3CCSV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccsV00
3I56V 1K9MW 1N8RW 3CC2V 1K73W 1YJWV 3CCMV 3CMAV 1K8AW 1M1KW 1YJ9V 1VQNV 3CXCU 1R73A 1VQOV 4WF9V 2OTLV 5DM6V 1W2BU 1VQKV 1VQ6V 1VQ5V 3CCJV 2OTJV 1M90W 1VQ7V 1Q7YW 3CCUV 2D3OW 4WCEV 1Q81W 1Q82W 1Q86W 1KQSU 3CCRV 3G71V 3CCQV 3I55V 1S72V 1JJ2U 1VQ9V 3CCLV 1KD1W 4WFAV 1VQLV 3CCEV 3CCSV 1NJIW 1VQ4V 1YHQV 1VQPV 4WFBV 3G6EV 3CC7V 3CPWU 3CC4V 1YIJV 1QVGU 2QEXV 3CD6V 1YJNV 2QA4V 1KC8W 1VQ8V 3OW2U 3CCVV 3G4SV 1YI2V 1VQMV 3CMEV 1QVFU 1YITV
chains in the Genus database with same CATH superfamily
3OMIB 1M9NA 3CC2V 3QO8A 3AG4C 2WLJA 1BQZA 3ZRXA 4IHJB 1P49A 2Q69A 3E8FA 3X2QC 1T5EA 1Q86W 3ASNB 3K5LA 1V54C 2BOBC 1XNRB 3IJ4A 4MT8A 2KKWA 3R66A 2AXTZ 1BT8A 3E83A 5D5PA 1EN4A 1MG1A 1L1FA 5KX5B 3P3PA 1Y74A 5C8YA 3RYIB 1SQPH 5KHHA 4DRXB 4FLYA 4JYAB 1KYOF 1OCRC 1X59A 1R3KC 3RVZA 4B3TO 3A0BZ 1KP3A 1S76D 2WLIA 1KD1W 2ZIMA 1NH2B 4JGSA 4JYBA 3J80N 3CSXA 4JASA 4YY3B 1IXBA 5LA6A 1VQMV 1IZ3A 3L71H 4PA7A 4U7OA 5GTIZ 2UUCO 5B5EZ 1MSWD 5BR8B 2CK3G 3D36C 1VARA 3ZHUA 3UCSC 3T1YB 1VQ7V 3GVMA 1OCOB 4FZ0A 5BXZA 3N2KB 3QVNA 3RYFB 1WJZA 4K35A 4CH6A 1NU1H 1YIJV 1YDXA 2F43G 1HNXB 3PN1A 4IHJA 2GSMB 1AP6A 1SF9A 4JI1O 4QJFB 4JAUA 5KUMA 2W6JG 4BIUA 1VQ6V 2Y48A 5GTHZ 1Q90D 3ZHQA 2CDYA 3TGUH 3ZX6A 3D8CA 3H1HH 5H5NA 5KX5A 3VQYA 2XT9A 1SA0B 3APOA 3CP1A 4UVCA 5EK0A 4JI8B 2ZR3A 3RYIA 4J7KA 4DRXA 4DW1A 3OGCC 4KFMA 1S5HC 4B7EA 1G1XB 1Y67A 4CS2A 1KQSU 1R3JC 2QSAA 3AK3A 4JI4O 4ZHQB 1PL4A 4UFZA 3ZBHA 4NXNB 4QPKA 4DV4O 5EC1C 2JJ1G 2CGNA 1N33O 3CJHB 3L72H 1VP7A 3CCMV 1IXMA 1WN7A 5CBGA 1SETA 2ZE5A 3MHSC 3ZMSA 2HLDG 3N2KA 1M90W 3RYFA 1YTFB 3JD3A 4UUJC 2BE3A 2QGNA 1URFA 2ZNIA 4LFCB 3CRMA 3QTCA 5CMUA 3CCVV 4CC5A 1IURA 3FFQA 4R8CA 1VQNV 4TV8B 1H2LA 4DV0B 2ZE6A 4LBEC 4DXWA 2LQTA 5KHGA 1IBKO 3ZMVA 4DV7B 1Q7YW 3W7SA 4PJ0Z 4O2BB 1PNMA 1I94B 2CH7B 4AHCA 1EN5A 1SA0A 4UVBA 5CA0B 4DR2O 1KC8W 4QPJA 3ETGA 5JJEB 1XI1A 1GRJA 2ZNJA 5IYCO 1FD9A 2KSDA 1WNSA 4ZHQA 4H0LB 4PDMA 4YIPA 1S72V 5L3FA 1NJIW 5IWAO 1IDSA 4NVPA 3F7YC 3CJHA 2C2AA 5ITZB 3B2EE 5LL6Y 4UCTA 1GH6A 2UXCB 4PI2A 3EVKA 3RVYA 4J9ZB 1K7DA 5IE9A 3P3NA 3ZMTA 3ABTA 1SQVH 5IYZB 4TV8A 3T4DA 3ZRWB 4LF9O 1K73W 1HR0O 3P30A 4PV1B 2X6AA 1J5EB 4O2BA 4H44B 2CH7A 2WPDG 4Z2WA 3T4ZA 2IM9A 5CA0A 2EULA 4JI2O 3P32A 2OYQA 4WFBV 1ROPA 5KHIA 3ZHRA 3ABLB 4ICGA 4J7ZA 3CX5F 1HNWO 4LFAO 3AG2B 2QM7A 4JI0O 3TJTA 4J42A 3ZS8C 1KUQA 2Q6AA 1EFRG 3L9DA 5DECA 1M4UA 3ABKB 4LF4B 4DV1O 5B3SB 3SJQC 1XNQO 1JMKC 3H9VA 4W4KA 4CS4A 4E2LA 2YIDA 4X66B 2EZPA 4D7SA 5LOVB 2VQEB 2QM8A 5ITZA 4X88A 4NB5A 4AILC 2XAGA 3I56V 4A5UB 1E79G 4X64B 4ZI7B 5AG2A 4BW9A 4WF9V 2IBZH 3NR7A 4O4LB 2ITDC 3I5DA 1GMGA 1H2MA 2HVKC 3ZIAG 3CCRV 4I5SA 4LFBB 2W0XA 2ADQB 2DWDC 1MA1A 4GKJB 3OR6C 5IYZA 4RQEA 2GTAA 4ZOLB 3ZRWA 2QEXV 1THZA 2F1MA 4RAIA 4LF6B 1ZLZA 1EBOA 1FFTB 3SJBC 4GKKB 3F5TA 3ETDA 3FB6C 3G71V 2EJ7A 2Q67A 5CBFA 2YC0A 5A2QN 1SQGA 2P4KA 3DXRB 2Y69B 4JI5B 2OWOA 3N2GB 1XMOO 2YXLA 2OCCC 2YS8A 4HAMA 3OMAB 4WFFA 3K0GA 5E79Z 4ABMA 4WFGA 3A0RA 5CA3A 4UCUA 5CA1B 1LR1A 5B1NA 1K4DC 2JGDB 4J10A 4TWKA 1OHHG 1VQKV 2H94A 3EXAA 2EIMB 2XNDG 1KP2A 4R6ZA 3B8NA 3SYCA 3K03A 5LOVA 1ZUQA 2P67A 3ASNC 4G28B 4FLZA 2RN9A 1Q5OA 3E89A 1VQPV 1MOFA 4JI3O 1XHXA 4I4TB 5LP6B 2Z5UA 1SKVA 3W7TA 1M1KW 4DV3B 3OMNB 1DTOA 3QG5A 1D5NA 4N21A 4WFHA 2YDEA 3M8AA 1TA8A 2JVDA 4ZOLA 2YI9A 1XQ8A 1WP7A 2QKAA 2JEUA 4GX5A 1QVFU 1N32O 1K8AW 4DR6B 3CS5A 2PI4A 1FYJA 3LDCA 4BWAA 2V4DA 4PDRA 4X20B 2EINB 3DXRA 3N2GA 1OCOC 3K08A 3RFRA 4OGQB 2P4VA 2RQ6A 2Q0AA 2QWRB 5CA1A 2ATKC 1F51A 2JGDA 1VF5B 3DC6A 3H01A 5A9GA 2A79B 2ZM6O 1AJQA 1FFXB 5KA6A 1UFIA 4ZBMA 3HKDB 2DE0X 5K1XA 3G80A 1DGSA 4X65O 2UU9B 1NBMG 1JJ2U 5JCOC 4AQYB 4X62B 5FNVB 5LHIA 1S3JA 3L73H 2AW9A 4I4TA 1KMIZ 2DYRC 3THOA 5LP6A 4Q20A 4K8XA 2UXDO 1KKCA 1FXVA 2DN9A 4UVAA 2ZE8A 4PDVA 3H1LH 4JYYA 1XOUA 2W6IG 4JI7B 1IBMB 2ZD9A 3C3TA 3E35A 4DYLA 2W0FC 1AJNA 1S5LZ 3AG1B 2FL4A 4JYCA 4TV9B 1YVWA 3OEHG 3CC7V 2IH1C 4JV5O 4J41A 4H13B 1F23A 1N36B 4KP4A 1AR5A 4DV5O 2UUBO 4WBNB 1ZL8B 5LGTA 3BABA 3K06A 2IH3C 4X20A 1JPXA 2Q0OC 4DR4B 3STLC 4OXSA 3SJAC 1NVPB 5EZYB 3SYQA 1IBLB 3U0ZA 2WA4A 4PA6A 5H9CA 1AJPA 1WA8B 1FFXA 1Z2GA 4PDLA 4FJCC 1HDJA 3HKDA 4X9QA 4O4HB 2X6CA 3K9AA 4GZRB 1K5SA 2NR5A 3BY6A 2WLHA 2RNBA 2EX3A 4B3RO 4X1IB 3J81N 4DR1B 1EM1A 1PPJH 2P90A 4PA4A 3CCLV 5FNVA 4MTFA 5B1BC 4GYCB 3ZHSA 4K0KO 3OAAG 2M7WA 3E22B 1GO3F 4H33A 1FPOA 3K5NA 5EYPB 3JCZA 1MZEA 2EZOA 2B1GA 4N23A 1XDCA 1GM7A 4TV9A 2HHHB 2JK5C 4U3JB 2ZQMA 4OX9O 4YJ3B 1GM9A 1N4CA 4CH5A 4WBNA 1ZL8A 4IYIA 2K9PA 1Q43A 1SQBH 4LF5B 1JVMA 1YCIA 5EZYA 2OIEA 3K57A 1G6UA 2Q8VA 1NZ6A 3BEHA 3SJCC 1NH2D 4QE9A 4UV9A 3VQXA 1QLEB 1WA8A 4DUZB 3AK1A 3KCXA 5JVDB 1F4MA 3EFFK 4CBCA 4O4HA 2ZDIC 3OR7C 4LP8A 3SYPA 2O57A 1VQOV 5IT9N 4TQDA 4X1IA 4CH3A 2IJKA 3U10A 5IY5B 2P22C 5L3CA 2D3OW 2ZE7A 3BPZA 2F66C 2QWPB 1B06A 3B09A 2LGQA 2LP7A 2R9IA 4D6TH 1K33A 3E22A 1PNKA 1YI2V 5EYPA 1TUEB 1YF2A 1YITV 1OCZB 3U11A 5LMNO 4B08A 3AG2C 2HG5C 4DR3O 3WG7B 4U3JA 3E8GA 4B3TB 2F4VO 2N04A 3GB7C 3ABKC 4PI0A 4YJ3A 1M57C 3CCSV 5GW7A 4DV2O 2PYJA 4JZGA 3ZHTA 5EIBC 2JS3A 3O65A 3FYIB 1Z5WA 1N0JA 1K5QA 5L3DA 1PD3A 4BIZA 4J80A 2UUCB 4GX2A 1A32A 1ENVA 2AGAA 1VQ5V 1BQ0A 1P7BA 1CP9A 5J2UB 3VQWA 2YEVB 4KUMA 3JSLA 3Q4HB 2HP8A 1QR8A 2ZR2A 2WSSG 3AG3C 5JVDA 2E76B 4MVRA 1EN6A 1S5JA 4MVUA 5FPOA 3MAQA 5IJ0B 4JI1B 3IFXA 4LH6A 4GCZA 4PA3A 2GHYA 1BCCH 1D2DA 1JR9A 3OEEG 4I0XB 3IGAC 1YTFD 2BSKB 4NTXA 2DYSB 5EBWC 1Y4MA 3BVOA 2YICA 2BOCC 1WAZA 3QO5A 4JI6O 4P2ZA 1XL6A 1L0LH 2ARHA 2D2CB 3HR0A 4JI4B 1G8MA 3M7MX 2LFSA 4FM2A 2WWWA 2JEXA 4DV4B 4LNUB 4DO2A 2B9ZA 1N33B 1Q6UA 4DR7O 4YJ2B 2UXXA 1I08A 5J2UA 4MW3A 2YEVA 5H2FZ 5LP6C 3Q4HA 5FL7G 1PNLA 3E8BA 4LF7O 2BTOA 2DQ3A 4XDKA 3TETA 4DR5O 3L74H 3N27A 4WFAV 1VQLV 2Q7EA 2XAFA 2RJZA 3CD6V 2XAHA 5IJ0A 2PZSA 4DV6O 1F7YA 1YJWV 3QO7A 4I0XA 4HYOA 4OPAA 1IBKB 2BSKA 1W2BU 2KG7B 1R6NA 1FJGO 1Q82W 4RQFA 3I55V 1F4NA 2CUGA 1VQ4V 5CB4B 2EINC 4O4JB 1U96A 4DR2B 2XHBA 3UKMA 4FPPA 1HNZO 1QBZA 1FXHA 2DWEC 2QTSA 1RM1B 4JAAA 5LMUO 1CPYA 4GT1A 3IAYA 3OTOO 4MVZA 1RPRA 1XL4A 2HVJC 3OGIB 1AP5A 2Z0AA 2RMKB 2YIBA 3WU2Z 2DW4A 4LNUA 4BW5A 5IWAB 1W59A 1KB9F 4L8JA 5KAFZ 1TGOA 1R3LC 4EEQA 3ML0A 4YJ2A 4GX0A 3WB2A 3OM3B 3TCUA 4EB6B 5LYJB 2CAZC 1X4TA 4YIOA 3K58A 5J9PC 5EIBD 4TUYB 3K5MA 2EIKC 2P7TC 3AG1C 3OUSA 1SQFA 4J7JA 5CN0A 1QVGU 5E1AC 4EFBA 1YHQV 4LF9B 1HR0B 2E74B 1O9GA 1FXKB 3JALB 1XMQO 2KG7A 3KCYA 1VF6A 5IYBO 3DSQA 4NTWA 5CB4A 2JRIA 4O4JA 1JFFB 2ITCC 4JI2B 3TXQA 3GWOA 1B3QA 2E5LO 4X66O 3H1KH 3FB7C 1HNWB 4LFAB 4JI0B 1Q6IA 2FKXA 2Q68A 1CEZA 1BL8A 4BR6A 2Z3YA 3IC9A 2L6LA 4DV1B 3CB2A 1XNQB 2ADPA 1YZBA 2ZINA 1S77D 2ZT9B 3SPJA 5KHJA 3WB0A 2F95B 1UPGA 4CS3A 1SERA 4FLUA 3B40A 3HPLC 2X6BA 1M93A 3MDSA 1BS3A 2YI8A 4EB6A 4KHPO 5LYJA 2VWKA 3JATB 3SYAA 1SZTA 1BHBA 4YHHO 4TUYA 1UJWB 4UCVA 3ZN0A 2A06H 2Y0IA 5B1AB 1BE3H 1I7FA 2X7RB 1MMMA 1VQ8V 4F6EA 1FXKA 3JALA 2A3QA 5LHGA 4PELA 3W7WA 1H2GA 3L75H 2DJVA 1OCCB 2UXBO 2KB1A 1JFFA 4IGGA 1HW7A 4LH7A 3CCQV 3JD0A 2QKCA 1N34O 3RN4A 2XOKG 4UCOA 1XMOB 1H38A 2JDIG 4O4IB 1XREA 3D36A 1QLEC 3JD2A 4B3MO 4JTAB 1FS0G 4Q6GA 3T2MA 3HKBB 4NXMO 5B66Z 2XUMA 1EZVH 1VEWA 2YXHA 4RUEA 4FFKA 3K5OA 1NTKH 4TSFG 4UCSA 4I9WA 1HP8A 2UUAO 4X1KA 4JI3B 1QR9A 1LUVA 3JATA 2QKSA 1V55B 3A2FA 1LUWA 4KXRA 3B4SA 1SC5B 5L3BA 3CRAA 2WLLB 1W0JG 3SPHA 2BCCH 1NR7A 5JWPA 3ABUA 3RYHB 1JOYA 3CEIA 3TK1A 5J2TB 3QF7A 4X89A 1MZFA 3LSUA 1QNMA 3CC4V 1N32B 3ZHVA 2Q7HA 2H3OA 1ZWIC 3S3WA 4EKWA 1DK1A 3UQ8A 3JD4A 3JCUZ 3K04A 3CE2A 1CXZB 1AI4A 3CRRA 2M6YA 5BZBA 1KKDA 1XEQA 2ZXWB 4L87A 4O4IA 3JSNA 1S0VA 1WB7A 1PKXA 1AI7A 2PTMA 1M5IA 1I0HA 2CTQA 3HKBA 2ZM6B 2K1EA 4DW0A 3T1CA 1Q6HA 5KA5A 1SESA 1AROP 4X65B 4JI7O 1NVPD 4F4LA 1QU7A 3F7VC 3JARB 3WFVA 1K92A 3OFNG 3ZRSA 1YJNV 2UXDB 4JTCB 5F2VO 2LW1A 2DMXA 2WLLA 4FM0A 2XAJA 3BAAA 3H1IH 4X8AA 1JA8A 3K79A 3RYHA 2Y0PA 4MTOA 4LF8O 1R6TA 4QE7A 1K34A 5J2TA 2V1DA 2R72A 4JV5B 3RBZA 2UUBB 4DV5B 2P06A 2QWOB 2QJ1A 3UM7A 2CGOA 3SR2C 3CXCU 3OTFA 5DEDA 2PYLA 2IW5A 2PGGA 4R7CA 4DUYO 4B3SO 3JAWA 3AK2A 3QNEA 3T1HO 1N0NA 4J9YB 4U3FH 1K97A 4BAYA 2YUAA 4P9PA 4QNHB 1ZTEA 4CZZA 2WLNA 2AHZA 2NNUA 4K8ZA 5KAIZ 1IVSA 2BTQB 2EJRA 3B77A 3ABMB 4F6RB 4B3RB 1DLBA 5LXTB 2A9HA 1H8HG 5FPRA 5KLVH 4GX1A 2VQFO 2E75B 3JARA 1R6KA 1VF6C 4MVSA 3RYCB 4ZIBA 4K0KB 3GWKC 2LO1A 1NT2B 1PM9A 2HJFC 1PV0A 2WA3A 1RM1C 4YXWG 3FX7A 3ZEDA 4PHZA 1GN4A 1L0NH 1ZX3A 5LGNA 1KU9A 4I7ZB 2OCCB 4OX9B 1XNRO 1K4CC 3JAKB 1COWG 2JIZG 5C93A 1N8RW 3AG7A 2EIJB 2HFEC 4ASUG 1P84F 1DF4A 2N05A 2CTPA 3SPGA 3UT5B 2FMLA 3JYCA 1AI5A 3UO3A 4JYAO 2MK3A 2PI5A 2F23A 5LGUA 1RP3B 2IU0A 2G38A 1RSOB 1I5YA 2EILB 5HFMA 1BZKA 2QWQB 2BTQA 4YY3O 3ABLC 4F6RA 2N74A 1NKDA 1YJ9V 5B1OA 5LXTA 2QDOA 5GONB 1FXKC 5BR8O 1AR4A 1G4YB 4IIJB 4XBFA 3BA9A 3T1YO 3HKEB 4FLVA 3RYCA 5B3SC 3ZRVA 3FB5C 4JZ2A 4FMTA 3G6EV 1ZSPA 2VS0A 2QTOA 1IX9A 5LMNB 1HNXO 2ODMA 3OT7A 2PUSA 5JQGB 4DR3B 3BCCH 1BMFG 4HNAB 1AB3A 5K1PA 2F4VB 1FAFA 2UXNA 2ZCEA 3ETQA 2LGWA 3JAKA 4CC6A 4DV2B 2QE7G 4WFEA 2GDSA 3ASOB 4JTDB 3KG2A 3G4SV 5KHKA 5IJ9B 3R65A 3UT5A 2GBOA 1AILA 4RO2A 4JI8O 1J95A 1R73A 3ETEA 3VOUA 2RDCA 1M56B 3A8TA 4UCRA 1R1BA 2DQ0A 1GN6A 2HKOA 1OJHA 2AHYA 2YIBD 1RSOA 2DYRB 4ZKIA 2L35A 3STZC 4FLTA 5B1AC 1B04A 4NXNO 1MABG 1BSMA 2Y69C 4LC1A 2Q4PA 5GONA 3APQA 3CMAV 4IIJA 2CTWA 2CTRA 4MW8A 2JGUA 2ZIOA 3HKEA 2B5UA 2A7WA 4MTXA 4DK0A 2GUZB 1OCCC 4XDJA 2EIMC 4R50A 2ZKOA 1BHAA 4I55B 3CCEV 4JPRA 4LFCO 3E86A 2OIGA 1R3IC 5JQGA 3LDEA 1BGYH 3IC7A 1NTZH 4JAVA 2AZ2A 4JI6B 4HNAA 3JASB 2XTAA 3L70H 1P7GA 4DV0O 3SPCA 4DV7O 2XASA 2WAMA 1H2KA 1Q3EA 2IU3A 1W0KG 1I94O 1AI6A 2OCHA 3SPIA 5IJ9A 4DR7B 2B1IA 5JJJB 1V55C 1D5AA 4XDLA 3DTUB 5JCOA 1VF7A 5L3EA 1KECA 4QGPA 3RGBA 4NKGB 2QWNB 4LF7B 3BRCA 4DR5B 1WPBA 5B1BB 4MSWC 4B7KA 1GTOA 3RT3C 2GV9A 4LCUC 2RCVA 5EC2C 2HR3A 4FK5C 4DV6B 1K9MW 4U7NA 2NN4A 2Y4UA 3CRCA 2UXCO 2GUZA 1E1RG 1FJGB 2E3CA 1LNQA 4I55A 1Q81W 3W7XA 1GM8A 1K3EA 2YIAA 3SGIA 1HNZB 2LW7A 2ZXWC 5JH7B 3AG4B 1YEWA 3JASA 5JJNB 5LMUB 2P6JA 2Y4TA 2AZ0A 3OTOB 3E2EA 3O9OA 3X2QB 3DGEA 4NR1A 5IYDO 3B8MA 4Z1MG 3WB1A 1V54B 1HWYA 5LHHA 3LDDA 4UV8A 1J5EO 2JJ2G 3BA8A 2Q7GA 3LUTB 3RWRD 3CRQA 1VMGA 3SYOA 4Z1VA 3ZCCA 1OCRB 2ETNA 1KBHA 1US6A 4G2KA 3ICXA 3C90A 4LF4O 5CBHA 2ILMA 3LNNA 2WLMA 3K59A 1Q8IA 1ORQC 3OW2U 1MNGA 2VQEO 3DC5A 4P9OA 2FTKA 2X0LA 4D7TA 3EHBB 4FLXA 1XMQB 4X64O 1JJOA 5TISZ 3NXSA 1JCHA 1M57B 4PA9A 3OUFA 3TXSA 1RFYA 1XBLA 1NQTA 2E5LB 5JH7A 4LFBO 4TOIA 5KMGB 4GKJO 2IJJA 4FLWA 4IYHA 4MS2A 3K9SA 3JD1A 4X1KB 1OZ0A 4LF6O 4X1YB 1TUBB 1TAEA 2FB5A 3J7AU 2R9AA 2PY5A 3ABMC 3AG3B 3CXHF 4GKKO 4JF3A 3W7UA 1L8DA 3HKCB 1Y76B 2ZDIA 3BHPA 5DN6G 2IJHA 2A0LA 5LBQA 2Q73A 4JI5O 3KKYA 4FFBB 1I5XA 4KHPB 4GUNA 4I9QA 3E8HA 4YHHB 3CCJV 2R9RB 3FAVB 4WCEV 1PL0A 2YXYA 1QQCA 3C3SA 3FB8C 3MHHC 3CPWU 1NS1A 1SRYA 1B6QA 1H2NA 1NR1A 4TT3G 5KUKA 4HZ3A 1OV9A 2JS5A 2EIJC 4H37A 3LSQA 2Q9LA 4DV3O 3PJSK 2UXBB 4W4LA 3ZMZA 1RPOA 5EBLC 4HBNA 1Z5VA 2VRZA 4IL6Z 4MVMA 5KMGA 5IY5C 1N34B 1O9HA 4RUFA 2IJIA 4B3MB 1FKAO 3ZJZA 4ZI7A 1WPXA 4O2AB 1NI8A 4O4LA 1TUBA 4X1YA 2EILC 2GTSA 4DR6O 4DK1A 3D3QA 4NXMB 3MD0A 5H6QA 1QHTA 1XILA 1YSCA 2WLKA 1OCZC 3CWBH 4IT5A 2XAQA 4BIOA 3HKCA 1Y76A 3WG7C 1VQ9V 1GAXA 5IDJA 2UUAB 3A0HZ 3BFRA 1TVKB 4FFBA 5BY1A 3K3WA 3CMEV 1P4RA 1GKFA 1WB8A 3FAVA 3SDLA 1GN2A 4RWUA 3FD9A 4FM1A 4LWSB 2UU9O 1ZAUA 1GN3A 4K3AA 5BMVB 3JAWB 4AI8A 4AQYO 4X62O 1SS3A 2QM4A 4UB8Z 4E4EA 4GLXA 2LFRA 1SQQH 3ASOC 5H6RA 3AEIA 4UXNA 1E1QG 4J11A 3K0DA 1IBMO 3FYEB 1M56C 1WLEA 3JAMN 5L3GA 4I50B 4MTGA 2VWJA 2DYSC 2DOSA 1JQ0A 4O2AA 5HFLA 4MVOA 2Q5ZA 1PP9H 1AR1B 2R70A 2QR4A 1N36O 1Y66A 3D3IA 4EFEA 3OD4A 4FZ1A 3H1JH 4LR3A 3HB3B 5DM6V 4CH4A 2PF4E 4QIWF 2EIKB 4DR4O 4NYKA 4NTYA 1TVKA 3KZIZ 4C7UA 5D5QA 3VQVA 1IBLO 2P5OA 3G67A 1YXBA 2QA4V 3ZMUA 1H8EG 1SZXA 3G6BA 3M99B 2EBOA 3LSSA 2OTLV 3ZN1A 3FKSG 4OPHA 1U97A 4LWSA 3VBBA 4LF8B 2OTJV 1XUQA 4KL1A 3CCUV 2YSUB 3LNMB 1AVMA 4DR1O 2HJDA 5BMVA 2LJ2A 2H8PC 5EBMC 1Y6XA 3F5WC 4P30A 1XHZA 2F93B 1Y74B 1VIBA 4I50A 4FIPC 4G27B 3S3XA 2CE4A 4DUYB 5C8YB 1H2SB 2KQXA 3CYOA 4B3SB 4PD4F 1MSDA 2HHHO 3T1HB 1WP8A 2WLIB 4MVQA 4TQFA 1DF5A 5FLXN 1JX9A 4FVMA 4UB6Z 1GK9A 5LA6B 2FYUH 2MW2B 4LF5O 3CHXA 2VQFB 1NTMH 1QCEA 1EZJA 1QLNA 1SQXH 3OE7G 2OT5A 2NLJC 3RW0A 1V9PA 4DUZO 3UO2A 2V7QG 2HEPA
chains in the Genus database with same CATH topology
3H01A 1M9NA 3OMIB 1BL8A 2A79B 3QO8A 3AG4C 1AJQA 5KA6A 3CC2V 2WLJA 2Z3YA 4ZBMA 3ZRXA 2Q69A 3SPCA 3E8FA 3X2QC 1S77D 3SPJA 2XASA 1Q86W 3ASNB 2WAMA 1NBMG 1V54C 1JJ2U 2BOBC 4MT8A 2IU3A 1W0KG 1SERA 1AI6A 3E83A 5LHIA 1S3JA 3HPLC 2X6BA 2DYRC 3SPIA 2B1IA 4Q20A 1MG1A 1L1FA 1FXVA 1CEZA 4UVAA 1V55C 4PDVA 4XDLA 3SYAA 1SZTA 3DTUB 1BHBA 2W6IG 5L3EA 1KECA 1OCRC 2ZD9A 3E35A 1UJWB 1R3KC 2W0FC 3RVZA 3ZN0A 1AJNA 3AG1B 1KP3A 1S76D 2WLIA 5B1AB 1KD1W 4JYCA 1NH2B 5B1BB 4JGSA 2X7RB 1GTOA 4MSWC 3OEHG 4JYBA 3CC7V 2IH1C 4JASA 4LCUC 5EC2C 1VQ8V 2HR3A 4FK5C 1FXKA 1F23A 1VQMV 4KP4A 1K9MW 5LHGA 4PA7A 4U7OA 4U7NA 4PELA 1MSWD 3W7WA 2CK3G 5LGTA 1H2GA 3K06A 2IH3C 1E1RG 1JPXA 1LNQA 1OCCB 2KB1A 3STLC 1VQ7V 1OCOB 1Q81W 4OXSA 3W7XA 1NVPB 1GM8A 1K3EA 3CCQV 3SYQA 3JD0A 2XOKG 1H38A 2JDIG 2ZXWC 4PA6A 1YIJV 3JD2A 3D36A 1QLEC 5H9CA 2F43G 1AJPA 3AG4B 4JTAB 1FS0G 2P6JA 4PDLA 4FJCC 3T2MA 2GSMB 3E2EA 4QJFB 3X2QB 2X6CA 3K9AA 4JAUA 2W6JG 1K5SA 5KUMA 4BIUA 3DGEA 1VQ6V 5IYDO 2Y48A 3B8MA 3BY6A 4Z1MG 1V54B 2WLHA 4RUEA 1HWYA 5LHHA 3LDDA 4TSFG 4UV8A 4I9WA 2JJ2G 4PA4A 2P90A 3CCLV 3LUTB 4MTFA 1QR9A 5B1BC 2QKSA 1V55B 3OAAG 3SYOA 2M7WA 3CP1A 4UVCA 5EK0A 1GO3F 4H33A 2ZR3A 3ZCCA 5L3BA 3OGCC 1OCRB 3JCZA 4KFMA 1S5HC 2EZOA 2WLLB 1W0JG 2B1GA 4N23A 3SPHA 4G2KA 1GM7A 1NR7A 1KQSU 1R3JC 2JK5C 5CBHA 3ABUA 2WLMA 1JOYA 2ZQMA 3TK1A 4X89A 4QPKA 1ORQC 1GM9A 3CC4V 5EC1C 2JJ1G 3OW2U 4P9OA 2FTKA 2X0LA 1ZWIC 3EHBB 4EKWA 3CCMV 1IXMA 3NXSA 5CBGA 1SETA 3MHSC 1JCHA 3ZMSA 3JD4A 3K04A 2HLDG 1JVMA 1M57B 1M90W 4PA9A 1AI4A 3OUFA 1YTFB 3JD3A 4UUJC 3BEHA 5BZBA 1KKDA 1NH2D 1NQTA 2ZXWB 4L87A 4QE9A 4UV9A 1QLEB 1S0VA 1PKXA 5CMUA 1AI7A 2IJJA 4MS2A 1F4MA 3CCVV 2K1EA 3EFFK 4CBCA 3JD1A 1OZ0A 3T1CA 2ZDIC 3OR7C 4LP8A 3SYPA 5KA5A 1SESA 4R8CA 1VQNV 1AROP 1VQOV 4LBEC 4DXWA 2IJKA 5IY5B 3ZMVA 3ABMC 1Q7YW 3AG3B 5L3CA 3W7SA 2D3OW 1NVPD 4F4LA 4JF3A 3W7UA 1PNMA 2ZDIA 5DN6G 2IJHA 2LP7A 3F7VC 2A0LA 3WFVA 4UVBA 5LBQA 2R9IA 1K92A 3OFNG 1K33A 4QPJA 1PNKA 3ZRSA 4JTCB 1YJNV 1YI2V 1KC8W 1TUEB 1I5XA 3ETGA 1OCZB 1YITV 2WLLA 2XAJA 3AG2C 3E8HA 2HG5C 3WG7B 5IYCO 4X8AA 3CCJV 3K79A 4MTOA 3E8GA 4PDMA 2R9RB 4QE7A 4WCEV 3GB7C 1PL0A 3ABKC 1K34A 1S72V 5L3FA 1M57C 3CCSV 5GW7A 3FB8C 1NJIW 3MHHC 2V1DA 3RBZA 3CPWU 3F7YC 3FYIB 1SRYA 1B6QA 1K5QA 5L3DA 1PD3A 1NR1A 4BIZA 2C2AA 3UM7A 4TT3G 5KUKA 4HZ3A 4GX2A 3CXCU 2EIJC 4H37A 1ENVA 3LSQA 2IW5A 1VQ5V 1P7BA 3PJSK 1CP9A 4R7CA 3ZMZA 1RPOA 2YEVB 5EBLC 3RVYA 4J9ZB 4KUMA 4MVMA 5IY5C 1QR8A 2ZR2A 1K7DA 2WSSG 3AG3C 3QNEA 4RUFA 2IJIA 4J9YB 1K97A 4BAYA 3ZMTA 3ZJZA 3ABTA 4P9PA 4MVRA 4QNHB 1WPXA 4CZZA 4MVUA 2WLNA 2AHZA 2NNUA 3T4DA 3ZRWB 2EILC 1K73W 3IFXA 3MD0A 5H6QA 4GCZA 1YSCA 4PA3A 2WLKA 3P30A 2EJRA 1OCZC 2GHYA 3ABMB 3B77A 2X6AA 3OEEG 2XAQA 3IGAC 1DLBA 1YTFD 2A9HA 1H8HG 4GX1A 3WG7C 2DYSB 2WPDG 3T4ZA 1VQ9V 1R6KA 5EBWC 5IDJA 4MVSA 1Y4MA 3P32A 4WFBV 1ROPA 3ABLB 3K3WA 3CMEV 3AG2B 2QM7A 2BOCC 1P4RA 3QO5A 1GKFA 2HJFC 2Q6AA 1RM1C 1EFRG 4YXWG 4P2ZA 1XL6A 3ABKB 5B3SB 3SJQC 1G8MA 5LGNA 2LFSA 2WWWA 4E2LA 2OCCB 2JEXA 1K4CC 2EZPA 1COWG 2JIZG 5C93A 4DO2A 2QM8A 4X88A 2Q68A 2LFRA 1N8RW 3ASOC 2XAGA 2EIJB 3AEIA 1E79G 2HFEC 4UXNA 5H6RA 4ASUG 3I56V 1E1QG 2UXXA 4WF9V 1DF4A 2ITDC 4MW3A 2YEVA 3SPGA 3JYCA 1AI5A 3K0DA 5FL7G 1GMGA 1PNLA 2HVKC 3FYEB 1M56C 1WLEA 3E8BA 3ZIAG 5L3GA 3CCRV 2DQ3A 4I5SA 2MK3A 4XDKA 3TETA 4WFAV 1VQLV 2PI5A 4MTGA 2DWDC 5LGUA 2DYSC 2XAFA 1JQ0A 2IU0A 3OR6C 4RQEA 5HFLA 3ZRWA 2QEXV 1I5YA 1THZA 2EILB 2XAHA 4MVOA 5HFMA 3CD6V 1AR1B 4RAIA 3ABLC 1Y66A 3D3IA 3QO7A 1YJWV 1NKDA 4HYOA 1YJ9V 5B1OA 5DM6V 3HB3B 1EBOA 1FFTB 1W2BU 1FXKC 4QIWF 1G4YB 1R6NA 4XBFA 2EIKB 1Q82W 4RQFA 3ETDA 3FB6C 3G71V 3I55V 1F4NA 5B3SC 5CBFA 2Q67A 1VQ4V 3ZRVA 2EINC 3FB5C 4FMTA 3G6EV 2Y69B 3UKMA 2OCCC 4FPPA 1QBZA 1FXHA 2QA4V 2QTOA 3ZMUA 1H8EG 4HAMA 3OMAB 4WFFA 2DWEC 3K0GA 3M99B 4WFGA 1RM1B 3A0RA 2EBOA 5CA3A 1CPYA 3LSSA 1K4DC 4GT1A 5B1NA 4TWKA 2OTLV 4MVZA 1RPRA 1OHHG 3ZN1A 1BMFG 1XL4A 2HVJC 3FKSG 3VBBA 1VQKV 2H94A 2OTJV 2EIMB 2UXNA 2YSUB 3CCUV 2XNDG 1KP2A 4R6ZA 2DW4A 3LNMB 3B8NA 3SYCA 3K03A 4BW5A 2QE7G 2P67A 3ASNC 4G28B 3E89A 4WFEA 1VQPV 1MOFA 2H8PC 3ASOB 4JTDB 1R3LC 3KG2A 3ML0A 3G4SV 5EBMC 3F5WC 4P30A 4GX0A 3R65A 2Z5UA 3W7TA 1M1KW 4RO2A 3OM3B 1J95A 1R73A 3TCUA 3ETEA 3VOUA 3OMNB 1DTOA 1M56B 4N21A 4WFHA 2DQ0A 4FIPC 4G27B 3CYOA 5J9PC 2HKOA 2AHYA 2DYRB 2EIKC 2P7TC 3AG1C 3OUSA 4ZKIA 3STZC 2WLIB 4MVQA 5CN0A 5B1AC 1DF5A 1QVGU 1JX9A 2JEUA 5E1AC 4GX5A 1MABG 1QVFU 1K8AW 1YHQV 2Y69C 4LC1A 1GK9A 2PI4A 1FXKB 3CMAV 3LDCA 4MW8A 1QCEA 5IYBO 2B5UA 4PDRA 1EZJA 4MTXA 2EINB 1QLNA 1OCCC 4XDJA 2EIMC 2ITCC 4R50A 1BHAA 1OCOC 3CCEV 3GWOA 2OT5A 3OE7G 3K08A 4JPRA 2NLJC 3RW0A 3FB7C 3E86A 1R3IC 3LDEA 3IC7A 2ATKC 1F51A 2V7QG 4JAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 V;  1K9M W;  1N8R W;  3CC2 V;  1K73 W;  1YJW V;  3CCM V;  3CMA V;  1K8A W;  1M1K W;  1YJ9 V;  1VQN V;  3CXC U;  1R73 A;  1VQO V;  4WF9 V;  2OTL V;  5DM6 V;  1W2B U;  1VQK V;  1VQ6 V;  1VQ5 V;  3CCJ V;  2OTJ V;  1M90 W;  1VQ7 V;  1Q7Y W;  3CCU V;  2D3O W;  4WCE V;  1Q81 W;  1Q82 W;  1Q86 W;  1KQS U;  3CCR V;  3G71 V;  3CCQ V;  3I55 V;  1S72 V;  1JJ2 U;  1VQ9 V;  3CCL V;  1KD1 W;  4WFA V;  1VQL V;  3CCE V;  3CCS V;  1NJI W;  1VQ4 V;  1YHQ V;  1VQP V;  4WFB V;  3G6E V;  3CC7 V;  3CPW U;  3CC4 V;  1YIJ V;  1QVG U;  2QEX V;  3CD6 V;  1YJN V;  2QA4 V;  1KC8 W;  1VQ8 V;  3OW2 U;  3CCV V;  3G4S V;  1YI2 V;  1VQM V;  3CME V;  1QVF U;  1YIT V; 
#chains in the Genus database with same CATH topology
 3OMI B;  1M9N A;  3CC2 V;  3QO8 A;  3AG4 C;  2WLJ A;  1BQZ A;  3ZRX A;  4IHJ B;  1P49 A;  2Q69 A;  3E8F A;  3X2Q C;  1T5E A;  1Q86 W;  3ASN B;  3K5L A;  1V54 C;  2BOB C;  1XNR B;  3IJ4 A;  4MT8 A;  2KKW A;  3R66 A;  2AXT Z;  1BT8 A;  3E83 A;  5D5P A;  1EN4 A;  1MG1 A;  1L1F A;  5KX5 B;  3P3P A;  1Y74 A;  5C8Y A;  3RYI B;  1SQP H;  5KHH A;  4DRX B;  4FLY A;  4JYA B;  1KYO F;  1OCR C;  1X59 A;  1R3K C;  3RVZ A;  4B3T O;  3A0B Z;  1KP3 A;  1S76 D;  2WLI A;  1KD1 W;  2ZIM A;  1NH2 B;  4JGS A;  4JYB A;  3J80 N;  3CSX A;  4JAS A;  4YY3 B;  1IXB A;  5LA6 A;  1VQM V;  1IZ3 A;  3L71 H;  4PA7 A;  4U7O A;  5GTI Z;  2UUC O;  5B5E Z;  1MSW D;  5BR8 B;  2CK3 G;  3D36 C;  1VAR A;  3ZHU A;  3UCS C;  3T1Y B;  1VQ7 V;  3GVM A;  1OCO B;  4FZ0 A;  5BXZ A;  3N2K B;  3QVN A;  3RYF B;  1WJZ A;  4K35 A;  4CH6 A;  1NU1 H;  1YIJ V;  1YDX A;  2F43 G;  1HNX B;  3PN1 A;  4IHJ A;  2GSM B;  1AP6 A;  1SF9 A;  4JI1 O;  4QJF B;  4JAU A;  5KUM A;  2W6J G;  4BIU A;  1VQ6 V;  2Y48 A;  5GTH Z;  1Q90 D;  3ZHQ A;  2CDY A;  3TGU H;  3ZX6 A;  3D8C A;  3H1H H;  5H5N A;  5KX5 A;  3VQY A;  2XT9 A;  1SA0 B;  3APO A;  3CP1 A;  4UVC A;  5EK0 A;  4JI8 B;  2ZR3 A;  3RYI A;  4J7K A;  4DRX A;  4DW1 A;  3OGC C;  4KFM A;  1S5H C;  4B7E A;  1G1X B;  1Y67 A;  4CS2 A;  1KQS U;  1R3J C;  2QSA A;  3AK3 A;  4JI4 O;  4ZHQ B;  1PL4 A;  4UFZ A;  3ZBH A;  4NXN B;  4QPK A;  4DV4 O;  5EC1 C;  2JJ1 G;  2CGN A;  1N33 O;  3CJH B;  3L72 H;  1VP7 A;  3CCM V;  1IXM A;  1WN7 A;  5CBG A;  1SET A;  2ZE5 A;  3MHS C;  3ZMS A;  2HLD G;  3N2K A;  1M90 W;  3RYF A;  1YTF B;  3JD3 A;  4UUJ C;  2BE3 A;  2QGN A;  1URF A;  2ZNI A;  4LFC B;  3CRM A;  3QTC A;  5CMU A;  3CCV V;  4CC5 A;  1IUR A;  3FFQ A;  4R8C A;  1VQN V;  4TV8 B;  1H2L A;  4DV0 B;  2ZE6 A;  4LBE C;  4DXW A;  2LQT A;  5KHG A;  1IBK O;  3ZMV A;  4DV7 B;  1Q7Y W;  3W7S A;  4PJ0 Z;  4O2B B;  1PNM A;  1I94 B;  2CH7 B;  4AHC A;  1EN5 A;  1SA0 A;  4UVB A;  5CA0 B;  4DR2 O;  1KC8 W;  4QPJ A;  3ETG A;  5JJE B;  1XI1 A;  1GRJ A;  2ZNJ A;  5IYC O;  1FD9 A;  2KSD A;  1WNS A;  4ZHQ A;  4H0L B;  4PDM A;  4YIP A;  1S72 V;  5L3F A;  1NJI W;  5IWA O;  1IDS A;  4NVP A;  3F7Y C;  3CJH A;  2C2A A;  5ITZ B;  3B2E E;  5LL6 Y;  4UCT A;  1GH6 A;  2UXC B;  4PI2 A;  3EVK A;  3RVY A;  4J9Z B;  1K7D A;  5IE9 A;  3P3N A;  3ZMT A;  3ABT A;  1SQV H;  5IYZ B;  4TV8 A;  3T4D A;  3ZRW B;  4LF9 O;  1K73 W;  1HR0 O;  3P30 A;  4PV1 B;  2X6A A;  1J5E B;  4O2B A;  4H44 B;  2CH7 A;  2WPD G;  4Z2W A;  3T4Z A;  2IM9 A;  5CA0 A;  2EUL A;  4JI2 O;  3P32 A;  2OYQ A;  4WFB V;  1ROP A;  5KHI A;  3ZHR A;  3ABL B;  4ICG A;  4J7Z A;  3CX5 F;  1HNW O;  4LFA O;  3AG2 B;  2QM7 A;  4JI0 O;  3TJT A;  4J42 A;  3ZS8 C;  1KUQ A;  2Q6A A;  1EFR G;  3L9D A;  5DEC A;  1M4U A;  3ABK B;  4LF4 B;  4DV1 O;  5B3S B;  3SJQ C;  1XNQ O;  1JMK C;  3H9V A;  4W4K A;  4CS4 A;  4E2L A;  2YID A;  4X66 B;  2EZP A;  4D7S A;  5LOV B;  2VQE B;  2QM8 A;  5ITZ A;  4X88 A;  4NB5 A;  4AIL C;  2XAG A;  3I56 V;  4A5U B;  1E79 G;  4X64 B;  4ZI7 B;  5AG2 A;  4BW9 A;  4WF9 V;  2IBZ H;  3NR7 A;  4O4L B;  2ITD C;  3I5D A;  1GMG A;  1H2M A;  2HVK C;  3ZIA G;  3CCR V;  4I5S A;  4LFB B;  2W0X A;  2ADQ B;  2DWD C;  1MA1 A;  4GKJ B;  3OR6 C;  5IYZ A;  4RQE A;  2GTA A;  4ZOL B;  3ZRW A;  2QEX V;  1THZ A;  2F1M A;  4RAI A;  4LF6 B;  1ZLZ A;  1EBO A;  1FFT B;  3SJB C;  4GKK B;  3F5T A;  3ETD A;  3FB6 C;  3G71 V;  2EJ7 A;  2Q67 A;  5CBF A;  2YC0 A;  5A2Q N;  1SQG A;  2P4K A;  3DXR B;  2Y69 B;  4JI5 B;  2OWO A;  3N2G B;  1XMO O;  2YXL A;  2OCC C;  2YS8 A;  4HAM A;  3OMA B;  4WFF A;  3K0G A;  5E79 Z;  4ABM A;  4WFG A;  3A0R A;  5CA3 A;  4UCU A;  5CA1 B;  1LR1 A;  5B1N A;  1K4D C;  2JGD B;  4J10 A;  4TWK A;  1OHH G;  1VQK V;  2H94 A;  3EXA A;  2EIM B;  2XND G;  1KP2 A;  4R6Z A;  3B8N A;  3SYC A;  3K03 A;  5LOV A;  1ZUQ A;  2P67 A;  3ASN C;  4G28 B;  4FLZ A;  2RN9 A;  1Q5O A;  3E89 A;  1VQP V;  1MOF A;  4JI3 O;  1XHX A;  4I4T B;  5LP6 B;  2Z5U A;  1SKV A;  3W7T A;  1M1K W;  4DV3 B;  3OMN B;  1DTO A;  3QG5 A;  1D5N A;  4N21 A;  4WFH A;  2YDE A;  3M8A A;  1TA8 A;  2JVD A;  4ZOL A;  2YI9 A;  1XQ8 A;  1WP7 A;  2QKA A;  2JEU A;  4GX5 A;  1QVF U;  1N32 O;  1K8A W;  4DR6 B;  3CS5 A;  2PI4 A;  1FYJ A;  3LDC A;  4BWA A;  2V4D A;  4PDR A;  4X20 B;  2EIN B;  3DXR A;  3N2G A;  1OCO C;  3K08 A;  3RFR A;  4OGQ B;  2P4V A;  2RQ6 A;  2Q0A A;  2QWR B;  5CA1 A;  2ATK C;  1F51 A;  2JGD A;  1VF5 B;  3DC6 A;  3H01 A;  5A9G A;  2A79 B;  2ZM6 O;  1AJQ A;  1FFX B;  5KA6 A;  1UFI A;  4ZBM A;  3HKD B;  2DE0 X;  5K1X A;  3G80 A;  1DGS A;  4X65 O;  2UU9 B;  1NBM G;  1JJ2 U;  5JCO C;  4AQY B;  4X62 B;  5FNV B;  5LHI A;  1S3J A;  3L73 H;  2AW9 A;  4I4T A;  1KMI Z;  2DYR C;  3THO A;  5LP6 A;  4Q20 A;  4K8X A;  2UXD O;  1KKC A;  1FXV A;  2DN9 A;  4UVA A;  2ZE8 A;  4PDV A;  3H1L H;  4JYY A;  1XOU A;  2W6I G;  4JI7 B;  1IBM B;  2ZD9 A;  3C3T A;  3E35 A;  4DYL A;  2W0F C;  1AJN A;  1S5L Z;  3AG1 B;  2FL4 A;  4JYC A;  4TV9 B;  1YVW A;  3OEH G;  3CC7 V;  2IH1 C;  4JV5 O;  4J41 A;  4H13 B;  1F23 A;  1N36 B;  4KP4 A;  1AR5 A;  4DV5 O;  2UUB O;  4WBN B;  1ZL8 B;  5LGT A;  3BAB A;  3K06 A;  2IH3 C;  4X20 A;  1JPX A;  2Q0O C;  4DR4 B;  3STL C;  4OXS A;  3SJA C;  1NVP B;  5EZY B;  3SYQ A;  1IBL B;  3U0Z A;  2WA4 A;  4PA6 A;  5H9C A;  1AJP A;  1WA8 B;  1FFX A;  1Z2G A;  4PDL A;  4FJC C;  1HDJ A;  3HKD A;  4X9Q A;  4O4H B;  2X6C A;  3K9A A;  4GZR B;  1K5S A;  2NR5 A;  3BY6 A;  2WLH A;  2RNB A;  2EX3 A;  4B3R O;  4X1I B;  3J81 N;  4DR1 B;  1EM1 A;  1PPJ H;  2P90 A;  4PA4 A;  3CCL V;  5FNV A;  4MTF A;  5B1B C;  4GYC B;  3ZHS A;  4K0K O;  3OAA G;  2M7W A;  3E22 B;  1GO3 F;  4H33 A;  1FPO A;  3K5N A;  5EYP B;  3JCZ A;  1MZE A;  2EZO A;  2B1G A;  4N23 A;  1XDC A;  1GM7 A;  4TV9 A;  2HHH B;  2JK5 C;  4U3J B;  2ZQM A;  4OX9 O;  4YJ3 B;  1GM9 A;  1N4C A;  4CH5 A;  4WBN A;  1ZL8 A;  4IYI A;  2K9P A;  1Q43 A;  1SQB H;  4LF5 B;  1JVM A;  1YCI A;  5EZY A;  2OIE A;  3K57 A;  1G6U A;  2Q8V A;  1NZ6 A;  3BEH A;  3SJC C;  1NH2 D;  4QE9 A;  4UV9 A;  3VQX A;  1QLE B;  1WA8 A;  4DUZ B;  3AK1 A;  3KCX A;  5JVD B;  1F4M A;  3EFF K;  4CBC A;  4O4H A;  2ZDI C;  3OR7 C;  4LP8 A;  3SYP A;  2O57 A;  1VQO V;  5IT9 N;  4TQD A;  4X1I A;  4CH3 A;  2IJK A;  3U10 A;  5IY5 B;  2P22 C;  5L3C A;  2D3O W;  2ZE7 A;  3BPZ A;  2F66 C;  2QWP B;  1B06 A;  3B09 A;  2LGQ A;  2LP7 A;  2R9I A;  4D6T H;  1K33 A;  3E22 A;  1PNK A;  1YI2 V;  5EYP A;  1TUE B;  1YF2 A;  1YIT V;  1OCZ B;  3U11 A;  5LMN O;  4B08 A;  3AG2 C;  2HG5 C;  4DR3 O;  3WG7 B;  4U3J A;  3E8G A;  4B3T B;  2F4V O;  2N04 A;  3GB7 C;  3ABK C;  4PI0 A;  4YJ3 A;  1M57 C;  3CCS V;  5GW7 A;  4DV2 O;  2PYJ A;  4JZG A;  3ZHT A;  5EIB C;  2JS3 A;  3O65 A;  3FYI B;  1Z5W A;  1N0J A;  1K5Q A;  5L3D A;  1PD3 A;  4BIZ A;  4J80 A;  2UUC B;  4GX2 A;  1A32 A;  1ENV A;  2AGA A;  1VQ5 V;  1BQ0 A;  1P7B A;  1CP9 A;  5J2U B;  3VQW A;  2YEV B;  4KUM A;  3JSL A;  3Q4H B;  2HP8 A;  1QR8 A;  2ZR2 A;  2WSS G;  3AG3 C;  5JVD A;  2E76 B;  4MVR A;  1EN6 A;  1S5J A;  4MVU A;  5FPO A;  3MAQ A;  5IJ0 B;  4JI1 B;  3IFX A;  4LH6 A;  4GCZ A;  4PA3 A;  2GHY A;  1BCC H;  1D2D A;  1JR9 A;  3OEE G;  4I0X B;  3IGA C;  1YTF D;  2BSK B;  4NTX A;  2DYS B;  5EBW C;  1Y4M A;  3BVO A;  2YIC A;  2BOC C;  1WAZ A;  3QO5 A;  4JI6 O;  4P2Z A;  1XL6 A;  1L0L H;  2ARH A;  2D2C B;  3HR0 A;  4JI4 B;  1G8M A;  3M7M X;  2LFS A;  4FM2 A;  2WWW A;  2JEX A;  4DV4 B;  4LNU B;  4DO2 A;  2B9Z A;  1N33 B;  1Q6U A;  4DR7 O;  4YJ2 B;  2UXX A;  1I08 A;  5J2U A;  4MW3 A;  2YEV A;  5H2F Z;  5LP6 C;  3Q4H A;  5FL7 G;  1PNL A;  3E8B A;  4LF7 O;  2BTO A;  2DQ3 A;  4XDK A;  3TET A;  4DR5 O;  3L74 H;  3N27 A;  4WFA V;  1VQL V;  2Q7E A;  2XAF A;  2RJZ A;  3CD6 V;  2XAH A;  5IJ0 A;  2PZS A;  4DV6 O;  1F7Y A;  1YJW V;  3QO7 A;  4I0X A;  4HYO A;  4OPA A;  1IBK B;  2BSK A;  1W2B U;  2KG7 B;  1R6N A;  1FJG O;  1Q82 W;  4RQF A;  3I55 V;  1F4N A;  2CUG A;  1VQ4 V;  5CB4 B;  2EIN C;  4O4J B;  1U96 A;  4DR2 B;  2XHB A;  3UKM A;  4FPP A;  1HNZ O;  1QBZ A;  1FXH A;  2DWE C;  2QTS A;  1RM1 B;  4JAA A;  5LMU O;  1CPY A;  4GT1 A;  3IAY A;  3OTO O;  4MVZ A;  1RPR A;  1XL4 A;  2HVJ C;  3OGI B;  1AP5 A;  2Z0A A;  2RMK B;  2YIB A;  3WU2 Z;  2DW4 A;  4LNU A;  4BW5 A;  5IWA B;  1W59 A;  1KB9 F;  4L8J A;  5KAF Z;  1TGO A;  1R3L C;  4EEQ A;  3ML0 A;  4YJ2 A;  4GX0 A;  3WB2 A;  3OM3 B;  3TCU A;  4EB6 B;  5LYJ B;  2CAZ C;  1X4T A;  4YIO A;  3K58 A;  5J9P C;  5EIB D;  4TUY B;  3K5M A;  2EIK C;  2P7T C;  3AG1 C;  3OUS A;  1SQF A;  4J7J A;  5CN0 A;  1QVG U;  5E1A C;  4EFB A;  1YHQ V;  4LF9 B;  1HR0 B;  2E74 B;  1O9G A;  1FXK B;  3JAL B;  1XMQ O;  2KG7 A;  3KCY A;  1VF6 A;  5IYB O;  3DSQ A;  4NTW A;  5CB4 A;  2JRI A;  4O4J A;  1JFF B;  2ITC C;  4JI2 B;  3TXQ A;  3GWO A;  1B3Q A;  2E5L O;  4X66 O;  3H1K H;  3FB7 C;  1HNW B;  4LFA B;  4JI0 B;  1Q6I A;  2FKX A;  2Q68 A;  1CEZ A;  1BL8 A;  4BR6 A;  2Z3Y A;  3IC9 A;  2L6L A;  4DV1 B;  3CB2 A;  1XNQ B;  2ADP A;  1YZB A;  2ZIN A;  1S77 D;  2ZT9 B;  3SPJ A;  5KHJ A;  3WB0 A;  2F95 B;  1UPG A;  4CS3 A;  1SER A;  4FLU A;  3B40 A;  3HPL C;  2X6B A;  1M93 A;  3MDS A;  1BS3 A;  2YI8 A;  4EB6 A;  4KHP O;  5LYJ A;  2VWK A;  3JAT B;  3SYA A;  1SZT A;  1BHB A;  4YHH O;  4TUY A;  1UJW B;  4UCV A;  3ZN0 A;  2A06 H;  2Y0I A;  5B1A B;  1BE3 H;  1I7F A;  2X7R B;  1MMM A;  1VQ8 V;  4F6E A;  1FXK A;  3JAL A;  2A3Q A;  5LHG A;  4PEL A;  3W7W A;  1H2G A;  3L75 H;  2DJV A;  1OCC B;  2UXB O;  2KB1 A;  1JFF A;  4IGG A;  1HW7 A;  4LH7 A;  3CCQ V;  3JD0 A;  2QKC A;  1N34 O;  3RN4 A;  2XOK G;  4UCO A;  1XMO B;  1H38 A;  2JDI G;  4O4I B;  1XRE A;  3D36 A;  1QLE C;  3JD2 A;  4B3M O;  4JTA B;  1FS0 G;  4Q6G A;  3T2M A;  3HKB B;  4NXM O;  5B66 Z;  2XUM A;  1EZV H;  1VEW A;  2YXH A;  4RUE A;  4FFK A;  3K5O A;  1NTK H;  4TSF G;  4UCS A;  4I9W A;  1HP8 A;  2UUA O;  4X1K A;  4JI3 B;  1QR9 A;  1LUV A;  3JAT A;  2QKS A;  1V55 B;  3A2F A;  1LUW A;  4KXR A;  3B4S A;  1SC5 B;  5L3B A;  3CRA A;  2WLL B;  1W0J G;  3SPH A;  2BCC H;  1NR7 A;  5JWP A;  3ABU A;  3RYH B;  1JOY A;  3CEI A;  3TK1 A;  5J2T B;  3QF7 A;  4X89 A;  1MZF A;  3LSU A;  1QNM A;  3CC4 V;  1N32 B;  3ZHV A;  2Q7H A;  2H3O A;  1ZWI C;  3S3W A;  4EKW A;  1DK1 A;  3UQ8 A;  3JD4 A;  3JCU Z;  3K04 A;  3CE2 A;  1CXZ B;  1AI4 A;  3CRR A;  2M6Y A;  5BZB A;  1KKD A;  1XEQ A;  2ZXW B;  4L87 A;  4O4I A;  3JSN A;  1S0V A;  1WB7 A;  1PKX A;  1AI7 A;  2PTM A;  1M5I A;  1I0H A;  2CTQ A;  3HKB A;  2ZM6 B;  2K1E A;  4DW0 A;  3T1C A;  1Q6H A;  5KA5 A;  1SES A;  1ARO P;  4X65 B;  4JI7 O;  1NVP D;  4F4L A;  1QU7 A;  3F7V C;  3JAR B;  3WFV A;  1K92 A;  3OFN G;  3ZRS A;  1YJN V;  2UXD B;  4JTC B;  5F2V O;  2LW1 A;  2DMX A;  2WLL A;  4FM0 A;  2XAJ A;  3BAA A;  3H1I H;  4X8A A;  1JA8 A;  3K79 A;  3RYH A;  2Y0P A;  4MTO A;  4LF8 O;  1R6T A;  4QE7 A;  1K34 A;  5J2T A;  2V1D A;  2R72 A;  4JV5 B;  3RBZ A;  2UUB B;  4DV5 B;  2P06 A;  2QWO B;  2QJ1 A;  3UM7 A;  2CGO A;  3SR2 C;  3CXC U;  3OTF A;  5DED A;  2PYL A;  2IW5 A;  2PGG A;  4R7C A;  4DUY O;  4B3S O;  3JAW A;  3AK2 A;  3QNE A;  3T1H O;  1N0N A;  4J9Y B;  4U3F H;  1K97 A;  4BAY A;  2YUA A;  4P9P A;  4QNH B;  1ZTE A;  4CZZ A;  2WLN A;  2AHZ A;  2NNU A;  4K8Z A;  5KAI Z;  1IVS A;  2BTQ B;  2EJR A;  3B77 A;  3ABM B;  4F6R B;  4B3R B;  1DLB A;  5LXT B;  2A9H A;  1H8H G;  5FPR A;  5KLV H;  4GX1 A;  2VQF O;  2E75 B;  3JAR A;  1R6K A;  1VF6 C;  4MVS A;  3RYC B;  4ZIB A;  4K0K B;  3GWK C;  2LO1 A;  1NT2 B;  1PM9 A;  2HJF C;  1PV0 A;  2WA3 A;  1RM1 C;  4YXW G;  3FX7 A;  3ZED A;  4PHZ A;  1GN4 A;  1L0N H;  1ZX3 A;  5LGN A;  1KU9 A;  4I7Z B;  2OCC B;  4OX9 B;  1XNR O;  1K4C C;  3JAK B;  1COW G;  2JIZ G;  5C93 A;  1N8R W;  3AG7 A;  2EIJ B;  2HFE C;  4ASU G;  1P84 F;  1DF4 A;  2N05 A;  2CTP A;  3SPG A;  3UT5 B;  2FML A;  3JYC A;  1AI5 A;  3UO3 A;  4JYA O;  2MK3 A;  2PI5 A;  2F23 A;  5LGU A;  1RP3 B;  2IU0 A;  2G38 A;  1RSO B;  1I5Y A;  2EIL B;  5HFM A;  1BZK A;  2QWQ B;  2BTQ A;  4YY3 O;  3ABL C;  4F6R A;  2N74 A;  1NKD A;  1YJ9 V;  5B1O A;  5LXT A;  2QDO A;  5GON B;  1FXK C;  5BR8 O;  1AR4 A;  1G4Y B;  4IIJ B;  4XBF A;  3BA9 A;  3T1Y O;  3HKE B;  4FLV A;  3RYC A;  5B3S C;  3ZRV A;  3FB5 C;  4JZ2 A;  4FMT A;  3G6E V;  1ZSP A;  2VS0 A;  2QTO A;  1IX9 A;  5LMN B;  1HNX O;  2ODM A;  3OT7 A;  2PUS A;  5JQG B;  4DR3 B;  3BCC H;  1BMF G;  4HNA B;  1AB3 A;  5K1P A;  2F4V B;  1FAF A;  2UXN A;  2ZCE A;  3ETQ A;  2LGW A;  3JAK A;  4CC6 A;  4DV2 B;  2QE7 G;  4WFE A;  2GDS A;  3ASO B;  4JTD B;  3KG2 A;  3G4S V;  5KHK A;  5IJ9 B;  3R65 A;  3UT5 A;  2GBO A;  1AIL A;  4RO2 A;  4JI8 O;  1J95 A;  1R73 A;  3ETE A;  3VOU A;  2RDC A;  1M56 B;  3A8T A;  4UCR A;  1R1B A;  2DQ0 A;  1GN6 A;  2HKO A;  1OJH A;  2AHY A;  2YIB D;  1RSO A;  2DYR B;  4ZKI A;  2L35 A;  3STZ C;  4FLT A;  5B1A C;  1B04 A;  4NXN O;  1MAB G;  1BSM A;  2Y69 C;  4LC1 A;  2Q4P A;  5GON A;  3APQ A;  3CMA V;  4IIJ A;  2CTW A;  2CTR A;  4MW8 A;  2JGU A;  2ZIO A;  3HKE A;  2B5U A;  2A7W A;  4MTX A;  4DK0 A;  2GUZ B;  1OCC C;  4XDJ A;  2EIM C;  4R50 A;  2ZKO A;  1BHA A;  4I55 B;  3CCE V;  4JPR A;  4LFC O;  3E86 A;  2OIG A;  1R3I C;  5JQG A;  3LDE A;  1BGY H;  3IC7 A;  1NTZ H;  4JAV A;  2AZ2 A;  4JI6 B;  4HNA A;  3JAS B;  2XTA A;  3L70 H;  1P7G A;  4DV0 O;  3SPC A;  4DV7 O;  2XAS A;  2WAM A;  1H2K A;  1Q3E A;  2IU3 A;  1W0K G;  1I94 O;  1AI6 A;  2OCH A;  3SPI A;  5IJ9 A;  4DR7 B;  2B1I A;  5JJJ B;  1V55 C;  1D5A A;  4XDL A;  3DTU B;  5JCO A;  1VF7 A;  5L3E A;  1KEC A;  4QGP A;  3RGB A;  4NKG B;  2QWN B;  4LF7 B;  3BRC A;  4DR5 B;  1WPB A;  5B1B B;  4MSW C;  4B7K A;  1GTO A;  3RT3 C;  2GV9 A;  4LCU C;  2RCV A;  5EC2 C;  2HR3 A;  4FK5 C;  4DV6 B;  1K9M W;  4U7N A;  2NN4 A;  2Y4U A;  3CRC A;  2UXC O;  2GUZ A;  1E1R G;  1FJG B;  2E3C A;  1LNQ A;  4I55 A;  1Q81 W;  3W7X A;  1GM8 A;  1K3E A;  2YIA A;  3SGI A;  1HNZ B;  2LW7 A;  2ZXW C;  5JH7 B;  3AG4 B;  1YEW A;  3JAS A;  5JJN B;  5LMU B;  2P6J A;  2Y4T A;  2AZ0 A;  3OTO B;  3E2E A;  3O9O A;  3X2Q B;  3DGE A;  4NR1 A;  5IYD O;  3B8M A;  4Z1M G;  3WB1 A;  1V54 B;  1HWY A;  5LHH A;  3LDD A;  4UV8 A;  1J5E O;  2JJ2 G;  3BA8 A;  2Q7G A;  3LUT B;  3RWR D;  3CRQ A;  1VMG A;  3SYO A;  4Z1V A;  3ZCC A;  1OCR B;  2ETN A;  1KBH A;  1US6 A;  4G2K A;  3ICX A;  3C90 A;  4LF4 O;  5CBH A;  2ILM A;  3LNN A;  2WLM A;  3K59 A;  1Q8I A;  1ORQ C;  3OW2 U;  1MNG A;  2VQE O;  3DC5 A;  4P9O A;  2FTK A;  2X0L A;  4D7T A;  3EHB B;  4FLX A;  1XMQ B;  4X64 O;  1JJO A;  5TIS Z;  3NXS A;  1JCH A;  1M57 B;  4PA9 A;  3OUF A;  3TXS A;  1RFY A;  1XBL A;  1NQT A;  2E5L B;  5JH7 A;  4LFB O;  4TOI A;  5KMG B;  4GKJ O;  2IJJ A;  4FLW A;  4IYH A;  4MS2 A;  3K9S A;  3JD1 A;  4X1K B;  1OZ0 A;  4LF6 O;  4X1Y B;  1TUB B;  1TAE A;  2FB5 A;  3J7A U;  2R9A A;  2PY5 A;  3ABM C;  3AG3 B;  3CXH F;  4GKK O;  4JF3 A;  3W7U A;  1L8D A;  3HKC B;  1Y76 B;  2ZDI A;  3BHP A;  5DN6 G;  2IJH A;  2A0L A;  5LBQ A;  2Q73 A;  4JI5 O;  3KKY A;  4FFB B;  1I5X A;  4KHP B;  4GUN A;  4I9Q A;  3E8H A;  4YHH B;  3CCJ V;  2R9R B;  3FAV B;  4WCE V;  1PL0 A;  2YXY A;  1QQC A;  3C3S A;  3FB8 C;  3MHH C;  3CPW U;  1NS1 A;  1SRY A;  1B6Q A;  1H2N A;  1NR1 A;  4TT3 G;  5KUK A;  4HZ3 A;  1OV9 A;  2JS5 A;  2EIJ C;  4H37 A;  3LSQ A;  2Q9L A;  4DV3 O;  3PJS K;  2UXB B;  4W4L A;  3ZMZ A;  1RPO A;  5EBL C;  4HBN A;  1Z5V A;  2VRZ A;  4IL6 Z;  4MVM A;  5KMG A;  5IY5 C;  1N34 B;  1O9H A;  4RUF A;  2IJI A;  4B3M B;  1FKA O;  3ZJZ A;  4ZI7 A;  1WPX A;  4O2A B;  1NI8 A;  4O4L A;  1TUB A;  4X1Y A;  2EIL C;  2GTS A;  4DR6 O;  4DK1 A;  3D3Q A;  4NXM B;  3MD0 A;  5H6Q A;  1QHT A;  1XIL A;  1YSC A;  2WLK A;  1OCZ C;  3CWB H;  4IT5 A;  2XAQ A;  4BIO A;  3HKC A;  1Y76 A;  3WG7 C;  1VQ9 V;  1GAX A;  5IDJ A;  2UUA B;  3A0H Z;  3BFR A;  1TVK B;  4FFB A;  5BY1 A;  3K3W A;  3CME V;  1P4R A;  1GKF A;  1WB8 A;  3FAV A;  3SDL A;  1GN2 A;  4RWU A;  3FD9 A;  4FM1 A;  4LWS B;  2UU9 O;  1ZAU A;  1GN3 A;  4K3A A;  5BMV B;  3JAW B;  4AI8 A;  4AQY O;  4X62 O;  1SS3 A;  2QM4 A;  4UB8 Z;  4E4E A;  4GLX A;  2LFR A;  1SQQ H;  3ASO C;  5H6R A;  3AEI A;  4UXN A;  1E1Q G;  4J11 A;  3K0D A;  1IBM O;  3FYE B;  1M56 C;  1WLE A;  3JAM N;  5L3G A;  4I50 B;  4MTG A;  2VWJ A;  2DYS C;  2DOS A;  1JQ0 A;  4O2A A;  5HFL A;  4MVO A;  2Q5Z A;  1PP9 H;  1AR1 B;  2R70 A;  2QR4 A;  1N36 O;  1Y66 A;  3D3I A;  4EFE A;  3OD4 A;  4FZ1 A;  3H1J H;  4LR3 A;  3HB3 B;  5DM6 V;  4CH4 A;  2PF4 E;  4QIW F;  2EIK B;  4DR4 O;  4NYK A;  4NTY A;  1TVK A;  3KZI Z;  4C7U A;  5D5Q A;  3VQV A;  1IBL O;  2P5O A;  3G67 A;  1YXB A;  2QA4 V;  3ZMU A;  1H8E G;  1SZX A;  3G6B A;  3M99 B;  2EBO A;  3LSS A;  2OTL V;  3ZN1 A;  3FKS G;  4OPH A;  1U97 A;  4LWS A;  3VBB A;  4LF8 B;  2OTJ V;  1XUQ A;  4KL1 A;  3CCU V;  2YSU B;  3LNM B;  1AVM A;  4DR1 O;  2HJD A;  5BMV A;  2LJ2 A;  2H8P C;  5EBM C;  1Y6X A;  3F5W C;  4P30 A;  1XHZ A;  2F93 B;  1Y74 B;  1VIB A;  4I50 A;  4FIP C;  4G27 B;  3S3X A;  2CE4 A;  4DUY B;  5C8Y B;  1H2S B;  2KQX A;  3CYO A;  4B3S B;  4PD4 F;  1MSD A;  2HHH O;  3T1H B;  1WP8 A;  2WLI B;  4MVQ A;  4TQF A;  1DF5 A;  5FLX N;  1JX9 A;  4FVM A;  4UB6 Z;  1GK9 A;  5LA6 B;  2FYU H;  2MW2 B;  4LF5 O;  3CHX A;  2VQF B;  1NTM H;  1QCE A;  1EZJ A;  1QLN A;  1SQX H;  3OE7 G;  2OT5 A;  2NLJ C;  3RW0 A;  1V9P A;  4DUZ O;  3UO2 A;  2V7Q G;  2HEP A; 
#chains in the Genus database with same CATH homology
 3H01 A;  1M9N A;  3OMI B;  1BL8 A;  2A79 B;  3QO8 A;  3AG4 C;  1AJQ A;  5KA6 A;  3CC2 V;  2WLJ A;  2Z3Y A;  4ZBM A;  3ZRX A;  2Q69 A;  3SPC A;  3E8F A;  3X2Q C;  1S77 D;  3SPJ A;  2XAS A;  1Q86 W;  3ASN B;  2WAM A;  1NBM G;  1V54 C;  1JJ2 U;  2BOB C;  4MT8 A;  2IU3 A;  1W0K G;  1SER A;  1AI6 A;  3E83 A;  5LHI A;  1S3J A;  3HPL C;  2X6B A;  2DYR C;  3SPI A;  2B1I A;  4Q20 A;  1MG1 A;  1L1F A;  1FXV A;  1CEZ A;  4UVA A;  1V55 C;  4PDV A;  4XDL A;  3SYA A;  1SZT A;  3DTU B;  1BHB A;  2W6I G;  5L3E A;  1KEC A;  1OCR C;  2ZD9 A;  3E35 A;  1UJW B;  1R3K C;  2W0F C;  3RVZ A;  3ZN0 A;  1AJN A;  3AG1 B;  1KP3 A;  1S76 D;  2WLI A;  5B1A B;  1KD1 W;  4JYC A;  1NH2 B;  5B1B B;  4JGS A;  2X7R B;  1GTO A;  4MSW C;  3OEH G;  4JYB A;  3CC7 V;  2IH1 C;  4JAS A;  4LCU C;  5EC2 C;  1VQ8 V;  2HR3 A;  4FK5 C;  1FXK A;  1F23 A;  1VQM V;  4KP4 A;  1K9M W;  5LHG A;  4PA7 A;  4U7O A;  4U7N A;  4PEL A;  1MSW D;  3W7W A;  2CK3 G;  5LGT A;  1H2G A;  3K06 A;  2IH3 C;  1E1R G;  1JPX A;  1LNQ A;  1OCC B;  2KB1 A;  3STL C;  1VQ7 V;  1OCO B;  1Q81 W;  4OXS A;  3W7X A;  1NVP B;  1GM8 A;  1K3E A;  3CCQ V;  3SYQ A;  3JD0 A;  2XOK G;  1H38 A;  2JDI G;  2ZXW C;  4PA6 A;  1YIJ V;  3JD2 A;  3D36 A;  1QLE C;  5H9C A;  2F43 G;  1AJP A;  3AG4 B;  4JTA B;  1FS0 G;  2P6J A;  4PDL A;  4FJC C;  3T2M A;  2GSM B;  3E2E A;  4QJF B;  3X2Q B;  2X6C A;  3K9A A;  4JAU A;  2W6J G;  1K5S A;  5KUM A;  4BIU A;  3DGE A;  1VQ6 V;  5IYD O;  2Y48 A;  3B8M A;  3BY6 A;  4Z1M G;  1V54 B;  2WLH A;  4RUE A;  1HWY A;  5LHH A;  3LDD A;  4TSF G;  4UV8 A;  4I9W A;  2JJ2 G;  4PA4 A;  2P90 A;  3CCL V;  3LUT B;  4MTF A;  1QR9 A;  5B1B C;  2QKS A;  1V55 B;  3OAA G;  3SYO A;  2M7W A;  3CP1 A;  4UVC A;  5EK0 A;  1GO3 F;  4H33 A;  2ZR3 A;  3ZCC A;  5L3B A;  3OGC C;  1OCR B;  3JCZ A;  4KFM A;  1S5H C;  2EZO A;  2WLL B;  1W0J G;  2B1G A;  4N23 A;  3SPH A;  4G2K A;  1GM7 A;  1NR7 A;  1KQS U;  1R3J C;  2JK5 C;  5CBH A;  3ABU A;  2WLM A;  1JOY A;  2ZQM A;  3TK1 A;  4X89 A;  4QPK A;  1ORQ C;  1GM9 A;  3CC4 V;  5EC1 C;  2JJ1 G;  3OW2 U;  4P9O A;  2FTK A;  2X0L A;  1ZWI C;  3EHB B;  4EKW A;  3CCM V;  1IXM A;  3NXS A;  5CBG A;  1SET A;  3MHS C;  1JCH A;  3ZMS A;  3JD4 A;  3K04 A;  2HLD G;  1JVM A;  1M57 B;  1M90 W;  4PA9 A;  1AI4 A;  3OUF A;  1YTF B;  3JD3 A;  4UUJ C;  3BEH A;  5BZB A;  1KKD A;  1NH2 D;  1NQT A;  2ZXW B;  4L87 A;  4QE9 A;  4UV9 A;  1QLE B;  1S0V A;  1PKX A;  5CMU A;  1AI7 A;  2IJJ A;  4MS2 A;  1F4M A;  3CCV V;  2K1E A;  3EFF K;  4CBC A;  3JD1 A;  1OZ0 A;  3T1C A;  2ZDI C;  3OR7 C;  4LP8 A;  3SYP A;  5KA5 A;  1SES A;  4R8C A;  1VQN V;  1ARO P;  1VQO V;  4LBE C;  4DXW A;  2IJK A;  5IY5 B;  3ZMV A;  3ABM C;  1Q7Y W;  3AG3 B;  5L3C A;  3W7S A;  2D3O W;  1NVP D;  4F4L A;  4JF3 A;  3W7U A;  1PNM A;  2ZDI A;  5DN6 G;  2IJH A;  2LP7 A;  3F7V C;  2A0L A;  3WFV A;  4UVB A;  5LBQ A;  2R9I A;  1K92 A;  3OFN G;  1K33 A;  4QPJ A;  1PNK A;  3ZRS A;  4JTC B;  1YJN V;  1YI2 V;  1KC8 W;  1TUE B;  1I5X A;  3ETG A;  1OCZ B;  1YIT V;  2WLL A;  2XAJ A;  3AG2 C;  3E8H A;  2HG5 C;  3WG7 B;  5IYC O;  4X8A A;  3CCJ V;  3K79 A;  4MTO A;  3E8G A;  4PDM A;  2R9R B;  4QE7 A;  4WCE V;  3GB7 C;  1PL0 A;  3ABK C;  1K34 A;  1S72 V;  5L3F A;  1M57 C;  3CCS V;  5GW7 A;  3FB8 C;  1NJI W;  3MHH C;  2V1D A;  3RBZ A;  3CPW U;  3F7Y C;  3FYI B;  1SRY A;  1B6Q A;  1K5Q A;  5L3D A;  1PD3 A;  1NR1 A;  4BIZ A;  2C2A A;  3UM7 A;  4TT3 G;  5KUK A;  4HZ3 A;  4GX2 A;  3CXC U;  2EIJ C;  4H37 A;  1ENV A;  3LSQ A;  2IW5 A;  1VQ5 V;  1P7B A;  3PJS K;  1CP9 A;  4R7C A;  3ZMZ A;  1RPO A;  2YEV B;  5EBL C;  3RVY A;  4J9Z B;  4KUM A;  4MVM A;  5IY5 C;  1QR8 A;  2ZR2 A;  1K7D A;  2WSS G;  3AG3 C;  3QNE A;  4RUF A;  2IJI A;  4J9Y B;  1K97 A;  4BAY A;  3ZMT A;  3ZJZ A;  3ABT A;  4P9P A;  4MVR A;  4QNH B;  1WPX A;  4CZZ A;  4MVU A;  2WLN A;  2AHZ A;  2NNU A;  3T4D A;  3ZRW B;  2EIL C;  1K73 W;  3IFX A;  3MD0 A;  5H6Q A;  4GCZ A;  1YSC A;  4PA3 A;  2WLK A;  3P30 A;  2EJR A;  1OCZ C;  2GHY A;  3ABM B;  3B77 A;  2X6A A;  3OEE G;  2XAQ A;  3IGA C;  1DLB A;  1YTF D;  2A9H A;  1H8H G;  4GX1 A;  3WG7 C;  2DYS B;  2WPD G;  3T4Z A;  1VQ9 V;  1R6K A;  5EBW C;  5IDJ A;  4MVS A;  1Y4M A;  3P32 A;  4WFB V;  1ROP A;  3ABL B;  3K3W A;  3CME V;  3AG2 B;  2QM7 A;  2BOC C;  1P4R A;  3QO5 A;  1GKF A;  2HJF C;  2Q6A A;  1RM1 C;  1EFR G;  4YXW G;  4P2Z A;  1XL6 A;  3ABK B;  5B3S B;  3SJQ C;  1G8M A;  5LGN A;  2LFS A;  2WWW A;  4E2L A;  2OCC B;  2JEX A;  1K4C C;  2EZP A;  1COW G;  2JIZ G;  5C93 A;  4DO2 A;  2QM8 A;  4X88 A;  2Q68 A;  2LFR A;  1N8R W;  3ASO C;  2XAG A;  2EIJ B;  3AEI A;  1E79 G;  2HFE C;  4UXN A;  5H6R A;  4ASU G;  3I56 V;  1E1Q G;  2UXX A;  4WF9 V;  1DF4 A;  2ITD C;  4MW3 A;  2YEV A;  3SPG A;  3JYC A;  1AI5 A;  3K0D A;  5FL7 G;  1GMG A;  1PNL A;  2HVK C;  3FYE B;  1M56 C;  1WLE A;  3E8B A;  3ZIA G;  5L3G A;  3CCR V;  2DQ3 A;  4I5S A;  2MK3 A;  4XDK A;  3TET A;  4WFA V;  1VQL V;  2PI5 A;  4MTG A;  2DWD C;  5LGU A;  2DYS C;  2XAF A;  1JQ0 A;  2IU0 A;  3OR6 C;  4RQE A;  5HFL A;  3ZRW A;  2QEX V;  1I5Y A;  1THZ A;  2EIL B;  2XAH A;  4MVO A;  5HFM A;  3CD6 V;  1AR1 B;  4RAI A;  3ABL C;  1Y66 A;  3D3I A;  3QO7 A;  1YJW V;  1NKD A;  4HYO A;  1YJ9 V;  5B1O A;  5DM6 V;  3HB3 B;  1EBO A;  1FFT B;  1W2B U;  1FXK C;  4QIW F;  1G4Y B;  1R6N A;  4XBF A;  2EIK B;  1Q82 W;  4RQF A;  3ETD A;  3FB6 C;  3G71 V;  3I55 V;  1F4N A;  5B3S C;  5CBF A;  2Q67 A;  1VQ4 V;  3ZRV A;  2EIN C;  3FB5 C;  4FMT A;  3G6E V;  2Y69 B;  3UKM A;  2OCC C;  4FPP A;  1QBZ A;  1FXH A;  2QA4 V;  2QTO A;  3ZMU A;  1H8E G;  4HAM A;  3OMA B;  4WFF A;  2DWE C;  3K0G A;  3M99 B;  4WFG A;  1RM1 B;  3A0R A;  2EBO A;  5CA3 A;  1CPY A;  3LSS A;  1K4D C;  4GT1 A;  5B1N A;  4TWK A;  2OTL V;  4MVZ A;  1RPR A;  1OHH G;  3ZN1 A;  1BMF G;  1XL4 A;  2HVJ C;  3FKS G;  3VBB A;  1VQK V;  2H94 A;  2OTJ V;  2EIM B;  2UXN A;  2YSU B;  3CCU V;  2XND G;  1KP2 A;  4R6Z A;  2DW4 A;  3LNM B;  3B8N A;  3SYC A;  3K03 A;  4BW5 A;  2QE7 G;  2P67 A;  3ASN C;  4G28 B;  3E89 A;  4WFE A;  1VQP V;  1MOF A;  2H8P C;  3ASO B;  4JTD B;  1R3L C;  3KG2 A;  3ML0 A;  3G4S V;  5EBM C;  3F5W C;  4P30 A;  4GX0 A;  3R65 A;  2Z5U A;  3W7T A;  1M1K W;  4RO2 A;  3OM3 B;  1J95 A;  1R73 A;  3TCU A;  3ETE A;  3VOU A;  3OMN B;  1DTO A;  1M56 B;  4N21 A;  4WFH A;  2DQ0 A;  4FIP C;  4G27 B;  3CYO A;  5J9P C;  2HKO A;  2AHY A;  2DYR B;  2EIK C;  2P7T C;  3AG1 C;  3OUS A;  4ZKI A;  3STZ C;  2WLI B;  4MVQ A;  5CN0 A;  5B1A C;  1DF5 A;  1QVG U;  1JX9 A;  2JEU A;  5E1A C;  4GX5 A;  1MAB G;  1QVF U;  1K8A W;  1YHQ V;  2Y69 C;  4LC1 A;  1GK9 A;  2PI4 A;  1FXK B;  3CMA V;  3LDC A;  4MW8 A;  1QCE A;  5IYB O;  2B5U A;  4PDR A;  1EZJ A;  4MTX A;  2EIN B;  1QLN A;  1OCC C;  4XDJ A;  2EIM C;  2ITC C;  4R50 A;  1BHA A;  1OCO C;  3CCE V;  3GWO A;  2OT5 A;  3OE7 G;  3K08 A;  4JPR A;  2NLJ C;  3RW0 A;  3FB7 C;  3E86 A;  1R3I C;  3LDE A;  3IC7 A;  2ATK C;  1F51 A;  2V7Q G;  4JAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...