4JF3A

Crystal structure of the mpmv tm retroviral fusion core
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
90
structure length
90
Chain Sequence
TQYTKLSHQLISDVQAISSTIQDLQDQVDSLAEVVLQNRRGLDLLTAEQGGICLALQEKCSFYANKSGIVRDKIKNLQDDLERRRRQLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Envelope glycoprotein
publication title Crystal structures of Beta- and gammaretrovirus fusion proteins reveal a role for electrostatic stapling in viral entry.
pubmed doi rcsb
source organism Mason-pfizer monkey virus
total genus 40
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jf3A00
2LP7A 3M99B 3K9AA 4FIPC 3GWOA 1DLBA 4N21A 5KA5A 1QR8A 1K34A 4JPRA 2M7WA 4E2LA 2MK3A 5CMUA 4N23A 2EZOA 1EBOA 2P6JA 1JPXA 3H01A 1Y66A 4JF3A 1MG1A 1F23A 1I5YA 1QBZA 1SZTA 3B8MA 1MOFA 3CP1A 1DF4A 2EZPA 3WFVA 3B77A 5H9CA 3B8NA 4FJCC 1QCEA 1Y4MA 4G2KA 1I5XA 5CN0A 3MHHC 3MHSC 3CYOA 1DF5A 2EBOA 5HFMA 5KA6A 2X7RB 4FK5C 1JQ0A 1K33A 1QR9A 1ENVA 4JGSA 2OT5A 3P30A 5HFLA
chains in the Genus database with same CATH superfamily
2CE4A 4JAUA 4YHHB 1VQ6V 2WLLA 4O4LA 3LSQA 1FFTB 3ZN1A 2P4KA 1QVFU 2WA3A 3T4ZA 1VQLV 2IU0A 1K4CC 4AILC 2GTAA 1I94O 3OW2U 2JJ2G 4JI3O 4OX9B 3K04A 5LP6B 4DR4B 1YTFB 4DV6B 2Y69B 2WPDG 3APOA 4JI5O 3FYIB 3B4SA 4X8AA 5AG2A 3ZIAG 1OCCB 4GKJO 2UXNA 2A3QA 1L0NH 3UKMA 4LF5O 4R7CA 2VRZA 3AK2A 5LGNA 1KD1W 2MW2B 1OCRB 3ASNC 1XL4A 5H5NA 3UM7A 5KHIA 4TQDA 4O4JB 3T1YO 2YEVA 3AG4C 1SQXH 1SERA 5IT9N 3AG2C 4B3SO 1O9GA 2DMXA 2PYLA 4DV0B 3A0BZ 4QIWF 2LJ2A 4I55A 5FPRA 2WLHA 5LXTB 3GB7C 3CCSV 2PZSA 2FMLA 1WA8A 2HFEC 3HKCB 1VQ8V 2ZD9A 2ZR3A 1XNRO 1K7DA 2DE0X 3AG1C 2D3OW 2ZR2A 3ML0A 3ASOB 3JYCA 3G4SV 1HNWB 3BHPA 4D6TH 5ITZA 1VIBA 3O9OA 2GDSA 1SA0B 1XEQA 1KU9A 1PNMA 2GUZB 1RFYA 1HNXB 5DECA 1K92A 4WFEA 4DV7O 2LFRA 4JYAB 1QCEA 1BGYH 4O2AB 4OPAA 4DR7B 1N33B 1DGSA 1Z2GA 1M1KW 5L3GA 3ZHQA 4QPJA 1SRYA 4B3TO 3OT7A 2UUCO 4MVOA 4JI1O 2V1DA 1KKDA 2XAFA 3L71H 3GVMA 5L3EA 2VWJA 4PHZA 4TV8B 4P30A 2OWOA 1IBKO 2E5LO 3LDDA 4UCVA 4ZBMA 4X66B 3B09A 1VARA 1J95A 3RYFB 2ZCEA 2EBOA 1V54C 1NTZH 3JD0A 3FAVB 1QR9A 2XUMA 4LF8O 2B1IA 4B3MO 1WB8A 4LF6O 3C90A 3IGAC 2BTQB 2YIBA 4O2BB 3E2EA 3HKBB 2P7TC 1FXKA 4WCEV 2YXHA 2FYUH 5LL6Y 1DF5A 4HAMA 1XQ8A 1BS3A 1GN6A 4X62B 1N36O 1QHTA 1YCIA 4LFBO 5LA6B 1G8MA 2YUAA 1UPGA 3MD0A 2BSKA 4EB6A 5C8YA 2ZT9B 4KHPB 5H2FZ 3GWKC 4ZOLA 4U3JA 2FKXA 2Q0AA 1ZL8A 2OCCB 5HFMA 4D7TA 4ABMA 2XT9A 3LNMB 3H1JH 1R3LC 3HKEA 4WFAV 3JAKB 3CE2A 1L8DA 2RNBA 1SQQH 3QVNA 1KYOF 1FAFA 3D3QA 2XHBA 4DK0A 3L70H 4DUYB 1M57C 3JATA 1GTOA 4DR5O 2QM7A 1MNGA 1KC8W 2YDEA 2DYSB 2ZDIC 3BFRA 5IJ0B 2F93B 1N34O 2Y48A 3CJHA 4NKGB 5LYJA 3CC7V 4PI2A 1L1FA 3CCQV 5EIBC 3FFQA 1S5HC 5EYPB 1XMOB 2YI8A 3JAMN 1Q7YW 5JJEB 1K5SA 1IBMO 4UXNA 4O4HB 4P9OA 1K8AW 2UUAB 3OUFA 4JI4O 4X1IB 1H38A 1AR5A 2HEPA 3T1HB 1KQSU 5BR8B 4DV3O 3P3NA 3N2GB 4P9PA 3OGCC 1R73A 1IURA 2YIBD 1TUEB 1M56C 2ADQB 4MS2A 5D5PA 3OFNG 4CH6A 3RYCA 5D5QA 2VQEB 3CXCU 3VOUA 2Q8VA 3I56V 4LH6A 1KBHA 1AJPA 2K1EA 5B1AB 4WFFA 4RWUA 1SQBH 5DN6G 4CH5A 5B1BB 5DM6V 1DLBA 1JVMA 2HP8A 2QE7G 3JASB 4J11A 5KMGB 2B1GA 2WLMA 3KKYA 3W7TA 2PI5A 3ABMB 3RYHA 1AI5A 4L8JA 5KX5B 4FFBA 4JI7O 4YJ2A 2F95B 2HHHB 1K33A 5EZYB 5J2TB 4FM2A 4DV4O 1B6QA 3LNNA 1IX9A 1JOYA 5CA1A 4X20B 1RPRA 4CH4A 2YXLA 3E86A 2JDIG 2RDCA 4PDRA 2X6AA 5KHJA 4DR2O 4NTXA 1ZSPA 1V55B 4EFBA 4EKWA 3S3WA 1HR0O 3ZRXA 3EFFK 4WBNA 5KAFZ 1AROP 3OEHG 3CSXA 3FB6C 4X64B 2MK3A 3K06A 4I4TB 3BRCA 2IM9A 1RSOA 3CRAA 3F7YC 4OXSA 2WLJA 4F6EA 2ATKC 4MT8A 5LP6A 3VQXA 1KB9F 1HNZB 4LF7B 2UXDO 1NR1A 3SJCC 1ZTEA 4FIPC 3E89A 5L3CA 2F4VB 5KUMA 3TXQA 1NS1A 4JZGA 2GTSA 1IBLB 3Q4HA 1W0JG 4O4JA 2BE3A 4YIPA 1ZWIC 1OCOB 2UXCO 3ZMSA 2JRIA 3ZRWA 5FPOA 4JTAB 1FFXB 2X6CA 5B3SC 4JV5O 4NVPA 4U3FH 2GHYA 3QF7A 1AILA 1FJGB 1THZA 3MDSA 3ETDA 1MG1A 4XDJA 2IJHA 3D3IA 5CBGA 1YHQV 3SJQC 4RQFA 1N8RW 3B2EE 1TVKB 1YIJV 4PD4F 4DV1B 3TCUA 3MHSC 1XHXA 3G6BA 1SC5B 1CPYA 1YVWA 2LGQA 2DJVA 3WB2A 1T5EA 1PPJH 3STZC 1YXBA 5BMVA 3THOA 4X65B 3CS5A 2IU3A 4IT5A 5B66Z 1QLEB 3ABKB 4NB5A 4DR3B 4DR6B 3QO7A 2ZDIA 4FMTA 1OV9A 3OM3B 2ILMA 4GKKB 2E76B 1FKAO 4YJ3A 4ASUG 2QTSA 1JJOA 4O2AA 3RGBA 4CC5A 5A9GA 1GMGA 2Q7EA 1XHZA 1XNQB 2F1MA 1EZJA 2A0LA 1JR9A 2XAGA 3K5LA 2YICA 1S5LZ 3NR7A 1BCCH 2DW4A 2DYRC 2GSMB 4QE7A 2KG7B 1IDSA 2YS8A 3K59A 5IYDO 1U97A 1A32A 2ZQMA 4NXMB 4X1YA 4K8XA 2XAJA 4YY3B 3D8CA 3DXRA 3ASNB 3DSQA 3VQYA 4TSFG 4DV5B 4ICGA 2R9RB 3JAWA 5KHKA 3K58A 2A06H 3HKDB 1RM1C 2DQ0A 3H1KH 4TV9B 3LSSA 3CPWU 1N33O 4BIZA 1RP3B 1XBLA 1SS3A 5J2UB 1QU7A 2NR5A 3HKBA 1OCZC 2BCCH 1YJ9V 4DK1A 1XUQA 2YXYA 1JFFB 4GZRB 4I0XB 2XAHA 3CX5F 4UVAA 2DOSA 4ZHQA 4JZ2A 1TUBB 4U7OA 4H37A 3F7VC 3HR0A 1NU1H 4KXRA 5JH7A 3AG1B 1P49A 4LFCB 4X89A 2VWKA 2F66C 4UUJC 2WSSG 1L0LH 1EFRG 3OE7G 3ZHTA 3CRQA 1NZ6A 1OJHA 1BL8A 1D5AA 4B08A 1VQMV 4P2ZA 2ODMA 4DXWA 4O4IB 4FLXA 5CN0A 4B7KA 1XOUA 5LHIA 1JCHA 1RPOA 3JAKA 4J7KA 3DTUB 2RJZA 3QG5A 3L74H 4I9WA 4TUYA 5IYZB 2F23A 4FLUA 4MVRA 4NTYA 2EIMB 2B5UA 4BWAA 2QDOA 2ZXWB 1BHAA 1VQKV 1SESA 2OYQA 1R6KA 2P4VA 1H2NA 2R9IA 3ZCCA 5GONA 1H2KA 1D2DA 2EIJC 2N74A 5LHHA 3LDEA 4PJ0Z 2E74B 4PDLA 2Y4TA 4IIJB 3JSLA 4E2LA 3CRCA 1H8HG 3FB5C 5LMNO 4AI8A 2H3OA 4WF9V 1W2BU 2G38A 4DUZO 2HR3A 1MZEA 2JS5A 2HKOA 4X1IA 2V4DA 3K3WA 3PJSK 1ZUQA 1V54B 3L75H 4X88A 1XMQO 3BEHA 3ABTA 5EK0A 1UFIA 2AZ0A 2Q7HA 1Y76A 1K3EA 3ZHVA 4QGPA 1YI2V 4IHJA 1EBOA 3X2QC 1K9MW 2JIZG 3UT5A 4J9YB 3L9DA 3WFVA 4HNAA 3VQWA 5IJ9B 1H2GA 3SPJA 2L35A 5E79Z 2RQ6A 2JGUA 1M93A 2QWNB 4DV2B 2CTWA 3AG3C 1HWYA 4JF3A 4GX0A 2ADPA 5IE9A 1M9NA 1SETA 2QWRB 3F5WC 4RUEA 2WLIB 5KX5A 2PYJA 4CS2A 4FJCC 5KA6A 3SYAA 2YC0A 1E79G 4CS3A 5EBMC 4UB8Z 4X1KA 4FLWA 5BR8O 2WWWA 5IYCO 4K0KO 5J2TA 2XTAA 4JTDB 3CMEV 4JI6O 1BE3H 4Z1MG 1QR8A 5CA3A 4X20A 3E8GA 2P6JA 2ZIOA 1SZTA 2KKWA 1VEWA 5IWAO 1M57B 1DF4A 3ZRSA 2X6BA 4J7JA 2Q69A 3H1IH 1G6UA 4FK5C 5EBLC 1GAXA 2LP7A 3UQ8A 3CMAV 4LF9O 4R6ZA 1HDJA 4I4TA 3OTOO 3CCJV 4QNHB 3BA9A 3H9VA 4DR1B 5LP6C 4UVCA 1WJZA 3G67A 4CS4A 5JJNB 5LHGA 2OTLV 3SPCA 3RBZA 3CYOA 1OCCC 3R66A 4ZIBA 1S5JA 4WFGA 1HW7A 1D5NA 2OT5A 1P7BA 2UUBB 1GKFA 5BXZA 2VQFO 3H1LH 2Q5ZA 3E22B 1OCRC 3E8HA 3JARB 1WP8A 4UCSA 5JVDB 1I5YA 2A7WA 4FM1A 4DRXB 4PV1B 3JALA 4AQYO 3EXAA 4TQFA 2EZPA 1PL0A 3D36A 4LNUA 2E3CA 1BMFG 4JI0O 2LW7A 4LF4O 3CRMA 3T2MA 3WU2Z 4I50B 2HJFC 4FZ0A 3U11A 1SZXA 2GV9A 4PI0A 1I94B 1TVKA 2AXTZ 1EN6A 4JI3B 3K5MA 4EEQA 4JI5B 1DTOA 3C3TA 3BY6A 4EFEA 1IZ3A 4GKJB 1Y67A 3ZHUA 3SYQA 4LF7O 3RVYA 3ASOC 4LF5B 5CA0B 3HB3B 3ICXA 4GCZA 3B8MA 3DGEA 1JX9A 2PGGA 4F6RA 2WLNA 5EC1C 1US6A 1Q90D 2QKCA 3T1YB 1G1XB 3LDCA 2QM8A 5FNVB 3UO2A 3MHHC 2FL4A 3EHBB 1R3IC 4R8CA 1Q6IA 2DWEC 2PTMA 3RW0A 2NLJC 2WLLB 1P7GA 1I08A 2DN9A 4UV8A 4J41A 4H13B 2KQXA 1IVSA 2X0LA 2ZKOA 1EZVH 2ZM6O 3ETQA 3CXHF 4KFMA 5GW7A 4PA9A 4WFHA 3KCYA 1XNRB 5H6RA 3ZEDA 5B5EZ 1AJNA 4UCTA 1AJQA 2P90A 1NT2B 2P5OA 1AI6A 5LGTA 2RN9A 4AHCA 1X4TA 4PA7A 2W6IG 4MW8A 4DV7B 2ETNA 1LR1A 1F51A 4NYKA 5EC2C 3OAAG 2ZE6A 2YEVB 4JI8O 3RYIB 3G6EV 5E1AC 2ARHA 5CB4B 2Y0PA 4WFBV 3BVOA 3U0ZA 4JPRA 3OMIB 4I55B 5B3SB 1ORQC 2EINB 1ROPA 2HG5C 3FD9A 1JFFA 1S0VA 3JD2A 1AI7A 1WA8B 3BA8A 4B3TB 1O9HA 1S72V 2UUCB 1N4CA 2QEXV 4J9ZB 4JI1B 4YIOA 3WG7B 1EN4A 2P06A 2UXBO 5BZBA 5KA5A 5ITZB 3JD1A 2EX3A 2CAZC 1NKDA 1IBKB 2DQ3A 2E5LB 1J5EO 3E8BA 4LWSA 5BY1A 4LFAO 3IJ4A 2LQTA 5KHHA 2OCCC 4H0LB 3CCLV 4JAAA 5JJJB 3G80A 2JGDA 5LOVA 3SPHA 2HLDG 1AVMA 3A2FA 3P32A 2WA4A 1Y74A 4LF8B 4B3MB 2IW5A 3K03A 5IY5B 5GTIZ 1F7YA 3WB0A 4UFZA 1GM9A 5GTHZ 1YEWA 1NTMH 2AHYA 2Q0OC 3FB8C 4B3RO 2QM4A 1WB7A 1BQ0A 2UXXA 2DYSC 4KL1A 3J80N 1X59A 2Z0AA 5IYBO 1R3KC 3BABA 3CB2A 3TXSA 1N36B 2DYRB 4IIJA 4PA3A 4LFBB 4C7UA 3CEIA 1BHBA 4LC1A 2LO1A 3DC6A 1GN3A 2XAQA 3T4DA 1N32O 3ETEA 3ZMVA 4NXNO 1KP2A 4TT3G 4G2KA 3VQVA 4JASA 1JQ0A 1NH2D 1GM7A 4JI2O 2UU9O 2ZE7A 3SPGA 4YHHO 1MSDA 3CHXA 2Q7GA 2CH7B 1Q5OA 3OUSA 4DR5B 5LXTA 2VS0A 1FXKB 1OCZB 1Q81W 4IL6Z 5IJ9A 5FLXN 4OX9O 3E8FA 4DR4O 3HKCA 4DV6O 2ZNJA 2QSAA 4DW1A 3OGIB 3SDLA 1S3JA 3H1HH 4I5SA 4RQEA 3MAQA 1Q8IA 3ZN0A 4E4EA 2IJJA 2R9AA 2EJ7A 1R6TA 4FM0A 1YDXA 1PP9H 2BSKB 4EB6B 4NTWA 1IBMB 5C8YB 1XL6A 3ABLC 1SA0A 2CTQA 2GUZA 2HVKC 1Q43A 4JI4B 4ZOLB 4U3JB 3A0RA 4RUFA 4CC6A 1AR1B 1ZL8B 1NVPD 1BSMA 5K1PA 4DV3B 4UVBA 3CRRA 3W7SA 2NN4A 2QTOA 3I5DA 2XASA 4W4KA 5B1OA 3TK1A 1IXBA 4DV0O 4GYCB 4BR6A 1Y66A 1YTFD 2BTOA 2F43G 3ZMUA 2PI4A 3OMAB 1W59A 2PF4E 2EIJB 1GRJA 5JQGB 3JSNA 2W0FC 3OMNB 5LYJB 3SYPA 2JEXA 4D7SA 1MABG 2ZIMA 5CBFA 3W7XA 4KP4A 1HNWO 1Y6XA 4TV8A 1HNXO 3ZS8C 2RMKB 3B8NA 4IYHA 4JYAO 1AB3A 1MMMA 1MZFA 3RYFA 2H8PC 3FAVA 3AG4B 5J9PC 1YJNV 5IDJA 1OZ0A 5LGUA 3RYCB 2XOKG 3AG2B 4BW5A 4DV4B 3F5TA 1SQPH 4LCUC 1YITV 3JARA 4DR7O 1UJWB 2BTQA 1HP8A 3X2QB 1QBZA 4O2BA 1PV0A 2JK5C 2H94A 3CCEV 3D36C 4DR2B 1NTKH 2EIKC 3CC2V 1HR0B 4F4LA 3IC7A 5HFLA 3AK3A 2JEUA 3A8TA 5LA6A 4J10A 4J7ZA 2EILC 4ZKIA 4I50A 5F2VO 1SKVA 3RYHB 2JVDA 3K9SA 5CBHA 4X66O 4GX1A 4J42A 1BT8A 1H2LA 4FFBB 4YJ2B 3FB7C 4KUMA 4XDLA 2UXDB 3OR7C 3OD4A 2O57A 1GN4A 1PKXA 4UCRA 2WLKA 1ZX3A 4GT1A 4QPKA 5CA1B 5L3DA 2A79B 3J81N 3I55V 3RFRA 2QKSA 5LBQA 5IJ0A 2UXCB 4MW3A 4XBFA 1FXVA 3KCXA 3DC5A 4FFKA 3BCCH 2R72A 4WBNB 1MA1A 1I7FA 4X62O 3ETGA 2N04A 4JV5B 3M7MX 2CTRA 4CH3A 1SQGA 1QNMA 4B7EA 4FLZA 4N23A 4OPHA 5EYPA 1F23A 2CGOA 4RO2A 1RSOB 1MOFA 4O4HA 4KHPO 1WLEA 1VQPV 2Y0IA 1XILA 3APQA 3N2GA 2QWQB 1QLNA 1AI4A 3N2KB 1KECA 3OTFA 4N21A 2M7WA 3P3PA 3SJAC 4MTFA 4DUYO 2YIDA 3Q4HB 4MTGA 3ZHRA 5KAIZ 4Z1VA 3RYIA 2IH3C 3TJTA 3ZRWB 5KUKA 1VQ7V 4LP8A 1GO3F 1VF6A 5CB4A 2IJIA 2ZINA 1N0NA 2Z3YA 1I0HA 2E75B 1YF2A 3K0DA 1CEZA 3JASA 5KMGA 1WAZA 1XMOO 2W6JG 4G28B 1WPBA 2UUAO 1FS0G 2LW1A 4L87A 1XI1A 3T1HO 4UB6Z 2Q67A 4ZI7B 4DO2A 5EZYA 3IC9A 2ZE5A 3M99B 1WN7A 4JTCB 1KP3A 5JCOA 2VQEO 5BMVB 5CMUA 3H01A 2P67A 5L3FA 2GBOA 3W7UA 3E83A 3IFXA 1FD9A 2IH1C 1NR7A 4JAVA 1MSWD 3FKSG 3ABUA 1S76D 5JWPA 4YJ3B 2OIEA 2EIMC 2ZXWC 3NXSA 4UCUA 5K1XA 1PM9A 4MVMA 3SGIA 3KZIZ 4K35A 1AP6A 4PA4A 2Y4UA 2CDYA 3SJBC 1QVGU 3AK1A 3RVZA 3U10A 2Y69C 2PUSA 2LFSA 3A0HZ 5LMUB 3CCMV 1VF7A 3QO5A 2HHHO 4IGGA 4QJFB 3K9AA 4X1YB 3VBBA 1N0JA 3GWOA 1TGOA 1M56B 2WAMA 3DXRB 1ZAUA 4HBNA 2ITCC 2NNUA 4FZ1A 4GLXA 3JAWB 1PL4A 4R50A 2CK3G 3AEIA 2BOCC 4MVSA 5L3BA 2D2CB 1G4YB 5KHGA 2ITDC 3P30A 1FFXA 2L6LA 4DYLA 1AR4A 3CCRV 5A2QN 1V9PA 1PD3A 2CH7A 4X64O 1JPXA 3BPZA 1F4NA 2CGNA 1WPXA 2XNDG 1K4DC 4ZHQB 1OHHG 1HNZO 1SQFA 5JH7B 3BAAA 3HPLC 4Q20A 5LMNB 2F4VO 2QWOB 2Z5UA 4JYBA 1VQ4V 4BAYA 4DUZB 3RN4A 4GX5A 2OTJV 1IBLO 1Q6UA 3PN1A 4YXWG 3M8AA 1CP9A 2W0XA 2EULA 4PELA 1XMQB 2BOBC 4TUYB 4B3SB 3W7WA 1R1BA 2DWDC 4O4LB 3JCUZ 4Q6GA 1S77D 3T1CA 1FJGO 4FLTA 2OIGA 1WP7A 5GONB 1R6NA 1Q6HA 5H9CA 1E1RG 4DV1O 2CUGA 3N27A 2Q4PA 1CXZB 5JQGA 2V7QG 3QNEA 4HYOA 2YIAA 2KG7A 1K5QA 3R65A 1ZLZA 2LGWA 1GH6A 2PY5A 4X65O 2P22C 3RWRD 1VQNV 4DR3O 1Y4MA 4DR6O 2M6YA 4K0KB 1B04A 3L73H 1ENVA 3ZMTA 3HKDA 4A5UB 1B06A 4MVQA 3O65A 4JI6B 4GKKO 4GUNA 5TISZ 1H8EG 4TV9A 1Y76B 1W0KG 3SPIA 2KB1A 4IHJB 2EZOA 1SF9A 2Q6AA 5J2UA 1XNQO 2KSDA 1TA8A 1VMGA 4XDKA 5IWAB 4FLVA 3S3XA 3UT5B 2Q9LA 4HNAB 4I0XA 2A9HA 3B77A 1JMKC 4JYYA 2FB5A 1SQVH 1U96A 1VF5B 1AP5A 5DEDA 1TUBA 1VQOV 4UV9A 3EVKA 4LF9B 4NXMO 3ZHSA 1NI8A 4I7ZB 3OTOB 4YY3O 1KMIZ 3ABLB 3L72H 1GM8A 3ZRVA 3K5OA 1QQCA 4O4IA 1Z5WA 4DV5O 1JJ2U 5FL7G 4X1KB 2AGAA 1H2SB 3LUTB 4BIUA 5IYZA 1XDCA 2VQFB 3CCUV 1KUQA 1P84F 3SR2C 4H33A 3C3SA 4IYIA 1EM1A 4LF6B 2AW9A 4AQYB 3K0GA 2IJKA 4LH7A 4MTOA 3CC4V 1URFA 4JI0B 1COWG 4Z2WA 3QTCA 4FPPA 4LF4B 4MSWC 3ZJZA 4TWKA 4CZZA 4LFCO 3SYCA 4K3AA 3LSUA 2R70A 3UCSC 1NJIW 2Q68A 4BIOA 3K5NA 3ZBHA 4U7NA 1I5XA 2K9PA 2QWPB 3N2KA 4MVUA 1M5IA 4MVZA 1RM1B 3CD6V 1K97A 3JALB 2YSUB 5B1AC 2QGNA 4LR3A 4J80A 1YSCA 2YI9A 4LNUB 1N34B 1VQ5V 1GK9A 2QJ1A 4BW9A 2EIKB 5B1BC 1VF6C 2B9ZA 3IAYA 1IXMA 2RCVA 3AG7A 2EINC 2EILB 4TOIA 3ABMC 2ZM6B 3CP1A 2WLIA 4PDVA 2X7RB 2IBZH 3WG7C 4H44B 4ZI7A 1PNLA 1Z5VA 4GX2A 3HKEB 3OEEG 3K57A 5JCOC 1XREA 3SYOA 1VP7A 3JATB 4F6RB 1EN5A 4OGQB 1YZBA 3KG2A 4JI8B 4X9QA 1V55C 3CJHB 4UCOA 1LNQA 1H2MA 4QE9A 4DV2O 5IY5C 5H6QA 5EBWC 2FTKA 3TETA 1DK1A 1B3QA 3CWBH 1JA8A 4W4LA 3STLC 1BQZA 4JYCA 4JI7B 1TAEA 4FVMA 2QA4V 4JGSA 4CBCA 1YJWV 2QR4A 2AHZA 3E35A 1Q82W 2JS3A 2UXBB 3J7AU 2OCHA 5KLVH 3E22A 1J5EB 1LUVA 1R3JC 5JVDA 4LFAB 4DRXA 3FYEB 3OR6C 2CTPA 1FYJA 4PDMA 2JJ1G 3K79A 1NBMG 1OCOC 1VQ9V 2AZ2A 3JD4A 4HZ3A 3JD3A 2QKAA 4DW0A 4MTXA 1NH2B 3G71V 3FX7A 3K08A 1K73W 1BZKA 1K34A 3RT3C 1PNKA 4B3RB 4NR1A 1FXKC 3AG3B 1WNSA 1LUWA 1E1QG 1GN2A 3UO3A 1Q86W 4DR1O 1NQTA 2EJRA 4FLYA 3JCZA 2HVJC 3QO8A 4G27B 5LMUO 1P4RA 2C2AA 2ZE8A 5B1NA 2HJDA 1Q3EA 2Q73A 5CA0A 2UUBO 5C93A 3TGUH 3ZX6A 4I9QA 3ZMZA 2ZNIA 1KKCA 4LWSB 4PA6A 1M4UA 1N32B 1QLEC 2N05A 3ABKC 3WB1A 3B40A 4NXNB 3CCVV 4K8ZA 1FPOA 5FNVA 4LBEC 2JGDB 5LOVB 4JI2B 4RAIA 2UU9B 1Y74B 1NVPB 1M90W 5EIBD 1FXHA 1F4MA
chains in the Genus database with same CATH topology
3G6EV 4QJFB 1CPYA 5E1AC 4JAUA 3K9AA 1VQ6V 3VBBA 3GWOA 4WFBV 2WLLA 3LSQA 4JPRA 3OMIB 1FFTB 1M56B 3STZC 3ZN1A 5B3SB 1QVFU 1ORQC 2WAMA 3T4ZA 2EINB 1VQLV 1ROPA 2HG5C 2IU3A 2IU0A 1K4CC 2ITCC 2NNUA 1S0VA 3OW2U 2JJ2G 1AI7A 1QLEB 3ABKB 3JD2A 3K04A 4R50A 1S72V 1YTFB 2CK3G 3AEIA 3QO7A 2Y69B 2WPDG 2BOCC 2QEXV 2ZDIA 4FMTA 3FYIB 3OM3B 4J9ZB 4MVSA 5L3BA 4X8AA 3ZIAG 1G4YB 1OCCB 2ITDC 3P30A 2UXNA 3WG7B 4ASUG 3UKMA 5BZBA 5KA5A 3CCRV 4R7CA 1GMGA 1PD3A 3JD1A 1NKDA 1JPXA 2DQ3A 5LGNA 1KD1W 1OCRB 3E8BA 3ASNC 1XL4A 1F4NA 3UM7A 1WPXA 1EZJA 2A0LA 2XNDG 1K4DC 2OCCC 2XAGA 3CCLV 2YEVA 3AG4C 2DW4A 3SPHA 2HLDG 2DYRC 2GSMB 4QE7A 1OHHG 3P32A 5IYDO 1SERA 3AG2C 2IW5A 3K03A 2ZQMA 2XAJA 3HPLC 4Q20A 5IY5B 4QIWF 1GM9A 2Z5UA 2AHYA 3FB8C 4JYBA 1VQ4V 2WLHA 4BAYA 3GB7C 2UXXA 2DYSC 4GX5A 3ASNB 3CCSV 4TSFG 2OTJV 2HFEC 2R9RB 5IYBO 4YXWG 1CP9A 1R3KC 1VQ8V 2ZD9A 4PELA 2ZR3A 2BOBC 2DYRB 1RM1C 4PA3A 1K7DA 2DQ0A 3AG1C 2D3OW 3W7WA 2ZR2A 2DWDC 3ASOB 3JYCA 3ML0A 3LSSA 3G4SV 1BHBA 3CPWU 1S77D 4BIZA 4LC1A 3T1CA 1PNMA 1OCZC 1YJ9V 2XAQA 1R6NA 1K92A 3T4DA 3ETEA 2XAHA 4WFEA 3ZMVA 5H9CA 1E1RG 2LFRA 4UVAA 1KP2A 1QCEA 4G2KA 4TT3G 4JASA 2V7QG 1JQ0A 1NH2D 3QNEA 1GM7A 4HYOA 4U7OA 4H37A 3F7VC 1K5QA 3SPGA 3R65A 3AG1B 4X89A 4UUJC 2WSSG 1EFRG 3OE7G 3OUSA 1M1KW 1BL8A 5L3GA 1VQMV 1FXKB 1OCZB 1Q81W 4P2ZA 4QPJA 4DXWA 1VQNV 1SRYA 1Y4MA 5CN0A 3E8FA 5LHIA 4MVOA 1JCHA 1ENVA 1S3JA 4I5SA 3ZMTA 4RQEA 2V1DA 4MVQA 1RPOA 3DTUB 1KKDA 4I9WA 4MVRA 1H8EG 2XAFA 2EIMB 2B5UA 3ZN0A 1W0KG 3SPIA 2IJJA 2KB1A 2ZXWB 5L3EA 2EZOA 1BHAA 2Q6AA 4P30A 1SESA 1XL6A 1R6KA 1VQKV 3ABLC 4XDKA 3LDDA 4ZBMA 2R9IA 2HVKC 3ZCCA 2A9HA 3A0RA 3B77A 4RUFA 1AR1B 2EIJC 1J95A 1NVPD 5LHHA 2EBOA 1V54C 3LDEA 4UVBA 3JD0A 1QR9A 3W7SA 1VQOV 4PDLA 4UV9A 2QTOA 2B1IA 2XASA 5B1OA 3TK1A 4E2LA 1H8HG 3FB5C 3IGAC 1Y66A 4WF9V 1W2BU 3E2EA 2P7TC 3ABLB 1YTFD 1GM8A 2HR3A 3ZRVA 1FXKA 2F43G 3ZMUA 2PI4A 2HKOA 4WCEV 3OMAB 1JJ2U 3K3WA 2EIJB 1DF5A 3PJSK 5FL7G 4HAMA 2W0FC 3OMNB 1V54B 3LUTB 4X88A 3SYPA 4BIUA 2JEXA 3BEHA 3ABTA 1MABG 5EK0A 3CCUV 1G8MA 4H33A 5CBFA 3W7XA 4KP4A 1K3EA 1YI2V 1EBOA 3MD0A 3X2QC 1K9MW 3K0GA 2IJKA 4MTOA 2JIZG 3CC4V 4J9YB 3WFVA 3B8NA 1H2GA 3SPJA 2H8PC 2OCCB 5HFMA 1COWG 4FPPA 3AG4B 5J9PC 3LNMB 4MSWC 3ZJZA 1R3LC 1YJNV 5IDJA 1OZ0A 4WFAV 5LGUA 2XOKG 3AG2B 4BW5A 4TWKA 4CZZA 4LCUC 1YITV 3AG3C 1UJWB 3SYCA 1HWYA 4JF3A 3X2QB 1QBZA 1M57C 4GX0A 1M9NA 1GTOA 1SETA 2Q68A 2JK5C 2QM7A 3F5WC 1NJIW 4RUEA 2WLIB 2H94A 1KC8W 3CCEV 2DYSB 2ZDIC 4FJCC 4U7NA 1I5XA 5KA6A 3SYAA 2Y48A 1E79G 5EBMC 2EIKC 3CC2V 2WWWA 5IYCO 4F4LA 3IC7A 3CC7V 4JTDB 5HFLA 4MVUA 1L1FA 2JEUA 3CMEV 3CCQV 4MVZA 1RM1B 4Z1MG 1QR8A 5CA3A 4ZKIA 2EILC 1S5HC 3E8GA 2P6JA 1Q7YW 3CD6V 1K97A 1K5SA 1SZTA 4UXNA 4P9OA 2YSUB 5B1AC 1M57B 1K8AW 1DF4A 3OUFA 5CBHA 4GX1A 3ZRSA 2X6BA 1YSCA 1H38A 1VQ5V 2Q69A 1GK9A 1KQSU 4FK5C 5EBLC 4P9PA 3FB7C 2EIKB 4KUMA 4XDLA 5B1BC 3OGCC 3OR7C 1R73A 1PKXA 2LP7A 1IXMA 3CMAV 1TUEB 1M56C 4MS2A 3OFNG 2WLKA 2EINC 4R6ZA 3CXCU 4GT1A 4QPKA 2EILB 3VOUA 5L3DA 3CCJV 4QNHB 2A79B 3I56V 3ABMC 1AJPA 3I55V 4UVCA 3CP1A 2WLIA 2K1EA 2QKSA 5B1AB 5LBQA 5LHGA 2OTLV 3SPCA 4WFFA 3RBZA 4MW3A 3CYOA 4XBFA 4PDVA 1OCCC 2X7RB 3WG7C 1FXVA 4WFGA 1PNLA 5DN6G 2OT5A 5B1BB 4GX2A 1P7BA 3OEEG 3ETGA 5DM6V 1GKFA 1DLBA 1JVMA 2QE7G 1OCRC 3E8HA 4N23A 2B1GA 3SYOA 1F23A 1I5YA 2WLMA 4RO2A 3W7TA 1MOFA 2PI5A 3ABMB 1AI5A 2EZPA 3KG2A 1WLEA 1PL0A 3D36A 1VQPV 1BMFG 1V55C 1LNQA 1K33A 4QE9A 1QLNA 1AI4A 1KECA 5IY5C 5H6QA 4N21A 5EBWC 2FTKA 3T2MA 2M7WA 1B6QA 3TETA 1JOYA 1RPRA 2HJFC 4MTFA 3E86A 2JDIG 4PDRA 4MTGA 3STLC 2X6AA 4JYCA 2IH3C 1DTOA 3BY6A 3ZRWB 2QA4V 1V55B 4EKWA 4JGSA 4CBCA 1YJWV 3SYQA 3ZRXA 5KUKA 3EFFK 2AHZA 3ASOC 3E35A 4LP8A 3RVYA 1GO3F 1VQ7V 1Q82W 2IJIA 1AROP 2Z3YA 3HB3B 3OEHG 3FB6C 1CEZA 3K0DA 2MK3A 3K06A 2W6JG 4GCZA 1R3JC 3B8MA 3DGEA 3F7YC 1JX9A 3FYEB 3OR6C 2WLNA 4OXSA 2WLJA 4G28B 5EC1C 4PDMA 2ATKC 2JJ1G 3K79A 4MT8A 1NBMG 1FS0G 3LDCA 1OCOC 2QM8A 3MHHC 3EHBB 1R3IC 4L87A 4R8CA 1VQ9V 2Q67A 2DWEC 3JD4A 4HZ3A 3JD3A 4DO2A 1NR1A 3RW0A 4MTXA 2NLJC 3G71V 1NH2B 3M99B 4FIPC 3E89A 2WLLB 4JTCB 1KP3A 3K08A 5L3CA 1K73W 1K34A 5KUMA 1PNKA 5CMUA 4UV8A 3H01A 2P67A 5L3FA 3W7UA 1FXKC 3AG3B 1E1QG 2X0LA 1Q86W 3E83A 1NQTA 3IFXA 2EJRA 2IH1C 1NR7A 1W0JG 4JAVA 4KFMA 1ZWIC 3JCZA 1MSWD 1OCOB 2HVJC 3FKSG 5GW7A 3QO8A 4G27B 3ZMSA 4PA9A 4WFHA 3ZRWA 3ABUA 5H6RA 1S76D 1P4RA 2C2AA 4JTAB 5B1NA 2EIMC 1AJNA 2ZXWC 2X6CA 5C93A 1AJQA 5B3SC 2P90A 3NXSA 4MVMA 3ZMZA 2GHYA 1THZA 1AI6A 3ETDA 5LGTA 1MG1A 4PA7A 2W6IG 2IJHA 3D3IA 4PA6A 4XDJA 5CBGA 1YHQV 4PA4A 3SJQC 4RQFA 1N8RW 4MW8A 1QLEC 3ABKC 1YIJV 1F51A 3CCVV 1QVGU 3RVZA 5EC2C 3OAAG 2Y69C 3TCUA 2YEVB 3MHSC 4LBEC 2LFSA 3CCMV 4RAIA 3QO5A 1NVPB 1M90W 1FXHA 1F4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP7 A;  3M99 B;  3K9A A;  4FIP C;  3GWO A;  1DLB A;  4N21 A;  5KA5 A;  1QR8 A;  1K34 A;  4JPR A;  2M7W A;  4E2L A;  2MK3 A;  5CMU A;  4N23 A;  2EZO A;  1EBO A;  2P6J A;  1JPX A;  3H01 A;  1Y66 A;  4JF3 A;  1MG1 A;  1F23 A;  1I5Y A;  1QBZ A;  1SZT A;  3B8M A;  1MOF A;  3CP1 A;  1DF4 A;  2EZP A;  3WFV A;  3B77 A;  5H9C A;  3B8N A;  4FJC C;  1QCE A;  1Y4M A;  4G2K A;  1I5X A;  5CN0 A;  3MHH C;  3MHS C;  3CYO A;  1DF5 A;  2EBO A;  5HFM A;  5KA6 A;  2X7R B;  4FK5 C;  1JQ0 A;  1K33 A;  1QR9 A;  1ENV A;  4JGS A;  2OT5 A;  3P30 A;  5HFL A; 
#chains in the Genus database with same CATH topology
 2CE4 A;  4JAU A;  4YHH B;  1VQ6 V;  2WLL A;  4O4L A;  3LSQ A;  1FFT B;  3ZN1 A;  2P4K A;  1QVF U;  2WA3 A;  3T4Z A;  1VQL V;  2IU0 A;  1K4C C;  4AIL C;  2GTA A;  1I94 O;  3OW2 U;  2JJ2 G;  4JI3 O;  4OX9 B;  3K04 A;  5LP6 B;  4DR4 B;  1YTF B;  4DV6 B;  2Y69 B;  2WPD G;  3APO A;  4JI5 O;  3FYI B;  3B4S A;  4X8A A;  5AG2 A;  3ZIA G;  1OCC B;  4GKJ O;  2UXN A;  2A3Q A;  1L0N H;  3UKM A;  4LF5 O;  4R7C A;  2VRZ A;  3AK2 A;  5LGN A;  1KD1 W;  2MW2 B;  1OCR B;  3ASN C;  1XL4 A;  5H5N A;  3UM7 A;  5KHI A;  4TQD A;  4O4J B;  3T1Y O;  2YEV A;  3AG4 C;  1SQX H;  1SER A;  5IT9 N;  3AG2 C;  4B3S O;  1O9G A;  2DMX A;  2PYL A;  4DV0 B;  3A0B Z;  4QIW F;  2LJ2 A;  4I55 A;  5FPR A;  2WLH A;  5LXT B;  3GB7 C;  3CCS V;  2PZS A;  2FML A;  1WA8 A;  2HFE C;  3HKC B;  1VQ8 V;  2ZD9 A;  2ZR3 A;  1XNR O;  1K7D A;  2DE0 X;  3AG1 C;  2D3O W;  2ZR2 A;  3ML0 A;  3ASO B;  3JYC A;  3G4S V;  1HNW B;  3BHP A;  4D6T H;  5ITZ A;  1VIB A;  3O9O A;  2GDS A;  1SA0 B;  1XEQ A;  1KU9 A;  1PNM A;  2GUZ B;  1RFY A;  1HNX B;  5DEC A;  1K92 A;  4WFE A;  4DV7 O;  2LFR A;  4JYA B;  1QCE A;  1BGY H;  4O2A B;  4OPA A;  4DR7 B;  1N33 B;  1DGS A;  1Z2G A;  1M1K W;  5L3G A;  3ZHQ A;  4QPJ A;  1SRY A;  4B3T O;  3OT7 A;  2UUC O;  4MVO A;  4JI1 O;  2V1D A;  1KKD A;  2XAF A;  3L71 H;  3GVM A;  5L3E A;  2VWJ A;  4PHZ A;  4TV8 B;  4P30 A;  2OWO A;  1IBK O;  2E5L O;  3LDD A;  4UCV A;  4ZBM A;  4X66 B;  3B09 A;  1VAR A;  1J95 A;  3RYF B;  2ZCE A;  2EBO A;  1V54 C;  1NTZ H;  3JD0 A;  3FAV B;  1QR9 A;  2XUM A;  4LF8 O;  2B1I A;  4B3M O;  1WB8 A;  4LF6 O;  3C90 A;  3IGA C;  2BTQ B;  2YIB A;  4O2B B;  3E2E A;  3HKB B;  2P7T C;  1FXK A;  4WCE V;  2YXH A;  2FYU H;  5LL6 Y;  1DF5 A;  4HAM A;  1XQ8 A;  1BS3 A;  1GN6 A;  4X62 B;  1N36 O;  1QHT A;  1YCI A;  4LFB O;  5LA6 B;  1G8M A;  2YUA A;  1UPG A;  3MD0 A;  2BSK A;  4EB6 A;  5C8Y A;  2ZT9 B;  4KHP B;  5H2F Z;  3GWK C;  4ZOL A;  4U3J A;  2FKX A;  2Q0A A;  1ZL8 A;  2OCC B;  5HFM A;  4D7T A;  4ABM A;  2XT9 A;  3LNM B;  3H1J H;  1R3L C;  3HKE A;  4WFA V;  3JAK B;  3CE2 A;  1L8D A;  2RNB A;  1SQQ H;  3QVN A;  1KYO F;  1FAF A;  3D3Q A;  2XHB A;  4DK0 A;  3L70 H;  4DUY B;  1M57 C;  3JAT A;  1GTO A;  4DR5 O;  2QM7 A;  1MNG A;  1KC8 W;  2YDE A;  2DYS B;  2ZDI C;  3BFR A;  5IJ0 B;  2F93 B;  1N34 O;  2Y48 A;  3CJH A;  4NKG B;  5LYJ A;  3CC7 V;  4PI2 A;  1L1F A;  3CCQ V;  5EIB C;  3FFQ A;  1S5H C;  5EYP B;  1XMO B;  2YI8 A;  3JAM N;  1Q7Y W;  5JJE B;  1K5S A;  1IBM O;  4UXN A;  4O4H B;  4P9O A;  1K8A W;  2UUA B;  3OUF A;  4JI4 O;  4X1I B;  1H38 A;  1AR5 A;  2HEP A;  3T1H B;  1KQS U;  5BR8 B;  4DV3 O;  3P3N A;  3N2G B;  4P9P A;  3OGC C;  1R73 A;  1IUR A;  2YIB D;  1TUE B;  1M56 C;  2ADQ B;  4MS2 A;  5D5P A;  3OFN G;  4CH6 A;  3RYC A;  5D5Q A;  2VQE B;  3CXC U;  3VOU A;  2Q8V A;  3I56 V;  4LH6 A;  1KBH A;  1AJP A;  2K1E A;  5B1A B;  4WFF A;  4RWU A;  1SQB H;  5DN6 G;  4CH5 A;  5B1B B;  5DM6 V;  1DLB A;  1JVM A;  2HP8 A;  2QE7 G;  3JAS B;  4J11 A;  5KMG B;  2B1G A;  2WLM A;  3KKY A;  3W7T A;  2PI5 A;  3ABM B;  3RYH A;  1AI5 A;  4L8J A;  5KX5 B;  4FFB A;  4JI7 O;  4YJ2 A;  2F95 B;  2HHH B;  1K33 A;  5EZY B;  5J2T B;  4FM2 A;  4DV4 O;  1B6Q A;  3LNN A;  1IX9 A;  1JOY A;  5CA1 A;  4X20 B;  1RPR A;  4CH4 A;  2YXL A;  3E86 A;  2JDI G;  2RDC A;  4PDR A;  2X6A A;  5KHJ A;  4DR2 O;  4NTX A;  1ZSP A;  1V55 B;  4EFB A;  4EKW A;  3S3W A;  1HR0 O;  3ZRX A;  3EFF K;  4WBN A;  5KAF Z;  1ARO P;  3OEH G;  3CSX A;  3FB6 C;  4X64 B;  2MK3 A;  3K06 A;  4I4T B;  3BRC A;  2IM9 A;  1RSO A;  3CRA A;  3F7Y C;  4OXS A;  2WLJ A;  4F6E A;  2ATK C;  4MT8 A;  5LP6 A;  3VQX A;  1KB9 F;  1HNZ B;  4LF7 B;  2UXD O;  1NR1 A;  3SJC C;  1ZTE A;  4FIP C;  3E89 A;  5L3C A;  2F4V B;  5KUM A;  3TXQ A;  1NS1 A;  4JZG A;  2GTS A;  1IBL B;  3Q4H A;  1W0J G;  4O4J A;  2BE3 A;  4YIP A;  1ZWI C;  1OCO B;  2UXC O;  3ZMS A;  2JRI A;  3ZRW A;  5FPO A;  4JTA B;  1FFX B;  2X6C A;  5B3S C;  4JV5 O;  4NVP A;  4U3F H;  2GHY A;  3QF7 A;  1AIL A;  1FJG B;  1THZ A;  3MDS A;  3ETD A;  1MG1 A;  4XDJ A;  2IJH A;  3D3I A;  5CBG A;  1YHQ V;  3SJQ C;  4RQF A;  1N8R W;  3B2E E;  1TVK B;  1YIJ V;  4PD4 F;  4DV1 B;  3TCU A;  3MHS C;  1XHX A;  3G6B A;  1SC5 B;  1CPY A;  1YVW A;  2LGQ A;  2DJV A;  3WB2 A;  1T5E A;  1PPJ H;  3STZ C;  1YXB A;  5BMV A;  3THO A;  4X65 B;  3CS5 A;  2IU3 A;  4IT5 A;  5B66 Z;  1QLE B;  3ABK B;  4NB5 A;  4DR3 B;  4DR6 B;  3QO7 A;  2ZDI A;  4FMT A;  1OV9 A;  3OM3 B;  2ILM A;  4GKK B;  2E76 B;  1FKA O;  4YJ3 A;  4ASU G;  2QTS A;  1JJO A;  4O2A A;  3RGB A;  4CC5 A;  5A9G A;  1GMG A;  2Q7E A;  1XHZ A;  1XNQ B;  2F1M A;  1EZJ A;  2A0L A;  1JR9 A;  2XAG A;  3K5L A;  2YIC A;  1S5L Z;  3NR7 A;  1BCC H;  2DW4 A;  2DYR C;  2GSM B;  4QE7 A;  2KG7 B;  1IDS A;  2YS8 A;  3K59 A;  5IYD O;  1U97 A;  1A32 A;  2ZQM A;  4NXM B;  4X1Y A;  4K8X A;  2XAJ A;  4YY3 B;  3D8C A;  3DXR A;  3ASN B;  3DSQ A;  3VQY A;  4TSF G;  4DV5 B;  4ICG A;  2R9R B;  3JAW A;  5KHK A;  3K58 A;  2A06 H;  3HKD B;  1RM1 C;  2DQ0 A;  3H1K H;  4TV9 B;  3LSS A;  3CPW U;  1N33 O;  4BIZ A;  1RP3 B;  1XBL A;  1SS3 A;  5J2U B;  1QU7 A;  2NR5 A;  3HKB A;  1OCZ C;  2BCC H;  1YJ9 V;  4DK1 A;  1XUQ A;  2YXY A;  1JFF B;  4GZR B;  4I0X B;  2XAH A;  3CX5 F;  4UVA A;  2DOS A;  4ZHQ A;  4JZ2 A;  1TUB B;  4U7O A;  4H37 A;  3F7V C;  3HR0 A;  1NU1 H;  4KXR A;  5JH7 A;  3AG1 B;  1P49 A;  4LFC B;  4X89 A;  2VWK A;  2F66 C;  4UUJ C;  2WSS G;  1L0L H;  1EFR G;  3OE7 G;  3ZHT A;  3CRQ A;  1NZ6 A;  1OJH A;  1BL8 A;  1D5A A;  4B08 A;  1VQM V;  4P2Z A;  2ODM A;  4DXW A;  4O4I B;  4FLX A;  5CN0 A;  4B7K A;  1XOU A;  5LHI A;  1JCH A;  1RPO A;  3JAK A;  4J7K A;  3DTU B;  2RJZ A;  3QG5 A;  3L74 H;  4I9W A;  4TUY A;  5IYZ B;  2F23 A;  4FLU A;  4MVR A;  4NTY A;  2EIM B;  2B5U A;  4BWA A;  2QDO A;  2ZXW B;  1BHA A;  1VQK V;  1SES A;  2OYQ A;  1R6K A;  2P4V A;  1H2N A;  2R9I A;  3ZCC A;  5GON A;  1H2K A;  1D2D A;  2EIJ C;  2N74 A;  5LHH A;  3LDE A;  4PJ0 Z;  2E74 B;  4PDL A;  2Y4T A;  4IIJ B;  3JSL A;  4E2L A;  3CRC A;  1H8H G;  3FB5 C;  5LMN O;  4AI8 A;  2H3O A;  4WF9 V;  1W2B U;  2G38 A;  4DUZ O;  2HR3 A;  1MZE A;  2JS5 A;  2HKO A;  4X1I A;  2V4D A;  3K3W A;  3PJS K;  1ZUQ A;  1V54 B;  3L75 H;  4X88 A;  1XMQ O;  3BEH A;  3ABT A;  5EK0 A;  1UFI A;  2AZ0 A;  2Q7H A;  1Y76 A;  1K3E A;  3ZHV A;  4QGP A;  1YI2 V;  4IHJ A;  1EBO A;  3X2Q C;  1K9M W;  2JIZ G;  3UT5 A;  4J9Y B;  3L9D A;  3WFV A;  4HNA A;  3VQW A;  5IJ9 B;  1H2G A;  3SPJ A;  2L35 A;  5E79 Z;  2RQ6 A;  2JGU A;  1M93 A;  2QWN B;  4DV2 B;  2CTW A;  3AG3 C;  1HWY A;  4JF3 A;  4GX0 A;  2ADP A;  5IE9 A;  1M9N A;  1SET A;  2QWR B;  3F5W C;  4RUE A;  2WLI B;  5KX5 A;  2PYJ A;  4CS2 A;  4FJC C;  5KA6 A;  3SYA A;  2YC0 A;  1E79 G;  4CS3 A;  5EBM C;  4UB8 Z;  4X1K A;  4FLW A;  5BR8 O;  2WWW A;  5IYC O;  4K0K O;  5J2T A;  2XTA A;  4JTD B;  3CME V;  4JI6 O;  1BE3 H;  4Z1M G;  1QR8 A;  5CA3 A;  4X20 A;  3E8G A;  2P6J A;  2ZIO A;  1SZT A;  2KKW A;  1VEW A;  5IWA O;  1M57 B;  1DF4 A;  3ZRS A;  2X6B A;  4J7J A;  2Q69 A;  3H1I H;  1G6U A;  4FK5 C;  5EBL C;  1GAX A;  2LP7 A;  3UQ8 A;  3CMA V;  4LF9 O;  4R6Z A;  1HDJ A;  4I4T A;  3OTO O;  3CCJ V;  4QNH B;  3BA9 A;  3H9V A;  4DR1 B;  5LP6 C;  4UVC A;  1WJZ A;  3G67 A;  4CS4 A;  5JJN B;  5LHG A;  2OTL V;  3SPC A;  3RBZ A;  3CYO A;  1OCC C;  3R66 A;  4ZIB A;  1S5J A;  4WFG A;  1HW7 A;  1D5N A;  2OT5 A;  1P7B A;  2UUB B;  1GKF A;  5BXZ A;  2VQF O;  3H1L H;  2Q5Z A;  3E22 B;  1OCR C;  3E8H A;  3JAR B;  1WP8 A;  4UCS A;  5JVD B;  1I5Y A;  2A7W A;  4FM1 A;  4DRX B;  4PV1 B;  3JAL A;  4AQY O;  3EXA A;  4TQF A;  2EZP A;  1PL0 A;  3D36 A;  4LNU A;  2E3C A;  1BMF G;  4JI0 O;  2LW7 A;  4LF4 O;  3CRM A;  3T2M A;  3WU2 Z;  4I50 B;  2HJF C;  4FZ0 A;  3U11 A;  1SZX A;  2GV9 A;  4PI0 A;  1I94 B;  1TVK A;  2AXT Z;  1EN6 A;  4JI3 B;  3K5M A;  4EEQ A;  4JI5 B;  1DTO A;  3C3T A;  3BY6 A;  4EFE A;  1IZ3 A;  4GKJ B;  1Y67 A;  3ZHU A;  3SYQ A;  4LF7 O;  3RVY A;  3ASO C;  4LF5 B;  5CA0 B;  3HB3 B;  3ICX A;  4GCZ A;  3B8M A;  3DGE A;  1JX9 A;  2PGG A;  4F6R A;  2WLN A;  5EC1 C;  1US6 A;  1Q90 D;  2QKC A;  3T1Y B;  1G1X B;  3LDC A;  2QM8 A;  5FNV B;  3UO2 A;  3MHH C;  2FL4 A;  3EHB B;  1R3I C;  4R8C A;  1Q6I A;  2DWE C;  2PTM A;  3RW0 A;  2NLJ C;  2WLL B;  1P7G A;  1I08 A;  2DN9 A;  4UV8 A;  4J41 A;  4H13 B;  2KQX A;  1IVS A;  2X0L A;  2ZKO A;  1EZV H;  2ZM6 O;  3ETQ A;  3CXH F;  4KFM A;  5GW7 A;  4PA9 A;  4WFH A;  3KCY A;  1XNR B;  5H6R A;  3ZED A;  5B5E Z;  1AJN A;  4UCT A;  1AJQ A;  2P90 A;  1NT2 B;  2P5O A;  1AI6 A;  5LGT A;  2RN9 A;  4AHC A;  1X4T A;  4PA7 A;  2W6I G;  4MW8 A;  4DV7 B;  2ETN A;  1LR1 A;  1F51 A;  4NYK A;  5EC2 C;  3OAA G;  2ZE6 A;  2YEV B;  4JI8 O;  3RYI B;  3G6E V;  5E1A C;  2ARH A;  5CB4 B;  2Y0P A;  4WFB V;  3BVO A;  3U0Z A;  4JPR A;  3OMI B;  4I55 B;  5B3S B;  1ORQ C;  2EIN B;  1ROP A;  2HG5 C;  3FD9 A;  1JFF A;  1S0V A;  3JD2 A;  1AI7 A;  1WA8 B;  3BA8 A;  4B3T B;  1O9H A;  1S72 V;  2UUC B;  1N4C A;  2QEX V;  4J9Z B;  4JI1 B;  4YIO A;  3WG7 B;  1EN4 A;  2P06 A;  2UXB O;  5BZB A;  5KA5 A;  5ITZ B;  3JD1 A;  2EX3 A;  2CAZ C;  1NKD A;  1IBK B;  2DQ3 A;  2E5L B;  1J5E O;  3E8B A;  4LWS A;  5BY1 A;  4LFA O;  3IJ4 A;  2LQT A;  5KHH A;  2OCC C;  4H0L B;  3CCL V;  4JAA A;  5JJJ B;  3G80 A;  2JGD A;  5LOV A;  3SPH A;  2HLD G;  1AVM A;  3A2F A;  3P32 A;  2WA4 A;  1Y74 A;  4LF8 B;  4B3M B;  2IW5 A;  3K03 A;  5IY5 B;  5GTI Z;  1F7Y A;  3WB0 A;  4UFZ A;  1GM9 A;  5GTH Z;  1YEW A;  1NTM H;  2AHY A;  2Q0O C;  3FB8 C;  4B3R O;  2QM4 A;  1WB7 A;  1BQ0 A;  2UXX A;  2DYS C;  4KL1 A;  3J80 N;  1X59 A;  2Z0A A;  5IYB O;  1R3K C;  3BAB A;  3CB2 A;  3TXS A;  1N36 B;  2DYR B;  4IIJ A;  4PA3 A;  4LFB B;  4C7U A;  3CEI A;  1BHB A;  4LC1 A;  2LO1 A;  3DC6 A;  1GN3 A;  2XAQ A;  3T4D A;  1N32 O;  3ETE A;  3ZMV A;  4NXN O;  1KP2 A;  4TT3 G;  4G2K A;  3VQV A;  4JAS A;  1JQ0 A;  1NH2 D;  1GM7 A;  4JI2 O;  2UU9 O;  2ZE7 A;  3SPG A;  4YHH O;  1MSD A;  3CHX A;  2Q7G A;  2CH7 B;  1Q5O A;  3OUS A;  4DR5 B;  5LXT A;  2VS0 A;  1FXK B;  1OCZ B;  1Q81 W;  4IL6 Z;  5IJ9 A;  5FLX N;  4OX9 O;  3E8F A;  4DR4 O;  3HKC A;  4DV6 O;  2ZNJ A;  2QSA A;  4DW1 A;  3OGI B;  3SDL A;  1S3J A;  3H1H H;  4I5S A;  4RQE A;  3MAQ A;  1Q8I A;  3ZN0 A;  4E4E A;  2IJJ A;  2R9A A;  2EJ7 A;  1R6T A;  4FM0 A;  1YDX A;  1PP9 H;  2BSK B;  4EB6 B;  4NTW A;  1IBM B;  5C8Y B;  1XL6 A;  3ABL C;  1SA0 A;  2CTQ A;  2GUZ A;  2HVK C;  1Q43 A;  4JI4 B;  4ZOL B;  4U3J B;  3A0R A;  4RUF A;  4CC6 A;  1AR1 B;  1ZL8 B;  1NVP D;  1BSM A;  5K1P A;  4DV3 B;  4UVB A;  3CRR A;  3W7S A;  2NN4 A;  2QTO A;  3I5D A;  2XAS A;  4W4K A;  5B1O A;  3TK1 A;  1IXB A;  4DV0 O;  4GYC B;  4BR6 A;  1Y66 A;  1YTF D;  2BTO A;  2F43 G;  3ZMU A;  2PI4 A;  3OMA B;  1W59 A;  2PF4 E;  2EIJ B;  1GRJ A;  5JQG B;  3JSN A;  2W0F C;  3OMN B;  5LYJ B;  3SYP A;  2JEX A;  4D7S A;  1MAB G;  2ZIM A;  5CBF A;  3W7X A;  4KP4 A;  1HNW O;  1Y6X A;  4TV8 A;  1HNX O;  3ZS8 C;  2RMK B;  3B8N A;  4IYH A;  4JYA O;  1AB3 A;  1MMM A;  1MZF A;  3RYF A;  2H8P C;  3FAV A;  3AG4 B;  5J9P C;  1YJN V;  5IDJ A;  1OZ0 A;  5LGU A;  3RYC B;  2XOK G;  3AG2 B;  4BW5 A;  4DV4 B;  3F5T A;  1SQP H;  4LCU C;  1YIT V;  3JAR A;  4DR7 O;  1UJW B;  2BTQ A;  1HP8 A;  3X2Q B;  1QBZ A;  4O2B A;  1PV0 A;  2JK5 C;  2H94 A;  3CCE V;  3D36 C;  4DR2 B;  1NTK H;  2EIK C;  3CC2 V;  1HR0 B;  4F4L A;  3IC7 A;  5HFL A;  3AK3 A;  2JEU A;  3A8T A;  5LA6 A;  4J10 A;  4J7Z A;  2EIL C;  4ZKI A;  4I50 A;  5F2V O;  1SKV A;  3RYH B;  2JVD A;  3K9S A;  5CBH A;  4X66 O;  4GX1 A;  4J42 A;  1BT8 A;  1H2L A;  4FFB B;  4YJ2 B;  3FB7 C;  4KUM A;  4XDL A;  2UXD B;  3OR7 C;  3OD4 A;  2O57 A;  1GN4 A;  1PKX A;  4UCR A;  2WLK A;  1ZX3 A;  4GT1 A;  4QPK A;  5CA1 B;  5L3D A;  2A79 B;  3J81 N;  3I55 V;  3RFR A;  2QKS A;  5LBQ A;  5IJ0 A;  2UXC B;  4MW3 A;  4XBF A;  1FXV A;  3KCX A;  3DC5 A;  4FFK A;  3BCC H;  2R72 A;  4WBN B;  1MA1 A;  1I7F A;  4X62 O;  3ETG A;  2N04 A;  4JV5 B;  3M7M X;  2CTR A;  4CH3 A;  1SQG A;  1QNM A;  4B7E A;  4FLZ A;  4N23 A;  4OPH A;  5EYP A;  1F23 A;  2CGO A;  4RO2 A;  1RSO B;  1MOF A;  4O4H A;  4KHP O;  1WLE A;  1VQP V;  2Y0I A;  1XIL A;  3APQ A;  3N2G A;  2QWQ B;  1QLN A;  1AI4 A;  3N2K B;  1KEC A;  3OTF A;  4N21 A;  2M7W A;  3P3P A;  3SJA C;  4MTF A;  4DUY O;  2YID A;  3Q4H B;  4MTG A;  3ZHR A;  5KAI Z;  4Z1V A;  3RYI A;  2IH3 C;  3TJT A;  3ZRW B;  5KUK A;  1VQ7 V;  4LP8 A;  1GO3 F;  1VF6 A;  5CB4 A;  2IJI A;  2ZIN A;  1N0N A;  2Z3Y A;  1I0H A;  2E75 B;  1YF2 A;  3K0D A;  1CEZ A;  3JAS A;  5KMG A;  1WAZ A;  1XMO O;  2W6J G;  4G28 B;  1WPB A;  2UUA O;  1FS0 G;  2LW1 A;  4L87 A;  1XI1 A;  3T1H O;  4UB6 Z;  2Q67 A;  4ZI7 B;  4DO2 A;  5EZY A;  3IC9 A;  2ZE5 A;  3M99 B;  1WN7 A;  4JTC B;  1KP3 A;  5JCO A;  2VQE O;  5BMV B;  5CMU A;  3H01 A;  2P67 A;  5L3F A;  2GBO A;  3W7U A;  3E83 A;  3IFX A;  1FD9 A;  2IH1 C;  1NR7 A;  4JAV A;  1MSW D;  3FKS G;  3ABU A;  1S76 D;  5JWP A;  4YJ3 B;  2OIE A;  2EIM C;  2ZXW C;  3NXS A;  4UCU A;  5K1X A;  1PM9 A;  4MVM A;  3SGI A;  3KZI Z;  4K35 A;  1AP6 A;  4PA4 A;  2Y4U A;  2CDY A;  3SJB C;  1QVG U;  3AK1 A;  3RVZ A;  3U10 A;  2Y69 C;  2PUS A;  2LFS A;  3A0H Z;  5LMU B;  3CCM V;  1VF7 A;  3QO5 A;  2HHH O;  4IGG A;  4QJF B;  3K9A A;  4X1Y B;  3VBB A;  1N0J A;  3GWO A;  1TGO A;  1M56 B;  2WAM A;  3DXR B;  1ZAU A;  4HBN A;  2ITC C;  2NNU A;  4FZ1 A;  4GLX A;  3JAW B;  1PL4 A;  4R50 A;  2CK3 G;  3AEI A;  2BOC C;  4MVS A;  5L3B A;  2D2C B;  1G4Y B;  5KHG A;  2ITD C;  3P30 A;  1FFX A;  2L6L A;  4DYL A;  1AR4 A;  3CCR V;  5A2Q N;  1V9P A;  1PD3 A;  2CH7 A;  4X64 O;  1JPX A;  3BPZ A;  1F4N A;  2CGN A;  1WPX A;  2XND G;  1K4D C;  4ZHQ B;  1OHH G;  1HNZ O;  1SQF A;  5JH7 B;  3BAA A;  3HPL C;  4Q20 A;  5LMN B;  2F4V O;  2QWO B;  2Z5U A;  4JYB A;  1VQ4 V;  4BAY A;  4DUZ B;  3RN4 A;  4GX5 A;  2OTJ V;  1IBL O;  1Q6U A;  3PN1 A;  4YXW G;  3M8A A;  1CP9 A;  2W0X A;  2EUL A;  4PEL A;  1XMQ B;  2BOB C;  4TUY B;  4B3S B;  3W7W A;  1R1B A;  2DWD C;  4O4L B;  3JCU Z;  4Q6G A;  1S77 D;  3T1C A;  1FJG O;  4FLT A;  2OIG A;  1WP7 A;  5GON B;  1R6N A;  1Q6H A;  5H9C A;  1E1R G;  4DV1 O;  2CUG A;  3N27 A;  2Q4P A;  1CXZ B;  5JQG A;  2V7Q G;  3QNE A;  4HYO A;  2YIA A;  2KG7 A;  1K5Q A;  3R65 A;  1ZLZ A;  2LGW A;  1GH6 A;  2PY5 A;  4X65 O;  2P22 C;  3RWR D;  1VQN V;  4DR3 O;  1Y4M A;  4DR6 O;  2M6Y A;  4K0K B;  1B04 A;  3L73 H;  1ENV A;  3ZMT A;  3HKD A;  4A5U B;  1B06 A;  4MVQ A;  3O65 A;  4JI6 B;  4GKK O;  4GUN A;  5TIS Z;  1H8E G;  4TV9 A;  1Y76 B;  1W0K G;  3SPI A;  2KB1 A;  4IHJ B;  2EZO A;  1SF9 A;  2Q6A A;  5J2U A;  1XNQ O;  2KSD A;  1TA8 A;  1VMG A;  4XDK A;  5IWA B;  4FLV A;  3S3X A;  3UT5 B;  2Q9L A;  4HNA B;  4I0X A;  2A9H A;  3B77 A;  1JMK C;  4JYY A;  2FB5 A;  1SQV H;  1U96 A;  1VF5 B;  1AP5 A;  5DED A;  1TUB A;  1VQO V;  4UV9 A;  3EVK A;  4LF9 B;  4NXM O;  3ZHS A;  1NI8 A;  4I7Z B;  3OTO B;  4YY3 O;  1KMI Z;  3ABL B;  3L72 H;  1GM8 A;  3ZRV A;  3K5O A;  1QQC A;  4O4I A;  1Z5W A;  4DV5 O;  1JJ2 U;  5FL7 G;  4X1K B;  2AGA A;  1H2S B;  3LUT B;  4BIU A;  5IYZ A;  1XDC A;  2VQF B;  3CCU V;  1KUQ A;  1P84 F;  3SR2 C;  4H33 A;  3C3S A;  4IYI A;  1EM1 A;  4LF6 B;  2AW9 A;  4AQY B;  3K0G A;  2IJK A;  4LH7 A;  4MTO A;  3CC4 V;  1URF A;  4JI0 B;  1COW G;  4Z2W A;  3QTC A;  4FPP A;  4LF4 B;  4MSW C;  3ZJZ A;  4TWK A;  4CZZ A;  4LFC O;  3SYC A;  4K3A A;  3LSU A;  2R70 A;  3UCS C;  1NJI W;  2Q68 A;  4BIO A;  3K5N A;  3ZBH A;  4U7N A;  1I5X A;  2K9P A;  2QWP B;  3N2K A;  4MVU A;  1M5I A;  4MVZ A;  1RM1 B;  3CD6 V;  1K97 A;  3JAL B;  2YSU B;  5B1A C;  2QGN A;  4LR3 A;  4J80 A;  1YSC A;  2YI9 A;  4LNU B;  1N34 B;  1VQ5 V;  1GK9 A;  2QJ1 A;  4BW9 A;  2EIK B;  5B1B C;  1VF6 C;  2B9Z A;  3IAY A;  1IXM A;  2RCV A;  3AG7 A;  2EIN C;  2EIL B;  4TOI A;  3ABM C;  2ZM6 B;  3CP1 A;  2WLI A;  4PDV A;  2X7R B;  2IBZ H;  3WG7 C;  4H44 B;  4ZI7 A;  1PNL A;  1Z5V A;  4GX2 A;  3HKE B;  3OEE G;  3K57 A;  5JCO C;  1XRE A;  3SYO A;  1VP7 A;  3JAT B;  4F6R B;  1EN5 A;  4OGQ B;  1YZB A;  3KG2 A;  4JI8 B;  4X9Q A;  1V55 C;  3CJH B;  4UCO A;  1LNQ A;  1H2M A;  4QE9 A;  4DV2 O;  5IY5 C;  5H6Q A;  5EBW C;  2FTK A;  3TET A;  1DK1 A;  1B3Q A;  3CWB H;  1JA8 A;  4W4L A;  3STL C;  1BQZ A;  4JYC A;  4JI7 B;  1TAE A;  4FVM A;  2QA4 V;  4JGS A;  4CBC A;  1YJW V;  2QR4 A;  2AHZ A;  3E35 A;  1Q82 W;  2JS3 A;  2UXB B;  3J7A U;  2OCH A;  5KLV H;  3E22 A;  1J5E B;  1LUV A;  1R3J C;  5JVD A;  4LFA B;  4DRX A;  3FYE B;  3OR6 C;  2CTP A;  1FYJ A;  4PDM A;  2JJ1 G;  3K79 A;  1NBM G;  1OCO C;  1VQ9 V;  2AZ2 A;  3JD4 A;  4HZ3 A;  3JD3 A;  2QKA A;  4DW0 A;  4MTX A;  1NH2 B;  3G71 V;  3FX7 A;  3K08 A;  1K73 W;  1BZK A;  1K34 A;  3RT3 C;  1PNK A;  4B3R B;  4NR1 A;  1FXK C;  3AG3 B;  1WNS A;  1LUW A;  1E1Q G;  1GN2 A;  3UO3 A;  1Q86 W;  4DR1 O;  1NQT A;  2EJR A;  4FLY A;  3JCZ A;  2HVJ C;  3QO8 A;  4G27 B;  5LMU O;  1P4R A;  2C2A A;  2ZE8 A;  5B1N A;  2HJD A;  1Q3E A;  2Q73 A;  5CA0 A;  2UUB O;  5C93 A;  3TGU H;  3ZX6 A;  4I9Q A;  3ZMZ A;  2ZNI A;  1KKC A;  4LWS B;  4PA6 A;  1M4U A;  1N32 B;  1QLE C;  2N05 A;  3ABK C;  3WB1 A;  3B40 A;  4NXN B;  3CCV V;  4K8Z A;  1FPO A;  5FNV A;  4LBE C;  2JGD B;  5LOV B;  4JI2 B;  4RAI A;  2UU9 B;  1Y74 B;  1NVP B;  1M90 W;  5EIB D;  1FXH A;  1F4M A; 
#chains in the Genus database with same CATH homology
 3G6E V;  4QJF B;  1CPY A;  5E1A C;  4JAU A;  3K9A A;  1VQ6 V;  3VBB A;  3GWO A;  4WFB V;  2WLL A;  3LSQ A;  4JPR A;  3OMI B;  1FFT B;  1M56 B;  3STZ C;  3ZN1 A;  5B3S B;  1QVF U;  1ORQ C;  2WAM A;  3T4Z A;  2EIN B;  1VQL V;  1ROP A;  2HG5 C;  2IU3 A;  2IU0 A;  1K4C C;  2ITC C;  2NNU A;  1S0V A;  3OW2 U;  2JJ2 G;  1AI7 A;  1QLE B;  3ABK B;  3JD2 A;  3K04 A;  4R50 A;  1S72 V;  1YTF B;  2CK3 G;  3AEI A;  3QO7 A;  2Y69 B;  2WPD G;  2BOC C;  2QEX V;  2ZDI A;  4FMT A;  3FYI B;  3OM3 B;  4J9Z B;  4MVS A;  5L3B A;  4X8A A;  3ZIA G;  1G4Y B;  1OCC B;  2ITD C;  3P30 A;  2UXN A;  3WG7 B;  4ASU G;  3UKM A;  5BZB A;  5KA5 A;  3CCR V;  4R7C A;  1GMG A;  1PD3 A;  3JD1 A;  1NKD A;  1JPX A;  2DQ3 A;  5LGN A;  1KD1 W;  1OCR B;  3E8B A;  3ASN C;  1XL4 A;  1F4N A;  3UM7 A;  1WPX A;  1EZJ A;  2A0L A;  2XND G;  1K4D C;  2OCC C;  2XAG A;  3CCL V;  2YEV A;  3AG4 C;  2DW4 A;  3SPH A;  2HLD G;  2DYR C;  2GSM B;  4QE7 A;  1OHH G;  3P32 A;  5IYD O;  1SER A;  3AG2 C;  2IW5 A;  3K03 A;  2ZQM A;  2XAJ A;  3HPL C;  4Q20 A;  5IY5 B;  4QIW F;  1GM9 A;  2Z5U A;  2AHY A;  3FB8 C;  4JYB A;  1VQ4 V;  2WLH A;  4BAY A;  3GB7 C;  2UXX A;  2DYS C;  4GX5 A;  3ASN B;  3CCS V;  4TSF G;  2OTJ V;  2HFE C;  2R9R B;  5IYB O;  4YXW G;  1CP9 A;  1R3K C;  1VQ8 V;  2ZD9 A;  4PEL A;  2ZR3 A;  2BOB C;  2DYR B;  1RM1 C;  4PA3 A;  1K7D A;  2DQ0 A;  3AG1 C;  2D3O W;  3W7W A;  2ZR2 A;  2DWD C;  3ASO B;  3JYC A;  3ML0 A;  3LSS A;  3G4S V;  1BHB A;  3CPW U;  1S77 D;  4BIZ A;  4LC1 A;  3T1C A;  1PNM A;  1OCZ C;  1YJ9 V;  2XAQ A;  1R6N A;  1K92 A;  3T4D A;  3ETE A;  2XAH A;  4WFE A;  3ZMV A;  5H9C A;  1E1R G;  2LFR A;  4UVA A;  1KP2 A;  1QCE A;  4G2K A;  4TT3 G;  4JAS A;  2V7Q G;  1JQ0 A;  1NH2 D;  3QNE A;  1GM7 A;  4HYO A;  4U7O A;  4H37 A;  3F7V C;  1K5Q A;  3SPG A;  3R65 A;  3AG1 B;  4X89 A;  4UUJ C;  2WSS G;  1EFR G;  3OE7 G;  3OUS A;  1M1K W;  1BL8 A;  5L3G A;  1VQM V;  1FXK B;  1OCZ B;  1Q81 W;  4P2Z A;  4QPJ A;  4DXW A;  1VQN V;  1SRY A;  1Y4M A;  5CN0 A;  3E8F A;  5LHI A;  4MVO A;  1JCH A;  1ENV A;  1S3J A;  4I5S A;  3ZMT A;  4RQE A;  2V1D A;  4MVQ A;  1RPO A;  3DTU B;  1KKD A;  4I9W A;  4MVR A;  1H8E G;  2XAF A;  2EIM B;  2B5U A;  3ZN0 A;  1W0K G;  3SPI A;  2IJJ A;  2KB1 A;  2ZXW B;  5L3E A;  2EZO A;  1BHA A;  2Q6A A;  4P30 A;  1SES A;  1XL6 A;  1R6K A;  1VQK V;  3ABL C;  4XDK A;  3LDD A;  4ZBM A;  2R9I A;  2HVK C;  3ZCC A;  2A9H A;  3A0R A;  3B77 A;  4RUF A;  1AR1 B;  2EIJ C;  1J95 A;  1NVP D;  5LHH A;  2EBO A;  1V54 C;  3LDE A;  4UVB A;  3JD0 A;  1QR9 A;  3W7S A;  1VQO V;  4PDL A;  4UV9 A;  2QTO A;  2B1I A;  2XAS A;  5B1O A;  3TK1 A;  4E2L A;  1H8H G;  3FB5 C;  3IGA C;  1Y66 A;  4WF9 V;  1W2B U;  3E2E A;  2P7T C;  3ABL B;  1YTF D;  1GM8 A;  2HR3 A;  3ZRV A;  1FXK A;  2F43 G;  3ZMU A;  2PI4 A;  2HKO A;  4WCE V;  3OMA B;  1JJ2 U;  3K3W A;  2EIJ B;  1DF5 A;  3PJS K;  5FL7 G;  4HAM A;  2W0F C;  3OMN B;  1V54 B;  3LUT B;  4X88 A;  3SYP A;  4BIU A;  2JEX A;  3BEH A;  3ABT A;  1MAB G;  5EK0 A;  3CCU V;  1G8M A;  4H33 A;  5CBF A;  3W7X A;  4KP4 A;  1K3E A;  1YI2 V;  1EBO A;  3MD0 A;  3X2Q C;  1K9M W;  3K0G A;  2IJK A;  4MTO A;  2JIZ G;  3CC4 V;  4J9Y B;  3WFV A;  3B8N A;  1H2G A;  3SPJ A;  2H8P C;  2OCC B;  5HFM A;  1COW G;  4FPP A;  3AG4 B;  5J9P C;  3LNM B;  4MSW C;  3ZJZ A;  1R3L C;  1YJN V;  5IDJ A;  1OZ0 A;  4WFA V;  5LGU A;  2XOK G;  3AG2 B;  4BW5 A;  4TWK A;  4CZZ A;  4LCU C;  1YIT V;  3AG3 C;  1UJW B;  3SYC A;  1HWY A;  4JF3 A;  3X2Q B;  1QBZ A;  1M57 C;  4GX0 A;  1M9N A;  1GTO A;  1SET A;  2Q68 A;  2JK5 C;  2QM7 A;  3F5W C;  1NJI W;  4RUE A;  2WLI B;  2H94 A;  1KC8 W;  3CCE V;  2DYS B;  2ZDI C;  4FJC C;  4U7N A;  1I5X A;  5KA6 A;  3SYA A;  2Y48 A;  1E79 G;  5EBM C;  2EIK C;  3CC2 V;  2WWW A;  5IYC O;  4F4L A;  3IC7 A;  3CC7 V;  4JTD B;  5HFL A;  4MVU A;  1L1F A;  2JEU A;  3CME V;  3CCQ V;  4MVZ A;  1RM1 B;  4Z1M G;  1QR8 A;  5CA3 A;  4ZKI A;  2EIL C;  1S5H C;  3E8G A;  2P6J A;  1Q7Y W;  3CD6 V;  1K97 A;  1K5S A;  1SZT A;  4UXN A;  4P9O A;  2YSU B;  5B1A C;  1M57 B;  1K8A W;  1DF4 A;  3OUF A;  5CBH A;  4GX1 A;  3ZRS A;  2X6B A;  1YSC A;  1H38 A;  1VQ5 V;  2Q69 A;  1GK9 A;  1KQS U;  4FK5 C;  5EBL C;  4P9P A;  3FB7 C;  2EIK B;  4KUM A;  4XDL A;  5B1B C;  3OGC C;  3OR7 C;  1R73 A;  1PKX A;  2LP7 A;  1IXM A;  3CMA V;  1TUE B;  1M56 C;  4MS2 A;  3OFN G;  2WLK A;  2EIN C;  4R6Z A;  3CXC U;  4GT1 A;  4QPK A;  2EIL B;  3VOU A;  5L3D A;  3CCJ V;  4QNH B;  2A79 B;  3I56 V;  3ABM C;  1AJP A;  3I55 V;  4UVC A;  3CP1 A;  2WLI A;  2K1E A;  2QKS A;  5B1A B;  5LBQ A;  5LHG A;  2OTL V;  3SPC A;  4WFF A;  3RBZ A;  4MW3 A;  3CYO A;  4XBF A;  4PDV A;  1OCC C;  2X7R B;  3WG7 C;  1FXV A;  4WFG A;  1PNL A;  5DN6 G;  2OT5 A;  5B1B B;  4GX2 A;  1P7B A;  3OEE G;  3ETG A;  5DM6 V;  1GKF A;  1DLB A;  1JVM A;  2QE7 G;  1OCR C;  3E8H A;  4N23 A;  2B1G A;  3SYO A;  1F23 A;  1I5Y A;  2WLM A;  4RO2 A;  3W7T A;  1MOF A;  2PI5 A;  3ABM B;  1AI5 A;  2EZP A;  3KG2 A;  1WLE A;  1PL0 A;  3D36 A;  1VQP V;  1BMF G;  1V55 C;  1LNQ A;  1K33 A;  4QE9 A;  1QLN A;  1AI4 A;  1KEC A;  5IY5 C;  5H6Q A;  4N21 A;  5EBW C;  2FTK A;  3T2M A;  2M7W A;  1B6Q A;  3TET A;  1JOY A;  1RPR A;  2HJF C;  4MTF A;  3E86 A;  2JDI G;  4PDR A;  4MTG A;  3STL C;  2X6A A;  4JYC A;  2IH3 C;  1DTO A;  3BY6 A;  3ZRW B;  2QA4 V;  1V55 B;  4EKW A;  4JGS A;  4CBC A;  1YJW V;  3SYQ A;  3ZRX A;  5KUK A;  3EFF K;  2AHZ A;  3ASO C;  3E35 A;  4LP8 A;  3RVY A;  1GO3 F;  1VQ7 V;  1Q82 W;  2IJI A;  1ARO P;  2Z3Y A;  3HB3 B;  3OEH G;  3FB6 C;  1CEZ A;  3K0D A;  2MK3 A;  3K06 A;  2W6J G;  4GCZ A;  1R3J C;  3B8M A;  3DGE A;  3F7Y C;  1JX9 A;  3FYE B;  3OR6 C;  2WLN A;  4OXS A;  2WLJ A;  4G28 B;  5EC1 C;  4PDM A;  2ATK C;  2JJ1 G;  3K79 A;  4MT8 A;  1NBM G;  1FS0 G;  3LDC A;  1OCO C;  2QM8 A;  3MHH C;  3EHB B;  1R3I C;  4L87 A;  4R8C A;  1VQ9 V;  2Q67 A;  2DWE C;  3JD4 A;  4HZ3 A;  3JD3 A;  4DO2 A;  1NR1 A;  3RW0 A;  4MTX A;  2NLJ C;  3G71 V;  1NH2 B;  3M99 B;  4FIP C;  3E89 A;  2WLL B;  4JTC B;  1KP3 A;  3K08 A;  5L3C A;  1K73 W;  1K34 A;  5KUM A;  1PNK A;  5CMU A;  4UV8 A;  3H01 A;  2P67 A;  5L3F A;  3W7U A;  1FXK C;  3AG3 B;  1E1Q G;  2X0L A;  1Q86 W;  3E83 A;  1NQT A;  3IFX A;  2EJR A;  2IH1 C;  1NR7 A;  1W0J G;  4JAV A;  4KFM A;  1ZWI C;  3JCZ A;  1MSW D;  1OCO B;  2HVJ C;  3FKS G;  5GW7 A;  3QO8 A;  4G27 B;  3ZMS A;  4PA9 A;  4WFH A;  3ZRW A;  3ABU A;  5H6R A;  1S76 D;  1P4R A;  2C2A A;  4JTA B;  5B1N A;  2EIM C;  1AJN A;  2ZXW C;  2X6C A;  5C93 A;  1AJQ A;  5B3S C;  2P90 A;  3NXS A;  4MVM A;  3ZMZ A;  2GHY A;  1THZ A;  1AI6 A;  3ETD A;  5LGT A;  1MG1 A;  4PA7 A;  2W6I G;  2IJH A;  3D3I A;  4PA6 A;  4XDJ A;  5CBG A;  1YHQ V;  4PA4 A;  3SJQ C;  4RQF A;  1N8R W;  4MW8 A;  1QLE C;  3ABK C;  1YIJ V;  1F51 A;  3CCV V;  1QVG U;  3RVZ A;  5EC2 C;  3OAA G;  2Y69 C;  3TCU A;  2YEV B;  3MHS C;  4LBE C;  2LFS A;  3CCM V;  4RAI A;  3QO5 A;  1NVP B;  1M90 W;  1FXH A;  1F4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...