3E35A

Actinobacteria-specific protein of unknown function, sco1997
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
269
Chain Sequence
DPQDLYTWEPKGLAVVDMALAQESAGLVMLYHFDGYIDAGETGDQIVDQVLDSLPHQVVARFDHDRLVDYRARRPLLTFKRDTWSDYEEPTIEVRLVQDATGAPFLFLSGPEPDVEWERFAAAVGQIVERLGVRLSVSFHGIPMGVPHTRPVGITPHGSRTDLVPFEEAQVPGSAEALVEYRLAQAGHDVLGVAAHVPHYVARSAYPDAALTVLEAITAATGLVLPGIAHSLRTDAHRTQTEIDRQIQEGDEELIALVQGLEHQYDAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein SCO1997
publication title Structural and phylogenetic analysis of a conserved actinobacteria-specific protein (ASP1; SCO1997) from Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 85
structure length 269
sequence length 274
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e35A02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e35A01
2HR3A 3D3IA 5CA3A 3E35A 5GW7A 3W7WA 3BY6A 3W7SA 1NVPB 4G4SP 2P90A 4HAMA 1NH2B 3VR0A 3MNFA 3W7UA 1RM1C 3W7XA 3GAAA 1YTFB 3W7TA 1S3JA 3WZ2A 3IC7A 2WAMA
chains in the Genus database with same CATH superfamily
3LX4A 4ID9A 1YRYE 3IJ4A 2F9LA 4NR1A 4V2UA 1HKUA 1UK7A 1JH8A 4EPXA 1P84F 3KAPA 4H7FA 2LKDA 2A9PA 3I6ZA 2ZJ3A 1P1FA 5HDBB 3IQDB 2F8MA 1UKEA 4GKKO 5FUYA 1BD3A 5HF9A 2DUNA 5C51B 4L5BA 3DOCA 4EP1A 3AIKA 2VEOA 2CJFA 4WUTA 2BSQA 1P2VA 3OOEA 4PPQA 4UCOA 3L4JA 3WGQA 3B5JA 4X94A 5AVJA 3W04A 4KBFA 1AS0A 5E8RA 3QLVA 2JK5C 3S4YA 2OP0A 1ORTA 4QE7A 1U0LA 3QU9A 1R12A 2JASA 3EDQA 1KYWA 5B7QA 3NDIA 4S04A 3IC5A 3V2IA 4CM4B 4MW2A 2DYRC 2QUBA 3ZGVA 3NV9A 3PT9A 4ML3A 4OGGA 4MPTA 4OFBA 1PLLA 5KNDD 1UC8A 3RRZA 1N7HA 1GZ4A 1XD8A 3MWDB 3OMLA 2VHCA 5AW6A 3TJTA 1N5RA 4F1WA 1CSEE 4LF9B 2YOFA 1SZCA 3L0BA 2GZSA 3N2NA 1A9SA 3AW8A 3GLHE 2FRDA 5DGTA 4GRAA 5JMPA 4RUEA 5EC2C 5B6PA 2E6KA 3EFFK 1GSIA 1TB4A 2GAIA 2CXXA 3ESXA 1OLUA 4PCUA 4YTEA 4FLVA 2QRKA 3TPFA 4E09A 2VYCA 2PUHA 2WKSA 1MX9A 2FP4A 1SXHA 4XIGS 4MUEA 621PA 2J9ZB 1HFJA 1WB9A 1SXJC 4MNTA 3IE1A 5KYUA 2X9VA 4XFDA 5DEDA 5CH8A 5ALOA 1ZD8A 5AM4A 4LY3A 2AV6A 1KVRA 4BLOA 3QXHA 4PO9A 4AN1A 2ODMA 1C1XB 1YD7A 3OT7A 4PIMA 4KOEC 2WSYB 3RYTC 2V6GA 3HBFA 2NPOA 5D2CA 5IBRA 2BP7B 2Z3ZA 4ER0A 2WIKA 1QIDA 4QUGA 3KVNA 5CT8A 3A0RA 2XASA 1WSWA 5LGNA 1US8B 4D8XA 1XNGA 2R00A 3SJUA 2P77A 3CCCA 1LNZA 1D2EA 1QCZA 2HDOA 5KMGB 2Z8YA 3P26A 2R7MA 3QMVA 3RF6A 2H08A 4G2KA 2II6A 2B4YA 2O7QA 1RABA 1A8PA 3F74A 1UBKS 3SS7X 1TQDA 3FD8A 2B99A 5K3OA 5JWRA 3VR5A 2DM6A 2Y05A 4UQPA 1ZOOA 2NW6A 5FNZA 3C0KA 2PTHA 2J85A 4E70A 2WAYA 4EQ6B 5HRAA 2BGLA 4IDQA 4D7TA 1M90W 1I5EA 4HYQA 3RT7A 3OE7G 1QR6A 3ZDRA 2X0EA 4MWCA 1I7SB 3ZBHA 3SSOA 4A5SA 5CTAA 4AICA 3DKKA 3ZH9B 3OW2U 4P5PA 3O03A 2OKGA 3HB3B 3KBBA 4KMMA 1F4LA 4LYFA 1JG7A 1KC1A 3TL3A 3H5IA 3TMYA 2O2GA 2ZTSA 4GT1A 1YRLA 2YUTA 4UW9A 2QAGA 1ISJA 1WXGA 4DR1O 1CY4A 2DBZA 2O1EA 3H3XA 1KU0A 1S1MA 1H3NA 2JKVA 2YNMD 1IEWA 2FQWA 5C9ZA 1M0EA 4FTWA 2CUNA 3LLVA 4RQUA 1Y4UA 2XTAA 5LZ7A 2BR3A 4I3FA 3HEAA 5LN1A 4UCTA 4BNJA 3T7RA 4D6PA 1OCZB 4O6VA 1X70A 4TWKA 5C8ZA 5ICFA 1H2HA 3HXPA 3RSFA 2AJLI 4Z3OA 3FDFA 5ALYA 5KTPA 1XHFA 1ZN7A 5KYGA 1J07A 1IAVA 1ONNA 2JLBA 1IYZA 1EEXB 3AEQA 2DH5A 2QL6A 2Q49A 2HRBA 2RH5A 3B3AA 3EDMA 4YRZA 3ZWBA 3P2EA 1SQXH 4MDEA 3KLBA 1R8XA 1U8CB 3N53A 1T2NA 4MW7A 4KXYA 3AQIA 4BATA 4BJ6A 1C1DB 4UC0A 1KGDA 4L78A 1FRFS 2CV2A 4OHMA 5F4ZA 1U8AA 4M60A 2HKIA 3HB0A 4M46A 1HUQA 4RKYA 5IM4F 1VLMA 4MA4A 1LD3A 3X1YA 1ZCBA 3N74A 3HXOA 1KIAA 1UOEA 2BFDB 4QPJC 3MB8A 2QZJA 2W2TA 1SURA 2BY4A 2RGAA 1QBZA 3QEBZ 1IQPA 2JLUA 4RHXA 5DGIA 1XRSB 1F48A 2XQVA 5EWMB 1R16A 2AC7A 3NEPX 2X0IA 1PGJA 3ZK7A 5DBIA 3AI2A 4O2RA 2QVYX 4DM7A 1AURA 3EEQA 1CKEA 2IPAB 4M8IA 4NZ9A 2XHZA 1YJNV 1DAKA 3SWWA 1MOFA 3CZ5A 1ZO8A 4JP5A 2VF4X 2GAOA 1YS2X 2IY8A 4D4GA 3IOBA 5A03A 3GCDA 5FJIA 3ZRWB 2G9ZA 4WFIA 4DSOA 2UZ3A 2XUMA 1T8TA 2VAWA 3FMOB 5JNTA 1HL3A 3Q9SA 2P2LA 1PYGA 3BMQB 3HRHA 2FG6C 2ZRNA 4ABMA 4JVNA 2ZBPA 4LXIA 3GA7A 2RJZA 1XZJA 5IH3A 5KQSA 2X8JA 1C0EA 2E4ZA 3I6IA 1KB9F 1X7WA 3FFWA 3GOQA 3MLBA 3GRYA 1IN4A 3N6RA 2P7IA 2OPHA 1L7OA 3E5RA 3MHHC 3TI7A 2P3QA 4ASUD 4GZMA 1Y7PA 4NS1A 3WG9A 4Z0PA 3DDNA 1V55B 2WSLA 1Y4ZA 4YUVA 1B3BA 1CUDA 3ZN1A 3GRVA 3S2GA 4QUEA 3MLEA 4QRDA 3KCNA 3QUCA 4JGSA 4M0MA 4ODIA 3WRXA 2H1RA 1EDZA 4YRAA 1NRIA 4QBFA 3QTBA 2C8JA 1A4IA 4IPTA 1AZLA 2DFPA 3PNQA 2AHRA 4NMMA 3E27A 7REQB 5BNWA 2HXYA 1LX7A 2ZS9A 1B8VA 2W90A 2GZHA 1TD9A 2I3ZA 4J1NA 4N3NA 2VHYA 3BDAA 4B31A 3ZLVA 3R8CA 1EBUA 1MA0A 1WCXA 4F3YA 5TVGA 1Y1KE 1ZCJA 4R2KA 3NHWA 4G97A 4OJTA 3EY9A 5AVXA 2G9UA 3AM3A 4WE3A 1KHHA 1V4NA 4FFRA 2CDCA 3ONNA 2J5KA 3NTXA 1E4EB 2AWNA 1LI5A 1NW8A 3RASA 1Z47A 4ZMRA 2P27A 4ZGWA 3ISTA 4FKBA 2PYIA 1V5IA 2QWXA 1EWTA 4PZAA 4JMLA 1IONA 3ZCSA 3HJHA 5GOTA 1JR4A 2R8RA 1CUWA 2B1QA 2FEOA 1XZFA 4OGFA 1F6DA 4UHBA 3VR6H 4NXNO 3IBGA 5DWVA 3H75A 4I99A 1XEQA 2HIGA 1RS0A 2EWMA 4YR7A 1J0BA 3ZNNA 2E75B 5KA6A 4AY6A 4MYRA 4BLRA 1TYDE 3RRBA 3QE0A 2O8VA 2CNKA 4PLHA 3E1GA 4US2R 5E6SA 3IEIA 4NCJA 2QRQA 2O5EA 4KR9A 1DFIA 2VP0A 4KREA 1A3CA 4J49A 4QDKA 1GPBA 4QAJA 4AHCA 1CEXA 2N04A 1SGWA 4KVAA 4AF6A 3ACDA 4GMKA 5ALZA 2M98A 5ENVA 2IKQA 2H1FA 3U3MA 2QBYA 2HHLA 1H0HA 3OLVA 5JJBA 2LGWA 1N0WA 1ZXXA 4GOKA 1LQUA 1M5UA 4LF6B 2O5CA 4X8AA 2V03A 4H7DA 3DOOA 4CG2A 4KKVA 4H31A 1FVFA 1PK8A 3AG4C 4RVNA 4D3XA 3ZPXA 4YJFA 3T1CA 2AYYA 4BKQA 3RU2A 2GXQA 5A71A 3UUFA 3KZCA 3EC2A 1CBUA 3PCTA 4V38A 5DTIA 3QH4A 1FFBA 1N2EA 4FJ0A 2OO7A 4QUBA 5DXJA 2FUNB 4IEIA 1ZRNA 2O23A 3W6UA 4O4LA 2W11A 3C6BA 1M4UA 5EN4A 3V4VB 3PWZA 1FUEA 3P19A 4D0RA 3EB9A 3VI3B 2D2FA 3W77A 3FYSA 4LSWA 4R1SA 5LQUA 2BOCC 3DV2A 1R9MA 3RKUA 2FEKA 2C5FA 2FVYA 3ZWKA 2NU9B 1WPQA 2CFRA 4G1VA 1LXCA 3CRRA 5LMCA 4P2BA 2P69A 3HU3A 5DDIP 1SPBS 4HNHA 1N2OA 1MC4A 5BMVB 3ROMA 2WWYA 2WDPA 1B42A 4X6UA 5A9SB 4MMYB 1RPTA 2ISCA 5ADVA 1MTOA 4RTMA 1RYZA 5TQ2A 5E1BA 5JCZA 2GTAA 3TQRA 1CC1S 2HFEC 5BW5A 4LV8B 1Y6GA 5JE8A 2WJ4A 1JKJA 3I04M 3Q87B 1L5ZA 1GTL1 1JG4A 4ACBA 2VDOB 2EULA 5F5LA 4M99A 1XD9A 1SB8A 3EVKA 4BGVA 2VJYA 4LRYA 4RABA 2R65A 4CCSA 1MAVA 3TGWA 3RD5A 3UJ6A 5KDLA 5CK5A 2GEDA 4O1MA 3OT5A 2IP1A 3HADA 3L0CA 4HS4A 4HDRA 3NFYA 2VZLA 4AJIA 2G0AA 3EC1A 2JI7A 1YFZA 3OM8A 4IDEA 1W0CA 4MCAA 5IF9A 1X59A 3P94A 1PWXA 4NX2A 2V59A 4IILA 3KVVA 3EOAI 1V7PC 3BXGA 5KJEA 2YC4C 4JV5O 4JEUA 3PFBA 4EARA 3A05A 3H2IA 4ZYTA 1PJZA 4B8ZA 1DWQA 4R40A 1CP9A 3H5VA 3TH5A 4HQRA 3VKWA 3B5EA 5ES3A 2XBMA 2OQIA 2Z3VA 2P8SA 3FOFC 2RK6A 4U63A 2DVMA 5AW1A 5LD2C 3HDGA 2DQZA 5E6UA 3GLGE 3D59A 3NHAA 1CFJA 3AM5A 1KKCA 4K03A 2R96A 3DLAA 1FJGO 1ATZA 1OC2A 1G59A 3V42A 1JI0A 2J31A 1MB0A 3FCCA 4P30A 3FTPA 4DV2B 2I7CA 4JLAA 1OH6A 4TS4A 5DHUA 2QTZA 3KOUA 2HEPA 4BXOB 1UBGA 2VCYA 2W6IA 4AP9A 5P21A 3INNA 1MD9A 2BEVB 2O7SA 4CL8A 4IJMA 1JZSA 3FPSA 2VO1A 3ZU3A 5L3VA 1CEQA 2XT0A 3RQIA 1KMHB 3RU3A 1A95A 3A31A 2EC5A 2PS3A 3STHA 2OR3A 5JJJB 1L5YA 4BVKA 2VF8A 3HHEA 1LF5A 2XSZD 5DM4A 4GM1A 4JYZA 5IT0A 2J6IA 4P9OA 1KJYA 4I50A 2UU9O 4GDMA 2Z4TA 3KSDO 4IM7A 4DFDA 4P3KA 1NBIA 3Q6MA 3WYGA 4L5IA 1QE0A 4IQ4A 1NXPA 2H0QA 4XQEA 1KDTA 1HDEA 3EMVA 2GYUA 1XTVA 5EVJA 2GJ9A 2IXGA 3MHSC 3RAFC 4RKQA 1K33A 2OBFA 1WZIA 1VPTA 5C1DA 4FE3A 4KE7A 5FT9A 1N4CA 4Y2XA 4Y30A 1RBMA 3Q2OA 4QL3A 4O1HA 1JEYB 1GQYA 4DR5O 1P31A 5JO0A 1WMSA 3ESYA 2HCJB 2RC6A 1AR5A 4JI7B 3EPHA 3CCUV 2BMJA 1J22A 4BJ1A 1EFVB 2PLNA 4KR6A 1VF6C 1SXJA 3AVOA 4NATA 1CVIA 1O97D 4YP7A 1JAYA 3GLKA 4MKIA 4V0RA 2G88A 1Y7HA 4LHYA 4LI3X 2ZXWC 2O5VA 2VPZA 4QG3A 2JJ1G 1I9GA 2CGNA 3N70A 3C6YA 1Q0UA 2ODPA 4D9BA 2IJIA 1GUBA 3UBTA 1OT5A 4OHXA 5U9CA 3U10A 3SPGA 3RBVA 3HJRA 2O0LA 1DV2A 4JAVC 2VJPA 2IHBA 5K51A 3SYLA 1AN0A 1K7YA 2YRFA 2QTGA 2QX9A 1YZBA 2YVAA 3LXUX 1W25A 1IVYA 4C0SA 1XVTA 4YRNA 2DPYA 1NN0A 4WLEA 4A5UB 2HRQA 5BN1A 2Y92A 3UA3A 3OBBA 3LLMA 1Q1NA 1WUJS 1A27A 3BEOA 1EJBA 2RGWA 1KQNA 4PXAA 3OP1A 2B6HA 2C61A 3PEEA 4KRXA 4UBOA 1EXVA 4KQGA 4GOMD 2X1MA 2Q9CA 1C8LA 1V8DA 1DB3A 4KB5A 3SIRA 2I4RA 4WJZA 4B87A 4HRXA 4L74A 1W4AA 1B16A 3DONA 3C3YA 2P78A 2XCLA 4IQFA 2EG9A 4TPKA 1EGVB 4QOIA 2ECKA 4D7AA 3JWEA 3U61B 1FUKA 5IVDA 1SH7A 2DLDA 4OXYA 3COZA 1E2IA 4FM9A 3TNFA 4W4LA 2YIDA 3FX2A 5ALUA 2C96A 3BMOB 3ZHVA 2VJBA 2FLVA 3E7XA 4R71A 4FLTA 1Z6ZA 3JD1A 2X1LA 4XWTA 1FCJA 4EL5A 4MKZA 4B6PA 3PR1A 3QE3A 3PFIA 2EDAA 2OHVA 1TZJA 4BLUA 2BUCA 1GQFA 4CV3A 5IG2A 4J3FA 3OZWA 5AWFC 3U56A 1ZZGA 4R31A 5CA1B 3B82A 3ONDA 4BS9A 3U39A 3ZGNA 2RDMA 3WNBA 1PVOA 1L7DA 5BOSB 1T13A 1JYFA 4KBYA 3LUHA 4HAYA 2YV5A 2ZJOA 1THGA 5E4FA 1E3IA 4BCDA 4MLCA 1KC8W 5GIOE 1MQSA 5KIAA 1E20A 1Z5NA 4Z1MA 3TFQA 5DM6V 3WWZA 2JIPA 1DSSG 2GLXA 4Y1FA 3MEQA 3ZDYB 4HDCA 1FLVA 3E61A 2CNNA 4I66A 4CQLB 1UADA 4FMPA 3GUCA 4L9RA 3V4LA 1I24A 3ZE7A 5C53B 4W9RA 3X2QC 1JLLA 4UVCA 4WQMA 5A2GA 2GD1O 1S2OA 4QDUA 3BJMA 3UWMA 1AJNA 3UJPA 4OQPA 2AMYA 4KMOA 4CLXA 4X1OA 3ZS8C 3AHEA 2H5LA 3FZGA 3NXSA 1RRMA 2XXBA 4PLWA 2FSVC 1ONBA 2O57A 4RWUA 2D8AA 2JGIA 3ZWXA 1YJBA 2C2HA 3IELA 1P77A 3U19A 2ZIWB 1FP1D 2VH2A 1UXIA 4FQ7A 4DR6B 3OA0A 3IR7A 1N7JA 2N05A 3TCXB 3QX7A 1ZVMA 4OHZA 2CK3G 1SEVA 2GPNA 4MCJA 4ZO6A 5K8JB 1VB5A 2OXTA 3RUDA 2XTNA 4E88A 5BNTA 1ZA2A 5I4KA 4N0MA 4UAUA 4FFSA 3H86A 4G86A 5BW4A 1K4YA 3EBPA 4I81A 1T8SA 3G2IA 2CZQA 2QN8A 1PUJA 1I3MA 1EWVA 1FXSA 3Q6IA 5ULLA 5EJ6A 1S02A 2QAGB 4IHAA 1RI3A 4F38A 2PMWB 5L6MB 4FFBB 1L5LA 3QFFA 3MWKA 4QE3A 1P39A 1V3QE 2Y1DA 5EG5A 3V8MA 3JR3A 2PXAA 4BAGA 4ALIA 3HI4A 3HL4A 4CETA 5HF5A 4HLCA 4HWRA 1TO1E 4HH3C 5JJNB 4IVNA 3VTZA 4K87A 2AC4A 1GU7A 1JVSA 5AI0A 2W7TA 1SERA 3DEYX 2JVKA 4HRAA 4PVDA 3IUPA 2O2ZA 5AVOA 3QVUA 3MC1A 4ZVUA 4JYPA 5G1NA 2JFZA 1YACA 2ZVJA 4U0KA 4G3XA 5DT9A 2AUTA 2MCFA 2QPLA 2IUEA 3TRHA 2HJHA 3PNVA 4MVCA 5FAXA 4ENVA 3ZDCA 3O8OA 4YYEA 2FOXA 2VDRB 2VJNA 4BN4A 2J87A 3RAGA 1I4OA 4X97A 3INTA 2YJGA 3ZVKA 3LLCA 5AVRA 3BK2A 1JHZA 3F7TA 2H2DA 4RKRA 5F73A 4B3TO 4ZK2A 3OLZA 1O58A 4I2VA 3SIPA 5LNK1 2J48A 3B1FA 5FPSA 1OV6A 3GEIA 4JLSA 4JTCB 1T5OA 1DBWA 3H1KH 4OHFA 2PYJA 2OORC 1K4DC 4P35A 1Y5RA 4IFEA 1ISGA 1LRLA 1U0JA 2ADQB 5FYQA 2PYLA 4WKGA 3VZCA 3DDHA 1Q0LA 1AQLA 2W2QA 4IWYA 3C3JA 5HR5A 1QPGA 5IT9N 5CBFA 4YI5A 2EIXA 4N01A 3KKZA 1YVWA 1XLTC 4E4TA 1QHNA 5JRJA 2OM2A 1J49A 1R0CA 1ULBA 1E6UA 2QXYA 1BMQA 1NV8A 1LUVA 3G9UA 2OVFA 4IDGA 3K70B 4H3SA 2F8SA 4XARA 1CRLA 1KO7A 2YXNA 4W1RA 3N05A 4JI0O 1J95A 4EQ6A 1X7WB 4PBSA 1K5DA 4KR2A 4P7FA 2Y1CA 2Y69C 2QPAA 4RHYA 1E9CA 3KAKA 4X3OA 4QODA 1CQPA 3SI7A 4QFDA 3ZK9A 4HWKA 1XZKA 3T4UA 1MG0A 4UD2A 3L7YA 2X7RB 4JIMA 3ITKA 4OKSA 4KXRA 4HFMA 3E89A 4IIBA 1RC8A 5KLVH 4FUTA 3E9ZA 1EFRG 1KMIY 2OT5A 4NMLA 3KQPA 3NUGA 1A69A 2PPVA 2PD6A 3WXBA 1PAUA 1K1EA 1CQIA 2WI8A 3L7OA 4C7UA 1HQYE 1P3DA 3N0WA 2OFOA 3KYIB 5IY5B 3PQEA 5CH3A 2QRNA 1X39A 3NOXA 4JYAO 3D3NA 2UUBO 5ALDA 1R8SA 2BGNA 2HLDD 1QLWA 4D7SA 1QMPA 5CEJA 3M3HA 2VWGA 2I65A 2OGUA 4B82A 5CGZA 1H1DA 1YZGA 2P4EA 3P1JA 3R65A 4MIEA 5DBGA 4C07A 1AUVA 3KWMA 2AD1A 1DZIA 3V34A 3RR2A 3K6JA 1XCGB 4KE6A 4DNQA 4HBZA 1CJMA 4DIBA 3I9NA 3PN1A 4AECA 3VR6A 4TTAA 2EARA 4TLDA 1ODLA 1C1DA 1NXVA 1QNFA 2YZ7A 1YFLA 2P4SA 5GADl 3CS5A 4DV1O 3OAAD 4B84A 2ZYHA 5ALIA 1U96A 5EMNA 3UJBA 1THMA 2B4AA 4PBTA 3FWHA 3LTEA 2BFDA 3R7FA 1CJTC 3RF7A 2Y77A 1MVNA 2J9YB 4RH1A 3WDSA 4JXJA 4IOMA 5LOVF 5HSGA 1JR3E 1Y74B 1WCIA 5E6SB 4UOQA 2ZROA 3R20A 1ID1A 2HRRA 5K4HA 2RIPA 1Q7TA 4FCCA 2OBLA 3R4CA 2JW5A 3S28A 2HSZA 4XQGA 1F1BA 1P1HA 4MUJA 5BYJA 5CURA 2O7RA 3B1ZA 4A5OA 4IUCS 2EINC 3ZRWA 5GOZA 1ZMOA 2XMGA 3GBPA 2HF2A 5FOQA 4B34A 4ZN6A 1NSYA 4H4DA 3SC2B 1ZIPA 3W90A 3BMQA 4HNAB 3BTOA 3FRIA 2B20A 2V7QG 2C04A 2H63A 3IUJA 3UUGA 5FPQA 1WHTA 1TJ5A 2M1ZA 1W34A 3N0RA 4EMTA 1BHSA 3A2LA 1J6UA 2GKSA 2HRCA 2O0KA 2R0QC 1LJUA 2GHYA 2J0UA 1P73A 2F67A 1X77A 4M0EA 4J4BA 4U9HS 1EUZA 1BU5A 3V46A 4KYUA 4ON9A 1GL7A 1KMQA 3RODA 2JHCA 3OQ1A 1FLAA 1GEEA 1Q5OA 1NS1A 1PGQA 2BONA 1F4NA 2Q0AA 4QHSA 3D4NA 5HGJA 2X77A 2P9GA 4J11A 1AD2A 2CLKB 4C20A 2PSFA 4X64B 1B6RA 4BASA 3TE7A 1G5FA 2VRNA 3OTFA 4X60A 1ABEA 3Q8WA 4J8PA 4EGJA 2FPKA 5L40A 2GDSA 2AN3A 1GPNA 1RHMA 4P3OA 2IYYA 2XNDD 4Q82A 5TQ2B 3L71H 2GUZB 3SSMA 4MUFA 1BW9A 1R0YA 3E58A 1W47A 1V41E 5A3RA 4X8HA 2VXYA 4JAAA 5CW1A 4CM8A 4ZI7F 1PTJA 1UPBA 3RWOA 3T6KA 1A5SB 4NXMB 3L01A 1DADA 3ABQB 1NE7A 1HE5A 3O73A 4GW3A 3ZJVA 3BCUA 4TSFD 1CZUA 1RIFA 4ESHA 1W0JA 1NP7A 4RUFA 1RWNA 2WFLA 4D0LB 3HV2A 4J0IA 5ILQA 1WEHA 3S7TA 3ESBA 3H11B 1PEAA 3T1HO 2GWRA 3R3JA 1EI9A 3UHAA 2VHQA 5KA5A 1GN9A 1K86A 4HDRB 3QJ5A 3JZDA 1WKCA 3QVSA 3QYPA 3AHDA 2P79A 3PK0A 2PMEA 1X0XA 4BPBA 5K0EA 3GDHA 3U09A 1PYDA 4G24A 2V7GA 4AJ4A 1PQYA 1VIYA 1ECPA 3U6KA 3RVMA 1UJNA 5JXHA 4CR6A 1OXSC 4BIOA 2D0PB 5DYTA 3AUXA 3CT4A 3KL2A 1NI5A 4GPIB 5ERYA 5IE9A 2MK3A 1J90A 3GG2A 2WHXA 1KQPA 4Z4EA 2FR1A 5THXA 4NCNA 4UCRA 3BE4A 3JQCA 5E6UB 2ATIA 3VKGA 4Z9AA 4DRXB 4N5LA 1FVHA 1U0SY 4FD2A 1MJFA 2RN9A 3BA1A 5TPZA 1EFUA 2J6HA 2H4HA 1XL6A 2NO9A 1POWA 3ZQ4A 4OJYA 2ETNA 1C7JA 3CVYA 5BWOA 4DV6B 1YTLA 2VWPA 2JHFA 3NO4A 1OFGA 3ZCVA 4N7JA 4N03A 1DE0A 3DF7A 4IIDA 2WJGA 5EEHA 3RHZA 2GARA 1GIAA 4PA9A 4UXIA 4C5BA 4BVJA 5BSKA 4FW8A 4ZVQA 1P7VA 1U94A 4A2PA 4MWTA 3QVXA 2EZUA 1GV1A 2A35A 1IBMB 3TRFA 3TWOA 2NU9A 4N8DA 4C4ZA 4FYIA 5A7FA 3MJFA 3MXOA 1HK7A 1BMFG 1R0WA 5EUQB 3UUWA 3O1IC 4GRDA 4UXHA 1NR5A 3IC9A 4CXMA 3NAZA 2DYRB 3R7BA 3ABOB 1I4WA 3VR2A 3TSYA 1XALA 4D74A 4IWXA 2DXIA 1HPLA 3A1CA 4UOEA 1RHKA 5A4IS 1QVZA 1COWA 2COEA 4I1RA 1OCRC 2NO0A 2ZAYA 4BQEA 5FH9A 1P7PA 1SHUX 4LY6A 3RVDA 3W7AA 2PXXA 4LEIA 5C80A 5HIAA 2LE0A 3UK0A 1UJ2A 4LJSA 2YXDA 2VTVA 1R9JA 2NO7A 3D6NB 4ZAXA 1ILWA 5FA5A 5LNK6 3NHBA 1NJFA 2G40A 2WQZA 2C9CA 4CT4B 1JHVA 1YR6A 1SXJB 3A3KA 3W2EA 4OP2A 1PT8A 2ZRPA 4KGVA 1PHRA 2GCNA 4B6FA 1GTJ1 3FBWA 3FYIB 3I5MA 3W1VA 1AXRA 3C3XA 2JC3A 1SC6A 1PDOA 1E1KA 5KB3A 2UKDA 5AD1A 4MKFA 3QPCA 4X9XA 2FR0A 4EENA 1P2FA 4BGIA 4IHQA 5KQMA 3CRMA 2YN2A 1DDGA 3BIXA 3PC4A 5FTKA 3A6FA 4OHCA 1OV4A 4RKEA 3KPJA 2X7HA 2JARA 1RHJA 4MRRA 3KTAA 1VMIA 1W4CA 3PC3A 4UCVA 5C3MA 4GGPA 3GB9A 5LP1A 1J7JA 3IXLA 4RD0A 4MYHA 2GYVA 3F7YC 1TD1A 4NQRA 3F6SA 1II0A 1Z26A 1SRQA 3ZRSA 4DW8A 2XCQA 3AEYA 3LTNC 4PIVA 1CK4A 4D4IA 1NN5A 4YFYA 1N33B 1F06A 3HYTA 3OMWA 1BQEA 2I67A 1XILA 3B70A 1OPRA 2FZEA 5C8VA 3IAUA 1W1IA 1L4KA 4I6GA 4YO8A 1C9JA 2HH9A 1VYTA 1PPJH 2JLWA 1KMHA 2XE8A 4RPKA 3G59A 3NP9A 1MO2A 2Q2QA 2ON6A 1QP0A 1NQAO 1GFSA 5BV8A 3V7WA 4CNBA 4LJ9A 3E3OA 5EUBA 1IRIA 5G3YA 3F8TA 4OJMX 2AI2A 4DQLA 1MH1A 3AK2A 1GUZA 1X92A 4KWHA 4MQ6A 1HO3A 1DCMA 2I7TA 1PYOA 4M9RA 4RBNA 3L6OO 5D1HA 5EHGA 2WU4A 4F3KA 2WHPB 3KT3A 1LY1A 5I6DA 4D98A 3JQBC 3GLFE 3LC0A 1SJ9A 4E31A 3I52A 4ETWA 3N59A 3ROGA 2WUEA 1PFQA 4QUHA 2ZK7A 3GDOA 2PGDA 3V1LA 1NW5A 4K81B 4R68A 4R3WA 2CVOA 1F2TA 3D6TB 3B6EA 4H7HA 1Y8ZA 3OJCA 4HEHA 3U0ZA 4UFZA 2PCJA 5H9CA 3FBTA 2PRJA 4BQSA 1V1RB 1RXYA 1NL3A 1WZ2A 4N8SA 3U44B 1GTMA 3SHWA 2AQ8A 1CUYA 1YZNA 3AIIA 4ZU6X 2FPIA 3VMMA 2P4UA 2DT5A 1H23A 5LQDA 5IJ9B 5DWQA 3EMBA 1W35A 3MFYA 3AB8A 3F4KA 3H8VA 2GVDC 3DT8A 3OF5A 1GHTA 2FKNA 3BFJA 4CR8A 3OE5A 3FSGA 1MZVA 3VPFA 1SVLA 2J9GA 4R54A 4KK4A 3VDRA 2YVLA 3IVGA 1JG2A 2FUG1 2FMHA 1XNJA 4I8XA 2BCGY 1KYOF 4L75A 3OE7D 4BBAA 1CQZA 1S76D 1P81A 1UBHS 1EXNA 4A0QA 4Z1VA 2FZCA 1YU6A 1NVFA 3CNNA 2OTJV 3I5AA 2JFUA 4XAQA 1XTTA 4NDAA 3ZCQA 4B3IA 4PA3A 4S3MA 3PD7A 2XQJA 5CU7A 3FWNA 1E3JA 2HK7A 1KJWA 4XCXA 5A9RA 1R4AA 4WAUA 5CITA 1QR2A 4EGQA 3ZY3A 5CB6A 3HUFA 4Q00A 4IHJA 3H2ZA 2GJ4A 2LGJA 3WLJA 5J4KA 3BXEA 5B36A 1JE0A 2NZUG 1P33A 2ONKA 3BMOA 2QLLA 3R7WA 1QYXA 2PJZA 2F00A 1VG0B 2W6CX 4IJQA 1MIHA 1WNFA 1FE8A 3O8OB 2YINC 3RC9A 3WADA 2YQZA 3Q12A 4JL8A 1JQDA 3PICA 1XMSA 2UAGA 3D1LA 3J80N 1HKHA 1RM5A 4KEAA 4MH0R 2JCXA 5KSOA 3HPLC 5HCNA 4KXQA 5CA1A 4FHEA 4C4XA 5BOSA 4A92A 3M99B 2K4MA 1XSEA 1RWQA 4MLDA 2P6NA 4J80A 3ZW7A 1YEWA 1XYGA 5JBQA 2PIDA 3ICWA 4MZDA 1L5RA 3MAJA 3DWFA 1XQXA 3NWOA 3WGGA 1IQ0A 2B5UA 4XJTA 3JQEA 3EASA 2NSHA 3Q9LA 1K73W 4OUDB 4KPUB 3KQHA 2XAJA 1E69A 4OLFA 5KVCA 4CQLA 1EE9A 2GEBA 4ZIBA 3K0FA 4EKYA 1QCEA 2F3TA 3SHQA 2HM7A 2XVAA 2WYVA 3KWJA 3MPUA 3QXCA 3AINA 4L8VA 1KFKB 3BWBA 1ZGJA 3RVZA 4L08A 3M9WA 4OMFG 4UNIA 2M6LA 3K0KA 1L7MA 1OC4A 5DF1A 2FLKA 3GW8A 5IJXA 4YMHA 1LPPA 4RSHA 2F3QA 4IXTA 1GCUA 4YUWA 3E35A 4I0XA 4BNYA 1K27A 4O2LA 2GUWA 5SV2A 1G38A 1HC7A 2V0GA 3V32A 3P0EA 3CLSC 3KZNA 2I3AA 1XPOA 3D1JA 1C3OB 4ARBA 1VIMA 3RFRA 1E2PA 5FBWB 3NKVA 4BAYA 3O95A 1JHXA 3M83A 1KHTA 4GM0A 1U0RA 3S5UA 5IH7A 3WL3A 1IURA 1XZPA 2OFXA 2V5AA 1Q1ZA 3O38A 3LFTA 3DZIA 1NOIA 3FTEA 4P92A 3K92A 3VH4A 4QBHA 2CTWA 5C46F 2CCKA 3G13A 1E8MA 3BWXA 2Z2XA 3VM6A 1W5TA 3R2JA 2E85A 1KECA 4PZEA 3W3AD 3JQ9A 2R5WA 2VPPA 1EM1A 4FFBA 1CQIB 4TSKA 4HQNA 4IGEA 2NN4A 1U8EA 3T1VA 2Y68A 4A6PA 2Y1EA 1J2YA 3SQNA 3ORQA 5I9TA 1YE3A 1WB8A 4G5SA 3BMCA 2Q3DA 4DGQA 1DXQA 5C32A 3HUEA 3L70H 3AG4B 4PD4F 3DMPA 3C1AA 3GGSA 1QG4A 2GCOA 4U2EA 2G28A 4C14A 5JWOA 4GXQA 1AXGA 2Z9BA 2P30A 3WC4A 1U0HC 4PSAA 4HI0E 2IZ1A 4RXUA 4B3BA 2BV3A 5LZ2A 4TLAA 2XNKA 3V4PB 4FT2A 3D8HA 3LVQE 1L8XA 1VSBA 2OHOA 4NEGA 4KXMA 1P29A 2WNSA 3VJKA 1QF9A 2IPOA 4Q1DA 3R66A 4KJXA 3I2KA 4L7QA 5LZ4A 3JASB 4G37A 1IY8A 4LJ4A 4MYSA 4BBPA 5DVZA 3CPWU 5CB8A 1AILA 1JMKC 5C8XA 4FGLA 5JZSA 1WCIB 2MSCB 3O8BA 3SC3A 1X8XA 3O91A 2GPJA 1DAHA 3FH0A 2IDJA 3PS9A 2UUCB 5K03A 4W9NC 3QFTA 2JFWA 3D5TA 1TAEA 2QMYA 4I9QA 4K8OA 2YV1A 4F04A 3OFVA 2ODBA 1ZBDA 1P45A 3OT4A 2AG6A 4XM0A 3DGEA 3DE7X 4GNRA 3IB6A 1ZCZA 1CDEA 3GFSA 2Y4UA 1WZCA 4NNOA 3WMEA 1KYQA 1Z08A 3WKBA 2QZ9A 2FDCA 4HB2A 2DMXA 2B5VA 4KYIB 1TUEA 2D5AA 1U1EA 5EXSA 1OVGA 1YHYA 4K6OA 4B0PA 2ZI5A 1YUMA 3T3PB 4PAMA 4UHHA 3WP1B 4OYRA 2RKBA 1QQTA 2R2GA 5HFJA 4L4ZA 3IEVA 1WHTB 3WU2Z 1QHSA 2W6NA 1UODA 4AG5A 5K8CA 2J0UB 2BZGA 2F1RA 3UVEA 1HTTA 1JZTA 4YA6A 2OV1A 3PVSA 1OBCA 5BYAA 3OZIA 4BN5A 3BSSA 4KVFA 4OHRA 2RHCA 5HKKA 4Z4QA 4DZZA 2SHKA 4NBKA 4C78A 4LDPA 3IP7A 4UCSA 4KFSA 3COPA 1E89A 2H48A 2LIVA 1B7GO 4US0R 3HR7A 2R6AA 1VPVA 4MTXA 4OXNA 2C8LA 2XMQA 5J43A 2ARKA 4JMPA 2IH5A 3ZX6A 2EQBA 5CB0A 3HN2A 1J2EA 4LF7O 4O4IF 4JBLA 4TXLA 4TV8B 3KNZA 3IHWA 2BUAA 1GRQA 3V1KA 1BW9B 3K9SA 3K5PA 4GUDA 2ZJ8A 1D9XA 4AN4A 3Q2IA 3NZEA 3BAAA 3LXMA 4P98A 4CM8B 3FPJA 4MKHA 4IV8A 4LX0A 2G9QA 3EXHC 2PGLA 3PYXA 2BLNA 5AK6A 5H2FZ 2ZRQA 4HGNA 1JHDA 5BXQC 2BGTA 1T6BY 5LB4A 2Q21A 1VHQA 4I8IA 2IYUA 2WFLB 3OCWA 2QLMA 1TCCA 1WA5A 1AVMA 3T9CA 1QHEA 4MGIR 3MTQA 3Q8KA 1KI3A 2Y0PA 3Q3CA 4KH1A 5GJCA 4HFJA 4LOLA 2HZBA 5AXDA 4C08A 3C6QA 4ZU3A 1PR0A 2GHQA 1GPKA 2MYUA 1Y74A 4EW3A 2KB1A 2AT1A 1KPIA 1A32A 2R6HA 3GEMA 3ZVRA 3JRXA 3VX3A 2YV2A 4NOLA 3DTVB 1PR9A 3VR3D 5ADUS 2HBYA 4JL5A 1A8IA 4IMJB 4FMTA 3SVTA 2P6PA 4DY4A 5JNVA 1P3JA 1Z12A 2VK1A 3KZ1E 1ZZEA 4B3SB 3STLC 1QC5A 2CHQA 1P5FA 2IGTA 5FHRA 4FYHA 1MMFB 5T67A 3MYRA 4KCGA 5LQKA 5KSZA 1F60A 1CUGA 3O8DA 4B7UA 4GVXA 5KVSA 3SC2A 2X5KO 3G8BA 3HCDA 1F9EA 121PA 4NFLA 4HNAA 2NT4A 4PA7A 5E9AA 3Q5DA 1EH5A 3SQMA 2OYQA 3W6OA 3CTMA 2FUG6 4WV3A 4IL5A 2ZXWB 1GT6A 1L3CA 4WJLA 1GTSA 5IVHA 1ND6A 3EFEA 4JQYA 2GF2A 3V48A 1VCIA 4FYKA 1SRRA 1M1NB 4YIOA 2GXUA 2GN1A 3O4FA 1XLVA 2QW1A 4MR9A 3ORYA 2WIBA 3AF6A 3NYIA 1Q21A 2BCJQ 5CW2A 1SD1A 4L0MA 2A9JA 1IDSA 4ARSA 1RKUA 4HADA 2RC5A 2Z0AA 3ZU5A 3EWSA 2QR4A 1X1AA 3IFXA 5BN3B 2C99A 1PJRA 2I6TA 5T7BA 3N2YA 5T4HA 5K3FB 1AK1A 1W9HA 5AW2A 3SZLA 3RHFA 5LXTA 1KOFA 3L7LA 2ONCA 2L69A 3U49A 3N9IA 4B7EA 3UAVA 1XOUA 4J75A 2OGZA 2I22A 3GL9A 1WZNA 1PX2A 3TOCA 4Y3UA 1BQ0A 3EVNA 2PRIA 4M9UA 4JZKA 3DHEA 4XFKA 1OZHA 4WK4B 2G9NA 4HHEA 1NTRA 2GUZA 3G9TA 4MVJI 2WUWE 2DW4A 1XG5A 3WZ2A 5EP3A 3I5XA 5AJVB 4LV5B 4CM5A 1TYCA 1SCIA 1Z5UA 3AV0B 5CDTA 2VUHB 3AHFA 3RH0A 2QAJA 4FMCB 4ME6A 3AFMA 1VCNA 3CTPA 3ROZA 1IM5A 2DBRA 5EY5B 4DQVA 3V7YA 1PJQA 4AM8A 3WMFA 1F6WA 1YKSA 2GR9A 1F12A 2YH2A 3K8ZA 4AYWA 1T5EA 3GUYA 4HSGA 5MFZA 3M2TA 3H11A 2I62A 2Q4DA 5FA8A 4ZTZB 3DBVO 1HNXO 5A02A 1HDRA 2YUIA 4Q15A 2IITA 1T43A 1PQPA 2CL7X 3W6NA 1TMKA 3LXRA 3NBZC 5DMXA 1L6RA 4PZZA 1A9OA 5KTNA 3TZCA 4GXRA 3RYIB 3JAMA 5EJGA 3TLMA 2ENWA 2G04A 2FWPA 2JJ1D 2XUIA 4R2MA 4XQ0A 3MS7A 5L7WA 4X91A 5FFNA 2HDNB 3L4SO 2A3RA 2WJ6A 2FN7A 1S96A 2MHCA 1ZS9A 4BLPA 3G8DA 3KTAB 3DO8A 3LX8A 4B7ZA 1P2DA 3R6GA 4C0AC 3O90A 3T3IA 3ICCA 3UV6A 3UMRA 1RMQA 4DRXA 1PNTA 2ZWMA 4ALNA 3LV8A 4WIAA 2PUSA 3B89A 4RXTA 1O77A 1QF7A 3OKAA 4N48A 1M2GA 3M6MD 1R0KA 1GZ7A 1WJZA 1CB7A 5F2OA 2P0YA 3GDGA 1NI4B 4UV8A 4D5EA 4QJ5A 3E9YA 2O19A 3NYWA 4L4YA 4G8CA 3P2IA 4WMLA 2QUZA 1DPFA 3L8ZA 2WHYA 3WYFA 4JYYA 3A0BZ 3ENKA 1CXZB 5FRDA 2OA0A 3WLKX 4IH1A 3OJXA 1PFGA 2PMCA 2IYRA 5JMWA 1X1QA 5E1AC 2R44A 1J1IA 1MV8A 3A7DA 4D0SA 1YQ9A 1MOSA 1ID8A 2JLZA 4GEKA 1L5WA 4QVGA 3WO0A 1J20A 4MT8A 4AJLA 4BUCA 1QO0A 3FVQA 5FPTA 4LHVA 5EP4A 1A5ZA 5J4LA 1JNXX 5CHYA 4WZBE 1SC5B 4IXMA 5ITVA 4GAEA 4FDLA 5DJ5A 2C3MA 1Y76A 3LF1A 3P9RA 4CNQA 3PHIA 1WXHA 2R7KA 3LZDA 1E6EA 4OH1A 4RZUA 1F2TB 4WY5A 4A9AA 3C1UA 3DZFA 1PNLA 2IS1A 1D5AA 1VJDA 4RZ2A 2IHNA 2I71A 3HUTA 4V03A 1KMMA 4CQMA 1K8YB 1JHQA 2WYWA 2NT3A 4N49A 1RRGA 3VDXA 2Q5LA 2P5OA 3GK3A 3G6BA 4INJA 4EY3A 1DCFA 1ZGZA 4YGXB 1KZ1A 2G3YA 2CWDA 2FPIB 3KK0A 3GLQA 3LZ6A 3PD0A 1Q1GA 3W8DA 1R66A 3EXG2 4RXMA 2PJUA 2H92A 2ZBFA 2R48A 3GGPA 4DDUA 3GARA 1AK9A 5GQSA 1OILA 1BXGB 1FFSA 5A0TA 2QORA 1N5LA 1Z3CA 3DE6X 1PQ4A 4OIMA 2J3IA 3O94A 1GN3A 1Y8AA 4K0KO 1OFHA 2V98A 2ZUEA 4R9NA 5C5CA 4XYMA 2QR2A 2HT1A 1PR4A 1LNSA 5J4HA 1Y89A 1YKFA 1PBNA 4M98A 2WTBA 2CK3D 3AGPA 3L6UA 3QIVA 3RIYA 4RDXA 1V5EA 3GUVA 5D3KA 5J3JA 3BFXA 1AQ6A 4UDOA 3BKWA 2W6JG 5JMTA 1RZUA 3EQ7A 1VQ1A 2MINA 1ZRSA 4FXPA 2R5NA 3JW8A 1ZUWA 5CH5A 1AB5A 3AJDA 2X6CA 1TU3A 1NXTA 2QVGA 4DQDA 1CZOA 1L3IA 4P9PA 3ZIAG 3VMFA 3QKRB 1UT6A 4IHJB 2YJ5A 4FFVA 3DHVA 3IBCA 4FONA 2X0DA 3PI6A 2Y69B 4II3A 4P0PB 2HPZA 1DKRA 2JI6A 1YB7A 2WWXA 3OFND 3WIUA 5JCJD 4UVBA 2EFYA 3R7WB 4I6JA 1HTBA 4WBNA 2FSIA 1UDWA 2P11A 3EIWA 4GP6A 4A0GA 4PZLA 3VSEA 2RI6A 4AKEA 1QOQB 2EJWA 2ZVPX 3EEOA 2V7UA 4JB2A 2IPXA 4KX3A 4NHOA 2AF4C 3GDWA 4KRYA 3RRMA 3U5ZB 4JZGA 3B6KA 2JEOA 2QMHA 3ER6A 5B6JA 4CTKA 2EVWX 5KTTA 4NOJA 2WHPA 3UWKA 3DS8A 1LZLA 1V3UA 2Q6VA 3OE1A 4NKRA 1J00A 4QVIA 4PGGA 4JLNA 3EGCA 4WKBA 3VTAA 2CDNA 5ERXA 2BMDA 1Q82W 1RRFA 2ZM6O 2X4GA 2QROA 5JDIC 3RWMB 1IC6A 3ZHYA 3K0FB 2RKOA 2W58A 4E46A 2F9MA 1GU1A 1ODJA 1X9HA 3IBSA 3SKXA 2IH4A 3EVBA 1KR2A 4QGBA 1Z82A 2I55A 1V1RA 4G1FA 3DMRA 2JEYA 1QTRA 3VBEA 2OTCA 3K5NA 3U44A 4AZVA 4FOSA 1QM5A 4I0XB 1AKRA 1G17A 3CWCA 4K6KA 5CA0B 5IJ9A 4EO9A 2PS9A 3U3DA 3RC8A 2ZYGA 2KWIA 4TMXA 4J9ZB 4RE5A 5ESXA 3GYGA 4QPJA 1GM8A 1DAEA 1KY2A 1X38A 3OO1A 2ZSUA 2JLYA 1QFMA 1H4VB 4OM7A 3BEDA 1JR2A 5H16A 4J0DA 3BDVA 4EGSA 1Y3FE 5EBMC 4RK0A 1CJCA 4CV0A 3CRCA 2DY0A 1BGWA 1O6BA 2FJ0A 1TKBA 1ADGA 4IRXA 3D3QA 2EWWA 4CH6A 4YREA 3TCNA 3AV3A 3S55A 2DSNA 2Q5IA 1NJGA 1ZXBA 1UJMA 4DJDC 1D8AA 1PHPA 2XVXA 1BYIA 2L42A 4F97A 4CC5A 4AQDA 5D3MA 1I9CA 3FCEA 1G6HA 4LV6A 2EINB 4HGRA 1MP0A 3WL8A 5AW4A 3C3MA 4DEVA 5L3QB 2XMPA 1LBHA 4Q34A 2JA2A 3BMCB 1EFRD 5HIJA 4PV7A 1DQNA 2HJSA 3B6ZA 4HPWA 4C7VA 2Z6VA 2I2BA 2BJHA 3WBKA 4KQ1A 5FB3A 4DVGA 5BNFA 2BKLA 4KDFA 3MZ0A 1IN8A 1G41A 2GCOB 1PK7A 5KSWB 3K9QO 3I04A 4YJ2A 3IOYA 4M1MA 3TLXA 5KO2A 3CWBH 4PS0A 3N6VA 1FYDA 5FQOA 1O4WA 2IOFK 3OPYB 1RXWA 2FMXA 4LJRA 4NULA 4KFTA 3GO4A 2ZU0C 1PJSA 3GCXA 3SM9A 1UKYA 2ZYAA 1JIIA 2VAMA 4WK2B 3SR0A 1DOZA 2L35A 3W9YA 1S7GA 2ZB7A 2NO1A 2A0YA 4QHTA 1JH9A 3LBHA 3MELA 2VBGA 1QHIA 3OGCC 3I42A 3TLCA 2C8KA 1E3EA 1BH2A 4P5DA 3FAKA 5LL6P 3TG2A 2AJBA 4AKTA 3TJRA 2ZAMA 4O02B 2CF5A 2ZBRA 5KHAA 2GS9A 2G7ZA 1KP9A 5JAIA 4BBZA 1W29A 4EWLA 4OUDA 4KPUA 5KHIA 3M6VA 4QUAA 4MR7B 3SQDA 2VCHA 1ZL8B 2P9FA 4DV3O 4MTCA 2NVWA 4P58A 3O7WA 1FQOA 2FI1A 5FBKA 5F5NA 4PPGA 4I7EA 4HZGA 5E0OA 4TUYA 1Y5IA 3F5MA 3EXHA 2M6RA 3R9WA 1HT2E 3U3ZA 4R2HA 2ZI6A 1G8JA 1W2HA 2VH5R 1OA0A 1TUEB 4OQQA 4PFSA 2FX3A 1OU0A 4QUDA 4M86A 2MR5A 1NVBA 3IAFA 3N8DA 2W93A 4MV5A 4LPSA 1F9AA 1QLNA 3ID6C 1RBZA 3LG2A 1T1EA 2WK1A 3W7XA 1C3OA 3GRRA 3MJEA 3ZI7A 3BHIA 1RMTA 3E8FA 3VI4B 1Y8RB 5JZ9A 3IAM1 5DHSA 1AA9A 5BXYA 3C7AA 2J4CA 3PU6A 4XIYA 4B75A 3ML0A 2K1EA 1QYDA 2PLWA 1PJ2A 3MMNA 2C94A 4E6PA 1UMCB 3OJFA 2OAEA 3JALA 2H4WA 1KVQA 3R3SA 1WUHS 1B2RA 2Q3JA 3V33A 4OQXA 4MLPA 4DJEC 3E7DA 5LMNB 2NTJA 3SYNA 4C5CA 3DLCA 2ZXFA 4NONA 4J76A 1DKOA 2PZMA 1KTIA 4MZXA 2ZXUA 5CVCA 1NGSA 1BX0A 3MWYW 3WVNA 1U6IA 3LYHA 4OYYA 5E9WA 3O9VA 4QSHA 5KSYA 3WJAA 4YRPA 4DUYO 4GS5A 2ZSAA 4UBKA 2C5AA 1JYEA 1DCTA 2VNJA 1Z33A 5LHGA 3GJQA 2XA1A 1PFKA 3C97A 16PKA 1T2CA 4J0CA 1V95A 4CM9A 4LMAA 4PGHA 4NXNB 1M57C 4BQRA 4NYMQ 5J9FA 4YALA 3FCOA 3T4ZA 1M6WA 1W19A 3LNCA 3ZY6A 4DUGA 2FFBA 3HGTA 2RGDA 3M5CA 2WMDA 4LKOA 1RWKA 3VO8A 1RHUA 3JASA 1QQCA 2G5CA 1BZKA 2R9VA 4UPEA 1NVPD 3PBKA 2VUIB 5LMUO 1U0NA 5CB4F 1FFHA 1ZA1A 1A82A 3SLRA 5TJ9A 5ELMA 3GFBA 4TQGA 1U1GA 1S8OA 2C92A 4U00A 1I2AA 4ND5A 2JKYA 3T5CA 4JLKA 2W37A 4MQUA 1VHWA 3OI7A 2C03A 1OCRB 5G1OA 3EZ7A 3LM8A 1KIFA 1SC4A 3TZBA 4X1IA 3RNOA 4ZCMA 1YR8A 3RO7A 1NTMH 5EIEA 3W9BA 1QC5B 2W2VA 1OLXA 4EH1A 2BHRA 4JOSA 2J3QA 4LNHA 3K5LA 1ZK3A 4MW8A 4QPPA 4ZI5A 2ZTMA 2IDZA 4ZBMA 2ZINA 1WZEA 4NCIA 3ZLUA 3ZDDA 2LPMA 1Y6FA 2Z9CA 3PDHA 2GM4A 1EVLA 4F96A 4BKOA 3GCGA 2ZATA 3TLZA 3HB1A 3UY4A 4A3SA 2HMWA 4KI7A 4ILKA 2IWRA 4CE6A 4YQFA 4NE2A 1AC5A 4MR9B 3ZY5A 1UKCA 3FSEA 3MSXA 3RS0A 2FPLA 5ALQA 4B6OA 1PI3A 1PJ3A 4UU1A 3IMFA 1I6KA 4BVGA 3B4SA 1BN7A 3HVRA 4J0JA 1JKMA 3MCVA 3RUIA 1U2SA 5B1EA 3VDQA 5JARA 5HKBA 3ORFA 5I9LA 3STTA 3O4GA 1PCXA 5JDCC 3JAKB 1NSTA 2HHHO 3G0OA 4R83A 3FB7C 5LXTB 2DH6A 3UJ7A 1YA6A 5FD8A 2C4MA 2JFQA 1S7CA 4FEGA 1L1RA 3F47A 4ZOQI 4HT3B 1ORHA 1OX4A 2WKQA 4DV5O 1YQGA 2N1BA 1DAGA 2C5EA 2QUJA 2JD2A 5JPIA 3TKLA 1BMFD 1TE2A 4X41A 4TV8A 1QSGA 4OBEA 1Y5NA 5G0VA 1Y0BA 2VDMB 3I1YA 4TWJA 2ALJA 5AH0A 4CFSA 5EIAA 4FXOA 2ZB2A 1Z29A 5JJLA 1JAXA 3WGIA 1I0HA 1K5PA 2GBFA 4LWZA 3HZRA 1C8KA 1XNRO 3RFCA 4L4RA 1N0JA 1VKHA 4MVJP 1D09A 2N9UA 4UCXA 4X44A 4BNHA 4MJ3A 2PKRA 1OYWA 4JENA 1CVRA 4LF4O 3LUFA 3S8EA 3OETA 3FMGA 5CDFE 3LUTB 1D2AA 3OEEG 3CU5A 2OY0A 4YAIA 2ZTVA 4JV5B 3SICE 4M7RA 2JJ2G 4BLSA 4AILC 2MMGA 1KNXA 4IFIA 4ZODA 2JPDA 2E5LO 1MOPA 1OAOC 1VSQA 2XQIA 3H1AA 4IJ6A 5I7FA 4OU4A 3HCPA 4MVYA 1XX6A 4Q47A 3DTVA 4XGRA 4GL2A 3BA6A 4DAOA 2RB5A 2VNSA 4JBGA 3AZPA 1N8RW 3BFKA 3MFQA 1TF5A 3HU5A 3BRCA 2H1HA 1FJGB 2OXIA 3ZBUA 1OCEA 3PT5A 2XCUA 4PG6A 1X1EA 2O50A 3ELDA 1IDN1 821PA 1DDIA 4Z7QB 3F46A 2WLMA 2M32A 5EUMA 1Z2PX 4IT5A 1FDUA 2FEMA 1ORRA 1VA4A 3DMHA 1VF6A 1JJ2U 1BVHA 3C5HA 3F6EX 2BGUA 3I5YA 1LVUA 2GJSA 2RCNA 3TS1A 3C5WP 3CUVA 1MC1A 1ENVA 3W7WA 4BDTA 3RUPA 2QX8A 4RX1A 4UXNA 1TCVA 3G88A 5KTKA 2Q4EA 4TWRA 4CKZA 4G0WA 1M1NA 4UOZA 4ZOLB 3HDVA 5HX7A 2DHCA 4RHUA 1AJQA 3CLUC 2PQ0A 2UU9B 4JAVA 1P0MA 1SQ6A 2XYHA 4GBED 5ESWA 5L7TA 1INLA 2FLWA 1S2LA 2XH8A 4DIKA 5BN3A 3ZNOA 2Q8VA 3DM5A 2RARA 5DN6G 2ZIVB 1Z6AA 5K3FA 4UM9D 1VJRA 1A7AA 3NASA 1WDTA 2AQKA 5K1XA 1NBME 1ZR4A 1XRMA 1ZC4A 3QRWA 3OMNB 3PXUA 2GGSA 3RWBA 3TLEA 4L3VA 5FWDA 4OLHA 3M81A 3RS4A 5DYYA 2RHWA 3PR2B 1I5OA 2WSSA 3NGLA 2G9VA 2PRZA 3BK1A 2C9DA 4J0EA 3F9CA 5JC8A 2B30A 1Y76B 2ZIFA 4HQFA 3DLIA 1YUNA 4P34A 2EKLA 5JRDS 2JK1A 4DWOA 1O6CA 4JXXA 4LJAA 1VE9A 5DEOA 3WS7A 4RY9A 3CVJA 1GSOA 1GKIA 5DSXA 3AJEA 1QONA 1UOPA 4CQMB 4B5LA 2QIPA 4FLWA 1V5FA 1RBQA 1ONOA 3ANNA 4RZIA 1IL0A 3ROFA 3T06B 3EEIA 5ITZB 2FN4A 1NDUA 1F20A 1HDCA 4MI1A 1XMOB 3D3KA 1JA0A 1N9ZA 1ZHOA 4QNRA 4CQNA 3FB4A 3LGSA 4BDSA 3PXGA 1S3FA 1SIOA 2NLOA 3E86A 4GYJA 4BW9A 4Q3DA 2DQKA 2OLJA 3FETA 4K28A 3RYIA 3VPAA 3CZPA 1NNLA 3HWWA 1ORVA 2PUVA 5CXSA 3NRBA 1W9MA 4HD8A 3G0IA 2HAEA 3ABSB 3RFXA 2LCFA 1H8HA 1T3ZA 1DZ3A 4O8ZA 3UMGA 1Y7IA 1K9VF 4LGYA 4UHCA 7MHTA 3ZS8A 3JSXA 4R8CA 1FRZA 1K6XA 1JPUA 5JS8A 4U3JB 2FSVA 1T0BA 3F9IA 1QLEC 1JEJA 2MINB 4ISBA 1G9TA 1N0HA 4GQAA 1PS9A 1OXUA 4KO2S 1TK3A 3ZV7A 2VF2A 3IAM6 3HXMA 2HCFA 1PNKA 4R1QA 3ROXA 1A96A 2QE7G 2XECA 2VQ3A 1E1RG 3QTLA 3FKSG 2F4NA 2QOEA 4XH9B 2XAHA 1DKPA 2J41A 2Y0DA 1NI4A 3SOZA 1C7QA 2AJTA 4ZYLA 4JQSA 5DH9A 1Q1EA 2VTEA 5TDHA 4WBNB 2W2LA 4OL0A 4DV7B 3B9BA 2YI9A 1LJ8A 1CXZA 1ZLYA 3R7SA 1DEAA 5IDQA 1O94C 1E2BA 3K6KA 3GJTA 1CFZA 3MGAA 2J59A 2HHAA 4EPVA 3HGMA 1CUVA 3TUJC 1XEWX 4BFVA 5DTJA 3T0FA 4YLGA 4HRVA 1OWOA 3F67A 3TIIA 4Q4JA 1PW5A 3WI7A 1JA8A 4HS9A 1LSUA 1G7CA 3N2EA 4DCGA 2QJFA 4BQNA 1MGOA 3CWZA 4LC0A 1MB4A 3FI9A 3VOTA 3OZRA 3CF4A 1G5HA 4BBJA 3UV3A 3WOVA 3QY9A 2QI9C 1KI8A 5KNBH 9GPBA 3OIWA 2GBOA 3A1VA 1ZK1A 1WN7A 4BWAA 1DMRA 5FUQA 2YMPA 2A9VA 2QENA 1J0DA 1A50B 2C2BA 1LWNA 1ZUIA 2RK4A 1N7GA 2Y0CA 2ZCUA 4M0CA 5LZ5A 3DAFA 5F2NA 4LH7A 2VQSA 5E3HA 5CD1A 3KCYA 3H9UA 1YXBA 3F6RA 4DOMA 4DC0A 4M1ZA 3FA2A 4MW6A 4TKLA 2WPDA 3U3OA 3UXYA 3U7HB 1O89A 4PSVA 2Z8XA 4EDFA 4ZZ3A 3CE2A 1JFRA 3O75A 1S8NA 4DSAA 3ABZA 2WD8A 1BXGA 3I0MA 1JBQA 4QRHA 3D31A 4WK0B 4NTYA 3E3AA 1GKKA 2OORA 2JDIA 1GR1A 2M9MA 3LNTA 2HFKA 1IE3A 2ZUVA 3T1QA 4MRMA 1E5VA 2H7YA 4BYMA 4D26A 5L53A 1OAAA 3VKFA 3PX2A 3ANXA 3DL4A 3LCMA 1H85A 4CKXA 5JUWA 3OPQA 2QT1A 2ZIMA 4KUGA 4B7XA 1ZONA 5D3MB 3SP1A 1I2CA 4AY3A 4EKEA 4JU8A 3NMUF 5AG2A 4ZDKA 1RU3A 3M4XA 1XLTA 3JR7A 3LF2A 3TRDA 4NZPA 5EPUA 1G1AA 1XZQA 2W6OA 3E7PA 4KHZA 2E1PA 1HI9A 1VF5B 5FO1A 4UDNA 3TXQA 1DC3A 3QKRA 2P5UA 1RAIA 4YJ2B 3SG0A 2QQ5A 4M53A 5IYBO 4QXOA 4S1OA 3H19A 1VRWA 3MTDA 1U9ZA 3L8HA 2VT3A 3FZYA 1UPTA 3ZQKA 4V3CA 4J2HA 1UMDA 3HYLA 4L4SA 2OC4A 3R6LA 3DEFA 2TYSB 2ISSD 4J6FA 4GIBA 4OVKA 4WBXC 4B3JA 3AKZA 2MSLA 2CMGA 3GLGB 4TYYA 2C5LA 4MMXB 521PA 1E1CA 5LLTA 2D4AA 4M0LA 4TVSA 2R87A 4UUNA 5K0TA 1SUSA 1QLJA 5AW9A 1W581 3FPAA 1REQA 4MB6A 3VR4A 4JODA 4LQCA 4BJ5A 2IJJA 1TRHA 1PWHA 1LFDB 1GGNA 3RE1A 5MDHA 5TC4A 4C3UA 1RXUA 1R0ZA 1Z28A 4PXYA 3IOCA 5IF3A 2QRZA 2PFSA 4NENB 4KN8A 4KJZA 3EQZA 3OZDA 1G21E 1XQVA 1U5CA 3HCAA 3PNLA 3GNTA 4FGUA 1C7EA 1OXTA 3FRHA 3MN1A 1JV2B 1N2ZA 2Z4RA 4V3BA 2ZR9A 3PEUA 1TMOA 3AKDA 1L5OA 2YV4A 4N65A 4TUYB 1MF7A 3EXHB 1W0KA 4CLOA 5FLYA 2O20A 1YZQA 1M33A 1BC5A 1XN1A 1WE2A 4J0QA 2YYZA 5CA0A 3UG6A 4MUHA 4U2GA 3N2ZB 1E77A 1XP5A 3GRFA 3QLUC 5IARA 4KPEC 2IYNA 4W6ZA 3GROA 1P4GA 1QMGA 1ZH6A 2I8CA 4PC1A 4RESA 4BL5A 1E6MA 3WBBA 2H9AA 1XU7A 3MBOA 3RS5A 3BZWA 2V97A 1GRJA 3NQ41 1L7XA 4K8RB 2EF1A 5I7WA 4CLDA 1H6BA 4KPYA 1EB9A 1EVZA 4X88A 1FSGA 1QRTA 3DXXA 4QIHA 3I55V 2Q9AA 3AJ9A 2AI3A 3WJ1A 3UOAB 3TL2A 2COKA 5F78A 1DV1A 5EUCA 3FR8A 1SETA 1AGRA 2RH8A 3LSQA 1L7BA 4EL0A 3JALB 5A5VA 3HACA 1KO8A 2UUBB 4FPXA 2FPMA 2D7DA 1E2DA 4ROTA 5L3QA 1JTFA 3FOAA 5HUJA 4L16A 1P5RA 3OTIA 2DHQA 2Q6OA 4D4MA 2ST1A 5C7YA 1CPYA 4ARZA 2XGMA 2GM5A 3ZI4A 4DDTA 1ZNWA 5TF4A 3I83A 2F7SA 4S24A 4IDOA 2F2TA 3F97A 1URPA 4DMHA 3AY7A 1X1SA 3PGMA 1T5BA 4KOAA 4X65O 2EFHB 3K53A 2W43A 1RJDA 5IK2A 4WEOA 4M6WB 3ZJYA 4RDHA 3T9FA 3SHFA 3H99A 2JFVA 5DGHA 4EZBA 4JYBA 5CYFA 3TTXA 3VYRB 1GMGA 3OPYA 4LOIA 1CS4C 2ZRIA 1E3SA 3KB8A 3GLSA 3PJGA 5DOZA 1DAOA 1P91A 3BY6A 5JC1A 3IO5A 2ZJAA 1SOWA 4AO7A 3RVPA 4MTLA 5A2QA 4HDKA 3L6CA 1VOTA 1H2MA 2IHZA 3PIRA 2EIJC 5DLQC 3OQIA 3KUUA 2CVZA 4LHZA 1VKRA 3G6WA 3I01M 3STVA 2QSJA 3PKIA 4YDHB 2D74A 3GHHA 1D0IA 1CR4A 4HMOA 2K6GA 3K73O 1XHLA 3COVA 1Z18A 1IXSB 5IAAA 3L04A 1N5OX 3I5UA 3WIEA 2Y6UA 2XVYA 3C7TA 3D8SA 4N6OA 4MR7A 1ZL8A 4XYGA 4ZOBA 3ZR4B 4NBLA 5J4YA 4ZZ1A 1AO3A 4NBSA 1K4KA 3VZDA 3PE6A 3UC5A 1U8XX 4C29A 4X1IB 1C9EA 2LP7A 3CF6R 4AD8A 3DLHA 1Q17A 5EZ6B 3SE0A 2Z08A 4DMUB 1QGED 1OLXB 2A5JA 4FE7A 1KS9A 1QE3A 4RKWA 3CH4B 3TTVA 3W5SA 3H2GA 1Y8QA 5DYNA 4DYHA 4B4WA 3PLRA 1RXEA 4NTWA 1T4DA 5JXGA 1WPRA 1CZHA 4CW7A 2PBZA 2CMKA 1GRVA 3PDIA 1U02A 4IJ5A 1TTHA 1B6QA 2KHZA 4ID3A 2DUWA 3F2VA 3D7KA 2VLBA 3KB6A 4AG3A 1MORA 1Y8RA 5G2OA 5ECDA 1OAOA 1GOTA 2JHPA 1WF3A 2OMKA 3QI7A 4BMVA 4C89A 1GCIA 2P2NA 2ZUCA 3UPTA 4I9GA 2BBWA 4FX2A 4RTQA 4RPGA 4RVDA 3IL2A 1U7TA 2CDAA 1XRNA 1D5WA 2ASEA 1O03A 1UMCA 4QXMA 5HVNA 3ZX5A 1LUAA 1XTKA 1YBAA 4JL6A 3S3TA 3OU7A 4LW8A 4MPDA 2I76A 2ZD9A 4C1NA 5LD2B 1IHXA 4DHEA 4JKOA 5KQPA 1GTRA 3LWDA 5GGYA 2P2DA 2R72A 1EJ2A 2P90A 4NBRA 4C6TA 2DMRA 1OX4B 2O1XA 3EZXA 3BJIC 4BNDA 5LA6A 2HWUA 1NN1A 5E1OA 1XA4A 2ETXA 5TSDA 4IMIB 1L0NH 3U40A 5DHAA 1C1YA 3WZMA 5H80A 4IDHA 3H87A 4FHCA 4DNFA 1R9NA 2H8PC 5LKRA 1XEWY 4D9CA 5EMMA 3DMDA 1SVNA 4IUBS 4LCJA 3UWSA 1Q0QA 3T1HB 3T1TA 5B1YA 5JSUA 3KJIA 3G8YA 3MWJA 5J5VA 4MS1A 1XVLA 1MVLA 3OZGA 3V4OA 3JQAD 1TF2A 4M0PA 3N5CA 4PSDA 3B52X 4LAFA 2P68A 1Q6HA 3L8GA 2Q29A 3DV9A 3U3RA 2Z3YA 3HJTA 3GLHA 4YUYA 1PSWA 2DWUA 3WKAA 1WXXA 1TLLA 1VCOA 1AZTA 3TYXA 4RLSA 2H4YA 4WFEA 4B1FA 4AQYO 1W6RA 3D4IA 4UTOA 5BR8O 3E4CA 3F9RA 2W0XA 1V8BA 2XQFA 3QVLA 3A58B 3HI6A 4N4AA 4C2AA 1ACLA 1EK5A 2ATXA 1WULS 2Z0MA 3NIGB 2IPNA 1DINA 4H3VA 4JA2A 1IHOA 4H7JA 3HWSA 1JJAA 4BO5A 2WQ7A 4N18A 5ESRA 4YRIA 1YDMA 1XN4A 4EHDA 4CBCA 4I3GA 3E9EA 1O5TA 1ZYUA 1A9XB 3OCZA 3RT3C 2H17A 1NZ6A 2GTIA 5DNCA 1RC1A 2ZBEA 2HCRA 1IEVA 1HEUA 2A1UB 3FNEA 3U4QA 1KH3A 4ND2A 3V1TC 3CCJV 3G67A 4Q7KA 4QEZA 1WV0A 5EC1C 5CLGA 1JDUA 2C84A 1SU4A 1BXKA 3A14A 3O84A 1Q6IA 3HVJA 3RRFA 1WETA 1D4AA 1ZM4A 1A8SA 4YMLA 3JAKA 1ZK0A 4YHHO 2BCCH 5I48A 1AU9A 4JUCA 4YT5A 2X40A 4PNHA 1KSGA 1LDGA 4JUFA 1MZFA 2RHHA 2IV7A 4WADA 2AHZA 4L8LA 1NH2D 3E9QA 2DCMA 5KWJA 2PWAA 3Q9NA 3VPSA 4R1TA 1MJNA 4Y6SA 1S2NA 1R50A 3LH5A 3FNIA 3HNRA 2QG6A 3L9WA 4XUDA 2D2XA 1WCYA 4DANA 5K4GA 4IOJA 3EARA 2WTAA 2ZQMA 3LKDA 1P1KA 3JQDA 3NNSA 4KPFC 4HUTA 2AE1A 3UEOA 3PTAA 3EF1A 2NWQA 5K1ZA 5KKAA 3CSUA 4UEKA 3CVXA 3HZOA 4Y18A 4PSUA 1XMIA 2CYCA 2KX7A 2XI4A 3FNHA 3LBFA 1R18A 4B85A 4C88A 5CYGA 4HBGA 3I6BA 3GD7A 4NYJR 2WRZA 3TKYA 3SYMA 2G5GX 3TLKA 2H54A 4JF3A 4CT0A 3JQBA 4ND6A 3S68A 1T2VA 3UMJA 2E37A 2PMFA 2JF0A 4Q3LA 4MINA 5LYJB 4P08A 4M89A 3MWLA 5FR1A 2J0EA 1B14A 2PQMA 3X2QB 2QYHA 4L6CA 1K98A 3IP5A 3IVXA 2QJRA 1M83A 1K34A 2PGXA 5KOHA 3DVRX 1GARA 2DR2A 1QH0A 1PJ8A 3EDYA 1BKDR 1KPHA 1LLCA 3IIKA 1DAPA 5HG0A 1QE5A 4BZWA 1JDJA 2ZWPA 3TQQA 1JPXA 1UIMA 3TDMA 2FN9A 1X42A 4G0MA 1R5BA 4D9FA 3AHGA 5LZ8A 4BMCA 1QJCA 3CLKA 4DLXA 5IDXA 5LZ9A 3GOHA 2W6JD 4BOYA 3D8CA 3WLRA 1WY7A 5BSRA 2PS1A 4RCYA 3HPRA 2ZSIA 5EP2A 4FZ5A 2IX9A 4YXWG 3QX9A 3RRYA 4RQEA 2BGKA 2BEJA 1NBWB 3O3CA 4ZOLA 2VNIA 4G1CA 1M66A 5ICGA 5EE5B 2MYTA 1SQBH 4HXGA 3LDUA 3ZIAD 4ZYXA 3K5WA 3AUSA 4YK7A 1NVAA 4KXWA 3KXLA 1PT9A 2N46A 4UHKA 2W70A 3D3WA 4PDLA 1QZZA 3OZFA 3U3JA 4U5XA 5J2TA 2A7XA 4KFUA 4DDKA 4FIDA 3SEZA 4MPRA 1DEKA 4MEAA 3QTTA 2V9ZA 1FX0A 3CCMV 4WZAE 3G7NA 4PHCA 1Y80A 3HYRA 4J16C 4MW9A 1MDBA 5AOAA 3KM0A 4Q4JB 4NSNA 2AEJA 3JQGA 2LTAA 1YMUA 4B47A 5KNBA 1RWBA 3K6SB 1OZFA 2I2WA 4N21A 3DD5A 1FVOA 1YHNA 3K0CC 1FW6A 2WF7A 1MUUA 4YWJA 3TAXA 3CSDA 4FS8A 2AYZA 4CJXA 1Z4JA 2YVQA 1QK4A 2WHQA 4CLHA 5COAA 3IT3A 3V8QA 1EFPA 3IUEA 1JWBB 4YRLA 4IYJA 1AI6A 3QVMA 4W82A 4TKVB 3IAEA 4UV9A 3UW3A 1JWAB 1M2NA 3WFZA 1A1VA 1CZLA 4M9SA 4MVJE 4MUXA 5ITZA 1V5WA 3OTHA 2J5QA 1FEZA 3ZWWA 2AJCA 1IOVA 2JFPA 1TQ8A 1N77A 1SVMA 1EPUA 4GKKB 4NH4A 3OQBA 2I2AA 3PP8A 1KDOA 4KODA 4EX6A 2WWGA 1U0BB 2B2NA 1I3CA 1QLHA 4ZVVA 3CN9A 3PEWA 1XKLA 1XL1A 2B0JA 2NO6A 4RY0A 3NBAA 2RHJA 5F52A 2AB0A 2CKDA 2ZSEA 2UVDA 4MRMB 1FDOA 1PL6A 1S5LZ 5AM0A 2IYLD 1XKQA 4DSNA 3T5TA 5DISB 4L27A 4JVMA 1W87A 4LGVA 5IVIA 4KIFA 4W5WA 5JFTA 3P2YA 4D99A 1VRCA 1Z9BA 4E2LA 1T9DA 4HG2A 3L0SA 1RLIA 4U3JA 1PGNA 1HYHA 3D7LA 5I7EA 3DJFA 4TN1A 3DT9A 4LVUA 4EO7A 1FBNA 1GPUA 4Q9JA 5CXUA 2NYRA 4F91B 2QTRA 1IJEA 2B83A 2OV2A 4R9VA 1I2BA 4R6WA 2HA2A 2UV8A 1VYHA 1SUIA 3LPCA 1R3JC 1Z8FA 2DFVA 2QB5A 3HP4A 1NMYA 3HE3A 1Z4NA 4AG6A 4BIUA 3I39X 1UMDB 3IRVA 4YRDA 2BM9A 4J6EA 1PSZA 1U4OA 4C7XA 3F96A 4JZYA 3L49A 4RTLA 4EI7A 2CFTA 4TRJA 3ZUPA 2CHUA 1YCGA 3HBAA 3DPSA 2YL2A 4MARA 4PA6A 3L7MA 1E1CB 4B3MO 4GVLA 2BSAA 1K97A 4B6QA 4QPNA 1Q12A 2PRYA 1REQB 2C59A 3S7ZA 1IM8A 1BDHA 1EWRA 3FYUC 3GJ8A 4WLFA 5L6LB 1S4QA 4ZEMA 2CCJA 2WHEA 5KC8A 1R27A 4X71A 2JAOA 1IZ3A 4E5DA 4LS3A 4G1BA 5CCDA 1TM1E 1P8AA 4EFLA 2GQ0A 2HTFA 4YRMA 4B48A 3R9KA 4FNOA 1ZOLA 3PKZA 3U4IA 4DYDA 2JCYA 4O2BA 1U6KA 3DO6A 1A2KC 4FFOA 1J5XA 3DBRA 1ZIYA 1XL4A 3EFOB 3NUQA 4XI9A 4LXHA 1GKUB 4YLYA 2ZIXB 1BWRA 2OG1A 2O6LA 2JVJA 1M57B 3Q88A 2A5FA 4OUKX 2QU8A 4ZQIA 4CLOB 1Z2NX 3VC3A 3GF4A 1VARA 1JPVA 1R0RE 1T9ZA 4MTOA 3S2ZA 2WP8J 4AZTA 3LRPA 4QZVA 3O2NA 3CW9A 4JT2A 1QBGA 4MEJA 3W7UA 1YQWA 4ABTA 1WX1A 1KJZA 3ZC3A 4KFMA 2FK8A 4BNXA 4CI9A 4M1SA 3GT4A 4AROA 4IH4A 3Q3IA 4IICA 3O4HA 4RVCA 1TU0A 2RGNC 3QOFA 3H7IA 1W5BA 2F1MA 1DL5A 1DTSA 4U0JA 2FRVA 1P7CA 1SC9A 4W9NA 5ECGC 4DR1B 3AUAA 1P7YA 2B3DA 2FTKE 4GI1A 3BORA 1VE5A 3CHXA 2ITCC 3LBNA 3P97A 1HRDA 3MQ4A 5B1AC 3L0ZA 1IZ8A 2WPNA 2PYZA 3BK7A 4F11A 3WNQA 4HVLA 1ZK4A 1O0SA 3ZLJA 1XTPA 3KJFA 1O8CA 1DHRA 3M4YA 4QTYA 4NVRA 3W7VA 4XX0B 3MBIA 3QG5A 1QDEA 4ARZB 4DPLA 2C9YA 2YYSA 1Q22A 4JZ2A 4YJ3B 4E3ZA 3M3DA 2YI8A 3PD1A 4HZ3A 1Q7BA 4X1YA 1EHCA 3KKPA 2BKUA 2ZOSA 4GWKA 2PSDA 1U3CA 1Y9EA 2I80A 1E1QG 1BXRA 3RC2A 2DKFA 3PXEA 2DSTA 3TRJA 1ZOIA 3RK0A 1Z6PA 3GLGA 4R1LA 4FW9A 1FDWA 1Q1BA 1P1IA 3DXYA 3CLHA 1TZBA 3L07A 4HDKB 5EXDA 3D2BA 1YI0A 2FW0A 5ALLA 1Q1QA 1SCUB 1WKVA 5FBZA 4WBSA 4I19A 5H5NA 3OQIB 3SZUA 3VTFA 4QGPA 2XNHA 4CKBA 4LQDA 3DBLB 1VL5A 1MSDA 1TX4B 2J08A 2J3JA 4OXIA 3R40A 1Z2AA 4U7WA 3C6KA 4HN2A 2V6IA 1LDBA 4NENA 1IN7A 3I1FA 3VR4H 1CIVA 2ANCA 1B0PA 3HH8A 4OP3A 1QGOA 3EN0A 4RQTA 4RW0A 1K8ZB 3RS8A 4RAIA 2XWJI 3U1VA 5A4AA 1XZGA 1ZCFA 3RUFA 3GUHA 1W93A 5I9SA 2CVFA 3BPSA 1M74A 4D9IA 2J33A 3DZGA 3V4RA 3WLMA 4PN3A 1CY2A 3C41J 4G0ZA 1K7SN 2GCEA 2WTEA 1QIGA 3RFUA 1Z4QA 1MX3A 3CRQA 3THWB 2FQQA 1VPEA 1A7KA 1GDTA 1Y3HA 3GLFB 2AKAB 2KPOA 1Y8QB 3H1PA 3HMKA 1KBOA 1NQOA 1DBSA 3FE2A 3ET4A 2WMYA 1LR1A 4E15A 1T1RA 1DEOA 3D6JA 2EP5A 1D07A 3IHTA 4ZO4A 3E3LA 3GWOA 3PDIB 1HZZC 3C2QA 1WP9A 1XTRA 1OKKD 3UTCA 2CHVA 1UFIA 1IDOA 2OD2A 2V7QD 3U26A 2BJVA 4YAJA 1YZKA 2V7VA 1W8DA 1DF4A 4M7PA 2AZ2A 1VIBA 4L9WA 1L4HA 1Z0DA 2CZGA 2Q6AA 1EVYA 1UBOS 2JIZG 3VQTA 4ZJUA 1N6NA 3ANYB 2AL7A 3RQSA 3NC1C 3PC2A 2RSLA 4JJIA 4R1NA 4FPPA 1N32O 4WCFC 3RPEA 2I1WA 2YIBD 3F5TA 1TMYA 4C6TB 2CTRA 2YX1A 3BREA 1RM0A 1J4AA 4BNDB 3GPLA 2FMKA 3WMRA 2GMWA 5LA6B 2W48A 5JCOC 1YHQV 3PHHA 3DQQA 4X3CA 5AM5A 4UUBA 1JFFA 4K6FA 4X90A 3RSQA 1E60A 4UZFA 3FR7A 4B76A 1Z16A 3Q41A 3TSZA 4M6WA 4YQZA 5H5JA 1SKYE 3A2KA 2NZWA 1II9A 3AT1A 4MVRA 1G3QA 4NS4A 2ECPA 2EBUA 1CERA 3A2NA 3ROQA 2J6BA 2B4QA 2YV3A 3I32A 4MS1B 1XRLA 5DO9A 3IC7A 1IHUA 3DE4X 4Q1VA 1CD5A 2C0PA 1E3WB 1FQKA 1LCIA 1RQLA 2RJ3A 3LQ2A 3PQDA 4H6XA 1BDMA 3SPIA 5MGBA 5TIIA 3CB2A 2H31A 3ZDQA 2I7DA 3D0RA 2GPSA 3TTYA 5LBUA 3GLHB 2QZZA 2GPWA 1VIVA 1XQ9A 1OT3A 4K40A 1YC5A 3OEED 1V37A 4R2JA 3CXUA 3FXAA 2NZVG 2DKNA 2JJ2D 3U0VA 4E1BA 1WCV1 1X74A 3K3PA 4BFCA 4TS1A 3KLOA 3WISA 3NVDA 1BKSB 5JNLA 5ICMA 2RI0A 2HEGA 2BF7A 1Y3DE 2OGWA 1NMEA 2D2IA 2Z2ZA 2YY5A 1VLJA 1EWKA 5D7BA 4XWGA 1B73A 3DF9A 4GQBA 1D1TA 2XUZA 4M36A 3A2MA 4B0OA 1FFDA 1J23A 3FVTA 1N9GB 2PUFA 1B2LA 3ZJTA 3G89A 3A1WA 2CF6A 4OU5A 1GKFA 1PM9A 3NBKA 2O5RA 3S3WA 1WCWA 3KPYA 3L05A 4A15A 2VYVD 4YONB 3U4QB 2BF4A 3WB0A 4U7NA 4HP8A 4BWVA 3PRHA 3NM5A 1UPCA 5FPRA 3MRSA 3HXLA 3H18A 1F7VA 3HDQA 1AKMA 3C74A 5GONF 3C70A 1UMBA 1S9DA 1HLGA 4XRRA 1ARZA 1PR1A 1FP2A 3RGBA 5CLHA 3PQCA 4WN9A 4EEKA 2Y9MB 4XYBA 3BCCH 5C5DA 4DJFC 3VU8A 4BY9E 4KFCA 1RAEA 5B1DA 1P9OA 3IVRA 3H9VA 3UYKA 1ZH0A 1ZNZA 5DN6D 4NK5A 1EFAA 4L5CA 3KR0A 2RQ6A 2FCRA 4R8LA 3VKVA 1AKEA 2D1SA 5AR1A 4OK6A 3BE5A 4OFWA 1R8YA 2BHSA 4YT8A 2KB0A 2GRJA 3O93A 4WEQA 1E79A 2XOKG 2UXXA 3TIGA 5CDYA 1IJKA 1DQYA 4IDDA 4M0FA 5TX7A 3P9ZA 2QVZX 4DLNA 3DR3A 2QTOA 4RZSA 3LKVA 3FI0A 1TVKA 2C57A 3ZBPA 1HNXB 3RIMA 2AJ8A 1T5TA 1YTFD 3EWNA 4PYIA 2WM2A 4O4JF 3DULA 3U60B 4AN0A 3ANTA 3J7AC 5EGSA 4LUCA 4N3GA 3ODGA 3G7UA 4PTZA 2HEIA 2PV0A 4KAJA 2UXBO 2RGGA 2L2QA 3T5BA 1TA9A 1Q6YA 1K68A 4O0LA 3HP1A 4OEHA 4L76A 5HMLA 1RT9A 1EAYA 5HYVA 4ZZ0A 3LL4A 2EW1A 5CFZA 3R0XA 2VP2A 5JSFA 5IYCO 2B98A 4CIVA 2ZWVA 3IHLA 4RL4A 3K4HA 1WOYA 1RFLA 4WFFA 1ZJWA 4YV1A 3NHRA 3LPNA 5KYTA 3C8HA 2WVAA 1T91A 2X6BA 4BGDA 3JAMN 1DUIA 5KOHB 3AB3A 5KSPA 3MM4A 1MC8A 1DCKA 2ZDHA 1KTVA 4ZO7A 4RSGA 3U7RA 3AO0B 3FN4A 3GLVA 2ZBDA 3FUCA 4JUIA 5ISMA 2PGNA 4UBMA 1E3QA 1KVUA 3ZNPA 2IEGA 1UT8A 4RMJA 2IEYA 2O48X 3CX8A 1GCGA 3C3DA 1ISFA 1KZ4A 4JB8A 4KP7A 5BUSA 1F2VA 1N5IA 1A9XA 1RI1A 1F7UA 1H22A 2QZ4A 5J2UF 2PE5A 4WFBV 4JDPA 3TW0A 3T99A 2BUBA 1VL8A 2CLSA 4OGWA 1IBLO 3G5MA 2A1UA 4UCWA 2ZRJA 3B1XA 1VJ5A 2LW1A 5BSEA 4ZO8A 2XWPA 4NZYA 2QE7D 5JJKA 1V5GA 1NXSA 1E1RD 1VP3A 2GK6A 1BEZA 3FKSD 3WIVA 3PLNA 3O7MA 2FWNA 4MO9A 5JALA 4BMPB 1ZNQO 1NV9A 3D3WB 2X2OA 5J23A 5JECA 4Q3KA 3FMFA 5SY9A 5J2TB 1GN2A 1FXHA 4PPYA 2K7ZA 4Y98A 1FX0B 1NLUA 4MV9A 1YCFA 1RIIA 1XDUA 4NB5A 1E3TA 4RYLA 4Y2JA 3VNUA 4RF2A 3PL5A 2FAXA 2IH1C 5AHOA 4TYMA 4OHOA 3JQGB 2ZGVA 3H0KA 4EG7A 3IKJA 1IB6A 3UW1A 5AXCA 2HK6A 3KEQA 1AA6A 1FJHA 3MJSA 3T38A 3A4TA 3B60A 4DR5B 2IZ6A 1EM8B 3PF9A 3R76A 1QPBA 3NHKA 4URUR 3NBFA 1XZCA 3EJWA 4L95C 3IGAC 4BNIA 2HMAA 1T9GS 4JLBA 2Q3BA 3LQYA 4QU8A 1D5NA 5AI4A 2IYXA 3KXPA 2OK7A 4D3FA 3MTBA 3IAAA 1EFPB 1RJWA 2YXHA 1QAMA 1M1UA 2RHTA 5IKEA 3VRHA 2G07A 4ZKIA 4B40A 2GZRA 4BNWA 2JHGA 3D3EA 2SICE 4RKFA 2ID4A 3OM0A 1XZ8A 1MMMA 3ETNA 1PJTA 2DHEA 2CJPA 9ATCA 2ONYA 4K0KB 4JLDA 2CNWD 3CPSA 4QELA 2O8CA 2GEFA 4BRZA 2EBWA 3WY9A 1SOMA 3KSAC 1J8MF 2NUBA 4R7GA 3AR6A 2QQEA 2DY1A 1Z6GA 4ZHQF 1D7OA 4A2CA 4O2AB 1O95C 4X7PA 1KORA 5LYJA 1Y1RA 5JMOA 1Z7BA 5JDIA 1Y5LA 2OQ2A 2WD7B 1LS1A 5D84A 3OGIB 5F9MA 5D6OA 3I2FA 2CUTA 4E32A 3IUMA 1DDOA 3OX3A 2RBEA 4F8JA 3HVIA 1LK5A 4C7MA 1O7JA 1XWWA 4PBRA 4LGCA 3ZGOA 1W1WA 2UYOA 1ZD1A 1PF7E 4XXHA 4BIZA 3VU0A 1VPLA 4AXBA 2NQ8A 1HNWO 1CDZA 4C7OA 5BRNA 3ZDBA 1I32A 5KHOC 1JHUA 1JR3A 3F3KA 3H2BA 3NB0A 1AKTA 3A26A 3WRVA 1DG3A 3TAHA 4YCSA 3F71A 2OCDA 4L15A 2CGEA 1Z5PA 1DIOB 2LP4Y 5ICEA 5KNCH 2BT4A 3IAHA 4FNGA 4POOA 4ZT3A 3DQZA 4F8YA 5T5QA