3E35A

Actinobacteria-specific protein of unknown function, sco1997
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
269
Chain Sequence
DPQDLYTWEPKGLAVVDMALAQESAGLVMLYHFDGYIDAGETGDQIVDQVLDSLPHQVVARFDHDRLVDYRARRPLLTFKRDTWSDYEEPTIEVRLVQDATGAPFLFLSGPEPDVEWERFAAAVGQIVERLGVRLSVSFHGIPMGVPHTRPVGITPHGSRTDLVPFEEAQVPGSAEALVEYRLAQAGHDVLGVAAHVPHYVARSAYPDAALTVLEAITAATGLVLPGIAHSLRTDAHRTQTEIDRQIQEGDEELIALVQGLEHQYDAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SCO1997
publication title Structural and phylogenetic analysis of a conserved actinobacteria-specific protein (ASP1; SCO1997) from Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Unknown function
total genus 85
structure length 269
sequence length 274
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e35A02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e35A01
5GW7A 1NH2B 2HR3A 1YTFB 3D3IA 3W7TA 1RM1C 2WAMA 3WZ2A 3W7WA 3W7SA 3IC7A 4G4SP 4HAMA 3MNFA 3W7XA 3E35A 1S3JA 3GAAA 3BY6A 3W7UA 3VR0A 5CA3A 2P90A 1NVPB
chains in the Genus database with same CATH superfamily
1SQGA 4ZOLB 1A7KA 2EFYA 4ZODA 4G5OA 4ZKEA 1AUQA 3NHYA 1QLHA 1KI6A 5CW2A 4C03A 1NMYA 2VHYA 1VJ1A 2EVWX 2M6RA 3KUKA 1UJMA 1JTEA 2P67A 1N2CA 2XNDA 2H9YA 4L28A 4YP0A 3QLUC 4N3AA 1ZVKA 3EXIA 2Y67A 3DBIA 4EKWA 3VQXA 4B5KA 1ECCA 1YIJV 3WWDA 3FOAA 3HB7A 3FPBA 3ESDA 1P0FA 2GNPA 4RENA 1XD2B 1TYAE 1NBHA 3CLHA 3U3MA 1V39A 5FH9A 3LDDA 4BO3A 3FYUB 1KEZA 1UQUA 1ZGCA 2OVBA 2WD7B 3OLVA 2RCVA 1AHNA 3CJHB 1RPRA 3E9MA 5KYUB 1NT2A 4WIAA 3HP4A 4TQGA 4M7PA 2XCQA 4HXYA 1KEEB 2IHUA 3FPFA 1KI1A 3ZQUA 4UCFA 2DR3A 1UFOA 4A36A 2XYRA 1JOYA 2GB4A 2OV1A 1SIWA 5JJLA 2WLHA 3WOHA 2VJMB 3DTYA 1MB2A 4BQSA 4O2AA 1ZSNA 3QA9A 2YWXA 2BI4A 2EF1A 3MJEA 3UAOA 1BGXT 5AKIA 3MT8A 1BVYF 4KVZA 3UJCA 2OL4A 1DF4A 1Z4QA 3IEMA 1OZGA 4F2GA 2G7ZA 3R3WA 4KXUA 1R9MA 3M1YA 2QMQA 1G19A 1XRRA 3IVCA 1XREA 3QVGA 4FPPA 1LPPA 1GPYA 5FEUA 1M6NA 2V1UA 2JVDA 4DMRA 1L7EA 2GLXA 2SKDA 3L4SO 2GD6A 4L5CA 5LQJA 1TZBA 1HA3A 4HSGA 4W4LA 4DWJA 4DG9A 2J30A 2ACKA 1E9CA 3OZUA 1BXKA 4YPOA 2HRQA 4ZWNA 1W29A 1PR3A 2R6JA 4G1FA 1E3WA 1KUQA 2C1EA 5IZCC 4C7KA 5BR7A 1C1DB 3ETGA 3TR5A 3ZTTA 2WU8A 2NZXA 3O9ZA 4MPPA 2CXHA 1D6MA 1NVDA 1RQRA 1US8B 2G63A 2WM3A 2HFJA 2RJZA 3LQFA 4MR7A 1KK2A 3I72A 1T43A 2FWRA 3J81k 1CNMA 1VB5A 2UYOA 4C05A 2YCLA 1SH7A 1V5GA 2O7QA 4L76A 3T1HO 3PWSA 4AJOA 3BHJA 1ONBA 4HRAA 2D8MA 1EU1A 5FBKA 2ZDIA 4GI2A 5L3EA 4LHSA 2FWNA 4D4JA 3DOCA 3RUIA 4D46A 4X64O 1JS1X 2QSZA 4D9HA 5HZGA 3PXGA 1W8IA 2BFEA 2YS7A 3GK3A 1V3QE 1VIBA 2GJ9A 2ZIFA 3MK31 2JCGA 4Z4QA 3TINA 3WBBA 3NP9A 3MWDB 1PJSA 1Z2NX 4EHHA 4LV6A 1CXZA 1KSFX 2Y1GA 1GN3A 1NN5A 2YHAA 5KX5F 2JDIA 5A0VA 2CLCX 1HNZO 2QBYA 2H9AA 3EEOA 5IKEA 1DGQA 3P19A 1THGA 4ISBA 1H4TA 5IS2A 3SYRA 4LF6O 4M89A 4EBFA 3NXSA 3CCSV 4H6WA 3HH8A 1TCAA 1E1NA 4YUYA 1MIHA 5IAJA 2AK3A 1U0SY 3GJTA 1ZL8B 3PICA 3EDYA 4WERA 3GHHA 5EA2A 3T4EA 3AFOA 3DMTC 3IDFA 5BURA 2R4TA 1ZM2A 1DWPA 3L9WA 4QRIA 4W1QA 2PD6A 4TQDA 1E4EA 1DX9A 4UXJA 1F4VA 2DYKA 3UXMA 1P4JA 4TTRA 2BGNA 1WY5A 4CG1A 2PGNA 4JR0A 1X70A 1FMFA 4UBMA 3SPXA 2NXWA 3NBKA 1Y76B 1DAGA 1G3MA 2C20A 3L2OB 3QRWA 4FYPA 3GEMA 3TTXA 5EGSA 1XNQO 1SUWA 1SXGA 5CLJA 2ZTVA 3RIHA 2QRQA 4Y2PA 2M1ZA 2DW4A 2AFRA 4K6HA 1CVIA 4OVKA 7REQA 5JD5A 3G0BA 3GPIA 1POWA 2PZFA 4RZHA 1CR1A 4KU4A 4HEA6 1CBUA 3A14A 5CBGA 4EECA 1SIBE 4L08A 1Q21A 4FS8A 1XOUA 1D07A 2A06H 3RAJA 5DB4A 5L45A 5C34B 4OB7A 3PUWA 4MOWA 1WB5A 2OCCB 2QUAA 1W4ZA 3UZUA 1X0VA 4N40A 1NYLA 2CAZC 1T3ZA 5MF6A 4GI3A 3V7WA 4J1TC 4TS9A 4DAEA 2CF6A 1SQVH 3M2PA 2ORYA 2DUNA 2FR8C 3VZBA 1SXJD 3W7AA 1KKLA 1AA9A 3W79A 2HP8A 3HM9A 4HFJA 4ND7A 3CX4A 3PQCA 3O1HB 1DC5A 3C6KA 4TSFG 4YIKA 4OP2A 1P3Y1 2X1VA 1Y9JA 1T9KA 3VKUA 1EZZA 1OREA 1BXZA 1KU6A 3IHWA 3MBIA 5FI3A 3QTTA 3JWEA 3IAS6 1EFTA 1EZ1A 4LBEC 4BFLA 1KY2A 2H17A 3M1IA 3HMQA 1AVMA 1O1YA 1M75A 5FL7D 4FR0A 4X6XA 3UW3A 4L15A 1KEUA 4AZ0A 3W06A 3BE5A 3LRPA 3HDQA 3OFNG 3ZJTA 2SECE 3TH5A 3KZ1E 1JU4A 3TFQA 2V7WA 1SCKA 1RKBA 4LA4A 1Z6GA 3AO0B 4JVNA 3RAFC 1DV2A 1KZ9A 4DXHA 3Q88A 1U3UA 4FM9A 4BKPA 4CH3A 1EFRG 2J7KA 2ZJ1A 4E4TA 1Q57A 4YJ2A 1APBA 2D1TA 2H1OA 2D5AA 4P9PA 1YFZA 3R0ZA 2H00A 2RARA 1ZNQO 1P9RA 4L9AA 2CBGA 1M2KA 3CX5F 1I94B 1JR6A 1IHUA 2ADMA 2NPIA 1MJHA 4EO7A 3KWJA 1OPXA 4ZEWA 3OJEA 4AYXA 1XSEA 1UK9A 3NYQA 1ZCZA 5BUSA 1PWHA 4D6PA 1BE6A 4FFBB 3GIDA 5KQPA 1VF5B 4YRPA 1RXEA 4IQ8A 3IAEA 3BGSA 3LUKA 3UAVA 3ZWMA 3O3CA 1IY9A 2SCUB 1CUBA 1QTQA 3HUDA 3EFBA 1S2IA 5I7WA 2NMVA 4IHJA 1NPTO 2QXYA 3GMIA 1OT3A 5DMXA 3EZXA 4LRYA 5JFGA 1DBQA 4B4WA 4B34A 4MV0A 5F4ZA 4BE9A 4ECAA 2I7DA 1CDZA 2P9YA 3NHPA 3URMA 1L9KA 4JEIA 1X2BA 8GPBA 3UH0A 1ZCBA 4YVFA 2IJIA 4ND5A 2FG7C 3C3JA 2IYZA 4RHCA 2RIRA 1VSVA 3D31A 3WNBA 1LWOA 1E2UA 4PXAA 1RLUA 4M99A 4UUAA 4KXXA 1MABA 3THXA 1E9AA 1A9SA 1CJVC 1MA3A 4ETNA 2GAAA 3IQZA 1E8MA 2UZ1A 1RRCA 3BA6A 3H3XA 4Y7DA 4FM0A 3R5TA 1C4WA 3QELA 5LZ9A 4AYWA 3HACA 4JI0B 4YA6A 3QYPA 4UUBA 4QVGA 3MUOA 3HABA 4EGFA 1QG0A 5JI3E 4N12A 3HL4A 4IDOA 3UHAA 4B6PA 1O4VA 4ZPJA 5D8DA 2FW7A 5HSGA 2R7KA 2GZDA 1EFHA 1JPJA 2H2HA 2VAXA 2A3QA 1K5GA 1K5DA 2IPMA 1H2KA 3MJFA 4MV1A 4RBNA 2DRIA 5JCOC 1A4XA 1W5TA 4U00A 2DUJA 3UK6A 3P32A 2ZI9A 4ZN6A 4FSXA 4M9RA 1VGRA 2IH4A 4AJHA 3Q9SA 3RSSA 4NCHA 3T2MA 4CIWA 3PQ4A 3OEHG 1ZHFA 4P3YA 1NJGA 1VPWA 2BI8A 5LFAA 1WLEA 1B6SA 5EWLB 2RAPA 2ORVA 2W2XA 1FB5A 3ND5A 1Q19A 3BAZA 4C22A 3C85A 3OEYA 4C08A 1G38A 2VUHB 1XCJA 3WGZA 2NAFA 4MUKA 4LOLA 1PQUA 2QB5A 4GKVA 4RPHA 2TMYA 4M60A 3UJ8A 3G2NA 4NG4A 1UJNA 2WVHA 1IHOA 1SFRA 2DECA 3HVIA 4DUYB 1FSGA 4KRYA 1NMEA 1JP7A 2X4GA 4YREA 5KX5B 1E7WA 2XHBA 4JI7B 5GWXA 1WHSA 1NR1A 1L8DA 1RPAA 3ICEA 1ABFA 4XR4A 4FQ8A 3IA2A 3R8XA 5A0FA 3CV3A 5J63A 5TF4A 1P2DA 1JG3A 2N04A 1MENA 2XUKA 1CEYA 3UAYA 4BU1A 1OGIA 2IYLD 2OHIA 4AS1A 2FW1A 5DKFA 4OK5A 4P34A 1G3UA 4EKIA 1VLZA 3H0CA 1Z17A 3ZRWB 3WJ1A 1IVNA 2QRVB 2B1GA 1CY6A 1TJNA 3STHA 4AJ9A 1TW3A 1R4NB 1UBNA 4W5QA 1DKLA 1RM1B 3LCMA 3QXHA 3BZWA 2QMHA 4FVTA 5TGTA 2UDPA 4FUTA 3LS2A 1YVPA 5CEEA 3PNPA 4BYGA 2ZXWB 4A5SA 1LSOA 4H4DA 4UFZA 1GITA 3BMOA 3M9XA 2A84A 3JPYA 4JC8A 2K7ZA 3LK6A 3CVJA 3VHQA 4XUEA 3AFMA 4HPXB 3BJRA 3P2EA 1WQ4A 1ENOA 5CBHA 3DZBA 2ZYWX 2CT8A 1RLTA 1EXDA 3HUUA 4UTNA 3AG1C 1BRTA 1PZNA 1NVFA 2X42A 1PV0A 3IJ4A 4HNQA 2Q3CA 3PUHA 4UQOA 3K96A 3TAUA 4GS5A 3WICA 3A2MA 4V03A 4Z0HO 1SXIA 2EGUA 3K2BA 4PSUA 3H2YA 1YFLA 1U2RA 3VPHA 5H9WA 3C8ZA 2PH5A 4IKPA 1RWWA 1II8B 1P5RA 2BGKA 4Q9KA 3AKEA 4YACA 3LY8A 1E7MA 3W3ZB 1Z8DA 3HBAA 1KWKA 4K88A 2IJJA 4LRXA 2HQBA 3NRCA 4W8HA 2MSKA 3BCRA 4J16C 1QIEA 2PBFA 2H4YA 3OOJA 3G9XA 2IXBA 1R5NA 1VLMA 1XIVA 3UAWA 3EVAA 1BQZA 3D3WB 1KOGA 3GFOA 3X44A 4Y9SA 3KB1A 5AIBA 3GZJA 2ZJ0A 4QEKA 3D4PA 2Q1XA 1J70A 1QVFU 3ONEA 3DLPX 1YZUA 5KHIA 1E1CB 4TTTS 1A4IA 4RESA 4GNKA 1WHTA 3ZHXA 1O2DA 4HI0E 1KEVA 1XYYA 1UC9A 2OILA 1P4RA 1YDFA 4UUJC 2ES4A 3FSEA 4RVUA 3QX9A 4LTNA 3DVRX 4GXQA 3NALA 4XDHA 5F2EA 2JJQA 4X8HA 2YBDA 1QB7A 1GTZA 3G68A 3F74A 2K5UA 1PUJA 4XQ0A 3M4NA 1OB2A 3MTGA 4XB1A 3DHWC 2NO9A 3RSLA 5FO0A 1U1GA 3GLKA 3ZXXA 3TSAA 3BMCA 1IZYA 4NJEB 3ROGA 3I92A 1P5JA 3UM9A 4JUDX 3N2GA 4YONB 1KU0A 4CVNA 1N5DA 2WAAA 2CC2A 4G97A 3K3WA 1AHPA 1JG6A 4MYHA 1ID1A 3AP3A 3TBKA 4Q9AA 2QORA 3T1YO 4C2UA 4FR2A 4LZZA 4JVSB 5IYDO 1CW2B 2VZ9A 2J3JA 2CNOA 2QU8A 5AK6A 3LSUA 4EYSA 2JIOA 2XGSA 3TVYA 3HKDB 1XD2A 1DKOA 2H4JA 4ZTZB 4WY2A 3W8NA 2VTBB 3BD8A 4KWHA 2PZ8A 2Y4TA 5IT9N 1J9GA 2NSYA 3USES 3CE9A 1P3DA 4US0R 5DTMA 2PTHA 2HLDA 3ZE1B 1KDZA 1BS9A 5KYUA 2FA9A 3Q7PA 5FLKA 4ON9A 1T5LA 2NVUA 3UQZA 1WV0A 3PD0A 3FDFA 3I6BA 5JV5A 2BM9A 1Y7TA 4RGYA 1R8SA 3ZR4B 3E81A 3AEZA 4OJTA 1YB5A 3OQIA 3G0HA 3Q7IA 4FHZA 2XF8A 1E2DA 3OQNA 1A9QA 3E15A 3RK0A 4MUJA 2JZCA 4P2GA 2WSSA 1TTPB 4LY9A 4UHEA 2VDLB 4KB5A 2I71A 3LQKA 1UPXA 1P72A 4NZOA 2DT5A 1CC1S 3BWVA 2WB2A 1QKKA 4YRCA 4CM1A 4PQFA 3CH6A 1M66A 4MWEA 3WQRA 4LC9A 1UKBA 1TKBA 2QT0A 1RXWA 3GPBA 4JA0A 3ZJYA 1YDMA 1LXCA 4Q00A 4CQMD 2PS0A 1U0JA 3O65A 4L57A 4V38A 4Z3OA 1D6JA 3DM5A 1TEVA 4JN6B 1VE3A 2BEWB 3TD2A 2MYPA 1A5AB 1NBIA 4JVMA 4O0LA 4NL4H 1HDGO 1N3IA 1TF5A 4FE3A 3ZXSA 3JVIA 2MW2B 2C8JA 3DOIA 4EGSA 3RRZA 2G77B 1RPTA 1NC1A 2WF9A 3GCGA 3SC2A 1P45A 4NPAA 2BF4A 3C6YA 1C3LA 1VPDA 3GYBA 3D5TA 4BECA 3G5TA 3A2KA 4EB6B 5TEVA 1KYZA 3REFA 2HK9A 2DCUA 4P38A 2M6SA 4QA9A 4BV2A 5C5DA 4BNVA 5CXXA 5ETJA 1KPGA 4B84A 2QTGA 5DBGA 4FGWA 6NULA 3EWAA 4O08A 1O0SA 2WMYA 1GSIA 3CZ4A 1RQLA 2QYSA 1CUEA 5KTNA 3DVQX 2ZWAA 4Z51A 1MX5A 3QSYA 4DN6A 2HJRA 5J2TA 3D4LA 2VYND 4OQZA 2PRSA 3FOCA 4EJSC 3EXAA 4L0CA 4P08A 3MJSA 2ZJ8A 4WSOA 2HJFC 2Q7DA 1ZIOA 5EE0A 1ISIA 1KERA 2BLLA 4IDBA 2LCIA 4YCAA 4H59A 3GVPA 5YASA 3FHTA 2NU8B 1IOLA 2YMQA 4KBYA 2WJYA 3CE6A 1C5KA 3AR4A 1ADGA 3ES9A 3FKSD 3EOAI 1IATA 2FKAA 2FPLA 1IBRA 2HO4A 2PPLA 1HNWO 3NT2A 4UXHA 2W2QA 1ZUHA 2VTDA 1U4NA 1Q6UA 5DECA 1KI6B 1ZITA 2Y93A 1L5LA 3QUCA 1RP3B 1Q50A 1X1TA 4K6GA 2GZ3A 5J4KA 4YJ2F 3OAAA 1N2CB 3U0BA 1ENYA 3L7BA 2CKDA 1ZAKA 2BFFA 2W6QA 1UH5A 3G2PA 2NO5A 3ZWWA 3EXIB 3QI2A 4DLLA 4K8XA 3TFWA 4PA6A 2ZS8A 5BR8O 4DRZA 2HKIA 2I2DA 5LNK6 3EAQA 3PSAA 4BCCA 3MPUA 1VCHA 3I42A 1T0PA 1KO1A 3MD0A 4QNRA 5C1BA 5EESA 4Z9AA 2BGWA 4Y1FA 1Z38A 3KKYA 4EENA 1TCVA 2JFYA 2ZSHA 4Y2UA 5DIFA 4DC9A 4C0HA 4IHJF 5CCXA 3PIIA 4XDJA 2Y92A 2VSNA 4FB5A 1IQ0A 2IXFA 5HOQA 1NC3A 2FKNA 1NT2B 2B3DA 4R1MA 1P8JA 2WU4A 3TRIA 3KWMA 3WV4A 1Y6JA 4ZVKA 4LS3A 3M5PA 5DM60 3KOYA 1BH2A 3H2ZA 1DK1A 4XLZA 3J81A 5JDIC 2Q2WA 3PGXA 4S1PA 3RYTC 4ZVPA 3K31A 3APQA 3PYXA 4X71A 3CUKA 4FI3C 3V3KA 3GLRA 5BWOA 1ZN8A 3D8TA 3TYXA 3PPWA 4E5MA 4MMZB 3H83A 1WW2A 4QJBA 4MUGA 3QVGB 3CRCA 2WB4A 3ZCXA 2UXBO 2ZIWB 3NHMA 4UBNA 1M1ZA 4I4TF 2GF9A 1OIWA 4NDNE 3GLTA 2FTKA 3UPUA 1KDOA 3REOA 1U31A 2AMYA 1WSDA 4IGFA 4PNHA 1C9KA 4EG1A 4FFVA 4ESOA 3Q7TA 2BISA 3WB1A 1E32A 1SBTA 3A70A 1GK9A 1HKUA 4JCOA 1BQ4A 5F5LA 3AZOA 3MUNA 2RFLA 3GFGA 1E3WB 3KOZA 3IP9A 1X1QA 1R2QA 4L4UA 1O9BA 1X0XA 2WJ3A 2AR9A 3ILSA 2G8NA 1BVHA 4AL4A 4MR7B 2QR4A 2H8GA 2XX3A 4GKAA 5AJXA 1V47A 3D8HA 1MJ5A 3PHHA 3AHFA 2EFGA 3R9WA 1AMOA 4ND8B 3F7OA 2OWEA 3U13A 3AB3A 4M46A 1E5QA 1ZH8A 1Z5UA 4TL8A 3HMKA 2YHBA 5CMUA 1IG0A 3DEJA 4DLKA 1WNFA 4WLUA 5ULLA 4MPDA 3RS7A 3HN7A 3NHKA 4OHRA 3PUKA 1CRLA 1NAHA 2BFNA 4B7UA 1OJHA 3ZU6A 2EJVA 3W0LB 3I73A 1XVVA 1DO2A 4HNRA 3A4YA 2P0EA 4OHMA 1YD7A 4F2DA 4OREX 4A6PA 3I76A 3QU9A 2WJJA 3ABQB 1CXZB 1L6IA 3UUFA 5JRJA 2Z57A 2QBYB 4DR6O 4JASA 3ZCUA 2DTEA 1MNQA 2YIBA 2GHTA 4DLAA 3R3XA 1NFFA 2J9ZB 2Y27A 2YQ4A 3W9UA 1EI9A 1YR7A 3B9QA 3RTDA 3AHCA 4YMIA 3ONWA 5LGTA 1R0WA 1H6DA 1UPBA 2OLKA 1NTZH 5KLVH 3M4JA 2SICE 3F78A 1E4EB 4IRMA 5CDSA 4DBLE 3VH1A 1RPNA 5EC1C 3WNCA 4Y2XA 3L1JA 4NZPA 1NY5A 3EMDA 1NSYA 4ASUA 3EQZA 4KK3A 3BY6A 1JIXA 4C88A 3KQWA 1CEZA 3QQ5A 3CW9A 5AVXA 4LSGA 3RYCA 5H9VA 4QUIA 1XDCA 1J5EO 1X8KA 7REQB 3HY4A 1Y4AE 4GKKB 4FBMA 4G9GA 2G17A 3JQFC 4D1YA 3CVOA 2JFZA 3NASA 4XIFA 4G1UC 3W6NA 4M8IA 1E2MA 4KWTA 2RGXA 4WLVA 4M7OA 9ATCA 1EKXA 2XB4A 2XUDA 2YC4C 1SQFA 3N3BC 3TI7A 2OSBA 5FYQA 3PJFA 5BY1A 1L9XA 3KQVA 1HT0A 2BHNA 1Z7WA 4XDZA 5KVSA 4YDHB 2XAHA 3CCLV 2I87A 1UOEA 1RCFA 5EWLA 2V7QD 3MCZA 2KMLA 4YJFA 3S3WA 2UVPA 3RANA 3RVKA 2CK3A 2R7NA 4IOMA 4Q24A 4JI5B 4PFKA 3BGDA 1PFWA 2WJWA 2XTJA 2ZP1A 4FLEA 4PBSA 3WFZA 1U7PA 4OATA 4ARCA 1SPXA 5FPTA 3GFFA 4R0VA 1SURA 2EBWA 3EGEA 3GJ4A 4TRJA 3N7UA 1XZAA 4RGVA 4WXYB 1OV9A 2ZB2A 2FSGA 1YA6A 4HYEA 1Z33A 4UOEA 2YI8A 2GPJA 2FQXA 4X61A 4ALIA 9LDBA 2AK2A 2ODMA 2CHQA 1CK4A 3CF4A 3ZBUA 3VR6H 1NRIA 4L2IA 1JEEA 1TFRA 4HZ3A 4I4CA 1K8RA 1Z56C 4C7JA 1T1EA 4RWUA 1P39A 2OO3A 3VO1A 1VKJA 3GD5A 2G38A 3SOPA 4EF5A 2BHTA 5ICFA 1Q3KA 4JIMA 5CW1A 2R72A 5T6BA 4RDIA 4YJ2B 5WRFA 3SXJA 5L4LA 2WTEA 4EM6A 1FP6A 4OXRA 1TYEB 3UKOA 5GTDA 2C98A 3O21A 2A9FA 1OLUB 4S12A 4OL0A 1U9CA 4V02A 2GAOA 3OQBA 2CFTA 1V37A 4BKRA 4C87A 1FE8A 5ILOA 3ZWBA 3IVGA 4OLFA 3DDZX 1V55B 3FAVA 5IJWA 1LQUA 3U1VA 5H3LA 5ESDA 1XQ8A 5FJJA 2I4MA 5IPFA 5GADl 4QPCA 1CLEA 2H7CA 2B6NA 4IGKA 5IKXA 3CVXA 4IHJB 4KHZA 1K6EA 4EIWA 1V6AA 4YHBA 2Y0IA 4QQFA 1R3IC 3SFTA 4WT7A 1W1WA 2H4WA 2Z2IA 1NTMH 3F7MA 4Y9DA 2E37A 2JFPA 5A9SB 4PG6A 3ULKA 2HEGA 4FZ0A 4MVJG 4PIPA 4FHGA 3PLNA 4MCHA 2WYOA 4IUDS 1UWLA 3OUFA 3ZCRA 4LFBB 4NV0A 3T7RA 1YQGA 1BMQA 2FEAA 3EUAA 1ULBA 2KE5A 1PGJA 3E61A 2GBPA 1II8A 3E7FA 3LP8A 4YRSA 1ROPA 1MABB 3KYCA 4XYMA 1ZJ4A 3SIPA 4P9NA 5IKMA 1Z9BA 3HBJA 2UZ1B 3R9KA 2QTLA 2QQ5A 1W88B 4UVCA 2FSHA 2IZ1A 4JT8A 2RG7A 4BWVA 1FL9A 3L82B 4I4TB 1NWHA 3LT1A 2HT6A 3GDFA 5E7MA 3PHGA 5CFOA 3BH6A 3KT8A 3D3WA 5E0KB 3R7FA 4KL8S 1V41E 1YNSA 1BMFG 3ORSA 1YZ3A 5HE9A 4QBTA 4MKIA 2BTOA 3D54D 2Z2XA 1WXHA 3H16A 3QOXA 4PZDA 3GAMA 1VJCA 2BMFA 2J09A 4GO1A 2ZCVA 2F8MA 2OZVA 3IMEA 2VAVA 3R41A 3GLIA 1GCOA 3OIGA 3KE9A 3EQ7A 4IT5A 3FJYA 4OK3A 3BTVA 4UUMA 3ZHSA 1OCRB 2XOKA 5ECDA 4MUFA 1D0SA 5H4GA 1RLMA 3INYA 4WESA 3IGAC 2DWEC 5IANA 4DCTA 1L4HA 1HNNA 3WRYC 2VAPA 2AOXA 1W6RA 4Z9BA 2QKCA 2FOLA 1KY3A 3DXZA 2EWVA 4Y2QA 3NYRA 4EPWA 1Z36A 1W30A 4L95C 3CT6A 5IH7A 1KMNA 3P3PA 4J42A 3WIVA 2D5LA 5I7FA 4N4AA 1A9XA 3C3BA 1SG9A 1UFVA 4DMKA 4CM5A 2CXSA 1T24A 3JVDA 4G86A 3JYHA 3K5WA 1O5IA 1E79D 1WHSB 4W4TA 4PPGA 3GEEA 1B6QA 2WTNA 5J2TF 1E18A 5EHNA 3HLTA 1CY7A 1HH4A 3D3EA 1MQAA 1H65A 5JY1A 4H6XA 2WR8A 3VR1A 1NMQA 2G28A 3FN4A 4WFFA 1FRQA 4ZIRA 4W7HA 1KZ4A 4LJYA 3ME5A 5AO9A 1HDJA 3T54A 4MDFA 4BX3A 2MMCA 2FPPA 2VHQA 4ZO9A 1YRLA 1XHFA 3L7CA 4ENTA 3CCFA 1TU3A 4OAOA 2BFAA 4FLWA 2AG1A 2R8YA 1EQUA 4IDDA 3PTZA 1X92A 1TADA 2FWPA 3G1UA 4IDQA 4IX1A 4LY3A 5ALWA 3HXOA 1RKQA 3V8BA 5I9SA 5K09A 1OASA 3G59A 2COUA 4XFKA 3PGVA 3BMOB 5DI9A 3LT0A 3D36A 5T7BA 1W6UA 4WH0A 1IHYA 1PJ8A 1P7WA 2KPOA 1QE3A 1ODTC 3PCRB 4TM8A 1CT9A 2YSUB 1O95A 5KTSA 4JJAA 1UT6A 3T9EA 3R4CA 3NNDA 2WMOB 1VL5A 1FFAA 3WZMA 5DGDA 1I7NA 4U7NA 2TRSB 1SBHA 1LBTA 2ONJA 1U5BB 3NNSA 3KZOA 4X90A 4CDMA 2CSXA 5FBWB 1LPOA 4BNFA 5DWQA 1CUUA 4KLRA 4YJKA 3ABLB 3FMOB 2OT5A 4PWYA 1FX1A 2NV0A 4J2HA 2VDKB 2WU3A 2P6NA 1TVKA 5F98A 2YXDA 1B0ZA 2HXSA 2C4KA 5CR9A 5B3AA 1FDWA 1H2YA 5KB3A 2P5UA 4DLTA 3MQ4A 3PNKA 1Y1PA 4ITVA 1VF7A 2IPLA 2DLNA 3HCFA 2G1PA 1G8FA 3BWCA 1E1QA 4Q21A 1TYBE 4KYTA 3EIHA 4LRQA 2G9QA 4PAQA 3LKDA 2WLNA 1YGYA 4DZZA 1TLFA 1TO6A 3RT3C 1UZLA 1Q6YA 3AHHA 4BVKA 3CSUA 1R5BA 1I3OA 1JIKA 1Q74A 3ED1A 1XL0A 2OFPA 4R8CA 3HCOA 5SICE 3TAHA 3MW8A 3KIPA 2JI6A 5F33A 1WZ2A 4FSDA 1J0AA 2ZYUX 1Z63A 4ZXPA 1L5OA 3AF2A 3TKYA 3O74A 1YL5A 4RK0A 5JSYA 2OHFA 1I7SB 2DYRC 2IW1A 2FGKA 2HOQA 4LOJA 3TSWA 4LFAO 4UMVA 1E6MA 2CV1A 4H18A 4ZYUA 2XCTB 4ZO6A 1QZUA 2WV7A 3SYTA 4G89A 4PCUA 2TMKA 2Z1MA 1GAXA 4JWTA 1WMSA 2FYUH 3FYSA 4ZO8A 3CJTA 3W5IA 3C7KA 2O5EA 2UYYA 2I29A 1N8KA 2C42A 1J4AA 5G1OA 4LJ5A 1DXHA 5FLYA 4GX2A 2FQYA 3KDAA 4XBFA 3CSXA 3BMCB 1P7PA 2LD4A 1T3TA 3N2GB 2EV9A 4UUNA 1ZH2A 4IIVA 1PP4A 1KQNA 3ZWPA 2PBLA 3K32A 1ZW6A 1LBQA 3K5IA 5AVQA 4W5JA 1EG7A 1LDNA 1LC3A 1KYTA 2FZ4A 1Y6GA 3C4JA 4FM2A 1QM5A 1IY0A 3HR4A 2B36A 3QYAA 1AB5A 4C07A 1XL1A 1TZKA 4JFAA 5HHTA 3AJAA 2JS5A 3FTPA 3OHSX 2P65A 4FGJA 3M49A 3DKIA 1PTJC 1E7YA 4ENQA 1IBKO 4PR0A 1I32A 2E4XA 3R5JA 5JS7A 1JZSA 2AF3C 2R9IA 1GUFA 3B1WA 3A1WA 3ZZUA 1UBHS 4MVYA 1E69A 2NVUB 3FIJA 1X7XB 4MVXA 1GN6A 3WB9A 1M1KW 5FA5A 1OPRA 2WF5A 2MCFA 4B6JA 3Q41A 4XLTA 2AJTA 2Q9BA 5HTOA 5DDIP 3WSTA 3OQIB 5K0TA 4RE6A 1Z0KA 5B3JA 2AD1A 3F6YA 2HA7A 1I5XA 4ZJYA 3NTQA 4F2WA 3MGKA 1TFUA 3ZWAA 3NV9A 1N2GA 1DJOA 3UF0A 5TPWA 4DC1A 3FVRA 4JYBA 2HIGA 4ZHQF 5AHKA 2IM9A 2ZE7A 2PU5A 5DHPA 4ACBA 3FE2A 2V3VA 3DDCA 3NBXX 2I3GA 5CDTA 2E4WA 1GTVA 3VOSA 5DGCA 1P49A 4BV3A 2FW9A 3BWYA 1UODA 1FEZA 3ORRA 1RVV1 4NSNA 3HSSA 1U1FA 2ZWVA 2PJRA 1JH8A 4J7UA 3PS9A 2NXCA 4U7WA 4NCBA 5I01A 2JIQA 5CLIA 1E2HA 1HE1C 1NN1A 3SXUA 1KL7A 1SHKA 3QJYA 3TLMA 3SC2B 5PNTA 4MYRA 1U2PA 4MO9A 2VHVA 3A05A 4K0KB 1QFZA 1Q43A 1T4GA 1WUIS 2A0FA 1WABA 2JCBA 1TEHA 4QFDA 4BX2A 4E2YA 4GP9A 1YC2A 5E0OA 5F3WB 1XDGA 1AQIA 2PWZA 1DBVO 2ZWMA 1VQ4V 3ABRB 4D42A 2P9QA 1YUNA 1ELOA 4PBTA 3OZWA 4ND8A 3NNNA 4GIBA 3ANNA 4Q7EA 4DM4A 5TRTA 3UNXA 1WZUA 2PG3A 3PXCX 4LOIA 4DMFA 1HT2E 4NE2A 3G0GA 5K8VA 5B66Z 1VG9B 2R4UA 2PGXA 1ORVA 4LYJA 5J2TB 3EUWA 1JEOA 4LY6A 3G2JA 3E58A 1DG1G 5JNSA 4F1KA 1SN7A 4CEIA 3MCTA 2NPOA 3LLSA 3DQQA 1DWOA 3WKDA 1ARZA 1NURA 1BW9B 3ZVNA 3BA9A 4EI2A 3H2KA 2A2ZA 4YALA 2M6YA 2AVNA 3D7SA 2JBWA 4WBSA 3KBBA 3JQAA 4P1ZA 4I1IA 4TKMA 3H1JH 2G40A 4X3CA 5DNYB 3PXUA 5K99A 4NTWA 4V2UA 5K20A 3N75A 1E4OA 5KTKA 5M04A 3HL0A 3B09A 3BPZA 1ESNA 2WT4A 4XZ3A 5CDFE 4GGPA 1I7FA 2GK4A 1EVIA 1PWZA 3LRXA 4BVJA 4B3GA 3LP5A 1MB3A 4K9SA 5K1PA 4E5PA 2BFFB 3EOBI 2XT9A 4QYWA 5BWMA 4KN6A 1FRZA 1KY4A 1M54A 1AQJA 2EG5A 4IGIA 2I0FA 1D03A 3W5CA 3IAUA 1KBHA 3QV1A 1QE5A 4YGYA 4DB4A 3PPIA 3GA0A 1GKFA 2Q5LA 5AXAA 3PI6A 1F0PA 3R6TA 5CNMA 4B6RA 3IP5A 4XQEA 1T34A 3IIKA 1I13A 3U4QA 3NTUA 1QOZA 3SJQC 5AKGA 3TSOA 2IIPA 4QBFA 3W5VA 1R12A 3BCSA 4DUZB 1EJ6A 4RD6A 1QNFA 5LQSA 2QIOA 1GKLA 4DNFA 3X1MA 3A1CA 4QBIA 2JAHA 4NLLA 3JQRA 2CNNA 2XBUA 1RCTE 2JK1A 3RH0A 2OK7A 4TSFA 1NQTA 1JFVA 1QX3A 3UG7A 1IM8A 3TX6A 4O29A 2IZ6A 1WOYA 3ANSA 5GJWC 4B3SB 1M0TA 2GDSA 5EIFA 2HQ1A 4FUQA 3OMXA 1TQ8A 5AOVA 4YYEA 4H0LB 4RMJA 1U2DC 2DFLA 4YK7A 3ZDZB 1T0IA 5FUMA 4RABA 3RT1A 1DEXA 4X84A 1P1JA 5IDJA 4KO2S 1J7JA 4MCIA 1JKJA 2X9QA 3DTUB 1BN7A 2WNIA 2QPTA 1OXVA 1IN1A 3H4IA 3I1YA 2HCRA 4RJJA 5LHHA 4UMEA 4EATA 3M6LA 3A2LA 2P6UA 5ECGC 1OI7A 3ZVRA 5KYTA 1T4BA 3M4ZA 1U0NA 4YUVA 1QHYA 3DV2A 4MWOA 3L1UA 1QC5B 4R7GA 3QEMB 4CLRA 1KOJA 1W4RA 4S2UA 4YC7A 8LDHA 4FBGA 2WIJA 4OHPA 2JRCA 4WFJA 4HWRA 5A4AA 2AB0A 3ROZA 2YIAA 1PFQA 5JEDA 4JKIA 4M0UA 2HCJB 2PANA 4J0GA 6YASA 2J08A 4C3VA 1OLUA 2QWNB 1AKMA 4Z8XA 5CEJA 2N75A 1GZ5A 3DONA 5K3EA 1S89A 4YP9A 1N57A 1DQNA 1GN9A 3H1LH 1TYZA 2NO0A 4L9RA 4HNUA 1A5BB 3UA4A 5BT9A 1PVDA 2D62A 4GRAA 2FVXA 4HSEA 5L3GA 4HBZA 1A95A 4DQXA 2CD7A 3CSSA 3FOWA 3SZLA 4JUIA 4U9UA 4A15A 5JBQA 1WX1A 4YXWG 2Y1DA 4MVQA 3GRCA 4TMTA 2CUNA 4ZYZA 4LWSA 4JASB 4X7PA 4Y9UA 5A9SA 1ONNA 5G0TA 2P0AA 4MKGA 4ZC1A 3E3MA 4IGEA 5JSKA 2DHQA 3T7DA 5SZKB 2JGRA 2ORWA 3DYIA 2WNSA 1A2BA 1YJAA 4EG4A 5LLTA 3DEZA 3ZEAA 2OCPA 4B75A 4C4PA 4EW3A 4DIEA 1R6TA 3A6EA 2RONA 1KDRA 5EJ6A 2V0GA 3DDSA 1N1GA 5CLLA 1JIUA 1SQ6A 1YONA 4JZYA 2A78A 3GUCA 4G2KA 4I9UA 3MSCA 4OXYA 2IEZA 5I7HA 5IU6A 4EMUA 1JALA 1MO2A 1W88A 4WOCA 3P0FA 3P96A 2QRNA 2Z3ZA 2Y4NA 2REXB 1K3TA 4PFJA 4V0QA 2GYVA 3QTCA 2Q9CA 5L53A 2BZ1A 4I4TA 5HZKA 2DQ0A 3OETA 3HWWA 4TWKA 2JHPA 1TO2E 3G88A 4MR8B 2BONA 5EJMA 3OQMA 4GVLA 3WGGA 2HN9A 1AQUA 5ILGA 2ATEA 2CDBA 5CLFA 3RYCB 4LZJA 4MQEA 1BXGA 4C78A 1P5FA 1D7AA 4MWGA 5JHHB 5AM3A 3NI2A 5K0EA 1VBKA 3UWOA 4QVIA 5CJJA 4CT4B 3O0DA 2BY4A 3OEHA 2EKZA 3I2GA 4U7FA 3PZRA 5JSUA 4QT4A 2ERCA 2XUPA 5FX2A 5FFNA 4AZVA 4UCWA 4BKOA 3SJUA 4XEHA 1RHJA 1TM3E 1DLJA 2PZEA 5KKCA 3UMJA 3B48A 2P78A 4PZUA 2FB9A 4EY3A 1JEDA 1UBUS 2AEFA 4KQJA 5HDQA 5L8VA 1G4YB 2ZJAA 4EB3A 4YJFB 4AJLA 4HC4A 2UVPB 2FZLA 3OM1A 3QOYA 1UZUA 3VPGA 5FOXA 1VYTA 1SZPA 5JJCA 1OU0A 4YO8A 3K06A 4PRYA 2QL5A 1W2BU 3I0NA 3IPYA 5BQOA 3ZLJA 5DHTA 1MAAA 4ZDWA 4QD3A 3NH9A 2PVSA 3SQDA 5B4TA 1VG0B 1N0UA 4ZYVA 3H87A 1FFWA 3ABIA 2P3OA 3H8VA 1E0AA 5TQ0B 1CWUA 2HDOA 2Z8YA 2UKDA 5DNDA 5DM2A 4YAJA 3L40A 2XVYA 3OCXA 2AR7A 4XJXA 3D3JA 4L2IB 3EK2A 2OORA 1W4LA 3F3YA 4IRXA 3PD7A 2Q8PA 5ED0A 2DE0X 3VR0A 5K8UA 2Q0XA 4LIPD 3GMTA 2C8LA 3WXBA 2FSUA 2CH7B 6ADHA 2EIJB 4GUAA 1NKVA 4K8RB 2NQTA 2YIMA 2CUTA 3UHJA 3VISA 3E5MA 4AC9A 3TNYA 4D4LA 1OIXA 3P9XA 3DCJA 4BNGA 4EF6A 2G72A 4QDTA 5B1AC 5DGHA 2AZMA 4XE5A 4PSDA 2WAOA 3LP6A 1FW8A 2D06A 1L3BA 4ISCA 5DLDA 1GLGA 3GRAA 1T5SA 2I03A 2MMGA 2DQ3A 4NOJA 3PNBA 4J7JA 3FAVB 5I9IA 3BT7A 3ELDA 3TRJA 4KI0A 2QKYA 4FQ5A 3D3NA 4F97A 2J5RA 4RQAA 2BYTA 3RWOA 4E2ZA 4K9PA 3LPCA 2QN8A 2G1UA 1XAIA 4DB2A 4KH0A 4HLCA 1U5BA 4HTAA 3OF2A 1H94A 1RR6A 5GZ6A 2AQHA 4FKBA 1I1NA 2CXXA 3NATA 2ZJ2A 4D6TH 3ZUPA 4B2LA 2V7TA 4OM8A 1Y67A 3HCEA 4IJ5A 3JYLA 5JEEA 2WAMA 3WB0A 1LPMA 2HB6A 3EWNA 2Q3EA 3KYCB 4HF7A 2Q68A 5CG2A 1XGKA 4V0SA 1KYOF 5HF5A 1O8BA 2QL9A 1CFJA 4ACAA 2JGMA 4EPRA 3ASNB 4IRUB 3ICQB 5C80A 3GCXA 4P2ZA 1L5HA 3TIXB 1FTYA 3P9SA 4D7SA 2Y69C 4E3ZA 2LUOA 3EFEA 3LHFA 1JQ3A 4IPTA 1HC7A 1TJ3A 2G1AA 2SKCA 1NBEA 1IEWA 4PYRA 4A82A 3BXEA 2VKTA 5A62A 3TR0A 4ZOQI 1USKA 3WLIA 1AX9A 4BIZA 4OA5A 4C2AA 3W7TA 3RADC 3D4BA 1URFA 2W6ZA 4PHGA 1E7SA 1QVVA 3I2IA 2ZPTX 5FLEX 1H2BA 3P0HA 5AVKA 2A4MA 4FX2A 2RQ6A 4LF7B 3D8NA 1NF2A 5EINA 3GLIB 5E1AC 2W2LA 3E6AA 5ECWA 3HJHA 1TQ4A 2PUWA 2BSQA 3BBLA 1B0UA 3VSEA 3GJYA 2YS8A 4WESB 1RACA 5A5EA 5CB0A 1JDNA 1R74A 1GQRA 2ZANA 3LBFA 3LE8A 4QWMA 2WWIA 3LCRA 2QTMA 5TY0A 1WMAA 5JS6A 4TS3A 2A9RA 4RA9A 2PX2A 3USZA 4LI3X 2P9ZA 2IVZA 1H8HG 1COWD 5DLQC 3F9RA 1URPA 1TAGA 1R0YA 4G07A 3DEFA 5BR4A 1UDBA 3MTJA 4UCUA 1VIYA 4Q18A 1A9XB 3IVRA 3AY3A 1L7PA 3LDFA 5KKAA 3SPCA 2BRUC 1QWOA 1WOMA 3KUUA 4XVCA 5B1BB 4O4LF 1WDWB 5FUWA 1K4KA 2LZ0A 2IIBA 3MWJA 3H19A 3N8NA 3ACBA 1T5IA 1Z0FA 2BT4A 1ZGAA 3CB2A 4NRDA 3RC7A 4QHYA 3JU3A 5FWYA 2JS3A 5FF9A 2NTVA 2FUG6 2C58A 3D5QA 4NF2A 4JLPA 1J49A 4FDLA 3JY6A 4EKNB 3MMXA 4N6NA 3G1TA 4WA8A 4YMGA 4DW0A 1S8FA 4HDAA 1FFGA 4ZIRB 3GJXC 5EKTA 1EB8A 3VX4A 2RHCA 4M1MA 1LV7A 4X3OA 5K8LA 4IWXA 1X7XA 3SR0A 3R65A 4QUGA 2FPPB 3OCVA 1G6KA 4B40A 1N8SA 4Z8YA 3JD1A 1LDBA 3HEMA 3NEPX 5IUJC 4GR5A 2XI4A 5E7QA 4BLUA 2G0NA 3IPRA 3OSUA 3EC7A 1CULC 4YLEA 1QJ4A 2X19A 1HTBA 1MF7A 3E9CA 4TRNA 4K9QA 4LXXA 2AF4C 4XGRA 2R8OA 5L3QA 1IDN1 2GILA 4LISA 4J80A 1F1BA 4JYCA 1SIOA 4Q16A 1KR5A 1BG6A 1H1TA 3AUKA 2XECA 3C97A 4WAUA 5EE5B 1LDEA 4L75A 1PHPA 5DU2A 3X1DA 4QU8A 2WKPA 1H6BA 3LLUA 4RD0A 1TUGA 4OGQB 2YWRA 4W9RA 3JX9A 4K9LA 3H5VA 4HZIA 1K06A 3L8MA 2XMPA 2AQIA 1G41A 4RHYA 4WXPA 5BSUA 3NJRA 3PE4A 1CDOA 4RZUA 6Q21A 4YRGA 2OCIA 3UAZA 3H3FA 3C1AA 3TTVA 4M55A 2XDWA 3FRIA 1S2GA 3WSWA 1TVKB 3WBKA 3RRYA 1VIVA 2OQIA 4BAUA 4D79A 2NUPB 1CF2O 3H2HA 2WWGA 5KNCD 3GNSA 1VP7A 2ZBFA 2WLMA 2GQ0A 2HZ7A 4P8RA 3K94A 3I8OA 4GOND 3PVZA 1XB2A 1XRJA 1NJSA 4IYJA 3RRJA 2FEWB 3IAM6 2YXNA 3RVNA 2ID8A 3CRW1 2X13A 1CCWA 3KJZA 2A30A 4V0MA 4PC3A 3EXG1 1X77A 4D4GA 5JAZA 3DJYA 2CYCA 3I1JA 4C0WA 1ZRSA 2YYSA 1XRMA 4YRJA 3KR2A 2PKQP 1I4TD 2JIDA 3MNFA 4D9JA 3AI1A 4YO7A 3C39A 2YNMC 1BMTA 3C5EA 4JP8A 3U31A 4CQLA 3RFRA 2QM7A 3B3JA 1T8YA 1NXOA 1WXEA 2CV0A 1TJ5A 1BW9A 4UEWA 2BCCH 2QUIA 1D2RA 4FOPA 4C4XA 2P1ZA 1YRQA 3LGSA 3C6QA 4DYVA 2WSLA 3QU4A 2MSEB 4BW9A 2NQ8A 4L51A 4TT3D 3KYDB 2PLWA 4O2BA 4KYVA 4JHXA 5FA6A 2I5PO 5EHXA 4UTZA 3WTCA 2ZR0A 4K40A 1CQZA 3AFNA 4Q39A 3S68A 3DE7X 1K5PA 2IQIA 2UZAA 4FYVA 3JQPA 4FYHA 2OXRA 1PS9A 5HRUA 2ITDC 4C7BA 4RSHA 2HV9A 4FMDF 3I5MA 2XAFA 3HV2A 4MW4A 1FZTA 5CA1F 4YP7A 2JIMA 1W34A 2Y1XA 2PFGA 1LBIA 5AJTA 3QE3A 1JILA 2W6MA 2QGNA 2ZIOA 4QXAA 1YZYA 1EUQA 2WG0A 3IOBA 4NCXA 1DAHA 1G3QA 4OAPA 2K7FA 3VI4B 1GYQA 1P9LA 4CMHA 3LUFA 4BCDA 5GMOA 4FFSA 1B04A 3FMGA 4DV4B 1GV0A 5T41A 1Q3HA 2CBZA 2OZEA 2D1FA 3L92A 4W5HA 4QKQA 2W8BA 1L8AA 5JWHA 4BB6A 4JC4A 3S5UA 3G89A 1V0JA 2BCEA 4BP1A 1DXOA 1NVVQ 5AHOA 1DMRA 3T3OA 1Y7HA 3U48A 1NX9A 1DEAA 4EEKA 4B2IA 2WUEA 1X39A 3ZQ4A 4LG1A 5JYDA 2OUIA 4MUBA 2C2MA 2EFHB 3S28A 1Y3FE 5KREA 4YQFA 3AI3A 3QU7A 4BNZA 1Z6ZA 2MOKA 1D3AA 3KQYA 2JA1A 4G5GA 1YJWV 1CSEE 2RK3A 4A9AA 1XDSA 1IL0A 4KAJA 4OH1A 3ZWXA 5TPWB 3NUZA 3O8NA 2Z4TA 3N86A 1J0EA 2ON6A 4R84A 2B1QA 2Z2KA 1IZ8A 1KNQA 5EMNA 1NQWA 4P35A 2FF5A 1QV9A 2BGIA 3BQ9A 3A25A 4HMPA 4LVNA 3ODGA 4B81A 1JSXA 3ASVA 4KR2A 3F47A 1Q0SA 3L7IA 1HXHA 3IPAA 1Z7EA 4KYUA 4YMHA 3LW7A 1MQ8B 3RC8A 3GT3A 1Y66A 1X9GA 1RZ3A 5E6RB 4U0JA 4LH7A 1D5CA 4OQXA 1BH6A 2W6IA 1D8TA 3SXUB 2A1IA 3FWZA 4FYXA 1K4MA 1QC5A 5KA6A 3QEMA 4PG8A 3T0FA 1H2LA 5COBA 2FEPA 1CERA 4ND4A 1NLFA 2Q2NA 1MZFA 2QG9A 5GP1A 1ZIPA 3PUZA 1NQXA 2PZGA 4FGUA 4F5YA 2D3WA 1CP2A 2G67A 3D59A 3CN7A 2IF0A 1EN5A 1JYEA 2CGNA 1BHJA 3L9XA 4AY6A 3X1KA 4JQYA 3FVQA 2CE4A 4NMLA 2ZIAA 5FWXB 1RBZA 2GKGA 3NR7A 1Z0AA 5K3DA 2AMLA 3LXMA 1I8TA 3QXCA 3ESXA 4J0IA 2P8JA 4EWLA 2WZQA 1QX4A 2A7WA 5BVGA 4OMFG 4NXMB 4B80A 5KCMA 3H97A 3IEIA 4CEIB 1PS8A 2C2ZA 1GFZA 3L18A 1WU7A 2F4NA 1E7RA 1CE8A 2O0HA 3U4GA 2GJ4A 3CLSC 2EYUA 3A3YA 2HSEA 3L4BC 2DFVA 4H27A 3JQAB 1N6PA 1TD1A 3ZN2A 5K6RA 2ZFUA 2PX6A 1F23A 4L4ZA 3PPVA 1CY4A 2XQFA 3AG6A 3U17A 4JR1A 1MCZA 3JVUA 1WUYA 2YWEA 2IE8A 1QRAA 2YN4A 5HCIA 3R75A 3TQOA 4AQYB 1XF1A 4RY0A 2CFRA 4PANA 3RO7A 1IHXA 1KI8A 2VQFO 2NXJA 2GN2A 4ZHQA 4P22A 2A1TS 4PTYA 1W75A 1PHRA 3I4LA 4DIBA 1GTOA 1A7JA 1MJFA 4CMKA 3Q8XB 4K6KA 1RTTA 1CVRA 2PR2A 2QRUA 1E9EA 1F0KA 1S9DA 4MHSA 2R6HA 1LUAA 4QBKA 1O7JA 3T4ZA 5LHGA 4MR8A 3LPMA 1BHO1 1GGKA 4QJ5A 1Z0JA 1GFIA 2V8BA 4Y9TA 4ZALA 3V7FA 4YAGA 1R6XA 1RYDA 3GZ4A 4ICIA 4EBBA 2A7XA 4O8ZA 4URVR 5LKRA 1H66A 5UKDA 4E2WA 2UXCB 2N47A 1SVMA 3TDMA 3O7WA 3QO7A 2EZ9A 2GPYA 3CLVA 2UUAB 3U4QB 1H42A 4HL6A 2FRXA 1QANA 1BKYA 2AW9A 3SYLA 3UMFA 2GEKA 1NVXQ 3ZUGA 3U7FB 4L8YA 3QENA 1J2TA 1KO4A 4LYAA 1SCNE 1V16B 3QFFA 1VYUA 4I5EA 2XNKA 3UMYA 4D25A 4G4GA 5MFPA 4JV5B 1XKLA 2WFMA 3HPLC 2ZR7A 2KS6A 5T4EA 2C9OA 4HLQB 3ZRSA 1ST3A 2Q8QA 2VRCA 4HZUB 4ZJUA 5J4LA 3T5AA 2GBOA 4MWDA 3QKSB 2BELA 3SQMA 2NN4A 4X62B 4JZKA 3DLIA 2NVOA 5KC9A 4JOBA 4I0XA 2JEYA 3DL4A 3WRXC 3H2IA 4Y0AA 4PAOA 2F23A 4NESA 4A0FA 2R1ZA 3V33A 4K3UA 2V6FA 3WRWA 1JKJB 6AT1A 3ZIAD 1MORA 3LNTA 1BS2A 1EK5A 5TQ0A 4Z1MD 2H2FA 2PS1A 4MEBA 4Y2HA 3NONA 2E7ZA 4Y9RA 3AR7A 3QVSA 3DNPA 2ATCA 3E9NA 2E74B 5CXUA 1PGNA 5G02A 3VR2D 4E7OA 1MJGA 1VCIA 3V9PA 2UUOA 4RJTA 3PRJA 2R2GA 5CUQA 4C04A 1Q1ZA 4UNSA 5HCNA 2CH7A 4CLRB 4RFSA 3MWYW 1AO0A 1ZVVA 2CMGA 2H52A 1C7ZA 3FF1A 5JR3A 3IOYA 4CHGA 1MD9A 4FMDB 1E2QA 4OSPA 3N8GA 5CA1B 3OA2A 2V03A 3ONDA 3PGLA 2GUZA 4CIVA 1J1IA 1WM1A 1YB7A 2CBXA 4WUVA 1V7PC 3ZHTA 3RPEA 1FFDA 3ZN0A 3DMNA 5SZHB 1H2SB 1E6UA 3VJLA 3L0DA 1ILEA 2JFOA 1E2PA 3ZNQA 1G1AA 3QWHA 2C84A 3WL6A 2BDUA 1DI0A 2MWMA 1M3SA 4KGXA 1J21A 1NVVR 2HSDA 4I5IA 1M0EA 1JQ5A 4MVJA 4Z4IA 1N7GA 3ZZTA 4YGXB 3NIGB 4DABA 3LUAA 2PGIA 4LWSB 2PX0A 3BAAA 4IV5A 1AHIA 3H5IA 3PK0A 2ZSKA 1IN6A 1TUBA 3MCUA 2V45A 3FYUC 2UAGA 5FPKA 3ROXA 3TW8A 2NSLA 2GBIA 4BNKA 1TPZA 4GEKA 3ETDA 1NXTA 4E5YA 1YO6A 3NG1A 1OW3B 2YMPA 2OCXA 5CGQB 3ESZA 3A9WA 4TYMA 3HHPA 1TCUA 2RDMA 1H69A 9MHTA 2ID4A 2YOFA 3F7TA 2H57A 1OCZB 3ZV6A 2RGWA 2DKOA 4YCSA 1HDOA 2H9IA 1S9HA 2HJ9A 4A73A 2AFHE 3GB9A 4LMPA 5AKYA 1EBOA 4YT2A 5DW0A 1WTCA 2FPKA 4AN1A 2ZPAA 3HRKA 1Z6PA 1BMFA 4BZZA 3RLIA 2FJPA 3FWPA 3S29A 2ARHA 1UXKA 5K0LA 4MQEB 4HWTA 4AY3A 4ND6A 1BXGB 4C6TA 1P91A 1FTQA 3EZGA 4FNMA 4HH4A 4MV9A 1LK5A 5CT4A 1U63A 1WBDA 1OVMA 5I51A 1VP3A 5HMLA 4JP5A 1NW5A 3TGPA 3L0YA 4L0MA 3HKCA 4R9NA 3A4NA 2LFSA 4B0PA 1N3YA 1JB1A 4JI7O 3RS8A 1CV2A 3D8RA 3IAHA 2QENA 1RWPA 2UZ0A 3F5WC 1K9SA 5TT0A 5JMPA 3QE0A 4XGKA 1I7QB 3PL5A 2PF4E 1XR3A 1NG9A 1Z29A 1ZO8A 2PZLA 1TGYA 2JAOA 3TM5A 1UKEA 4U7JA 4X89A 1L5KA 5HG0A 5IFLA 4DV5B 4IVRA 1UPAA 3LOUA 2ZTSA 3WY9A 1P9OA 3VZRA 4I8XA 2AFIB 4RYLA 4DCSA 3CKLA 1ACJA 1Z3CA 4OXSA 2PA0A 3GJZA 1KH1A 1BEUB 4MKXA 1KZ6A 1NLUA 4Y2YA 4ZXFA 3AVWA 1DRJA 1DUIA 2HK8A 5ADVA 1SZDA 2PI4A 1GQOA 3KPVA 4E13A 3Q87B 2RGUA 4Z53A 3SLRA 4YQYA 2W4QA 1EMDA 3X0DA 1QHFA 3QFTA 2J6CA 1HNXO 4IY1A 2QM0A 4FC7A 1RLIA 5LLSA 2JJYA 2C00A 1VI2A 3L8ZA 4K3AA 2I2CA 2Q50A 1M90W 1EP1B 2AT1A 4MV4A 5HKKD 3I9OA 1E3LA 5K4AA 3KTAA 3VVMA 1AQ6A 1HK7A 2GS9A 3RJ5A 3LSSA 4WDQA 4XIGS 3JPWA 2ISQA 3DE0X 4DLNA 2P4UA 2O3SA 3D3IA 3HU3A 3RSOA 5BOVA 1MX3A 2KHZA 1H2RS 4M37A 5FWNA 4O2BF 2BMJA 3AIMA 1XMIA 3G6WA 1KMQA 4KIWA 4MK4A 3VDRA 1JGTA 4EG6A 4CLHA 1JLKA 2Q3JA 3RBXA 1KYIA 1Z15A 3F7NA 1GPBA 3A3OA 3BCUA 4N01A 5AM2A 1ESEA 1UT8A 1JPUA 2XE6A 1TI7A 3A6HA 4XDYA 2GJ8A 4GKJO 2QLLA 1AF4A 4IIHA 2PLRA 4URHA 4CFZA 2D2VA 4HEHA 2EKBA 3Q1KA 4M6WA 4KMMA 3U09A 1JBKA 2O8VA 2VBIA 1GA6A 3ZVMA 3P9RA 4JAUA 1NH2B 2GNAA 2OSVA 5FLXA 2Q4RA 2VJCA 4DYHA 3TJZA 3UWMA 6LDHA 4O0MA 4FMBB 3MRVA 1J6UA 4IO1A 3ETNA 3AUAA 1E98A 2XUQA 3LC0A 1XWFA 3QXXA 1ZI8A 3NT4A 3KT0A 3CLSD 4KRGA 4NU6A 2NUPA 2GHYA 2YXBA 2Q2OA 4W99A 2J3QA 2GCNA 1N0NA 1UKAA 1VQ8V 1QRSA 1T4CA 1JR2A 2K6GA 1QR8A 2Z5VA 1TVEA 4Q0MA 2QQ0A 4L5AA 1UBSB 5IYZA 3FVVA 3NFYA 4DV6B 5J5AA 4LDQA 1L5HB 5JSZA 5IKPA 5HFJA 5KPDA 3N28A 1FCJA 3B38A 3VYWA 3AG2C 3BWEA 2O3JA 4MPRA 2XWSA 4MWSA 3T34A 4ANFA 5BWCA 2W0MA 3E9YA 4PCAA 1T0JB 1LDYA 4U0KA 3UJ3X 2ZWOA 1HLGA 3VKGA 5IVDA 2ZI7A 3IBGA 3CWBH 2VEOA 3OT1A 3SVZA 1H8EG 1SQQH 1Z4JA 3ZW8A 4R2LA 2OY0A 2EDAA 2MINA 4N7BA 4QYIA 4B4VA 1GDDA 3KYIB 1YR2A 1ANKA 1QP4A 3VKFA 4I4LA 1IJKA 1T5OA 3PQ7A 4DJAA 3AL3A 5K6AC 3KYDA 3D0KA 4C5AA 1NPYA 4X0EA 1SCAA 1OAOA 1LLUA 2FDXA 4G5YA 4DF3A 4H1TA 2CCKA 4GOXA 3KJQA 3FNQA 4KPGA 1JVMA 1SG6A 2GEFA 5ARCA 2ISCA 3EXHC 4EFBA 2CUGA 1EVYA 5FP0A 4QPNA 1PNOA 4RA9B 4BBAA 3C7DB 4WKNA 3H7AA 4HVLA 4F3TA 4HQFA 1JI3A 3OJ0A 4QDKA 2HFKA 3FB5C 4B3RB 1UBJS 4K8ZA 3J80A 5A05A 2B92A 3TQFA 4TSKA 2IS4A 4A3SA 4D45A 4PI2A 2WP8J 3TMAA 1PFUA 2WJGA 2EULA 3OY7A 4UFPA 1WXGA 4QVKA 3S2IA 1J0DA 3VYTB 4JELA 1LFAA 4KQGA 3OTIA 1CRZA 1MC5A 3FDXA 3PNSA 5FWYB 1VLQA 2H16A 4AJJA 1CX9B 1IX9A 2G4VA 3UW1A 4EQ6B 2DWQA 4GX5A 1NSFA 1W19A 2WZCA 2C2YA 4BZQA 3OIUA 3RFFA 3CMCO 4U7TB 5B1HA 4MVJP 4FLYA 3TZLA 4KIUA 4DV7O 4RM3A 1AU9A 1DO8A 1FSSA 1CB7A 4X44A 3FFWA 5MN4A 1MC4A 3ED5A 4F9GA 1HY3A 4YROA 1BFKA 2GRAA 3UBTA 1D4AA 3R6DA 4LCUC 2R7AA 3BX1A 1EFVA 4RY8A 2UUBB 1IPHA 3EJWA 5AKJA 2GBLA 3F7YC 2V9ZA 3BWBA 4BTEA 1YTLA 5B6IA 3CEMA 2VAMA 3ILVA 3SBOA 2HU7A 4HAXA 4OHFA 3WKAA 1OXMA 5L3QB 4MTFA 2GXSA 5BN3B 4KO3S 4DSAA 1FP7A 1QQCA 5CYPA 4W9NC 1QP7A 5A6VA 2DPHA 2AHRA 4CMEA 4JYAO 4A0SA 2ADPA 3LY9A 4CR7A 1M6YA 4MT8A 4XVUA 5B2ZA 3EEQA 2ZIVB 5IT0A 3PRKE 3J7AU 3RIMA 1BFDA 1EX7A 4E33A 3HADA 2G80A 3QKRB 4Q9IA 1V2GA 4IZ6A 2RC5A 3FGNA 1Z2EA 3PDIA 4NOKA 5E6RA 1XZNA 1MOQA 1VZ3A 2WLKA 2YIVX 1H5UA 1PM9A 3Q0TA 3O2QB 4AKIA 2OOSA 4HAUA 3SPIA 3F71A 4KVAA 3CZQA 2AC7A 2PUTA 3D6UA 3TPFA 4M0CA 3CLKA 1KFJB 3J7TA 3ZU2A 3RD5A 1NUAA 3R9XB 2ATXA 3WI7A 1K68A 1RIIA 2XE8A 4BE7B 3G2OA 2BM0A 3C3CA 3NGLA 4W6ZA 2HNKA 1HE8B 3ID6C 4AT1A 3FY4A 4NABA 5FWXA 1NP3A 2F66C 4O4LA 4RPCA 5LP6C 2FN3A 3OTHA 4Q48A 3NCTA 4C30A 5ITZB 4J9UE 7GPBA 5LZ2A 2CL5A 3AOEA 3JWIA 5IK2A 1KO8A 4XI9A 2DUMA 3WGTA 2BR4A 4I46A 1DS6A 1KQSU 5SYNA 1J06A 4CQLB 3HYSA 1ZR4A 1Q91A 1P6UA 3X1YA 2HYIC 1EBUA 1W47A 2EEPA 3DNFA 4Q7KA 2CDRA 2VJOA 2IX3A 2BCGY 5T3UA 4DDMA 3ZCSA 3TGWA 1NJ6A 1TYCA 3MTIA 3SXPA 3KOOA 3TRDA 1Z2CA 5AVJA 3I4CA 1LUWA 4O2BB 2N46A 3OPYB 3CPWU 3NBFA 5JZOA 3TSZA 1Y80A 4ZFNA 2B21A 2UU9B 4NTZA 5IDVA 5LIPA 3WG9A 4Y30A 4PLVA 3AJEA 3ICWA 1E8DA 4IEIA 5B1IA 1YVUA 3VKWA 3AFHA 4Z49A 1LQTA 1KB9F 4P3KA 3NYWA 4BMVA 4ZRDA 2F90A 2J9XB 1DKNA 3UJ7A 1VYHA 1J33A 1PIWA 1WL8A 1FYDA 4POOA 3FFBA 4RORA 3WDSA 3GDOA 3CPHA 3DKKA 1FVFA 4XPIA 1KI4A 4JYMA 3D2CA 1G8GA 2WLIA 4X6UA 2QQFA 1TZCA 2C88A 1P29A 4N5LA 3TB4A 2EIXA 5EZSA 2JGUA 3OP1A 1I3KA 1QF9A 3ZU4A 2FH5B 1Q1GA 3NIFB 1RQXA 2W8BB 2VWHA 3Q9NA 3PX3A 4MVJF 3HB3B 5T4BA 2JJ1G 3HNPA 4CMCA 1GM7A 3OGCC 1EJ2A 4J49A 1P1RA 4OHXA 2AYZA 3KDPA 3M6XA 4GYCB 1IUNA 1JZTA 1QFXA 1NA5A 4W1PA 4U3JA 5DOZA 2KX7A 4WZBB 1SR8A 1V16A 4Z0PA 3UMVA 5K0SA 3P94A 4OMCA 3IVMA 1NUHA 4Z99A 2C2WA 1P44A 2AX3A 4WCDA 4GDFA 3L4KA 3HHEA 3INRA 5CVJA 1JHUA 3X3HA 3L93A 3E8XA 1QPGA 5KI6A 1E3SA 5AFSA 2PZMA 1D2GA 1Q82W 3PQ5A 3JTEA 3OFVA 4HZUA 2BKXA 2F8SA 3M2TA 4BZWA 2O8EA 4E21A 3QKSA 3QVWA 3JSXA 4HYQA 3KHTA 4ZD6A 3RWRD 4QAQA 5C81A 1RBMA 4FFWA 1HE5A 3QKUA 3BA8A 4MX8A 4R54A 3PUVA 1Q15A 3OFNA 2I76A 5HA5A 1YQDA 4AECA 3TGLA 4AJPA 1UBRS 4WWHA 4EZEA 2RHLA 2R6CA 2WOJA 3WMRA 3KQPA 5I6DA 3STYA 4UBLA 4BB0A 4KR7A 1JQBA 1QFJA 1A69A 2E1PA 3QUBA 4A4DA 2NZVG 4FFNA 1EFRA 3GEIA 3RW9A 1KOFA 1GGJA 2Q27A 1NJ2A 2DUWA 4HX9A 4JYYA 5C1PA 2I3AA 5IT5A 3SC3A 1HOTA 3IHKA 1Z47A 2VIIA 1J8VA 5CA1A 4TGLA 1TA9A 4DDKA 2Y2UA 4ZVSA 5DBOA 5JLAA 4PYJA 1XTRA 1UC8A 1GA1A 2IOQA 4G0VA 5IVPA 5JJKA 1GM5A 3KSZO 2AOVA 5TEWA 5BVGB 2XDAA 1GA4A 3PQ8A 2WU1A 1JG1A 1B3QA 4CKYA 4JTAB 2XNSA 4S05A 1TF2A 4NXNO 3EFOA 4S1WA 1YR6A 3FHLA 2Z95A 3GJQA 1RZRA 4XASA 1FXSA 2H5EA 5T4FA 3V3TA 3QVOA 2VPYA 2JRIA 3T3DA 5LBUA 3U49A 1CE8B 2BSXA 5EI5A 3EPKA 3PVCA 5BPFA 1H22A 5T67A 1O6BA 2I6SA 3VM6A 3ZGNA 4YXFA 4CIBA 4CL8A 1VHQA 2WP0A 2CHEA 3K4PA 2F4VB 2IZ0A 3ZJZA 3O8CA 1XQWA 1F7VA 2OV6A 1PGOA 4PA4A 2LNDA 4AU1A 1R3KC 2NNWB 1GM8A 4QGSA 4ZHQB 1O97C 3OIFA 1GG5A 3RTEA 5JASA 4OJYA 3LDHA 4G5RA 1GZSA 4IIYA 3RVPA 3K20A 1W85B 1Y8AA 5D84A 3DOJA 4FYWA 1G20E 2CNKA 3QXGA 2I7CA 3NHJA 1ZU4A 3OEEG 4OM7A 2AG6A 2CLMB 4KWEA 1HMPA 4ZMRA 4KDRA 4H4EA 5L3ZA 3VO8A 2PMEA 2VPWA 5MN6A 2X6RA 1V8FA 4BMXA 3JVVA 1UQTA 3JYNA 5KYXA 1NI4A 3F97A 3TLBA 4FDTA 3HVHA 3MT0A 1RP7A 4Z9YA 2FFAA 4K6MA 1PT9A 4B79A 1NRWA 3DOUA 4YAFA 1DG9A 5AKLA 1Y3HA 1N6LA 1FX0A 4IQ4A 4BHTA 3ABMB 1E6LA 3K9NA 3MG9A 3B1ZA 4MDYA 5K2MA 3VU9A 3OLYA 4D3ZA 5G1NA 1XU9A 3CYOA 4C4ZA 3ZDYB 4D3XA 1GUZA 2JKVA 1SOAA 2X5KO 2VF8A 4QIWF 1V4VA 4KJZA 2R62A 4JJ4A 3LDEA 3OT4A 2GEBA 1Y89A 3CMAV 3WYGA 1DC4A 1RCUA 4FNGA 2YRWA 2XF2A 3WYEA 2AFIA 1HDIA 1XILA 2A79B 4I0XB 3CM0A 5IC6A 1C2YA 4XX1A 4X66O 2WYHA 2V7BA 2R11A 4GSLA 5IYZF 4DV1O 2JI7A 4IFBA 2PU7A 1ZXXA 1XRNA 1QO0D 4LN1A 4NOLA 3AHGA 1H2GA 1E2FA 5L4SA 3DZDA 3UVEA 5AJHA 3L49A 4HDQB 3AKYA 2WSIA 4HGQA 2UZIR 4RELA 1TRKA 1QCEA 4X1KB 4EL0A 1QQAA 4HAYA 1KH3A 3LHIA 2FETA 1YRAA 2XWQA 4RFSB 2AC4A 4RZIA 1OFUX 1KVTA 2CDYA 1LVUA 1SVOA 3HGQA 2IY7A 2H5JA 1SD1A 1TM5E 2AG5A 3K0SA 2C8KA 1OA0A 3MQFA 1M5UA 1V71A 1XELA 5LC1A 3BRCA 5ABPA 3K5HA 4FMCF 3S55A 1G3IA 5IBCA 3BMQA 2GUZB 4BVBA 1EGVB 2Q28A 1R0ZA 3AVTA 3PQDA 1YACA 3BJIC 1ZPDA 4B0OA 3OPVA 3W5DA 3LO8A 4PYIA 2YZKA 4LXIA 1KZGB 5E3JA 2VYVA 2J33A 4AM8A 4FHDA 2YFHA 1H5NA 3HNRA 1IE3A 4MVMA 4ZTBA 4JA2A 1G5QA 4FP9A 4IVPA 5DTEA 2I7VA 5G53C 2HAEA 3KV3O 2Q49A 1OX4A 4N3CA 1AR4A 1PF7E 2D0DA 5GJCA 3OTWA 1SBQA 1VDMA 1TUBB 2Y1KA 3E1KA 3FDIA 2AJ8A 4R41A 3CB4A 5J59A 2IE0A 3TW8B 5GAJA 1DL5A 1MSDA 3MFYA 2QD2A 3I34X 3H2GA 2PXAA 2BZ0A 3S7ZA 4MMYB 1RI3A 2EJWA 2P2SA 4DRYA 1EDBA 2XBLA 1ZIDA 1WUTA 3A2NA 2Y71A 1XMXA 3I9FA 1ABBA 1SXJE 5BUQA 4TN5A 1JE0A 1ISSA 3KD2A 1V7ZA 4MSWC 4JBGA 1YASA 3U3DA 2CCGA 3KJNA 4TXJA 2XTNA 3QEKA 2WWHA 5DNWA 2ATKC 1J2EA 3BXGA 3RSZA 2QP3A 4DMMA 1JKXA 4M1ZA 1DIRA 4Z5XA 3SYOA 1QU7A 2D00A 3W2HA 4IV8A 4GI7A 1AH2A 4FW9A 3QPBA 2FSIA 2HMWA 4LYYA 2QKAA 1ZC4A 1EBFA 2O2GA 1SHUX 4C6TB 2G5PA 4GBJA 3CWCA 2BHRA 1DUSA 2HW8A 4BX9A 1QYDA 2C9DA 1E1LA 4B3XA 4B8YA 4WZ6A 2C61A 5KC8A 1GZUA 1UBTS 3NDJA 3R0QA 1HG0A 4LJRA 3CT4A 3HKCB 1U3DA 5J5VA 3N1UA 2Q5EA 2P2GA 3UCXA 2FMFA 2CKMA 5JOQA 5U4QA 4FXPA 2JAPA 2EZTA 3BSFA 4I6EA 1LBSA 2R9AA 2GAJA 1QCZA 3B1KA 3IV7A 3RJTA 3TPCA 3MEQA 1Y1KE 1J7KA 4TYPA 3EXG2 4KNVA 4D8YA 1OJ7A 3NBMA 1BHQ1 2PZSA 2J87A 3T15A 2ZDIC 4YN3A 2PUDA 2JS7A 4IDHA 4UE6A 1XXHA 3FNHA 3SMQA 2RCNA 1FJ2A 3SE0A 1PT5A 3RF7A 5L9AA 1WB4A 3IJPA 4U7GA 4KEAA 2WHXA 5DXFA 4YYZA 2IYXA 3SYQA 1WVMA 2O06A 2GZAA 4PDRA 2X7JA 4EQ6A 2GXQA 1P33A 4NMMA 1E1RD 3O1LA 2ZBQA 1M5TA 4X54A 1FJGO 1JHYA 1L5SA 4KRXA 3MB5A 3KTAB 5CBPA 1T15A 2GRUA 3AG5A 3JYQA 2ZNJA 2DWDC 4U7OA 4FLVA 4OKNA 3I6QA 4BW5A 1ADBA 1YVDA 1XLUA 3KVYA 4MYTA 4U4AA 3SQOA 4EYQA 2HSJA 3P2MA 3OJLA 4FFDA 5LZ5A 3LKZA 1FDIA 2LDXA 2HXYA 4DR3O 4GMGA 2HA5A 3KRTA 4UM9B 2ETXA 1F2DA 4XARA 4XWWA 2ZAGA 5BN3A 2JFFA 3LV8A 1K0FA 4R8KA 3WIDA 2Z0MA 5JRDS 3VOUA 2IKQA 3Q9UA 5DCYA 1QAOA 3H9BA 1N32O 3II6X 2AZDA 2AX4A 3ZJ5A 2A9KA 3A0BZ 2RIPA 1U5AA 2H8KA 4DV0B 3F8TA 3MMZA 4M6WB 5HIJA 4PGMA 2PMDA 3QNEA 4N9QA 4LP8A 5J40A 3OZFA 4Y1EA 4AMGA 3LCJA 3QKRA 2ID9A 1Z2PX 5F2KA 4RADA 2IBMA 4LF4B 3COWA 5KQRA 3IRVA 1RMYA 3RYHA 1RZVA 3L41A 3RHSA 4URWR 3OZSA 3FOZA 1C9DB 4Q1VA 3KX2A 3AETA 2N1MA 1UADA 2OENG 3WHIA 2W43A 2OCLA 5FULA 3RIXA 3PBKA 3R9XA 3HZHA 2X14A 4UCVA 1T4CB 4A5UB 5E1OA 3COZA 2W58A 5L3RA 1X14A 1YTFD 5KVVA 1EZ4A 2WMDA 3I12A 2NZ8A 3ENVA 1VHWA 4K3VA 4JJ6A 5IYZB 4QBHA 4M8NE 1PKEA 5JSZB 4HGOA 3RHZA 2QOEA 2EBOA 3W4JA 2QLMA 2ZS7A 5ITZA 1O97D 3DL0A 4I2VA 2BUAA 1I7PA 4HXGA 1L7OA 3CRVA 3VR6D 2GEDA 3IDQA 3OFJA 4REOA 1NQUA 1LC0A 4D5EA 2FJUA 3TUZC 4CUKA 2WAXA 1GNPA 4NI5A 3OT1B 5C37A 3KU1A 4LZPA 5EJ5A 1HBJA 1QYRA 3K1JA 3ZDCA 2MINB 3UIEA 4QYIB 3RN4A 1KDYA 3L8GA 4JBWA 2C3OA 5ALQA 3RVOA 3TRHA 3K9FC 4LK2A 2XUOA 1B8VA 3TB6A 5KHKA 4CMIB 5LZ8A 3T61A 2JARA 1DIGA 1YWGO 1UJWB 4FGSA 1Q12A 3MJCA 3OPYA 4LC1A 2IS2A 4FD3A 1VKZA 2VHJA 3W4KA 3PC8A 5CX4A 4CMBA 2HMYB 2GO1A 1QVGU 4PR3A 1P0CA 2B30A 2ZXEA 3CONA 1PNLA 3T99A 2F1KA 4BFYA 2NZ2A 1PL8A 5GJVC 4GF5A 1Q7YW 4RHXA 5E4YA 4H3SA 5JAQA 1FQWA 3W04A 3RJZA 2XB9A 4DJFC 4IILA 5FNVA 3IHLA 1PRYA 1K66A 3ZU3A 421PA 3CURA 1HEYA 3T9AA 4PLYA 4ONEA 1V55C 4IL5A 3COYA 1PWYE 5DH9A 6ABPA 1AOXA 1AGPA 4C0JA 5KA5A 3R3UA 1Z25A 3TNLA 1NU6A 3GJ8A 1OXSC 1GO2A 3ABUA 4NH0A 2CTWA 5DJ5A 3CC8A 2NNUA 1V43A 1OBCA 2I1QA 2DHDA 4LXHA 1RRVA 3D6TB 1JJ7A 2WTMA 3HFSA 3K9AA 4ZDJA 3LUJA 3EF0A 2LGQA 1WZNA 3P9IA 3OMAB 5IXYA 4ZOCA 2J41A 1SXPA 3KJEA 4WZBA 3CRRA 1EFVB 3CCBA 5IY5C 1KVQA 3MGBA 1KC1A 1IZ3A 1SS3A 1KNXA 4ER6A 3PNQA 3V4LA 3BRQA 4AO6A 1JXAA 4K0KO 4IJMA 2GEJA 4R0NA 2F62A 2L69A 4DCUA 5CEFA 3RVBA 4BIMA 1AN9A 5E8RA 3AG3B 4W5WA 4GCZA 4MTCA 4XM0A 3GLSA 4A27A 1XTIA 1XZEA 3EQ8A 1HYHA 1VBNA 1N3LA 3RUCA 4E46A 1U2ZA 2X22A 1KO5A 5BN4B 1D2EA 4A6DA 4UTXA 4AMBA 2VHZA 3CUVA 3B2EA 2NO6A 2RNBA 2KBFA 2WG1A 3PDIB 4H7EA 3C3XA 1S8OA 1EEHA 2OHXA 2QY6A 4M9CA 2VUUA 2HJHA 1X1CA 2QVXX 3FCSB 3C3PA 2IY8A 2QN9A 3OWXA 1GKKA 4KHPB 2CF5A 2ERYA 4X9XA 1XZQA 1DBSA 4ZQBA 4M8SA 5D1HA 4BIOA 5HZHA 4P3NA 1V9SA 3W2GA 3EYAA 5B4VA 5KAFZ 1EFCA 4M0EA 2QIPA 4AKHA 1M6VB 3ENNA 2EW8A 2J3KA 4OQ4A 1WXQA 5JYEA 1A9ZA 1ULTA 4LE0A 3MBKA 5EAIA 5IBPA 3FDZA 3IP1A 4O4LB 3F1LA 2LQTA 4N48A 2QQGA 2R96A 3ZZMA 3O4FA 3GDHA 1ZCFA 4KO8A 3RYIA 2OKCA 1YS4A 5EXTA 4FYMA 2J5XA 1TIPA 1W94A 3ZE6A 1J8DA 1JFFA 4J76A 2Q4TA 2XW6A 3KB6A 3T7EA 4R1OA 2C95A 1Q6ZA 3CJQA 1LLDA 3EOZA 2XE7A 1YE5A 1P1IA 3YASA 4Z9FA 4CGYA 4JC5A 1MG1A 2GPTA 2NU7A 4MV3A 1G2QA 3IUJA 3TR6A 2VH1A 1ADJA 4PLCA 4N3GA 1FDRA 2VZEA 4MQ5A 4A16A 1PDOA 3EA5A 1GT6A 2BFDA 3RGGA 1NBMG 3GZTB 1NR5A 2OYCA 1EVZA 5A4MS 3EH2A 3E4CA 3CIOA 4KL1A 4J7AA 4KFUA 5JMWA 3B3QA 3UJPA 5ALDA 3NTXA 3FJOA 4EHJA 2JIZG 1Z4IA 2ECPA 3QEJA 2IU3A 1TA0A 4MTOA 1V5WA 3F46A 4XIIA 1JTFA 2AKYA 2IP2A 2XUZA 1LBHA 1ZOSA 2QD4A 1R6VA 4Q01A 4QOJA 3E5NA 4UNRA 2X8LA 4YR7A 1W85A 4JKOA 5THQA 2BEJA 3TD6A 1RXIA 2ZJ5A 1XCPA 2QJRA 2KKWA 1IU9A 4XPIB 1ACMA 2WLIB 1XL4A 2ZYVX 2X2OA 1K6MA 1GKIA 1XCMA 3H65A 1LK7A 2XKBA 4D3SA 4WV3A 2FFQA 4CV1A 2OP1A 1K27A 1NAIA 1B6RA 2YCBA 4MI6A 4E7PA 3MJRA 3QJGA 2PGGA 1E96A 5IAOA 2JHCA 1TAEA 3L7LA 1VSTA 3RF6A 5FPHA 3IHTA 4U3JB 4HZGA 3VMMA 4YMTA 5K2OA 4OG2A 4HNSA 2HIAA 2QVBA 4FWBA 4RANA 2LWIA 3P2KA 2IH3C 4GI5A 3KZKA 4DGQA 5B36A 2ATVA 4WCFA 5AI5A 3DR5A 5DV9A 4ZZ2A 4Q6BA 2IELA 3JS5A 3AVVA 1SOVA 2QE7D 5JAOA 2P4SA 4WECA 3O90A 1V8DA 3FUXA 2C4MA 4II7A 1O94A 3OJOA 2O8EB 4J2TA 3U56A 1IM5A 2FU5C 5JROA 1R4MA 4ABMA 1CU1A 2DBQA 2BEVA 4EHDA 3ELBA 4DCCA 4YMSA 4F92B 3HO6A 4FT2A 4OA8A 4H77A 1C9EA 1YXBA 1UWCA 1I94O 3ZW9A 5CCBA 4LQCA 3N6VA 1JQKA 3VGJA 4C20A 3TZHA 2ZQYA 1D2HA 4PICA 3V4OA 1WKCA 1K8AW 3T52A 5HK9A 5JCXA 1E3TA 2ZYRA 3EZ7A 2CJXA 4X1KA 2HGZA 3FLAA 4E4YA 2BFWA 1JHPA 2XYQA 4D4IA 3RKRA 1GQ2A 1NV8A 3RC9A 5CDUA 1QDEA 1OAKA 4RCYA 3DLCA 1VQPV 1Q20A 2QN6A 2BFCA 4P5DA 5ALJA 3NEJA 4Y6GB 2OTJV 4R8RA 4EHAA 4KBFA 4WJKB 2OO7A 5DNAA 3NWJA 4XD7A 4AG3A 4V0RA 1PWEA 3OZCA 4YV2A 4ENUA 3S2FA 4QE3A 4CE6A 2AHYA 2D5CA 5J1TB 4UCRA 1H3FA 1EM6A 4F6CA 3LGXA 3V1NA 4DLWA 2INGX 4M1SA 4NV1A 5ELLA 1OCEA 2RHDA 3P27A 1W0KG 1CNEA 3D6VA 5DMHA 3IAFA 3JQQA 2JKYA 2BL4A 1RP1A 3U4HA 3EFOB 2CN1A 2P6MA 4JY7A 3BICA 3A3PA 5F4BA 5ENVA 3N2KA 1S2OA 5TMPA 3DH0A 3AVUA 2JFQA 2R25B 4JNKA 3EHEA 1OZ0A 2GTPA 1N4AA 4NTXA 1QUEA 4M1TA 2GPNA 4IIGA 1LEHA 4JI0O 2YNMD 4D4KA 4YRAA 4AIRA 4KQHA 3JRXA 3L8CA 2VF7A 4BY9E 2PKEA 5ALVA 2BVNA 1MTZA 2JEZA 5TT1A 3E23A 2EIHA 3ZZ1A 2H59A 4BEJA 2OBNA 2R6R1 3G85A 5J9PC 4HQOA 3MINA 2IIQA 5C7YA 3L0CA 3A1DA 4FFKA 5ADUS 3FD9A 2ORED 1IPFA 2J85A 1IWPB 1M1XB 4C14A 2ZJFA 5AXDA 1E1MA 3IT1A 3JR7A 4AJIA 2OYSA 1QZZA 2Z08A 4XQGA 5GJBA 1UXGA 3ZNNA 2YZGA 1A2KC 1Y7LA 1C8BA 4EB8A 3LUBA 3NQ41 2CY0A 1T13A 3RARA 1J1UA 4UV9A 3O8DA 2HXGA 4P30A 3BM5A 4BNMA 3CG0A 2RHBA 5TR9A 3JV7A 5ALXA 3KQLA 4F96A 3GVIA 3AIKA 2OPBA 1XZ8A 1WSWA 4GLFA 1II9A 2FZVA 3C43A 3VU0A 1E1KA 2IYYA 3ZW7A 2Q6OA 3LTEA 3FH0A 4PN3A 5JIBA 5KYXB 2MSWA 1NI4B 5I7RA 2Q4PA 2CZGA 4DUYO 1E5DA 4L6CA 5KWSA 2Y1FA 1UXIA 3M4XA 1FX0B 5JMOA 1R8QA 2C57A 3ZH2A 2ODPA 3LH5A 1ONPA 4L0QA 1YJ9V 2BUBA 1H38A 2IUFA 1FUYB 3B53X 3VU9B 4Q15A 2XYGA 2YJNA 1GADO 3OF5A 2L19A 3E03A 4BWAA 3OZDA 2J5KA 2VK1A 4F4JA 2PFKA 1PFKA 2FW8A 4MWZA 3CLRC 3WGJA 3GRKA 2AI2A 3VH4A 4FEYA 4OIFA 2HZBA 3NTLA 5AI8A 2J4DA 3L7NA 4MLPA 1VPVA 4DMCA 1BA3A 5FBHA 3AVOA 4Q19A 2R8XA 4PZ0A 4DUPA 2ODQA 1RI1A 5CDYA 3DULA 3SF8A 2DMRA 4PV1B 4DADA 1ZGZA 1YT5A 2EKLA 3QUTA 3TECE 3B3GA 2WYUA 5LBIA 1UDRA 4H1WA 1JQEA 2R7LA 2YWBA 2L82A 4R05A 3CUTA 3V6MA 3UO3A 1QVAA 1V25A 4DY4A 2XGGA 2XKKA 5HBRA 2IUSA 1TEZA 1VFNA 3TQSA 4QPJA 4MH0R 3GHYA 4DPMA 3K2EA 1R3JC 4B71A 2FWBA 1JU9A 5A4KA 3W2EA 4QXRA 1JLLB 4BAZA 3O4VA 1ML3A 4HN2A 4G9EA 1S2LA 1G16A 1IBLB 3QGMA 4BATA 2PH7A 3E8MA 4QGGA 3BMQB 5ALFA 2H51A 1CZUA 1ZG3A 4M0MA 4JD5A 2ZBDA 3BK7A 4L1KA 4YWHA 1NKSA 2GHQA 4PQRA 3UT5B 4PZAA 1LX6A 4BP9A 1VQMV 2J0UA 3ML1A 3Q8LA 4HBGA 2E1RA 3DC2A 1E6EA 5JD4A 1ZD3A 4RKRA 1E99A 1XG5A 2GPWA 1UM9A 1YR3A 2FUNB 2ZPUA 5FNVF 1NFRA 5KTRA 2P1RA 4BFXA 4GMDA 4B7CA 1OX4B 1OH5A 1TJ4A 2EILB 3OZTA 3SYMA 2QRZA 4Q3BA 3W5UA 1AKQA 1IEXA 8ABPA 5EBMC 3IFXA 1SVKA 1OJLA 1U4SA 5A9RA 2Z6AA 1YS7A 3UPDA 2BBTA 3WR5A 1ORWA 3HP1A 2JGLA 3WIUA 4BO7A 4N0EA 3QPAA 5DCLA 2GGSA 4TV9F 2QMEA 2DR0A 2OCCC 4IDNA 1T5DX 3IV9A 2RHHA 3V2GA 4BWYA 1HDEA 5JHGB 2PUSA