3CCSV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccsV00
2OTJV 1Q7YW 3I55V 1YI2V 1N8RW 1YJNV 1M1KW 3CCQV 1VQMV 1QVGU 3CCUV 1YITV 1M90W 1YHQV 3CC7V 1Q82W 3CCRV 3CCVV 1W2BU 3G6EV 2D3OW 1NJIW 3CCMV 1KD1W 1VQ8V 3CCLV 1Q81W 1VQ9V 1VQ4V 3CC4V 1QVFU 3CC2V 1VQKV 1VQPV 4WCEV 1K8AW 1Q86W 1VQ7V 5DM6V 1YJWV 2OTLV 3CCSV 3G71V 3CD6V 1S72V 1VQLV 3CXCU 3CMAV 3CCEV 1KQSU 3CPWU 3CMEV 2QEXV 2QA4V 1YIJV 1VQ6V 4WF9V 3G4SV 1VQNV 1JJ2U 3OW2U 1YJ9V 1K9MW 1R73A 3CCJV 4WFBV 4WFAV 3I56V 1VQOV 1K73W 1VQ5V 1KC8W
chains in the Genus database with same CATH superfamily
4LF7O 2BOBC 4BIUA 2AHYA 1EFRG 1XNRB 5GTIZ 1ZL8B 1WN7A 4GKJO 4FLTA 2P4VA 1V55C 2AHZA 4MVZA 2VRZA 2VS0A 4LF8B 1YEWA 3AG2C 1UJWB 2IH3C 5LP6A 2JJ2G 3RYHA 4JTDB 2IJHA 4HAMA 3CCUV 1EZVH 2HLDG 5IWAO 1TAEA 3P3PA 3ZMUA 3J80N 1IBKO 2O57A 4TSFG 1AR5A 2YC0A 2RQ6A 3FAVB 3ETGA 3ABUA 4Q6GA 1P7BA 3Q4HA 3M8AA 3BRCA 4QNHB 2L6LA 4KL1A 2L35A 4LF8O 1SQQH 3TJTA 3FB7C 4QPKA 2WAMA 2W6JG 4IT5A 1ZLZA 5C8YB 2Y69C 3AG3C 5IYCO 4GKJB 1RP3B 4JYCA 1QVFU 3QO8A 3H1JH 4CH6A 1QR8A 1H2SB 3G6BA 1R6KA 2YXHA 2ILMA 2BSKB 3NR7A 2EIJB 4LFBO 5D5PA 1M93A 1RSOB 3RGBA 1RPOA 1L1FA 3BEHA 4IYHA 2OTJV 5IJ0A 1N8RW 5J2UB 3RYCA 4J42A 3D36C 1K4DC 4EFEA 1YCIA 2EULA 1Q6IA 3ABLC 2WLKA 4X1KA 4OX9B 4G2KA 3AG4C 2UUAB 1XL6A 4H37A 2R70A 2ARHA 1R1BA 4MTFA 2YI8A 4MVUA 1JX9A 1BGYH 1YHQV 5EK0A 4QPJA 3STZC 3SYQA 1FKAO 4UCTA 4B3SO 1B06A 2ZE6A 3P30A 3O9OA 2WLLB 2DYSC 2QWQB 1K92A 3CCJV 1AI5A 4X1KB 1R6NA 4ZI7A 1IBLB 3OR7C 3O65A 4N23A 4GKKB 2JGDB 5FLXN 2EINC 4N21A 4FLZA 4FFBB 1VQ4V 3C90A 4X88A 1R6TA 4UCSA 2VQFB 2KQXA 1VQLV 4P2ZA 3K9SA 5BMVA 1VQNV 3JD3A 2PI4A 5E79Z 3WB0A 1IXBA 1Q3EA 5EIBC 3U10A 1U97A 4I0XB 1EBOA 1KD1W 3QG5A 1IBKB 4O2AB 2QTSA 1WAZA 3G80A 4O4JA 3VQXA 4ZIBA 3B09A 1VF7A 5KA5A 4F6EA 1X4TA 1F51A 1FFXA 1GN2A 1ZL8A 5L3FA 1I5YA 3E8HA 3AG3B 1S5JA 1T5EA 1SZXA 5IY5C 1XQ8A 1DF4A 2NLJC 3ZRVA 3SR2C 3DXRB 4JAVA 1VQ9V 5A2QN 2KSDA 2Y48A 2EIJC 3RVZA 5K1XA 3SJAC 1MABG 1SC5B 1IX9A 1KU9A 3MDSA 1MMMA 2JVDA 1AJPA 4WBNA 2YIAA 1SESA 4UV8A 4ZHQB 3FAVA 4B3MB 1SKVA 4GYCB 3AG4B 2ZE7A 4XDKA 1W2BU 3IC7A 1HNWB 2P4KA 4MTXA 4BIOA 3LNMB 2ETNA 4YJ2B 3RYHB 4NR1A 1ENVA 1J5EB 2OIEA 4U7NA 5EYPA 1IBMB 5GTHZ 1IBMO 3D8CA 1FD9A 1TUBB 2QWNB 2R9IA 2ZE8A 1KKCA 4I50A 1E1QG 1A32A 3K5OA 1KYOF 1LNQA 5CA3A 4LCUC 2NNUA 1VQKV 2DYSB 1JCHA 5LYJB 2NN4A 4FLXA 1SQVH 3ASNB 1HNXB 4UCOA 5B66Z 1ZTEA 3CHXA 3SYOA 1QVGU 2WLNA 3HKCA 2RCVA 3ABTA 2V1DA 2F93B 2E5LO 1BQ0A 2LGQA 3AG7A 3N2GA 3T1YB 4UVAA 2OTLV 5LA6B 1NVPD 4AI8A 3ETDA 2ZNIA 1OCOB 1LR1A 1AROP 3STLC 1QR9A 1B04A 3OW2U 1Z2GA 1JOYA 2LFSA 1GRJA 4HNAB 3K9AA 2YSUB 3CB2A 4DR1B 1JJOA 3N2GB 2IBZH 4O4IB 3K03A 5H2FZ 2ADPA 4U3JB 5CA0A 4RUEA 5B3SB 4JI0B 3OTOB 4X89A 1QCEA 3T1HB 2IM9A 2ZM6B 5KLVH 2HJDA 5LHGA 2QWPB 2LFRA 3BPZA 2ZE5A 5B1BC 4JI5O 5LMUB 4YJ2A 3ZHUA 4J11A 5JH7A 1QBZA 3CRMA 1SQBH 5IWAB 5JVDA 5JJNB 4LF9B 1EN5A 1N0NA 2P06A 4JI3B 4ZHQA 1VQ7V 1BSMA 2ZINA 1V54B 3E2EA 5LOVA 4U3JA 3K5MA 2ADQB 1BCCH 1BS3A 4FFBA 1DF5A 2GV9A 2OCCB 2BCCH 4TQDA 2UXCB 1G1XB 4FLYA 2W6IG 2WLIB 1R3LC 3ZRXA 4CC6A 3OFNG 1FXKA 4UVBA 3CRQA 1SA0B 4JI6O 1XUQA 2Q67A 4IHJA 3HKDA 4DR6O 3RW0A 3CYOA 1HNXO 4K0KO 2WA4A 2ZXWC 3RYIB 4DV6O 2PYLA 4B3MO 1SS3A 2DMXA 1WA8A 4I4TB 3SPCA 4DRXA 2N74A 4CH4A 3WG7B 3WB2A 1XMOO 3KG2A 1M57B 4PI0A 1FPOA 4TT3G 3G71V 2YIBD 4U7OA 2EJ7A 5CBHA 5ITZB 2FMLA 5KX5A 1Y4MA 3B4SA 1IXMA 4JTAB 3TCUA 1JA8A 4IIJA 2K1EA 5LGTA 1WPBA 4KHPO 5B1OA 1W0KG 3CS5A 1HNWO 3SPIA 2AZ2A 4LF6B 3QO5A 1JVMA 4X1IB 1YJWV 1TGOA 1OV9A 4LR3A 2JRIA 1JR9A 5IYDO 4LF5O 1K7DA 3BFRA 2V7QG 1US6A 2DJVA 4X62B 4X65B 4JYAO 2FYUH 2HHHB 3LSQA 1F4NA 2UUBO 2XAHA 4K3AA 5J9PC 1H8HG 3FFQA 4DR7O 2FL4A 1MZFA 5B1BB 4MSWC 4TV8B 4KUMA 2F43G 4FLUA 1SERA 1VF5B 1FXKB 1P4RA 4UCVA 3AG1C 4DV2O 2UU9O 3K59A 1BT8A 3DC5A 4PD4F 4X65O 4JYAB 1WNSA 3MHHC 1AI6A 4KP4A 1PNMA 1VF6C 5LYJA 3HR0A 1BL8A 2IJKA 4BW5A 4DV4O 4QJFB 3CSXA 2YXLA 3MAQA 4MVSA 4JI7O 5KAIZ 4E2LA 2C2AA 2RN9A 4IGGA 2G38A 3APQA 1N4CA 1YITV 4X1YA 3E83A 3E8FA 3ZCCA 4IL6Z 1OCRB 3CP1A 2DWDC 3R65A 4WFEA 2QM7A 5L3EA 2H94A 3WU2Z 4LFAB 1E79G 2WLJA 2DWEC 5H5NA 5LP6C 1OZ0A 1F4MA 1KB9F 4JI1O 3OUFA 1L8DA 4PDLA 3WG7C 4Z2WA 2ZT9B 5EZYA 5KUMA 3ASOB 3M7MX 4JPRA 2KG7A 4WCEV 2GUZB 3T1CA 2EBOA 2CTWA 4DV4B 2UXDB 4JI6B 2BE3A 2UXNA 2OT5A 1MG1A 5H6QA 2X6AA 1FAFA 3RWRD 2YS8A 1AVMA 4DV0B 1KP2A 3B8MA 2FTKA 5JVDB 4OPHA 4JI8B 4JV5O 2CTRA 2HJFC 2XT9A 3RBZA 4CH5A 4LH7A 4O4LA 3FD9A 4Z1MG 4MVRA 3CCEV 2OIGA 3C3SA 3FYIB 1Q6HA 4X20B 2HVKC 1SA0A 1PP9H 2LQTA 4MTGA 1YTFB 2P22C 1FJGO 4GT1A 1AR1B 3C3TA 4GX2A 4OXSA 2H3OA 2HFEC 4U3FH 4DXWA 1K5SA 3EHBB 1VP7A 1GO3F 4LF4O 1ZWIC 3T2MA 5EBMC 1FXKC 3T1HO 3F7VC 4R6ZA 1JQ0A 4YJ3B 2EX3A 2OYQA 3TETA 4ICGA 5ITZA 1FXVA 2EIMC 3H1LH 3UM7A 1VQMV 2ITDC 2HHHO 4UXNA 4I4TA 5JJJB 2Q69A 4FMTA 3JD0A 1NH2B 4FIPC 4TUYA 3FX7A 3K5LA 1PV0A 3ZHVA 1M56B 5BR8O 2Q7GA 2Q4PA 2XAGA 4NXNB 4IYIA 3L70H 3Q4HB 3J81N 1JJ2U 2F4VO 3KKYA 2Y4TA 4DV6B 3H1HH 3R66A 4K35A 2E5LB 3HKEB 2Q73A 1D5AA 5LP6B 4YJ3A 3ZX6A 1Y74A 1DTOA 5CB4B 1FS0G 4LFAO 2B5UA 2DE0X 3OMAB 3RYFB 2WA3A 3OUSA 4WFGA 3JD1A 3ASOC 1LUWA 1YI2V 3CCQV 2P6JA 1Y74B 2D3OW 2WLHA 1H2LA 2M7WA 2QJ1A 3ML0A 2PTMA 4UUJC 2ZDIC 2GBOA 4E4EA 5C8YA 3CMEV 1K5QA 3SJBC 3ICXA 5FPRA 3LSSA 4X64B 2ZDIA 4PA9A 1XMQB 1BQZA 2XAQA 3T4ZA 3ZMZA 1DK1A 1HR0O 4JZGA 4CBCA 5IJ9B 3AG2B 5L3DA 4YY3B 1CEZA 3GB7C 3RVYA 3CC2V 1YSCA 3W7WA 4RWUA 3E8GA 1GKFA 5BR8B 1DGSA 1S5HC 4D7TA 2E3CA 1XEQA 3JAKB 4NYKA 5LHIA 3VQVA 4G28B 4QE7A 2YXYA 1FJGB 5GONA 4YXWG 3MHSC 2VQEO 1NS1A 2YUAA 3FB8C 2HEPA 4TV8A 3H1KH 4LC1A 4B08A 1I08A 4YY3O 2EIKB 3KCYA 4RQFA 4DUYO 1XDCA 2Y0IA 2XASA 4AHCA 2JDIG 2QKAA 4TV9B 1VQ6V 4B3RB 4PA7A 3WB1A 3H9VA 1L0LH 3JATA 3D36A 3EXAA 1M56C 2VQEB 5KHJA 1XNRO 1Q81W 3H01A 5LMNO 3JD2A 3B8NA 5KMGB 2XHBA 2JK5C 2CK3G 5CBFA 4RUFA 3SDLA 4X66O 2B9ZA 1ZSPA 2CTQA 4DV0O 1KECA 4LP8A 4NXMB 2ZIOA 1WP8A 3SYPA 1Z5VA 3H1IH 4JI4O 4EFBA 1CPYA 2P5OA 3EFFK 3APOA 1CP9A 3UKMA 4FFKA 1BHBA 2OCHA 4DR4B 2GDSA 1NKDA 3OD4A 5EC2C 1AJNA 4DR2O 2QSAA 3K08A 4JYBA 4PA3A 5FPOA 3L71H 1YF2A 4ZOLB 2CTPA 2AGAA 1S77D 4MVQA 4ZKIA 2Z5UA 4JI3O 1K34A 2DQ3A 2LP7A 1GM9A 3CMAV 2DYRB 4XDJA 5DEDA 1HW7A 5JWPA 3ABMB 5EC1C 3M99B 1RM1C 3LUTB 4W4KA 2VWKA 5H9CA 1WPXA 1SQGA 2YEVA 1YTFD 4I0XA 4HZ3A 3OMNB 4TUYB 2A0LA 2RJZA 3W7XA 1G4YB 3JATB 3BA9A 4DW0A 2YDEA 4DR3O 1QNMA 2ZM6O 2XAFA 3JCZA 1GN6A 5IE9A 3SPJA 5KX5B 2F95B 1GH6A 4LFBB 1H2GA 3SYCA 4DV5O 4PJ0Z 1SQXH 4DV5B 2EIKC 1M9NA 3B77A 5A9GA 1N34O 4TWKA 4DV3B 2PYJA 5CA1B 4JV5B 1GN4A 3OR6C 5LGNA 1IDSA 3JASB 2QR4A 1JFFB 1XNQB 5FL7G 3U11A 1B6QA 4J9YB 4X9QA 2ZKOA 3UQ8A 4NB5A 4HNAA 4DK1A 1QLEB 4FLVA 2Q7HA 2Z3YA 3K0DA 3QO7A 1Q82W 5DN6G 4J7JA 4P9PA 1VMGA 2KKWA 3EVKA 2QTOA 4OPAA 2R72A 4QIWF 2UXDO 3E22B 1SRYA 1XBLA 5KAFZ 5IYZB 4JF3A 5CMUA 1O9GA 2Q6AA 4K0KB 4PA6A 3S3WA 4RO2A 1LUVA 4H13B 4KHPB 3WFVA 4GKKO 1TVKB 1AP5A 3K5NA 3K58A 2A7WA 4HYOA 2X6CA 3CC4V 1WB7A 2UXBB 3RYCB 4JYYA 5J2UA 4AQYB 4G27B 5KUKA 4JI2B 3QF7A 1Q90D 2UXCO 4X66B 1Q7YW 1B3QA 3E35A 1SETA 2DYRC 4EKWA 1F7YA 3SYAA 3ABMC 3ZMVA 2IW5A 2YEVB 1WJZA 2GTAA 3QTCA 1QQCA 4B3RO 2Q0AA 1YIJV 1RPRA 1IZ3A 3OEHG 4IHJB 3JYCA 1TA8A 1OCOC 1BE3H 1XOUA 3LNNA 2UXXA 4DV7O 1S76D 4EEQA 2LGWA 3ZRSA 2EZPA 3PN1A 4DUYB 3W7SA 3BY6A 2IH1C 4GX1A 4CS3A 5B3SC 2QA4V 5CA1A 3BABA 1YZBA 4WF9V 4A5UB 2N05A 4JAUA 4DR1O 1GN3A 4TQFA 4X62O 3S3XA 4BW9A 2X0LA 3CC7V 3ZHTA 3OGIB 1VIBA 4FZ1A 3BA8A 1P49A 2Q9LA 1QU7A 4UB6Z 3AK3A 5BY1A 4J80A 4O4IA 3QVNA 1IVSA 4FM0A 3K0GA 1COWG 1R73A 4XBFA 4WFAV 5HFMA 2DN9A 3E22A 3A0RA 1K97A 1XHZA 2X6BA 2E76B 3K06A 2OCCC 5BMVB 1PD3A 2P67A 3CCMV 1NVPB 3L73H 1TUBA 2Q0OC 4F6RA 3VBBA 1HWYA 4CC5A 3U0ZA 1AR4A 4JI1B 1BZKA 1H2MA 2A06H 1HR0B 2ZR3A 4BR6A 4KFMA 4H44B 2ITCC 2X7RB 4ABMA 4R50A 2ZXWB 3BVOA 2HG5C 2E75B 3D3QA 3CD6V 4DUZO 4NTYA 3KCXA 2UUAO 3FB6C 3W7UA 2CH7A 1K9MW 4J9ZB 4DR2B 1Y6XA 4O2AA 2BOCC 5BXZA 4B7KA 1PM9A 4JAAA 5FNVA 2WWWA 3ZEDA 1JMKC 3JAWA 1PNKA 4GUNA 3ZN0A 2B1GA 1UPGA 5IJ0B 2UXBO 2IU3A 5EIBD 1XILA 1OHHG 4UFZA 4J10A 1EN4A 3B40A 3CWBH 3ZS8C 4K8XA 3CEIA 2XTAA 3L75H 5KHIA 3CCLV 1N32B 1SQPH 3K79A 4YHHB 4J7ZA 4EB6B 5FNVB 2XNDG 2QEXV 5KA6A 3HKCB 2GSMB 2CAZC 2Q8VA 2HR3A 4DK0A 2LO1A 4FVMA 3A8TA 3JASA 1NTMH 5B1NA 3SPHA 1YJNV 3K04A 4JGSA 3RYIA 2NR5A 3AG1B 2QE7G 3HKEA 1ROPA 1N33O 3CCSV 5JJEB 3CRCA 2B1IA 1I94B 1JFFA 3HPLC 3JALB 2A9HA 3IJ4A 2GUZA 1J95A 1K33A 2YIDA 3TXQA 1O9HA 5L3CA 3GWKC 4P30A 2UUCB 4B3TB 3F7YC 2K9PA 1Q5OA 1N32O 2PF4E 1MA1A 3ZJZA 1GMGA 4FJCC 1OCRC 2CUGA 1TVKA 4R7CA 1YJ9V 3HB3B 3JAWB 5K1PA 4LF7B 3P3NA 3OT7A 3UO2A 2M6YA 3W7TA 3TK1A 5IT9N 1Q43A 1BHAA 2JEXA 2CGOA 1I0HA 2MK3A 1S0VA 4PV1B 1TUEB 5JQGB 3N2KB 2JGUA 4FLWA 1AP6A 2WLLA 4CZZA 4L8JA 3OE7G 4DV1B 1H8EG 1W0JG 1Q86W 4JI4B 5JQGA 4LNUB 3TGUH 1S72V 3JD4A 5LXTA 1KUQA 1J5EO 5HFLA 2AXTZ 3SJQC 1XNQO 2ZD9A 1SF9A 1VQOV 4WFBV 4CS2A 5CN0A 2EINB 4MT8A 4DV2B 2UU9B 4LNUA 5GONB 2FB5A 4PI2A 1Y67A 4GLXA 2PY5A 4DV3O 1N34B 1PPJH 1XI1A 4QGPA 1MSWD 1AI4A 1V9PA 2JEUA 2LJ2A 4UV9A 4X20A 1K4CC 5J2TB 3ETEA 1JPXA 2XAJA 4BAYA 5KHKA 3JSNA 2PI5A 4X1IA 4C7UA 1KC8W 5LL6Y 4I50B 3ZIAG 1IURA 2KB1A 2P7TC 1NTKH 2RMKB 1H2KA 4FK5C 4H0LB 3G6EV 4BWAA 5LBQA 4DV7B 4JI8O 3VQYA 2BTQA 4K8ZA 3TXSA 3OTOO 2WLIA 2CH7B 2EZOA 3G4SV 5IY5B 2D2CB 1PKXA 1NZ6A 3JARB 1NR7A 1IBLO 4JTCB 3LSUA 1M5IA 1PNLA 1VQ8V 4RQEA 2PUSA 3UO3A 4YHHO 1P7GA 1MOFA 4DYLA 1NU1H 4MS2A 2DQ0A 2JJ1G 3DC6A 4JI2O 5E1AC 5L3BA 1VEWA 4CS4A 3AK1A 1AB3A 1OCZB 3RFRA 2ZQMA 1X59A 2LW1A 3N27A 1R3JC 3JCUZ 5F2VO 4DV1O 2CE4A 5KHHA 2OWOA 2Z0AA 1AILA 4B3SB 5EYPB 2QGNA 4DR5O 4LFCB 3DGEA 4LFCO 1VQ5V 4NVPA 2QKSA 2EJRA 2QDOA 5B5EZ 1QLNA 3L9DA 1HDJA 4TV9A 4DW1A 2W0XA 1HNZB 2UUCO 4B3TO 4XDLA 4AILC 3VOUA 4UCRA 1QHTA 2QKCA 4PDVA 3ZHSA 3ASNC 4LBEC 1NR1A 5LXTB 2A3QA 4J7KA 1EN6A 1I5XA 5D5QA 2PGGA 4J41A 3T4DA 4I9QA 4PHZA 4GCZA 4MW3A 4O4HB 4PA4A 1K73W 2RDCA 4LWSB 1W59A 5LMUO 2CGNA 4ZI7B 1K3EA 3IAYA 2F23A 4H33A 4MVMA 3OAAG 2QM8A 3UT5B 3FB5C 4JASA 2P90A 2WPDG 3GWOA 4F6RB 5IJ9A 4I9WA 1KQSU 3SGIA 1ZAUA 3OEEG 3DSQA 1MZEA 2HP8A 3HKBA 2BTOA 3G67A 3ZMSA 3CX5F 3CE2A 2YICA 1GK9A 1WB8A 3RN4A 3A2FA 2N04A 1FFTB 3LDCA 1S3JA 1BMFG 3CXHF 2Q7EA 2Q68A 1GTOA 4LF4B 5DM6V 2H8PC 2FKXA 5JH7B 3CXCU 3P32A 1FFXB 4X64O 5IYZA 3A0HZ 3PJSK 5EZYB 1N36B 1KKDA 1NT2B 5CB4A 1M1KW 3JAMN 4MTOA 4DO2A 5KMGA 1V54C 1VARA 3HKBB 4WFFA 4LF6O 2WLMA 4LH6A 2E74B 4AQYO 1OCZC 2GHYA 2EILB 1XMQO 1D2DA 3GVMA 4WFHA 4L87A 4P9OA 1SZTA 4PELA 1HP8A 4YIPA 4WBNB 2QM4A 1GM7A 2CDYA 4O4LB 4FM2A 5AG2A 1U96A 1XMOB 1EM1A 5CA0B 3UCSC 5TISZ 2Q5ZA 4EB6A 4DR5B 1F23A 4I7ZB 1KBHA 1KMIZ 4DR6B 1YXBA 4R8CA 4HBNA 1Y66A 1H2NA 1RM1B 1M57C 4NKGB 2WSSG 2BTQB 4X8AA 4O4JB 1GM8A 1Y76B 3FYEB 1K8AW 4OX9O 3ZBHA 1NI8A 1N33B 2Y0PA 1THZA 5B1AB 3LDEA 4D6TH 4GZRB 3JALA 1R3IC 1DLBA 2R9RB 3ETQA 2ZCEA 2ZR2A 1ORQC 5C93A 4ASUG 4B7EA 2HVJC 3L74H 3CRRA 2Y4UA 3X2QB 2JIZG 3IC9A 3QNEA 4LF9O 4FM1A 3AK2A 3K57A 4YIOA 5LA6A 1URFA 1VF6A 4O2BA 1WLEA 4DR3B 3AEIA 2BSKA 3OMIB 5KHGA 2LW7A 4JI5B 1Y76A 1P84F 2MW2B 2ODMA 2IJJA 1GAXA 5JCOA 1MNGA 3I5DA 2KG7B 3LDDA 1QLEC 2QWRB 3ABKB 1SQFA 4KXRA 4DR7B 1FYJA 4LWSA 1OCCB 4GX5A 2A79B 3SJCC 3A0BZ 1Q6UA 2YI9A 3BAAA 5LHHA 3F5TA 2XOKG 3JARA 1NH2D 4O2BB 4I55B 1HNZO 3CCRV 3JAKA 2F1MA 1NTZH 4UCUA 2EILC 4MW8A 2VQFO 3D3IA 4JZ2A 5EBWC 3ZRWB 4X1YB 2XUMA 1E1RG 5EBLC 3I55V 4NXMO 2AW9A 3OGCC 5CBGA 3OTFA 4CH3A 4Z1VA 2JS5A 3E89A 5J2TA 4ZBMA 4PDRA 5GW7A 4DUZB 5LMNB 1YVWA 3CJHB 1NQTA 3CRAA 1PL0A 1M4UA 3B2EE 1N0JA 1N36O 1OJHA 5L3GA 3ZRWA 1WA8B 3IGAC 5DECA 4W4LA 1M90W 4DRXB 3CCVV 5H6RA 5B1AC 4I5SA 3RYFA 2DOSA 2ZIMA 3E8BA 4FPPA 2VWJA 1CXZB 1G6UA 1PL4A 1Q8IA 2JGDA 4NTXA 1V55B 3IFXA 4JI7B 2F4VB 1D5NA 2V4DA 3RT3C 3X2QC 2QWOB 4BIZA 3CJHA 1NJIW 3ZN1A 1KP3A 2DW4A 1NBMG 1ZUQA 1AJQA 1H38A 3BHPA 3VQWA 5BZBA 1EZJA 3JSLA 1I94O 3CPWU 3THOA 5LOVB 1RFYA 3L72H 4IIJB 2R9AA 3I56V 1FXHA 3ABKC 4PDMA 4OGQB 3NXSA 1OCCC 1S5LZ 4RAIA 1XHXA 3DTUB 3UT5A 2UUBB 5IDJA 2IJIA 5IYBO 4MVOA 4UVCA 1I7FA 4D7SA 1VQPV 2IU0A 4JI0O 1YDXA 1WP7A 3ZHQA 2Y69B 2AZ0A 1ZX3A 2EIMB 4GX0A 3BCCH 3OM3B 4TOIA 4LF5B 1XL4A 2GTSA 2RNBA 1RSOA 3HKDB 5LGUA 1AI7A 4I55A 3F5WC 1L0NH 4F4LA 1MSDA 3T1YO 5JCOC 3SPGA 4Q20A 3K3WA 4ZOLA 3ABLB 3E86A 1XREA 1Z5WA 2ZNJA 3N2KA 4O4HA 2PZSA 1UFIA 2JS3A 4UB8Z 2YIBA 3MD0A 4FZ0A 3KZIZ 4QE9A 3ZMTA 1G8MA 4NTWA 4NXNO 2F66C 3J7AU 4DR4O 1R3KC 3DXRA 2W0FC 3FKSG 3ZHRA 2HKOA 2ATKC
chains in the Genus database with same CATH topology
2ZQMA 2V7QG 1QLEB 2BOBC 4BIUA 2AHYA 2Z3YA 1EFRG 1R3JC 3K0DA 3QO7A 3LSQA 1Q82W 5DN6G 1F4NA 4P9PA 2XAHA 5J9PC 1H8HG 1V55C 2QTOA 4QIWF 2AHZA 1SRYA 5B1BB 4MSWC 4KUMA 2F43G 4MVZA 4JF3A 5CMUA 3DGEA 2Q6AA 1SERA 1FXKB 1P4RA 3AG2C 1UJWB 1VQ5V 2IH3C 2QKSA 2EJRA 3AG1C 1QLNA 4PA6A 2JJ2G 4RO2A 4JTDB 2IJHA 3WFVA 4HAMA 3CCUV 4XDLA 2HLDG 3MHHC 1AI6A 3VOUA 4KP4A 3ZMUA 4HYOA 1PNMA 2X6CA 3CC4V 4TSFG 4PDVA 3ASNC 4LBEC 1BL8A 1NR1A 3ETGA 3ABUA 2IJKA 4BW5A 1P7BA 4QJFB 1I5XA 4G27B 4QNHB 4MVSA 5KUKA 3T4DA 4E2LA 2C2AA 3FB7C 4GCZA 4MW3A 1K73W 4PA4A 4QPKA 2WAMA 1Q7YW 1K3EA 2W6JG 1YITV 3E35A 4H33A 1SETA 2Y69C 3AG3C 4MVMA 5IYCO 3E83A 3E8FA 3ZCCA 3OAAG 2DYRC 2QM8A 4EKWA 4JYCA 1QVFU 1OCRB 3FB5C 3SYAA 3ABMC 4JASA 2P90A 2WPDG 3CP1A 3GWOA 3QO8A 3ZMVA 1QR8A 2DWDC 2IW5A 3R65A 4WFEA 2QM7A 1R6KA 2YEVB 4I9WA 5L3EA 2H94A 1KQSU 1E79G 2WLJA 2DWEC 2EIJB 3OEEG 1YIJV 1RPRA 1OZ0A 3OEHG 3ZMSA 1RPOA 1F4MA 1L1FA 3BEHA 3JYCA 3OUFA 2OTJV 1OCOC 4PDLA 1N8RW 3WG7C 1GK9A 2UXXA 1S76D 5KUMA 1K4DC 1FFTB 3ASOB 3LDCA 4JPRA 1S3JA 1BMFG 2EZPA 3ZRSA 3ABLC 4WCEV 2Q68A 1GTOA 3T1CA 2EBOA 2WLKA 5DM6V 4G2KA 3AG4C 2H8PC 2UXNA 3CXCU 3P32A 3W7SA 3BY6A 2IH1C 2OT5A 4GX1A 1XL6A 5B3SC 1MG1A 4H37A 4WF9V 2QA4V 5H6QA 3PJSK 2X6AA 4JAUA 1KKDA 4MTFA 1M1KW 1KP2A 3B8MA 2X0LA 4MTOA 4MVUA 1JX9A 2FTKA 4DO2A 1YHQV 3CC7V 1V54C 4WFFA 5EK0A 2HJFC 4QPJA 3RBZA 3STZC 3SYQA 2WLMA 4Z1MG 4MVRA 3CCEV 1OCZC 3P30A 2GHYA 3FYIB 2WLLB 2DYSC 2EILB 4WFHA 3K0GA 1K92A 2HVKC 4L87A 1COWG 1R73A 4P9OA 4XBFA 4WFAV 5HFMA 1SZTA 1AI5A 4MTGA 4PELA 1YTFB 1R6NA 4GT1A 1AR1B 3A0RA 1K97A 1GM7A 3OR7C 4N23A 4GX2A 2X6BA 3K06A 2OCCC 4OXSA 2HFEC 1PD3A 1K5SA 2EINC 2P67A 3EHBB 4N21A 4DXWA 3CCMV 1NVPB 1VQ4V 1GO3F 1ZWIC 3T2MA 4X88A 5EBMC 3VBBA 1FXKC 1HWYA 1VQLV 4P2ZA 1F23A 3F7VC 4R6ZA 1VQNV 3JD3A 1JQ0A 2PI4A 3TETA 1FXVA 2EIMC 4R8CA 2ZR3A 3UM7A 1Y66A 4KFMA 1VQMV 2ITDC 2ITCC 1RM1B 4UXNA 1M57C 2Q69A 4FMTA 2X7RB 3JD0A 2WSSG 1EBOA 1NH2B 4FIPC 4R50A 1KD1W 2ZXWB 2HG5C 4X8AA 1GM8A 3FYEB 1K8AW 1M56B 3CD6V 3CCJV 2XAGA 1THZA 5B1AB 5KA5A 3LDEA 1F51A 3FB6C 3W7UA 1JJ2U 1K9MW 4J9ZB 1R3IC 1DLBA 5L3FA 2R9RB 1I5YA 3E8HA 3AG3B 2ZR2A 1ORQC 5C93A 4ASUG 2BOCC 5IY5C 1DF4A 2NLJC 2HVJC 2WWWA 3ZRVA 4JAVA 1VQ9V 1PNKA 3X2QB 3ZN0A 2JIZG 2Y48A 2B1GA 3QNEA 2EIJC 2IU3A 3RVZA 1DTOA 1MABG 1FS0G 1WLEA 2B5UA 1OHHG 3AEIA 3OMAB 3OMIB 1AJPA 3OUSA 4WFGA 1SESA 4UV8A 3JD1A 3ASOC 1YI2V 3CCQV 2P6JA 2IJJA 3AG4B 4XDKA 1W2BU 3IC7A 2D3OW 2WLHA 2M7WA 3LDDA 3CCLV 1QLEC 4MTXA 3ABKB 3K79A 3LNMB 3ML0A 1OCCB 4UUJC 2ZDIC 1ENVA 4GX5A 2A79B 4U7NA 3CMEV 2XNDG 2QEXV 1K5QA 5KA6A 3LSSA 2ZDIA 4PA9A 2GSMB 2XAQA 3T4ZA 2HR3A 3ZMZA 5LHHA 2XOKG 1NH2D 5B1NA 2R9IA 3SPHA 1YJNV 3K04A 4JGSA 4CBCA 1E1QG 3AG2B 5L3DA 3AG1B 3CCRV 2QE7G 1LNQA 5CA3A 1CEZA 3GB7C 1ROPA 4LCUC 3RVYA 2NNUA 1YSCA 1VQKV 2DYSB 2EILC 3CC2V 1JCHA 3W7WA 4MW8A 3CCSV 3E8GA 3D3IA 5EBWC 3ZRWB 1GKFA 1S5HC 2B1IA 3HPLC 2A9HA 3ASNB 5LHIA 1J95A 1K33A 4G28B 4QE7A 1E1RG 5EBLC 5L3CA 3I55V 4YXWG 3SYOA 3MHSC 3OGCC 4P30A 3FB8C 5CBGA 1QVGU 3F7YC 2WLNA 4LC1A 3ABTA 2V1DA 2EIKB 4RQFA 4UVAA 2XASA 3E89A 4ZBMA 2OTLV 4PDRA 5GW7A 2JDIG 1NVPD 3ETDA 3ZJZA 1GMGA 4FJCC 1OCOB 1OCRC 1AROP 1NQTA 1VQ6V 3STLC 1QR9A 4R7CA 1PL0A 3OW2U 1YJ9V 4PA7A 1JOYA 3HB3B 2LFSA 3K9AA 2YSUB 3D36A 5L3GA 3K03A 1M56C 3ZRWA 3IGAC 1M90W 3CCVV 3W7TA 5H6RA 5B1AC 3TK1A 1Q81W 4RUEA 4I5SA 5B3SB 3E8BA 3H01A 4X89A 1QCEA 4FPPA 3JD2A 3B8NA 2JK5C 2CK3G 1BHAA 2JEXA 2MK3A 1V55B 5LHGA 3IFXA 5CBFA 1S0VA 2LFRA 4RUFA 5B1BC 1TUEB 3X2QC 1KECA 4LP8A 2WLLA 4CZZA 1QBZA 4BIZA 3OE7G 1NJIW 3ZN1A 1KP3A 3SYPA 1H8EG 2DW4A 1NBMG 1W0JG 1Q86W 1AJQA 1H38A 1VQ7V 1CPYA 1V54B 3EFFK 1EZJA 5BZBA 1S72V 1CP9A 3JD4A 3UKMA 3E2EA 3CPWU 5HFLA 3SJQC 1BHBA 2ZD9A 1DF5A 1NKDA 2OCCB 5EC2C 1AJNA 4WFBV 3I56V 1VQOV 1FXHA 5CN0A 2EINB 4MT8A 3K08A 4JYBA 4PA3A 3ABKC 2W6IG 2WLIB 1R3LC 4PDMA 3NXSA 1OCCC 1S77D 3ZRXA 4RAIA 3OFNG 3DTUB 1FXKA 4MVQA 4UVBA 1MSWD 5IDJA 1AI4A 2IJIA 2JEUA 4UV9A 5IYBO 4MVOA 4UVCA 4ZKIA 2Z5UA 1VQPV 1K4CC 2IU0A 1K34A 2DQ3A 2LP7A 3ETEA 2Y69B 1GM9A 1JPXA 3CMAV 2DYRB 4XDJA 2XAJA 4BAYA 2EIMB 4GX0A 3ABMB 3OM3B 2Q67A 1XL4A 5EC1C 3M99B 2PI5A 1RM1C 3LUTB 3RW0A 3CYOA 5LGUA 1KC8W 1AI7A 5H9CA 2ZXWC 1WPXA 3ZIAG 2KB1A 2P7TC 2YEVA 3F5WC 1YTFD 4FK5C 3SPCA 4F4LA 3G6EV 5LBQA 4HZ3A 3OMNB 2A0LA 3W7XA 3WG7B 3KG2A 1G4YB 1M57B 4TT3G 3G71V 2WLIA 4U7OA 3SPGA 5CBHA 4Q20A 3K3WA 2XAFA 1Y4MA 3JCZA 3SPJA 3ABLB 2EZOA 3G4SV 3E86A 5IY5B 1IXMA 4JTAB 1H2GA 3SYCA 3TCUA 1PKXA 1NR7A 2K1EA 5LGTA 2EIKC 1M9NA 5B1OA 1W0KG 4JTCB 3B77A 4TWKA 3SPIA 1PNLA 1VQ8V 3MD0A 4RQEA 3OR6C 4QE9A 5LGNA 3QO5A 1JVMA 3ZMTA 1YJWV 1MOFA 1G8MA 4MS2A 2DQ0A 2JJ1G 5FL7G 5E1AC 5L3BA 5IYDO 1K7DA 1R3KC 1B6QA 4J9YB 2W0FC 3FKSG 2HKOA 2ATKC 1OCZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ V;  1Q7Y W;  3I55 V;  1YI2 V;  1N8R W;  1YJN V;  1M1K W;  3CCQ V;  1VQM V;  1QVG U;  3CCU V;  1YIT V;  1M90 W;  1YHQ V;  3CC7 V;  1Q82 W;  3CCR V;  3CCV V;  1W2B U;  3G6E V;  2D3O W;  1NJI W;  3CCM V;  1KD1 W;  1VQ8 V;  3CCL V;  1Q81 W;  1VQ9 V;  1VQ4 V;  3CC4 V;  1QVF U;  3CC2 V;  1VQK V;  1VQP V;  4WCE V;  1K8A W;  1Q86 W;  1VQ7 V;  5DM6 V;  1YJW V;  2OTL V;  3CCS V;  3G71 V;  3CD6 V;  1S72 V;  1VQL V;  3CXC U;  3CMA V;  3CCE V;  1KQS U;  3CPW U;  3CME V;  2QEX V;  2QA4 V;  1YIJ V;  1VQ6 V;  4WF9 V;  3G4S V;  1VQN V;  1JJ2 U;  3OW2 U;  1YJ9 V;  1K9M W;  1R73 A;  3CCJ V;  4WFB V;  4WFA V;  3I56 V;  1VQO V;  1K73 W;  1VQ5 V;  1KC8 W; 
#chains in the Genus database with same CATH topology
 4LF7 O;  2BOB C;  4BIU A;  2AHY A;  1EFR G;  1XNR B;  5GTI Z;  1ZL8 B;  1WN7 A;  4GKJ O;  4FLT A;  2P4V A;  1V55 C;  2AHZ A;  4MVZ A;  2VRZ A;  2VS0 A;  4LF8 B;  1YEW A;  3AG2 C;  1UJW B;  2IH3 C;  5LP6 A;  2JJ2 G;  3RYH A;  4JTD B;  2IJH A;  4HAM A;  3CCU V;  1EZV H;  2HLD G;  5IWA O;  1TAE A;  3P3P A;  3ZMU A;  3J80 N;  1IBK O;  2O57 A;  4TSF G;  1AR5 A;  2YC0 A;  2RQ6 A;  3FAV B;  3ETG A;  3ABU A;  4Q6G A;  1P7B A;  3Q4H A;  3M8A A;  3BRC A;  4QNH B;  2L6L A;  4KL1 A;  2L35 A;  4LF8 O;  1SQQ H;  3TJT A;  3FB7 C;  4QPK A;  2WAM A;  2W6J G;  4IT5 A;  1ZLZ A;  5C8Y B;  2Y69 C;  3AG3 C;  5IYC O;  4GKJ B;  1RP3 B;  4JYC A;  1QVF U;  3QO8 A;  3H1J H;  4CH6 A;  1QR8 A;  1H2S B;  3G6B A;  1R6K A;  2YXH A;  2ILM A;  2BSK B;  3NR7 A;  2EIJ B;  4LFB O;  5D5P A;  1M93 A;  1RSO B;  3RGB A;  1RPO A;  1L1F A;  3BEH A;  4IYH A;  2OTJ V;  5IJ0 A;  1N8R W;  5J2U B;  3RYC A;  4J42 A;  3D36 C;  1K4D C;  4EFE A;  1YCI A;  2EUL A;  1Q6I A;  3ABL C;  2WLK A;  4X1K A;  4OX9 B;  4G2K A;  3AG4 C;  2UUA B;  1XL6 A;  4H37 A;  2R70 A;  2ARH A;  1R1B A;  4MTF A;  2YI8 A;  4MVU A;  1JX9 A;  1BGY H;  1YHQ V;  5EK0 A;  4QPJ A;  3STZ C;  3SYQ A;  1FKA O;  4UCT A;  4B3S O;  1B06 A;  2ZE6 A;  3P30 A;  3O9O A;  2WLL B;  2DYS C;  2QWQ B;  1K92 A;  3CCJ V;  1AI5 A;  4X1K B;  1R6N A;  4ZI7 A;  1IBL B;  3OR7 C;  3O65 A;  4N23 A;  4GKK B;  2JGD B;  5FLX N;  2EIN C;  4N21 A;  4FLZ A;  4FFB B;  1VQ4 V;  3C90 A;  4X88 A;  1R6T A;  4UCS A;  2VQF B;  2KQX A;  1VQL V;  4P2Z A;  3K9S A;  5BMV A;  1VQN V;  3JD3 A;  2PI4 A;  5E79 Z;  3WB0 A;  1IXB A;  1Q3E A;  5EIB C;  3U10 A;  1U97 A;  4I0X B;  1EBO A;  1KD1 W;  3QG5 A;  1IBK B;  4O2A B;  2QTS A;  1WAZ A;  3G80 A;  4O4J A;  3VQX A;  4ZIB A;  3B09 A;  1VF7 A;  5KA5 A;  4F6E A;  1X4T A;  1F51 A;  1FFX A;  1GN2 A;  1ZL8 A;  5L3F A;  1I5Y A;  3E8H A;  3AG3 B;  1S5J A;  1T5E A;  1SZX A;  5IY5 C;  1XQ8 A;  1DF4 A;  2NLJ C;  3ZRV A;  3SR2 C;  3DXR B;  4JAV A;  1VQ9 V;  5A2Q N;  2KSD A;  2Y48 A;  2EIJ C;  3RVZ A;  5K1X A;  3SJA C;  1MAB G;  1SC5 B;  1IX9 A;  1KU9 A;  3MDS A;  1MMM A;  2JVD A;  1AJP A;  4WBN A;  2YIA A;  1SES A;  4UV8 A;  4ZHQ B;  3FAV A;  4B3M B;  1SKV A;  4GYC B;  3AG4 B;  2ZE7 A;  4XDK A;  1W2B U;  3IC7 A;  1HNW B;  2P4K A;  4MTX A;  4BIO A;  3LNM B;  2ETN A;  4YJ2 B;  3RYH B;  4NR1 A;  1ENV A;  1J5E B;  2OIE A;  4U7N A;  5EYP A;  1IBM B;  5GTH Z;  1IBM O;  3D8C A;  1FD9 A;  1TUB B;  2QWN B;  2R9I A;  2ZE8 A;  1KKC A;  4I50 A;  1E1Q G;  1A32 A;  3K5O A;  1KYO F;  1LNQ A;  5CA3 A;  4LCU C;  2NNU A;  1VQK V;  2DYS B;  1JCH A;  5LYJ B;  2NN4 A;  4FLX A;  1SQV H;  3ASN B;  1HNX B;  4UCO A;  5B66 Z;  1ZTE A;  3CHX A;  3SYO A;  1QVG U;  2WLN A;  3HKC A;  2RCV A;  3ABT A;  2V1D A;  2F93 B;  2E5L O;  1BQ0 A;  2LGQ A;  3AG7 A;  3N2G A;  3T1Y B;  4UVA A;  2OTL V;  5LA6 B;  1NVP D;  4AI8 A;  3ETD A;  2ZNI A;  1OCO B;  1LR1 A;  1ARO P;  3STL C;  1QR9 A;  1B04 A;  3OW2 U;  1Z2G A;  1JOY A;  2LFS A;  1GRJ A;  4HNA B;  3K9A A;  2YSU B;  3CB2 A;  4DR1 B;  1JJO A;  3N2G B;  2IBZ H;  4O4I B;  3K03 A;  5H2F Z;  2ADP A;  4U3J B;  5CA0 A;  4RUE A;  5B3S B;  4JI0 B;  3OTO B;  4X89 A;  1QCE A;  3T1H B;  2IM9 A;  2ZM6 B;  5KLV H;  2HJD A;  5LHG A;  2QWP B;  2LFR A;  3BPZ A;  2ZE5 A;  5B1B C;  4JI5 O;  5LMU B;  4YJ2 A;  3ZHU A;  4J11 A;  5JH7 A;  1QBZ A;  3CRM A;  1SQB H;  5IWA B;  5JVD A;  5JJN B;  4LF9 B;  1EN5 A;  1N0N A;  2P06 A;  4JI3 B;  4ZHQ A;  1VQ7 V;  1BSM A;  2ZIN A;  1V54 B;  3E2E A;  5LOV A;  4U3J A;  3K5M A;  2ADQ B;  1BCC H;  1BS3 A;  4FFB A;  1DF5 A;  2GV9 A;  2OCC B;  2BCC H;  4TQD A;  2UXC B;  1G1X B;  4FLY A;  2W6I G;  2WLI B;  1R3L C;  3ZRX A;  4CC6 A;  3OFN G;  1FXK A;  4UVB A;  3CRQ A;  1SA0 B;  4JI6 O;  1XUQ A;  2Q67 A;  4IHJ A;  3HKD A;  4DR6 O;  3RW0 A;  3CYO A;  1HNX O;  4K0K O;  2WA4 A;  2ZXW C;  3RYI B;  4DV6 O;  2PYL A;  4B3M O;  1SS3 A;  2DMX A;  1WA8 A;  4I4T B;  3SPC A;  4DRX A;  2N74 A;  4CH4 A;  3WG7 B;  3WB2 A;  1XMO O;  3KG2 A;  1M57 B;  4PI0 A;  1FPO A;  4TT3 G;  3G71 V;  2YIB D;  4U7O A;  2EJ7 A;  5CBH A;  5ITZ B;  2FML A;  5KX5 A;  1Y4M A;  3B4S A;  1IXM A;  4JTA B;  3TCU A;  1JA8 A;  4IIJ A;  2K1E A;  5LGT A;  1WPB A;  4KHP O;  5B1O A;  1W0K G;  3CS5 A;  1HNW O;  3SPI A;  2AZ2 A;  4LF6 B;  3QO5 A;  1JVM A;  4X1I B;  1YJW V;  1TGO A;  1OV9 A;  4LR3 A;  2JRI A;  1JR9 A;  5IYD O;  4LF5 O;  1K7D A;  3BFR A;  2V7Q G;  1US6 A;  2DJV A;  4X62 B;  4X65 B;  4JYA O;  2FYU H;  2HHH B;  3LSQ A;  1F4N A;  2UUB O;  2XAH A;  4K3A A;  5J9P C;  1H8H G;  3FFQ A;  4DR7 O;  2FL4 A;  1MZF A;  5B1B B;  4MSW C;  4TV8 B;  4KUM A;  2F43 G;  4FLU A;  1SER A;  1VF5 B;  1FXK B;  1P4R A;  4UCV A;  3AG1 C;  4DV2 O;  2UU9 O;  3K59 A;  1BT8 A;  3DC5 A;  4PD4 F;  4X65 O;  4JYA B;  1WNS A;  3MHH C;  1AI6 A;  4KP4 A;  1PNM A;  1VF6 C;  5LYJ A;  3HR0 A;  1BL8 A;  2IJK A;  4BW5 A;  4DV4 O;  4QJF B;  3CSX A;  2YXL A;  3MAQ A;  4MVS A;  4JI7 O;  5KAI Z;  4E2L A;  2C2A A;  2RN9 A;  4IGG A;  2G38 A;  3APQ A;  1N4C A;  1YIT V;  4X1Y A;  3E83 A;  3E8F A;  3ZCC A;  4IL6 Z;  1OCR B;  3CP1 A;  2DWD C;  3R65 A;  4WFE A;  2QM7 A;  5L3E A;  2H94 A;  3WU2 Z;  4LFA B;  1E79 G;  2WLJ A;  2DWE C;  5H5N A;  5LP6 C;  1OZ0 A;  1F4M A;  1KB9 F;  4JI1 O;  3OUF A;  1L8D A;  4PDL A;  3WG7 C;  4Z2W A;  2ZT9 B;  5EZY A;  5KUM A;  3ASO B;  3M7M X;  4JPR A;  2KG7 A;  4WCE V;  2GUZ B;  3T1C A;  2EBO A;  2CTW A;  4DV4 B;  2UXD B;  4JI6 B;  2BE3 A;  2UXN A;  2OT5 A;  1MG1 A;  5H6Q A;  2X6A A;  1FAF A;  3RWR D;  2YS8 A;  1AVM A;  4DV0 B;  1KP2 A;  3B8M A;  2FTK A;  5JVD B;  4OPH A;  4JI8 B;  4JV5 O;  2CTR A;  2HJF C;  2XT9 A;  3RBZ A;  4CH5 A;  4LH7 A;  4O4L A;  3FD9 A;  4Z1M G;  4MVR A;  3CCE V;  2OIG A;  3C3S A;  3FYI B;  1Q6H A;  4X20 B;  2HVK C;  1SA0 A;  1PP9 H;  2LQT A;  4MTG A;  1YTF B;  2P22 C;  1FJG O;  4GT1 A;  1AR1 B;  3C3T A;  4GX2 A;  4OXS A;  2H3O A;  2HFE C;  4U3F H;  4DXW A;  1K5S A;  3EHB B;  1VP7 A;  1GO3 F;  4LF4 O;  1ZWI C;  3T2M A;  5EBM C;  1FXK C;  3T1H O;  3F7V C;  4R6Z A;  1JQ0 A;  4YJ3 B;  2EX3 A;  2OYQ A;  3TET A;  4ICG A;  5ITZ A;  1FXV A;  2EIM C;  3H1L H;  3UM7 A;  1VQM V;  2ITD C;  2HHH O;  4UXN A;  4I4T A;  5JJJ B;  2Q69 A;  4FMT A;  3JD0 A;  1NH2 B;  4FIP C;  4TUY A;  3FX7 A;  3K5L A;  1PV0 A;  3ZHV A;  1M56 B;  5BR8 O;  2Q7G A;  2Q4P A;  2XAG A;  4NXN B;  4IYI A;  3L70 H;  3Q4H B;  3J81 N;  1JJ2 U;  2F4V O;  3KKY A;  2Y4T A;  4DV6 B;  3H1H H;  3R66 A;  4K35 A;  2E5L B;  3HKE B;  2Q73 A;  1D5A A;  5LP6 B;  4YJ3 A;  3ZX6 A;  1Y74 A;  1DTO A;  5CB4 B;  1FS0 G;  4LFA O;  2B5U A;  2DE0 X;  3OMA B;  3RYF B;  2WA3 A;  3OUS A;  4WFG A;  3JD1 A;  3ASO C;  1LUW A;  1YI2 V;  3CCQ V;  2P6J A;  1Y74 B;  2D3O W;  2WLH A;  1H2L A;  2M7W A;  2QJ1 A;  3ML0 A;  2PTM A;  4UUJ C;  2ZDI C;  2GBO A;  4E4E A;  5C8Y A;  3CME V;  1K5Q A;  3SJB C;  3ICX A;  5FPR A;  3LSS A;  4X64 B;  2ZDI A;  4PA9 A;  1XMQ B;  1BQZ A;  2XAQ A;  3T4Z A;  3ZMZ A;  1DK1 A;  1HR0 O;  4JZG A;  4CBC A;  5IJ9 B;  3AG2 B;  5L3D A;  4YY3 B;  1CEZ A;  3GB7 C;  3RVY A;  3CC2 V;  1YSC A;  3W7W A;  4RWU A;  3E8G A;  1GKF A;  5BR8 B;  1DGS A;  1S5H C;  4D7T A;  2E3C A;  1XEQ A;  3JAK B;  4NYK A;  5LHI A;  3VQV A;  4G28 B;  4QE7 A;  2YXY A;  1FJG B;  5GON A;  4YXW G;  3MHS C;  2VQE O;  1NS1 A;  2YUA A;  3FB8 C;  2HEP A;  4TV8 A;  3H1K H;  4LC1 A;  4B08 A;  1I08 A;  4YY3 O;  2EIK B;  3KCY A;  4RQF A;  4DUY O;  1XDC A;  2Y0I A;  2XAS A;  4AHC A;  2JDI G;  2QKA A;  4TV9 B;  1VQ6 V;  4B3R B;  4PA7 A;  3WB1 A;  3H9V A;  1L0L H;  3JAT A;  3D36 A;  3EXA A;  1M56 C;  2VQE B;  5KHJ A;  1XNR O;  1Q81 W;  3H01 A;  5LMN O;  3JD2 A;  3B8N A;  5KMG B;  2XHB A;  2JK5 C;  2CK3 G;  5CBF A;  4RUF A;  3SDL A;  4X66 O;  2B9Z A;  1ZSP A;  2CTQ A;  4DV0 O;  1KEC A;  4LP8 A;  4NXM B;  2ZIO A;  1WP8 A;  3SYP A;  1Z5V A;  3H1I H;  4JI4 O;  4EFB A;  1CPY A;  2P5O A;  3EFF K;  3APO A;  1CP9 A;  3UKM A;  4FFK A;  1BHB A;  2OCH A;  4DR4 B;  2GDS A;  1NKD A;  3OD4 A;  5EC2 C;  1AJN A;  4DR2 O;  2QSA A;  3K08 A;  4JYB A;  4PA3 A;  5FPO A;  3L71 H;  1YF2 A;  4ZOL B;  2CTP A;  2AGA A;  1S77 D;  4MVQ A;  4ZKI A;  2Z5U A;  4JI3 O;  1K34 A;  2DQ3 A;  2LP7 A;  1GM9 A;  3CMA V;  2DYR B;  4XDJ A;  5DED A;  1HW7 A;  5JWP A;  3ABM B;  5EC1 C;  3M99 B;  1RM1 C;  3LUT B;  4W4K A;  2VWK A;  5H9C A;  1WPX A;  1SQG A;  2YEV A;  1YTF D;  4I0X A;  4HZ3 A;  3OMN B;  4TUY B;  2A0L A;  2RJZ A;  3W7X A;  1G4Y B;  3JAT B;  3BA9 A;  4DW0 A;  2YDE A;  4DR3 O;  1QNM A;  2ZM6 O;  2XAF A;  3JCZ A;  1GN6 A;  5IE9 A;  3SPJ A;  5KX5 B;  2F95 B;  1GH6 A;  4LFB B;  1H2G A;  3SYC A;  4DV5 O;  4PJ0 Z;  1SQX H;  4DV5 B;  2EIK C;  1M9N A;  3B77 A;  5A9G A;  1N34 O;  4TWK A;  4DV3 B;  2PYJ A;  5CA1 B;  4JV5 B;  1GN4 A;  3OR6 C;  5LGN A;  1IDS A;  3JAS B;  2QR4 A;  1JFF B;  1XNQ B;  5FL7 G;  3U11 A;  1B6Q A;  4J9Y B;  4X9Q A;  2ZKO A;  3UQ8 A;  4NB5 A;  4HNA A;  4DK1 A;  1QLE B;  4FLV A;  2Q7H A;  2Z3Y A;  3K0D A;  3QO7 A;  1Q82 W;  5DN6 G;  4J7J A;  4P9P A;  1VMG A;  2KKW A;  3EVK A;  2QTO A;  4OPA A;  2R72 A;  4QIW F;  2UXD O;  3E22 B;  1SRY A;  1XBL A;  5KAF Z;  5IYZ B;  4JF3 A;  5CMU A;  1O9G A;  2Q6A A;  4K0K B;  4PA6 A;  3S3W A;  4RO2 A;  1LUV A;  4H13 B;  4KHP B;  3WFV A;  4GKK O;  1TVK B;  1AP5 A;  3K5N A;  3K58 A;  2A7W A;  4HYO A;  2X6C A;  3CC4 V;  1WB7 A;  2UXB B;  3RYC B;  4JYY A;  5J2U A;  4AQY B;  4G27 B;  5KUK A;  4JI2 B;  3QF7 A;  1Q90 D;  2UXC O;  4X66 B;  1Q7Y W;  1B3Q A;  3E35 A;  1SET A;  2DYR C;  4EKW A;  1F7Y A;  3SYA A;  3ABM C;  3ZMV A;  2IW5 A;  2YEV B;  1WJZ A;  2GTA A;  3QTC A;  1QQC A;  4B3R O;  2Q0A A;  1YIJ V;  1RPR A;  1IZ3 A;  3OEH G;  4IHJ B;  3JYC A;  1TA8 A;  1OCO C;  1BE3 H;  1XOU A;  3LNN A;  2UXX A;  4DV7 O;  1S76 D;  4EEQ A;  2LGW A;  3ZRS A;  2EZP A;  3PN1 A;  4DUY B;  3W7S A;  3BY6 A;  2IH1 C;  4GX1 A;  4CS3 A;  5B3S C;  2QA4 V;  5CA1 A;  3BAB A;  1YZB A;  4WF9 V;  4A5U B;  2N05 A;  4JAU A;  4DR1 O;  1GN3 A;  4TQF A;  4X62 O;  3S3X A;  4BW9 A;  2X0L A;  3CC7 V;  3ZHT A;  3OGI B;  1VIB A;  4FZ1 A;  3BA8 A;  1P49 A;  2Q9L A;  1QU7 A;  4UB6 Z;  3AK3 A;  5BY1 A;  4J80 A;  4O4I A;  3QVN A;  1IVS A;  4FM0 A;  3K0G A;  1COW G;  1R73 A;  4XBF A;  4WFA V;  5HFM A;  2DN9 A;  3E22 A;  3A0R A;  1K97 A;  1XHZ A;  2X6B A;  2E76 B;  3K06 A;  2OCC C;  5BMV B;  1PD3 A;  2P67 A;  3CCM V;  1NVP B;  3L73 H;  1TUB A;  2Q0O C;  4F6R A;  3VBB A;  1HWY A;  4CC5 A;  3U0Z A;  1AR4 A;  4JI1 B;  1BZK A;  1H2M A;  2A06 H;  1HR0 B;  2ZR3 A;  4BR6 A;  4KFM A;  4H44 B;  2ITC C;  2X7R B;  4ABM A;  4R50 A;  2ZXW B;  3BVO A;  2HG5 C;  2E75 B;  3D3Q A;  3CD6 V;  4DUZ O;  4NTY A;  3KCX A;  2UUA O;  3FB6 C;  3W7U A;  2CH7 A;  1K9M W;  4J9Z B;  4DR2 B;  1Y6X A;  4O2A A;  2BOC C;  5BXZ A;  4B7K A;  1PM9 A;  4JAA A;  5FNV A;  2WWW A;  3ZED A;  1JMK C;  3JAW A;  1PNK A;  4GUN A;  3ZN0 A;  2B1G A;  1UPG A;  5IJ0 B;  2UXB O;  2IU3 A;  5EIB D;  1XIL A;  1OHH G;  4UFZ A;  4J10 A;  1EN4 A;  3B40 A;  3CWB H;  3ZS8 C;  4K8X A;  3CEI A;  2XTA A;  3L75 H;  5KHI A;  3CCL V;  1N32 B;  1SQP H;  3K79 A;  4YHH B;  4J7Z A;  4EB6 B;  5FNV B;  2XND G;  2QEX V;  5KA6 A;  3HKC B;  2GSM B;  2CAZ C;  2Q8V A;  2HR3 A;  4DK0 A;  2LO1 A;  4FVM A;  3A8T A;  3JAS A;  1NTM H;  5B1N A;  3SPH A;  1YJN V;  3K04 A;  4JGS A;  3RYI A;  2NR5 A;  3AG1 B;  2QE7 G;  3HKE A;  1ROP A;  1N33 O;  3CCS V;  5JJE B;  3CRC A;  2B1I A;  1I94 B;  1JFF A;  3HPL C;  3JAL B;  2A9H A;  3IJ4 A;  2GUZ A;  1J95 A;  1K33 A;  2YID A;  3TXQ A;  1O9H A;  5L3C A;  3GWK C;  4P30 A;  2UUC B;  4B3T B;  3F7Y C;  2K9P A;  1Q5O A;  1N32 O;  2PF4 E;  1MA1 A;  3ZJZ A;  1GMG A;  4FJC C;  1OCR C;  2CUG A;  1TVK A;  4R7C A;  1YJ9 V;  3HB3 B;  3JAW B;  5K1P A;  4LF7 B;  3P3N A;  3OT7 A;  3UO2 A;  2M6Y A;  3W7T A;  3TK1 A;  5IT9 N;  1Q43 A;  1BHA A;  2JEX A;  2CGO A;  1I0H A;  2MK3 A;  1S0V A;  4PV1 B;  1TUE B;  5JQG B;  3N2K B;  2JGU A;  4FLW A;  1AP6 A;  2WLL A;  4CZZ A;  4L8J A;  3OE7 G;  4DV1 B;  1H8E G;  1W0J G;  1Q86 W;  4JI4 B;  5JQG A;  4LNU B;  3TGU H;  1S72 V;  3JD4 A;  5LXT A;  1KUQ A;  1J5E O;  5HFL A;  2AXT Z;  3SJQ C;  1XNQ O;  2ZD9 A;  1SF9 A;  1VQO V;  4WFB V;  4CS2 A;  5CN0 A;  2EIN B;  4MT8 A;  4DV2 B;  2UU9 B;  4LNU A;  5GON B;  2FB5 A;  4PI2 A;  1Y67 A;  4GLX A;  2PY5 A;  4DV3 O;  1N34 B;  1PPJ H;  1XI1 A;  4QGP A;  1MSW D;  1AI4 A;  1V9P A;  2JEU A;  2LJ2 A;  4UV9 A;  4X20 A;  1K4C C;  5J2T B;  3ETE A;  1JPX A;  2XAJ A;  4BAY A;  5KHK A;  3JSN A;  2PI5 A;  4X1I A;  4C7U A;  1KC8 W;  5LL6 Y;  4I50 B;  3ZIA G;  1IUR A;  2KB1 A;  2P7T C;  1NTK H;  2RMK B;  1H2K A;  4FK5 C;  4H0L B;  3G6E V;  4BWA A;  5LBQ A;  4DV7 B;  4JI8 O;  3VQY A;  2BTQ A;  4K8Z A;  3TXS A;  3OTO O;  2WLI A;  2CH7 B;  2EZO A;  3G4S V;  5IY5 B;  2D2C B;  1PKX A;  1NZ6 A;  3JAR B;  1NR7 A;  1IBL O;  4JTC B;  3LSU A;  1M5I A;  1PNL A;  1VQ8 V;  4RQE A;  2PUS A;  3UO3 A;  4YHH O;  1P7G A;  1MOF A;  4DYL A;  1NU1 H;  4MS2 A;  2DQ0 A;  2JJ1 G;  3DC6 A;  4JI2 O;  5E1A C;  5L3B A;  1VEW A;  4CS4 A;  3AK1 A;  1AB3 A;  1OCZ B;  3RFR A;  2ZQM A;  1X59 A;  2LW1 A;  3N27 A;  1R3J C;  3JCU Z;  5F2V O;  4DV1 O;  2CE4 A;  5KHH A;  2OWO A;  2Z0A A;  1AIL A;  4B3S B;  5EYP B;  2QGN A;  4DR5 O;  4LFC B;  3DGE A;  4LFC O;  1VQ5 V;  4NVP A;  2QKS A;  2EJR A;  2QDO A;  5B5E Z;  1QLN A;  3L9D A;  1HDJ A;  4TV9 A;  4DW1 A;  2W0X A;  1HNZ B;  2UUC O;  4B3T O;  4XDL A;  4AIL C;  3VOU A;  4UCR A;  1QHT A;  2QKC A;  4PDV A;  3ZHS A;  3ASN C;  4LBE C;  1NR1 A;  5LXT B;  2A3Q A;  4J7K A;  1EN6 A;  1I5X A;  5D5Q A;  2PGG A;  4J41 A;  3T4D A;  4I9Q A;  4PHZ A;  4GCZ A;  4MW3 A;  4O4H B;  4PA4 A;  1K73 W;  2RDC A;  4LWS B;  1W59 A;  5LMU O;  2CGN A;  4ZI7 B;  1K3E A;  3IAY A;  2F23 A;  4H33 A;  4MVM A;  3OAA G;  2QM8 A;  3UT5 B;  3FB5 C;  4JAS A;  2P90 A;  2WPD G;  3GWO A;  4F6R B;  5IJ9 A;  4I9W A;  1KQS U;  3SGI A;  1ZAU A;  3OEE G;  3DSQ A;  1MZE A;  2HP8 A;  3HKB A;  2BTO A;  3G67 A;  3ZMS A;  3CX5 F;  3CE2 A;  2YIC A;  1GK9 A;  1WB8 A;  3RN4 A;  3A2F A;  2N04 A;  1FFT B;  3LDC A;  1S3J A;  1BMF G;  3CXH F;  2Q7E A;  2Q68 A;  1GTO A;  4LF4 B;  5DM6 V;  2H8P C;  2FKX A;  5JH7 B;  3CXC U;  3P32 A;  1FFX B;  4X64 O;  5IYZ A;  3A0H Z;  3PJS K;  5EZY B;  1N36 B;  1KKD A;  1NT2 B;  5CB4 A;  1M1K W;  3JAM N;  4MTO A;  4DO2 A;  5KMG A;  1V54 C;  1VAR A;  3HKB B;  4WFF A;  4LF6 O;  2WLM A;  4LH6 A;  2E74 B;  4AQY O;  1OCZ C;  2GHY A;  2EIL B;  1XMQ O;  1D2D A;  3GVM A;  4WFH A;  4L87 A;  4P9O A;  1SZT A;  4PEL A;  1HP8 A;  4YIP A;  4WBN B;  2QM4 A;  1GM7 A;  2CDY A;  4O4L B;  4FM2 A;  5AG2 A;  1U96 A;  1XMO B;  1EM1 A;  5CA0 B;  3UCS C;  5TIS Z;  2Q5Z A;  4EB6 A;  4DR5 B;  1F23 A;  4I7Z B;  1KBH A;  1KMI Z;  4DR6 B;  1YXB A;  4R8C A;  4HBN A;  1Y66 A;  1H2N A;  1RM1 B;  1M57 C;  4NKG B;  2WSS G;  2BTQ B;  4X8A A;  4O4J B;  1GM8 A;  1Y76 B;  3FYE B;  1K8A W;  4OX9 O;  3ZBH A;  1NI8 A;  1N33 B;  2Y0P A;  1THZ A;  5B1A B;  3LDE A;  4D6T H;  4GZR B;  3JAL A;  1R3I C;  1DLB A;  2R9R B;  3ETQ A;  2ZCE A;  2ZR2 A;  1ORQ C;  5C93 A;  4ASU G;  4B7E A;  2HVJ C;  3L74 H;  3CRR A;  2Y4U A;  3X2Q B;  2JIZ G;  3IC9 A;  3QNE A;  4LF9 O;  4FM1 A;  3AK2 A;  3K57 A;  4YIO A;  5LA6 A;  1URF A;  1VF6 A;  4O2B A;  1WLE A;  4DR3 B;  3AEI A;  2BSK A;  3OMI B;  5KHG A;  2LW7 A;  4JI5 B;  1Y76 A;  1P84 F;  2MW2 B;  2ODM A;  2IJJ A;  1GAX A;  5JCO A;  1MNG A;  3I5D A;  2KG7 B;  3LDD A;  1QLE C;  2QWR B;  3ABK B;  1SQF A;  4KXR A;  4DR7 B;  1FYJ A;  4LWS A;  1OCC B;  4GX5 A;  2A79 B;  3SJC C;  3A0B Z;  1Q6U A;  2YI9 A;  3BAA A;  5LHH A;  3F5T A;  2XOK G;  3JAR A;  1NH2 D;  4O2B B;  4I55 B;  1HNZ O;  3CCR V;  3JAK A;  2F1M A;  1NTZ H;  4UCU A;  2EIL C;  4MW8 A;  2VQF O;  3D3I A;  4JZ2 A;  5EBW C;  3ZRW B;  4X1Y B;  2XUM A;  1E1R G;  5EBL C;  3I55 V;  4NXM O;  2AW9 A;  3OGC C;  5CBG A;  3OTF A;  4CH3 A;  4Z1V A;  2JS5 A;  3E89 A;  5J2T A;  4ZBM A;  4PDR A;  5GW7 A;  4DUZ B;  5LMN B;  1YVW A;  3CJH B;  1NQT A;  3CRA A;  1PL0 A;  1M4U A;  3B2E E;  1N0J A;  1N36 O;  1OJH A;  5L3G A;  3ZRW A;  1WA8 B;  3IGA C;  5DEC A;  4W4L A;  1M90 W;  4DRX B;  3CCV V;  5H6R A;  5B1A C;  4I5S A;  3RYF A;  2DOS A;  2ZIM A;  3E8B A;  4FPP A;  2VWJ A;  1CXZ B;  1G6U A;  1PL4 A;  1Q8I A;  2JGD A;  4NTX A;  1V55 B;  3IFX A;  4JI7 B;  2F4V B;  1D5N A;  2V4D A;  3RT3 C;  3X2Q C;  2QWO B;  4BIZ A;  3CJH A;  1NJI W;  3ZN1 A;  1KP3 A;  2DW4 A;  1NBM G;  1ZUQ A;  1AJQ A;  1H38 A;  3BHP A;  3VQW A;  5BZB A;  1EZJ A;  3JSL A;  1I94 O;  3CPW U;  3THO A;  5LOV B;  1RFY A;  3L72 H;  4IIJ B;  2R9A A;  3I56 V;  1FXH A;  3ABK C;  4PDM A;  4OGQ B;  3NXS A;  1OCC C;  1S5L Z;  4RAI A;  1XHX A;  3DTU B;  3UT5 A;  2UUB B;  5IDJ A;  2IJI A;  5IYB O;  4MVO A;  4UVC A;  1I7F A;  4D7S A;  1VQP V;  2IU0 A;  4JI0 O;  1YDX A;  1WP7 A;  3ZHQ A;  2Y69 B;  2AZ0 A;  1ZX3 A;  2EIM B;  4GX0 A;  3BCC H;  3OM3 B;  4TOI A;  4LF5 B;  1XL4 A;  2GTS A;  2RNB A;  1RSO A;  3HKD B;  5LGU A;  1AI7 A;  4I55 A;  3F5W C;  1L0N H;  4F4L A;  1MSD A;  3T1Y O;  5JCO C;  3SPG A;  4Q20 A;  3K3W A;  4ZOL A;  3ABL B;  3E86 A;  1XRE A;  1Z5W A;  2ZNJ A;  3N2K A;  4O4H A;  2PZS A;  1UFI A;  2JS3 A;  4UB8 Z;  2YIB A;  3MD0 A;  4FZ0 A;  3KZI Z;  4QE9 A;  3ZMT A;  1G8M A;  4NTW A;  4NXN O;  2F66 C;  3J7A U;  4DR4 O;  1R3K C;  3DXR A;  2W0F C;  3FKS G;  3ZHR A;  2HKO A;  2ATK C; 
#chains in the Genus database with same CATH homology
 2ZQM A;  2V7Q G;  1QLE B;  2BOB C;  4BIU A;  2AHY A;  2Z3Y A;  1EFR G;  1R3J C;  3K0D A;  3QO7 A;  3LSQ A;  1Q82 W;  5DN6 G;  1F4N A;  4P9P A;  2XAH A;  5J9P C;  1H8H G;  1V55 C;  2QTO A;  4QIW F;  2AHZ A;  1SRY A;  5B1B B;  4MSW C;  4KUM A;  2F43 G;  4MVZ A;  4JF3 A;  5CMU A;  3DGE A;  2Q6A A;  1SER A;  1FXK B;  1P4R A;  3AG2 C;  1UJW B;  1VQ5 V;  2IH3 C;  2QKS A;  2EJR A;  3AG1 C;  1QLN A;  4PA6 A;  2JJ2 G;  4RO2 A;  4JTD B;  2IJH A;  3WFV A;  4HAM A;  3CCU V;  4XDL A;  2HLD G;  3MHH C;  1AI6 A;  3VOU A;  4KP4 A;  3ZMU A;  4HYO A;  1PNM A;  2X6C A;  3CC4 V;  4TSF G;  4PDV A;  3ASN C;  4LBE C;  1BL8 A;  1NR1 A;  3ETG A;  3ABU A;  2IJK A;  4BW5 A;  1P7B A;  4QJF B;  1I5X A;  4G27 B;  4QNH B;  4MVS A;  5KUK A;  3T4D A;  4E2L A;  2C2A A;  3FB7 C;  4GCZ A;  4MW3 A;  1K73 W;  4PA4 A;  4QPK A;  2WAM A;  1Q7Y W;  1K3E A;  2W6J G;  1YIT V;  3E35 A;  4H33 A;  1SET A;  2Y69 C;  3AG3 C;  4MVM A;  5IYC O;  3E83 A;  3E8F A;  3ZCC A;  3OAA G;  2DYR C;  2QM8 A;  4EKW A;  4JYC A;  1QVF U;  1OCR B;  3FB5 C;  3SYA A;  3ABM C;  4JAS A;  2P90 A;  2WPD G;  3CP1 A;  3GWO A;  3QO8 A;  3ZMV A;  1QR8 A;  2DWD C;  2IW5 A;  3R65 A;  4WFE A;  2QM7 A;  1R6K A;  2YEV B;  4I9W A;  5L3E A;  2H94 A;  1KQS U;  1E79 G;  2WLJ A;  2DWE C;  2EIJ B;  3OEE G;  1YIJ V;  1RPR A;  1OZ0 A;  3OEH G;  3ZMS A;  1RPO A;  1F4M A;  1L1F A;  3BEH A;  3JYC A;  3OUF A;  2OTJ V;  1OCO C;  4PDL A;  1N8R W;  3WG7 C;  1GK9 A;  2UXX A;  1S76 D;  5KUM A;  1K4D C;  1FFT B;  3ASO B;  3LDC A;  4JPR A;  1S3J A;  1BMF G;  2EZP A;  3ZRS A;  3ABL C;  4WCE V;  2Q68 A;  1GTO A;  3T1C A;  2EBO A;  2WLK A;  5DM6 V;  4G2K A;  3AG4 C;  2H8P C;  2UXN A;  3CXC U;  3P32 A;  3W7S A;  3BY6 A;  2IH1 C;  2OT5 A;  4GX1 A;  1XL6 A;  5B3S C;  1MG1 A;  4H37 A;  4WF9 V;  2QA4 V;  5H6Q A;  3PJS K;  2X6A A;  4JAU A;  1KKD A;  4MTF A;  1M1K W;  1KP2 A;  3B8M A;  2X0L A;  4MTO A;  4MVU A;  1JX9 A;  2FTK A;  4DO2 A;  1YHQ V;  3CC7 V;  1V54 C;  4WFF A;  5EK0 A;  2HJF C;  4QPJ A;  3RBZ A;  3STZ C;  3SYQ A;  2WLM A;  4Z1M G;  4MVR A;  3CCE V;  1OCZ C;  3P30 A;  2GHY A;  3FYI B;  2WLL B;  2DYS C;  2EIL B;  4WFH A;  3K0G A;  1K92 A;  2HVK C;  4L87 A;  1COW G;  1R73 A;  4P9O A;  4XBF A;  4WFA V;  5HFM A;  1SZT A;  1AI5 A;  4MTG A;  4PEL A;  1YTF B;  1R6N A;  4GT1 A;  1AR1 B;  3A0R A;  1K97 A;  1GM7 A;  3OR7 C;  4N23 A;  4GX2 A;  2X6B A;  3K06 A;  2OCC C;  4OXS A;  2HFE C;  1PD3 A;  1K5S A;  2EIN C;  2P67 A;  3EHB B;  4N21 A;  4DXW A;  3CCM V;  1NVP B;  1VQ4 V;  1GO3 F;  1ZWI C;  3T2M A;  4X88 A;  5EBM C;  3VBB A;  1FXK C;  1HWY A;  1VQL V;  4P2Z A;  1F23 A;  3F7V C;  4R6Z A;  1VQN V;  3JD3 A;  1JQ0 A;  2PI4 A;  3TET A;  1FXV A;  2EIM C;  4R8C A;  2ZR3 A;  3UM7 A;  1Y66 A;  4KFM A;  1VQM V;  2ITD C;  2ITC C;  1RM1 B;  4UXN A;  1M57 C;  2Q69 A;  4FMT A;  2X7R B;  3JD0 A;  2WSS G;  1EBO A;  1NH2 B;  4FIP C;  4R50 A;  1KD1 W;  2ZXW B;  2HG5 C;  4X8A A;  1GM8 A;  3FYE B;  1K8A W;  1M56 B;  3CD6 V;  3CCJ V;  2XAG A;  1THZ A;  5B1A B;  5KA5 A;  3LDE A;  1F51 A;  3FB6 C;  3W7U A;  1JJ2 U;  1K9M W;  4J9Z B;  1R3I C;  1DLB A;  5L3F A;  2R9R B;  1I5Y A;  3E8H A;  3AG3 B;  2ZR2 A;  1ORQ C;  5C93 A;  4ASU G;  2BOC C;  5IY5 C;  1DF4 A;  2NLJ C;  2HVJ C;  2WWW A;  3ZRV A;  4JAV A;  1VQ9 V;  1PNK A;  3X2Q B;  3ZN0 A;  2JIZ G;  2Y48 A;  2B1G A;  3QNE A;  2EIJ C;  2IU3 A;  3RVZ A;  1DTO A;  1MAB G;  1FS0 G;  1WLE A;  2B5U A;  1OHH G;  3AEI A;  3OMA B;  3OMI B;  1AJP A;  3OUS A;  4WFG A;  1SES A;  4UV8 A;  3JD1 A;  3ASO C;  1YI2 V;  3CCQ V;  2P6J A;  2IJJ A;  3AG4 B;  4XDK A;  1W2B U;  3IC7 A;  2D3O W;  2WLH A;  2M7W A;  3LDD A;  3CCL V;  1QLE C;  4MTX A;  3ABK B;  3K79 A;  3LNM B;  3ML0 A;  1OCC B;  4UUJ C;  2ZDI C;  1ENV A;  4GX5 A;  2A79 B;  4U7N A;  3CME V;  2XND G;  2QEX V;  1K5Q A;  5KA6 A;  3LSS A;  2ZDI A;  4PA9 A;  2GSM B;  2XAQ A;  3T4Z A;  2HR3 A;  3ZMZ A;  5LHH A;  2XOK G;  1NH2 D;  5B1N A;  2R9I A;  3SPH A;  1YJN V;  3K04 A;  4JGS A;  4CBC A;  1E1Q G;  3AG2 B;  5L3D A;  3AG1 B;  3CCR V;  2QE7 G;  1LNQ A;  5CA3 A;  1CEZ A;  3GB7 C;  1ROP A;  4LCU C;  3RVY A;  2NNU A;  1YSC A;  1VQK V;  2DYS B;  2EIL C;  3CC2 V;  1JCH A;  3W7W A;  4MW8 A;  3CCS V;  3E8G A;  3D3I A;  5EBW C;  3ZRW B;  1GKF A;  1S5H C;  2B1I A;  3HPL C;  2A9H A;  3ASN B;  5LHI A;  1J95 A;  1K33 A;  4G28 B;  4QE7 A;  1E1R G;  5EBL C;  5L3C A;  3I55 V;  4YXW G;  3SYO A;  3MHS C;  3OGC C;  4P30 A;  3FB8 C;  5CBG A;  1QVG U;  3F7Y C;  2WLN A;  4LC1 A;  3ABT A;  2V1D A;  2EIK B;  4RQF A;  4UVA A;  2XAS A;  3E89 A;  4ZBM A;  2OTL V;  4PDR A;  5GW7 A;  2JDI G;  1NVP D;  3ETD A;  3ZJZ A;  1GMG A;  4FJC C;  1OCO B;  1OCR C;  1ARO P;  1NQT A;  1VQ6 V;  3STL C;  1QR9 A;  4R7C A;  1PL0 A;  3OW2 U;  1YJ9 V;  4PA7 A;  1JOY A;  3HB3 B;  2LFS A;  3K9A A;  2YSU B;  3D36 A;  5L3G A;  3K03 A;  1M56 C;  3ZRW A;  3IGA C;  1M90 W;  3CCV V;  3W7T A;  5H6R A;  5B1A C;  3TK1 A;  1Q81 W;  4RUE A;  4I5S A;  5B3S B;  3E8B A;  3H01 A;  4X89 A;  1QCE A;  4FPP A;  3JD2 A;  3B8N A;  2JK5 C;  2CK3 G;  1BHA A;  2JEX A;  2MK3 A;  1V55 B;  5LHG A;  3IFX A;  5CBF A;  1S0V A;  2LFR A;  4RUF A;  5B1B C;  1TUE B;  3X2Q C;  1KEC A;  4LP8 A;  2WLL A;  4CZZ A;  1QBZ A;  4BIZ A;  3OE7 G;  1NJI W;  3ZN1 A;  1KP3 A;  3SYP A;  1H8E G;  2DW4 A;  1NBM G;  1W0J G;  1Q86 W;  1AJQ A;  1H38 A;  1VQ7 V;  1CPY A;  1V54 B;  3EFF K;  1EZJ A;  5BZB A;  1S72 V;  1CP9 A;  3JD4 A;  3UKM A;  3E2E A;  3CPW U;  5HFL A;  3SJQ C;  1BHB A;  2ZD9 A;  1DF5 A;  1NKD A;  2OCC B;  5EC2 C;  1AJN A;  4WFB V;  3I56 V;  1VQO V;  1FXH A;  5CN0 A;  2EIN B;  4MT8 A;  3K08 A;  4JYB A;  4PA3 A;  3ABK C;  2W6I G;  2WLI B;  1R3L C;  4PDM A;  3NXS A;  1OCC C;  1S77 D;  3ZRX A;  4RAI A;  3OFN G;  3DTU B;  1FXK A;  4MVQ A;  4UVB A;  1MSW D;  5IDJ A;  1AI4 A;  2IJI A;  2JEU A;  4UV9 A;  5IYB O;  4MVO A;  4UVC A;  4ZKI A;  2Z5U A;  1VQP V;  1K4C C;  2IU0 A;  1K34 A;  2DQ3 A;  2LP7 A;  3ETE A;  2Y69 B;  1GM9 A;  1JPX A;  3CMA V;  2DYR B;  4XDJ A;  2XAJ A;  4BAY A;  2EIM B;  4GX0 A;  3ABM B;  3OM3 B;  2Q67 A;  1XL4 A;  5EC1 C;  3M99 B;  2PI5 A;  1RM1 C;  3LUT B;  3RW0 A;  3CYO A;  5LGU A;  1KC8 W;  1AI7 A;  5H9C A;  2ZXW C;  1WPX A;  3ZIA G;  2KB1 A;  2P7T C;  2YEV A;  3F5W C;  1YTF D;  4FK5 C;  3SPC A;  4F4L A;  3G6E V;  5LBQ A;  4HZ3 A;  3OMN B;  2A0L A;  3W7X A;  3WG7 B;  3KG2 A;  1G4Y B;  1M57 B;  4TT3 G;  3G71 V;  2WLI A;  4U7O A;  3SPG A;  5CBH A;  4Q20 A;  3K3W A;  2XAF A;  1Y4M A;  3JCZ A;  3SPJ A;  3ABL B;  2EZO A;  3G4S V;  3E86 A;  5IY5 B;  1IXM A;  4JTA B;  1H2G A;  3SYC A;  3TCU A;  1PKX A;  1NR7 A;  2K1E A;  5LGT A;  2EIK C;  1M9N A;  5B1O A;  1W0K G;  4JTC B;  3B77 A;  4TWK A;  3SPI A;  1PNL A;  1VQ8 V;  3MD0 A;  4RQE A;  3OR6 C;  4QE9 A;  5LGN A;  3QO5 A;  1JVM A;  3ZMT A;  1YJW V;  1MOF A;  1G8M A;  4MS2 A;  2DQ0 A;  2JJ1 G;  5FL7 G;  5E1A C;  5L3B A;  5IYD O;  1K7D A;  1R3K C;  1B6Q A;  4J9Y B;  2W0F C;  3FKS G;  2HKO A;  2ATK C;  1OCZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...