4J9ZB

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and ns309
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
97
structure length
97
Chain Sequence
GRKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unstructured to structured transition of an intrinsically disordered protein peptide in coupling Ca2+-sensing and SK channel activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/calcium binding
molecule keywords Small conductance calcium-activated potassium channel protei
total genus 35
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4j9zB00
3T2MA 4RUEA 2H8PC 3ABLC 1OCOC 2X6BA 4LBEC 3ABMC 3FB6C 4MVOA 1K4CC 4R8CA 5EBWC 4PA9A 3F7VC 3SJQC 3E83A 3T1CA 3UM7A 1QLEC 2AHYA 4CBCA 4DXWA 5EC2C 3SYPA 3SYOA 3E8HA 3R65A 3KG2A 4MS2A 3E86A 3LDCA 4GX5A 3LDDA 4XDJA 4R6ZA 4WFFA 4PDMA 4GX1A 3AG4C 5CBHA 4MW8A 1R3LC 4RO2A 1OCRC 4JTAB 3TCUA 4QNHB 4PA7A 2DWDC 2DYRC 2WLJA 4WFGA 3T4ZA 4XDLA 3OUSA 3X2QC 2EINC 4OXSA 3PJSK 3SYAA 4MTOA 4MW3A 2Q6AA 3LDEA 3RBZA 1JVMA 3AG3C 1R3KC 2AHZA 4RAIA 3ZRSA 3K04A 1OCZC 2Q67A 3LNMB 4LCUC 4MTFA 3E8GA 4MVMA 5KUMA 3SYCA 5E1AC 1ZWIC 2R9RB 2WLMA 4MVRA 4P2ZA 1J95A 1V55C 4J9ZB 5B3SC 2QKSA 4R50A 4J9YB 4X88A 1M57C 2Q69A 1R3IC 4RUFA 3GB7C 5BZBA 2EIKC 1V54C 4PA3A 1M56C 1LNQA 2P7TC 3SPCA 1OCCC 4QE9A 2A79B 4MVQA 3ABKC 5J9PC 2WLIB 2EIJC 3K03A 2YEVA 3AG2C 1XL4A 3LUTB 3OUFA 4PDVA 2IH1C 4R7CA 5B1BC 1KKDA 3FB5C 4X8AA 2BOCC 2WLLB 1R3JC 4MVUA 4QE7A 4F4LA 2DYSC 4LP8A 4XDKA 4P9OA 4TWKA 2HJFC 4WFHA 4EKWA 4UUJC 2WLKA 2ZD9A 4GX2A 3OR7C 3STZC 2QTOA 3T4DA 3K08A 2JK5C 2ATKC 3E8BA 4I9WA 5EBLC 5EK0A 3E8FA 5EC1C 2HVKC 2WLNA 4H37A 2KB1A 3IGAC 4G28B 2Q68A 2IH3C 4P30A 3K06A 4PA4A 3ASOC 4X89A 3STLC 3ASNC 3E89A 3JYCA 2BOBC 4P9PA 4PDLA 1P7BA 2NLJC 1K4DC 4G27B 4KFMA 5EBMC 3BEHA 5CBFA 2A9HA 2A0LA 2Y69C 3FB7C 3EFFK 3SPJA 4PDRA 2X6AA 2X6CA 3RVZA 3OR6C 3SPIA 4PA6A 3K0DA 4BW5A 3SYQA 2K1EA 2W0FC 3RVYA 5CBGA 2ITCC 2OCCC 3SPHA 3IFXA 2ZXWC 3SPGA 2HFEC 4JTDB 5IY5C 4JTCB 4MTGA 2HVJC 2WLHA 3WG7C 5KUKA 5B1AC 3VOUA 2WLIA 2HG5C 2ITDC 2DWEC 3F5WC 4H33A 3ZJZA 4MVSA 3HPLC 4MSWC 1XL6A 2WLLA 3K0GA 3OGCC 4MVZA 3AG1C 1BL8A 4WFEA 1S5HC 4GX0A 2EIMC 4HZ3A 4ZBMA 3F7YC 1ORQC 3RW0A 3TETA 1G4YB 3UKMA 3FB8C 4HYOA 2EILC
chains in the Genus database with same CATH superfamily
1VQKV 1AROP 1BQ0A 2LQTA 3HKCB 1JA8A 2P90A 2IU3A 1MZFA 1Z5VA 2DQ3A 3E8HA 3JARA 3CRMA 4J7KA 3LDDA 1K33A 3MHSC 5JJNB 3HKEB 1AILA 1H8HG 4O2AA 5LGTA 2WLJA 1E1RG 4DW1A 4BW9A 3ZHRA 4DRXB 5JCOA 4JYYA 4DV6O 1FXKA 4DUZO 3D3QA 2Q69A 3JCZA 3RYFB 2Y4UA 2LGWA 2JS3A 4E2LA 2JS5A 4FVMA 3K5NA 4JYCA 1FPOA 4AILC 3CD6V 1Q81W 4CC6A 3BVOA 2HHHO 1Z2GA 2KKWA 5C8YA 5EC1C 1JQ0A 1S0VA 4PDLA 2X7RB 3DSQA 2EBOA 1NU1H 1EN5A 3ABUA 1Y76A 2A7WA 3OR6C 3K3WA 3AK3A 5LGNA 4BW5A 1BS3A 4FLZA 1G6UA 3JSLA 4JI0O 4ICGA 2OCCC 3DC6A 3WB2A 2ZM6O 1M5IA 1I7FA 4JTCB 3VOUA 2ZKOA 3KCYA 3ZJZA 3HPLC 1YVWA 5GTHZ 3TETA 3J7AU 2AW9A 1IBKB 4DV6B 2ZE5A 4OX9O 2JJ1G 1PNKA 1NI8A 1K4CC 1SKVA 2YEVB 4TV8A 2VWJA 2Y48A 3R66A 1Q82W 5IYBO 3CX5F 5IYCO 3L72H 2UXCO 4TV9A 1R6NA 3ZRWB 3K57A 2AHZA 3P3NA 4DV5O 4LFAO 3LSSA 4J11A 4NXMB 5HFLA 1PL0A 5H2FZ 2EZPA 3Q4HA 4X1IB 4YIOA 5L3CA 4FFBB 1TUEB 2O57A 2Q0OC 2Z0AA 3PN1A 2XASA 3BABA 5H5NA 3WB1A 2WLLB 3RYIB 4XDKA 4EKWA 2OT5A 4U7NA 1PKXA 4B3TO 1VQ5V 2XNDG 1TVKB 5FPRA 1Y4MA 1SQGA 2DMXA 1MG1A 3TGUH 4DW0A 2QTSA 3LSQA 3ASNC 2JGDB 3ETDA 2BTQB 4UB8Z 4OGQB 3J81N 1IURA 4JI5O 1WLEA 1IXMA 4WFBV 2QWQB 1L8DA 4O4LB 1BMFG 4JAUA 1B06A 1IBMO 5CBGA 4UFZA 1NZ6A 3CJHA 1ZSPA 3W7XA 3HR0A 1H2NA 5JVDA 1SESA 1BL8A 1ORQC 4K8XA 3LSUA 5EBWC 1F7YA 3E35A 1RFYA 1VQPV 2PY5A 1K73W 1CXZB 2OCHA 1PD3A 1OCRC 2LP7A 2CTRA 4JTAB 3OUSA 3BPZA 1JVMA 5A9GA 5BY1A 3ZRSA 2WPDG 4D6TH 2ZE7A 4JI1B 4F6EA 1SZTA 5JCOC 4X1KB 3ZBHA 4R50A 4LFBO 2V4DA 1NQTA 4O4HB 3ZHQA 2D2CB 5LP6B 1VQ6V 1VQ7V 3QF7A 1LNQA 2BE3A 4MVQA 3THOA 2V1DA 3QO7A 1PV0A 1NR7A 2L6LA 2PYLA 4DV5B 3ZHVA 5B5EZ 2QA4V 3A0HZ 2ETNA 1U97A 4UCOA 1HNZO 3OAAG 2N05A 5LA6B 4MT8A 5KMGA 4IIJB 1S5LZ 4JI5B 3E8FA 3A0BZ 5KHGA 2Q7HA 4NXNB 3ZRWA 2WSSG 1NT2B 1XQ8A 4LF7B 3L75H 3ZMZA 3AEIA 3OTOO 4UVCA 2K1EA 3SGIA 5GONA 4MTXA 5KHHA 1X59A 1KU9A 4MTGA 2QWPB 2DE0X 3G71V 4MVSA 4WCEV 3CC7V 2ZIMA 2UUCB 1T5EA 3ZRXA 1I94B 4LF9O 3FB8C 1SA0A 3B8MA 1IBMB 2VRZA 2IM9A 3ETGA 1G1XB 2UXBO 2ZINA 2Q7GA 1VMGA 2QE7G 3SYOA 4MS2A 4B3SO 3SJBC 4BIUA 3D3IA 3JARB 3B8NA 5B66Z 4TT3G 5KMGB 2DYSB 2LO1A 4JI0B 4MTOA 4DR3B 5AG2A 3OGIB 1AI4A 1EZVH 1Q6IA 5E1AC 3FX7A 4PHZA 1MOFA 4FLUA 1IBLO 2EIKC 4CS3A 2B1IA 5IE9A 2P7TC 3K59A 5B1OA 4FLWA 1BGYH 4DR5O 5IJ9B 1XBLA 3B2EE 3OUFA 1KKDA 4JI4B 1WAZA 2QGNA 5JJJB 1NR1A 2YIAA 4J80A 2V7QG 4TQFA 1VQ8V 1S3JA 1GK9A 3AK1A 2Y0IA 1Y67A 4RWUA 4PA4A 3CRCA 1K4DC 3F5TA 1MA1A 4FFKA 3ABMB 4U3FH 5B1BB 4PDRA 4O2AB 1KD1W 4DYLA 2OYQA 1FFTB 3FYEB 5IT9N 1QU7A 5JH7B 5FNVA 2GTAA 4IL6Z 3SR2C 3SPHA 2ZXWC 4UVAA 3M7MX 3ZEDA 1WN7A 2UXDO 5C93A 2DWEC 2KSDA 2EX3A 4YHHO 4X1KA 2UXBB 4UXNA 3EXAA 2JRIA 3E22B 3T2MA 2RMKB 4D7TA 3ABLC 1OCOC 1NH2B 4JPRA 4IIJA 1NTKH 1YSCA 1OJHA 1IX9A 4HBNA 3P3PA 4NVPA 1XHZA 3HKBB 1VF7A 2YS8A 1GKFA 4CH4A 5BR8O 1XOUA 2E76B 2Q6AA 3OW2U 4DK1A 2R9IA 5L3BA 3K04A 3EVKA 5IJ0A 1P49A 3MHHC 1GN3A 1M93A 1ZAUA 5B3SC 2GUZB 3JATB 2R72A 2E75B 5J2TB 2LGQA 5J2UB 1D2DA 2DOSA 1M56C 3L71H 1M90W 3UO3A 5LMUB 3DGEA 4N21A 2OIGA 2FB5A 1QNMA 3U11A 1VF5B 4XBFA 1XL4A 4DR3O 2PI4A 5CB4B 3FKSG 3M8AA 2UUAB 3BY6A 4UCUA 4O4IB 2P4VA 5EBLC 2WWWA 4TV8B 3IGAC 4X89A 2JVDA 2EZOA 3EHBB 4KFMA 3G6EV 1YF2A 2YICA 2MW2B 1N33O 3ABKB 4FZ0A 1OZ0A 4LF4B 1XMQB 1WB7A 2YXLA 3K79A 5JH7A 4UCVA 3K5LA 4ZHQA 4QPKA 1DF4A 1I0HA 2N74A 2QR4A 1AR4A 4X66O 1Q3EA 4X1YB 3OTOB 4HYOA 1L0LH 2JJ2G 3ABMC 1BE3H 5LMNO 4GKJO 1QHTA 5KHJA 4NXNO 4DXWA 5H6QA 2XOKG 3RYIA 4R6ZA 4I55A 4DR6B 1TAEA 5CA0B 4QJFB 2JEXA 1Y6XA 4PA7A 2DYRC 3LNNA 5LYJA 1Q6UA 2EINC 3SJAC 2UUAO 3LDEA 3AG3C 5IY5B 3AG2B 4FM2A 2MK3A 4RAIA 3FFQA 3ZMSA 4B3MO 4WBNB 1HR0B 4LF8O 3CYOA 3G67A 4EB6B 3JAMN 5BR8B 2Z3YA 2F66C 5BZBA 3H9VA 1KMIZ 4IT5A 5J9PC 1N33B 2A06H 1QVGU 2Q9LA 5LOVB 2ZT9B 3E22A 1YEWA 3JD4A 3OR7C 4B7EA 3HB3B 3E2EA 1F23A 4AHCA 4AQYO 2WLNA 4GKKB 3ML0A 1DTOA 1S77D 3E89A 2BOBC 1P7BA 1SC5B 2CTPA 2CH7A 2JGUA 1K5QA 2HEPA 4FK5C 2LJ2A 1JFFB 1NKDA 2X6AA 4DUYB 3J80N 4IYIA 4WF9V 4JZ2A 1Q5OA 1XMOO 4ZIBA 5EIBD 2CGNA 1FXKC 1IXBA 2Q4PA 3HKDA 4UVBA 4ZHQB 1RP3B 2VQFB 1M9NA 3I5DA 4MSWC 2PYJA 3H1JH 3F7YC 5LMNB 4GKJB 5J2TA 5IWAO 2ZE6A 4RUEA 2QKCA 4JI1O 4E4EA 3G6BA 4KP4A 5TISZ 1VF6C 4R8CA 5K1PA 4PA9A 3E83A 1Q6HA 2VWKA 2AHYA 2EIKB 1VQMV 2YI8A 3JAWB 3SYPA 4W4KA 3D36A 3OTFA 3CC4V 4WFFA 4FIPC 1ZLZA 1FJGO 4MW8A 1K92A 2HKOA 2BCCH 1SQQH 4I7ZB 4Q6GA 2EIJB 3RBZA 5DN6G 4L87A 4CH3A 5KLVH 1HNZB 1NTMH 4X20B 3LNMB 3TXQA 3ZX6A 1GMGA 2DN9A 2R9RB 4MVRA 1TUBB 1V55C 2CTWA 2QWRB 3WG7B 2QKSA 4I50A 2UXNA 1XMOB 1K97A 4PA3A 4DR2B 4YJ3B 4DV2O 2NR5A 3HKCA 2WLIB 5A2QN 4O2BA 1VEWA 1PNLA 3TK1A 4J41A 4LFAB 2BOCC 1G8MA 3ZCCA 3W7SA 1YZBA 2EULA 4A5UB 1J5EO 1W2BU 1WJZA 3OEEG 1XEQA 1XHXA 3JD2A 5CMUA 1EM1A 3IC7A 3MDSA 2UUCO 3VQVA 3STLC 5LMUO 2IH3C 3QTCA 1B3QA 5K1XA 4DR7O 3ABLB 2YIBD 4EEQA 1RPOA 3FYIB 3GWOA 3JAKA 3B77A 4I55B 4LR3A 2ZIOA 1P7GA 5B3SB 2CTQA 4FLYA 3RVZA 5GW7A 4B3TB 3CRQA 1Z5WA 3DXRB 2LFRA 1Q7YW 5LXTA 2ITDC 4PV1B 4C7UA 3ZHSA 3OEHG 4Q20A 5EYPB 4GX0A 3GWKC 4I4TA 3N2GA 1F4MA 4JYBA 3L74H 3C90A 3W7UA 3UM7A 1QLEC 5HFMA 3CHXA 1IVSA 1LR1A 2GTSA 2G38A 4BIZA 5JJEB 2CGOA 2XT9A 2ZR3A 4XDJA 4DR2O 4DV3O 1JFFA 3CPWU 4NXMO 4DV4O 1D5AA 5KAFZ 1XMQO 1R3KC 4JAAA 3ZN1A 2Q67A 2NN4A 2XAHA 3A2FA 1YITV 1S76D 3CCUV 1R3IC 5FNVB 2RN9A 4BR6A 4U3JB 1P84F 3HKDB 3BA8A 2IJKA 1ZX3A 5LXTB 3M99B 3H1KH 2OTLV 4TQDA 1HR0O 4LF8B 1H38A 4FPPA 1PM9A 4FLTA 2HJFC 4HAMA 4UUJC 2ZD9A 4DV0O 4GX2A 1UFIA 1IBLB 5EK0A 5BMVA 4J42A 1TVKA 4YHHB 4DV1B 1D5NA 3APOA 2Z5UA 4JI6O 1U96A 4DR5B 1I5YA 4KHPO 5EBMC 4B3MB 4ZOLB 3CP1A 1NS1A 3KKYA 5BXZA 1KUQA 4FM0A 2XAJA 2X6CA 1EZJA 2YXYA 3QG5A 4YY3B 1N36B 3C3TA 4UV8A 1KP3A 2ITCC 4X1IA 3ETQA 2HVJC 1RM1B 1VF6A 5B1AC 3CMAV 2WLIA 3W7TA 2CDYA 2DQ0A 2WLLA 4MVZA 1VQ9V 4WFEA 5IYZA 3UT5B 3DC5A 2YI9A 4I50B 4F6RA 1OV9A 5CA1B 1WP8A 4RQEA 4JAVA 4LBEC 3OFNG 2VQEB 4DR1B 1AB3A 4I0XB 2JGDA 1BQZA 4B7KA 4X64B 3HKBA 4PELA 4GX1A 5KA5A 1JJOA 4O4LA 5FL7G 2W0XA 1N34O 5JQGB 1E1QG 4XDLA 4G2KA 4KL1A 1B04A 1SZXA 1N4CA 3CJHB 5ITZB 4DV7B 1Y74B 1BSMA 3JATA 3ZMUA 3CB2A 3MD0A 1SRYA 4J9YB 3Q4HB 4CH5A 1B6QA 2LW1A 1L0NH 2QSAA 1FS0G 1XUQA 2ZDIA 2JEUA 4EB6A 1V54C 4FMTA 2Q8VA 3TXSA 4JF3A 3SPCA 2A79B 2K9PA 1YTFD 1XDCA 3KCXA 3LUTB 1MMMA 1R3JC 3UT5A 2YIDA 1YJWV 4X1YA 5DM6V 3STZC 2QTOA 3E8BA 4I9QA 1AP5A 1W0KG 5CA3A 4BIOA 3JAKB 1JPXA 1E79G 1GTOA 4X64O 5CBFA 5DEDA 3SPIA 4PA6A 4DV0B 1I94O 1HNXO 3WB0A 3DXRA 2FMLA 3OMNB 3SYQA 2W0FC 1O9HA 3ZHUA 4JV5B 2QJ1A 3SPGA 1W0JG 4LFCO 2P67A 3H1IH 1AJNA 2GBOA 3C3SA 3VBBA 1SQVH 4ABMA 4JI3B 1N34B 4IYHA 3N27A 1KYOF 4JASA 1SQXH 5F2VO 1XL6A 3K0GA 2P5OA 4NKGB 1S5HC 3RW0A 1J5EB 2EILC 3NR7A 4DV7O 1N36O 1N32O 1MSWD 2ADQB 3OMAB 4CBCA 4Z1VA 4GT1A 4I0XA 3E86A 2F93B 1NH2D 4DV2B 2CAZC 2DYRB 2ZR2A 4QNHB 2IU0A 3GVMA 3I55V 2YSUB 3X2QC 1KBHA 4TUYA 3N2KA 4MTFA 1IZ3A 1AR1B 4JI4O 4GCZA 1ZWIC 2HJDA 2WLMA 4AQYB 3CMEV 4GZRB 1ENVA 1S72V 4DR6O 4LF5B 3GB7C 4F6RB 5CA1A 1BCCH 2PF4E 3FD9A 1M4UA 1L1FA 3ABTA 3P32A 4JV5O 3K9AA 1QVFU 3JCUZ 1V54B 4P9OA 4TWKA 1BHAA 4H0LB 4ZI7B 2LFSA 1MSDA 1MZEA 4I9WA 2Q0AA 4LNUA 3JD0A 1AJQA 3K5MA 4G28B 2Q68A 2F23A 1QLEB 4LFBB 1EN4A 2NLJC 4OPHA 4BAYA 3G80A 2YDEA 3HKEA 2ZXWB 1YJ9V 3K0DA 5IDJA 4TV9B 1IBKO 2H94A 5EZYA 4N23A 4DRXA 5LHHA 5LGUA 1COWG 2UUBO 4DK0A 2XTAA 2RQ6A 2P4KA 4HZ3A 4ZBMA 2EJ7A 4YY3O 2EJRA 2QM8A 2IJIA 4MVOA 2GHYA 2QM7A 3H01A 5D5QA 3LDCA 3CCRV 4LF9B 4X66B 1R3LC 3CWBH 1W59A 2HLDG 3A0RA 5LYJB 3SYAA 4I5SA 5LBQA 2XHBA 4X20A 3CC2V 1FD9A 4K0KO 5IJ0B 1AI7A 4P2ZA 4J9ZB 2JIZG 2OIEA 5B1AB 5KAIZ 5GTIZ 3BCCH 4UCTA 2DJVA 1HDJA 3ZMVA 2QWOB 1CPYA 3AG1B 2P06A 4IHJA 2UUBB 4UCSA 4DR1O 2N04A 4PDVA 2AGAA 3ZRVA 4DO2A 3FB5C 3UCSC 3U0ZA 1TA8A 2DYSC 5CB4A 2UU9B 4X62O 3CE2A 1XNQO 5C8YB 4CS2A 3L73H 5H9CA 1H2GA 3JALA 1WPXA 3FAVA 3X2QB 1F51A 2HVKC 1Q43A 4PJ0Z 4PD4F 1GAXA 2AZ2A 3K06A 1XREA 3JYCA 3OE7G 4FZ1A 4LH6A 1A32A 3JD1A 3FB7C 5KA6A 4ZOLA 3QVNA 1URFA 3CCMV 3B4SA 2PZSA 2RDCA 1HNWB 4LWSA 1WA8A 1I5XA 1N0NA 1R73A 2DW4A 3CRAA 1PNMA 2WAMA 3T1YO 2HFEC 3W7WA 2E74B 3AG7A 5J2UA 1K9MW 1YDXA 3RYCA 4FLVA 1S5JA 4DR7B 2HG5C 2EIMB 1JCHA 1RSOA 2X0LA 2QM4A 1VQOV 3KZIZ 3RT3C 3RFRA 3UKMA 1HNXB 3N2GB 4J7ZA 2RNBA 2QWNB 4JI2B 4FM1A 3T1HO 5FPOA 3SJQC 4D7SA 5L3FA 1QQCA 2H3OA 3AG4B 2VQFO 3RN4A 1DK1A 3R65A 2FL4A 4GX5A 4PDMA 3ZS8C 1BT8A 1K8AW 1JJ2U 2DWDC 4WFGA 3H1LH 2EILB 3G4SV 4NYKA 1GO3F 4LCUC 1P4RA 2RJZA 2F4VB 2ZQMA 2Y4TA 5EYPA 4LWSB 3VQWA 1M57C 1ZTEA 2ARHA 4RUFA 4O4HA 5LP6A 3MAQA 4FFBA 3RYCB 1OCCC 1XILA 4GKKO 1XNQB 3AG2C 4EFBA 1Q86W 4LC1A 4MVUA 2IW5A 2QKAA 4GUNA 1M56B 1AVMA 2Y0PA 4LF7O 4LNUB 1DLBA 4KHPB 4O4JA 1UJWB 4EFEA 3ZIAG 1R1BA 3TJTA 4B08A 1FYJA 2HR3A 5L3GA 1ZL8B 4G27B 3BEHA 1ZUQA 4WBNA 3RYHB 2A0LA 4WFAV 2Y69C 2VQEO 3SPJA 1QR9A 1GRJA 2AZ0A 4NTWA 1RPRA 1AI6A 1SS3A 1THZA 5LHIA 4HNAA 5L3EA 2Q73A 2FKXA 2F95B 5GONB 3CCJV 3L9DA 1GN4A 5DECA 4H33A 1YI2V 2ZCEA 3AG1C 2EIMC 4DV1O 1YXBA 1YHQV 3FAVB 3L70H 3T1CA 1OCZB 4CZZA 3BRCA 1US6A 4YJ2A 1FAFA 4TSFG 4J7JA 3SJCC 1YIJV 3AG4C 4RO2A 1I08A 1WA8B 1PL4A 1WB8A 1AI5A 2OWOA 3PJSK 5ITZA 1GH6A 1VIBA 1WNSA 4ASUG 4MVMA 1MABG 3K9SA 1H2LA 1Y74A 1OHHG 4X88A 3OD4A 4Z2WA 4IGGA 4DV4B 1SA0B 4DUZB 4NB5A 4H44B 2EIJC 2YXHA 4R7CA 4U7OA 5IJ9A 2AXTZ 1EFRG 3S3WA 3BAAA 4QE7A 4F4LA 1KECA 4X9QA 2E5LO 5LA6A 3APQA 3OMIB 1JR9A 2W6JG 1NTZH 4H37A 2XAFA 2BSKB 3CXHF 2PI5A 3BA9A 2KQXA 1NBMG 1FXVA 4JYAO 1DGSA 2A3QA 1ZL8A 1RM1C 2EINB 1N32B 4LFCB 1Q90D 3NXSA 2B9ZA 4CC5A 1QBZA 1K5SA 4JZGA 3O9OA 2XAQA 5LL6Y 3D8CA 2ODMA 2GDSA 4JTDB 1AP6A 4O2BB 1FFXB 5IYZB 2ZM6B 1KKCA 3CRRA 1NJIW 3OT7A 5IYDO 4I4TB 5KX5A 2UXCB 2X6BA 4O4JB 3FB6C 4B3RB 1XNRB 1IDSA 2XUMA 2FTKA 4LH7A 4K35A 1H8EG 1XI1A 2KG7A 1KB9F 1WPBA 1NVPD 3DTUB 4OPAA 3IJ4A 1QR8A 3RYHA 5E79Z 1JOYA 5CBHA 1KQSU 3BFRA 5JQGA 2CUGA 4JI2O 1GN2A 2R70A 5LP6C 4MW3A 1MNGA 3SYCA 4W4LA 1K3EA 4OX9B 1UPGA 1N8RW 1ROPA 3AK2A 3RYFA 4JGSA 3ZN0A 5LHGA 2GUZA 4QGPA 4HNAB 4QIWF 3ASOB 2HP8A 4QE9A 3ABKC 4JI6B 2QDOA 1R6KA 3K03A 3CS5A 3B40A 5B1BC 3I56V 2RCVA 5JWPA 4UV9A 3OM3B 2IJJA 1M1KW 4WFHA 3CXCU 2P6JA 1FXHA 4Z1MG 3T4DA 3K08A 4LF5O 4ZI7A 2PUSA 1VQ4V 3JALB 4TUYB 2KG7B 4P30A 3K58A 3ASOC 4P9PA 2BSKA 4H13B 2F4VO 1AJPA 3IC9A 4L8JA 1XNRO 1GM7A 3CCSV 3T1HB 3ZMTA 1HP8A 4PI2A 3RVYA 2BTOA 2D3OW 4YIPA 3IFXA 4DR4O 1PPJH 3BHPA 3AG3B 5IY5C 3WG7C 4LF6B 2CE4A 3F5WC 4JI7O 3OGCC 2IJHA 1VQLV 1RSOB 3QO5A 2UXXA 4B3RO 5JVDB 1F4NA 3UQ8A 4U3JA 3CCLV 1EBOA 1OCCB 2JDIG 4KXRA 3F7VC 4UCRA 2XAGA 3CSXA 3O65A 4TOIA 3P30A 3K5OA 3D36C 5EC2C 2M6YA 4JI3O 4GYCB 1Q8IA 5KHKA 2M7WA 2OCCB 2Y69B 3ETEA 2OTJV 3CCVV 3T4ZA 4K0KB 4FLXA 4X62B 3S3XA 1R6TA 1OCZC 2YC0A 1N0JA 3QNEA 1FXKB 1H2MA 2ZNJA 2HHHB 1H2SB 2YUAA 4IHJB 5KX5B 2W6IG 2UU9O 4LF6O 1GN6A 3CEIA 2PTMA 2Q7EA 4X8AA 5L3DA 4DR4B 1JX9A 1QCEA 1JMKC 4LP8A 2YIBA 2ZDIC 2WLKA 3JD3A 5LOVA 3ICXA 1OCRB 1NVPB 1VARA 1VQNV 1SQBH 3RGBA 1YJNV 3JASA 2JK5C 4JI7B 1SQFA 2F1MA 2KB1A 3JSNA 3B09A 4CH6A 4NTXA 2WA3A 2GV9A 3EFFK 2FYUH 3T1YB 2ADPA 2C2AA 1Y66A 5IWAB 2WA4A 3QO8A 1FJGB 5KUKA 4JYAB 1H2KA 3SDLA 2VS0A 1V9PA 1SF9A 4YXWG 4X65B 1OCOB 4LF4O 1HNWO 2E5LB 1KC8W 2H8PC 1V55B 4QPJA 5BMVB 1KP2A 4JI8B 3ASNB 4ZKIA 4GLXA 4J10A 3KG2A 1QLNA 1DF5A 1X4TA 2CH7B 3U10A 5CA0A 1FKAO 3JASB 1Y76B 3TCUA 2ZE8A 2IBZH 3RWRD 2LW7A 4OXSA 1O9GA 1CP9A 2ILMA 2B5UA 2CK3G 1HW7A 3E8GA 5KUMA 2R9AA 5D5PA 1J95A 1M57B 3H1HH 1BZKA 2QEXV 1TUBA 3WU2Z 4CS4A 4NR1A 2NNUA 4KUMA 4B3SB 1CEZA 4BWAA 3VQYA 2L35A 2F43G 3CCEV 2P22C 2YEVA 2E3CA 3CCQV 2IH1C 3JAWA 1SERA 4RQFA 1YTFB 1SETA 3VQXA 1GM8A 1TGOA 2GSMB 3WFVA 4O4IA 2ATKC 2Q5ZA 2PGGA 5FLXN 1GM9A 5KHIA 2UXDB 4YJ2B 1SQPH 3IAYA 2BTQA 1LUWA 2A9HA 4AI8A 1VP7A 3ZHTA 4K8ZA 4JI8O 5CN0A 4NTYA 3N2KB 4DV3B 1K7DA 1EN6A 4YJ3A 4X65O 2WLHA 1YCIA 5EZYB 1K34A 1WP7A 1LUVA 4FJCC 3A8TA 2ZNIA 3UO2A 5EIBC 1BHBA 5B1NA 1FFXA 1AR5A 4UB6Z 2B1GA 4K3AA 5H6RA 4DUYO 1PP9H 1G4YB 1HWYA 4PI0A
chains in the Genus database with same CATH topology
1VQKV 3T2MA 1YHQV 4JAVA 3ABLC 1AROP 1OCOC 4LBEC 1NH2B 4JPRA 3OFNG 1YSCA 3T1CA 1OCZB 2P90A 2IU3A 4CZZA 2DQ3A 3E8HA 4TSFG 3LDDA 4PELA 1YIJV 4GX1A 3AG4C 1K33A 3MHSC 4RO2A 5KA5A 1GKFA 1H8HG 5FL7G 5LGTA 2WLJA 1E1QG 1E1RG 4XDLA 1AI5A 3PJSK 4G2KA 2Q6AA 3OW2U 2R9IA 5L3BA 4ASUG 3K04A 4MVMA 1MABG 1FXKA 3MHHC 3ZMUA 5B3SC 3MD0A 1OHHG 1SRYA 4J9YB 4X88A 1B6QA 2Q69A 3JCZA 2ZDIA 1FS0G 2JEUA 1V54C 1M56C 4FMTA 4E2LA 1M90W 4JF3A 3SPCA 2A79B 3DGEA 4N21A 1YTFD 2EIJC 4XBFA 1XL4A 3LUTB 4JYCA 4R7CA 4U7OA 2PI4A 1EFRG 3FKSG 4QE7A 1R3JC 4F4LA 3BY6A 1KECA 3CD6V 1YJWV 1Q81W 5DM6V 3STZC 2QTOA 3E8BA 3OMIB 5EBLC 2W6JG 5EC1C 2WWWA 1W0KG 4H37A 1JQ0A 2XAFA 3IGAC 1S0VA 4X89A 5CA3A 4PDLA 2PI5A 2EZOA 1NBMG 3EHBB 1FXVA 1JPXA 2X7RB 1E79G 1GTOA 2EBOA 4KFMA 5CBFA 3G6EV 1RM1C 2EINB 3NXSA 3ABUA 3OR6C 3ABKB 3K3WA 4PA6A 3SPIA 5LGNA 1OZ0A 4BW5A 3OMNB 3SYQA 2W0FC 1QBZA 1K5SA 2XAQA 2OCCC 3SPGA 1W0JG 3K79A 2P67A 4JTDB 4JTCB 1AJNA 3VOUA 3VBBA 4QPKA 1DF4A 3ZJZA 3HPLC 4JASA 1XL6A 3K0GA 1S5HC 1NJIW 3RW0A 3TETA 5IYDO 4HYOA 2EILC 2X6BA 2JJ2G 3ABMC 2JJ1G 1PNKA 3FB6C 1K4CC 2FTKA 2YEVB 1H8EG 1MSWD 3OMAB 4CBCA 4DXWA 2Y48A 4GT1A 1NVPD 1Q82W 5H6QA 3E86A 2XOKG 5IYBO 3DTUB 4R6ZA 1QR8A 1NH2D 1JOYA 5CBHA 1KQSU 2DYRB 2ZR2A 4QJFB 2JEXA 4QNHB 4PA7A 5IYCO 2IU0A 2DYRC 3I55V 2YSUB 2EINC 3X2QC 4MW3A 3LDEA 3AG3C 1R6NA 5IY5B 3AG2B 3ZRWB 2MK3A 2AHZA 4RAIA 3ZMSA 4MTFA 3SYCA 1AR1B 1K3EA 3LSSA 4GCZA 1ZWIC 2WLMA 3CYOA 3CMEV 1N8RW 1ROPA 1ENVA 4JGSA 1PL0A 5HFLA 1S72V 3ZN0A 5LHGA 2EZPA 2Z3YA 3GB7C 5BZBA 5L3CA 4QIWF 3ASOB 4QE9A 3ABKC 5J9PC 1TUEB 1R6KA 3K03A 1L1FA 2XASA 3ABTA 3P32A 1QVGU 5B1BC 3I56V 2WLLB 3K9AA 1QVFU 4UV9A 4XDKA 1V54B 3OM3B 2IJJA 4P9OA 4TWKA 4WFHA 4EKWA 2P6JA 2OT5A 4U7NA 3CXCU 1M1KW 1FXHA 1BHAA 1PKXA 3JD4A 3OR7C 4Z1MG 3T4DA 1VQ5V 2XNDG 3K08A 3HB3B 2LFSA 1Y4MA 3E2EA 1F23A 4I9WA 1MG1A 3JD0A 2WLNA 1VQ4V 1AJQA 3ML0A 4G28B 2Q68A 3LSQA 1DTOA 4P30A 3ASOC 1S77D 1QLEB 3ASNC 3E89A 2BOBC 3ETDA 4P9PA 1P7BA 2NLJC 1AJPA 1WLEA 1IXMA 1K5QA 4WFBV 4FK5C 4BAYA 1GM7A 1NKDA 2X6AA 3CCSV 1BMFG 4JAUA 3ZMTA 2ZXWB 1YJ9V 3K0DA 5IDJA 5CBGA 4WF9V 3RVYA 2D3OW 3IFXA 2H94A 4N23A 3AG3B 5IY5C 1FXKC 3WG7C 5LHHA 5LGUA 1COWG 4UVBA 3W7XA 3F5WC 1M9NA 4MSWC 1SESA 3OGCC 2IJHA 1BL8A 1VQLV 4HZ3A 4ZBMA 3QO5A 2UXXA 1ORQC 3F7YC 2EJRA 1F4NA 2QM8A 2IJIA 4RUEA 3CCLV 4KP4A 4MVOA 5EBWC 1EBOA 1OCCB 4R8CA 4PA9A 2JDIG 3F7VC 3E35A 3E83A 1VQPV 2XAGA 2AHYA 3P30A 2EIKB 1VQMV 2GHYA 2QM7A 5EC2C 3H01A 3SYPA 1K73W 1PD3A 3D36A 3LDCA 3CC4V 4WFFA 2M7WA 2OCCB 2Y69B 4FIPC 3CCRV 4MW8A 1R3LC 1OCRC 3ETEA 2HLDG 2LP7A 3A0RA 2OTJV 1K92A 4JTAB 3CCVV 2HKOA 3T4ZA 3OUSA 3SYAA 4I5SA 5LBQA 2EIJB 3RBZA 1JVMA 4L87A 5DN6G 3CC2V 3ZRSA 1OCZC 3LNMB 2WPDG 1GMGA 1AI7A 2R9RB 4MVRA 4P2ZA 1V55C 3QNEA 4J9ZB 2JIZG 1SZTA 1FXKB 2QKSA 3WG7B 4R50A 5B1AB 1NQTA 1VQ6V 2UXNA 3ZMVA 1VQ7V 1K97A 4PA3A 1CPYA 2W6IG 3AG1B 1LNQA 4MVQA 2V1DA 3QO7A 2WLIB 1PNLA 1NR7A 4PDVA 3TK1A 3ZRVA 4DO2A 3FB5C 4X8AA 2BOCC 1G8MA 2QA4V 3ZCCA 3W7SA 5L3DA 2DYSC 1JX9A 1QCEA 4LP8A 2ZDIC 3OAAG 2WLKA 3JD3A 1NVPB 1VQNV 1OCRB 1W2BU 1YJNV 2JK5C 5H9CA 1H2GA 4MT8A 3JD2A 1WPXA 3E8FA 3OEEG 5CMUA 3X2QB 1F51A 2HVKC 3IC7A 2KB1A 3STLC 2IH3C 3K06A 3JYCA 3ZRWA 3OE7G 3ABLB 2WSSG 1RPOA 3FYIB 3GWOA 3JD1A 3B77A 3FB7C 3EFFK 5KA6A 3CCMV 5B3SB 3RVZA 3ZMZA 3AEIA 2C2AA 5GW7A 1I5XA 1R73A 1Y66A 2DW4A 1PNMA 2WAMA 4UVCA 2K1EA 3QO8A 4MTXA 2HFEC 3W7WA 1K9MW 2LFRA 4MTGA 1Q7YW 5KUKA 2HG5C 2ITDC 2EIMB 1JCHA 3G71V 3OEHG 4MVSA 4Q20A 4WCEV 3CC7V 2X0LA 4YXWG 1VQOV 4GX0A 3ZRXA 1OCOB 3UKMA 3FB8C 1F4MA 4JYBA 1KC8W 3B8MA 2H8PC 1V55B 3ETGA 4QPJA 3W7UA 1KP2A 3SJQC 3UM7A 1QLEC 3ASNB 4ZKIA 5L3FA 5HFMA 2QE7G 3AG4B 3SYOA 4BIZA 3R65A 3KG2A 4MS2A 1QLNA 2ZR3A 4GX5A 1DF5A 4XDJA 4BIUA 4PDMA 3D3IA 3B8NA 3CPWU 3TCUA 4TT3G 1K8AW 1JJ2U 2DWDC 2DYSB 4WFGA 2EILB 3G4SV 4OXSA 4MTOA 1CP9A 1GO3F 2B5UA 1R3KC 3ZN1A 2CK3G 4LCUC 2Q67A 1P4RA 3E8GA 1AI4A 5KUMA 2XAHA 5E1AC 1YITV 1J95A 1M57B 2ZQMA 1MOFA 2QEXV 1S76D 1M57C 3CCUV 1R3IC 2NNUA 4RUFA 2EIKC 4KUMA 1CEZA 2B1IA 2P7TC 1OCCC 5B1OA 2IJKA 2F43G 3CCEV 3M99B 2YEVA 3AG2C 3OUFA 3CCQV 2IH1C 2OTLV 1KKDA 1Q86W 1H38A 4LC1A 4MVUA 4FPPA 1NR1A 2IW5A 1SERA 2HJFC 1M56B 4HAMA 4UUJC 2ZD9A 4RQFA 1YTFB 4GX2A 1SETA 2V7QG 1VQ8V 1GM8A 2GSMB 1S3JA 3WFVA 1DLBA 2ATKC 1GK9A 1UJWB 5EK0A 3ZIAG 2Z5UA 1GM9A 4PA4A 1I5YA 2HR3A 1K4DC 4G27B 5L3GA 5EBMC 3BEHA 3ABMB 3CP1A 5B1BB 2A9HA 2A0LA 4WFAV 2Y69C 3SPJA 4PDRA 1QR9A 2XAJA 5CN0A 1RPRA 1EZJA 2X6CA 1AI6A 1KD1W 1FFTB 3FYEB 4UV8A 1KP3A 1THZA 2ITCC 5LHIA 3SPHA 2ZXWC 4UVAA 5L3EA 1K7DA 3CCJV 2HVJC 2WLHA 1RM1B 5B1AC 1K34A 3CMAV 2WLIA 5C93A 4FJCC 2DWEC 3W7TA 4H33A 1YI2V 1BHBA 5B1NA 2DQ0A 2WLLA 4MVZA 1VQ9V 3AG1C 4WFEA 2B1GA 2EIMC 4UXNA 5H6RA 1G4YB 1HWYA 4RQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T2M A;  4RUE A;  2H8P C;  3ABL C;  1OCO C;  2X6B A;  4LBE C;  3ABM C;  3FB6 C;  4MVO A;  1K4C C;  4R8C A;  5EBW C;  4PA9 A;  3F7V C;  3SJQ C;  3E83 A;  3T1C A;  3UM7 A;  1QLE C;  2AHY A;  4CBC A;  4DXW A;  5EC2 C;  3SYP A;  3SYO A;  3E8H A;  3R65 A;  3KG2 A;  4MS2 A;  3E86 A;  3LDC A;  4GX5 A;  3LDD A;  4XDJ A;  4R6Z A;  4WFF A;  4PDM A;  4GX1 A;  3AG4 C;  5CBH A;  4MW8 A;  1R3L C;  4RO2 A;  1OCR C;  4JTA B;  3TCU A;  4QNH B;  4PA7 A;  2DWD C;  2DYR C;  2WLJ A;  4WFG A;  3T4Z A;  4XDL A;  3OUS A;  3X2Q C;  2EIN C;  4OXS A;  3PJS K;  3SYA A;  4MTO A;  4MW3 A;  2Q6A A;  3LDE A;  3RBZ A;  1JVM A;  3AG3 C;  1R3K C;  2AHZ A;  4RAI A;  3ZRS A;  3K04 A;  1OCZ C;  2Q67 A;  3LNM B;  4LCU C;  4MTF A;  3E8G A;  4MVM A;  5KUM A;  3SYC A;  5E1A C;  1ZWI C;  2R9R B;  2WLM A;  4MVR A;  4P2Z A;  1J95 A;  1V55 C;  4J9Z B;  5B3S C;  2QKS A;  4R50 A;  4J9Y B;  4X88 A;  1M57 C;  2Q69 A;  1R3I C;  4RUF A;  3GB7 C;  5BZB A;  2EIK C;  1V54 C;  4PA3 A;  1M56 C;  1LNQ A;  2P7T C;  3SPC A;  1OCC C;  4QE9 A;  2A79 B;  4MVQ A;  3ABK C;  5J9P C;  2WLI B;  2EIJ C;  3K03 A;  2YEV A;  3AG2 C;  1XL4 A;  3LUT B;  3OUF A;  4PDV A;  2IH1 C;  4R7C A;  5B1B C;  1KKD A;  3FB5 C;  4X8A A;  2BOC C;  2WLL B;  1R3J C;  4MVU A;  4QE7 A;  4F4L A;  2DYS C;  4LP8 A;  4XDK A;  4P9O A;  4TWK A;  2HJF C;  4WFH A;  4EKW A;  4UUJ C;  2WLK A;  2ZD9 A;  4GX2 A;  3OR7 C;  3STZ C;  2QTO A;  3T4D A;  3K08 A;  2JK5 C;  2ATK C;  3E8B A;  4I9W A;  5EBL C;  5EK0 A;  3E8F A;  5EC1 C;  2HVK C;  2WLN A;  4H37 A;  2KB1 A;  3IGA C;  4G28 B;  2Q68 A;  2IH3 C;  4P30 A;  3K06 A;  4PA4 A;  3ASO C;  4X89 A;  3STL C;  3ASN C;  3E89 A;  3JYC A;  2BOB C;  4P9P A;  4PDL A;  1P7B A;  2NLJ C;  1K4D C;  4G27 B;  4KFM A;  5EBM C;  3BEH A;  5CBF A;  2A9H A;  2A0L A;  2Y69 C;  3FB7 C;  3EFF K;  3SPJ A;  4PDR A;  2X6A A;  2X6C A;  3RVZ A;  3OR6 C;  3SPI A;  4PA6 A;  3K0D A;  4BW5 A;  3SYQ A;  2K1E A;  2W0F C;  3RVY A;  5CBG A;  2ITC C;  2OCC C;  3SPH A;  3IFX A;  2ZXW C;  3SPG A;  2HFE C;  4JTD B;  5IY5 C;  4JTC B;  4MTG A;  2HVJ C;  2WLH A;  3WG7 C;  5KUK A;  5B1A C;  3VOU A;  2WLI A;  2HG5 C;  2ITD C;  2DWE C;  3F5W C;  4H33 A;  3ZJZ A;  4MVS A;  3HPL C;  4MSW C;  1XL6 A;  2WLL A;  3K0G A;  3OGC C;  4MVZ A;  3AG1 C;  1BL8 A;  4WFE A;  1S5H C;  4GX0 A;  2EIM C;  4HZ3 A;  4ZBM A;  3F7Y C;  1ORQ C;  3RW0 A;  3TET A;  1G4Y B;  3UKM A;  3FB8 C;  4HYO A;  2EIL C; 
#chains in the Genus database with same CATH topology
 1VQK V;  1ARO P;  1BQ0 A;  2LQT A;  3HKC B;  1JA8 A;  2P90 A;  2IU3 A;  1MZF A;  1Z5V A;  2DQ3 A;  3E8H A;  3JAR A;  3CRM A;  4J7K A;  3LDD A;  1K33 A;  3MHS C;  5JJN B;  3HKE B;  1AIL A;  1H8H G;  4O2A A;  5LGT A;  2WLJ A;  1E1R G;  4DW1 A;  4BW9 A;  3ZHR A;  4DRX B;  5JCO A;  4JYY A;  4DV6 O;  1FXK A;  4DUZ O;  3D3Q A;  2Q69 A;  3JCZ A;  3RYF B;  2Y4U A;  2LGW A;  2JS3 A;  4E2L A;  2JS5 A;  4FVM A;  3K5N A;  4JYC A;  1FPO A;  4AIL C;  3CD6 V;  1Q81 W;  4CC6 A;  3BVO A;  2HHH O;  1Z2G A;  2KKW A;  5C8Y A;  5EC1 C;  1JQ0 A;  1S0V A;  4PDL A;  2X7R B;  3DSQ A;  2EBO A;  1NU1 H;  1EN5 A;  3ABU A;  1Y76 A;  2A7W A;  3OR6 C;  3K3W A;  3AK3 A;  5LGN A;  4BW5 A;  1BS3 A;  4FLZ A;  1G6U A;  3JSL A;  4JI0 O;  4ICG A;  2OCC C;  3DC6 A;  3WB2 A;  2ZM6 O;  1M5I A;  1I7F A;  4JTC B;  3VOU A;  2ZKO A;  3KCY A;  3ZJZ A;  3HPL C;  1YVW A;  5GTH Z;  3TET A;  3J7A U;  2AW9 A;  1IBK B;  4DV6 B;  2ZE5 A;  4OX9 O;  2JJ1 G;  1PNK A;  1NI8 A;  1K4C C;  1SKV A;  2YEV B;  4TV8 A;  2VWJ A;  2Y48 A;  3R66 A;  1Q82 W;  5IYB O;  3CX5 F;  5IYC O;  3L72 H;  2UXC O;  4TV9 A;  1R6N A;  3ZRW B;  3K57 A;  2AHZ A;  3P3N A;  4DV5 O;  4LFA O;  3LSS A;  4J11 A;  4NXM B;  5HFL A;  1PL0 A;  5H2F Z;  2EZP A;  3Q4H A;  4X1I B;  4YIO A;  5L3C A;  4FFB B;  1TUE B;  2O57 A;  2Q0O C;  2Z0A A;  3PN1 A;  2XAS A;  3BAB A;  5H5N A;  3WB1 A;  2WLL B;  3RYI B;  4XDK A;  4EKW A;  2OT5 A;  4U7N A;  1PKX A;  4B3T O;  1VQ5 V;  2XND G;  1TVK B;  5FPR A;  1Y4M A;  1SQG A;  2DMX A;  1MG1 A;  3TGU H;  4DW0 A;  2QTS A;  3LSQ A;  3ASN C;  2JGD B;  3ETD A;  2BTQ B;  4UB8 Z;  4OGQ B;  3J81 N;  1IUR A;  4JI5 O;  1WLE A;  1IXM A;  4WFB V;  2QWQ B;  1L8D A;  4O4L B;  1BMF G;  4JAU A;  1B06 A;  1IBM O;  5CBG A;  4UFZ A;  1NZ6 A;  3CJH A;  1ZSP A;  3W7X A;  3HR0 A;  1H2N A;  5JVD A;  1SES A;  1BL8 A;  1ORQ C;  4K8X A;  3LSU A;  5EBW C;  1F7Y A;  3E35 A;  1RFY A;  1VQP V;  2PY5 A;  1K73 W;  1CXZ B;  2OCH A;  1PD3 A;  1OCR C;  2LP7 A;  2CTR A;  4JTA B;  3OUS A;  3BPZ A;  1JVM A;  5A9G A;  5BY1 A;  3ZRS A;  2WPD G;  4D6T H;  2ZE7 A;  4JI1 B;  4F6E A;  1SZT A;  5JCO C;  4X1K B;  3ZBH A;  4R50 A;  4LFB O;  2V4D A;  1NQT A;  4O4H B;  3ZHQ A;  2D2C B;  5LP6 B;  1VQ6 V;  1VQ7 V;  3QF7 A;  1LNQ A;  2BE3 A;  4MVQ A;  3THO A;  2V1D A;  3QO7 A;  1PV0 A;  1NR7 A;  2L6L A;  2PYL A;  4DV5 B;  3ZHV A;  5B5E Z;  2QA4 V;  3A0H Z;  2ETN A;  1U97 A;  4UCO A;  1HNZ O;  3OAA G;  2N05 A;  5LA6 B;  4MT8 A;  5KMG A;  4IIJ B;  1S5L Z;  4JI5 B;  3E8F A;  3A0B Z;  5KHG A;  2Q7H A;  4NXN B;  3ZRW A;  2WSS G;  1NT2 B;  1XQ8 A;  4LF7 B;  3L75 H;  3ZMZ A;  3AEI A;  3OTO O;  4UVC A;  2K1E A;  3SGI A;  5GON A;  4MTX A;  5KHH A;  1X59 A;  1KU9 A;  4MTG A;  2QWP B;  2DE0 X;  3G71 V;  4MVS A;  4WCE V;  3CC7 V;  2ZIM A;  2UUC B;  1T5E A;  3ZRX A;  1I94 B;  4LF9 O;  3FB8 C;  1SA0 A;  3B8M A;  1IBM B;  2VRZ A;  2IM9 A;  3ETG A;  1G1X B;  2UXB O;  2ZIN A;  2Q7G A;  1VMG A;  2QE7 G;  3SYO A;  4MS2 A;  4B3S O;  3SJB C;  4BIU A;  3D3I A;  3JAR B;  3B8N A;  5B66 Z;  4TT3 G;  5KMG B;  2DYS B;  2LO1 A;  4JI0 B;  4MTO A;  4DR3 B;  5AG2 A;  3OGI B;  1AI4 A;  1EZV H;  1Q6I A;  5E1A C;  3FX7 A;  4PHZ A;  1MOF A;  4FLU A;  1IBL O;  2EIK C;  4CS3 A;  2B1I A;  5IE9 A;  2P7T C;  3K59 A;  5B1O A;  4FLW A;  1BGY H;  4DR5 O;  5IJ9 B;  1XBL A;  3B2E E;  3OUF A;  1KKD A;  4JI4 B;  1WAZ A;  2QGN A;  5JJJ B;  1NR1 A;  2YIA A;  4J80 A;  2V7Q G;  4TQF A;  1VQ8 V;  1S3J A;  1GK9 A;  3AK1 A;  2Y0I A;  1Y67 A;  4RWU A;  4PA4 A;  3CRC A;  1K4D C;  3F5T A;  1MA1 A;  4FFK A;  3ABM B;  4U3F H;  5B1B B;  4PDR A;  4O2A B;  1KD1 W;  4DYL A;  2OYQ A;  1FFT B;  3FYE B;  5IT9 N;  1QU7 A;  5JH7 B;  5FNV A;  2GTA A;  4IL6 Z;  3SR2 C;  3SPH A;  2ZXW C;  4UVA A;  3M7M X;  3ZED A;  1WN7 A;  2UXD O;  5C93 A;  2DWE C;  2KSD A;  2EX3 A;  4YHH O;  4X1K A;  2UXB B;  4UXN A;  3EXA A;  2JRI A;  3E22 B;  3T2M A;  2RMK B;  4D7T A;  3ABL C;  1OCO C;  1NH2 B;  4JPR A;  4IIJ A;  1NTK H;  1YSC A;  1OJH A;  1IX9 A;  4HBN A;  3P3P A;  4NVP A;  1XHZ A;  3HKB B;  1VF7 A;  2YS8 A;  1GKF A;  4CH4 A;  5BR8 O;  1XOU A;  2E76 B;  2Q6A A;  3OW2 U;  4DK1 A;  2R9I A;  5L3B A;  3K04 A;  3EVK A;  5IJ0 A;  1P49 A;  3MHH C;  1GN3 A;  1M93 A;  1ZAU A;  5B3S C;  2GUZ B;  3JAT B;  2R72 A;  2E75 B;  5J2T B;  2LGQ A;  5J2U B;  1D2D A;  2DOS A;  1M56 C;  3L71 H;  1M90 W;  3UO3 A;  5LMU B;  3DGE A;  4N21 A;  2OIG A;  2FB5 A;  1QNM A;  3U11 A;  1VF5 B;  4XBF A;  1XL4 A;  4DR3 O;  2PI4 A;  5CB4 B;  3FKS G;  3M8A A;  2UUA B;  3BY6 A;  4UCU A;  4O4I B;  2P4V A;  5EBL C;  2WWW A;  4TV8 B;  3IGA C;  4X89 A;  2JVD A;  2EZO A;  3EHB B;  4KFM A;  3G6E V;  1YF2 A;  2YIC A;  2MW2 B;  1N33 O;  3ABK B;  4FZ0 A;  1OZ0 A;  4LF4 B;  1XMQ B;  1WB7 A;  2YXL A;  3K79 A;  5JH7 A;  4UCV A;  3K5L A;  4ZHQ A;  4QPK A;  1DF4 A;  1I0H A;  2N74 A;  2QR4 A;  1AR4 A;  4X66 O;  1Q3E A;  4X1Y B;  3OTO B;  4HYO A;  1L0L H;  2JJ2 G;  3ABM C;  1BE3 H;  5LMN O;  4GKJ O;  1QHT A;  5KHJ A;  4NXN O;  4DXW A;  5H6Q A;  2XOK G;  3RYI A;  4R6Z A;  4I55 A;  4DR6 B;  1TAE A;  5CA0 B;  4QJF B;  2JEX A;  1Y6X A;  4PA7 A;  2DYR C;  3LNN A;  5LYJ A;  1Q6U A;  2EIN C;  3SJA C;  2UUA O;  3LDE A;  3AG3 C;  5IY5 B;  3AG2 B;  4FM2 A;  2MK3 A;  4RAI A;  3FFQ A;  3ZMS A;  4B3M O;  4WBN B;  1HR0 B;  4LF8 O;  3CYO A;  3G67 A;  4EB6 B;  3JAM N;  5BR8 B;  2Z3Y A;  2F66 C;  5BZB A;  3H9V A;  1KMI Z;  4IT5 A;  5J9P C;  1N33 B;  2A06 H;  1QVG U;  2Q9L A;  5LOV B;  2ZT9 B;  3E22 A;  1YEW A;  3JD4 A;  3OR7 C;  4B7E A;  3HB3 B;  3E2E A;  1F23 A;  4AHC A;  4AQY O;  2WLN A;  4GKK B;  3ML0 A;  1DTO A;  1S77 D;  3E89 A;  2BOB C;  1P7B A;  1SC5 B;  2CTP A;  2CH7 A;  2JGU A;  1K5Q A;  2HEP A;  4FK5 C;  2LJ2 A;  1JFF B;  1NKD A;  2X6A A;  4DUY B;  3J80 N;  4IYI A;  4WF9 V;  4JZ2 A;  1Q5O A;  1XMO O;  4ZIB A;  5EIB D;  2CGN A;  1FXK C;  1IXB A;  2Q4P A;  3HKD A;  4UVB A;  4ZHQ B;  1RP3 B;  2VQF B;  1M9N A;  3I5D A;  4MSW C;  2PYJ A;  3H1J H;  3F7Y C;  5LMN B;  4GKJ B;  5J2T A;  5IWA O;  2ZE6 A;  4RUE A;  2QKC A;  4JI1 O;  4E4E A;  3G6B A;  4KP4 A;  5TIS Z;  1VF6 C;  4R8C A;  5K1P A;  4PA9 A;  3E83 A;  1Q6H A;  2VWK A;  2AHY A;  2EIK B;  1VQM V;  2YI8 A;  3JAW B;  3SYP A;  4W4K A;  3D36 A;  3OTF A;  3CC4 V;  4WFF A;  4FIP C;  1ZLZ A;  1FJG O;  4MW8 A;  1K92 A;  2HKO A;  2BCC H;  1SQQ H;  4I7Z B;  4Q6G A;  2EIJ B;  3RBZ A;  5DN6 G;  4L87 A;  4CH3 A;  5KLV H;  1HNZ B;  1NTM H;  4X20 B;  3LNM B;  3TXQ A;  3ZX6 A;  1GMG A;  2DN9 A;  2R9R B;  4MVR A;  1TUB B;  1V55 C;  2CTW A;  2QWR B;  3WG7 B;  2QKS A;  4I50 A;  2UXN A;  1XMO B;  1K97 A;  4PA3 A;  4DR2 B;  4YJ3 B;  4DV2 O;  2NR5 A;  3HKC A;  2WLI B;  5A2Q N;  4O2B A;  1VEW A;  1PNL A;  3TK1 A;  4J41 A;  4LFA B;  2BOC C;  1G8M A;  3ZCC A;  3W7S A;  1YZB A;  2EUL A;  4A5U B;  1J5E O;  1W2B U;  1WJZ A;  3OEE G;  1XEQ A;  1XHX A;  3JD2 A;  5CMU A;  1EM1 A;  3IC7 A;  3MDS A;  2UUC O;  3VQV A;  3STL C;  5LMU O;  2IH3 C;  3QTC A;  1B3Q A;  5K1X A;  4DR7 O;  3ABL B;  2YIB D;  4EEQ A;  1RPO A;  3FYI B;  3GWO A;  3JAK A;  3B77 A;  4I55 B;  4LR3 A;  2ZIO A;  1P7G A;  5B3S B;  2CTQ A;  4FLY A;  3RVZ A;  5GW7 A;  4B3T B;  3CRQ A;  1Z5W A;  3DXR B;  2LFR A;  1Q7Y W;  5LXT A;  2ITD C;  4PV1 B;  4C7U A;  3ZHS A;  3OEH G;  4Q20 A;  5EYP B;  4GX0 A;  3GWK C;  4I4T A;  3N2G A;  1F4M A;  4JYB A;  3L74 H;  3C90 A;  3W7U A;  3UM7 A;  1QLE C;  5HFM A;  3CHX A;  1IVS A;  1LR1 A;  2GTS A;  2G38 A;  4BIZ A;  5JJE B;  2CGO A;  2XT9 A;  2ZR3 A;  4XDJ A;  4DR2 O;  4DV3 O;  1JFF A;  3CPW U;  4NXM O;  4DV4 O;  1D5A A;  5KAF Z;  1XMQ O;  1R3K C;  4JAA A;  3ZN1 A;  2Q67 A;  2NN4 A;  2XAH A;  3A2F A;  1YIT V;  1S76 D;  3CCU V;  1R3I C;  5FNV B;  2RN9 A;  4BR6 A;  4U3J B;  1P84 F;  3HKD B;  3BA8 A;  2IJK A;  1ZX3 A;  5LXT B;  3M99 B;  3H1K H;  2OTL V;  4TQD A;  1HR0 O;  4LF8 B;  1H38 A;  4FPP A;  1PM9 A;  4FLT A;  2HJF C;  4HAM A;  4UUJ C;  2ZD9 A;  4DV0 O;  4GX2 A;  1UFI A;  1IBL B;  5EK0 A;  5BMV A;  4J42 A;  1TVK A;  4YHH B;  4DV1 B;  1D5N A;  3APO A;  2Z5U A;  4JI6 O;  1U96 A;  4DR5 B;  1I5Y A;  4KHP O;  5EBM C;  4B3M B;  4ZOL B;  3CP1 A;  1NS1 A;  3KKY A;  5BXZ A;  1KUQ A;  4FM0 A;  2XAJ A;  2X6C A;  1EZJ A;  2YXY A;  3QG5 A;  4YY3 B;  1N36 B;  3C3T A;  4UV8 A;  1KP3 A;  2ITC C;  4X1I A;  3ETQ A;  2HVJ C;  1RM1 B;  1VF6 A;  5B1A C;  3CMA V;  2WLI A;  3W7T A;  2CDY A;  2DQ0 A;  2WLL A;  4MVZ A;  1VQ9 V;  4WFE A;  5IYZ A;  3UT5 B;  3DC5 A;  2YI9 A;  4I50 B;  4F6R A;  1OV9 A;  5CA1 B;  1WP8 A;  4RQE A;  4JAV A;  4LBE C;  3OFN G;  2VQE B;  4DR1 B;  1AB3 A;  4I0X B;  2JGD A;  1BQZ A;  4B7K A;  4X64 B;  3HKB A;  4PEL A;  4GX1 A;  5KA5 A;  1JJO A;  4O4L A;  5FL7 G;  2W0X A;  1N34 O;  5JQG B;  1E1Q G;  4XDL A;  4G2K A;  4KL1 A;  1B04 A;  1SZX A;  1N4C A;  3CJH B;  5ITZ B;  4DV7 B;  1Y74 B;  1BSM A;  3JAT A;  3ZMU A;  3CB2 A;  3MD0 A;  1SRY A;  4J9Y B;  3Q4H B;  4CH5 A;  1B6Q A;  2LW1 A;  1L0N H;  2QSA A;  1FS0 G;  1XUQ A;  2ZDI A;  2JEU A;  4EB6 A;  1V54 C;  4FMT A;  2Q8V A;  3TXS A;  4JF3 A;  3SPC A;  2A79 B;  2K9P A;  1YTF D;  1XDC A;  3KCX A;  3LUT B;  1MMM A;  1R3J C;  3UT5 A;  2YID A;  1YJW V;  4X1Y A;  5DM6 V;  3STZ C;  2QTO A;  3E8B A;  4I9Q A;  1AP5 A;  1W0K G;  5CA3 A;  4BIO A;  3JAK B;  1JPX A;  1E79 G;  1GTO A;  4X64 O;  5CBF A;  5DED A;  3SPI A;  4PA6 A;  4DV0 B;  1I94 O;  1HNX O;  3WB0 A;  3DXR A;  2FML A;  3OMN B;  3SYQ A;  2W0F C;  1O9H A;  3ZHU A;  4JV5 B;  2QJ1 A;  3SPG A;  1W0J G;  4LFC O;  2P67 A;  3H1I H;  1AJN A;  2GBO A;  3C3S A;  3VBB A;  1SQV H;  4ABM A;  4JI3 B;  1N34 B;  4IYH A;  3N27 A;  1KYO F;  4JAS A;  1SQX H;  5F2V O;  1XL6 A;  3K0G A;  2P5O A;  4NKG B;  1S5H C;  3RW0 A;  1J5E B;  2EIL C;  3NR7 A;  4DV7 O;  1N36 O;  1N32 O;  1MSW D;  2ADQ B;  3OMA B;  4CBC A;  4Z1V A;  4GT1 A;  4I0X A;  3E86 A;  2F93 B;  1NH2 D;  4DV2 B;  2CAZ C;  2DYR B;  2ZR2 A;  4QNH B;  2IU0 A;  3GVM A;  3I55 V;  2YSU B;  3X2Q C;  1KBH A;  4TUY A;  3N2K A;  4MTF A;  1IZ3 A;  1AR1 B;  4JI4 O;  4GCZ A;  1ZWI C;  2HJD A;  2WLM A;  4AQY B;  3CME V;  4GZR B;  1ENV A;  1S72 V;  4DR6 O;  4LF5 B;  3GB7 C;  4F6R B;  5CA1 A;  1BCC H;  2PF4 E;  3FD9 A;  1M4U A;  1L1F A;  3ABT A;  3P32 A;  4JV5 O;  3K9A A;  1QVF U;  3JCU Z;  1V54 B;  4P9O A;  4TWK A;  1BHA A;  4H0L B;  4ZI7 B;  2LFS A;  1MSD A;  1MZE A;  4I9W A;  2Q0A A;  4LNU A;  3JD0 A;  1AJQ A;  3K5M A;  4G28 B;  2Q68 A;  2F23 A;  1QLE B;  4LFB B;  1EN4 A;  2NLJ C;  4OPH A;  4BAY A;  3G80 A;  2YDE A;  3HKE A;  2ZXW B;  1YJ9 V;  3K0D A;  5IDJ A;  4TV9 B;  1IBK O;  2H94 A;  5EZY A;  4N23 A;  4DRX A;  5LHH A;  5LGU A;  1COW G;  2UUB O;  4DK0 A;  2XTA A;  2RQ6 A;  2P4K A;  4HZ3 A;  4ZBM A;  2EJ7 A;  4YY3 O;  2EJR A;  2QM8 A;  2IJI A;  4MVO A;  2GHY A;  2QM7 A;  3H01 A;  5D5Q A;  3LDC A;  3CCR V;  4LF9 B;  4X66 B;  1R3L C;  3CWB H;  1W59 A;  2HLD G;  3A0R A;  5LYJ B;  3SYA A;  4I5S A;  5LBQ A;  2XHB A;  4X20 A;  3CC2 V;  1FD9 A;  4K0K O;  5IJ0 B;  1AI7 A;  4P2Z A;  4J9Z B;  2JIZ G;  2OIE A;  5B1A B;  5KAI Z;  5GTI Z;  3BCC H;  4UCT A;  2DJV A;  1HDJ A;  3ZMV A;  2QWO B;  1CPY A;  3AG1 B;  2P06 A;  4IHJ A;  2UUB B;  4UCS A;  4DR1 O;  2N04 A;  4PDV A;  2AGA A;  3ZRV A;  4DO2 A;  3FB5 C;  3UCS C;  3U0Z A;  1TA8 A;  2DYS C;  5CB4 A;  2UU9 B;  4X62 O;  3CE2 A;  1XNQ O;  5C8Y B;  4CS2 A;  3L73 H;  5H9C A;  1H2G A;  3JAL A;  1WPX A;  3FAV A;  3X2Q B;  1F51 A;  2HVK C;  1Q43 A;  4PJ0 Z;  4PD4 F;  1GAX A;  2AZ2 A;  3K06 A;  1XRE A;  3JYC A;  3OE7 G;  4FZ1 A;  4LH6 A;  1A32 A;  3JD1 A;  3FB7 C;  5KA6 A;  4ZOL A;  3QVN A;  1URF A;  3CCM V;  3B4S A;  2PZS A;  2RDC A;  1HNW B;  4LWS A;  1WA8 A;  1I5X A;  1N0N A;  1R73 A;  2DW4 A;  3CRA A;  1PNM A;  2WAM A;  3T1Y O;  2HFE C;  3W7W A;  2E74 B;  3AG7 A;  5J2U A;  1K9M W;  1YDX A;  3RYC A;  4FLV A;  1S5J A;  4DR7 B;  2HG5 C;  2EIM B;  1JCH A;  1RSO A;  2X0L A;  2QM4 A;  1VQO V;  3KZI Z;  3RT3 C;  3RFR A;  3UKM A;  1HNX B;  3N2G B;  4J7Z A;  2RNB A;  2QWN B;  4JI2 B;  4FM1 A;  3T1H O;  5FPO A;  3SJQ C;  4D7S A;  5L3F A;  1QQC A;  2H3O A;  3AG4 B;  2VQF O;  3RN4 A;  1DK1 A;  3R65 A;  2FL4 A;  4GX5 A;  4PDM A;  3ZS8 C;  1BT8 A;  1K8A W;  1JJ2 U;  2DWD C;  4WFG A;  3H1L H;  2EIL B;  3G4S V;  4NYK A;  1GO3 F;  4LCU C;  1P4R A;  2RJZ A;  2F4V B;  2ZQM A;  2Y4T A;  5EYP A;  4LWS B;  3VQW A;  1M57 C;  1ZTE A;  2ARH A;  4RUF A;  4O4H A;  5LP6 A;  3MAQ A;  4FFB A;  3RYC B;  1OCC C;  1XIL A;  4GKK O;  1XNQ B;  3AG2 C;  4EFB A;  1Q86 W;  4LC1 A;  4MVU A;  2IW5 A;  2QKA A;  4GUN A;  1M56 B;  1AVM A;  2Y0P A;  4LF7 O;  4LNU B;  1DLB A;  4KHP B;  4O4J A;  1UJW B;  4EFE A;  3ZIA G;  1R1B A;  3TJT A;  4B08 A;  1FYJ A;  2HR3 A;  5L3G A;  1ZL8 B;  4G27 B;  3BEH A;  1ZUQ A;  4WBN A;  3RYH B;  2A0L A;  4WFA V;  2Y69 C;  2VQE O;  3SPJ A;  1QR9 A;  1GRJ A;  2AZ0 A;  4NTW A;  1RPR A;  1AI6 A;  1SS3 A;  1THZ A;  5LHI A;  4HNA A;  5L3E A;  2Q73 A;  2FKX A;  2F95 B;  5GON B;  3CCJ V;  3L9D A;  1GN4 A;  5DEC A;  4H33 A;  1YI2 V;  2ZCE A;  3AG1 C;  2EIM C;  4DV1 O;  1YXB A;  1YHQ V;  3FAV B;  3L70 H;  3T1C A;  1OCZ B;  4CZZ A;  3BRC A;  1US6 A;  4YJ2 A;  1FAF A;  4TSF G;  4J7J A;  3SJC C;  1YIJ V;  3AG4 C;  4RO2 A;  1I08 A;  1WA8 B;  1PL4 A;  1WB8 A;  1AI5 A;  2OWO A;  3PJS K;  5ITZ A;  1GH6 A;  1VIB A;  1WNS A;  4ASU G;  4MVM A;  1MAB G;  3K9S A;  1H2L A;  1Y74 A;  1OHH G;  4X88 A;  3OD4 A;  4Z2W A;  4IGG A;  4DV4 B;  1SA0 B;  4DUZ B;  4NB5 A;  4H44 B;  2EIJ C;  2YXH A;  4R7C A;  4U7O A;  5IJ9 A;  2AXT Z;  1EFR G;  3S3W A;  3BAA A;  4QE7 A;  4F4L A;  1KEC A;  4X9Q A;  2E5L O;  5LA6 A;  3APQ A;  3OMI B;  1JR9 A;  2W6J G;  1NTZ H;  4H37 A;  2XAF A;  2BSK B;  3CXH F;  2PI5 A;  3BA9 A;  2KQX A;  1NBM G;  1FXV A;  4JYA O;  1DGS A;  2A3Q A;  1ZL8 A;  1RM1 C;  2EIN B;  1N32 B;  4LFC B;  1Q90 D;  3NXS A;  2B9Z A;  4CC5 A;  1QBZ A;  1K5S A;  4JZG A;  3O9O A;  2XAQ A;  5LL6 Y;  3D8C A;  2ODM A;  2GDS A;  4JTD B;  1AP6 A;  4O2B B;  1FFX B;  5IYZ B;  2ZM6 B;  1KKC A;  3CRR A;  1NJI W;  3OT7 A;  5IYD O;  4I4T B;  5KX5 A;  2UXC B;  2X6B A;  4O4J B;  3FB6 C;  4B3R B;  1XNR B;  1IDS A;  2XUM A;  2FTK A;  4LH7 A;  4K35 A;  1H8E G;  1XI1 A;  2KG7 A;  1KB9 F;  1WPB A;  1NVP D;  3DTU B;  4OPA A;  3IJ4 A;  1QR8 A;  3RYH A;  5E79 Z;  1JOY A;  5CBH A;  1KQS U;  3BFR A;  5JQG A;  2CUG A;  4JI2 O;  1GN2 A;  2R70 A;  5LP6 C;  4MW3 A;  1MNG A;  3SYC A;  4W4L A;  1K3E A;  4OX9 B;  1UPG A;  1N8R W;  1ROP A;  3AK2 A;  3RYF A;  4JGS A;  3ZN0 A;  5LHG A;  2GUZ A;  4QGP A;  4HNA B;  4QIW F;  3ASO B;  2HP8 A;  4QE9 A;  3ABK C;  4JI6 B;  2QDO A;  1R6K A;  3K03 A;  3CS5 A;  3B40 A;  5B1B C;  3I56 V;  2RCV A;  5JWP A;  4UV9 A;  3OM3 B;  2IJJ A;  1M1K W;  4WFH A;  3CXC U;  2P6J A;  1FXH A;  4Z1M G;  3T4D A;  3K08 A;  4LF5 O;  4ZI7 A;  2PUS A;  1VQ4 V;  3JAL B;  4TUY B;  2KG7 B;  4P30 A;  3K58 A;  3ASO C;  4P9P A;  2BSK A;  4H13 B;  2F4V O;  1AJP A;  3IC9 A;  4L8J A;  1XNR O;  1GM7 A;  3CCS V;  3T1H B;  3ZMT A;  1HP8 A;  4PI2 A;  3RVY A;  2BTO A;  2D3O W;  4YIP A;  3IFX A;  4DR4 O;  1PPJ H;  3BHP A;  3AG3 B;  5IY5 C;  3WG7 C;  4LF6 B;  2CE4 A;  3F5W C;  4JI7 O;  3OGC C;  2IJH A;  1VQL V;  1RSO B;  3QO5 A;  2UXX A;  4B3R O;  5JVD B;  1F4N A;  3UQ8 A;  4U3J A;  3CCL V;  1EBO A;  1OCC B;  2JDI G;  4KXR A;  3F7V C;  4UCR A;  2XAG A;  3CSX A;  3O65 A;  4TOI A;  3P30 A;  3K5O A;  3D36 C;  5EC2 C;  2M6Y A;  4JI3 O;  4GYC B;  1Q8I A;  5KHK A;  2M7W A;  2OCC B;  2Y69 B;  3ETE A;  2OTJ V;  3CCV V;  3T4Z A;  4K0K B;  4FLX A;  4X62 B;  3S3X A;  1R6T A;  1OCZ C;  2YC0 A;  1N0J A;  3QNE A;  1FXK B;  1H2M A;  2ZNJ A;  2HHH B;  1H2S B;  2YUA A;  4IHJ B;  5KX5 B;  2W6I G;  2UU9 O;  4LF6 O;  1GN6 A;  3CEI A;  2PTM A;  2Q7E A;  4X8A A;  5L3D A;  4DR4 B;  1JX9 A;  1QCE A;  1JMK C;  4LP8 A;  2YIB A;  2ZDI C;  2WLK A;  3JD3 A;  5LOV A;  3ICX A;  1OCR B;  1NVP B;  1VAR A;  1VQN V;  1SQB H;  3RGB A;  1YJN V;  3JAS A;  2JK5 C;  4JI7 B;  1SQF A;  2F1M A;  2KB1 A;  3JSN A;  3B09 A;  4CH6 A;  4NTX A;  2WA3 A;  2GV9 A;  3EFF K;  2FYU H;  3T1Y B;  2ADP A;  2C2A A;  1Y66 A;  5IWA B;  2WA4 A;  3QO8 A;  1FJG B;  5KUK A;  4JYA B;  1H2K A;  3SDL A;  2VS0 A;  1V9P A;  1SF9 A;  4YXW G;  4X65 B;  1OCO B;  4LF4 O;  1HNW O;  2E5L B;  1KC8 W;  2H8P C;  1V55 B;  4QPJ A;  5BMV B;  1KP2 A;  4JI8 B;  3ASN B;  4ZKI A;  4GLX A;  4J10 A;  3KG2 A;  1QLN A;  1DF5 A;  1X4T A;  2CH7 B;  3U10 A;  5CA0 A;  1FKA O;  3JAS B;  1Y76 B;  3TCU A;  2ZE8 A;  2IBZ H;  3RWR D;  2LW7 A;  4OXS A;  1O9G A;  1CP9 A;  2ILM A;  2B5U A;  2CK3 G;  1HW7 A;  3E8G A;  5KUM A;  2R9A A;  5D5P A;  1J95 A;  1M57 B;  3H1H H;  1BZK A;  2QEX V;  1TUB A;  3WU2 Z;  4CS4 A;  4NR1 A;  2NNU A;  4KUM A;  4B3S B;  1CEZ A;  4BWA A;  3VQY A;  2L35 A;  2F43 G;  3CCE V;  2P22 C;  2YEV A;  2E3C A;  3CCQ V;  2IH1 C;  3JAW A;  1SER A;  4RQF A;  1YTF B;  1SET A;  3VQX A;  1GM8 A;  1TGO A;  2GSM B;  3WFV A;  4O4I A;  2ATK C;  2Q5Z A;  2PGG A;  5FLX N;  1GM9 A;  5KHI A;  2UXD B;  4YJ2 B;  1SQP H;  3IAY A;  2BTQ A;  1LUW A;  2A9H A;  4AI8 A;  1VP7 A;  3ZHT A;  4K8Z A;  4JI8 O;  5CN0 A;  4NTY A;  3N2K B;  4DV3 B;  1K7D A;  1EN6 A;  4YJ3 A;  4X65 O;  2WLH A;  1YCI A;  5EZY B;  1K34 A;  1WP7 A;  1LUV A;  4FJC C;  3A8T A;  2ZNI A;  3UO2 A;  5EIB C;  1BHB A;  5B1N A;  1FFX A;  1AR5 A;  4UB6 Z;  2B1G A;  4K3A A;  5H6R A;  4DUY O;  1PP9 H;  1G4Y B;  1HWY A;  4PI0 A; 
#chains in the Genus database with same CATH homology
 1VQK V;  3T2M A;  1YHQ V;  4JAV A;  3ABL C;  1ARO P;  1OCO C;  4LBE C;  1NH2 B;  4JPR A;  3OFN G;  1YSC A;  3T1C A;  1OCZ B;  2P90 A;  2IU3 A;  4CZZ A;  2DQ3 A;  3E8H A;  4TSF G;  3LDD A;  4PEL A;  1YIJ V;  4GX1 A;  3AG4 C;  1K33 A;  3MHS C;  4RO2 A;  5KA5 A;  1GKF A;  1H8H G;  5FL7 G;  5LGT A;  2WLJ A;  1E1Q G;  1E1R G;  4XDL A;  1AI5 A;  3PJS K;  4G2K A;  2Q6A A;  3OW2 U;  2R9I A;  5L3B A;  4ASU G;  3K04 A;  4MVM A;  1MAB G;  1FXK A;  3MHH C;  3ZMU A;  5B3S C;  3MD0 A;  1OHH G;  1SRY A;  4J9Y B;  4X88 A;  1B6Q A;  2Q69 A;  3JCZ A;  2ZDI A;  1FS0 G;  2JEU A;  1V54 C;  1M56 C;  4FMT A;  4E2L A;  1M90 W;  4JF3 A;  3SPC A;  2A79 B;  3DGE A;  4N21 A;  1YTF D;  2EIJ C;  4XBF A;  1XL4 A;  3LUT B;  4JYC A;  4R7C A;  4U7O A;  2PI4 A;  1EFR G;  3FKS G;  4QE7 A;  1R3J C;  4F4L A;  3BY6 A;  1KEC A;  3CD6 V;  1YJW V;  1Q81 W;  5DM6 V;  3STZ C;  2QTO A;  3E8B A;  3OMI B;  5EBL C;  2W6J G;  5EC1 C;  2WWW A;  1W0K G;  4H37 A;  1JQ0 A;  2XAF A;  3IGA C;  1S0V A;  4X89 A;  5CA3 A;  4PDL A;  2PI5 A;  2EZO A;  1NBM G;  3EHB B;  1FXV A;  1JPX A;  2X7R B;  1E79 G;  1GTO A;  2EBO A;  4KFM A;  5CBF A;  3G6E V;  1RM1 C;  2EIN B;  3NXS A;  3ABU A;  3OR6 C;  3ABK B;  3K3W A;  4PA6 A;  3SPI A;  5LGN A;  1OZ0 A;  4BW5 A;  3OMN B;  3SYQ A;  2W0F C;  1QBZ A;  1K5S A;  2XAQ A;  2OCC C;  3SPG A;  1W0J G;  3K79 A;  2P67 A;  4JTD B;  4JTC B;  1AJN A;  3VOU A;  3VBB A;  4QPK A;  1DF4 A;  3ZJZ A;  3HPL C;  4JAS A;  1XL6 A;  3K0G A;  1S5H C;  1NJI W;  3RW0 A;  3TET A;  5IYD O;  4HYO A;  2EIL C;  2X6B A;  2JJ2 G;  3ABM C;  2JJ1 G;  1PNK A;  3FB6 C;  1K4C C;  2FTK A;  2YEV B;  1H8E G;  1MSW D;  3OMA B;  4CBC A;  4DXW A;  2Y48 A;  4GT1 A;  1NVP D;  1Q82 W;  5H6Q A;  3E86 A;  2XOK G;  5IYB O;  3DTU B;  4R6Z A;  1QR8 A;  1NH2 D;  1JOY A;  5CBH A;  1KQS U;  2DYR B;  2ZR2 A;  4QJF B;  2JEX A;  4QNH B;  4PA7 A;  5IYC O;  2IU0 A;  2DYR C;  3I55 V;  2YSU B;  2EIN C;  3X2Q C;  4MW3 A;  3LDE A;  3AG3 C;  1R6N A;  5IY5 B;  3AG2 B;  3ZRW B;  2MK3 A;  2AHZ A;  4RAI A;  3ZMS A;  4MTF A;  3SYC A;  1AR1 B;  1K3E A;  3LSS A;  4GCZ A;  1ZWI C;  2WLM A;  3CYO A;  3CME V;  1N8R W;  1ROP A;  1ENV A;  4JGS A;  1PL0 A;  5HFL A;  1S72 V;  3ZN0 A;  5LHG A;  2EZP A;  2Z3Y A;  3GB7 C;  5BZB A;  5L3C A;  4QIW F;  3ASO B;  4QE9 A;  3ABK C;  5J9P C;  1TUE B;  1R6K A;  3K03 A;  1L1F A;  2XAS A;  3ABT A;  3P32 A;  1QVG U;  5B1B C;  3I56 V;  2WLL B;  3K9A A;  1QVF U;  4UV9 A;  4XDK A;  1V54 B;  3OM3 B;  2IJJ A;  4P9O A;  4TWK A;  4WFH A;  4EKW A;  2P6J A;  2OT5 A;  4U7N A;  3CXC U;  1M1K W;  1FXH A;  1BHA A;  1PKX A;  3JD4 A;  3OR7 C;  4Z1M G;  3T4D A;  1VQ5 V;  2XND G;  3K08 A;  3HB3 B;  2LFS A;  1Y4M A;  3E2E A;  1F23 A;  4I9W A;  1MG1 A;  3JD0 A;  2WLN A;  1VQ4 V;  1AJQ A;  3ML0 A;  4G28 B;  2Q68 A;  3LSQ A;  1DTO A;  4P30 A;  3ASO C;  1S77 D;  1QLE B;  3ASN C;  3E89 A;  2BOB C;  3ETD A;  4P9P A;  1P7B A;  2NLJ C;  1AJP A;  1WLE A;  1IXM A;  1K5Q A;  4WFB V;  4FK5 C;  4BAY A;  1GM7 A;  1NKD A;  2X6A A;  3CCS V;  1BMF G;  4JAU A;  3ZMT A;  2ZXW B;  1YJ9 V;  3K0D A;  5IDJ A;  5CBG A;  4WF9 V;  3RVY A;  2D3O W;  3IFX A;  2H94 A;  4N23 A;  3AG3 B;  5IY5 C;  1FXK C;  3WG7 C;  5LHH A;  5LGU A;  1COW G;  4UVB A;  3W7X A;  3F5W C;  1M9N A;  4MSW C;  1SES A;  3OGC C;  2IJH A;  1BL8 A;  1VQL V;  4HZ3 A;  4ZBM A;  3QO5 A;  2UXX A;  1ORQ C;  3F7Y C;  2EJR A;  1F4N A;  2QM8 A;  2IJI A;  4RUE A;  3CCL V;  4KP4 A;  4MVO A;  5EBW C;  1EBO A;  1OCC B;  4R8C A;  4PA9 A;  2JDI G;  3F7V C;  3E35 A;  3E83 A;  1VQP V;  2XAG A;  2AHY A;  3P30 A;  2EIK B;  1VQM V;  2GHY A;  2QM7 A;  5EC2 C;  3H01 A;  3SYP A;  1K73 W;  1PD3 A;  3D36 A;  3LDC A;  3CC4 V;  4WFF A;  2M7W A;  2OCC B;  2Y69 B;  4FIP C;  3CCR V;  4MW8 A;  1R3L C;  1OCR C;  3ETE A;  2HLD G;  2LP7 A;  3A0R A;  2OTJ V;  1K92 A;  4JTA B;  3CCV V;  2HKO A;  3T4Z A;  3OUS A;  3SYA A;  4I5S A;  5LBQ A;  2EIJ B;  3RBZ A;  1JVM A;  4L87 A;  5DN6 G;  3CC2 V;  3ZRS A;  1OCZ C;  3LNM B;  2WPD G;  1GMG A;  1AI7 A;  2R9R B;  4MVR A;  4P2Z A;  1V55 C;  3QNE A;  4J9Z B;  2JIZ G;  1SZT A;  1FXK B;  2QKS A;  3WG7 B;  4R50 A;  5B1A B;  1NQT A;  1VQ6 V;  2UXN A;  3ZMV A;  1VQ7 V;  1K97 A;  4PA3 A;  1CPY A;  2W6I G;  3AG1 B;  1LNQ A;  4MVQ A;  2V1D A;  3QO7 A;  2WLI B;  1PNL A;  1NR7 A;  4PDV A;  3TK1 A;  3ZRV A;  4DO2 A;  3FB5 C;  4X8A A;  2BOC C;  1G8M A;  2QA4 V;  3ZCC A;  3W7S A;  5L3D A;  2DYS C;  1JX9 A;  1QCE A;  4LP8 A;  2ZDI C;  3OAA G;  2WLK A;  3JD3 A;  1NVP B;  1VQN V;  1OCR B;  1W2B U;  1YJN V;  2JK5 C;  5H9C A;  1H2G A;  4MT8 A;  3JD2 A;  1WPX A;  3E8F A;  3OEE G;  5CMU A;  3X2Q B;  1F51 A;  2HVK C;  3IC7 A;  2KB1 A;  3STL C;  2IH3 C;  3K06 A;  3JYC A;  3ZRW A;  3OE7 G;  3ABL B;  2WSS G;  1RPO A;  3FYI B;  3GWO A;  3JD1 A;  3B77 A;  3FB7 C;  3EFF K;  5KA6 A;  3CCM V;  5B3S B;  3RVZ A;  3ZMZ A;  3AEI A;  2C2A A;  5GW7 A;  1I5X A;  1R73 A;  1Y66 A;  2DW4 A;  1PNM A;  2WAM A;  4UVC A;  2K1E A;  3QO8 A;  4MTX A;  2HFE C;  3W7W A;  1K9M W;  2LFR A;  4MTG A;  1Q7Y W;  5KUK A;  2HG5 C;  2ITD C;  2EIM B;  1JCH A;  3G71 V;  3OEH G;  4MVS A;  4Q20 A;  4WCE V;  3CC7 V;  2X0L A;  4YXW G;  1VQO V;  4GX0 A;  3ZRX A;  1OCO B;  3UKM A;  3FB8 C;  1F4M A;  4JYB A;  1KC8 W;  3B8M A;  2H8P C;  1V55 B;  3ETG A;  4QPJ A;  3W7U A;  1KP2 A;  3SJQ C;  3UM7 A;  1QLE C;  3ASN B;  4ZKI A;  5L3F A;  5HFM A;  2QE7 G;  3AG4 B;  3SYO A;  4BIZ A;  3R65 A;  3KG2 A;  4MS2 A;  1QLN A;  2ZR3 A;  4GX5 A;  1DF5 A;  4XDJ A;  4BIU A;  4PDM A;  3D3I A;  3B8N A;  3CPW U;  3TCU A;  4TT3 G;  1K8A W;  1JJ2 U;  2DWD C;  2DYS B;  4WFG A;  2EIL B;  3G4S V;  4OXS A;  4MTO A;  1CP9 A;  1GO3 F;  2B5U A;  1R3K C;  3ZN1 A;  2CK3 G;  4LCU C;  2Q67 A;  1P4R A;  3E8G A;  1AI4 A;  5KUM A;  2XAH A;  5E1A C;  1YIT V;  1J95 A;  1M57 B;  2ZQM A;  1MOF A;  2QEX V;  1S76 D;  1M57 C;  3CCU V;  1R3I C;  2NNU A;  4RUF A;  2EIK C;  4KUM A;  1CEZ A;  2B1I A;  2P7T C;  1OCC C;  5B1O A;  2IJK A;  2F43 G;  3CCE V;  3M99 B;  2YEV A;  3AG2 C;  3OUF A;  3CCQ V;  2IH1 C;  2OTL V;  1KKD A;  1Q86 W;  1H38 A;  4LC1 A;  4MVU A;  4FPP A;  1NR1 A;  2IW5 A;  1SER A;  2HJF C;  1M56 B;  4HAM A;  4UUJ C;  2ZD9 A;  4RQF A;  1YTF B;  4GX2 A;  1SET A;  2V7Q G;  1VQ8 V;  1GM8 A;  2GSM B;  1S3J A;  3WFV A;  1DLB A;  2ATK C;  1GK9 A;  1UJW B;  5EK0 A;  3ZIA G;  2Z5U A;  1GM9 A;  4PA4 A;  1I5Y A;  2HR3 A;  1K4D C;  4G27 B;  5L3G A;  5EBM C;  3BEH A;  3ABM B;  3CP1 A;  5B1B B;  2A9H A;  2A0L A;  4WFA V;  2Y69 C;  3SPJ A;  4PDR A;  1QR9 A;  2XAJ A;  5CN0 A;  1RPR A;  1EZJ A;  2X6C A;  1AI6 A;  1KD1 W;  1FFT B;  3FYE B;  4UV8 A;  1KP3 A;  1THZ A;  2ITC C;  5LHI A;  3SPH A;  2ZXW C;  4UVA A;  5L3E A;  1K7D A;  3CCJ V;  2HVJ C;  2WLH A;  1RM1 B;  5B1A C;  1K34 A;  3CMA V;  2WLI A;  5C93 A;  4FJC C;  2DWE C;  3W7T A;  4H33 A;  1YI2 V;  1BHB A;  5B1N A;  2DQ0 A;  2WLL A;  4MVZ A;  1VQ9 V;  3AG1 C;  4WFE A;  2B1G A;  2EIM C;  4UXN A;  5H6R A;  1G4Y B;  1HWY A;  4RQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...