2QWNB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-386aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi state
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
MDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
total genus 30
structure length 94
sequence length 94
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwnB00
2GUZB 2QWPB 1WJZA 2GUZA 2CTQA 1FAFA 4J80A 2M6YA 1NZ6A 1FPOA 2N04A 2L6LA 2CTWA 2CUGA 2KQXA 1BQZA 2Y4TA 2LGWA 2QWRB 4IT5A 2CTPA 1HDJA 3APQA 2PF4E 3APOA 1BQ0A 2LO1A 1XBLA 4RWUA 2YUAA 2N05A 2QSAA 2YS8A 2QWQB 2Y4UA 3UCSC 2OCHA 2QWOB 4J7ZA 2CTRA 3AG7A 2QWNB 1GH6A 3UO3A 1N4CA 2EJ7A 2DMXA 1IURA 3UO2A 3BVOA 2DN9A
chains in the Genus database with same CATH superfamily
1VQOV 1SESA 1SRYA 4TV8B 4BW5A 2YC0A 4UXNA 4DR7O 4TSFG 3VQXA 1BMFG 5IJ0A 1K73W 1Y6XA 1NVPD 1MOFA 1W0KG 1XL6A 2DYRC 4CH4A 1SS3A 4BW9A 3C3SA 1M5IA 1HP8A 2NLJC 3K08A 2UUAO 1BCCH 5JQGB 4K35A 2XOKG 4CS3A 1K5QA 4CS2A 4JI2B 5CA0A 5EYPA 2HVJC 3JALA 4TV9A 2QM8A 5AG2A 2Q67A 1RPRA 1YZBA 1KB9F 2R9IA 2YS8A 3AG2C 1V55B 4JGSA 2QEXV 4DUYO 2W6IG 1SQPH 1H2GA 2QA4V 4BR6A 4LF4O 3H9VA 3VBBA 3CCRV 4PELA 3TK1A 4FLXA 2E75B 2Q73A 5EIBD 3QO5A 4NTWA 1XUQA 2JEXA 2F93B 3ZMTA 4B3SO 2X7RB 2Q7EA 4GKKB 3ZCCA 5J2UA 4MSWC 5IYBO 3K59A 1KUQA 1Q90D 3MAQA 4B3RO 4TWKA 3K0GA 1XMOB 3BA9A 1XHXA 4R50A 3RYIB 1GO3F 4DR5B 3LUTB 5ITZA 3CCQV 3CXHF 5LA6B 1GKFA 2O57A 2QWOB 3DSQA 1DF5A 1K4DC 2QWNB 2EJRA 5KX5B 4GT1A 4TUYB 4MW8A 1N0NA 3RWRD 2WLHA 3PJSK 5LOVB 1NVPB 3MHSC 4YHHB 2OCCC 3H01A 4QNHB 2RQ6A 2R9RB 1JJOA 4DR7B 3SYPA 4KUMA 2X6BA 1MMMA 3LDEA 1ROPA 4OPHA 1R6NA 2EILB 5JWPA 4J9YB 3OEHG 2XAGA 5BR8O 2BE3A 2F1MA 5CMUA 1AR4A 4BIZA 4FFKA 2QJ1A 5K1PA 3K9AA 4DV0O 1NQTA 2IW5A 5CBHA 2K9PA 3M7MX 3OTOO 2EX3A 2ZD9A 3B8MA 3E86A 2GUZB 4DUYB 2ZE5A 4XDLA 4X8AA 1AJQA 1WA8A 1RM1C 4LF4B 4FLUA 1PPJH 5TISZ 1PL0A 2HJFC 1PD3A 4K3AA 5LL6Y 3HPLC 2XAJA 5B66Z 2VQEO 4QE7A 3MHHC 2H3OA 4MVQA 5KUMA 4DYLA 3CC4V 1OCCC 4B3SB 3RYHA 4I0XA 4UVBA 3LSUA 2XHBA 4CC6A 4B3MB 1F23A 4KHPO 3CC2V 3L70H 2ZXWB 1R3IC 3L74H 2F43G 4DK1A 4JI8O 1ZL8B 4LF6O 5LP6B 3IJ4A 1FXKC 2GSMB 4B3RB 5FPOA 1OCZC 1ORQC 1LNQA 1IBLB 4HAMA 2QM7A 5CBGA 2JJ1G 4CZZA 3FYIB 3ZHRA 2CK3G 4LFAB 4DR1B 1XREA 3K79A 3CJHA 3CS5A 2F4VB 1LR1A 1SQXH 1H2MA 4GX2A 3ZRWB 4LNUA 1KC8W 3IC9A 1NKDA 4I4TB 4WBNA 1QVFU 1H2SB 4FJCC 4NTXA 3ASNC 3CXCU 3NXSA 2VQFB 2ATKC 1AR1B 2JJ2G 5DECA 3DGEA 5LHIA 4X66O 1KU9A 3AG1B 2FB5A 1YEWA 2HEPA 2CTWA 5BR8B 1BT8A 3HB3B 3SPJA 4FLTA 1GN4A 1QCEA 1BS3A 1TA8A 4FLZA 4FLWA 2AHZA 2ZIOA 4J7ZA 1LUWA 3E83A 4UB8Z 3ABMB 3ZMSA 4P30A 5LGNA 2MK3A 4UFZA 3OTOB 2JEUA 4WFAV 1NJIW 1YIJV 3G6BA 1GTOA 3E8GA 3FFQA 1EN5A 1H8EG 5IDJA 3JASA 1G6UA 4I5SA 5CA1A 1AROP 2VQEB 4HNAA 4L87A 3K5LA 1AVMA 3H1KH 1HNWO 5JJEB 2HFEC 4UUJC 1TVKA 4I9WA 3WG7C 4KHPB 1BQZA 3CSXA 5LBQA 1S5JA 2N05A 3CPWU 2KG7B 4JAAA 1WB7A 3C90A 3DC6A 4DV2O 3HKEB 4ZOLB 5FNVB 1EN4A 1S76D 1MZFA 3OR7C 4JTDB 1DF4A 4Z1VA 2Q7HA 3AEIA 3PN1A 1GN3A 4K0KB 1N36B 4CS4A 4HYOA 2GTAA 1KMIZ 1XBLA 2WLLB 2WSSG 4UCUA 3SDLA 2ZQMA 4I55B 3RYFA 2ODMA 5CBFA 1SQGA 2W6JG 2RN9A 1R6KA 3W7WA 4JZGA 4U7OA 3BFRA 1LUVA 3G80A 1IBMO 2KSDA 4X66B 1H38A 2WA3A 4IYHA 3W7SA 5H5NA 2ZM6B 4RO2A 3SGIA 3OT7A 1DLBA 1F4MA 5BMVB 1VQ8V 1R3JC 4GX5A 4DK0A 2JK5C 4PJ0Z 5EBMC 2W0XA 5LHHA 2F66C 2BTOA 4LF5B 1GK9A 3JD2A 1KKCA 1BHAA 3W7XA 4Q20A 2B9ZA 3RW0A 4GYCB 3VQVA 4U7NA 2ZKOA 5FPRA 2ZIMA 3OTFA 3F5WC 1KBHA 2EIMB 5H6RA 1K8AW 1Y74B 4O4LB 4F6RB 4X9QA 4J11A 3MD0A 4DV3B 2ZT9B 4NKGB 3T4DA 5KMGB 4E4EA 1AB3A 3K04A 5L3FA 1XDCA 2QKAA 4UV8A 4DRXA 4YJ3B 1ZLZA 3RYCB 1QR9A 5CB4B 3S3WA 3K5OA 4UCRA 2BSKA 3OMNB 3GVMA 3WU2Z 1WJZA 1VIBA 4P2ZA 3EVKA 4IHJB 4DR6B 5KHIA 1T5EA 2OIGA 3X2QB 4TQFA 1I7FA 2ETNA 5GONB 5IJ9B 4RUFA 5KLVH 3JARA 2AXTZ 2EULA 2HVKC 4O2BA 3P32A 1YF2A 1IURA 5B1AC 3T2MA 2IJKA 1ENVA 1KQSU 3GWKC 4JPRA 2ZR3A 1OCOC 1YJNV 4FIPC 3C3TA 1IBMB 4W4LA 1B04A 3L9DA 1OCRC 3SJQC 2F23A 1K97A 2QE7G 5FLXN 2VS0A 1E1QG 5LXTB 4JAVA 5KAIZ 2DN9A 2H94A 3HKBB 4I50B 4HZ3A 4MTXA 2YI9A 1R3KC 1K4CC 4PV1B 1VQMV 4EFEA 4JI4O 1UFIA 4IIJA 1RSOB 2LW7A 4GKJB 4O2AB 2JS3A 3ZEDA 2WA4A 2LP7A 4PDMA 3ABKB 1WP8A 1J5EO 1JQ0A 3E2EA 3U11A 4J41A 1R1BA 2QTSA 4XDKA 4DW1A 3JD3A 1AJPA 3OE7G 1PP9H 4ZI7B 2OTLV 5IT9N 4KFMA 4DO2A 4DXWA 1GM7A 2WWWA 3JAWB 2LQTA 2YI8A 1JJ2U 2PYJA 1G8MA 3B8NA 4DV5B 1FFXA 4O4HB 1K5SA 4ZBMA 1L8DA 3HR0A 3E35A 4ZHQB 2GHYA 4UB6Z 1N33O 4DR5O 3AG3C 4BIOA 1W2BU 2HHHO 3FAVB 4ICGA 5EZYA 1NR1A 4X20A 3FB8C 2RNBA 4GLXA 4D7SA 1KECA 1NTKH 1R6TA 3W7UA 2CDYA 3E8HA 1AP6A 5C8YB 5LP6C 3F5TA 1OJHA 1I08A 1Q6IA 3H1LH 4JZ2A 1VP7A 1WN7A 2Y69C 1KYOF 1K34A 1AI6A 4YJ2B 1JA8A 3D3QA 1VEWA 4OXSA 1O9HA 4RQFA 1QR8A 3AG4B 2PTMA 1Q43A 2Q8VA 1NI8A 4PI0A 3ETGA 1XI1A 4LWSB 4R8CA 4O4IA 2WLKA 5DN6G 2WLIB 3SYOA 3T1YO 3CCJV 5GTHZ 4FM1A 1SQVH 4JI4B 4MTGA 3UT5A 2ADPA 3DC5A 3D8CA 1Y4MA 1F7YA 3IAYA 4PA7A 3G6EV 1DGSA 1QBZA 2YXHA 2X0LA 1J5EB 4U3JA 2VWJA 4AI8A 4WFHA 3STZC 4J42A 1S77D 4O4JB 5B1BC 1VARA 4JV5O 3SPHA 2GBOA 3APOA 2P7TC 2E74B 2RJZA 1VQ7V 5E79Z 2OYQA 4B3MO 1J95A 4J10A 2IJIA 2CAZC 3D36A 2DJVA 5L3GA 1CXZB 3ZMUA 2E3CA 4NR1A 3BRCA 1R73A 4F4LA 4H44B 2AZ2A 3BY6A 4TOIA 4FFBB 4RUEA 5IYZB 1N33B 3JAKA 2HHHB 1A32A 4LFAO 4DR1O 1D2DA 2F95B 4PDRA 2L35A 2F4VO 5L3DA 4DR4O 1SF9A 4XBFA 5JVDB 1KP3A 2JGDB 3FYEB 3N2GA 1Q7YW 2WLNA 5LMNO 4NXMB 2C2AA 2YICA 2B1IA 2VQFO 3WB1A 4NTYA 4IL6Z 3D36C 3FB7C 2M7WA 1B3QA 2DYSB 4YIOA 1W59A 2BTQB 2QWPB 4YXWG 4OX9O 2ILMA 4TQDA 3ASOB 2Q0OC 3K3WA 2DW4A 3ZHQA 2IJJA 1UJWB 3CCMV 1QNMA 4UCSA 4DV1O 2PUSA 4W4KA 1BSMA 4X1YB 1TUBB 3T1YB 1X4TA 5KUKA 1FJGO 5H6QA 1FXKA 5KA6A 1ZWIC 4PA9A 4C7UA 1Y74A 2CH7B 2UXXA 2XUMA 5LYJA 2EINB 2UXNA 1NZ6A 3ABLC 3K9SA 5K1XA 1K92A 3G71V 5BY1A 1PL4A 1DK1A 2OT5A 4JV5B 2IBZH 2XTAA 2VWKA 1EN6A 4JI3B 3RFRA 5IY5B 5JH7B 1WNSA 2FKXA 5B3SC 4I7ZB 2EIKB 1M56B 3ABTA 1V54B 4FM0A 1B6QA 3T1HO 1H2NA 1PNKA 1XNQO 1H2LA 5J2TA 1OV9A 2W0FC 3E22B 1P4RA 3LDCA 3W7TA 2YUAA 1Q81W 1FYJA 4QE9A 1OZ0A 4MT8A 3HKCA 4FM2A 3N2KA 1W0JG 1IVSA 3HKDA 3A8TA 2DWDC 4DR4B 4K0KO 1N36O 1S5LZ 1QLEC 3O65A 5B1OA 3SYQA 2QDOA 1MSDA 1HDJA 2DQ0A 5LMNB 4PA4A 1JMKC 3DXRA 2AZ0A 3CB2A 2XNDG 5LXTA 3OUSA 4J7JA 2IJHA 3ZHTA 1M57C 4I50A 4OX9B 4FK5C 2ZM6O 1JFFB 4DV6O 3ZN1A 3FB6C 5JJNB 3JD1A 4DV1B 4LC1A 3QVNA 1Y76B 3AG2B 5F2VO 3Q4HB 1VF5B 4FPPA 2NNUA 2ZR2A 3EHBB 3R66A 3JATA 1FJGB 2Q68A 4EB6A 1AR5A 4LF5O 1L1FA 3OR6C 4Q6GA 5IJ0B 1YTFD 3CD6V 5IYDO 5DEDA 1SQFA 5D5QA 4J9ZB 1YVWA 2V1DA 4JYAO 2Y4UA 5KHJA 2UU9B 2MW2B 4DV3O 3QO7A 1D5NA 2A9HA 1XILA 3BABA 4X1KA 5CA0B 5EYPB 3QTCA 3JALB 4TV9B 2AHYA 2N04A 3T1HB 2KQXA 1XNQB 3LSSA 1XEQA 1SA0A 2OTJV 3UM7A 4X1IA 3JSNA 2YEVA 1NR7A 4N23A 3LDDA 2E5LO 1WB8A 5KA5A 4DR6O 2QGNA 4X89A 4N21A 2P4KA 4R7CA 4TV8A 4LF9O 2EIJC 1EZJA 4JI0B 2WLMA 4CBCA 2OCCB 3TJTA 4LF8B 5KHGA 3T1CA 2P5OA 1FFTB 1N32O 5J2UB 2HP8A 1NU1H 3UO3A 2FTKA 5JJJB 1VQKV 1VQ4V 4ASUG 1YCIA 2PI5A 3FKSG 1HNZB 2CTQA 2M6YA 5JQGA 1Q6UA 3RGBA 4PI2A 1Q6HA 5JCOA 5ITZB 2WLIA 1MNGA 3K06A 4DV6B 2YSUB 3KZIZ 2NN4A 3OGCC 4B7KA 1YTFB 5HFLA 1NH2D 4DV7B 5A2QN 2OWOA 1HWYA 2HLDG 3J81N 4GKJO 1RM1B 3P3NA 1SKVA 1YSCA 2HKOA 3B09A 2UUBO 2ADQB 4H37A 4PA6A 4MVUA 2UXCB 1VF6A 1PV0A 1GH6A 2AW9A 5H9CA 4JYAB 2Y48A 4LH6A 1OCCB 1S72V 2A7WA 3WB2A 3ZMVA 3OMAB 3K58A 2P90A 3P30A 5JCOC 4JI7O 2IM9A 4MTOA 3JCUZ 1M1KW 2PF4E 1EFRG 1V55C 2ZNJA 3RYIA 4B7EA 1K33A 2P67A 2PYLA 4DV5O 2XAHA 1OCZB 5LA6A 4LFCO 1THZA 4DW0A 2NR5A 5GW7A 1V9PA 3B40A 1YITV 5KX5A 4GX1A 4AQYB 1U97A 1WA8B 4TUYA 1IXBA 5KAFZ 3JCZA 5LOVA 2E5LB 3BEHA 1P7GA 1KP2A 5CA3A 2Q6AA 1VF6C 4QPJA 4LF9B 1QQCA 3RYHB 4I0XB 3ASNB 3VQYA 1FXVA 1N32B 2Z0AA 4H13B 3ZN0A 5E1AC 1VF7A 2Q0AA 3B77A 2Y0IA 4I9QA 4CH5A 4RWUA 3ETQA 5BXZA 2H8PC 3EFFK 4Z2WA 1VQ9V 1MA1A 3VOUA 1RFYA 2KKWA 3B4SA 2X6AA 3L75H 3CJHB 1IBKO 2GV9A 4WFFA 2GUZA 4IGGA 3CHXA 4LNUB 1JX9A 2CUGA 2KB1A 4WBNB 5BZBA 5L3BA 3CWBH 2JRIA 3QG5A 4K8XA 3ZBHA 1G1XB 2XASA 5CN0A 1GN2A 2EILC 3CRRA 2UUBB 1JVMA 1BZKA 2YXYA 2LFSA 4PD4F 2YIBA 4AHCA 4CC5A 1SZTA 3KG2A 1QU7A 3M8AA 1NTZH 3TETA 4ABMA 3WG7B 4JI7B 2UXBO 1ZL8A 5LP6A 1F4NA 1R3LC 3E8FA 3H1JH 4R6ZA 4YY3O 1K7DA 1US6A 5EIBC 2DMXA 2Z5UA 3FD9A 3BHPA 3KCXA 4LFCB 1K9MW 4DR3O 2RCVA 1EM1A 4GCZA 4MVSA 2Q69A 3SYAA 1NTMH 1S5HC 4DR2O 3ZRWA 3R65A 3JASB 2FYUH 4X62O 4I4TA 3A2FA 5CA1B 1M56C 2XAFA 4HNAB 3WFVA 4E2LA 2EJ7A 1Z5VA 4PDLA 3ZMZA 2ZXWC 3K57A 1TVKB 4B08A 1N0JA 1COWG 4NXMO 3IC7A 3NR7A 1XNRO 1D5AA 1AI4A 1TAEA 2ITDC 1HNXO 1FPOA 2PI4A 3ETDA 4A5UB 4GUNA 3FX7A 2IU3A 1SETA 1H2KA 4KL1A 1VMGA 1BQ0A 3SPCA 3BPZA 2LW1A 1WLEA 3OW2U 1O9GA 1IZ3A 2UUCO 3CRCA 4LFBO 1Q86W 1IBKB 3TCUA 5DM6V 2LJ2A 1CPYA 4BWAA 2A0LA 2YXLA 1MABG 2JGUA 3RYFB 3ZIAG 2BOBC 1M90W 1Q82W 3J7AU 4JTCB 1SC5B 3ZS8C 3AG1C 4MTFA 2P6JA 1BL8A 2GDSA 4IT5A 1SQQH 4TT3G 3I56V 4JI3O 4U3FH 1TGOA 2UXBB 1SZXA 2KG7A 3ABMC 1U96A 1HW7A 4YY3B 3H1IH 1YI2V 1WPXA 3HKEA 4ZOLA 4X64B 3CMAV 5FNVA 4X65O 4P9OA 1B06A 4JYCA 2R9AA 4DR3B 1P84F 2QKSA 1RP3B 5LHGA 1WAZA 3ML0A 2ZNIA 1NS1A 2LFRA 4DR2B 2WLLA 4JI5O 1YDXA 3JD4A 4X62B 4I55A 4RAIA 1YXBA 1VQ5V 5B1AB 1AI5A 1G4YB 3CRMA 4MVMA 2YIBD 1JOYA 3TXQA 4MVRA 2L6LA 2WLJA 3VQWA 5D5PA 5IWAB 1XNRB 2CTPA 4LH7A 4D7TA 1HNXB 1OCOB 4HBNA 4DRXB 4NXNB 3SR2C 3CCSV 4DV4O 1OCRB 4LP8A 1F51A 1ZTEA 2BSKB 1E1RG 1CP9A 5KHKA 1PKXA 1QHTA 5BMVA 2ZDIA 2N74A 3CMEV 3CP1A 2G38A 4WCEV 2QWRB 2UUCB 5LGTA 4LFBB 1OHHG 3JARB 4JTAB 4O2BB 3AG7A 4QIWF 3RN4A 4OPAA 3CRAA 1GAXA 1AILA 3LNNA 4H33A 2B1GA 4O4LA 4F6RA 1QLNA 5C93A 1AP5A 2UUAB 1Q5OA 2DWEC 3THOA 4JI1O 4OGQB 5KMGA 2ZINA 2UU9O 1HR0O 1PM9A 5EK0A 1EBOA 3JD0A 4YJ3A 3RYCA 5EC1C 2ZDIC 5CB4A 3H1HH 4QJFB 1I94O 1FAFA 4IHJA 4X65B 3K5NA 3ZRVA 4IIJB 2R70A 2LO1A 4LF7O 3AG3B 3UKMA 5IJ9A 5GONA 3AK3A 5EBWC 2EIMC 1I5YA 4WFBV 3J80N 1VQ6V 1WP7A 3BA8A 1FKAO 4JI5B 3SPGA 2B5UA 3CCEV 1VQLV 2QM4A 2WPDG 4JI0O 5IYCO 1YHQV 4LF8O 2PY5A 3CE2A 4QGPA 1N34O 2P22C 3APQA 4FVMA 4G28B 2DOSA 3I5DA 2Y69B 2QWQB 1SQBH 2DQ3A 2QR4A 2DE0X 2Q9LA 1Y67A 2DYRB 3UO2A 1HNZO 1FFXB 3T4ZA 3L71H 3F7VC 4DV4B 4FMTA 1M4UA 3HKBA 4WFEA 2UXDO 1MG1A 3BCCH 3DTUB 4UCTA 3X2QC 5EZYB 2HR3A 1KD1W 3K03A 4X20B 2YIDA 4KXRA 3JYCA 1RSOA 3G67A 1MSWD 3UCSC 2OCHA 4O2AA 3CCLV 1Z5WA 3QO8A 4JF3A 2V7QG 2ZE8A 1PNLA 3AK1A 4UCVA 3A0RA 4DV7O 1FS0G 4J80A 3G4SV 1P7BA 4UVCA 3K5MA 5EBLC 4CH3A 1UPGA 4ZI7A 1CEZA 4P9PA 2JDIG 5B1BB 4MVZA 2UXCO 3JAWA 3BAAA 4JI1B 4FLYA 4H0LB 1M9NA 4G27B 4DV0B 3CRQA 3OGIB 3AK2A 1HR0B 2ARHA 1XOUA 3JAMN 2A79B 1Y66A 1DTOA 5HFMA 4O4HA 1I5XA 2ZE7A 4JASA 4O4IB 3S3XA 5L3CA 3D3IA 1I94B 4ZHQA 3E89A 1X59A 2K1EA 3WB0A 5LGUA 1Q8IA 3FAVA 3RVZA 1TUEB 3UT5B 3ABKC 3OAAG 1FD9A 4JI6O 3LSQA 2CGNA 4LF7B 3OM3B 1IDSA 4AQYO 2CE4A 1PNMA 4U3JB 1WPBA 1VQPV 3ICXA 5C8YA 3KCYA 4NVPA 4D6TH 4JI8B 1S0VA 4NB5A 4LF6B 2IH1C 1QVGU 2QSAA 1N34B 4YJ2A 3MDSA 1Q3EA 1N4CA 1AJNA 2PZSA 3ZRSA 2ZCEA 2Z3YA 2XAQA 3STLC 2EBOA 2P4VA 1XMQO 4LWSA 2HG5C 3U10A 1GMGA 3ZHSA 2UXDB 3JAKB 3L73H 4WF9V 4UCOA 1VQNV 5LMUO 2CTRA 3ZRXA 2Q7GA 4FZ0A 2Y0PA 4UVAA 4FZ1A 1FXHA 3I55V 4CH6A 4MVOA 3M99B 1L0LH 3CX5F 3N2GB 1SERA 4QPKA 2LGWA 1XHZA 2GTSA 1ZX3A 2A3QA 4J7KA 4O4JA 2D3OW 3ABLB 4RQEA 1RPOA 1KKDA 2BOCC 1YJWV 3AG4C 3ZX6A 5L3EA 3BVOA 3EXAA 5B3SB 3CEIA 3SJCC 2PGGA 1IXMA 3QNEA 4G2KA 1JR9A 4ZKIA 3A0BZ 1JCHA 4X88A 4K8ZA 4BAYA 4EKWA 3RT3C 3OD4A 4PDVA 4JYYA 2OIEA 3E8BA 3KKYA 4YIPA 1S3JA 3UQ8A 4FFBA 3FB5C 1FXKB 5IYZA 3OFNG 5H2FZ 2EZOA 1BGYH 5KHHA 4GX0A 4WFGA 4JI6B 5LYJB 1XL4A 2D2CB 2Q5ZA 1HNWB 5JVDA 2JGDA 3TXSA 4GZRB 2XT9A 4DUZO 2HJDA 1K3EA 3O9OA 4B3TO 3U0ZA 1QLEB 4F6EA 1JPXA 2P06A 4LBEC 3CCUV 4BIUA 4JAUA 4MS2A 2YDEA 2ZE6A 4LCUC 2BTQA 4DV2B 3SPIA 1NT2B 5J2TB 4IYIA 1M57B 3TGUH 2IH3C 1ZUQA 3ZHUA 2FMLA 5GTIZ 4PA3A 3L72H 3GB7C 1XMQB 2AGAA 1IBLO 2QKCA 5FL7G 3HKCB 1ZSPA 3N2KB 4X1YA 1TUBA 4AILC 4L8JA 1NH2B 3HKDB 2E76B 3GWOA 5LMUB 5A9GA 1BE3H 1N8RW 3OEEG 3SJBC 1EZVH 2CH7A 3CYOA 2R72A 5EC2C 4XDJA 3SYCA 1XQ8A 3B2EE 3K0DA 3DXRB 2RDCA 3IFXA 2DYSC 1I0HA 2JS5A 2YIAA 1IX9A 5JH7A 5J9PC 1M93A 3ASOC 4JI2O 3RBZA 3CCVV 5B1NA 4EFBA 4ZIBA 3OMIB 3OUFA 1GM9A 3ABUA 2IU0A 4NYKA 2JIZG 2LGQA 3E22A 3F7YC 3ZHVA 3IGAC 5IE9A 3JSLA 3JATB 3ZJZA 4X64O 2V4DA 3RVYA 1AI7A 2CGOA 4EB6B 2EINC 4LR3A 4Z1MG 1NBMG 2RMKB 3SJAC 1L0NH 3ETEA 2Q4PA 2EIJB 1P49A 2A06H 4GKKO 1Z2GA 3LNMB 5IY5C 4DUZB 5B5EZ 1MZEA 2EIKC 4B3TB 2BCCH 1V54C 3QF7A 4FLVA 2X6CA 2WAMA 4X1KB 4PHZA 1XMOO 2JVDA 1H8HG 4EEQA 1URFA 3N27A 2QTOA 5IWAO 4JYBA 2FL4A 1ZAUA 4UV9A 1E79G 2Y4TA 2ITCC 4NXNO 1GM8A 1JFFA 1SA0B 3A0HZ 2VRZA 4X1IB 2EZPA 2YEVB 1GN6A 3P3PA 1BHBA 4KP4A 1Y76A 3CC7V 4MW3A 1GRJA 1YJ9V 4YHHO 3Q4HA
chains in the Genus database with same CATH topology
2GUZB 2QWPB 1WJZA 2GUZA 2CTQA 1FAFA 4J80A 2M6YA 1NZ6A 1FPOA 2N04A 2L6LA 2CTWA 2CUGA 2KQXA 1BQZA 2Y4TA 2LGWA 2QWRB 4IT5A 2CTPA 1HDJA 3APQA 2PF4E 3APOA 1BQ0A 2LO1A 1XBLA 4RWUA 2YUAA 2N05A 2QSAA 2YS8A 2QWQB 2Y4UA 3UCSC 2OCHA 2QWOB 4J7ZA 2CTRA 3AG7A 2QWNB 1GH6A 3UO3A 1N4CA 2EJ7A 2DMXA 1IURA 3UO2A 3BVOA 2DN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUZ B;  2QWP B;  1WJZ A;  2GUZ A;  2CTQ A;  1FAF A;  4J80 A;  2M6Y A;  1NZ6 A;  1FPO A;  2N04 A;  2L6L A;  2CTW A;  2CUG A;  2KQX A;  1BQZ A;  2Y4T A;  2LGW A;  2QWR B;  4IT5 A;  2CTP A;  1HDJ A;  3APQ A;  2PF4 E;  3APO A;  1BQ0 A;  2LO1 A;  1XBL A;  4RWU A;  2YUA A;  2N05 A;  2QSA A;  2YS8 A;  2QWQ B;  2Y4U A;  3UCS C;  2OCH A;  2QWO B;  4J7Z A;  2CTR A;  3AG7 A;  2QWN B;  1GH6 A;  3UO3 A;  1N4C A;  2EJ7 A;  2DMX A;  1IUR A;  3UO2 A;  3BVO A;  2DN9 A; 
#chains in the Genus database with same CATH topology
 1VQO V;  1SES A;  1SRY A;  4TV8 B;  4BW5 A;  2YC0 A;  4UXN A;  4DR7 O;  4TSF G;  3VQX A;  1BMF G;  5IJ0 A;  1K73 W;  1Y6X A;  1NVP D;  1MOF A;  1W0K G;  1XL6 A;  2DYR C;  4CH4 A;  1SS3 A;  4BW9 A;  3C3S A;  1M5I A;  1HP8 A;  2NLJ C;  3K08 A;  2UUA O;  1BCC H;  5JQG B;  4K35 A;  2XOK G;  4CS3 A;  1K5Q A;  4CS2 A;  4JI2 B;  5CA0 A;  5EYP A;  2HVJ C;  3JAL A;  4TV9 A;  2QM8 A;  5AG2 A;  2Q67 A;  1RPR A;  1YZB A;  1KB9 F;  2R9I A;  2YS8 A;  3AG2 C;  1V55 B;  4JGS A;  2QEX V;  4DUY O;  2W6I G;  1SQP H;  1H2G A;  2QA4 V;  4BR6 A;  4LF4 O;  3H9V A;  3VBB A;  3CCR V;  4PEL A;  3TK1 A;  4FLX A;  2E75 B;  2Q73 A;  5EIB D;  3QO5 A;  4NTW A;  1XUQ A;  2JEX A;  2F93 B;  3ZMT A;  4B3S O;  2X7R B;  2Q7E A;  4GKK B;  3ZCC A;  5J2U A;  4MSW C;  5IYB O;  3K59 A;  1KUQ A;  1Q90 D;  3MAQ A;  4B3R O;  4TWK A;  3K0G A;  1XMO B;  3BA9 A;  1XHX A;  4R50 A;  3RYI B;  1GO3 F;  4DR5 B;  3LUT B;  5ITZ A;  3CCQ V;  3CXH F;  5LA6 B;  1GKF A;  2O57 A;  2QWO B;  3DSQ A;  1DF5 A;  1K4D C;  2QWN B;  2EJR A;  5KX5 B;  4GT1 A;  4TUY B;  4MW8 A;  1N0N A;  3RWR D;  2WLH A;  3PJS K;  5LOV B;  1NVP B;  3MHS C;  4YHH B;  2OCC C;  3H01 A;  4QNH B;  2RQ6 A;  2R9R B;  1JJO A;  4DR7 B;  3SYP A;  4KUM A;  2X6B A;  1MMM A;  3LDE A;  1ROP A;  4OPH A;  1R6N A;  2EIL B;  5JWP A;  4J9Y B;  3OEH G;  2XAG A;  5BR8 O;  2BE3 A;  2F1M A;  5CMU A;  1AR4 A;  4BIZ A;  4FFK A;  2QJ1 A;  5K1P A;  3K9A A;  4DV0 O;  1NQT A;  2IW5 A;  5CBH A;  2K9P A;  3M7M X;  3OTO O;  2EX3 A;  2ZD9 A;  3B8M A;  3E86 A;  2GUZ B;  4DUY B;  2ZE5 A;  4XDL A;  4X8A A;  1AJQ A;  1WA8 A;  1RM1 C;  4LF4 B;  4FLU A;  1PPJ H;  5TIS Z;  1PL0 A;  2HJF C;  1PD3 A;  4K3A A;  5LL6 Y;  3HPL C;  2XAJ A;  5B66 Z;  2VQE O;  4QE7 A;  3MHH C;  2H3O A;  4MVQ A;  5KUM A;  4DYL A;  3CC4 V;  1OCC C;  4B3S B;  3RYH A;  4I0X A;  4UVB A;  3LSU A;  2XHB A;  4CC6 A;  4B3M B;  1F23 A;  4KHP O;  3CC2 V;  3L70 H;  2ZXW B;  1R3I C;  3L74 H;  2F43 G;  4DK1 A;  4JI8 O;  1ZL8 B;  4LF6 O;  5LP6 B;  3IJ4 A;  1FXK C;  2GSM B;  4B3R B;  5FPO A;  1OCZ C;  1ORQ C;  1LNQ A;  1IBL B;  4HAM A;  2QM7 A;  5CBG A;  2JJ1 G;  4CZZ A;  3FYI B;  3ZHR A;  2CK3 G;  4LFA B;  4DR1 B;  1XRE A;  3K79 A;  3CJH A;  3CS5 A;  2F4V B;  1LR1 A;  1SQX H;  1H2M A;  4GX2 A;  3ZRW B;  4LNU A;  1KC8 W;  3IC9 A;  1NKD A;  4I4T B;  4WBN A;  1QVF U;  1H2S B;  4FJC C;  4NTX A;  3ASN C;  3CXC U;  3NXS A;  2VQF B;  2ATK C;  1AR1 B;  2JJ2 G;  5DEC A;  3DGE A;  5LHI A;  4X66 O;  1KU9 A;  3AG1 B;  2FB5 A;  1YEW A;  2HEP A;  2CTW A;  5BR8 B;  1BT8 A;  3HB3 B;  3SPJ A;  4FLT A;  1GN4 A;  1QCE A;  1BS3 A;  1TA8 A;  4FLZ A;  4FLW A;  2AHZ A;  2ZIO A;  4J7Z A;  1LUW A;  3E83 A;  4UB8 Z;  3ABM B;  3ZMS A;  4P30 A;  5LGN A;  2MK3 A;  4UFZ A;  3OTO B;  2JEU A;  4WFA V;  1NJI W;  1YIJ V;  3G6B A;  1GTO A;  3E8G A;  3FFQ A;  1EN5 A;  1H8E G;  5IDJ A;  3JAS A;  1G6U A;  4I5S A;  5CA1 A;  1ARO P;  2VQE B;  4HNA A;  4L87 A;  3K5L A;  1AVM A;  3H1K H;  1HNW O;  5JJE B;  2HFE C;  4UUJ C;  1TVK A;  4I9W A;  3WG7 C;  4KHP B;  1BQZ A;  3CSX A;  5LBQ A;  1S5J A;  2N05 A;  3CPW U;  2KG7 B;  4JAA A;  1WB7 A;  3C90 A;  3DC6 A;  4DV2 O;  3HKE B;  4ZOL B;  5FNV B;  1EN4 A;  1S76 D;  1MZF A;  3OR7 C;  4JTD B;  1DF4 A;  4Z1V A;  2Q7H A;  3AEI A;  3PN1 A;  1GN3 A;  4K0K B;  1N36 B;  4CS4 A;  4HYO A;  2GTA A;  1KMI Z;  1XBL A;  2WLL B;  2WSS G;  4UCU A;  3SDL A;  2ZQM A;  4I55 B;  3RYF A;  2ODM A;  5CBF A;  1SQG A;  2W6J G;  2RN9 A;  1R6K A;  3W7W A;  4JZG A;  4U7O A;  3BFR A;  1LUV A;  3G80 A;  1IBM O;  2KSD A;  4X66 B;  1H38 A;  2WA3 A;  4IYH A;  3W7S A;  5H5N A;  2ZM6 B;  4RO2 A;  3SGI A;  3OT7 A;  1DLB A;  1F4M A;  5BMV B;  1VQ8 V;  1R3J C;  4GX5 A;  4DK0 A;  2JK5 C;  4PJ0 Z;  5EBM C;  2W0X A;  5LHH A;  2F66 C;  2BTO A;  4LF5 B;  1GK9 A;  3JD2 A;  1KKC A;  1BHA A;  3W7X A;  4Q20 A;  2B9Z A;  3RW0 A;  4GYC B;  3VQV A;  4U7N A;  2ZKO A;  5FPR A;  2ZIM A;  3OTF A;  3F5W C;  1KBH A;  2EIM B;  5H6R A;  1K8A W;  1Y74 B;  4O4L B;  4F6R B;  4X9Q A;  4J11 A;  3MD0 A;  4DV3 B;  2ZT9 B;  4NKG B;  3T4D A;  5KMG B;  4E4E A;  1AB3 A;  3K04 A;  5L3F A;  1XDC A;  2QKA A;  4UV8 A;  4DRX A;  4YJ3 B;  1ZLZ A;  3RYC B;  1QR9 A;  5CB4 B;  3S3W A;  3K5O A;  4UCR A;  2BSK A;  3OMN B;  3GVM A;  3WU2 Z;  1WJZ A;  1VIB A;  4P2Z A;  3EVK A;  4IHJ B;  4DR6 B;  5KHI A;  1T5E A;  2OIG A;  3X2Q B;  4TQF A;  1I7F A;  2ETN A;  5GON B;  5IJ9 B;  4RUF A;  5KLV H;  3JAR A;  2AXT Z;  2EUL A;  2HVK C;  4O2B A;  3P32 A;  1YF2 A;  1IUR A;  5B1A C;  3T2M A;  2IJK A;  1ENV A;  1KQS U;  3GWK C;  4JPR A;  2ZR3 A;  1OCO C;  1YJN V;  4FIP C;  3C3T A;  1IBM B;  4W4L A;  1B04 A;  3L9D A;  1OCR C;  3SJQ C;  2F23 A;  1K97 A;  2QE7 G;  5FLX N;  2VS0 A;  1E1Q G;  5LXT B;  4JAV A;  5KAI Z;  2DN9 A;  2H94 A;  3HKB B;  4I50 B;  4HZ3 A;  4MTX A;  2YI9 A;  1R3K C;  1K4C C;  4PV1 B;  1VQM V;  4EFE A;  4JI4 O;  1UFI A;  4IIJ A;  1RSO B;  2LW7 A;  4GKJ B;  4O2A B;  2JS3 A;  3ZED A;  2WA4 A;  2LP7 A;  4PDM A;  3ABK B;  1WP8 A;  1J5E O;  1JQ0 A;  3E2E A;  3U11 A;  4J41 A;  1R1B A;  2QTS A;  4XDK A;  4DW1 A;  3JD3 A;  1AJP A;  3OE7 G;  1PP9 H;  4ZI7 B;  2OTL V;  5IT9 N;  4KFM A;  4DO2 A;  4DXW A;  1GM7 A;  2WWW A;  3JAW B;  2LQT A;  2YI8 A;  1JJ2 U;  2PYJ A;  1G8M A;  3B8N A;  4DV5 B;  1FFX A;  4O4H B;  1K5S A;  4ZBM A;  1L8D A;  3HR0 A;  3E35 A;  4ZHQ B;  2GHY A;  4UB6 Z;  1N33 O;  4DR5 O;  3AG3 C;  4BIO A;  1W2B U;  2HHH O;  3FAV B;  4ICG A;  5EZY A;  1NR1 A;  4X20 A;  3FB8 C;  2RNB A;  4GLX A;  4D7S A;  1KEC A;  1NTK H;  1R6T A;  3W7U A;  2CDY A;  3E8H A;  1AP6 A;  5C8Y B;  5LP6 C;  3F5T A;  1OJH A;  1I08 A;  1Q6I A;  3H1L H;  4JZ2 A;  1VP7 A;  1WN7 A;  2Y69 C;  1KYO F;  1K34 A;  1AI6 A;  4YJ2 B;  1JA8 A;  3D3Q A;  1VEW A;  4OXS A;  1O9H A;  4RQF A;  1QR8 A;  3AG4 B;  2PTM A;  1Q43 A;  2Q8V A;  1NI8 A;  4PI0 A;  3ETG A;  1XI1 A;  4LWS B;  4R8C A;  4O4I A;  2WLK A;  5DN6 G;  2WLI B;  3SYO A;  3T1Y O;  3CCJ V;  5GTH Z;  4FM1 A;  1SQV H;  4JI4 B;  4MTG A;  3UT5 A;  2ADP A;  3DC5 A;  3D8C A;  1Y4M A;  1F7Y A;  3IAY A;  4PA7 A;  3G6E V;  1DGS A;  1QBZ A;  2YXH A;  2X0L A;  1J5E B;  4U3J A;  2VWJ A;  4AI8 A;  4WFH A;  3STZ C;  4J42 A;  1S77 D;  4O4J B;  5B1B C;  1VAR A;  4JV5 O;  3SPH A;  2GBO A;  3APO A;  2P7T C;  2E74 B;  2RJZ A;  1VQ7 V;  5E79 Z;  2OYQ A;  4B3M O;  1J95 A;  4J10 A;  2IJI A;  2CAZ C;  3D36 A;  2DJV A;  5L3G A;  1CXZ B;  3ZMU A;  2E3C A;  4NR1 A;  3BRC A;  1R73 A;  4F4L A;  4H44 B;  2AZ2 A;  3BY6 A;  4TOI A;  4FFB B;  4RUE A;  5IYZ B;  1N33 B;  3JAK A;  2HHH B;  1A32 A;  4LFA O;  4DR1 O;  1D2D A;  2F95 B;  4PDR A;  2L35 A;  2F4V O;  5L3D A;  4DR4 O;  1SF9 A;  4XBF A;  5JVD B;  1KP3 A;  2JGD B;  3FYE B;  3N2G A;  1Q7Y W;  2WLN A;  5LMN O;  4NXM B;  2C2A A;  2YIC A;  2B1I A;  2VQF O;  3WB1 A;  4NTY A;  4IL6 Z;  3D36 C;  3FB7 C;  2M7W A;  1B3Q A;  2DYS B;  4YIO A;  1W59 A;  2BTQ B;  2QWP B;  4YXW G;  4OX9 O;  2ILM A;  4TQD A;  3ASO B;  2Q0O C;  3K3W A;  2DW4 A;  3ZHQ A;  2IJJ A;  1UJW B;  3CCM V;  1QNM A;  4UCS A;  4DV1 O;  2PUS A;  4W4K A;  1BSM A;  4X1Y B;  1TUB B;  3T1Y B;  1X4T A;  5KUK A;  1FJG O;  5H6Q A;  1FXK A;  5KA6 A;  1ZWI C;  4PA9 A;  4C7U A;  1Y74 A;  2CH7 B;  2UXX A;  2XUM A;  5LYJ A;  2EIN B;  2UXN A;  1NZ6 A;  3ABL C;  3K9S A;  5K1X A;  1K92 A;  3G71 V;  5BY1 A;  1PL4 A;  1DK1 A;  2OT5 A;  4JV5 B;  2IBZ H;  2XTA A;  2VWK A;  1EN6 A;  4JI3 B;  3RFR A;  5IY5 B;  5JH7 B;  1WNS A;  2FKX A;  5B3S C;  4I7Z B;  2EIK B;  1M56 B;  3ABT A;  1V54 B;  4FM0 A;  1B6Q A;  3T1H O;  1H2N A;  1PNK A;  1XNQ O;  1H2L A;  5J2T A;  1OV9 A;  2W0F C;  3E22 B;  1P4R A;  3LDC A;  3W7T A;  2YUA A;  1Q81 W;  1FYJ A;  4QE9 A;  1OZ0 A;  4MT8 A;  3HKC A;  4FM2 A;  3N2K A;  1W0J G;  1IVS A;  3HKD A;  3A8T A;  2DWD C;  4DR4 B;  4K0K O;  1N36 O;  1S5L Z;  1QLE C;  3O65 A;  5B1O A;  3SYQ A;  2QDO A;  1MSD A;  1HDJ A;  2DQ0 A;  5LMN B;  4PA4 A;  1JMK C;  3DXR A;  2AZ0 A;  3CB2 A;  2XND G;  5LXT A;  3OUS A;  4J7J A;  2IJH A;  3ZHT A;  1M57 C;  4I50 A;  4OX9 B;  4FK5 C;  2ZM6 O;  1JFF B;  4DV6 O;  3ZN1 A;  3FB6 C;  5JJN B;  3JD1 A;  4DV1 B;  4LC1 A;  3QVN A;  1Y76 B;  3AG2 B;  5F2V O;  3Q4H B;  1VF5 B;  4FPP A;  2NNU A;  2ZR2 A;  3EHB B;  3R66 A;  3JAT A;  1FJG B;  2Q68 A;  4EB6 A;  1AR5 A;  4LF5 O;  1L1F A;  3OR6 C;  4Q6G A;  5IJ0 B;  1YTF D;  3CD6 V;  5IYD O;  5DED A;  1SQF A;  5D5Q A;  4J9Z B;  1YVW A;  2V1D A;  4JYA O;  2Y4U A;  5KHJ A;  2UU9 B;  2MW2 B;  4DV3 O;  3QO7 A;  1D5N A;  2A9H A;  1XIL A;  3BAB A;  4X1K A;  5CA0 B;  5EYP B;  3QTC A;  3JAL B;  4TV9 B;  2AHY A;  2N04 A;  3T1H B;  2KQX A;  1XNQ B;  3LSS A;  1XEQ A;  1SA0 A;  2OTJ V;  3UM7 A;  4X1I A;  3JSN A;  2YEV A;  1NR7 A;  4N23 A;  3LDD A;  2E5L O;  1WB8 A;  5KA5 A;  4DR6 O;  2QGN A;  4X89 A;  4N21 A;  2P4K A;  4R7C A;  4TV8 A;  4LF9 O;  2EIJ C;  1EZJ A;  4JI0 B;  2WLM A;  4CBC A;  2OCC B;  3TJT A;  4LF8 B;  5KHG A;  3T1C A;  2P5O A;  1FFT B;  1N32 O;  5J2U B;  2HP8 A;  1NU1 H;  3UO3 A;  2FTK A;  5JJJ B;  1VQK V;  1VQ4 V;  4ASU G;  1YCI A;  2PI5 A;  3FKS G;  1HNZ B;  2CTQ A;  2M6Y A;  5JQG A;  1Q6U A;  3RGB A;  4PI2 A;  1Q6H A;  5JCO A;  5ITZ B;  2WLI A;  1MNG A;  3K06 A;  4DV6 B;  2YSU B;  3KZI Z;  2NN4 A;  3OGC C;  4B7K A;  1YTF B;  5HFL A;  1NH2 D;  4DV7 B;  5A2Q N;  2OWO A;  1HWY A;  2HLD G;  3J81 N;  4GKJ O;  1RM1 B;  3P3N A;  1SKV A;  1YSC A;  2HKO A;  3B09 A;  2UUB O;  2ADQ B;  4H37 A;  4PA6 A;  4MVU A;  2UXC B;  1VF6 A;  1PV0 A;  1GH6 A;  2AW9 A;  5H9C A;  4JYA B;  2Y48 A;  4LH6 A;  1OCC B;  1S72 V;  2A7W A;  3WB2 A;  3ZMV A;  3OMA B;  3K58 A;  2P90 A;  3P30 A;  5JCO C;  4JI7 O;  2IM9 A;  4MTO A;  3JCU Z;  1M1K W;  2PF4 E;  1EFR G;  1V55 C;  2ZNJ A;  3RYI A;  4B7E A;  1K33 A;  2P67 A;  2PYL A;  4DV5 O;  2XAH A;  1OCZ B;  5LA6 A;  4LFC O;  1THZ A;  4DW0 A;  2NR5 A;  5GW7 A;  1V9P A;  3B40 A;  1YIT V;  5KX5 A;  4GX1 A;  4AQY B;  1U97 A;  1WA8 B;  4TUY A;  1IXB A;  5KAF Z;  3JCZ A;  5LOV A;  2E5L B;  3BEH A;  1P7G A;  1KP2 A;  5CA3 A;  2Q6A A;  1VF6 C;  4QPJ A;  4LF9 B;  1QQC A;  3RYH B;  4I0X B;  3ASN B;  3VQY A;  1FXV A;  1N32 B;  2Z0A A;  4H13 B;  3ZN0 A;  5E1A C;  1VF7 A;  2Q0A A;  3B77 A;  2Y0I A;  4I9Q A;  4CH5 A;  4RWU A;  3ETQ A;  5BXZ A;  2H8P C;  3EFF K;  4Z2W A;  1VQ9 V;  1MA1 A;  3VOU A;  1RFY A;  2KKW A;  3B4S A;  2X6A A;  3L75 H;  3CJH B;  1IBK O;  2GV9 A;  4WFF A;  2GUZ A;  4IGG A;  3CHX A;  4LNU B;  1JX9 A;  2CUG A;  2KB1 A;  4WBN B;  5BZB A;  5L3B A;  3CWB H;  2JRI A;  3QG5 A;  4K8X A;  3ZBH A;  1G1X B;  2XAS A;  5CN0 A;  1GN2 A;  2EIL C;  3CRR A;  2UUB B;  1JVM A;  1BZK A;  2YXY A;  2LFS A;  4PD4 F;  2YIB A;  4AHC A;  4CC5 A;  1SZT A;  3KG2 A;  1QU7 A;  3M8A A;  1NTZ H;  3TET A;  4ABM A;  3WG7 B;  4JI7 B;  2UXB O;  1ZL8 A;  5LP6 A;  1F4N A;  1R3L C;  3E8F A;  3H1J H;  4R6Z A;  4YY3 O;  1K7D A;  1US6 A;  5EIB C;  2DMX A;  2Z5U A;  3FD9 A;  3BHP A;  3KCX A;  4LFC B;  1K9M W;  4DR3 O;  2RCV A;  1EM1 A;  4GCZ A;  4MVS A;  2Q69 A;  3SYA A;  1NTM H;  1S5H C;  4DR2 O;  3ZRW A;  3R65 A;  3JAS B;  2FYU H;  4X62 O;  4I4T A;  3A2F A;  5CA1 B;  1M56 C;  2XAF A;  4HNA B;  3WFV A;  4E2L A;  2EJ7 A;  1Z5V A;  4PDL A;  3ZMZ A;  2ZXW C;  3K57 A;  1TVK B;  4B08 A;  1N0J A;  1COW G;  4NXM O;  3IC7 A;  3NR7 A;  1XNR O;  1D5A A;  1AI4 A;  1TAE A;  2ITD C;  1HNX O;  1FPO A;  2PI4 A;  3ETD A;  4A5U B;  4GUN A;  3FX7 A;  2IU3 A;  1SET A;  1H2K A;  4KL1 A;  1VMG A;  1BQ0 A;  3SPC A;  3BPZ A;  2LW1 A;  1WLE A;  3OW2 U;  1O9G A;  1IZ3 A;  2UUC O;  3CRC A;  4LFB O;  1Q86 W;  1IBK B;  3TCU A;  5DM6 V;  2LJ2 A;  1CPY A;  4BWA A;  2A0L A;  2YXL A;  1MAB G;  2JGU A;  3RYF B;  3ZIA G;  2BOB C;  1M90 W;  1Q82 W;  3J7A U;  4JTC B;  1SC5 B;  3ZS8 C;  3AG1 C;  4MTF A;  2P6J A;  1BL8 A;  2GDS A;  4IT5 A;  1SQQ H;  4TT3 G;  3I56 V;  4JI3 O;  4U3F H;  1TGO A;  2UXB B;  1SZX A;  2KG7 A;  3ABM C;  1U96 A;  1HW7 A;  4YY3 B;  3H1I H;  1YI2 V;  1WPX A;  3HKE A;  4ZOL A;  4X64 B;  3CMA V;  5FNV A;  4X65 O;  4P9O A;  1B06 A;  4JYC A;  2R9A A;  4DR3 B;  1P84 F;  2QKS A;  1RP3 B;  5LHG A;  1WAZ A;  3ML0 A;  2ZNI A;  1NS1 A;  2LFR A;  4DR2 B;  2WLL A;  4JI5 O;  1YDX A;  3JD4 A;  4X62 B;  4I55 A;  4RAI A;  1YXB A;  1VQ5 V;  5B1A B;  1AI5 A;  1G4Y B;  3CRM A;  4MVM A;  2YIB D;  1JOY A;  3TXQ A;  4MVR A;  2L6L A;  2WLJ A;  3VQW A;  5D5P A;  5IWA B;  1XNR B;  2CTP A;  4LH7 A;  4D7T A;  1HNX B;  1OCO B;  4HBN A;  4DRX B;  4NXN B;  3SR2 C;  3CCS V;  4DV4 O;  1OCR B;  4LP8 A;  1F51 A;  1ZTE A;  2BSK B;  1E1R G;  1CP9 A;  5KHK A;  1PKX A;  1QHT A;  5BMV A;  2ZDI A;  2N74 A;  3CME V;  3CP1 A;  2G38 A;  4WCE V;  2QWR B;  2UUC B;  5LGT A;  4LFB B;  1OHH G;  3JAR B;  4JTA B;  4O2B B;  3AG7 A;  4QIW F;  3RN4 A;  4OPA A;  3CRA A;  1GAX A;  1AIL A;  3LNN A;  4H33 A;  2B1G A;  4O4L A;  4F6R A;  1QLN A;  5C93 A;  1AP5 A;  2UUA B;  1Q5O A;  2DWE C;  3THO A;  4JI1 O;  4OGQ B;  5KMG A;  2ZIN A;  2UU9 O;  1HR0 O;  1PM9 A;  5EK0 A;  1EBO A;  3JD0 A;  4YJ3 A;  3RYC A;  5EC1 C;  2ZDI C;  5CB4 A;  3H1H H;  4QJF B;  1I94 O;  1FAF A;  4IHJ A;  4X65 B;  3K5N A;  3ZRV A;  4IIJ B;  2R70 A;  2LO1 A;  4LF7 O;  3AG3 B;  3UKM A;  5IJ9 A;  5GON A;  3AK3 A;  5EBW C;  2EIM C;  1I5Y A;  4WFB V;  3J80 N;  1VQ6 V;  1WP7 A;  3BA8 A;  1FKA O;  4JI5 B;  3SPG A;  2B5U A;  3CCE V;  1VQL V;  2QM4 A;  2WPD G;  4JI0 O;  5IYC O;  1YHQ V;  4LF8 O;  2PY5 A;  3CE2 A;  4QGP A;  1N34 O;  2P22 C;  3APQ A;  4FVM A;  4G28 B;  2DOS A;  3I5D A;  2Y69 B;  2QWQ B;  1SQB H;  2DQ3 A;  2QR4 A;  2DE0 X;  2Q9L A;  1Y67 A;  2DYR B;  3UO2 A;  1HNZ O;  1FFX B;  3T4Z A;  3L71 H;  3F7V C;  4DV4 B;  4FMT A;  1M4U A;  3HKB A;  4WFE A;  2UXD O;  1MG1 A;  3BCC H;  3DTU B;  4UCT A;  3X2Q C;  5EZY B;  2HR3 A;  1KD1 W;  3K03 A;  4X20 B;  2YID A;  4KXR A;  3JYC A;  1RSO A;  3G67 A;  1MSW D;  3UCS C;  2OCH A;  4O2A A;  3CCL V;  1Z5W A;  3QO8 A;  4JF3 A;  2V7Q G;  2ZE8 A;  1PNL A;  3AK1 A;  4UCV A;  3A0R A;  4DV7 O;  1FS0 G;  4J80 A;  3G4S V;  1P7B A;  4UVC A;  3K5M A;  5EBL C;  4CH3 A;  1UPG A;  4ZI7 A;  1CEZ A;  4P9P A;  2JDI G;  5B1B B;  4MVZ A;  2UXC O;  3JAW A;  3BAA A;  4JI1 B;  4FLY A;  4H0L B;  1M9N A;  4G27 B;  4DV0 B;  3CRQ A;  3OGI B;  3AK2 A;  1HR0 B;  2ARH A;  1XOU A;  3JAM N;  2A79 B;  1Y66 A;  1DTO A;  5HFM A;  4O4H A;  1I5X A;  2ZE7 A;  4JAS A;  4O4I B;  3S3X A;  5L3C A;  3D3I A;  1I94 B;  4ZHQ A;  3E89 A;  1X59 A;  2K1E A;  3WB0 A;  5LGU A;  1Q8I A;  3FAV A;  3RVZ A;  1TUE B;  3UT5 B;  3ABK C;  3OAA G;  1FD9 A;  4JI6 O;  3LSQ A;  2CGN A;  4LF7 B;  3OM3 B;  1IDS A;  4AQY O;  2CE4 A;  1PNM A;  4U3J B;  1WPB A;  1VQP V;  3ICX A;  5C8Y A;  3KCY A;  4NVP A;  4D6T H;  4JI8 B;  1S0V A;  4NB5 A;  4LF6 B;  2IH1 C;  1QVG U;  2QSA A;  1N34 B;  4YJ2 A;  3MDS A;  1Q3E A;  1N4C A;  1AJN A;  2PZS A;  3ZRS A;  2ZCE A;  2Z3Y A;  2XAQ A;  3STL C;  2EBO A;  2P4V A;  1XMQ O;  4LWS A;  2HG5 C;  3U10 A;  1GMG A;  3ZHS A;  2UXD B;  3JAK B;  3L73 H;  4WF9 V;  4UCO A;  1VQN V;  5LMU O;  2CTR A;  3ZRX A;  2Q7G A;  4FZ0 A;  2Y0P A;  4UVA A;  4FZ1 A;  1FXH A;  3I55 V;  4CH6 A;  4MVO A;  3M99 B;  1L0L H;  3CX5 F;  3N2G B;  1SER A;  4QPK A;  2LGW A;  1XHZ A;  2GTS A;  1ZX3 A;  2A3Q A;  4J7K A;  4O4J A;  2D3O W;  3ABL B;  4RQE A;  1RPO A;  1KKD A;  2BOC C;  1YJW V;  3AG4 C;  3ZX6 A;  5L3E A;  3BVO A;  3EXA A;  5B3S B;  3CEI A;  3SJC C;  2PGG A;  1IXM A;  3QNE A;  4G2K A;  1JR9 A;  4ZKI A;  3A0B Z;  1JCH A;  4X88 A;  4K8Z A;  4BAY A;  4EKW A;  3RT3 C;  3OD4 A;  4PDV A;  4JYY A;  2OIE A;  3E8B A;  3KKY A;  4YIP A;  1S3J A;  3UQ8 A;  4FFB A;  3FB5 C;  1FXK B;  5IYZ A;  3OFN G;  5H2F Z;  2EZO A;  1BGY H;  5KHH A;  4GX0 A;  4WFG A;  4JI6 B;  5LYJ B;  1XL4 A;  2D2C B;  2Q5Z A;  1HNW B;  5JVD A;  2JGD A;  3TXS A;  4GZR B;  2XT9 A;  4DUZ O;  2HJD A;  1K3E A;  3O9O A;  4B3T O;  3U0Z A;  1QLE B;  4F6E A;  1JPX A;  2P06 A;  4LBE C;  3CCU V;  4BIU A;  4JAU A;  4MS2 A;  2YDE A;  2ZE6 A;  4LCU C;  2BTQ A;  4DV2 B;  3SPI A;  1NT2 B;  5J2T B;  4IYI A;  1M57 B;  3TGU H;  2IH3 C;  1ZUQ A;  3ZHU A;  2FML A;  5GTI Z;  4PA3 A;  3L72 H;  3GB7 C;  1XMQ B;  2AGA A;  1IBL O;  2QKC A;  5FL7 G;  3HKC B;  1ZSP A;  3N2K B;  4X1Y A;  1TUB A;  4AIL C;  4L8J A;  1NH2 B;  3HKD B;  2E76 B;  3GWO A;  5LMU B;  5A9G A;  1BE3 H;  1N8R W;  3OEE G;  3SJB C;  1EZV H;  2CH7 A;  3CYO A;  2R72 A;  5EC2 C;  4XDJ A;  3SYC A;  1XQ8 A;  3B2E E;  3K0D A;  3DXR B;  2RDC A;  3IFX A;  2DYS C;  1I0H A;  2JS5 A;  2YIA A;  1IX9 A;  5JH7 A;  5J9P C;  1M93 A;  3ASO C;  4JI2 O;  3RBZ A;  3CCV V;  5B1N A;  4EFB A;  4ZIB A;  3OMI B;  3OUF A;  1GM9 A;  3ABU A;  2IU0 A;  4NYK A;  2JIZ G;  2LGQ A;  3E22 A;  3F7Y C;  3ZHV A;  3IGA C;  5IE9 A;  3JSL A;  3JAT B;  3ZJZ A;  4X64 O;  2V4D A;  3RVY A;  1AI7 A;  2CGO A;  4EB6 B;  2EIN C;  4LR3 A;  4Z1M G;  1NBM G;  2RMK B;  3SJA C;  1L0N H;  3ETE A;  2Q4P A;  2EIJ B;  1P49 A;  2A06 H;  4GKK O;  1Z2G A;  3LNM B;  5IY5 C;  4DUZ B;  5B5E Z;  1MZE A;  2EIK C;  4B3T B;  2BCC H;  1V54 C;  3QF7 A;  4FLV A;  2X6C A;  2WAM A;  4X1K B;  4PHZ A;  1XMO O;  2JVD A;  1H8H G;  4EEQ A;  1URF A;  3N27 A;  2QTO A;  5IWA O;  4JYB A;  2FL4 A;  1ZAU A;  4UV9 A;  1E79 G;  2Y4T A;  2ITC C;  4NXN O;  1GM8 A;  1JFF A;  1SA0 B;  3A0H Z;  2VRZ A;  4X1I B;  2EZP A;  2YEV B;  1GN6 A;  3P3P A;  1BHB A;  4KP4 A;  1Y76 A;  3CC7 V;  4MW3 A;  1GRJ A;  1YJ9 V;  4YHH O;  3Q4H A; 
#chains in the Genus database with same CATH homology
 2GUZ B;  2QWP B;  1WJZ A;  2GUZ A;  2CTQ A;  1FAF A;  4J80 A;  2M6Y A;  1NZ6 A;  1FPO A;  2N04 A;  2L6L A;  2CTW A;  2CUG A;  2KQX A;  1BQZ A;  2Y4T A;  2LGW A;  2QWR B;  4IT5 A;  2CTP A;  1HDJ A;  3APQ A;  2PF4 E;  3APO A;  1BQ0 A;  2LO1 A;  1XBL A;  4RWU A;  2YUA A;  2N05 A;  2QSA A;  2YS8 A;  2QWQ B;  2Y4U A;  3UCS C;  2OCH A;  2QWO B;  4J7Z A;  2CTR A;  3AG7 A;  2QWN B;  1GH6 A;  3UO3 A;  1N4C A;  2EJ7 A;  2DMX A;  1IUR A;  3UO2 A;  3BVO A;  2DN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...