4JF3A

Crystal structure of the mpmv tm retroviral fusion core
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
90
structure length
90
Chain Sequence
TQYTKLSHQLISDVQAISSTIQDLQDQVDSLAEVVLQNRRGLDLLTAEQGGICLALQEKCSFYANKSGIVRDKIKNLQDDLERRRRQLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Beta- and gammaretrovirus fusion proteins reveal a role for electrostatic stapling in viral entry.
pubmed doi rcsb
source organism Mason-pfizer monkey virus
molecule tags Viral protein
molecule keywords Envelope glycoprotein
total genus 40
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jf3A00
1MG1A 3H01A 3P30A 1QR8A 1ENVA 3WFVA 2OT5A 3MHSC 3GWOA 1K33A 1K34A 1I5YA 1MOFA 1SZTA 3CP1A 1QBZA 2X7RB 5KA5A 2EZPA 4FK5C 3B8NA 4N23A 4G2KA 5H9CA 1DF4A 3CYOA 4JGSA 4JF3A 4N21A 4E2LA 1Y4MA 1EBOA 1QCEA 1DF5A 3B8MA 2MK3A 3K9AA 4FIPC 5HFMA 3MHHC 5CN0A 5HFLA 2EZOA 3M99B 2M7WA 5KA6A 1F23A 2LP7A 1I5XA 1QR9A 3B77A 1JPXA 2EBOA 1DLBA 1Y66A 4FJCC 4JPRA 5CMUA 1JQ0A 2P6JA
chains in the Genus database with same CATH superfamily
3R65A 5B3SC 4OPAA 3RBZA 1M57B 3OFNG 4N21A 3STZC 4YJ2A 1HNXO 1K5QA 4TT3G 2CK3G 1JCHA 3CX5F 2M7WA 2RDCA 1KKDA 5EZYA 4FM0A 2EILB 1WAZA 3DXRA 2DW4A 3CCVV 4LF7O 3OT7A 2IJKA 2IW5A 3VBBA 1V55C 2ITDC 4JAVA 4CC6A 1JJ2U 4UCOA 3RYHB 2GHYA 1VQ5V 1QNMA 3B4SA 2XOKG 4KHPO 1WN7A 2ZXWB 4X64B 3AG3B 1NBMG 4O2BB 1GK9A 5BR8O 5JCOC 4B3MB 5KHKA 1BGYH 4JPRA 3O9OA 4UB8Z 2FB5A 3CE2A 3BCCH 4DV7O 1VQ7V 2HFEC 3GWOA 2C2AA 5C8YA 3SJBC 2HP8A 3E8HA 5JVDA 2LFSA 3WB1A 3F7VC 4X1IA 1AI7A 1OCCC 2VQFB 4PDMA 2XHBA 1EN6A 5EBWC 1QLEB 4JYBA 1G8MA 2QSAA 4X1KB 5FPOA 2XUMA 5B1AB 1EM1A 4QIWF 4J11A 3ZRSA 4AHCA 4ZHQA 1N0NA 3BFRA 4X89A 1I08A 3Q4HA 2EZPA 4IYHA 2ADQB 1EZJA 4LNUA 1L0NH 2CTRA 4JI1B 2DOSA 5KUKA 1PV0A 5DEDA 3K57A 4FLWA 2UXCO 4JI7O 2NN4A 4JYYA 3ASOC 5B1OA 1PD3A 1E79G 2FL4A 4UCSA 2Q7EA 1PNKA 4TUYB 4PDVA 3OGCC 3SPJA 4FMTA 4IHJB 1SQVH 4FK5C 1Q6HA 3APOA 3K5NA 1NVPD 5JQGA 2E76B 1SQGA 4KUMA 3UKMA 4JTCB 2XAJA 4DR7B 1K73W 5L3DA 2PGGA 3DSQA 5IJ0B 3CXCU 4AQYB 3I55V 4FLXA 1KECA 2QDOA 1CP9A 1URFA 4D6TH 1GO3F 4XDKA 4NXNB 4E2LA 1Z5WA 4UCUA 1ZLZA 3SDLA 4WF9V 3E35A 2QTOA 5HFLA 2ZINA 3FX7A 1NH2D 1RM1C 2QTSA 4DV1B 1PKXA 3K0GA 1ZWIC 5CMUA 4HAMA 4O2AB 4PJ0Z 3CXHF 2JVDA 2W0FC 4MT8A 4PA7A 4JI3B 2ZKOA 3ZMSA 3ASOB 4X1IB 3T4ZA 1VMGA 2E5LO 4GYCB 5IT9N 1F51A 3CWBH 1QQCA 3D8CA 1KQSU 1XBLA 2WPDG 2YEVA 1NTMH 1UFIA 2A79B 1XMQO 3ZHUA 4PD4F 2IBZH 5EIBD 3JARB 3IC7A 3CC2V 3IGAC 5FPRA 3K5OA 4R8CA 4DR1B 2OTJV 4J7KA 2R70A 1IXMA 3HKBA 2OCCB 1M90W 4DV0B 2EIMC 3N2GB 4LR3A 3SPHA 2ZR3A 1IXBA 1CPYA 4QPJA 1FXVA 1Y76A 3FB5C 2EINB 3ZHRA 4EEQA 2H8PC 1BE3H 3UT5A 4JGSA 4H0LB 2WWWA 2GUZA 1SRYA 5LHIA 5GONA 2WA4A 1JFFB 4X62B 2QKCA 2PYJA 4B3SB 2HVJC 2F93B 4O2AA 4MVOA 5EIBC 4JI2O 3OEEG 3AG4C 1HR0O 2Z0AA 1FJGO 2PI5A 4GX5A 5J2TA 4K8XA 3CEIA 2DN9A 2VQFO 1IVSA 1Z5VA 1FS0G 4TQFA 4B3SO 4X1KA 2WLKA 3P32A 4J7JA 3AG2B 2X6BA 1S72V 2P6JA 4I55A 4I9QA 4BR6A 5K1XA 1FAFA 2CH7A 5EK0A 1Q6UA 5KMGB 3KZIZ 1XDCA 4ZI7B 4IHJA 1E1QG 5IYCO 5BY1A 3H1JH 4DV4O 1D5AA 2JIZG 2YS8A 4DR1O 4ZOLA 4PA9A 5JJJB 4HBNA 1YDXA 4X66O 1AR5A 3SJAC 3VQWA 5IJ0A 5FLXN 2UUCB 5H6QA 1M9NA 2ZNIA 5EC1C 4YY3B 3MHHC 4TV9B 1N4CA 3EHBB 5C8YB 2Q0OC 4DR7O 1E1RG 1HR0B 4H44B 3J80N 3AG7A 3CRMA 1OV9A 4LP8A 5CA0A 2QWOB 3T2MA 4FFKA 1R3KC 4X20A 4DRXB 3C90A 1EBOA 3N27A 4LFBO 2QWQB 4GX0A 4FLZA 4I5SA 2XT9A 4J80A 4WBNB 2YI8A 3H1IH 3L73H 3QF7A 1JQ0A 1PL4A 1VEWA 2UXXA 4K3AA 2JK5C 2CDYA 3UQ8A 2LW1A 1Q5OA 3SPIA 4PV1B 2B1GA 4PHZA 4DUYO 4LFCO 1F4NA 4LBEC 3EVKA 1NU1H 2Y69C 2Q67A 2LJ2A 2A3QA 3LNNA 3JASB 2YUAA 3AK2A 2FTKA 4DUZO 2VWJA 3LDCA 3TXSA 1GN2A 2ZIMA 2IJJA 3KG2A 3CCQV 2DWDC 5B1NA 5KHIA 4YIPA 5IWAB 4RQEA 3RVYA 2PZSA 1K4CC 3X2QC 3UM7A 3SGIA 5BR8B 2OYQA 4Z1MG 3FKSG 5IYZB 4JI3O 2NLJC 4DR4B 4OXSA 1FD9A 2CTWA 3JSNA 3A8TA 3CCLV 3IC9A 2JJ1G 2WLNA 3UT5B 4O4JA 1QCEA 2CAZC 3UO3A 3JSLA 3JD3A 1SA0A 2ZT9B 4DR2B 5LXTB 2UXDO 2Q4PA 4JTAB 5EYPA 4TWKA 4HNAB 4JI7B 3B8NA 1Q7YW 1GM8A 4AQYO 3K04A 1SQPH 4K8ZA 3ZJZA 1RP3B 1B6QA 4JI4O 3K08A 2RNBA 3CMAV 1TGOA 3ZRWB 2K9PA 5JH7B 2OIGA 2EINC 4FLUA 3M8AA 3F7YC 1W59A 5IYZA 2EIJC 1Q90D 1Y67A 1ZSPA 4KHPB 4J42A 2CTQA 2QM8A 3RYIA 1HDJA 3K06A 4DR4O 3J7AU 2X6AA 3ASNC 4GT1A 5JQGB 1N33B 1AROP 2YIBD 4K35A 1K33A 4MVSA 2Z3YA 5LGUA 2ZR2A 2R9IA 4JYCA 3RGBA 1JX9A 2OIEA 4TV8B 2VQEB 1P49A 5KUMA 1IBKB 2OTLV 4FLTA 3JAWB 3CCRV 4WFGA 1KMIZ 4PA3A 1VQNV 4IIJB 3N2KA 2YXHA 4JASA 1XMOB 1B06A 4JI4B 1TA8A 2RJZA 2YI9A 1Y74A 4CH5A 1N32O 1BHAA 2HR3A 1U96A 1YTFB 1O9HA 2UUCO 4LCUC 4RAIA 3FFQA 3OEHG 1NS1A 2AGAA 4B7EA 4YHHB 3OGIB 5D5QA 3HKDA 1Q82W 2BSKB 3TXQA 4LF6B 3TGUH 3C3TA 1OCRC 4W4KA 2XAHA 1W0KG 5LHHA 2BTQA 1KB9F 2Q7HA 5KA5A 1AB3A 2H94A 4E4EA 4MVRA 3CC7V 1FPOA 4JF3A 1GRJA 2W6IG 3BY6A 1KC8W 4ZHQB 3ZRVA 5LGTA 2R9AA 2WLJA 3ZMTA 4NVPA 2F23A 2ZM6B 2LW7A 1NKDA 3FB7C 3RYHA 4DR5O 2GTSA 3LDDA 3TCUA 3CP1A 4BW5A 4I4TA 4N23A 1JR9A 3LDEA 3K59A 4XDJA 3MAQA 1ZTEA 1AI6A 4LF7B 1PNLA 3E8GA 5TISZ 2HJFC 3SPGA 1RSOA 4ZBMA 2MK3A 3T1YO 1J5EB 2EZOA 4DR6B 1K8AW 4R7CA 3JALB 3JASA 3SYAA 4IGGA 3H01A 4TUYA 2BSKA 1G6UA 4AILC 2UUAB 1ZX3A 3OTOB 4JI8O 3E86A 1D5NA 4X64O 1HW7A 4X88A 4A5UB 1ZL8A 2EIKC 2W6JG 3OTFA 4RUEA 2QR4A 1AVMA 2EJ7A 3ABLC 3ZHTA 4GKJB 4QE7A 3L71H 5LYJB 2FMLA 2Q6AA 5CBGA 3ABMC 2HLDG 4WFEA 4X65B 1H2NA 1UPGA 1SETA 4O4HA 2NNUA 1MMMA 5DECA 5B1BC 1IBMO 4B3TB 1Q43A 1H2SB 1OCOB 4BW9A 1V9PA 1K97A 2P4KA 4AI8A 1VQMV 5BXZA 3DTUB 4ABMA 5B1AC 5LP6B 2DE0X 1CXZB 4JV5B 1AJNA 4YXWG 4UV9A 1YIJV 2F66C 3CSXA 1N0JA 1L1FA 1XOUA 4B3TO 3GB7C 4JZ2A 1G4YB 3J81N 2YC0A 2DWEC 4UCVA 3CJHA 2M6YA 1XL6A 4J9YB 3S3XA 1VF7A 1PL0A 2ZXWC 1IBLB 2AZ2A 1JMKC 2B9ZA 4R6ZA 1FXHA 3CPWU 2YICA 2JDIG 3ZMZA 3ABLB 1THZA 1UJWB 5CA1A 2KG7B 4PI0A 1IZ3A 4JYAO 4XBFA 2WA3A 3H1LH 1F23A 4X62O 4X65O 2Q8VA 4K0KO 1XHZA 1FFXA 3ABMB 4F6RB 4L87A 5KHGA 2RMKB 1KD1W 3OR6C 4BAYA 1AI4A 1NQTA 5BZBA 5EBLC 5LA6B 1AR4A 1COWG 1TVKA 3EXAA 1XL4A 1OZ0A 2LO1A 2CE4A 4Z2WA 4DV6O 4JV5O 3ICXA 2EULA 2XAGA 2ITCC 3JAWA 3VOUA 1IBMB 4UFZA 1WB8A 1KKCA 3QNEA 2X0LA 2E74B 2ZE7A 2JGDA 4LF4B 1K34A 3CJHB 1J95A 1EN5A 5KAIZ 1V54C 2ZNJA 2DYRB 3SR2C 1ZAUA 3ABKB 3D3IA 2QWRB 4BWAA 1N32B 5HFMA 5CA1B 4B3MO 5CN0A 5KAFZ 1BHBA 1H38A 4KFMA 5LMUB 4DR3O 5FL7G 4FLYA 1BQZA 1AILA 1BMFG 2GTAA 1MG1A 3FYEB 3E89A 3CHXA 1AJPA 4D7TA 4MS2A 5B3SB 3CYOA 1XHXA 1SF9A 3JATA 1K3EA 2YIBA 4X66B 3OMIB 1B3QA 3ZRXA 3QTCA 4DK0A 2L6LA 1G1XB 3B2EE 5LP6A 4DV0O 2HHHB 1WP8A 4DR6O 1YXBA 3CB2A 4B7KA 3IAYA 3ABTA 2PI4A 2E5LB 4UVBA 4MW3A 1A32A 4I55B 1O9GA 2QWNB 4NTXA 5LMNB 1I7FA 1DTOA 3B77A 1R6TA 3RN4A 1HWYA 1WB7A 2YIAA 4CS3A 2Q0AA 1VQPV 1V54B 4ZIBA 3CRQA 2DYRC 3MHSC 2EIMB 4CH6A 3I56V 3T1HB 2WLMA 1NZ6A 3DC5A 2BOBC 2WLHA 4KXRA 3OAAG 5JJNB 3AK3A 5F2VO 5J2UA 4FZ1A 5A2QN 2A06H 3BVOA 5IJ9A 4X8AA 2VWKA 3K9SA 1OCCB 4LF8B 2DQ3A 2WLLA 4O4LB 5B66Z 2Q5ZA 3GVMA 3PN1A 1R6NA 2UXBB 5GONB 5AG2A 1S76D 2B5UA 2ZE6A 2Y0IA 3HKEA 3HKEB 3OM3B 2DQ0A 4QE9A 3L70H 2D3OW 3ZHSA 1YJNV 4GZRB 5LMNO 4I4TB 3F5TA 3OD4A 4DYLA 3JATB 4GX2A 4DUYB 3K0DA 3BHPA 4TV8A 5JWPA 2JGDB 3AG2C 2Q68A 2DYSB 4EFEA 1NI8A 1XI1A 1OHHG 4LWSB 4WFHA 3JCZA 1IX9A 5EZYB 4O2BA 4FLVA 2KQXA 2F4VO 2BE3A 3HR0A 3C3SA 3A0BZ 3ZEDA 1W2BU 3RYIB 4I0XA 5D5PA 5CBFA 4DRXA 2OWOA 4F6RA 1YJWV 2UXDB 1BL8A 3ML0A 5CA0B 4MTXA 4U3FH 4JI8B 3RYCA 2A0LA 3T1HO 3U11A 2XAFA 3D36A 1WPBA 2QGNA 1QVGU 4LF5B 3OMAB 2QE7G 2WLIA 1OJHA 2ZE5A 4NXMO 2IJHA 1I5YA 1XREA 3AG1C 4Q6GA 2QKAA 1N34B 1FXKB 4FPPA 4DV7B 2EX3A 1MSDA 4P2ZA 3AK1A 3E83A 3T4DA 4DV5B 5JJEB 1YHQV 2Y0PA 3K5LA 1H8HG 1JVMA 1SQQH 2Q7GA 3ZIAG 3P3PA 1VF6C 2F4VB 4HYOA 2KG7A 4PI2A 5KMGA 2JGUA 5LOVA 1L8DA 1GH6A 1I0HA 3A2FA 4TQDA 2LGWA 4I50A 4J9ZB 2UUAO 3IJ4A 4O4JB 4C7UA 1IDSA 1OCZB 3EFFK 4DK1A 4O4IB 4DV5O 3LNMB 5IY5C 1MNGA 2EBOA 3QO5A 2N05A 4QJFB 1KU9A 1M56C 2PY5A 1N34O 3QO8A 4TSFG 5J2UB 3H9VA 2X7RB 1GMGA 2ADPA 2XAQA 1QU7A 5BMVB 5BMVA 1AI5A 1SZXA 2PF4E 2UU9O 4Q20A 4DR2O 4JI0O 3JD4A 1R3JC 2AZ0A 2WAMA 4FFBB 3IFXA 1V55B 1M57C 2ETNA 5GW7A 1QR8A 1AJQA 2P22C 2ZDIA 3ETGA 4NYKA 3JD2A 1XNRO 5JVDB 1DGSA 4EB6A 4G28B 1MZFA 1BT8A 2JRIA 5LOVB 4X1YA 1VF6A 2Q9LA 3AEIA 1GN4A 4WFFA 1HNXB 1GM9A 4FJCC 4FM1A 4PA6A 3SYPA 4LF8O 3WFVA 3A0RA 3OUFA 4KL1A 1GAXA 4IL6Z 2IH3C 5LHGA 1NTKH 3RT3C 1LUVA 3AG3C 4FIPC 1XMQB 3ZCCA 5H2FZ 1IURA 3DXRB 3HB3B 3R66A 1TUBB 1AR1B 3K3WA 3HPLC 3M7MX 1RSOB 4DW1A 3L74H 3JD0A 1WJZA 1MA1A 4U3JA 2BCCH 2JS5A 1ROPA 2YXYA 3HKCA 1HNWO 3HKDB 3ZBHA 2WLLB 2ZDIC 2EIKB 5CB4B 2P06A 1NR7A 1YITV 4BIUA 4JZGA 4P9OA 1XEQA 3U10A 3RWRD 2N74A 1BZKA 3L9DA 4DV3B 2Y48A 3ASNB 3W7WA 1WLEA 4X1YB 2BTOA 2HVKC 4LH6A 4CH4A 3JAKB 3FAVA 3D36C 4JI1O 3B09A 3G71V 1BS3A 5CB4A 5KX5B 4J41A 1BSMA 5IDJA 4JAAA 3RVZA 4R50A 4F6EA 2ATKC 4ZOLB 4LC1A 4WCEV 3UCSC 1S0VA 3D3QA 1IBKO 4I50B 4MVUA 5H9CA 3FD9A 1QVFU 1Q81W 1RFYA 1GN3A 4EB6B 1GKFA 3VQXA 1Q86W 1HNWB 2EILC 3WB2A 1GN6A 4YHHO 3CRCA 3JD1A 2Y4UA 3MDSA 3CCSV 2HJDA 4UB6Z 1I94B 4RWUA 1VQ8V 2Q69A 3ZN1A 1Y6XA 2WLIB 2ARHA 1FYJA 2OCHA 4GUNA 1N36B 3BAAA 5H6RA 4UV8A 1WA8B 2AHZA 3P3NA 3AG1B 2P4VA 5EYPB 4OGQB 1JFFA 3GWKC 1QBZA 1VQ6V 1OCRB 2RCVA 3H1KH 1PNMA 4O4HB 1AP5A 2OCCC 2VS0A 3G4SV 1HNZO 4GKJO 3TETA 2CGNA 1TUEB 1KYOF 1L0LH 2YDEA 3FB6C 3K5MA 2AHYA 2JS3A 3OUSA 3O65A 4UVCA 4P30A 1VIBA 2RQ6A 2ZE8A 2VQEO 3WG7B 1Q3EA 2QJ1A 1HNZB 3B8MA 3K9AA 2P67A 5B1BB 3JARA 4MSWC 4I0XB 1OCOC 3A0HZ 2KKWA 3ZX6A 4YJ3A 1XMOO 2UUBO 3B40A 4GCZA 1WNSA 2VRZA 4RO2A 3LSQA 1YF2A 5K1PA 1N36O 2R72A 4FVMA 2N04A 3TJTA 2P5OA 5ITZA 4MTGA 2PYLA 1EZVH 3STLC 3CRAA 3RFRA 3SJCC 5KHJA 1FXKA 3CCMV 1JA8A 2PTMA 2YXLA 1SS3A 1VQOV 2IU3A 1NTZH 3JAMN 3E8BA 4G2KA 5LP6C 1SESA 3WB0A 3UO2A 1LNQA 3JYCA 2BTQB 5KA6A 2KSDA 4UCTA 4NXMB 1ZL8B 1DLBA 3CS5A 2YSUB 4BIZA 2GUZB 5LXTA 1R73A 3WG7C 3APQA 2AXTZ 2QM7A 4PELA 1M5IA 3LSSA 1Y76B 4LFAB 5FNVA 3G67A 4JI0B 3JAKA 2AW9A 4LNUB 4JI6O 5DM6V 1RM1B 1KBHA 1H8EG 3BA8A 3VQVA 4LWSA 1VARA 3LSUA 1I5XA 3KCYA 3H1HH 4U7OA 3RW0A 5LBQA 2JJ2G 5IYBO 5KX5A 1VQLV 2XASA 4H13B 1SZTA 4UVAA 5LMUO 4DR3B 2QKSA 1DF4A 1K5SA 4NB5A 3I5DA 1DF5A 1U97A 4DV2O 4YIOA 1QHTA 3RYFA 4MVQA 3ZHQA 2V4DA 4ZI7A 3T1CA 4NTYA 1K9MW 4JI6B 1M93A 4F4LA 4P9PA 4UCRA 2Y69B 4MVMA 4JAUA 1HP8A 1KP2A 2XNDG 1QLEC 1TAEA 1YEWA 4ASUG 4JI5B 1NH2B 4GX1A 2QA4V 3W7UA 1QR9A 2UXBO 1PM9A 1YJ9V 4MTFA 1TUBA 3QG5A 5J2TB 4PDLA 2LQTA 5IWAO 2YIDA 4IT5A 3W7TA 5FNVB 3L72H 2DMXA 1ORQC 4W4LA 3OR7C 2CUGA 1US6A 1MABG 1SC5B 3ABKC 4OX9O 2HEPA 3VQYA 4X20B 4U3JB 2UXCB 3JALA 1VQKV 4NR1A 3W7SA 1ENVA 5L3EA 1NT2B 1H2GA 1R1BA 1B04A 1S5LZ 2CH7B 4MVZA 4FZ0A 1H2KA 1S5JA 3N2GA 4IIJA 4DUZB 1WP7A 1LUWA 1FXKC 1NVPB 1S5HC 4DXWA 2HHHO 2DJVA 5IYDO 1K92A 4OPHA 5LGNA 4NTWA 3S3WA 4B3RB 5J9PC 3F5WC 2P90A 3AG4B 5C93A 5E1AC 4X9QA 1Z2GA 4CBCA 4EKWA 5KHHA 5JH7A 1YCIA 3PJSK 3CCJV 3ETQA 1YTFD 3G6EV 4J10A 4CZZA 4J7ZA 2D2CB 1H2MA 3FYIB 3QO7A 1OCZC 2EIJB 5H5NA 1I94O 4RQFA 1DK1A 3E22A 5CA3A 2Y4TA 3ZMUA 3LUTB 4ICGA 1Y74B 2LFRA 3WU2Z 3MD0A 1Q8IA 3L75H 3E2EA 1XNQO 1ZUQA 2HKOA 5KLVH 4LF4O 4YJ3B 2O57A 2GV9A 1YSCA 2GSMB 3NR7A 2XTAA 3G80A 3ZN0A 2K1EA 2L35A 3OW2U 4LFAO 1P7BA 4IYIA 4MW8A 2X6CA 5ITZB 2ZQMA 1VQ9V 2IM9A 3BPZA 1W0JG 4LFBB 2DYSC 2ZCEA 3SYQA 4CC5A 3OMNB 3CD6V 1RPRA 2Q73A 4LFCB 2E3CA 2ZIOA 2OT5A 3HKBB 3JCUZ 1XUQA 1X4TA 4DV2B 1Y4MA 4O4LA 3CCUV 2QEXV 4WFAV 5B5EZ 1FFTB 1BQ0A 2A9HA 1FJGB 1GTOA 1K7DA 2HG5C 1R3IC 1AP6A 2V1DA 3CRRA 1JPXA 2ILMA 2JEUA 3FAVB 1MSWD 4BIOA 5E79Z 4DV3O 5LYJA 3P30A 1IBLO 1NR1A 1T5EA 1SERA 3G6BA 3W7XA 3BRCA 2YEVB 1X59A 1P4RA 4JI2B 4CS2A 1EN4A 2GDSA 5LL6Y 4GKKO 3SPCA 1YI2V 1N8RW 2F1MA 2Z5UA 5EBMC 3ETDA 1M1KW 2NR5A 4D7SA 3NXSA 2R9RB 1SA0B 3HKCB 2W0XA 2P7TC 4RUFA 1XQ8A 1FKAO 1JJOA 4DV1O 1BCCH 1MOFA 3ZMVA 2JEXA 3DGEA 4NKGB 1KUQA 4QPKA 1SQFA 4L8JA 1P84F 4LF6O 1VF5B 2UUBB 1R6KA 3KCXA 3X2QB 2IU0A 3E8FA 2H3OA 3DC6A 4DV6B 1Y66A 2BOCC 4LF9O 2PUSA 1PP9H 2MW2B 4WFBV 4DV4B 4K0KB 5IY5B 3U0ZA 3CC4V 2CTPA 2ZM6O 1R3LC 5GTHZ 1VQ4V 1NJIW 1MZEA 3K03A 3SYOA 4Z1VA 4G27B 2KB1A 1PPJH 3BA9A 1XNRB 2A7WA 2RN9A 3CCEV 2ODMA 4WBNA 4FM2A 4YY3O 5L3BA 4YJ2B 3ZS8C 4LF9B 5CBHA 4PA4A 2IJIA 4QNHB 2CGOA 1S3JA 1LR1A 2G38A 1H2LA 3OTOO 3BABA 4FFBA 5L3FA 1N33O 2B1IA 2UU9B 3SJQC 4LF5O 4I9WA 4PDRA 5EC2C 4HZ3A 1F4MA 3Q4HB 4EFBA 3ZRWA 5A9GA 3ABUA 2GBOA 3T1YB 1J5EO 3CMEV 3KKYA 1D2DA 2FKXA 4GKKB 3N2KB 1CEZA 3QVNA 1K4DC 5JCOA 3RYCB 1QLNA 3THOA 1Q6IA 5GTIZ 4GLXA 1P7GA 3M99B 4O4IA 1XNQB 1SQXH 1YVWA 2LP7A 3ZHVA 3TK1A 4ZKIA 1WA8A 4U7NA 1WPXA 3ETEA 1RPOA 4MTOA 3RYFB 3OE7G 4TV9A 1GM7A 2FYUH 5DN6G 1TVKB 4OX9B 1YZBA 4DO2A 4H37A 1M4UA 4NXNO 2F43G 1EFRG 5IE9A 4H33A 1FFXB 2QM4A 3E22B 5L3CA 4DR5B 4CH3A 3K79A 1JOYA 4CS4A 4DW0A 4JYAB 1F7YA 4JI5O 1S77D 4B08A 3FB8C 4UXNA 5L3GA 2UXNA 4B3RO 4TOIA 4I7ZB 4HNAA 1KP3A 2LGQA 3SYCA 1SQBH 1VP7A 2EJRA 2IH1C 4KP4A 2E75B 1M56B 5IJ9B 2F95B 1XILA 2ZD9A 4QGPA 1SKVA 4UUJC 2V7QG 3BEHA 4JTDB 3K58A 4LH7A 5LA6A 2WSSG 2QWPB 4XDLA
chains in the Genus database with same CATH topology
3R65A 2JJ2G 5B3SC 4GX2A 3RBZA 1M57B 5IYBO 4JTAB 3K0DA 1VQLV 2XASA 3OFNG 1SZTA 4TWKA 4UVAA 3AG2C 2Q68A 2DYSB 2QKSA 3B8NA 1DF4A 1K5SA 4N21A 3STZC 1GM8A 1Q7YW 1DF5A 3K04A 1K5QA 3ZJZA 4TT3G 2CK3G 4MVQA 1JCHA 1OHHG 1B6QA 2M7WA 3K08A 4WFHA 3JCZA 3T1CA 3CMAV 1KKDA 3ZRWB 2EILB 2DW4A 3CCVV 2EINC 1K9MW 2IJKA 3F7YC 2IW5A 1W2BU 4F4LA 2EIJC 3VBBA 4P9PA 1V55C 5CBFA 2ITDC 2Y69B 4JAVA 4MVMA 4JAUA 1JJ2U 1YJWV 1KP2A 2GHYA 2XNDG 1VQ5V 1QLEC 2XOKG 1BL8A 3ML0A 2ZXWB 4ASUG 2QM8A 4MTXA 4GX1A 3AG3B 2QA4V 3W7UA 1NH2B 1NBMG 2A0LA 3K06A 1QR9A 2XAFA 3D36A 1GK9A 2X6AA 3ASNC 4GT1A 1YJ9V 4MTFA 1QVGU 3OMAB 4JPRA 4PDLA 2QE7G 2WLIA 1AROP 1VQ7V 2HFEC 2IJHA 3GWOA 2C2AA 4MVSA 1K33A 1I5YA 3W7TA 3AG1C 2Z3YA 5LGUA 2ZR2A 2R9IA 3E8HA 4JYCA 2LFSA 1FXKB 3F7VC 4FPPA 1ORQC 1JX9A 1AI7A 1OCCC 3OR7C 4PDMA 1MABG 4P2ZA 3ABKC 3E83A 5EBWC 1QLEB 3T4DA 4JYBA 5KUMA 2OTLV 1G8MA 3CCRV 1YHQV 5B1AB 1H8HG 1JVMA 4WFGA 1VQKV 4PA3A 4QIWF 3ZIAG 1VQNV 4HYOA 3W7SA 3ZRSA 1ENVA 4JASA 5L3EA 4X89A 1H2GA 2EZPA 4J9ZB 1EZJA 4MVZA 1BHAA 2HR3A 5KUKA 1YTFB 1OCZB 3EFFK 1FXKC 1NVPB 4LCUC 4RAIA 3ASOC 1S5HC 3LNMB 5B1OA 4DXWA 3OEHG 5IYDO 1K92A 5LGNA 5IY5C 1PD3A 2EBOA 1E79G 5J9PC 3QO5A 3F5WC 4QJFB 2P90A 1Q82W 3AG4B 5C93A 1M56C 1PNKA 5E1AC 1OCRC 4PDVA 2XAHA 3OGCC 3QO8A 4TSFG 1W0KG 5LHHA 3SPJA 4FMTA 4CBCA 2X7RB 1GMGA 2XAQA 4EKWA 5KA5A 4FK5C 2H94A 3PJSK 4MVRA 3CCJV 3CC7V 4JF3A 2W6IG 3BY6A 1NVPD 1AI5A 1YTFD 4Q20A 3G6EV 1KC8W 4KUMA 3UKMA 4CZZA 3ZRVA 3JD4A 1R3JC 3FYIB 2XAJA 4JTCB 5LGTA 2WLJA 3ZMTA 3QO7A 1OCZC 1K73W 2WAMA 5L3DA 2EIJB 1NKDA 4RQFA 3IFXA 1V55B 1M57C 3CXCU 5CA3A 5GW7A 3FB7C 3I55V 1KECA 1QR8A 3LDDA 1AJQA 1CP9A 3ZMUA 3LUTB 3ETGA 2ZDIA 3TCUA 3CP1A 1GO3F 4XDKA 4BW5A 3JD2A 3LDEA 4N23A 4XDJA 4E2LA 1AI6A 2LFRA 3MD0A 1PNLA 3E8GA 3SPGA 2HJFC 4WF9V 4G28B 4ZBMA 2MK3A 2QTOA 3E35A 3E2EA 5HFLA 2EZOA 1NH2D 1K8AW 2HKOA 1RM1C 4R7CA 3AEIA 1PKXA 4WFFA 3K0GA 1YSCA 1GM9A 1ZWIC 2GSMB 4FJCC 5CMUA 4HAMA 3SYAA 3H01A 4PA6A 3SYPA 3WFVA 3ZN0A 2K1EA 3OW2U 2W0FC 1P7BA 4MT8A 3E86A 4PA7A 4MW8A 2X6CA 4X88A 3A0RA 3ZMSA 3OUFA 3ASOB 3T4ZA 2EIKC 2ZQMA 2W6JG 2IH3C 5LHGA 4RUEA 1F51A 3AG3C 1VQ9V 1W0JG 4FIPC 1KQSU 2WPDG 2DYSC 3ZCCA 2YEVA 3ABLC 3SYQA 3HB3B 3OMNB 2A79B 3CD6V 1RPRA 1AR1B 3K3WA 3HPLC 4QE7A 2OT5A 2Q6AA 5CBGA 3ABMC 2HLDG 4WFEA 3JD0A 3IC7A 3CC2V 1SETA 3IGAC 1ROPA 4R8CA 2NNUA 1Y4MA 3CCUV 2WLLB 5B1BC 2QEXV 2ZDIC 2OTJV 1OCOB 4WFAV 1FFTB 2EIKB 2A9HA 1NR7A 1GTOA 1IXMA 1K7DA 2HG5C 1YITV 1R3IC 4BIUA 2OCCB 2V1DA 1M90W 1JPXA 2EIMC 2JEUA 1K97A 1VQMV 1MSWD 4P9OA 3DTUB 3P30A 3SPHA 1NR1A 5B1AC 2ZR3A 2Y48A 3ASNB 3W7XA 1SERA 3W7WA 4QPJA 1CPYA 1WLEA 1FXVA 2YEVB 1AJNA 3FB5C 4YXWG 2EINB 4UV9A 2HVKC 1YIJV 2H8PC 1P4RA 4JGSA 1L1FA 2WWWA 3GB7C 1G4YB 3SPCA 1YI2V 1N8RW 1SRYA 5LHIA 3G71V 2DWEC 2Z5UA 5EBMC 3ETDA 4J9YB 1XL6A 5IDJA 1M1KW 3RVZA 2HVJC 4R50A 1PL0A 2ZXWC 3NXSA 2R9RB 2ATKC 2P7TC 4RUFA 4MVOA 4LC1A 4WCEV 3OEEG 3AG4C 1S0VA 1MOFA 4R6ZA 1FXHA 3ZMVA 3CPWU 2JEXA 3DGEA 2PI5A 4MVUA 2JDIG 4QPKA 5H9CA 4GX5A 3ZMZA 1QVFU 1Q81W 1GKFA 3ABLB 1Q86W 1THZA 1UJWB 1R6KA 3X2QB 2EILC 2IU0A 4XBFA 1FS0G 3E8FA 1F23A 2WLKA 3P32A 3ABMB 3JD1A 1Y66A 3AG2B 2X6BA 4L87A 1S72V 2BOCC 2P6JA 4WFBV 3CCSV 1KD1W 5IY5B 3OR6C 4BAYA 1AI4A 3CC4V 1NQTA 5BZBA 5EBLC 1VQ8V 1R3LC 1COWG 1VQ4V 5EK0A 1NJIW 1XL4A 2Q69A 3ZN1A 1OZ0A 3K03A 3SYOA 4G27B 2WLIB 2KB1A 3CCEV 1E1QG 5IYCO 5H6RA 2XAGA 4UV8A 5L3BA 2ITCC 3VOUA 2AHZA 2JIZG 5CBHA 3AG1B 4PA9A 3QNEA 4PA4A 2IJIA 4QNHB 2X0LA 1S3JA 1K34A 1J95A 1QBZA 1V54C 1VQ6V 2DYRB 1OCRB 1PNMA 3ABKB 2OCCC 3D3IA 3G4SV 5L3FA 5H6QA 3TETA 2B1IA 1TUEB 1M9NA 5EC1C 3SJQC 5HFMA 3MHHC 4I9WA 4PDRA 5CN0A 5EC2C 4HZ3A 1F4MA 3EHBB 1BHBA 1H38A 4KFMA 1E1RG 3FB6C 5FL7G 3ZRWA 2AHYA 3ABUA 3OUSA 1BMFG 3CMEV 4LP8A 1CEZA 1MG1A 3FYEB 4UVCA 3E89A 4P30A 1K4DC 3T2MA 1AJPA 1R3KC 1QLNA 4MS2A 5B3SB 3CYOA 3WG7B 1EBOA 3B8MA 4GX0A 3K9AA 2P67A 3M99B 5B1BB 4I5SA 1K3EA 4MSWC 2LP7A 1OCOC 3TK1A 3OMIB 4ZKIA 4U7NA 3ZRXA 4GCZA 1JQ0A 1WPXA 3ETEA 1RPOA 4RO2A 2UXXA 4MTOA 2JK5C 3OE7G 3LSQA 3SPIA 1GM7A 5DN6G 2B1GA 3ABTA 2PI4A 4MTGA 1F4NA 4LBEC 4DO2A 4UVBA 4MW3A 4H37A 2Y69C 2Q67A 2F43G 1EFRG 3STLC 1DTOA 4H33A 3B77A 1FXKA 1HWYA 1VQPV 5L3CA 1V54B 3CCMV 2FTKA 2DYRC 3K79A 1JOYA 3MHSC 2EIMB 1VQOV 2IU3A 3LDCA 3I56V 2IJJA 2WLMA 3E8BA 4G2KA 3KG2A 1S77D 3CCQV 2BOBC 2DWDC 5B1NA 1SESA 2WLHA 4RQEA 1LNQA 3FB8C 4UXNA 3OAAG 5L3GA 2UXNA 3RVYA 3JYCA 5KA6A 1K4CC 4X8AA 1KP3A 3X2QC 1OCCB 3SYCA 2DQ3A 3UM7A 1DLBA 2YSUB 2WLLA 4BIZA 1R6NA 2EJRA 1R73A 3WG7C 2IH1C 4Z1MG 3FKSG 4KP4A 2NLJC 2QM7A 4PELA 1M56B 4OXSA 3LSSA 1S76D 2B5UA 3CCLV 2JJ1G 2WLNA 2ZD9A 5DM6V 1RM1B 1QCEA 1H8EG 4UUJC 2V7QG 3BEHA 3OM3B 4JTDB 2DQ0A 4QE9A 2D3OW 1YJNV 1I5XA 2WSSG 4U7OA 3RW0A 3JD3A 4XDLA 5LBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG1 A;  3H01 A;  3P30 A;  1QR8 A;  1ENV A;  3WFV A;  2OT5 A;  3MHS C;  3GWO A;  1K33 A;  1K34 A;  1I5Y A;  1MOF A;  1SZT A;  3CP1 A;  1QBZ A;  2X7R B;  5KA5 A;  2EZP A;  4FK5 C;  3B8N A;  4N23 A;  4G2K A;  5H9C A;  1DF4 A;  3CYO A;  4JGS A;  4JF3 A;  4N21 A;  4E2L A;  1Y4M A;  1EBO A;  1QCE A;  1DF5 A;  3B8M A;  2MK3 A;  3K9A A;  4FIP C;  5HFM A;  3MHH C;  5CN0 A;  5HFL A;  2EZO A;  3M99 B;  2M7W A;  5KA6 A;  1F23 A;  2LP7 A;  1I5X A;  1QR9 A;  3B77 A;  1JPX A;  2EBO A;  1DLB A;  1Y66 A;  4FJC C;  4JPR A;  5CMU A;  1JQ0 A;  2P6J A; 
#chains in the Genus database with same CATH topology
 3R65 A;  5B3S C;  4OPA A;  3RBZ A;  1M57 B;  3OFN G;  4N21 A;  3STZ C;  4YJ2 A;  1HNX O;  1K5Q A;  4TT3 G;  2CK3 G;  1JCH A;  3CX5 F;  2M7W A;  2RDC A;  1KKD A;  5EZY A;  4FM0 A;  2EIL B;  1WAZ A;  3DXR A;  2DW4 A;  3CCV V;  4LF7 O;  3OT7 A;  2IJK A;  2IW5 A;  3VBB A;  1V55 C;  2ITD C;  4JAV A;  4CC6 A;  1JJ2 U;  4UCO A;  3RYH B;  2GHY A;  1VQ5 V;  1QNM A;  3B4S A;  2XOK G;  4KHP O;  1WN7 A;  2ZXW B;  4X64 B;  3AG3 B;  1NBM G;  4O2B B;  1GK9 A;  5BR8 O;  5JCO C;  4B3M B;  5KHK A;  1BGY H;  4JPR A;  3O9O A;  4UB8 Z;  2FB5 A;  3CE2 A;  3BCC H;  4DV7 O;  1VQ7 V;  2HFE C;  3GWO A;  2C2A A;  5C8Y A;  3SJB C;  2HP8 A;  3E8H A;  5JVD A;  2LFS A;  3WB1 A;  3F7V C;  4X1I A;  1AI7 A;  1OCC C;  2VQF B;  4PDM A;  2XHB A;  1EN6 A;  5EBW C;  1QLE B;  4JYB A;  1G8M A;  2QSA A;  4X1K B;  5FPO A;  2XUM A;  5B1A B;  1EM1 A;  4QIW F;  4J11 A;  3ZRS A;  4AHC A;  4ZHQ A;  1N0N A;  3BFR A;  4X89 A;  1I08 A;  3Q4H A;  2EZP A;  4IYH A;  2ADQ B;  1EZJ A;  4LNU A;  1L0N H;  2CTR A;  4JI1 B;  2DOS A;  5KUK A;  1PV0 A;  5DED A;  3K57 A;  4FLW A;  2UXC O;  4JI7 O;  2NN4 A;  4JYY A;  3ASO C;  5B1O A;  1PD3 A;  1E79 G;  2FL4 A;  4UCS A;  2Q7E A;  1PNK A;  4TUY B;  4PDV A;  3OGC C;  3SPJ A;  4FMT A;  4IHJ B;  1SQV H;  4FK5 C;  1Q6H A;  3APO A;  3K5N A;  1NVP D;  5JQG A;  2E76 B;  1SQG A;  4KUM A;  3UKM A;  4JTC B;  2XAJ A;  4DR7 B;  1K73 W;  5L3D A;  2PGG A;  3DSQ A;  5IJ0 B;  3CXC U;  4AQY B;  3I55 V;  4FLX A;  1KEC A;  2QDO A;  1CP9 A;  1URF A;  4D6T H;  1GO3 F;  4XDK A;  4NXN B;  4E2L A;  1Z5W A;  4UCU A;  1ZLZ A;  3SDL A;  4WF9 V;  3E35 A;  2QTO A;  5HFL A;  2ZIN A;  3FX7 A;  1NH2 D;  1RM1 C;  2QTS A;  4DV1 B;  1PKX A;  3K0G A;  1ZWI C;  5CMU A;  4HAM A;  4O2A B;  4PJ0 Z;  3CXH F;  2JVD A;  2W0F C;  4MT8 A;  4PA7 A;  4JI3 B;  2ZKO A;  3ZMS A;  3ASO B;  4X1I B;  3T4Z A;  1VMG A;  2E5L O;  4GYC B;  5IT9 N;  1F51 A;  3CWB H;  1QQC A;  3D8C A;  1KQS U;  1XBL A;  2WPD G;  2YEV A;  1NTM H;  1UFI A;  2A79 B;  1XMQ O;  3ZHU A;  4PD4 F;  2IBZ H;  5EIB D;  3JAR B;  3IC7 A;  3CC2 V;  3IGA C;  5FPR A;  3K5O A;  4R8C A;  4DR1 B;  2OTJ V;  4J7K A;  2R70 A;  1IXM A;  3HKB A;  2OCC B;  1M90 W;  4DV0 B;  2EIM C;  3N2G B;  4LR3 A;  3SPH A;  2ZR3 A;  1IXB A;  1CPY A;  4QPJ A;  1FXV A;  1Y76 A;  3FB5 C;  2EIN B;  3ZHR A;  4EEQ A;  2H8P C;  1BE3 H;  3UT5 A;  4JGS A;  4H0L B;  2WWW A;  2GUZ A;  1SRY A;  5LHI A;  5GON A;  2WA4 A;  1JFF B;  4X62 B;  2QKC A;  2PYJ A;  4B3S B;  2HVJ C;  2F93 B;  4O2A A;  4MVO A;  5EIB C;  4JI2 O;  3OEE G;  3AG4 C;  1HR0 O;  2Z0A A;  1FJG O;  2PI5 A;  4GX5 A;  5J2T A;  4K8X A;  3CEI A;  2DN9 A;  2VQF O;  1IVS A;  1Z5V A;  1FS0 G;  4TQF A;  4B3S O;  4X1K A;  2WLK A;  3P32 A;  4J7J A;  3AG2 B;  2X6B A;  1S72 V;  2P6J A;  4I55 A;  4I9Q A;  4BR6 A;  5K1X A;  1FAF A;  2CH7 A;  5EK0 A;  1Q6U A;  5KMG B;  3KZI Z;  1XDC A;  4ZI7 B;  4IHJ A;  1E1Q G;  5IYC O;  5BY1 A;  3H1J H;  4DV4 O;  1D5A A;  2JIZ G;  2YS8 A;  4DR1 O;  4ZOL A;  4PA9 A;  5JJJ B;  4HBN A;  1YDX A;  4X66 O;  1AR5 A;  3SJA C;  3VQW A;  5IJ0 A;  5FLX N;  2UUC B;  5H6Q A;  1M9N A;  2ZNI A;  5EC1 C;  4YY3 B;  3MHH C;  4TV9 B;  1N4C A;  3EHB B;  5C8Y B;  2Q0O C;  4DR7 O;  1E1R G;  1HR0 B;  4H44 B;  3J80 N;  3AG7 A;  3CRM A;  1OV9 A;  4LP8 A;  5CA0 A;  2QWO B;  3T2M A;  4FFK A;  1R3K C;  4X20 A;  4DRX B;  3C90 A;  1EBO A;  3N27 A;  4LFB O;  2QWQ B;  4GX0 A;  4FLZ A;  4I5S A;  2XT9 A;  4J80 A;  4WBN B;  2YI8 A;  3H1I H;  3L73 H;  3QF7 A;  1JQ0 A;  1PL4 A;  1VEW A;  2UXX A;  4K3A A;  2JK5 C;  2CDY A;  3UQ8 A;  2LW1 A;  1Q5O A;  3SPI A;  4PV1 B;  2B1G A;  4PHZ A;  4DUY O;  4LFC O;  1F4N A;  4LBE C;  3EVK A;  1NU1 H;  2Y69 C;  2Q67 A;  2LJ2 A;  2A3Q A;  3LNN A;  3JAS B;  2YUA A;  3AK2 A;  2FTK A;  4DUZ O;  2VWJ A;  3LDC A;  3TXS A;  1GN2 A;  2ZIM A;  2IJJ A;  3KG2 A;  3CCQ V;  2DWD C;  5B1N A;  5KHI A;  4YIP A;  5IWA B;  4RQE A;  3RVY A;  2PZS A;  1K4C C;  3X2Q C;  3UM7 A;  3SGI A;  5BR8 B;  2OYQ A;  4Z1M G;  3FKS G;  5IYZ B;  4JI3 O;  2NLJ C;  4DR4 B;  4OXS A;  1FD9 A;  2CTW A;  3JSN A;  3A8T A;  3CCL V;  3IC9 A;  2JJ1 G;  2WLN A;  3UT5 B;  4O4J A;  1QCE A;  2CAZ C;  3UO3 A;  3JSL A;  3JD3 A;  1SA0 A;  2ZT9 B;  4DR2 B;  5LXT B;  2UXD O;  2Q4P A;  4JTA B;  5EYP A;  4TWK A;  4HNA B;  4JI7 B;  3B8N A;  1Q7Y W;  1GM8 A;  4AQY O;  3K04 A;  1SQP H;  4K8Z A;  3ZJZ A;  1RP3 B;  1B6Q A;  4JI4 O;  3K08 A;  2RNB A;  3CMA V;  1TGO A;  3ZRW B;  2K9P A;  5JH7 B;  2OIG A;  2EIN C;  4FLU A;  3M8A A;  3F7Y C;  1W59 A;  5IYZ A;  2EIJ C;  1Q90 D;  1Y67 A;  1ZSP A;  4KHP B;  4J42 A;  2CTQ A;  2QM8 A;  3RYI A;  1HDJ A;  3K06 A;  4DR4 O;  3J7A U;  2X6A A;  3ASN C;  4GT1 A;  5JQG B;  1N33 B;  1ARO P;  2YIB D;  4K35 A;  1K33 A;  4MVS A;  2Z3Y A;  5LGU A;  2ZR2 A;  2R9I A;  4JYC A;  3RGB A;  1JX9 A;  2OIE A;  4TV8 B;  2VQE B;  1P49 A;  5KUM A;  1IBK B;  2OTL V;  4FLT A;  3JAW B;  3CCR V;  4WFG A;  1KMI Z;  4PA3 A;  1VQN V;  4IIJ B;  3N2K A;  2YXH A;  4JAS A;  1XMO B;  1B06 A;  4JI4 B;  1TA8 A;  2RJZ A;  2YI9 A;  1Y74 A;  4CH5 A;  1N32 O;  1BHA A;  2HR3 A;  1U96 A;  1YTF B;  1O9H A;  2UUC O;  4LCU C;  4RAI A;  3FFQ A;  3OEH G;  1NS1 A;  2AGA A;  4B7E A;  4YHH B;  3OGI B;  5D5Q A;  3HKD A;  1Q82 W;  2BSK B;  3TXQ A;  4LF6 B;  3TGU H;  3C3T A;  1OCR C;  4W4K A;  2XAH A;  1W0K G;  5LHH A;  2BTQ A;  1KB9 F;  2Q7H A;  5KA5 A;  1AB3 A;  2H94 A;  4E4E A;  4MVR A;  3CC7 V;  1FPO A;  4JF3 A;  1GRJ A;  2W6I G;  3BY6 A;  1KC8 W;  4ZHQ B;  3ZRV A;  5LGT A;  2R9A A;  2WLJ A;  3ZMT A;  4NVP A;  2F23 A;  2ZM6 B;  2LW7 A;  1NKD A;  3FB7 C;  3RYH A;  4DR5 O;  2GTS A;  3LDD A;  3TCU A;  3CP1 A;  4BW5 A;  4I4T A;  4N23 A;  1JR9 A;  3LDE A;  3K59 A;  4XDJ A;  3MAQ A;  1ZTE A;  1AI6 A;  4LF7 B;  1PNL A;  3E8G A;  5TIS Z;  2HJF C;  3SPG A;  1RSO A;  4ZBM A;  2MK3 A;  3T1Y O;  1J5E B;  2EZO A;  4DR6 B;  1K8A W;  4R7C A;  3JAL B;  3JAS A;  3SYA A;  4IGG A;  3H01 A;  4TUY A;  2BSK A;  1G6U A;  4AIL C;  2UUA B;  1ZX3 A;  3OTO B;  4JI8 O;  3E86 A;  1D5N A;  4X64 O;  1HW7 A;  4X88 A;  4A5U B;  1ZL8 A;  2EIK C;  2W6J G;  3OTF A;  4RUE A;  2QR4 A;  1AVM A;  2EJ7 A;  3ABL C;  3ZHT A;  4GKJ B;  4QE7 A;  3L71 H;  5LYJ B;  2FML A;  2Q6A A;  5CBG A;  3ABM C;  2HLD G;  4WFE A;  4X65 B;  1H2N A;  1UPG A;  1SET A;  4O4H A;  2NNU A;  1MMM A;  5DEC A;  5B1B C;  1IBM O;  4B3T B;  1Q43 A;  1H2S B;  1OCO B;  4BW9 A;  1V9P A;  1K97 A;  2P4K A;  4AI8 A;  1VQM V;  5BXZ A;  3DTU B;  4ABM A;  5B1A C;  5LP6 B;  2DE0 X;  1CXZ B;  4JV5 B;  1AJN A;  4YXW G;  4UV9 A;  1YIJ V;  2F66 C;  3CSX A;  1N0J A;  1L1F A;  1XOU A;  4B3T O;  3GB7 C;  4JZ2 A;  1G4Y B;  3J81 N;  2YC0 A;  2DWE C;  4UCV A;  3CJH A;  2M6Y A;  1XL6 A;  4J9Y B;  3S3X A;  1VF7 A;  1PL0 A;  2ZXW C;  1IBL B;  2AZ2 A;  1JMK C;  2B9Z A;  4R6Z A;  1FXH A;  3CPW U;  2YIC A;  2JDI G;  3ZMZ A;  3ABL B;  1THZ A;  1UJW B;  5CA1 A;  2KG7 B;  4PI0 A;  1IZ3 A;  4JYA O;  4XBF A;  2WA3 A;  3H1L H;  1F23 A;  4X62 O;  4X65 O;  2Q8V A;  4K0K O;  1XHZ A;  1FFX A;  3ABM B;  4F6R B;  4L87 A;  5KHG A;  2RMK B;  1KD1 W;  3OR6 C;  4BAY A;  1AI4 A;  1NQT A;  5BZB A;  5EBL C;  5LA6 B;  1AR4 A;  1COW G;  1TVK A;  3EXA A;  1XL4 A;  1OZ0 A;  2LO1 A;  2CE4 A;  4Z2W A;  4DV6 O;  4JV5 O;  3ICX A;  2EUL A;  2XAG A;  2ITC C;  3JAW A;  3VOU A;  1IBM B;  4UFZ A;  1WB8 A;  1KKC A;  3QNE A;  2X0L A;  2E74 B;  2ZE7 A;  2JGD A;  4LF4 B;  1K34 A;  3CJH B;  1J95 A;  1EN5 A;  5KAI Z;  1V54 C;  2ZNJ A;  2DYR B;  3SR2 C;  1ZAU A;  3ABK B;  3D3I A;  2QWR B;  4BWA A;  1N32 B;  5HFM A;  5CA1 B;  4B3M O;  5CN0 A;  5KAF Z;  1BHB A;  1H38 A;  4KFM A;  5LMU B;  4DR3 O;  5FL7 G;  4FLY A;  1BQZ A;  1AIL A;  1BMF G;  2GTA A;  1MG1 A;  3FYE B;  3E89 A;  3CHX A;  1AJP A;  4D7T A;  4MS2 A;  5B3S B;  3CYO A;  1XHX A;  1SF9 A;  3JAT A;  1K3E A;  2YIB A;  4X66 B;  3OMI B;  1B3Q A;  3ZRX A;  3QTC A;  4DK0 A;  2L6L A;  1G1X B;  3B2E E;  5LP6 A;  4DV0 O;  2HHH B;  1WP8 A;  4DR6 O;  1YXB A;  3CB2 A;  4B7K A;  3IAY A;  3ABT A;  2PI4 A;  2E5L B;  4UVB A;  4MW3 A;  1A32 A;  4I55 B;  1O9G A;  2QWN B;  4NTX A;  5LMN B;  1I7F A;  1DTO A;  3B77 A;  1R6T A;  3RN4 A;  1HWY A;  1WB7 A;  2YIA A;  4CS3 A;  2Q0A A;  1VQP V;  1V54 B;  4ZIB A;  3CRQ A;  2DYR C;  3MHS C;  2EIM B;  4CH6 A;  3I56 V;  3T1H B;  2WLM A;  1NZ6 A;  3DC5 A;  2BOB C;  2WLH A;  4KXR A;  3OAA G;  5JJN B;  3AK3 A;  5F2V O;  5J2U A;  4FZ1 A;  5A2Q N;  2A06 H;  3BVO A;  5IJ9 A;  4X8A A;  2VWK A;  3K9S A;  1OCC B;  4LF8 B;  2DQ3 A;  2WLL A;  4O4L B;  5B66 Z;  2Q5Z A;  3GVM A;  3PN1 A;  1R6N A;  2UXB B;  5GON B;  5AG2 A;  1S76 D;  2B5U A;  2ZE6 A;  2Y0I A;  3HKE A;  3HKE B;  3OM3 B;  2DQ0 A;  4QE9 A;  3L70 H;  2D3O W;  3ZHS A;  1YJN V;  4GZR B;  5LMN O;  4I4T B;  3F5T A;  3OD4 A;  4DYL A;  3JAT B;  4GX2 A;  4DUY B;  3K0D A;  3BHP A;  4TV8 A;  5JWP A;  2JGD B;  3AG2 C;  2Q68 A;  2DYS B;  4EFE A;  1NI8 A;  1XI1 A;  1OHH G;  4LWS B;  4WFH A;  3JCZ A;  1IX9 A;  5EZY B;  4O2B A;  4FLV A;  2KQX A;  2F4V O;  2BE3 A;  3HR0 A;  3C3S A;  3A0B Z;  3ZED A;  1W2B U;  3RYI B;  4I0X A;  5D5P A;  5CBF A;  4DRX A;  2OWO A;  4F6R A;  1YJW V;  2UXD B;  1BL8 A;  3ML0 A;  5CA0 B;  4MTX A;  4U3F H;  4JI8 B;  3RYC A;  2A0L A;  3T1H O;  3U11 A;  2XAF A;  3D36 A;  1WPB A;  2QGN A;  1QVG U;  4LF5 B;  3OMA B;  2QE7 G;  2WLI A;  1OJH A;  2ZE5 A;  4NXM O;  2IJH A;  1I5Y A;  1XRE A;  3AG1 C;  4Q6G A;  2QKA A;  1N34 B;  1FXK B;  4FPP A;  4DV7 B;  2EX3 A;  1MSD A;  4P2Z A;  3AK1 A;  3E83 A;  3T4D A;  4DV5 B;  5JJE B;  1YHQ V;  2Y0P A;  3K5L A;  1H8H G;  1JVM A;  1SQQ H;  2Q7G A;  3ZIA G;  3P3P A;  1VF6 C;  2F4V B;  4HYO A;  2KG7 A;  4PI2 A;  5KMG A;  2JGU A;  5LOV A;  1L8D A;  1GH6 A;  1I0H A;  3A2F A;  4TQD A;  2LGW A;  4I50 A;  4J9Z B;  2UUA O;  3IJ4 A;  4O4J B;  4C7U A;  1IDS A;  1OCZ B;  3EFF K;  4DK1 A;  4O4I B;  4DV5 O;  3LNM B;  5IY5 C;  1MNG A;  2EBO A;  3QO5 A;  2N05 A;  4QJF B;  1KU9 A;  1M56 C;  2PY5 A;  1N34 O;  3QO8 A;  4TSF G;  5J2U B;  3H9V A;  2X7R B;  1GMG A;  2ADP A;  2XAQ A;  1QU7 A;  5BMV B;  5BMV A;  1AI5 A;  1SZX A;  2PF4 E;  2UU9 O;  4Q20 A;  4DR2 O;  4JI0 O;  3JD4 A;  1R3J C;  2AZ0 A;  2WAM A;  4FFB B;  3IFX A;  1V55 B;  1M57 C;  2ETN A;  5GW7 A;  1QR8 A;  1AJQ A;  2P22 C;  2ZDI A;  3ETG A;  4NYK A;  3JD2 A;  1XNR O;  5JVD B;  1DGS A;  4EB6 A;  4G28 B;  1MZF A;  1BT8 A;  2JRI A;  5LOV B;  4X1Y A;  1VF6 A;  2Q9L A;  3AEI A;  1GN4 A;  4WFF A;  1HNX B;  1GM9 A;  4FJC C;  4FM1 A;  4PA6 A;  3SYP A;  4LF8 O;  3WFV A;  3A0R A;  3OUF A;  4KL1 A;  1GAX A;  4IL6 Z;  2IH3 C;  5LHG A;  1NTK H;  3RT3 C;  1LUV A;  3AG3 C;  4FIP C;  1XMQ B;  3ZCC A;  5H2F Z;  1IUR A;  3DXR B;  3HB3 B;  3R66 A;  1TUB B;  1AR1 B;  3K3W A;  3HPL C;  3M7M X;  1RSO B;  4DW1 A;  3L74 H;  3JD0 A;  1WJZ A;  1MA1 A;  4U3J A;  2BCC H;  2JS5 A;  1ROP A;  2YXY A;  3HKC A;  1HNW O;  3HKD B;  3ZBH A;  2WLL B;  2ZDI C;  2EIK B;  5CB4 B;  2P06 A;  1NR7 A;  1YIT V;  4BIU A;  4JZG A;  4P9O A;  1XEQ A;  3U10 A;  3RWR D;  2N74 A;  1BZK A;  3L9D A;  4DV3 B;  2Y48 A;  3ASN B;  3W7W A;  1WLE A;  4X1Y B;  2BTO A;  2HVK C;  4LH6 A;  4CH4 A;  3JAK B;  3FAV A;  3D36 C;  4JI1 O;  3B09 A;  3G71 V;  1BS3 A;  5CB4 A;  5KX5 B;  4J41 A;  1BSM A;  5IDJ A;  4JAA A;  3RVZ A;  4R50 A;  4F6E A;  2ATK C;  4ZOL B;  4LC1 A;  4WCE V;  3UCS C;  1S0V A;  3D3Q A;  1IBK O;  4I50 B;  4MVU A;  5H9C A;  3FD9 A;  1QVF U;  1Q81 W;  1RFY A;  1GN3 A;  4EB6 B;  1GKF A;  3VQX A;  1Q86 W;  1HNW B;  2EIL C;  3WB2 A;  1GN6 A;  4YHH O;  3CRC A;  3JD1 A;  2Y4U A;  3MDS A;  3CCS V;  2HJD A;  4UB6 Z;  1I94 B;  4RWU A;  1VQ8 V;  2Q69 A;  3ZN1 A;  1Y6X A;  2WLI B;  2ARH A;  1FYJ A;  2OCH A;  4GUN A;  1N36 B;  3BAA A;  5H6R A;  4UV8 A;  1WA8 B;  2AHZ A;  3P3N A;  3AG1 B;  2P4V A;  5EYP B;  4OGQ B;  1JFF A;  3GWK C;  1QBZ A;  1VQ6 V;  1OCR B;  2RCV A;  3H1K H;  1PNM A;  4O4H B;  1AP5 A;  2OCC C;  2VS0 A;  3G4S V;  1HNZ O;  4GKJ O;  3TET A;  2CGN A;  1TUE B;  1KYO F;  1L0L H;  2YDE A;  3FB6 C;  3K5M A;  2AHY A;  2JS3 A;  3OUS A;  3O65 A;  4UVC A;  4P30 A;  1VIB A;  2RQ6 A;  2ZE8 A;  2VQE O;  3WG7 B;  1Q3E A;  2QJ1 A;  1HNZ B;  3B8M A;  3K9A A;  2P67 A;  5B1B B;  3JAR A;  4MSW C;  4I0X B;  1OCO C;  3A0H Z;  2KKW A;  3ZX6 A;  4YJ3 A;  1XMO O;  2UUB O;  3B40 A;  4GCZ A;  1WNS A;  2VRZ A;  4RO2 A;  3LSQ A;  1YF2 A;  5K1P A;  1N36 O;  2R72 A;  4FVM A;  2N04 A;  3TJT A;  2P5O A;  5ITZ A;  4MTG A;  2PYL A;  1EZV H;  3STL C;  3CRA A;  3RFR A;  3SJC C;  5KHJ A;  1FXK A;  3CCM V;  1JA8 A;  2PTM A;  2YXL A;  1SS3 A;  1VQO V;  2IU3 A;  1NTZ H;  3JAM N;  3E8B A;  4G2K A;  5LP6 C;  1SES A;  3WB0 A;  3UO2 A;  1LNQ A;  3JYC A;  2BTQ B;  5KA6 A;  2KSD A;  4UCT A;  4NXM B;  1ZL8 B;  1DLB A;  3CS5 A;  2YSU B;  4BIZ A;  2GUZ B;  5LXT A;  1R73 A;  3WG7 C;  3APQ A;  2AXT Z;  2QM7 A;  4PEL A;  1M5I A;  3LSS A;  1Y76 B;  4LFA B;  5FNV A;  3G67 A;  4JI0 B;  3JAK A;  2AW9 A;  4LNU B;  4JI6 O;  5DM6 V;  1RM1 B;  1KBH A;  1H8E G;  3BA8 A;  3VQV A;  4LWS A;  1VAR A;  3LSU A;  1I5X A;  3KCY A;  3H1H H;  4U7O A;  3RW0 A;  5LBQ A;  2JJ2 G;  5IYB O;  5KX5 A;  1VQL V;  2XAS A;  4H13 B;  1SZT A;  4UVA A;  5LMU O;  4DR3 B;  2QKS A;  1DF4 A;  1K5S A;  4NB5 A;  3I5D A;  1DF5 A;  1U97 A;  4DV2 O;  4YIO A;  1QHT A;  3RYF A;  4MVQ A;  3ZHQ A;  2V4D A;  4ZI7 A;  3T1C A;  4NTY A;  1K9M W;  4JI6 B;  1M93 A;  4F4L A;  4P9P A;  4UCR A;  2Y69 B;  4MVM A;  4JAU A;  1HP8 A;  1KP2 A;  2XND G;  1QLE C;  1TAE A;  1YEW A;  4ASU G;  4JI5 B;  1NH2 B;  4GX1 A;  2QA4 V;  3W7U A;  1QR9 A;  2UXB O;  1PM9 A;  1YJ9 V;  4MTF A;  1TUB A;  3QG5 A;  5J2T B;  4PDL A;  2LQT A;  5IWA O;  2YID A;  4IT5 A;  3W7T A;  5FNV B;  3L72 H;  2DMX A;  1ORQ C;  4W4L A;  3OR7 C;  2CUG A;  1US6 A;  1MAB G;  1SC5 B;  3ABK C;  4OX9 O;  2HEP A;  3VQY A;  4X20 B;  4U3J B;  2UXC B;  3JAL A;  1VQK V;  4NR1 A;  3W7S A;  1ENV A;  5L3E A;  1NT2 B;  1H2G A;  1R1B A;  1B04 A;  1S5L Z;  2CH7 B;  4MVZ A;  4FZ0 A;  1H2K A;  1S5J A;  3N2G A;  4IIJ A;  4DUZ B;  1WP7 A;  1LUW A;  1FXK C;  1NVP B;  1S5H C;  4DXW A;  2HHH O;  2DJV A;  5IYD O;  1K92 A;  4OPH A;  5LGN A;  4NTW A;  3S3W A;  4B3R B;  5J9P C;  3F5W C;  2P90 A;  3AG4 B;  5C93 A;  5E1A C;  4X9Q A;  1Z2G A;  4CBC A;  4EKW A;  5KHH A;  5JH7 A;  1YCI A;  3PJS K;  3CCJ V;  3ETQ A;  1YTF D;  3G6E V;  4J10 A;  4CZZ A;  4J7Z A;  2D2C B;  1H2M A;  3FYI B;  3QO7 A;  1OCZ C;  2EIJ B;  5H5N A;  1I94 O;  4RQF A;  1DK1 A;  3E22 A;  5CA3 A;  2Y4T A;  3ZMU A;  3LUT B;  4ICG A;  1Y74 B;  2LFR A;  3WU2 Z;  3MD0 A;  1Q8I A;  3L75 H;  3E2E A;  1XNQ O;  1ZUQ A;  2HKO A;  5KLV H;  4LF4 O;  4YJ3 B;  2O57 A;  2GV9 A;  1YSC A;  2GSM B;  3NR7 A;  2XTA A;  3G80 A;  3ZN0 A;  2K1E A;  2L35 A;  3OW2 U;  4LFA O;  1P7B A;  4IYI A;  4MW8 A;  2X6C A;  5ITZ B;  2ZQM A;  1VQ9 V;  2IM9 A;  3BPZ A;  1W0J G;  4LFB B;  2DYS C;  2ZCE A;  3SYQ A;  4CC5 A;  3OMN B;  3CD6 V;  1RPR A;  2Q73 A;  4LFC B;  2E3C A;  2ZIO A;  2OT5 A;  3HKB B;  3JCU Z;  1XUQ A;  1X4T A;  4DV2 B;  1Y4M A;  4O4L A;  3CCU V;  2QEX V;  4WFA V;  5B5E Z;  1FFT B;  1BQ0 A;  2A9H A;  1FJG B;  1GTO A;  1K7D A;  2HG5 C;  1R3I C;  1AP6 A;  2V1D A;  3CRR A;  1JPX A;  2ILM A;  2JEU A;  3FAV B;  1MSW D;  4BIO A;  5E79 Z;  4DV3 O;  5LYJ A;  3P30 A;  1IBL O;  1NR1 A;  1T5E A;  1SER A;  3G6B A;  3W7X A;  3BRC A;  2YEV B;  1X59 A;  1P4R A;  4JI2 B;  4CS2 A;  1EN4 A;  2GDS A;  5LL6 Y;  4GKK O;  3SPC A;  1YI2 V;  1N8R W;  2F1M A;  2Z5U A;  5EBM C;  3ETD A;  1M1K W;  2NR5 A;  4D7S A;  3NXS A;  2R9R B;  1SA0 B;  3HKC B;  2W0X A;  2P7T C;  4RUF A;  1XQ8 A;  1FKA O;  1JJO A;  4DV1 O;  1BCC H;  1MOF A;  3ZMV A;  2JEX A;  3DGE A;  4NKG B;  1KUQ A;  4QPK A;  1SQF A;  4L8J A;  1P84 F;  4LF6 O;  1VF5 B;  2UUB B;  1R6K A;  3KCX A;  3X2Q B;  2IU0 A;  3E8F A;  2H3O A;  3DC6 A;  4DV6 B;  1Y66 A;  2BOC C;  4LF9 O;  2PUS A;  1PP9 H;  2MW2 B;  4WFB V;  4DV4 B;  4K0K B;  5IY5 B;  3U0Z A;  3CC4 V;  2CTP A;  2ZM6 O;  1R3L C;  5GTH Z;  1VQ4 V;  1NJI W;  1MZE A;  3K03 A;  3SYO A;  4Z1V A;  4G27 B;  2KB1 A;  1PPJ H;  3BA9 A;  1XNR B;  2A7W A;  2RN9 A;  3CCE V;  2ODM A;  4WBN A;  4FM2 A;  4YY3 O;  5L3B A;  4YJ2 B;  3ZS8 C;  4LF9 B;  5CBH A;  4PA4 A;  2IJI A;  4QNH B;  2CGO A;  1S3J A;  1LR1 A;  2G38 A;  1H2L A;  3OTO O;  3BAB A;  4FFB A;  5L3F A;  1N33 O;  2B1I A;  2UU9 B;  3SJQ C;  4LF5 O;  4I9W A;  4PDR A;  5EC2 C;  4HZ3 A;  1F4M A;  3Q4H B;  4EFB A;  3ZRW A;  5A9G A;  3ABU A;  2GBO A;  3T1Y B;  1J5E O;  3CME V;  3KKY A;  1D2D A;  2FKX A;  4GKK B;  3N2K B;  1CEZ A;  3QVN A;  1K4D C;  5JCO A;  3RYC B;  1QLN A;  3THO A;  1Q6I A;  5GTI Z;  4GLX A;  1P7G A;  3M99 B;  4O4I A;  1XNQ B;  1SQX H;  1YVW A;  2LP7 A;  3ZHV A;  3TK1 A;  4ZKI A;  1WA8 A;  4U7N A;  1WPX A;  3ETE A;  1RPO A;  4MTO A;  3RYF B;  3OE7 G;  4TV9 A;  1GM7 A;  2FYU H;  5DN6 G;  1TVK B;  4OX9 B;  1YZB A;  4DO2 A;  4H37 A;  1M4U A;  4NXN O;  2F43 G;  1EFR G;  5IE9 A;  4H33 A;  1FFX B;  2QM4 A;  3E22 B;  5L3C A;  4DR5 B;  4CH3 A;  3K79 A;  1JOY A;  4CS4 A;  4DW0 A;  4JYA B;  1F7Y A;  4JI5 O;  1S77 D;  4B08 A;  3FB8 C;  4UXN A;  5L3G A;  2UXN A;  4B3R O;  4TOI A;  4I7Z B;  4HNA A;  1KP3 A;  2LGQ A;  3SYC A;  1SQB H;  1VP7 A;  2EJR A;  2IH1 C;  4KP4 A;  2E75 B;  1M56 B;  5IJ9 B;  2F95 B;  1XIL A;  2ZD9 A;  4QGP A;  1SKV A;  4UUJ C;  2V7Q G;  3BEH A;  4JTD B;  3K58 A;  4LH7 A;  5LA6 A;  2WSS G;  2QWP B;  4XDL A; 
#chains in the Genus database with same CATH homology
 3R65 A;  2JJ2 G;  5B3S C;  4GX2 A;  3RBZ A;  1M57 B;  5IYB O;  4JTA B;  3K0D A;  1VQL V;  2XAS A;  3OFN G;  1SZT A;  4TWK A;  4UVA A;  3AG2 C;  2Q68 A;  2DYS B;  2QKS A;  3B8N A;  1DF4 A;  1K5S A;  4N21 A;  3STZ C;  1GM8 A;  1Q7Y W;  1DF5 A;  3K04 A;  1K5Q A;  3ZJZ A;  4TT3 G;  2CK3 G;  4MVQ A;  1JCH A;  1OHH G;  1B6Q A;  2M7W A;  3K08 A;  4WFH A;  3JCZ A;  3T1C A;  3CMA V;  1KKD A;  3ZRW B;  2EIL B;  2DW4 A;  3CCV V;  2EIN C;  1K9M W;  2IJK A;  3F7Y C;  2IW5 A;  1W2B U;  4F4L A;  2EIJ C;  3VBB A;  4P9P A;  1V55 C;  5CBF A;  2ITD C;  2Y69 B;  4JAV A;  4MVM A;  4JAU A;  1JJ2 U;  1YJW V;  1KP2 A;  2GHY A;  2XND G;  1VQ5 V;  1QLE C;  2XOK G;  1BL8 A;  3ML0 A;  2ZXW B;  4ASU G;  2QM8 A;  4MTX A;  4GX1 A;  3AG3 B;  2QA4 V;  3W7U A;  1NH2 B;  1NBM G;  2A0L A;  3K06 A;  1QR9 A;  2XAF A;  3D36 A;  1GK9 A;  2X6A A;  3ASN C;  4GT1 A;  1YJ9 V;  4MTF A;  1QVG U;  3OMA B;  4JPR A;  4PDL A;  2QE7 G;  2WLI A;  1ARO P;  1VQ7 V;  2HFE C;  2IJH A;  3GWO A;  2C2A A;  4MVS A;  1K33 A;  1I5Y A;  3W7T A;  3AG1 C;  2Z3Y A;  5LGU A;  2ZR2 A;  2R9I A;  3E8H A;  4JYC A;  2LFS A;  1FXK B;  3F7V C;  4FPP A;  1ORQ C;  1JX9 A;  1AI7 A;  1OCC C;  3OR7 C;  4PDM A;  1MAB G;  4P2Z A;  3ABK C;  3E83 A;  5EBW C;  1QLE B;  3T4D A;  4JYB A;  5KUM A;  2OTL V;  1G8M A;  3CCR V;  1YHQ V;  5B1A B;  1H8H G;  1JVM A;  4WFG A;  1VQK V;  4PA3 A;  4QIW F;  3ZIA G;  1VQN V;  4HYO A;  3W7S A;  3ZRS A;  1ENV A;  4JAS A;  5L3E A;  4X89 A;  1H2G A;  2EZP A;  4J9Z B;  1EZJ A;  4MVZ A;  1BHA A;  2HR3 A;  5KUK A;  1YTF B;  1OCZ B;  3EFF K;  1FXK C;  1NVP B;  4LCU C;  4RAI A;  3ASO C;  1S5H C;  3LNM B;  5B1O A;  4DXW A;  3OEH G;  5IYD O;  1K92 A;  5LGN A;  5IY5 C;  1PD3 A;  2EBO A;  1E79 G;  5J9P C;  3QO5 A;  3F5W C;  4QJF B;  2P90 A;  1Q82 W;  3AG4 B;  5C93 A;  1M56 C;  1PNK A;  5E1A C;  1OCR C;  4PDV A;  2XAH A;  3OGC C;  3QO8 A;  4TSF G;  1W0K G;  5LHH A;  3SPJ A;  4FMT A;  4CBC A;  2X7R B;  1GMG A;  2XAQ A;  4EKW A;  5KA5 A;  4FK5 C;  2H94 A;  3PJS K;  4MVR A;  3CCJ V;  3CC7 V;  4JF3 A;  2W6I G;  3BY6 A;  1NVP D;  1AI5 A;  1YTF D;  4Q20 A;  3G6E V;  1KC8 W;  4KUM A;  3UKM A;  4CZZ A;  3ZRV A;  3JD4 A;  1R3J C;  3FYI B;  2XAJ A;  4JTC B;  5LGT A;  2WLJ A;  3ZMT A;  3QO7 A;  1OCZ C;  1K73 W;  2WAM A;  5L3D A;  2EIJ B;  1NKD A;  4RQF A;  3IFX A;  1V55 B;  1M57 C;  3CXC U;  5CA3 A;  5GW7 A;  3FB7 C;  3I55 V;  1KEC A;  1QR8 A;  3LDD A;  1AJQ A;  1CP9 A;  3ZMU A;  3LUT B;  3ETG A;  2ZDI A;  3TCU A;  3CP1 A;  1GO3 F;  4XDK A;  4BW5 A;  3JD2 A;  3LDE A;  4N23 A;  4XDJ A;  4E2L A;  1AI6 A;  2LFR A;  3MD0 A;  1PNL A;  3E8G A;  3SPG A;  2HJF C;  4WF9 V;  4G28 B;  4ZBM A;  2MK3 A;  2QTO A;  3E35 A;  3E2E A;  5HFL A;  2EZO A;  1NH2 D;  1K8A W;  2HKO A;  1RM1 C;  4R7C A;  3AEI A;  1PKX A;  4WFF A;  3K0G A;  1YSC A;  1GM9 A;  1ZWI C;  2GSM B;  4FJC C;  5CMU A;  4HAM A;  3SYA A;  3H01 A;  4PA6 A;  3SYP A;  3WFV A;  3ZN0 A;  2K1E A;  3OW2 U;  2W0F C;  1P7B A;  4MT8 A;  3E86 A;  4PA7 A;  4MW8 A;  2X6C A;  4X88 A;  3A0R A;  3ZMS A;  3OUF A;  3ASO B;  3T4Z A;  2EIK C;  2ZQM A;  2W6J G;  2IH3 C;  5LHG A;  4RUE A;  1F51 A;  3AG3 C;  1VQ9 V;  1W0J G;  4FIP C;  1KQS U;  2WPD G;  2DYS C;  3ZCC A;  2YEV A;  3ABL C;  3SYQ A;  3HB3 B;  3OMN B;  2A79 B;  3CD6 V;  1RPR A;  1AR1 B;  3K3W A;  3HPL C;  4QE7 A;  2OT5 A;  2Q6A A;  5CBG A;  3ABM C;  2HLD G;  4WFE A;  3JD0 A;  3IC7 A;  3CC2 V;  1SET A;  3IGA C;  1ROP A;  4R8C A;  2NNU A;  1Y4M A;  3CCU V;  2WLL B;  5B1B C;  2QEX V;  2ZDI C;  2OTJ V;  1OCO B;  4WFA V;  1FFT B;  2EIK B;  2A9H A;  1NR7 A;  1GTO A;  1IXM A;  1K7D A;  2HG5 C;  1YIT V;  1R3I C;  4BIU A;  2OCC B;  2V1D A;  1M90 W;  1JPX A;  2EIM C;  2JEU A;  1K97 A;  1VQM V;  1MSW D;  4P9O A;  3DTU B;  3P30 A;  3SPH A;  1NR1 A;  5B1A C;  2ZR3 A;  2Y48 A;  3ASN B;  3W7X A;  1SER A;  3W7W A;  4QPJ A;  1CPY A;  1WLE A;  1FXV A;  2YEV B;  1AJN A;  3FB5 C;  4YXW G;  2EIN B;  4UV9 A;  2HVK C;  1YIJ V;  2H8P C;  1P4R A;  4JGS A;  1L1F A;  2WWW A;  3GB7 C;  1G4Y B;  3SPC A;  1YI2 V;  1N8R W;  1SRY A;  5LHI A;  3G71 V;  2DWE C;  2Z5U A;  5EBM C;  3ETD A;  4J9Y B;  1XL6 A;  5IDJ A;  1M1K W;  3RVZ A;  2HVJ C;  4R50 A;  1PL0 A;  2ZXW C;  3NXS A;  2R9R B;  2ATK C;  2P7T C;  4RUF A;  4MVO A;  4LC1 A;  4WCE V;  3OEE G;  3AG4 C;  1S0V A;  1MOF A;  4R6Z A;  1FXH A;  3ZMV A;  3CPW U;  2JEX A;  3DGE A;  2PI5 A;  4MVU A;  2JDI G;  4QPK A;  5H9C A;  4GX5 A;  3ZMZ A;  1QVF U;  1Q81 W;  1GKF A;  3ABL B;  1Q86 W;  1THZ A;  1UJW B;  1R6K A;  3X2Q B;  2EIL C;  2IU0 A;  4XBF A;  1FS0 G;  3E8F A;  1F23 A;  2WLK A;  3P32 A;  3ABM B;  3JD1 A;  1Y66 A;  3AG2 B;  2X6B A;  4L87 A;  1S72 V;  2BOC C;  2P6J A;  4WFB V;  3CCS V;  1KD1 W;  5IY5 B;  3OR6 C;  4BAY A;  1AI4 A;  3CC4 V;  1NQT A;  5BZB A;  5EBL C;  1VQ8 V;  1R3L C;  1COW G;  1VQ4 V;  5EK0 A;  1NJI W;  1XL4 A;  2Q69 A;  3ZN1 A;  1OZ0 A;  3K03 A;  3SYO A;  4G27 B;  2WLI B;  2KB1 A;  3CCE V;  1E1Q G;  5IYC O;  5H6R A;  2XAG A;  4UV8 A;  5L3B A;  2ITC C;  3VOU A;  2AHZ A;  2JIZ G;  5CBH A;  3AG1 B;  4PA9 A;  3QNE A;  4PA4 A;  2IJI A;  4QNH B;  2X0L A;  1S3J A;  1K34 A;  1J95 A;  1QBZ A;  1V54 C;  1VQ6 V;  2DYR B;  1OCR B;  1PNM A;  3ABK B;  2OCC C;  3D3I A;  3G4S V;  5L3F A;  5H6Q A;  3TET A;  2B1I A;  1TUE B;  1M9N A;  5EC1 C;  3SJQ C;  5HFM A;  3MHH C;  4I9W A;  4PDR A;  5CN0 A;  5EC2 C;  4HZ3 A;  1F4M A;  3EHB B;  1BHB A;  1H38 A;  4KFM A;  1E1R G;  3FB6 C;  5FL7 G;  3ZRW A;  2AHY A;  3ABU A;  3OUS A;  1BMF G;  3CME V;  4LP8 A;  1CEZ A;  1MG1 A;  3FYE B;  4UVC A;  3E89 A;  4P30 A;  1K4D C;  3T2M A;  1AJP A;  1R3K C;  1QLN A;  4MS2 A;  5B3S B;  3CYO A;  3WG7 B;  1EBO A;  3B8M A;  4GX0 A;  3K9A A;  2P67 A;  3M99 B;  5B1B B;  4I5S A;  1K3E A;  4MSW C;  2LP7 A;  1OCO C;  3TK1 A;  3OMI B;  4ZKI A;  4U7N A;  3ZRX A;  4GCZ A;  1JQ0 A;  1WPX A;  3ETE A;  1RPO A;  4RO2 A;  2UXX A;  4MTO A;  2JK5 C;  3OE7 G;  3LSQ A;  3SPI A;  1GM7 A;  5DN6 G;  2B1G A;  3ABT A;  2PI4 A;  4MTG A;  1F4N A;  4LBE C;  4DO2 A;  4UVB A;  4MW3 A;  4H37 A;  2Y69 C;  2Q67 A;  2F43 G;  1EFR G;  3STL C;  1DTO A;  4H33 A;  3B77 A;  1FXK A;  1HWY A;  1VQP V;  5L3C A;  1V54 B;  3CCM V;  2FTK A;  2DYR C;  3K79 A;  1JOY A;  3MHS C;  2EIM B;  1VQO V;  2IU3 A;  3LDC A;  3I56 V;  2IJJ A;  2WLM A;  3E8B A;  4G2K A;  3KG2 A;  1S77 D;  3CCQ V;  2BOB C;  2DWD C;  5B1N A;  1SES A;  2WLH A;  4RQE A;  1LNQ A;  3FB8 C;  4UXN A;  3OAA G;  5L3G A;  2UXN A;  3RVY A;  3JYC A;  5KA6 A;  1K4C C;  4X8A A;  1KP3 A;  3X2Q C;  1OCC B;  3SYC A;  2DQ3 A;  3UM7 A;  1DLB A;  2YSU B;  2WLL A;  4BIZ A;  1R6N A;  2EJR A;  1R73 A;  3WG7 C;  2IH1 C;  4Z1M G;  3FKS G;  4KP4 A;  2NLJ C;  2QM7 A;  4PEL A;  1M56 B;  4OXS A;  3LSS A;  1S76 D;  2B5U A;  3CCL V;  2JJ1 G;  2WLN A;  2ZD9 A;  5DM6 V;  1RM1 B;  1QCE A;  1H8E G;  4UUJ C;  2V7Q G;  3BEH A;  3OM3 B;  4JTD B;  2DQ0 A;  4QE9 A;  2D3O W;  1YJN V;  1I5X A;  2WSS G;  4U7O A;  3RW0 A;  3JD3 A;  4XDL A;  5LBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...