2QWNB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-386aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi state
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
b'MDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
total genus 30
structure length 94
sequence length 94
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwnB00
2L6LA 2CTPA 1FPOA 4RWUA 2QWOB 2KQXA 1NZ6A 1GH6A 3UO3A 1IURA 2CTWA 1WJZA 2PF4E 1HDJA 2CTRA 2Y4TA 4J7ZA 2M6YA 2QWQB 2OCHA 2QWRB 3BVOA 3UCSC 2CUGA 2EJ7A 2DN9A 2QWNB 2LGWA 2N04A 2QWPB 2DMXA 2N05A 1N4CA 2QSAA 2Y4UA 2CTQA 3APQA 1BQZA 1BQ0A 1FAFA 2GUZB 1XBLA 2GUZA 4IT5A 3UO2A 3APOA 4J80A 3AG7A 2YUAA 2LO1A 2YS8A
chains in the Genus database with same CATH superfamily
4FM0A 4QNHB 4LF7O 3KZIZ 4O4IB 2DOSA 1D5AA 3FB7C 1HNZB 5KA6A 1CPYA 3FB6C 4MTOA 3DXRA 3ETQA 2QSAA 1HNXB 2HVJC 3UO2A 2XASA 5J2TA 4LF9B 2OTJV 3AEIA 3J7AU 5LOVA 4UVCA 1Q86W 3EXAA 1XQ8A 1N36O 4N23A 3VQWA 4PDLA 2Q68A 5BMVB 4DR5B 2IJJA 2F1MA 1W0JG 2XAHA 4Q6GA 2WLLB 2ZE8A 4UCVA 3JALA 1RPRA 5B3SB 4TV8B 5LMUB 2P22C 3ZMTA 1VF7A 2RN9A 2IU3A 5EBWC 4RQFA 1IURA 2P6JA 3L75H 3UT5A 1QCEA 3ZBHA 5B1AB 1XNQB 1VF6C 4ZHQB 4YY3O 1KYOF 2ZINA 3SJBC 5IY5C 4IL6Z 4DV0O 4DV2B 3ABLB 2Z3YA 3CCJV 4DRXB 4FZ1A 5LHIA 3S3XA 1US6A 1VIBA 5EBMC 2UXXA 4TT3G 3QO8A 5BMVA 2QEXV 4JI2O 3QVNA 1BS3A 3B09A 2WLLA 2GV9A 4B3RB 3O9OA 3K59A 3N2KB 4TV8A 2XAJA 4UCRA 1ORQC 1GO3F 2BSKB 3SYOA 4R8CA 2XAQA 5K1PA 3K0DA 1M56C 3ZRSA 4QJFB 2M6YA 5L3EA 2Q67A 3M8AA 1TUBB 4JI4B 4CBCA 2HJDA 4JI5O 1BHBA 4DRXA 4WFAV 1URFA 5LP6A 2YC0A 5H5NA 2GHYA 3G80A 4FFBA 1MMMA 1SF9A 3FFQA 2LGQA 2QJ1A 3ZHTA 1KKCA 2E74B 3JCZA 1NQTA 3G67A 2RCVA 3D36A 1Z5VA 2GUZA 2ZD9A 3N2KA 3LSUA 2VQFB 3T4DA 1I94B 3K57A 4JYAO 1PM9A 3RYFB 4O2AA 4X1KB 4TWKA 2YIBA 4HBNA 1BL8A 1QBZA 2CAZC 4LF4O 2CUGA 1F23A 2W0XA 3ZN1A 1NBMG 4PA4A 1TA8A 1XDCA 1BQZA 1M90W 1N33B 1K4CC 1H2LA 3ZS8C 3T4ZA 4JF3A 1BGYH 1P4RA 3CYOA 4BIZA 1NKDA 3E22B 1R6TA 4UFZA 3CCSV 1FJGB 5JCOC 4ZBMA 3ZMZA 3THOA 1XI1A 4GX5A 5B1OA 2Q6AA 3CCVV 4XDJA 4DR3B 4I5SA 4UCSA 3TK1A 4I7ZB 4I9WA 4L8JA 2OT5A 1YITV 4X9QA 3RYFA 1DK1A 4U3JB 3E89A 1N32B 3SDLA 2Z0AA 2H94A 5A2QN 4DR2B 1VQ6V 1KQSU 1K9MW 3FKSG 1ZAUA 4A5UB 1LNQA 2CE4A 2JEUA 1I0HA 2EILC 1V54B 1RSOB 4MVZA 1I7FA 3KCXA 4NXMO 1SQGA 4QGPA 1SZXA 2A0LA 2Q0AA 4JYCA 4NTYA 3WFVA 2QWOB 2P5OA 4I0XB 1EZVH 1WJZA 2JDIG 2Y69B 1WB8A 4WFEA 1JR9A 3K5LA 3OUFA 3IFXA 2YI8A 1BQ0A 2ITCC 1R73A 3FYEB 3LDDA 4MTXA 2OIEA 1PKXA 2XAGA 1YXBA 3CC4V 4FM1A 4YJ3B 3K03A 1NZ6A 1AI4A 4U3JA 4J10A 5KHIA 4KHPO 4LC1A 4I9QA 3HPLC 1FS0G 3K04A 1SA0B 3A0BZ 5IJ9B 1OHHG 3HKDB 3OGCC 2PTMA 3L70H 1NTMH 4B3MB 1JPXA 1QVGU 1AB3A 2VQEB 4BW5A 1JMKC 1R3IC 4LH7A 4I0XA 1ZL8B 2WA4A 1Q43A 3P32A 2EIMB 2WWWA 2AW9A 2UXNA 1ZTEA 3CWBH 5LA6B 1XHXA 1L0NH 4CH5A 2DMXA 1NJIW 2HP8A 1X4TA 2WLMA 5CBHA 4X89A 5K1XA 4MS2A 2UU9B 4YJ3A 1N8RW 4JAAA 1K7DA 2ZDIA 3CPWU 3CX5F 1AI6A 4JI0O 1BT8A 5BXZA 3ABKC 3H1IH 1SA0A 2ZR2A 2QGNA 3HKDA 2AGAA 3CCUV 4DUZB 3O65A 3T1HB 1PNLA 2ZXWC 4WFHA 4FLZA 3A8TA 1MA1A 2CH7B 4PDRA 3AG2C 1RM1B 1ZL8A 2HFEC 4H37A 4ICGA 1BMFG 2FL4A 1QNMA 3CEIA 3MDSA 5LA6A 1MNGA 4Z1MG 1VQ5V 4CH4A 1SQVH 1JFFB 1M4UA 1BE3H 3K5OA 1IBMB 4TOIA 3OR6C 1UFIA 5IE9A 5KA5A 2HVKC 3MHSC 5E79Z 5JWPA 3ABUA 4TUYA 2OCCB 1K92A 3S3WA 1N34B 5LHGA 1DTOA 4DV4O 1GN3A 3ABMB 2W0FC 1V9PA 1QLNA 2EINC 1Q81W 3ZIAG 1RP3B 1NVPB 4NXNO 5JJEB 5B5EZ 4PELA 1N0JA 2KG7B 1FKAO 2CH7A 2EBOA 1XILA 4DW1A 2KKWA 2CDYA 2E3CA 2ODMA 2CTRA 2QKSA 5B1BC 4CH6A 2ZCEA 2EIJC 2ADPA 2ZE6A 1HNWB 1JFFA 1GMGA 2DYRC 1VQNV 4I50B 1HWYA 5L3CA 4MT8A 3SPJA 1HR0O 2PZSA 2EX3A 3K5MA 3HR0A 2RJZA 1KB9F 2F66C 4IIJB 3H1KH 1GM7A 3H01A 4LF7B 1E1RG 5LHHA 1SESA 4NTXA 3RYHB 2XTAA 3HKCB 5KUMA 3C90A 1AI7A 1UJWB 2QA4V 1SQQH 1WLEA 2BOBC 4FM2A 3SPHA 1KECA 1JOYA 2EIKC 1YTFB 2QWRB 3JASA 5E1AC 3CMAV 5CMUA 4I4TB 1N36B 1ZSPA 4DR6O 5H9CA 5CBFA 1OCRB 2PI4A 4HYOA 2F93B 3BA8A 3UM7A 3BABA 4IHJB 3GB7C 4CS3A 2BCCH 2CGOA 2A06H 1J5EO 4IIJA 2QTSA 4FLVA 4DK0A 5EZYB 5L3BA 2NLJC 1OCCC 5AG2A 3M99B 3D8CA 4DYLA 3ASNC 1M1KW 2Q9LA 3RYHA 4ASUG 3CD6V 4JI8O 3BPZA 4YY3B 3APOA 3ML0A 4FLYA 2YXYA 2IBZH 3H9VA 4TSFG 4NYKA 4DV0B 3CP1A 5EC1C 3E2EA 2PY5A 3UO3A 4YHHO 1BHAA 3OEHG 3VQVA 4I4TA 1M93A 1MG1A 3FYIB 5IY5B 4YJ2B 3IAYA 4JI6O 2DYSB 3G6BA 2QTOA 5KX5B 4JI2B 4JTAB 3CCMV 4FIPC 5IWAB 4CS4A 3JD3A 1Y76A 2M7WA 3FAVA 5LGNA 1ROPA 1BZKA 1P7GA 1Q5OA 3SJQC 5EZYA 4BIUA 3E8BA 1EN5A 5CA0B 1IX9A 2RNBA 4J9ZB 1AP5A 5LYJB 4F6EA 1CP9A 1FD9A 3T1YO 1NS1A 1AR4A 3OD4A 1GN4A 4NVPA 1O9GA 2GSMB 5IJ0B 2IJIA 4BWAA 1AR1B 3BY6A 4JI5B 4LF5O 3LNMB 4HZ3A 4AI8A 4RUEA 4UCOA 3RYCB 3TETA 2UXBO 5KX5A 2H8PC 1FFXB 1K4DC 3SPIA 4X65O 3JAMN 4EFBA 4I55B 3QG5A 4X20B 1FXKB 4P9PA 4LR3A 3X2QC 3OW2U 4JYAB 1F7YA 3OFNG 5CA0A 4JAVA 4OGQB 4FPPA 1VEWA 2WAMA 1YJWV 3AK1A 3HKEB 4LF4B 2UXCO 1OZ0A 3Q4HB 5CA1A 4GKJO 2QKAA 3CS5A 5FPOA 1KD1W 2CTPA 2W6IG 2IJKA 2ZQMA 4O4IA 1PV0A 5CB4B 1O9HA 3TGUH 5CA3A 3SYCA 3RYCA 4O4JB 4LFBO 5H6QA 3OEEG 4UCUA 1SZTA 1KC8W 4J7KA 3ZRWB 1FFXA 1MSDA 4JI1O 2V4DA 3AG1B 3BHPA 3C3SA 5KMGB 2P4VA 2C2AA 4I55A 1VQLV 1AI5A 4X20A 1FXKA 1H2SB 4KFMA 3I56V 2JRIA 4UB6Z 4K0KO 4DV3O 3WG7B 2RMKB 1NTZH 1MOFA 2N04A 5JJJB 4MTGA 1VQOV 1E79G 5J9PC 1GAXA 3JARB 3HKEA 1WA8B 2JGDB 1P84F 3Q4HA 3ASOB 2QDOA 4X8AA 4Q20A 1BSMA 2X6AA 3OR7C 4JI7O 2CTWA 4FJCC 2X7RB 4J7ZA 4NXMB 5IYZB 3SGIA 3W7XA 4ZHQA 1G8MA 3G71V 4H0LB 3ZRWA 3QTCA 2FB5A 4GZRB 1XEQA 4GLXA 1GM8A 1XHZA 3G6EV 5IYCO 3ZHRA 3A2FA 2WA3A 3E8GA 4R7CA 3JARA 4U7OA 4KHPB 1LUWA 2JEXA 1WA8A 3APQA 3L73H 3M7MX 1Q3EA 3CC2V 2E75B 3OMNB 2BSKA 4DR4O 5FPRA 2WPDG 1K97A 5IYZA 2NR5A 4GX0A 2HLDG 1TUBA 1R1BA 3QO5A 3OTFA 3JD1A 2IH1C 2CTQA 1COWG 1FAFA 3CSXA 5B3SC 2ZT9B 1NR1A 4LH6A 4XBFA 4GUNA 4CC6A 3K06A 2Q7HA 1MABG 3CRAA 2PYJA 5B1AC 4B7KA 2UXDO 5GTHZ 2NN4A 4O4LB 2AZ0A 3P3PA 4JI0B 2HJFC 2VWKA 2ZNJA 4OPHA 4CS2A 1BCCH 1Z5WA 3ABLC 2B5UA 5B1NA 2L6LA 3CJHB 1IBKO 2B1GA 5KHJA 3OT7A 5LP6C 3TJTA 2D2CB 3HKBB 5FLXN 4GT1A 2AHYA 5KAFZ 4X1KA 2YICA 1R6NA 4X66O 4PA7A 5FL7G 3D36C 3D3IA 3AG4B 3FB5C 4UV9A 4F4LA 1YDXA 5LMNO 2Y0PA 2ZXWB 4O4HB 3JAKB 1R3LC 4MW8A 1NH2B 4U7NA 3AG2B 3E22A 1SKVA 3AG3C 1JX9A 2BTOA 3ZMUA 3RYIB 4HNAB 4O2BB 1AR5A 4O4LA 4LBEC 4KUMA 3JYCA 3JSNA 4DV4B 1H8EG 2YIBD 2EJRA 3DC6A 1CXZB 2F23A 1WP8A 2EZOA 4NXNB 4Z2WA 3JCUZ 3SJCC 3HKBA 3SYQA 3L74H 4JAUA 2BE3A 2QWNB 1AJNA 1ZLZA 4H33A 1XNRO 1XL4A 2QE7G 3J80N 4O4HA 3ETDA 1RFYA 5ITZB 1S5HC 1RSOA 3JAKA 3MD0A 4WCEV 1IBLO 2JIZG 5LL6Y 3UQ8A 4YIOA 4DR7O 1GTOA 1OCZC 1HR0B 1XMQO 4HNAA 4O2BA 4MVOA 1L1FA 4X1IB 2EIJB 3BAAA 1QLEB 3CRQA 2VQFO 2HG5C 4UCTA 1ZUQA 1Y6XA 2DWDC 4D7SA 1F51A 4FLWA 3CC7V 1Y66A 4EFEA 1ENVA 2IH3C 5LBQA 1GM9A 1OCOB 2X0LA 2Q8VA 3STZC 4EB6B 1K3EA 2IM9A 5IJ9A 4NKGB 5L3FA 1Q6HA 4X88A 3VQYA 4DR6B 1QQCA 2GDSA 4L87A 3U0ZA 2XT9A 1XREA 2F4VO 2F43G 3KG2A 1P7BA 2EIKB 3PJSK 2Q69A 3OTOB 3K58A 1JVMA 4X1IA 5H6RA 4NR1A 1S77D 1J5EB 1V54C 1EZJA 1Q90D 4X1YB 3CRCA 1M57B 2ZIOA 3MHHC 3RWRD 1VF5B 4JI8B 4AQYO 1NR7A 5GTIZ 5GONB 3CCRV 2Y69C 2A9HA 2Y48A 4DV1O 3UCSC 2OIGA 4EB6A 3CRMA 2R9IA 2N05A 1TAEA 4YHHB 3ASNB 1DF4A 3H1JH 2UUAO 3OMAB 2Y4UA 1QHTA 1K73W 4JYBA 3N27A 4JI6B 1J95A 4R50A 2ZDIC 5KLVH 1VQ8V 1FPOA 4RWUA 2LW1A 4TV9B 1NI8A 3B8NA 2KB1A 3ZRVA 2R70A 4TQFA 1PL0A 1H8HG 2OWOA 2PI5A 3L72H 4X1YA 2Q5ZA 4CH3A 4FZ0A 3A0HZ 2G38A 5JH7B 2X6CA 2EIMC 1S3JA 3KCYA 3T1YB 4LNUB 3FB8C 1WPXA 1H2MA 2DN9A 1F4NA 4LF5B 1D5NA 4WFFA 3F7VC 3JAWB 1SERA 2ZM6O 4JZ2A 3T1CA 2UXBB 1SS3A 5BR8O 1S76D 2KG7A 4Z1VA 3LSQA 4FLXA 1WAZA 1G4YB 4TV9A 3JATB 5EYPB 5D5QA 3ZEDA 2CGNA 3JD2A 4JTCB 4B3TO 4PI2A 4WFBV 3JSLA 4KXRA 1PPJH 1T5EA 4R6ZA 3BFRA 3IJ4A 4I50A 1H38A 4J80A 4JGSA 3OM3B 4K8XA 2P06A 3B77A 4AHCA 1RM1C 2UXCB 3CMEV 1IDSA 4YIPA 1I08A 4GKJB 5LXTB 2FKXA 3ZHVA 2N74A 2UUCO 3LDEA 4JV5O 2R9AA 5EC2C 5IYBO 1LUVA 3K08A 4BAYA 4IYIA 1XMOO 4LFAO 4LF8O 4W4KA 1PP9H 1YEWA 3HKCA 4RO2A 4LFBB 1I5YA 4GKKO 2WLKA 1MZFA 4JI1B 2OCCC 3JATA 2HHHO 2PGGA 1XOUA 3ABMC 2LQTA 2LP7A 1GRJA 2Q73A 4RAIA 4DV5O 4K0KB 3SPCA 3RGBA 4DV3B 3ZHUA 1NT2B 3OUSA 3F5TA 1NVPD 2NNUA 4IHJA 4CZZA 2E5LO 3ZMSA 2EULA 3P3NA 3ZHQA 2EJ7A 4JI7B 2DWEC 2QM4A 1VMGA 1JJOA 3GWOA 3EVKA 2PUSA 3DXRB 5F2VO 1WB7A 4FK5C 5J2TB 1YZBA 4K3AA 4TQDA 2HR3A 4RQEA 2XNDG 3K79A 3CXCU 3SYAA 5KHKA 5FNVB 5KHGA 1M56B 4DR1O 3WB0A 4X62O 3U10A 1VF6A 4MTFA 4OX9O 2JGUA 3W7UA 3K5NA 4YJ2A 1GN2A 1R6KA 3H1LH 1X59A 1IZ3A 4JI3O 2GTAA 2KSDA 2VS0A 1B3QA 2YXLA 3JD0A 2WSSG 3VQXA 3NXSA 4MVMA 1HDJA 4PA3A 1EM1A 3UT5B 1B6QA 1Z2GA 1FXVA 5DEDA 3BCCH 2ARHA 4DR4B 1TGOA 2ZKOA 3RN4A 4QIWF 4LFCO 1YTFD 1OCRC 5LGTA 1H2KA 2HKOA 3IGAC 5LYJA 2AZ2A 5GW7A 1AJQA 4UV8A 1YJ9V 3H1HH 5IJ0A 5FNVA 4GYCB 1YCIA 1K5SA 3BVOA 4UXNA 3DGEA 5C8YB 4N21A 1Y4MA 2QR4A 2ADQB 2R72A 4OXSA 4ZI7B 4PDVA 2UXDB 1P49A 2FMLA 3QF7A 4UVAA 1QR8A 3K0GA 5BZBA 2CK3G 3IC9A 5BY1A 4QE9A 4X64O 1VQ7V 1Y67A 4MVQA 3QO7A 2AXTZ 4B7EA 3DSQA 3OMIB 3CCQV 4FMTA 4DUYO 1IBKB 1Y74B 3L71H 1G1XB 1IXBA 2V1DA 1DLBA 3N2GB 2UUBO 1V55C 2DYSC 2R9RB 4JPRA 4LCUC 1B06A 3DTUB 5KUKA 1YI2V 4X66B 3LSSA 4BIOA 3W7TA 4LF6O 1MZEA 1SETA 1R3KC 2YIDA 3OGIB 5KAIZ 4G2KA 4B3SO 5LMNB 4PI0A 5LP6B 2W6JG 2IU0A 2JS3A 1GK9A 4FFBB 4UVBA 5CB4A 5C8YA 5IWAO 2VRZA 4O4JA 3CE2A 3F5WC 1GN6A 1XUQA 4ZI7A 1Q6UA 4G27B 3E83A 2WLNA 3KKYA 1M9NA 2GUZB 2EILB 1WPBA 3JD4A 5KMGA 4DV7O 3RFRA 4DV6O 3W7SA 1KBHA 5EBLC 2P7TC 4O2AB 1U97A 3AG3B 1W2BU 5JCOA 1Y74A 3LUTB 3N2GA 1ZWIC 2LGWA 4DO2A 2QWPB 2Q7GA 2ITDC 4DW0A 1U96A 2JGDA 1FYJA 3P30A 4J7JA 3ABTA 2LO1A 4ZOLB 1XNRB 1SQFA 2RQ6A 3RBZA 2D3OW 2MW2B 4PHZA 1FXKC 1HNZO 1IBLB 2WLHA 1KMIZ 1E1QG 4DR7B 4W4LA 1HNXO 3ETGA 2ZE5A 1CEZA 1XMQB 5IDJA 1N4CA 3RVYA 4LF9O 1ZX3A 1I5XA 3ZJZA 1K5QA 4B08A 4IGGA 2DE0X 2YS8A 2IJHA 3LDCA 2PYLA 2K1EA 3E8FA 1OCZB 5JQGB 4DR5O 1A32A 1SQXH 1G6UA 1WP7A 3BRCA 3I55V 1VARA 5EIBC 1VQ4V 1KP2A 4G28B 5L3DA 3IC7A 5LMUO 3T2MA 1Q7YW 1TVKB 1YF2A 3ZCCA 5EIBD 1HW7A 3CRRA 1NTKH 3AG1C 3K3WA 1WN7A 4ZOLA 3HB3B 2ILMA 2XAFA 3LNNA 3FX7A 5HFMA 3SR2C 1XNQO 4ZKIA 4PD4F 1HP8A 2P67A 3E86A 3WG7C 4DV2O 3ABKB 4NB5A 3WU2Z 1D2DA 2F4VB 5L3GA 4FLUA 4PDMA 1AROP 3L9DA 3SPGA 2YDEA 3ASOC 3ZMVA 4E4EA 3TXSA 4KL1A 5JQGA 4FVMA 5B66Z 2O57A 3EHBB 4AQYB 4B3RO 4F6RB 3GWKC 4C7UA 5DECA 3K9AA 4P9OA 1EN6A 2QM8A 1TVKA 4DV1B 3J81N 2QM7A 3VBBA 4H44B 2A7WA 1EFRG 4P2ZA 3RVZA 4J41A 2UUAB 3CJHA 4IYHA 1S5JA 2KQXA 4GCZA 4GX2A 1VQMV 4D6TH 2JK5C 1KU9A 3D3QA 4K35A 4JI4O 2ATKC 4PV1B 4U3FH 4FLTA 2EINB 1THZA 4EKWA 2JJ2G 3GVMA 4P30A 1EBOA 1Q6IA 1SQPH 1JA8A 4FFKA 4MVRA 2DJVA 5DN6G 2ETNA 2Q7EA 2GTSA 1SQBH 3BEHA 3RYIA 3NR7A 3CHXA 4F6RA 3I5DA 5B1BB 3ETEA 3U11A 3WB2A 1MSWD 4WFGA 3SJAC 4UB8Z 1I94O 2DYRB 3EFFK 2ZIMA 4MVSA 3R65A 5IYDO 4WBNB 5J2UB 3E8HA 2BOCC 2ZM6B 5D5PA 2WLJA 1PNKA 2A79B 2X6BA 1UPGA 1YHQV 5BR8B 4J42A 2DQ3A 2MK3A 2OTLV 1N33O 4RUFA 4WF9V 1DF5A 1K8AW 4J11A 3ZX6A 4MVUA 5ITZA 2Y0IA 4BW9A 3CCLV 3MAQA 4B3TB 3STLC 2YUAA 3SYPA 1FJGO 1AVMA 2YXHA 4LWSB 1EN4A 4TUYB 2HEPA 2LFSA 1YVWA 1VQKV 2JJ1G 1QR9A 2Z5UA 2QWQB 2V7QG 4HAMA 4PA9A 1W59A 3W7WA 2JS5A 3ZRXA 3CXHF 3AG4C 2IW5A 2AHZA 3ZHSA 4DR3O 2UUCB 3BA9A 3PN1A 4JV5B 5IT9N 5H2FZ 4GX1A 1XMOB 4WBNA 5J2UA 2DQ0A 3TCUA 4LFAB 2XUMA 2LW7A 4LF8B 5KHHA 1N32O 1WNSA 4JZGA 1AP6A 2B9ZA 4JASA 4GKKB 4DR2O 1NH2D 2PF4E 2P90A 4MSWC 3QNEA 2YEVB 3E35A 2HHHB 1SRYA 1OCCB 4XDLA 2LFRA 4JYYA 1M5IA 3CB2A 5C93A 2WLIB 4DV5B 2DW4A 5LGUA 4LWSA 3OAAG 5JVDB 1JQ0A 3TXQA 2BTQB 4LP8A 2JVDA 1FXHA 5JJNB 2E5LB 1H2GA 2K9PA 5DM6V 3AK3A 4IT5A 1K34A 2LJ2A 4PA6A 1Q8IA 1VQ9V 2FTKA 3UKMA 1GH6A 4UUJC 4J9YB 3B8MA 3B4SA 5GONA 1QU7A 2YEVA 3B40A 3JASB 4EEQA 4ZIBA 3K9SA 4B3MO 3RT3C 1QLEC 2EZPA 4DR1B 1IVSA 2VQEO 4X62B 5CBGA 4OX9B 2WLIA 2A3QA 2L35A 3VOUA 3F7YC 3ICXA 5JVDA 4QE7A 4E2LA 4K8ZA 2BTQA 4JI3B 4OPAA 1KP3A 1OCOC 4X65B 1S72V 3OE7G 1S0VA 3RW0A 3DC5A 2UU9O 1LR1A 5HFLA 1OJHA 1DGSA 2RDCA 4QPJA 2ZE7A 1NU1H 1XBLA 4D7TA 1TUEB 4ABMA 4LFCB 1FFTB 5TISZ 3A0RA 3WB1A 3R66A 3C3TA 5JH7A 4DK1A 1GKFA 4LNUA 4DUZO 3T1HO 4H13B 4QPKA 3X2QB 3CCEV 4CC5A 4MW3A 2F95B 1JJ2U 2P4KA 2XOKG 4KP4A 4PJ0Z 3JAWA 1OV9A 1YSCA 1M57C 1S5LZ 4AILC 3AG7A 1H2NA 1W0KG 1Y76B 3OTOO 1R3JC 3FAVB 2Q0OC 1PD3A 1F4MA 5EYPA 2GBOA 3FD9A 4X64B 2ZR3A 2YI9A 1IXMA 2FYUH 1RPOA 3B2EE 1YIJV 1IBMO 1N0NA 1L8DA 4DUYB 1YJNV 1PNMA 2UUBB 4BR6A 1N34O 1JCHA 5EK0A 4LF6B 1L0LH 1K33A 2XHBA 1KKDA 5LXTA 1SC5B 1VQPV 1AJPA 4B3SB 2OYQA 1Q82W 2VWJA 1V55B 4NTWA 2H3OA 1KUQA 5A9GA 2B1IA 1VP7A 3AK2A 1XL6A 1AILA 4XDKA 1B04A 4DXWA 5LOVB 2YIAA 3G4SV 4DV7B 1HNWO 2Y4TA 4DV6B 5CN0A 3ZN0A 2OCHA 1QVFU 2Q4PA 1PL4A 2ZNIA 2YSUB 3JALB 5CA1B 2E76B 4JTDB 4YXWG 2QKCA
chains in the Genus database with same CATH topology
2L6LA 2CTPA 1FPOA 4RWUA 2QWOB 2KQXA 1NZ6A 1GH6A 3UO3A 1IURA 2CTWA 1WJZA 2PF4E 1HDJA 2CTRA 2Y4TA 4J7ZA 2M6YA 2QWQB 2OCHA 2QWRB 3BVOA 3UCSC 2CUGA 2EJ7A 2DN9A 2QWNB 2LGWA 2N04A 2QWPB 2DMXA 2N05A 1N4CA 2QSAA 2Y4UA 2CTQA 3APQA 1BQZA 1BQ0A 1FAFA 2GUZB 1XBLA 2GUZA 4IT5A 3UO2A 3APOA 4J80A 3AG7A 2YUAA 2LO1A 2YS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6L A;  2CTP A;  1FPO A;  4RWU A;  2QWO B;  2KQX A;  1NZ6 A;  1GH6 A;  3UO3 A;  1IUR A;  2CTW A;  1WJZ A;  2PF4 E;  1HDJ A;  2CTR A;  2Y4T A;  4J7Z A;  2M6Y A;  2QWQ B;  2OCH A;  2QWR B;  3BVO A;  3UCS C;  2CUG A;  2EJ7 A;  2DN9 A;  2QWN B;  2LGW A;  2N04 A;  2QWP B;  2DMX A;  2N05 A;  1N4C A;  2QSA A;  2Y4U A;  2CTQ A;  3APQ A;  1BQZ A;  1BQ0 A;  1FAF A;  2GUZ B;  1XBL A;  2GUZ A;  4IT5 A;  3UO2 A;  3APO A;  4J80 A;  3AG7 A;  2YUA A;  2LO1 A;  2YS8 A; 
#chains in the Genus database with same CATH topology
 4FM0 A;  4QNH B;  4LF7 O;  3KZI Z;  4O4I B;  2DOS A;  1D5A A;  3FB7 C;  1HNZ B;  5KA6 A;  1CPY A;  3FB6 C;  4MTO A;  3DXR A;  3ETQ A;  2QSA A;  1HNX B;  2HVJ C;  3UO2 A;  2XAS A;  5J2T A;  4LF9 B;  2OTJ V;  3AEI A;  3J7A U;  5LOV A;  4UVC A;  1Q86 W;  3EXA A;  1XQ8 A;  1N36 O;  4N23 A;  3VQW A;  4PDL A;  2Q68 A;  5BMV B;  4DR5 B;  2IJJ A;  2F1M A;  1W0J G;  2XAH A;  4Q6G A;  2WLL B;  2ZE8 A;  4UCV A;  3JAL A;  1RPR A;  5B3S B;  4TV8 B;  5LMU B;  2P22 C;  3ZMT A;  1VF7 A;  2RN9 A;  2IU3 A;  5EBW C;  4RQF A;  1IUR A;  2P6J A;  3L75 H;  3UT5 A;  1QCE A;  3ZBH A;  5B1A B;  1XNQ B;  1VF6 C;  4ZHQ B;  4YY3 O;  1KYO F;  2ZIN A;  3SJB C;  5IY5 C;  4IL6 Z;  4DV0 O;  4DV2 B;  3ABL B;  2Z3Y A;  3CCJ V;  4DRX B;  4FZ1 A;  5LHI A;  3S3X A;  1US6 A;  1VIB A;  5EBM C;  2UXX A;  4TT3 G;  3QO8 A;  5BMV A;  2QEX V;  4JI2 O;  3QVN A;  1BS3 A;  3B09 A;  2WLL A;  2GV9 A;  4B3R B;  3O9O A;  3K59 A;  3N2K B;  4TV8 A;  2XAJ A;  4UCR A;  1ORQ C;  1GO3 F;  2BSK B;  3SYO A;  4R8C A;  2XAQ A;  5K1P A;  3K0D A;  1M56 C;  3ZRS A;  4QJF B;  2M6Y A;  5L3E A;  2Q67 A;  3M8A A;  1TUB B;  4JI4 B;  4CBC A;  2HJD A;  4JI5 O;  1BHB A;  4DRX A;  4WFA V;  1URF A;  5LP6 A;  2YC0 A;  5H5N A;  2GHY A;  3G80 A;  4FFB A;  1MMM A;  1SF9 A;  3FFQ A;  2LGQ A;  2QJ1 A;  3ZHT A;  1KKC A;  2E74 B;  3JCZ A;  1NQT A;  3G67 A;  2RCV A;  3D36 A;  1Z5V A;  2GUZ A;  2ZD9 A;  3N2K A;  3LSU A;  2VQF B;  3T4D A;  1I94 B;  3K57 A;  4JYA O;  1PM9 A;  3RYF B;  4O2A A;  4X1K B;  4TWK A;  2YIB A;  4HBN A;  1BL8 A;  1QBZ A;  2CAZ C;  4LF4 O;  2CUG A;  1F23 A;  2W0X A;  3ZN1 A;  1NBM G;  4PA4 A;  1TA8 A;  1XDC A;  1BQZ A;  1M90 W;  1N33 B;  1K4C C;  1H2L A;  3ZS8 C;  3T4Z A;  4JF3 A;  1BGY H;  1P4R A;  3CYO A;  4BIZ A;  1NKD A;  3E22 B;  1R6T A;  4UFZ A;  3CCS V;  1FJG B;  5JCO C;  4ZBM A;  3ZMZ A;  3THO A;  1XI1 A;  4GX5 A;  5B1O A;  2Q6A A;  3CCV V;  4XDJ A;  4DR3 B;  4I5S A;  4UCS A;  3TK1 A;  4I7Z B;  4I9W A;  4L8J A;  2OT5 A;  1YIT V;  4X9Q A;  3RYF A;  1DK1 A;  4U3J B;  3E89 A;  1N32 B;  3SDL A;  2Z0A A;  2H94 A;  5A2Q N;  4DR2 B;  1VQ6 V;  1KQS U;  1K9M W;  3FKS G;  1ZAU A;  4A5U B;  1LNQ A;  2CE4 A;  2JEU A;  1I0H A;  2EIL C;  1V54 B;  1RSO B;  4MVZ A;  1I7F A;  3KCX A;  4NXM O;  1SQG A;  4QGP A;  1SZX A;  2A0L A;  2Q0A A;  4JYC A;  4NTY A;  3WFV A;  2QWO B;  2P5O A;  4I0X B;  1EZV H;  1WJZ A;  2JDI G;  2Y69 B;  1WB8 A;  4WFE A;  1JR9 A;  3K5L A;  3OUF A;  3IFX A;  2YI8 A;  1BQ0 A;  2ITC C;  1R73 A;  3FYE B;  3LDD A;  4MTX A;  2OIE A;  1PKX A;  2XAG A;  1YXB A;  3CC4 V;  4FM1 A;  4YJ3 B;  3K03 A;  1NZ6 A;  1AI4 A;  4U3J A;  4J10 A;  5KHI A;  4KHP O;  4LC1 A;  4I9Q A;  3HPL C;  1FS0 G;  3K04 A;  1SA0 B;  3A0B Z;  5IJ9 B;  1OHH G;  3HKD B;  3OGC C;  2PTM A;  3L70 H;  1NTM H;  4B3M B;  1JPX A;  1QVG U;  1AB3 A;  2VQE B;  4BW5 A;  1JMK C;  1R3I C;  4LH7 A;  4I0X A;  1ZL8 B;  2WA4 A;  1Q43 A;  3P32 A;  2EIM B;  2WWW A;  2AW9 A;  2UXN A;  1ZTE A;  3CWB H;  5LA6 B;  1XHX A;  1L0N H;  4CH5 A;  2DMX A;  1NJI W;  2HP8 A;  1X4T A;  2WLM A;  5CBH A;  4X89 A;  5K1X A;  4MS2 A;  2UU9 B;  4YJ3 A;  1N8R W;  4JAA A;  1K7D A;  2ZDI A;  3CPW U;  3CX5 F;  1AI6 A;  4JI0 O;  1BT8 A;  5BXZ A;  3ABK C;  3H1I H;  1SA0 A;  2ZR2 A;  2QGN A;  3HKD A;  2AGA A;  3CCU V;  4DUZ B;  3O65 A;  3T1H B;  1PNL A;  2ZXW C;  4WFH A;  4FLZ A;  3A8T A;  1MA1 A;  2CH7 B;  4PDR A;  3AG2 C;  1RM1 B;  1ZL8 A;  2HFE C;  4H37 A;  4ICG A;  1BMF G;  2FL4 A;  1QNM A;  3CEI A;  3MDS A;  5LA6 A;  1MNG A;  4Z1M G;  1VQ5 V;  4CH4 A;  1SQV H;  1JFF B;  1M4U A;  1BE3 H;  3K5O A;  1IBM B;  4TOI A;  3OR6 C;  1UFI A;  5IE9 A;  5KA5 A;  2HVK C;  3MHS C;  5E79 Z;  5JWP A;  3ABU A;  4TUY A;  2OCC B;  1K92 A;  3S3W A;  1N34 B;  5LHG A;  1DTO A;  4DV4 O;  1GN3 A;  3ABM B;  2W0F C;  1V9P A;  1QLN A;  2EIN C;  1Q81 W;  3ZIA G;  1RP3 B;  1NVP B;  4NXN O;  5JJE B;  5B5E Z;  4PEL A;  1N0J A;  2KG7 B;  1FKA O;  2CH7 A;  2EBO A;  1XIL A;  4DW1 A;  2KKW A;  2CDY A;  2E3C A;  2ODM A;  2CTR A;  2QKS A;  5B1B C;  4CH6 A;  2ZCE A;  2EIJ C;  2ADP A;  2ZE6 A;  1HNW B;  1JFF A;  1GMG A;  2DYR C;  1VQN V;  4I50 B;  1HWY A;  5L3C A;  4MT8 A;  3SPJ A;  1HR0 O;  2PZS A;  2EX3 A;  3K5M A;  3HR0 A;  2RJZ A;  1KB9 F;  2F66 C;  4IIJ B;  3H1K H;  1GM7 A;  3H01 A;  4LF7 B;  1E1R G;  5LHH A;  1SES A;  4NTX A;  3RYH B;  2XTA A;  3HKC B;  5KUM A;  3C90 A;  1AI7 A;  1UJW B;  2QA4 V;  1SQQ H;  1WLE A;  2BOB C;  4FM2 A;  3SPH A;  1KEC A;  1JOY A;  2EIK C;  1YTF B;  2QWR B;  3JAS A;  5E1A C;  3CMA V;  5CMU A;  4I4T B;  1N36 B;  1ZSP A;  4DR6 O;  5H9C A;  5CBF A;  1OCR B;  2PI4 A;  4HYO A;  2F93 B;  3BA8 A;  3UM7 A;  3BAB A;  4IHJ B;  3GB7 C;  4CS3 A;  2BCC H;  2CGO A;  2A06 H;  1J5E O;  4IIJ A;  2QTS A;  4FLV A;  4DK0 A;  5EZY B;  5L3B A;  2NLJ C;  1OCC C;  5AG2 A;  3M99 B;  3D8C A;  4DYL A;  3ASN C;  1M1K W;  2Q9L A;  3RYH A;  4ASU G;  3CD6 V;  4JI8 O;  3BPZ A;  4YY3 B;  3APO A;  3ML0 A;  4FLY A;  2YXY A;  2IBZ H;  3H9V A;  4TSF G;  4NYK A;  4DV0 B;  3CP1 A;  5EC1 C;  3E2E A;  2PY5 A;  3UO3 A;  4YHH O;  1BHA A;  3OEH G;  3VQV A;  4I4T A;  1M93 A;  1MG1 A;  3FYI B;  5IY5 B;  4YJ2 B;  3IAY A;  4JI6 O;  2DYS B;  3G6B A;  2QTO A;  5KX5 B;  4JI2 B;  4JTA B;  3CCM V;  4FIP C;  5IWA B;  4CS4 A;  3JD3 A;  1Y76 A;  2M7W A;  3FAV A;  5LGN A;  1ROP A;  1BZK A;  1P7G A;  1Q5O A;  3SJQ C;  5EZY A;  4BIU A;  3E8B A;  1EN5 A;  5CA0 B;  1IX9 A;  2RNB A;  4J9Z B;  1AP5 A;  5LYJ B;  4F6E A;  1CP9 A;  1FD9 A;  3T1Y O;  1NS1 A;  1AR4 A;  3OD4 A;  1GN4 A;  4NVP A;  1O9G A;  2GSM B;  5IJ0 B;  2IJI A;  4BWA A;  1AR1 B;  3BY6 A;  4JI5 B;  4LF5 O;  3LNM B;  4HZ3 A;  4AI8 A;  4RUE A;  4UCO A;  3RYC B;  3TET A;  2UXB O;  5KX5 A;  2H8P C;  1FFX B;  1K4D C;  3SPI A;  4X65 O;  3JAM N;  4EFB A;  4I55 B;  3QG5 A;  4X20 B;  1FXK B;  4P9P A;  4LR3 A;  3X2Q C;  3OW2 U;  4JYA B;  1F7Y A;  3OFN G;  5CA0 A;  4JAV A;  4OGQ B;  4FPP A;  1VEW A;  2WAM A;  1YJW V;  3AK1 A;  3HKE B;  4LF4 B;  2UXC O;  1OZ0 A;  3Q4H B;  5CA1 A;  4GKJ O;  2QKA A;  3CS5 A;  5FPO A;  1KD1 W;  2CTP A;  2W6I G;  2IJK A;  2ZQM A;  4O4I A;  1PV0 A;  5CB4 B;  1O9H A;  3TGU H;  5CA3 A;  3SYC A;  3RYC A;  4O4J B;  4LFB O;  5H6Q A;  3OEE G;  4UCU A;  1SZT A;  1KC8 W;  4J7K A;  3ZRW B;  1FFX A;  1MSD A;  4JI1 O;  2V4D A;  3AG1 B;  3BHP A;  3C3S A;  5KMG B;  2P4V A;  2C2A A;  4I55 A;  1VQL V;  1AI5 A;  4X20 A;  1FXK A;  1H2S B;  4KFM A;  3I56 V;  2JRI A;  4UB6 Z;  4K0K O;  4DV3 O;  3WG7 B;  2RMK B;  1NTZ H;  1MOF A;  2N04 A;  5JJJ B;  4MTG A;  1VQO V;  1E79 G;  5J9P C;  1GAX A;  3JAR B;  3HKE A;  1WA8 B;  2JGD B;  1P84 F;  3Q4H A;  3ASO B;  2QDO A;  4X8A A;  4Q20 A;  1BSM A;  2X6A A;  3OR7 C;  4JI7 O;  2CTW A;  4FJC C;  2X7R B;  4J7Z A;  4NXM B;  5IYZ B;  3SGI A;  3W7X A;  4ZHQ A;  1G8M A;  3G71 V;  4H0L B;  3ZRW A;  3QTC A;  2FB5 A;  4GZR B;  1XEQ A;  4GLX A;  1GM8 A;  1XHZ A;  3G6E V;  5IYC O;  3ZHR A;  3A2F A;  2WA3 A;  3E8G A;  4R7C A;  3JAR A;  4U7O A;  4KHP B;  1LUW A;  2JEX A;  1WA8 A;  3APQ A;  3L73 H;  3M7M X;  1Q3E A;  3CC2 V;  2E75 B;  3OMN B;  2BSK A;  4DR4 O;  5FPR A;  2WPD G;  1K97 A;  5IYZ A;  2NR5 A;  4GX0 A;  2HLD G;  1TUB A;  1R1B A;  3QO5 A;  3OTF A;  3JD1 A;  2IH1 C;  2CTQ A;  1COW G;  1FAF A;  3CSX A;  5B3S C;  2ZT9 B;  1NR1 A;  4LH6 A;  4XBF A;  4GUN A;  4CC6 A;  3K06 A;  2Q7H A;  1MAB G;  3CRA A;  2PYJ A;  5B1A C;  4B7K A;  2UXD O;  5GTH Z;  2NN4 A;  4O4L B;  2AZ0 A;  3P3P A;  4JI0 B;  2HJF C;  2VWK A;  2ZNJ A;  4OPH A;  4CS2 A;  1BCC H;  1Z5W A;  3ABL C;  2B5U A;  5B1N A;  2L6L A;  3CJH B;  1IBK O;  2B1G A;  5KHJ A;  3OT7 A;  5LP6 C;  3TJT A;  2D2C B;  3HKB B;  5FLX N;  4GT1 A;  2AHY A;  5KAF Z;  4X1K A;  2YIC A;  1R6N A;  4X66 O;  4PA7 A;  5FL7 G;  3D36 C;  3D3I A;  3AG4 B;  3FB5 C;  4UV9 A;  4F4L A;  1YDX A;  5LMN O;  2Y0P A;  2ZXW B;  4O4H B;  3JAK B;  1R3L C;  4MW8 A;  1NH2 B;  4U7N A;  3AG2 B;  3E22 A;  1SKV A;  3AG3 C;  1JX9 A;  2BTO A;  3ZMU A;  3RYI B;  4HNA B;  4O2B B;  1AR5 A;  4O4L A;  4LBE C;  4KUM A;  3JYC A;  3JSN A;  4DV4 B;  1H8E G;  2YIB D;  2EJR A;  3DC6 A;  1CXZ B;  2F23 A;  1WP8 A;  2EZO A;  4NXN B;  4Z2W A;  3JCU Z;  3SJC C;  3HKB A;  3SYQ A;  3L74 H;  4JAU A;  2BE3 A;  2QWN B;  1AJN A;  1ZLZ A;  4H33 A;  1XNR O;  1XL4 A;  2QE7 G;  3J80 N;  4O4H A;  3ETD A;  1RFY A;  5ITZ B;  1S5H C;  1RSO A;  3JAK A;  3MD0 A;  4WCE V;  1IBL O;  2JIZ G;  5LL6 Y;  3UQ8 A;  4YIO A;  4DR7 O;  1GTO A;  1OCZ C;  1HR0 B;  1XMQ O;  4HNA A;  4O2B A;  4MVO A;  1L1F A;  4X1I B;  2EIJ B;  3BAA A;  1QLE B;  3CRQ A;  2VQF O;  2HG5 C;  4UCT A;  1ZUQ A;  1Y6X A;  2DWD C;  4D7S A;  1F51 A;  4FLW A;  3CC7 V;  1Y66 A;  4EFE A;  1ENV A;  2IH3 C;  5LBQ A;  1GM9 A;  1OCO B;  2X0L A;  2Q8V A;  3STZ C;  4EB6 B;  1K3E A;  2IM9 A;  5IJ9 A;  4NKG B;  5L3F A;  1Q6H A;  4X88 A;  3VQY A;  4DR6 B;  1QQC A;  2GDS A;  4L87 A;  3U0Z A;  2XT9 A;  1XRE A;  2F4V O;  2F43 G;  3KG2 A;  1P7B A;  2EIK B;  3PJS K;  2Q69 A;  3OTO B;  3K58 A;  1JVM A;  4X1I A;  5H6R A;  4NR1 A;  1S77 D;  1J5E B;  1V54 C;  1EZJ A;  1Q90 D;  4X1Y B;  3CRC A;  1M57 B;  2ZIO A;  3MHH C;  3RWR D;  1VF5 B;  4JI8 B;  4AQY O;  1NR7 A;  5GTI Z;  5GON B;  3CCR V;  2Y69 C;  2A9H A;  2Y48 A;  4DV1 O;  3UCS C;  2OIG A;  4EB6 A;  3CRM A;  2R9I A;  2N05 A;  1TAE A;  4YHH B;  3ASN B;  1DF4 A;  3H1J H;  2UUA O;  3OMA B;  2Y4U A;  1QHT A;  1K73 W;  4JYB A;  3N27 A;  4JI6 B;  1J95 A;  4R50 A;  2ZDI C;  5KLV H;  1VQ8 V;  1FPO A;  4RWU A;  2LW1 A;  4TV9 B;  1NI8 A;  3B8N A;  2KB1 A;  3ZRV A;  2R70 A;  4TQF A;  1PL0 A;  1H8H G;  2OWO A;  2PI5 A;  3L72 H;  4X1Y A;  2Q5Z A;  4CH3 A;  4FZ0 A;  3A0H Z;  2G38 A;  5JH7 B;  2X6C A;  2EIM C;  1S3J A;  3KCY A;  3T1Y B;  4LNU B;  3FB8 C;  1WPX A;  1H2M A;  2DN9 A;  1F4N A;  4LF5 B;  1D5N A;  4WFF A;  3F7V C;  3JAW B;  1SER A;  2ZM6 O;  4JZ2 A;  3T1C A;  2UXB B;  1SS3 A;  5BR8 O;  1S76 D;  2KG7 A;  4Z1V A;  3LSQ A;  4FLX A;  1WAZ A;  1G4Y B;  4TV9 A;  3JAT B;  5EYP B;  5D5Q A;  3ZED A;  2CGN A;  3JD2 A;  4JTC B;  4B3T O;  4PI2 A;  4WFB V;  3JSL A;  4KXR A;  1PPJ H;  1T5E A;  4R6Z A;  3BFR A;  3IJ4 A;  4I50 A;  1H38 A;  4J80 A;  4JGS A;  3OM3 B;  4K8X A;  2P06 A;  3B77 A;  4AHC A;  1RM1 C;  2UXC B;  3CME V;  1IDS A;  4YIP A;  1I08 A;  4GKJ B;  5LXT B;  2FKX A;  3ZHV A;  2N74 A;  2UUC O;  3LDE A;  4JV5 O;  2R9A A;  5EC2 C;  5IYB O;  1LUV A;  3K08 A;  4BAY A;  4IYI A;  1XMO O;  4LFA O;  4LF8 O;  4W4K A;  1PP9 H;  1YEW A;  3HKC A;  4RO2 A;  4LFB B;  1I5Y A;  4GKK O;  2WLK A;  1MZF A;  4JI1 B;  2OCC C;  3JAT A;  2HHH O;  2PGG A;  1XOU A;  3ABM C;  2LQT A;  2LP7 A;  1GRJ A;  2Q73 A;  4RAI A;  4DV5 O;  4K0K B;  3SPC A;  3RGB A;  4DV3 B;  3ZHU A;  1NT2 B;  3OUS A;  3F5T A;  1NVP D;  2NNU A;  4IHJ A;  4CZZ A;  2E5L O;  3ZMS A;  2EUL A;  3P3N A;  3ZHQ A;  2EJ7 A;  4JI7 B;  2DWE C;  2QM4 A;  1VMG A;  1JJO A;  3GWO A;  3EVK A;  2PUS A;  3DXR B;  5F2V O;  1WB7 A;  4FK5 C;  5J2T B;  1YZB A;  4K3A A;  4TQD A;  2HR3 A;  4RQE A;  2XND G;  3K79 A;  3CXC U;  3SYA A;  5KHK A;  5FNV B;  5KHG A;  1M56 B;  4DR1 O;  3WB0 A;  4X62 O;  3U10 A;  1VF6 A;  4MTF A;  4OX9 O;  2JGU A;  3W7U A;  3K5N A;  4YJ2 A;  1GN2 A;  1R6K A;  3H1L H;  1X59 A;  1IZ3 A;  4JI3 O;  2GTA A;  2KSD A;  2VS0 A;  1B3Q A;  2YXL A;  3JD0 A;  2WSS G;  3VQX A;  3NXS A;  4MVM A;  1HDJ A;  4PA3 A;  1EM1 A;  3UT5 B;  1B6Q A;  1Z2G A;  1FXV A;  5DED A;  3BCC H;  2ARH A;  4DR4 B;  1TGO A;  2ZKO A;  3RN4 A;  4QIW F;  4LFC O;  1YTF D;  1OCR C;  5LGT A;  1H2K A;  2HKO A;  3IGA C;  5LYJ A;  2AZ2 A;  5GW7 A;  1AJQ A;  4UV8 A;  1YJ9 V;  3H1H H;  5IJ0 A;  5FNV A;  4GYC B;  1YCI A;  1K5S A;  3BVO A;  4UXN A;  3DGE A;  5C8Y B;  4N21 A;  1Y4M A;  2QR4 A;  2ADQ B;  2R72 A;  4OXS A;  4ZI7 B;  4PDV A;  2UXD B;  1P49 A;  2FML A;  3QF7 A;  4UVA A;  1QR8 A;  3K0G A;  5BZB A;  2CK3 G;  3IC9 A;  5BY1 A;  4QE9 A;  4X64 O;  1VQ7 V;  1Y67 A;  4MVQ A;  3QO7 A;  2AXT Z;  4B7E A;  3DSQ A;  3OMI B;  3CCQ V;  4FMT A;  4DUY O;  1IBK B;  1Y74 B;  3L71 H;  1G1X B;  1IXB A;  2V1D A;  1DLB A;  3N2G B;  2UUB O;  1V55 C;  2DYS C;  2R9R B;  4JPR A;  4LCU C;  1B06 A;  3DTU B;  5KUK A;  1YI2 V;  4X66 B;  3LSS A;  4BIO A;  3W7T A;  4LF6 O;  1MZE A;  1SET A;  1R3K C;  2YID A;  3OGI B;  5KAI Z;  4G2K A;  4B3S O;  5LMN B;  4PI0 A;  5LP6 B;  2W6J G;  2IU0 A;  2JS3 A;  1GK9 A;  4FFB B;  4UVB A;  5CB4 A;  5C8Y A;  5IWA O;  2VRZ A;  4O4J A;  3CE2 A;  3F5W C;  1GN6 A;  1XUQ A;  4ZI7 A;  1Q6U A;  4G27 B;  3E83 A;  2WLN A;  3KKY A;  1M9N A;  2GUZ B;  2EIL B;  1WPB A;  3JD4 A;  5KMG A;  4DV7 O;  3RFR A;  4DV6 O;  3W7S A;  1KBH A;  5EBL C;  2P7T C;  4O2A B;  1U97 A;  3AG3 B;  1W2B U;  5JCO A;  1Y74 A;  3LUT B;  3N2G A;  1ZWI C;  2LGW A;  4DO2 A;  2QWP B;  2Q7G A;  2ITD C;  4DW0 A;  1U96 A;  2JGD A;  1FYJ A;  3P30 A;  4J7J A;  3ABT A;  2LO1 A;  4ZOL B;  1XNR B;  1SQF A;  2RQ6 A;  3RBZ A;  2D3O W;  2MW2 B;  4PHZ A;  1FXK C;  1HNZ O;  1IBL B;  2WLH A;  1KMI Z;  1E1Q G;  4DR7 B;  4W4L A;  1HNX O;  3ETG A;  2ZE5 A;  1CEZ A;  1XMQ B;  5IDJ A;  1N4C A;  3RVY A;  4LF9 O;  1ZX3 A;  1I5X A;  3ZJZ A;  1K5Q A;  4B08 A;  4IGG A;  2DE0 X;  2YS8 A;  2IJH A;  3LDC A;  2PYL A;  2K1E A;  3E8F A;  1OCZ B;  5JQG B;  4DR5 O;  1A32 A;  1SQX H;  1G6U A;  1WP7 A;  3BRC A;  3I55 V;  1VAR A;  5EIB C;  1VQ4 V;  1KP2 A;  4G28 B;  5L3D A;  3IC7 A;  5LMU O;  3T2M A;  1Q7Y W;  1TVK B;  1YF2 A;  3ZCC A;  5EIB D;  1HW7 A;  3CRR A;  1NTK H;  3AG1 C;  3K3W A;  1WN7 A;  4ZOL A;  3HB3 B;  2ILM A;  2XAF A;  3LNN A;  3FX7 A;  5HFM A;  3SR2 C;  1XNQ O;  4ZKI A;  4PD4 F;  1HP8 A;  2P67 A;  3E86 A;  3WG7 C;  4DV2 O;  3ABK B;  4NB5 A;  3WU2 Z;  1D2D A;  2F4V B;  5L3G A;  4FLU A;  4PDM A;  1ARO P;  3L9D A;  3SPG A;  2YDE A;  3ASO C;  3ZMV A;  4E4E A;  3TXS A;  4KL1 A;  5JQG A;  4FVM A;  5B66 Z;  2O57 A;  3EHB B;  4AQY B;  4B3R O;  4F6R B;  3GWK C;  4C7U A;  5DEC A;  3K9A A;  4P9O A;  1EN6 A;  2QM8 A;  1TVK A;  4DV1 B;  3J81 N;  2QM7 A;  3VBB A;  4H44 B;  2A7W A;  1EFR G;  4P2Z A;  3RVZ A;  4J41 A;  2UUA B;  3CJH A;  4IYH A;  1S5J A;  2KQX A;  4GCZ A;  4GX2 A;  1VQM V;  4D6T H;  2JK5 C;  1KU9 A;  3D3Q A;  4K35 A;  4JI4 O;  2ATK C;  4PV1 B;  4U3F H;  4FLT A;  2EIN B;  1THZ A;  4EKW A;  2JJ2 G;  3GVM A;  4P30 A;  1EBO A;  1Q6I A;  1SQP H;  1JA8 A;  4FFK A;  4MVR A;  2DJV A;  5DN6 G;  2ETN A;  2Q7E A;  2GTS A;  1SQB H;  3BEH A;  3RYI A;  3NR7 A;  3CHX A;  4F6R A;  3I5D A;  5B1B B;  3ETE A;  3U11 A;  3WB2 A;  1MSW D;  4WFG A;  3SJA C;  4UB8 Z;  1I94 O;  2DYR B;  3EFF K;  2ZIM A;  4MVS A;  3R65 A;  5IYD O;  4WBN B;  5J2U B;  3E8H A;  2BOC C;  2ZM6 B;  5D5P A;  2WLJ A;  1PNK A;  2A79 B;  2X6B A;  1UPG A;  1YHQ V;  5BR8 B;  4J42 A;  2DQ3 A;  2MK3 A;  2OTL V;  1N33 O;  4RUF A;  4WF9 V;  1DF5 A;  1K8A W;  4J11 A;  3ZX6 A;  4MVU A;  5ITZ A;  2Y0I A;  4BW9 A;  3CCL V;  3MAQ A;  4B3T B;  3STL C;  2YUA A;  3SYP A;  1FJG O;  1AVM A;  2YXH A;  4LWS B;  1EN4 A;  4TUY B;  2HEP A;  2LFS A;  1YVW A;  1VQK V;  2JJ1 G;  1QR9 A;  2Z5U A;  2QWQ B;  2V7Q G;  4HAM A;  4PA9 A;  1W59 A;  3W7W A;  2JS5 A;  3ZRX A;  3CXH F;  3AG4 C;  2IW5 A;  2AHZ A;  3ZHS A;  4DR3 O;  2UUC B;  3BA9 A;  3PN1 A;  4JV5 B;  5IT9 N;  5H2F Z;  4GX1 A;  1XMO B;  4WBN A;  5J2U A;  2DQ0 A;  3TCU A;  4LFA B;  2XUM A;  2LW7 A;  4LF8 B;  5KHH A;  1N32 O;  1WNS A;  4JZG A;  1AP6 A;  2B9Z A;  4JAS A;  4GKK B;  4DR2 O;  1NH2 D;  2PF4 E;  2P90 A;  4MSW C;  3QNE A;  2YEV B;  3E35 A;  2HHH B;  1SRY A;  1OCC B;  4XDL A;  2LFR A;  4JYY A;  1M5I A;  3CB2 A;  5C93 A;  2WLI B;  4DV5 B;  2DW4 A;  5LGU A;  4LWS A;  3OAA G;  5JVD B;  1JQ0 A;  3TXQ A;  2BTQ B;  4LP8 A;  2JVD A;  1FXH A;  5JJN B;  2E5L B;  1H2G A;  2K9P A;  5DM6 V;  3AK3 A;  4IT5 A;  1K34 A;  2LJ2 A;  4PA6 A;  1Q8I A;  1VQ9 V;  2FTK A;  3UKM A;  1GH6 A;  4UUJ C;  4J9Y B;  3B8M A;  3B4S A;  5GON A;  1QU7 A;  2YEV A;  3B40 A;  3JAS B;  4EEQ A;  4ZIB A;  3K9S A;  4B3M O;  3RT3 C;  1QLE C;  2EZP A;  4DR1 B;  1IVS A;  2VQE O;  4X62 B;  5CBG A;  4OX9 B;  2WLI A;  2A3Q A;  2L35 A;  3VOU A;  3F7Y C;  3ICX A;  5JVD A;  4QE7 A;  4E2L A;  4K8Z A;  2BTQ A;  4JI3 B;  4OPA A;  1KP3 A;  1OCO C;  4X65 B;  1S72 V;  3OE7 G;  1S0V A;  3RW0 A;  3DC5 A;  2UU9 O;  1LR1 A;  5HFL A;  1OJH A;  1DGS A;  2RDC A;  4QPJ A;  2ZE7 A;  1NU1 H;  1XBL A;  4D7T A;  1TUE B;  4ABM A;  4LFC B;  1FFT B;  5TIS Z;  3A0R A;  3WB1 A;  3R66 A;  3C3T A;  5JH7 A;  4DK1 A;  1GKF A;  4LNU A;  4DUZ O;  3T1H O;  4H13 B;  4QPK A;  3X2Q B;  3CCE V;  4CC5 A;  4MW3 A;  2F95 B;  1JJ2 U;  2P4K A;  2XOK G;  4KP4 A;  4PJ0 Z;  3JAW A;  1OV9 A;  1YSC A;  1M57 C;  1S5L Z;  4AIL C;  3AG7 A;  1H2N A;  1W0K G;  1Y76 B;  3OTO O;  1R3J C;  3FAV B;  2Q0O C;  1PD3 A;  1F4M A;  5EYP A;  2GBO A;  3FD9 A;  4X64 B;  2ZR3 A;  2YI9 A;  1IXM A;  2FYU H;  1RPO A;  3B2E E;  1YIJ V;  1IBM O;  1N0N A;  1L8D A;  4DUY B;  1YJN V;  1PNM A;  2UUB B;  4BR6 A;  1N34 O;  1JCH A;  5EK0 A;  4LF6 B;  1L0L H;  1K33 A;  2XHB A;  1KKD A;  5LXT A;  1SC5 B;  1VQP V;  1AJP A;  4B3S B;  2OYQ A;  1Q82 W;  2VWJ A;  1V55 B;  4NTW A;  2H3O A;  1KUQ A;  5A9G A;  2B1I A;  1VP7 A;  3AK2 A;  1XL6 A;  1AIL A;  4XDK A;  1B04 A;  4DXW A;  5LOV B;  2YIA A;  3G4S V;  4DV7 B;  1HNW O;  2Y4T A;  4DV6 B;  5CN0 A;  3ZN0 A;  2OCH A;  1QVF U;  2Q4P A;  1PL4 A;  2ZNI A;  2YSU B;  3JAL B;  5CA1 B;  2E76 B;  4JTD B;  4YXW G;  2QKC A; 
#chains in the Genus database with same CATH homology
 2L6L A;  2CTP A;  1FPO A;  4RWU A;  2QWO B;  2KQX A;  1NZ6 A;  1GH6 A;  3UO3 A;  1IUR A;  2CTW A;  1WJZ A;  2PF4 E;  1HDJ A;  2CTR A;  2Y4T A;  4J7Z A;  2M6Y A;  2QWQ B;  2OCH A;  2QWR B;  3BVO A;  3UCS C;  2CUG A;  2EJ7 A;  2DN9 A;  2QWN B;  2LGW A;  2N04 A;  2QWP B;  2DMX A;  2N05 A;  1N4C A;  2QSA A;  2Y4U A;  2CTQ A;  3APQ A;  1BQZ A;  1BQ0 A;  1FAF A;  2GUZ B;  1XBL A;  2GUZ A;  4IT5 A;  3UO2 A;  3APO A;  4J80 A;  3AG7 A;  2YUA A;  2LO1 A;  2YS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...