2QWNB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-386aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi state
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
MDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
total genus 30
structure length 94
sequence length 94
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwnB00
2N04A 2LGWA 2QWNB 1FPOA 4J80A 2DMXA 1BQ0A 2QSAA 2YUAA 2CUGA 3APOA 2EJ7A 1NZ6A 2GUZA 2DN9A 2Y4UA 2QWQB 1HDJA 4J7ZA 2L6LA 3UO3A 3UO2A 2CTRA 1GH6A 1N4CA 4RWUA 2QWRB 1XBLA 2N05A 2CTPA 4IT5A 1BQZA 1IURA 2LO1A 2M6YA 2PF4E 2Y4TA 3APQA 2CTWA 2YS8A 2CTQA 3UCSC 2QWPB 2QWOB 3AG7A 2OCHA 2KQXA 1WJZA 1FAFA 2GUZB 3BVOA
chains in the Genus database with same CATH superfamily
5B66Z 2ZINA 1XL4A 2X7RB 1FS0G 5IE9A 4FZ0A 1NTZH 2FL4A 2Z5UA 1QR9A 2PYLA 1M57C 2YEVB 4JI3B 2A06H 2IBZH 2GBOA 4UVBA 1R73A 5JJJB 3E89A 1Y74A 1VMGA 2Q4PA 3QVNA 2D2CB 4DYLA 1W0KG 4X66O 1N34O 4DR6O 1VQPV 4HYOA 1S76D 2VQEB 2CGNA 3ZRSA 4JI4O 2UUBO 3ZHUA 4RWUA 4K35A 1F4NA 4YJ2A 4MT8A 1GTOA 3S3WA 4QJFB 1PM9A 2HKOA 3K0DA 1EBOA 1M93A 2H94A 1Q6IA 4ZHQA 3BRCA 5E79Z 4WFEA 3BA9A 5EYPA 3RYCB 4X1YB 3ZN0A 3CHXA 2M7WA 4PA7A 5LOVA 1K5SA 2JEUA 2QKAA 1MZFA 4LH6A 3CRRA 4O4HA 4TSFG 1HNZO 2F23A 1YXBA 1E79G 2EINB 3CCLV 2V1DA 1GN2A 1KECA 2JGDA 1T5EA 1DLBA 1IBLB 1WA8A 2QWNB 4QGPA 1Y76A 4KL1A 1PP9H 3GVMA 4DUYO 1OCZB 1XMQO 1PPJH 4DR3O 4HZ3A 3CXCU 1LNQA 3UT5A 2P06A 2HLDG 3WG7C 5L3CA 1IBKO 1YJ9V 1AR4A 4CC6A 1L1FA 3ZHTA 5A9GA 3DXRA 3SPIA 4BIOA 4NXNO 2XAJA 4AHCA 1R3IC 3ASNB 1TUBB 4ZHQB 1FKAO 3E8GA 1SQVH 4A5UB 5EYPB 1TVKA 3H01A 1P7GA 1W59A 4UV8A 2VRZA 1NVPD 1EN4A 4NB5A 2PYJA 1PD3A 5IWAB 1FYJA 1KC8W 4O4HB 5A2QN 3KCXA 2ILMA 1L8DA 4RUEA 5LHGA 2VWJA 2F4VB 1ZAUA 4B3RO 2W0FC 2QGNA 2ZD9A 3X2QB 2YIBD 2KQXA 1Y67A 4GKJB 4IIJB 1YSCA 3JD2A 2EIMC 2QA4V 2YIAA 2L35A 4MVUA 3ZBHA 4K0KB 3UO2A 4X1IB 2EIJB 2IJKA 3HPLC 5DEDA 2ZE7A 5FNVA 1R6NA 3RYIB 1NH2D 1H38A 3ZIAG 1K34A 3ABKB 5IT9N 3RBZA 3L72H 4UCOA 5EZYA 5GONB 4D7SA 3EFFK 2YSUB 1ZSPA 3K9AA 4MS2A 1AP6A 4JI3O 4LF7B 2GUZA 4G2KA 3SPGA 4Z1VA 1MSWD 4UCRA 2E74B 2FMLA 5KHJA 5L3FA 3ZCCA 4DO2A 3I55V 5H9CA 3CB2A 3E35A 1A32A 2ODMA 2R72A 1K97A 5KUKA 2EBOA 5IYZA 3K59A 4ZI7A 4BAYA 4LC1A 2Q7HA 3SPCA 2Q6AA 4FLXA 2UU9B 2UUAB 1SQGA 4WFFA 1Q43A 1CEZA 3FKSG 5FNVB 5B3SC 4JI5O 4Q6GA 4DR4B 3VOUA 3GWOA 3OT7A 4TWKA 3C3SA 5C8YB 2Z3YA 1BE3H 4JF3A 3FYIB 4NXMB 3AG1C 2RDCA 3SYPA 4TUYB 3ZHSA 1JPXA 3PN1A 3PJSK 1Q3EA 1N33B 1SQXH 2Q0AA 2XOKG 1I08A 5KX5A 3SJCC 1N8RW 1GN4A 1DTOA 1WLEA 4DUZO 4IYHA 3E83A 2DJVA 4DV7B 2QKCA 4ZOLB 3HKEB 2BTQB 2R70A 4ZI7B 4HBNA 5CBHA 4LP8A 1RP3B 2YXYA 1P84F 2UXDB 1G4YB 3AEIA 2YXLA 4HNAA 3SGIA 4R8CA 1SZTA 2FTKA 1NU1H 1YF2A 2WAMA 2A3QA 1VQ5V 3QF7A 1QLEB 4CH6A 2JIZG 4OX9O 1H2KA 3T4DA 1Z5WA 1OZ0A 4NTYA 3B8NA 1OCRB 3SYOA 1OCCB 5CA0A 1FXKB 1AROP 5KUMA 4J11A 5JQGB 1XOUA 4RQEA 5L3EA 2BSKB 3STLC 4LFCO 5FLXN 1SQPH 3ZX6A 2WLIB 3L75H 3OD4A 1B6QA 3QO5A 3K9SA 3CD6V 4FPPA 4NKGB 3KKYA 5JCOC 4K0KO 3J80N 5CA1A 1OCOC 4PDVA 1VQMV 5KX5B 5ITZA 4PA9A 5IY5B 4RQFA 5CBGA 4JYAB 4ZBMA 2EIKB 2PI4A 3FB7C 3ZRWA 3ZHRA 3L71H 3RVYA 4DV3B 2WSSG 1XHZA 1FFXB 1FFTB 1AB3A 2LFRA 3CCMV 3FAVB 1XILA 3HKBA 3AK2A 3W7UA 1PNKA 4PDLA 2V4DA 3RGBA 5GW7A 1K33A 2YUAA 3JATA 4QPKA 2HR3A 3ZMSA 2Y4UA 3MD0A 3CRMA 2VWKA 4DRXA 2IU3A 4FLWA 3SR2C 1SZXA 1BQZA 2DYRC 2LO1A 3VQXA 4QNHB 1WP8A 2UXNA 1GRJA 1NTMH 4G28B 3TK1A 4R7CA 2N74A 4Z2WA 2DQ0A 3CC7V 3W7SA 2ATKC 5BMVA 3TXQA 1BQ0A 1JJOA 3CJHA 2QWQB 4JZ2A 4OGQB 4P9OA 1N32O 2K1EA 4UCVA 5CBFA 1JVMA 2UU9O 4FFKA 3ABLB 2UUAO 2UXCB 4O2BB 4MVQA 1IX9A 1QVFU 1V54C 3BY6A 1US6A 5LA6A 2RMKB 3O65A 3BA8A 4IL6Z 3IAYA 3T1CA 4MVZA 4AILC 3JAKA 1SESA 4MTOA 3JD4A 5H6QA 1VQOV 3W7TA 1COWG 3OTOO 2WLJA 3T1YO 2E76B 4ZIBA 1AILA 3CRCA 2Y4TA 3H1KH 1WN7A 1Q7YW 1YDXA 2DQ3A 2JJ2G 2QWOB 4GX1A 4O2AA 3FB5C 2B9ZA 3CCUV 1D5AA 1BT8A 3ABMB 4H37A 4DR1O 4RUFA 4DRXB 4LF4B 2JRIA 1NZ6A 3K5LA 2Y48A 2CTRA 2ADPA 3JASB 5LP6A 1HNWB 3TGUH 4BIZA 4X62O 4ZKIA 2OTJV 4LF6O 4DR2B 2NR5A 1Q82W 1ZLZA 1IZ3A 3BAAA 1P7BA 3CJHB 3E22A 3ICXA 1PL4A 3SDLA 1Q86W 1SKVA 4LF9O 4I7ZB 2N05A 4NTXA 1VQ9V 4DK1A 1YI2V 4B3TB 5LA6B 3G71V 2YEVA 3HKDB 4B7EA 1OJHA 1UFIA 2AXTZ 1VQ4V 4FZ1A 4TQDA 2ITDC 3AG2B 3D36C 4TQFA 3L9DA 1EM1A 3C3TA 2X6AA 2QKSA 4JV5O 1P4RA 3E8HA 4JAVA 3EHBB 1AI7A 1E1QG 3N27A 2Q5ZA 3BPZA 4LR3A 3S3XA 1Z2GA 1M57B 3ZEDA 2LJ2A 3WB0A 4Z1MG 2NNUA 4CH4A 4UCUA 5LP6B 2BCCH 4X1YA 5BR8B 4WF9V 4DV5B 3P32A 5E1AC 1DGSA 2CTQA 1M1KW 1K8AW 2WLNA 4JI6B 1MNGA 4J9YB 5AG2A 5IJ0A 1M56C 1ZX3A 4WCEV 2P5OA 5LYJB 5B1BB 4O4JB 4IT5A 1B04A 2PI5A 1DF4A 5LGNA 3F7VC 1OHHG 1XL6A 1FD9A 1WP7A 3KG2A 2DOSA 2JDIG 2UXCO 4DV4O 4GUNA 4P2ZA 4OPAA 4F4LA 1TGOA 4PDRA 3G6EV 3N2KA 1SA0B 1K5QA 5CMUA 2ZM6B 2WPDG 4MTXA 1K9MW 4UCTA 4YXWG 2ZDIC 4NVPA 4LFBO 4Q20A 4GKKB 4KFMA 3LUTB 2OIGA 2OTLV 4LCUC 3D3QA 1TUBA 4PV1B 2ZR2A 5J2TB 5BY1A 1K3EA 4I5SA 3P30A 2FYUH 3OMAB 5LMNB 3W7XA 1XBLA 1KBHA 1JCHA 3ZJZA 2EZPA 2YS8A 4LF4O 3J81N 1SERA 5LBQA 3FB8C 2B1GA 4LF8B 1SC5B 3ZMUA 1XNRO 5IJ0B 2IW5A 4DR2O 2HEPA 2YDEA 4IIJA 3RVZA 3N2GB 1I5YA 4H0LB 1YHQV 4BIUA 4X1IA 4TV8B 3E2EA 4JAAA 5KA6A 1Q6HA 4B3SB 3RYIA 3N2KB 2QM8A 2EZOA 1MOFA 1VEWA 3CYOA 5GONA 2HHHB 3ASOC 1HP8A 3LDCA 3L74H 3DTUB 2XAHA 4EEQA 1S5LZ 2CH7B 4PELA 3CP1A 1B3QA 1YTFD 3K5MA 1QU7A 3WB2A 3OM3B 3Q4HB 3FYEB 2F1MA 3B8MA 1RFYA 3ETQA 2UXBB 2ARHA 2JK5C 2L6LA 1HNXB 1YIJV 1EZVH 1XUQA 2ADQB 2E75B 2M6YA 4AQYB 2IH1C 1TUEB 2E5LB 1PNMA 3VQWA 4XDJA 1VARA 3JALB 4X89A 4LF5B 3BCCH 1MMMA 1IBMB 3ML0A 5BR8O 4DXWA 3CE2A 1FPOA 4J7KA 3IC9A 1UJWB 1GM8A 2EJ7A 4H13B 5D5PA 3W7WA 1FJGB 4U3JB 2ZXWB 1VF5B 3LNNA 3CX5F 3R65A 3SJBC 3OGIB 4B3MB 5EC1C 5CA3A 4JI0B 3K57A 4X8AA 2EULA 3LNMB 5C8YA 4MVOA 4WBNB 2PZSA 5B1NA 4TUYA 4MW8A 1M90W 3RYHA 2VS0A 5DM6V 5J2UA 4FLVA 4H44B 3JAMN 3BABA 5KAFZ 1YZBA 2DWEC 5B3SB 4DR7B 5LXTB 1K92A 4J42A 5L3GA 2VQEO 2AGAA 4GLXA 4TT3G 2HP8A 3SYAA 1ZUQA 1K4DC 3ZRXA 2X6BA 3AG1B 4FLYA 4ZOLA 3T2MA 1WB8A 1AJPA 3HKEA 2BTQA 4I4TA 4GKKO 1SETA 2ZR3A 2QM4A 3X2QC 5LGUA 3CCQV 3B09A 1I5XA 1IURA 4R6ZA 4U7NA 5BXZA 3H1HH 3EVKA 2KG7A 4KHPB 1EN6A 4FJCC 4GYCB 4GX0A 5LMUB 2A9HA 4X20A 3MHHC 5JH7B 1AP5A 3CRQA 1D2DA 4J7ZA 1GN6A 3ABKC 4YJ3B 1BMFG 2QM7A 4I0XA 4LNUB 4U7OA 1IBLO 1FXKA 4UUJC 5JQGA 3K79A 1XNQB 2BSKA 4UXNA 1G6UA 3RYHB 3CC4V 1QCEA 2WLIA 1G8MA 2XUMA 3OGCC 4DV1B 5J2UB 3WU2Z 4CH5A 2P22C 1F4MA 2CAZC 4TV9B 4WFGA 1GH6A 1O9HA 4JYYA 1VF6A 4G27B 1NJIW 2EILC 3UQ8A 1QNMA 1K7DA 2XAFA 1TAEA 3I5DA 2JS3A 1FFXA 4I4TB 1S5JA 1L0NH 3B4SA 3UM7A 3FAVA 4FLZA 1Q8IA 3I56V 4JAUA 2DYSB 4DR5B 1PNLA 2QWRB 1OCOB 2KG7B 4C7UA 1PKXA 1NS1A 1W0JG 3BHPA 5IWAO 1NR1A 3CCSV 4H33A 3L73H 4X20B 1BCCH 1HNXO 1EFRG 2WA4A 4IYIA 2F4VO 4FM2A 1VQ8V 4JZGA 1WPXA 4I0XB 4JTCB 4CH3A 2Q9LA 5B1OA 1NT2B 3HKCB 2UUCB 4GKJO 1R6TA 2LGQA 1KMIZ 2R9IA 3JAWB 4JI8B 1JA8A 3M7MX 3VQYA 2X0LA 4O2BA 1DF5A 1J5EB 1IVSA 1S72V 3LSQA 1RM1C 1H2MA 2WLLA 1JJ2U 4F6EA 3MAQA 1EZJA 4JI0O 1NI8A 1JX9A 3UCSC 1DK1A 4LF7O 1Q81W 3C90A 3RWRD 3A0HZ 2RQ6A 3HR0A 4LBEC 4ABMA 5H6RA 5L3DA 4UB8Z 3CMAV 4K3AA 5LL6Y 2LFSA 5CN0A 3MHSC 4DR7O 3H1JH 2FKXA 5K1XA 2D3OW 1HWYA 4JI7B 4E2LA 3IC7A 2CK3G 1H2NA 1Y6XA 4MW3A 3JASA 3O9OA 1VQLV 4MVMA 3QTCA 2XT9A 4FM0A 4PDMA 1SQQH 3JSNA 5LGTA 1LUVA 1R6KA 3GWKC 1AVMA 1R3LC 1Z5VA 4EKWA 5EIBD 4X64B 4DV6B 5EBLC 1QBZA 4GT1A 3ABTA 2RN9A 2OCHA 2WLLB 1URFA 3OEHG 5IY5C 1NVPB 1XEQA 1YJNV 4N21A 2O57A 4DR4O 3HKDA 2EIKC 2JEXA 3OE7G 2CUGA 3LSUA 3U10A 2MW2B 4QE7A 2W6JG 5IYCO 2HFEC 4NXMO 1Q90D 4RAIA 4X66B 3OAAG 1N34B 2OCCC 2X6CA 5CB4B 4DV1O 2UUBB 4JI4B 2UXXA 2B1IA 3G67A 1GM9A 2NLJC 1FAFA 3M8AA 3CEIA 1N33O 3DGEA 3AG4C 1GKFA 3LDDA 4FFBA 4FVMA 2P4KA 4NTWA 3JARB 3SYCA 4IHJB 4X9QA 3CC2V 4DV7O 1N36B 5FPOA 1NH2B 1HNZB 3WB1A 2UXDO 3UKMA 1H8HG 3APOA 1ORQC 4I50A 3K5NA 1PL0A 1JQ0A 2F43G 4U3FH 1PV0A 2BE3A 1RSOA 4PI0A 1Q6UA 5LYJA 4DV0B 2YC0A 4O4JA 4DR3B 5JVDB 3DC5A 2ZCEA 1R3JC 1AI4A 4B7KA 1VQ6V 3AG3B 3E86A 4X88A 2UUCO 2KKWA 1MA1A 3LDEA 2HVKC 1IBKB 3CCEV 4JI1B 3RYFB 1KU9A 2R9RB 1YCIA 4GZRB 2Y69C 1SA0A 3ABMC 1VQKV 2EJRA 3AG7A 5H2FZ 4NXNB 4FFBB 3ZRVA 4JYAO 1CP9A 3H9VA 2DWDC 4QIWF 3B2EE 4PA3A 1ENVA 4UV9A 5J9PC 1CXZB 1K4CC 5J2TA 4DV3O 3K03A 5GTHZ 2PY5A 1ZL8A 2CDYA 2G38A 1AI6A 4JPRA 2Q7EA 5EBMC 1TA8A 1W2BU 4B3RB 2QDOA 4I50B 2C2AA 4YIPA 5EK0A 2LW7A 2ZE5A 2DN9A 1SS3A 4UCSA 1BL8A 3OR7C 5EBWC 3QG5A 1RSOB 1GAXA 4X1KB 4D6TH 1J95A 3LSSA 2YI8A 3FFQA 2RCVA 3N2GA 5BZBA 4CC5A 2XHBA 4O4LB 3ZMTA 1XDCA 1S77D 3IGAC 3QNEA 4TV8A 1H2LA 4I55B 4OPHA 1U96A 1AR1B 1KYOF 2QSAA 4X64O 4DV6O 2PTMA 4PA4A 2A79B 4O4IB 3U11A 1H2GA 3T1HB 2HG5C 2B5UA 3ZMZA 4LH7A 2LW1A 1V55C 2OWOA 4F6RB 3G80A 1X59A 4JTAB 2CH7A 5LP6C 2WA3A 5KA5A 3TJTA 3SJAC 1RPOA 3OUFA 3TETA 2LGWA 2QR4A 3WG7B 2PUSA 5B1AC 3Q4HA 4GX2A 5KHKA 3MDSA 4YIOA 4PD4F 1ZL8B 3H1IH 3UO3A 2QTOA 2XAGA 4RO2A 2KSDA 5KHGA 1LR1A 2Y0IA 1XHXA 1KB9F 4FK5C 2WLKA 3ASOB 1B06A 1I7FA 4EB6B 4OXSA 3B40A 3CCJV 3OW2U 1VIBA 1F51A 2EX3A 3L70H 2DMXA 2GV9A 3JALA 5B1BC 1N36O 1HNWO 1BHAA 4EFBA 4WFBV 3JD1A 5LHIA 1HW7A 2LQTA 4CS4A 1Y4MA 4FLUA 2IM9A 1SRYA 1F7YA 3CWBH 4CBCA 3VQVA 2VQFB 3A8TA 4JI5B 3JD0A 5KMGA 4U3JA 2Q67A 4X65B 4J80A 3RFRA 4XBFA 4B3TO 3M99B 4YHHB 4DV0O 1JOYA 4ASUG 4WBNA 4DW1A 4LFAB 3WFVA 1Y74B 2EIMB 1I0HA 2Y0PA 5C93A 3APQA 3FB6C 3AK3A 2GTSA 4JI1O 4KUMA 3TCUA 3CPWU 2DE0X 2BOBC 3CMEV 5LXTA 4DUZB 2YIDA 3DSQA 1KQSU 2EINC 3ETGA 4YJ2B 1IXBA 4PJ0Z 1HDJA 3THOA 4HAMA 1VQNV 2CTPA 3SPJA 3K04A 2QJ1A 1QQCA 5IDJA 3RN4A 4W4LA 5LOVB 1OCZC 3CRAA 3SYQA 2N04A 5H5NA 4DV5O 1YITV 4BW5A 4OX9B 4K8XA 4DV2B 3EXAA 4AI8A 1QHTA 5JH7A 3CCRV 2JGDB 4EFEA 1UPGA 2PF4E 4JI6O 5KMGB 1WA8B 3ETDA 1Y76B 4YJ3A 1JFFA 4LNUA 2WLMA 4ICGA 4LFCB 4YY3B 4FLTA 2CE4A 2ZKOA 1VP7A 5EIBC 3JCUZ 1HR0B 2QEXV 3ASNC 1BGYH 4J9ZB 5K1PA 3ZHQA 3IJ4A 3UT5B 1M9NA 2QE7G 2HJDA 3D3IA 2AHZA 5JWPA 4TV9A 3DXRB 4UFZA 1MABG 1U97A 3K06A 1VF7A 3T1HO 4LWSA 2GDSA 5IYDO 2ZM6O 5F2VO 1WB7A 4PI2A 4P9PA 2JVDA 3OFNG 3OEEG 4W4KA 1M4UA 3J7AU 2JJ1G 5JCOA 1XQ8A 1TVKB 1ZTEA 2Q7GA 3F5WC 3F5TA 2EILB 4JYBA 5LMNO 2EIJC 1NQTA 2ZXWC 2YXHA 5KLVH 5JJNB 3CSXA 1JFFB 3AK1A 4LF8O 1MZEA 4QPJA 1N32B 1S3JA 3HKCA 1FXHA 4MTGA 3JAWA 4FM1A 4MVRA 1N0NA 3KCYA 2AZ0A 2DW4A 1WPBA 2IJIA 2VQFO 1KD1W 2P7TC 4UB6Z 3K08A 4WFHA 4B3SO 1GO3F 5EZYB 4XDLA 4QE9A 2ZIMA 4X65O 1OV9A 4BWAA 2V7QG 2OIEA 2AZ2A 4LWSB 3OTOB 4D7TA 3T1YB 4YHHO 2HHHO 1I94B 2GUZB 2H8PC 3B77A 1R3KC 3IFXA 4LFAO 1CPYA 4WFAV 3OMIB 1N0JA 1RM1B 4DR1B 2WLHA 1SQBH 4NYKA 2W0XA 4J7JA 1QR8A 4DW0A 3H1LH 2ZE6A 2Q68A 3KZIZ 1IDSA 3A0RA 1P49A 5HFLA 1IXMA 3STZC 2XTAA 2UXBO 1F23A 1V9PA 1Q5OA 4X62B 1XMOB 1YVWA 4LF6B 5IYZB 3ZS8C 2F66C 3OUSA 4AQYO 2E5LO 5FPRA 1RPRA 3OTFA 3K0GA 4LF5O 4MTFA 1IBMO 1KP3A 2IJJA 1SF9A 2ZT9B 3RW0A 5KHHA 3T4ZA 4PHZA 4CS3A 2ZE8A 5TISZ 4N23A 4LF9B 2F95B 3JSLA 4DV2O 1AI5A 1WJZA 2RJZA 2DYRB 4GCZA 1M5IA 1S0VA 1QLNA 2Z0AA 3OMNB 5EC2C 2A7WA 2BTOA 1YJWV 1FJGO 3SPHA 5B5EZ 1BHBA 3P3NA 4E4EA 3A0BZ 1N4CA 2BOCC 1FXVA 4L87A 4B3MO 4YY3O 2ITCC 4BR6A 3JCZA 2P4VA 3QO8A 4MVSA 1HR0O 4JV5B 3ETEA 5CB4A 4P30A 2IU0A 2DYSC 1NBMG 1V54B 2YIBA 3OR6C 2NN4A 4XDKA 4FIPC 4JASA 3RT3C 1QLEC 4JI2B 3A2FA 4BW9A 2AW9A 2MK3A 1E1RG 4FMTA 1ZWIC 2ZIOA 3JARA 1H2SB 2F93B 4IHJA 1OCRC 3ZHVA 4I9QA 2XNDG 1KKCA 1OCCC 3D36A 2OCCB 2HJFC 1FXKC 4J41A 5D5QA 4HNAB 1MG1A 1GM7A 3K5OA 3AG4B 2P67A 1S5HC 3R66A 4KHPO 3FX7A 1K73W 3SJQC 5GTIZ 4KP4A 2ZNIA 3G4SV 4CZZA 1AJQA 2K9PA 5LMUO 1YTFB 4JYCA 2GSMB 3F7YC 5CA0B 2ZQMA 1VF6C 2LP7A 4TOIA 2IH3C 1GN3A 2AHYA 3CS5A 3P3PA 3ZMVA 5JVDA 2OT5A 1KKDA 1GMGA 1WNSA 2PGGA 2A0LA 1XNQO 2E3CA 1L0LH 4DV4B 1AR5A 1AJNA 3RYFA 4DR6B 1BSMA 1MSDA 3BEHA 3JYCA 2QWPB 3K58A 1BZKA 5IJ9A 5CA1B 5ITZB 4LFBB 2ETNA 1Y66A 2FB5A 1LUWA 4GX5A 5HFMA 1SQFA 3ABUA 3TXSA 3ZRWB 2Q73A 1I94O 2XAQA 3HKBB 2W6IG 3FD9A 5DECA 2R9AA 3JATB 2Y69B 3BVOA 4MSWC 4JTDB 4DR5O 4UVCA 1NTKH 4KXRA 1NKDA 3ABLC 5IYBO 2ZDIA 1THZA 3VBBA 3CCVV 5KAIZ 1BS3A 1XNRB 4IGGA 2Q0OC 3K3WA 1G1XB 1XMOO 4DUYB 3BFRA 2ZNJA 1XMQB 4I9WA 4R50A 4X1KA 1EN5A 5BMVB 1YEWA 3QO7A 2YICA 1KUQA 2CGOA 4O4LA 1JMKC 2GTAA 2HVJC 5LHHA 4JI8O 4NR1A 3DC6A 3ZN1A 4I55A 2Q69A 1J5EO 5IJ9B 4O4IA 1D5NA 1M56B 3NXSA 4JGSA 3JAKB 2WWWA 5JJEB 2OYQA 1ROPA 1WAZA 1O9GA 4J10A 4PA6A 1JR9A 4F6RA 3JD3A 3U0ZA 1KP2A 1XREA 2KB1A 2JGUA 2XASA 5DN6G 2YI9A 5KHIA 4O2AB 5L3BA 4CS2A 2IJHA 2RNBA 5FL7G 2QTSA 2CTWA 3G6BA 3GB7C 2H3OA 3NR7A 1GK9A 3D8CA 1VQ7V 1V55B 1QVGU 2P90A 4JI2O 1H8EG 4L8JA 2JS5A 4JI7O 4EB6A 2Q8VA 3E8BA 4DK0A 3RYCA 4K8ZA 5B1AB 3CXHF 3E8FA 1XI1A 3HB3B 1R1BA 2P6JA 3AG3C 3E22B 4B08A 3AG2C 1X4TA 1NR7A 2GHYA 4UVAA
chains in the Genus database with same CATH topology
2N04A 2LGWA 2QWNB 1FPOA 4J80A 2DMXA 1BQ0A 2QSAA 2YUAA 2CUGA 3APOA 2EJ7A 1NZ6A 2GUZA 2DN9A 2Y4UA 2QWQB 1HDJA 4J7ZA 2L6LA 3UO3A 3UO2A 2CTRA 1GH6A 1N4CA 4RWUA 2QWRB 1XBLA 2N05A 2CTPA 4IT5A 1BQZA 1IURA 2LO1A 2M6YA 2PF4E 2Y4TA 3APQA 2CTWA 2YS8A 2CTQA 3UCSC 2QWPB 2QWOB 3AG7A 2OCHA 2KQXA 1WJZA 1FAFA 2GUZB 3BVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N04 A;  2LGW A;  2QWN B;  1FPO A;  4J80 A;  2DMX A;  1BQ0 A;  2QSA A;  2YUA A;  2CUG A;  3APO A;  2EJ7 A;  1NZ6 A;  2GUZ A;  2DN9 A;  2Y4U A;  2QWQ B;  1HDJ A;  4J7Z A;  2L6L A;  3UO3 A;  3UO2 A;  2CTR A;  1GH6 A;  1N4C A;  4RWU A;  2QWR B;  1XBL A;  2N05 A;  2CTP A;  4IT5 A;  1BQZ A;  1IUR A;  2LO1 A;  2M6Y A;  2PF4 E;  2Y4T A;  3APQ A;  2CTW A;  2YS8 A;  2CTQ A;  3UCS C;  2QWP B;  2QWO B;  3AG7 A;  2OCH A;  2KQX A;  1WJZ A;  1FAF A;  2GUZ B;  3BVO A; 
#chains in the Genus database with same CATH topology
 5B66 Z;  2ZIN A;  1XL4 A;  2X7R B;  1FS0 G;  5IE9 A;  4FZ0 A;  1NTZ H;  2FL4 A;  2Z5U A;  1QR9 A;  2PYL A;  1M57 C;  2YEV B;  4JI3 B;  2A06 H;  2IBZ H;  2GBO A;  4UVB A;  1R73 A;  5JJJ B;  3E89 A;  1Y74 A;  1VMG A;  2Q4P A;  3QVN A;  2D2C B;  4DYL A;  1W0K G;  4X66 O;  1N34 O;  4DR6 O;  1VQP V;  4HYO A;  1S76 D;  2VQE B;  2CGN A;  3ZRS A;  4JI4 O;  2UUB O;  3ZHU A;  4RWU A;  4K35 A;  1F4N A;  4YJ2 A;  4MT8 A;  1GTO A;  3S3W A;  4QJF B;  1PM9 A;  2HKO A;  3K0D A;  1EBO A;  1M93 A;  2H94 A;  1Q6I A;  4ZHQ A;  3BRC A;  5E79 Z;  4WFE A;  3BA9 A;  5EYP A;  3RYC B;  4X1Y B;  3ZN0 A;  3CHX A;  2M7W A;  4PA7 A;  5LOV A;  1K5S A;  2JEU A;  2QKA A;  1MZF A;  4LH6 A;  3CRR A;  4O4H A;  4TSF G;  1HNZ O;  2F23 A;  1YXB A;  1E79 G;  2EIN B;  3CCL V;  2V1D A;  1GN2 A;  1KEC A;  2JGD A;  1T5E A;  1DLB A;  1IBL B;  1WA8 A;  2QWN B;  4QGP A;  1Y76 A;  4KL1 A;  1PP9 H;  3GVM A;  4DUY O;  1OCZ B;  1XMQ O;  1PPJ H;  4DR3 O;  4HZ3 A;  3CXC U;  1LNQ A;  3UT5 A;  2P06 A;  2HLD G;  3WG7 C;  5L3C A;  1IBK O;  1YJ9 V;  1AR4 A;  4CC6 A;  1L1F A;  3ZHT A;  5A9G A;  3DXR A;  3SPI A;  4BIO A;  4NXN O;  2XAJ A;  4AHC A;  1R3I C;  3ASN B;  1TUB B;  4ZHQ B;  1FKA O;  3E8G A;  1SQV H;  4A5U B;  5EYP B;  1TVK A;  3H01 A;  1P7G A;  1W59 A;  4UV8 A;  2VRZ A;  1NVP D;  1EN4 A;  4NB5 A;  2PYJ A;  1PD3 A;  5IWA B;  1FYJ A;  1KC8 W;  4O4H B;  5A2Q N;  3KCX A;  2ILM A;  1L8D A;  4RUE A;  5LHG A;  2VWJ A;  2F4V B;  1ZAU A;  4B3R O;  2W0F C;  2QGN A;  2ZD9 A;  3X2Q B;  2YIB D;  2KQX A;  1Y67 A;  4GKJ B;  4IIJ B;  1YSC A;  3JD2 A;  2EIM C;  2QA4 V;  2YIA A;  2L35 A;  4MVU A;  3ZBH A;  4K0K B;  3UO2 A;  4X1I B;  2EIJ B;  2IJK A;  3HPL C;  5DED A;  2ZE7 A;  5FNV A;  1R6N A;  3RYI B;  1NH2 D;  1H38 A;  3ZIA G;  1K34 A;  3ABK B;  5IT9 N;  3RBZ A;  3L72 H;  4UCO A;  5EZY A;  5GON B;  4D7S A;  3EFF K;  2YSU B;  1ZSP A;  3K9A A;  4MS2 A;  1AP6 A;  4JI3 O;  4LF7 B;  2GUZ A;  4G2K A;  3SPG A;  4Z1V A;  1MSW D;  4UCR A;  2E74 B;  2FML A;  5KHJ A;  5L3F A;  3ZCC A;  4DO2 A;  3I55 V;  5H9C A;  3CB2 A;  3E35 A;  1A32 A;  2ODM A;  2R72 A;  1K97 A;  5KUK A;  2EBO A;  5IYZ A;  3K59 A;  4ZI7 A;  4BAY A;  4LC1 A;  2Q7H A;  3SPC A;  2Q6A A;  4FLX A;  2UU9 B;  2UUA B;  1SQG A;  4WFF A;  1Q43 A;  1CEZ A;  3FKS G;  5FNV B;  5B3S C;  4JI5 O;  4Q6G A;  4DR4 B;  3VOU A;  3GWO A;  3OT7 A;  4TWK A;  3C3S A;  5C8Y B;  2Z3Y A;  1BE3 H;  4JF3 A;  3FYI B;  4NXM B;  3AG1 C;  2RDC A;  3SYP A;  4TUY B;  3ZHS A;  1JPX A;  3PN1 A;  3PJS K;  1Q3E A;  1N33 B;  1SQX H;  2Q0A A;  2XOK G;  1I08 A;  5KX5 A;  3SJC C;  1N8R W;  1GN4 A;  1DTO A;  1WLE A;  4DUZ O;  4IYH A;  3E83 A;  2DJV A;  4DV7 B;  2QKC A;  4ZOL B;  3HKE B;  2BTQ B;  2R70 A;  4ZI7 B;  4HBN A;  5CBH A;  4LP8 A;  1RP3 B;  2YXY A;  1P84 F;  2UXD B;  1G4Y B;  3AEI A;  2YXL A;  4HNA A;  3SGI A;  4R8C A;  1SZT A;  2FTK A;  1NU1 H;  1YF2 A;  2WAM A;  2A3Q A;  1VQ5 V;  3QF7 A;  1QLE B;  4CH6 A;  2JIZ G;  4OX9 O;  1H2K A;  3T4D A;  1Z5W A;  1OZ0 A;  4NTY A;  3B8N A;  1OCR B;  3SYO A;  1OCC B;  5CA0 A;  1FXK B;  1ARO P;  5KUM A;  4J11 A;  5JQG B;  1XOU A;  4RQE A;  5L3E A;  2BSK B;  3STL C;  4LFC O;  5FLX N;  1SQP H;  3ZX6 A;  2WLI B;  3L75 H;  3OD4 A;  1B6Q A;  3QO5 A;  3K9S A;  3CD6 V;  4FPP A;  4NKG B;  3KKY A;  5JCO C;  4K0K O;  3J80 N;  5CA1 A;  1OCO C;  4PDV A;  1VQM V;  5KX5 B;  5ITZ A;  4PA9 A;  5IY5 B;  4RQF A;  5CBG A;  4JYA B;  4ZBM A;  2EIK B;  2PI4 A;  3FB7 C;  3ZRW A;  3ZHR A;  3L71 H;  3RVY A;  4DV3 B;  2WSS G;  1XHZ A;  1FFX B;  1FFT B;  1AB3 A;  2LFR A;  3CCM V;  3FAV B;  1XIL A;  3HKB A;  3AK2 A;  3W7U A;  1PNK A;  4PDL A;  2V4D A;  3RGB A;  5GW7 A;  1K33 A;  2YUA A;  3JAT A;  4QPK A;  2HR3 A;  3ZMS A;  2Y4U A;  3MD0 A;  3CRM A;  2VWK A;  4DRX A;  2IU3 A;  4FLW A;  3SR2 C;  1SZX A;  1BQZ A;  2DYR C;  2LO1 A;  3VQX A;  4QNH B;  1WP8 A;  2UXN A;  1GRJ A;  1NTM H;  4G28 B;  3TK1 A;  4R7C A;  2N74 A;  4Z2W A;  2DQ0 A;  3CC7 V;  3W7S A;  2ATK C;  5BMV A;  3TXQ A;  1BQ0 A;  1JJO A;  3CJH A;  2QWQ B;  4JZ2 A;  4OGQ B;  4P9O A;  1N32 O;  2K1E A;  4UCV A;  5CBF A;  1JVM A;  2UU9 O;  4FFK A;  3ABL B;  2UUA O;  2UXC B;  4O2B B;  4MVQ A;  1IX9 A;  1QVF U;  1V54 C;  3BY6 A;  1US6 A;  5LA6 A;  2RMK B;  3O65 A;  3BA8 A;  4IL6 Z;  3IAY A;  3T1C A;  4MVZ A;  4AIL C;  3JAK A;  1SES A;  4MTO A;  3JD4 A;  5H6Q A;  1VQO V;  3W7T A;  1COW G;  3OTO O;  2WLJ A;  3T1Y O;  2E76 B;  4ZIB A;  1AIL A;  3CRC A;  2Y4T A;  3H1K H;  1WN7 A;  1Q7Y W;  1YDX A;  2DQ3 A;  2JJ2 G;  2QWO B;  4GX1 A;  4O2A A;  3FB5 C;  2B9Z A;  3CCU V;  1D5A A;  1BT8 A;  3ABM B;  4H37 A;  4DR1 O;  4RUF A;  4DRX B;  4LF4 B;  2JRI A;  1NZ6 A;  3K5L A;  2Y48 A;  2CTR A;  2ADP A;  3JAS B;  5LP6 A;  1HNW B;  3TGU H;  4BIZ A;  4X62 O;  4ZKI A;  2OTJ V;  4LF6 O;  4DR2 B;  2NR5 A;  1Q82 W;  1ZLZ A;  1IZ3 A;  3BAA A;  1P7B A;  3CJH B;  3E22 A;  3ICX A;  1PL4 A;  3SDL A;  1Q86 W;  1SKV A;  4LF9 O;  4I7Z B;  2N05 A;  4NTX A;  1VQ9 V;  4DK1 A;  1YI2 V;  4B3T B;  5LA6 B;  3G71 V;  2YEV A;  3HKD B;  4B7E A;  1OJH A;  1UFI A;  2AXT Z;  1VQ4 V;  4FZ1 A;  4TQD A;  2ITD C;  3AG2 B;  3D36 C;  4TQF A;  3L9D A;  1EM1 A;  3C3T A;  2X6A A;  2QKS A;  4JV5 O;  1P4R A;  3E8H A;  4JAV A;  3EHB B;  1AI7 A;  1E1Q G;  3N27 A;  2Q5Z A;  3BPZ A;  4LR3 A;  3S3X A;  1Z2G A;  1M57 B;  3ZED A;  2LJ2 A;  3WB0 A;  4Z1M G;  2NNU A;  4CH4 A;  4UCU A;  5LP6 B;  2BCC H;  4X1Y A;  5BR8 B;  4WF9 V;  4DV5 B;  3P32 A;  5E1A C;  1DGS A;  2CTQ A;  1M1K W;  1K8A W;  2WLN A;  4JI6 B;  1MNG A;  4J9Y B;  5AG2 A;  5IJ0 A;  1M56 C;  1ZX3 A;  4WCE V;  2P5O A;  5LYJ B;  5B1B B;  4O4J B;  4IT5 A;  1B04 A;  2PI5 A;  1DF4 A;  5LGN A;  3F7V C;  1OHH G;  1XL6 A;  1FD9 A;  1WP7 A;  3KG2 A;  2DOS A;  2JDI G;  2UXC O;  4DV4 O;  4GUN A;  4P2Z A;  4OPA A;  4F4L A;  1TGO A;  4PDR A;  3G6E V;  3N2K A;  1SA0 B;  1K5Q A;  5CMU A;  2ZM6 B;  2WPD G;  4MTX A;  1K9M W;  4UCT A;  4YXW G;  2ZDI C;  4NVP A;  4LFB O;  4Q20 A;  4GKK B;  4KFM A;  3LUT B;  2OIG A;  2OTL V;  4LCU C;  3D3Q A;  1TUB A;  4PV1 B;  2ZR2 A;  5J2T B;  5BY1 A;  1K3E A;  4I5S A;  3P30 A;  2FYU H;  3OMA B;  5LMN B;  3W7X A;  1XBL A;  1KBH A;  1JCH A;  3ZJZ A;  2EZP A;  2YS8 A;  4LF4 O;  3J81 N;  1SER A;  5LBQ A;  3FB8 C;  2B1G A;  4LF8 B;  1SC5 B;  3ZMU A;  1XNR O;  5IJ0 B;  2IW5 A;  4DR2 O;  2HEP A;  2YDE A;  4IIJ A;  3RVZ A;  3N2G B;  1I5Y A;  4H0L B;  1YHQ V;  4BIU A;  4X1I A;  4TV8 B;  3E2E A;  4JAA A;  5KA6 A;  1Q6H A;  4B3S B;  3RYI A;  3N2K B;  2QM8 A;  2EZO A;  1MOF A;  1VEW A;  3CYO A;  5GON A;  2HHH B;  3ASO C;  1HP8 A;  3LDC A;  3L74 H;  3DTU B;  2XAH A;  4EEQ A;  1S5L Z;  2CH7 B;  4PEL A;  3CP1 A;  1B3Q A;  1YTF D;  3K5M A;  1QU7 A;  3WB2 A;  3OM3 B;  3Q4H B;  3FYE B;  2F1M A;  3B8M A;  1RFY A;  3ETQ A;  2UXB B;  2ARH A;  2JK5 C;  2L6L A;  1HNX B;  1YIJ V;  1EZV H;  1XUQ A;  2ADQ B;  2E75 B;  2M6Y A;  4AQY B;  2IH1 C;  1TUE B;  2E5L B;  1PNM A;  3VQW A;  4XDJ A;  1VAR A;  3JAL B;  4X89 A;  4LF5 B;  3BCC H;  1MMM A;  1IBM B;  3ML0 A;  5BR8 O;  4DXW A;  3CE2 A;  1FPO A;  4J7K A;  3IC9 A;  1UJW B;  1GM8 A;  2EJ7 A;  4H13 B;  5D5P A;  3W7W A;  1FJG B;  4U3J B;  2ZXW B;  1VF5 B;  3LNN A;  3CX5 F;  3R65 A;  3SJB C;  3OGI B;  4B3M B;  5EC1 C;  5CA3 A;  4JI0 B;  3K57 A;  4X8A A;  2EUL A;  3LNM B;  5C8Y A;  4MVO A;  4WBN B;  2PZS A;  5B1N A;  4TUY A;  4MW8 A;  1M90 W;  3RYH A;  2VS0 A;  5DM6 V;  5J2U A;  4FLV A;  4H44 B;  3JAM N;  3BAB A;  5KAF Z;  1YZB A;  2DWE C;  5B3S B;  4DR7 B;  5LXT B;  1K92 A;  4J42 A;  5L3G A;  2VQE O;  2AGA A;  4GLX A;  4TT3 G;  2HP8 A;  3SYA A;  1ZUQ A;  1K4D C;  3ZRX A;  2X6B A;  3AG1 B;  4FLY A;  4ZOL A;  3T2M A;  1WB8 A;  1AJP A;  3HKE A;  2BTQ A;  4I4T A;  4GKK O;  1SET A;  2ZR3 A;  2QM4 A;  3X2Q C;  5LGU A;  3CCQ V;  3B09 A;  1I5X A;  1IUR A;  4R6Z A;  4U7N A;  5BXZ A;  3H1H H;  3EVK A;  2KG7 A;  4KHP B;  1EN6 A;  4FJC C;  4GYC B;  4GX0 A;  5LMU B;  2A9H A;  4X20 A;  3MHH C;  5JH7 B;  1AP5 A;  3CRQ A;  1D2D A;  4J7Z A;  1GN6 A;  3ABK C;  4YJ3 B;  1BMF G;  2QM7 A;  4I0X A;  4LNU B;  4U7O A;  1IBL O;  1FXK A;  4UUJ C;  5JQG A;  3K79 A;  1XNQ B;  2BSK A;  4UXN A;  1G6U A;  3RYH B;  3CC4 V;  1QCE A;  2WLI A;  1G8M A;  2XUM A;  3OGC C;  4DV1 B;  5J2U B;  3WU2 Z;  4CH5 A;  2P22 C;  1F4M A;  2CAZ C;  4TV9 B;  4WFG A;  1GH6 A;  1O9H A;  4JYY A;  1VF6 A;  4G27 B;  1NJI W;  2EIL C;  3UQ8 A;  1QNM A;  1K7D A;  2XAF A;  1TAE A;  3I5D A;  2JS3 A;  1FFX A;  4I4T B;  1S5J A;  1L0N H;  3B4S A;  3UM7 A;  3FAV A;  4FLZ A;  1Q8I A;  3I56 V;  4JAU A;  2DYS B;  4DR5 B;  1PNL A;  2QWR B;  1OCO B;  2KG7 B;  4C7U A;  1PKX A;  1NS1 A;  1W0J G;  3BHP A;  5IWA O;  1NR1 A;  3CCS V;  4H33 A;  3L73 H;  4X20 B;  1BCC H;  1HNX O;  1EFR G;  2WA4 A;  4IYI A;  2F4V O;  4FM2 A;  1VQ8 V;  4JZG A;  1WPX A;  4I0X B;  4JTC B;  4CH3 A;  2Q9L A;  5B1O A;  1NT2 B;  3HKC B;  2UUC B;  4GKJ O;  1R6T A;  2LGQ A;  1KMI Z;  2R9I A;  3JAW B;  4JI8 B;  1JA8 A;  3M7M X;  3VQY A;  2X0L A;  4O2B A;  1DF5 A;  1J5E B;  1IVS A;  1S72 V;  3LSQ A;  1RM1 C;  1H2M A;  2WLL A;  1JJ2 U;  4F6E A;  3MAQ A;  1EZJ A;  4JI0 O;  1NI8 A;  1JX9 A;  3UCS C;  1DK1 A;  4LF7 O;  1Q81 W;  3C90 A;  3RWR D;  3A0H Z;  2RQ6 A;  3HR0 A;  4LBE C;  4ABM A;  5H6R A;  5L3D A;  4UB8 Z;  3CMA V;  4K3A A;  5LL6 Y;  2LFS A;  5CN0 A;  3MHS C;  4DR7 O;  3H1J H;  2FKX A;  5K1X A;  2D3O W;  1HWY A;  4JI7 B;  4E2L A;  3IC7 A;  2CK3 G;  1H2N A;  1Y6X A;  4MW3 A;  3JAS A;  3O9O A;  1VQL V;  4MVM A;  3QTC A;  2XT9 A;  4FM0 A;  4PDM A;  1SQQ H;  3JSN A;  5LGT A;  1LUV A;  1R6K A;  3GWK C;  1AVM A;  1R3L C;  1Z5V A;  4EKW A;  5EIB D;  4X64 B;  4DV6 B;  5EBL C;  1QBZ A;  4GT1 A;  3ABT A;  2RN9 A;  2OCH A;  2WLL B;  1URF A;  3OEH G;  5IY5 C;  1NVP B;  1XEQ A;  1YJN V;  4N21 A;  2O57 A;  4DR4 O;  3HKD A;  2EIK C;  2JEX A;  3OE7 G;  2CUG A;  3LSU A;  3U10 A;  2MW2 B;  4QE7 A;  2W6J G;  5IYC O;  2HFE C;  4NXM O;  1Q90 D;  4RAI A;  4X66 B;  3OAA G;  1N34 B;  2OCC C;  2X6C A;  5CB4 B;  4DV1 O;  2UUB B;  4JI4 B;  2UXX A;  2B1I A;  3G67 A;  1GM9 A;  2NLJ C;  1FAF A;  3M8A A;  3CEI A;  1N33 O;  3DGE A;  3AG4 C;  1GKF A;  3LDD A;  4FFB A;  4FVM A;  2P4K A;  4NTW A;  3JAR B;  3SYC A;  4IHJ B;  4X9Q A;  3CC2 V;  4DV7 O;  1N36 B;  5FPO A;  1NH2 B;  1HNZ B;  3WB1 A;  2UXD O;  3UKM A;  1H8H G;  3APO A;  1ORQ C;  4I50 A;  3K5N A;  1PL0 A;  1JQ0 A;  2F43 G;  4U3F H;  1PV0 A;  2BE3 A;  1RSO A;  4PI0 A;  1Q6U A;  5LYJ A;  4DV0 B;  2YC0 A;  4O4J A;  4DR3 B;  5JVD B;  3DC5 A;  2ZCE A;  1R3J C;  1AI4 A;  4B7K A;  1VQ6 V;  3AG3 B;  3E86 A;  4X88 A;  2UUC O;  2KKW A;  1MA1 A;  3LDE A;  2HVK C;  1IBK B;  3CCE V;  4JI1 B;  3RYF B;  1KU9 A;  2R9R B;  1YCI A;  4GZR B;  2Y69 C;  1SA0 A;  3ABM C;  1VQK V;  2EJR A;  3AG7 A;  5H2F Z;  4NXN B;  4FFB B;  3ZRV A;  4JYA O;  1CP9 A;  3H9V A;  2DWD C;  4QIW F;  3B2E E;  4PA3 A;  1ENV A;  4UV9 A;  5J9P C;  1CXZ B;  1K4C C;  5J2T A;  4DV3 O;  3K03 A;  5GTH Z;  2PY5 A;  1ZL8 A;  2CDY A;  2G38 A;  1AI6 A;  4JPR A;  2Q7E A;  5EBM C;  1TA8 A;  1W2B U;  4B3R B;  2QDO A;  4I50 B;  2C2A A;  4YIP A;  5EK0 A;  2LW7 A;  2ZE5 A;  2DN9 A;  1SS3 A;  4UCS A;  1BL8 A;  3OR7 C;  5EBW C;  3QG5 A;  1RSO B;  1GAX A;  4X1K B;  4D6T H;  1J95 A;  3LSS A;  2YI8 A;  3FFQ A;  2RCV A;  3N2G A;  5BZB A;  4CC5 A;  2XHB A;  4O4L B;  3ZMT A;  1XDC A;  1S77 D;  3IGA C;  3QNE A;  4TV8 A;  1H2L A;  4I55 B;  4OPH A;  1U96 A;  1AR1 B;  1KYO F;  2QSA A;  4X64 O;  4DV6 O;  2PTM A;  4PA4 A;  2A79 B;  4O4I B;  3U11 A;  1H2G A;  3T1H B;  2HG5 C;  2B5U A;  3ZMZ A;  4LH7 A;  2LW1 A;  1V55 C;  2OWO A;  4F6R B;  3G80 A;  1X59 A;  4JTA B;  2CH7 A;  5LP6 C;  2WA3 A;  5KA5 A;  3TJT A;  3SJA C;  1RPO A;  3OUF A;  3TET A;  2LGW A;  2QR4 A;  3WG7 B;  2PUS A;  5B1A C;  3Q4H A;  4GX2 A;  5KHK A;  3MDS A;  4YIO A;  4PD4 F;  1ZL8 B;  3H1I H;  3UO3 A;  2QTO A;  2XAG A;  4RO2 A;  2KSD A;  5KHG A;  1LR1 A;  2Y0I A;  1XHX A;  1KB9 F;  4FK5 C;  2WLK A;  3ASO B;  1B06 A;  1I7F A;  4EB6 B;  4OXS A;  3B40 A;  3CCJ V;  3OW2 U;  1VIB A;  1F51 A;  2EX3 A;  3L70 H;  2DMX A;  2GV9 A;  3JAL A;  5B1B C;  1N36 O;  1HNW O;  1BHA A;  4EFB A;  4WFB V;  3JD1 A;  5LHI A;  1HW7 A;  2LQT A;  4CS4 A;  1Y4M A;  4FLU A;  2IM9 A;  1SRY A;  1F7Y A;  3CWB H;  4CBC A;  3VQV A;  2VQF B;  3A8T A;  4JI5 B;  3JD0 A;  5KMG A;  4U3J A;  2Q67 A;  4X65 B;  4J80 A;  3RFR A;  4XBF A;  4B3T O;  3M99 B;  4YHH B;  4DV0 O;  1JOY A;  4ASU G;  4WBN A;  4DW1 A;  4LFA B;  3WFV A;  1Y74 B;  2EIM B;  1I0H A;  2Y0P A;  5C93 A;  3APQ A;  3FB6 C;  3AK3 A;  2GTS A;  4JI1 O;  4KUM A;  3TCU A;  3CPW U;  2DE0 X;  2BOB C;  3CME V;  5LXT A;  4DUZ B;  2YID A;  3DSQ A;  1KQS U;  2EIN C;  3ETG A;  4YJ2 B;  1IXB A;  4PJ0 Z;  1HDJ A;  3THO A;  4HAM A;  1VQN V;  2CTP A;  3SPJ A;  3K04 A;  2QJ1 A;  1QQC A;  5IDJ A;  3RN4 A;  4W4L A;  5LOV B;  1OCZ C;  3CRA A;  3SYQ A;  2N04 A;  5H5N A;  4DV5 O;  1YIT V;  4BW5 A;  4OX9 B;  4K8X A;  4DV2 B;  3EXA A;  4AI8 A;  1QHT A;  5JH7 A;  3CCR V;  2JGD B;  4EFE A;  1UPG A;  2PF4 E;  4JI6 O;  5KMG B;  1WA8 B;  3ETD A;  1Y76 B;  4YJ3 A;  1JFF A;  4LNU A;  2WLM A;  4ICG A;  4LFC B;  4YY3 B;  4FLT A;  2CE4 A;  2ZKO A;  1VP7 A;  5EIB C;  3JCU Z;  1HR0 B;  2QEX V;  3ASN C;  1BGY H;  4J9Z B;  5K1P A;  3ZHQ A;  3IJ4 A;  3UT5 B;  1M9N A;  2QE7 G;  2HJD A;  3D3I A;  2AHZ A;  5JWP A;  4TV9 A;  3DXR B;  4UFZ A;  1MAB G;  1U97 A;  3K06 A;  1VF7 A;  3T1H O;  4LWS A;  2GDS A;  5IYD O;  2ZM6 O;  5F2V O;  1WB7 A;  4PI2 A;  4P9P A;  2JVD A;  3OFN G;  3OEE G;  4W4K A;  1M4U A;  3J7A U;  2JJ1 G;  5JCO A;  1XQ8 A;  1TVK B;  1ZTE A;  2Q7G A;  3F5W C;  3F5T A;  2EIL B;  4JYB A;  5LMN O;  2EIJ C;  1NQT A;  2ZXW C;  2YXH A;  5KLV H;  5JJN B;  3CSX A;  1JFF B;  3AK1 A;  4LF8 O;  1MZE A;  4QPJ A;  1N32 B;  1S3J A;  3HKC A;  1FXH A;  4MTG A;  3JAW A;  4FM1 A;  4MVR A;  1N0N A;  3KCY A;  2AZ0 A;  2DW4 A;  1WPB A;  2IJI A;  2VQF O;  1KD1 W;  2P7T C;  4UB6 Z;  3K08 A;  4WFH A;  4B3S O;  1GO3 F;  5EZY B;  4XDL A;  4QE9 A;  2ZIM A;  4X65 O;  1OV9 A;  4BWA A;  2V7Q G;  2OIE A;  2AZ2 A;  4LWS B;  3OTO B;  4D7T A;  3T1Y B;  4YHH O;  2HHH O;  1I94 B;  2GUZ B;  2H8P C;  3B77 A;  1R3K C;  3IFX A;  4LFA O;  1CPY A;  4WFA V;  3OMI B;  1N0J A;  1RM1 B;  4DR1 B;  2WLH A;  1SQB H;  4NYK A;  2W0X A;  4J7J A;  1QR8 A;  4DW0 A;  3H1L H;  2ZE6 A;  2Q68 A;  3KZI Z;  1IDS A;  3A0R A;  1P49 A;  5HFL A;  1IXM A;  3STZ C;  2XTA A;  2UXB O;  1F23 A;  1V9P A;  1Q5O A;  4X62 B;  1XMO B;  1YVW A;  4LF6 B;  5IYZ B;  3ZS8 C;  2F66 C;  3OUS A;  4AQY O;  2E5L O;  5FPR A;  1RPR A;  3OTF A;  3K0G A;  4LF5 O;  4MTF A;  1IBM O;  1KP3 A;  2IJJ A;  1SF9 A;  2ZT9 B;  3RW0 A;  5KHH A;  3T4Z A;  4PHZ A;  4CS3 A;  2ZE8 A;  5TIS Z;  4N23 A;  4LF9 B;  2F95 B;  3JSL A;  4DV2 O;  1AI5 A;  1WJZ A;  2RJZ A;  2DYR B;  4GCZ A;  1M5I A;  1S0V A;  1QLN A;  2Z0A A;  3OMN B;  5EC2 C;  2A7W A;  2BTO A;  1YJW V;  1FJG O;  3SPH A;  5B5E Z;  1BHB A;  3P3N A;  4E4E A;  3A0B Z;  1N4C A;  2BOC C;  1FXV A;  4L87 A;  4B3M O;  4YY3 O;  2ITC C;  4BR6 A;  3JCZ A;  2P4V A;  3QO8 A;  4MVS A;  1HR0 O;  4JV5 B;  3ETE A;  5CB4 A;  4P30 A;  2IU0 A;  2DYS C;  1NBM G;  1V54 B;  2YIB A;  3OR6 C;  2NN4 A;  4XDK A;  4FIP C;  4JAS A;  3RT3 C;  1QLE C;  4JI2 B;  3A2F A;  4BW9 A;  2AW9 A;  2MK3 A;  1E1R G;  4FMT A;  1ZWI C;  2ZIO A;  3JAR A;  1H2S B;  2F93 B;  4IHJ A;  1OCR C;  3ZHV A;  4I9Q A;  2XND G;  1KKC A;  1OCC C;  3D36 A;  2OCC B;  2HJF C;  1FXK C;  4J41 A;  5D5Q A;  4HNA B;  1MG1 A;  1GM7 A;  3K5O A;  3AG4 B;  2P67 A;  1S5H C;  3R66 A;  4KHP O;  3FX7 A;  1K73 W;  3SJQ C;  5GTI Z;  4KP4 A;  2ZNI A;  3G4S V;  4CZZ A;  1AJQ A;  2K9P A;  5LMU O;  1YTF B;  4JYC A;  2GSM B;  3F7Y C;  5CA0 B;  2ZQM A;  1VF6 C;  2LP7 A;  4TOI A;  2IH3 C;  1GN3 A;  2AHY A;  3CS5 A;  3P3P A;  3ZMV A;  5JVD A;  2OT5 A;  1KKD A;  1GMG A;  1WNS A;  2PGG A;  2A0L A;  1XNQ O;  2E3C A;  1L0L H;  4DV4 B;  1AR5 A;  1AJN A;  3RYF A;  4DR6 B;  1BSM A;  1MSD A;  3BEH A;  3JYC A;  2QWP B;  3K58 A;  1BZK A;  5IJ9 A;  5CA1 B;  5ITZ B;  4LFB B;  2ETN A;  1Y66 A;  2FB5 A;  1LUW A;  4GX5 A;  5HFM A;  1SQF A;  3ABU A;  3TXS A;  3ZRW B;  2Q73 A;  1I94 O;  2XAQ A;  3HKB B;  2W6I G;  3FD9 A;  5DEC A;  2R9A A;  3JAT B;  2Y69 B;  3BVO A;  4MSW C;  4JTD B;  4DR5 O;  4UVC A;  1NTK H;  4KXR A;  1NKD A;  3ABL C;  5IYB O;  2ZDI A;  1THZ A;  3VBB A;  3CCV V;  5KAI Z;  1BS3 A;  1XNR B;  4IGG A;  2Q0O C;  3K3W A;  1G1X B;  1XMO O;  4DUY B;  3BFR A;  2ZNJ A;  1XMQ B;  4I9W A;  4R50 A;  4X1K A;  1EN5 A;  5BMV B;  1YEW A;  3QO7 A;  2YIC A;  1KUQ A;  2CGO A;  4O4L A;  1JMK C;  2GTA A;  2HVJ C;  5LHH A;  4JI8 O;  4NR1 A;  3DC6 A;  3ZN1 A;  4I55 A;  2Q69 A;  1J5E O;  5IJ9 B;  4O4I A;  1D5N A;  1M56 B;  3NXS A;  4JGS A;  3JAK B;  2WWW A;  5JJE B;  2OYQ A;  1ROP A;  1WAZ A;  1O9G A;  4J10 A;  4PA6 A;  1JR9 A;  4F6R A;  3JD3 A;  3U0Z A;  1KP2 A;  1XRE A;  2KB1 A;  2JGU A;  2XAS A;  5DN6 G;  2YI9 A;  5KHI A;  4O2A B;  5L3B A;  4CS2 A;  2IJH A;  2RNB A;  5FL7 G;  2QTS A;  2CTW A;  3G6B A;  3GB7 C;  2H3O A;  3NR7 A;  1GK9 A;  3D8C A;  1VQ7 V;  1V55 B;  1QVG U;  2P90 A;  4JI2 O;  1H8E G;  4L8J A;  2JS5 A;  4JI7 O;  4EB6 A;  2Q8V A;  3E8B A;  4DK0 A;  3RYC A;  4K8Z A;  5B1A B;  3CXH F;  3E8F A;  1XI1 A;  3HB3 B;  1R1B A;  2P6J A;  3AG3 C;  3E22 B;  4B08 A;  3AG2 C;  1X4T A;  1NR7 A;  2GHY A;  4UVA A; 
#chains in the Genus database with same CATH homology
 2N04 A;  2LGW A;  2QWN B;  1FPO A;  4J80 A;  2DMX A;  1BQ0 A;  2QSA A;  2YUA A;  2CUG A;  3APO A;  2EJ7 A;  1NZ6 A;  2GUZ A;  2DN9 A;  2Y4U A;  2QWQ B;  1HDJ A;  4J7Z A;  2L6L A;  3UO3 A;  3UO2 A;  2CTR A;  1GH6 A;  1N4C A;  4RWU A;  2QWR B;  1XBL A;  2N05 A;  2CTP A;  4IT5 A;  1BQZ A;  1IUR A;  2LO1 A;  2M6Y A;  2PF4 E;  2Y4T A;  3APQ A;  2CTW A;  2YS8 A;  2CTQ A;  3UCS C;  2QWP B;  2QWO B;  3AG7 A;  2OCH A;  2KQX A;  1WJZ A;  1FAF A;  2GUZ B;  3BVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...