4J9ZB

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and ns309
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
97
structure length
97
Chain Sequence
GRKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein/calcium binding
molecule keywords Small conductance calcium-activated potassium channel protei
publication title Unstructured to structured transition of an intrinsically disordered protein peptide in coupling Ca2+-sensing and SK channel activation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 35
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4j9zB00
1OCOC 3ASNC 2WLMA 3BEHA 4EKWA 5EC2C 2HJFC 2Q6AA 4XDJA 3T4DA 5EBMC 4LBEC 2ZD9A 1K4DC 2BOCC 3SYAA 3TETA 1KKDA 2WLLB 4R7CA 2AHYA 3RVZA 3SPCA 1XL4A 3SYPA 3ZJZA 3LDDA 3T2MA 4XDKA 1V54C 2Q68A 4JTCB 3K0GA 4KFMA 4PA6A 4GX2A 4PDLA 2DYSC 3E8FA 3LUTB 4QE7A 5IY5C 1M57C 3EFFK 4XDLA 5EBWC 4CBCA 1BL8A 2DYRC 5KUMA 4P30A 1K4CC 5CBGA 2AHZA 3WG7C 3F7YC 2WLNA 3K0DA 1M56C 4PDRA 4RAIA 2WLHA 4HYOA 1P7BA 3SPJA 3ABMC 3LDEA 4H37A 4MTOA 4WFFA 4BW5A 4MVMA 4OXSA 3T1CA 5EBLC 3SJQC 5EC1C 5B3SC 1R3IC 3R65A 3SPGA 2EINC 2Q69A 4QE9A 2YEVA 2EIJC 1R3KC 3RVYA 1JVMA 4WFEA 3HPLC 3K03A 2A79B 4X8AA 1ORQC 3ABLC 1OCCC 2QTOA 3UM7A 2IH3C 2WLJA 3STLC 4PA9A 5KUKA 4WFHA 4GX1A 2BOBC 2NLJC 4MVRA 3SYQA 3GB7C 4UUJC 3ZRSA 4MTGA 4P2ZA 5CBFA 2ITCC 4R8CA 3E86A 2DWDC 2QKSA 3LDCA 3E83A 2OCCC 5BZBA 4MSWC 2X6BA 3OR6C 3SYCA 1QLEC 3AG3C 4MS2A 3OGCC 4G27B 4ZBMA 2P7TC 2WLIB 2HG5C 2EIKC 3E8BA 4MVSA 4MVQA 4G28B 3UKMA 3F5WC 4R6ZA 4J9YB 2ITDC 4DXWA 3FB7C 4RUEA 2W0FC 2ATKC 2EILC 4X89A 3E89A 3K04A 4PDVA 2X6AA 1G4YB 2KB1A 2WLIA 4PA4A 5J9PC 3OUSA 5CBHA 4PDMA 4WFGA 3AG2C 3X2QC 2HVJC 3JYCA 1V55C 4J9ZB 2HFEC 3SYOA 3VOUA 2Q67A 4MVZA 2DWEC 4HZ3A 2X6CA 5E1AC 1LNQA 1R3LC 3E8GA 3OUFA 4MW8A 5EK0A 2A0LA 4RUFA 3ASOC 4PA3A 3AG1C 5B1BC 4JTAB 4P9PA 4LCUC 2EIMC 3IFXA 3PJSK 4TWKA 3RBZA 1S5HC 3FB6C 2R9RB 2IH1C 3FB5C 3IGAC 3F7VC 1XL6A 4F4LA 2A9HA 2Y69C 4JTDB 4LP8A 4MVOA 5B1AC 4QNHB 2JK5C 2H8PC 2HVKC 3AG4C 3T4ZA 2WLLA 3KG2A 3TCUA 4R50A 4I9WA 4H33A 3RW0A 3STZC 1J95A 2WLKA 2ZXWC 4MW3A 1OCRC 4PA7A 3OR7C 4P9OA 4RO2A 3SPHA 3E8HA 3SPIA 4MVUA 2K1EA 3FB8C 1OCZC 1ZWIC 4GX0A 4X88A 3ABKC 4MTFA 1R3JC 4GX5A 3LNMB 3K06A 3K08A
chains in the Genus database with same CATH superfamily
2LFSA 1SRYA 3BEHA 5EC2C 1JFFA 3AK3A 3RYCA 2YIDA 2X0LA 5BXZA 4B7EA 1QLEB 3AG3B 3JD4A 1RFYA 4DW1A 5HFMA 3O9OA 1N33O 2Q68A 1K5QA 4JASA 1Q90D 2A7WA 1R6TA 1NT2B 3L70H 1OCRB 3E22B 4LWSB 2F23A 2IM9A 4DR2B 1SS3A 1R3IC 1W0KG 2EINC 3N2GB 4QE9A 4NKGB 5LP6B 4WFEA 3CD6V 4HAMA 2XAGA 4A5UB 4LF7O 4GX1A 2E3CA 2ZXWB 3RYHA 3CMAV 3B40A 4DRXB 3GB7C 2F93B 2EZOA 1OCZB 2UUCB 3LDCA 3D36C 4J7ZA 3CXHF 4TT3G 4KP4A 5CA1B 4IHJA 4X62O 2KKWA 1WB8A 3BHPA 1V54B 3FAVB 4LNUB 3APQA 4X1KB 5K1XA 3B8NA 3CCJV 1V55C 1HDJA 1R6NA 2HFEC 4FZ0A 2JGDB 1VF7A 5H9CA 4TV9B 1SQGA 4PD4F 2VWKA 4Z1MG 3MAQA 2EIMC 3PJSK 1S5HC 3ZHQA 1HNXO 1I5YA 5A2QN 1WA8A 4YJ2A 1QR8A 1HNWO 5IJ0B 2LO1A 3D3IA 5GONA 4JYYA 4FPPA 4MVUA 2K1EA 1MA1A 4GT1A 1Z5VA 3E35A 4GX5A 4UFZA 3N27A 5EYPB 4ZHQA 3RT3C 5L3EA 1BCCH 2FMLA 4DV1B 2HEPA 4FFBB 1AVMA 1CEZA 4J42A 2ZIMA 4BIOA 4XDLA 3CCQV 4DV2B 4JI6B 4J80A 3F5TA 1HWYA 4FM1A 2M6YA 1IVSA 1XDCA 2ZE5A 1KYOF 5LGUA 1SQBH 2YEVB 4JYBA 1I08A 3RYIB 5JJNB 5IYBO 3CJHA 4PV1B 3ZHUA 1AB3A 4X20A 3DC5A 2IJIA 1NQTA 2Q7GA 3K79A 3ZHSA 3JALA 4CH4A 2DJVA 4X64B 2UXBO 3KZIZ 2PYJA 4K0KB 4UUJC 3ZRSA 1U97A 4XBFA 2E5LO 2ZNJA 3ABKB 2QM7A 3EXAA 4WBNB 3HKBB 4X1IA 1Z5WA 5IE9A 4K3AA 4N21A 2Q7HA 4DXWA 2L6LA 1OZ0A 4BW9A 1H2KA 5J9PC 3OGIB 5CBHA 1WJZA 1YDXA 4FLVA 4PDMA 5KHIA 1XHZA 1HW7A 1FXHA 1US6A 1FS0G 2YSUB 2CTQA 2NN4A 3VQVA 1XNRB 4FMTA 4I50B 5D5QA 5BMVA 4JYCA 4DR2O 1ZTEA 3D36A 2A9HA 3OT7A 5J2TB 1PPJH 2ZQMA 4NXNB 2KG7B 3ABLB 4CS3A 3HB3B 5FPRA 1MSWD 4WFAV 2N74A 3K59A 1QVFU 4LBEC 3ZHVA 2Z5UA 1ZL8B 4DR6B 3H1IH 2GUZA 1AR4A 4DV5O 5IY5C 2UXXA 5KUMA 1VARA 3G67A 2RJZA 2A06H 1YEWA 1JJ2U 4H37A 2CH7A 1AP5A 5B3SC 2Q5ZA 4LF4B 3CCRV 4FLUA 3K03A 2QA4V 2GTSA 3CC4V 3SJCC 4LR3A 1OJHA 3MHHC 5B1NA 2DW4A 2K9PA 4JI5B 1NH2D 4CH5A 4KUMA 2ZE6A 1AP6A 2Q9LA 4QJFB 3QO5A 1BHAA 4R6ZA 2ITDC 2EILC 3L74H 2EIJB 3QNEA 4PDVA 4DV1O 2QDOA 3X2QC 2UUAB 4Z2WA 2IJHA 1H2LA 4JI6O 2Q67A 4MVZA 5E1AC 2ETNA 3ZN1A 2OCCB 1FFXB 1SQFA 3SGIA 3ETQA 5KX5A 2UU9O 3ICXA 4B3SO 2QEXV 1ROPA 5B66Z 2F95B 2Q7EA 5CB4B 3ZEDA 1UJWB 1YJWV 4LF9B 1SZXA 1Q6HA 2ZE7A 2OCHA 3JATA 2YXLA 3BRCA 4MTFA 3KCXA 3LNMB 3K08A 3AK1A 1D5AA 4L87A 4I4TA 1TGOA 4PHZA 3VBBA 3JASB 4BAYA 1QR9A 3RYFA 2HLDG 4TV8A 4NR1A 2Y69B 1L1FA 1J5EO 2GBOA 1K7DA 4JAUA 1VIBA 3TXQA 1MG1A 4O2BA 5C8YB 3F7YC 4K35A 2Y48A 4HYOA 3SPJA 1XNRO 4MTOA 1GM9A 2JDIG 1K8AW 2ZE8A 1PP9H 3R65A 4O2AB 2OIEA 2NNUA 4X8AA 4YJ3A 1KQSU 3NR7A 2IBZH 1I5XA 5DN6G 3W7SA 2O57A 1BQZA 5H2FZ 1QVGU 5JQGA 2BOBC 1UPGA 3GVMA 2QWPB 5K1PA 2DWDC 2XNDG 4JF3A 4CS2A 1XI1A 1ZUQA 2YS8A 1YXBA 3CWBH 4D7SA 2RMKB 2XASA 2WA4A 4QGPA 4DR6O 1NH2B 1Q86W 2CGNA 1BGYH 4UB8Z 2IW5A 4OPAA 5JJEB 1AI7A 4IIJB 4BWAA 3J80N 1IBLB 2CUGA 2RN9A 2QWQB 2DQ0A 3IC9A 4FJCC 4J9ZB 3JAKA 2P90A 1DLBA 1OV9A 4LC1A 4D7TA 3JAMN 2V7QG 2A0LA 1S72V 3AG1C 1TUEB 3FB6C 3IGAC 1N33B 2CTRA 1H2GA 4LF4O 3H01A 1VMGA 1QU7A 3OTFA 4P9OA 3G71V 1JX9A 2KQXA 1VQPV 5DECA 3ASNC 3CE2A 2ZIOA 1O9GA 3ETDA 4JI5O 2Q6AA 4NVPA 1K73W 2UXDB 2UUBB 1K34A 1TVKA 3ZCCA 3SPCA 5J2UA 3T1YO 1TUBA 3ZMUA 3AG4B 3E8FA 1D2DA 2DYRC 1PNLA 1H8HG 2UUAO 3K0DA 2P5OA 1SKVA 3B2EE 2XT9A 4DR7B 3OMAB 4NTXA 4N23A 4WF9V 2CTWA 5F2VO 3BFRA 1U96A 1R3KC 5L3CA 5ITZA 2A79B 4UXNA 2FL4A 2PI4A 4U3JB 1MNGA 1YF2A 1VQKV 1PM9A 4PELA 1S0VA 1PNKA 2WPDG 1HNXB 1EFRG 1RPRA 4KHPB 2PTMA 1GN6A 1SETA 1XQ8A 4X89A 2YICA 3K04A 4O4JB 2X6AA 2OIGA 5LGTA 1W0JG 3A0HZ 2Q4PA 1I7FA 4TUYA 4K8ZA 1WA8B 4B3TB 2XOKG 1FXVA 4DK1A 5GONB 4JI8O 4I0XA 4LP8A 5B1AC 4MTXA 3VQYA 3MHSC 4HNAA 4O4IA 2Q0AA 1IURA 2HJDA 1IBMB 2OWOA 2DMXA 4H33A 4ZIBA 4ZHQB 3Q4HA 3QTCA 1GN4A 1WP7A 1QCEA 4ZOLA 2VS0A 4CC5A 3RWRD 1RSOA 1Y74A 4O4HA 3OMNB 3SYPA 1K5SA 1UFIA 3T2MA 4JTCB 2GV9A 5JVDA 2YI8A 2UXBB 1S76D 1F51A 1MABG 3OW2U 4CS4A 1K4CC 1IBLO 1JA8A 5IWAO 4IL6Z 4UV9A 3OEHG 4WFFA 3BABA 4OXSA 5EBLC 3ASOB 1KP2A 1Y67A 1NVPD 2R9AA 1KKCA 1HNZO 1KD1W 2P67A 4YY3B 3WFVA 5LA6A 4PJ0Z 3CC2V 2WLJA 2PF4E 3D8CA 5L3FA 1M4UA 3C3TA 5KMGA 1MZEA 4P2ZA 2LJ2A 1YZBA 1NS1A 3ZRWA 2X6BA 1QLEC 3AG3C 3DXRB 3QF7A 4DR5O 4J9YB 1FD9A 5LHGA 1H8EG 4DUZB 3FB7C 2UUBO 2UXDO 2EINB 2ATKC 4X1YA 2WLIA 4J10A 3CEIA 1Y6XA 3JYCA 5LYJA 3CCLV 1Z2GA 2DWEC 3ETEA 2VQEO 3RBZA 4X65B 2PY5A 4DR7O 1QNMA 3F7VC 2AXTZ 2R9IA 5LL6Y 4DV5B 2H8PC 2BTQA 4X9QA 3C90A 1LR1A 4DO2A 2ZXWC 4PA7A 3G6EV 1AI6A 2R72A 3A0BZ 1OCZC 1ZWIC 1K9MW 3CC7V 1V55B 5KLVH 1GTOA 5LOVB 4U7NA 2N05A 1YHQV 2GUZB 1N0JA 3UT5A 5CN0A 3GWKC 4CC6A 1M93A 1GMGA 1P84F 4KHPO 1V54C 1GN3A 3P30A 2IJKA 3G4SV 4DW0A 4FM2A 2N04A 2CH7B 4JZGA 3QVNA 4H13B 4PDRA 3RGBA 1L8DA 4NYKA 2WSSG 2Y4TA 4B3TO 4OGQB 3S3XA 1MMMA 4DUYO 2FKXA 2F66C 3UM7A 4GKJB 1RM1B 3BVOA 5CA0A 3JD1A 1YVWA 5LXTA 2AW9A 3M8AA 4JI3B 1IBMO 4MVRA 1NVPB 2AZ2A 1H38A 3JAWB 4L8JA 4UCOA 4GKKB 1A32A 1FJGB 3THOA 2E74B 4ZBMA 3W7XA 3A0RA 2UU9B 1Y76A 4AQYB 4PI2A 5AG2A 3F5WC 5IYDO 4B3SB 1AJNA 1V9PA 3H1HH 4EFEA 5LHHA 1SC5B 5L3BA 2F4VB 3WG7B 1BS3A 3E8GA 1M56B 1NR1A 3CRRA 4JI1B 1N8RW 3H9VA 2LFRA 1J5EB 1WPBA 1Q8IA 2JK5C 1SERA 2BE3A 2XAHA 1MSDA 3JSNA 4YY3O 1J95A 4I4TB 1AILA 3CCSV 3ABKC 1BZKA 3HR0A 3WB0A 1AJQA 2LP7A 3BCCH 2WLMA 4LWSA 5GTIZ 3NXSA 1AJPA 2BOCC 5H5NA 2VWJA 5BR8B 1JR9A 3LSSA 1F23A 1XL4A 4ZI7B 2JEUA 4WFBV 1EZJA 4DUZO 2YIBA 1AI4A 5EBWC 4G2KA 1BL8A 1OHHG 3CRAA 3WU2Z 3K9AA 4P30A 3MD0A 1FXKC 1XOUA 1Q43A 2WLNA 1LUVA 1P7BA 1KECA 4DRXA 2RNBA 4LFCB 3APOA 5KHHA 5L3DA 3ZMTA 4FIPC 4X65O 4GZRB 4WCEV 1Q81W 1S77D 3EHBB 3ABLC 5IY5B 1Q6UA 2JJ1G 2QM4A 3FAVA 4LNUA 2V4DA 1JPXA 2EJRA 1BT8A 2Y0PA 1OCOB 2QM8A 2JGDA 2JVDA 3UKMA 3FYIB 1I0HA 4KL1A 4UCTA 4ZKIA 2E76B 4O4LA 4B3RO 2PZSA 5CA3A 4DV4B 1RPOA 2KB1A 5KAFZ 1L0NH 1T5EA 2ZT9B 1M57B 2GHYA 1NU1H 4CH6A 3N2KB 5CMUA 2CTPA 1BSMA 3K57A 5FNVB 2R70A 3FFQA 1XL6A 1URFA 2JRIA 3T1YB 2V1DA 3HKDA 3W7UA 3T4ZA 4DYLA 3CCMV 2F1MA 4FFBA 3SPHA 3E8HA 4UCSA 4GKJO 3ZN0A 4F6EA 1VQLV 5IDJA 4JI3O 3CRCA 1KC8W 1TVKB 2E75B 1Q6IA 3MDSA 5J2UB 4EKWA 1TUBB 2P4KA 1ZX3A 2PGGA 3OFNG 3SYAA 4GKKO 1KKDA 2WLLB 4PI0A 3ZIAG 4R7CA 1KUQA 1FJGO 3IJ4A 4AQYO 1XNQB 5LMUB 2XUMA 4KFMA 4PA6A 3K5NA 2XTAA 2DYSC 3LUTB 5L3GA 3K58A 4BIUA 2A3QA 5EIBD 5IJ9B 3G6BA 4FLYA 5JH7B 1NJIW 2F4VO 3LDEA 2OT5A 4MVMA 5ITZB 3W7WA 4JI1O 5EZYA 4ICGA 2Q0OC 1R73A 4DK0A 1TA8A 4U7OA 5LMNO 1SQQH 2QJ1A 1VF5B 4JYAB 5CBFA 2QR4A 2JGUA 1DF4A 2B1IA 4JI8B 4DV0B 3OGCC 4G27B 1FXKA 4AHCA 3AK2A 3OD4A 4G28B 1N36O 5BR8O 4EEQA 2MK3A 4F6RB 2F43G 3AG2C 5J2TA 2VRZA 2KG7A 4RQFA 2X6CA 3D3QA 4JAAA 2DQ3A 1R3LC 3JD0A 1JQ0A 3K5LA 3B77A 4BIZA 4HNAB 4JTAB 4O4IB 1VQ9V 4LFCO 4JTDB 1AR1B 4EB6B 1ZSPA 4X66B 4ZOLB 2IJJA 4GX0A 4B08A 1RSOB 5IWAB 2EBOA 2W6IG 5FPOA 2OTLV 4JI7O 4O4HB 2Z0AA 2HJFC 2H94A 2OTJV 2C2AA 3AG1B 1KB9F 1HNZB 1GKFA 3LSQA 4DR1O 1FPOA 2ILMA 2BSKB 4PDLA 1VQ4V 1K33A 3EFFK 1VEWA 4DV4O 5FLXN 2DE0X 1JFFB 1PNMA 3RYCB 5KHJA 2WA3A 4I55A 4J7KA 3ABMC 4DV6B 4DR5B 1SQXH 3T1CA 1WB7A 3JARA 5B1BB 5LA6B 3I56V 3SPGA 1MOFA 5TISZ 2QWNB 3ABTA 2ADPA 5KMGB 3HKEA 3BAAA 2DYRB 4H0LB 1VF6C 3CX5F 4MTGA 3H1LH 2BCCH 3E86A 2QKSA 2VQEB 1IDSA 4X1YB 3CP1A 2WLIB 3ABUA 3E8BA 3ML0A 2XAJA 2YIAA 3M99B 3RYHB 1ZLZA 1XNQO 4PA4A 5LMUO 1NTKH 3J81N 4GLXA 1WN7A 1FFTB 4IHJB 5IYZA 4HZ3A 4QPKA 5DM6V 1N0NA 4PA3A 4QPJA 3OEEG 2ARHA 2BTQB 4BR6A 3CHXA 3IAYA 1N32B 2AGAA 2LW1A 4Z1VA 2FB5A 4I9WA 3RW0A 2WLKA 1OCCB 3ZMZA 3K5OA 3UT5B 1CP9A 4YIOA 3DC6A 4W4KA 3CRQA 3CCUV 4JYAO 3TXSA 4FLTA 5JCOC 4YJ2B 5C8YA 2QKCA 1EBOA 2B1GA 2ZR2A 5JJJB 1BQ0A 1S5LZ 5GW7A 4DV0O 2EIKB 4DUYB 3ZJZA 3K9SA 2QGNA 2JS3A 1XMOB 3ZMSA 4RQEA 1IX9A 2CK3G 4B7KA 3W7TA 5LBQA 4Q6GA 2HHHB 1WPXA 3L71H 1N34B 3BY6A 1XMQB 2WLHA 2QWOB 2XAFA 2HKOA 2Q69A 2P6JA 1GAXA 1VQMV 5A9GA 4NXMO 1S5JA 4YIPA 4AI8A 1XUQA 4OX9B 3LNNA 4DV7B 3G80A 4X66O 2NLJC 1BMFG 1S3JA 4I5SA 5KAIZ 3QG5A 3CJHB 2ADQB 4YHHO 4X20B 4Q20A 3L75H 1PD3A 3ZRXA 3JALB 4UVAA 1YJNV 2YI9A 3OTOO 1YTFB 2RDCA 1GM7A 1N4CA 1PL4A 4LF8B 1IXMA 1K97A 2GDSA 4X1IB 1XREA 4MT8A 3CS5A 1SZTA 1M1KW 1YIJV 4NTYA 5EK0A 3ASOC 1VF6A 3AEIA 4AILC 2GTAA 4DV6O 4DR3B 1E79G 4MVOA 1Q7YW 2P22C 3ETGA 1LUWA 2ZM6B 4R50A 3FKSG 1YJ9V 1OCRC 3HKCA 3VQWA 5H6RA 1F4NA 2YXHA 5BMVB 3FB8C 3CPWU 5EC1C 1H2MA 1SF9A 4ASUG 4DR4B 2ODMA 4IYIA 1NKDA 2ZNIA 1KP3A 3CRMA 2FTKA 5H6QA 3RVZA 1P7GA 5LP6C 3K3WA 3CCVV 4D6TH 3TGUH 1IXBA 3CXCU 4I9QA 4JI2O 1PL0A 2G38A 4U3JA 1SA0A 1F4MA 2MW2B 1XILA 2EIMB 4B3RB 2CAZC 2UXCO 4YXWG 5JCOA 3RVYA 4DV3O 2LQTA 3TK1A 1ORQC 1N32O 1BHBA 4WFHA 2IU3A 3CYOA 4O4JA 4IYHA 4J7JA 4H44B 4O4LB 3OR6C 3SYCA 2KSDA 3OMIB 4MVQA 4HBNA 4E2LA 1EN5A 5IYCO 1G4YB 1HP8A 2L35A 1XMOO 3T1HB 2HVJC 4FFKA 2HP8A 5B1OA 2HHHO 1LNQA 4FM0A 3HKDB 3OUFA 4MW8A 4UB6Z 4RUFA 1N34O 3L72H 1XMQO 1I94B 3SDLA 4E4EA 4OPHA 4FLWA 2ZCEA 1VQ5V 3UCSC 1RM1C 4LF6O 4UCRA 3H1KH 1NBMG 1WAZA 4JV5O 2P06A 1Y4MA 4OX9O 1KU9A 1R3JC 4DV7O 2NR5A 5KX5B 2D2CB 1VQOV 2AZ0A 1TAEA 3TETA 2H3OA 1DTOA 2ZR3A 2QSAA 5LMNB 4GX2A 3JATB 1K3EA 4UCVA 3WB2A 4CBCA 1G8MA 1NZ6A 4LH7A 1H2NA 5JWPA 4LF8O 2LGWA 3WG7C 1QBZA 3LSUA 1M56C 5EZYB 3RYFB 4KXRA 4TV8B 3E22A 4BW5A 1IBKB 1JCHA 1N36B 2EULA 1K92A 1L0LH 4FZ1A 2BTOA 3C3SA 3DXRA 3WB1A 3HPLC 4DR3O 4O2BB 2EZPA 1PKXA 2QTOA 3STLC 1X4TA 1ZAUA 4PA9A 4LH6A 5KUKA 3UQ8A 3N2GA 2ZM6O 3DTUB 5LP6A 3BA9A 1FXKB 1D5NA 3U10A 2JS5A 1VP7A 2B5UA 3OM3B 4YJ3B 4DR4O 2HG5C 1WLEA 3L73H 1Q5OA 2QTSA 5CA1A 5JQGB 2LGQA 1FAFA 3GWOA 3OUSA 5E79Z 4K8XA 2YC0A 4WFGA 3J7AU 3SYOA 2VQFB 2EX3A 4JI7B 2UUCO 4X1KA 1XBLA 4LFAB 4CH3A 2XHBA 3L9DA 5LOVA 4LCUC 3IFXA 4DR1B 2PI5A 3ZBHA 2R9RB 2IH1C 5B3SB 1E1RG 2ZINA 4TV9A 3M7MX 2Y0IA 3KCYA 1O9HA 3JAKB 3KG2A 4RWUA 1FKAO 3STZC 4MW3A 4RO2A 2W6JG 1YI2V 2IU0A 5IJ0A 5IT9N 3FD9A 4GUNA 1OCOC 2QE7G 2LW7A 3RFRA 3DSQA 3DGEA 1VQ6V 3JSLA 3P3PA 1H2SB 1AI5A 2W0XA 1P49A 5EYPA 2P4VA 3O65A 2XAQA 2CE4A 4XDKA 1B3QA 1NI8A 2EILB 2QKAA 4I55B 1M57C 4JI0B 4J11A 4I7ZB 2JJ2G 3CCEV 3R66A 3X2QB 2AHZA 4JPRA 3JARB 3T1HO 4JZ2A 1EN6A 4J41A 3JAWA 3B4SA 1DF5A 4NB5A 4FLZA 2PUSA 1I94O 3HKEB 2ZDIC 2YEVA 2EIJC 2OYQA 1JVMA 3QO8A 3RYIA 1Q3EA 2DYSB 2IH3C 3SJAC 4DV2O 4JI4B 5D5PA 4R8CA 2YDEA 2PYLA 2OCCC 3JD3A 5BZBA 2YUAA 3SR2C 2GSMB 4MVSA 4IT5A 3P3NA 3BA8A 4WBNA 2W0FC 3HKBA 4LFBB 3P32A 5IYZB 4ABMA 4X64O 4NTWA 3ZX6A 1SESA 4K0KO 1MZFA 2X7RB 1XEQA 1E1QG 1P4RA 1GRJA 1BE3H 2EJ7A 4I50A 1QLNA 4F4LA 1IBKO 3ZRVA 2Y69C 4TSFG 4QNHB 4B3MB 4ZI7A 1M9NA 1JOYA 2UXNA 4TUYB 3AG2B 5HFLA 3A8TA 1B06A 3TCUA 3K06A 3U0ZA 4GCZA 4I0XB 4XDJA 3T4DA 5EBMC 1K4DC 2QWRB 1COWG 2AHYA 1HR0B 3EVKA 1VQ7V 4NXMB 1Q82W 3LDDA 1B6QA 1ZL8A 3Q4HB 1QHTA 4TQFA 2Q8VA 4C7UA 3I5DA 1NR7A 4NXNO 3TJTA 3RN4A 4EFBA 5CBGA 3K5MA 1IZ3A 1W59A 5C93A 4YHHB 2HR3A 2VQFO 1Y74B 1NTMH 5JVDB 4LFAO 2M7WA 1XHXA 3OTOB 3ZS8C 5B5EZ 4LF5B 1DK1A 4UVCA 3JCUZ 4UCUA 2CGOA 2ITCC 3QO7A 3AG7A 3ASNB 4MSWC 3N2KA 1WP8A 4MS2A 3ABMB 1VQ8V 4TQDA 1EM1A 5FNVA 4JGSA 1RP3B 4RUEA 3I55V 2YXYA 3OAAG 5KHGA 1M5IA 2RCVA 2ZDIA 4JI0O 3ZRWB 3VOUA 4CZZA 1YTFD 3CB2A 3CMEV 1JMKC 5B1BC 5EIBC 1QQCA 2JEXA 3E2EA 3KKYA 1Y66A 3HKCB 3ZHTA 1R6KA 1FFXA 4QIWF 2HVKC 4LF7B 3AG4C 5LYJB 5KHKA 2WLLA 5KA6A 5DEDA 3B8MA 4JI2B 4X88A 1EZVH 4JI4O 5CB4A 4IGGA 1AROP 1AR5A 4X62B 5IJ9A 2CDYA 3ZHRA 2ZD9A 1KBHA 3A2FA 2UXCB 5JH7A 1PV0A 4DV3B 1GM8A 3UO2A 3K0GA 3JASA 4FVMA 3U11A 4QE7A 4LFBO 5KA5A 1G1XB 1G6UA 2DN9A 1SA0B 1R1BA 2YIBD 4U3FH 4LF9O 2WAMA 5GTHZ 5LGNA 1GO3F 4RAIA 3BPZA 3VQXA 2DOSA 1WNSA 2Z3YA 3SJBC 3SJQC 2D3OW 1THZA 1HNWB 3FX7A 4UVBA 5B1AB 1OCCC 1YCIA 4B3MO 4O2AA 1ENVA 2B9ZA 3SYQA 1EN4A 3S3WA 4F6RA 4TOIA 4UV8A 3E83A 1M90W 3PN1A 2FYUH 1FYJA 1JJOA 4W4LA 1X59A 2P7TC 2EIKC 4FLXA 1NTZH 3JD2A 3IC7A 5CA0B 5LXTB 4LF6B 1HR0O 3E89A 1GK9A 3UO3A 3ZMVA 5BY1A 1DGSA 5FL7G 4JV5B 2WWWA 4EB6A 4JAVA 1KMIZ 2RQ6A 1GN2A 1F7YA 1Y76B 3B09A 1VQNV 4IIJA 4FK5C 1SQPH 2Q73A 5LHIA 4P9PA 4TWKA 3FB5C 3CSXA 4GYCB 1B04A 2Y4UA 1CXZB 2ZKOA 3OE7G 1SQVH 2JIZG 4LF5O 3FYEB 3OR7C 1YSCA 3SPIA 2E5LB 1GH6A 2BSKA 1W2BU 3JCZA 3H1JH 1YITV 1CPYA
chains in the Genus database with same CATH topology
2LFSA 3ASNC 1SRYA 3BEHA 4EKWA 5EC2C 3ETDA 2Q6AA 1VQOV 2X0LA 1K73W 3OFNG 1K34A 1QLEB 3AG3B 3JD4A 3SYAA 3TETA 2WLLB 3ZIAG 1KKDA 4R7CA 3ZCCA 3SPCA 5HFMA 1DTOA 2ZR3A 2Q68A 1K5QA 4JASA 4KFMA 4PA6A 3ZMUA 4GX2A 2DYSC 3AG4B 3E8FA 3LUTB 4BIUA 5L3GA 1K3EA 4CBCA 1G8MA 2DYRC 1OCRB 1PNLA 1H8HG 3WG7C 1QBZA 3K0DA 1M56C 1NJIW 3LDEA 3OMAB 4BW5A 2OT5A 4MVMA 1JCHA 4N23A 3W7WA 1R3IC 4WF9V 1K92A 1W0KG 2EINC 4QE9A 1R3KC 1R73A 5L3CA 4WFEA 3HPLC 2A79B 4UXNA 2EZPA 3CD6V 1PKXA 2QTOA 4HAMA 2XAGA 4U7OA 3STLC 4PA9A 2PI4A 5KUKA 4GX1A 3DTUB 2ZXWB 3CMAV 3GB7C 1VQKV 1FXKB 2EZOA 5CBFA 1OCZB 1DF4A 3LDCA 4PELA 4KP4A 2B1IA 4TT3G 1S0VA 1PNKA 2WPDG 2B5UA 3OM3B 3OGCC 4G27B 1FXKA 2HG5C 1EFRG 1RPRA 1WLEA 4G28B 1SETA 4X89A 3K04A 1V54B 2X6AA 3GWOA 2MK3A 3OUSA 5LGTA 2F43G 1W0JG 4WFGA 3AG2C 3B8NA 3CCJV 1V55C 1R6NA 2HFEC 3SYOA 4RQFA 2X6CA 5H9CA 2DQ3A 1R3LC 3JD0A 1JQ0A 3B77A 4BIZA 2XOKG 1FXVA 4JTAB 4Z1MG 4LCUC 2EIMC 3IFXA 3PJSK 1VQ9V 2PI5A 1S5HC 2R9RB 2IH1C 5B3SB 1E1RG 1I5YA 4JTDB 4LP8A 1QR8A 5B1AC 4MTXA 1AR1B 3MHSC 3D3IA 3KG2A 4H33A 3STZC 4MW3A 4RO2A 2W6JG 4FPPA 2IJJA 2K1EA 4MVUA 1YI2V 2IU0A 4GX0A 4GT1A 3E35A 4GX5A 1OCOC 2EBOA 2QE7G 2W6IG 2OTLV 1QCEA 2HJFC 2H94A 2OTJV 3DGEA 1VQ6V 2C2AA 3AG1B 5L3EA 1AI5A 1GKFA 3LSQA 3OMNB 3SYPA 1K5SA 2XAQA 3T2MA 4XDKA 4JTCB 1CEZA 2EILB 4PDLA 1VQ4V 1K33A 1S76D 1M57C 3EFFK 4XDLA 3CCQV 2JJ2G 3CCEV 1F51A 1MABG 1HWYA 3OW2U 3X2QB 1K4CC 1PNMA 2AHZA 4JPRA 5LGUA 2YEVB 3ABMC 4UV9A 3OEHG 4JYBA 4WFFA 4OXSA 1DF5A 3T1CA 5EBLC 3ASOB 5IYBO 1KP2A 5B1BB 3I56V 3SPGA 1NVPD 1MOFA 1KD1W 2ZDIC 2P67A 3ABTA 2IJIA 2YEVA 1NQTA 2EIJC 3WFVA 1JVMA 3K79A 3QO8A 3CC2V 2DYSB 2IH3C 2WLJA 2DYRB 5L3FA 4UUJC 3ZRSA 4MTGA 4P2ZA 4XBFA 4R8CA 3E86A 3ABKB 2QKSA 2OCCC 2QM7A 3JD3A 5BZBA 3ZRWA 2X6BA 1QLEC 3AG3C 2GSMB 3CP1A 2WLIB 3ABUA 3E8BA 4MVSA 3ML0A 4N21A 4J9YB 2XAJA 5LHGA 1H8EG 4DXWA 3FB7C 2EINB 2W0FC 2ATKC 3M99B 2WLIA 1OZ0A 4PA4A 3P32A 5J9PC 5CBHA 4PDMA 1FXHA 1SESA 3JYCA 1FFTB 1FS0G 2YSUB 3CCLV 2X7RB 4FMTA 2DWEC 4HZ3A 1E1QG 4QPKA 5DM6V 1P4RA 4PA3A 4QPJA 3ETEA 3OEEG 4JYCA 3RBZA 1QLNA 3F7VC 4F4LA 3D36A 3ZRVA 2A9HA 2R9IA 2Y69C 4TSFG 4QNHB 2H8PC 2ZQMA 4I9WA 3RW0A 1M9NA 2WLKA 1OCCB 2ZXWC 3ABLB 4PA7A 3ZMZA 3HB3B 4DO2A 2UXNA 3G6EV 4WFAV 1MSWD 3AG2B 1AI6A 5HFLA 1CP9A 1OCZC 1ZWIC 3CC7V 1V55B 1K9MW 1GTOA 4U7NA 3TCUA 3K06A 4LBEC 3CCUV 1QVFU 4GCZA 2Z5UA 4XDJA 1YHQV 3T4DA 5EBMC 5CN0A 1EBOA 2B1GA 2ZR2A 1K4DC 1COWG 5GW7A 2AHYA 1VQ7V 2EIKB 1GMGA 3ZJZA 3LDDA 1B6QA 1Q82W 1V54C 3P30A 2IJKA 3ZMSA 5IY5C 4RQEA 1NR7A 2CK3G 3G4SV 2UXXA 3W7TA 5KUMA 5CBGA 5LBQA 1WPXA 5C93A 2HR3A 4PDRA 3BY6A 2WLHA 1JJ2U 2XAFA 4H37A 2HKOA 2WSSG 5B3SC 2M7WA 3CCRV 2Q69A 2P6JA 1VQMV 3K03A 2QA4V 3UM7A 1RM1B 3JD1A 3CC4V 4UVCA 2NLJC 3MHHC 4MVRA 5B1NA 1BMFG 1NVPB 1H38A 2DW4A 1S3JA 4I5SA 2ITCC 1NH2D 3QO7A 4KUMA 3ASNB 4MSWC 4MS2A 3ABMB 4Q20A 4QJFB 1PD3A 3QO5A 4ZBMA 3W7XA 3ZRXA 3A0RA 1VQ8V 1BHAA 1JOYA 3F5WC 4R6ZA 5IYDO 4UVAA 4JGSA 2ITDC 1YJNV 4RUEA 2EILC 1YTFB 2EIJB 1AJNA 3QNEA 3OAAG 3I55V 1GM7A 4PDVA 3X2QC 5LHHA 2ZDIA 3ZRWB 2IJHA 5L3BA 1IXMA 1K97A 3VOUA 2Q67A 4MT8A 4CZZA 4MVZA 5E1AC 3WG7B 3ZN1A 1SZTA 1YTFD 2OCCB 3E8GA 1YIJV 1M56B 1NR1A 5EK0A 1M1KW 3ASOC 3CMEV 5B1BC 3AEIA 2JEXA 1N8RW 3E2EA 2LFRA 1Y66A 1E79G 1R6KA 4MVOA 1Q7YW 2QEXV 2JK5C 1SERA 4QIWF 2HVKC 2XAHA 1ROPA 3AG4C 2WLLA 3ETGA 4R50A 3FKSG 5KA6A 1YJ9V 1J95A 1UJWB 1YJWV 1OCRC 3B8MA 5H6RA 1F4NA 3FB8C 3CCSV 4X88A 3ABKC 3CPWU 4MTFA 3LNMB 5EC1C 3K08A 1AJQA 2LP7A 1AROP 2WLMA 4L87A 3VBBA 4ASUG 3NXSA 1AJPA 1NKDA 2ZD9A 4BAYA 1KP3A 1QR9A 2BOCC 2FTKA 5H6QA 3RVZA 2HLDG 3LSSA 1F23A 1XL4A 1GM8A 2Y69B 2JEUA 3K3WA 4WFBV 3CCVV 3K0GA 1L1FA 1EZJA 1AI4A 4QE7A 1K7DA 5EBWC 4JAUA 4G2KA 1BL8A 1OHHG 5KA5A 3CXCU 1MG1A 3K9AA 4P30A 3MD0A 1FXKC 2WAMA 1PL0A 3F7YC 2WLNA 2Y48A 5LGNA 1GO3F 4RAIA 4HYOA 1P7BA 3SPJA 1KECA 4MTOA 1F4MA 1GM9A 2Z3YA 3SJQC 2JDIG 1THZA 5L3DA 2D3OW 1K8AW 2EIMB 3R65A 3ZMTA 4FIPC 4WCEV 1Q81W 4YXWG 1S77D 2NNUA 3RVYA 4UVBA 4X8AA 5B1AB 3EHBB 3TK1A 1ORQC 3ABLC 1OCCC 1KQSU 1BHBA 3W7SA 5IY5B 1I5XA 5DN6G 1ENVA 4WFHA 2IU3A 1QVGU 3CYOA 2JJ1G 2BOBC 3SYQA 4UV8A 1JPXA 2EJRA 2DWDC 3E83A 2XNDG 1M90W 4JF3A 1OCOB 2QM8A 3OR6C 3SYCA 2XASA 3OMIB 2P7TC 4MVQA 2EIKC 3UKMA 3FYIB 4E2LA 3JD2A 3IC7A 4ZKIA 1NH2B 1Q86W 5IYCO 5CA3A 3E89A 1GK9A 2IW5A 1RPOA 3ZMVA 1G4YB 2KB1A 5FL7G 1AI7A 1M57B 2GHYA 2WWWA 2HVJC 2DQ0A 4FJCC 4J9ZB 4JAVA 2P90A 5CMUA 1DLBA 5B1OA 4LC1A 1LNQA 1VQNV 4FK5C 2V7QG 3OUFA 4MW8A 5LHIA 2A0LA 4RUFA 1S72V 3AG1C 1TUEB 4P9PA 4TWKA 3FB6C 3FB5C 3IGAC 1XL6A 2V1DA 1H2GA 1VQ5V 3W7UA 3OE7G 1RM1C 3T4ZA 3H01A 2JIZG 1NBMG 3FYEB 3CCMV 3OR7C 4P9OA 1YSCA 3SPHA 3E8HA 3SPIA 1W2BU 3JCZA 3G71V 3ZN0A 1JX9A 1Y4MA 1VQLV 5IDJA 1YITV 1VQPV 1R3JC 1CPYA 1KC8W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO C;  3ASN C;  2WLM A;  3BEH A;  4EKW A;  5EC2 C;  2HJF C;  2Q6A A;  4XDJ A;  3T4D A;  5EBM C;  4LBE C;  2ZD9 A;  1K4D C;  2BOC C;  3SYA A;  3TET A;  1KKD A;  2WLL B;  4R7C A;  2AHY A;  3RVZ A;  3SPC A;  1XL4 A;  3SYP A;  3ZJZ A;  3LDD A;  3T2M A;  4XDK A;  1V54 C;  2Q68 A;  4JTC B;  3K0G A;  4KFM A;  4PA6 A;  4GX2 A;  4PDL A;  2DYS C;  3E8F A;  3LUT B;  4QE7 A;  5IY5 C;  1M57 C;  3EFF K;  4XDL A;  5EBW C;  4CBC A;  1BL8 A;  2DYR C;  5KUM A;  4P30 A;  1K4C C;  5CBG A;  2AHZ A;  3WG7 C;  3F7Y C;  2WLN A;  3K0D A;  1M56 C;  4PDR A;  4RAI A;  2WLH A;  4HYO A;  1P7B A;  3SPJ A;  3ABM C;  3LDE A;  4H37 A;  4MTO A;  4WFF A;  4BW5 A;  4MVM A;  4OXS A;  3T1C A;  5EBL C;  3SJQ C;  5EC1 C;  5B3S C;  1R3I C;  3R65 A;  3SPG A;  2EIN C;  2Q69 A;  4QE9 A;  2YEV A;  2EIJ C;  1R3K C;  3RVY A;  1JVM A;  4WFE A;  3HPL C;  3K03 A;  2A79 B;  4X8A A;  1ORQ C;  3ABL C;  1OCC C;  2QTO A;  3UM7 A;  2IH3 C;  2WLJ A;  3STL C;  4PA9 A;  5KUK A;  4WFH A;  4GX1 A;  2BOB C;  2NLJ C;  4MVR A;  3SYQ A;  3GB7 C;  4UUJ C;  3ZRS A;  4MTG A;  4P2Z A;  5CBF A;  2ITC C;  4R8C A;  3E86 A;  2DWD C;  2QKS A;  3LDC A;  3E83 A;  2OCC C;  5BZB A;  4MSW C;  2X6B A;  3OR6 C;  3SYC A;  1QLE C;  3AG3 C;  4MS2 A;  3OGC C;  4G27 B;  4ZBM A;  2P7T C;  2WLI B;  2HG5 C;  2EIK C;  3E8B A;  4MVS A;  4MVQ A;  4G28 B;  3UKM A;  3F5W C;  4R6Z A;  4J9Y B;  2ITD C;  4DXW A;  3FB7 C;  4RUE A;  2W0F C;  2ATK C;  2EIL C;  4X89 A;  3E89 A;  3K04 A;  4PDV A;  2X6A A;  1G4Y B;  2KB1 A;  2WLI A;  4PA4 A;  5J9P C;  3OUS A;  5CBH A;  4PDM A;  4WFG A;  3AG2 C;  3X2Q C;  2HVJ C;  3JYC A;  1V55 C;  4J9Z B;  2HFE C;  3SYO A;  3VOU A;  2Q67 A;  4MVZ A;  2DWE C;  4HZ3 A;  2X6C A;  5E1A C;  1LNQ A;  1R3L C;  3E8G A;  3OUF A;  4MW8 A;  5EK0 A;  2A0L A;  4RUF A;  3ASO C;  4PA3 A;  3AG1 C;  5B1B C;  4JTA B;  4P9P A;  4LCU C;  2EIM C;  3IFX A;  3PJS K;  4TWK A;  3RBZ A;  1S5H C;  3FB6 C;  2R9R B;  2IH1 C;  3FB5 C;  3IGA C;  3F7V C;  1XL6 A;  4F4L A;  2A9H A;  2Y69 C;  4JTD B;  4LP8 A;  4MVO A;  5B1A C;  4QNH B;  2JK5 C;  2H8P C;  2HVK C;  3AG4 C;  3T4Z A;  2WLL A;  3KG2 A;  3TCU A;  4R50 A;  4I9W A;  4H33 A;  3RW0 A;  3STZ C;  1J95 A;  2WLK A;  2ZXW C;  4MW3 A;  1OCR C;  4PA7 A;  3OR7 C;  4P9O A;  4RO2 A;  3SPH A;  3E8H A;  3SPI A;  4MVU A;  2K1E A;  3FB8 C;  1OCZ C;  1ZWI C;  4GX0 A;  4X88 A;  3ABK C;  4MTF A;  1R3J C;  4GX5 A;  3LNM B;  3K06 A;  3K08 A; 
#chains in the Genus database with same CATH topology
 2LFS A;  1SRY A;  3BEH A;  5EC2 C;  1JFF A;  3AK3 A;  3RYC A;  2YID A;  2X0L A;  5BXZ A;  4B7E A;  1QLE B;  3AG3 B;  3JD4 A;  1RFY A;  4DW1 A;  5HFM A;  3O9O A;  1N33 O;  2Q68 A;  1K5Q A;  4JAS A;  1Q90 D;  2A7W A;  1R6T A;  1NT2 B;  3L70 H;  1OCR B;  3E22 B;  4LWS B;  2F23 A;  2IM9 A;  4DR2 B;  1SS3 A;  1R3I C;  1W0K G;  2EIN C;  3N2G B;  4QE9 A;  4NKG B;  5LP6 B;  4WFE A;  3CD6 V;  4HAM A;  2XAG A;  4A5U B;  4LF7 O;  4GX1 A;  2E3C A;  2ZXW B;  3RYH A;  3CMA V;  3B40 A;  4DRX B;  3GB7 C;  2F93 B;  2EZO A;  1OCZ B;  2UUC B;  3LDC A;  3D36 C;  4J7Z A;  3CXH F;  4TT3 G;  4KP4 A;  5CA1 B;  4IHJ A;  4X62 O;  2KKW A;  1WB8 A;  3BHP A;  1V54 B;  3FAV B;  4LNU B;  3APQ A;  4X1K B;  5K1X A;  3B8N A;  3CCJ V;  1V55 C;  1HDJ A;  1R6N A;  2HFE C;  4FZ0 A;  2JGD B;  1VF7 A;  5H9C A;  4TV9 B;  1SQG A;  4PD4 F;  2VWK A;  4Z1M G;  3MAQ A;  2EIM C;  3PJS K;  1S5H C;  3ZHQ A;  1HNX O;  1I5Y A;  5A2Q N;  1WA8 A;  4YJ2 A;  1QR8 A;  1HNW O;  5IJ0 B;  2LO1 A;  3D3I A;  5GON A;  4JYY A;  4FPP A;  4MVU A;  2K1E A;  1MA1 A;  4GT1 A;  1Z5V A;  3E35 A;  4GX5 A;  4UFZ A;  3N27 A;  5EYP B;  4ZHQ A;  3RT3 C;  5L3E A;  1BCC H;  2FML A;  4DV1 B;  2HEP A;  4FFB B;  1AVM A;  1CEZ A;  4J42 A;  2ZIM A;  4BIO A;  4XDL A;  3CCQ V;  4DV2 B;  4JI6 B;  4J80 A;  3F5T A;  1HWY A;  4FM1 A;  2M6Y A;  1IVS A;  1XDC A;  2ZE5 A;  1KYO F;  5LGU A;  1SQB H;  2YEV B;  4JYB A;  1I08 A;  3RYI B;  5JJN B;  5IYB O;  3CJH A;  4PV1 B;  3ZHU A;  1AB3 A;  4X20 A;  3DC5 A;  2IJI A;  1NQT A;  2Q7G A;  3K79 A;  3ZHS A;  3JAL A;  4CH4 A;  2DJV A;  4X64 B;  2UXB O;  3KZI Z;  2PYJ A;  4K0K B;  4UUJ C;  3ZRS A;  1U97 A;  4XBF A;  2E5L O;  2ZNJ A;  3ABK B;  2QM7 A;  3EXA A;  4WBN B;  3HKB B;  4X1I A;  1Z5W A;  5IE9 A;  4K3A A;  4N21 A;  2Q7H A;  4DXW A;  2L6L A;  1OZ0 A;  4BW9 A;  1H2K A;  5J9P C;  3OGI B;  5CBH A;  1WJZ A;  1YDX A;  4FLV A;  4PDM A;  5KHI A;  1XHZ A;  1HW7 A;  1FXH A;  1US6 A;  1FS0 G;  2YSU B;  2CTQ A;  2NN4 A;  3VQV A;  1XNR B;  4FMT A;  4I50 B;  5D5Q A;  5BMV A;  4JYC A;  4DR2 O;  1ZTE A;  3D36 A;  2A9H A;  3OT7 A;  5J2T B;  1PPJ H;  2ZQM A;  4NXN B;  2KG7 B;  3ABL B;  4CS3 A;  3HB3 B;  5FPR A;  1MSW D;  4WFA V;  2N74 A;  3K59 A;  1QVF U;  4LBE C;  3ZHV A;  2Z5U A;  1ZL8 B;  4DR6 B;  3H1I H;  2GUZ A;  1AR4 A;  4DV5 O;  5IY5 C;  2UXX A;  5KUM A;  1VAR A;  3G67 A;  2RJZ A;  2A06 H;  1YEW A;  1JJ2 U;  4H37 A;  2CH7 A;  1AP5 A;  5B3S C;  2Q5Z A;  4LF4 B;  3CCR V;  4FLU A;  3K03 A;  2QA4 V;  2GTS A;  3CC4 V;  3SJC C;  4LR3 A;  1OJH A;  3MHH C;  5B1N A;  2DW4 A;  2K9P A;  4JI5 B;  1NH2 D;  4CH5 A;  4KUM A;  2ZE6 A;  1AP6 A;  2Q9L A;  4QJF B;  3QO5 A;  1BHA A;  4R6Z A;  2ITD C;  2EIL C;  3L74 H;  2EIJ B;  3QNE A;  4PDV A;  4DV1 O;  2QDO A;  3X2Q C;  2UUA B;  4Z2W A;  2IJH A;  1H2L A;  4JI6 O;  2Q67 A;  4MVZ A;  5E1A C;  2ETN A;  3ZN1 A;  2OCC B;  1FFX B;  1SQF A;  3SGI A;  3ETQ A;  5KX5 A;  2UU9 O;  3ICX A;  4B3S O;  2QEX V;  1ROP A;  5B66 Z;  2F95 B;  2Q7E A;  5CB4 B;  3ZED A;  1UJW B;  1YJW V;  4LF9 B;  1SZX A;  1Q6H A;  2ZE7 A;  2OCH A;  3JAT A;  2YXL A;  3BRC A;  4MTF A;  3KCX A;  3LNM B;  3K08 A;  3AK1 A;  1D5A A;  4L87 A;  4I4T A;  1TGO A;  4PHZ A;  3VBB A;  3JAS B;  4BAY A;  1QR9 A;  3RYF A;  2HLD G;  4TV8 A;  4NR1 A;  2Y69 B;  1L1F A;  1J5E O;  2GBO A;  1K7D A;  4JAU A;  1VIB A;  3TXQ A;  1MG1 A;  4O2B A;  5C8Y B;  3F7Y C;  4K35 A;  2Y48 A;  4HYO A;  3SPJ A;  1XNR O;  4MTO A;  1GM9 A;  2JDI G;  1K8A W;  2ZE8 A;  1PP9 H;  3R65 A;  4O2A B;  2OIE A;  2NNU A;  4X8A A;  4YJ3 A;  1KQS U;  3NR7 A;  2IBZ H;  1I5X A;  5DN6 G;  3W7S A;  2O57 A;  1BQZ A;  5H2F Z;  1QVG U;  5JQG A;  2BOB C;  1UPG A;  3GVM A;  2QWP B;  5K1P A;  2DWD C;  2XND G;  4JF3 A;  4CS2 A;  1XI1 A;  1ZUQ A;  2YS8 A;  1YXB A;  3CWB H;  4D7S A;  2RMK B;  2XAS A;  2WA4 A;  4QGP A;  4DR6 O;  1NH2 B;  1Q86 W;  2CGN A;  1BGY H;  4UB8 Z;  2IW5 A;  4OPA A;  5JJE B;  1AI7 A;  4IIJ B;  4BWA A;  3J80 N;  1IBL B;  2CUG A;  2RN9 A;  2QWQ B;  2DQ0 A;  3IC9 A;  4FJC C;  4J9Z B;  3JAK A;  2P90 A;  1DLB A;  1OV9 A;  4LC1 A;  4D7T A;  3JAM N;  2V7Q G;  2A0L A;  1S72 V;  3AG1 C;  1TUE B;  3FB6 C;  3IGA C;  1N33 B;  2CTR A;  1H2G A;  4LF4 O;  3H01 A;  1VMG A;  1QU7 A;  3OTF A;  4P9O A;  3G71 V;  1JX9 A;  2KQX A;  1VQP V;  5DEC A;  3ASN C;  3CE2 A;  2ZIO A;  1O9G A;  3ETD A;  4JI5 O;  2Q6A A;  4NVP A;  1K73 W;  2UXD B;  2UUB B;  1K34 A;  1TVK A;  3ZCC A;  3SPC A;  5J2U A;  3T1Y O;  1TUB A;  3ZMU A;  3AG4 B;  3E8F A;  1D2D A;  2DYR C;  1PNL A;  1H8H G;  2UUA O;  3K0D A;  2P5O A;  1SKV A;  3B2E E;  2XT9 A;  4DR7 B;  3OMA B;  4NTX A;  4N23 A;  4WF9 V;  2CTW A;  5F2V O;  3BFR A;  1U96 A;  1R3K C;  5L3C A;  5ITZ A;  2A79 B;  4UXN A;  2FL4 A;  2PI4 A;  4U3J B;  1MNG A;  1YF2 A;  1VQK V;  1PM9 A;  4PEL A;  1S0V A;  1PNK A;  2WPD G;  1HNX B;  1EFR G;  1RPR A;  4KHP B;  2PTM A;  1GN6 A;  1SET A;  1XQ8 A;  4X89 A;  2YIC A;  3K04 A;  4O4J B;  2X6A A;  2OIG A;  5LGT A;  1W0J G;  3A0H Z;  2Q4P A;  1I7F A;  4TUY A;  4K8Z A;  1WA8 B;  4B3T B;  2XOK G;  1FXV A;  4DK1 A;  5GON B;  4JI8 O;  4I0X A;  4LP8 A;  5B1A C;  4MTX A;  3VQY A;  3MHS C;  4HNA A;  4O4I A;  2Q0A A;  1IUR A;  2HJD A;  1IBM B;  2OWO A;  2DMX A;  4H33 A;  4ZIB A;  4ZHQ B;  3Q4H A;  3QTC A;  1GN4 A;  1WP7 A;  1QCE A;  4ZOL A;  2VS0 A;  4CC5 A;  3RWR D;  1RSO A;  1Y74 A;  4O4H A;  3OMN B;  3SYP A;  1K5S A;  1UFI A;  3T2M A;  4JTC B;  2GV9 A;  5JVD A;  2YI8 A;  2UXB B;  1S76 D;  1F51 A;  1MAB G;  3OW2 U;  4CS4 A;  1K4C C;  1IBL O;  1JA8 A;  5IWA O;  4IL6 Z;  4UV9 A;  3OEH G;  4WFF A;  3BAB A;  4OXS A;  5EBL C;  3ASO B;  1KP2 A;  1Y67 A;  1NVP D;  2R9A A;  1KKC A;  1HNZ O;  1KD1 W;  2P67 A;  4YY3 B;  3WFV A;  5LA6 A;  4PJ0 Z;  3CC2 V;  2WLJ A;  2PF4 E;  3D8C A;  5L3F A;  1M4U A;  3C3T A;  5KMG A;  1MZE A;  4P2Z A;  2LJ2 A;  1YZB A;  1NS1 A;  3ZRW A;  2X6B A;  1QLE C;  3AG3 C;  3DXR B;  3QF7 A;  4DR5 O;  4J9Y B;  1FD9 A;  5LHG A;  1H8E G;  4DUZ B;  3FB7 C;  2UUB O;  2UXD O;  2EIN B;  2ATK C;  4X1Y A;  2WLI A;  4J10 A;  3CEI A;  1Y6X A;  3JYC A;  5LYJ A;  3CCL V;  1Z2G A;  2DWE C;  3ETE A;  2VQE O;  3RBZ A;  4X65 B;  2PY5 A;  4DR7 O;  1QNM A;  3F7V C;  2AXT Z;  2R9I A;  5LL6 Y;  4DV5 B;  2H8P C;  2BTQ A;  4X9Q A;  3C90 A;  1LR1 A;  4DO2 A;  2ZXW C;  4PA7 A;  3G6E V;  1AI6 A;  2R72 A;  3A0B Z;  1OCZ C;  1ZWI C;  1K9M W;  3CC7 V;  1V55 B;  5KLV H;  1GTO A;  5LOV B;  4U7N A;  2N05 A;  1YHQ V;  2GUZ B;  1N0J A;  3UT5 A;  5CN0 A;  3GWK C;  4CC6 A;  1M93 A;  1GMG A;  1P84 F;  4KHP O;  1V54 C;  1GN3 A;  3P30 A;  2IJK A;  3G4S V;  4DW0 A;  4FM2 A;  2N04 A;  2CH7 B;  4JZG A;  3QVN A;  4H13 B;  4PDR A;  3RGB A;  1L8D A;  4NYK A;  2WSS G;  2Y4T A;  4B3T O;  4OGQ B;  3S3X A;  1MMM A;  4DUY O;  2FKX A;  2F66 C;  3UM7 A;  4GKJ B;  1RM1 B;  3BVO A;  5CA0 A;  3JD1 A;  1YVW A;  5LXT A;  2AW9 A;  3M8A A;  4JI3 B;  1IBM O;  4MVR A;  1NVP B;  2AZ2 A;  1H38 A;  3JAW B;  4L8J A;  4UCO A;  4GKK B;  1A32 A;  1FJG B;  3THO A;  2E74 B;  4ZBM A;  3W7X A;  3A0R A;  2UU9 B;  1Y76 A;  4AQY B;  4PI2 A;  5AG2 A;  3F5W C;  5IYD O;  4B3S B;  1AJN A;  1V9P A;  3H1H H;  4EFE A;  5LHH A;  1SC5 B;  5L3B A;  2F4V B;  3WG7 B;  1BS3 A;  3E8G A;  1M56 B;  1NR1 A;  3CRR A;  4JI1 B;  1N8R W;  3H9V A;  2LFR A;  1J5E B;  1WPB A;  1Q8I A;  2JK5 C;  1SER A;  2BE3 A;  2XAH A;  1MSD A;  3JSN A;  4YY3 O;  1J95 A;  4I4T B;  1AIL A;  3CCS V;  3ABK C;  1BZK A;  3HR0 A;  3WB0 A;  1AJQ A;  2LP7 A;  3BCC H;  2WLM A;  4LWS A;  5GTI Z;  3NXS A;  1AJP A;  2BOC C;  5H5N A;  2VWJ A;  5BR8 B;  1JR9 A;  3LSS A;  1F23 A;  1XL4 A;  4ZI7 B;  2JEU A;  4WFB V;  1EZJ A;  4DUZ O;  2YIB A;  1AI4 A;  5EBW C;  4G2K A;  1BL8 A;  1OHH G;  3CRA A;  3WU2 Z;  3K9A A;  4P30 A;  3MD0 A;  1FXK C;  1XOU A;  1Q43 A;  2WLN A;  1LUV A;  1P7B A;  1KEC A;  4DRX A;  2RNB A;  4LFC B;  3APO A;  5KHH A;  5L3D A;  3ZMT A;  4FIP C;  4X65 O;  4GZR B;  4WCE V;  1Q81 W;  1S77 D;  3EHB B;  3ABL C;  5IY5 B;  1Q6U A;  2JJ1 G;  2QM4 A;  3FAV A;  4LNU A;  2V4D A;  1JPX A;  2EJR A;  1BT8 A;  2Y0P A;  1OCO B;  2QM8 A;  2JGD A;  2JVD A;  3UKM A;  3FYI B;  1I0H A;  4KL1 A;  4UCT A;  4ZKI A;  2E76 B;  4O4L A;  4B3R O;  2PZS A;  5CA3 A;  4DV4 B;  1RPO A;  2KB1 A;  5KAF Z;  1L0N H;  1T5E A;  2ZT9 B;  1M57 B;  2GHY A;  1NU1 H;  4CH6 A;  3N2K B;  5CMU A;  2CTP A;  1BSM A;  3K57 A;  5FNV B;  2R70 A;  3FFQ A;  1XL6 A;  1URF A;  2JRI A;  3T1Y B;  2V1D A;  3HKD A;  3W7U A;  3T4Z A;  4DYL A;  3CCM V;  2F1M A;  4FFB A;  3SPH A;  3E8H A;  4UCS A;  4GKJ O;  3ZN0 A;  4F6E A;  1VQL V;  5IDJ A;  4JI3 O;  3CRC A;  1KC8 W;  1TVK B;  2E75 B;  1Q6I A;  3MDS A;  5J2U B;  4EKW A;  1TUB B;  2P4K A;  1ZX3 A;  2PGG A;  3OFN G;  3SYA A;  4GKK O;  1KKD A;  2WLL B;  4PI0 A;  3ZIA G;  4R7C A;  1KUQ A;  1FJG O;  3IJ4 A;  4AQY O;  1XNQ B;  5LMU B;  2XUM A;  4KFM A;  4PA6 A;  3K5N A;  2XTA A;  2DYS C;  3LUT B;  5L3G A;  3K58 A;  4BIU A;  2A3Q A;  5EIB D;  5IJ9 B;  3G6B A;  4FLY A;  5JH7 B;  1NJI W;  2F4V O;  3LDE A;  2OT5 A;  4MVM A;  5ITZ B;  3W7W A;  4JI1 O;  5EZY A;  4ICG A;  2Q0O C;  1R73 A;  4DK0 A;  1TA8 A;  4U7O A;  5LMN O;  1SQQ H;  2QJ1 A;  1VF5 B;  4JYA B;  5CBF A;  2QR4 A;  2JGU A;  1DF4 A;  2B1I A;  4JI8 B;  4DV0 B;  3OGC C;  4G27 B;  1FXK A;  4AHC A;  3AK2 A;  3OD4 A;  4G28 B;  1N36 O;  5BR8 O;  4EEQ A;  2MK3 A;  4F6R B;  2F43 G;  3AG2 C;  5J2T A;  2VRZ A;  2KG7 A;  4RQF A;  2X6C A;  3D3Q A;  4JAA A;  2DQ3 A;  1R3L C;  3JD0 A;  1JQ0 A;  3K5L A;  3B77 A;  4BIZ A;  4HNA B;  4JTA B;  4O4I B;  1VQ9 V;  4LFC O;  4JTD B;  1AR1 B;  4EB6 B;  1ZSP A;  4X66 B;  4ZOL B;  2IJJ A;  4GX0 A;  4B08 A;  1RSO B;  5IWA B;  2EBO A;  2W6I G;  5FPO A;  2OTL V;  4JI7 O;  4O4H B;  2Z0A A;  2HJF C;  2H94 A;  2OTJ V;  2C2A A;  3AG1 B;  1KB9 F;  1HNZ B;  1GKF A;  3LSQ A;  4DR1 O;  1FPO A;  2ILM A;  2BSK B;  4PDL A;  1VQ4 V;  1K33 A;  3EFF K;  1VEW A;  4DV4 O;  5FLX N;  2DE0 X;  1JFF B;  1PNM A;  3RYC B;  5KHJ A;  2WA3 A;  4I55 A;  4J7K A;  3ABM C;  4DV6 B;  4DR5 B;  1SQX H;  3T1C A;  1WB7 A;  3JAR A;  5B1B B;  5LA6 B;  3I56 V;  3SPG A;  1MOF A;  5TIS Z;  2QWN B;  3ABT A;  2ADP A;  5KMG B;  3HKE A;  3BAA A;  2DYR B;  4H0L B;  1VF6 C;  3CX5 F;  4MTG A;  3H1L H;  2BCC H;  3E86 A;  2QKS A;  2VQE B;  1IDS A;  4X1Y B;  3CP1 A;  2WLI B;  3ABU A;  3E8B A;  3ML0 A;  2XAJ A;  2YIA A;  3M99 B;  3RYH B;  1ZLZ A;  1XNQ O;  4PA4 A;  5LMU O;  1NTK H;  3J81 N;  4GLX A;  1WN7 A;  1FFT B;  4IHJ B;  5IYZ A;  4HZ3 A;  4QPK A;  5DM6 V;  1N0N A;  4PA3 A;  4QPJ A;  3OEE G;  2ARH A;  2BTQ B;  4BR6 A;  3CHX A;  3IAY A;  1N32 B;  2AGA A;  2LW1 A;  4Z1V A;  2FB5 A;  4I9W A;  3RW0 A;  2WLK A;  1OCC B;  3ZMZ A;  3K5O A;  3UT5 B;  1CP9 A;  4YIO A;  3DC6 A;  4W4K A;  3CRQ A;  3CCU V;  4JYA O;  3TXS A;  4FLT A;  5JCO C;  4YJ2 B;  5C8Y A;  2QKC A;  1EBO A;  2B1G A;  2ZR2 A;  5JJJ B;  1BQ0 A;  1S5L Z;  5GW7 A;  4DV0 O;  2EIK B;  4DUY B;  3ZJZ A;  3K9S A;  2QGN A;  2JS3 A;  1XMO B;  3ZMS A;  4RQE A;  1IX9 A;  2CK3 G;  4B7K A;  3W7T A;  5LBQ A;  4Q6G A;  2HHH B;  1WPX A;  3L71 H;  1N34 B;  3BY6 A;  1XMQ B;  2WLH A;  2QWO B;  2XAF A;  2HKO A;  2Q69 A;  2P6J A;  1GAX A;  1VQM V;  5A9G A;  4NXM O;  1S5J A;  4YIP A;  4AI8 A;  1XUQ A;  4OX9 B;  3LNN A;  4DV7 B;  3G80 A;  4X66 O;  2NLJ C;  1BMF G;  1S3J A;  4I5S A;  5KAI Z;  3QG5 A;  3CJH B;  2ADQ B;  4YHH O;  4X20 B;  4Q20 A;  3L75 H;  1PD3 A;  3ZRX A;  3JAL B;  4UVA A;  1YJN V;  2YI9 A;  3OTO O;  1YTF B;  2RDC A;  1GM7 A;  1N4C A;  1PL4 A;  4LF8 B;  1IXM A;  1K97 A;  2GDS A;  4X1I B;  1XRE A;  4MT8 A;  3CS5 A;  1SZT A;  1M1K W;  1YIJ V;  4NTY A;  5EK0 A;  3ASO C;  1VF6 A;  3AEI A;  4AIL C;  2GTA A;  4DV6 O;  4DR3 B;  1E79 G;  4MVO A;  1Q7Y W;  2P22 C;  3ETG A;  1LUW A;  2ZM6 B;  4R50 A;  3FKS G;  1YJ9 V;  1OCR C;  3HKC A;  3VQW A;  5H6R A;  1F4N A;  2YXH A;  5BMV B;  3FB8 C;  3CPW U;  5EC1 C;  1H2M A;  1SF9 A;  4ASU G;  4DR4 B;  2ODM A;  4IYI A;  1NKD A;  2ZNI A;  1KP3 A;  3CRM A;  2FTK A;  5H6Q A;  3RVZ A;  1P7G A;  5LP6 C;  3K3W A;  3CCV V;  4D6T H;  3TGU H;  1IXB A;  3CXC U;  4I9Q A;  4JI2 O;  1PL0 A;  2G38 A;  4U3J A;  1SA0 A;  1F4M A;  2MW2 B;  1XIL A;  2EIM B;  4B3R B;  2CAZ C;  2UXC O;  4YXW G;  5JCO A;  3RVY A;  4DV3 O;  2LQT A;  3TK1 A;  1ORQ C;  1N32 O;  1BHB A;  4WFH A;  2IU3 A;  3CYO A;  4O4J A;  4IYH A;  4J7J A;  4H44 B;  4O4L B;  3OR6 C;  3SYC A;  2KSD A;  3OMI B;  4MVQ A;  4HBN A;  4E2L A;  1EN5 A;  5IYC O;  1G4Y B;  1HP8 A;  2L35 A;  1XMO O;  3T1H B;  2HVJ C;  4FFK A;  2HP8 A;  5B1O A;  2HHH O;  1LNQ A;  4FM0 A;  3HKD B;  3OUF A;  4MW8 A;  4UB6 Z;  4RUF A;  1N34 O;  3L72 H;  1XMQ O;  1I94 B;  3SDL A;  4E4E A;  4OPH A;  4FLW A;  2ZCE A;  1VQ5 V;  3UCS C;  1RM1 C;  4LF6 O;  4UCR A;  3H1K H;  1NBM G;  1WAZ A;  4JV5 O;  2P06 A;  1Y4M A;  4OX9 O;  1KU9 A;  1R3J C;  4DV7 O;  2NR5 A;  5KX5 B;  2D2C B;  1VQO V;  2AZ0 A;  1TAE A;  3TET A;  2H3O A;  1DTO A;  2ZR3 A;  2QSA A;  5LMN B;  4GX2 A;  3JAT B;  1K3E A;  4UCV A;  3WB2 A;  4CBC A;  1G8M A;  1NZ6 A;  4LH7 A;  1H2N A;  5JWP A;  4LF8 O;  2LGW A;  3WG7 C;  1QBZ A;  3LSU A;  1M56 C;  5EZY B;  3RYF B;  4KXR A;  4TV8 B;  3E22 A;  4BW5 A;  1IBK B;  1JCH A;  1N36 B;  2EUL A;  1K92 A;  1L0L H;  4FZ1 A;  2BTO A;  3C3S A;  3DXR A;  3WB1 A;  3HPL C;  4DR3 O;  4O2B B;  2EZP A;  1PKX A;  2QTO A;  3STL C;  1X4T A;  1ZAU A;  4PA9 A;  4LH6 A;  5KUK A;  3UQ8 A;  3N2G A;  2ZM6 O;  3DTU B;  5LP6 A;  3BA9 A;  1FXK B;  1D5N A;  3U10 A;  2JS5 A;  1VP7 A;  2B5U A;  3OM3 B;  4YJ3 B;  4DR4 O;  2HG5 C;  1WLE A;  3L73 H;  1Q5O A;  2QTS A;  5CA1 A;  5JQG B;  2LGQ A;  1FAF A;  3GWO A;  3OUS A;  5E79 Z;  4K8X A;  2YC0 A;  4WFG A;  3J7A U;  3SYO A;  2VQF B;  2EX3 A;  4JI7 B;  2UUC O;  4X1K A;  1XBL A;  4LFA B;  4CH3 A;  2XHB A;  3L9D A;  5LOV A;  4LCU C;  3IFX A;  4DR1 B;  2PI5 A;  3ZBH A;  2R9R B;  2IH1 C;  5B3S B;  1E1R G;  2ZIN A;  4TV9 A;  3M7M X;  2Y0I A;  3KCY A;  1O9H A;  3JAK B;  3KG2 A;  4RWU A;  1FKA O;  3STZ C;  4MW3 A;  4RO2 A;  2W6J G;  1YI2 V;  2IU0 A;  5IJ0 A;  5IT9 N;  3FD9 A;  4GUN A;  1OCO C;  2QE7 G;  2LW7 A;  3RFR A;  3DSQ A;  3DGE A;  1VQ6 V;  3JSL A;  3P3P A;  1H2S B;  1AI5 A;  2W0X A;  1P49 A;  5EYP A;  2P4V A;  3O65 A;  2XAQ A;  2CE4 A;  4XDK A;  1B3Q A;  1NI8 A;  2EIL B;  2QKA A;  4I55 B;  1M57 C;  4JI0 B;  4J11 A;  4I7Z B;  2JJ2 G;  3CCE V;  3R66 A;  3X2Q B;  2AHZ A;  4JPR A;  3JAR B;  3T1H O;  4JZ2 A;  1EN6 A;  4J41 A;  3JAW A;  3B4S A;  1DF5 A;  4NB5 A;  4FLZ A;  2PUS A;  1I94 O;  3HKE B;  2ZDI C;  2YEV A;  2EIJ C;  2OYQ A;  1JVM A;  3QO8 A;  3RYI A;  1Q3E A;  2DYS B;  2IH3 C;  3SJA C;  4DV2 O;  4JI4 B;  5D5P A;  4R8C A;  2YDE A;  2PYL A;  2OCC C;  3JD3 A;  5BZB A;  2YUA A;  3SR2 C;  2GSM B;  4MVS A;  4IT5 A;  3P3N A;  3BA8 A;  4WBN A;  2W0F C;  3HKB A;  4LFB B;  3P32 A;  5IYZ B;  4ABM A;  4X64 O;  4NTW A;  3ZX6 A;  1SES A;  4K0K O;  1MZF A;  2X7R B;  1XEQ A;  1E1Q G;  1P4R A;  1GRJ A;  1BE3 H;  2EJ7 A;  4I50 A;  1QLN A;  4F4L A;  1IBK O;  3ZRV A;  2Y69 C;  4TSF G;  4QNH B;  4B3M B;  4ZI7 A;  1M9N A;  1JOY A;  2UXN A;  4TUY B;  3AG2 B;  5HFL A;  3A8T A;  1B06 A;  3TCU A;  3K06 A;  3U0Z A;  4GCZ A;  4I0X B;  4XDJ A;  3T4D A;  5EBM C;  1K4D C;  2QWR B;  1COW G;  2AHY A;  1HR0 B;  3EVK A;  1VQ7 V;  4NXM B;  1Q82 W;  3LDD A;  1B6Q A;  1ZL8 A;  3Q4H B;  1QHT A;  4TQF A;  2Q8V A;  4C7U A;  3I5D A;  1NR7 A;  4NXN O;  3TJT A;  3RN4 A;  4EFB A;  5CBG A;  3K5M A;  1IZ3 A;  1W59 A;  5C93 A;  4YHH B;  2HR3 A;  2VQF O;  1Y74 B;  1NTM H;  5JVD B;  4LFA O;  2M7W A;  1XHX A;  3OTO B;  3ZS8 C;  5B5E Z;  4LF5 B;  1DK1 A;  4UVC A;  3JCU Z;  4UCU A;  2CGO A;  2ITC C;  3QO7 A;  3AG7 A;  3ASN B;  4MSW C;  3N2K A;  1WP8 A;  4MS2 A;  3ABM B;  1VQ8 V;  4TQD A;  1EM1 A;  5FNV A;  4JGS A;  1RP3 B;  4RUE A;  3I55 V;  2YXY A;  3OAA G;  5KHG A;  1M5I A;  2RCV A;  2ZDI A;  4JI0 O;  3ZRW B;  3VOU A;  4CZZ A;  1YTF D;  3CB2 A;  3CME V;  1JMK C;  5B1B C;  5EIB C;  1QQC A;  2JEX A;  3E2E A;  3KKY A;  1Y66 A;  3HKC B;  3ZHT A;  1R6K A;  1FFX A;  4QIW F;  2HVK C;  4LF7 B;  3AG4 C;  5LYJ B;  5KHK A;  2WLL A;  5KA6 A;  5DED A;  3B8M A;  4JI2 B;  4X88 A;  1EZV H;  4JI4 O;  5CB4 A;  4IGG A;  1ARO P;  1AR5 A;  4X62 B;  5IJ9 A;  2CDY A;  3ZHR A;  2ZD9 A;  1KBH A;  3A2F A;  2UXC B;  5JH7 A;  1PV0 A;  4DV3 B;  1GM8 A;  3UO2 A;  3K0G A;  3JAS A;  4FVM A;  3U11 A;  4QE7 A;  4LFB O;  5KA5 A;  1G1X B;  1G6U A;  2DN9 A;  1SA0 B;  1R1B A;  2YIB D;  4U3F H;  4LF9 O;  2WAM A;  5GTH Z;  5LGN A;  1GO3 F;  4RAI A;  3BPZ A;  3VQX A;  2DOS A;  1WNS A;  2Z3Y A;  3SJB C;  3SJQ C;  2D3O W;  1THZ A;  1HNW B;  3FX7 A;  4UVB A;  5B1A B;  1OCC C;  1YCI A;  4B3M O;  4O2A A;  1ENV A;  2B9Z A;  3SYQ A;  1EN4 A;  3S3W A;  4F6R A;  4TOI A;  4UV8 A;  3E83 A;  1M90 W;  3PN1 A;  2FYU H;  1FYJ A;  1JJO A;  4W4L A;  1X59 A;  2P7T C;  2EIK C;  4FLX A;  1NTZ H;  3JD2 A;  3IC7 A;  5CA0 B;  5LXT B;  4LF6 B;  1HR0 O;  3E89 A;  1GK9 A;  3UO3 A;  3ZMV A;  5BY1 A;  1DGS A;  5FL7 G;  4JV5 B;  2WWW A;  4EB6 A;  4JAV A;  1KMI Z;  2RQ6 A;  1GN2 A;  1F7Y A;  1Y76 B;  3B09 A;  1VQN V;  4IIJ A;  4FK5 C;  1SQP H;  2Q73 A;  5LHI A;  4P9P A;  4TWK A;  3FB5 C;  3CSX A;  4GYC B;  1B04 A;  2Y4U A;  1CXZ B;  2ZKO A;  3OE7 G;  1SQV H;  2JIZ G;  4LF5 O;  3FYE B;  3OR7 C;  1YSC A;  3SPI A;  2E5L B;  1GH6 A;  2BSK A;  1W2B U;  3JCZ A;  3H1J H;  1YIT V;  1CPY A; 
#chains in the Genus database with same CATH homology
 2LFS A;  3ASN C;  1SRY A;  3BEH A;  4EKW A;  5EC2 C;  3ETD A;  2Q6A A;  1VQO V;  2X0L A;  1K73 W;  3OFN G;  1K34 A;  1QLE B;  3AG3 B;  3JD4 A;  3SYA A;  3TET A;  2WLL B;  3ZIA G;  1KKD A;  4R7C A;  3ZCC A;  3SPC A;  5HFM A;  1DTO A;  2ZR3 A;  2Q68 A;  1K5Q A;  4JAS A;  4KFM A;  4PA6 A;  3ZMU A;  4GX2 A;  2DYS C;  3AG4 B;  3E8F A;  3LUT B;  4BIU A;  5L3G A;  1K3E A;  4CBC A;  1G8M A;  2DYR C;  1OCR B;  1PNL A;  1H8H G;  3WG7 C;  1QBZ A;  3K0D A;  1M56 C;  1NJI W;  3LDE A;  3OMA B;  4BW5 A;  2OT5 A;  4MVM A;  1JCH A;  4N23 A;  3W7W A;  1R3I C;  4WF9 V;  1K92 A;  1W0K G;  2EIN C;  4QE9 A;  1R3K C;  1R73 A;  5L3C A;  4WFE A;  3HPL C;  2A79 B;  4UXN A;  2EZP A;  3CD6 V;  1PKX A;  2QTO A;  4HAM A;  2XAG A;  4U7O A;  3STL C;  4PA9 A;  2PI4 A;  5KUK A;  4GX1 A;  3DTU B;  2ZXW B;  3CMA V;  3GB7 C;  1VQK V;  1FXK B;  2EZO A;  5CBF A;  1OCZ B;  1DF4 A;  3LDC A;  4PEL A;  4KP4 A;  2B1I A;  4TT3 G;  1S0V A;  1PNK A;  2WPD G;  2B5U A;  3OM3 B;  3OGC C;  4G27 B;  1FXK A;  2HG5 C;  1EFR G;  1RPR A;  1WLE A;  4G28 B;  1SET A;  4X89 A;  3K04 A;  1V54 B;  2X6A A;  3GWO A;  2MK3 A;  3OUS A;  5LGT A;  2F43 G;  1W0J G;  4WFG A;  3AG2 C;  3B8N A;  3CCJ V;  1V55 C;  1R6N A;  2HFE C;  3SYO A;  4RQF A;  2X6C A;  5H9C A;  2DQ3 A;  1R3L C;  3JD0 A;  1JQ0 A;  3B77 A;  4BIZ A;  2XOK G;  1FXV A;  4JTA B;  4Z1M G;  4LCU C;  2EIM C;  3IFX A;  3PJS K;  1VQ9 V;  2PI5 A;  1S5H C;  2R9R B;  2IH1 C;  5B3S B;  1E1R G;  1I5Y A;  4JTD B;  4LP8 A;  1QR8 A;  5B1A C;  4MTX A;  1AR1 B;  3MHS C;  3D3I A;  3KG2 A;  4H33 A;  3STZ C;  4MW3 A;  4RO2 A;  2W6J G;  4FPP A;  2IJJ A;  2K1E A;  4MVU A;  1YI2 V;  2IU0 A;  4GX0 A;  4GT1 A;  3E35 A;  4GX5 A;  1OCO C;  2EBO A;  2QE7 G;  2W6I G;  2OTL V;  1QCE A;  2HJF C;  2H94 A;  2OTJ V;  3DGE A;  1VQ6 V;  2C2A A;  3AG1 B;  5L3E A;  1AI5 A;  1GKF A;  3LSQ A;  3OMN B;  3SYP A;  1K5S A;  2XAQ A;  3T2M A;  4XDK A;  4JTC B;  1CEZ A;  2EIL B;  4PDL A;  1VQ4 V;  1K33 A;  1S76 D;  1M57 C;  3EFF K;  4XDL A;  3CCQ V;  2JJ2 G;  3CCE V;  1F51 A;  1MAB G;  1HWY A;  3OW2 U;  3X2Q B;  1K4C C;  1PNM A;  2AHZ A;  4JPR A;  5LGU A;  2YEV B;  3ABM C;  4UV9 A;  3OEH G;  4JYB A;  4WFF A;  4OXS A;  1DF5 A;  3T1C A;  5EBL C;  3ASO B;  5IYB O;  1KP2 A;  5B1B B;  3I56 V;  3SPG A;  1NVP D;  1MOF A;  1KD1 W;  2ZDI C;  2P67 A;  3ABT A;  2IJI A;  2YEV A;  1NQT A;  2EIJ C;  3WFV A;  1JVM A;  3K79 A;  3QO8 A;  3CC2 V;  2DYS B;  2IH3 C;  2WLJ A;  2DYR B;  5L3F A;  4UUJ C;  3ZRS A;  4MTG A;  4P2Z A;  4XBF A;  4R8C A;  3E86 A;  3ABK B;  2QKS A;  2OCC C;  2QM7 A;  3JD3 A;  5BZB A;  3ZRW A;  2X6B A;  1QLE C;  3AG3 C;  2GSM B;  3CP1 A;  2WLI B;  3ABU A;  3E8B A;  4MVS A;  3ML0 A;  4N21 A;  4J9Y B;  2XAJ A;  5LHG A;  1H8E G;  4DXW A;  3FB7 C;  2EIN B;  2W0F C;  2ATK C;  3M99 B;  2WLI A;  1OZ0 A;  4PA4 A;  3P32 A;  5J9P C;  5CBH A;  4PDM A;  1FXH A;  1SES A;  3JYC A;  1FFT B;  1FS0 G;  2YSU B;  3CCL V;  2X7R B;  4FMT A;  2DWE C;  4HZ3 A;  1E1Q G;  4QPK A;  5DM6 V;  1P4R A;  4PA3 A;  4QPJ A;  3ETE A;  3OEE G;  4JYC A;  3RBZ A;  1QLN A;  3F7V C;  4F4L A;  3D36 A;  3ZRV A;  2A9H A;  2R9I A;  2Y69 C;  4TSF G;  4QNH B;  2H8P C;  2ZQM A;  4I9W A;  3RW0 A;  1M9N A;  2WLK A;  1OCC B;  2ZXW C;  3ABL B;  4PA7 A;  3ZMZ A;  3HB3 B;  4DO2 A;  2UXN A;  3G6E V;  4WFA V;  1MSW D;  3AG2 B;  1AI6 A;  5HFL A;  1CP9 A;  1OCZ C;  1ZWI C;  3CC7 V;  1V55 B;  1K9M W;  1GTO A;  4U7N A;  3TCU A;  3K06 A;  4LBE C;  3CCU V;  1QVF U;  4GCZ A;  2Z5U A;  4XDJ A;  1YHQ V;  3T4D A;  5EBM C;  5CN0 A;  1EBO A;  2B1G A;  2ZR2 A;  1K4D C;  1COW G;  5GW7 A;  2AHY A;  1VQ7 V;  2EIK B;  1GMG A;  3ZJZ A;  3LDD A;  1B6Q A;  1Q82 W;  1V54 C;  3P30 A;  2IJK A;  3ZMS A;  5IY5 C;  4RQE A;  1NR7 A;  2CK3 G;  3G4S V;  2UXX A;  3W7T A;  5KUM A;  5CBG A;  5LBQ A;  1WPX A;  5C93 A;  2HR3 A;  4PDR A;  3BY6 A;  2WLH A;  1JJ2 U;  2XAF A;  4H37 A;  2HKO A;  2WSS G;  5B3S C;  2M7W A;  3CCR V;  2Q69 A;  2P6J A;  1VQM V;  3K03 A;  2QA4 V;  3UM7 A;  1RM1 B;  3JD1 A;  3CC4 V;  4UVC A;  2NLJ C;  3MHH C;  4MVR A;  5B1N A;  1BMF G;  1NVP B;  1H38 A;  2DW4 A;  1S3J A;  4I5S A;  2ITC C;  1NH2 D;  3QO7 A;  4KUM A;  3ASN B;  4MSW C;  4MS2 A;  3ABM B;  4Q20 A;  4QJF B;  1PD3 A;  3QO5 A;  4ZBM A;  3W7X A;  3ZRX A;  3A0R A;  1VQ8 V;  1BHA A;  1JOY A;  3F5W C;  4R6Z A;  5IYD O;  4UVA A;  4JGS A;  2ITD C;  1YJN V;  4RUE A;  2EIL C;  1YTF B;  2EIJ B;  1AJN A;  3QNE A;  3OAA G;  3I55 V;  1GM7 A;  4PDV A;  3X2Q C;  5LHH A;  2ZDI A;  3ZRW B;  2IJH A;  5L3B A;  1IXM A;  1K97 A;  3VOU A;  2Q67 A;  4MT8 A;  4CZZ A;  4MVZ A;  5E1A C;  3WG7 B;  3ZN1 A;  1SZT A;  1YTF D;  2OCC B;  3E8G A;  1YIJ V;  1M56 B;  1NR1 A;  5EK0 A;  1M1K W;  3ASO C;  3CME V;  5B1B C;  3AEI A;  2JEX A;  1N8R W;  3E2E A;  2LFR A;  1Y66 A;  1E79 G;  1R6K A;  4MVO A;  1Q7Y W;  2QEX V;  2JK5 C;  1SER A;  4QIW F;  2HVK C;  2XAH A;  1ROP A;  3AG4 C;  2WLL A;  3ETG A;  4R50 A;  3FKS G;  5KA6 A;  1YJ9 V;  1J95 A;  1UJW B;  1YJW V;  1OCR C;  3B8M A;  5H6R A;  1F4N A;  3FB8 C;  3CCS V;  4X88 A;  3ABK C;  3CPW U;  4MTF A;  3LNM B;  5EC1 C;  3K08 A;  1AJQ A;  2LP7 A;  1ARO P;  2WLM A;  4L87 A;  3VBB A;  4ASU G;  3NXS A;  1AJP A;  1NKD A;  2ZD9 A;  4BAY A;  1KP3 A;  1QR9 A;  2BOC C;  2FTK A;  5H6Q A;  3RVZ A;  2HLD G;  3LSS A;  1F23 A;  1XL4 A;  1GM8 A;  2Y69 B;  2JEU A;  3K3W A;  4WFB V;  3CCV V;  3K0G A;  1L1F A;  1EZJ A;  1AI4 A;  4QE7 A;  1K7D A;  5EBW C;  4JAU A;  4G2K A;  1BL8 A;  1OHH G;  5KA5 A;  3CXC U;  1MG1 A;  3K9A A;  4P30 A;  3MD0 A;  1FXK C;  2WAM A;  1PL0 A;  3F7Y C;  2WLN A;  2Y48 A;  5LGN A;  1GO3 F;  4RAI A;  4HYO A;  1P7B A;  3SPJ A;  1KEC A;  4MTO A;  1F4M A;  1GM9 A;  2Z3Y A;  3SJQ C;  2JDI G;  1THZ A;  5L3D A;  2D3O W;  1K8A W;  2EIM B;  3R65 A;  3ZMT A;  4FIP C;  4WCE V;  1Q81 W;  4YXW G;  1S77 D;  2NNU A;  3RVY A;  4UVB A;  4X8A A;  5B1A B;  3EHB B;  3TK1 A;  1ORQ C;  3ABL C;  1OCC C;  1KQS U;  1BHB A;  3W7S A;  5IY5 B;  1I5X A;  5DN6 G;  1ENV A;  4WFH A;  2IU3 A;  1QVG U;  3CYO A;  2JJ1 G;  2BOB C;  3SYQ A;  4UV8 A;  1JPX A;  2EJR A;  2DWD C;  3E83 A;  2XND G;  1M90 W;  4JF3 A;  1OCO B;  2QM8 A;  3OR6 C;  3SYC A;  2XAS A;  3OMI B;  2P7T C;  4MVQ A;  2EIK C;  3UKM A;  3FYI B;  4E2L A;  3JD2 A;  3IC7 A;  4ZKI A;  1NH2 B;  1Q86 W;  5IYC O;  5CA3 A;  3E89 A;  1GK9 A;  2IW5 A;  1RPO A;  3ZMV A;  1G4Y B;  2KB1 A;  5FL7 G;  1AI7 A;  1M57 B;  2GHY A;  2WWW A;  2HVJ C;  2DQ0 A;  4FJC C;  4J9Z B;  4JAV A;  2P90 A;  5CMU A;  1DLB A;  5B1O A;  4LC1 A;  1LNQ A;  1VQN V;  4FK5 C;  2V7Q G;  3OUF A;  4MW8 A;  5LHI A;  2A0L A;  4RUF A;  1S72 V;  3AG1 C;  1TUE B;  4P9P A;  4TWK A;  3FB6 C;  3FB5 C;  3IGA C;  1XL6 A;  2V1D A;  1H2G A;  1VQ5 V;  3W7U A;  3OE7 G;  1RM1 C;  3T4Z A;  3H01 A;  2JIZ G;  1NBM G;  3FYE B;  3CCM V;  3OR7 C;  4P9O A;  1YSC A;  3SPH A;  3E8H A;  3SPI A;  1W2B U;  3JCZ A;  3G71 V;  3ZN0 A;  1JX9 A;  1Y4M A;  1VQL V;  5IDJ A;  1YIT V;  1VQP V;  1R3J C;  1CPY A;  1KC8 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...