2ZKOA

Structural basis for dsrna recognition by ns1 protein of human influenza virus a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
70
structure length
70
Chain Sequence
MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(P*AP*GP*AP*CP*AP*GP*CP*AP*UP*UP*AP*UP*GP*CP*UP*GP*
publication title Structural basis for dsRNA recognition by NS1 protein of influenza A virus
pubmed doi rcsb
source organism Influenza a virus
total genus 30
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2zkoA00
4DUYO 2UXBO 2F4VO 4GKJO 3M8AA 2LW7A 1XNQO 5LMNO 3J7AU 1YZBA 1A32A 1XMQO 4B3RO 2N74A 5IWAO 1AB3A 1J5EO 4JI3O 1HNWO 2UUBO 2UXDO 5A2QN 4DV2O 2VQEO 2DJVA 1KUQA 4LF9O 2ZM6O 3T1YO 4OPHA 2AGAA 4DV4O 5BR8O 4DV3O 2JRIA 4X65O 2ZKOA 4DR6O 4B3SO 1IBMO 5LL6Y 3SDLA 3F5TA 4DV5O 2E5LO 4DR4O 2UUAO 1DK1A 4B3TO 4GKKO 1IBKO 4AQYO 4DV6O 1XMOO 5IT9N 4DR7O 4JYAO 4LFBO 4DR3O 1D2DA 3JAMN 4X66O 4OX9O 1HNZO 4JI8O 2Z0AA 4LF6O 4JI0O 1R1BA 1NS1A 1F7YA 4B3MO 1G1XB 2VQFO 4NXNO 1N34O 2UU9O 4JI6O 1IBLO 3T1HO 4LFAO 4JI1O 4X64O 1R6TA 4LFCO 4NXMO 1FKAO 4YY3O 4DUZO 1XEQA 4YHHO 1XNRO 2UXCO 3R66A 5LMUO 1AILA 4DV0O 1HNXO 1I94O 5BXZA 4JI4O 1FJGO 4X62O 3J80N 2DOSA 1N36O 1N33O 4LF8O 3OTOO 2FKXA 1FYJA 2HHHO 4LF7O 4DR5O 1HR0O 4JV5O 4DR2O 4OPAA 4DV7O 4LF5O 5BY1A 5H5NA 1N32O 3RT3C 4JI5O 4K0KO 3J81N 4DR1O 4JI7O 5FLXN 1X59A 4DV1O 4JI2O 4LF4O 4A5UB 3O65A 2UUCO 4KHPO
chains in the Genus database with same CATH superfamily
4F4LA 2UUAB 1VF7A 3CX5F 1G8MA 4J10A 4IYIA 1XMQO 3JCZA 1JQ0A 4RO2A 4CC5A 4UXNA 1OCOC 2E75B 2ILMA 1PL0A 5CBHA 5CA0A 3P32A 5B1BC 2R9IA 3WG7B 3BABA 5LHHA 3ETEA 1DF4A 5CBFA 3CPWU 3K08A 3ABKC 5CN0A 3T4ZA 4L87A 5BR8O 3L73H 3QO7A 3LUTB 4WFGA 2F66C 2OCCB 2Q68A 4X66B 1XDCA 3G4SV 1HWYA 3EFFK 1OCZC 1H8HG 2AW9A 1S77D 4F6EA 4YJ3A 1VMGA 4LF6O 2JK5C 3ZMTA 4PD4F 1HR0B 3HKEA 1N8RW 2AHYA 1E1QG 2Y0PA 4LBEC 3Q4HB 4I50A 4O4HA 4J42A 3T1CA 5IJ9A 4X64O 3LNMB 4ABMA 1AROP 1YCIA 4I9WA 4UVAA 3R66A 5LOVA 1AILA 1MG1A 2JEXA 2N05A 4GT1A 3OMNB 1FFXB 3LSQA 4JI4O 2QWQB 4N21A 4TOIA 2P5OA 4Z1MG 4JF3A 4LF7B 1QBZA 1KC8W 1VP7A 4YJ2A 4O4IA 4NVPA 1R3JC 4DW0A 3ZBHA 2OCHA 2JJ1G 3RFRA 2XHBA 3H1JH 4Q6GA 1ZX3A 1HW7A 3ZRVA 2EJ7A 1WP8A 4RUFA 4JI2O 5IYZA 4LF4O 4B3SB 4LCUC 1OCOB 3IJ4A 3O65A 4X20B 3BRCA 3H9VA 2OYQA 1AP6A 1P49A 2BE3A 5B1BB 4MVZA 3MDSA 5KX5A 3ABKB 2QKCA 4LFBB 4C7UA 4RWUA 1LUVA 3SYCA 3D36C 4JZ2A 1MA1A 3K57A 2IJHA 1M90W 1QU7A 5IE9A 1H2SB 2BSKA 1OCZB 1N34B 4JI6B 1SQQH 1PP9H 1JMKC 4NXMB 3F7VC 5LL6Y 3AK2A 2HP8A 5JVDB 4DR7B 4ZHQA 2AHZA 2A7WA 1VIBA 1Z5WA 1VQNV 1RSOB 3JSLA 3ZJZA 2GUZA 2E74B 2AXTZ 3L74H 1T5EA 3B09A 1ZL8B 5FNVA 1CP9A 2L6LA 2EINC 4LH7A 2WLIA 3E22B 2LQTA 2Q9LA 4GYCB 2OWOA 4D7SA 1R1BA 1SZTA 1SF9A 3T1HB 5LBQA 1YXBA 4BR6A 5JQGB 4JI7B 1U96A 4FLYA 1FKAO 4TV9A 3AEIA 3HKCB 1AR5A 4I55B 1I94O 4U3JB 4X62O 4UCOA 4EKWA 3TJTA 5EYPA 4FM2A 1K8AW 1AR4A 1NR7A 5EC1C 4WCEV 1WA8A 3K0GA 1YI2V 4YXWG 2E76B 4N23A 3JARB 1Q86W 1IX9A 3LDEA 4K35A 1M93A 2F43G 1M9NA 2YIBD 1XILA 4DV1O 1F4NA 1QQCA 3AG1B 1M57C 5JH7B 2QWNB 4B3RB 3M8AA 4WFBV 2ZCEA 2XASA 3APQA 1A32A 5J2UB 4GX2A 4UFZA 4JI3O 1S5JA 3DGEA 4JI8B 4PA9A 2JS3A 1R6KA 2PTMA 4FZ0A 5JCOC 1GH6A 2YIDA 4JAVA 1Q3EA 1O9GA 2EILC 3K5MA 1Q81W 2QM8A 4XDKA 1KU9A 4JYCA 2EINB 3OUFA 2UUAO 4B3TO 1CPYA 1VQMV 1IBKO 1QVGU 2YXHA 4DR3B 2JS5A 1NTKH 4B3MB 1S76D 1M5IA 2A79B 3LSSA 5F2VO 2MW2B 2RMKB 1FS0G 2WLMA 2YC0A 3Q4HA 2Q5ZA 2CTWA 5KA5A 2BOCC 4IL6Z 3CB2A 1XEQA 1L8DA 1XNRO 4X1YB 3EHBB 4DW1A 2UUCB 2F23A 2YUAA 3GB7C 1FFXA 2RCVA 2NN4A 2IH1C 5LGUA 3ZRSA 4JV5B 4P2ZA 3BA8A 2N04A 1J5EB 3CCEV 1M57B 2GTSA 3IAYA 4X1KB 4K0KB 4LNUB 1HR0O 1Q43A 4LR3A 5LP6C 2ADQB 3SPCA 3W7WA 1WLEA 3JD4A 4JPRA 1VARA 2W0FC 4QPJA 2PYLA 4DUYO 4UV8A 1R6NA 1K4DC 4TV8B 1X4TA 4JYAB 2R9AA 5KHKA 1P7GA 3QF7A 2EILB 3OMAB 1KB9F 3BFRA 5KAIZ 3K5OA 4DV2O 3MD0A 5BR8B 3CCJV 2ZE7A 2EJRA 4KUMA 4XDLA 1JX9A 5E1AC 4OPHA 4UCRA 5CB4B 4CH3A 4CC6A 4B3SO 4MVUA 1EZVH 4UCUA 2Q7EA 5JVDA 4W4KA 4DV0B 3CSXA 1FJGB 1Q90D 2HLDG 2ZE6A 3L72H 3ABTA 3QNEA 1BMFG 4LFBO 4LF6B 4K8ZA 3OUSA 5GTIZ 1ZLZA 2P4KA 3FFQA 4FJCC 3E22A 4YIPA 1BSMA 3GWOA 1N34O 4GLXA 1K73W 1KYOF 4JI6O 3FYIB 5JQGA 3H1LH 5KHIA 1NH2D 1GMGA 2ZXWC 2XOKG 4NXMO 1ZWIC 2HJFC 3T2MA 1RM1C 1AJPA 1NR1A 4JI4B 3HKCA 1S3JA 2IU3A 3WB1A 4U3FH 4P30A 1WP7A 4O2BB 1NU1H 3RWRD 5TISZ 3ZHRA 2LW1A 3JARA 3RGBA 3A0RA 3T1YB 2D3OW 1JFFB 3ABUA 1QNMA 1XL6A 3AK3A 4JI7O 4X65B 2QWOB 1AVMA 1KP2A 3D36A 5JH7A 4QJFB 4XBFA 3T4DA 1XMOB 1XBLA 2DW4A 4PHZA 5J2UA 1JPXA 2F93B 5LYJB 4PJ0Z 4LH6A 2QJ1A 5KA6A 1N0NA 2PGGA 3DTUB 2X7RB 1SA0A 1H38A 3N2GA 2QWPB 3ZX6A 4NXNB 2BTOA 3E83A 1FFTB 4PA7A 1KECA 1UJWB 1IVSA 1P4RA 1P84F 3HKDB 3IC9A 2V1DA 1L0LH 5EIBD 4HAMA 3OEHG 2BCCH 3P30A 3SJBC 3H01A 2ZR3A 1RM1B 4JI8O 4MTGA 2Q0OC 2M7WA 2VWJA 2VQFO 2XNDG 1QCEA 4I4TB 4B08A 5KHJA 2O57A 3CRQA 4Z2WA 4DR1B 4FFKA 3OAAG 3AG3C 4B7KA 4FFBA 3KZIZ 1TUBB 3FB6C 4DUZO 4X1YA 4YHHO 1VF5B 2ZT9B 1F23A 5EIBC 4U7OA 1Q6HA 2NLJC 2UXBB 3K04A 1TUEB 3ZMUA 3UO2A 4I9QA 2WWWA 3TK1A 2DN9A 4IYHA 4HNAB 1R73A 1NH2B 3ASOC 2KKWA 1VF6A 4QGPA 4X1KA 3E2EA 4IHJB 1NZ6A 3L70H 4FM1A 3ZHTA 5EBLC 1VQ6V 2LGQA 3W7SA 4DR6B 4FZ1A 4J80A 2H8PC 2UUCO 3ABMC 4TQDA 1GRJA 2V7QG 2GHYA 1NI8A 5IDJA 2YIBA 1SESA 5IJ0B 4H33A 3X2QC 3CHXA 4GX0A 4MW8A 3D3IA 3MHHC 2ZDIC 1J5EO 4L8JA 1EM1A 5J2TB 3WB0A 2PI4A 3ASNC 1JJOA 5HFLA 4UVBA 4W4LA 4QNHB 2CH7B 2CTPA 1ZAUA 3OMIB 5CB4A 2HVKC 1D5AA 4CS2A 4X89A 4B3TB 3G80A 4UCTA 1IBKB 2EIJC 3EXAA 3ZN1A 2JJ2G 5CBGA 1W59A 4JYAO 3AG3B 3HR0A 3JAMN 4CS4A 2Y4UA 1DF5A 5LHIA 3UT5B 4JYBA 2XT9A 2FTKA 4DR2B 1G1XB 2YXLA 2YSUB 3M99B 5LA6B 1V55C 3ZN0A 4KP4A 3H1IH 1KP3A 2X0LA 3TCUA 1XNRB 2YIAA 2A9HA 3JALB 4QE7A 1B6QA 1F51A 1QLEC 3ASOB 5DEDA 1OJHA 4PA6A 4DRXB 3SJAC 4PV1B 5KUMA 3CRMA 4DV0O 2HJDA 4FVMA 4R7CA 3BCCH 5C8YB 1FJGO 3RYHB 3I56V 1D5NA 1JOYA 1KKCA 2M6YA 1H2NA 4O2BA 5LXTA 3HPLC 5KMGA 4R50A 4B7EA 1BCCH 3ABMB 4J7JA 3VQWA 1BHAA 2DQ0A 2R70A 3SR2C 1K33A 5E79Z 1JFFA 2IW5A 4GX1A 2WPDG 3X2QB 4DUYB 1K5SA 1EBOA 3JD2A 2P6JA 1NJIW 3ASNB 3CCSV 4CH4A 3CEIA 2F4VO 2ZQMA 3K9AA 1CEZA 4DV6B 4RQEA 3HB3B 5LYJA 3ZHVA 1R3KC 3B2EE 3CYOA 2P7TC 4DV2B 2QDOA 1MMMA 2HVJC 3B8NA 3JSNA 1DLBA 1M56C 5ITZB 3T1YO 3RYCB 2QWRB 4X65O 4PELA 3HKDA 2UXCB 1XI1A 4DR4O 1ZSPA 4WFFA 1XMOO 2G38A 4J41A 3BVOA 3K79A 3OT7A 1V55B 4Z1VA 2QM7A 1SS3A 1GN6A 3CXHF 1SERA 1QLEB 2DWEC 2EBOA 2CGOA 3E8BA 4MSWC 1GN4A 2CDYA 2B1IA 1XREA 4ZI7B 1F7YA 4I4TA 2QR4A 3LSUA 4I7ZB 4D6TH 4NXNO 1YJ9V 4LWSB 2QKSA 1TUBA 1ORQC 1I5YA 4OXSA 3C3TA 3KG2A 5EZYB 4OGQB 5B1NA 3STLC 3RW0A 2IJKA 2DYSC 5LMNB 4HNAA 2F1MA 5L3EA 1YIJV 5IWAB 4IHJA 3W7UA 1SQXH 2QE7G 3G67A 1N32O 5B1AC 4DO2A 4X1IB 4DR1O 3UKMA 1KD1W 2RQ6A 3JAKB 4FPPA 4EB6B 2UXBO 3E89A 1FD9A 2FYUH 3TETA 4PI0A 1SQPH 1YZBA 3IC7A 5IJ0A 1H2GA 3K06A 3JAWA 4BW5A 1ZUQA 1PNLA 1OCRC 3N2KB 1EN5A 2Y0IA 4RUEA 2FL4A 2W6JG 2CAZC 4JGSA 2CH7A 1KUQA 2UXXA 3E8HA 3S3XA 4GCZA 1MSDA 4DR6O 2IU0A 1H2MA 1SZXA 4Q20A 2GSMB 1DK1A 4KL1A 2X6BA 4YIOA 2ZNIA 3RYIB 2K1EA 1M4UA 1N36B 2KQXA 2OIGA 2WSSG 1MSWD 1OCCC 3ZRXA 3UT5A 2VQFB 2DYRC 3C90A 2DYSB 2QGNA 3SYOA 4DUZB 4YHHB 2Q6AA 1KMIZ 4DRXA 3WU2Z 1B04A 5K1XA 5C8YA 3RYHA 4I5SA 3OGIB 2V4DA 4JTDB 5DECA 2YEVB 4JTAB 4MTOA 3GWKC 3VQYA 2Q67A 4J7KA 1OZ0A 1TAEA 3ML0A 3JYCA 2UXDB 4DR2O 1YEWA 2B5UA 4DV7O 2BOBC 1NVPD 2ATKC 1Y76B 3NR7A 5EK0A 5J9PC 3J81N 4MVRA 4X88A 1PPJH 4G28B 2CE4A 2CGNA 4TT3G 3SJQC 4K8XA 3K5LA 1OCRB 4F6RB 1CXZB 3B77A 4X8AA 3THOA 3CCRV 3UCSC 4WFEA 5B66Z 4DV5B 1BQ0A 2XUMA 1FXHA 3FB7C 1QHTA 1G4YB 1DGSA 2N74A 4O2AB 1E1RG 4NKGB 4WBNB 4JAUA 5KUKA 2UUBO 2L35A 1ROPA 2P4VA 1WPBA 2RDCA 5ITZA 4U7NA 4JI0B 2R72A 4X20A 3RYCA 4DV3O 2P90A 4LFAB 5JJEB 1OCCB 4LFCB 2ZR2A 3R65A 3SDLA 1XQ8A 2IBZH 5LMUB 3OFNG 1UPGA 3CMEV 1HNXB 5AG2A 2DYRB 4DV6O 4MTXA 2VWKA 1SRYA 1YJNV 1Y74B 3JASB 1HNZO 2EULA 3ZHUA 3CRRA 4DR5B 2ITDC 3F5WC 2ZNJA 4MS2A 1YDXA 1B3QA 3SYPA 1VQKV 4BIUA 2ITCC 2CTQA 4JYYA 5DM6V 4LWSA 4MT8A 3AK1A 1GTOA 2UXCO 4AILC 2Z5UA 5EZYA 4DK1A 2WA4A 1RSOA 1SQFA 1ZL8A 2PZSA 3FKSG 1XNQB 5IYCO 2RN9A 3AG7A 1AI6A 3OTOO 1K7DA 5JWPA 2ZD9A 1H2KA 4MVSA 3ZHQA 4UV9A 4BW9A 1N4CA 3U0ZA 3B8MA 3C3SA 1MZEA 4QIWF 5BY1A 3CJHB 2DMXA 4X1IA 2IJIA 3CE2A 4I55A 3SPJA 2F4VB 4U3JA 5LP6B 3VQVA 4EB6A 2KB1A 2MK3A 1NVPB 4BAYA 3M7MX 3CCLV 1JCHA 4AQYB 5L3BA 2LW7A 5LMNO 3J7AU 1GN2A 1YF2A 3RVZA 3OW2U 5EC2C 5IWAO 3E8GA 3N2KA 1BE3H 2DQ3A 2DWDC 5LHGA 3HKBB 2Q69A 1PL4A 3IGAC 3CWBH 4LC1A 4YJ3B 3SPGA 1AI5A 4DR4B 1FXVA 4JI1B 1JA8A 1US6A 4YY3B 2QKAA 3F5TA 2E5LO 2HG5C 4BIZA 4O4HB 2ODMA 3U11A 5IT9N 3OR7C 1I0HA 5CA1B 5LOVB 1Q82W 4WFHA 2WLJA 2EX3A 1J95A 1S5LZ 3JD3A 2A0LA 4J11A 1VEWA 2IM9A 3MAQA 4R6ZA 3H1KH 1I7FA 4O4IB 4FLTA 3KCYA 3D3QA 4D7TA 3GVMA 1VQ8V 4O4LB 3ETQA 4UUJC 4UVCA 1HP8A 1S5HC 1HDJA 3CCQV 5IYZB 2QM4A 3BHPA 1OHHG 2ZXWB 3AG4C 4JAAA 2JVDA 1N36O 2YEVA 1GO3F 1R3IC 5FPRA 4TWKA 1N32B 4UCSA 1F4MA 3CC2V 1O9HA 4RQFA 2C2AA 3OD4A 3UO3A 1K9MW 1Y76A 5H5NA 1Z5VA 3RT3C 4BIOA 4TUYB 3BPZA 2WLNA 3SPHA 2Y69C 4F6RA 1GK9A 1KBHA 4JTCB 1ENVA 1PKXA 3BAAA 4O2AA 4LNUA 1GKFA 3TGUH 4I0XB 3FYEB 4MVQA 4WBNA 5L3CA 1K3EA 5GTHZ 2UXDO 1VQ4V 1BGYH 4UB6Z 4EFEA 2ZM6O 4LP8A 2OCCC 3G71V 2QSAA 1VQ9V 1FAFA 2WLIB 2QA4V 3DSQA 4JASA 4TV8A 5JCOA 5L3DA 3OR6C 1Y66A 2KSDA 4DV5O 1DTOA 2A06H 2AZ2A 2JEUA 1SKVA 3VBBA 3FAVB 2Q7HA 5CA3A 3CP1A 3D8CA 2LFRA 1Y74A 3JASA 5GONB 3EVKA 5DN6G 3W7XA 5BMVB 3SYAA 4JI0O 4LF5B 2WLLB 1WA8B 3SYQA 2PI5A 2P67A 2QTOA 4LFAO 3P3NA 4LFCO 3K3WA 3WB2A 4UCVA 5H2FZ 5LMUO 3L9DA 1HNXO 2GTAA 5EBWC 3ABLC 5BXZA 2X6CA 4H0LB 1WB8A 1BQZA 3CCMV 2ZINA 4O4JB 2Y69B 2JGUA 4ZIBA 5A9GA 4DV7B 1W0JG 1IZ3A 5KLVH 5L3GA 1JR9A 1HNWB 4DR5O 3PJSK 3CJHA 3L71H 2VQEB 1LNQA 1BHBA 2HKOA 3E86A 3K5NA 1OV9A 4TSFG 1TVKB 4A5UB 5LP6A 1VQLV 2OT5A 1U97A 2PUSA 1XNQO 1S0VA 1EN6A 2ZE8A 2ETNA 2X6AA 2UUBB 1AB3A 1SC5B 4OX9B 2H94A 3HKBA 5FPOA 1AR1B 4DV3B 4H37A 3JD1A 2AGAA 3QO8A 3UQ8A 2ZIOA 1PNKA 4EFBA 2XAFA 4IT5A 5IYDO 1QLNA 2ZKOA 3STZC 5B3SC 3QTCA 2EZPA 1JVMA 3MHSC 3O9OA 5BZBA 4AQYO 5IYBO 4NR1A 2EIJB 5CA1A 1HNZB 2NR5A 4IIJB 3CD6V 1IDSA 3BEHA 3KKYA 3G6BA 3LNNA 5H9CA 3CRCA 2HHHB 3UM7A 2VRZA 4IGGA 1R3LC 3FB8C 2ARHA 4E2LA 3ABLB 1UFIA 1GN3A 5JJNB 1NT2B 3RN4A 2Z3YA 5D5QA 1YVWA 4O4LA 4JI1O 1Y6XA 1RFYA 4PDLA 3TXQA 4YY3O 2YI8A 4HBNA 1URFA 4JI5B 4CBCA 1GAXA 1TGOA 3K0DA 3DC6A 3OTOB 4GKJB 1XL4A 2HEPA 2OIEA 1N33O 1S72V 4ZOLB 5IY5C 2FKXA 1XHXA 3APOA 2LJ2A 1PD3A 2ADPA 4G27B 4BWAA 4GZRB 2D2CB 1IXBA 3RYFB 3SJCC 3AG1C 4LF9B 4TUYA 2DE0X 1L1FA 3ETDA 2GV9A 4KHPO 1SQGA 1H8EG 1SQBH 4GKKB 4PDVA 1EZJA 3ZRWB 1WAZA 2PY5A 4I0XA 3ZMZA 5B3SB 2CUGA 1Z2GA 5A2QN 3QO5A 3K03A 2ZIMA 2DJVA 4EEQA 4DV4O 4TQFA 4RAIA 1M56B 2BTQB 1NQTA 2E5LB 1E79G 1MABG 1KQSU 1N0JA 3A0HZ 1WNSA 3FAVA 1FXKC 1BS3A 4NTWA 3BA9A 5J2TA 4ZBMA 5GONA 4LF8B 1M1KW 1D2DA 3H1HH 1Y4MA 4WFAV 5BMVA 3OEEG 3PN1A 1WJZA 4AHCA 2CTRA 1JJ2U 2WLLA 4QE9A 2UU9O 1IBLO 1GM7A 5IY5B 4KXRA 5CMUA 5EBMC 3RBZA 1YJWV 2UXNA 4WF9V 1GM9A 1ZTEA 1I5XA 1IURA 1VF6C 5FL7G 5KAFZ 4O4JA 4NYKA 4DYLA 3CS5A 1VQOV 1FYJA 3AG2C 3K9SA 4FMTA 5LA6A 1WPXA 2RJZA 4PDRA 3FD9A 3JALA 4LF5O 2QEXV 4UB8Z 1QVFU 1SA0B 4MVOA 3FX7A 5FLXN 3N2GB 1TVKA 4AI8A 3DXRB 1IBMB 3ETGA 3A2FA 5B1AB 4H13B 1Q6IA 2B9ZA 3A0BZ 2YS8A 4P9OA 2WLHA 5L3FA 3I55V 3CC7V 1AJNA 1RPRA 4FIPC 4XDJA 3RVYA 1W2BU 2EIMC 1HNWO 2ZM6B 2K9PA 3QG5A 2VQEO 2ZDIA 1FXKB 1GM8A 1P7BA 2FMLA 1RP3B 2OTLV 2JRIA 3ZS8C 2ZE5A 1V54C 2VS0A 3OTFA 4G2KA 2P06A 2KG7B 2XAJA 3ZHSA 4FFBB 4NTYA 1SETA 1B06A 4ZKIA 1BT8A 2EIKC 4IIJA 4FM0A 2R9RB 4X66O 4OX9O 2LO1A 4E4EA 3CMAV 2JGDB 3ZIAG 3CXCU 4ASUG 1NBMG 1H2LA 1Q7YW 1R6TA 3JATB 2XAHA 1BZKA 1YITV 3AG2B 4NTXA 2HR3A 2RNBA 5B1OA 4DK0A 2Q7GA 4FLUA 2WAMA 1K92A 1MNGA 4ZOLA 1XMQB 1THZA 5LGTA 3SGIA 1K97A 4ZI7A 2HHHO 2HFEC 4X9QA 4LF7O 1WN7A 4FLZA 1EN4A 3RYFA 1AI7A 4GUNA 4FLWA 2PYJA 4CH6A 2OTJV 5K1PA 4FLVA 2XAGA 1X59A 3U10A 1V9PA 4JI5O 2EIMB 2LGWA 4PA3A 4GKJO 3S3WA 2Q4PA 3NXSA 3OM3B 2AZ0A 5H6QA 3ZRWA 3OGCC 1K5QA 4HZ3A 2F95B 3ZCCA 1V54B 3QVNA 2YDEA 2H3OA 3CCVV 4DXWA 3LDDA 5CA0B 4MTFA 1SQVH 2P22C 4LF9O 2Q73A 2EIKB 4P9PA 3JAKA 4CH5A 2BTQA 1AI4A 1LUWA 5D5PA 2GBOA 1EFRG 4X64B 3ZMSA 2IH3C 3A8TA 4FK5C 4GKKO 4ICGA 3E35A 3VOUA 4DR7O 4HYOA 3BY6A 4JZGA 1I08A 1VQPV 1W0KG 2Z0AA 3L75H 2B1GA 5HFMA 1BL8A 4GX5A 3HKEB 4R8CA 1NS1A 5KMGB 5LXTB 1COWG 5B5EZ 1YHQV 2YXYA 3T1HO 1NTMH 3LDCA 4I50B 5IJ9B 4JI2B 4LF4B 3RYIA 2XTAA 2CK3G 1N33B 3E8FA 5C93A 3J80N 1YTFD 1YSCA 4QPKA 1KKDA 4LF8O 1QR9A 4YJ2B 1XHZA 3N27A 3VQXA 1K4CC 1IXMA 2LP7A 3W7TA 3OE7G 2Q8VA 2EZOA 5KHGA 1WB7A 4KHPB 3DXRA 2XAQA 4J9YB 1PV0A 1LR1A 3B4SA 1Y67A 2QTSA 5KHHA 1MOFA 2YI9A 3B40A 5JJJB 2LFSA 2WA3A 5KX5B 1VQ5V 4B3RO 4PA4A 4NB5A 4CS3A 1PM9A 2W6IG 1XUQA 4DV4B 3P3PA 3IFXA 1FXKA 3K58A 2E3CA 1QR8A 3ZEDA 2BSKB 3SPIA 2FB5A 4FLXA 1IBMO 3CC4V 3I5DA 1Q5OA 2KG7A 1NKDA 2JDIG 2NNUA 4ZHQB 3WG7C 3KCXA 4K3AA 1I94B 4PI2A 4X62B 3TXSA 2YICA 5GW7A 4DR3O 4H44B 4J7ZA 2GUZB 3F7YC 5FNVB 2JGDA 3FB5C 1VQ7V 3JCUZ 2UU9B 1TA8A 3G6EV 1IBLB 4B3MO 4CZZA 1Q8IA 3DC5A 2A3QA 2PF4E 4PDMA 1XOUA 3JATA 4DV1B 3K59A 4TV9B 5H6RA 3ICXA 2Y4TA 3WFVA 2Y48A 4MVMA 1AP5A 1Q6UA 1AJQA 1G6UA 1L0NH 2IJJA 2GDSA 1K34A 2DOSA 1MZFA 3JD0A 5EYPB 2WLKA 1RPOA 1NTZH 3AG4B 4JI3B 1PNMA 4JV5O 3JAWB 4OPAA 4KFMA 3CCUV 1YTFB 4J9ZB 2JIZG 4K0KO 2Q0AA 2W0XA 1FPOA 5LGNA 3ZMVA 4MW3A 3CRAA
chains in the Genus database with same CATH topology
4DUYO 2UXBO 2F4VO 4GKJO 3M8AA 2LW7A 1XNQO 5LMNO 3J7AU 1YZBA 1A32A 1XMQO 4B3RO 2N74A 5IWAO 1AB3A 1J5EO 4JI3O 1HNWO 2UUBO 2UXDO 5A2QN 4DV2O 2VQEO 2DJVA 1KUQA 4LF9O 2ZM6O 3T1YO 4OPHA 2AGAA 4DV4O 5BR8O 4DV3O 2JRIA 4X65O 2ZKOA 4DR6O 4B3SO 1IBMO 5LL6Y 3SDLA 3F5TA 4DV5O 2E5LO 4DR4O 2UUAO 1DK1A 4B3TO 4GKKO 1IBKO 4AQYO 4DV6O 1XMOO 5IT9N 4DR7O 4JYAO 4LFBO 4DR3O 1D2DA 3JAMN 4X66O 4OX9O 1HNZO 4JI8O 2Z0AA 4LF6O 4JI0O 1R1BA 1NS1A 1F7YA 4B3MO 1G1XB 2VQFO 4NXNO 1N34O 2UU9O 4JI6O 1IBLO 3T1HO 4LFAO 4JI1O 4X64O 1R6TA 4LFCO 4NXMO 1FKAO 4YY3O 4DUZO 1XEQA 4YHHO 1XNRO 2UXCO 3R66A 5LMUO 1AILA 4DV0O 1HNXO 1I94O 5BXZA 4JI4O 1FJGO 4X62O 3J80N 2DOSA 1N36O 1N33O 4LF8O 3OTOO 2FKXA 1FYJA 2HHHO 4LF7O 4DR5O 1HR0O 4JV5O 4DR2O 4OPAA 4DV7O 4LF5O 5BY1A 5H5NA 1N32O 3RT3C 4JI5O 4K0KO 3J81N 4DR1O 4JI7O 5FLXN 1X59A 4DV1O 4JI2O 4LF4O 4A5UB 3O65A 2UUCO 4KHPO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY O;  2UXB O;  2F4V O;  4GKJ O;  3M8A A;  2LW7 A;  1XNQ O;  5LMN O;  3J7A U;  1YZB A;  1A32 A;  1XMQ O;  4B3R O;  2N74 A;  5IWA O;  1AB3 A;  1J5E O;  4JI3 O;  1HNW O;  2UUB O;  2UXD O;  5A2Q N;  4DV2 O;  2VQE O;  2DJV A;  1KUQ A;  4LF9 O;  2ZM6 O;  3T1Y O;  4OPH A;  2AGA A;  4DV4 O;  5BR8 O;  4DV3 O;  2JRI A;  4X65 O;  2ZKO A;  4DR6 O;  4B3S O;  1IBM O;  5LL6 Y;  3SDL A;  3F5T A;  4DV5 O;  2E5L O;  4DR4 O;  2UUA O;  1DK1 A;  4B3T O;  4GKK O;  1IBK O;  4AQY O;  4DV6 O;  1XMO O;  5IT9 N;  4DR7 O;  4JYA O;  4LFB O;  4DR3 O;  1D2D A;  3JAM N;  4X66 O;  4OX9 O;  1HNZ O;  4JI8 O;  2Z0A A;  4LF6 O;  4JI0 O;  1R1B A;  1NS1 A;  1F7Y A;  4B3M O;  1G1X B;  2VQF O;  4NXN O;  1N34 O;  2UU9 O;  4JI6 O;  1IBL O;  3T1H O;  4LFA O;  4JI1 O;  4X64 O;  1R6T A;  4LFC O;  4NXM O;  1FKA O;  4YY3 O;  4DUZ O;  1XEQ A;  4YHH O;  1XNR O;  2UXC O;  3R66 A;  5LMU O;  1AIL A;  4DV0 O;  1HNX O;  1I94 O;  5BXZ A;  4JI4 O;  1FJG O;  4X62 O;  3J80 N;  2DOS A;  1N36 O;  1N33 O;  4LF8 O;  3OTO O;  2FKX A;  1FYJ A;  2HHH O;  4LF7 O;  4DR5 O;  1HR0 O;  4JV5 O;  4DR2 O;  4OPA A;  4DV7 O;  4LF5 O;  5BY1 A;  5H5N A;  1N32 O;  3RT3 C;  4JI5 O;  4K0K O;  3J81 N;  4DR1 O;  4JI7 O;  5FLX N;  1X59 A;  4DV1 O;  4JI2 O;  4LF4 O;  4A5U B;  3O65 A;  2UUC O;  4KHP O; 
#chains in the Genus database with same CATH topology
 4F4L A;  2UUA B;  1VF7 A;  3CX5 F;  1G8M A;  4J10 A;  4IYI A;  1XMQ O;  3JCZ A;  1JQ0 A;  4RO2 A;  4CC5 A;  4UXN A;  1OCO C;  2E75 B;  2ILM A;  1PL0 A;  5CBH A;  5CA0 A;  3P32 A;  5B1B C;  2R9I A;  3WG7 B;  3BAB A;  5LHH A;  3ETE A;  1DF4 A;  5CBF A;  3CPW U;  3K08 A;  3ABK C;  5CN0 A;  3T4Z A;  4L87 A;  5BR8 O;  3L73 H;  3QO7 A;  3LUT B;  4WFG A;  2F66 C;  2OCC B;  2Q68 A;  4X66 B;  1XDC A;  3G4S V;  1HWY A;  3EFF K;  1OCZ C;  1H8H G;  2AW9 A;  1S77 D;  4F6E A;  4YJ3 A;  1VMG A;  4LF6 O;  2JK5 C;  3ZMT A;  4PD4 F;  1HR0 B;  3HKE A;  1N8R W;  2AHY A;  1E1Q G;  2Y0P A;  4LBE C;  3Q4H B;  4I50 A;  4O4H A;  4J42 A;  3T1C A;  5IJ9 A;  4X64 O;  3LNM B;  4ABM A;  1ARO P;  1YCI A;  4I9W A;  4UVA A;  3R66 A;  5LOV A;  1AIL A;  1MG1 A;  2JEX A;  2N05 A;  4GT1 A;  3OMN B;  1FFX B;  3LSQ A;  4JI4 O;  2QWQ B;  4N21 A;  4TOI A;  2P5O A;  4Z1M G;  4JF3 A;  4LF7 B;  1QBZ A;  1KC8 W;  1VP7 A;  4YJ2 A;  4O4I A;  4NVP A;  1R3J C;  4DW0 A;  3ZBH A;  2OCH A;  2JJ1 G;  3RFR A;  2XHB A;  3H1J H;  4Q6G A;  1ZX3 A;  1HW7 A;  3ZRV A;  2EJ7 A;  1WP8 A;  4RUF A;  4JI2 O;  5IYZ A;  4LF4 O;  4B3S B;  4LCU C;  1OCO B;  3IJ4 A;  3O65 A;  4X20 B;  3BRC A;  3H9V A;  2OYQ A;  1AP6 A;  1P49 A;  2BE3 A;  5B1B B;  4MVZ A;  3MDS A;  5KX5 A;  3ABK B;  2QKC A;  4LFB B;  4C7U A;  4RWU A;  1LUV A;  3SYC A;  3D36 C;  4JZ2 A;  1MA1 A;  3K57 A;  2IJH A;  1M90 W;  1QU7 A;  5IE9 A;  1H2S B;  2BSK A;  1OCZ B;  1N34 B;  4JI6 B;  1SQQ H;  1PP9 H;  1JMK C;  4NXM B;  3F7V C;  5LL6 Y;  3AK2 A;  2HP8 A;  5JVD B;  4DR7 B;  4ZHQ A;  2AHZ A;  2A7W A;  1VIB A;  1Z5W A;  1VQN V;  1RSO B;  3JSL A;  3ZJZ A;  2GUZ A;  2E74 B;  2AXT Z;  3L74 H;  1T5E A;  3B09 A;  1ZL8 B;  5FNV A;  1CP9 A;  2L6L A;  2EIN C;  4LH7 A;  2WLI A;  3E22 B;  2LQT A;  2Q9L A;  4GYC B;  2OWO A;  4D7S A;  1R1B A;  1SZT A;  1SF9 A;  3T1H B;  5LBQ A;  1YXB A;  4BR6 A;  5JQG B;  4JI7 B;  1U96 A;  4FLY A;  1FKA O;  4TV9 A;  3AEI A;  3HKC B;  1AR5 A;  4I55 B;  1I94 O;  4U3J B;  4X62 O;  4UCO A;  4EKW A;  3TJT A;  5EYP A;  4FM2 A;  1K8A W;  1AR4 A;  1NR7 A;  5EC1 C;  4WCE V;  1WA8 A;  3K0G A;  1YI2 V;  4YXW G;  2E76 B;  4N23 A;  3JAR B;  1Q86 W;  1IX9 A;  3LDE A;  4K35 A;  1M93 A;  2F43 G;  1M9N A;  2YIB D;  1XIL A;  4DV1 O;  1F4N A;  1QQC A;  3AG1 B;  1M57 C;  5JH7 B;  2QWN B;  4B3R B;  3M8A A;  4WFB V;  2ZCE A;  2XAS A;  3APQ A;  1A32 A;  5J2U B;  4GX2 A;  4UFZ A;  4JI3 O;  1S5J A;  3DGE A;  4JI8 B;  4PA9 A;  2JS3 A;  1R6K A;  2PTM A;  4FZ0 A;  5JCO C;  1GH6 A;  2YID A;  4JAV A;  1Q3E A;  1O9G A;  2EIL C;  3K5M A;  1Q81 W;  2QM8 A;  4XDK A;  1KU9 A;  4JYC A;  2EIN B;  3OUF A;  2UUA O;  4B3T O;  1CPY A;  1VQM V;  1IBK O;  1QVG U;  2YXH A;  4DR3 B;  2JS5 A;  1NTK H;  4B3M B;  1S76 D;  1M5I A;  2A79 B;  3LSS A;  5F2V O;  2MW2 B;  2RMK B;  1FS0 G;  2WLM A;  2YC0 A;  3Q4H A;  2Q5Z A;  2CTW A;  5KA5 A;  2BOC C;  4IL6 Z;  3CB2 A;  1XEQ A;  1L8D A;  1XNR O;  4X1Y B;  3EHB B;  4DW1 A;  2UUC B;  2F23 A;  2YUA A;  3GB7 C;  1FFX A;  2RCV A;  2NN4 A;  2IH1 C;  5LGU A;  3ZRS A;  4JV5 B;  4P2Z A;  3BA8 A;  2N04 A;  1J5E B;  3CCE V;  1M57 B;  2GTS A;  3IAY A;  4X1K B;  4K0K B;  4LNU B;  1HR0 O;  1Q43 A;  4LR3 A;  5LP6 C;  2ADQ B;  3SPC A;  3W7W A;  1WLE A;  3JD4 A;  4JPR A;  1VAR A;  2W0F C;  4QPJ A;  2PYL A;  4DUY O;  4UV8 A;  1R6N A;  1K4D C;  4TV8 B;  1X4T A;  4JYA B;  2R9A A;  5KHK A;  1P7G A;  3QF7 A;  2EIL B;  3OMA B;  1KB9 F;  3BFR A;  5KAI Z;  3K5O A;  4DV2 O;  3MD0 A;  5BR8 B;  3CCJ V;  2ZE7 A;  2EJR A;  4KUM A;  4XDL A;  1JX9 A;  5E1A C;  4OPH A;  4UCR A;  5CB4 B;  4CH3 A;  4CC6 A;  4B3S O;  4MVU A;  1EZV H;  4UCU A;  2Q7E A;  5JVD A;  4W4K A;  4DV0 B;  3CSX A;  1FJG B;  1Q90 D;  2HLD G;  2ZE6 A;  3L72 H;  3ABT A;  3QNE A;  1BMF G;  4LFB O;  4LF6 B;  4K8Z A;  3OUS A;  5GTI Z;  1ZLZ A;  2P4K A;  3FFQ A;  4FJC C;  3E22 A;  4YIP A;  1BSM A;  3GWO A;  1N34 O;  4GLX A;  1K73 W;  1KYO F;  4JI6 O;  3FYI B;  5JQG A;  3H1L H;  5KHI A;  1NH2 D;  1GMG A;  2ZXW C;  2XOK G;  4NXM O;  1ZWI C;  2HJF C;  3T2M A;  1RM1 C;  1AJP A;  1NR1 A;  4JI4 B;  3HKC A;  1S3J A;  2IU3 A;  3WB1 A;  4U3F H;  4P30 A;  1WP7 A;  4O2B B;  1NU1 H;  3RWR D;  5TIS Z;  3ZHR A;  2LW1 A;  3JAR A;  3RGB A;  3A0R A;  3T1Y B;  2D3O W;  1JFF B;  3ABU A;  1QNM A;  1XL6 A;  3AK3 A;  4JI7 O;  4X65 B;  2QWO B;  1AVM A;  1KP2 A;  3D36 A;  5JH7 A;  4QJF B;  4XBF A;  3T4D A;  1XMO B;  1XBL A;  2DW4 A;  4PHZ A;  5J2U A;  1JPX A;  2F93 B;  5LYJ B;  4PJ0 Z;  4LH6 A;  2QJ1 A;  5KA6 A;  1N0N A;  2PGG A;  3DTU B;  2X7R B;  1SA0 A;  1H38 A;  3N2G A;  2QWP B;  3ZX6 A;  4NXN B;  2BTO A;  3E83 A;  1FFT B;  4PA7 A;  1KEC A;  1UJW B;  1IVS A;  1P4R A;  1P84 F;  3HKD B;  3IC9 A;  2V1D A;  1L0L H;  5EIB D;  4HAM A;  3OEH G;  2BCC H;  3P30 A;  3SJB C;  3H01 A;  2ZR3 A;  1RM1 B;  4JI8 O;  4MTG A;  2Q0O C;  2M7W A;  2VWJ A;  2VQF O;  2XND G;  1QCE A;  4I4T B;  4B08 A;  5KHJ A;  2O57 A;  3CRQ A;  4Z2W A;  4DR1 B;  4FFK A;  3OAA G;  3AG3 C;  4B7K A;  4FFB A;  3KZI Z;  1TUB B;  3FB6 C;  4DUZ O;  4X1Y A;  4YHH O;  1VF5 B;  2ZT9 B;  1F23 A;  5EIB C;  4U7O A;  1Q6H A;  2NLJ C;  2UXB B;  3K04 A;  1TUE B;  3ZMU A;  3UO2 A;  4I9Q A;  2WWW A;  3TK1 A;  2DN9 A;  4IYH A;  4HNA B;  1R73 A;  1NH2 B;  3ASO C;  2KKW A;  1VF6 A;  4QGP A;  4X1K A;  3E2E A;  4IHJ B;  1NZ6 A;  3L70 H;  4FM1 A;  3ZHT A;  5EBL C;  1VQ6 V;  2LGQ A;  3W7S A;  4DR6 B;  4FZ1 A;  4J80 A;  2H8P C;  2UUC O;  3ABM C;  4TQD A;  1GRJ A;  2V7Q G;  2GHY A;  1NI8 A;  5IDJ A;  2YIB A;  1SES A;  5IJ0 B;  4H33 A;  3X2Q C;  3CHX A;  4GX0 A;  4MW8 A;  3D3I A;  3MHH C;  2ZDI C;  1J5E O;  4L8J A;  1EM1 A;  5J2T B;  3WB0 A;  2PI4 A;  3ASN C;  1JJO A;  5HFL A;  4UVB A;  4W4L A;  4QNH B;  2CH7 B;  2CTP A;  1ZAU A;  3OMI B;  5CB4 A;  2HVK C;  1D5A A;  4CS2 A;  4X89 A;  4B3T B;  3G80 A;  4UCT A;  1IBK B;  2EIJ C;  3EXA A;  3ZN1 A;  2JJ2 G;  5CBG A;  1W59 A;  4JYA O;  3AG3 B;  3HR0 A;  3JAM N;  4CS4 A;  2Y4U A;  1DF5 A;  5LHI A;  3UT5 B;  4JYB A;  2XT9 A;  2FTK A;  4DR2 B;  1G1X B;  2YXL A;  2YSU B;  3M99 B;  5LA6 B;  1V55 C;  3ZN0 A;  4KP4 A;  3H1I H;  1KP3 A;  2X0L A;  3TCU A;  1XNR B;  2YIA A;  2A9H A;  3JAL B;  4QE7 A;  1B6Q A;  1F51 A;  1QLE C;  3ASO B;  5DED A;  1OJH A;  4PA6 A;  4DRX B;  3SJA C;  4PV1 B;  5KUM A;  3CRM A;  4DV0 O;  2HJD A;  4FVM A;  4R7C A;  3BCC H;  5C8Y B;  1FJG O;  3RYH B;  3I56 V;  1D5N A;  1JOY A;  1KKC A;  2M6Y A;  1H2N A;  4O2B A;  5LXT A;  3HPL C;  5KMG A;  4R50 A;  4B7E A;  1BCC H;  3ABM B;  4J7J A;  3VQW A;  1BHA A;  2DQ0 A;  2R70 A;  3SR2 C;  1K33 A;  5E79 Z;  1JFF A;  2IW5 A;  4GX1 A;  2WPD G;  3X2Q B;  4DUY B;  1K5S A;  1EBO A;  3JD2 A;  2P6J A;  1NJI W;  3ASN B;  3CCS V;  4CH4 A;  3CEI A;  2F4V O;  2ZQM A;  3K9A A;  1CEZ A;  4DV6 B;  4RQE A;  3HB3 B;  5LYJ A;  3ZHV A;  1R3K C;  3B2E E;  3CYO A;  2P7T C;  4DV2 B;  2QDO A;  1MMM A;  2HVJ C;  3B8N A;  3JSN A;  1DLB A;  1M56 C;  5ITZ B;  3T1Y O;  3RYC B;  2QWR B;  4X65 O;  4PEL A;  3HKD A;  2UXC B;  1XI1 A;  4DR4 O;  1ZSP A;  4WFF A;  1XMO O;  2G38 A;  4J41 A;  3BVO A;  3K79 A;  3OT7 A;  1V55 B;  4Z1V A;  2QM7 A;  1SS3 A;  1GN6 A;  3CXH F;  1SER A;  1QLE B;  2DWE C;  2EBO A;  2CGO A;  3E8B A;  4MSW C;  1GN4 A;  2CDY A;  2B1I A;  1XRE A;  4ZI7 B;  1F7Y A;  4I4T A;  2QR4 A;  3LSU A;  4I7Z B;  4D6T H;  4NXN O;  1YJ9 V;  4LWS B;  2QKS A;  1TUB A;  1ORQ C;  1I5Y A;  4OXS A;  3C3T A;  3KG2 A;  5EZY B;  4OGQ B;  5B1N A;  3STL C;  3RW0 A;  2IJK A;  2DYS C;  5LMN B;  4HNA A;  2F1M A;  5L3E A;  1YIJ V;  5IWA B;  4IHJ A;  3W7U A;  1SQX H;  2QE7 G;  3G67 A;  1N32 O;  5B1A C;  4DO2 A;  4X1I B;  4DR1 O;  3UKM A;  1KD1 W;  2RQ6 A;  3JAK B;  4FPP A;  4EB6 B;  2UXB O;  3E89 A;  1FD9 A;  2FYU H;  3TET A;  4PI0 A;  1SQP H;  1YZB A;  3IC7 A;  5IJ0 A;  1H2G A;  3K06 A;  3JAW A;  4BW5 A;  1ZUQ A;  1PNL A;  1OCR C;  3N2K B;  1EN5 A;  2Y0I A;  4RUE A;  2FL4 A;  2W6J G;  2CAZ C;  4JGS A;  2CH7 A;  1KUQ A;  2UXX A;  3E8H A;  3S3X A;  4GCZ A;  1MSD A;  4DR6 O;  2IU0 A;  1H2M A;  1SZX A;  4Q20 A;  2GSM B;  1DK1 A;  4KL1 A;  2X6B A;  4YIO A;  2ZNI A;  3RYI B;  2K1E A;  1M4U A;  1N36 B;  2KQX A;  2OIG A;  2WSS G;  1MSW D;  1OCC C;  3ZRX A;  3UT5 A;  2VQF B;  2DYR C;  3C90 A;  2DYS B;  2QGN A;  3SYO A;  4DUZ B;  4YHH B;  2Q6A A;  1KMI Z;  4DRX A;  3WU2 Z;  1B04 A;  5K1X A;  5C8Y A;  3RYH A;  4I5S A;  3OGI B;  2V4D A;  4JTD B;  5DEC A;  2YEV B;  4JTA B;  4MTO A;  3GWK C;  3VQY A;  2Q67 A;  4J7K A;  1OZ0 A;  1TAE A;  3ML0 A;  3JYC A;  2UXD B;  4DR2 O;  1YEW A;  2B5U A;  4DV7 O;  2BOB C;  1NVP D;  2ATK C;  1Y76 B;  3NR7 A;  5EK0 A;  5J9P C;  3J81 N;  4MVR A;  4X88 A;  1PPJ H;  4G28 B;  2CE4 A;  2CGN A;  4TT3 G;  3SJQ C;  4K8X A;  3K5L A;  1OCR B;  4F6R B;  1CXZ B;  3B77 A;  4X8A A;  3THO A;  3CCR V;  3UCS C;  4WFE A;  5B66 Z;  4DV5 B;  1BQ0 A;  2XUM A;  1FXH A;  3FB7 C;  1QHT A;  1G4Y B;  1DGS A;  2N74 A;  4O2A B;  1E1R G;  4NKG B;  4WBN B;  4JAU A;  5KUK A;  2UUB O;  2L35 A;  1ROP A;  2P4V A;  1WPB A;  2RDC A;  5ITZ A;  4U7N A;  4JI0 B;  2R72 A;  4X20 A;  3RYC A;  4DV3 O;  2P90 A;  4LFA B;  5JJE B;  1OCC B;  4LFC B;  2ZR2 A;  3R65 A;  3SDL A;  1XQ8 A;  2IBZ H;  5LMU B;  3OFN G;  1UPG A;  3CME V;  1HNX B;  5AG2 A;  2DYR B;  4DV6 O;  4MTX A;  2VWK A;  1SRY A;  1YJN V;  1Y74 B;  3JAS B;  1HNZ O;  2EUL A;  3ZHU A;  3CRR A;  4DR5 B;  2ITD C;  3F5W C;  2ZNJ A;  4MS2 A;  1YDX A;  1B3Q A;  3SYP A;  1VQK V;  4BIU A;  2ITC C;  2CTQ A;  4JYY A;  5DM6 V;  4LWS A;  4MT8 A;  3AK1 A;  1GTO A;  2UXC O;  4AIL C;  2Z5U A;  5EZY A;  4DK1 A;  2WA4 A;  1RSO A;  1SQF A;  1ZL8 A;  2PZS A;  3FKS G;  1XNQ B;  5IYC O;  2RN9 A;  3AG7 A;  1AI6 A;  3OTO O;  1K7D A;  5JWP A;  2ZD9 A;  1H2K A;  4MVS A;  3ZHQ A;  4UV9 A;  4BW9 A;  1N4C A;  3U0Z A;  3B8M A;  3C3S A;  1MZE A;  4QIW F;  5BY1 A;  3CJH B;  2DMX A;  4X1I A;  2IJI A;  3CE2 A;  4I55 A;  3SPJ A;  2F4V B;  4U3J A;  5LP6 B;  3VQV A;  4EB6 A;  2KB1 A;  2MK3 A;  1NVP B;  4BAY A;  3M7M X;  3CCL V;  1JCH A;  4AQY B;  5L3B A;  2LW7 A;  5LMN O;  3J7A U;  1GN2 A;  1YF2 A;  3RVZ A;  3OW2 U;  5EC2 C;  5IWA O;  3E8G A;  3N2K A;  1BE3 H;  2DQ3 A;  2DWD C;  5LHG A;  3HKB B;  2Q69 A;  1PL4 A;  3IGA C;  3CWB H;  4LC1 A;  4YJ3 B;  3SPG A;  1AI5 A;  4DR4 B;  1FXV A;  4JI1 B;  1JA8 A;  1US6 A;  4YY3 B;  2QKA A;  3F5T A;  2E5L O;  2HG5 C;  4BIZ A;  4O4H B;  2ODM A;  3U11 A;  5IT9 N;  3OR7 C;  1I0H A;  5CA1 B;  5LOV B;  1Q82 W;  4WFH A;  2WLJ A;  2EX3 A;  1J95 A;  1S5L Z;  3JD3 A;  2A0L A;  4J11 A;  1VEW A;  2IM9 A;  3MAQ A;  4R6Z A;  3H1K H;  1I7F A;  4O4I B;  4FLT A;  3KCY A;  3D3Q A;  4D7T A;  3GVM A;  1VQ8 V;  4O4L B;  3ETQ A;  4UUJ C;  4UVC A;  1HP8 A;  1S5H C;  1HDJ A;  3CCQ V;  5IYZ B;  2QM4 A;  3BHP A;  1OHH G;  2ZXW B;  3AG4 C;  4JAA A;  2JVD A;  1N36 O;  2YEV A;  1GO3 F;  1R3I C;  5FPR A;  4TWK A;  1N32 B;  4UCS A;  1F4M A;  3CC2 V;  1O9H A;  4RQF A;  2C2A A;  3OD4 A;  3UO3 A;  1K9M W;  1Y76 A;  5H5N A;  1Z5V A;  3RT3 C;  4BIO A;  4TUY B;  3BPZ A;  2WLN A;  3SPH A;  2Y69 C;  4F6R A;  1GK9 A;  1KBH A;  4JTC B;  1ENV A;  1PKX A;  3BAA A;  4O2A A;  4LNU A;  1GKF A;  3TGU H;  4I0X B;  3FYE B;  4MVQ A;  4WBN A;  5L3C A;  1K3E A;  5GTH Z;  2UXD O;  1VQ4 V;  1BGY H;  4UB6 Z;  4EFE A;  2ZM6 O;  4LP8 A;  2OCC C;  3G71 V;  2QSA A;  1VQ9 V;  1FAF A;  2WLI B;  2QA4 V;  3DSQ A;  4JAS A;  4TV8 A;  5JCO A;  5L3D A;  3OR6 C;  1Y66 A;  2KSD A;  4DV5 O;  1DTO A;  2A06 H;  2AZ2 A;  2JEU A;  1SKV A;  3VBB A;  3FAV B;  2Q7H A;  5CA3 A;  3CP1 A;  3D8C A;  2LFR A;  1Y74 A;  3JAS A;  5GON B;  3EVK A;  5DN6 G;  3W7X A;  5BMV B;  3SYA A;  4JI0 O;  4LF5 B;  2WLL B;  1WA8 B;  3SYQ A;  2PI5 A;  2P67 A;  2QTO A;  4LFA O;  3P3N A;  4LFC O;  3K3W A;  3WB2 A;  4UCV A;  5H2F Z;  5LMU O;  3L9D A;  1HNX O;  2GTA A;  5EBW C;  3ABL C;  5BXZ A;  2X6C A;  4H0L B;  1WB8 A;  1BQZ A;  3CCM V;  2ZIN A;  4O4J B;  2Y69 B;  2JGU A;  4ZIB A;  5A9G A;  4DV7 B;  1W0J G;  1IZ3 A;  5KLV H;  5L3G A;  1JR9 A;  1HNW B;  4DR5 O;  3PJS K;  3CJH A;  3L71 H;  2VQE B;  1LNQ A;  1BHB A;  2HKO A;  3E86 A;  3K5N A;  1OV9 A;  4TSF G;  1TVK B;  4A5U B;  5LP6 A;  1VQL V;  2OT5 A;  1U97 A;  2PUS A;  1XNQ O;  1S0V A;  1EN6 A;  2ZE8 A;  2ETN A;  2X6A A;  2UUB B;  1AB3 A;  1SC5 B;  4OX9 B;  2H94 A;  3HKB A;  5FPO A;  1AR1 B;  4DV3 B;  4H37 A;  3JD1 A;  2AGA A;  3QO8 A;  3UQ8 A;  2ZIO A;  1PNK A;  4EFB A;  2XAF A;  4IT5 A;  5IYD O;  1QLN A;  2ZKO A;  3STZ C;  5B3S C;  3QTC A;  2EZP A;  1JVM A;  3MHS C;  3O9O A;  5BZB A;  4AQY O;  5IYB O;  4NR1 A;  2EIJ B;  5CA1 A;  1HNZ B;  2NR5 A;  4IIJ B;  3CD6 V;  1IDS A;  3BEH A;  3KKY A;  3G6B A;  3LNN A;  5H9C A;  3CRC A;  2HHH B;  3UM7 A;  2VRZ A;  4IGG A;  1R3L C;  3FB8 C;  2ARH A;  4E2L A;  3ABL B;  1UFI A;  1GN3 A;  5JJN B;  1NT2 B;  3RN4 A;  2Z3Y A;  5D5Q A;  1YVW A;  4O4L A;  4JI1 O;  1Y6X A;  1RFY A;  4PDL A;  3TXQ A;  4YY3 O;  2YI8 A;  4HBN A;  1URF A;  4JI5 B;  4CBC A;  1GAX A;  1TGO A;  3K0D A;  3DC6 A;  3OTO B;  4GKJ B;  1XL4 A;  2HEP A;  2OIE A;  1N33 O;  1S72 V;  4ZOL B;  5IY5 C;  2FKX A;  1XHX A;  3APO A;  2LJ2 A;  1PD3 A;  2ADP A;  4G27 B;  4BWA A;  4GZR B;  2D2C B;  1IXB A;  3RYF B;  3SJC C;  3AG1 C;  4LF9 B;  4TUY A;  2DE0 X;  1L1F A;  3ETD A;  2GV9 A;  4KHP O;  1SQG A;  1H8E G;  1SQB H;  4GKK B;  4PDV A;  1EZJ A;  3ZRW B;  1WAZ A;  2PY5 A;  4I0X A;  3ZMZ A;  5B3S B;  2CUG A;  1Z2G A;  5A2Q N;  3QO5 A;  3K03 A;  2ZIM A;  2DJV A;  4EEQ A;  4DV4 O;  4TQF A;  4RAI A;  1M56 B;  2BTQ B;  1NQT A;  2E5L B;  1E79 G;  1MAB G;  1KQS U;  1N0J A;  3A0H Z;  1WNS A;  3FAV A;  1FXK C;  1BS3 A;  4NTW A;  3BA9 A;  5J2T A;  4ZBM A;  5GON A;  4LF8 B;  1M1K W;  1D2D A;  3H1H H;  1Y4M A;  4WFA V;  5BMV A;  3OEE G;  3PN1 A;  1WJZ A;  4AHC A;  2CTR A;  1JJ2 U;  2WLL A;  4QE9 A;  2UU9 O;  1IBL O;  1GM7 A;  5IY5 B;  4KXR A;  5CMU A;  5EBM C;  3RBZ A;  1YJW V;  2UXN A;  4WF9 V;  1GM9 A;  1ZTE A;  1I5X A;  1IUR A;  1VF6 C;  5FL7 G;  5KAF Z;  4O4J A;  4NYK A;  4DYL A;  3CS5 A;  1VQO V;  1FYJ A;  3AG2 C;  3K9S A;  4FMT A;  5LA6 A;  1WPX A;  2RJZ A;  4PDR A;  3FD9 A;  3JAL A;  4LF5 O;  2QEX V;  4UB8 Z;  1QVF U;  1SA0 B;  4MVO A;  3FX7 A;  5FLX N;  3N2G B;  1TVK A;  4AI8 A;  3DXR B;  1IBM B;  3ETG A;  3A2F A;  5B1A B;  4H13 B;  1Q6I A;  2B9Z A;  3A0B Z;  2YS8 A;  4P9O A;  2WLH A;  5L3F A;  3I55 V;  3CC7 V;  1AJN A;  1RPR A;  4FIP C;  4XDJ A;  3RVY A;  1W2B U;  2EIM C;  1HNW O;  2ZM6 B;  2K9P A;  3QG5 A;  2VQE O;  2ZDI A;  1FXK B;  1GM8 A;  1P7B A;  2FML A;  1RP3 B;  2OTL V;  2JRI A;  3ZS8 C;  2ZE5 A;  1V54 C;  2VS0 A;  3OTF A;  4G2K A;  2P06 A;  2KG7 B;  2XAJ A;  3ZHS A;  4FFB B;  4NTY A;  1SET A;  1B06 A;  4ZKI A;  1BT8 A;  2EIK C;  4IIJ A;  4FM0 A;  2R9R B;  4X66 O;  4OX9 O;  2LO1 A;  4E4E A;  3CMA V;  2JGD B;  3ZIA G;  3CXC U;  4ASU G;  1NBM G;  1H2L A;  1Q7Y W;  1R6T A;  3JAT B;  2XAH A;  1BZK A;  1YIT V;  3AG2 B;  4NTX A;  2HR3 A;  2RNB A;  5B1O A;  4DK0 A;  2Q7G A;  4FLU A;  2WAM A;  1K92 A;  1MNG A;  4ZOL A;  1XMQ B;  1THZ A;  5LGT A;  3SGI A;  1K97 A;  4ZI7 A;  2HHH O;  2HFE C;  4X9Q A;  4LF7 O;  1WN7 A;  4FLZ A;  1EN4 A;  3RYF A;  1AI7 A;  4GUN A;  4FLW A;  2PYJ A;  4CH6 A;  2OTJ V;  5K1P A;  4FLV A;  2XAG A;  1X59 A;  3U10 A;  1V9P A;  4JI5 O;  2EIM B;  2LGW A;  4PA3 A;  4GKJ O;  3S3W A;  2Q4P A;  3NXS A;  3OM3 B;  2AZ0 A;  5H6Q A;  3ZRW A;  3OGC C;  1K5Q A;  4HZ3 A;  2F95 B;  3ZCC A;  1V54 B;  3QVN A;  2YDE A;  2H3O A;  3CCV V;  4DXW A;  3LDD A;  5CA0 B;  4MTF A;  1SQV H;  2P22 C;  4LF9 O;  2Q73 A;  2EIK B;  4P9P A;  3JAK A;  4CH5 A;  2BTQ A;  1AI4 A;  1LUW A;  5D5P A;  2GBO A;  1EFR G;  4X64 B;  3ZMS A;  2IH3 C;  3A8T A;  4FK5 C;  4GKK O;  4ICG A;  3E35 A;  3VOU A;  4DR7 O;  4HYO A;  3BY6 A;  4JZG A;  1I08 A;  1VQP V;  1W0K G;  2Z0A A;  3L75 H;  2B1G A;  5HFM A;  1BL8 A;  4GX5 A;  3HKE B;  4R8C A;  1NS1 A;  5KMG B;  5LXT B;  1COW G;  5B5E Z;  1YHQ V;  2YXY A;  3T1H O;  1NTM H;  3LDC A;  4I50 B;  5IJ9 B;  4JI2 B;  4LF4 B;  3RYI A;  2XTA A;  2CK3 G;  1N33 B;  3E8F A;  5C93 A;  3J80 N;  1YTF D;  1YSC A;  4QPK A;  1KKD A;  4LF8 O;  1QR9 A;  4YJ2 B;  1XHZ A;  3N27 A;  3VQX A;  1K4C C;  1IXM A;  2LP7 A;  3W7T A;  3OE7 G;  2Q8V A;  2EZO A;  5KHG A;  1WB7 A;  4KHP B;  3DXR A;  2XAQ A;  4J9Y B;  1PV0 A;  1LR1 A;  3B4S A;  1Y67 A;  2QTS A;  5KHH A;  1MOF A;  2YI9 A;  3B40 A;  5JJJ B;  2LFS A;  2WA3 A;  5KX5 B;  1VQ5 V;  4B3R O;  4PA4 A;  4NB5 A;  4CS3 A;  1PM9 A;  2W6I G;  1XUQ A;  4DV4 B;  3P3P A;  3IFX A;  1FXK A;  3K58 A;  2E3C A;  1QR8 A;  3ZED A;  2BSK B;  3SPI A;  2FB5 A;  4FLX A;  1IBM O;  3CC4 V;  3I5D A;  1Q5O A;  2KG7 A;  1NKD A;  2JDI G;  2NNU A;  4ZHQ B;  3WG7 C;  3KCX A;  4K3A A;  1I94 B;  4PI2 A;  4X62 B;  3TXS A;  2YIC A;  5GW7 A;  4DR3 O;  4H44 B;  4J7Z A;  2GUZ B;  3F7Y C;  5FNV B;  2JGD A;  3FB5 C;  1VQ7 V;  3JCU Z;  2UU9 B;  1TA8 A;  3G6E V;  1IBL B;  4B3M O;  4CZZ A;  1Q8I A;  3DC5 A;  2A3Q A;  2PF4 E;  4PDM A;  1XOU A;  3JAT A;  4DV1 B;  3K59 A;  4TV9 B;  5H6R A;  3ICX A;  2Y4T A;  3WFV A;  2Y48 A;  4MVM A;  1AP5 A;  1Q6U A;  1AJQ A;  1G6U A;  1L0N H;  2IJJ A;  2GDS A;  1K34 A;  2DOS A;  1MZF A;  3JD0 A;  5EYP B;  2WLK A;  1RPO A;  1NTZ H;  3AG4 B;  4JI3 B;  1PNM A;  4JV5 O;  3JAW B;  4OPA A;  4KFM A;  3CCU V;  1YTF B;  4J9Z B;  2JIZ G;  4K0K O;  2Q0A A;  2W0X A;  1FPO A;  5LGN A;  3ZMV A;  4MW3 A;  3CRA A; 
#chains in the Genus database with same CATH homology
 4DUY O;  2UXB O;  2F4V O;  4GKJ O;  3M8A A;  2LW7 A;  1XNQ O;  5LMN O;  3J7A U;  1YZB A;  1A32 A;  1XMQ O;  4B3R O;  2N74 A;  5IWA O;  1AB3 A;  1J5E O;  4JI3 O;  1HNW O;  2UUB O;  2UXD O;  5A2Q N;  4DV2 O;  2VQE O;  2DJV A;  1KUQ A;  4LF9 O;  2ZM6 O;  3T1Y O;  4OPH A;  2AGA A;  4DV4 O;  5BR8 O;  4DV3 O;  2JRI A;  4X65 O;  2ZKO A;  4DR6 O;  4B3S O;  1IBM O;  5LL6 Y;  3SDL A;  3F5T A;  4DV5 O;  2E5L O;  4DR4 O;  2UUA O;  1DK1 A;  4B3T O;  4GKK O;  1IBK O;  4AQY O;  4DV6 O;  1XMO O;  5IT9 N;  4DR7 O;  4JYA O;  4LFB O;  4DR3 O;  1D2D A;  3JAM N;  4X66 O;  4OX9 O;  1HNZ O;  4JI8 O;  2Z0A A;  4LF6 O;  4JI0 O;  1R1B A;  1NS1 A;  1F7Y A;  4B3M O;  1G1X B;  2VQF O;  4NXN O;  1N34 O;  2UU9 O;  4JI6 O;  1IBL O;  3T1H O;  4LFA O;  4JI1 O;  4X64 O;  1R6T A;  4LFC O;  4NXM O;  1FKA O;  4YY3 O;  4DUZ O;  1XEQ A;  4YHH O;  1XNR O;  2UXC O;  3R66 A;  5LMU O;  1AIL A;  4DV0 O;  1HNX O;  1I94 O;  5BXZ A;  4JI4 O;  1FJG O;  4X62 O;  3J80 N;  2DOS A;  1N36 O;  1N33 O;  4LF8 O;  3OTO O;  2FKX A;  1FYJ A;  2HHH O;  4LF7 O;  4DR5 O;  1HR0 O;  4JV5 O;  4DR2 O;  4OPA A;  4DV7 O;  4LF5 O;  5BY1 A;  5H5N A;  1N32 O;  3RT3 C;  4JI5 O;  4K0K O;  3J81 N;  4DR1 O;  4JI7 O;  5FLX N;  1X59 A;  4DV1 O;  4JI2 O;  4LF4 O;  4A5U B;  3O65 A;  2UUC O;  4KHP O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...