3M8AA

Crystal structure of swine flu virus ns1 n-terminal rna binding domain from h1n1 influenza a/california/07/2009
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
71
structure length
71
Chain Sequence
MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLVGKQIVEWILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title Crystal Structure of Swine Flu Virus NS1 N-Terminal RNA Binding Domain from H1N1 Influenza A/California/07/2009
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 28
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3m8aA00
4LF9O 1XMOO 1R6TA 2LW7A 4DV5O 4JI7O 4GKKO 2FKXA 1KUQA 1FJGO 4LFAO 4LF7O 3SDLA 4AQYO 1N32O 1G1XB 1XNQO 4JI1O 3J81N 1YZBA 1AILA 1XEQA 4NXMO 2JRIA 2DOSA 1J5EO 4X64O 2UUAO 5IT9N 1HNXO 1N36O 1F7YA 5LMUO 4LF8O 2E5LO 2Z0AA 1HNWO 1NS1A 3RT3C 1HNZO 4GKJO 2AGAA 1HR0O 5LMNO 1XMQO 4YHHO 3F5TA 5IWAO 4OPHA 3J80N 4JI0O 4JI4O 3O65A 4JI6O 3T1HO 4JI2O 4DV1O 1XNRO 3T1YO 1DK1A 4JYAO 4LF5O 4X66O 1FYJA 3OTOO 1D2DA 3JAMN 4B3SO 4DR5O 4KHPO 4OPAA 4DR2O 4OX9O 4K0KO 2ZKOA 4DV4O 2VQEO 4DR1O 4DR3O 2UUCO 4DUZO 4DR7O 4LFBO 1IBMO 4DR4O 1A32A 4LFCO 1X59A 5BR8O 4X62O 4A5UB 1IBLO 5A2QN 4DR6O 4B3MO 5FLXN 2UXDO 5LL6Y 1R1BA 2ZM6O 4JI8O 5H5NA 2DJVA 3J7AU 4JV5O 4JI5O 4X65O 4LF4O 2F4VO 4DV3O 2N74A 4B3RO 4DV6O 2VQFO 1AB3A 4B3TO 1N33O 4JI3O 4DUYO 1N34O 2HHHO 2UU9O 4DV0O 2UXCO 4LF6O 3M8AA 4DV7O 2UUBO 5BY1A 4DV2O 5BXZA 4YY3O 1I94O 1FKAO 4NXNO 2UXBO 3R66A 1IBKO
chains in the Genus database with same CATH superfamily
4UCVA 1XMOO 3G4SV 1NR7A 1SA0A 4J11A 1N32O 3QO5A 1LUWA 1OCCB 4FMTA 1PKXA 4X1IB 1I94B 4U7OA 1AILA 4I4TB 3EHBB 1HP8A 2EINB 1BHAA 5L3BA 4O4JB 3IFXA 5EZYB 2F93B 1XQ8A 4R7CA 2QM8A 1S5JA 3CP1A 1XMQO 2IM9A 4X1YB 3TJTA 3F7YC 1SETA 3OGIB 4PV1B 4X20B 3ZMUA 1US6A 2RN9A 2ZE5A 4GCZA 2IJJA 4N21A 2IJHA 3E22B 2XT9A 1ZAUA 1N8RW 2MK3A 2EIJB 4PA4A 2G38A 4PA6A 5J2UA 2E75B 2EJ7A 1AR4A 4DR7B 2P06A 2P4KA 3FKSG 1RFYA 2KKWA 3CWBH 4G28B 3CCRV 3JATB 1VIBA 3K04A 2ZR3A 5F2VO 4JV5B 4K0KB 3B40A 4HNAB 3MD0A 4FLTA 4DV0B 2WPDG 1ZLZA 4JPRA 4EKWA 1E1QG 2XAQA 2YDEA 4CS2A 2QKSA 1EBOA 1Q81W 2OIEA 4BR6A 1QBZA 2Z5UA 4QE9A 1TUBB 4J80A 1JCHA 4LF4B 2AHZA 3PJSK 4TUYB 2HHHB 3D3QA 5L3GA 3TCUA 3ML0A 3PN1A 1OJHA 1SQBH 3I55V 2YIBA 1COWG 2CTQA 1EM1A 5C8YA 1HR0B 4WBNA 4U3JA 4B7EA 1YIJV 5CA1A 4I55B 4TSFG 5IE9A 4LH7A 5IWAO 4O2AB 3WB1A 3HPLC 3T4DA 3CRMA 4QIWF 5JQGB 2DE0X 1JX9A 4WFAV 2AHYA 2JEUA 4DR2B 2QSAA 1GN4A 5H6QA 5JVDB 3CCVV 4DR3B 3LSUA 4LH6A 1DTOA 5K1XA 4IL6Z 1K4CC 4LFBB 2BSKB 2QE7G 1FXKA 4OXSA 2XAGA 4MVMA 3SPCA 3IC9A 5J2TB 1GAXA 3CCMV 1QLEC 2A79B 3ZHUA 3QVNA 1Y6XA 4JTAB 1L0NH 4FM0A 4KFMA 4B3TB 1UJWB 3K3WA 1RPOA 1SA0B 3ZHVA 3OM3B 4B3RO 2UXCO 1K33A 2B1IA 3LUTB 1WJZA 4LF6O 3M8AA 4FIPC 3L70H 1PNLA 3JSNA 1FKAO 4U7NA 3LNMB 1JFFA 1NQTA 3KG2A 4FVMA 4X9QA 4LFAO 3SYCA 3X2QB 3L74H 2R9AA 1L0LH 2WLNA 5B5EZ 3JAKB 4JI3B 3K06A 4NXMB 4BW5A 5JH7A 1M93A 3BY6A 1VQLV 1WAZA 3OAAG 4MW8A 5JJJB 4IHJA 2DN9A 3FB8C 1PV0A 3I5DA 2BOBC 1GN3A 2ADQB 1W2BU 4JI1B 4JZGA 5LHIA 1W0KG 4P9OA 5IY5B 1Z5WA 3UQ8A 3JSLA 3T1CA 1V55B 3CPWU 4RUEA 4JI4O 3STLC 4X88A 3H1IH 2ZT9B 4RQFA 4PDMA 1M56B 1B04A 1WB7A 1JR9A 2BE3A 2EIMB 1PD3A 4QPKA 1NVPB 1MOFA 4PA9A 2QGNA 3JD3A 2H94A 2YXHA 1AR5A 1AI5A 3OR7C 3P3NA 5B66Z 4R8CA 3ZIAG 1VQ7V 3IJ4A 4DR7O 2H8PC 3AG3B 4DR4O 2ZQMA 1BL8A 1YTFB 1X59A 2OCHA 3TXSA 4FPPA 2B1GA 3FYEB 5B3SC 1CEZA 3G80A 4DV3B 3D8CA 3JALA 3B8NA 2Q68A 2H3OA 2WLIA 4JV5O 5C93A 3ZRVA 4FM1A 2EZPA 4DYLA 5D5PA 4KUMA 1GO3F 2HG5C 4DV0O 5KHJA 4DV5B 5L3FA 1SQQH 4O4LA 1O9GA 1XL6A 1OCRC 2LW7A 4JI5B 5C8YB 4WBNB 2W6IG 2WLMA 4U3JB 3CCQV 3VQYA 4DV6B 5CA1B 1AI7A 2GTSA 4DUYB 4FZ1A 1IXBA 1GM7A 1QQCA 3TGUH 2A0LA 2EZOA 1JVMA 2P90A 2F95B 3K5OA 3MAQA 3O9OA 3W7TA 2KG7A 4ZI7B 1NH2D 1DLBA 2B5UA 5IDJA 1XMOB 2QEXV 2N05A 3A2FA 1Q6IA 2EILB 1N32B 5ITZA 5LMUO 3K59A 4D7SA 3KZIZ 1YSCA 1HR0O 5H2FZ 3CYOA 2CK3G 2MW2B 2F43G 4NR1A 1FXKB 4RAIA 3SJQC 4Z1MG 4JI2O 1PL0A 5LOVA 2Y0PA 1U97A 1WP8A 3ZMSA 1OCOC 5D5QA 1E1RG 1NTZH 2R72A 4RO2A 3IAYA 1KMIZ 3CRRA 4QNHB 2R70A 1HDJA 4DR2O 1KP3A 3ZN1A 4DUZB 1AJNA 3M99B 5LP6A 4X1IA 4MVZA 3LDCA 4DR3O 4FLUA 1X4TA 2PYLA 2NLJC 4LFBO 4I4TA 3HKCB 3CCLV 2R9IA 1JFFB 4O4JA 3N2GA 1K97A 4X89A 2VQFB 4UV9A 1R3KC 5KMGA 2Q7HA 2QKCA 2NN4A 4B3TO 4X1YA 4X20A 4IHJB 1YVWA 1B06A 2JK5C 3NR7A 4TWKA 1GH6A 1VQMV 4K8ZA 1BCCH 4PHZA 4GKKO 3WG7B 1XILA 3W7UA 3SDLA 4MVUA 3APQA 3UCSC 4MTOA 2LGWA 1QVGU 2RCVA 1UFIA 5EYPA 3SPHA 5KX5B 4NXMO 3FAVA 2P6JA 1IDSA 1VF7A 3BEHA 3JD0A 1FAFA 3K57A 4HNAA 5B1AB 5BMVA 3ZRWB 4EEQA 3BRCA 2P67A 2ODMA 4JYYA 3DXRA 1SQPH 2A7WA 4WFBV 3CCUV 5KHHA 5AG2A 3DSQA 3AG4B 4GZRB 3H9VA 1I08A 3OMAB 1TUBA 4HZ3A 3STZC 5CA3A 3OFNG 3EVKA 3ABMC 4LNUB 3JALB 5IJ9B 3H1HH 2WLIB 3OGCC 1Q6HA 1K5QA 2ZCEA 2JEXA 1SZXA 5FL7G 2BOCC 4UV8A 2UUCO 1VQ4V 4PDLA 5HFLA 1M1KW 1OCCC 3MHHC 4FLVA 2IJIA 4X65B 4B3MO 5FLXN 2GV9A 3TK1A 3ETDA 5LGNA 1XHZA 4H13B 1Q82W 2E3CA 1S5HC 1KC8W 1CP9A 2EINC 2YIDA 5JCOC 2B9ZA 1H2MA 2JIZG 3SJBC 4DV3O 4O2AA 3CC4V 2N74A 1T5EA 1YITV 2DMXA 1PNMA 4JI7B 1EN6A 2KG7B 2QDOA 5FNVA 4B7KA 4UXNA 4DV5O 5ITZB 1AR1B 1H2LA 4QGPA 3CEIA 4UVCA 2UXCB 2CTRA 2EBOA 2GBOA 1AVMA 2ZE6A 1NU1H 3W7WA 2EIJC 1HNXB 5J2TA 4MTFA 4OGQB 4XDKA 1M4UA 3U10A 5LOVB 2UUAO 1Y76A 2PYJA 3C3TA 2QWPB 2BCCH 2Z0AA 1NS1A 5EIBD 5A9GA 3H01A 4GKJO 4BWAA 3KCYA 4J7JA 3OEEG 1PP9H 5LA6A 1XNRB 1K73W 1FXHA 5LP6B 1AI4A 2Q5ZA 1K8AW 3O65A 4CH6A 2DWEC 2Q0OC 3K9AA 2ITDC 2CAZC 2FB5A 4OX9B 3ZHQA 1YF2A 3ETEA 3WB2A 1ZSPA 3N2GB 3JAWB 2Y48A 3JAKA 3LDEA 4JI4B 4F6RA 5KMGB 1KKCA 4DUZO 4I50B 1A32A 2WLJA 2P4VA 1I7FA 3CRAA 3CHXA 3E83A 1WNSA 2F4VB 1TA8A 1SESA 4DR4B 3C3SA 5LBQA 2VQFO 3G71V 2YI8A 3WFVA 5EYPB 3HR0A 3JCZA 1VF6C 4GLXA 3BA8A 2QKAA 5DECA 3FAVB 4CH3A 3N2KA 4MVQA 4QPJA 3OUSA 1U96A 4GX5A 1VQKV 2ZXWB 1ZL8A 1L1FA 1MZFA 4AILC 2QWRB 3ASOB 5L3CA 2PI4A 4O4HA 2YXLA 1BT8A 2ITCC 3M7MX 5BMVB 1KU9A 1G1XB 1G4YB 3BHPA 3P3PA 3WB0A 4LC1A 2GTAA 1K7DA 4EFBA 1SF9A 3TETA 3J81N 3DXRB 1V9PA 1VEWA 4LWSA 1B6QA 1HNZB 2QJ1A 1P49A 3SPIA 4MVRA 4YHHB 3SJAC 1N36O 1D5NA 5E1AC 3ETGA 1VQ8V 2XNDG 4FFKA 2D3OW 3BCCH 4DV1B 2VRZA 4CZZA 3BVOA 3ETQA 4JYAB 4NTXA 3J80N 1NKDA 2GUZB 3IGAC 4IIJB 4R50A 5EC1C 2XHBA 5LMUB 3DC5A 5CN0A 4FLZA 1BQZA 1ORQC 1K92A 4X66O 1FYJA 1FFTB 2QM7A 3CXCU 1BZKA 4PA7A 4OPAA 5KHGA 1SKVA 3AEIA 4Q6GA 4WFEA 2CTWA 4LBEC 4JI2B 1FS0G 4LFCB 3H1JH 2EJRA 2YS8A 3X2QC 4JAAA 4ZI7A 5BZBA 2QTOA 5LHHA 5FNVB 3HKEA 3RN4A 3F7VC 1XUQA 3E8HA 3B4SA 1R1BA 4X1KA 2HVKC 2HFEC 3S3XA 4X65O 4DV7B 4DV2B 1RPRA 1S0VA 2XUMA 4O4IA 2DYRB 1S3JA 3ZMTA 1H38A 5IYBO 2YI9A 5IY5C 1V55C 1THZA 5KUMA 1GM9A 1MZEA 4JI7O 1Y76B 2ZINA 1Y66A 4WFFA 1M56C 2XASA 3CCSV 3JCUZ 3HB3B 3BABA 4HAMA 5LA6B 1AP6A 3RWRD 4ZIBA 2EIMC 5LGUA 4LF8B 3AG1B 4GKKB 1H2KA 3HKCA 1HNXO 4NTYA 5LMNB 3CMEV 1F7YA 5GTHZ 1EN4A 3QF7A 1M90W 2Y4TA 3AG3C 4O2BA 3EFFK 4LP8A 1KD1W 5LHGA 1MA1A 3RYIA 4WFHA 2HVJC 2DQ3A 4F6RB 4LF5B 1MABG 2ILMA 1XNRO 2QWNB 2X0LA 1YHQV 1TUEB 1MG1A 5KAFZ 3L73H 2JVDA 5GTIZ 3CRQA 5CA0A 4KHPO 2PUSA 4OX9O 2OT5A 3B77A 2ZKOA 4P30A 2DYSB 3C90A 5BR8B 5KX5A 1D5AA 2NNUA 2HLDG 4L8JA 3Q4HA 1VQ5V 1LNQA 3N2KB 4JAVA 3R65A 1ZL8B 3CE2A 2OTLV 4XDLA 3ZRWA 1PL4A 4O4HB 2ZIOA 3D3IA 2R9RB 4NTWA 2UUCB 4MTGA 1QLEB 2F4VO 2EILC 1SRYA 5KAIZ 3RVZA 2W0XA 3CS5A 4B3MB 2DW4A 2OIGA 1FJGB 4LWSB 4LF7B 2FMLA 1V54B 2ZD9A 3VQXA 4P2ZA 3SYAA 4NB5A 3THOA 1FXKC 5CBHA 1KUQA 4LNUA 2CGOA 5CBGA 5IJ9A 3RYCB 1GMGA 3L72H 2NR5A 1BGYH 3QO7A 1YZBA 3JYCA 1ZX3A 2N04A 4XDJA 3K79A 4FJCC 1SERA 1R3LC 2WLLB 1HNZO 4J7KA 2WLHA 4LR3A 4TV9A 2IW5A 2AGAA 4JF3A 1HWYA 1OCZB 2YIBD 3T1HB 4YHHO 1OZ0A 2Q8VA 3E2EA 3F5TA 5FPOA 3CSXA 1F4MA 2P5OA 1NBMG 2UUAB 3U11A 1VP7A 2FTKA 4D7TA 5KHKA 4DV1O 2QWQB 3G67A 1YDXA 3L71H 2YICA 1F23A 5IYZA 4J7ZA 2VWKA 4G27B 4MT8A 1S5LZ 1OHHG 5B1OA 4GKJB 3P32A 4IYIA 1NH2B 4L87A 3DGEA 3HKEB 4TV8A 1TVKB 1BSMA 1GN2A 4X1KB 3ABLB 1PM9A 4Z1VA 4XBFA 2JDIG 1P84F 2OWOA 1S76D 1ZUQA 3BA9A 5EBMC 3WG7C 4O4IB 4RUFA 2QR4A 5EBLC 4DK0A 4LFCO 3E89A 2Q4PA 1N4CA 2LFRA 4ABMA 4DR6O 2XAFA 4FLYA 1K4DC 1YXBA 3D36A 1VMGA 2PF4E 1ZTEA 1EFRG 1VQ6V 4MS2A 1MNGA 3J7AU 4F6EA 1YJNV 1NI8A 1YJWV 5B1AC 4UUJC 1IBKB 3ICXA 1EZVH 4D6TH 4DV7O 5BY1A 4DV2O 3SYQA 3AK1A 4PELA 3CX5F 5E79Z 1H2SB 3FFQA 3AG4C 2Q6AA 2Q69A 1GTOA 3JAWA 2ETNA 4IGGA 4O2BB 1RSOA 1I5YA 2HP8A 2IH1C 3RYIB 2AW9A 1QR9A 1KYOF 1R6KA 3OE7G 5B1NA 3CJHA 4I50A 3UKMA 4GX0A 2E5LB 3OMNB 5IJ0A 3ZJZA 4CH4A 1Q5OA 2CDYA 1AJQA 4LF8O 2ZDIA 2OCCB 4J10A 4DK1A 3JASA 5CA0B 4NKGB 3CD6V 2K9PA 5LMNO 3SGIA 2A3QA 2EIKB 5EK0A 4FFBB 5FPRA 1K5SA 4PI0A 4E4EA 1N36B 4UCSA 4CBCA 4EB6B 3ZMZA 4LF5O 3Q4HB 5DEDA 3ZEDA 1VQOV 2Y4UA 2PI5A 2CE4A 1LR1A 3RVYA 1R73A 1J95A 3G6EV 3K5LA 4TT3G 1R6NA 1UPGA 5B1BB 4CS3A 1SZTA 4X66B 4JZ2A 3OEHG 1RM1B 3EXAA 2JJ1G 1SQXH 4CH5A 2ZE8A 5BR8O 4JGSA 2LJ2A 3ZS8C 3JD4A 2PTMA 1N34B 1SS3A 2WSSG 4BAYA 2IBZH 3CCJV 2UUBB 3AK2A 4NVPA 2UXXA 1IVSA 4JASA 2GUZA 4UCUA 3D36C 4IIJA 2F66C 1FFXA 3E35A 1QCEA 2LP7A 2HJFC 5J9PC 1AJPA 4J42A 5LP6C 3E8BA 1R6TA 2ZNIA 3SJCC 4K35A 3RFRA 1FJGO 1VF5B 4LF7O 2JGDA 3B09A 4TV9B 1Q3EA 3MDSA 2C2AA 1CXZB 2L6LA 1WB8A 1F51A 2RDCA 2JRIA 4UB6Z 3RYFA 5IYZB 2YIAA 2M6YA 3CCEV 2Y69B 3H1LH 1DGSA 2YUAA 2YSUB 4TV8B 4JYBA 4JI0B 3RBZA 4K3AA 1W59A 3S3WA 2VWJA 1KP2A 4QE7A 2Q9LA 3T1HO 4B3SB 1Q6UA 1WP7A 1KKDA 4IT5A 3E86A 1B3QA 1PNKA 2AZ2A 1GRJA 2VS0A 2ZXWC 4I7ZB 3GWOA 2EULA 2ZNJA 4DV4O 3ASOC 3FB6C 3ZBHA 3ASNB 4H33A 2FYUH 2HKOA 3GB7C 2JS5A 2ZE7A 3QNEA 2CUGA 2GDSA 4WFGA 4KHPB 4DW1A 4UCOA 3F5WC 1Y4MA 5LL6Y 2DJVA 3AG2B 4MVSA 4PDVA 3RYHB 1Y74B 3CMAV 1RSOB 4MSWC 1ENVA 1M57B 5H9CA 1AB3A 5CB4B 4W4KA 1YI2V 4CC5A 2XAHA 1QLNA 3VBBA 1VQ9V 3CJHB 1IURA 5IJ0B 1IBKO 1H8HG 2YEVA 1H8EG 1K34A 2ZIMA 2FKXA 2P7TC 4YJ2B 4AI8A 1E79G 2ZR2A 2IU3A 1P4RA 3N27A 4UCTA 3JASB 1IZ3A 2DWDC 1XBLA 2WAMA 3A0RA 3B8MA 3SYOA 1O9HA 3ZRSA 1TGOA 2EX3A 3CXHF 3B2EE 4NYKA 1I5XA 1FXVA 4UCRA 2GSMB 1L8DA 2LO1A 4I5SA 3LSSA 1BS3A 1F4NA 1IX9A 3HKBA 1QHTA 2IU0A 2E5LO 1P7BA 1HNWO 4E2LA 1G6UA 4N23A 4JI6B 3LNNA 3QG5A 3T1YB 2QWOB 3ABKB 2CH7A 3ZRXA 4R6ZA 4PJ0Z 4I0XA 2L35A 2X7RB 4YJ3B 4K8XA 1YCIA 4H37A 3SR2C 3K03A 2DYRC 3FB7C 1D2DA 1OV9A 2LW1A 3RYCA 3MHSC 2F23A 1NTMH 3QO8A 1XOUA 3SPGA 4GX2A 3AG7A 1MMMA 3K9SA 4X62B 2QM4A 1DF5A 4YIPA 2D2CB 1Q86W 1FFXB 3ZHRA 3BFRA 2ZM6B 3FX7A 4ZHQA 2A06H 2JJ2G 1CPYA 4YIOA 3W7XA 2V4DA 2W6JG 2QA4V 1R3IC 2WLLA 3AG1C 5H5NA 1JJ2U 4FLXA 2UU9B 2Q0AA 2JGDB 3QTCA 4I9QA 4FZ0A 2Q7EA 1N34O 2UXBB 1EN5A 4DRXA 4DR6B 5GW7A 2UUBO 2V7QG 4UVAA 2M7WA 4WCEV 2OTJV 2RNBA 3RYFB 3T2MA 3KCXA 5L3EA 3K08A 1TVKA 4HYOA 4CC6A 2RJZA 3K0GA 3E8GA 2KB1A 3A8TA 4TOIA 4AQYO 4KP4A 3W7SA 2CTPA 2PZSA 3ZMVA 1Z5VA 5LYJB 4X64B 1BQ0A 4X8AA 4WF9V 1S72V 2GHYA 4KL1A 1J5EO 2DYSC 5IT9N 2JS3A 2O57A 2E74B 2FL4A 5LXTB 3LSQA 1ZWIC 4W4LA 4J9ZB 1TAEA 3VOUA 1QR8A 4BIOA 4OPHA 4JI0O 1YEWA 4ZOLA 2P22C 1ROPA 3OTOB 2BTQA 1NT2B 1JMKC 4C7UA 1Q90D 4B3SO 3FB5C 4DR5O 4DR1B 4TQDA 1H2GA 2WA3A 1V54C 1IBMB 4MVOA 5CMUA 2VQEO 4DXWA 3CC2V 1Q43A 1QVFU 1WA8A 3ZCCA 4RWUA 4MTXA 1GN6A 1Q8IA 5A2QN 2OYQA 4J41A 2YEVB 2DQ0A 1N33B 1N0NA 4MW3A 4GYCB 4FFBA 2K1EA 4YY3B 1GKFA 1SQGA 4LF9B 2IH3C 1OCZC 3JD1A 4EB6A 1I94O 4DO2A 2CGNA 3R66A 3H1KH 4LCUC 3HKBB 1XNQB 3ZHSA 1WPBA 5J2UB 2BTOA 4FLWA 2AXTZ 2F1MA 2E76B 4AHCA 4JYAO 3IC7A 1MSDA 1Z2GA 3GVMA 2CH7B 3ABLC 4PA3A 2IJKA 2UXNA 2WA4A 1NVPD 4I0XB 1JA8A 2QTSA 1MSWD 4FM2A 2Y0IA 4JAUA 3GWKC 3ZHTA 1NTKH 3SYPA 5DM6V 3WU2Z 4JYCA 3UM7A 3ZX6A 5LGTA 1AP5A 2HEPA 4DW0A 4ZKIA 1YTFD 4UB8Z 4BIZA 4JI6O 1DF4A 4PD4F 3T1YO 4GT1A 4U3FH 4ZHQB 1M9NA 1PPJH 4H44B 4K0KO 3RGBA 1VQNV 3HKDA 1K3EA 4PDRA 3P30A 5H6RA 1IBLB 3JARA 3UT5A 2XOKG 4B08A 2UXDB 4DRXB 1H2NA 3FYIB 4ASUG 3DC6A 4UFZA 4JI8B 2WLKA 4X62O 4ICGA 3K58A 1IXMA 3OT7A 1AROP 4TQFA 3JD2A 2ZM6O 4DV4B 1RP3B 4LF4O 1SC5B 4GX1A 4NXNB 2OCCC 1KQSU 2HHHO 2UU9O 1JOYA 2WWWA 2YC0A 2V1DA 3BPZA 3L9DA 2LFSA 2A9HA 2RMKB 4ZBMA 2EIKC 5KA6A 1P7GA 2UXBO 3FD9A 1NZ6A 5GONA 3AK3A 2X6CA 5CBFA 3KKYA 3OW2U 1WN7A 1BHBA 4PI2A 4YXWG 5B3SB 5JJEB 1G8MA 1XEQA 4ZOLB 5IYDO 3VQVA 5IYCO 2BTQB 2X6BA 2DOSA 4FK5C 3VQWA 5DN6G 4X64O 5B1BC 3L75H 1XMQB 2LQTA 3RT3C 1RM1C 3ABTA 1W0JG 3RYHA 1Y74A 4Z2WA 1Y67A 2ARHA 1URFA 4GUNA 5CB4A 1XL4A 1OCRB 3OUFA 1DK1A 1JJOA 1JQ0A 1GM8A 2Q73A 1HNWB 1R3JC 1WA8B 5JCOA 2HR3A 1XHXA 5EZYA 3OTOO 3JAMN 4YJ2A 2Q7GA 3K5MA 2AZ0A 1K9MW 1LUVA 5JH7B 2KSDA 1WLEA 1XREA 2X6AA 4DR1O 3BAAA 4P9PA 1IBMO 1BE3H 1M5IA 3OD4A 3E22A 3CC7V 4A5UB 3TXQA 4I9WA 3T4ZA 2XAJA 1JPXA 2HJDA 1HW7A 3K0DA 2KQXA 2Y69C 3CRCA 1OCOB 1N33O 1I0HA 4JI3O 4Q20A 5KLVH 3G6BA 3JATA 1N0JA 1Q7YW 4YY3O 4YJ3A 1WPXA 2JGUA 4IYHA 1SQVH 5HFMA 5EC2C 4LF9O 1NJIW 2W0FC 4JTCB 2RQ6A 5TISZ 3RW0A 1KECA 2XTAA 1QNMA 3OR6C 3UO3A 1XNQO 4JI1O 3I56V 4BW9A 1FPOA 5EBWC 4KXRA 1YJ9V 5KA5A 1VQPV 5EIBC 2ADPA 1SQFA 5JWPA 4AQYB 3ASNC 3OTFA 5IWAB 1QU7A 4TUYA 4EFEA 5K1PA 3SPJA 3APOA 3ZN0A 3HKDB 1J5EB 4BIUA 3JARB 3AG2C 3UT5B 2Q67A 1FD9A 4J9YB 5JJNB 4QJFB 1EZJA 1M57C 4O4LB 1KB9F 2PGGA 3LDDA 3A0BZ 4G2KA 4I55A 1VF6A 4RQEA 3UO2A 3DTUB 3A0HZ 1S77D 1AI6A 4UVBA 1VARA 1GK9A 5L3DA 5JQGA 5LYJA 4CS4A 5KUKA 2ZDIC 4JTDB 3U0ZA 4DR5B 1IBLO 1KBHA 1XDCA 5JVDA 2YXYA 2UXDO 4H0LB 5GONB 4B3RB 5LXTA 4JI8O 1NR1A 3E8FA 4F4LA 2VQEB 5KHIA 3K5NA 4LF6B 4JI5O 2PY5A 1BMFG 2ATKC 2BSKA 3CB2A 3NXSA 2Z3YA 4DV6O 4DUYO 4HBNA 2LGQA 3ABMB 1XI1A 5BXZA 4LFAB 3ABUA 4NXNO 3ABKC 3OMIB
chains in the Genus database with same CATH topology
4LF9O 1XMOO 1R6TA 2LW7A 4DV5O 4JI7O 4GKKO 2FKXA 1KUQA 1FJGO 4LFAO 4LF7O 3SDLA 4AQYO 1N32O 1G1XB 1XNQO 4JI1O 3J81N 1YZBA 1AILA 1XEQA 4NXMO 2JRIA 2DOSA 1J5EO 4X64O 2UUAO 5IT9N 1HNXO 1N36O 1F7YA 5LMUO 4LF8O 2E5LO 2Z0AA 1HNWO 1NS1A 3RT3C 1HNZO 4GKJO 2AGAA 1HR0O 5LMNO 1XMQO 4YHHO 3F5TA 5IWAO 4OPHA 3J80N 4JI0O 4JI4O 3O65A 4JI6O 3T1HO 4JI2O 4DV1O 1XNRO 3T1YO 1DK1A 4JYAO 4LF5O 4X66O 1FYJA 3OTOO 1D2DA 3JAMN 4B3SO 4DR5O 4KHPO 4OPAA 4DR2O 4OX9O 4K0KO 2ZKOA 4DV4O 2VQEO 4DR1O 4DR3O 2UUCO 4DUZO 4DR7O 4LFBO 1IBMO 4DR4O 1A32A 4LFCO 1X59A 5BR8O 4X62O 4A5UB 1IBLO 5A2QN 4DR6O 4B3MO 5FLXN 2UXDO 5LL6Y 1R1BA 2ZM6O 4JI8O 5H5NA 2DJVA 3J7AU 4JV5O 4JI5O 4X65O 4LF4O 2F4VO 4DV3O 2N74A 4B3RO 4DV6O 2VQFO 1AB3A 4B3TO 1N33O 4JI3O 4DUYO 1N34O 2HHHO 2UU9O 4DV0O 2UXCO 4LF6O 3M8AA 4DV7O 2UUBO 5BY1A 4DV2O 5BXZA 4YY3O 1I94O 1FKAO 4NXNO 2UXBO 3R66A 1IBKO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 O;  1XMO O;  1R6T A;  2LW7 A;  4DV5 O;  4JI7 O;  4GKK O;  2FKX A;  1KUQ A;  1FJG O;  4LFA O;  4LF7 O;  3SDL A;  4AQY O;  1N32 O;  1G1X B;  1XNQ O;  4JI1 O;  3J81 N;  1YZB A;  1AIL A;  1XEQ A;  4NXM O;  2JRI A;  2DOS A;  1J5E O;  4X64 O;  2UUA O;  5IT9 N;  1HNX O;  1N36 O;  1F7Y A;  5LMU O;  4LF8 O;  2E5L O;  2Z0A A;  1HNW O;  1NS1 A;  3RT3 C;  1HNZ O;  4GKJ O;  2AGA A;  1HR0 O;  5LMN O;  1XMQ O;  4YHH O;  3F5T A;  5IWA O;  4OPH A;  3J80 N;  4JI0 O;  4JI4 O;  3O65 A;  4JI6 O;  3T1H O;  4JI2 O;  4DV1 O;  1XNR O;  3T1Y O;  1DK1 A;  4JYA O;  4LF5 O;  4X66 O;  1FYJ A;  3OTO O;  1D2D A;  3JAM N;  4B3S O;  4DR5 O;  4KHP O;  4OPA A;  4DR2 O;  4OX9 O;  4K0K O;  2ZKO A;  4DV4 O;  2VQE O;  4DR1 O;  4DR3 O;  2UUC O;  4DUZ O;  4DR7 O;  4LFB O;  1IBM O;  4DR4 O;  1A32 A;  4LFC O;  1X59 A;  5BR8 O;  4X62 O;  4A5U B;  1IBL O;  5A2Q N;  4DR6 O;  4B3M O;  5FLX N;  2UXD O;  5LL6 Y;  1R1B A;  2ZM6 O;  4JI8 O;  5H5N A;  2DJV A;  3J7A U;  4JV5 O;  4JI5 O;  4X65 O;  4LF4 O;  2F4V O;  4DV3 O;  2N74 A;  4B3R O;  4DV6 O;  2VQF O;  1AB3 A;  4B3T O;  1N33 O;  4JI3 O;  4DUY O;  1N34 O;  2HHH O;  2UU9 O;  4DV0 O;  2UXC O;  4LF6 O;  3M8A A;  4DV7 O;  2UUB O;  5BY1 A;  4DV2 O;  5BXZ A;  4YY3 O;  1I94 O;  1FKA O;  4NXN O;  2UXB O;  3R66 A;  1IBK O; 
#chains in the Genus database with same CATH topology
 4UCV A;  1XMO O;  3G4S V;  1NR7 A;  1SA0 A;  4J11 A;  1N32 O;  3QO5 A;  1LUW A;  1OCC B;  4FMT A;  1PKX A;  4X1I B;  1I94 B;  4U7O A;  1AIL A;  4I4T B;  3EHB B;  1HP8 A;  2EIN B;  1BHA A;  5L3B A;  4O4J B;  3IFX A;  5EZY B;  2F93 B;  1XQ8 A;  4R7C A;  2QM8 A;  1S5J A;  3CP1 A;  1XMQ O;  2IM9 A;  4X1Y B;  3TJT A;  3F7Y C;  1SET A;  3OGI B;  4PV1 B;  4X20 B;  3ZMU A;  1US6 A;  2RN9 A;  2ZE5 A;  4GCZ A;  2IJJ A;  4N21 A;  2IJH A;  3E22 B;  2XT9 A;  1ZAU A;  1N8R W;  2MK3 A;  2EIJ B;  4PA4 A;  2G38 A;  4PA6 A;  5J2U A;  2E75 B;  2EJ7 A;  1AR4 A;  4DR7 B;  2P06 A;  2P4K A;  3FKS G;  1RFY A;  2KKW A;  3CWB H;  4G28 B;  3CCR V;  3JAT B;  1VIB A;  3K04 A;  2ZR3 A;  5F2V O;  4JV5 B;  4K0K B;  3B40 A;  4HNA B;  3MD0 A;  4FLT A;  4DV0 B;  2WPD G;  1ZLZ A;  4JPR A;  4EKW A;  1E1Q G;  2XAQ A;  2YDE A;  4CS2 A;  2QKS A;  1EBO A;  1Q81 W;  2OIE A;  4BR6 A;  1QBZ A;  2Z5U A;  4QE9 A;  1TUB B;  4J80 A;  1JCH A;  4LF4 B;  2AHZ A;  3PJS K;  4TUY B;  2HHH B;  3D3Q A;  5L3G A;  3TCU A;  3ML0 A;  3PN1 A;  1OJH A;  1SQB H;  3I55 V;  2YIB A;  1COW G;  2CTQ A;  1EM1 A;  5C8Y A;  1HR0 B;  4WBN A;  4U3J A;  4B7E A;  1YIJ V;  5CA1 A;  4I55 B;  4TSF G;  5IE9 A;  4LH7 A;  5IWA O;  4O2A B;  3WB1 A;  3HPL C;  3T4D A;  3CRM A;  4QIW F;  5JQG B;  2DE0 X;  1JX9 A;  4WFA V;  2AHY A;  2JEU A;  4DR2 B;  2QSA A;  1GN4 A;  5H6Q A;  5JVD B;  3CCV V;  4DR3 B;  3LSU A;  4LH6 A;  1DTO A;  5K1X A;  4IL6 Z;  1K4C C;  4LFB B;  2BSK B;  2QE7 G;  1FXK A;  4OXS A;  2XAG A;  4MVM A;  3SPC A;  3IC9 A;  5J2T B;  1GAX A;  3CCM V;  1QLE C;  2A79 B;  3ZHU A;  3QVN A;  1Y6X A;  4JTA B;  1L0N H;  4FM0 A;  4KFM A;  4B3T B;  1UJW B;  3K3W A;  1RPO A;  1SA0 B;  3ZHV A;  3OM3 B;  4B3R O;  2UXC O;  1K33 A;  2B1I A;  3LUT B;  1WJZ A;  4LF6 O;  3M8A A;  4FIP C;  3L70 H;  1PNL A;  3JSN A;  1FKA O;  4U7N A;  3LNM B;  1JFF A;  1NQT A;  3KG2 A;  4FVM A;  4X9Q A;  4LFA O;  3SYC A;  3X2Q B;  3L74 H;  2R9A A;  1L0L H;  2WLN A;  5B5E Z;  3JAK B;  4JI3 B;  3K06 A;  4NXM B;  4BW5 A;  5JH7 A;  1M93 A;  3BY6 A;  1VQL V;  1WAZ A;  3OAA G;  4MW8 A;  5JJJ B;  4IHJ A;  2DN9 A;  3FB8 C;  1PV0 A;  3I5D A;  2BOB C;  1GN3 A;  2ADQ B;  1W2B U;  4JI1 B;  4JZG A;  5LHI A;  1W0K G;  4P9O A;  5IY5 B;  1Z5W A;  3UQ8 A;  3JSL A;  3T1C A;  1V55 B;  3CPW U;  4RUE A;  4JI4 O;  3STL C;  4X88 A;  3H1I H;  2ZT9 B;  4RQF A;  4PDM A;  1M56 B;  1B04 A;  1WB7 A;  1JR9 A;  2BE3 A;  2EIM B;  1PD3 A;  4QPK A;  1NVP B;  1MOF A;  4PA9 A;  2QGN A;  3JD3 A;  2H94 A;  2YXH A;  1AR5 A;  1AI5 A;  3OR7 C;  3P3N A;  5B66 Z;  4R8C A;  3ZIA G;  1VQ7 V;  3IJ4 A;  4DR7 O;  2H8P C;  3AG3 B;  4DR4 O;  2ZQM A;  1BL8 A;  1YTF B;  1X59 A;  2OCH A;  3TXS A;  4FPP A;  2B1G A;  3FYE B;  5B3S C;  1CEZ A;  3G80 A;  4DV3 B;  3D8C A;  3JAL A;  3B8N A;  2Q68 A;  2H3O A;  2WLI A;  4JV5 O;  5C93 A;  3ZRV A;  4FM1 A;  2EZP A;  4DYL A;  5D5P A;  4KUM A;  1GO3 F;  2HG5 C;  4DV0 O;  5KHJ A;  4DV5 B;  5L3F A;  1SQQ H;  4O4L A;  1O9G A;  1XL6 A;  1OCR C;  2LW7 A;  4JI5 B;  5C8Y B;  4WBN B;  2W6I G;  2WLM A;  4U3J B;  3CCQ V;  3VQY A;  4DV6 B;  5CA1 B;  1AI7 A;  2GTS A;  4DUY B;  4FZ1 A;  1IXB A;  1GM7 A;  1QQC A;  3TGU H;  2A0L A;  2EZO A;  1JVM A;  2P90 A;  2F95 B;  3K5O A;  3MAQ A;  3O9O A;  3W7T A;  2KG7 A;  4ZI7 B;  1NH2 D;  1DLB A;  2B5U A;  5IDJ A;  1XMO B;  2QEX V;  2N05 A;  3A2F A;  1Q6I A;  2EIL B;  1N32 B;  5ITZ A;  5LMU O;  3K59 A;  4D7S A;  3KZI Z;  1YSC A;  1HR0 O;  5H2F Z;  3CYO A;  2CK3 G;  2MW2 B;  2F43 G;  4NR1 A;  1FXK B;  4RAI A;  3SJQ C;  4Z1M G;  4JI2 O;  1PL0 A;  5LOV A;  2Y0P A;  1U97 A;  1WP8 A;  3ZMS A;  1OCO C;  5D5Q A;  1E1R G;  1NTZ H;  2R72 A;  4RO2 A;  3IAY A;  1KMI Z;  3CRR A;  4QNH B;  2R70 A;  1HDJ A;  4DR2 O;  1KP3 A;  3ZN1 A;  4DUZ B;  1AJN A;  3M99 B;  5LP6 A;  4X1I A;  4MVZ A;  3LDC A;  4DR3 O;  4FLU A;  1X4T A;  2PYL A;  2NLJ C;  4LFB O;  4I4T A;  3HKC B;  3CCL V;  2R9I A;  1JFF B;  4O4J A;  3N2G A;  1K97 A;  4X89 A;  2VQF B;  4UV9 A;  1R3K C;  5KMG A;  2Q7H A;  2QKC A;  2NN4 A;  4B3T O;  4X1Y A;  4X20 A;  4IHJ B;  1YVW A;  1B06 A;  2JK5 C;  3NR7 A;  4TWK A;  1GH6 A;  1VQM V;  4K8Z A;  1BCC H;  4PHZ A;  4GKK O;  3WG7 B;  1XIL A;  3W7U A;  3SDL A;  4MVU A;  3APQ A;  3UCS C;  4MTO A;  2LGW A;  1QVG U;  2RCV A;  1UFI A;  5EYP A;  3SPH A;  5KX5 B;  4NXM O;  3FAV A;  2P6J A;  1IDS A;  1VF7 A;  3BEH A;  3JD0 A;  1FAF A;  3K57 A;  4HNA A;  5B1A B;  5BMV A;  3ZRW B;  4EEQ A;  3BRC A;  2P67 A;  2ODM A;  4JYY A;  3DXR A;  1SQP H;  2A7W A;  4WFB V;  3CCU V;  5KHH A;  5AG2 A;  3DSQ A;  3AG4 B;  4GZR B;  3H9V A;  1I08 A;  3OMA B;  1TUB A;  4HZ3 A;  3STZ C;  5CA3 A;  3OFN G;  3EVK A;  3ABM C;  4LNU B;  3JAL B;  5IJ9 B;  3H1H H;  2WLI B;  3OGC C;  1Q6H A;  1K5Q A;  2ZCE A;  2JEX A;  1SZX A;  5FL7 G;  2BOC C;  4UV8 A;  2UUC O;  1VQ4 V;  4PDL A;  5HFL A;  1M1K W;  1OCC C;  3MHH C;  4FLV A;  2IJI A;  4X65 B;  4B3M O;  5FLX N;  2GV9 A;  3TK1 A;  3ETD A;  5LGN A;  1XHZ A;  4H13 B;  1Q82 W;  2E3C A;  1S5H C;  1KC8 W;  1CP9 A;  2EIN C;  2YID A;  5JCO C;  2B9Z A;  1H2M A;  2JIZ G;  3SJB C;  4DV3 O;  4O2A A;  3CC4 V;  2N74 A;  1T5E A;  1YIT V;  2DMX A;  1PNM A;  4JI7 B;  1EN6 A;  2KG7 B;  2QDO A;  5FNV A;  4B7K A;  4UXN A;  4DV5 O;  5ITZ B;  1AR1 B;  1H2L A;  4QGP A;  3CEI A;  4UVC A;  2UXC B;  2CTR A;  2EBO A;  2GBO A;  1AVM A;  2ZE6 A;  1NU1 H;  3W7W A;  2EIJ C;  1HNX B;  5J2T A;  4MTF A;  4OGQ B;  4XDK A;  1M4U A;  3U10 A;  5LOV B;  2UUA O;  1Y76 A;  2PYJ A;  3C3T A;  2QWP B;  2BCC H;  2Z0A A;  1NS1 A;  5EIB D;  5A9G A;  3H01 A;  4GKJ O;  4BWA A;  3KCY A;  4J7J A;  3OEE G;  1PP9 H;  5LA6 A;  1XNR B;  1K73 W;  1FXH A;  5LP6 B;  1AI4 A;  2Q5Z A;  1K8A W;  3O65 A;  4CH6 A;  2DWE C;  2Q0O C;  3K9A A;  2ITD C;  2CAZ C;  2FB5 A;  4OX9 B;  3ZHQ A;  1YF2 A;  3ETE A;  3WB2 A;  1ZSP A;  3N2G B;  3JAW B;  2Y48 A;  3JAK A;  3LDE A;  4JI4 B;  4F6R A;  5KMG B;  1KKC A;  4DUZ O;  4I50 B;  1A32 A;  2WLJ A;  2P4V A;  1I7F A;  3CRA A;  3CHX A;  3E83 A;  1WNS A;  2F4V B;  1TA8 A;  1SES A;  4DR4 B;  3C3S A;  5LBQ A;  2VQF O;  3G71 V;  2YI8 A;  3WFV A;  5EYP B;  3HR0 A;  3JCZ A;  1VF6 C;  4GLX A;  3BA8 A;  2QKA A;  5DEC A;  3FAV B;  4CH3 A;  3N2K A;  4MVQ A;  4QPJ A;  3OUS A;  1U96 A;  4GX5 A;  1VQK V;  2ZXW B;  1ZL8 A;  1L1F A;  1MZF A;  4AIL C;  2QWR B;  3ASO B;  5L3C A;  2PI4 A;  4O4H A;  2YXL A;  1BT8 A;  2ITC C;  3M7M X;  5BMV B;  1KU9 A;  1G1X B;  1G4Y B;  3BHP A;  3P3P A;  3WB0 A;  4LC1 A;  2GTA A;  1K7D A;  4EFB A;  1SF9 A;  3TET A;  3J81 N;  3DXR B;  1V9P A;  1VEW A;  4LWS A;  1B6Q A;  1HNZ B;  2QJ1 A;  1P49 A;  3SPI A;  4MVR A;  4YHH B;  3SJA C;  1N36 O;  1D5N A;  5E1A C;  3ETG A;  1VQ8 V;  2XND G;  4FFK A;  2D3O W;  3BCC H;  4DV1 B;  2VRZ A;  4CZZ A;  3BVO A;  3ETQ A;  4JYA B;  4NTX A;  3J80 N;  1NKD A;  2GUZ B;  3IGA C;  4IIJ B;  4R50 A;  5EC1 C;  2XHB A;  5LMU B;  3DC5 A;  5CN0 A;  4FLZ A;  1BQZ A;  1ORQ C;  1K92 A;  4X66 O;  1FYJ A;  1FFT B;  2QM7 A;  3CXC U;  1BZK A;  4PA7 A;  4OPA A;  5KHG A;  1SKV A;  3AEI A;  4Q6G A;  4WFE A;  2CTW A;  4LBE C;  4JI2 B;  1FS0 G;  4LFC B;  3H1J H;  2EJR A;  2YS8 A;  3X2Q C;  4JAA A;  4ZI7 A;  5BZB A;  2QTO A;  5LHH A;  5FNV B;  3HKE A;  3RN4 A;  3F7V C;  1XUQ A;  3E8H A;  3B4S A;  1R1B A;  4X1K A;  2HVK C;  2HFE C;  3S3X A;  4X65 O;  4DV7 B;  4DV2 B;  1RPR A;  1S0V A;  2XUM A;  4O4I A;  2DYR B;  1S3J A;  3ZMT A;  1H38 A;  5IYB O;  2YI9 A;  5IY5 C;  1V55 C;  1THZ A;  5KUM A;  1GM9 A;  1MZE A;  4JI7 O;  1Y76 B;  2ZIN A;  1Y66 A;  4WFF A;  1M56 C;  2XAS A;  3CCS V;  3JCU Z;  3HB3 B;  3BAB A;  4HAM A;  5LA6 B;  1AP6 A;  3RWR D;  4ZIB A;  2EIM C;  5LGU A;  4LF8 B;  3AG1 B;  4GKK B;  1H2K A;  3HKC A;  1HNX O;  4NTY A;  5LMN B;  3CME V;  1F7Y A;  5GTH Z;  1EN4 A;  3QF7 A;  1M90 W;  2Y4T A;  3AG3 C;  4O2B A;  3EFF K;  4LP8 A;  1KD1 W;  5LHG A;  1MA1 A;  3RYI A;  4WFH A;  2HVJ C;  2DQ3 A;  4F6R B;  4LF5 B;  1MAB G;  2ILM A;  1XNR O;  2QWN B;  2X0L A;  1YHQ V;  1TUE B;  1MG1 A;  5KAF Z;  3L73 H;  2JVD A;  5GTI Z;  3CRQ A;  5CA0 A;  4KHP O;  2PUS A;  4OX9 O;  2OT5 A;  3B77 A;  2ZKO A;  4P30 A;  2DYS B;  3C90 A;  5BR8 B;  5KX5 A;  1D5A A;  2NNU A;  2HLD G;  4L8J A;  3Q4H A;  1VQ5 V;  1LNQ A;  3N2K B;  4JAV A;  3R65 A;  1ZL8 B;  3CE2 A;  2OTL V;  4XDL A;  3ZRW A;  1PL4 A;  4O4H B;  2ZIO A;  3D3I A;  2R9R B;  4NTW A;  2UUC B;  4MTG A;  1QLE B;  2F4V O;  2EIL C;  1SRY A;  5KAI Z;  3RVZ A;  2W0X A;  3CS5 A;  4B3M B;  2DW4 A;  2OIG A;  1FJG B;  4LWS B;  4LF7 B;  2FML A;  1V54 B;  2ZD9 A;  3VQX A;  4P2Z A;  3SYA A;  4NB5 A;  3THO A;  1FXK C;  5CBH A;  1KUQ A;  4LNU A;  2CGO A;  5CBG A;  5IJ9 A;  3RYC B;  1GMG A;  3L72 H;  2NR5 A;  1BGY H;  3QO7 A;  1YZB A;  3JYC A;  1ZX3 A;  2N04 A;  4XDJ A;  3K79 A;  4FJC C;  1SER A;  1R3L C;  2WLL B;  1HNZ O;  4J7K A;  2WLH A;  4LR3 A;  4TV9 A;  2IW5 A;  2AGA A;  4JF3 A;  1HWY A;  1OCZ B;  2YIB D;  3T1H B;  4YHH O;  1OZ0 A;  2Q8V A;  3E2E A;  3F5T A;  5FPO A;  3CSX A;  1F4M A;  2P5O A;  1NBM G;  2UUA B;  3U11 A;  1VP7 A;  2FTK A;  4D7T A;  5KHK A;  4DV1 O;  2QWQ B;  3G67 A;  1YDX A;  3L71 H;  2YIC A;  1F23 A;  5IYZ A;  4J7Z A;  2VWK A;  4G27 B;  4MT8 A;  1S5L Z;  1OHH G;  5B1O A;  4GKJ B;  3P32 A;  4IYI A;  1NH2 B;  4L87 A;  3DGE A;  3HKE B;  4TV8 A;  1TVK B;  1BSM A;  1GN2 A;  4X1K B;  3ABL B;  1PM9 A;  4Z1V A;  4XBF A;  2JDI G;  1P84 F;  2OWO A;  1S76 D;  1ZUQ A;  3BA9 A;  5EBM C;  3WG7 C;  4O4I B;  4RUF A;  2QR4 A;  5EBL C;  4DK0 A;  4LFC O;  3E89 A;  2Q4P A;  1N4C A;  2LFR A;  4ABM A;  4DR6 O;  2XAF A;  4FLY A;  1K4D C;  1YXB A;  3D36 A;  1VMG A;  2PF4 E;  1ZTE A;  1EFR G;  1VQ6 V;  4MS2 A;  1MNG A;  3J7A U;  4F6E A;  1YJN V;  1NI8 A;  1YJW V;  5B1A C;  4UUJ C;  1IBK B;  3ICX A;  1EZV H;  4D6T H;  4DV7 O;  5BY1 A;  4DV2 O;  3SYQ A;  3AK1 A;  4PEL A;  3CX5 F;  5E79 Z;  1H2S B;  3FFQ A;  3AG4 C;  2Q6A A;  2Q69 A;  1GTO A;  3JAW A;  2ETN A;  4IGG A;  4O2B B;  1RSO A;  1I5Y A;  2HP8 A;  2IH1 C;  3RYI B;  2AW9 A;  1QR9 A;  1KYO F;  1R6K A;  3OE7 G;  5B1N A;  3CJH A;  4I50 A;  3UKM A;  4GX0 A;  2E5L B;  3OMN B;  5IJ0 A;  3ZJZ A;  4CH4 A;  1Q5O A;  2CDY A;  1AJQ A;  4LF8 O;  2ZDI A;  2OCC B;  4J10 A;  4DK1 A;  3JAS A;  5CA0 B;  4NKG B;  3CD6 V;  2K9P A;  5LMN O;  3SGI A;  2A3Q A;  2EIK B;  5EK0 A;  4FFB B;  5FPR A;  1K5S A;  4PI0 A;  4E4E A;  1N36 B;  4UCS A;  4CBC A;  4EB6 B;  3ZMZ A;  4LF5 O;  3Q4H B;  5DED A;  3ZED A;  1VQO V;  2Y4U A;  2PI5 A;  2CE4 A;  1LR1 A;  3RVY A;  1R73 A;  1J95 A;  3G6E V;  3K5L A;  4TT3 G;  1R6N A;  1UPG A;  5B1B B;  4CS3 A;  1SZT A;  4X66 B;  4JZ2 A;  3OEH G;  1RM1 B;  3EXA A;  2JJ1 G;  1SQX H;  4CH5 A;  2ZE8 A;  5BR8 O;  4JGS A;  2LJ2 A;  3ZS8 C;  3JD4 A;  2PTM A;  1N34 B;  1SS3 A;  2WSS G;  4BAY A;  2IBZ H;  3CCJ V;  2UUB B;  3AK2 A;  4NVP A;  2UXX A;  1IVS A;  4JAS A;  2GUZ A;  4UCU A;  3D36 C;  4IIJ A;  2F66 C;  1FFX A;  3E35 A;  1QCE A;  2LP7 A;  2HJF C;  5J9P C;  1AJP A;  4J42 A;  5LP6 C;  3E8B A;  1R6T A;  2ZNI A;  3SJC C;  4K35 A;  3RFR A;  1FJG O;  1VF5 B;  4LF7 O;  2JGD A;  3B09 A;  4TV9 B;  1Q3E A;  3MDS A;  2C2A A;  1CXZ B;  2L6L A;  1WB8 A;  1F51 A;  2RDC A;  2JRI A;  4UB6 Z;  3RYF A;  5IYZ B;  2YIA A;  2M6Y A;  3CCE V;  2Y69 B;  3H1L H;  1DGS A;  2YUA A;  2YSU B;  4TV8 B;  4JYB A;  4JI0 B;  3RBZ A;  4K3A A;  1W59 A;  3S3W A;  2VWJ A;  1KP2 A;  4QE7 A;  2Q9L A;  3T1H O;  4B3S B;  1Q6U A;  1WP7 A;  1KKD A;  4IT5 A;  3E86 A;  1B3Q A;  1PNK A;  2AZ2 A;  1GRJ A;  2VS0 A;  2ZXW C;  4I7Z B;  3GWO A;  2EUL A;  2ZNJ A;  4DV4 O;  3ASO C;  3FB6 C;  3ZBH A;  3ASN B;  4H33 A;  2FYU H;  2HKO A;  3GB7 C;  2JS5 A;  2ZE7 A;  3QNE A;  2CUG A;  2GDS A;  4WFG A;  4KHP B;  4DW1 A;  4UCO A;  3F5W C;  1Y4M A;  5LL6 Y;  2DJV A;  3AG2 B;  4MVS A;  4PDV A;  3RYH B;  1Y74 B;  3CMA V;  1RSO B;  4MSW C;  1ENV A;  1M57 B;  5H9C A;  1AB3 A;  5CB4 B;  4W4K A;  1YI2 V;  4CC5 A;  2XAH A;  1QLN A;  3VBB A;  1VQ9 V;  3CJH B;  1IUR A;  5IJ0 B;  1IBK O;  1H8H G;  2YEV A;  1H8E G;  1K34 A;  2ZIM A;  2FKX A;  2P7T C;  4YJ2 B;  4AI8 A;  1E79 G;  2ZR2 A;  2IU3 A;  1P4R A;  3N27 A;  4UCT A;  3JAS B;  1IZ3 A;  2DWD C;  1XBL A;  2WAM A;  3A0R A;  3B8M A;  3SYO A;  1O9H A;  3ZRS A;  1TGO A;  2EX3 A;  3CXH F;  3B2E E;  4NYK A;  1I5X A;  1FXV A;  4UCR A;  2GSM B;  1L8D A;  2LO1 A;  4I5S A;  3LSS A;  1BS3 A;  1F4N A;  1IX9 A;  3HKB A;  1QHT A;  2IU0 A;  2E5L O;  1P7B A;  1HNW O;  4E2L A;  1G6U A;  4N23 A;  4JI6 B;  3LNN A;  3QG5 A;  3T1Y B;  2QWO B;  3ABK B;  2CH7 A;  3ZRX A;  4R6Z A;  4PJ0 Z;  4I0X A;  2L35 A;  2X7R B;  4YJ3 B;  4K8X A;  1YCI A;  4H37 A;  3SR2 C;  3K03 A;  2DYR C;  3FB7 C;  1D2D A;  1OV9 A;  2LW1 A;  3RYC A;  3MHS C;  2F23 A;  1NTM H;  3QO8 A;  1XOU A;  3SPG A;  4GX2 A;  3AG7 A;  1MMM A;  3K9S A;  4X62 B;  2QM4 A;  1DF5 A;  4YIP A;  2D2C B;  1Q86 W;  1FFX B;  3ZHR A;  3BFR A;  2ZM6 B;  3FX7 A;  4ZHQ A;  2A06 H;  2JJ2 G;  1CPY A;  4YIO A;  3W7X A;  2V4D A;  2W6J G;  2QA4 V;  1R3I C;  2WLL A;  3AG1 C;  5H5N A;  1JJ2 U;  4FLX A;  2UU9 B;  2Q0A A;  2JGD B;  3QTC A;  4I9Q A;  4FZ0 A;  2Q7E A;  1N34 O;  2UXB B;  1EN5 A;  4DRX A;  4DR6 B;  5GW7 A;  2UUB O;  2V7Q G;  4UVA A;  2M7W A;  4WCE V;  2OTJ V;  2RNB A;  3RYF B;  3T2M A;  3KCX A;  5L3E A;  3K08 A;  1TVK A;  4HYO A;  4CC6 A;  2RJZ A;  3K0G A;  3E8G A;  2KB1 A;  3A8T A;  4TOI A;  4AQY O;  4KP4 A;  3W7S A;  2CTP A;  2PZS A;  3ZMV A;  1Z5V A;  5LYJ B;  4X64 B;  1BQ0 A;  4X8A A;  4WF9 V;  1S72 V;  2GHY A;  4KL1 A;  1J5E O;  2DYS C;  5IT9 N;  2JS3 A;  2O57 A;  2E74 B;  2FL4 A;  5LXT B;  3LSQ A;  1ZWI C;  4W4L A;  4J9Z B;  1TAE A;  3VOU A;  1QR8 A;  4BIO A;  4OPH A;  4JI0 O;  1YEW A;  4ZOL A;  2P22 C;  1ROP A;  3OTO B;  2BTQ A;  1NT2 B;  1JMK C;  4C7U A;  1Q90 D;  4B3S O;  3FB5 C;  4DR5 O;  4DR1 B;  4TQD A;  1H2G A;  2WA3 A;  1V54 C;  1IBM B;  4MVO A;  5CMU A;  2VQE O;  4DXW A;  3CC2 V;  1Q43 A;  1QVF U;  1WA8 A;  3ZCC A;  4RWU A;  4MTX A;  1GN6 A;  1Q8I A;  5A2Q N;  2OYQ A;  4J41 A;  2YEV B;  2DQ0 A;  1N33 B;  1N0N A;  4MW3 A;  4GYC B;  4FFB A;  2K1E A;  4YY3 B;  1GKF A;  1SQG A;  4LF9 B;  2IH3 C;  1OCZ C;  3JD1 A;  4EB6 A;  1I94 O;  4DO2 A;  2CGN A;  3R66 A;  3H1K H;  4LCU C;  3HKB B;  1XNQ B;  3ZHS A;  1WPB A;  5J2U B;  2BTO A;  4FLW A;  2AXT Z;  2F1M A;  2E76 B;  4AHC A;  4JYA O;  3IC7 A;  1MSD A;  1Z2G A;  3GVM A;  2CH7 B;  3ABL C;  4PA3 A;  2IJK A;  2UXN A;  2WA4 A;  1NVP D;  4I0X B;  1JA8 A;  2QTS A;  1MSW D;  4FM2 A;  2Y0I A;  4JAU A;  3GWK C;  3ZHT A;  1NTK H;  3SYP A;  5DM6 V;  3WU2 Z;  4JYC A;  3UM7 A;  3ZX6 A;  5LGT A;  1AP5 A;  2HEP A;  4DW0 A;  4ZKI A;  1YTF D;  4UB8 Z;  4BIZ A;  4JI6 O;  1DF4 A;  4PD4 F;  3T1Y O;  4GT1 A;  4U3F H;  4ZHQ B;  1M9N A;  1PPJ H;  4H44 B;  4K0K O;  3RGB A;  1VQN V;  3HKD A;  1K3E A;  4PDR A;  3P30 A;  5H6R A;  1IBL B;  3JAR A;  3UT5 A;  2XOK G;  4B08 A;  2UXD B;  4DRX B;  1H2N A;  3FYI B;  4ASU G;  3DC6 A;  4UFZ A;  4JI8 B;  2WLK A;  4X62 O;  4ICG A;  3K58 A;  1IXM A;  3OT7 A;  1ARO P;  4TQF A;  3JD2 A;  2ZM6 O;  4DV4 B;  1RP3 B;  4LF4 O;  1SC5 B;  4GX1 A;  4NXN B;  2OCC C;  1KQS U;  2HHH O;  2UU9 O;  1JOY A;  2WWW A;  2YC0 A;  2V1D A;  3BPZ A;  3L9D A;  2LFS A;  2A9H A;  2RMK B;  4ZBM A;  2EIK C;  5KA6 A;  1P7G A;  2UXB O;  3FD9 A;  1NZ6 A;  5GON A;  3AK3 A;  2X6C A;  5CBF A;  3KKY A;  3OW2 U;  1WN7 A;  1BHB A;  4PI2 A;  4YXW G;  5B3S B;  5JJE B;  1G8M A;  1XEQ A;  4ZOL B;  5IYD O;  3VQV A;  5IYC O;  2BTQ B;  2X6B A;  2DOS A;  4FK5 C;  3VQW A;  5DN6 G;  4X64 O;  5B1B C;  3L75 H;  1XMQ B;  2LQT A;  3RT3 C;  1RM1 C;  3ABT A;  1W0J G;  3RYH A;  1Y74 A;  4Z2W A;  1Y67 A;  2ARH A;  1URF A;  4GUN A;  5CB4 A;  1XL4 A;  1OCR B;  3OUF A;  1DK1 A;  1JJO A;  1JQ0 A;  1GM8 A;  2Q73 A;  1HNW B;  1R3J C;  1WA8 B;  5JCO A;  2HR3 A;  1XHX A;  5EZY A;  3OTO O;  3JAM N;  4YJ2 A;  2Q7G A;  3K5M A;  2AZ0 A;  1K9M W;  1LUV A;  5JH7 B;  2KSD A;  1WLE A;  1XRE A;  2X6A A;  4DR1 O;  3BAA A;  4P9P A;  1IBM O;  1BE3 H;  1M5I A;  3OD4 A;  3E22 A;  3CC7 V;  4A5U B;  3TXQ A;  4I9W A;  3T4Z A;  2XAJ A;  1JPX A;  2HJD A;  1HW7 A;  3K0D A;  2KQX A;  2Y69 C;  3CRC A;  1OCO B;  1N33 O;  1I0H A;  4JI3 O;  4Q20 A;  5KLV H;  3G6B A;  3JAT A;  1N0J A;  1Q7Y W;  4YY3 O;  4YJ3 A;  1WPX A;  2JGU A;  4IYH A;  1SQV H;  5HFM A;  5EC2 C;  4LF9 O;  1NJI W;  2W0F C;  4JTC B;  2RQ6 A;  5TIS Z;  3RW0 A;  1KEC A;  2XTA A;  1QNM A;  3OR6 C;  3UO3 A;  1XNQ O;  4JI1 O;  3I56 V;  4BW9 A;  1FPO A;  5EBW C;  4KXR A;  1YJ9 V;  5KA5 A;  1VQP V;  5EIB C;  2ADP A;  1SQF A;  5JWP A;  4AQY B;  3ASN C;  3OTF A;  5IWA B;  1QU7 A;  4TUY A;  4EFE A;  5K1P A;  3SPJ A;  3APO A;  3ZN0 A;  3HKD B;  1J5E B;  4BIU A;  3JAR B;  3AG2 C;  3UT5 B;  2Q67 A;  1FD9 A;  4J9Y B;  5JJN B;  4QJF B;  1EZJ A;  1M57 C;  4O4L B;  1KB9 F;  2PGG A;  3LDD A;  3A0B Z;  4G2K A;  4I55 A;  1VF6 A;  4RQE A;  3UO2 A;  3DTU B;  3A0H Z;  1S77 D;  1AI6 A;  4UVB A;  1VAR A;  1GK9 A;  5L3D A;  5JQG A;  5LYJ A;  4CS4 A;  5KUK A;  2ZDI C;  4JTD B;  3U0Z A;  4DR5 B;  1IBL O;  1KBH A;  1XDC A;  5JVD A;  2YXY A;  2UXD O;  4H0L B;  5GON B;  4B3R B;  5LXT A;  4JI8 O;  1NR1 A;  3E8F A;  4F4L A;  2VQE B;  5KHI A;  3K5N A;  4LF6 B;  4JI5 O;  2PY5 A;  1BMF G;  2ATK C;  2BSK A;  3CB2 A;  3NXS A;  2Z3Y A;  4DV6 O;  4DUY O;  4HBN A;  2LGQ A;  3ABM B;  1XI1 A;  5BXZ A;  4LFA B;  3ABU A;  4NXN O;  3ABK C;  3OMI B; 
#chains in the Genus database with same CATH homology
 4LF9 O;  1XMO O;  1R6T A;  2LW7 A;  4DV5 O;  4JI7 O;  4GKK O;  2FKX A;  1KUQ A;  1FJG O;  4LFA O;  4LF7 O;  3SDL A;  4AQY O;  1N32 O;  1G1X B;  1XNQ O;  4JI1 O;  3J81 N;  1YZB A;  1AIL A;  1XEQ A;  4NXM O;  2JRI A;  2DOS A;  1J5E O;  4X64 O;  2UUA O;  5IT9 N;  1HNX O;  1N36 O;  1F7Y A;  5LMU O;  4LF8 O;  2E5L O;  2Z0A A;  1HNW O;  1NS1 A;  3RT3 C;  1HNZ O;  4GKJ O;  2AGA A;  1HR0 O;  5LMN O;  1XMQ O;  4YHH O;  3F5T A;  5IWA O;  4OPH A;  3J80 N;  4JI0 O;  4JI4 O;  3O65 A;  4JI6 O;  3T1H O;  4JI2 O;  4DV1 O;  1XNR O;  3T1Y O;  1DK1 A;  4JYA O;  4LF5 O;  4X66 O;  1FYJ A;  3OTO O;  1D2D A;  3JAM N;  4B3S O;  4DR5 O;  4KHP O;  4OPA A;  4DR2 O;  4OX9 O;  4K0K O;  2ZKO A;  4DV4 O;  2VQE O;  4DR1 O;  4DR3 O;  2UUC O;  4DUZ O;  4DR7 O;  4LFB O;  1IBM O;  4DR4 O;  1A32 A;  4LFC O;  1X59 A;  5BR8 O;  4X62 O;  4A5U B;  1IBL O;  5A2Q N;  4DR6 O;  4B3M O;  5FLX N;  2UXD O;  5LL6 Y;  1R1B A;  2ZM6 O;  4JI8 O;  5H5N A;  2DJV A;  3J7A U;  4JV5 O;  4JI5 O;  4X65 O;  4LF4 O;  2F4V O;  4DV3 O;  2N74 A;  4B3R O;  4DV6 O;  2VQF O;  1AB3 A;  4B3T O;  1N33 O;  4JI3 O;  4DUY O;  1N34 O;  2HHH O;  2UU9 O;  4DV0 O;  2UXC O;  4LF6 O;  3M8A A;  4DV7 O;  2UUB O;  5BY1 A;  4DV2 O;  5BXZ A;  4YY3 O;  1I94 O;  1FKA O;  4NXN O;  2UXB O;  3R66 A;  1IBK O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...