3M8AA

Crystal structure of swine flu virus ns1 n-terminal rna binding domain from h1n1 influenza a/california/07/2009
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
71
structure length
71
Chain Sequence
MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLVGKQIVEWILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Swine Flu Virus NS1 N-Terminal RNA Binding Domain from H1N1 Influenza A/California/07/2009
rcsb
source organism Influenza a virus
molecule tags Viral protein
molecule keywords Nonstructural protein 1
total genus 28
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3m8aA00
2VQFO 2E5LO 4DV5O 1IBLO 5FLXN 4X66O 2HHHO 4GKJO 2UUAO 4A5UB 4JI3O 1DK1A 4OPAA 4JI1O 4GKKO 4DV7O 4DR2O 1F7YA 4DR1O 4LF7O 1XNRO 1HR0O 5BR8O 1XEQA 1N36O 1D2DA 3SDLA 5LL6Y 1I94O 4JI7O 4LFAO 4B3MO 5H5NA 4NXMO 2UU9O 3M8AA 4JI2O 4B3RO 1J5EO 1N32O 2ZM6O 1KUQA 2JRIA 5IWAO 4LF4O 4LF5O 4NXNO 4DR6O 1IBKO 1XNQO 4LF6O 2LW7A 4JI6O 1HNXO 3T1HO 1NS1A 5BXZA 4DV0O 3O65A 4DV2O 4DUZO 4DV1O 4X62O 4JI4O 2AGAA 4DV6O 5IT9N 4B3SO 2F4VO 4JV5O 1HNZO 1X59A 2UUBO 4KHPO 3OTOO 4OPHA 4LF8O 5BY1A 4LFBO 2UXBO 4JI5O 1A32A 4DR5O 2DJVA 1R1BA 5A2QN 4AQYO 4DR3O 1XMOO 1AB3A 4YHHO 1N34O 1YZBA 3RT3C 1N33O 1IBMO 3J7AU 1HNWO 1AILA 3JAMN 4YY3O 4DV4O 1FKAO 2ZKOA 2UXCO 4DR7O 1FYJA 1R6TA 1XMQO 3R66A 3J80N 5LMNO 4B3TO 4LF9O 3F5TA 5LMUO 2DOSA 4DR4O 4JI0O 1FJGO 4LFCO 2N74A 4JYAO 4DUYO 4OX9O 2Z0AA 4X64O 1G1XB 4X65O 4JI8O 3J81N 3T1YO 2UUCO 2VQEO 4DV3O 4K0KO 2UXDO 2FKXA
chains in the Genus database with same CATH superfamily
5KLVH 3WB2A 5LXTB 1B04A 3CYOA 3RYFB 2RQ6A 4EFEA 2YSUB 5LGTA 4O4HB 4DR1B 2ZDIC 1XNRO 2GDSA 3U11A 3ZN1A 1XQ8A 4DV7B 5L3EA 1FPOA 1NT2B 4YJ3B 4XBFA 2Q8VA 1Y67A 3UKMA 1Z2GA 2UU9O 4TT3G 1FS0G 3C90A 3JASA 4PDLA 2DYSB 2CTPA 3JATB 5KHJA 1DF5A 3O65A 5IYDO 2Q7GA 4DUZO 2EJRA 4FM1A 2BOCC 1GN3A 4UCUA 2PYLA 3SYAA 2XAJA 1BCCH 1PNLA 4MVUA 4DV4B 2WSSG 1VF6C 3W7WA 4HZ3A 3CCVV 1A32A 4EB6A 1N0JA 4JAVA 5KHHA 1XMOO 4CC5A 2XOKG 2BTQB 4UFZA 1VQLV 4QGPA 4NVPA 2WA3A 4UB8Z 3G6EV 5LMNB 4UCVA 3ASOC 2IH1C 3ML0A 2OYQA 1AILA 2DWEC 4DR2B 4D6TH 3TCUA 2L35A 3KZIZ 1FJGO 3IFXA 4PI2A 3JARA 1R3IC 3JALA 1IXMA 3GVMA 3ZRWB 1E1RG 3CMAV 3T1YO 3ETDA 4CBCA 4K0KO 1EN4A 1Y76B 5B66Z 2DYRC 3OT7A 5JWPA 1EM1A 1PKXA 1OHHG 1OCRB 4PA4A 2EIKC 1W0JG 1YVWA 4BAYA 4X8AA 1UPGA 3WFVA 4P2ZA 3ZMSA 4R8CA 2OCCC 4LFAO 2W0XA 2B9ZA 1R3JC 5LYJB 3CJHA 3CRRA 3OGCC 1J5EO 2R72A 4CC6A 2QA4V 1DGSA 2DMXA 1Y66A 2JGUA 2O57A 4DV2B 2PF4E 1TUEB 4JI6O 4LFAB 3I5DA 2HJFC 1EZJA 1VQ5V 4JYBA 1AROP 2EZOA 5EZYA 4MVSA 1XOUA 2EZPA 4DV6O 3E2EA 3EXAA 2KQXA 2RCVA 1NTKH 3ABUA 1N0NA 4CH5A 3SPCA 3MHSC 3VBBA 3K5MA 4OGQB 4MVMA 1GK9A 3JCZA 2HEPA 4YHHO 1RPOA 1N34O 3HKEB 3JAKA 2IU0A 3P32A 1B3QA 1ZL8A 2LFRA 4BW5A 4FK5C 4DV4O 2ZE7A 4DR7O 2EBOA 4FLZA 3FYEB 5LMNO 1XMQB 2Q7HA 3ZIAG 5HFLA 4YY3B 2Y48A 3KG2A 2QR4A 3QTCA 1SC5B 2AHZA 1XILA 3SJBC 1WP7A 1T5EA 1V54B 2VQFO 3OW2U 1HDJA 1MSWD 3OR6C 5C93A 1WAZA 3UT5B 2FYUH 2QSAA 2P4KA 3B40A 4LF6B 1TAEA 5KA5A 4MT8A 4I9WA 3ZRXA 1XL4A 4FPPA 4J9YB 4I4TB 1KQSU 5CA1B 4LCUC 1K73W 1AR5A 2E5LB 3CEIA 1AI4A 5L3CA 3VQXA 4NXMO 3OMIB 1NTZH 1N32B 1SZXA 2QEXV 3GB7C 2ZM6O 4QE7A 4IIJA 3RYHA 5JVDB 5IYZB 2OIGA 1SZTA 1P84F 4H37A 1FXHA 2ZCEA 1HNXO 3EFFK 5EBWC 1NS1A 4YXWG 1GH6A 2E76B 3E35A 4DV2O 4DV0B 3F7VC 2QWPB 2ZM6B 4PA3A 5L3GA 4DK1A 3K79A 4I55B 5IT9N 2F4VO 1VQ4V 1OCRC 3JALB 1F4MA 4RAIA 1K9MW 2AZ0A 4ZIBA 4TSFG 2G38A 1Q82W 4NTYA 1E79G 2WLIB 4IGGA 3ZHVA 5D5PA 5LHGA 2CK3G 1N8RW 1WPBA 4JYYA 4Q20A 3BRCA 1DLBA 4FFBA 4DR4B 1FXKC 2ODMA 2HVJC 4BWAA 1SESA 3ASOB 3AG3B 1WJZA 1K5QA 1K4CC 2ADQB 4LF9B 1GM9A 4JI0O 1K97A 3FAVB 2Q6AA 3T1CA 4LFCO 4LH7A 1VQ9V 4I50B 3K0DA 2YEVB 3CD6V 2ZXWC 1XREA 2CTRA 2MK3A 3JD3A 4GX5A 1Q90D 1YTFB 3B8MA 4GKJO 3ASNB 4LBEC 2LGWA 3ZHTA 2CDYA 3CE2A 4GKKB 3B77A 4YIPA 3SPHA 2CTQA 1AR4A 2FTKA 2E75B 3UO2A 3OM3B 3TXSA 1M9NA 3K3WA 5IYBO 4QNHB 2DYSC 4WBNB 4YIOA 3K06A 1YCIA 2QM7A 3M8AA 3UO3A 3FB7C 2BSKB 3JCUZ 1VQOV 1SQBH 3LSQA 4TV9A 4DR6O 4LF5O 2IJKA 4IT5A 2WLNA 2XTAA 2ZIMA 3W7XA 1OJHA 5EYPA 2ZQMA 3AK2A 4LF6O 3G71V 1S77D 3R65A 4JYCA 1JR9A 5LOVB 3D3IA 4X1KB 1OCOC 2CGNA 3ZJZA 3CXCU 1NVPD 4X62O 3RWRD 4FLXA 5CA1A 1R3LC 1DF4A 4KUMA 4UUJC 1GM7A 5K1PA 4OPHA 5BY1A 4RUEA 1Q86W 2OIEA 2Q5ZA 4TQFA 1JCHA 3U0ZA 1JJOA 1B6QA 4UCRA 2JJ2G 4JTDB 2XUMA 2QM4A 4QJFB 3X2QB 4QIWF 2A79B 3JAMN 1COWG 3N27A 1TGOA 2RN9A 5FPOA 4JASA 4PA7A 1S3JA 5B5EZ 2ZE5A 1N36B 4J11A 1NJIW 3MAQA 4JZGA 1BMFG 2HFEC 2V1DA 3S3WA 1H38A 2P5OA 4OXSA 3HKCB 2HHHB 3SPJA 1DK1A 5DN6G 2WLLB 5CBGA 4FFKA 1E1QG 2Y4UA 3VQWA 3FB6C 3AG7A 1KKCA 2X6BA 4DV5B 3RYFA 1OCCB 4ZOLB 5CB4B 5JCOA 5H5NA 4BIZA 1YSCA 4G27B 2UU9B 4JI2O 4B3RO 4DYLA 2QTOA 4J7ZA 1ENVA 1M57B 3LSUA 4JI5B 1XNQO 1IX9A 2KKWA 4GX2A 3T1HB 3FKSG 5BMVA 1RP3B 5J2TB 2PY5A 3OUFA 2XASA 2CUGA 2N05A 4LP8A 4ZHQA 1N34B 1KP2A 2LP7A 4UVCA 3W7SA 1OZ0A 3DXRB 2N04A 2DQ0A 1HNZO 1VQMV 2R9RB 1L8DA 1MABG 3WB1A 1JFFA 4H0LB 4WBNA 4QPKA 4EFBA 4LFBO 4NKGB 5HFMA 3OUSA 1S5HC 3STZC 1L0NH 4GLXA 4TV8A 1V55B 1YJWV 1M56B 1N33B 2QKAA 1N33O 2YXHA 1LUVA 1GAXA 3H9VA 1SQFA 3TXQA 2ZKOA 1H2KA 4X9QA 1NTMH 3VQVA 3L72H 2PI4A 1WB8A 1IURA 4H13B 4HBNA 1OCZC 4IHJA 1NQTA 5IYCO 2GTSA 1JMKC 4ICGA 2ZT9B 4O4LB 2Q7EA 5IY5B 3L70H 3CB2A 1M1KW 3APOA 5EYPB 3BAAA 1ROPA 3RYIA 4WF9V 4P30A 3QVNA 3UQ8A 2XAHA 3DC6A 4MVOA 1OCOB 1MNGA 5IE9A 5KMGB 3E22A 2LGQA 3DGEA 2VRZA 1N36O 2WLLA 1JA8A 3D36C 1ZX3A 3CCRV 4U7OA 1MZEA 4Z1MG 2F43G 1AJNA 4FMTA 2GTAA 3LUTB 1IBKB 2EIMC 1S0VA 1Q6HA 1AVMA 1M4UA 2CH7B 2JGDB 4NTXA 1RPRA 3T1HO 1F4NA 3ASNC 1KKDA 5EIBD 2ADPA 4NXNB 2WWWA 2A9HA 1Q43A 2ZE6A 1RM1C 4LNUA 5EC1C 4D7SA 2ZXWB 4MSWC 1QNMA 2F23A 4AQYB 2XNDG 1XBLA 3CCEV 5LMUB 4J41A 2OWOA 4QE9A 2VS0A 1F51A 4FLVA 1FXKB 1XMOB 1SKVA 2PZSA 4ZHQB 3CPWU 1RSOB 3HKEA 3JAKB 2K9PA 3OEEG 2M6YA 4WCEV 2OCHA 1WA8A 1WLEA 1EZVH 3ZN0A 3G80A 4FLYA 2HJDA 3K08A 2UXDB 1G1XB 4MS2A 1NR1A 1TUBA 2UUCO 2YC0A 2P7TC 4JI1B 4G2KA 2E5LO 2ITCC 3OEHG 4I0XA 5CA3A 2Y0PA 2ARHA 1K8AW 5GW7A 4J9ZB 1XNRB 2E3CA 2QDOA 3G6BA 4F6EA 2VWJA 1FXVA 3CCSV 4B3MB 5F2VO 2DE0X 2BOBC 1JFFB 2JDIG 3SYPA 2EINC 2IW5A 4IHJB 3AG1B 5LP6B 5DM6V 5KHIA 1N32O 5JH7B 4JTCB 1IVSA 3RGBA 2A7WA 1BT8A 2B1IA 3OTOB 1H2MA 1J95A 4CS3A 2CGOA 3HKDB 5LA6A 1NVPB 2GSMB 1SRYA 5IJ9B 4X20A 1GMGA 2AGAA 2YS8A 3TK1A 4R7CA 4B3SO 4EB6B 1KYOF 2AHYA 5KAIZ 3THOA 1KMIZ 3JD1A 1XDCA 3LNNA 1R1BA 3Q4HA 1EN6A 1XL6A 4DR3O 1NZ6A 2QWOB 4ABMA 2A06H 2VWKA 1YIJV 4ZI7B 1SQXH 1PV0A 3FX7A 1CP9A 4YHHB 3K57A 1HNWB 4JI8B 5IJ0A 5TISZ 1R6TA 3D3QA 2YIDA 1VIBA 4Z2WA 1WP8A 4UVBA 3OAAG 1L0LH 3OTFA 2YIAA 4LFCB 2X0LA 4BR6A 4OX9O 4DUYB 2QWRB 4UVAA 2YI8A 4JI8O 2H3OA 3K59A 3HR0A 5B3SB 3RYHB 4J42A 2EULA 2OTJV 3SJAC 1AI6A 1FJGB 2H94A 3K5LA 3RW0A 1K4DC 4O2AB 2VQFB 3CC4V 5LGUA 4WFEA 1VQNV 1HNXB 4LF5B 1AJQA 3CCMV 1PP9H 4LNUB 1SQQH 2ETNA 3ABLB 4DV3B 1JPXA 4FIPC 1QLEB 1RM1B 2RJZA 4LF4O 4IYHA 2WLHA 3VQYA 2X6AA 2QKSA 3FB5C 4HNAA 5A9GA 3E86A 2EIKB 1FFXB 2FMLA 4O4JA 1SETA 2QWNB 5E1AC 3QO8A 1LNQA 2DYRB 2V7QG 5GONB 2W0FC 3HKDA 1EBOA 2YICA 1X59A 2F66C 4LF8O 1G8MA 2RDCA 4DR5B 1BE3H 2UXBO 4JI0B 2MW2B 2JEUA 1VP7A 3FB8C 3ZHUA 5LP6A 2W6IG 3W7TA 4PELA 3CSXA 1XI1A 1OV9A 1B06A 5FNVA 3RVZA 4LF8B 3APQA 3QNEA 1URFA 1LR1A 3P3NA 3O9OA 1XMQO 1EN5A 2AXTZ 1JOYA 4B3TO 3SPIA 4AILC 5IY5C 4DR4O 2EILB 4O4IB 1NH2B 4FLUA 3OR7C 3CWBH 1OCZB 2VQEO 2IM9A 4JI3B 2C2AA 2DW4A 5CA0B 4HYOA 4DV5O 1IDSA 4I4TA 3LSSA 3ZRWA 1BQ0A 5LOVA 5B1AC 2YXLA 2NN4A 3T4ZA 4ZI7A 1XUQA 5LA6B 4B08A 4J7KA 4JAUA 2KG7B 4W4KA 1Y6XA 2EJ7A 1M56C 1HR0O 1HR0B 4GCZA 4UB6Z 1V55C 1NBMG 1AJPA 3B09A 2WA4A 5JVDA 3C3SA 3L9DA 2Z3YA 2PTMA 1W59A 3AK1A 3OE7G 4J10A 4X88A 1R6NA 3ZHQA 1QVFU 4MVRA 2QTSA 2QKCA 2BTQA 3ABMC 1Q3EA 3SYOA 3U10A 2PYJA 1K7DA 1K34A 5EBLC 4ASUG 3AG2C 4DV0O 3CP1A 2D2CB 2ZR3A 1VMGA 4AI8A 1I94B 2NR5A 1XHZA 3MD0A 2F4VB 2P6JA 4PI0A 3STLC 3D8CA 1H2NA 3OTOO 2A3QA 2DJVA 2WPDG 1OCCC 4PJ0Z 1AB3A 4JI6B 2V4DA 3N2KB 4FFBB 1YF2A 4DW0A 2UUCB 2LQTA 4HNAB 4KP4A 3RYCA 5J2UA 1IBMO 4RUFA 1K33A 3K58A 2R9IA 4LF9O 3F5TA 5GONA 1W0KG 3CRMA 5H9CA 3AEIA 3J81N 3OMNB 3ZBHA 4R50A 5BMVB 5L3BA 4N21A 4GYCB 4X66B 1YHQV 3QG5A 4X66O 1O9HA 4NYKA 4LF7B 4C7UA 4U3JA 3WG7C 1Q8IA 2WAMA 5EZYB 1YXBA 1NU1H 4PV1B 4BW9A 4DW1A 3JD2A 2OT5A 1YTFD 1SS3A 3S3XA 3G67A 4JI7O 2W6JG 1IZ3A 1Q6UA 2JRIA 2BE3A 5IWAO 5IWAB 1IBKO 2XAQA 4RWUA 4AHCA 2YDEA 1EFRG 3KKYA 1F23A 4JAAA 2GHYA 4CH6A 3BY6A 3ZHSA 1BHAA 2EIJC 2JS5A 1R73A 1HP8A 3KCYA 1XNQB 5KHKA 5IYZA 4UCOA 2KG7A 4DR6B 3M99B 5ITZA 2ZINA 1GO3F 2UUBO 4FLTA 3BABA 4I7ZB 3TETA 5C8YB 2UXNA 5LYJA 5B1BB 3CJHB 1HNZB 5A2QN 2UXCB 4CS4A 4AQYO 1BL8A 1JQ0A 1VEWA 3ABKC 4FJCC 4FLWA 4MVQA 1PD3A 3E8GA 3H01A 3G4SV 1QLNA 1YDXA 1FKAO 5GTIZ 2IJIA 1NI8A 3B8NA 1Z5WA 3L73H 3DTUB 3K0GA 3HKBA 2EILC 2QJ1A 5AG2A 1RSOA 3JSNA 4PDMA 2Z0AA 3CCUV 1WN7A 2Y69C 3ABKB 1GKFA 2RNBA 1G4YB 5B1BC 3CCQV 5JJEB 1J5EB 4A5UB 1TUBB 4KFMA 3E83A 5CMUA 2CH7A 1P7GA 2GV9A 3JD0A 1MOFA 3PN1A 1CXZB 1AP5A 4YJ2A 1I08A 1XEQA 4P9PA 4I55A 3AG4C 3FFQA 5BR8B 3CHXA 4H44B 2HLDG 1DTOA 2K1EA 3T2MA 2WLIA 3CRQA 2NNUA 5FL7G 3TGUH 5FPRA 5J2UB 2LW7A 3RYCB 3CC2V 1CEZA 4GT1A 1US6A 3GWOA 3L74H 2NLJC 2YIBA 4LWSA 4J80A 1CPYA 3LNMB 5LHIA 1QLEC 4JI4O 1TA8A 3ICXA 1GN4A 3CRAA 5LBQA 1O9GA 1AI7A 4X62B 1PPJH 2ATKC 3N2GB 1SA0A 1VF6A 3I56V 3BEHA 1LUWA 4Z1VA 4TQDA 4K8XA 3H1KH 3M7MX 1K3EA 2A0LA 4J7JA 4I0XB 3ZMVA 3B4SA 5J9PC 1Q81W 4IYIA 4OX9B 4DRXA 3E8BA 4F6RB 3J7AU 5B3SC 1HNWO 2D3OW 3UM7A 1V54C 3A0HZ 3LDEA 3CMEV 3SJQC 5IDJA 4O4LA 2ZNIA 3CRCA 1KBHA 3NR7A 3K9SA 4TV9B 1THZA 4K0KB 4UV9A 4JF3A 3L71H 1M5IA 1HW7A 5DECA 3T4DA 2QWQB 1BHBA 4U7NA 4XDKA 4JI1O 2YXYA 3CXHF 5IJ9A 3LDCA 5KUKA 4X20B 3HKCA 4B7EA 5ITZB 1NKDA 4XDLA 3AG2B 4NXMB 5JQGA 2RMKB 4UCTA 3MDSA 5H6QA 3BHPA 1L1FA 3ABMB 5LHHA 4B3MO 4I50A 2YEVA 1BSMA 3K5OA 1KUQA 1XHXA 2WLMA 4GX0A 3F7YC 4O2BA 1VQPV 4LR3A 4B3RB 3ETQA 1ZTEA 3AK3A 3IC9A 4JPRA 3A0BZ 4HAMA 3EHBB 2BCCH 3E8HA 4DV1O 3AG1C 5LP6C 2JEXA 3A0RA 1KD1W 4G28B 4YJ2B 3ZS8C 3RFRA 4KHPO 3JAWB 3BPZA 5B1AB 4JI4B 3DXRA 4JI5O 3K5NA 3SGIA 3C3TA 5H6RA 2AW9A 4DR7B 2OCCB 2ILMA 3F5WC 4MTOA 5GTHZ 1YZBA 2HG5C 1GTOA 4MTFA 4WFFA 4O2AA 5B1OA 1NR7A 4MTXA 2PGGA 2IJJA 1PL0A 5CBFA 2BTOA 3OFNG 4LWSB 1H2SB 4W4LA 1S72V 4QPJA 3CC7V 3R66A 3ZMTA 1ZL8B 2ZIOA 4LFBB 5LMUO 1Y74B 2H8PC 4F4LA 2AZ2A 5EBMC 4PA6A 3ABTA 1FFTB 1SA0B 2R9AA 5LXTA 4O4IA 2WLJA 3H1IH 2FKXA 3BFRA 1KB9F 4H33A 1KU9A 5FLXN 1KC8W 1JJ2U 4GX1A 3QO5A 1VQ8V 2XT9A 2ZD9A 4DRXB 3ZX6A 4DR1O 3ZRSA 2IBZH 1QR9A 2YI9A 2JK5C 4ZKIA 1P4RA 4PA9A 3SDLA 5LL6Y 5JH7A 4D7TA 4K3AA 2B5UA 1M93A 3DSQA 2IU3A 3JASB 5JQGB 2Q69A 3P30A 5L3FA 1Y76A 3ZMZA 1JX9A 1AI5A 3K03A 2ZDIA 2XAFA 3L75H 3ABLC 4TUYA 2EIMB 3E8FA 1R6KA 4F6RA 4RQEA 1QQCA 1FAFA 1Q7YW 2KSDA 1ZWIC 4LH6A 4RQFA 1VQKV 4B3SB 3CS5A 3UCSC 2OTLV 3Q4HB 1SERA 3WB0A 4TOIA 4KHPB 4FM0A 1N4CA 3IJ4A 4X65B 1Y4MA 4B7KA 3ZCCA 5IJ0B 1TVKB 2F1MA 1I7FA 5KA6A 3ZMUA 4PDRA 2Y0IA 2JJ1G 2Q0OC 3RN4A 4DV6B 3OD4A 1PNMA 3EVKA 4BIOA 4YY3O 1FXKA 2Y4TA 4Q6GA 1ZLZA 4I5SA 2UXXA 4E2LA 1R3KC 3W7UA 1S76D 3JAWA 4DUYO 4JYAO 1YEWA 1I0HA 1IXBA 4XDJA 5E79Z 2UXDO 1Z5VA 1YITV 4NR1A 2DWDC 5LGNA 3H1LH 2HKOA 4R6ZA 4TV8B 3D36A 3SPGA 3CX5F 2CAZC 2ITDC 1MMMA 2ZNJA 4JI3O 2JGDA 3K04A 1VARA 3LDDA 4GKKO 1F7YA 3SYCA 1VF7A 2LO1A 2YIBD 3T1YB 3FYIB 3IAYA 4U3FH 2KB1A 1YJ9V 1Y74A 1I94O 1D5NA 2E74B 1MA1A 5J2TA 4O4JB 1ORQC 3K9AA 3GWKC 4LC1A 4PHZA 2EINB 3IGAC 2PUSA 2BSKA 3TJTA 1GN6A 3UT5A 3RYIB 2Q73A 4CH4A 1MG1A 1K92A 2X7RB 5BXZA 3A2FA 3BVOA 2Q9LA 3QO7A 4LF4B 4TUYB 1BQZA 4RO2A 4JV5B 2LFSA 4JTAB 1U97A 2CTWA 4JV5O 4UCSA 2UXBB 1VQ7V 4WFHA 1VQ6V 4DR5O 3CCJV 2IJHA 1WNSA 1PM9A 1AR1B 3JD4A 1P49A 4MW8A 4IIJB 3MHHC 3RT3C 1MSDA 5CN0A 2ZE8A 1VF5B 4DK0A 1IBLB 1UJWB 2UUAB 2YUAA 1TVKA 1FYJA 3VOUA 2GUZB 1YJNV 1M90W 2Q0AA 2F95B 2PI5A 2DOSA 3BCCH 1QHTA 5B1NA 4X64O 2LJ2A 4X65O 3ETEA 1SQPH 4JI7B 3X2QC 2L6LA 3QF7A 1BZKA 1ZAUA 4FVMA 4GUNA 2HHHO 3E22B 4L87A 2R70A 3HB3B 4OPAA 4DR2O 2P4VA 4GKJB 1V9PA 3H1HH 2Q4PA 2JVDA 4LF7O 5EIBC 4CH3A 1D5AA 1QR8A 2P22C 1D2DA 4DV1B 1WA8B 4L8JA 1YI2V 1S5LZ 4NB5A 2P67A 5C8YA 4X1IB 3ZHRA 4EEQA 3H1JH 3IC7A 2WLKA 1G6UA 5BZBA 1SQVH 4P9OA 1QVGU 3AG4B 1I5YA 4UV8A 2FB5A 3ZEDA 4NTWA 1H8EG 3ETGA 3OGIB 1S5JA 4I9QA 4K8ZA 1FFXA 5JCOC 1P7BA 3HPLC 3OMAB 5KX5A 4JZ2A 3WU2Z 5KAFZ 4MW3A 1SF9A 4X1YB 2Y69B 5JJJB 1AP6A 1QBZA 1GRJA 2EX3A 4DXWA 3RBZA 5DEDA 3JSLA 1PL4A 3N2GA 4FZ1A 1U96A 1KECA 2M7WA 4WFAV 2DN9A 5KHGA 2Z5UA 4X1KA 3FAVA 3SYQA 2B1GA 5FNVB 5EC2C 3J80N 5JJNB 3BA9A 2CE4A 4YJ3A 2Q67A 1W2BU 3AG3C 4FZ0A 1IBMB 1ZUQA 4WFGA 3P3PA 3SJCC 2QGNA 4TWKA 4U3JB 3A8TA 3I55V 4X64B 1IBLO 1WB7A 4O4HA 2UUAO 4N23A 2XHBA 2QM8A 3E89A 4DV7O 5CA0A 4B3TB 2HR3A 4K35A 4DO2A 2EIJB 2LW1A 3FD9A 4UXNA 1QU7A 2P06A 5BR8O 1X4TA 1ZSPA 2HVKC 4DUZB 1KP3A 1MZFA 4KL1A 5KMGA 2FL4A 2VQEB 1GN2A 1M57C 4CS2A 2DQ3A 4NXNO 2ZR2A 3JATA 5D5QA 1SQGA 4X1IA 1I5XA 2JIZG 1H2GA 5KUMA 4DR3B 1WPXA 2GBOA 4EKWA 4ZBMA 3WG7B 1H2LA 3NXSA 1K5SA 1QCEA 5EK0A 4O2BB 1BGYH 1H8HG 2Q68A 3DC5A 2GUZA 5H2FZ 4JGSA 4BIUA 2P90A 3JYCA 1RFYA 3SR2C 4JI2B 3JARB 2QE7G 4X89A 4WFBV 2UUBB 1FD9A 4ZOLA 5CB4A 3CCLV 4PDVA 4MVZA 2X6CA 4JYAB 4CZZA 5KX5B 1BS3A 1NH2D 4FM2A 5CBHA 4IL6Z 4KXRA 3RVYA 3B2EE 4PD4F 1PNKA 2XAGA 3HKBB 3N2KA 1GM8A 2UXCO 2JS3A 1JVMA 1Q5OA 2F93B 3BA8A 3PJSK 4GZRB 4E4EA 1UFIA 2N74A 2HP8A 4MTGA 1HWYA 4X1YA 5K1XA 3KCXA 4DV3O 1Q6IA 3ZRVA 2IH3C 5L3DA
chains in the Genus database with same CATH topology
2VQFO 2E5LO 4DV5O 1IBLO 5FLXN 4X66O 2HHHO 4GKJO 2UUAO 4A5UB 4JI3O 1DK1A 4OPAA 4JI1O 4GKKO 4DV7O 4DR2O 1F7YA 4DR1O 4LF7O 1XNRO 1HR0O 5BR8O 1XEQA 1N36O 1D2DA 3SDLA 5LL6Y 1I94O 4JI7O 4LFAO 4B3MO 5H5NA 4NXMO 2UU9O 3M8AA 4JI2O 4B3RO 1J5EO 1N32O 2ZM6O 1KUQA 2JRIA 5IWAO 4LF4O 4LF5O 4NXNO 4DR6O 1IBKO 1XNQO 4LF6O 2LW7A 4JI6O 1HNXO 3T1HO 1NS1A 5BXZA 4DV0O 3O65A 4DV2O 4DUZO 4DV1O 4X62O 4JI4O 2AGAA 4DV6O 5IT9N 4B3SO 2F4VO 4JV5O 1HNZO 1X59A 2UUBO 4KHPO 3OTOO 4OPHA 4LF8O 5BY1A 4LFBO 2UXBO 4JI5O 1A32A 4DR5O 2DJVA 1R1BA 5A2QN 4AQYO 4DR3O 1XMOO 1AB3A 4YHHO 1N34O 1YZBA 3RT3C 1N33O 1IBMO 3J7AU 1HNWO 1AILA 3JAMN 4YY3O 4DV4O 1FKAO 2ZKOA 2UXCO 4DR7O 1FYJA 1R6TA 1XMQO 3R66A 3J80N 5LMNO 4B3TO 4LF9O 3F5TA 5LMUO 2DOSA 4DR4O 4JI0O 1FJGO 4LFCO 2N74A 4JYAO 4DUYO 4OX9O 2Z0AA 4X64O 1G1XB 4X65O 4JI8O 3J81N 3T1YO 2UUCO 2VQEO 4DV3O 4K0KO 2UXDO 2FKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF O;  2E5L O;  4DV5 O;  1IBL O;  5FLX N;  4X66 O;  2HHH O;  4GKJ O;  2UUA O;  4A5U B;  4JI3 O;  1DK1 A;  4OPA A;  4JI1 O;  4GKK O;  4DV7 O;  4DR2 O;  1F7Y A;  4DR1 O;  4LF7 O;  1XNR O;  1HR0 O;  5BR8 O;  1XEQ A;  1N36 O;  1D2D A;  3SDL A;  5LL6 Y;  1I94 O;  4JI7 O;  4LFA O;  4B3M O;  5H5N A;  4NXM O;  2UU9 O;  3M8A A;  4JI2 O;  4B3R O;  1J5E O;  1N32 O;  2ZM6 O;  1KUQ A;  2JRI A;  5IWA O;  4LF4 O;  4LF5 O;  4NXN O;  4DR6 O;  1IBK O;  1XNQ O;  4LF6 O;  2LW7 A;  4JI6 O;  1HNX O;  3T1H O;  1NS1 A;  5BXZ A;  4DV0 O;  3O65 A;  4DV2 O;  4DUZ O;  4DV1 O;  4X62 O;  4JI4 O;  2AGA A;  4DV6 O;  5IT9 N;  4B3S O;  2F4V O;  4JV5 O;  1HNZ O;  1X59 A;  2UUB O;  4KHP O;  3OTO O;  4OPH A;  4LF8 O;  5BY1 A;  4LFB O;  2UXB O;  4JI5 O;  1A32 A;  4DR5 O;  2DJV A;  1R1B A;  5A2Q N;  4AQY O;  4DR3 O;  1XMO O;  1AB3 A;  4YHH O;  1N34 O;  1YZB A;  3RT3 C;  1N33 O;  1IBM O;  3J7A U;  1HNW O;  1AIL A;  3JAM N;  4YY3 O;  4DV4 O;  1FKA O;  2ZKO A;  2UXC O;  4DR7 O;  1FYJ A;  1R6T A;  1XMQ O;  3R66 A;  3J80 N;  5LMN O;  4B3T O;  4LF9 O;  3F5T A;  5LMU O;  2DOS A;  4DR4 O;  4JI0 O;  1FJG O;  4LFC O;  2N74 A;  4JYA O;  4DUY O;  4OX9 O;  2Z0A A;  4X64 O;  1G1X B;  4X65 O;  4JI8 O;  3J81 N;  3T1Y O;  2UUC O;  2VQE O;  4DV3 O;  4K0K O;  2UXD O;  2FKX A; 
#chains in the Genus database with same CATH topology
 5KLV H;  3WB2 A;  5LXT B;  1B04 A;  3CYO A;  3RYF B;  2RQ6 A;  4EFE A;  2YSU B;  5LGT A;  4O4H B;  4DR1 B;  2ZDI C;  1XNR O;  2GDS A;  3U11 A;  3ZN1 A;  1XQ8 A;  4DV7 B;  5L3E A;  1FPO A;  1NT2 B;  4YJ3 B;  4XBF A;  2Q8V A;  1Y67 A;  3UKM A;  1Z2G A;  2UU9 O;  4TT3 G;  1FS0 G;  3C90 A;  3JAS A;  4PDL A;  2DYS B;  2CTP A;  3JAT B;  5KHJ A;  1DF5 A;  3O65 A;  5IYD O;  2Q7G A;  4DUZ O;  2EJR A;  4FM1 A;  2BOC C;  1GN3 A;  4UCU A;  2PYL A;  3SYA A;  2XAJ A;  1BCC H;  1PNL A;  4MVU A;  4DV4 B;  2WSS G;  1VF6 C;  3W7W A;  4HZ3 A;  3CCV V;  1A32 A;  4EB6 A;  1N0J A;  4JAV A;  5KHH A;  1XMO O;  4CC5 A;  2XOK G;  2BTQ B;  4UFZ A;  1VQL V;  4QGP A;  4NVP A;  2WA3 A;  4UB8 Z;  3G6E V;  5LMN B;  4UCV A;  3ASO C;  2IH1 C;  3ML0 A;  2OYQ A;  1AIL A;  2DWE C;  4DR2 B;  4D6T H;  3TCU A;  2L35 A;  3KZI Z;  1FJG O;  3IFX A;  4PI2 A;  3JAR A;  1R3I C;  3JAL A;  1IXM A;  3GVM A;  3ZRW B;  1E1R G;  3CMA V;  3T1Y O;  3ETD A;  4CBC A;  4K0K O;  1EN4 A;  1Y76 B;  5B66 Z;  2DYR C;  3OT7 A;  5JWP A;  1EM1 A;  1PKX A;  1OHH G;  1OCR B;  4PA4 A;  2EIK C;  1W0J G;  1YVW A;  4BAY A;  4X8A A;  1UPG A;  3WFV A;  4P2Z A;  3ZMS A;  4R8C A;  2OCC C;  4LFA O;  2W0X A;  2B9Z A;  1R3J C;  5LYJ B;  3CJH A;  3CRR A;  3OGC C;  1J5E O;  2R72 A;  4CC6 A;  2QA4 V;  1DGS A;  2DMX A;  1Y66 A;  2JGU A;  2O57 A;  4DV2 B;  2PF4 E;  1TUE B;  4JI6 O;  4LFA B;  3I5D A;  2HJF C;  1EZJ A;  1VQ5 V;  4JYB A;  1ARO P;  2EZO A;  5EZY A;  4MVS A;  1XOU A;  2EZP A;  4DV6 O;  3E2E A;  3EXA A;  2KQX A;  2RCV A;  1NTK H;  3ABU A;  1N0N A;  4CH5 A;  3SPC A;  3MHS C;  3VBB A;  3K5M A;  4OGQ B;  4MVM A;  1GK9 A;  3JCZ A;  2HEP A;  4YHH O;  1RPO A;  1N34 O;  3HKE B;  3JAK A;  2IU0 A;  3P32 A;  1B3Q A;  1ZL8 A;  2LFR A;  4BW5 A;  4FK5 C;  4DV4 O;  2ZE7 A;  4DR7 O;  2EBO A;  4FLZ A;  3FYE B;  5LMN O;  1XMQ B;  2Q7H A;  3ZIA G;  5HFL A;  4YY3 B;  2Y48 A;  3KG2 A;  2QR4 A;  3QTC A;  1SC5 B;  2AHZ A;  1XIL A;  3SJB C;  1WP7 A;  1T5E A;  1V54 B;  2VQF O;  3OW2 U;  1HDJ A;  1MSW D;  3OR6 C;  5C93 A;  1WAZ A;  3UT5 B;  2FYU H;  2QSA A;  2P4K A;  3B40 A;  4LF6 B;  1TAE A;  5KA5 A;  4MT8 A;  4I9W A;  3ZRX A;  1XL4 A;  4FPP A;  4J9Y B;  4I4T B;  1KQS U;  5CA1 B;  4LCU C;  1K73 W;  1AR5 A;  2E5L B;  3CEI A;  1AI4 A;  5L3C A;  3VQX A;  4NXM O;  3OMI B;  1NTZ H;  1N32 B;  1SZX A;  2QEX V;  3GB7 C;  2ZM6 O;  4QE7 A;  4IIJ A;  3RYH A;  5JVD B;  5IYZ B;  2OIG A;  1SZT A;  1P84 F;  4H37 A;  1FXH A;  2ZCE A;  1HNX O;  3EFF K;  5EBW C;  1NS1 A;  4YXW G;  1GH6 A;  2E76 B;  3E35 A;  4DV2 O;  4DV0 B;  3F7V C;  2QWP B;  2ZM6 B;  4PA3 A;  5L3G A;  4DK1 A;  3K79 A;  4I55 B;  5IT9 N;  2F4V O;  1VQ4 V;  1OCR C;  3JAL B;  1F4M A;  4RAI A;  1K9M W;  2AZ0 A;  4ZIB A;  4TSF G;  2G38 A;  1Q82 W;  4NTY A;  1E79 G;  2WLI B;  4IGG A;  3ZHV A;  5D5P A;  5LHG A;  2CK3 G;  1N8R W;  1WPB A;  4JYY A;  4Q20 A;  3BRC A;  1DLB A;  4FFB A;  4DR4 B;  1FXK C;  2ODM A;  2HVJ C;  4BWA A;  1SES A;  3ASO B;  3AG3 B;  1WJZ A;  1K5Q A;  1K4C C;  2ADQ B;  4LF9 B;  1GM9 A;  4JI0 O;  1K97 A;  3FAV B;  2Q6A A;  3T1C A;  4LFC O;  4LH7 A;  1VQ9 V;  4I50 B;  3K0D A;  2YEV B;  3CD6 V;  2ZXW C;  1XRE A;  2CTR A;  2MK3 A;  3JD3 A;  4GX5 A;  1Q90 D;  1YTF B;  3B8M A;  4GKJ O;  3ASN B;  4LBE C;  2LGW A;  3ZHT A;  2CDY A;  3CE2 A;  4GKK B;  3B77 A;  4YIP A;  3SPH A;  2CTQ A;  1AR4 A;  2FTK A;  2E75 B;  3UO2 A;  3OM3 B;  3TXS A;  1M9N A;  3K3W A;  5IYB O;  4QNH B;  2DYS C;  4WBN B;  4YIO A;  3K06 A;  1YCI A;  2QM7 A;  3M8A A;  3UO3 A;  3FB7 C;  2BSK B;  3JCU Z;  1VQO V;  1SQB H;  3LSQ A;  4TV9 A;  4DR6 O;  4LF5 O;  2IJK A;  4IT5 A;  2WLN A;  2XTA A;  2ZIM A;  3W7X A;  1OJH A;  5EYP A;  2ZQM A;  3AK2 A;  4LF6 O;  3G71 V;  1S77 D;  3R65 A;  4JYC A;  1JR9 A;  5LOV B;  3D3I A;  4X1K B;  1OCO C;  2CGN A;  3ZJZ A;  3CXC U;  1NVP D;  4X62 O;  3RWR D;  4FLX A;  5CA1 A;  1R3L C;  1DF4 A;  4KUM A;  4UUJ C;  1GM7 A;  5K1P A;  4OPH A;  5BY1 A;  4RUE A;  1Q86 W;  2OIE A;  2Q5Z A;  4TQF A;  1JCH A;  3U0Z A;  1JJO A;  1B6Q A;  4UCR A;  2JJ2 G;  4JTD B;  2XUM A;  2QM4 A;  4QJF B;  3X2Q B;  4QIW F;  2A79 B;  3JAM N;  1COW G;  3N27 A;  1TGO A;  2RN9 A;  5FPO A;  4JAS A;  4PA7 A;  1S3J A;  5B5E Z;  2ZE5 A;  1N36 B;  4J11 A;  1NJI W;  3MAQ A;  4JZG A;  1BMF G;  2HFE C;  2V1D A;  3S3W A;  1H38 A;  2P5O A;  4OXS A;  3HKC B;  2HHH B;  3SPJ A;  1DK1 A;  5DN6 G;  2WLL B;  5CBG A;  4FFK A;  1E1Q G;  2Y4U A;  3VQW A;  3FB6 C;  3AG7 A;  1KKC A;  2X6B A;  4DV5 B;  3RYF A;  1OCC B;  4ZOL B;  5CB4 B;  5JCO A;  5H5N A;  4BIZ A;  1YSC A;  4G27 B;  2UU9 B;  4JI2 O;  4B3R O;  4DYL A;  2QTO A;  4J7Z A;  1ENV A;  1M57 B;  3LSU A;  4JI5 B;  1XNQ O;  1IX9 A;  2KKW A;  4GX2 A;  3T1H B;  3FKS G;  5BMV A;  1RP3 B;  5J2T B;  2PY5 A;  3OUF A;  2XAS A;  2CUG A;  2N05 A;  4LP8 A;  4ZHQ A;  1N34 B;  1KP2 A;  2LP7 A;  4UVC A;  3W7S A;  1OZ0 A;  3DXR B;  2N04 A;  2DQ0 A;  1HNZ O;  1VQM V;  2R9R B;  1L8D A;  1MAB G;  3WB1 A;  1JFF A;  4H0L B;  4WBN A;  4QPK A;  4EFB A;  4LFB O;  4NKG B;  5HFM A;  3OUS A;  1S5H C;  3STZ C;  1L0N H;  4GLX A;  4TV8 A;  1V55 B;  1YJW V;  1M56 B;  1N33 B;  2QKA A;  1N33 O;  2YXH A;  1LUV A;  1GAX A;  3H9V A;  1SQF A;  3TXQ A;  2ZKO A;  1H2K A;  4X9Q A;  1NTM H;  3VQV A;  3L72 H;  2PI4 A;  1WB8 A;  1IUR A;  4H13 B;  4HBN A;  1OCZ C;  4IHJ A;  1NQT A;  5IYC O;  2GTS A;  1JMK C;  4ICG A;  2ZT9 B;  4O4L B;  2Q7E A;  5IY5 B;  3L70 H;  3CB2 A;  1M1K W;  3APO A;  5EYP B;  3BAA A;  1ROP A;  3RYI A;  4WF9 V;  4P30 A;  3QVN A;  3UQ8 A;  2XAH A;  3DC6 A;  4MVO A;  1OCO B;  1MNG A;  5IE9 A;  5KMG B;  3E22 A;  2LGQ A;  3DGE A;  2VRZ A;  1N36 O;  2WLL A;  1JA8 A;  3D36 C;  1ZX3 A;  3CCR V;  4U7O A;  1MZE A;  4Z1M G;  2F43 G;  1AJN A;  4FMT A;  2GTA A;  3LUT B;  1IBK B;  2EIM C;  1S0V A;  1Q6H A;  1AVM A;  1M4U A;  2CH7 B;  2JGD B;  4NTX A;  1RPR A;  3T1H O;  1F4N A;  3ASN C;  1KKD A;  5EIB D;  2ADP A;  4NXN B;  2WWW A;  2A9H A;  1Q43 A;  2ZE6 A;  1RM1 C;  4LNU A;  5EC1 C;  4D7S A;  2ZXW B;  4MSW C;  1QNM A;  2F23 A;  4AQY B;  2XND G;  1XBL A;  3CCE V;  5LMU B;  4J41 A;  2OWO A;  4QE9 A;  2VS0 A;  1F51 A;  4FLV A;  1FXK B;  1XMO B;  1SKV A;  2PZS A;  4ZHQ B;  3CPW U;  1RSO B;  3HKE A;  3JAK B;  2K9P A;  3OEE G;  2M6Y A;  4WCE V;  2OCH A;  1WA8 A;  1WLE A;  1EZV H;  3ZN0 A;  3G80 A;  4FLY A;  2HJD A;  3K08 A;  2UXD B;  1G1X B;  4MS2 A;  1NR1 A;  1TUB A;  2UUC O;  2YC0 A;  2P7T C;  4JI1 B;  4G2K A;  2E5L O;  2ITC C;  3OEH G;  4I0X A;  5CA3 A;  2Y0P A;  2ARH A;  1K8A W;  5GW7 A;  4J9Z B;  1XNR B;  2E3C A;  2QDO A;  3G6B A;  4F6E A;  2VWJ A;  1FXV A;  3CCS V;  4B3M B;  5F2V O;  2DE0 X;  2BOB C;  1JFF B;  2JDI G;  3SYP A;  2EIN C;  2IW5 A;  4IHJ B;  3AG1 B;  5LP6 B;  5DM6 V;  5KHI A;  1N32 O;  5JH7 B;  4JTC B;  1IVS A;  3RGB A;  2A7W A;  1BT8 A;  2B1I A;  3OTO B;  1H2M A;  1J95 A;  4CS3 A;  2CGO A;  3HKD B;  5LA6 A;  1NVP B;  2GSM B;  1SRY A;  5IJ9 B;  4X20 A;  1GMG A;  2AGA A;  2YS8 A;  3TK1 A;  4R7C A;  4B3S O;  4EB6 B;  1KYO F;  2AHY A;  5KAI Z;  3THO A;  1KMI Z;  3JD1 A;  1XDC A;  3LNN A;  1R1B A;  3Q4H A;  1EN6 A;  1XL6 A;  4DR3 O;  1NZ6 A;  2QWO B;  4ABM A;  2A06 H;  2VWK A;  1YIJ V;  4ZI7 B;  1SQX H;  1PV0 A;  3FX7 A;  1CP9 A;  4YHH B;  3K57 A;  1HNW B;  4JI8 B;  5IJ0 A;  5TIS Z;  1R6T A;  3D3Q A;  2YID A;  1VIB A;  4Z2W A;  1WP8 A;  4UVB A;  3OAA G;  1L0L H;  3OTF A;  2YIA A;  4LFC B;  2X0L A;  4BR6 A;  4OX9 O;  4DUY B;  2QWR B;  4UVA A;  2YI8 A;  4JI8 O;  2H3O A;  3K59 A;  3HR0 A;  5B3S B;  3RYH B;  4J42 A;  2EUL A;  2OTJ V;  3SJA C;  1AI6 A;  1FJG B;  2H94 A;  3K5L A;  3RW0 A;  1K4D C;  4O2A B;  2VQF B;  3CC4 V;  5LGU A;  4WFE A;  1VQN V;  1HNX B;  4LF5 B;  1AJQ A;  3CCM V;  1PP9 H;  4LNU B;  1SQQ H;  2ETN A;  3ABL B;  4DV3 B;  1JPX A;  4FIP C;  1QLE B;  1RM1 B;  2RJZ A;  4LF4 O;  4IYH A;  2WLH A;  3VQY A;  2X6A A;  2QKS A;  3FB5 C;  4HNA A;  5A9G A;  3E86 A;  2EIK B;  1FFX B;  2FML A;  4O4J A;  1SET A;  2QWN B;  5E1A C;  3QO8 A;  1LNQ A;  2DYR B;  2V7Q G;  5GON B;  2W0F C;  3HKD A;  1EBO A;  2YIC A;  1X59 A;  2F66 C;  4LF8 O;  1G8M A;  2RDC A;  4DR5 B;  1BE3 H;  2UXB O;  4JI0 B;  2MW2 B;  2JEU A;  1VP7 A;  3FB8 C;  3ZHU A;  5LP6 A;  2W6I G;  3W7T A;  4PEL A;  3CSX A;  1XI1 A;  1OV9 A;  1B06 A;  5FNV A;  3RVZ A;  4LF8 B;  3APQ A;  3QNE A;  1URF A;  1LR1 A;  3P3N A;  3O9O A;  1XMQ O;  1EN5 A;  2AXT Z;  1JOY A;  4B3T O;  3SPI A;  4AIL C;  5IY5 C;  4DR4 O;  2EIL B;  4O4I B;  1NH2 B;  4FLU A;  3OR7 C;  3CWB H;  1OCZ B;  2VQE O;  2IM9 A;  4JI3 B;  2C2A A;  2DW4 A;  5CA0 B;  4HYO A;  4DV5 O;  1IDS A;  4I4T A;  3LSS A;  3ZRW A;  1BQ0 A;  5LOV A;  5B1A C;  2YXL A;  2NN4 A;  3T4Z A;  4ZI7 A;  1XUQ A;  5LA6 B;  4B08 A;  4J7K A;  4JAU A;  2KG7 B;  4W4K A;  1Y6X A;  2EJ7 A;  1M56 C;  1HR0 O;  1HR0 B;  4GCZ A;  4UB6 Z;  1V55 C;  1NBM G;  1AJP A;  3B09 A;  2WA4 A;  5JVD A;  3C3S A;  3L9D A;  2Z3Y A;  2PTM A;  1W59 A;  3AK1 A;  3OE7 G;  4J10 A;  4X88 A;  1R6N A;  3ZHQ A;  1QVF U;  4MVR A;  2QTS A;  2QKC A;  2BTQ A;  3ABM C;  1Q3E A;  3SYO A;  3U10 A;  2PYJ A;  1K7D A;  1K34 A;  5EBL C;  4ASU G;  3AG2 C;  4DV0 O;  3CP1 A;  2D2C B;  2ZR3 A;  1VMG A;  4AI8 A;  1I94 B;  2NR5 A;  1XHZ A;  3MD0 A;  2F4V B;  2P6J A;  4PI0 A;  3STL C;  3D8C A;  1H2N A;  3OTO O;  2A3Q A;  2DJV A;  2WPD G;  1OCC C;  4PJ0 Z;  1AB3 A;  4JI6 B;  2V4D A;  3N2K B;  4FFB B;  1YF2 A;  4DW0 A;  2UUC B;  2LQT A;  4HNA B;  4KP4 A;  3RYC A;  5J2U A;  1IBM O;  4RUF A;  1K33 A;  3K58 A;  2R9I A;  4LF9 O;  3F5T A;  5GON A;  1W0K G;  3CRM A;  5H9C A;  3AEI A;  3J81 N;  3OMN B;  3ZBH A;  4R50 A;  5BMV B;  5L3B A;  4N21 A;  4GYC B;  4X66 B;  1YHQ V;  3QG5 A;  4X66 O;  1O9H A;  4NYK A;  4LF7 B;  4C7U A;  4U3J A;  3WG7 C;  1Q8I A;  2WAM A;  5EZY B;  1YXB A;  1NU1 H;  4PV1 B;  4BW9 A;  4DW1 A;  3JD2 A;  2OT5 A;  1YTF D;  1SS3 A;  3S3X A;  3G67 A;  4JI7 O;  2W6J G;  1IZ3 A;  1Q6U A;  2JRI A;  2BE3 A;  5IWA O;  5IWA B;  1IBK O;  2XAQ A;  4RWU A;  4AHC A;  2YDE A;  1EFR G;  3KKY A;  1F23 A;  4JAA A;  2GHY A;  4CH6 A;  3BY6 A;  3ZHS A;  1BHA A;  2EIJ C;  2JS5 A;  1R73 A;  1HP8 A;  3KCY A;  1XNQ B;  5KHK A;  5IYZ A;  4UCO A;  2KG7 A;  4DR6 B;  3M99 B;  5ITZ A;  2ZIN A;  1GO3 F;  2UUB O;  4FLT A;  3BAB A;  4I7Z B;  3TET A;  5C8Y B;  2UXN A;  5LYJ A;  5B1B B;  3CJH B;  1HNZ B;  5A2Q N;  2UXC B;  4CS4 A;  4AQY O;  1BL8 A;  1JQ0 A;  1VEW A;  3ABK C;  4FJC C;  4FLW A;  4MVQ A;  1PD3 A;  3E8G A;  3H01 A;  3G4S V;  1QLN A;  1YDX A;  1FKA O;  5GTI Z;  2IJI A;  1NI8 A;  3B8N A;  1Z5W A;  3L73 H;  3DTU B;  3K0G A;  3HKB A;  2EIL C;  2QJ1 A;  5AG2 A;  1RSO A;  3JSN A;  4PDM A;  2Z0A A;  3CCU V;  1WN7 A;  2Y69 C;  3ABK B;  1GKF A;  2RNB A;  1G4Y B;  5B1B C;  3CCQ V;  5JJE B;  1J5E B;  4A5U B;  1TUB B;  4KFM A;  3E83 A;  5CMU A;  2CH7 A;  1P7G A;  2GV9 A;  3JD0 A;  1MOF A;  3PN1 A;  1CXZ B;  1AP5 A;  4YJ2 A;  1I08 A;  1XEQ A;  4P9P A;  4I55 A;  3AG4 C;  3FFQ A;  5BR8 B;  3CHX A;  4H44 B;  2HLD G;  1DTO A;  2K1E A;  3T2M A;  2WLI A;  3CRQ A;  2NNU A;  5FL7 G;  3TGU H;  5FPR A;  5J2U B;  2LW7 A;  3RYC B;  3CC2 V;  1CEZ A;  4GT1 A;  1US6 A;  3GWO A;  3L74 H;  2NLJ C;  2YIB A;  4LWS A;  4J80 A;  1CPY A;  3LNM B;  5LHI A;  1QLE C;  4JI4 O;  1TA8 A;  3ICX A;  1GN4 A;  3CRA A;  5LBQ A;  1O9G A;  1AI7 A;  4X62 B;  1PPJ H;  2ATK C;  3N2G B;  1SA0 A;  1VF6 A;  3I56 V;  3BEH A;  1LUW A;  4Z1V A;  4TQD A;  4K8X A;  3H1K H;  3M7M X;  1K3E A;  2A0L A;  4J7J A;  4I0X B;  3ZMV A;  3B4S A;  5J9P C;  1Q81 W;  4IYI A;  4OX9 B;  4DRX A;  3E8B A;  4F6R B;  3J7A U;  5B3S C;  1HNW O;  2D3O W;  3UM7 A;  1V54 C;  3A0H Z;  3LDE A;  3CME V;  3SJQ C;  5IDJ A;  4O4L A;  2ZNI A;  3CRC A;  1KBH A;  3NR7 A;  3K9S A;  4TV9 B;  1THZ A;  4K0K B;  4UV9 A;  4JF3 A;  3L71 H;  1M5I A;  1HW7 A;  5DEC A;  3T4D A;  2QWQ B;  1BHB A;  4U7N A;  4XDK A;  4JI1 O;  2YXY A;  3CXH F;  5IJ9 A;  3LDC A;  5KUK A;  4X20 B;  3HKC A;  4B7E A;  5ITZ B;  1NKD A;  4XDL A;  3AG2 B;  4NXM B;  5JQG A;  2RMK B;  4UCT A;  3MDS A;  5H6Q A;  3BHP A;  1L1F A;  3ABM B;  5LHH A;  4B3M O;  4I50 A;  2YEV A;  1BSM A;  3K5O A;  1KUQ A;  1XHX A;  2WLM A;  4GX0 A;  3F7Y C;  4O2B A;  1VQP V;  4LR3 A;  4B3R B;  3ETQ A;  1ZTE A;  3AK3 A;  3IC9 A;  4JPR A;  3A0B Z;  4HAM A;  3EHB B;  2BCC H;  3E8H A;  4DV1 O;  3AG1 C;  5LP6 C;  2JEX A;  3A0R A;  1KD1 W;  4G28 B;  4YJ2 B;  3ZS8 C;  3RFR A;  4KHP O;  3JAW B;  3BPZ A;  5B1A B;  4JI4 B;  3DXR A;  4JI5 O;  3K5N A;  3SGI A;  3C3T A;  5H6R A;  2AW9 A;  4DR7 B;  2OCC B;  2ILM A;  3F5W C;  4MTO A;  5GTH Z;  1YZB A;  2HG5 C;  1GTO A;  4MTF A;  4WFF A;  4O2A A;  5B1O A;  1NR7 A;  4MTX A;  2PGG A;  2IJJ A;  1PL0 A;  5CBF A;  2BTO A;  3OFN G;  4LWS B;  1H2S B;  4W4L A;  1S72 V;  4QPJ A;  3CC7 V;  3R66 A;  3ZMT A;  1ZL8 B;  2ZIO A;  4LFB B;  5LMU O;  1Y74 B;  2H8P C;  4F4L A;  2AZ2 A;  5EBM C;  4PA6 A;  3ABT A;  1FFT B;  1SA0 B;  2R9A A;  5LXT A;  4O4I A;  2WLJ A;  3H1I H;  2FKX A;  3BFR A;  1KB9 F;  4H33 A;  1KU9 A;  5FLX N;  1KC8 W;  1JJ2 U;  4GX1 A;  3QO5 A;  1VQ8 V;  2XT9 A;  2ZD9 A;  4DRX B;  3ZX6 A;  4DR1 O;  3ZRS A;  2IBZ H;  1QR9 A;  2YI9 A;  2JK5 C;  4ZKI A;  1P4R A;  4PA9 A;  3SDL A;  5LL6 Y;  5JH7 A;  4D7T A;  4K3A A;  2B5U A;  1M93 A;  3DSQ A;  2IU3 A;  3JAS B;  5JQG B;  2Q69 A;  3P30 A;  5L3F A;  1Y76 A;  3ZMZ A;  1JX9 A;  1AI5 A;  3K03 A;  2ZDI A;  2XAF A;  3L75 H;  3ABL C;  4TUY A;  2EIM B;  3E8F A;  1R6K A;  4F6R A;  4RQE A;  1QQC A;  1FAF A;  1Q7Y W;  2KSD A;  1ZWI C;  4LH6 A;  4RQF A;  1VQK V;  4B3S B;  3CS5 A;  3UCS C;  2OTL V;  3Q4H B;  1SER A;  3WB0 A;  4TOI A;  4KHP B;  4FM0 A;  1N4C A;  3IJ4 A;  4X65 B;  1Y4M A;  4B7K A;  3ZCC A;  5IJ0 B;  1TVK B;  2F1M A;  1I7F A;  5KA6 A;  3ZMU A;  4PDR A;  2Y0I A;  2JJ1 G;  2Q0O C;  3RN4 A;  4DV6 B;  3OD4 A;  1PNM A;  3EVK A;  4BIO A;  4YY3 O;  1FXK A;  2Y4T A;  4Q6G A;  1ZLZ A;  4I5S A;  2UXX A;  4E2L A;  1R3K C;  3W7U A;  1S76 D;  3JAW A;  4DUY O;  4JYA O;  1YEW A;  1I0H A;  1IXB A;  4XDJ A;  5E79 Z;  2UXD O;  1Z5V A;  1YIT V;  4NR1 A;  2DWD C;  5LGN A;  3H1L H;  2HKO A;  4R6Z A;  4TV8 B;  3D36 A;  3SPG A;  3CX5 F;  2CAZ C;  2ITD C;  1MMM A;  2ZNJ A;  4JI3 O;  2JGD A;  3K04 A;  1VAR A;  3LDD A;  4GKK O;  1F7Y A;  3SYC A;  1VF7 A;  2LO1 A;  2YIB D;  3T1Y B;  3FYI B;  3IAY A;  4U3F H;  2KB1 A;  1YJ9 V;  1Y74 A;  1I94 O;  1D5N A;  2E74 B;  1MA1 A;  5J2T A;  4O4J B;  1ORQ C;  3K9A A;  3GWK C;  4LC1 A;  4PHZ A;  2EIN B;  3IGA C;  2PUS A;  2BSK A;  3TJT A;  1GN6 A;  3UT5 A;  3RYI B;  2Q73 A;  4CH4 A;  1MG1 A;  1K92 A;  2X7R B;  5BXZ A;  3A2F A;  3BVO A;  2Q9L A;  3QO7 A;  4LF4 B;  4TUY B;  1BQZ A;  4RO2 A;  4JV5 B;  2LFS A;  4JTA B;  1U97 A;  2CTW A;  4JV5 O;  4UCS A;  2UXB B;  1VQ7 V;  4WFH A;  1VQ6 V;  4DR5 O;  3CCJ V;  2IJH A;  1WNS A;  1PM9 A;  1AR1 B;  3JD4 A;  1P49 A;  4MW8 A;  4IIJ B;  3MHH C;  3RT3 C;  1MSD A;  5CN0 A;  2ZE8 A;  1VF5 B;  4DK0 A;  1IBL B;  1UJW B;  2UUA B;  2YUA A;  1TVK A;  1FYJ A;  3VOU A;  2GUZ B;  1YJN V;  1M90 W;  2Q0A A;  2F95 B;  2PI5 A;  2DOS A;  3BCC H;  1QHT A;  5B1N A;  4X64 O;  2LJ2 A;  4X65 O;  3ETE A;  1SQP H;  4JI7 B;  3X2Q C;  2L6L A;  3QF7 A;  1BZK A;  1ZAU A;  4FVM A;  4GUN A;  2HHH O;  3E22 B;  4L87 A;  2R70 A;  3HB3 B;  4OPA A;  4DR2 O;  2P4V A;  4GKJ B;  1V9P A;  3H1H H;  2Q4P A;  2JVD A;  4LF7 O;  5EIB C;  4CH3 A;  1D5A A;  1QR8 A;  2P22 C;  1D2D A;  4DV1 B;  1WA8 B;  4L8J A;  1YI2 V;  1S5L Z;  4NB5 A;  2P67 A;  5C8Y A;  4X1I B;  3ZHR A;  4EEQ A;  3H1J H;  3IC7 A;  2WLK A;  1G6U A;  5BZB A;  1SQV H;  4P9O A;  1QVG U;  3AG4 B;  1I5Y A;  4UV8 A;  2FB5 A;  3ZED A;  4NTW A;  1H8E G;  3ETG A;  3OGI B;  1S5J A;  4I9Q A;  4K8Z A;  1FFX A;  5JCO C;  1P7B A;  3HPL C;  3OMA B;  5KX5 A;  4JZ2 A;  3WU2 Z;  5KAF Z;  4MW3 A;  1SF9 A;  4X1Y B;  2Y69 B;  5JJJ B;  1AP6 A;  1QBZ A;  1GRJ A;  2EX3 A;  4DXW A;  3RBZ A;  5DED A;  3JSL A;  1PL4 A;  3N2G A;  4FZ1 A;  1U96 A;  1KEC A;  2M7W A;  4WFA V;  2DN9 A;  5KHG A;  2Z5U A;  4X1K A;  3FAV A;  3SYQ A;  2B1G A;  5FNV B;  5EC2 C;  3J80 N;  5JJN B;  3BA9 A;  2CE4 A;  4YJ3 A;  2Q67 A;  1W2B U;  3AG3 C;  4FZ0 A;  1IBM B;  1ZUQ A;  4WFG A;  3P3P A;  3SJC C;  2QGN A;  4TWK A;  4U3J B;  3A8T A;  3I55 V;  4X64 B;  1IBL O;  1WB7 A;  4O4H A;  2UUA O;  4N23 A;  2XHB A;  2QM8 A;  3E89 A;  4DV7 O;  5CA0 A;  4B3T B;  2HR3 A;  4K35 A;  4DO2 A;  2EIJ B;  2LW1 A;  3FD9 A;  4UXN A;  1QU7 A;  2P06 A;  5BR8 O;  1X4T A;  1ZSP A;  2HVK C;  4DUZ B;  1KP3 A;  1MZF A;  4KL1 A;  5KMG A;  2FL4 A;  2VQE B;  1GN2 A;  1M57 C;  4CS2 A;  2DQ3 A;  4NXN O;  2ZR2 A;  3JAT A;  5D5Q A;  1SQG A;  4X1I A;  1I5X A;  2JIZ G;  1H2G A;  5KUM A;  4DR3 B;  1WPX A;  2GBO A;  4EKW A;  4ZBM A;  3WG7 B;  1H2L A;  3NXS A;  1K5S A;  1QCE A;  5EK0 A;  4O2B B;  1BGY H;  1H8H G;  2Q68 A;  3DC5 A;  2GUZ A;  5H2F Z;  4JGS A;  4BIU A;  2P90 A;  3JYC A;  1RFY A;  3SR2 C;  4JI2 B;  3JAR B;  2QE7 G;  4X89 A;  4WFB V;  2UUB B;  1FD9 A;  4ZOL A;  5CB4 A;  3CCL V;  4PDV A;  4MVZ A;  2X6C A;  4JYA B;  4CZZ A;  5KX5 B;  1BS3 A;  1NH2 D;  4FM2 A;  5CBH A;  4IL6 Z;  4KXR A;  3RVY A;  3B2E E;  4PD4 F;  1PNK A;  2XAG A;  3HKB B;  3N2K A;  1GM8 A;  2UXC O;  2JS3 A;  1JVM A;  1Q5O A;  2F93 B;  3BA8 A;  3PJS K;  4GZR B;  4E4E A;  1UFI A;  2N74 A;  2HP8 A;  4MTG A;  1HWY A;  4X1Y A;  5K1X A;  3KCX A;  4DV3 O;  1Q6I A;  3ZRV A;  2IH3 C;  5L3D A; 
#chains in the Genus database with same CATH homology
 2VQF O;  2E5L O;  4DV5 O;  1IBL O;  5FLX N;  4X66 O;  2HHH O;  4GKJ O;  2UUA O;  4A5U B;  4JI3 O;  1DK1 A;  4OPA A;  4JI1 O;  4GKK O;  4DV7 O;  4DR2 O;  1F7Y A;  4DR1 O;  4LF7 O;  1XNR O;  1HR0 O;  5BR8 O;  1XEQ A;  1N36 O;  1D2D A;  3SDL A;  5LL6 Y;  1I94 O;  4JI7 O;  4LFA O;  4B3M O;  5H5N A;  4NXM O;  2UU9 O;  3M8A A;  4JI2 O;  4B3R O;  1J5E O;  1N32 O;  2ZM6 O;  1KUQ A;  2JRI A;  5IWA O;  4LF4 O;  4LF5 O;  4NXN O;  4DR6 O;  1IBK O;  1XNQ O;  4LF6 O;  2LW7 A;  4JI6 O;  1HNX O;  3T1H O;  1NS1 A;  5BXZ A;  4DV0 O;  3O65 A;  4DV2 O;  4DUZ O;  4DV1 O;  4X62 O;  4JI4 O;  2AGA A;  4DV6 O;  5IT9 N;  4B3S O;  2F4V O;  4JV5 O;  1HNZ O;  1X59 A;  2UUB O;  4KHP O;  3OTO O;  4OPH A;  4LF8 O;  5BY1 A;  4LFB O;  2UXB O;  4JI5 O;  1A32 A;  4DR5 O;  2DJV A;  1R1B A;  5A2Q N;  4AQY O;  4DR3 O;  1XMO O;  1AB3 A;  4YHH O;  1N34 O;  1YZB A;  3RT3 C;  1N33 O;  1IBM O;  3J7A U;  1HNW O;  1AIL A;  3JAM N;  4YY3 O;  4DV4 O;  1FKA O;  2ZKO A;  2UXC O;  4DR7 O;  1FYJ A;  1R6T A;  1XMQ O;  3R66 A;  3J80 N;  5LMN O;  4B3T O;  4LF9 O;  3F5T A;  5LMU O;  2DOS A;  4DR4 O;  4JI0 O;  1FJG O;  4LFC O;  2N74 A;  4JYA O;  4DUY O;  4OX9 O;  2Z0A A;  4X64 O;  1G1X B;  4X65 O;  4JI8 O;  3J81 N;  3T1Y O;  2UUC O;  2VQE O;  4DV3 O;  4K0K O;  2UXD O;  2FKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...