2QWNB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-386aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi state
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
MDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
total genus 30
structure length 94
sequence length 94
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwnB00
2QWNB 2CTPA 1BQZA 4IT5A 2QSAA 2LGWA 2DMXA 2QWQB 2GUZB 1FAFA 2QWOB 1NZ6A 2LO1A 3AG7A 1WJZA 2QWPB 1BQ0A 2Y4TA 2KQXA 2YS8A 2M6YA 2N05A 2OCHA 3UO3A 2GUZA 2EJ7A 3BVOA 1GH6A 2CTWA 2Y4UA 2N04A 4J7ZA 2PF4E 3APOA 2YUAA 3UCSC 1XBLA 1IURA 1HDJA 2QWRB 2L6LA 2CTRA 1FPOA 4RWUA 1N4CA 4J80A 3UO2A 3APQA 2DN9A 2CTQA 2CUGA
chains in the Genus database with same CATH superfamily
5FNVB 1NU1H 4JGSA 5KHKA 4MS2A 3AK1A 4J7JA 4DR5B 3ABLB 1PL4A 2LO1A 3ZMSA 1ZX3A 4K35A 4RQFA 4DR4O 4NYKA 3KKYA 2E75B 4H44B 3A0BZ 4O4JB 2XAQA 5CA0B 3BPZA 2UXBO 2YSUB 1CPYA 1MSDA 2KKWA 2R9AA 5LP6A 4FK5C 1RFYA 3ABTA 2CAZC 3K06A 1L8DA 2PY5A 3BEHA 3E22A 3ZEDA 2GDSA 5LA6A 5KX5B 2UUBB 4IYIA 1US6A 2XAGA 2Y4TA 1TVKB 1I94B 4DV1B 4FVMA 3N2GB 2D2CB 4PA7A 3Q4HB 5KMGB 4CS3A 2WA4A 4JTCB 3OFNG 2CUGA 4ZKIA 2QKSA 4GKKO 4CH3A 4JTDB 1KKCA 3F7VC 4QPKA 1DF4A 1NR7A 4FFBB 3GVMA 3VQYA 4UVAA 3JARA 2JGDA 1XDCA 5IDJA 4YY3O 2H3OA 1VF6A 1VIBA 3D8CA 5L3FA 3CHXA 4TV9A 3OUSA 1KU9A 2OTLV 1SC5B 1VQ7V 1YI2V 1PM9A 2GHYA 4UB8Z 2ZE7A 1FJGO 4GX1A 1XL4A 3WU2Z 3NXSA 4DR7B 4X8AA 2JS5A 5CN0A 1M93A 3ZMZA 4CBCA 2XAJA 4JZGA 2ZQMA 1NVPB 1R3LC 1Q81W 3P3NA 1BMFG 5DECA 4I0XB 3ZCCA 2KG7B 2NLJC 2MW2B 2ZINA 4J7ZA 1UPGA 1XILA 2Q67A 4X64O 3JASB 3C3SA 4K3AA 4WBNB 1B04A 1IX9A 1AP5A 4LWSB 4G27B 1SZXA 3J7AU 2YEVA 4AHCA 4I9QA 4R7CA 5CA3A 2ZR2A 4OGQB 1OZ0A 1GH6A 4C7UA 3ZHQA 4JI3B 3LUTB 2N04A 2WLIB 2Q73A 3TXQA 4J9YB 4ZOLB 1S5LZ 4DUZB 5A9GA 4D6TH 1NVPD 2HEPA 3CMAV 3MHHC 2LGQA 1HNWB 4U3FH 1M56B 4NKGB 3JD0A 5EYPA 3JAWB 4TQDA 2Q8VA 5FLXN 5KAIZ 2A79B 2P5OA 4X1YA 4LNUA 3APOA 4AQYO 4G28B 3UKMA 3G71V 1V54C 2DW4A 1H2GA 3KG2A 3SPCA 2LFRA 3VOUA 5IJ0A 2UUCB 1PNMA 2ZDIA 5LP6B 2Q68A 1YJWV 5BR8O 1R6KA 1SQFA 2PYLA 1NTMH 4PA4A 1AI4A 4LF8B 4I50B 4P9PA 3F5WC 1H38A 5LA6B 1I5XA 3E35A 2ILMA 2X6AA 1M9NA 1R1BA 2Y69B 1KB9F 3G6EV 4DV5O 5LMUB 3W7SA 1BQZA 1N0NA 1JQ0A 1RPRA 5B1BC 1PL0A 3CCQV 1XQ8A 1J5EO 4JI4B 3M7MX 3BVOA 3ABKC 1RSOA 1HWYA 1YITV 2ETNA 1QLEC 4OX9O 4TOIA 4K8XA 2Y48A 4X1KB 3WG7C 4DV4B 1VF7A 1BS3A 4WFBV 4X20A 1DK1A 2JGDB 2QEXV 3R66A 4JYAO 1WP7A 5CA1A 2EIJB 4JI7B 4PDLA 1GM8A 2NNUA 4TV9B 2HFEC 1HR0O 3PN1A 3BY6A 1XMQB 2CDYA 2JJ1G 1JMKC 3ZBHA 3T1YO 4DXWA 4FLXA 1X59A 3CCUV 2DYRC 1GK9A 3ASNC 3OR7C 4JI2B 1F4MA 4HAMA 4BIUA 3A0RA 1KUQA 3SJCC 4BIOA 2H94A 5AG2A 4UV9A 1BSMA 2HVJC 3JD2A 4FM0A 4WCEV 2Q5ZA 3ZHUA 3BAAA 2P4VA 4MSWC 4H0LB 3P32A 4MT8A 1R3KC 1WA8A 4X66O 5KAFZ 4DR2O 2GBOA 5FPRA 3G80A 4L87A 2QGNA 3APQA 3ETGA 4DR3O 3OT7A 4X62O 2EINB 5JJJB 3ZMVA 5JJNB 2MK3A 2GV9A 3IGAC 1H2LA 2QSAA 4DR1B 1YIJV 3JCUZ 1Q5OA 2UU9O 1I7FA 3CYOA 3JD3A 5KA6A 2QA4V 3IFXA 5EYPB 3DXRA 4HYOA 3OEEG 2VS0A 5EBWC 4MTFA 2X6BA 5L3CA 2Q6AA 4ZHQA 4X65O 4LH6A 3H1LH 1Y74A 4J42A 1VQ8V 3TGUH 2F43G 2E3CA 3STZC 4KXRA 5D5QA 3ZRSA 5L3GA 4AILC 4MVSA 4DV7O 2HJFC 5IYZB 4JV5O 4DV3O 1B6QA 5C8YA 4YJ2B 3H9VA 1XNQB 1N32B 2A9HA 4GX0A 5KLVH 3ABLC 3ZIAG 2VWJA 1QVFU 1SESA 2YXYA 1GN3A 2Q9LA 4B3SO 1RPOA 3CP1A 4KL1A 1VQ5V 2VQEB 4DV6B 3FX7A 2CTQA 1V55B 2JK5C 3DC6A 1N8RW 2K9PA 5LGNA 5C93A 4G2KA 2A0LA 4LF9B 1I08A 2N05A 1YCIA 1RSOB 2IJIA 1BHAA 3RYIA 1N36B 5GONA 3ETEA 1SQQH 1SF9A 4LFAB 1FPOA 3N2KB 4RUEA 1IBKO 4X20B 4OPHA 3THOA 5CA1B 1KP2A 5LHHA 1G6UA 5A2QN 2QWPB 4GZRB 2JDIG 2ODMA 2EJ7A 3K9SA 4UCTA 3RYCA 1EZJA 4LF5O 1K8AW 4ASUG 4W4LA 1WAZA 3ASOC 2ZKOA 1O9HA 1PNLA 3U10A 1M1KW 2V1DA 1D5AA 2LQTA 3QTCA 1M4UA 3WB1A 4OPAA 4LFCB 4NB5A 1Q7YW 3DSQA 1XMOO 3RVZA 2E76B 4UCUA 1H8EG 2EIKB 1H2KA 3SJBC 4EFBA 4WFEA 3M99B 4MW8A 2PZSA 1SERA 4U3JA 2K1EA 4Z1VA 3CCJV 3ZRXA 1WA8B 4UVBA 4IIJA 4U7OA 1P7BA 3SYCA 2ZIMA 3SJAC 5J2TA 2Y4UA 3JD1A 4GKJB 1HDJA 3ABMC 3E8GA 2A3QA 1AP6A 1BGYH 4CH5A 3OMNB 1OCRB 1Q6IA 1K33A 3KZIZ 2CTPA 1FXKA 3D3IA 4K0KO 3AG3B 1SRYA 3CB2A 1SQPH 2YDEA 5LMNB 1W59A 2WLLA 4IHJA 4PI2A 3JALA 3CEIA 3HKEA 3OE7G 3DXRB 4ABMA 4DV0O 1AR5A 4LF6O 4ZBMA 4ZHQB 5H6QA 1Y74B 3CD6V 3STLC 5LYJB 4QE9A 2UUAB 1VQ6V 1BE3H 1VQ9V 3ZX6A 3AK2A 3SPJA 2JEUA 4XDJA 5C8YB 2JS3A 1NI8A 1XHXA 4UFZA 3SYOA 4YHHO 2F4VB 5EIBC 4LP8A 5CBHA 1HNZO 1XHZA 4DUYO 1AR4A 5KHHA 3CCMV 3MDSA 1K5QA 1JFFA 2IJKA 3W7XA 2ZR3A 2QJ1A 4LF7O 4GYCB 2LJ2A 3D36C 2UXBB 2EILB 1W2BU 2Q7HA 4J9ZB 1XOUA 1NKDA 1AJPA 1M57C 2Y69C 3WB0A 4DR5O 4F6RA 5ITZA 3F5TA 5H9CA 4PA9A 1YTFB 4X88A 2RCVA 2FTKA 4UCSA 3ZHTA 4KHPB 4CZZA 3RYIB 4JI5B 2QKAA 4E2LA 5GONB 3K03A 1H2MA 3VQXA 4FLYA 1VQLV 2HKOA 4TWKA 2KSDA 1AI7A 3QNEA 4HZ3A 5F2VO 4FLVA 5IT9N 2WWWA 1PKXA 3H1JH 2UUBO 3B4SA 2DE0X 3CCEV 4YIOA 4NXNB 1CP9A 1TUBA 1I94O 4JYBA 1K3EA 4DV1O 3K0DA 4GX5A 3UT5A 1PPJH 4QIWF 2YIDA 1F23A 2B5UA 4PA6A 5LGUA 2N74A 3AG4C 3DC5A 4YY3B 1OCOC 1YTFD 1ORQC 4IT5A 1E1QG 2LGWA 1B3QA 5H5NA 2ADQB 3AG1C 2WLMA 4JYYA 1NBMG 1M5IA 2WLHA 2YXLA 2DOSA 2OCCB 3JD4A 3CCLV 3BCCH 5DM6V 2IH3C 3HB3B 4WF9V 3OD4A 1SKVA 2F93B 2QM8A 4U3JB 5L3BA 2BSKA 2IJJA 5L3DA 5TISZ 3EVKA 1IDSA 2HJDA 3RYFA 5BMVB 2YIAA 4IIJB 3RYHA 2NN4A 5J2TB 4TSFG 3LNNA 2GUZA 3OTOB 1AJQA 2ZIOA 2IU3A 4B3TB 4DR7O 1O9GA 1SA0A 2YI8A 1TUEB 1KD1W 4JI1B 5B3SB 4JI8B 2EZPA 3AG2B 4DK0A 3JSLA 1R3JC 3K58A 1FXKB 5LOVB 1CXZB 4QE7A 3CRRA 1GN6A 4YJ3A 3RBZA 4PDRA 1AR1B 2WLLB 2OCHA 3JALB 3HKEB 4XDLA 1JA8A 3CWBH 4P9OA 3WFVA 2GTAA 1PV0A 2Y0IA 4JAVA 4F6EA 4KFMA 3CMEV 1SS3A 3LDDA 1QBZA 5LL6Y 3GWOA 1JJOA 1S72V 2F66C 2LW7A 2FB5A 2CH7A 2ADPA 1QU7A 3B40A 5KUMA 5E79Z 2Q4PA 1AVMA 4FLWA 4FM2A 1JVMA 4JI3O 2FL4A 1FYJA 4NVPA 1BQ0A 2RN9A 2W6JG 3UO3A 3E8BA 4DUZO 4LFBB 4UCOA 1VEWA 1K92A 4CH4A 2WLKA 4MTGA 1HNWO 1K9MW 2QWNB 4BW9A 4W4KA 4JYCA 2QWQB 3TCUA 1Z5VA 1Y76A 3CE2A 3K3WA 4MVZA 4B7EA 1RM1C 3L71H 3CXHF 4X1IA 1XBLA 1NJIW 4O4LA 2NR5A 4BIZA 4HNAA 5ITZB 2ZNJA 3E22B 1V55C 2UXCB 5IJ9A 4Q6GA 4FMTA 5B1AC 2UUCO 2EULA 2WLNA 4O4IA 2QWOB 5JCOC 1Q43A 2F1MA 4RUFA 1NTKH 1N33B 1ZL8A 4LF8O 3M8AA 1GN2A 1JCHA 2EIMB 4NXMB 1ZLZA 1OCCC 2ZM6B 1FXVA 3K04A 2IW5A 3IAYA 1GAXA 5LMUO 4BWAA 2F95B 2IM9A 2QE7G 1TUBB 3I56V 4JI4O 3UT5B 3SPGA 5JWPA 2P67A 3BABA 2P06A 3JARB 2BOBC 3SYPA 1VQMV 3RN4A 2CGNA 4FZ0A 5JJEB 1TA8A 3K0GA 2V7QG 2BTOA 2W0XA 4DV4O 3B77A 4HBNA 4TUYA 3CCVV 3ETQA 1Y67A 5BZBA 1GN4A 4JI6B 3T2MA 4JI7O 1GTOA 1R6NA 5DN6G 5IWAB 3UM7A 4DRXA 5EBLC 2DJVA 2JGUA 2JIZG 2XAHA 1XMQO 2CTWA 2PTMA 2RDCA 1TGOA 3K9AA 2XNDG 1OV9A 5E1AC 2BSKB 3B09A 2IJHA 3CRQA 3I5DA 3QO8A 2FKXA 3RYFB 1DGSA 3RYHB 2YI9A 5LGTA 3VQVA 2P7TC 3J81N 1AI6A 2GUZB 4U7NA 1WLEA 4JI2O 4JAAA 3T1HB 5CB4A 3K57A 1F51A 1EZVH 1KECA 3ZHVA 1YJNV 1HNXB 1S5HC 3L74H 2AGAA 4R8CA 1R6TA 1ZWIC 2YEVB 1NQTA 2RNBA 3FAVA 3K5OA 3ZN0A 1IBMB 3IC7A 3AG3C 3ZJZA 4PDMA 1E1RG 4I5SA 4QGPA 2WLJA 3ZHRA 4FZ1A 5J2UA 3B8NA 2M7WA 1BZKA 4X89A 1U96A 1ENVA 3CRAA 4K8ZA 2CH7B 1UFIA 3QG5A 2QDOA 1NH2D 4PDVA 4GLXA 4DR1O 3SJQC 1HW7A 2IH1C 2UXXA 4LF4B 3SYQA 4B3MB 3HKDA 3JATA 4WFFA 4X1YB 3TK1A 3DGEA 5CMUA 4LNUB 4TV8A 5IYBO 2HR3A 1KYOF 1N34B 1GMGA 2ARHA 4R50A 1PD3A 2YUAA 1QHTA 3ZS8C 3JYCA 4JF3A 1XNRB 3GWKC 3MHSC 2ZE6A 1Y76B 1Y4MA 5IJ0B 4A5UB 4P2ZA 4NTWA 1IXBA 1ZTEA 3F7YC 1S0VA 3ABUA 1K7DA 4X1IB 2Z5UA 4O4LB 2P6JA 3FB6C 3A2FA 1VMGA 1COWG 3R65A 4HNAB 3G4SV 1IBLB 2VQFB 5IJ9B 1XNQO 3UO2A 1VP7A 2Q0OC 2HHHB 1N32O 1V54B 2OTJV 1WB7A 1WP8A 2QR4A 4IYHA 4O4IB 2PI5A 1P49A 2EX3A 1ZL8B 3UQ8A 4J11A 1L0NH 2M6YA 2X7RB 2O57A 3WB2A 3C90A 4EB6A 3HKBA 2VQEO 4DV6O 3OEHG 1DF5A 4O2AA 2KB1A 1J95A 4GCZA 4WFGA 4ZIBA 3FYEB 3JCZA 1WN7A 4LF9O 2ZCEA 5B1BB 3FFQA 1Q6UA 1YEWA 1N36O 1P7GA 1MG1A 2XT9A 4JASA 4LFAO 4JAUA 3UCSC 1YHQV 3ABKB 2QTOA 2L35A 1QLEB 1Z2GA 2OWOA 5D5PA 3N2GA 1M90W 1OCZB 3Q4HA 4FJCC 1OHHG 3WG7B 3OTFA 3FB8C 3RGBA 4DRXB 2ITCC 3FYIB 1LR1A 3CJHA 4WFHA 3BFRA 3RW0A 4FFBA 4FLUA 3ZMUA 2H8PC 2OCCC 1GKFA 1AROP 2JJ2G 2Y0PA 3I55V 5EZYA 2ZT9B 3B2EE 3RWRD 2AXTZ 1Y66A 2AZ0A 4UV8A 5CB4B 3ZN1A 4LFCO 3TJTA 3JAKA 1Y6XA 3QF7A 2IBZH 5EBMC 3ASNB 1W0JG 2PGGA 4MTXA 1AILA 4TT3G 1NS1A 5EC2C 3ZRWA 1T5EA 3FAVB 1FD9A 4EKWA 1JJ2U 1KBHA 1FXKC 2DQ0A 1OJHA 2UXNA 3RVYA 1R73A 3W7TA 5J2UB 1K5SA 1FAFA 4PA3A 1FKAO 4GKJO 2UXDB 5KUKA 1B06A 1P4RA 2ZE5A 2JVDA 4I0XA 1P84F 4DO2A 1URFA 5EC1C 3OUFA 3ZMTA 1EN6A 3FKSG 3OR6C 4MVQA 1GO3F 1M56C 2E5LB 4DV2B 2XASA 4DV0B 4B3RB 3H01A 1QQCA 2ITDC 4DR6B 1MMMA 3HKDB 3JATB 2AHYA 1MZEA 2AZ2A 3OGIB 4TV8B 5LMNO 2R9RB 5J9PC 1G8MA 4JI0B 3QO7A 5KHIA 2WPDG 3E83A 3BA9A 1VQNV 1XEQA 5GTIZ 3LSUA 1F4NA 1SZTA 3B8MA 4NR1A 4ZOLA 1U97A 4DW0A 1EBOA 2UUAO 1QNMA 2Q7GA 3K59A 1VARA 3ML0A 3P30A 3EHBB 4IL6Z 1NZ6A 5K1PA 1IXMA 5B1NA 5LP6C 1ZAUA 2PUSA 1I5YA 2V4DA 2Z0AA 4DR4B 2F4VO 1KMIZ 1BCCH 5DEDA 3SPHA 1W0KG 4PD4F 1RP3B 2B1IA 1KP3A 4O2BA 4EB6B 1QCEA 2ATKC 3HKBB 4O2AB 2EIMC 3OAAG 3K5MA 1YJ9V 3LSSA 1FXHA 2WSSG 2LW1A 3T1CA 4I50A 4OXSA 4NTXA 3D36A 3L70H 3CPWU 1HP8A 4KHPO 3CRCA 4FLTA 1WPXA 4LC1A 5CBGA 4JI5O 1VQKV 1MSWD 4GKKB 2EIJC 1VF6C 2DWDC 3CSXA 3RYCB 2QM7A 4RAIA 1TAEA 5FPOA 2ZE8A 1K34A 4UXNA 3KCXA 4NXNO 3CJHB 4X1KA 1LUWA 4DYLA 4H33A 1VF5B 4J10A 1IZ3A 3LNMB 2BCCH 3JAMN 5EZYB 1BT8A 2OYQA 2EZOA 3O9OA 4EEQA 1FJGB 2ZXWB 4YIPA 5IY5B 1MNGA 3ASOB 3ETDA 1LUVA 3OMIB 1FFXA 3JAKB 4TQFA 1SQGA 2R9IA 3A8TA 4J41A 4FM1A 3CC4V 3ZRWB 4CS2A 4UUJC 3KCYA 4X64B 4PHZA 1SQVH 2DN9A 1GRJA 2EINC 1Q8IA 3AK3A 3E89A 3SDLA 1D2DA 3OTOO 1Q6HA 1ZSPA 4B3TO 4J7KA 2ZNIA 2FMLA 1H8HG 4IHJB 4JI1O 4JI8O 5JH7A 4Z2WA 3E8FA 4B7KA 5HFLA 5H6RA 2DYSB 4I7ZB 3ABMB 5HFMA 1S3JA 2IU0A 1JR9A 1VQPV 1KC8W 1ZUQA 3X2QB 4I55A 3QVNA 3RT3C 1G4YB 1IURA 4PI0A 1QLNA 3CC2V 1S76D 4IGGA 1AI5A 4AQYB 2DQ3A 2A06H 3S3WA 3T4ZA 4H37A 3CXCU 2ZDIC 2D3OW 2RQ6A 1WJZA 4RO2A 4LFBO 1JFFB 1PP9H 5FL7G 2OIEA 4JPRA 2CK3G 2YIBA 1H2SB 1SETA 4ZI7A 3EFFK 1GM9A 5BR8B 3K5LA 2BE3A 5IYZA 4F6RB 4O2BB 1S77D 2Q0AA 4YJ2A 1QVGU 1ROPA 3RFRA 2QTSA 1YXBA 2WAMA 4CS4A 4DV5B 2XOKG 1H2NA 4MVMA 1J5EB 3T4DA 3FD9A 1FS0G 4CC6A 2UXCO 1XREA 1N4CA 1XI1A 4MVOA 4I4TA 3SYAA 4OX9B 1M57B 4MTOA 1NR1A 1N0JA 2RMKB 3CRMA 1L1FA 1Q86W 1N33O 4H13B 2DMXA 4LR3A 3HKCA 2RJZA 2C2AA 4NXMO 2ZM6O 1S5JA 5JCOA 1UJWB 3E2EA 4JYAB 1MABG 1YDXA 1XL6A 4X9QA 5EIBD 3K79A 1OCZC 3A0HZ 4XDKA 3EXAA 2OIGA 1HR0B 4I9WA 1LNQA 5JQGA 4MVRA 1VQOV 3N2KA 5LHIA 3HR0A 3T1YB 4GUNA 1YZBA 4DW1A 2R70A 2G38A 2X0LA 4DK1A 3AG4B 5BXZA 1K4DC 1OCOB 4O4HA 4JI6O 2EIKC 3K08A 1FFXB 5IWAO 4GX2A 2W6IG 3LDCA 1VQ4V 3G67A 1D5NA 4N23A 3AG1B 3BHPA 3H1HH 2JEXA 1NH2B 1SA0B 3U11A 2EJRA 4RQEA 3MD0A 1YSCA 5KHGA 1YVWA 4X66B 1K73W 1OCRC 4DR2B 2XUMA 4P30A 1WNSA 4QNHB 2VRZA 1EFRG 1QR9A 2QM4A 4LCUC 2JRIA 4YJ3B 4BW5A 3CC7V 4DR3B 3T1HO 3H1KH 4X62B 3CCRV 4D7SA 1JOYA 5JH7B 1Q82W 2CGOA 2W0FC 1HNXO 1E79G 2BOCC 3BRCA 2LFSA 2XTAA 3U0ZA 3SPIA 2UU9B 3CCSV 5IYCO 3OMAB 1KKDA 3LDEA 1IBMO 1X4TA 5GW7A 1V9PA 2Z3YA 3PJSK 3AG7A 4I55B 2YS8A 1THZA 1FFTB 2P90A 4X65B 5B66Z 4PV1B 2P4KA 4N21A 2Q69A 2BTQA 2CTRA 4RWUA 4J80A 2GTSA 1BHBA 4DV7B 4JV5B 3L72H 4DV3B 4LF4O 3CS5A 1WPBA 4PJ0Z 4B3MO 5IE9A 5LXTA 4FFKA 3SGIA 2X6CA 3O65A 1N34O 2XAFA 5LYJA 5JVDA 1QR8A 4ZI7B 4BAYA 2HP8A 5BY1A 1XNRO 1JX9A 4UCVA 1EN4A 4CH6A 1K97A 2AHZA 1AJNA 4CC5A 2EILC 4B3SB 1Q90D 2OT5A 1I0HA 3J80N 3L9DA 1DLBA 2EBOA 5FNVA 1EN5A 4QJFB 4JZ2A 5LBQA 3E8HA 4YXWG 2KQXA 3L73H 1RM1B 1IBLO 4UB6Z 2VQFO 3VQWA 4F4LA 2HHHO 3BA8A 1MOFA 4I4TB 4O4JA 4BR6A 1NT2B 5CA0A 1NTZH 2E74B 2VWKA 1G1XB 1K4CC 5B5EZ 2HG5C 2YIBD 3HKCB 4EFEA 5B1AB 5GTHZ 5KA5A 1IBKB 2WA3A 3CX5F 4UVCA 5H2FZ 2HLDG 4XBFA 5KX5A 4ICGA 3MAQA 3D3QA 3HPLC 3IJ4A 4FLZA 2PF4E 3OW2U 1OCCB 3AEIA 1TVKA 1A32A 4L8JA 4TUYB 3N27A 1SQBH 5JQGB 2YXHA 2PYJA 5KMGA 2B1GA 3GB7C 3FB5C 3DTUB 1XUQA 4LF5B 2PI4A 5B1OA 4KP4A 3TXSA 3W7WA 1SQXH 1GM7A 3W7UA 4GT1A 2YC0A 1WB8A 5KHJA 3JSNA 4LH7A 5L3EA 3OM3B 2R72A 2DWEC 4O4HB 2ZXWC 2L6LA 2LP7A 4FPPA 5IY5C 4LBEC 2YICA 3TETA 1XMOB 5EK0A 4B08A 5LHGA 5IYDO 1CEZA 4MW3A 3G6BA 4E4EA 3LSQA 4NTYA 1KQSU 4Z1MG 1MZFA 2DYRB 4R6ZA 3OGCC 3QO5A 1IVSA 3K5NA 5B3SC 5K1XA 3AG2C 1MA1A 3SR2C 1L0LH 1F7YA 2Q7EA 3ICXA 3C3TA 3NR7A 1R3IC 1Z5WA 1Q3EA 3FB7C 3ZHSA 5BMVA 2HVKC 1JPXA 4QPJA 4K0KB 2F23A 2DYSC 2KG7A 2P22C 4KUMA 1EM1A 4FIPC 3JASA 3VBBA 1AB3A 4WBNA 4LF6B 2UXDO 4LWSA 4JTAB 5LOVA 4D7TA 1BL8A 4AI8A 2B9ZA 3X2QC 1DTOA 2BTQB 3H1IH 3P3PA 2FYUH 2ZD9A 2QWRB 3E86A 2E5LO 4DV2O 4B3RO 2WLIA 3ZRVA 4DR6O 2AW9A 5LXTB 3S3XA 2CE4A 3L75H 4Q20A 4UCRA 4YHHB 2GSMB 5JVDB 4PELA 4JI0O 2QKCA 1HNZB 3IC9A 1PNKA 3JAWA 4DUYB 2XHBA 5CBFA 1YF2A 2A7WA 4WFAV 4MVUA 4LF7B
chains in the Genus database with same CATH topology
2QWNB 2CTPA 1BQZA 4IT5A 2QSAA 2LGWA 2DMXA 2QWQB 2GUZB 1FAFA 2QWOB 1NZ6A 2LO1A 3AG7A 1WJZA 2QWPB 1BQ0A 2Y4TA 2KQXA 2YS8A 2M6YA 2N05A 2OCHA 3UO3A 2GUZA 2EJ7A 3BVOA 1GH6A 2CTWA 2Y4UA 2N04A 4J7ZA 2PF4E 3APOA 2YUAA 3UCSC 1XBLA 1IURA 1HDJA 2QWRB 2L6LA 2CTRA 1FPOA 4RWUA 1N4CA 4J80A 3UO2A 3APQA 2DN9A 2CTQA 2CUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWN B;  2CTP A;  1BQZ A;  4IT5 A;  2QSA A;  2LGW A;  2DMX A;  2QWQ B;  2GUZ B;  1FAF A;  2QWO B;  1NZ6 A;  2LO1 A;  3AG7 A;  1WJZ A;  2QWP B;  1BQ0 A;  2Y4T A;  2KQX A;  2YS8 A;  2M6Y A;  2N05 A;  2OCH A;  3UO3 A;  2GUZ A;  2EJ7 A;  3BVO A;  1GH6 A;  2CTW A;  2Y4U A;  2N04 A;  4J7Z A;  2PF4 E;  3APO A;  2YUA A;  3UCS C;  1XBL A;  1IUR A;  1HDJ A;  2QWR B;  2L6L A;  2CTR A;  1FPO A;  4RWU A;  1N4C A;  4J80 A;  3UO2 A;  3APQ A;  2DN9 A;  2CTQ A;  2CUG A; 
#chains in the Genus database with same CATH topology
 5FNV B;  1NU1 H;  4JGS A;  5KHK A;  4MS2 A;  3AK1 A;  4J7J A;  4DR5 B;  3ABL B;  1PL4 A;  2LO1 A;  3ZMS A;  1ZX3 A;  4K35 A;  4RQF A;  4DR4 O;  4NYK A;  3KKY A;  2E75 B;  4H44 B;  3A0B Z;  4O4J B;  2XAQ A;  5CA0 B;  3BPZ A;  2UXB O;  2YSU B;  1CPY A;  1MSD A;  2KKW A;  2R9A A;  5LP6 A;  4FK5 C;  1RFY A;  3ABT A;  2CAZ C;  3K06 A;  1L8D A;  2PY5 A;  3BEH A;  3E22 A;  3ZED A;  2GDS A;  5LA6 A;  5KX5 B;  2UUB B;  4IYI A;  1US6 A;  2XAG A;  2Y4T A;  1TVK B;  1I94 B;  4DV1 B;  4FVM A;  3N2G B;  2D2C B;  4PA7 A;  3Q4H B;  5KMG B;  4CS3 A;  2WA4 A;  4JTC B;  3OFN G;  2CUG A;  4ZKI A;  2QKS A;  4GKK O;  4CH3 A;  4JTD B;  1KKC A;  3F7V C;  4QPK A;  1DF4 A;  1NR7 A;  4FFB B;  3GVM A;  3VQY A;  4UVA A;  3JAR A;  2JGD A;  1XDC A;  5IDJ A;  4YY3 O;  2H3O A;  1VF6 A;  1VIB A;  3D8C A;  5L3F A;  3CHX A;  4TV9 A;  3OUS A;  1KU9 A;  2OTL V;  1SC5 B;  1VQ7 V;  1YI2 V;  1PM9 A;  2GHY A;  4UB8 Z;  2ZE7 A;  1FJG O;  4GX1 A;  1XL4 A;  3WU2 Z;  3NXS A;  4DR7 B;  4X8A A;  2JS5 A;  5CN0 A;  1M93 A;  3ZMZ A;  4CBC A;  2XAJ A;  4JZG A;  2ZQM A;  1NVP B;  1R3L C;  1Q81 W;  3P3N A;  1BMF G;  5DEC A;  4I0X B;  3ZCC A;  2KG7 B;  2NLJ C;  2MW2 B;  2ZIN A;  4J7Z A;  1UPG A;  1XIL A;  2Q67 A;  4X64 O;  3JAS B;  3C3S A;  4K3A A;  4WBN B;  1B04 A;  1IX9 A;  1AP5 A;  4LWS B;  4G27 B;  1SZX A;  3J7A U;  2YEV A;  4AHC A;  4I9Q A;  4R7C A;  5CA3 A;  2ZR2 A;  4OGQ B;  1OZ0 A;  1GH6 A;  4C7U A;  3ZHQ A;  4JI3 B;  3LUT B;  2N04 A;  2WLI B;  2Q73 A;  3TXQ A;  4J9Y B;  4ZOL B;  1S5L Z;  4DUZ B;  5A9G A;  4D6T H;  1NVP D;  2HEP A;  3CMA V;  3MHH C;  2LGQ A;  1HNW B;  4U3F H;  1M56 B;  4NKG B;  3JD0 A;  5EYP A;  3JAW B;  4TQD A;  2Q8V A;  5FLX N;  5KAI Z;  2A79 B;  2P5O A;  4X1Y A;  4LNU A;  3APO A;  4AQY O;  4G28 B;  3UKM A;  3G71 V;  1V54 C;  2DW4 A;  1H2G A;  3KG2 A;  3SPC A;  2LFR A;  3VOU A;  5IJ0 A;  2UUC B;  1PNM A;  2ZDI A;  5LP6 B;  2Q68 A;  1YJW V;  5BR8 O;  1R6K A;  1SQF A;  2PYL A;  1NTM H;  4PA4 A;  1AI4 A;  4LF8 B;  4I50 B;  4P9P A;  3F5W C;  1H38 A;  5LA6 B;  1I5X A;  3E35 A;  2ILM A;  2X6A A;  1M9N A;  1R1B A;  2Y69 B;  1KB9 F;  3G6E V;  4DV5 O;  5LMU B;  3W7S A;  1BQZ A;  1N0N A;  1JQ0 A;  1RPR A;  5B1B C;  1PL0 A;  3CCQ V;  1XQ8 A;  1J5E O;  4JI4 B;  3M7M X;  3BVO A;  3ABK C;  1RSO A;  1HWY A;  1YIT V;  2ETN A;  1QLE C;  4OX9 O;  4TOI A;  4K8X A;  2Y48 A;  4X1K B;  3WG7 C;  4DV4 B;  1VF7 A;  1BS3 A;  4WFB V;  4X20 A;  1DK1 A;  2JGD B;  2QEX V;  3R66 A;  4JYA O;  1WP7 A;  5CA1 A;  2EIJ B;  4JI7 B;  4PDL A;  1GM8 A;  2NNU A;  4TV9 B;  2HFE C;  1HR0 O;  3PN1 A;  3BY6 A;  1XMQ B;  2CDY A;  2JJ1 G;  1JMK C;  3ZBH A;  3T1Y O;  4DXW A;  4FLX A;  1X59 A;  3CCU V;  2DYR C;  1GK9 A;  3ASN C;  3OR7 C;  4JI2 B;  1F4M A;  4HAM A;  4BIU A;  3A0R A;  1KUQ A;  3SJC C;  4BIO A;  2H94 A;  5AG2 A;  4UV9 A;  1BSM A;  2HVJ C;  3JD2 A;  4FM0 A;  4WCE V;  2Q5Z A;  3ZHU A;  3BAA A;  2P4V A;  4MSW C;  4H0L B;  3P32 A;  4MT8 A;  1R3K C;  1WA8 A;  4X66 O;  5KAF Z;  4DR2 O;  2GBO A;  5FPR A;  3G80 A;  4L87 A;  2QGN A;  3APQ A;  3ETG A;  4DR3 O;  3OT7 A;  4X62 O;  2EIN B;  5JJJ B;  3ZMV A;  5JJN B;  2MK3 A;  2GV9 A;  3IGA C;  1H2L A;  2QSA A;  4DR1 B;  1YIJ V;  3JCU Z;  1Q5O A;  2UU9 O;  1I7F A;  3CYO A;  3JD3 A;  5KA6 A;  2QA4 V;  3IFX A;  5EYP B;  3DXR A;  4HYO A;  3OEE G;  2VS0 A;  5EBW C;  4MTF A;  2X6B A;  5L3C A;  2Q6A A;  4ZHQ A;  4X65 O;  4LH6 A;  3H1L H;  1Y74 A;  4J42 A;  1VQ8 V;  3TGU H;  2F43 G;  2E3C A;  3STZ C;  4KXR A;  5D5Q A;  3ZRS A;  5L3G A;  4AIL C;  4MVS A;  4DV7 O;  2HJF C;  5IYZ B;  4JV5 O;  4DV3 O;  1B6Q A;  5C8Y A;  4YJ2 B;  3H9V A;  1XNQ B;  1N32 B;  2A9H A;  4GX0 A;  5KLV H;  3ABL C;  3ZIA G;  2VWJ A;  1QVF U;  1SES A;  2YXY A;  1GN3 A;  2Q9L A;  4B3S O;  1RPO A;  3CP1 A;  4KL1 A;  1VQ5 V;  2VQE B;  4DV6 B;  3FX7 A;  2CTQ A;  1V55 B;  2JK5 C;  3DC6 A;  1N8R W;  2K9P A;  5LGN A;  5C93 A;  4G2K A;  2A0L A;  4LF9 B;  1I08 A;  2N05 A;  1YCI A;  1RSO B;  2IJI A;  1BHA A;  3RYI A;  1N36 B;  5GON A;  3ETE A;  1SQQ H;  1SF9 A;  4LFA B;  1FPO A;  3N2K B;  4RUE A;  1IBK O;  4X20 B;  4OPH A;  3THO A;  5CA1 B;  1KP2 A;  5LHH A;  1G6U A;  5A2Q N;  2QWP B;  4GZR B;  2JDI G;  2ODM A;  2EJ7 A;  3K9S A;  4UCT A;  3RYC A;  1EZJ A;  4LF5 O;  1K8A W;  4ASU G;  4W4L A;  1WAZ A;  3ASO C;  2ZKO A;  1O9H A;  1PNL A;  3U10 A;  1M1K W;  2V1D A;  1D5A A;  2LQT A;  3QTC A;  1M4U A;  3WB1 A;  4OPA A;  4LFC B;  4NB5 A;  1Q7Y W;  3DSQ A;  1XMO O;  3RVZ A;  2E76 B;  4UCU A;  1H8E G;  2EIK B;  1H2K A;  3SJB C;  4EFB A;  4WFE A;  3M99 B;  4MW8 A;  2PZS A;  1SER A;  4U3J A;  2K1E A;  4Z1V A;  3CCJ V;  3ZRX A;  1WA8 B;  4UVB A;  4IIJ A;  4U7O A;  1P7B A;  3SYC A;  2ZIM A;  3SJA C;  5J2T A;  2Y4U A;  3JD1 A;  4GKJ B;  1HDJ A;  3ABM C;  3E8G A;  2A3Q A;  1AP6 A;  1BGY H;  4CH5 A;  3OMN B;  1OCR B;  1Q6I A;  1K33 A;  3KZI Z;  2CTP A;  1FXK A;  3D3I A;  4K0K O;  3AG3 B;  1SRY A;  3CB2 A;  1SQP H;  2YDE A;  5LMN B;  1W59 A;  2WLL A;  4IHJ A;  4PI2 A;  3JAL A;  3CEI A;  3HKE A;  3OE7 G;  3DXR B;  4ABM A;  4DV0 O;  1AR5 A;  4LF6 O;  4ZBM A;  4ZHQ B;  5H6Q A;  1Y74 B;  3CD6 V;  3STL C;  5LYJ B;  4QE9 A;  2UUA B;  1VQ6 V;  1BE3 H;  1VQ9 V;  3ZX6 A;  3AK2 A;  3SPJ A;  2JEU A;  4XDJ A;  5C8Y B;  2JS3 A;  1NI8 A;  1XHX A;  4UFZ A;  3SYO A;  4YHH O;  2F4V B;  5EIB C;  4LP8 A;  5CBH A;  1HNZ O;  1XHZ A;  4DUY O;  1AR4 A;  5KHH A;  3CCM V;  3MDS A;  1K5Q A;  1JFF A;  2IJK A;  3W7X A;  2ZR3 A;  2QJ1 A;  4LF7 O;  4GYC B;  2LJ2 A;  3D36 C;  2UXB B;  2EIL B;  1W2B U;  2Q7H A;  4J9Z B;  1XOU A;  1NKD A;  1AJP A;  1M57 C;  2Y69 C;  3WB0 A;  4DR5 O;  4F6R A;  5ITZ A;  3F5T A;  5H9C A;  4PA9 A;  1YTF B;  4X88 A;  2RCV A;  2FTK A;  4UCS A;  3ZHT A;  4KHP B;  4CZZ A;  3RYI B;  4JI5 B;  2QKA A;  4E2L A;  5GON B;  3K03 A;  1H2M A;  3VQX A;  4FLY A;  1VQL V;  2HKO A;  4TWK A;  2KSD A;  1AI7 A;  3QNE A;  4HZ3 A;  5F2V O;  4FLV A;  5IT9 N;  2WWW A;  1PKX A;  3H1J H;  2UUB O;  3B4S A;  2DE0 X;  3CCE V;  4YIO A;  4NXN B;  1CP9 A;  1TUB A;  1I94 O;  4JYB A;  1K3E A;  4DV1 O;  3K0D A;  4GX5 A;  3UT5 A;  1PPJ H;  4QIW F;  2YID A;  1F23 A;  2B5U A;  4PA6 A;  5LGU A;  2N74 A;  3AG4 C;  3DC5 A;  4YY3 B;  1OCO C;  1YTF D;  1ORQ C;  4IT5 A;  1E1Q G;  2LGW A;  1B3Q A;  5H5N A;  2ADQ B;  3AG1 C;  2WLM A;  4JYY A;  1NBM G;  1M5I A;  2WLH A;  2YXL A;  2DOS A;  2OCC B;  3JD4 A;  3CCL V;  3BCC H;  5DM6 V;  2IH3 C;  3HB3 B;  4WF9 V;  3OD4 A;  1SKV A;  2F93 B;  2QM8 A;  4U3J B;  5L3B A;  2BSK A;  2IJJ A;  5L3D A;  5TIS Z;  3EVK A;  1IDS A;  2HJD A;  3RYF A;  5BMV B;  2YIA A;  4IIJ B;  3RYH A;  2NN4 A;  5J2T B;  4TSF G;  3LNN A;  2GUZ A;  3OTO B;  1AJQ A;  2ZIO A;  2IU3 A;  4B3T B;  4DR7 O;  1O9G A;  1SA0 A;  2YI8 A;  1TUE B;  1KD1 W;  4JI1 B;  5B3S B;  4JI8 B;  2EZP A;  3AG2 B;  4DK0 A;  3JSL A;  1R3J C;  3K58 A;  1FXK B;  5LOV B;  1CXZ B;  4QE7 A;  3CRR A;  1GN6 A;  4YJ3 A;  3RBZ A;  4PDR A;  1AR1 B;  2WLL B;  2OCH A;  3JAL B;  3HKE B;  4XDL A;  1JA8 A;  3CWB H;  4P9O A;  3WFV A;  2GTA A;  1PV0 A;  2Y0I A;  4JAV A;  4F6E A;  4KFM A;  3CME V;  1SS3 A;  3LDD A;  1QBZ A;  5LL6 Y;  3GWO A;  1JJO A;  1S72 V;  2F66 C;  2LW7 A;  2FB5 A;  2CH7 A;  2ADP A;  1QU7 A;  3B40 A;  5KUM A;  5E79 Z;  2Q4P A;  1AVM A;  4FLW A;  4FM2 A;  1JVM A;  4JI3 O;  2FL4 A;  1FYJ A;  4NVP A;  1BQ0 A;  2RN9 A;  2W6J G;  3UO3 A;  3E8B A;  4DUZ O;  4LFB B;  4UCO A;  1VEW A;  1K92 A;  4CH4 A;  2WLK A;  4MTG A;  1HNW O;  1K9M W;  2QWN B;  4BW9 A;  4W4K A;  4JYC A;  2QWQ B;  3TCU A;  1Z5V A;  1Y76 A;  3CE2 A;  3K3W A;  4MVZ A;  4B7E A;  1RM1 C;  3L71 H;  3CXH F;  4X1I A;  1XBL A;  1NJI W;  4O4L A;  2NR5 A;  4BIZ A;  4HNA A;  5ITZ B;  2ZNJ A;  3E22 B;  1V55 C;  2UXC B;  5IJ9 A;  4Q6G A;  4FMT A;  5B1A C;  2UUC O;  2EUL A;  2WLN A;  4O4I A;  2QWO B;  5JCO C;  1Q43 A;  2F1M A;  4RUF A;  1NTK H;  1N33 B;  1ZL8 A;  4LF8 O;  3M8A A;  1GN2 A;  1JCH A;  2EIM B;  4NXM B;  1ZLZ A;  1OCC C;  2ZM6 B;  1FXV A;  3K04 A;  2IW5 A;  3IAY A;  1GAX A;  5LMU O;  4BWA A;  2F95 B;  2IM9 A;  2QE7 G;  1TUB B;  3I56 V;  4JI4 O;  3UT5 B;  3SPG A;  5JWP A;  2P67 A;  3BAB A;  2P06 A;  3JAR B;  2BOB C;  3SYP A;  1VQM V;  3RN4 A;  2CGN A;  4FZ0 A;  5JJE B;  1TA8 A;  3K0G A;  2V7Q G;  2BTO A;  2W0X A;  4DV4 O;  3B77 A;  4HBN A;  4TUY A;  3CCV V;  3ETQ A;  1Y67 A;  5BZB A;  1GN4 A;  4JI6 B;  3T2M A;  4JI7 O;  1GTO A;  1R6N A;  5DN6 G;  5IWA B;  3UM7 A;  4DRX A;  5EBL C;  2DJV A;  2JGU A;  2JIZ G;  2XAH A;  1XMQ O;  2CTW A;  2PTM A;  2RDC A;  1TGO A;  3K9A A;  2XND G;  1OV9 A;  5E1A C;  2BSK B;  3B09 A;  2IJH A;  3CRQ A;  3I5D A;  3QO8 A;  2FKX A;  3RYF B;  1DGS A;  3RYH B;  2YI9 A;  5LGT A;  3VQV A;  2P7T C;  3J81 N;  1AI6 A;  2GUZ B;  4U7N A;  1WLE A;  4JI2 O;  4JAA A;  3T1H B;  5CB4 A;  3K57 A;  1F51 A;  1EZV H;  1KEC A;  3ZHV A;  1YJN V;  1HNX B;  1S5H C;  3L74 H;  2AGA A;  4R8C A;  1R6T A;  1ZWI C;  2YEV B;  1NQT A;  2RNB A;  3FAV A;  3K5O A;  3ZN0 A;  1IBM B;  3IC7 A;  3AG3 C;  3ZJZ A;  4PDM A;  1E1R G;  4I5S A;  4QGP A;  2WLJ A;  3ZHR A;  4FZ1 A;  5J2U A;  3B8N A;  2M7W A;  1BZK A;  4X89 A;  1U96 A;  1ENV A;  3CRA A;  4K8Z A;  2CH7 B;  1UFI A;  3QG5 A;  2QDO A;  1NH2 D;  4PDV A;  4GLX A;  4DR1 O;  3SJQ C;  1HW7 A;  2IH1 C;  2UXX A;  4LF4 B;  3SYQ A;  4B3M B;  3HKD A;  3JAT A;  4WFF A;  4X1Y B;  3TK1 A;  3DGE A;  5CMU A;  4LNU B;  4TV8 A;  5IYB O;  2HR3 A;  1KYO F;  1N34 B;  1GMG A;  2ARH A;  4R50 A;  1PD3 A;  2YUA A;  1QHT A;  3ZS8 C;  3JYC A;  4JF3 A;  1XNR B;  3GWK C;  3MHS C;  2ZE6 A;  1Y76 B;  1Y4M A;  5IJ0 B;  4A5U B;  4P2Z A;  4NTW A;  1IXB A;  1ZTE A;  3F7Y C;  1S0V A;  3ABU A;  1K7D A;  4X1I B;  2Z5U A;  4O4L B;  2P6J A;  3FB6 C;  3A2F A;  1VMG A;  1COW G;  3R65 A;  4HNA B;  3G4S V;  1IBL B;  2VQF B;  5IJ9 B;  1XNQ O;  3UO2 A;  1VP7 A;  2Q0O C;  2HHH B;  1N32 O;  1V54 B;  2OTJ V;  1WB7 A;  1WP8 A;  2QR4 A;  4IYH A;  4O4I B;  2PI5 A;  1P49 A;  2EX3 A;  1ZL8 B;  3UQ8 A;  4J11 A;  1L0N H;  2M6Y A;  2X7R B;  2O57 A;  3WB2 A;  3C90 A;  4EB6 A;  3HKB A;  2VQE O;  4DV6 O;  3OEH G;  1DF5 A;  4O2A A;  2KB1 A;  1J95 A;  4GCZ A;  4WFG A;  4ZIB A;  3FYE B;  3JCZ A;  1WN7 A;  4LF9 O;  2ZCE A;  5B1B B;  3FFQ A;  1Q6U A;  1YEW A;  1N36 O;  1P7G A;  1MG1 A;  2XT9 A;  4JAS A;  4LFA O;  4JAU A;  3UCS C;  1YHQ V;  3ABK B;  2QTO A;  2L35 A;  1QLE B;  1Z2G A;  2OWO A;  5D5P A;  3N2G A;  1M90 W;  1OCZ B;  3Q4H A;  4FJC C;  1OHH G;  3WG7 B;  3OTF A;  3FB8 C;  3RGB A;  4DRX B;  2ITC C;  3FYI B;  1LR1 A;  3CJH A;  4WFH A;  3BFR A;  3RW0 A;  4FFB A;  4FLU A;  3ZMU A;  2H8P C;  2OCC C;  1GKF A;  1ARO P;  2JJ2 G;  2Y0P A;  3I55 V;  5EZY A;  2ZT9 B;  3B2E E;  3RWR D;  2AXT Z;  1Y66 A;  2AZ0 A;  4UV8 A;  5CB4 B;  3ZN1 A;  4LFC O;  3TJT A;  3JAK A;  1Y6X A;  3QF7 A;  2IBZ H;  5EBM C;  3ASN B;  1W0J G;  2PGG A;  4MTX A;  1AIL A;  4TT3 G;  1NS1 A;  5EC2 C;  3ZRW A;  1T5E A;  3FAV B;  1FD9 A;  4EKW A;  1JJ2 U;  1KBH A;  1FXK C;  2DQ0 A;  1OJH A;  2UXN A;  3RVY A;  1R73 A;  3W7T A;  5J2U B;  1K5S A;  1FAF A;  4PA3 A;  1FKA O;  4GKJ O;  2UXD B;  5KUK A;  1B06 A;  1P4R A;  2ZE5 A;  2JVD A;  4I0X A;  1P84 F;  4DO2 A;  1URF A;  5EC1 C;  3OUF A;  3ZMT A;  1EN6 A;  3FKS G;  3OR6 C;  4MVQ A;  1GO3 F;  1M56 C;  2E5L B;  4DV2 B;  2XAS A;  4DV0 B;  4B3R B;  3H01 A;  1QQC A;  2ITD C;  4DR6 B;  1MMM A;  3HKD B;  3JAT B;  2AHY A;  1MZE A;  2AZ2 A;  3OGI B;  4TV8 B;  5LMN O;  2R9R B;  5J9P C;  1G8M A;  4JI0 B;  3QO7 A;  5KHI A;  2WPD G;  3E83 A;  3BA9 A;  1VQN V;  1XEQ A;  5GTI Z;  3LSU A;  1F4N A;  1SZT A;  3B8M A;  4NR1 A;  4ZOL A;  1U97 A;  4DW0 A;  1EBO A;  2UUA O;  1QNM A;  2Q7G A;  3K59 A;  1VAR A;  3ML0 A;  3P30 A;  3EHB B;  4IL6 Z;  1NZ6 A;  5K1P A;  1IXM A;  5B1N A;  5LP6 C;  1ZAU A;  2PUS A;  1I5Y A;  2V4D A;  2Z0A A;  4DR4 B;  2F4V O;  1KMI Z;  1BCC H;  5DED A;  3SPH A;  1W0K G;  4PD4 F;  1RP3 B;  2B1I A;  1KP3 A;  4O2B A;  4EB6 B;  1QCE A;  2ATK C;  3HKB B;  4O2A B;  2EIM C;  3OAA G;  3K5M A;  1YJ9 V;  3LSS A;  1FXH A;  2WSS G;  2LW1 A;  3T1C A;  4I50 A;  4OXS A;  4NTX A;  3D36 A;  3L70 H;  3CPW U;  1HP8 A;  4KHP O;  3CRC A;  4FLT A;  1WPX A;  4LC1 A;  5CBG A;  4JI5 O;  1VQK V;  1MSW D;  4GKK B;  2EIJ C;  1VF6 C;  2DWD C;  3CSX A;  3RYC B;  2QM7 A;  4RAI A;  1TAE A;  5FPO A;  2ZE8 A;  1K34 A;  4UXN A;  3KCX A;  4NXN O;  3CJH B;  4X1K A;  1LUW A;  4DYL A;  4H33 A;  1VF5 B;  4J10 A;  1IZ3 A;  3LNM B;  2BCC H;  3JAM N;  5EZY B;  1BT8 A;  2OYQ A;  2EZO A;  3O9O A;  4EEQ A;  1FJG B;  2ZXW B;  4YIP A;  5IY5 B;  1MNG A;  3ASO B;  3ETD A;  1LUV A;  3OMI B;  1FFX A;  3JAK B;  4TQF A;  1SQG A;  2R9I A;  3A8T A;  4J41 A;  4FM1 A;  3CC4 V;  3ZRW B;  4CS2 A;  4UUJ C;  3KCY A;  4X64 B;  4PHZ A;  1SQV H;  2DN9 A;  1GRJ A;  2EIN C;  1Q8I A;  3AK3 A;  3E89 A;  3SDL A;  1D2D A;  3OTO O;  1Q6H A;  1ZSP A;  4B3T O;  4J7K A;  2ZNI A;  2FML A;  1H8H G;  4IHJ B;  4JI1 O;  4JI8 O;  5JH7 A;  4Z2W A;  3E8F A;  4B7K A;  5HFL A;  5H6R A;  2DYS B;  4I7Z B;  3ABM B;  5HFM A;  1S3J A;  2IU0 A;  1JR9 A;  1VQP V;  1KC8 W;  1ZUQ A;  3X2Q B;  4I55 A;  3QVN A;  3RT3 C;  1G4Y B;  1IUR A;  4PI0 A;  1QLN A;  3CC2 V;  1S76 D;  4IGG A;  1AI5 A;  4AQY B;  2DQ3 A;  2A06 H;  3S3W A;  3T4Z A;  4H37 A;  3CXC U;  2ZDI C;  2D3O W;  2RQ6 A;  1WJZ A;  4RO2 A;  4LFB O;  1JFF B;  1PP9 H;  5FL7 G;  2OIE A;  4JPR A;  2CK3 G;  2YIB A;  1H2S B;  1SET A;  4ZI7 A;  3EFF K;  1GM9 A;  5BR8 B;  3K5L A;  2BE3 A;  5IYZ A;  4F6R B;  4O2B B;  1S77 D;  2Q0A A;  4YJ2 A;  1QVG U;  1ROP A;  3RFR A;  2QTS A;  1YXB A;  2WAM A;  4CS4 A;  4DV5 B;  2XOK G;  1H2N A;  4MVM A;  1J5E B;  3T4D A;  3FD9 A;  1FS0 G;  4CC6 A;  2UXC O;  1XRE A;  1N4C A;  1XI1 A;  4MVO A;  4I4T A;  3SYA A;  4OX9 B;  1M57 B;  4MTO A;  1NR1 A;  1N0J A;  2RMK B;  3CRM A;  1L1F A;  1Q86 W;  1N33 O;  4H13 B;  2DMX A;  4LR3 A;  3HKC A;  2RJZ A;  2C2A A;  4NXM O;  2ZM6 O;  1S5J A;  5JCO A;  1UJW B;  3E2E A;  4JYA B;  1MAB G;  1YDX A;  1XL6 A;  4X9Q A;  5EIB D;  3K79 A;  1OCZ C;  3A0H Z;  4XDK A;  3EXA A;  2OIG A;  1HR0 B;  4I9W A;  1LNQ A;  5JQG A;  4MVR A;  1VQO V;  3N2K A;  5LHI A;  3HR0 A;  3T1Y B;  4GUN A;  1YZB A;  4DW1 A;  2R70 A;  2G38 A;  2X0L A;  4DK1 A;  3AG4 B;  5BXZ A;  1K4D C;  1OCO B;  4O4H A;  4JI6 O;  2EIK C;  3K08 A;  1FFX B;  5IWA O;  4GX2 A;  2W6I G;  3LDC A;  1VQ4 V;  3G67 A;  1D5N A;  4N23 A;  3AG1 B;  3BHP A;  3H1H H;  2JEX A;  1NH2 B;  1SA0 B;  3U11 A;  2EJR A;  4RQE A;  3MD0 A;  1YSC A;  5KHG A;  1YVW A;  4X66 B;  1K73 W;  1OCR C;  4DR2 B;  2XUM A;  4P30 A;  1WNS A;  4QNH B;  2VRZ A;  1EFR G;  1QR9 A;  2QM4 A;  4LCU C;  2JRI A;  4YJ3 B;  4BW5 A;  3CC7 V;  4DR3 B;  3T1H O;  3H1K H;  4X62 B;  3CCR V;  4D7S A;  1JOY A;  5JH7 B;  1Q82 W;  2CGO A;  2W0F C;  1HNX O;  1E79 G;  2BOC C;  3BRC A;  2LFS A;  2XTA A;  3U0Z A;  3SPI A;  2UU9 B;  3CCS V;  5IYC O;  3OMA B;  1KKD A;  3LDE A;  1IBM O;  1X4T A;  5GW7 A;  1V9P A;  2Z3Y A;  3PJS K;  3AG7 A;  4I55 B;  2YS8 A;  1THZ A;  1FFT B;  2P90 A;  4X65 B;  5B66 Z;  4PV1 B;  2P4K A;  4N21 A;  2Q69 A;  2BTQ A;  2CTR A;  4RWU A;  4J80 A;  2GTS A;  1BHB A;  4DV7 B;  4JV5 B;  3L72 H;  4DV3 B;  4LF4 O;  3CS5 A;  1WPB A;  4PJ0 Z;  4B3M O;  5IE9 A;  5LXT A;  4FFK A;  3SGI A;  2X6C A;  3O65 A;  1N34 O;  2XAF A;  5LYJ A;  5JVD A;  1QR8 A;  4ZI7 B;  4BAY A;  2HP8 A;  5BY1 A;  1XNR O;  1JX9 A;  4UCV A;  1EN4 A;  4CH6 A;  1K97 A;  2AHZ A;  1AJN A;  4CC5 A;  2EIL C;  4B3S B;  1Q90 D;  2OT5 A;  1I0H A;  3J80 N;  3L9D A;  1DLB A;  2EBO A;  5FNV A;  1EN5 A;  4QJF B;  4JZ2 A;  5LBQ A;  3E8H A;  4YXW G;  2KQX A;  3L73 H;  1RM1 B;  1IBL O;  4UB6 Z;  2VQF O;  3VQW A;  4F4L A;  2HHH O;  3BA8 A;  1MOF A;  4I4T B;  4O4J A;  4BR6 A;  1NT2 B;  5CA0 A;  1NTZ H;  2E74 B;  2VWK A;  1G1X B;  1K4C C;  5B5E Z;  2HG5 C;  2YIB D;  3HKC B;  4EFE A;  5B1A B;  5GTH Z;  5KA5 A;  1IBK B;  2WA3 A;  3CX5 F;  4UVC A;  5H2F Z;  2HLD G;  4XBF A;  5KX5 A;  4ICG A;  3MAQ A;  3D3Q A;  3HPL C;  3IJ4 A;  4FLZ A;  2PF4 E;  3OW2 U;  1OCC B;  3AEI A;  1TVK A;  1A32 A;  4L8J A;  4TUY B;  3N27 A;  1SQB H;  5JQG B;  2YXH A;  2PYJ A;  5KMG A;  2B1G A;  3GB7 C;  3FB5 C;  3DTU B;  1XUQ A;  4LF5 B;  2PI4 A;  5B1O A;  4KP4 A;  3TXS A;  3W7W A;  1SQX H;  1GM7 A;  3W7U A;  4GT1 A;  2YC0 A;  1WB8 A;  5KHJ A;  3JSN A;  4LH7 A;  5L3E A;  3OM3 B;  2R72 A;  2DWE C;  4O4H B;  2ZXW C;  2L6L A;  2LP7 A;  4FPP A;  5IY5 C;  4LBE C;  2YIC A;  3TET A;  1XMO B;  5EK0 A;  4B08 A;  5LHG A;  5IYD O;  1CEZ A;  4MW3 A;  3G6B A;  4E4E A;  3LSQ A;  4NTY A;  1KQS U;  4Z1M G;  1MZF A;  2DYR B;  4R6Z A;  3OGC C;  3QO5 A;  1IVS A;  3K5N A;  5B3S C;  5K1X A;  3AG2 C;  1MA1 A;  3SR2 C;  1L0L H;  1F7Y A;  2Q7E A;  3ICX A;  3C3T A;  3NR7 A;  1R3I C;  1Z5W A;  1Q3E A;  3FB7 C;  3ZHS A;  5BMV A;  2HVK C;  1JPX A;  4QPJ A;  4K0K B;  2F23 A;  2DYS C;  2KG7 A;  2P22 C;  4KUM A;  1EM1 A;  4FIP C;  3JAS A;  3VBB A;  1AB3 A;  4WBN A;  4LF6 B;  2UXD O;  4LWS A;  4JTA B;  5LOV A;  4D7T A;  1BL8 A;  4AI8 A;  2B9Z A;  3X2Q C;  1DTO A;  2BTQ B;  3H1I H;  3P3P A;  2FYU H;  2ZD9 A;  2QWR B;  3E86 A;  2E5L O;  4DV2 O;  4B3R O;  2WLI A;  3ZRV A;  4DR6 O;  2AW9 A;  5LXT B;  3S3X A;  2CE4 A;  3L75 H;  4Q20 A;  4UCR A;  4YHH B;  2GSM B;  5JVD B;  4PEL A;  4JI0 O;  2QKC A;  1HNZ B;  3IC9 A;  1PNK A;  3JAW A;  4DUY B;  2XHB A;  5CBF A;  1YF2 A;  2A7W A;  4WFA V;  4MVU A;  4LF7 B; 
#chains in the Genus database with same CATH homology
 2QWN B;  2CTP A;  1BQZ A;  4IT5 A;  2QSA A;  2LGW A;  2DMX A;  2QWQ B;  2GUZ B;  1FAF A;  2QWO B;  1NZ6 A;  2LO1 A;  3AG7 A;  1WJZ A;  2QWP B;  1BQ0 A;  2Y4T A;  2KQX A;  2YS8 A;  2M6Y A;  2N05 A;  2OCH A;  3UO3 A;  2GUZ A;  2EJ7 A;  3BVO A;  1GH6 A;  2CTW A;  2Y4U A;  2N04 A;  4J7Z A;  2PF4 E;  3APO A;  2YUA A;  3UCS C;  1XBL A;  1IUR A;  1HDJ A;  2QWR B;  2L6L A;  2CTR A;  1FPO A;  4RWU A;  1N4C A;  4J80 A;  3UO2 A;  3APQ A;  2DN9 A;  2CTQ A;  2CUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...