A;  4FFB B;  4CS3 A;  1EN5 A;  4MTG A;  3RT3 C;  1XDC A;  1WA8 A;  2L35 A;  2CTR A;  2PF4 E;  1YIJ V;  4UCV A;  2C2A A;  4NKG B;  5IJ9 A;  5CN0 A;  5LXT B;  2XAQ A;  1ZAU A;  4GT1 A;  4K0K B;  1FFT B;  1N32 O;  4H44 B;  2QGN A;  1CEZ A;  3UT5 A;  4FLX A;  1IBK B;  5DED A;  4JI4 B;  4J9Z B;  4WFA V;  2YIC A;  5J2U A;  4LF6 O;  3ZHS A;  2YEV A;  4KL1 A;  1FKA O;  5DM6 V;  3H1H H;  3K0D A;  1XI1 A;  3J80 N;  4X64 B;  3R65 A;  1MSD A;  4PDR A;  4FM2 A;  2EBO A;  5LA6 A;  1I7F A;  3BFR A;  4HNA A;  1N33 B;  3I5D A;  1DK1 A;  1IBM O;  1VQN V; 
#chains in the Genus database with same CATH homology
 5LMN O;  2HHH O;  1G1X B;  4DR5 O;  1XNR O;  1R6T A;  3O65 A;  2UUC O;  4LF5 O;  4GKJ O;  2UUB O;  4JI1 O;  4JI3 O;  1YZB A;  5A2Q N;  1XMQ O;  4DV5 O;  2FKX A;  3T1H O;  5FLX N;  1X59 A;  5BR8 O;  3SDL A;  4DR6 O;  1AIL A;  4DV4 O;  4LFB O;  4YY3 O;  4OPH A;  4B3S O;  3JAM N;  1R1B A;  4AQY O;  4X62 O;  1IBL O;  4KHP O;  2AGA A;  5LMU O;  1J5E O;  4JV5 O;  3F5T A;  2VQE O;  1HNW O;  2LW7 A;  2N74 A;  4DV1 O;  4DR2 O;  1I94 O;  4NXM O;  4DR3 O;  4X66 O;  4DV2 O;  1HNX O;  2DJV A;  4JI0 O;  1F7Y A;  3OTO O;  2DOS A;  4JI7 O;  4B3T O;  4LF7 O;  1A32 A;  1N36 O;  2JRI A;  4LF9 O;  1XNQ O;  1NS1 A;  5LL6 Y;  2UXB O;  5IT9 N;  4YHH O;  1HNZ O;  4JI5 O;  3RT3 C;  4OPA A;  3R66 A;  2F4V O;  1FJG O;  4K0K O;  1XMO O;  5BXZ A;  5BY1 A;  4JI6 O;  2ZKO A;  4LFA O;  4DR4 O;  1XEQ A;  4DV6 O;  4B3R O;  4DR7 O;  3T1Y O;  2Z0A A;  1N32 O;  4DV3 O;  3J7A U;  4X64 O;  4DV0 O;  4DV7 O;  4JI8 O;  1AB3 A;  4A5U B;  5IWA O;  2E5L O;  1N34 O;  1D2D A;  2VQF O;  4LF6 O;  1FKA O;  4DUZ O;  3M8A A;  4LF4 O;  4JYA O;  3J80 N;  4OX9 O;  1FYJ A;  4JI2 O;  5H5N A;  2UXC O;  1N33 O;  4X65 O;  3J81 N;  4DR1 O;  1IBK O;  2UUA O;  4LFC O;  4JI4 O;  4DUY O;  4LF8 O;  1HR0 O;  2UU9 O;  4B3M O;  1DK1 A;  1IBM O;  4NXN O;  1KUQ A;  2UXD O;  4GKK O;  2ZM6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...