2ZKOA

Structural basis for dsrna recognition by ns1 protein of human influenza virus a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
70
structure length
70
Chain Sequence
MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(P*AP*GP*AP*CP*AP*GP*CP*AP*UP*UP*AP*UP*GP*CP*UP*GP*
publication title Structural basis for dsRNA recognition by NS1 protein of influenza A virus
pubmed doi rcsb
source organism Influenza a virus
molecule tags Rna binding protein/rna
total genus 30
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2zkoA00
4X65O 4DR4O 4X64O 5LMUO 4LFBO 5BY1A 4JI1O 4DV4O 1F7YA 1FJGO 1HR0O 4YHHO 2UUCO 5IT9N 1FKAO 1R6TA 4JI5O 4A5UB 1N32O 3T1YO 1X59A 3O65A 1NS1A 4LFCO 1N36O 4JI8O 1I94O 4LF5O 4DR1O 2FKXA 3OTOO 4LF7O 4JI6O 4LF9O 4OX9O 5FLXN 1AB3A 4JI2O 4JI7O 4B3TO 3RT3C 2ZKOA 1XMQO 5LL6Y 4LF8O 4JYAO 2UU9O 4OPAA 4JI3O 1FYJA 2DJVA 5H5NA 4DR3O 4NXMO 4LF6O 4DV2O 4OPHA 3J7AU 4B3SO 4JI0O 2UXCO 4X66O 2VQFO 4LFAO 3F5TA 4DV1O 4B3RO 3R66A 1XMOO 2AGAA 4DV3O 4DV6O 4B3MO 4X62O 1HNZO 2DOSA 2JRIA 1G1XB 2UUBO 2UUAO 3T1HO 4GKJO 5LMNO 1HNXO 1R1BA 1DK1A 4AQYO 2F4VO 2N74A 4DR7O 5BR8O 1IBLO 1N34O 4DV5O 4JI4O 4YY3O 1HNWO 4DR6O 1XEQA 4DR2O 2E5LO 2HHHO 4KHPO 1AILA 1XNRO 3J81N 1A32A 4GKKO 2UXDO 4JV5O 4DUYO 1KUQA 2VQEO 3J80N 2LW7A 4K0KO 5BXZA 4NXNO 1IBKO 2ZM6O 4DV7O 2Z0AA 1N33O 5IWAO 4LF4O 3SDLA 1D2DA 1J5EO 4DUZO 3JAMN 4DR5O 2UXBO 4DV0O 3M8AA 1YZBA 1IBMO 5A2QN 1XNQO
chains in the Genus database with same CATH superfamily
3OD4A 4PV1B 1IBLB 3LSSA 3SJCC 3FB6C 4CH4A 3JD2A 4UCVA 2HR3A 2YEVB 1NU1H 2UUCO 2UXBB 4QIWF 2OIGA 4FIPC 2E5LB 4TV9B 1GN6A 3K0DA 4BIUA 1U97A 4LFCO 4FLVA 3MDSA 3OGIB 2CAZC 4XBFA 2DYRC 3SPGA 1FAFA 1F51A 1WN7A 1L0NH 1DF4A 1GN2A 3JD0A 5LA6A 3K79A 3W7TA 4NTYA 2LGQA 1SQBH 2QWPB 3ETEA 3EHBB 3VOUA 2WLNA 5BZBA 3K06A 3U10A 2Q9LA 5CB4A 1NH2D 1V9PA 1YVWA 2LO1A 3ZRWB 4BW5A 5JQGB 5J2TA 2QGNA 2QE7G 4X9QA 2ZINA 4B7EA 4KP4A 1QLNA 1MMMA 3H1JH 2OWOA 2MW2B 3B8MA 5CA3A 3OMNB 1MZFA 4DW1A 2WLKA 3QVNA 4JAAA 2QWRB 4NVPA 1N34B 5D5PA 4D6TH 4X1YB 3H1KH 3ZX6A 1SA0B 1XDCA 2HVJC 2QKAA 1Q90D 3T1CA 2WSSG 2KKWA 2ZR3A 1EM1A 3S3WA 3CRQA 3CC2V 1AROP 1K3EA 1FD9A 3ASOB 4PJ0Z 3M8AA 3OMAB 3CJHB 1P84F 4X65O 2HEPA 4X64O 1H8EG 4WBNA 2YXYA 4DK1A 2H94A 3FFQA 2Q67A 3CC7V 1NTMH 1HDJA 2RQ6A 4JI8O 5BMVB 3N2GB 5KHKA 1B04A 5AG2A 1PNKA 3HR0A 2WWWA 3AG2C 2HJFC 1WAZA 5LGNA 3N27A 1IURA 1CEZA 3B2EE 4JI0O 4I9QA 4G2KA 3G67A 5KUMA 4EKWA 4EFEA 4LFAO 3H1LH 1Z5VA 2BTOA 4FPPA 1FXHA 2IH3C 4EFBA 1OZ0A 1ZSPA 4PDMA 3HKCB 1NZ6A 2GUZB 4DRXB 2AHYA 4JI6B 1SKVA 2HKOA 3WU2Z 3ABMC 4JAUA 1SC5B 1BQ0A 3OAAG 2IU3A 3FYEB 2XAJA 4H13B 1GN3A 4JZ2A 4H44B 4YIOA 1J95A 1NTZH 2RMKB 1FPOA 1QLEC 5CA0B 4YJ2A 1TVKA 2OIEA 2P67A 3CEIA 5LP6A 1KD1W 4FMTA 2O57A 3ZJZA 5LYJB 4MW8A 4IYHA 5EYPA 5LGUA 3OEEG 1SESA 3RWRD 4MVQA 4P2ZA 2YSUB 3CP1A 3HKDB 3SDLA 5JJNB 4LF4O 1D2DA 2YIBA 4CH5A 4CH6A 3AG4C 1WPXA 1NH2B 1M57C 3E22A 4H33A 2X7RB 4AHCA 5K1PA 4IT5A 1NVPD 2P4KA 3A2FA 3T1YO 1Q5OA 2ZXWC 2CK3G 1I94O 5FNVB 4X64B 1P4RA 1XREA 2QEXV 2C2AA 5C93A 1YJNV 3LSQA 1W0JG 3SPCA 1GK9A 2CTWA 1YHQV 3D3QA 4IL6Z 4Z1VA 2QWNB 2WPDG 5IJ9B 1JVMA 3QO7A 3K9SA 4X8AA 2UU9O 3H9VA 4O4JA 1Q82W 3ZHUA 5J2UA 1YXBA 1TUBA 2QSAA 1Q43A 4DR4B 3ETQA 1YSCA 3DXRA 2CTQA 3G80A 2AGAA 2Z5UA 1LR1A 3GVMA 4JI1B 5IDJA 3BABA 2WLLA 5EZYB 5FPRA 2DOSA 2HJDA 1G1XB 1WLEA 1ENVA 1TAEA 3K5LA 2ZE7A 1XHZA 1QCEA 4JI0B 1V54C 1FXVA 2Y0PA 1ZL8A 4LR3A 1VQMV 2Y0IA 2CUGA 3X2QB 3A0RA 4OXSA 4JYAB 2HHHO 1KC8W 1S5HC 2W0XA 4N23A 4KHPO 5IYZB 4ZBMA 1G6UA 3J81N 5B3SC 2EIJC 3Q4HB 4CBCA 3K5MA 4ZHQA 4WCEV 1XUQA 4C7UA 4MVMA 3CMAV 5H6RA 5EC1C 4W4KA 1IBKO 1XMOB 1KB9F 4UCUA 3QTCA 4J9ZB 3JAWB 4JTCB 3AK2A 5LMNB 1G4YB 3IGAC 1OCOB 4P9PA 4DV4O 1TGOA 2EIMB 3L9DA 1H8HG 4FJCC 3O65A 5GONB 3FB8C 3OTOO 1PPJH 2GV9A 2LFSA 4LF7O 2OTLV 5B1BB 1PL4A 2GSMB 2F1MA 3VQWA 4B7KA 1JPXA 3T1YB 1VF6A 1YF2A 1I94B 2D3OW 2F23A 2EINC 3IAYA 2JS3A 3APQA 1Y76A 4X66O 4AILC 4TV8A 3GB7C 1SQQH 2A7WA 1VARA 2R9IA 1QQCA 1Q7YW 2WLJA 2FTKA 1NVPB 1VQ9V 1DF5A 1JA8A 3L70H 4DV5O 4LF9B 3VQVA 1FFXB 3CCLV 3ZEDA 4D7TA 1AILA 5KMGB 2XTAA 4NXMB 2F66C 3CCQV 2WLMA 5CMUA 3EVKA 3N2KA 4LNUA 3OUFA 2VQEO 4GUNA 4X1KB 2YIDA 2QTOA 4KHPB 2QM4A 1H2LA 3M7MX 1BMFG 2YI8A 3RYFB 3DTUB 3ABLC 4X20A 5L3FA 1S72V 2FMLA 2FYUH 4MVZA 2GTSA 3W7XA 1M56B 3MAQA 3RYCA 5LGTA 1Z2GA 2QDOA 3FAVB 1K9MW 2ETNA 2CGOA 4WFGA 3RVYA 3U0ZA 3ZHSA 4MTOA 1X59A 1F4NA 5B66Z 4IHJB 5L3EA 2JGDA 5H6QA 2VRZA 4KFMA 1MG1A 3ML0A 3JATA 4RWUA 2WLIA 3SYOA 2D2CB 2EBOA 3CRAA 1NKDA 2WA4A 3E8GA 3R65A 4U7OA 1JQ0A 4BAYA 3BRCA 2DYSC 2CDYA 5LL6Y 2JGUA 3ABUA 4YJ3A 4N21A 3HKBB 4ZI7A 1V55C 1UFIA 1XQ8A 2OT5A 4MSWC 5EBLC 3JARA 1FXKB 3D8CA 2ZE8A 4FLWA 4I0XB 2LFRA 3K59A 4PI0A 1P7BA 3CCJV 4X62O 4KXRA 3SJBC 4DV6O 1VQ7V 3CB2A 1KYOF 4ZOLB 1THZA 2UUBO 4TQFA 3STZC 1JFFB 4O4IB 4X66B 2AXTZ 4MTFA 4I50A 2ADQB 5KAFZ 4DR1B 1OHHG 3FKSG 2ZD9A 2N05A 5EBMC 3RYIB 2A3QA 4O2AA 1KKCA 3MD0A 2HG5C 5L3CA 2GTAA 4B3TB 4LF8B 1Q6UA 1GO3F 4F6RA 4UB8Z 5JCOA 4FZ0A 1L0LH 4DV5B 4XDJA 3ETGA 4TQDA 1YIJV 5ITZB 4PD4F 3J80N 4K0KO 1UPGA 4UCRA 5B1AC 1J5EO 4DUZO 3RGBA 1AI5A 2R72A 1KECA 1Z5WA 2JIZG 2VWJA 2A06H 2ZCEA 4K8XA 3A8TA 1US6A 4FLUA 1AJNA 1XL6A 2ZE5A 5IT9N 2Q0AA 2PYLA 1JJOA 3FX7A 1D5AA 5IJ0A 2XAFA 3RYHA 2EILB 3QF7A 3ZBHA 1JR9A 4JI7O 2PY5A 2FL4A 5LA6B 3ZN0A 5JVDA 4RO2A 4B3SO 2DE0X 2OCHA 1W2BU 2UXCO 2KG7A 1PL0A 3ZRVA 5DECA 2YIBD 1WA8A 2JK5C 4RUFA 2E76B 2YS8A 5CB4B 1N0NA 2BSKA 4YHHB 4LWSB 3UKMA 4UCSA 3WB1A 2QM7A 2Y4TA 4PDRA 3CXCU 5EIBC 1VF6C 3ASNB 3K5NA 3CS5A 4X1IA 2F4VO 4PELA 2HVKC 4FVMA 4DV6B 4R6ZA 2F93B 3TXSA 1COWG 4DR2O 1XMQB 3LNNA 3KCYA 4GKKO 2YEVA 2HP8A 1ZTEA 1S5JA 4JV5O 4UVBA 4DUYO 2JEUA 1VF7A 1K4CC 4L8JA 4O4LA 2B5UA 2JS5A 5IWAO 1OCZC 1W59A 1M9NA 3B40A 3AK3A 4RAIA 1TA8A 5L3GA 3BCCH 4LC1A 3ZCCA 5LMUO 2YI9A 4NYKA 1YI2V 2EJ7A 4O2BB 1K5QA 1HR0O 3P3NA 3GWOA 4WBNB 1VEWA 4FK5C 2Q68A 5GTHZ 3WB2A 4FLXA 4WFEA 3ZRWA 3ZIAG 1N36O 5JQGA 1MSWD 1VP7A 2Q4PA 3OT7A 4DYLA 4FM0A 3IFXA 1JOYA 2K1EA 1O9GA 1EN4A 1K92A 1K5SA 2H8PC 3OGCC 3QNEA 3LDEA 2Q73A 1GM9A 4U3JA 5H5NA 5KX5B 3ABTA 1OCRB 3OEHG 1Y4MA 4D7SA 3IC7A 2EIKB 4X1YA 2UUCB 1K7DA 3CXHF 3B8NA 1SA0A 1Q86W 3AK1A 3STLC 1KP2A 1SQXH 4LFCB 2XT9A 2UXCB 3OM3B 4GX2A 1WJZA 4DR7O 1SQGA 2V1DA 5K1XA 4IIJB 5KA6A 4YY3O 3E8BA 1T5EA 1AI4A 1KP3A 1I08A 5CBHA 1MOFA 1WB8A 5IY5C 2UXDO 1EN6A 1YDXA 2B1GA 4HAMA 3ABKB 5KAIZ 1RM1B 3NXSA 2LW7A 3GWKC 4LH6A 1TVKB 2IH1C 3OMIB 4JYBA 4YJ2B 3SPJA 5C8YB 2ZM6O 1OCCC 3N2GA 1MZEA 2IJJA 3H01A 5LP6B 3L72H 1N33O 2ZNIA 4CS2A 3SPHA 1VQPV 4MTXA 4K3AA 1RPRA 4I4TB 3BA9A 4GX1A 2PUSA 1JCHA 3JCZA 3MHHC 5JCOC 4KUMA 1FJGO 2GHYA 2PI4A 4WFBV 4PA9A 1W0KG 2F95B 1VQNV 3CCMV 4JI5O 4A5UB 5FL7G 2X6AA 2NLJC 5LMUB 2R70A 1RSOB 1YITV 5E1AC 3WG7C 4YXWG 1HR0B 3HKCA 2BCCH 4B08A 3BA8A 2XUMA 3AG1C 3ZHTA 5TISZ 1WP8A 4DRXA 4TUYB 2UXXA 5H2FZ 2K9PA 3C3TA 3LDDA 3J7AU 2EZPA 3F5WC 3B4SA 1E1QG 4X65B 1YCIA 3E83A 2VQFO 1EN5A 2XHBA 1SQVH 2Y69C 1IDSA 3NR7A 4MW3A 1HWYA 1IXBA 3H1IH 5LYJA 2OCCC 3P30A 4MVRA 4I7ZB 1G8MA 3CC4V 1HNXO 5LXTA 4JI8B 3HKDA 2F43G 3LSUA 4BIZA 4OGQB 1ZUQA 1SERA 1QBZA 4O4HB 4JI4O 3AG3C 3K57A 3UT5B 4DR6O 2EZOA 2MK3A 2RNBA 2PYJA 3K08A 3L71H 3SJQC 2P90A 1N4CA 3FB5C 4YY3B 1VQ4V 1R6NA 4Z1MG 3CCUV 5FNVA 4LFAB 2ZIOA 2A79B 1BE3H 3CYOA 4DR5O 1TUEB 2ZT9B 1PV0A 3I55V 5IJ9A 4FFKA 3CE2A 2ARHA 2ZM6B 3KG2A 1IZ3A 2DQ3A 2QWOB 1Y74B 1XI1A 1N33B 1VQ5V 3F7YC 4J42A 1R6TA 1F4MA 3TK1A 4FFBB 3G6EV 2OTJV 2Y48A 5EZYA 3JSLA 2YDEA 4R7CA 4NTWA 1AR4A 1FJGB 4DXWA 3O9OA 1IVSA 4JI5B 2YICA 2DYRB 4JI2O 4YIPA 4LF4B 4OPAA 4XDKA 3FD9A 5B5EZ 4DR3O 1F23A 4LF6O 3D36C 4OPHA 4JYCA 5IYZA 2E3CA 1WPBA 1ROPA 1SF9A 4QE7A 4U3FH 3Q4HA 1Y76B 1KMIZ 3UO2A 3W7WA 1AR1B 1PNMA 3CCSV 1GTOA 1GRJA 5F2VO 1YJ9V 3G4SV 4J7ZA 3KKYA 3EFFK 3PN1A 3JAWA 1K34A 2RCVA 3CRMA 1Y67A 1OV9A 4UUJC 5LOVB 1HNXB 4HYOA 2UU9B 3P3PA 1XNRO 4WFAV 2Q7EA 5JH7B 4P30A 4UV8A 4JI4B 5KHJA 3F7VC 1Q3EA 4EB6B 4I5SA 1XHXA 1JMKC 4LNUB 4DV7O 3VBBA 3HPLC 4HNAB 4I9WA 3CPWU 3ASOC 4RQEA 5CN0A 2XAQA 1M90W 2DWEC 4QPKA 4MVOA 2XOKG 5IYCO 4J11A 4QGPA 2JEXA 4NR1A 4ZKIA 1KU9A 5FPOA 3SGIA 3JD3A 3RYCB 2HHHB 4K8ZA 2ZDIC 1NR1A 1NS1A 2Q5ZA 2P22C 3OTFA 3H1HH 3S3XA 2LQTA 5DEDA 3TGUH 1YEWA 1IBKB 2CH7B 3DC5A 3E35A 3JASB 4HBNA 1SQPH 1QR8A 3AG2B 3BVOA 2IU0A 1Q6HA 2L35A 1FFXA 1JJ2U 3WB0A 4ZI7B 5KMGA 1NR7A 4JI2B 3R66A 4B3RO 2Z3YA 4UV9A 4W4LA 4DV4B 1HNZO 4LF6B 1RM1C 4GX0A 4X1KA 4EEQA 5HFMA 1VQLV 4FLYA 3T1HO 2IJHA 5L3DA 5LHGA 1N8RW 2DN9A 4J7JA 4J7KA 3CMEV 1K73W 1RPOA 3RYFA 3OTOB 3HKEB 1IBLO 3RFRA 4LF7B 4J41A 4I50B 1LUVA 2ODMA 2B1IA 1FFTB 1H38A 3VQXA 1M1KW 1XEQA 1BHAA 4JYYA 3ABMB 3L74H 1S5LZ 2E5LO 3OE7G 3JCUZ 4O2AB 4X89A 1R3KC 3FAVA 4I55B 1GH6A 2KSDA 4CC5A 1QLEB 3FB7C 3AEIA 4IHJA 3RW0A 3VQYA 2B9ZA 1NQTA 3K3WA 5EC2C 3SYAA 3T4ZA 2XAGA 4MVSA 3ZMSA 4FZ1A 3IC9A 3TXQA 1DLBA 2R9RB 2QTSA 1QVFU 4J9YB 4JASA 3AG4B 1K4DC 4DV7B 5DM6V 1M57B 2BOBC 2PF4E 2R9AA 3JAKA 3SJAC 3HKBA 2YXLA 1F7YA 4LP8A 1AJQA 2QM8A 3B09A 2XAHA 2FKXA 3LNMB 4ZOLA 2ZXWB 3RVZA 1JFFA 2VQEB 4OX9O 4CH3A 4O4IA 3P32A 1SETA 2ATKC 3E8FA 1UJWB 2IM9A 1AB3A 3RT3C 4PA4A 5CA1B 1I5XA 1ZWIC 1ZX3A 3RYIA 5JJJB 1SZXA 1I7FA 3THOA 5JVDB 3ZRXA 1BZKA 4TWKA 5ITZA 2VWKA 1XILA 1PKXA 2JRIA 2AW9A 3W7UA 4PA3A 3G6BA 3KZIZ 3I5DA 3X2QC 2N74A 1V54B 1Y6XA 3E89A 3BHPA 3CWBH 4JTAB 3T4DA 1HP8A 2NR5A 3RBZA 3T1HB 1MNGA 2FB5A 2ITCC 1BL8A 3K0GA 2BTQA 3CX5F 4MT8A 1BGYH 3JALA 5B3SB 1NI8A 1R3LC 5J2TB 2EIJB 2IJKA 2LW1A 4NB5A 2GDSA 3ZS8C 1N0JA 4QJFB 4X62B 1KBHA 1E1RG 3M99B 2JVDA 2Q7HA 3K5OA 4G27B 4O4LB 2UUBB 3OR7C 5EBWC 2ZE6A 1YTFD 1YZBA 1BHBA 1OCOC 3CCVV 2BOCC 1ZLZA 4LFBO 3DSQA 2EIMC 3K03A 4TV9A 1FS0G 1FKAO 2YXHA 4DO2A 1VMGA 4Q6GA 5B1BC 4LWSA 1U96A 3A0HZ 5KLVH 1HW7A 3E86A 4JI6O 2LP7A 4K0KB 2AZ2A 2ITDC 4NTXA 3TETA 3QG5A 2VS0A 1L1FA 3SPIA 1VF5B 4JI3O 1FYJA 3SR2C 1J5EB 4DUZB 2X6CA 1WB7A 2WA3A 3D36A 1YJWV 4QE9A 4U3JB 4OX9B 1S3JA 2LGWA 4UCOA 1B3QA 3ZRSA 2EINB 1H2MA 1MABG 5KHHA 2H3OA 1XBLA 1BCCH 1R3JC 3W7SA 1DK1A 1BS3A 3B77A 1HNWO 2DWDC 4X88A 1ORQC 3U11A 4JI7B 4O2BA 5EK0A 2P7TC 1H2NA 4FLTA 4UFZA 2Q6AA 4QNHB 1S76D 1AP6A 4B3SB 4JZGA 4F6EA 2V4DA 2P5OA 4GLXA 2Q0OC 4GYCB 1EFRG 1R6KA 5CBGA 2LJ2A 3CJHA 2WLHA 1M56C 1IBMO 3ABLB 1Y66A 4GT1A 1GN4A 3LUTB 4DR4O 2ZIMA 2F4VB 5KX5A 3T2MA 5BY1A 4JI1O 4LCUC 1H2KA 5EIBD 2KB1A 3QO5A 3CRRA 5BMVA 1ZAUA 2ZDIA 4DR2B 2NN4A 4GKKB 2ILMA 3A0BZ 4LFBB 5EYPB 4QPJA 1QHTA 2EULA 2PZSA 4JV5B 2YIAA 4DUYB 3ZMTA 4ZIBA 4LBEC 4JYAO 2CGNA 4K35A 4IIJA 2PI5A 3E22B 5IWAB 4UVAA 2DJVA 5KA5A 2DYSB 1I0HA 4DV2O 3CRCA 1FXKC 1EZJA 2IW5A 3SYQA 1NJIW 1V55B 2Q8VA 1DGSA 1PP9H 4DV1O 2DQ0A 1XMOO 4JI3B 5A9GA 2HFEC 1RP3B 3CCEV 1YTFB 3BPZA 5C8YA 4BWAA 2IJIA 2QKCA 2GUZA 1GM8A 2RDCA 5LMNO 1N36B 2QR4A 3JD4A 4I4TA 3BFRA 5LXTB 3SYCA 5JJEB 4O4JB 1VQKV 2AZ0A 1AI6A 5J2UB 5KHGA 1TUBB 3UM7A 4PDVA 5CA0A 4R8CA 3AG7A 4HZ3A 3FYIB 3DXRB 4UXNA 2EX3A 1HNWB 1PNLA 2WLLB 4JF3A 5CBFA 1K8AW 1RSOA 3RN4A 5GTIZ 2CTRA 1H2GA 2QJ1A 4TSFG 5GW7A 1ZL8B 5B1AB 4WFHA 2WAMA 4BW9A 1WNSA 1AR5A 1LNQA 4TUYA 1XNQO 2CTPA 3ETDA 4DR7B 2QA4V 1K33A 2JDIG 1IXMA 1AVMA 1CP9A 3CCRV 4ZHQB 4KL1A 1IBMB 4J80A 3CHXA 4LF5O 3JYCA 4Q20A 3K9AA 2UXDB 2EILC 4LF9O 1EZVH 1H2SB 5LHHA 5KHIA 2Q69A 2ZKOA 4O4HA 4GZRB 1VQOV 3ICXA 3BEHA 3UT5A 4NXMO 4JGSA 1JX9A 1NBMG 4PI2A 1KKDA 1MA1A 2KQXA 3K04A 4MTGA 2OYQA 4DV3O 1K97A 3PJSK 3ZMVA 3IJ4A 4DV2B 1MSDA 3ASNC 2Y4UA 2P06A 1AJPA 4FM1A 4AQYO 4DV1B 2ZR2A 5LBQA 2W6IG 4H37A 1VQ8V 2PTMA 4XDLA 5IE9A 4IYIA 1SQFA 1LUWA 5KUKA 1Y74A 4ASUG 4JPRA 1WP7A 2NNUA 1RFYA 1EBOA 3ZHVA 3EXAA 4PHZA 4TV8B 1R73A 3OW2U 3TCUA 4L87A 4FFBA 1PD3A 2UXNA 2W0FC 1R3IC 2A0LA 2VQFB 5B1OA 2Z0AA 1URFA 2DMXA 5E79Z 3ZMZA 3JAMN 2L6LA 3DC6A 4RQFA 4DV0O 1OCZB 5J9PC 3JSNA 2PGGA 2RJZA 3BAAA 2Q7GA 4R50A 1L8DA 4G28B 2M6YA 1AI7A 3WFVA 4GCZA 5GONA 4DR6B 4BR6A 2A9HA 4NKGB 3SYPA 3N2KB 1N32O 1P7GA 5JWPA 1B06A 2X0LA 4H0LB 1XNQB 4F4LA 4DR1O 3JD1A 1KQSU 4WFFA 3L75H 4LH7A 4TT3G 1QNMA 5FLXN 2YUAA 2BE3A 1S77D 4X20B 1DTOA 4B3TO 4LF8O 3KCXA 4DK0A 4LF5B 4E4EA 2IBZH 1OCRC 1X4TA 1OJHA 5IYBO 4DR5B 4RUEA 5IYDO 2XASA 5LOVA 2HLDG 4E2LA 2E74B 2EIKC 5JH7A 4UB6Z 3F5TA 4UVCA 4B3MO 2JGDB 2XNDG 3QO8A 2QKSA 3DGEA 4EB6A 1SS3A 2G38A 4JAVA 2W6JG 3LDCA 3JATB 2UUAO 2WLIB 4GKJO 4HNAA 1QR9A 3UQ8A 2V7QG 5BR8O 1P49A 4DV3B 1GMGA 4IGGA 4YJ3B 4FLZA 2E75B 1M93A 2N04A 2EJRA 2P6JA 1S0VA 3ZN1A 1VQ6V 3UCSC 4PA6A 4DW0A 3JARB 1D5NA 4AQYB 4DR3B 3ABKC 4CS4A 4UCTA 5IY5B 1KUQA 5LP6C 4NXNO 4WF9V 4GX5A 4CZZA 1Q8IA 1OCCB 3I56V 2UXBO 4TOIA 2CH7A 3JASA 2YC0A 4PA7A 2QWQB 5H9CA 1E79G 3ZHQA 4BIOA 4F6RB 2GBOA 3OR6C 1VIBA 4YHHO 3JAKB 4DV0B 2M7WA 1GKFA 3L73H 1XNRB 1GAXA 1I5YA 3CD6V 4MS2A 1XL4A 1M5IA 1SZTA 1NTKH 3WG7B 5DN6G 2P4VA 1N32B 3HKEA 3ZHRA 1XMQO 4AI8A 3C3SA 5D5QA 5B1NA 1BSMA 1XOUA 3AG1B 3OUSA 3E8HA 1QU7A 1FXKA 4FM2A 1BQZA 1QVGU 4P9OA 2DW4A 5LHIA 4I0XA 4PDLA 3K58A 3APOA 4I55A 5L3BA 2X6BA 3OFNG 4MVUA 3C90A 3E2EA 5IJ0B 2AHZA 2JJ2G 2Y69B 3D3IA 4JTDB 1O9HA 1GM7A 1PM9A 4ABMA 3G71V 1R1BA 3RYHB 2OCCB 4U7NA 3UO3A 1Q6IA 1M4UA 1N34O 4B3MB 3BY6A 4J10A 1Q81W 1SRYA 2ZQMA 3AG3B 2UUAB 1B6QA 2JJ1G 1AP5A 4Z2WA 4GKJB 3MHSC 1BT8A 2KG7B 1A32A 4CC6A 5HFLA 1CXZB 5BR8B 2RN9A 3ZMUA 1WA8B 2BTQB 2BSKB 4CS3A 2ZNJA 2CE4A 5BXZA 3JALB 4ICGA 4B3RB 3CSXA 1HNZB 2ADPA 4X1IB 3HB3B 1IX9A 1CPYA 1NT2B 5A2QN 4NXNB 5CA1A 3TJTA
chains in the Genus database with same CATH topology
4X65O 4DR4O 4X64O 5LMUO 4LFBO 5BY1A 4JI1O 4DV4O 1F7YA 1FJGO 1HR0O 4YHHO 2UUCO 5IT9N 1FKAO 1R6TA 4JI5O 4A5UB 1N32O 3T1YO 1X59A 3O65A 1NS1A 4LFCO 1N36O 4JI8O 1I94O 4LF5O 4DR1O 2FKXA 3OTOO 4LF7O 4JI6O 4LF9O 4OX9O 5FLXN 1AB3A 4JI2O 4JI7O 4B3TO 3RT3C 2ZKOA 1XMQO 5LL6Y 4LF8O 4JYAO 2UU9O 4OPAA 4JI3O 1FYJA 2DJVA 5H5NA 4DR3O 4NXMO 4LF6O 4DV2O 4OPHA 3J7AU 4B3SO 4JI0O 2UXCO 4X66O 2VQFO 4LFAO 3F5TA 4DV1O 4B3RO 3R66A 1XMOO 2AGAA 4DV3O 4DV6O 4B3MO 4X62O 1HNZO 2DOSA 2JRIA 1G1XB 2UUBO 2UUAO 3T1HO 4GKJO 5LMNO 1HNXO 1R1BA 1DK1A 4AQYO 2F4VO 2N74A 4DR7O 5BR8O 1IBLO 1N34O 4DV5O 4JI4O 4YY3O 1HNWO 4DR6O 1XEQA 4DR2O 2E5LO 2HHHO 4KHPO 1AILA 1XNRO 3J81N 1A32A 4GKKO 2UXDO 4JV5O 4DUYO 1KUQA 2VQEO 3J80N 2LW7A 4K0KO 5BXZA 4NXNO 1IBKO 2ZM6O 4DV7O 2Z0AA 1N33O 5IWAO 4LF4O 3SDLA 1D2DA 1J5EO 4DUZO 3JAMN 4DR5O 2UXBO 4DV0O 3M8AA 1YZBA 1IBMO 5A2QN 1XNQO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 O;  4DR4 O;  4X64 O;  5LMU O;  4LFB O;  5BY1 A;  4JI1 O;  4DV4 O;  1F7Y A;  1FJG O;  1HR0 O;  4YHH O;  2UUC O;  5IT9 N;  1FKA O;  1R6T A;  4JI5 O;  4A5U B;  1N32 O;  3T1Y O;  1X59 A;  3O65 A;  1NS1 A;  4LFC O;  1N36 O;  4JI8 O;  1I94 O;  4LF5 O;  4DR1 O;  2FKX A;  3OTO O;  4LF7 O;  4JI6 O;  4LF9 O;  4OX9 O;  5FLX N;  1AB3 A;  4JI2 O;  4JI7 O;  4B3T O;  3RT3 C;  2ZKO A;  1XMQ O;  5LL6 Y;  4LF8 O;  4JYA O;  2UU9 O;  4OPA A;  4JI3 O;  1FYJ A;  2DJV A;  5H5N A;  4DR3 O;  4NXM O;  4LF6 O;  4DV2 O;  4OPH A;  3J7A U;  4B3S O;  4JI0 O;  2UXC O;  4X66 O;  2VQF O;  4LFA O;  3F5T A;  4DV1 O;  4B3R O;  3R66 A;  1XMO O;  2AGA A;  4DV3 O;  4DV6 O;  4B3M O;  4X62 O;  1HNZ O;  2DOS A;  2JRI A;  1G1X B;  2UUB O;  2UUA O;  3T1H O;  4GKJ O;  5LMN O;  1HNX O;  1R1B A;  1DK1 A;  4AQY O;  2F4V O;  2N74 A;  4DR7 O;  5BR8 O;  1IBL O;  1N34 O;  4DV5 O;  4JI4 O;  4YY3 O;  1HNW O;  4DR6 O;  1XEQ A;  4DR2 O;  2E5L O;  2HHH O;  4KHP O;  1AIL A;  1XNR O;  3J81 N;  1A32 A;  4GKK O;  2UXD O;  4JV5 O;  4DUY O;  1KUQ A;  2VQE O;  3J80 N;  2LW7 A;  4K0K O;  5BXZ A;  4NXN O;  1IBK O;  2ZM6 O;  4DV7 O;  2Z0A A;  1N33 O;  5IWA O;  4LF4 O;  3SDL A;  1D2D A;  1J5E O;  4DUZ O;  3JAM N;  4DR5 O;  2UXB O;  4DV0 O;  3M8A A;  1YZB A;  1IBM O;  5A2Q N;  1XNQ O; 
#chains in the Genus database with same CATH topology
 3OD4 A;  4PV1 B;  1IBL B;  3LSS A;  3SJC C;  3FB6 C;  4CH4 A;  3JD2 A;  4UCV A;  2HR3 A;  2YEV B;  1NU1 H;  2UUC O;  2UXB B;  4QIW F;  2OIG A;  4FIP C;  2E5L B;  4TV9 B;  1GN6 A;  3K0D A;  4BIU A;  1U97 A;  4LFC O;  4FLV A;  3MDS A;  3OGI B;  2CAZ C;  4XBF A;  2DYR C;  3SPG A;  1FAF A;  1F51 A;  1WN7 A;  1L0N H;  1DF4 A;  1GN2 A;  3JD0 A;  5LA6 A;  3K79 A;  3W7T A;  4NTY A;  2LGQ A;  1SQB H;  2QWP B;  3ETE A;  3EHB B;  3VOU A;  2WLN A;  5BZB A;  3K06 A;  3U10 A;  2Q9L A;  5CB4 A;  1NH2 D;  1V9P A;  1YVW A;  2LO1 A;  3ZRW B;  4BW5 A;  5JQG B;  5J2T A;  2QGN A;  2QE7 G;  4X9Q A;  2ZIN A;  4B7E A;  4KP4 A;  1QLN A;  1MMM A;  3H1J H;  2OWO A;  2MW2 B;  3B8M A;  5CA3 A;  3OMN B;  1MZF A;  4DW1 A;  2WLK A;  3QVN A;  4JAA A;  2QWR B;  4NVP A;  1N34 B;  5D5P A;  4D6T H;  4X1Y B;  3H1K H;  3ZX6 A;  1SA0 B;  1XDC A;  2HVJ C;  2QKA A;  1Q90 D;  3T1C A;  2WSS G;  2KKW A;  2ZR3 A;  1EM1 A;  3S3W A;  3CRQ A;  3CC2 V;  1ARO P;  1K3E A;  1FD9 A;  3ASO B;  4PJ0 Z;  3M8A A;  3OMA B;  3CJH B;  1P84 F;  4X65 O;  2HEP A;  4X64 O;  1H8E G;  4WBN A;  2YXY A;  4DK1 A;  2H94 A;  3FFQ A;  2Q67 A;  3CC7 V;  1NTM H;  1HDJ A;  2RQ6 A;  4JI8 O;  5BMV B;  3N2G B;  5KHK A;  1B04 A;  5AG2 A;  1PNK A;  3HR0 A;  2WWW A;  3AG2 C;  2HJF C;  1WAZ A;  5LGN A;  3N27 A;  1IUR A;  1CEZ A;  3B2E E;  4JI0 O;  4I9Q A;  4G2K A;  3G67 A;  5KUM A;  4EKW A;  4EFE A;  4LFA O;  3H1L H;  1Z5V A;  2BTO A;  4FPP A;  1FXH A;  2IH3 C;  4EFB A;  1OZ0 A;  1ZSP A;  4PDM A;  3HKC B;  1NZ6 A;  2GUZ B;  4DRX B;  2AHY A;  4JI6 B;  1SKV A;  2HKO A;  3WU2 Z;  3ABM C;  4JAU A;  1SC5 B;  1BQ0 A;  3OAA G;  2IU3 A;  3FYE B;  2XAJ A;  4H13 B;  1GN3 A;  4JZ2 A;  4H44 B;  4YIO A;  1J95 A;  1NTZ H;  2RMK B;  1FPO A;  1QLE C;  5CA0 B;  4YJ2 A;  1TVK A;  2OIE A;  2P67 A;  3CEI A;  5LP6 A;  1KD1 W;  4FMT A;  2O57 A;  3ZJZ A;  5LYJ B;  4MW8 A;  4IYH A;  5EYP A;  5LGU A;  3OEE G;  1SES A;  3RWR D;  4MVQ A;  4P2Z A;  2YSU B;  3CP1 A;  3HKD B;  3SDL A;  5JJN B;  4LF4 O;  1D2D A;  2YIB A;  4CH5 A;  4CH6 A;  3AG4 C;  1WPX A;  1NH2 B;  1M57 C;  3E22 A;  4H33 A;  2X7R B;  4AHC A;  5K1P A;  4IT5 A;  1NVP D;  2P4K A;  3A2F A;  3T1Y O;  1Q5O A;  2ZXW C;  2CK3 G;  1I94 O;  5FNV B;  4X64 B;  1P4R A;  1XRE A;  2QEX V;  2C2A A;  5C93 A;  1YJN V;  3LSQ A;  1W0J G;  3SPC A;  1GK9 A;  2CTW A;  1YHQ V;  3D3Q A;  4IL6 Z;  4Z1V A;  2QWN B;  2WPD G;  5IJ9 B;  1JVM A;  3QO7 A;  3K9S A;  4X8A A;  2UU9 O;  3H9V A;  4O4J A;  1Q82 W;  3ZHU A;  5J2U A;  1YXB A;  1TUB A;  2QSA A;  1Q43 A;  4DR4 B;  3ETQ A;  1YSC A;  3DXR A;  2CTQ A;  3G80 A;  2AGA A;  2Z5U A;  1LR1 A;  3GVM A;  4JI1 B;  5IDJ A;  3BAB A;  2WLL A;  5EZY B;  5FPR A;  2DOS A;  2HJD A;  1G1X B;  1WLE A;  1ENV A;  1TAE A;  3K5L A;  2ZE7 A;  1XHZ A;  1QCE A;  4JI0 B;  1V54 C;  1FXV A;  2Y0P A;  1ZL8 A;  4LR3 A;  1VQM V;  2Y0I A;  2CUG A;  3X2Q B;  3A0R A;  4OXS A;  4JYA B;  2HHH O;  1KC8 W;  1S5H C;  2W0X A;  4N23 A;  4KHP O;  5IYZ B;  4ZBM A;  1G6U A;  3J81 N;  5B3S C;  2EIJ C;  3Q4H B;  4CBC A;  3K5M A;  4ZHQ A;  4WCE V;  1XUQ A;  4C7U A;  4MVM A;  3CMA V;  5H6R A;  5EC1 C;  4W4K A;  1IBK O;  1XMO B;  1KB9 F;  4UCU A;  3QTC A;  4J9Z B;  3JAW B;  4JTC B;  3AK2 A;  5LMN B;  1G4Y B;  3IGA C;  1OCO B;  4P9P A;  4DV4 O;  1TGO A;  2EIM B;  3L9D A;  1H8H G;  4FJC C;  3O65 A;  5GON B;  3FB8 C;  3OTO O;  1PPJ H;  2GV9 A;  2LFS A;  4LF7 O;  2OTL V;  5B1B B;  1PL4 A;  2GSM B;  2F1M A;  3VQW A;  4B7K A;  1JPX A;  3T1Y B;  1VF6 A;  1YF2 A;  1I94 B;  2D3O W;  2F23 A;  2EIN C;  3IAY A;  2JS3 A;  3APQ A;  1Y76 A;  4X66 O;  4AIL C;  4TV8 A;  3GB7 C;  1SQQ H;  2A7W A;  1VAR A;  2R9I A;  1QQC A;  1Q7Y W;  2WLJ A;  2FTK A;  1NVP B;  1VQ9 V;  1DF5 A;  1JA8 A;  3L70 H;  4DV5 O;  4LF9 B;  3VQV A;  1FFX B;  3CCL V;  3ZED A;  4D7T A;  1AIL A;  5KMG B;  2XTA A;  4NXM B;  2F66 C;  3CCQ V;  2WLM A;  5CMU A;  3EVK A;  3N2K A;  4LNU A;  3OUF A;  2VQE O;  4GUN A;  4X1K B;  2YID A;  2QTO A;  4KHP B;  2QM4 A;  1H2L A;  3M7M X;  1BMF G;  2YI8 A;  3RYF B;  3DTU B;  3ABL C;  4X20 A;  5L3F A;  1S72 V;  2FML A;  2FYU H;  4MVZ A;  2GTS A;  3W7X A;  1M56 B;  3MAQ A;  3RYC A;  5LGT A;  1Z2G A;  2QDO A;  3FAV B;  1K9M W;  2ETN A;  2CGO A;  4WFG A;  3RVY A;  3U0Z A;  3ZHS A;  4MTO A;  1X59 A;  1F4N A;  5B66 Z;  4IHJ B;  5L3E A;  2JGD A;  5H6Q A;  2VRZ A;  4KFM A;  1MG1 A;  3ML0 A;  3JAT A;  4RWU A;  2WLI A;  3SYO A;  2D2C B;  2EBO A;  3CRA A;  1NKD A;  2WA4 A;  3E8G A;  3R65 A;  4U7O A;  1JQ0 A;  4BAY A;  3BRC A;  2DYS C;  2CDY A;  5LL6 Y;  2JGU A;  3ABU A;  4YJ3 A;  4N21 A;  3HKB B;  4ZI7 A;  1V55 C;  1UFI A;  1XQ8 A;  2OT5 A;  4MSW C;  5EBL C;  3JAR A;  1FXK B;  3D8C A;  2ZE8 A;  4FLW A;  4I0X B;  2LFR A;  3K59 A;  4PI0 A;  1P7B A;  3CCJ V;  4X62 O;  4KXR A;  3SJB C;  4DV6 O;  1VQ7 V;  3CB2 A;  1KYO F;  4ZOL B;  1THZ A;  2UUB O;  4TQF A;  3STZ C;  1JFF B;  4O4I B;  4X66 B;  2AXT Z;  4MTF A;  4I50 A;  2ADQ B;  5KAF Z;  4DR1 B;  1OHH G;  3FKS G;  2ZD9 A;  2N05 A;  5EBM C;  3RYI B;  2A3Q A;  4O2A A;  1KKC A;  3MD0 A;  2HG5 C;  5L3C A;  2GTA A;  4B3T B;  4LF8 B;  1Q6U A;  1GO3 F;  4F6R A;  4UB8 Z;  5JCO A;  4FZ0 A;  1L0L H;  4DV5 B;  4XDJ A;  3ETG A;  4TQD A;  1YIJ V;  5ITZ B;  4PD4 F;  3J80 N;  4K0K O;  1UPG A;  4UCR A;  5B1A C;  1J5E O;  4DUZ O;  3RGB A;  1AI5 A;  2R72 A;  1KEC A;  1Z5W A;  2JIZ G;  2VWJ A;  2A06 H;  2ZCE A;  4K8X A;  3A8T A;  1US6 A;  4FLU A;  1AJN A;  1XL6 A;  2ZE5 A;  5IT9 N;  2Q0A A;  2PYL A;  1JJO A;  3FX7 A;  1D5A A;  5IJ0 A;  2XAF A;  3RYH A;  2EIL B;  3QF7 A;  3ZBH A;  1JR9 A;  4JI7 O;  2PY5 A;  2FL4 A;  5LA6 B;  3ZN0 A;  5JVD A;  4RO2 A;  4B3S O;  2DE0 X;  2OCH A;  1W2B U;  2UXC O;  2KG7 A;  1PL0 A;  3ZRV A;  5DEC A;  2YIB D;  1WA8 A;  2JK5 C;  4RUF A;  2E76 B;  2YS8 A;  5CB4 B;  1N0N A;  2BSK A;  4YHH B;  4LWS B;  3UKM A;  4UCS A;  3WB1 A;  2QM7 A;  2Y4T A;  4PDR A;  3CXC U;  5EIB C;  1VF6 C;  3ASN B;  3K5N A;  3CS5 A;  4X1I A;  2F4V O;  4PEL A;  2HVK C;  4FVM A;  4DV6 B;  4R6Z A;  2F93 B;  3TXS A;  1COW G;  4DR2 O;  1XMQ B;  3LNN A;  3KCY A;  4GKK O;  2YEV A;  2HP8 A;  1ZTE A;  1S5J A;  4JV5 O;  4UVB A;  4DUY O;  2JEU A;  1VF7 A;  1K4C C;  4L8J A;  4O4L A;  2B5U A;  2JS5 A;  5IWA O;  1OCZ C;  1W59 A;  1M9N A;  3B40 A;  3AK3 A;  4RAI A;  1TA8 A;  5L3G A;  3BCC H;  4LC1 A;  3ZCC A;  5LMU O;  2YI9 A;  4NYK A;  1YI2 V;  2EJ7 A;  4O2B B;  1K5Q A;  1HR0 O;  3P3N A;  3GWO A;  4WBN B;  1VEW A;  4FK5 C;  2Q68 A;  5GTH Z;  3WB2 A;  4FLX A;  4WFE A;  3ZRW A;  3ZIA G;  1N36 O;  5JQG A;  1MSW D;  1VP7 A;  2Q4P A;  3OT7 A;  4DYL A;  4FM0 A;  3IFX A;  1JOY A;  2K1E A;  1O9G A;  1EN4 A;  1K92 A;  1K5S A;  2H8P C;  3OGC C;  3QNE A;  3LDE A;  2Q73 A;  1GM9 A;  4U3J A;  5H5N A;  5KX5 B;  3ABT A;  1OCR B;  3OEH G;  1Y4M A;  4D7S A;  3IC7 A;  2EIK B;  4X1Y A;  2UUC B;  1K7D A;  3CXH F;  3B8N A;  1SA0 A;  1Q86 W;  3AK1 A;  3STL C;  1KP2 A;  1SQX H;  4LFC B;  2XT9 A;  2UXC B;  3OM3 B;  4GX2 A;  1WJZ A;  4DR7 O;  1SQG A;  2V1D A;  5K1X A;  4IIJ B;  5KA6 A;  4YY3 O;  3E8B A;  1T5E A;  1AI4 A;  1KP3 A;  1I08 A;  5CBH A;  1MOF A;  1WB8 A;  5IY5 C;  2UXD O;  1EN6 A;  1YDX A;  2B1G A;  4HAM A;  3ABK B;  5KAI Z;  1RM1 B;  3NXS A;  2LW7 A;  3GWK C;  4LH6 A;  1TVK B;  2IH1 C;  3OMI B;  4JYB A;  4YJ2 B;  3SPJ A;  5C8Y B;  2ZM6 O;  1OCC C;  3N2G A;  1MZE A;  2IJJ A;  3H01 A;  5LP6 B;  3L72 H;  1N33 O;  2ZNI A;  4CS2 A;  3SPH A;  1VQP V;  4MTX A;  4K3A A;  1RPR A;  4I4T B;  3BA9 A;  4GX1 A;  2PUS A;  1JCH A;  3JCZ A;  3MHH C;  5JCO C;  4KUM A;  1FJG O;  2GHY A;  2PI4 A;  4WFB V;  4PA9 A;  1W0K G;  2F95 B;  1VQN V;  3CCM V;  4JI5 O;  4A5U B;  5FL7 G;  2X6A A;  2NLJ C;  5LMU B;  2R70 A;  1RSO B;  1YIT V;  5E1A C;  3WG7 C;  4YXW G;  1HR0 B;  3HKC A;  2BCC H;  4B08 A;  3BA8 A;  2XUM A;  3AG1 C;  3ZHT A;  5TIS Z;  1WP8 A;  4DRX A;  4TUY B;  2UXX A;  5H2F Z;  2K9P A;  3C3T A;  3LDD A;  3J7A U;  2EZP A;  3F5W C;  3B4S A;  1E1Q G;  4X65 B;  1YCI A;  3E83 A;  2VQF O;  1EN5 A;  2XHB A;  1SQV H;  2Y69 C;  1IDS A;  3NR7 A;  4MW3 A;  1HWY A;  1IXB A;  3H1I H;  5LYJ A;  2OCC C;  3P30 A;  4MVR A;  4I7Z B;  1G8M A;  3CC4 V;  1HNX O;  5LXT A;  4JI8 B;  3HKD A;  2F43 G;  3LSU A;  4BIZ A;  4OGQ B;  1ZUQ A;  1SER A;  1QBZ A;  4O4H B;  4JI4 O;  3AG3 C;  3K57 A;  3UT5 B;  4DR6 O;  2EZO A;  2MK3 A;  2RNB A;  2PYJ A;  3K08 A;  3L71 H;  3SJQ C;  2P90 A;  1N4C A;  3FB5 C;  4YY3 B;  1VQ4 V;  1R6N A;  4Z1M G;  3CCU V;  5FNV A;  4LFA B;  2ZIO A;  2A79 B;  1BE3 H;  3CYO A;  4DR5 O;  1TUE B;  2ZT9 B;  1PV0 A;  3I55 V;  5IJ9 A;  4FFK A;  3CE2 A;  2ARH A;  2ZM6 B;  3KG2 A;  1IZ3 A;  2DQ3 A;  2QWO B;  1Y74 B;  1XI1 A;  1N33 B;  1VQ5 V;  3F7Y C;  4J42 A;  1R6T A;  1F4M A;  3TK1 A;  4FFB B;  3G6E V;  2OTJ V;  2Y48 A;  5EZY A;  3JSL A;  2YDE A;  4R7C A;  4NTW A;  1AR4 A;  1FJG B;  4DXW A;  3O9O A;  1IVS A;  4JI5 B;  2YIC A;  2DYR B;  4JI2 O;  4YIP A;  4LF4 B;  4OPA A;  4XDK A;  3FD9 A;  5B5E Z;  4DR3 O;  1F23 A;  4LF6 O;  3D36 C;  4OPH A;  4JYC A;  5IYZ A;  2E3C A;  1WPB A;  1ROP A;  1SF9 A;  4QE7 A;  4U3F H;  3Q4H A;  1Y76 B;  1KMI Z;  3UO2 A;  3W7W A;  1AR1 B;  1PNM A;  3CCS V;  1GTO A;  1GRJ A;  5F2V O;  1YJ9 V;  3G4S V;  4J7Z A;  3KKY A;  3EFF K;  3PN1 A;  3JAW A;  1K34 A;  2RCV A;  3CRM A;  1Y67 A;  1OV9 A;  4UUJ C;  5LOV B;  1HNX B;  4HYO A;  2UU9 B;  3P3P A;  1XNR O;  4WFA V;  2Q7E A;  5JH7 B;  4P30 A;  4UV8 A;  4JI4 B;  5KHJ A;  3F7V C;  1Q3E A;  4EB6 B;  4I5S A;  1XHX A;  1JMK C;  4LNU B;  4DV7 O;  3VBB A;  3HPL C;  4HNA B;  4I9W A;  3CPW U;  3ASO C;  4RQE A;  5CN0 A;  2XAQ A;  1M90 W;  2DWE C;  4QPK A;  4MVO A;  2XOK G;  5IYC O;  4J11 A;  4QGP A;  2JEX A;  4NR1 A;  4ZKI A;  1KU9 A;  5FPO A;  3SGI A;  3JD3 A;  3RYC B;  2HHH B;  4K8Z A;  2ZDI C;  1NR1 A;  1NS1 A;  2Q5Z A;  2P22 C;  3OTF A;  3H1H H;  3S3X A;  2LQT A;  5DED A;  3TGU H;  1YEW A;  1IBK B;  2CH7 B;  3DC5 A;  3E35 A;  3JAS B;  4HBN A;  1SQP H;  1QR8 A;  3AG2 B;  3BVO A;  2IU0 A;  1Q6H A;  2L35 A;  1FFX A;  1JJ2 U;  3WB0 A;  4ZI7 B;  5KMG A;  1NR7 A;  4JI2 B;  3R66 A;  4B3R O;  2Z3Y A;  4UV9 A;  4W4L A;  4DV4 B;  1HNZ O;  4LF6 B;  1RM1 C;  4GX0 A;  4X1K A;  4EEQ A;  5HFM A;  1VQL V;  4FLY A;  3T1H O;  2IJH A;  5L3D A;  5LHG A;  1N8R W;  2DN9 A;  4J7J A;  4J7K A;  3CME V;  1K73 W;  1RPO A;  3RYF A;  3OTO B;  3HKE B;  1IBL O;  3RFR A;  4LF7 B;  4J41 A;  4I50 B;  1LUV A;  2ODM A;  2B1I A;  1FFT B;  1H38 A;  3VQX A;  1M1K W;  1XEQ A;  1BHA A;  4JYY A;  3ABM B;  3L74 H;  1S5L Z;  2E5L O;  3OE7 G;  3JCU Z;  4O2A B;  4X89 A;  1R3K C;  3FAV A;  4I55 B;  1GH6 A;  2KSD A;  4CC5 A;  1QLE B;  3FB7 C;  3AEI A;  4IHJ A;  3RW0 A;  3VQY A;  2B9Z A;  1NQT A;  3K3W A;  5EC2 C;  3SYA A;  3T4Z A;  2XAG A;  4MVS A;  3ZMS A;  4FZ1 A;  3IC9 A;  3TXQ A;  1DLB A;  2R9R B;  2QTS A;  1QVF U;  4J9Y B;  4JAS A;  3AG4 B;  1K4D C;  4DV7 B;  5DM6 V;  1M57 B;  2BOB C;  2PF4 E;  2R9A A;  3JAK A;  3SJA C;  3HKB A;  2YXL A;  1F7Y A;  4LP8 A;  1AJQ A;  2QM8 A;  3B09 A;  2XAH A;  2FKX A;  3LNM B;  4ZOL A;  2ZXW B;  3RVZ A;  1JFF A;  2VQE B;  4OX9 O;  4CH3 A;  4O4I A;  3P32 A;  1SET A;  2ATK C;  3E8F A;  1UJW B;  2IM9 A;  1AB3 A;  3RT3 C;  4PA4 A;  5CA1 B;  1I5X A;  1ZWI C;  1ZX3 A;  3RYI A;  5JJJ B;  1SZX A;  1I7F A;  3THO A;  5JVD B;  3ZRX A;  1BZK A;  4TWK A;  5ITZ A;  2VWK A;  1XIL A;  1PKX A;  2JRI A;  2AW9 A;  3W7U A;  4PA3 A;  3G6B A;  3KZI Z;  3I5D A;  3X2Q C;  2N74 A;  1V54 B;  1Y6X A;  3E89 A;  3BHP A;  3CWB H;  4JTA B;  3T4D A;  1HP8 A;  2NR5 A;  3RBZ A;  3T1H B;  1MNG A;  2FB5 A;  2ITC C;  1BL8 A;  3K0G A;  2BTQ A;  3CX5 F;  4MT8 A;  1BGY H;  3JAL A;  5B3S B;  1NI8 A;  1R3L C;  5J2T B;  2EIJ B;  2IJK A;  2LW1 A;  4NB5 A;  2GDS A;  3ZS8 C;  1N0J A;  4QJF B;  4X62 B;  1KBH A;  1E1R G;  3M99 B;  2JVD A;  2Q7H A;  3K5O A;  4G27 B;  4O4L B;  2UUB B;  3OR7 C;  5EBW C;  2ZE6 A;  1YTF D;  1YZB A;  1BHB A;  1OCO C;  3CCV V;  2BOC C;  1ZLZ A;  4LFB O;  3DSQ A;  2EIM C;  3K03 A;  4TV9 A;  1FS0 G;  1FKA O;  2YXH A;  4DO2 A;  1VMG A;  4Q6G A;  5B1B C;  4LWS A;  1U96 A;  3A0H Z;  5KLV H;  1HW7 A;  3E86 A;  4JI6 O;  2LP7 A;  4K0K B;  2AZ2 A;  2ITD C;  4NTX A;  3TET A;  3QG5 A;  2VS0 A;  1L1F A;  3SPI A;  1VF5 B;  4JI3 O;  1FYJ A;  3SR2 C;  1J5E B;  4DUZ B;  2X6C A;  1WB7 A;  2WA3 A;  3D36 A;  1YJW V;  4QE9 A;  4U3J B;  4OX9 B;  1S3J A;  2LGW A;  4UCO A;  1B3Q A;  3ZRS A;  2EIN B;  1H2M A;  1MAB G;  5KHH A;  2H3O A;  1XBL A;  1BCC H;  1R3J C;  3W7S A;  1DK1 A;  1BS3 A;  3B77 A;  1HNW O;  2DWD C;  4X88 A;  1ORQ C;  3U11 A;  4JI7 B;  4O2B A;  5EK0 A;  2P7T C;  1H2N A;  4FLT A;  4UFZ A;  2Q6A A;  4QNH B;  1S76 D;  1AP6 A;  4B3S B;  4JZG A;  4F6E A;  2V4D A;  2P5O A;  4GLX A;  2Q0O C;  4GYC B;  1EFR G;  1R6K A;  5CBG A;  2LJ2 A;  3CJH A;  2WLH A;  1M56 C;  1IBM O;  3ABL B;  1Y66 A;  4GT1 A;  1GN4 A;  3LUT B;  4DR4 O;  2ZIM A;  2F4V B;  5KX5 A;  3T2M A;  5BY1 A;  4JI1 O;  4LCU C;  1H2K A;  5EIB D;  2KB1 A;  3QO5 A;  3CRR A;  5BMV A;  1ZAU A;  2ZDI A;  4DR2 B;  2NN4 A;  4GKK B;  2ILM A;  3A0B Z;  4LFB B;  5EYP B;  4QPJ A;  1QHT A;  2EUL A;  2PZS A;  4JV5 B;  2YIA A;  4DUY B;  3ZMT A;  4ZIB A;  4LBE C;  4JYA O;  2CGN A;  4K35 A;  4IIJ A;  2PI5 A;  3E22 B;  5IWA B;  4UVA A;  2DJV A;  5KA5 A;  2DYS B;  1I0H A;  4DV2 O;  3CRC A;  1FXK C;  1EZJ A;  2IW5 A;  3SYQ A;  1NJI W;  1V55 B;  2Q8V A;  1DGS A;  1PP9 H;  4DV1 O;  2DQ0 A;  1XMO O;  4JI3 B;  5A9G A;  2HFE C;  1RP3 B;  3CCE V;  1YTF B;  3BPZ A;  5C8Y A;  4BWA A;  2IJI A;  2QKC A;  2GUZ A;  1GM8 A;  2RDC A;  5LMN O;  1N36 B;  2QR4 A;  3JD4 A;  4I4T A;  3BFR A;  5LXT B;  3SYC A;  5JJE B;  4O4J B;  1VQK V;  2AZ0 A;  1AI6 A;  5J2U B;  5KHG A;  1TUB B;  3UM7 A;  4PDV A;  5CA0 A;  4R8C A;  3AG7 A;  4HZ3 A;  3FYI B;  3DXR B;  4UXN A;  2EX3 A;  1HNW B;  1PNL A;  2WLL B;  4JF3 A;  5CBF A;  1K8A W;  1RSO A;  3RN4 A;  5GTI Z;  2CTR A;  1H2G A;  2QJ1 A;  4TSF G;  5GW7 A;  1ZL8 B;  5B1A B;  4WFH A;  2WAM A;  4BW9 A;  1WNS A;  1AR5 A;  1LNQ A;  4TUY A;  1XNQ O;  2CTP A;  3ETD A;  4DR7 B;  2QA4 V;  1K33 A;  2JDI G;  1IXM A;  1AVM A;  1CP9 A;  3CCR V;  4ZHQ B;  4KL1 A;  1IBM B;  4J80 A;  3CHX A;  4LF5 O;  3JYC A;  4Q20 A;  3K9A A;  2UXD B;  2EIL C;  4LF9 O;  1EZV H;  1H2S B;  5LHH A;  5KHI A;  2Q69 A;  2ZKO A;  4O4H A;  4GZR B;  1VQO V;  3ICX A;  3BEH A;  3UT5 A;  4NXM O;  4JGS A;  1JX9 A;  1NBM G;  4PI2 A;  1KKD A;  1MA1 A;  2KQX A;  3K04 A;  4MTG A;  2OYQ A;  4DV3 O;  1K97 A;  3PJS K;  3ZMV A;  3IJ4 A;  4DV2 B;  1MSD A;  3ASN C;  2Y4U A;  2P06 A;  1AJP A;  4FM1 A;  4AQY O;  4DV1 B;  2ZR2 A;  5LBQ A;  2W6I G;  4H37 A;  1VQ8 V;  2PTM A;  4XDL A;  5IE9 A;  4IYI A;  1SQF A;  1LUW A;  5KUK A;  1Y74 A;  4ASU G;  4JPR A;  1WP7 A;  2NNU A;  1RFY A;  1EBO A;  3ZHV A;  3EXA A;  4PHZ A;  4TV8 B;  1R73 A;  3OW2 U;  3TCU A;  4L87 A;  4FFB A;  1PD3 A;  2UXN A;  2W0F C;  1R3I C;  2A0L A;  2VQF B;  5B1O A;  2Z0A A;  1URF A;  2DMX A;  5E79 Z;  3ZMZ A;  3JAM N;  2L6L A;  3DC6 A;  4RQF A;  4DV0 O;  1OCZ B;  5J9P C;  3JSN A;  2PGG A;  2RJZ A;  3BAA A;  2Q7G A;  4R50 A;  1L8D A;  4G28 B;  2M6Y A;  1AI7 A;  3WFV A;  4GCZ A;  5GON A;  4DR6 B;  4BR6 A;  2A9H A;  4NKG B;  3SYP A;  3N2K B;  1N32 O;  1P7G A;  5JWP A;  1B06 A;  2X0L A;  4H0L B;  1XNQ B;  4F4L A;  4DR1 O;  3JD1 A;  1KQS U;  4WFF A;  3L75 H;  4LH7 A;  4TT3 G;  1QNM A;  5FLX N;  2YUA A;  2BE3 A;  1S77 D;  4X20 B;  1DTO A;  4B3T O;  4LF8 O;  3KCX A;  4DK0 A;  4LF5 B;  4E4E A;  2IBZ H;  1OCR C;  1X4T A;  1OJH A;  5IYB O;  4DR5 B;  4RUE A;  5IYD O;  2XAS A;  5LOV A;  2HLD G;  4E2L A;  2E74 B;  2EIK C;  5JH7 A;  4UB6 Z;  3F5T A;  4UVC A;  4B3M O;  2JGD B;  2XND G;  3QO8 A;  2QKS A;  3DGE A;  4EB6 A;  1SS3 A;  2G38 A;  4JAV A;  2W6J G;  3LDC A;  3JAT B;  2UUA O;  2WLI B;  4GKJ O;  4HNA A;  1QR9 A;  3UQ8 A;  2V7Q G;  5BR8 O;  1P49 A;  4DV3 B;  1GMG A;  4IGG A;  4YJ3 B;  4FLZ A;  2E75 B;  1M93 A;  2N04 A;  2EJR A;  2P6J A;  1S0V A;  3ZN1 A;  1VQ6 V;  3UCS C;  4PA6 A;  4DW0 A;  3JAR B;  1D5N A;  4AQY B;  4DR3 B;  3ABK C;  4CS4 A;  4UCT A;  5IY5 B;  1KUQ A;  5LP6 C;  4NXN O;  4WF9 V;  4GX5 A;  4CZZ A;  1Q8I A;  1OCC B;  3I56 V;  2UXB O;  4TOI A;  2CH7 A;  3JAS A;  2YC0 A;  4PA7 A;  2QWQ B;  5H9C A;  1E79 G;  3ZHQ A;  4BIO A;  4F6R B;  2GBO A;  3OR6 C;  1VIB A;  4YHH O;  3JAK B;  4DV0 B;  2M7W A;  1GKF A;  3L73 H;  1XNR B;  1GAX A;  1I5Y A;  3CD6 V;  4MS2 A;  1XL4 A;  1M5I A;  1SZT A;  1NTK H;  3WG7 B;  5DN6 G;  2P4V A;  1N32 B;  3HKE A;  3ZHR A;  1XMQ O;  4AI8 A;  3C3S A;  5D5Q A;  5B1N A;  1BSM A;  1XOU A;  3AG1 B;  3OUS A;  3E8H A;  1QU7 A;  1FXK A;  4FM2 A;  1BQZ A;  1QVG U;  4P9O A;  2DW4 A;  5LHI A;  4I0X A;  4PDL A;  3K58 A;  3APO A;  4I55 A;  5L3B A;  2X6B A;  3OFN G;  4MVU A;  3C90 A;  3E2E A;  5IJ0 B;  2AHZ A;  2JJ2 G;  2Y69 B;  3D3I A;  4JTD B;  1O9H A;  1GM7 A;  1PM9 A;  4ABM A;  3G71 V;  1R1B A;  3RYH B;  2OCC B;  4U7N A;  3UO3 A;  1Q6I A;  1M4U A;  1N34 O;  4B3M B;  3BY6 A;  4J10 A;  1Q81 W;  1SRY A;  2ZQM A;  3AG3 B;  2UUA B;  1B6Q A;  2JJ1 G;  1AP5 A;  4Z2W A;  4GKJ B;  3MHS C;  1BT8 A;  2KG7 B;  1A32 A;  4CC6 A;  5HFL A;  1CXZ B;  5BR8 B;  2RN9 A;  3ZMU A;  1WA8 B;  2BTQ B;  2BSK B;  4CS3 A;  2ZNJ A;  2CE4 A;  5BXZ A;  3JAL B;  4ICG A;  4B3R B;  3CSX A;  1HNZ B;  2ADP A;  4X1I B;  3HB3 B;  1IX9 A;  1CPY A;  1NT2 B;  5A2Q N;  4NXN B;  5CA1 A;  3TJT A; 
#chains in the Genus database with same CATH homology
 4X65 O;  4DR4 O;  4X64 O;  5LMU O;  4LFB O;  5BY1 A;  4JI1 O;  4DV4 O;  1F7Y A;  1FJG O;  1HR0 O;  4YHH O;  2UUC O;  5IT9 N;  1FKA O;  1R6T A;  4JI5 O;  4A5U B;  1N32 O;  3T1Y O;  1X59 A;  3O65 A;  1NS1 A;  4LFC O;  1N36 O;  4JI8 O;  1I94 O;  4LF5 O;  4DR1 O;  2FKX A;  3OTO O;  4LF7 O;  4JI6 O;  4LF9 O;  4OX9 O;  5FLX N;  1AB3 A;  4JI2 O;  4JI7 O;  4B3T O;  3RT3 C;  2ZKO A;  1XMQ O;  5LL6 Y;  4LF8 O;  4JYA O;  2UU9 O;  4OPA A;  4JI3 O;  1FYJ A;  2DJV A;  5H5N A;  4DR3 O;  4NXM O;  4LF6 O;  4DV2 O;  4OPH A;  3J7A U;  4B3S O;  4JI0 O;  2UXC O;  4X66 O;  2VQF O;  4LFA O;  3F5T A;  4DV1 O;  4B3R O;  3R66 A;  1XMO O;  2AGA A;  4DV3 O;  4DV6 O;  4B3M O;  4X62 O;  1HNZ O;  2DOS A;  2JRI A;  1G1X B;  2UUB O;  2UUA O;  3T1H O;  4GKJ O;  5LMN O;  1HNX O;  1R1B A;  1DK1 A;  4AQY O;  2F4V O;  2N74 A;  4DR7 O;  5BR8 O;  1IBL O;  1N34 O;  4DV5 O;  4JI4 O;  4YY3 O;  1HNW O;  4DR6 O;  1XEQ A;  4DR2 O;  2E5L O;  2HHH O;  4KHP O;  1AIL A;  1XNR O;  3J81 N;  1A32 A;  4GKK O;  2UXD O;  4JV5 O;  4DUY O;  1KUQ A;  2VQE O;  3J80 N;  2LW7 A;  4K0K O;  5BXZ A;  4NXN O;  1IBK O;  2ZM6 O;  4DV7 O;  2Z0A A;  1N33 O;  5IWA O;  4LF4 O;  3SDL A;  1D2D A;  1J5E O;  4DUZ O;  3JAM N;  4DR5 O;  2UXB O;  4DV0 O;  3M8A A;  1YZB A;  1IBM O;  5A2Q N;  1XNQ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...