3E35A

Actinobacteria-specific protein of unknown function, sco1997
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
269
Chain Sequence
DPQDLYTWEPKGLAVVDMALAQESAGLVMLYHFDGYIDAGETGDQIVDQVLDSLPHQVVARFDHDRLVDYRARRPLLTFKRDTWSDYEEPTIEVRLVQDATGAPFLFLSGPEPDVEWERFAAAVGQIVERLGVRLSVSFHGIPMGVPHTRPVGITPHGSRTDLVPFEEAQVPGSAEALVEYRLAQAGHDVLGVAAHVPHYVARSAYPDAALTVLEAITAATGLVLPGIAHSLRTDAHRTQTEIDRQIQEGDEELIALVQGLEHQYDAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and phylogenetic analysis of a conserved actinobacteria-specific protein (ASP1; SCO1997) from Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Unknown function
molecule keywords Uncharacterized protein SCO1997
total genus 85
structure length 269
sequence length 274
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e35A02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e35A01
5CA3A 3D3IA 3W7TA 3VR0A 1RM1C 3IC7A 3MNFA 2HR3A 3BY6A 4HAMA 3E35A 1YTFB 1NVPB 3W7UA 1NH2B 2P90A 3W7SA 3WZ2A 3W7XA 3GAAA 4G4SP 3W7WA 5GW7A 2WAMA 1S3JA
chains in the Genus database with same CATH superfamily
5CGQB 4YMIA 5JAPA 4MVJE 2GPBA 3I01A 3Q12A 4RY0A 3EVCA 4TZTA 4G4GA 5TARA 4A8HA 5IS2A 2UYYA 2UXDB 3I34X 4XQ9A 2F17A 5EUBA 4X24A 2QE6A 3UJNA 3OCCA 3C8HA 3M5DA 1GPLA 1HL7A 1SBTA 3L1IA 3E35A 3L49A 3R0QA 3TZLA 5I7RA 4BNDA 3OQBA 4DCOA 4O5OA 4CFSA 4YMTA 2IH4A 1N34O 3TNDA 3HPRA 2R8OA 5IDYA 3NTRA 4Q3AA 4EUSA 5BORA 2E4XA 2J4FA 3LLVA 1TIBA 4L73A 1V8OA 4GL2A 1HE5A 1QNFA 2X7JA 1CYEA 2V55B 4U2DA 2BFWA 4X6LA 2H31A 2JB9A 5CNKA 2FR1A 1JWLA 4BBZA 2IX9A 4E09A 3PUYA 1FYWA 2XCUA 1WW8A 4HRAA 3O7MA 1Z2GA 2F67A 2L6LA 2X86A 3UO8B 3UZUA 5I7UA 5IAOA 3DFZA 2VTEA 3DT8A 4MKFA 4OXIA 1I7PA 5EMJA 1ZMTA 3I53A 2DKOA 2NTEA 3PFCA 2XZPA 1ENPA 4O4IB 2WT9A 3PIIA 2BEWA 3U7QA 1MX5A 2HQSA 2W6ZA 3GPCA 2EQBA 1QYRA 4MYRA 1FNSA 2I1LA 5ECYA 1QHHA 3RVLA 2VJPA 2P4UA 2QE7A 1N9KA 1KJIA 2CDAA 3FRIA 4ZVKA 1L5WA 4JEIA 3RWBA 1FDUA 4AJHA 1IM5A 1FTSA 4WXRA 1IN1A 1S8NA 1SHJA 3MM4A 1MC8A 1PFVA 1J7JA 2C77A 1OD6A 1CERA 3IAAA 3SR3A 1XCLA 5K3EA 3BT7A 1QCCA 2V7PA 3QLVA 3H1AA 1FXVA 3ENNA 1OLXB 2LV8A 3CWZA 4J16A 3KQUA 5CP8A 4DCGA 1OV6A 4KJXA 4Q00A 3K9CA 5LD2C 3K8ZA 4OPMA 4QEZA 3RSZA 3U13A 1T15A 2GEFA 3EULA 4JGSA 2IHTA 3AEZA 1VLQA 4JEHA 3J80N 5JARA 4QGFA 2ZB8A 5F12A 4ZEXA 3S2EA 3V42A 3GQBA 1X1QA 1U3UA 2ZSHA 4ZQBA 3IKVA 1LK0A 5C18A 2JJMA 3PITA 4JU8A 2VJMB 4HAUA 1H66A 5ALDA 3K1YA 3TTYA 2IU4A 2UVDA 3CJHB 4X1YA 3EQZA 1SCQA 5KVQA 5D01A 4B32A 2I2BA 3ICQB 1J25A 1GTZA 4CHTA 1ODIA 2ZRPA 1XROA 4MVCA 1CR2A 3UAYA 4KACA 2JIMA 4QDUA 1EZZA 3D9QX 4BWVA 2OHIA 3AVXA 3KQSA 1UWCA 1VCNA 3FMOB 4N0EA 1FS6A 4IYJA 4KLRA 2BONA 4JYMA 3VOBA 4C0HA 1CR6A 1Y4SA 3CRW1 5FR1A 5JASA 2WTXA 3H2IA 2GX6A 5AW4A 4UTNA 2ZR7A 3W5DA 1UC8A 4P08A 2YXPX 5KYXB 2WZBA 2EIMC 3HCRA 3MB8A 1N2EA 4LYGA 4W8OA 3PR1A 3TW6A 1EBOA 1EFUA 2VJLA 621PA 2Q0XA 4I6GA 3M9XA 4IBOA 2ZIVB 3CC2V 2DH5A 4BGDA 2HCTA 2P4VA 3F7VC 1HDYA 1WABA 3H83A 5DKFA 3LKDA 3RC8A 2FE1A 3AGPA 3QPCA 3ZW9A 3QTBA 4OL9A 2IV7A 2ZVJA 1U2GC 1E1CB 1V7ZA 5K6AC 4YQEA 2E89A 5ALXA 4IFBA 4WY8A 1SMKA 5JAIA 1GGMA 4P33A 5BSTA 5ES4B 1VE1A 4TYYA 4A10A 5K0ZA 2ZCEA 1Z4IA 4JJ6A 2Q5FA 2MYTA 2DTDA 2QNRA 2X3UA 2Z09A 3PHLA 5A4AA 1SF9A 4UMDA 3O26A 4QO8A 4IHJF 1WVIA 2AOWA 4CM9A 3F6EX 3WLSA 1H2GA 4MW3A 1IOWA 1P7VA 5EINA 1QNLA 4E32A 1XQVA 2WTBA 3FI0A 1Q2UA 3E7WA 4CMEC 1NDUA 4EUFA 1KEVA 5ULLA 1GYPA 1Z4NA 2PVCA 3Q8MA 2XNDG 1Z63A 1YSCA 1YR8A 5HFAA 2L19A 2MSDB 3UANA 1NYTA 1FW8A 3A9SA 4EL0A 3LW8A 2O7VA 1M1KW 1UKZA 4HFMA 1M5UA 4IGGA 4Q3EA 3OE7G 1T5HX 1EUZA 1U0SY 5JNUA 1MC4A 5CU7A 4B9AA 3ZMTA 4GQIA 5TMPA 3MOSA 2FFHA 2VWGA 2GYUA 4RK6A 2SKDA 2VEDA 3KUKA 4AN0A 4D44A 2BGKA 3DXXA 1D2AA 4OATA 5IN5A 4P3XA 3LC7O 3B7WA 4RCVA 3THWB 3OGCC 2AXNA 3G8YA 1IJEA 5HP4A 3GEGA 1I0LA 1D2CA 2UUCO 1YJXA 4B9EA 2W42A 4O8CA 4WCDA 5TXGA 1EFKA 4HVLA 2B61A 3CF6R 1AIPA 4BP8A 4NTWA 5DX1A 1IBLO 1LY1A 1OFGA 1XA0A 4OGLA 4POAA 1XCOA 3TI9A 4CUJA 1GKLA 3LC0A 4B3IA 5TT0A 2H5EA 4CM6A 1XZGA 3A9UA 4TZKA 4MDEA 1J07A 2BI8A 2J3JA 3BERA 2P9JA 4YP1A 3U11A 1IUNA 2ILVA 3WL6A 1E7RA 4EPVA 4ZCRA 2G4CA 3VRHA 2GUGA 5AUPB 1PHPA 2YASA 2DRIA 2HJSA 1RFLA 2Q4TA 3D54D 3LK7A 3M1IA 1EWRA 2VH2A 3A25A 4Z7JA 2EBHX 2J0VA 1Y98A 1ZNQO 2F62A 1DHRA 5FPKA 3T3HA 4LIPD 4Q9KA 4LF4B 3KKMA 4MGZR 1OCEA 3DR5A 1F4VA 3MBKA 1EXDA 4JAVC 1V26A 5THXA 4WF9V 1OAKA 2WIAA 3AR7A 2VUHB 3NTOA 4Z4EA 1W0KD 2DWQA 3RG2A 3LD9A 1XT6A 3TF5A 4O4LB 1KI9A 3B52X 1GRNA 3B3GA 1CZHA 4NYMQ 3BWXA 3R20A 2N05A 4N47A 4D6PA 1N6RA 5DNDA 3UO2A 5BV0A 5DBIA 1DTWA 1WB9A 2QU8A 1ODLA 3WLMA 5L3QA 4CS2A 3SHTA 3G67A 2F7SA 3K30A 2ZYGA 4KQ6A 4JLKA 2IKQA 4V03A 1ZD3A 1JH8A 4F45A 1R3LC 2VJBA 2FFBA 3Q7RA 3R74A 1CTQA 2G6BA 3EZ6A 5DYGA 4DMUB 3EZ2A 4B3SB 5DB4A 3ZEAA 3ER9A 2LCQA 1FBTA 1P0CA 1JHMA 4TTSA 3RAEC 4IIDA 3TG2A 5FOQA 1PV4A 1Z82A 4ZTBA 1BD4A 3S1SA 4Z7NB 1JT2A 1ZI9A 4HAWA 2JHAA 5B1NA 3MUEA 2BSQA 4ZV4A 4ZAFA 4II2A 1X7GA 2NW6A 1ZRSA 4NE7A 2PUBA 4P38A 1U4OA 4H44B 3TZ6A 1H5UA 3EGOA 2ZUTA 1IXYA 1GZSA 2CH7A 4FYPA 1PUXA 1IBRA 5IU6A 4JX9A 5ED0A 4ZV9A 3M8KA 4ZICA 1H2YA 3SEFA 1E60A 1G9TA 2I5PO 3CZ5A 4QUAA 1I7QB 1RC8A 2ZETA 5AKLA 3QYAA 2PBLA 4Z1MA 5DLDA 1THMA 5EIHA 1RMTA 2PRZA 4NK4A 1PVOA 1ARZA 4DLSA 4EDFA 2WV9A 4C88A 1KECA 1X94A 2PMFA 1L5HA 3VU3A 3ZLVA 3K9BA 5IAGA 4F6CA 2VNSA 4I4TB 4RKEA 3R09A 3L07A 4BCBA 2X0RA 2OV4A 2Z5UA 1OV4A 1YR9A 1PT9A 1EJ0A 1IEWA 2DULA 1D5WA 3ABRB 4PN3A 3LO5A 2WLNA 3BJZA 1JQ0A 2WYIA 1ZD8A 3DW1X 2ZUUA 4H15A 3AF0A 1NHWA 4HYQA 4C4TA 1H22A 1E5VA 4C7UA 2FETA 1J1ZA 3EZLA 4QBTA 4J7JA 1VJ5A 2RHHA 4M37A 1PN3A 3TLJA 1VYHA 4RO2A 1XE3A 1B3BA 2RI6A 3VQVA 2VHUA 1EKXA 3NBQA 4J75A 4GYKA 3SC3A 4ZU1X 2O8FA 3JQ9A 5A4FS 1DIRA 4K3VA 1TEVA 4IICA 1AJPA 1GZ6A 1TDJA 1F6WA 2JA1A 2POQX 3ANSA 2PZFA 1HBJA 3R3VA 3HJUA 4JASA 4Z8XA 3CC4V 1QTRA 2C8LA 2IUYA 4QTUB 1VPWA 4L5YA 1FMTA 1NW7A 3A04A 2WFZA 2WLIA 3F4BA 1R66A 3GRPA 1RQXA 1P45A 2DR2A 5CYPA 1KAQA 3FNQA 1L9KA 1A4RA 4NAVA 1MB0A 1J1IA 2DP4E 2BZSA 2K5UA 4OXQA 1MPTA 5HCUA 3UUFA 3I92A 3DO8A 3L7LA 3OX3A 4KO8A 1R12A 4OPAA 1RVV1 3BWVA 4KPFC 4Z4FA 8MHTA 4EL5A 1P7BA 1XXHE 2EULA 4RTJA 4OMDA 1EWQA 2DVMA 4R83A 3ZCSA 1IXKA 1XEAA 1A9YA 4WLUA 4Z0HO 4NYJR 1QRRA 2Y9PB 4QAQA 4TTJA 3W4JA 4FC7A 1XZCA 5F98A 3MS7A 5B2FA 1QHGA 3D0QA 5AO9A 4EG4A 1FTNA 1VLHA 3KLBA 2WA4A 3N05A 3NHBA 4O2AF 4HUJA 2ZBGA 3C1UA 5CW1A 4ZDWA 4E3ZA 5JS7A 4M1YA 4MTXA 3N8KA 5I7HA 5BQ5A 2JFFA 3PTLA 1NXQA 3BFRA 3PQ8A 2IXTA 3U3RA 1VHLA 4AF8A 4OGQB 1LQ2A 1I2DA 4CBVA 3Q3CA 3A28A 1YQWA 4FKBA 1I8TA 1XDZA 4JLAA 4NTZA 5FL3A 2DHCA 3TTTA 3TJTA 1FNMA 4MCHA 4PBSA 3ZD6A 3TLAA 1LUVA 5EBWC 4UEQA 1E2EA 3UAOA 2YWJA 3C8DA 4U7JA 1BZKA 3O3NB 2QSUA 4F60A 4CDRA 2W11A 3TLEA 2GTHA 1BA3A 5F4ZA 5B53A 5KQSA 2HXYA 3ST7A 2FW8A 3LZDA 4AILC 2AVDA 2A8YA 3Q5DA 1TYCA 2WUDA 3ZEIA 5KPDA 4KO4S 2GETA 5A7GA 4ARCA 5IANA 2H59A 2IU6A 3MYYA 2B2XA 1T2UA 3G82C 7REQA 5ALZA 2B78A 5IVHA 3WC4A 3TCXB 5DECA 3V4RA 3FVVA 3STXA 1Z5UA 2DSNA 4FWIB 1LLUA 2FOIA 3CU5A 3FYEB 4I66A 1I3LA 2Q45A 3T7DA 5G4KB 4A16A 1IM2A 3DNPA 1WPQA 2PCLA 4ZAVA 1IVYA 1MABG 3A4LA 1L4BA 4YJ3F 2IDZA 5AM5A 2GVDC 3ID6C 3I9FA 4JLPA 3W4KA 3HM9A 2DE0X 2O3RA 4HYYA 5DX8A 5BW8A 4BNGA 1XJ5A 2H1LA 2F93B 4DV0B 3AUUA 4BGIA 4FIDA 3GRFA 4WCVA 3BSSA 4WD3A 3QNWA 4ZT5A 4LBEC 2X40A 3I2GA 4C7BA 3I6YA 3AEKA 5TQ2A 3V00A 5A0FA 1ZVQA 2JAUA 2WR8A 4QE3A 1Q43A 1HYGA 3KSZO 4BO7A 1CV2A 6LDHA 3BGSA 1K8AW 2A5LA 4TLLB 5KYXA 4YCNA 3AFGA 3PQ6A 3D8SA 3V4PB 1JHOA 3WWYA 1TCBA 3A27A 4GXTA 2GCOA 5DT2A 2VDUE 4S1NA 2HX1A 1H2WA 5KNDH 2RHTA 3ECSA 3HJRA 1F20A 2CVQA 2V03A 5IVIA 4V0OA 3E58A 3TCUA 4GWKA 1VRWA 2W4MA 3UAVA 1YRAA 5F7OA 5KO2A 3OKFA 1EGQA 3EB9A 3N0XA 4FGLA 3RAJA 3SJBA 1KEWA 4BVAA 2C95A 2I6QA 2LE0A 3IMCA 4B81A 5C2JB 3GA0A 1AX9A 1IMJA 3P0FA 1Z5OA 3WK7A 5BW4A 5AVZA 2D3TA 1NNI1 1O03A 1V71A 4WCFA 3G7SA 4OQ4A 1A7AA 1AROP 1HT0A 1QYDA 2C31A 2B25A 1N5JA 4YI5A 4CNBA 4N0QA 4MRSA 4XYMA 4HDNB 1EWTA 2OM6A 3VHLB 4B6RA 2BL4A 1E7YA 4JP3A 3TXAA 3WFJA 2QGNA 5LXTB 1C1XB 4EFLA 4KI7A 4HX9A 3WBKA 3P96A 1AQJA 2ECOA 3SIPA 1JDBC 1YJ8A 3CLUC 1K86A 3GCDA 1GKIA 1SBQA 2W2PA 3PKIA 4R1MA 4R9SA 2BMFA 2H5LA 4I3FA 4OAPA 4U9HS 1I6WA 2F3TA 2GD0A 4KZPA 1RKBA 1BDJA 2YV1A 2G36A 4M9QA 4Z9FA 1F4MA 2WVGA 4DC1A 1P7CA 2VTDA 3PWZA 4B2YA 2RGCA 1FDTA 2QTTA 4BFYA 2ONCA 4CQLA 1C3JA 2Q21A 4C6TA 4HWGA 3CX5F 3NHUA 4QVIA 3HKDA 2JVDA 3FB6C 2X5KO 1E63A 3RROA 1Q0UA 4QT4A 1QVVA 3BE8A 5IN4A 2B83A 5E1MA 1Z15A 2LQTA 2XJ9A 1FXUA 3G7NA 3P2IA 5G4LA 1J22A 2DF8A 2CMGA 1U2DC 1Z6PA 3L8CA 1JHDA 4GIBA 3W90A 4UTPA 1GRRA 1KZYC 5D3MB 3UIEA 3PL5A 3WMEA 4DREA 2W2LD 4CC5A 3WV4A 3VNQA 4IZ6A 1KTIA 3DL0A 3S0JA 3HDVA 1XZMA 5DWQA 3K32A 1VHWA 5E6RA 4ZJYA 2CTWA 4BQPA 1A0OA 4D9KA 4KGXA 3LF2A 1JHQA 4NYKA 4U2FA 5ADWA 2D1RA 1I08A 3DYVA 4PLYA 5B4UA 2QL5A 1GJRA 1MKYA 4DDHA 3PK0A 1MG1A 3OT7A 1WU7A 4KB5A 4DQUA 4JI1O 3L3BA 3F3SA 4FBLA 3TSCA 4I50F 1Z38A 2AXPA 3I2JA 3EA4A 1W96A 4WX2B 5IWAB 5AJUA 2A7XA 3RYIB 2C4WA 2VSQA 2SECE 1L7RA 2JHCA 4YRMA 3GLIA 4V0QA 3VDRA 1MZFA 3GH1A 1IQ0A 4TMXA 1GG8A 4BNWA 2XB9A 1MGOA 2AEJA 5KAMA 3CLVA 4BRSA 5IABA 4RZQA 3CZ4A 2I6GA 2V7QG 1ZJZA 1MB3A 1GGVA 1QGOA 4LXGA 1DT3A 2OOSA 1NI4B 2D54A 1GPH1 1GAQA 3HC7A 4OH1A 2X6BA 2RC5A 4D9BA 5LMUB 1WQ1R 3CG0A 2AXQA 5M2QA 5DHFA 2WU3A 4IIHA 2HBRA 2OBBA 1DJNA 2X4DA 4F9FA 5KYGA 2IHZA 3A0RB 3GMTA 4JLNA 4BFVA 4A73A 4I46A 2P9YA 1IWPB 3RT3C 2JAQA 3U9LA 4IYRA 3NC4A 3T5PA 5IH3A 5F7XA 3VKHA 1YKFA 3PLNA 3DFIA 1OWPA 3QFFA 1XNQB 1H0RA 1NJSA 3CNQS 4WK4B 3LLCA 1K7YA 2JGUA 2OCXA 3K1TA 1J9ZA 2ZT7A 2O7RA 4POOA 4PA4A 1E9SA 3CZCA 4AMZA 1OROA 1OYYA 1EDDA 2VJMA 1N92A 1JDTA 1XZLA 2GO1A 3QJGA 4G5FA 1DC6A 1GPKA 3DC2A 1Z35A 5LOVB 3EXHC 1DOZA 4PJ0Z 3H2ZA 1OT3A 5TGTA 3C90A 1UK8A 4QVKA 4CE6A 2A0FA 1RQRA 5FD8A 4RHFA 3S3WA 1EEHA 5LVAA 3QVKA 4JLBA 2REBA 5GWXA 3QUSA 1VMEA 3KVVA 4YREA 2JIRA 2VSOA 5T8KA 1CCWA 3ZCRA 1P2GA 1TM3E 3TZCA 2ERCA 2BKEA 2Y6VA 2OCCB 1JSRA 1KYZA 3OIGA 1AQUA 1FNBA 1KMMA 3OO1A 7GPBA 1MFZA 1Y6ZA 1D2HA 3OD1A 4X88A 1HNWO 1LBSA 1I0ZA 1K2VN 2FG7C 4ZBMA 2FPWA 3E8XA 4G0QA 4PV7A 4R7GA 5A7HA 4TKUB 4D8XA 3KCYA 3INYA 4NCHA 4Q18A 4AMBA 5BR1A 1ZHHA 5IT5A 4RVGA 2VUSA 2BLLA 1UP6A 2GRJA 3IVAA 4JTCB 3DQZA 3H1BA 4GQAA 5BO5A 2X41A 4EG1A 4O2AA 3ZV4A 5JZ9A 5KVSA 4N8EA 3E8BA 1Q95A 1F51A 3L84A 3OY2A 3R6LA 2RJOA 2NO1A 1T5TA 1FBNA 2CF6A 3GA5A 5K8UA 3ANMA 5AI8A 3P7MA 1KEZA 3VR6A 1IHOA 2E6KA 2RC6A 4GR5A 5IYZB 2VH5R 3GT0A 5DRTA 3VQYA 2ZYHA 3CM0A 1JSLA 1PG0A 2I71A 1QU7A 3G71V 2JJ2G 2F4NA 1GCUA 3BMCA 3D43A 3B3FA 4GVPA 4KAAA 2CE4A 4MUGA 1RHJA 2P7HA 1VKOA 4NENB 5KOIA 1L5LA 2O8DB 1LDEA 2Z04A 4EFNA 3T4EA 5JD6A 4UCFA 4KXWA 3A6LA 2HR3A 4LDNA 3IA2A 4M38A 1RM0A 2H8PC 1RRMA 5CLGA 5I7VA 1YFZA 2FYTA 4HLCA 4JXKA 3GCWA 2RIRA 3IILA 2D7JA 2XGGA 4CS3A 1W1IA 1HRDA 2GBGA 3RU9A 3QLUA 3W5BA 2ITDC 1X1CA 2CJXA 1Z2OX 4DHEA 2MDTA 5JWRA 5DBHX 3NKVA 3OHPA 1MAAA 2DPGA 3MMZA 2AWOA 2HNAA 1M0SA 3X1KA 2NU7B 1XU9A 1PJ8A 2XY4A 4CKZA 5DI3B 3JQ8B 5E4TA 2YMPA 4DM3A 1YQ9A 5EJ6A 1AQ6A 721PA 3L41A 4RF5A 5H82A 5KQGA 1DCKA 4RTPA 4MDFA 2WYHA 4G27B 5BN4B 1W4ZA 1OCCC 3KTOA 4XB1A 1XBTA 2H57A 1TJYA 2EL7A 2OT3B 2G9VA 3EUAA 2CUZA 4X44A 1CS4C 3CVOA 5DCLA 1Z83A 2ISCA 3OH8A 2C3UA 2GTIA 2VA9A 3IIMA 3CHYA 5DM4A 5ITWA 2OD9A 1M74A 5CK5A 1ZC4A 3BKWA 4HUQA 2NAPA 4W5OA 3H1TA 3SSMA 2BI7A 5HQJA 2ADPA 1HWYA 3IMEA 4DCSA 1Q21A 3SDBA 4YCMA 2EZ9A 1PT8A 3WG7C 1Y5IA 2PGOA 2Y93A 5IYCO 1XX6A 4XQCA 1UT6A 3H9BA 1G6KA 2XUGA 2BDTA 4KVFA 4PSKA 4XM1A 5AI9A 5F5LA 3ZCUA 3X44A 5JBIA 3MGKA 1C4OA 3R41A 4TT3D 2HIMA 1GTJ1 3CF0A 3LHFA 1BQ3A 2GPWA 1P62B 3W3AA 4FNMA 3U7JA 3GG9A 5CN0A 2ZFUA 4FEEA 3ZWMA 4TVOA 1Q57A 3CT6A 3TW8A 1SURA 2X5OA 3G5UA 4DDVA 1A95A 1FPOA 2DZDA 3AFMA 3ANYB 2Y76A 1ZR4A 4HWPA 3OEEA 1K4CC 1FTQA 1PFUA 5DULA 4C2BA 2WNHA 5HTOA 2ZDIC 4TLBA 3SJCC 4CJXA 1OBVA 2HA6A 3I62A 1R0XA 3VDXA 1KZ1A 2HMYB 2XGOA 2XYHA 5KVAA 1LLQA 1VMDA 1MEJA 1Q7YW 1OIWA 4BVKA 4BXOA 1GV0A 1HEYA 1UBLS 1ZVJA 5IW8A 2HSGA 1IE3A 2C92A 1R64A 3ZDFA 2B8JA 5K2OA 3UH0A 1O0SA 3E7PA 1L4HA 1T6ZA 4FOSA 2NMVA 1FLNA 2IYYA 1DOHA 4NKGB 1B2LA 1A71A 1U94A 5IJ9B 3EZYA 2OO7A 2BUCA 1LLFA 3BPSA 2C4KA 3NFRA 4MUHA 3JTMA 1DIBA 3E15A 4RENA 4NBSA 1DKNA 1UINA 3LNCA 3N2EA 1VP7A 3MS4A 4MPJA 2ORED 5EHQA 4ENSA 2ZRBA 5FHQA 6YASA 5GZ6A 3HI4A 2CK3G 5B58C 1YQGA 5DI9A 2HEIA 3I01M 1GY8A 3KHSA 5FORA 2D2IA 1XMXA 3NKLA 1XRSB 2D8AA 2WE7A 3SYKA 1LD3A 3PHJA 3GVHA 5AI6A 4HH4A 5E1OA 2KB0A 1SKBA 4W82A 3U7RA 3RHTA 1TA9A 3VZSA 1V54C 5ADUS 2JGDB 5TEWA 4RQFA 1MO6A 3FGPA 1DV1A 5L3GA 1I4DD 1GN9A 2H65A 2RAFA 2RGBA 3G9XA 3QY9A 3TNLA 4E5UA 4AZ0B 2F9LA 1E7MA 1V95A 2IIVA 4ZQCB 5ERYA 1AHIA 4YRFA 1IOVA 4HFNA 4MI6A 4PAWA 3RGWS 4ZIRB 3GJZA 3ASUA 4ND4A 3HHEA 3OTHA 2VO1A 3RQIA 1NASA 2F1MA 4MT8A 2IP4A 4HDKA 2M6RA 3TLKA 4UBLA 4IDCA 3I4LA 1UBKS 5GADl 4A0GA 2AHZA 3CR8A 7ABPA 4A15A 2R6HA 2B5OA 1NI4A 2G3YA 3IUEA 3M6AA 4KYTA 3WISA 3ZY5A 4HT3B 1NT4A 3A1DA 1A50B 3CLTD 3MWEA 1U3CA 1AZLA 1KOFA 4WV3A 4R8KA 2OIGA 1S4MA 1NX9A 1AVTA 4RLFA 4U7FA 1MOSA 5DSTA 3OOHA 4L0CA 1ZOSA 3C24A 2RCNA 3NQ41 1GGEA 1M8JA 2PV7A 5L8VA 3EVKA 2QWQB 1YFLA 3AGQA 4XD7A 5U1PA 2AYZA 2Z1NA 1NF2A 3CPHA 3BY6A 5EE3A 3UJ7A 1VGQA 1NOIA 1UQRA 5EJ5A 5IKPA 1N6NA 1G8PA 1Q0LA 1VGRA 2C03A 2FF7A 2WNSA 1GCIA 3Q85A 3QOXA 4OYHA 4WNCA 5GONF 2ZS8A 2A1IA 3WR5A 5SY6A 1X92A 4CWAA 3GAMA 1U28A 4UUNA 1ZUQA 2KM1A 4RF2A 3TMKA 3PHIA 3PNSA 5CBPB 4UD6A 2Q3HA 3OM9A 2PUSA 1E2DA 2CN1A 4C06A 1Z0SA 2RBKA 1HDRA 1Q7CA 2VUTA 3ZWOA 3DE5X 2OAGA 5GIPE 1IBSA 3QU4A 4WNAA 3WYBA 5LYJF 1Y8QB 2ID4A 4P3PA 1VJ0A 3HS3A 4L5CA 3FCUB 1B26A 1CQZA 2CJFA 3RAGA 5LMZA 1Q50A 3E2MA 3ROXA 2PSDA 1G2QA 4UFOA 1UDRA 3AMVA 4ZVSA 4C4XA 5A5FA 1QDLB 3AL2A 3DVAB 3PEVA 3R3HA 4KE9A 5AM4A 4GKKB 4DNOA 4EB3A 4Q9NA 2VRWA 4ZVPA 4E08A 4E30A 4GPTA 1T1SA 3AILA 1MO5A 4UMFA 1CU1A 2CNDA 4RUKA 2ICAA 3HGMA 1YEWA 1MUUA 3OUTA 3C5HA 1BMFD 3MMPA 2DB3A 1T9GR 4KMSA 3ZE9A 5E0KB 4CR7A 1IONA 1UKCA 1ZGJA 3OIWA 4CG2A 1OXXK 1W88A 1AD2A 2Q6VA 2LW1A 1XCMA 2BBTA 3FJ1A 3SYPA 5I48A 1Q44A 1XTQA 4I1YA 1IAQA 2C78A 1P2UA 2QRHA 2Y67A 4JKYA 3VNRA 2B4AA 1W30A 2JFBA 3FFBA 3GXBA 4PLPA 4DMCA 4PI2A 4BV3A 5C7LO 3WRXC 2Q4EA 4XTCS 4L8JA 2DM6A 3AHDA 1FZTA 3AG3C 3C3EA 1XRLA 3VYTB 3KV3O 4HR7A 1BDBA 3ECCA 2PMCA 2QRKA 2VZLA 3AINA 2SICE 1AP5A 1ZIYA 5HVNA 1UAAA 4BNMA 2REOA 2OORA 4YV1A 3AK4A 1JCHA 3VQWA 5EC2C 2PPVA 4TTPA 2YI8A 1K6XA 1BHO1 4QHYA 5DSXA 1FU7A 1SBIA 4WCFB 3SQDA 3RT9A 1V48A 1CLUA 1SQ0A 4PX2A 3JRWA 1MNGA 2YWFA 3RSOA 1L0LH 1IFXA 1ZU4A 2J3EA 3HI6A 3QZUA 1YQTA 3UF0A 4JYZA 5JC8A 3A3PA 2D4AA 3RRNA 3OQVA 2N47A 4IHJB 4D8UA 2ZIOA 2CFTA 4I9WA 2NVUB 3RKRA 2ONZA 2GNAA 5KDLA 3OI7A 1GUAA 1I5RA 3RH0A 3IVCA 5FLKA 4NV1A 5DNCA 4ENVA 1MOZA 2H2AA 1OI2A 4LKRA 1GN8A 1G17A 2WA3A 4RQUA 1A2BA 3W5CA 1E61A 1NTOA 1GTRA 3DYBA 3LSUA 3CTMA 1W2HA 2BR4A 2GCOB 4W4TA 1C4XA 4XRRA 5H4HA 4F0JA 5BN1A 2JBWA 3DKIA 2I4IA 5CTJA 3L6OO 1AQLA 1BYUA 2UXDO 3KU1A 4KXUA 4DEVA 2VZ0A 4RD1A 2ZIEA 1VA4A 5J58A 2ZJFA 1IXSB 3ZDZB 2KG7B 1W0JD 3QNEA 1G291 4DR6B 3K2BA 2Y99A 2PRIA 1CUAA 2ZSKA 1WCWA 5AHRA 3ZBQA 1IEXA 2ZRJA 2W2KA 3I3SR 1YHZA 4KCGA 2UUAB 3SOZA 1IX9A 5ALLA 3O1JC 1W73A 4H60A 3KSUA 1A5AB 1NVKA 2CLDX 4X6XA 4D7AA 2Q0AA 2BFPA 2QJOA 4U7NA 2CUTA 3ABTA 4YI3A 2I3AA 5ILQA 4QICA 2VRZA 4F6RB 2QVCA 3G5TA 3VZRA 2HC9A 4Q7KA 5BYJA 3OPMA 4HAXA 4G86A 3FH0A 5ER9A 1D4AA 1JHXA 3H9VA 2QSAA 1K0UA 1NR5A 3QLJA 4FE4A 2VL7A 4ACAA 4V3CA 5EMLA 4AY2A 1XC7A 3TW0A 4DLKA 3K5LA 3OIVA 1Z47A 4TSKA 1LDMA 1G55A 3P0EA 2Q7XA 5T3UA 1VCOA 4YP6A 1K8RA 2ZJBA 3CRAA 3Q40A 4JOSA 3TTSA 7REQB 5C9ZA 5J23A 2JRIA 1AQYA 3MPOA 1A8IA 5GPBA 4XWGA 1NXSA 3EYAA 3RC9A 3BHNA 4BKQA 4XDYA 4I5GA 3TXXA 4D9JA 2Z4TA 3IUSA 1IY2A 1OVGA 4KQJA 3AJDA 5AOBA 4BO3A 1P80A 5IRCD 2I8AA 1HSOA 3V4VB 2R8PA 2F2TA 1PNRA 1FY2A 1TVCA 4FT2A 1Z2DA 1BAPA 3T94A 1BHSA 2XHBA 1T8TA 2O8BB 3OWOA 3K9GA 5K2MA 3ZDQA 2RIPA 4C3UA 4NU0A 4M8LA 4MP3A 1WWKA 1AB5A 1KDTA 2C99A 3VPSA 4NKRA 1LPNA 5FTKA 3G6EV 3TIXB 2W6OA 3DPIA 2XDYA 2VUUA 3QG5A 4FFVA 4JBHA 3CLRD 5I45A 5BV8A 2XBUA 1MA3A 2QAGB 5HQ3B 3OT4A 1O0BA 1NATA 2FEWB 2PU5A 3FUXA 3QMWA 4E15A 2VP9A 4IIUA 3L1HA 5BSFA 1DKQA 2EXXA 2JH3A 1FFHA 2EFYA 4IDEA 4DF3A 2XIJA 1PR2A 3FOWA 1VCIA 4DV1O 1F5SA 2W6ID 3ADDA 5JWOA 2OMKA 2ZITA 3QPDA 3ESCA 3ZBTA 3T6KA 1JQ3A 2VC2B 1ZA1A 4MIYA 2VQEB 1Q14A 1GG9A 4EP1A 4KAJA 5IVDA 4MZXA 1WG8A 1Y1RA 1EZVH 2Z3WA 5H6RA 4ZZ2A 3UB4A 2AI1A 3EDQA 4UUPA 3FG9A 3LPMA 5JLJA 3CVVA 1OI3A 1XF9A 3LYHA 4IHJA 1WBBA 4P5PA 3HJGA 2RKWA 1EQAA 1PJZA 4MICA 1QC5A 2JFWA 4CI0B 4Z5XA 3QSGA 4MKHA 5K6TA 1ZICA 2NVWA 4Z9BA 4MRMA 4P83A 3T3PB 4KXYA 1KORA 3FM9A 4DW1A 1Z4OA 4EKYA 1JIJA 4KBYA 2J85A 2VDOB 1DLIA 4I1IA 2FZCA 2ES4A 1ONSA 4N12A 5EFZA 4TLEA 3RB8A 4CLRB 2XT0A 4EY7A 4RE6A 4Q6GA 1ODKA 4I5SA 3LNNA 3HDGA 1HNNA 1VRCA 3PC4A 1GITA 3NYIA 3ESRA 2DXIA 3JATB 2QTNA 5CIWA 1YZVA 4F8YA 2I6FA 3NCTA 2D6FA 2VQDA 4G9BA 1S0UA 3PV0A 4NBWA 1WZ2A 1SG0A 2F3SA 2RDCA 1D0VA 1E1DA 4ZI7B 2GD6A 3SEQA 3UTDA 3ISVA 2JLCA 3NTVA 2O8DA 2QUIA 1G21A 4MRNA 1A77A 2HOQA 3ZCVA 3QXJA 3DVAA 1YQUA 3DDWA 1T3HA 4H6VA 2BCJQ 2VQSA 4DMLA 2E75B 5TS2A 1GM9A 1KDYA 3VXKA 3HYTA 3OEED 5CT4A 2OLJA 2CMDA 3T5CA 4CI9A 1N5LA 5A9RA 2FXIA 2K9PA 3TEFA 1JIXA 3SYAA 4BU0A 1GN4A 1XHXA 2CXPA 2Z0AA 4ID3A 5AI0A 4ALNA 2DQZA 1FE8A 2XAAA 2R00A 3ESXA 4AJIA 4XLLA 4FYXA 5JE8A 1XV5A 3ZRXA 1UC5B 3NHRA 1DJOA 4K05A 1UZMA 3BB4A 3ZYZA 2EZTA 3GUZA 5JSZA 4NJMA 4XJXA 2AZXA 2GBLC 1Q6YA 2KI5A 5KKAA 4B4KA 1WB6A 5K0TA 2Z6QA 1MG5A 1XCGB 1TPZA 3NANA 3U3MA 1U04A 3DT9A 2VDNB 5L3DA 4RF4A 4FB4A 4XWWA 3LC1O 3EEOA 1U9IA 3CSSA 3AJ9A 4GD3Q 5AIBA 4K9SA 1JRLA 5L3RA 1M2NA 3KPVA 3RRFA 3W9YA 5BY2A 1VIVA 4MR8A 3C3TA 1Y66A 1KP9A 2HL6A 3BD6A 4PPGA 4C7MA 1UKBA 1WEHA 3C6QA 1HNXB 2CHFA 3BJMA 3JWIA 2D2XA 3W3AH 1E6EA 1E4OA 1ULSA 4UAVA 4AZTA 3U56A 4KR6A 2VZ9A 5L3QB 2PMKA 5CT8A 3ZCCA 1RHKA 5TPZA 3U5TA 4Z3OA 3I05A 3TSZA 4TLAA 5AHWA 4C6RA 1XVIA 1VI5A 4AN4A 2PBZA 4YPVA 3QYFA 1O8BA 2BT4A 2FJPA 4DV7B 4DMRA 1JIUA 4MP6A 3U1VA 3DWFA 4Z3KA 4X93A 4EKWA 3K0GA 2FH5B 3VU9A 2C1EA 3OUZA 5FOTA 4F5EA 3NP7A 4JMPA 1T8YA 2AI3A 4ILEA 1D6SA 4YHBA 1TC1A 3B7PA 2NU6A 3F0TA 3U7IA 3V8EA 2O1WA 2KJQA 5KVVA 3ZXSA 4UC0A 3LW7A 1RACA 3LX5A 1DF4A 4UOEA 1FFDA 2GHTA 4DW8A 1F6BA 1J33A 3I83A 1H1TA 2J9YB 2ZB7A 3H18A 3MJFA 2EATA 1C9JA 2BFBA 2P90A 1XOIA 1TD1A 2OCLA 1LLCA 1MJGA 3NASA 2QSYA 2VBGA 3WNZA 3A2NA 1M90W 1DTWB 1M1YA 2ZB4A 3KZMA 4QOSA 1GLGA 4UW9A 3TQTA 1F1BA 2B94A 2O23A 3LKBA 1VQMV 2DR3A 4HQ0A 4NE2A 4B85A 5ILGA 2YZNA 5FJIA 3X1MA 5CB4F 1ZN7A 4V2IA 4CIWA 4D43A 3BIOA 1BJKA 1MG0A 4ENRA 3HWX1 4LK3A 3CMEV 3K9AA 3LGXA 4OOFA 3WNDA 3SVZA 1TM2A 3VGPA 4ZU3A 5I3ZA 3CNOA 4G37A 1N9ZA 4D80A 3TBKA 5C31A 2LKDA 4GP9A 4DQ0A 1H69A 1IZ7A 1T3TA 4U8GA 2PKWA 1R8SA 3IDZA 1KFCB 3M4NA 3MLEA 3V46A 4ZIRA 1QRTA 3RYFB 3WIVA 2XF2A 3NS7A 3A0HZ 3P2MA 5ICMA 4JITA 5K01A 3R8CA 3EVEA 4AZ0A 3U3ZA 1HZZA 5CB4B 1N5MA 2G4LA 2NADA 3AEQB 3I73A 1XZQA 2L2QA 1PJTA 4W5WA 2QNBA 3UC5A 2P2CA 4DR2B 1NLMA 2OBMA 3D8HA 1Q84A 5IXSA 4NHEA 2H3HA 3WZLA 3IEIA 5KMGA 4D46A 3JWEA 4UDYX 1RYBA 4TTAA 2XQIA 3I0MA 3GH3A 5EKUA 2OFOA 3WLRA 1T0JB 2R751 4Z1MG 2ENUA 1S76D 3AP1A 4WFBV 2O6LA 5LN1A 4ZVNA 3GXOA 2OVBA 1XHZA 1GN2A 1PP9H 5ITSA 4UNNA 1H2SB 5ITZA 1YKGA 3LT5A 3LPLA 3DDCA 3PQDA 1XRJA 4R9NA 4UM9D 5EQDA 5CXUA 2HU7A 2WPDD 4J41A 4OHZA 4DABA 1UXIA 4BNYA 4PI0A 1CQWA 1RJDA 3C6BA 3HDYA 4C5BA 4KFUA 2CE7A 4JP5A 1PGQA 5EUMA 1V3VA 2ZQZA 4QD3A 3R9XA 3LY5A 2AOVA 3L7IA 1PLLA 2V7EA 4UXHA 4HB2A 3U4CA 2W6NA 5FT9A 3O9VA 2CFSA 1QZXA 2O2HA 3QXCA 2VSXA 5JQGA 2CJYA 4L3VA 2ANCA 5KWVA 2B3DA 1NN5A 1NN3A 2QW1A 3OP1A 1E9EA 4XCQA 4BV9A 1RHUA 4QG3A 1BL8A 3AOEA 3DOJA 3T5BA 2HQOA 2WG2A 4LHVA 3SC4A 1Z33A 2HFJA 3D6JA 1OFTA 3ZE6A 5B2ZA 1MF7A 1X77A 2ASVA 3CH6A 1KS9A 4ZYLA 2X0LA 3PRJA 4XGRA 4EJSC 4M7WA 5CA0A 3BCHA 4LBYA 4MI9A 1CY2A 2X6AA 3Q8WA 1Z0ZA 3DSRA 5BQXA 5AYVA 1CVRA 1IY9A 4FLYA 2Y4NA 4Z3DA 3K2EA 3D7SA 1OXVA 2WTUA 1J09A 2OZLB 4ETWA 3K8YA 2E7ZA 4NNOA 4HJXA 3RHSA 3SYQA 4R3UC 3WDKA 5J4VA 1HDOA 1JIQA 1OY1A 5AK4A 1EJBA 1M72A 1N5DA 1NSFA 1S2MA 1WCXA 2EFCB 2QT9A 2YJ6A 4QRHA 5SYAA 4C4OA 4DNPA 2V7GA 4F3NA 4GP6A 5EWJA 5HE8A 2MOKA 2IZ6A 3OAAD 4HTFB 3OCWA 1J0BA 4PICA 1ZKMA 3ESAA 2AKAB 3AZPA 3COZA 1U7DA 3IIIA 3T3GA 4TWBA 5AUOB 5BN4A 4RH1A 1TU0A 4B35A 4BO2A 4RIEA 3JYHA 2OXEA 4KIFA 1AG9A 3HE3A 2A0KA 1OB5A 3KJIA 3WYAA 2VPPA 2ZPAA 2UZAA 5LNK1 2PGAA 4BNIA 5AVRA 3J81k 2VLIA 4NH0A 1GL7A 2DQKA 3D3KA 4HNVA 1F06A 4XJVA 2VF8A 2AIRA 1YQQA 2I7DA 1BROA 2QTAA 3AC0A 3CLSC 2FSFA 3NWPA 4E1VA 5JZSA 5KB3A 1AJEA 1J2UA 2OZKA 3ETCA 5IYZA 1IBKO 1XAGA 3V5NA 2XDWA 3HXMA 6REQA 2CDNA 2Q5ZA 2FLWA 3ZQUA 4DPLA 1VKNA 1AXRA 1WTCA 2CXXA 3ONNA 3PGXA 3ZGXA 3ZJZA 4LY6A 1EFTA 2J5KA 3E3LA 4B2PA 3SQXA 1YXMA 3UFXB 2EFHB 3JAMN 2C7RA 1TAGA 4BWFB 4LGCA 4P7FA 3F9IA 1YE8A 2JEXA 2EX3A 3PFKA 4ROSA 5CLQA 3SEAA 3VHXA 2YQ5A 1RI2A 3HL0A 4BKOA 5JFGA 5K05A 2RCVA 4OU4A 3STTA 1K3FA 3EC7A 4ACBA 3ADCA 1F7VA 4L4SA 5AM2A 2HXSA 2IOFA 3HY3A 1Q11A 3B2NA 3H0CA 1E5DA 1R6KA 1KPHA 3MK31 4RIGA 5CVDA 5FWXB 3AG4C 1DRVA 1KL7A 2QUJA 1CY1A 1IATA 3CX8A 3HH8A 2L18A 1IH8A 3MJDA 4LF9B 4UEWA 4XWTA 2FW1A 2TS1A 5GQSA 3W5AA 2EZ4A 3EQ2A 2PZBA 3CS5A 2I2WA 5BW6B 2WM9B 2ZOSA 4RD0A 3FB4A 1KI4A 3G1WA 5DIFA 2OYQA 1XFDA 5E38A 4AXXA 2NUTB 4C29A 1G59A 4CM4A 2IP1A 4MVJH 4UBNA 1XNHA 4I55A 3ZWXA 2HP8A 4YMUA 4J2OA 1U0GA 5IYZF 2B30A 1AZTA 4HBZA 5DHUA 3RW9A 5JZBA 3VQXA 2BN4A 4OK5A 4URYR 4BASA 2F1KA 1KETA 3PE3A 4FP9A 3DO6A 4KXNA 4D3DA 4MW9A 5JR3A 3L8MA 3WXBA 2IVZA 3E3MA 1EK5A 4B4DA 2BMEA 4TMZA 5JCXA 2WRZA 5FADA 5BYKA 1P61B 4REQA 1SUIA 2AL7A 2EBWA 2LCIA 1P7GA 1KXZA 5LC1A 2J1LA 3ZE7A 4ASUD 2ZS7A 4FONA 4LJYA 1NI8A 4NVPA 1FX0A 1Y5NA 2VAVA 3WGVA 1UFVA 4XVUA 5AVQA 2P91A 4R3WA 3K20A 5H83A 3OUFA 4W7HA 5KZMB 4XFKA 4Q9LA 5JZVA 5LCXA 2JS3A 1DDOA 1E5LA 1G8HA 1T0PA 4JZKA 1BQEA 2RK3A 4Q01A 3O74A 4KDRA 2XOKA 4GRAA 1C81A 1E79D 1YHYA 4KWEA 2PUWA 2NV6A 1JR9A 3CUVA 4AIIA 1EPUA 5C35A 2OXTA 5CDGA 3PCRB 1VPTA 5GM2A 2GT1A 2ONJA 1JU9A 1E9FA 3P94A 1CUEA 4QDOA 1LNSA 2GWRA 2OC4A 5JNVA 5JJBA 1ZL0A 4U0KA 1P1CA 3AG7A 1ZITA 2AQHA 3GF4A 3PNPA 5FI3A 3FTCA 1T36B 4GMXA 2FSIA 1HC7A 2QWRB 1OWNA 1U96A 1I2ZA 1Z8FA 2UUBB 3AETB 1DC3A 3GLVA 3N58A 4MJ7A 4WDQA 5LIPA 2XMDA 3TIVA 2XXBA 5ESRA 4HZGA 5AKKA 4X91A 1XPUA 3HCPA 3UJ9A 3UBMA 3TBHA 4FHZA 2GHQA 4IV0A 1Y7IA 4C7OA 1ZWLA 4JHXA 3RUDA 3ZNQA 4IQ8A 2ZUFA 5FTJA 3S5UA 3ILYA 5I7WA 1RPNA 3BGWA 4NG5A 5E6RB 5BMOA 1N3BA 1AO3A 5AWFC 2PXCA 1B6SA 1L5GB 3OJEA 2ILTA 3M6VA 1CR0A 2Q46A 2DY1A 1K06A 2QTMA 3LQQA 3KYCB 2WYVA 3FSGA 3M82A 1QE0A 1VZ2A 4FXOA 4GXRA 1WBDA 4U3JB 1IZYA 4WW0A 1YL7A 4AJ1A 4DJDC 1G8MA 1AMNA 2P2YA 3DE0X 1EBFA 2QE7G 2NU9B 3E05A 3GIWA 2CNLA 1C2YA 1U0TA 2QX8A 2Q1TA 2QN7A 3FPEA 3EE6A 4ZDJA 3KUXA 5C37A 4E11A 3SQMA 4QPPA 5DMXA 1NXWA 2OG1A 2QMOA 3ZE1B 8AT1A 3QYPA 1R6NA 2VPWA 1SO8A 2NZUG 3AKYA 1GPMA 3K0BA 3KFVA 1AGPA 1YIAA 4K26A 1KEEB 2GF0A 2DYRC 3M3PA 3C6MA 1XHFA 3VQTA 3WGYA 4DMMA 4KR3A 4WK0B 4GECA 3R5TA 3K1JA 1KH2A 4H7HA 3ZHYA 1VG8A 1IB0A 2C00A 2QX4A 1BE6A 2YRXA 4TSRA 5JW6A 1WP9A 2RMKB 1Z3IX 4C76A 2VP6A 2XMBA 5HK9A 1DQPA 1PBTA 1Z39A 2FZVA 3OOWA 4NQRA 2G1AA 3ZY3A 1EN5A 1J24A 4FB5A 1QS0B 2FLKA 1JG2A 1FEZA 3TZEA 3CUEF 4NARA 1MB2A 2OK8A 3P0RA 3VPCA 5EXTA 1ODJA 1AHHA 2H7VA 3VH2A 1MPXA 4BNZA 1T5OA 4WOJA 1IZZA 4W4LA 2HD4A 3BDAA 5KAFZ 2ZBRA 4TXHA 4URUR 5AUQA 4EHLA 5TB5A 1U1EA 4RBNA 5C0OE 1E1QA 4WFGA 3NHPA 1YF2A 5ARDA 5FOVA 4LF6O 2D2FA 1T0UA 3NHFA 1X42A 3DZGA 4P54A 5AKEA 1EUDB 1RXCA 1UBOS 2NSLA 3A1EA 2X0KA 4PQRA 2OCGA 3V34A 2WKPA 2YN2A 4OXYA 3I6ZA 1A9PA 1UZNA 4TUYB 4W63A 2GA8A 2QWNB 1XMJA 5LXTA 1C1XA 2Q7OE 1ZVVA 3GD5A 4P86A 3N28A 1EFPA 1C1DA 4RSMA 1R88A 1L7PA 3ZGLA 4ER0A 2E55A 1MIHA 4RK7A 1AB6A 3VSEA 3IURA 1W76A 3WJ2A 3ZUPA 4HYTA 2NO5A 4D6YA 2D13A 2PKQO 4G5HA 4S1PA 4CR8A 2QM4A 2BRUA 5JJLA 3TOSA 4ECAA 1YZKA 3FTQA 3DTVA 3GRAA 2V9ZA 2DUNA 3EH2A 1XZJA 1JMKC 2Y0DA 4KLCA 4YMVA 3F67A 3FXAA 1PK8A 5FKJA 4UASA 1ZSNA 1SU8A 4YJHA 5MFPA 5JFTA 3N3AC 2G38A 4PONA 3Q8XB 1VHJA 2LKCA 2BE7A 1QVAA 1G6Q1 2FN3A 1CJKC 3EDYA 5KHIA 3RYTC 1B6RA 4FI3C 4AP5A 3CH5A 1KOLA 3SJUA 1N0UA 2I4OA 4A0RA 1APBA 4CH5A 1CUCA 4LFBB 3C0KA 2Z2JA 3LIPA 2EJUA 1ZXLA 3KKEA 3LX6A 4TYMA 1NOJA 1JNXX 1GDHA 3PE6A 1EJ2A 3S3TA 1GKKA 1QYVA 2AMFA 3E3OA 4OYRA 1BH2A 1KPGA 3IQEA 4AJ2A 1BCRA 1L7NA 3OZRA 2GAAA 4XVHA 1Q6HA 2WTMA 1Z5ZA 4OX9O 1DAEA 4ECEA 2PWYA 2P9GA 5D7BA 3RNLA 3SMQA 3N2GA 5B6JA 2B3TA 1PPJH 2CLCX 3D4BA 1GGFA 4G4JA 2DPHA 3WJAA 4F1KA 5LYJA 1N2HA 3E4CA 3HXOA 1MOPA 3HN6A 2R8ZA 4J3NA 5HMLA 1P1JA 2CDYA 1GAXA 2QTCA 1QM5A 3LPDA 5JSZB 1ZJWA 2HLDG 2KLBA 2R1UA 4LTNA 3EVTA 5DCWA 5C7OO 3S2SA 1NYLA 2FZ4A 1S3SA 1ZIDA 2AT1A 3JAWB 4DC9A 4DLLA 4K0KO 4JSRA 1JXMA 2FFRA 2MSKA 3N6RA 3PQEA 3U0VA 2QPAA 3UJDA 3WJ1A 3DWEX 4C4YA 4S05A 1Z8NA 5MGBA 4QRDA 1NVDA 2X13A 2BLNA 3G2NA 3OC0A 1MR3F 3QVSA 1WMAA 2GBCA 3EZXA 4FDUA 4Z9XA 1MAVA 2V7WA 4E4EA 5I7AA 5KNCH 1SUSA 1RJWA 4GX1A 2DJ5A 1FDWA 1MCZA 1V8BA 3WIUA 4FCVA 2LVBA 3DT6A 1XQ1A 2OM2A 3A7DA 3IGFA 5SZIA 4B7ZA 2XJ4A 1WMEA 3ML1A 4F2WA 4EY6A 4RH3A 4LCEA 1T2AA 2J5BA 4LA4A 5EKXA 4YRPA 4HLDA 4CT4B 3ZRWB 1KVUA 2JFGA 2OCIA 1A96A 4CF3A 3D5TA 1THTA 1P2FA 2LP7A 2G08A 2PK3A 2RBGA 2W0MA 2WW8A 2KS6A 3HU5A 3U4IA 3D8RA 3ZI0A 1UJMA 3LUDA 4GICA 1WJZA 4UXIA 4BV2A 4CV3A 2GAIA 4WMLA 4KUEA 3E7FA 2H07A 1QVZA 1ZAKA 4HQOA 3QVVA 4I1RA 4M0CA 1E1QD 1XZAA 3KE9A 1LRJA 4CKYA 3QU2A 1HETA 4OAOA 5DM6V 4RPKA 2YMQA 3L9XA 2D8MA 4MQEB 1G7TA 5F3RA 4PTYA 4G4IA 3SF8B 3KIPA 3TM5A 4MPDA 3GVCA 1JIKA 4BAUA 2DCMA 4JYBA 2FSHA 1UJ4A 3D6VA 2AUMA 4UOQA 3R7WA 3SDLA 1KK0A 2I62A 4PZEA 5ISMA 3LA6A 4RMJA 4C5AA 2IZ0A 3OVMA 4MTFA 3FHLA 3KDSE 2ZPTX 4DN6A 3U81A 3DQQA 3JALA 4H1VA 4MH0R 1J9EA 4XDKA 1WE2A 2AS0A 4ZCPA 1OU0A 3RRBA 4CS4A 5COBA 3QOWA 1BWRA 1KYWA 2EZ8A 2O9JA 4II7A 5EQJB 1V1RA 5CMLA 1G98A 1KWKA 3THXB 4WQMA 1ZLXA 4OG2A 4PLTA 4CF4A 1HOXA 4CMIA 2Q07A 1KKLA 5KLVH 1YQXA 4XASA 5LA6B 3ZGVA 1K5HA 1PUJA 1ZM4A 4LWSA 4HF7A 4EARA 2FU5C 3RR2A 4EELA 3C8MA 3E6AA 1J7KA 2GARA 4RKFA 4JF3A 5CDFE 3HBAA 2XKBA 3KT6A 4E1BA 3SJBC 1OYVA 3LBIA 3BZWA 1JPNA 3DOUA 1RLOA 2H92A 4PA3A 3HMQA 3Q11A 4LYFA 4GX0A 4MUMA 4TS1A 4A6PA 1GSOA 3WS7A 3W5IA 4X66B 1Y76B 4YRTA 2ZXFA 4I4TA 1T9HA 3IE1A 4TTVA 3KWFA 4EYSA 4PQFA 5FUQA 2AWNA 3CIFA 2OCHA 2XAHA 3FRHA 1PSZA 3RC7A 3KPYA 3AW8A 3MAGA 4M22A 5ECDA 1E94E 3VI4B 5I47A 1QK4A 2JJQA 3O82A 5I8PA 4W5NA 4F9TA 1GEEA 3DTNA 2FHSA 3K1ZA 4WN3A 1GZ7A 2WV7A 2W2KB 4Q02A 1UMKA 2Q0SA 3KD2A 3W7SA 4XDZA 1DT5A 3L93A 4YLEA 2WNIA 3VDMA 2WINI 3TG8A 1SCNE 421PA 4KTTE 3W2HA 5JNWA 1WXFA 3ONVA 4N5DA 4HCJA 1L8XA 3IR6A 1QIEA 5H80A 2YFKA 2GXUA 2A3QA 1S6YA 1N36O 2JL1A 1G20B 4JI2O 5CURA 3HJBA 4U7PB 4MVWA 1O97D 2Q9UA 5F9FA 3CCVV 3SJAC 4BPBA 3U40A 1RBZA 1VJ1A 3PXAA 4GT1A 3OICA 3H6GA 2GAFA 1QCZA 4G0PA 1JHUA 3FYHA 3LHIA 3I52A 4U9IS 1RWOA 5JMOA 3EXFB 3IOEA 2SCUA 3B51X 2HHLA 3HVUA 1E6MA 4HAMA 3A1NA 4GKBA 4P22A 5CRIA 5JY6A 3F96A 4M83A 4AJLA 3K70B 4WBSA 1DFGA 4DLAA 1Z56C 3TZHA 1S9DA 1V2GA 5BUCA 1QZZA 2IHKA 1RM4A 2JLAA 3BE4A 4D41A 3T54A 1RPJA 1FLAA 3DFUA 1XRNA 4G4SO 1OJHA 5B64A 1PDWA 3MAAC 1QRUA 2Q9LA 4S1OA 4F4UA 4U6NA 1T9GS 3IQDB 1S3JA 3K94A 5CYFA 3MWGA 2ZTHA 2UZIR 5BSEA 4FLUA 4JIGA 1SAYA 1LRKA 1ZWKA 3QYJA 4LX8A 4UD2A 4WK2B 4X00A 1IHYA 4QSHA 2NU8A 4F96A 3KXDA 1N8NA 1M0EA 4OLFA 1PQUA 2ISSD 2Q4OA 3GUCA 1H85A 4WRRA 4YAEA 4RVCA 4KQ1A 2I6SA 3WGKA 5F3WB 2I22A 1U9JA 5ALNA 4CV0A 3ETLA 1KK1A 4KSBA 3IOBA 3TLGA 3AFOA 3THYA 3I39X 4M0EA 2H1FA 1RE1A 4BKMA 2MHCA 2XUOA 3ANTA 4LKOA 1O95A 1MO3A 2WF9A 3BRWA 4HPWA 5FUXA 4Y7DA 1GWNA 1SRQA 2FPIA 2CB9A 5DOZA 1SD2A 1UQUA 3EGEA 2IEZA 3STYA 4HK4A 1TE2A 3CVYA 2QN8A 2VR1A 3LVQE 3OQIB 4JJAA 2C8KA 2LDXA 3TWOA 4NCAA 3LYAA 1OMOA 5FHRA 4FW9A 4LOHA 5J9PC 1O94A 1V3QE 2H4XA 3A7EA 4D74A 1T4CA 3CCSV 4YP0A 4FW8A 4U9UA 5HILA 3ZK9A 5JU6A 2JGKA 4EAAA 4JP8A 2VTKA 4ZOBA 5E0OA 1EM8A 1X80B 3OLQA 5E3JA 3ABLB 1YA8A 3BCRA 3FPSA 2RHDA 3O4FA 1VB3A 4A23A 4EHDA 4RXMA 3G8BA 3RC2A 1I36A 5CB8A 5L3SB 3FGZA 2ZAOA 1L5ZA 2PIDA 4JMLA 4PHTA 4GW3A 5KA5A 1Z7YA 1TEHA 2MWMA 3ED5A 3GC6A 2M7WA 5F73A 4JBIA 8LDHA 3K0AB 4B47A 2JDIA 2O0HA 4I4CA 1TJ4A 3BGVA 1FX1A 1BW9B 3IDAA 2QA4V 1G20E 1N2JA 1WNFA 4YGXB 2WMOB 5JJNB 3ZVRA 2ORWA 4MW0A 5KYUB 3AK2A 4V1CA 1V9CA 2ODPA 4NECA 3I9OA 2C61A 3B3JA 4HAOA 3OAAA 2GM9A 5DM2A 4ZRDA 5ETJA 4B17A 4BYGA 1JR2A 1RAEA 2P27A 4RD3A 1O96A 3CRNA 2OUIA 3NGXA 4H18A 4RV5A 4GYCB 1YKSA 2E18A 3R2JA 5C7IO 4PDRA 4R1PA 3MTGA 2RI1A 3RNOA 4G0XA 4UEKA 4K8ZA 3L82B 5BSVA 3SIXA 1N0JA 3L0OA 4WIAA 2HG5C 4MIKA 4FBGA 5CLJA 4TRJA 5BMVA 1M8GA 1WL8A 4M98A 4KN8A 1J49A 5KYTA 5D1HA 2EG5A 5DGDA 3NHWA 1L5SA 2H48A 1S1MA 4RJ2A 3HP1A 5JATA 3B38A 3LPCA 1YDMA 1ZOLA 3LDHA 5K09A 1MO4A 5AW9A 3JVEA 4S2EA 5TPZD 4QJIA 5JUWA 4HDKB 3TSWA 4XEUA 1S72V 2G72A 4UM9B 1OLOA 3QPBA 5IM5A 2EZOA 1Q86W 4LQ4A 1FFXB 3MRVA 1Q0HA 3CFYA 2HQRA 3NZEA 3VA7A 3L2OB 3V9AA 4EFMA 4FHDA 2CLMB 1TT7A 1OZGA 1P33A 4DR1B 3ET4A 4LZPA 1NP7A 3T99A 2Y66A 3SAJA 2KPOA 3QTCA 4NG4A 3AFNA 4PCAA 4WZAE 4E1AA 3ILVA 2CT8A 1YRLA 5M29A 1S8FA 1V5WA 2MSEB 2VHYA 5H3LA 3WZ2A 4AS2A 1MJHA 2V7QA 2RHWA 4QTZA 4EYKA 4GVLA 2V0CA 1LSUA 4R8LA 4TKVB 2J31A 1S7CA 4KRGA 3WNVA 3WLIA 4L75A 1YRHA 2R11A 3UH1A 3VSDA 2G71A 1YFJA 4P9PA 4LNHA 3PXGA 1DIAA 3QKUA 1USKA 4O4IF 4CKBA 4YYZA 3U4MA 4WLOA 5E9QA 1Z12A 1YUMA 1C7RA 1NQXA 1DIGA 3NHJA 3ZX5A 3AG5A 2UAGA 2X8WA 2IGBA 4RKYA 3RRXA 2AOXA 2JJ2A 5AKZA 4DWWA 4XIYA 4CQJA 4EG3A 1JLHA 1OASA 5JDCC 1J0AA 1QYIA 2HSWA 2TMYA 1FZQA 2I0FA 4LYDA 3QBDA 4K2AA 2JAHA 1IPHA 4MHOA 2I76A 4UV9A 3FLEA 4RXUA 1T2VA 4UAUA 4FX5A 4CLDA 4I8XA 2OYSA 4JXZA 2OSVA 2P22C 1FFBA 1CDOA 4PYQA 2D7CA 4H7FA 2Y1CA 1LX6A 2PGNA 2W48A 3FF4A 1CK4A 2JIZG 1V47A 2V45A 2WBLC 3O8QB 3ROGA 4KXLA 4B84A 2BEWB 1S2GA 2ZTLA 3X2QB 5K0CA 4MQMA 2E21A 2YFQA 1ISSA 2ZRQA 4QU5A 3TPFA 4K8OA 1Z16A 4Y1RA 5CXXA 1RYDA 2Y1XA 3FWYA 2DQSA 2OWEA 2GS9A 3PUXA 2ODQA 4MR9B 1SQBH 1R1DA 4LCJA 3VHQA 1TAUA 1BDIA 3CRZA 1F2DA 4X92A 3VISA 2PY5A 4ITUA 3T06B 2X9LA 3CLSD 2FPKA 3X1JA 2BEUB 5DM60 3FHCB 3NVKI 2BM8A 1FP7A 2ATVA 1UOOA 5JCJA 4O4IA 1J90A 2H1WA 3U7QB 4UTVA 1QU2A 3WDLA 1NT2A 2ADFA 3WVNA 5L53A 1SRRA 1ISIA 4Q1EA 3V8MA 4FHEA 1FIUA 2J7PD 1QHSA 5ERXA 1UWKA 4M1WA 1EHYA 1WLSA 5JHGB 4RKRA 4J90A 4GHWA 4U02A 3S2UA 3U49A 2C1ZA 3IEMA 5JD3A 3G6KA 4LDPA 1VG1A 3OETA 3RIMA 1WEKA 1DFHA 4FFNA 3EUEA 4FTWA 1TUEA 4X9XA 3TD9A 1EDEA 4DTIA 1V0JA 1WMFA 2OE2A 2UXBO 1ZEJA 1T8RA 1CUHA 4I3GA 4QYSA 3EH1A 5FV4A 4NYMR 3DC6A 1SVMA 1LW6E 1TMKA 3V1LA 4WZZA 5FJJA 2VZ8A 4F4FA 2CDBA 4AKIA 1B1CA 4TXLA 5GJBA 3B1XA 2OD2A 4M86A 4MUJA 3CLRC 3NJ8A 3FOZA 3DLHA 3HL4A 4PAMA 1G6OA 4NU6A 1BX3A 1KARA 3E82A 5BR4A 4AQ7A 2A2ZA 1N2CE 3MT0A 5LGTA 3CWQA 2ACVA 5DM1A 5DTMA 1PL7A 3QUAA 1NR7A 1OTXA 4OJKA 5IKEA 3UWOA 5DXJA 3ES9A 3KOUA 3KEGA 4DPKA 1XAHA 1BHJA 3IJEB 4KFTA 5DV9A 4J4BA 3PDHA 4KXMA 1UXJA 3D4LA 4Y98A 1ZI8A 3KJHA 1ORHA 3THRA 1TF7A 1U80A 2P6NA 4EW3A 2XKKA 4O5AA 4RPHA 4FHFA 1YVPA 4BRZA 2INGX 3IQXA 2QK4A 1NQVA 1J5EO 1XLVA 2E76B 3PTZA 1WVGA 4E94A 4C78A 1BDMA 1CHNA 3C8ZA 2ORIA 5LQCA 4Y2XA 2X3YA 4PRZA 4S0XA 4P7KA 1QFYA 2IYPA 3AJRA 4NENA 5E4YA 2QXUA 4DV1B 3ANLA 3NGLA 2E2WA 1DMSA 3E5HA 1DVRA 3RAPR 3RVBA 3FWZA 3T1HB 4TL6A 2ARHA 1WY5A 3ADOA 5IBPA 3SZLA 1N2ZA 4QDJA 1MAUA 5D1NA 4J1QA 4ZGGA 3EGWA 1VSUA 4I2NA 5K9ZA 4Q47A 2DFLA 4LHWA 4M88A 1MVLA 2AGVA 4HMOA 1REQA 2G7MC 2J09A 1DMRA 2GYWA 4IOJA 3X2FA 3JQRA 1QF6A 2CKDA 3W5UA 1JG3A 1G5PA 2JFZA 5I9SA 2OHOA 2QJTA 1F2TB 4NBNA 1EVEA 3ZHVA 2ACKA 3VDQA 1FLDA 1MTOA 1VI6A 2O2IA 4ODIA 3RS0A 1GZ4A 4H16A 2PJRA 2AV6A 2H1RA 2XNCA 1CR1A 4AB1A 4A6DA 3H9GA 4H3SA 4GDFA 2BRUC 1GN3A 4FM2A 4OP2A 1X0XA 3G2QA 5G53C 2ORVA 1W6UA 5JI2E 1PJ3A 3PT5A 4A5SA 4QO7A 3LY7A 2L82A 4KXQA 3UAGA 4L5AA 4LZZA 1JDNA 1U7UA 1TGOA 3FDZB 3V48A 1Z06A 1M1UA 4P31A 2H85A 1SVKA 1B3QA 2FWPA 2PT9A 1PNVA 1ZM9A 4MQFB 4RYLA 1FJXA 1E6WA 2OLKA 6Q21A 2AKYA 4C87A 5CB4A 4H0CA 1VJTA 3DC7A 4I4LA 3RIEA 1OU4A 1YVWA 5C3UA 4D4HA 3QSYA 1M6YA 1NKTA 3P2JA 3H04A 4D42A 4X20A 4YT2A 1ZRNA 5L6LB 1R74A 4ZVOA 1DBIA 2C0PA 3ODGA 2CTQA 2FTKE 2PX8A 1R16A 2AMYA 2WSLA 3ABMB 3RK1A 1GDTA 1JEQB 1K9SA 1Z4MA 2JS5A 2NZVG 3R77A 1TL7C 5EL0A 5JAZA 3V1KA 1YB4A 2XD4A 3QO8A 3E5MA 2EF0A 3UMVA 2R6FA 2KB1A 2HUPA 1M75A 4TRMA 2JKVA 5DGTA 2C3OA 2VIIA 3GDHA 5DHAA 5FFNA 3W8NA 1O6ZA 4X3CA 2YVQA 3Q7SA 1CS0B 3WYDA 4K9LA 1G0OA 5DM70 5BSGA 5JRZA 2BFBB 2YCLA 1ZD5A 4B3DA 1KO7A 2HREA 3QHQA 4OJYA 1N0IA 2UVPB 5E6SB 1U3DA 3PPWA 1TUBB 2BEVB 3LOQA 4OHWA 3IP1A 4D45A 3JASA 2NYAA 1QHEA 2C4HA 5KNLA 1M2WA 1ZCJA 3FTNA 1FTGA 1TQ4A 2P40A 3NONA 4Z4HA 1XD2A 5KKCA 4HNSA 2UUOA 2VNHA 2A5YB 3TJRA 2EBOA 2OBLA 2AHRA 1XEFA 1Q1NA 3B5JA 3H1GA 3M6LA 3UMRA 5F2NA 1W2WB 4DJEC 4HJRA 1Z6AA 4YAGA 3T1VA 1LI7A 2R48A 4LYHA 2R8BA 1NSYA 2LWIA 3HGQA 3GRRA 3MQ2A 4XIFA 4AMUA 4E33A 2QTWB 3N3BC 1OTYA 1BSVA 3NEPX 3TLBA 2QRMA 2WHYA 3QWHA 5LUBA 4UNQA 2EP7A 5BXZA 2Q7GA 3PX3A 2BGMA 1GNQA 2BTQB 3Q0EA 1RXWA 2XCOA 3R40A 4LXTA 1ZGAA 3WBBA 1G16A 5T4FA 2ZBPA 4M55A 4F3RA 2IY7A 3LBAA 4UFZA 2Z08A 3SZGA 1JJVA 4JCCA 3CCRV 2FPMA 2W6PA 2XRFA 1T10A 1TOAA 4JL8A 1H2EA 1CFJA 2Q99A 5FOWA 1ANKA 1Q16A 2XAJA 2O2EA 3BK7A 4K9NA 1E9RA 4C6TB 1XL4A 3TX2A 1CQIB 2A9OA 2Y6UA 1WETA 2LZ0A 2MYUA 1F9EA 1BGVA 2WLSA 4AQYO 2ZR2A 1J0CA 3NT4A 4UE2A 3V55A 3WP1B 1EK6A 3EAFA 3M6WA 5BNIA 5K4GA 2JLWA 3AKCA 4WZAB 3HJFA 1XYGA 3O1HB 4A0FA 4KHPO 4FWBA 2WJIA 5K4AA 4GOND 4L6AA 4BQOA 1L6RA 3WKDA 1FC0A 2GJ8A 1LBQA 3DSQA 4LY0A 4RNDB 2XWJI 3O8BA 5JEDA 2XMZA 5A1JA 2IUTA 2BCGY 2Q0QA 2D06A 1RAFA 1PVVA 1Z36A 4B09A 4I50B 4NBLA 5A4JA 3BTVA 4C03A 3KHKA 3DOFA 5DBFA 5BWCA 5ICCA 4P4SA 1UFIA 3AVTA 1PLKA 4B7EA 3REQB 3I8SA 3CVXA 3ZIUA 1G63A 2OP1A 1Q74A 2XKJE 4EEXA 1QH0A 2D1YA 2HWUA 2PKQP 3J7AU 4JENA 5ECGC 4ZT4A 4MSWC 3R7FA 4UBOA 4CLRA 4HC4A 1B00A 3M70A 3R3ZA 2QROA 2KSDA 1CP2A 1UAGA 1W4BA 1P7WA 3QXGA 5LLDA 5AJHA 3TRIA 1U31A 3KWMA 3UAWA 1OAOA 3FJOA 2HXGA 5EE0A 5DK6A 1TAHA 2FWIA 1JLLA 1HLPA 3NNDA 2JAWA 1G9XA 3MIIA 4M1OA 4EAQA 4W5QA 3AVPA 1GKYA 2QMZA 3A1SA 2H2DA 3NBFA 4IUBS 3ICOA 1DK1A 4FYVA 5HEKA 1XZDA 3RS9A 1L7BA 5HFLA 1YA6A 1LBHA 4F84A 2P5SA 4B3JA 3DXZA 1VBFA 5T7BA 2ZSBA 3FAZA 2BD0A 2F8MA 3DTVD 3SKXA 2ZRIA 4QT0A 4R8MA 2XUQA 2B36A 1UKEA 2R7MA 4BX0A 3ZIDA 1G66A 4JAVA 5BR7A 3M6MD 1E2IA 2JI7A 4QGHA 3OFND 3H2BA 5A5VA 1OA1A 1KJJA 3IPRA 4QJ5A 4DV0O 2GVNA 3VR5H 4EPRA 1DC5A 2XMQA 3RDPA 5KSYA 4BVJA 2P4KA 3KNZA 1J8QA 3OZIA 3LF1A 1D2RA 1J8FA 4IRXA 3T1YO 3DW3X 4KUHA 3E8HA 4KQXA 1JLMA 2YIBD 1JFRA 3CUTA 2AG8A 3DXYA 4QODA 4N6GA 4DR4O 2XH8A 1YOVB 2HBZA 3CUKA 1O89A 3ZJ4A 3FTDA 4DDTA 4WJLA 5GTDA 4FZRA 2A9RA 4QUBA 5KHAA 1FXKA 1Q1EA 4RZUA 2J08A 1JJBA 2O52A 3RVPA 2YWXA 3W1VA 3UMYA 4M0PA 4ZZ1A 5EZSA 4Y8VA 3PC3A 3AIMA 1TKAA 3LUCA 1BCSA 3VR2A 5FTNA 2LTAA 1LC0A 3UFBA 3OU2A 1Y3HA 4RJTA 2G5GX 4DIEA 2VJQA 4QQNA 3IQHX 4ROTA 2G0NA 2CGEA 3ZYCA 1A9RA 2X22A 4ML3A 2RGYA 4QBGB 5I9NA 3S70A 2PZKA 4CYMA 3FJYA 3KC2A 2CHUA 2R3SA 4U63A 3V2HA 3L7OA 2QRZA 1EFRD 4K0KB 2WSSA 5SYMA 5LL6P 3H01A 4PAQA 5BOVA 1A4XA 4BO0A 3QUQA 2FR8C 3GUUA 4KO2S 2OV1A 1Z3CA 4QYXA 1MH9A 2Q5IA 1EH5A 4FFBB 2OTLV 2Q62A 1VCMA 3EODA 3JVUA 4X65O 4OA8A 1GQ2A 4H3HB 4ZOEA 3ZW8A 2BH9A 2E6UX 4YALA 4MRAA 1ZK2A 3ASNB 3MWKA 4M9UA 4UBMA 3OE4A 4H0NA 5FWYB 4W1PA 3O7WA 1A32A 1RW4A 4EFDA 2DWUA 2DOKA 2R2GA 3WDSA 3DUFB 4OBBA 3WLKX 4FK8A 3DUWA 4NR1A 5E2AA 3QKIA 1A9ZA 1NQWA 1SZCA 5ALIA 5HBGA 1JHYA 2O8FB 5EIFA 1AHPA 2R6GA 3CONA 1LS1A 4CN8A 2IEDA 4G56A 1KU6A 3E83A 1JKJA 2FVXA 4GOMD 1TTTA 4GZ3A 3ESBA 5IC4A 1ZH6A 5E8JA 3TCNA 4KKXB 3R0ZA 2L35A 5C8DA 3UK0A 1DAPA 1VQOV 1DLJA 2NVUA 1QV7A 2PH3A 3EHDA 3R44A 4RVHA 2CBGA 1M2GA 4V0RA 1EAYA 3AWDA 5EVJA 2F1IA 1WP8A 1DKUA 2EL9A 4HQKA 2C5LA 2H2IA 1SCUA 5JH7A 1DI0A 1U8AA 2GN6A 5ALFA 5PGMA 3ASOC 2BZ1A 5E3HA 5JMTA 1H8HG 1M6NA 5KHHA 1VHQA 5KWEA 2V4MA 4KITB 3MJ4A 3AWIA 1QO9A 3T9BA 1YDFA 1ZUIA 3FY4A 1E2GA 2FEPA 4JS0A 1I51A 4UNSA 3RC3A 5KTOA 1KSFX 4OLJA 4DHWA 1B0PA 4NXNO 1LJUA 2A6PA 1BZYA 2XHEA 3OMAB 1YZFA 3ORHA 5F76A 1D7AA 1E5TA 4NOMA 3X43A 1XNJA 2YL2A 1WOMA 1UPFA 5H02A 5HFMA 5KTPA 3FLMA 3LYUA 1HY3A 1JMVA 4TWRA 3SGLA 3VYRB 2Q6IA 3GFRA 4AU1A 1I30A 1YDWA 1BRMA 2VA8A 3FUTA 5E2IA 3CO0S 4E5SA 1EYZA 2BGLA 4KMMA 1JQKA 1Y3AA 2Z8ZA 4OUDB 4PBTA 4PZCA 4H1UA 4BKPA 3LUFA 2QUZA 1Z07A 3T0IA 3PJEA 5K4HA 2VSYA 2J9RA 3G2MA 3RWMB 1TFRA 1TA0A 3DDNA 3QVLA 3HZZA 4GLFA 4DIMA 2VXCA 3KZXA 5JH7B 2A9JA 2D5IA 3L6DA 4N18A 3QPUA 2ZBVA 4WFFA 1OHHD 4K3AA 1R0CA 1RJFA 3HYLA 4H7PA 4S12A 4M1TA 4DLBA 4DXHA 5MF6A 2QLJA 1HZZC 2VATA 1EP1B 5TT1A 4J07A 3PDUA 3CN9A 3K6RA 2OV8A 1TKBA 3LUJA 5EUCA 1KMCA 3K8OE 3ZJTA 2BMWA 3KBBA 1BCCH 4EI8A 3AI2A 4MA5A 1NY6A 1KAOA 1ORIA 5EEGA 5BQFA 5DTEA 5J4KA 4RFSB 5K8TA 5HW0A 3QWBA 1HNXO 3FZYA 2W6JG 3LLSA 1SBNE 2X42A 4NNJA 5DHSA 1LBTA 1RRGA 5B3JC 4GE0A 4PYJA 1N5RA 3D0RA 3RVYA 1V55B 1LTKA 4S0ZA 3ROQA 1RRFA 2QRJA 2OZPA 3FB1A 1W9HA 3O6VA 4I81A 4IJQA 1D2MA 1FAFA 4LK2A 2E5LB 2B7CA 3SQNA 3RFVA 1QV9A 3JYOA 1N6OA 2FEXA 4U7DA 1ZGHA 2NT4A 2W22A 2XNDA 5B37A 1WKVA 3L18A 4LOJA 1H65A 1Q5PA 5HJ2A 4DDMA 4BGVA 4E70A 1U1FA 2VDKB 2X8AA 1M8PA 4JGBA 2H16A 4RDXA 4B75A 2J30A 2J3IA 1WY7A 1Q3KA 1V11B 4B7CA 1NVMB 2W6JA 5BWLA 1L0BA 5JXHA 1M5RA 3ZHXA 2R65A 2EV9A 3TFQA 4DCTA 1I7SB 5BN5A 1YCGA 2JVKA 4BEBA 5DTJA 2WIDA 5EJGA 4KWTA 1SZTA 1JZQA 1QZUA 3QO7A 1JR4A 1OBCA 2IJHA 1TECE 2BFEA 4HDRA 2H8GA 2ERYA 3LDEA 1NVPD 1YZBA 1QGZA 2EKZA 3QWIA 4QUIA 3BCCH 3K4QA 1NWCA 3ONEA 4JOQA 4KI0A 4CDMA 5HS4A 4TZ6A 1ENOA 2FUEA 2HDNB 2PZ8A 3M1LA 3CD6V 3GP5A 2MTBA 2DTXA 5EZ6B 1PFGA 5LHIA 5C3MA 4J29A 5SV2A 1L5MA 2NSHA 2QKAA 1N2CB 4IDPA 4CKEB 4RWUA 1G5IA 1M1NB 1TKCA 2DKNA 3N76A 4FN4A 1SG6A 4EUHA 1C4WA 4Z4QA 3GRUA 3AESA 3GFGA 3BQMB 4XQEA 2ASEA 4HDOB 3H3FA 4EJ2A 2EP5A 3EOBI 4GNKA 1U02A 4OXXA 4RPJA 2Q5OA 2WM3A 3T7AA 3ZWVA 4NOKA 5J9FA 4UHFA 5H0IA 1SZDA 3WHPA 1N0HA 3AW9A 4HHEA 4S24A 5ENVA 1JFTA 3QP9A 1YBHA 3UHOA 3ZWWA 3MZ0A 3P9SA 1C3EA 1QBZA 2FSSA 4FD2A 5L3ZA 3H17A 2QKSA 4UCRA 4DR6O 1UFKA 4JUDX 1I5OA 2WWRA 4ZVTA 2CFRA 2B8WA 3C3MA 2QU7A 1WOYA 3QLVC 3NI2A 2DBZA 4TS4A 4FZ0A 5ALHA 1YL5A 1P84F 2JLYA 1F8YA 1GUBA 1X19A 3HDTA 3OPVA 4RS3A 3S44A 5CPBA 3F4LA 4BLQA 4HEJA 3BDIA 3B78A 3VPAA 4MCIA 1JR6A 2HUNA 1RLJA 1W85A 2XRMA 1OCOC 2ZJZA 4KOAA 3NP9A 3LCUA 2OQIA 3AK1A 1D2NA 2KBEA 1E1RG 3LA8A 1YMUA 3L7BA 3PPVA 1P8JA 4GOLD 1JYEA 4GVXA 4Y6RA 1Z4PX 4MQ6A 2OHFA 3T5DA 1IUOA 3E9DA 4ER6A 1ZPDA 1L3CA 2YZKA 4J1SA 3I9LA 2GPYA 3ICPA 1O9GA 2XBLA 5CJPA 5CAEA 3COSA 2ZNJA 3TRDA 2DYKA 4GP7A 4Z0PA 4DEXA 5KHLB 3TQRA 3ZVLA 1P0PA 1ZN8A 2XZLA 1UZLA 3EIOA 4L4RA 3F7MA 3F90A 2DPLA 1GNVA 3I9V1 4FBMA 3ASVA 1I80A 1YWGO 1K9VF 2QR3A 4LC1A 2AG0A 3OQHA 4A0QA 2A9QA 4I50A 1UANA 2ZI4A 3H5RA 4IWXA 4R8VA 2R68A 1DXHA 3AL3A 5E1AC 3EC1A 4P80A 5LP6F 2XQGA 3C1TA 3W6UA 3U4QA 1M66A 1O1YA 1GTL1 2QM8A 1GZ3A 3NBKA 4AYWA 1NUHA 3UHJA 3BHJA 1A27A 1RWXA 2H17A 2NZ8A 2A9FA 5FLXN 2WJGA 3FA2A 3FDJA 3LGSA 4WXMA 1MQAA 3JZAA 1VSVA 3K09C 3MCAA 2IYZA 1E5XA 4F9GA 1DRWA 1NDQA 1Y1KE 3FFTA 2ID7A 1KI7A 3TDKA 4WY5A 2WHPA 4UM7A 5IJWA 5KOYA 2BHLA 1A2KC 4L07A 1AS0A 3BILA 3HU1A 4Q4CA 1EVYA 5FO0A 5KINB 1SXPA 3DVQX 2AVNA 2ZZMA 1UAYA 3HA5A 1J5XA 3W9UA 5DYNA 1TT5A 4X8OA 2P8JA 2DYSB 2F95B 3IV9A 4LRUA 1F4LA 3U4DA 1O97C 5FI5A 2JATA 4GWGA 4LSZA 1ODFA 1P3DA 2VXOA 4EO4A 3DGFC 4LTDA 1Q19A 2FWRA 1WAMA 3C14C 5CT6A 5G0TA 4TVSA 2JJYA 3QO5A 3R0JA 1MTZA 2QMEA 3V80A 1MV8A 3HVRA 3M9WA 1BCRB 1VKZA 2Q5EA 4EB0A 1PJ4A 4OQLA 5GY7A 3H97A 1TYDE 4C6HA 4BFTA 3C70A 4E4YA 2F4VB 4O63O 3T41A 1OX4A 4ILKA 4JQZA 4R8SA 3D8BA 5DI3A 4YMSA 4BMCA 1Y5RA 1FUYB 2C07A 3N8DA 1I94B 3BL5A 4CLOB 3UUGA 1FMLA 1CX9B 5CFOA 4DKJA 5DE3A 4LHEA 2E4UA 2FW9A 2PRSA 3HDJA 3KEOA 3QUCA 1E7WA 2RG1A 2V65A 4EA6A 2O4CA 5C8XA 1Y1QA 4UVDA 2OV2A 2LW7A 1L7MA 5I5EA 5HNKA 4CTNA 2GM3A 3CNEA 1LPSA 4DR2O 4N21A 2DUMA 4CIYA 1PJAA 5JS6A 3CJHA 1MT0A 2HHAA 2ZJ6A 3WGHA 3ELBA 3KAPA 4H9GA 5CBFA 4RJJA 5HYVA 1G6UA 1NS1A 2EILB 2W6IA 2IKSA 1XA3A 3DKRA 2JGNA 2IUSA 3BRWD 5LB4A 4PV1B 3BMCB 4S35A 2IGTA 1P5ZB 1PW5A 4TTQA 3VSCA 1RCFA 3L70H 1F17A 2F9FA 3MNFA 3BWYA 4ETMA 1E3MA 1ECCA 3LCJA 5CDYA 1PCXA 3EOAI 5EHNA 3VYVA 3GG2A 1JPXA 3DAFA 3HUEA 3QEJA 4IDGA 3TLZA 3EX7C 4JUFA 3DLAA 4TSFD 3V1NA 4FYYA 3M33A 2ESRA 4TUYA 1PS0A 2HHJA 3B48A 3K2IA 4JY7A 4EPXA 2HU2A 1DC4A 1ULAA 1ZVKA 2VK2A 3SBXA 4EJSA 4Z49A 5BW5A 4X20B 2PH7A 3ABSB 1XAIA 5JS8A 4F11A 4Q3BA 2Z95A 4H4DA 3NWOA 3II6X 2WI8A 4B40A 3H11A 4RAIA 4MW5A 4EZBA 1IWBB 1PE0A 3FR8A 4RA9B 3ERCA 4UV8A 4FVTA 2E3JA 1EVQA 4W6ZA 3WL5A 2EU8A 3G79A 1J8VA 1IBLB 4QYIA 1RYZA 2YWRA 1VF5B 1LWOA 1U7ZA 2NO4A 3OEYA 3E0XA 3AYXB 3PNOA 2GZ2A 4NRDA 1KPIA 3SKYA 3SHFA 1EINA 3WIOA 4G1FA 1II0A 1ONPA 2FZEA 2DW4A 3C3XA 1N32O 4WACA 4AULA 1TZBA 4ARZA 2Y05A 1JQ5A 5FUBA 2CV0A 3R9WA 5EZYB 2ZM6O 4F2GA 4HZIA 1UBEA 1J2TA 3BMQA 3DHNA 4ETNA 1YJQA 2O4UX 2R6ZA 4GZMA 3KQOA 2YJ4A 4OP1A 3MTDA 2R97A 2XYVA 3KTFA 1Y4AE 2JBAB 4FGWA 1Y6XA 1ONOA 2FK8A 3SNHA 3LXRA 4JR2A 5CVUA 2EBFX 2G83A 4N49A 3A26A 1QIMA 2ZW9A 3DZDA 1UJ5A 2AFHA 3KQTA 4L5IA 2ETXA 3LLUA 2IBMA 2WDPA 3HNOA 4UBJA 5BYAA 4ARIA 2AW9A 2A3RA 3OFNA 4EEZA 1Y1PA 1ZX3A 1MHPA 2DWOA 3E5RA 1K3UB 4D0GA 4IGFA 1ZSYA 5JSUA 2C29D 4B80A 3IVXA 4PGAA 1SKAA 5BRJA 3PE4A 1HP8A 4DM4A 1GIAA 1RWKA 1SIWA 1H6AA 2HH9A 2O3QA 2RH5A 3Q1KA 4J7XA 1DWPA 3A9VA 4PFQA 4XE5A 2ZBFA 4LVOA 1NX6A 2BBOA 1NW9B 4JAAA 1SC6A 2YQZA 4UMEA 1PV2A 4AX8A 2C2OA 3T38A 3ABUA 4R81A 3GHYA 1TXGA 3CX4A 3TMYA 2QTVB 1FP6A 5CUQA 4CL0A 2WFLA 1A8HA 1P6UA 2IA5A 3QLEA 4LV8B 4YEDA 3TRKA 1F0KA 2D1QA 2VHQA 2YN4A 1L8DA 3NVAA 4P58A 1JX6A 1IBMB 2H51A 3JQ9C 3LUBA 2H0RA 2AUTA 3PQ4A 4MKZA 2QTVA 3KCXA 4K46A 3OY7A 4YONB 2BKLA 1E1RD 2W4IA 4JC0A 5FUYA 4E2FA 3OF5A 4QOEA 1ILEA 4L3WA 1Q3EA 3HV0A 3IQIX 5CLHA 4AK9A 2AA3A 1T35A 5DHPA 4D4KA 2BR3A 1K4YA 3L7CA 3B6KA 1I2AA 2QLFA 1IWOA 2XQVA 4PAOA