3M8AA

Crystal structure of swine flu virus ns1 n-terminal rna binding domain from h1n1 influenza a/california/07/2009
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
71
structure length
71
Chain Sequence
MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLVGKQIVEWILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Nonstructural protein 1
publication title Crystal Structure of Swine Flu Virus NS1 N-Terminal RNA Binding Domain from H1N1 Influenza A/California/07/2009
rcsb
source organism Influenza a virus
total genus 28
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3m8aA00
2ZKOA 4X66O 1FJGO 4DV2O 2DJVA 4JI8O 2AGAA 3OTOO 4NXNO 5LL6Y 1A32A 4LFAO 1FYJA 1HNWO 4DUZO 2JRIA 1DK1A 4LFCO 4DUYO 5A2QN 2DOSA 3R66A 3RT3C 3O65A 4GKKO 4DR6O 1FKAO 4OX9O 5FLXN 3T1HO 1KUQA 4JI0O 4JI3O 4DR3O 3J81N 4DR7O 3SDLA 1N33O 1IBMO 3F5TA 4X65O 3J80N 4GKJO 2HHHO 4B3TO 4JV5O 4LF9O 1G1XB 1D2DA 4JI1O 1HNXO 4DV6O 1J5EO 3T1YO 4DR1O 4DV0O 5LMUO 2N74A 4B3RO 5IT9N 1XMOO 1XEQA 5H5NA 4X62O 4OPAA 5IWAO 2VQFO 5BR8O 4LFBO 1HR0O 2UUCO 2E5LO 4DR4O 2UUAO 4OPHA 2VQEO 1IBLO 3JAMN 4NXMO 4K0KO 1N34O 1XNRO 2Z0AA 4DV5O 4DR2O 4X64O 4DV7O 2UXCO 1HNZO 1XMQO 4JYAO 4YHHO 4YY3O 2ZM6O 1NS1A 2LW7A 3M8AA 4B3SO 1AB3A 4A5UB 2UXDO 4LF7O 1N36O 2FKXA 4AQYO 2UXBO 4LF4O 1R1BA 4DV3O 1N32O 5BY1A 4DR5O 4JI6O 4JI7O 2F4VO 4DV1O 1IBKO 4B3MO 1R6TA 2UUBO 2UU9O 5BXZA 1XNQO 4LF6O 4LF8O 1X59A 4LF5O 1AILA 1I94O 4KHPO 4JI5O 3J7AU 4JI4O 1YZBA 4JI2O 5LMNO 4DV4O 1F7YA
chains in the Genus database with same CATH superfamily
2RN9A 1VF5B 1K4CC 2Q69A 1FYJA 3FFQA 4NKGB 4X64B 4EKWA 3ETEA 3K08A 3HKBB 3JYCA 4NTYA 4IYHA 3W7UA 3R66A 4UXNA 1HWYA 1H8HG 2YEVB 4HNAB 2XAGA 3AG1C 4LF7B 2DQ3A 1QBZA 2GBOA 4O2BA 3H01A 3UO3A 1SF9A 1Q8IA 3CC4V 3JSNA 4WFAV 1H2SB 1FXVA 1VQ6V 2HLDG 2F4VB 4DV1B 4PDLA 4CH5A 1EN4A 2HHHO 5LP6C 4LF9O 3ASOB 1SC5B 2P7TC 3E8HA 4X1KA 4DR1O 3APQA 3ZRXA 4QGPA 1EM1A 4JI5B 3JD2A 1XI1A 1DLBA 2DWDC 1AJPA 1UJWB 2Q8VA 4TUYA 1OJHA 3U11A 1HNXB 2WLLB 4I4TA 4Q20A 2B1GA 1S5JA 2Z0AA 2EINC 3D3QA 5DECA 2QWNB 1QR9A 1KQSU 5IWAB 1NS1A 3ABUA 1Y74B 3SGIA 3PN1A 1AI5A 5CA0B 4TSFG 3K5MA 4AHCA 3B77A 3JCZA 4DR5O 4JI6O 1H8EG 5H9CA 2AW9A 1W0JG 3HKDA 5KMGA 4MTGA 3CSXA 3JARB 2Q67A 4LF6O 4LF8O 1K9MW 2V1DA 3SPIA 3E35A 3SYCA 4DXWA 4O4JA 2O57A 2CTQA 3KCYA 4FLXA 4ABMA 3OAAG 3H9VA 4GCZA 5B1NA 1JA8A 1NT2B 2LGWA 4QJFB 4F4LA 2CTWA 4DV7B 3QO8A 1GH6A 2YI9A 4QIWF 3HB3B 1ZL8A 1Y76B 3ZRWB 3UKMA 4OX9O 4X8AA 4B3SB 1PNKA 1FD9A 4K8XA 4O4HB 1WLEA 3T1HO 3ZBHA 4JI0O 1YJ9V 3U10A 5BZBA 1TVKB 1XDCA 2WPDG 1SQXH 5ITZA 4YJ2A 3W7WA 5FNVB 3OR6C 2X6BA 1CEZA 2XAHA 5IT9N 1M56C 2WLIB 1XOUA 5LOVB 5H5NA 3JASB 1Q6HA 4P30A 1NI8A 2H94A 5JCOA 5IY5C 1SZTA 4ZHQB 2GUZA 2E5LO 4FLVA 4DRXA 3L72H 4U3FH 1Y4MA 3RYIB 2Y4UA 3K0DA 4UVAA 2JGDA 3WG7C 4AILC 3OUSA 3STZC 1R6KA 1IX9A 1K34A 4I0XB 1SERA 2A7WA 1WPXA 4OGQB 2WLNA 1KKDA 4I9WA 4BAYA 4Z2WA 1JQ0A 2PTMA 1F4MA 3CX5F 4EFEA 4MW3A 3FB5C 4LF9B 2YXHA 1OZ0A 4MS2A 3BY6A 4DR1B 1QLEC 3GB7C 3RVYA 1QVGU 3OUFA 2YUAA 2QJ1A 1QU7A 1DTOA 4J9YB 3K5LA 1NVPD 3CHXA 3E83A 5D5PA 4OPHA 2FL4A 5L3FA 1I5XA 4MTFA 1NVPB 1XILA 1PL4A 2NNUA 4O4LA 1HNWO 4FLZA 4WFEA 3RGBA 3OFNG 4WFGA 4UVBA 4UUJC 3CRMA 3O9OA 1DK1A 2F93B 4NTWA 4J80A 4I50A 5JJNB 3AG1B 1NJIW 4UCVA 4Z1MG 3APOA 3JD4A 3N2GB 5B5EZ 2HG5C 5GTIZ 2VWJA 3CC7V 4HAMA 4UB8Z 2UXNA 3TETA 3WB0A 2DWEC 5LP6B 1SS3A 4JI6B 2L6LA 4DR5B 5B3SB 2WLKA 4RQEA 3BABA 1I08A 1VQKV 1OCOC 2IJKA 3SYOA 1H38A 4LF8B 3NXSA 3OE7G 4CS3A 4FJCC 2WSSG 2VQFO 3A0RA 1IXMA 4YJ3B 3CCUV 3OMAB 5J9PC 1TUBB 2CGNA 2EINB 3CCRV 4UVCA 2ZR2A 2R72A 3ZS8C 4OX9B 3B09A 4R50A 2KB1A 4D7SA 5H6QA 3T1HB 3JD3A 4MVOA 3JAWB 2LW7A 2YI8A 4JI0B 5IE9A 3E22B 2JJ1G 2CH7B 3KCXA 2NN4A 1MNGA 5J2TB 2QEXV 1PL0A 4FM2A 3KG2A 2QKCA 1YDXA 1JOYA 4N23A 1BE3H 3D3IA 1K97A 1N36B 5LMNO 3X2QC 4O4IB 2E5LB 2X6CA 3SPJA 3LDDA 3RYCA 2HKOA 3OTOO 5B1OA 1R3LC 4FPPA 2QWOB 5KA6A 2Q7HA 1CPYA 2LW1A 2BSKB 2PI4A 2QE7G 4GUNA 1GO3F 3O65A 3FYEB 3ZMVA 1OCZB 3KZIZ 1G8MA 3DSQA 1XREA 2IBZH 1D5AA 1ZWIC 1ZSPA 2F95B 3ABLC 3ZHRA 3FB8C 1HDJA 3ZJZA 3I56V 4UCSA 4XDJA 3L73H 4D7TA 1VIBA 2HJDA 5KHIA 3HKCA 1WB7A 5LMUO 4B3RO 5EZYB 1XMOO 1XEQA 3JAKB 3FAVA 2VRZA 2YIAA 3AG4C 3SJQC 2IW5A 3K04A 5B1AB 3AEIA 2UUAO 1GN6A 1HNWB 2XAJA 2PI5A 1M4UA 5EYPB 2P5OA 2CUGA 4H44B 2BTOA 2QKAA 4DV5O 1Z5WA 2VS0A 2YC0A 1E1RG 1JX9A 1GRJA 4YY3O 5EBMC 3ZRVA 2CE4A 2QWPB 1AB3A 1RFYA 1YITV 1XL6A 4WF9V 4FVMA 4F6EA 2JJ2G 4TV9B 4K8ZA 1SESA 4FMTA 3P30A 4IHJA 5LGTA 1BSMA 2ETNA 4LP8A 3K0GA 5KAIZ 4WFBV 1TA8A 2CK3G 2WLJA 4GT1A 5H2FZ 4KUMA 1VQ4V 2DJVA 2D2CB 2Q68A 1MZEA 1W59A 2QKSA 4D6TH 1VQNV 2YXLA 4NR1A 1ROPA 1VQ7V 1M93A 5A2QN 1AI7A 3EHBB 3VQVA 3RBZA 3IJ4A 1M5IA 4H0LB 4XDKA 2EJRA 3OM3B 3AK3A 2XT9A 4JTCB 5D5QA 4IYIA 5FLXN 1YJNV 1WA8B 4MVUA 3CJHA 4DR7O 4IIJB 4UV9A 3L9DA 3W7XA 4X65O 1BQZA 1I0HA 4PELA 2CTPA 4CC6A 4CS2A 1HNXO 3UT5A 1L8DA 1YVWA 1NH2D 2PGGA 2EILB 3G4SV 3P32A 2XNDG 3OR7C 1LNQA 5LMNB 4LWSB 5IWAO 3B8NA 4FLYA 1F23A 1NH2B 1QHTA 3DXRA 5JWPA 4J7JA 5DN6G 3OTOB 1NTZH 3Q4HB 5CB4B 4J7KA 2NLJC 2KG7B 5JVDB 5JQGB 1W0KG 2JVDA 3R65A 1FFXB 4RO2A 1AR1B 1BS3A 2KKWA 4CZZA 2ZDIA 5L3DA 4HBNA 4FFBB 1N0JA 1YSCA 4FLUA 1WNSA 4FK5C 1ZTEA 4JAUA 4FIPC 4NYKA 4L8JA 4JTDB 1QNMA 5E1AC 3S3WA 4WBNB 5DM6V 4B3MO 2JS5A 3S3XA 5LMUB 1YCIA 4B3RB 1XMOB 4J7ZA 3X2QB 4KHPO 1KMIZ 3BVOA 1GN2A 4DV4O 3RYHB 2UUAB 4L87A 4X66O 1ZAUA 5IJ0B 1WP8A 1AROP 2HVJC 1Q82W 2FMLA 3GWOA 3SYAA 1NTMH 5GW7A 4B7KA 4YY3B 3K9AA 1Q86W 4PA4A 3SYPA 3A0BZ 1EZVH 3ASNB 2PYJA 3CCJV 2BTQB 5C8YB 3DTUB 4PI0A 3H1IH 2WLLA 1DGSA 3ZCCA 4CH3A 1H2NA 2B5UA 1KP2A 5BMVB 1K5QA 1G1XB 2ZINA 1RSOB 1M57B 2QDOA 2M6YA 4YIPA 2V7QG 5B1BB 1QLNA 1Y74A 3AG4B 3K59A 5CA0A 1UPGA 1HR0O 1S77D 4JAAA 1KYOF 1BMFG 5JH7B 3VBBA 2IH1C 4JV5B 4NXMO 1EFRG 1VP7A 5IYBO 3JALB 3OMIB 3CCLV 5B3SC 5J2UB 1YTFD 2DN9A 4J11A 1GM9A 1N4CA 4P9OA 1TGOA 4UV8A 1VF7A 2R9RB 3SJCC 4PI2A 3E2EA 2E76B 1YTFB 4DR7B 2ILMA 4X65B 4H33A 4DK0A 4CH4A 1R1BA 2Q5ZA 3EXAA 2MK3A 4TQDA 2Y48A 5IYZA 1XL4A 3L71H 3UM7A 1Y76A 4JASA 4O4HA 1N8RW 3N27A 3C90A 3H1HH 4JYBA 3B2EE 1K33A 4ZOLA 5LHGA 1TVKA 3LDEA 3A2FA 4RUEA 2OTLV 5FNVA 4G28B 2YXYA 2JGUA 3CP1A 1Q81W 3HKEA 3CS5A 2WLIA 5LOVA 3VQYA 3CCSV 4NVPA 3KKYA 1DF5A 5EC1C 1Q3EA 4O2BB 3K9SA 3SDLA 4JZGA 5GTHZ 3F5TA 3AG2C 4CBCA 3J80N 2Q7EA 4GKJO 1MZFA 4B3MB 2E75B 1I7FA 4B3TO 4W4KA 2F1MA 1PKXA 1JJ2U 4GLXA 3CMAV 1GK9A 4KHPB 4X1KB 4ZIBA 1OV9A 3F7VC 1WP7A 2YS8A 4DV4B 1EBOA 2HJFC 4X66B 5HFLA 2UUCO 1OCZC 2AZ2A 2WWWA 2RMKB 1V55B 2DE0X 4I4TB 1O9HA 3ZX6A 1KD1W 1O9GA 2OYQA 4WFFA 3CYOA 4PDVA 1T5EA 3ML0A 3ETQA 1F51A 4CH6A 1L0LH 3ZHTA 1N36O 1KC8W 3D8CA 5E79Z 5KHKA 4QE7A 4AQYO 2UXXA 3K03A 2BE3A 1JPXA 5B1AC 4DR2B 2P22C 3HPLC 1AR4A 3GWKC 2Q7GA 3HKDB 3CWBH 3N2GA 4JYYA 4X1YA 2LFSA 4F6RB 2BOCC 2DMXA 3EVKA 4ICGA 1HR0B 2A0LA 2Q4PA 4NXMB 5KHJA 1JJOA 4R8CA 1L0NH 1WB8A 1SQPH 4KP4A 4LH6A 1NR7A 2EIKC 3K58A 1H2KA 4EFBA 1IXBA 3H1JH 1Q7YW 3CC2V 1ZL8B 3M99B 3OMNB 4YJ3A 5GONB 2FYUH 3ZEDA 1TUBA 4X88A 4FZ1A 3TXQA 2GHYA 3BFRA 3UQ8A 4UCOA 3SPHA 1JCHA 2LGQA 4FLWA 4YJ2B 1NZ6A 2A79B 1G4YB 2QGNA 5A9GA 4FM1A 3JAWA 5LXTA 4H37A 3E22A 3PJSK 3ZMSA 2GSMB 4GX0A 3AG3B 4LNUA 3B8MA 3K79A 3BA9A 4IT5A 4FLTA 1R3IC 3QO5A 1Q90D 2WAMA 2GUZB 2W0XA 4JF3A 3JAMN 4O2AB 4DRXB 3N2KB 3G80A 1J95A 4U7NA 5IYDO 5IDJA 2M7WA 3C3TA 2GDSA 2RJZA 4IGGA 2N04A 3FKSG 3RYFA 4EB6A 2ZM6O 4QE9A 2EILC 1CP9A 1R73A 3I5DA 2IH3C 1YHQV 4DR4B 4GKJB 2QM4A 2FKXA 4B3TB 3I55V 3BCCH 3TCUA 4J10A 1FXHA 3A0HZ 3AK1A 2ZIMA 2ADPA 4JPRA 2P4KA 1AI6A 1AILA 4PD4F 4GX5A 3MD0A 4OXSA 2UUCB 1IVSA 2ZE5A 1FJGO 4JI8O 2RQ6A 1SA0B 2HP8A 1E79G 5CBGA 2EZOA 2JRIA 2DOSA 4YXWG 1FFTB 1N0NA 1I94B 4BWAA 2ZIOA 4I50B 4TQFA 3QNEA 3T4ZA 1FKAO 4PA9A 2ZQMA 1VF6C 3IFXA 3AG2B 4PV1B 2EIMB 4AQYB 2XTAA 4E2LA 2GTSA 1BQ0A 2ZCEA 4BR6A 1XQ8A 5LYJA 1MABG 1ENVA 4MTOA 4JZ2A 3CCMV 1AJQA 3ZMUA 2RDCA 4TV9A 3F5WC 2XASA 3ASNC 2K9PA 4LC1A 3W7SA 2WA3A 1N34O 3OEEG 2EIJB 4U3JB 3CEIA 1HNZO 1GM8A 1VMGA 1M57C 3P3NA 3DC5A 2KSDA 1K8AW 5B1BC 3K3WA 3D36C 1K92A 2PYLA 4BW9A 2HVKC 2WA4A 4K0KB 1URFA 1FXKC 2VWKA 1NR1A 4MW8A 5EK0A 3K5NA 2P90A 3CCEV 3W7TA 2DQ0A 4HZ3A 1X59A 3ZN1A 2LJ2A 5TISZ 3ZHUA 1GKFA 4XBFA 1Y6XA 4H13B 2E3CA 4IIJA 2ZKOA 2GTAA 1LR1A 2Y0PA 4NXNO 1A32A 4DUZO 4JAVA 3E89A 1WJZA 2EIKB 1XHZA 1JMKC 2P67A 3LSUA 5CN0A 3VQXA 1VQLV 1KP3A 2ZM6B 1S76D 1VQ5V 5LHHA 3WFVA 3Q4HA 2B9ZA 2KG7A 4FZ0A 5KUMA 2P4VA 4QNHB 3TJTA 3IC9A 5IJ9B 2AXTZ 3BA8A 2IM9A 5LHIA 1CXZB 1FFXA 1THZA 4JV5O 1Y66A 1D2DA 1S3JA 3CRAA 2CGOA 2QWQB 1PV0A 4BW5A 1QR8A 3HKCB 4DV0O 2R9AA 4X62O 4OPAA 1R3JC 3CD6V 4RWUA 4ZKIA 1FJGB 4JI8B 3TGUH 1COWG 3VOUA 1K73W 4JGSA 4ZBMA 3SR2C 1XNRO 1W2BU 3RWRD 4JYAO 4YHHO 2ZD9A 1OCCB 3ABMC 1KBHA 1JFFB 1Q43A 3RYHA 5KX5B 3MAQA 4I55B 4I9QA 5IJ0A 4X20B 1K5SA 1B04A 4BIOA 4LF4O 5AG2A 4FFKA 4CC5A 1L1FA 3JATB 4ZI7A 1P7GA 1V55C 2AZ0A 4X1IA 3BEHA 1WAZA 3QO7A 2EZPA 3EFFK 4IL6Z 1P7BA 1RM1C 4MT8A 5BMVA 3SJBC 1PP9H 1DF4A 1IDSA 1N34B 5K1PA 1RSOA 3HKBA 4J9ZB 1US6A 1ORQC 2ODMA 2YIBD 3HR0A 1TAEA 1HNZB 1G6UA 2YEVA 3A8TA 4HNAA 2ITDC 3CXHF 1MSDA 4FM0A 4DW1A 1PNMA 5JH7A 1KUQA 3P3PA 1EZJA 3CJHB 1AP5A 5EBLC 2F23A 4CS4A 1EN5A 3B40A 4MSWC 2IU3A 2XUMA 5FL7G 1B06A 1NQTA 3UT5B 4PDRA 2P06A 2JIZG 2OTJV 2OIGA 5EBWC 2ZNJA 1IBMB 2Q0AA 5CBFA 3JCUZ 4NXNB 3DXRB 4WFHA 3C3SA 4DUZB 3ZMTA 2QR4A 2DW4A 2ADQB 1SQQH 2EBOA 4PHZA 3IGAC 3NR7A 1FS0G 4DR2O 4LR3A 1YIJV 1AJNA 2UXCO 4HYOA 2IJIA 3G6BA 1XMQO 4XDLA 4P2ZA 1UFIA 1V54C 2EJ7A 1RPOA 3U0ZA 1NBMG 1FXKB 2H8PC 2Q73A 2YIDA 2LP7A 2QM8A 1IURA 3AG3C 3FB6C 1B3QA 2XHBA 5JCOC 3MHSC 1VQPV 1IBKO 4TV8B 2UUBO 1NKDA 3JARA 4DV0B 3WB1A 2UU9O 1XNQO 1S0VA 4X62B 2BOBC 2YSUB 2Y69C 2ITCC 4I7ZB 4JI2O 1GM7A 3CRCA 2AGAA 5CA1B 1SQVH 3SPGA 1XNRB 3FYIB 3LNNA 2R70A 1X4TA 3L75H 3AG7A 3ZRWA 4JYAB 4YHHB 2ZE7A 2RCVA 4R7CA 5KHGA 4Q6GA 5DEDA 5LA6B 1VQOV 1SZXA 1Q5OA 4PA3A 3CB2A 1N33O 4LF4B 1XBLA 1KB9F 4LFAB 2CDYA 1BHAA 2E74B 5KHHA 3SPCA 4TWKA 2K1EA 3ABKC 3G6EV 1J5EO 4TOIA 1ZUQA 1BL8A 1PM9A 3JASA 3H1LH 4UCTA 5L3GA 1BCCH 4ZHQA 2C2AA 3E86A 1R6NA 5BR8O 4LFBO 4J41A 1VQ8V 3WU2Z 1Q6IA 3ETGA 4DR4O 3RYIA 1U96A 2EIMC 4MVQA 2EULA 3ABMB 2LO1A 4F6RA 1BT8A 1JR9A 4DK1A 4I0XA 3ETDA 1M1KW 3ZHSA 4A5UB 2UXDO 5KLVH 1VQ9V 4EEQA 1SQBH 5JJEB 4DV3O 4TUYB 4JI7O 2D3OW 5K1XA 2OIEA 5CMUA 2H3OA 5IYZB 4JTAB 5FPRA 2DYRC 1KU9A 2EIJC 1I94O 3VQWA 5GONA 2QA4V 4JI4O 1RM1B 3BHPA 1OCRB 1F7YA 2JS3A 4ZOLB 5LBQA 4DV2O 3OEHG 5KUKA 5LGNA 5LL6Y 4UB6Z 3F7YC 2P6JA 3FX7A 1SQFA 2CTRA 4LFCO 3QVNA 2UXCB 3JD1A 3TXSA 5EC2C 1XMQB 3CE2A 3HKEB 3THOA 5KMGB 1Y67A 3T2MA 4GKKO 4DR6O 4Z1VA 2A3QA 4PA7A 3AK2A 4DR3O 3CXCU 4X9QA 5LP6A 2OCCC 3T1CA 2NR5A 4O2AA 4O4JB 1VQMV 3N2KA 5LGUA 3MHHC 3IAYA 1IBKB 2UUBB 2XAFA 2ZE8A 2QTOA 1BHBA 5KA5A 4PA6A 2UU9B 1XNQB 1M90W 3OD4A 4DYLA 4JI2B 2JEXA 3CRRA 2Y0IA 2VQEO 1IBLO 2HHHB 4KFMA 4B08A 2QSAA 4K0KO 1LUWA 1AP6A 1FAFA 3CRQA 1AR5A 3RW0A 2W0FC 5ITZB 4PJ0Z 3QF7A 2X6AA 1Q6UA 2Q6AA 1V54B 3K57A 3M8AA 2CH7A 1YF2A 2XOKG 1E1QG 1N33B 1SA0A 1VARA 2A06H 1ZX3A 4U7OA 5J2TA 1Z5VA 4GYCB 1N32O 2X0LA 1OHHG 1SKVA 4BIUA 1HW7A 1J5EB 2KQXA 3CPWU 1AVMA 2JGDB 2Y69B 1F4NA 1PD3A 2PUSA 4X1YB 2X7RB 3SYQA 3QTCA 4O4IA 5BR8B 4LFBB 1I5YA 3OT7A 2DYSC 1OCCC 1PPJH 3WB2A 3ZN0A 2QM7A 3B4SA 2IU0A 2LFRA 2BSKA 1LUVA 1KKCA 4LF6B 3CCVV 2RNBA 4C7UA 4ASUG 5FPOA 2UXDB 1EN6A 1KECA 1BZKA 4K35A 4JI3O 4DV3B 1MOFA 4NB5A 1M9NA 4JI7B 4MVRA 3OGCC 1H2GA 2EX3A 1B6QA 2AHZA 2FB5A 2IJHA 4O4LB 3RFRA 1S5HC 3ABKB 4U3JA 2A9HA 5HFMA 2OCHA 3LSSA 2R9IA 1MSWD 4DV6O 5EZYA 2JDIG 3JAKA 2N74A 4DW0A 2OWOA 5LXTB 4JI4B 1GTOA 4MVSA 4DV2B 2FTKA 4LNUB 1V9PA 1D5NA 1RP3B 3BPZA 3ICXA 5EYPA 3T4DA 1P84F 4LFCB 5H6RA 2QTSA 2ZXWC 2MW2B 4N21A 3H1KH 4GKKB 4DR6B 4LBEC 2ARHA 1XUQA 2W6IG 3LSQA 3RVZA 3RYFB 4EB6B 4DR3B 3IC7A 3QG5A 1H2LA 5CBHA 4P9PA 2ZR3A 3ZRSA 2UXBO 1QQCA 1GMGA 1S72V 2HEPA 4G2KA 1R6TA 3DC6A 4B7EA 2DYRB 1GAXA 1SRYA 1K4DC 1SQGA 4JYCA 3STLC 4LF5O 3TK1A 4AI8A 5C93A 2B1IA 1U97A 4GZRB 1MMMA 3G71V 1QCEA 5IJ9A 4RUFA 2ZDIC 2VQEB 4I5SA 1IBLB 2GV9A 5EIBC 1MG1A 4K3AA 2LQTA 3K5OA 3ABTA 3DGEA 1NTKH 1M56B 3SJAC 4UFZA 5F2VO 4DUYO 3JSLA 1P4RA 5IY5B 3G67A 3GVMA 5L3BA 3UO2A 2OCCB 1WA8A 4KXRA 3OGIB 3K06A 4NTXA 1H2MA 1YJWV 4PDMA 1IBMO 4QPKA 2WLHA 1N32B 3WG7B 3RYCB 3FD9A 1SETA 3UCSC 3BRCA 3CCQV 4JI1O 2BCCH 3ASOC 3T1YO 1JFFA 4QPJA 5LYJB 2AHYA 4LWSA 5KX5A 4RQFA 4I55A 1PNLA 4X20A 3ZHQA 5CB4A 2ZNIA 5JVDA 2Q0OC 3JATA 1QLEB 5JQGA 4GX2A 1HP8A 2ATKC 1S5LZ 1GN3A 2JEUA 5IYCO 4X64O 2XAQA 1RPRA 4FFBA 3RN4A 1AI4A 4UCRA 2VQFB 3JD0A 4MVMA 4JI3B 3OTFA 4LF7O 2V4DA 3FAVB 1VEWA 4TT3G 4KL1A 3LUTB 4WBNA 5BY1A 4BIZA 2F4VO 3E8FA 4DV1O 2YDEA 4DV6B 1VF6A 2Q9LA 1MA1A 5BXZA 5CA3A 2YIBA 2DYSB 1TUEB 4JI5O 2JK5C 2F66C 1IZ3A 4G27B 4R6ZA 1OCOB 4LFAO 1WPBA 3ZIAG 4E4EA 2PZSA 2CAZC 1P49A 4DO2A 1QVFU 4IHJB 3RT3C 2ZT9B 3ZHVA 4YIOA 2BTQA 5C8YA 3J81N 2UXBB 1WN7A 1K3EA 3M7MX 5L3CA 1OCRC 4MTXA 1JVMA 2N05A 4W4LA 5B66Z 3ZMZA 2Z5UA 1NU1H 1BGYH 3OW2U 2HFEC 2G38A 4LF5B 2PF4E 3D36A 2HR3A 1FXKA 5L3EA 2PY5A 3MDSA 5KAFZ 1YEWA 4WCEV 1K7DA 4X89A 2QWRB 3L70H 2L35A 4LH7A 3BAAA 2ZXWB 3LDCA 3L74H 4TV8A 3JALA 4DUYB 1XHXA 5J2UA 1YI2V 2Y4TA 4GX1A 4DV7O 1YXBA 2YICA 2F43G 4LCUC 1ZLZA 2WLMA 4B3SO 5CA1A 4UCUA 2OT5A 1R3KC 2W6JG 3FB7C 3CMEV 2Z3YA 4DV5B 4JI1B 1Z2GA 3E8BA 2IJJA 3T1YB 4ZI7B 2ZE6A 5LA6A 1FPOA 5JJJB 5EIBD 4MVZA 4RAIA 3LNMB 3ABLB 3J7AU 4X1IB 1YZBA 3E8GA 4J42A 1GN4A
chains in the Genus database with same CATH topology
2ZKOA 4X66O 1FJGO 4DV2O 2DJVA 4JI8O 2AGAA 3OTOO 4NXNO 5LL6Y 1A32A 4LFAO 1FYJA 1HNWO 4DUZO 2JRIA 1DK1A 4LFCO 4DUYO 5A2QN 2DOSA 3R66A 3RT3C 3O65A 4GKKO 4DR6O 1FKAO 4OX9O 5FLXN 3T1HO 1KUQA 4JI0O 4JI3O 4DR3O 3J81N 4DR7O 3SDLA 1N33O 1IBMO 3F5TA 4X65O 3J80N 4GKJO 2HHHO 4B3TO 4JV5O 4LF9O 1G1XB 1D2DA 4JI1O 1HNXO 4DV6O 1J5EO 3T1YO 4DR1O 4DV0O 5LMUO 2N74A 4B3RO 5IT9N 1XMOO 1XEQA 5H5NA 4X62O 4OPAA 5IWAO 2VQFO 5BR8O 4LFBO 1HR0O 2UUCO 2E5LO 4DR4O 2UUAO 4OPHA 2VQEO 1IBLO 3JAMN 4NXMO 4K0KO 1N34O 1XNRO 2Z0AA 4DV5O 4DR2O 4X64O 4DV7O 2UXCO 1HNZO 1XMQO 4JYAO 4YHHO 4YY3O 2ZM6O 1NS1A 2LW7A 3M8AA 4B3SO 1AB3A 4A5UB 2UXDO 4LF7O 1N36O 2FKXA 4AQYO 2UXBO 4LF4O 1R1BA 4DV3O 1N32O 5BY1A 4DR5O 4JI6O 4JI7O 2F4VO 4DV1O 1IBKO 4B3MO 1R6TA 2UUBO 2UU9O 5BXZA 1XNQO 4LF6O 4LF8O 1X59A 4LF5O 1AILA 1I94O 4KHPO 4JI5O 3J7AU 4JI4O 1YZBA 4JI2O 5LMNO 4DV4O 1F7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZKO A;  4X66 O;  1FJG O;  4DV2 O;  2DJV A;  4JI8 O;  2AGA A;  3OTO O;  4NXN O;  5LL6 Y;  1A32 A;  4LFA O;  1FYJ A;  1HNW O;  4DUZ O;  2JRI A;  1DK1 A;  4LFC O;  4DUY O;  5A2Q N;  2DOS A;  3R66 A;  3RT3 C;  3O65 A;  4GKK O;  4DR6 O;  1FKA O;  4OX9 O;  5FLX N;  3T1H O;  1KUQ A;  4JI0 O;  4JI3 O;  4DR3 O;  3J81 N;  4DR7 O;  3SDL A;  1N33 O;  1IBM O;  3F5T A;  4X65 O;  3J80 N;  4GKJ O;  2HHH O;  4B3T O;  4JV5 O;  4LF9 O;  1G1X B;  1D2D A;  4JI1 O;  1HNX O;  4DV6 O;  1J5E O;  3T1Y O;  4DR1 O;  4DV0 O;  5LMU O;  2N74 A;  4B3R O;  5IT9 N;  1XMO O;  1XEQ A;  5H5N A;  4X62 O;  4OPA A;  5IWA O;  2VQF O;  5BR8 O;  4LFB O;  1HR0 O;  2UUC O;  2E5L O;  4DR4 O;  2UUA O;  4OPH A;  2VQE O;  1IBL O;  3JAM N;  4NXM O;  4K0K O;  1N34 O;  1XNR O;  2Z0A A;  4DV5 O;  4DR2 O;  4X64 O;  4DV7 O;  2UXC O;  1HNZ O;  1XMQ O;  4JYA O;  4YHH O;  4YY3 O;  2ZM6 O;  1NS1 A;  2LW7 A;  3M8A A;  4B3S O;  1AB3 A;  4A5U B;  2UXD O;  4LF7 O;  1N36 O;  2FKX A;  4AQY O;  2UXB O;  4LF4 O;  1R1B A;  4DV3 O;  1N32 O;  5BY1 A;  4DR5 O;  4JI6 O;  4JI7 O;  2F4V O;  4DV1 O;  1IBK O;  4B3M O;  1R6T A;  2UUB O;  2UU9 O;  5BXZ A;  1XNQ O;  4LF6 O;  4LF8 O;  1X59 A;  4LF5 O;  1AIL A;  1I94 O;  4KHP O;  4JI5 O;  3J7A U;  4JI4 O;  1YZB A;  4JI2 O;  5LMN O;  4DV4 O;  1F7Y A; 
#chains in the Genus database with same CATH topology
 2RN9 A;  1VF5 B;  1K4C C;  2Q69 A;  1FYJ A;  3FFQ A;  4NKG B;  4X64 B;  4EKW A;  3ETE A;  3K08 A;  3HKB B;  3JYC A;  4NTY A;  4IYH A;  3W7U A;  3R66 A;  4UXN A;  1HWY A;  1H8H G;  2YEV B;  4HNA B;  2XAG A;  3AG1 C;  4LF7 B;  2DQ3 A;  1QBZ A;  2GBO A;  4O2B A;  3H01 A;  3UO3 A;  1SF9 A;  1Q8I A;  3CC4 V;  3JSN A;  4WFA V;  1H2S B;  1FXV A;  1VQ6 V;  2HLD G;  2F4V B;  4DV1 B;  4PDL A;  4CH5 A;  1EN4 A;  2HHH O;  5LP6 C;  4LF9 O;  3ASO B;  1SC5 B;  2P7T C;  3E8H A;  4X1K A;  4DR1 O;  3APQ A;  3ZRX A;  4QGP A;  1EM1 A;  4JI5 B;  3JD2 A;  1XI1 A;  1DLB A;  2DWD C;  1AJP A;  1UJW B;  2Q8V A;  4TUY A;  1OJH A;  3U11 A;  1HNX B;  2WLL B;  4I4T A;  4Q20 A;  2B1G A;  1S5J A;  2Z0A A;  2EIN C;  3D3Q A;  5DEC A;  2QWN B;  1QR9 A;  1KQS U;  5IWA B;  1NS1 A;  3ABU A;  1Y74 B;  3SGI A;  3PN1 A;  1AI5 A;  5CA0 B;  4TSF G;  3K5M A;  4AHC A;  3B77 A;  3JCZ A;  4DR5 O;  4JI6 O;  1H8E G;  5H9C A;  2AW9 A;  1W0J G;  3HKD A;  5KMG A;  4MTG A;  3CSX A;  3JAR B;  2Q67 A;  4LF6 O;  4LF8 O;  1K9M W;  2V1D A;  3SPI A;  3E35 A;  3SYC A;  4DXW A;  4O4J A;  2O57 A;  2CTQ A;  3KCY A;  4FLX A;  4ABM A;  3OAA G;  3H9V A;  4GCZ A;  5B1N A;  1JA8 A;  1NT2 B;  2LGW A;  4QJF B;  4F4L A;  2CTW A;  4DV7 B;  3QO8 A;  1GH6 A;  2YI9 A;  4QIW F;  3HB3 B;  1ZL8 A;  1Y76 B;  3ZRW B;  3UKM A;  4OX9 O;  4X8A A;  4B3S B;  1PNK A;  1FD9 A;  4K8X A;  4O4H B;  1WLE A;  3T1H O;  3ZBH A;  4JI0 O;  1YJ9 V;  3U10 A;  5BZB A;  1TVK B;  1XDC A;  2WPD G;  1SQX H;  5ITZ A;  4YJ2 A;  3W7W A;  5FNV B;  3OR6 C;  2X6B A;  1CEZ A;  2XAH A;  5IT9 N;  1M56 C;  2WLI B;  1XOU A;  5LOV B;  5H5N A;  3JAS B;  1Q6H A;  4P30 A;  1NI8 A;  2H94 A;  5JCO A;  5IY5 C;  1SZT A;  4ZHQ B;  2GUZ A;  2E5L O;  4FLV A;  4DRX A;  3L72 H;  4U3F H;  1Y4M A;  3RYI B;  2Y4U A;  3K0D A;  4UVA A;  2JGD A;  3WG7 C;  4AIL C;  3OUS A;  3STZ C;  1R6K A;  1IX9 A;  1K34 A;  4I0X B;  1SER A;  2A7W A;  1WPX A;  4OGQ B;  2WLN A;  1KKD A;  4I9W A;  4BAY A;  4Z2W A;  1JQ0 A;  2PTM A;  1F4M A;  3CX5 F;  4EFE A;  4MW3 A;  3FB5 C;  4LF9 B;  2YXH A;  1OZ0 A;  4MS2 A;  3BY6 A;  4DR1 B;  1QLE C;  3GB7 C;  3RVY A;  1QVG U;  3OUF A;  2YUA A;  2QJ1 A;  1QU7 A;  1DTO A;  4J9Y B;  3K5L A;  1NVP D;  3CHX A;  3E83 A;  5D5P A;  4OPH A;  2FL4 A;  5L3F A;  1I5X A;  4MTF A;  1NVP B;  1XIL A;  1PL4 A;  2NNU A;  4O4L A;  1HNW O;  4FLZ A;  4WFE A;  3RGB A;  3OFN G;  4WFG A;  4UVB A;  4UUJ C;  3CRM A;  3O9O A;  1DK1 A;  2F93 B;  4NTW A;  4J80 A;  4I50 A;  5JJN B;  3AG1 B;  1NJI W;  4UCV A;  4Z1M G;  3APO A;  3JD4 A;  3N2G B;  5B5E Z;  2HG5 C;  5GTI Z;  2VWJ A;  3CC7 V;  4HAM A;  4UB8 Z;  2UXN A;  3TET A;  3WB0 A;  2DWE C;  5LP6 B;  1SS3 A;  4JI6 B;  2L6L A;  4DR5 B;  5B3S B;  2WLK A;  4RQE A;  3BAB A;  1I08 A;  1VQK V;  1OCO C;  2IJK A;  3SYO A;  1H38 A;  4LF8 B;  3NXS A;  3OE7 G;  4CS3 A;  4FJC C;  2WSS G;  2VQF O;  3A0R A;  1IXM A;  4YJ3 B;  3CCU V;  3OMA B;  5J9P C;  1TUB B;  2CGN A;  2EIN B;  3CCR V;  4UVC A;  2ZR2 A;  2R72 A;  3ZS8 C;  4OX9 B;  3B09 A;  4R50 A;  2KB1 A;  4D7S A;  5H6Q A;  3T1H B;  3JD3 A;  4MVO A;  3JAW B;  2LW7 A;  2YI8 A;  4JI0 B;  5IE9 A;  3E22 B;  2JJ1 G;  2CH7 B;  3KCX A;  2NN4 A;  1MNG A;  5J2T B;  2QEX V;  1PL0 A;  4FM2 A;  3KG2 A;  2QKC A;  1YDX A;  1JOY A;  4N23 A;  1BE3 H;  3D3I A;  1K97 A;  1N36 B;  5LMN O;  3X2Q C;  4O4I B;  2E5L B;  2X6C A;  3SPJ A;  3LDD A;  3RYC A;  2HKO A;  3OTO O;  5B1O A;  1R3L C;  4FPP A;  2QWO B;  5KA6 A;  2Q7H A;  1CPY A;  2LW1 A;  2BSK B;  2PI4 A;  2QE7 G;  4GUN A;  1GO3 F;  3O65 A;  3FYE B;  3ZMV A;  1OCZ B;  3KZI Z;  1G8M A;  3DSQ A;  1XRE A;  2IBZ H;  1D5A A;  1ZWI C;  1ZSP A;  2F95 B;  3ABL C;  3ZHR A;  3FB8 C;  1HDJ A;  3ZJZ A;  3I56 V;  4UCS A;  4XDJ A;  3L73 H;  4D7T A;  1VIB A;  2HJD A;  5KHI A;  3HKC A;  1WB7 A;  5LMU O;  4B3R O;  5EZY B;  1XMO O;  1XEQ A;  3JAK B;  3FAV A;  2VRZ A;  2YIA A;  3AG4 C;  3SJQ C;  2IW5 A;  3K04 A;  5B1A B;  3AEI A;  2UUA O;  1GN6 A;  1HNW B;  2XAJ A;  2PI5 A;  1M4U A;  5EYP B;  2P5O A;  2CUG A;  4H44 B;  2BTO A;  2QKA A;  4DV5 O;  1Z5W A;  2VS0 A;  2YC0 A;  1E1R G;  1JX9 A;  1GRJ A;  4YY3 O;  5EBM C;  3ZRV A;  2CE4 A;  2QWP B;  1AB3 A;  1RFY A;  1YIT V;  1XL6 A;  4WF9 V;  4FVM A;  4F6E A;  2JJ2 G;  4TV9 B;  4K8Z A;  1SES A;  4FMT A;  3P30 A;  4IHJ A;  5LGT A;  1BSM A;  2ETN A;  4LP8 A;  3K0G A;  5KAI Z;  4WFB V;  1TA8 A;  2CK3 G;  2WLJ A;  4GT1 A;  5H2F Z;  4KUM A;  1VQ4 V;  2DJV A;  2D2C B;  2Q68 A;  1MZE A;  1W59 A;  2QKS A;  4D6T H;  1VQN V;  2YXL A;  4NR1 A;  1ROP A;  1VQ7 V;  1M93 A;  5A2Q N;  1AI7 A;  3EHB B;  3VQV A;  3RBZ A;  3IJ4 A;  1M5I A;  4H0L B;  4XDK A;  2EJR A;  3OM3 B;  3AK3 A;  2XT9 A;  4JTC B;  5D5Q A;  4IYI A;  5FLX N;  1YJN V;  1WA8 B;  4MVU A;  3CJH A;  4DR7 O;  4IIJ B;  4UV9 A;  3L9D A;  3W7X A;  4X65 O;  1BQZ A;  1I0H A;  4PEL A;  2CTP A;  4CC6 A;  4CS2 A;  1HNX O;  3UT5 A;  1L8D A;  1YVW A;  1NH2 D;  2PGG A;  2EIL B;  3G4S V;  3P32 A;  2XND G;  3OR7 C;  1LNQ A;  5LMN B;  4LWS B;  5IWA O;  3B8N A;  4FLY A;  1F23 A;  1NH2 B;  1QHT A;  3DXR A;  5JWP A;  4J7J A;  5DN6 G;  3OTO B;  1NTZ H;  3Q4H B;  5CB4 B;  4J7K A;  2NLJ C;  2KG7 B;  5JVD B;  5JQG B;  1W0K G;  2JVD A;  3R65 A;  1FFX B;  4RO2 A;  1AR1 B;  1BS3 A;  2KKW A;  4CZZ A;  2ZDI A;  5L3D A;  4HBN A;  4FFB B;  1N0J A;  1YSC A;  4FLU A;  1WNS A;  4FK5 C;  1ZTE A;  4JAU A;  4FIP C;  4NYK A;  4L8J A;  4JTD B;  1QNM A;  5E1A C;  3S3W A;  4WBN B;  5DM6 V;  4B3M O;  2JS5 A;  3S3X A;  5LMU B;  1YCI A;  4B3R B;  1XMO B;  4J7Z A;  3X2Q B;  4KHP O;  1KMI Z;  3BVO A;  1GN2 A;  4DV4 O;  3RYH B;  2UUA B;  4L87 A;  4X66 O;  1ZAU A;  5IJ0 B;  1WP8 A;  1ARO P;  2HVJ C;  1Q82 W;  2FML A;  3GWO A;  3SYA A;  1NTM H;  5GW7 A;  4B7K A;  4YY3 B;  3K9A A;  1Q86 W;  4PA4 A;  3SYP A;  3A0B Z;  1EZV H;  3ASN B;  2PYJ A;  3CCJ V;  2BTQ B;  5C8Y B;  3DTU B;  4PI0 A;  3H1I H;  2WLL A;  1DGS A;  3ZCC A;  4CH3 A;  1H2N A;  2B5U A;  1KP2 A;  5BMV B;  1K5Q A;  1G1X B;  2ZIN A;  1RSO B;  1M57 B;  2QDO A;  2M6Y A;  4YIP A;  2V7Q G;  5B1B B;  1QLN A;  1Y74 A;  3AG4 B;  3K59 A;  5CA0 A;  1UPG A;  1HR0 O;  1S77 D;  4JAA A;  1KYO F;  1BMF G;  5JH7 B;  3VBB A;  2IH1 C;  4JV5 B;  4NXM O;  1EFR G;  1VP7 A;  5IYB O;  3JAL B;  3OMI B;  3CCL V;  5B3S C;  5J2U B;  1YTF D;  2DN9 A;  4J11 A;  1GM9 A;  1N4C A;  4P9O A;  1TGO A;  4UV8 A;  1VF7 A;  2R9R B;  3SJC C;  4PI2 A;  3E2E A;  2E76 B;  1YTF B;  4DR7 B;  2ILM A;  4X65 B;  4H33 A;  4DK0 A;  4CH4 A;  1R1B A;  2Q5Z A;  3EXA A;  2MK3 A;  4TQD A;  2Y48 A;  5IYZ A;  1XL4 A;  3L71 H;  3UM7 A;  1Y76 A;  4JAS A;  4O4H A;  1N8R W;  3N27 A;  3C90 A;  3H1H H;  4JYB A;  3B2E E;  1K33 A;  4ZOL A;  5LHG A;  1TVK A;  3LDE A;  3A2F A;  4RUE A;  2OTL V;  5FNV A;  4G28 B;  2YXY A;  2JGU A;  3CP1 A;  1Q81 W;  3HKE A;  3CS5 A;  2WLI A;  5LOV A;  3VQY A;  3CCS V;  4NVP A;  3KKY A;  1DF5 A;  5EC1 C;  1Q3E A;  4O2B B;  3K9S A;  3SDL A;  4JZG A;  5GTH Z;  3F5T A;  3AG2 C;  4CBC A;  3J80 N;  2Q7E A;  4GKJ O;  1MZF A;  4B3M B;  2E75 B;  1I7F A;  4B3T O;  4W4K A;  2F1M A;  1PKX A;  1JJ2 U;  4GLX A;  3CMA V;  1GK9 A;  4KHP B;  4X1K B;  4ZIB A;  1OV9 A;  3F7V C;  1WP7 A;  2YS8 A;  4DV4 B;  1EBO A;  2HJF C;  4X66 B;  5HFL A;  2UUC O;  1OCZ C;  2AZ2 A;  2WWW A;  2RMK B;  1V55 B;  2DE0 X;  4I4T B;  1O9H A;  3ZX6 A;  1KD1 W;  1O9G A;  2OYQ A;  4WFF A;  3CYO A;  4PDV A;  1T5E A;  3ML0 A;  3ETQ A;  1F51 A;  4CH6 A;  1L0L H;  3ZHT A;  1N36 O;  1KC8 W;  3D8C A;  5E79 Z;  5KHK A;  4QE7 A;  4AQY O;  2UXX A;  3K03 A;  2BE3 A;  1JPX A;  5B1A C;  4DR2 B;  2P22 C;  3HPL C;  1AR4 A;  3GWK C;  2Q7G A;  3HKD B;  3CWB H;  3N2G A;  4JYY A;  4X1Y A;  2LFS A;  4F6R B;  2BOC C;  2DMX A;  3EVK A;  4ICG A;  1HR0 B;  2A0L A;  2Q4P A;  4NXM B;  5KHJ A;  1JJO A;  4R8C A;  1L0N H;  1WB8 A;  1SQP H;  4KP4 A;  4LH6 A;  1NR7 A;  2EIK C;  3K58 A;  1H2K A;  4EFB A;  1IXB A;  3H1J H;  1Q7Y W;  3CC2 V;  1ZL8 B;  3M99 B;  3OMN B;  4YJ3 A;  5GON B;  2FYU H;  3ZED A;  1TUB A;  4X88 A;  4FZ1 A;  3TXQ A;  2GHY A;  3BFR A;  3UQ8 A;  4UCO A;  3SPH A;  1JCH A;  2LGQ A;  4FLW A;  4YJ2 B;  1NZ6 A;  2A79 B;  1G4Y B;  2QGN A;  5A9G A;  4FM1 A;  3JAW A;  5LXT A;  4H37 A;  3E22 A;  3PJS K;  3ZMS A;  2GSM B;  4GX0 A;  3AG3 B;  4LNU A;  3B8M A;  3K79 A;  3BA9 A;  4IT5 A;  4FLT A;  1R3I C;  3QO5 A;  1Q90 D;  2WAM A;  2GUZ B;  2W0X A;  4JF3 A;  3JAM N;  4O2A B;  4DRX B;  3N2K B;  3G80 A;  1J95 A;  4U7N A;  5IYD O;  5IDJ A;  2M7W A;  3C3T A;  2GDS A;  2RJZ A;  4IGG A;  2N04 A;  3FKS G;  3RYF A;  4EB6 A;  2ZM6 O;  4QE9 A;  2EIL C;  1CP9 A;  1R73 A;  3I5D A;  2IH3 C;  1YHQ V;  4DR4 B;  4GKJ B;  2QM4 A;  2FKX A;  4B3T B;  3I55 V;  3BCC H;  3TCU A;  4J10 A;  1FXH A;  3A0H Z;  3AK1 A;  2ZIM A;  2ADP A;  4JPR A;  2P4K A;  1AI6 A;  1AIL A;  4PD4 F;  4GX5 A;  3MD0 A;  4OXS A;  2UUC B;  1IVS A;  2ZE5 A;  1FJG O;  4JI8 O;  2RQ6 A;  1SA0 B;  2HP8 A;  1E79 G;  5CBG A;  2EZO A;  2JRI A;  2DOS A;  4YXW G;  1FFT B;  1N0N A;  1I94 B;  4BWA A;  2ZIO A;  4I50 B;  4TQF A;  3QNE A;  3T4Z A;  1FKA O;  4PA9 A;  2ZQM A;  1VF6 C;  3IFX A;  3AG2 B;  4PV1 B;  2EIM B;  4AQY B;  2XTA A;  4E2L A;  2GTS A;  1BQ0 A;  2ZCE A;  4BR6 A;  1XQ8 A;  5LYJ A;  1MAB G;  1ENV A;  4MTO A;  4JZ2 A;  3CCM V;  1AJQ A;  3ZMU A;  2RDC A;  4TV9 A;  3F5W C;  2XAS A;  3ASN C;  2K9P A;  4LC1 A;  3W7S A;  2WA3 A;  1N34 O;  3OEE G;  2EIJ B;  4U3J B;  3CEI A;  1HNZ O;  1GM8 A;  1VMG A;  1M57 C;  3P3N A;  3DC5 A;  2KSD A;  1K8A W;  5B1B C;  3K3W A;  3D36 C;  1K92 A;  2PYL A;  4BW9 A;  2HVK C;  2WA4 A;  4K0K B;  1URF A;  1FXK C;  2VWK A;  1NR1 A;  4MW8 A;  5EK0 A;  3K5N A;  2P90 A;  3CCE V;  3W7T A;  2DQ0 A;  4HZ3 A;  1X59 A;  3ZN1 A;  2LJ2 A;  5TIS Z;  3ZHU A;  1GKF A;  4XBF A;  1Y6X A;  4H13 B;  2E3C A;  4IIJ A;  2ZKO A;  2GTA A;  1LR1 A;  2Y0P A;  4NXN O;  1A32 A;  4DUZ O;  4JAV A;  3E89 A;  1WJZ A;  2EIK B;  1XHZ A;  1JMK C;  2P67 A;  3LSU A;  5CN0 A;  3VQX A;  1VQL V;  1KP3 A;  2ZM6 B;  1S76 D;  1VQ5 V;  5LHH A;  3WFV A;  3Q4H A;  2B9Z A;  2KG7 A;  4FZ0 A;  5KUM A;  2P4V A;  4QNH B;  3TJT A;  3IC9 A;  5IJ9 B;  2AXT Z;  3BA8 A;  2IM9 A;  5LHI A;  1CXZ B;  1FFX A;  1THZ A;  4JV5 O;  1Y66 A;  1D2D A;  1S3J A;  3CRA A;  2CGO A;  2QWQ B;  1PV0 A;  4BW5 A;  1QR8 A;  3HKC B;  4DV0 O;  2R9A A;  4X62 O;  4OPA A;  1R3J C;  3CD6 V;  4RWU A;  4ZKI A;  1FJG B;  4JI8 B;  3TGU H;  1COW G;  3VOU A;  1K73 W;  4JGS A;  4ZBM A;  3SR2 C;  1XNR O;  1W2B U;  3RWR D;  4JYA O;  4YHH O;  2ZD9 A;  1OCC B;  3ABM C;  1KBH A;  1JFF B;  1Q43 A;  3RYH A;  5KX5 B;  3MAQ A;  4I55 B;  4I9Q A;  5IJ0 A;  4X20 B;  1K5S A;  1B04 A;  4BIO A;  4LF4 O;  5AG2 A;  4FFK A;  4CC5 A;  1L1F A;  3JAT B;  4ZI7 A;  1P7G A;  1V55 C;  2AZ0 A;  4X1I A;  3BEH A;  1WAZ A;  3QO7 A;  2EZP A;  3EFF K;  4IL6 Z;  1P7B A;  1RM1 C;  4MT8 A;  5BMV A;  3SJB C;  1PP9 H;  1DF4 A;  1IDS A;  1N34 B;  5K1P A;  1RSO A;  3HKB A;  4J9Z B;  1US6 A;  1ORQ C;  2ODM A;  2YIB D;  3HR0 A;  1TAE A;  1HNZ B;  1G6U A;  2YEV A;  3A8T A;  4HNA A;  2ITD C;  3CXH F;  1MSD A;  4FM0 A;  4DW1 A;  1PNM A;  5JH7 A;  1KUQ A;  3P3P A;  1EZJ A;  3CJH B;  1AP5 A;  5EBL C;  2F23 A;  4CS4 A;  1EN5 A;  3B40 A;  4MSW C;  2IU3 A;  2XUM A;  5FL7 G;  1B06 A;  1NQT A;  3UT5 B;  4PDR A;  2P06 A;  2JIZ G;  2OTJ V;  2OIG A;  5EBW C;  2ZNJ A;  1IBM B;  2Q0A A;  5CBF A;  3JCU Z;  4NXN B;  3DXR B;  4WFH A;  3C3S A;  4DUZ B;  3ZMT A;  2QR4 A;  2DW4 A;  2ADQ B;  1SQQ H;  2EBO A;  4PHZ A;  3IGA C;  3NR7 A;  1FS0 G;  4DR2 O;  4LR3 A;  1YIJ V;  1AJN A;  2UXC O;  4HYO A;  2IJI A;  3G6B A;  1XMQ O;  4XDL A;  4P2Z A;  1UFI A;  1V54 C;  2EJ7 A;  1RPO A;  3U0Z A;  1NBM G;  1FXK B;  2H8P C;  2Q73 A;  2YID A;  2LP7 A;  2QM8 A;  1IUR A;  3AG3 C;  3FB6 C;  1B3Q A;  2XHB A;  5JCO C;  3MHS C;  1VQP V;  1IBK O;  4TV8 B;  2UUB O;  1NKD A;  3JAR A;  4DV0 B;  3WB1 A;  2UU9 O;  1XNQ O;  1S0V A;  4X62 B;  2BOB C;  2YSU B;  2Y69 C;  2ITC C;  4I7Z B;  4JI2 O;  1GM7 A;  3CRC A;  2AGA A;  5CA1 B;  1SQV H;  3SPG A;  1XNR B;  3FYI B;  3LNN A;  2R70 A;  1X4T A;  3L75 H;  3AG7 A;  3ZRW A;  4JYA B;  4YHH B;  2ZE7 A;  2RCV A;  4R7C A;  5KHG A;  4Q6G A;  5DED A;  5LA6 B;  1VQO V;  1SZX A;  1Q5O A;  4PA3 A;  3CB2 A;  1N33 O;  4LF4 B;  1XBL A;  1KB9 F;  4LFA B;  2CDY A;  1BHA A;  2E74 B;  5KHH A;  3SPC A;  4TWK A;  2K1E A;  3ABK C;  3G6E V;  1J5E O;  4TOI A;  1ZUQ A;  1BL8 A;  1PM9 A;  3JAS A;  3H1L H;  4UCT A;  5L3G A;  1BCC H;  4ZHQ A;  2C2A A;  3E86 A;  1R6N A;  5BR8 O;  4LFB O;  4J41 A;  1VQ8 V;  3WU2 Z;  1Q6I A;  3ETG A;  4DR4 O;  3RYI A;  1U96 A;  2EIM C;  4MVQ A;  2EUL A;  3ABM B;  2LO1 A;  4F6R A;  1BT8 A;  1JR9 A;  4DK1 A;  4I0X A;  3ETD A;  1M1K W;  3ZHS A;  4A5U B;  2UXD O;  5KLV H;  1VQ9 V;  4EEQ A;  1SQB H;  5JJE B;  4DV3 O;  4TUY B;  4JI7 O;  2D3O W;  5K1X A;  2OIE A;  5CMU A;  2H3O A;  5IYZ B;  4JTA B;  5FPR A;  2DYR C;  1KU9 A;  2EIJ C;  1I94 O;  3VQW A;  5GON A;  2QA4 V;  4JI4 O;  1RM1 B;  3BHP A;  1OCR B;  1F7Y A;  2JS3 A;  4ZOL B;  5LBQ A;  4DV2 O;  3OEH G;  5KUK A;  5LGN A;  5LL6 Y;  4UB6 Z;  3F7Y C;  2P6J A;  3FX7 A;  1SQF A;  2CTR A;  4LFC O;  3QVN A;  2UXC B;  3JD1 A;  3TXS A;  5EC2 C;  1XMQ B;  3CE2 A;  3HKE B;  3THO A;  5KMG B;  1Y67 A;  3T2M A;  4GKK O;  4DR6 O;  4Z1V A;  2A3Q A;  4PA7 A;  3AK2 A;  4DR3 O;  3CXC U;  4X9Q A;  5LP6 A;  2OCC C;  3T1C A;  2NR5 A;  4O2A A;  4O4J B;  1VQM V;  3N2K A;  5LGU A;  3MHH C;  3IAY A;  1IBK B;  2UUB B;  2XAF A;  2ZE8 A;  2QTO A;  1BHB A;  5KA5 A;  4PA6 A;  2UU9 B;  1XNQ B;  1M90 W;  3OD4 A;  4DYL A;  4JI2 B;  2JEX A;  3CRR A;  2Y0I A;  2VQE O;  1IBL O;  2HHH B;  4KFM A;  4B08 A;  2QSA A;  4K0K O;  1LUW A;  1AP6 A;  1FAF A;  3CRQ A;  1AR5 A;  3RW0 A;  2W0F C;  5ITZ B;  4PJ0 Z;  3QF7 A;  2X6A A;  1Q6U A;  2Q6A A;  1V54 B;  3K57 A;  3M8A A;  2CH7 A;  1YF2 A;  2XOK G;  1E1Q G;  1N33 B;  1SA0 A;  1VAR A;  2A06 H;  1ZX3 A;  4U7O A;  5J2T A;  1Z5V A;  4GYC B;  1N32 O;  2X0L A;  1OHH G;  1SKV A;  4BIU A;  1HW7 A;  1J5E B;  2KQX A;  3CPW U;  1AVM A;  2JGD B;  2Y69 B;  1F4N A;  1PD3 A;  2PUS A;  4X1Y B;  2X7R B;  3SYQ A;  3QTC A;  4O4I A;  5BR8 B;  4LFB B;  1I5Y A;  3OT7 A;  2DYS C;  1OCC C;  1PPJ H;  3WB2 A;  3ZN0 A;  2QM7 A;  3B4S A;  2IU0 A;  2LFR A;  2BSK A;  1LUV A;  1KKC A;  4LF6 B;  3CCV V;  2RNB A;  4C7U A;  4ASU G;  5FPO A;  2UXD B;  1EN6 A;  1KEC A;  1BZK A;  4K35 A;  4JI3 O;  4DV3 B;  1MOF A;  4NB5 A;  1M9N A;  4JI7 B;  4MVR A;  3OGC C;  1H2G A;  2EX3 A;  1B6Q A;  2AHZ A;  2FB5 A;  2IJH A;  4O4L B;  3RFR A;  1S5H C;  3ABK B;  4U3J A;  2A9H A;  5HFM A;  2OCH A;  3LSS A;  2R9I A;  1MSW D;  4DV6 O;  5EZY A;  2JDI G;  3JAK A;  2N74 A;  4DW0 A;  2OWO A;  5LXT B;  4JI4 B;  1GTO A;  4MVS A;  4DV2 B;  2FTK A;  4LNU B;  1V9P A;  1D5N A;  1RP3 B;  3BPZ A;  3ICX A;  5EYP A;  3T4D A;  1P84 F;  4LFC B;  5H6R A;  2QTS A;  2ZXW C;  2MW2 B;  4N21 A;  3H1K H;  4GKK B;  4DR6 B;  4LBE C;  2ARH A;  1XUQ A;  2W6I G;  3LSQ A;  3RVZ A;  3RYF B;  4EB6 B;  4DR3 B;  3IC7 A;  3QG5 A;  1H2L A;  5CBH A;  4P9P A;  2ZR3 A;  3ZRS A;  2UXB O;  1QQC A;  1GMG A;  1S72 V;  2HEP A;  4G2K A;  1R6T A;  3DC6 A;  4B7E A;  2DYR B;  1GAX A;  1SRY A;  1K4D C;  1SQG A;  4JYC A;  3STL C;  4LF5 O;  3TK1 A;  4AI8 A;  5C93 A;  2B1I A;  1U97 A;  4GZR B;  1MMM A;  3G71 V;  1QCE A;  5IJ9 A;  4RUF A;  2ZDI C;  2VQE B;  4I5S A;  1IBL B;  2GV9 A;  5EIB C;  1MG1 A;  4K3A A;  2LQT A;  3K5O A;  3ABT A;  3DGE A;  1NTK H;  1M56 B;  3SJA C;  4UFZ A;  5F2V O;  4DUY O;  3JSL A;  1P4R A;  5IY5 B;  3G67 A;  3GVM A;  5L3B A;  3UO2 A;  2OCC B;  1WA8 A;  4KXR A;  3OGI B;  3K06 A;  4NTX A;  1H2M A;  1YJW V;  4PDM A;  1IBM O;  4QPK A;  2WLH A;  1N32 B;  3WG7 B;  3RYC B;  3FD9 A;  1SET A;  3UCS C;  3BRC A;  3CCQ V;  4JI1 O;  2BCC H;  3ASO C;  3T1Y O;  1JFF A;  4QPJ A;  5LYJ B;  2AHY A;  4LWS A;  5KX5 A;  4RQF A;  4I55 A;  1PNL A;  4X20 A;  3ZHQ A;  5CB4 A;  2ZNI A;  5JVD A;  2Q0O C;  3JAT A;  1QLE B;  5JQG A;  4GX2 A;  1HP8 A;  2ATK C;  1S5L Z;  1GN3 A;  2JEU A;  5IYC O;  4X64 O;  2XAQ A;  1RPR A;  4FFB A;  3RN4 A;  1AI4 A;  4UCR A;  2VQF B;  3JD0 A;  4MVM A;  4JI3 B;  3OTF A;  4LF7 O;  2V4D A;  3FAV B;  1VEW A;  4TT3 G;  4KL1 A;  3LUT B;  4WBN A;  5BY1 A;  4BIZ A;  2F4V O;  3E8F A;  4DV1 O;  2YDE A;  4DV6 B;  1VF6 A;  2Q9L A;  1MA1 A;  5BXZ A;  5CA3 A;  2YIB A;  2DYS B;  1TUE B;  4JI5 O;  2JK5 C;  2F66 C;  1IZ3 A;  4G27 B;  4R6Z A;  1OCO B;  4LFA O;  1WPB A;  3ZIA G;  4E4E A;  2PZS A;  2CAZ C;  1P49 A;  4DO2 A;  1QVF U;  4IHJ B;  3RT3 C;  2ZT9 B;  3ZHV A;  4YIO A;  2BTQ A;  5C8Y A;  3J81 N;  2UXB B;  1WN7 A;  1K3E A;  3M7M X;  5L3C A;  1OCR C;  4MTX A;  1JVM A;  2N05 A;  4W4L A;  5B66 Z;  3ZMZ A;  2Z5U A;  1NU1 H;  1BGY H;  3OW2 U;  2HFE C;  2G38 A;  4LF5 B;  2PF4 E;  3D36 A;  2HR3 A;  1FXK A;  5L3E A;  2PY5 A;  3MDS A;  5KAF Z;  1YEW A;  4WCE V;  1K7D A;  4X89 A;  2QWR B;  3L70 H;  2L35 A;  4LH7 A;  3BAA A;  2ZXW B;  3LDC A;  3L74 H;  4TV8 A;  3JAL A;  4DUY B;  1XHX A;  5J2U A;  1YI2 V;  2Y4T A;  4GX1 A;  4DV7 O;  1YXB A;  2YIC A;  2F43 G;  4LCU C;  1ZLZ A;  2WLM A;  4B3S O;  5CA1 A;  4UCU A;  2OT5 A;  1R3K C;  2W6J G;  3FB7 C;  3CME V;  2Z3Y A;  4DV5 B;  4JI1 B;  1Z2G A;  3E8B A;  2IJJ A;  3T1Y B;  4ZI7 B;  2ZE6 A;  5LA6 A;  1FPO A;  5JJJ B;  5EIB D;  4MVZ A;  4RAI A;  3LNM B;  3ABL B;  3J7A U;  4X1I B;  1YZB A;  3E8G A;  4J42 A;  1GN4 A; 
#chains in the Genus database with same CATH homology
 2ZKO A;  4X66 O;  1FJG O;  4DV2 O;  2DJV A;  4JI8 O;  2AGA A;  3OTO O;  4NXN O;  5LL6 Y;  1A32 A;  4LFA O;  1FYJ A;  1HNW O;  4DUZ O;  2JRI A;  1DK1 A;  4LFC O;  4DUY O;  5A2Q N;  2DOS A;  3R66 A;  3RT3 C;  3O65 A;  4GKK O;  4DR6 O;  1FKA O;  4OX9 O;  5FLX N;  3T1H O;  1KUQ A;  4JI0 O;  4JI3 O;  4DR3 O;  3J81 N;  4DR7 O;  3SDL A;  1N33 O;  1IBM O;  3F5T A;  4X65 O;  3J80 N;  4GKJ O;  2HHH O;  4B3T O;  4JV5 O;  4LF9 O;  1G1X B;  1D2D A;  4JI1 O;  1HNX O;  4DV6 O;  1J5E O;  3T1Y O;  4DR1 O;  4DV0 O;  5LMU O;  2N74 A;  4B3R O;  5IT9 N;  1XMO O;  1XEQ A;  5H5N A;  4X62 O;  4OPA A;  5IWA O;  2VQF O;  5BR8 O;  4LFB O;  1HR0 O;  2UUC O;  2E5L O;  4DR4 O;  2UUA O;  4OPH A;  2VQE O;  1IBL O;  3JAM N;  4NXM O;  4K0K O;  1N34 O;  1XNR O;  2Z0A A;  4DV5 O;  4DR2 O;  4X64 O;  4DV7 O;  2UXC O;  1HNZ O;  1XMQ O;  4JYA O;  4YHH O;  4YY3 O;  2ZM6 O;  1NS1 A;  2LW7 A;  3M8A A;  4B3S O;  1AB3 A;  4A5U B;  2UXD O;  4LF7 O;  1N36 O;  2FKX A;  4AQY O;  2UXB O;  4LF4 O;  1R1B A;  4DV3 O;  1N32 O;  5BY1 A;  4DR5 O;  4JI6 O;  4JI7 O;  2F4V O;  4DV1 O;  1IBK O;  4B3M O;  1R6T A;  2UUB O;  2UU9 O;  5BXZ A;  1XNQ O;  4LF6 O;  4LF8 O;  1X59 A;  4LF5 O;  1AIL A;  1I94 O;  4KHP O;  4JI5 O;  3J7A U;  4JI4 O;  1YZB A;  4JI2 O;  5LMN O;  4DV4 O;  1F7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...