3E35A

Actinobacteria-specific protein of unknown function, sco1997
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
269
Chain Sequence
b'DPQDLYTWEPKGLAVVDMALAQESAGLVMLYHFDGYIDAGETGDQIVDQVLDSLPHQVVARFDHDRLVDYRARRPLLTFKRDTWSDYEEPTIEVRLVQDATGAPFLFLSGPEPDVEWERFAAAVGQIVERLGVRLSVSFHGIPMGVPHTRPVGITPHGSRTDLVPFEEAQVPGSAEALVEYRLAQAGHDVLGVAAHVPHYVARSAYPDAALTVLEAITAATGLVLPGIAHSLRTDAHRTQTEIDRQIQEGDEELIALVQGLEHQYDAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SCO1997
publication title Structural and phylogenetic analysis of a conserved actinobacteria-specific protein (ASP1; SCO1997) from Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Unknown function
total genus 85
structure length 269
sequence length 274
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e35A02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e35A01
3BY6A 4HAMA 1S3JA 3E35A 3IC7A 3MNFA 3W7WA 3W7UA 3WZ2A 3D3IA 5CA3A 3GAAA 3W7SA 1RM1C 1NH2B 3W7XA 3W7TA 2HR3A 4G4SP 1YTFB 2P90A 2WAMA 5GW7A 1NVPB 3VR0A
chains in the Genus database with same CATH superfamily
3ROZA 4B84A 1TDJA 1EXWA 1LD3A 4OX9B 2Q5CA 4HEQA 2BMEA 4BS9A 2PGLA 4O08A 1FUKA 4ZO8A 2J5QA 1SZJG 1XD8A 4J0CA 4AUMA 1B42A 1TM1E 4QQKA 4P0QB 5EP3A 4ZT3A 3ZHXA 5C3MA 4XM0A 1BHO1 1E61A 4HGOA 2ECOA 4TTJA 3VZDA 2J5RA 4IDEA 1BQ0A 5KJEA 3TNFA 1R8JA 1XZCA 1V1MA 3R3SA 3CT6A 1ORTA 2EGGA 2N04A 2I80A 5JTTA 4MUGA 3GEMA 2QQEA 3H8VA 3BH7A 3H8WA 5L40A 1ISFA 3JQ8B 1WTAA 1P8JA 3BAZA 4EECA 2W6IA 4KSYA 4YQYA 3QLVA 2Q8NA 4U7WA 4AJ9A 3BMOB 5G4KB 3M82A 2CVZA 1OCZC 1PGQA 1NKSA 3QM1A 2FKNA 1TCVA 1VXOA 2HRBA 2RCNA 4M0EA 3DTVB 3LHSA 4ZHQF 4M1SA 4DSNA 3FTFA 5ALEA 3GRUA 3IOYA 3IUYA 3ZU4A 4YQEA 2QMYA 2AFIB 1PT6A 4EGCB 3C41J 4AC9A 4JXKA 1W88B 4AJLA 1LSUA 2EV9A 3OQJA 4U7FA 1NGSA 2UDPA 1Z08A 2GPSA 3KFVA 4ZMRA 3PJDA 5AM0A 5KUMA 2XT9A 1Y4DE 4LECA 4GVLA 2G80A 4RQTA 1EPUA 3MJCA 3T5TA 3GA0A 3A0HZ 5JWHA 3WL5A 3S1SA 3VVBA 5LQAA 3PLRA 2IP2A 3FF1A 5DULA 4JEUA 3VAAA 1CC1S 3DGEA 1TUEA 1JQBA 5HBRA 4URFA 5C8YB 4UBKA 4HXEB 1OJLA 1UMDA 1CZUA 3N5KA 3ONFA 4TLLB 1WBJB 2AXPA 2QLBA 2YRFA 2VSXA 5JDCA 3NR7A 4NWIA 4BDTA 4NNJA 3KJNA 2XOXA 2NTVA 2Q4OA 4O4LA 2OKCA 4HXFB 1L1EA 1C80A 1UPCA 1QO0A 2BD0A 1P33A 4DLAA 1EZ4A 1NRIA 1E9VA 4ZCMA 3QUBA 2HMAA 3ICXA 4EPRA 3GFTA 3IHKA 1RSOB 4CCAA 5IK2A 4KWEA 5CH3A 4IV8A 2FN8A 1J5XA 4DVJA 1OFTA 1NR7A 1R9MA 3LDUA 1MA0A 1D4ZA 1KYWA 2VS1A 3M3PA 4C4PA 1PJAA 3L6EA 4GVXA 5AVOA 4OMFG 1WULS 1OF1A 4ZV4A 4EAQA 1MLDA 1E1QA 2QZ4A 4GU5A 5DOVA 1PDWA 2DFKB 3TD9A 5BRJA 1W87A 5J4KA 3EDRA 2R7MA 3SSNA 4JKYA 1XJ0A 3ZBPA 2H11A 1VIYA 1Y9JA 4D82A 1GNLA 2R84A 5C32A 3PL5A 3KJFA 4QXMA 5E3HA 4AS1A 2C31A 3BSSA 6LDHA 2HEGA 2E21A 1SZPA 1YRWA 2BGKA 2QR3A 3UM9A 3GJZA 1W36B 2WMNB 4HGQA 4Q37A 4Z4EA 3P30A 4BVHA 4ZYXA 2BTQB 2EFEB 2J3EA 4RE6A 4EF5A 2VPXA 3UH1A 4TKUB 1Y4ZA 2ZSIA 3THRA 4B3FX 5LN1A 5J58A 2PWYA 5JNTA 3MMPA 2L6LA 3MTJA 2O3JA 1RYBA 2A5LA 3FN4A 3T5CA 1ONOA 4KR9A 5FADA 2F9MA 4QG7A 1UKVY 1D04A 3RIMA 1AQNA 3AIIA 4PONA 2JASA 3VPBA 4ZD6A 3SP1A 1ZK2A 4OFWA 2XDQA 4JC0A 1XQYA 4PBRA 3PNQA 1ZO8A 4H4DA 1BKSB 2X0KA 2Y76A 4GPD1 2HF9A 3BXZA 4Q1AA 4YNBA 2DPMA 4YAKA 3AOEC 1XL0A 2ZZKA 1VHWA 5B3LA 1I4EB 4GQAA 4PR3A 4OQPA 3OQVA 3INTA 2WFZA 4MXDA 3NQ41 5BY1A 2HX1A 5KOHB 3STUA 5DP2A 1ZIPA 2NSJA 3FDJA 2VTBA 3T0IA 3FVQA 3TPFA 3RYHB 3HCCA 2VEOA 2EX1A 1UBHS 5DGCA 2V4DA 2H48A 1GQFA 2XXBA 2JFXA 5CFPA 1RXWA 2C98A 3W0LB 2I2DA 2EP5A 3IQHX 1HL7A 1CJVC 1IEVA 3HDHA 1GT91 1OVMA 5JD6A 3BCUA 2F17A 5CD9A 3KKQA 2UYYA 2IRWA 2KW5A 4NOLA 2H00A 1QO0D 1CJSA 4RVDA 1Z6TA 1LB1B 4GZRB 1SU6A 1ZM2A 2MR6A 4MS1B 3LDFA 2JI9A 2ZULA 5IRCD 2HSEA 5LOVA 2HVKC 2PRKA 1G2IA 4C88A 5EMMA 6AT1A 3A6DA 3MK31 1U94A 4B2LA 2NIPA 1OROA 5IZCC 2W4QA 2QJWA 5JUWA 1SH7A 4RGQA 1E1QD 1ZL0A 4LTDA 1PL7A 3ZN1A 1EE1A 3WO1A 2HMUA 5D7NA 3JRNA 4RMJA 1KH2A 1MRNA 1N5DA 1H2NA 1NU1H 3SBXA 5ELLA 1RJGA 5TF0A 2ZT8A 1P9RA 2BEKA 2ARHA 3N3AC 1NI8A 2ZG6A 2RH9B 2FWAA 3HJTA 4F97A 2DFVA 3OTWA 4CUKA 5I9LA 2QORA 4A73A 1VHJA 3O84A 4Q1EA 1P7GA 1VQ1A 4AUEA 2CFTA 1J8FA 2AMYA 2ZWPA 3EVZA 1N33B 4IX9A 2E4YA 1Z22A 3QTBA 1HKUA 3GQBA 3GRRA 1R6KA 2OHHA 1N5OX 4PD4F 1FUYB 5HG0A 4I50F 3BHJA 1N5MA 1TJ5A 4A23A 5EMLA 4B43A 3HO6A 3QJ5A 4ZI3A 3TLGA 2P8SA 4R3NA 1Z6GA 1BDBA 2CNNA 4HWRA 2GBFA 2XE6A 4RVNA 4KJXA 3A26A 1EP9A 1SB9A 4LMAA 3W7AA 2C5BA 4X20B 1F8YA 2NT3A 2IDJA 1L5MA 4X84A 2VCHA 3PJEA 3R5SA 2OT3B 4ZCLA 1W49A 4FC7A 2IXEA 1KKLA 3ZBTA 2Y2UA 4TLCA 1OGYA 1YKSA 3NOOA 1WPRA 2X7HA 4W9NC 2N1MA 4DDTA 5HQJA 4MR9A 2RONA 4C7MA 1XZLA 4IG9A 3JAMN 3EARA 1SBNE 4PYQA 3EXEB 3AFOA 3K5IA 3CCFA 1YBHA 5B2EA 5JALA 2IYVA 5G53C 4D81A 3PLAE 2QEXV 3VR1A 2E9SA 2WT9A 2CKMA 4A27A 2A5GA 3WGOA 2O7VA 4CH4A 2RIRA 1MMFB 5HMLA 3C3KA 3SN6A 3R3YA 1SRRA 2R4QA 2WTAA 5EHNA 1H9CA 3FZNA 3VZQA 1MC1A 5AMXA 5IU6A 1E6WA 5AJHA 2W42A 1QHFA 3KHSA 4GP9A 4C4XA 1G3UA 2R97A 1Z4QA 2WIFA 5EJ6A 3HSYA 5C7LO 2IDKA 3RFUA 4X8MA 3UQ8A 5E1BA 4BPBA 5J5CA 3M9LA 3KOWA 4I6EA 2PY5A 3CRZA 2HB6A 3DG9A 1JA0A 4BLWA 3CCQV 4EMTA 1U3CA 1RQ2A 2C42A 1MXHA 3K08A 4L02A 2VYQA 2GAFA 4P53A 1JDTA 3IJPA 1E7YA 1OZFA 2O7QA 4DG8A 2IF2A 5KC9A 3I83A 1D7AA 4JLWA 3LWZA 5JZMA 3G7NA 3IAFA 1QDLB 3ON5A 3WL7A 4CIAA 3MBOA 2X22A 1DGSA 1E3WB 3GWZA 5JMWA 2B34A 1PF7E 2WUGA 4GDMA 3OFNA 1OCOB 4OXXA 1A4IA 1OXBB 3IRUA 2AG6A 4KHPB 1HX7A 2WWIA 1Y74B 4DMKA 2KI5A 4HQKA 2PUCA 4A4DA 1TM4E 1N9ZA 3CC8A 3EISA 4TVSA 1NJSA 3E8SA 4KTTE 5HUHA 3LO8A 1T8RA 3FDIA 4P3NA 1P4RA 1QV9A 4HB3A 1VB3A 3JVVA 5CJJA 3PQEA 5EIBD 4N18A 2PH5A 1SXJC 3SYMA 2IS1A 5LVAA 2W2TA 3CPEA 1RCFA 1FRNA 1N9GB 1CUDA 4UNPA 4ZRNA 2VZ9A 5JJBA 4ILKA 3NVMB 5JPDA 1DJPA 2FJUA 2OFPA 3GLTA 4OXKA 1LH0A 1ZU4A 1JPXA 3D2CA 4Z2WA 3A6EA 2GBCA 2I62A 4YAUA 4MYSA 4L8JA 5L7WA 2YASA 4NZNA 3SS8A 3KJZA 3ZWXA 1EWVA 4YAWA 1Q43A 1YIOA 4R69A 1GKKA 1GRJA 2PKCA 2HLNA 3OE7A 2RHDA 1AS2A 1GA4A 1OWMA 1NW8A 2OK7A 3JPWA 2FW0A 1PR0A 1GCAA 2FPSA 2XNDD 1DADA 2VP2A 3I30X 2DC1A 4RZUA 4C0HA 4BWGA 1P5JA 1RYDA 2A0WA 2HA0A 1QYDA 1YRQA 1CUFA 1UJBA 1T9AA 2ENWA 3HDVA 3WWPA 4RVHA 2PS0A 4I9UA 1Z0DA 4LMBA 4QUIA 1G6UA 4ALNA 1MFZA 3AR9A 4CGYA 1R73A 5BNZA 2A67A 5IDYA 3KT6A 2BZ0A 4C6RA 2FX3A 1VJCA 2Y93A 3O9ZA 2JS5A 1K4CC 2F8TA 3GPBA 3BSYA 2FAXA 5DLEA 1RPTA 2EHDA 2I55A 4XIGS 3QYPA 4EI9A 5EKSA 3QKRA 1XZPA 4DCMA 1ZPDA 3C98A 3OMIB 4ZGGA 4YJKA 2IYNA 4TSFG 2I54A 3MTQA 3SKVA 5EHXA 2RSLA 3PEEA 3CUEF 3MSCA 4K9NA 4L08A 4NEHB 1ZC4A 5KC8A 5IX8A 1ESDA 1U5CA 5KTTA 1VIDA 3M3HA 5EBWC 4KPEC 2OB1A 2P77A 5KHJA 5HBGA 1E4OA 2V97A 3OFND 1JPJA 2CMGA 3I9OA 1GY8A 1GN2A 4KPYA 1AI5A 2HDNB 4KQ9A 2QM0A 1H0KA 2WYUA 5K4AA 3FPGA 4YRJA 5JD4A 3RUDA 2BI7A 4EJSB 1NN1A 2UVPB 4W4KA 2NVOA 3LL7A 4JUFA 3T7JA 1I4WA 4KFTA 1KYQA 3ZW8A 1DKRA 2I4NA 5D87A 1USGA 3ENNA 3V55A 3W6ZA 4JNCA 4GR5A 3LUBA 1VSTA 2PS9A 1PIWA 2VAPA 2ZFUA 4RJTA 3GEHA 1E58A 5DDIP 4IX1A 4ZOQI 4W6ZA 3PXEA 4GRIA 3A4LA 4TLEA 3L9DA 4PAOA 2OXCA 3KALA 3WZ2A 5IAEA 3M4XA 2IVZA 3QPCA 2HCRA 1P2DA 1LBIA 5JCOA 3V8BA 3MYRA 1MH9A 2HK7A 1WA8B 3F6YA 2ZIOA 2O8DA 4YMWA 4QSMA 1XO1A 5GZ6A 1QGUB 3NBAA 5CBPB 4TRRA 5B1DA 1F7UA 3DE6X 1HE8B 4X8LA 5CA0A 2VK2A 5LBIA 3UWPA 4IO1A 2ID4A 4JI5O 4HH0A 2B61A 1LC0A 3LQ4A 2DPHA 2GHIA 3NO4A 5GV8A 4LV8B 4B76A 2AHYA 3C6XA 1J39A 3FH0A 4EMSA 1S3SA 3RS7A 4UPVA 4UHHA 1F8XA 3I6MA 1DBRA 4RVGA 2G6BA 5HNKA 1Y6FA 1JDJA 3SD7A 3HSSA 4MV8A 4NZOA 5MGBA 1V9LA 2CUGA 3ABRB 3LQ2A 4S2EA 3TJZA 4GI2A 2RGGA 1WHSB 4IIFA 4CIDA 1R3UA 2YIJA 3C3CA 5CJPA 3OJ0A 5AVWA 5IJ9B 3JATB 2QRQA 1V9CA 5BPFA 3JQ9C 1ZJZA 4KYVA 1DJQA 2C2OA 4YDHB 4HEHA 3ZN0A 4NBLA 4MVOA 3CXCU 3T5PA 2DE0X 1L7OA 2JGNA 5DYGA 1U0GA 4B7EA 4PRKA 3S1LA 3N7TA 3Q3IA 2QTWB 4RJIA 1E0KA 3KS9A 4G8BA 4WLOA 1AN9A 1F0NA 3GYBA 2VA8A 1AKRA 3MCTA 3BTUA 3IIMA 2RHGB 3ZE9A 1EHYA 6REQB 1NNEA 3ICWA 3V4LA 3RWOA 1ZCAA 4HZUB 3HNOA 3BWDD 4BVEA 5AOCA 4DVGA 1E3QA 1MC5A 3Q87B 3C1TA 3OURA 3H2GA 4XIFA 1KJNA 1Q7GA 3OX4A 3IBYA 4HEA6 4MTFA 1OA0A 2UYHA 2WF5A 1K8YB 1GNTA 2YEVB 5JHHB 5AXDA 5CVDA 2BR3A 1QRRA 2ZYDA 2ILVA 1KYXA 2XHEA 3MWEA 3ZY3A 2PKXA 4YLGA 2XKKA 3SDSA 2VUHB 4RH0A 1C0KA 3TINA 4LXYA 4Y2QA 5BY2A 3TE6A 2WJGA 1M5IA 2R1VA 1SN7A 3OZCA 3TDKA 5C7YA 3MPOA 4IXWA 5AW0A 2PX3A 3HCNA 1WZEA 2QDKA 4TQUS 2XCIA 2AHOA 4WXHA 4MMZB 3EY4A 3MGBA 4BP1A 1EB8A 1JB1A 5CCXA 1QYVA 3BEOA 3E03A 4MI1A 3U40A 2C92A 2PGXA 3W4JA 2PJRA 5DLDA 5IFKA 4F56A 1WZNA 2IHKA 1SUDA 4L85A 3BWBA 3H1TA 1MQ9A 2WJIA 4GNKA 5DP1A 2A7WA 2HJVA 3I62A 1LS6A 1RHMA 5CVEA 4ECAA 1C81A 2WMOB 2P2ZA 4HX5A 1DJMA 1GTRA 1ES9A 2Z5GA 4IJVA 2FCRA 5SZJA 3TZQA 3D0KA 4X1IB 1OJHA 3G5AA 4I5DA 3RLFA 4ARBA 4EARA 1KJZA 5BQ3A 2FSPA 2XV1A 2DFDA 5D5QA 3ZWVA 5FEUA 4MWEA 1W0JA 2KG7B 1FNSA 2XSZD 3UKMA 5CDGA 2PUFA 2XW6A 1NQAO 4JUIA 4EFDA 2H4YA 2NU7B 1XQ1A 4DA4A 3AJRA 4TZTA 1JEOA 3PKIA 2IXBA 2PR2A 2CUNA 1QH1A 5AK6A 1GL6A 1P7PA 2XB4A 4JSYA 4KQMA 4O63O 1YJCA 1I6KA 3R6LA 1SBZA 1TJ4A 1ZA2A 1EZVH 3T5DA 3SBEA 5EIXA 2WTNA 2ATXA 2AHZA 3MCAA 4K1LA 4DA6A 3FRIA 3VA7A 4PNZA 2BEVA 3KAPA 4CPDA 3B8MA 5B1AC 4U63A 1BSMA 4B6SA 4E5VA 1G16A 2ZTVA 1X1EA 3FPJA 2FJPA 4O6VA 2Y77A 2DBZA 4FCVA 3OZFA 1L4LA 1YH3A 2DWCA 3G5UA 3WNQA 4IKPA 4ZA2A 4CM1A 3IJ5A 4MI9A 1F1JA 3KO8A 2ZRDA 1AHPA 4YJ3A 3R0VA 3FYUA 2CD9A 1WMDA 1IZYA 1EGAA 2J5XA 2ZIVB 1VB5A 1KC1A 4AN4A 3NDPA 2HBYA 3F4LA 3ZDCA 1ZC3A 3OPYI 1R3JC 2M6LA 3EUAA 3JASA 4QTZA 1HNZB 4H0NA 4JCOA 4H44B 3O1IC 2GUGA 2AZDA 1QIJA 2PSJA 3U2QA 2IOYA 4BX8A 2QMEA 4UAVA 1M0SA 1FYFA 3T61A 2QGNA 3VJRA 1O08A 2EJUA 4B3DA 2Y6VA 2XQJA 1COWG 2DU8A 5LGNA 3OPNA 1KWGA 3BJRA 3ZMUA 1XQVA 2BM0A 3DHNA 1ZWLA 5JJNB 3A4TA 2KS6A 4ON9A 2BHSA 1O54A 5HDBB 1M0TA 1JECA 4UCWA 5GZ3A 1PZFA 4NC9A 3JY6A 5HP4A 4FMCF 3WDKA 4LG1A 4QQRA 2ZRKA 3OCZA 2ZP1A 4MB2A 5ECWA 4YRGA 2EU8A 4PLFA 5BN3A 1EP2B 4N0MA 3AVYA 1Q77A 1JVSA 3DXRB 4IFEA 4EKNB 1L7BA 5HKBA 4PDRA 2ATIA 3VPSA 3RI3A 4F6RA 1GZVA 3DMPA 1AK9A 4DADA 3OJXA 1TLTA 2D7DA 4WF9V 4HADA 1W0JD 2NXNA 3T7CA 3HA5A 1BS9A 1VL6A 2R44A 4IRXA 3MINB 3ONDA 1W76A 5AWFC 3GCZA 2GR9A 4V39A 1MX5A 3VDXA 3MXOA 3AB3A 1YULA 5KS2A 3ZRXA 1ST2A 1SUCA 4WKGA 2YFQA 3RHFA 3L0DA 2PKWA 5T4EA 4ABMA 4E32A 2W8BA 3V4OA 3ETHA 1JJBA 4TT3D 4U6NA 2BFFB 2ID8A 3IA7A 1TPYA 4PBSA 4DA0A 1F2UB 1E69A 2NZVG 2O07A 4I5IA 3ENZA 1PWEA 2BKUA 5FIUA 3PX7A 4V1CI 1Y63A 5FPHA 3RKRA 3JALA 4CXMA 3NI2A 1LC3A 4I4LA 3MBIA 2XQIA 2PUBA 3EZXA 2CXHA 3KTAB 3ZCSA 5EJGA 2P6OA 5A5EA 1QH8B 2ZXWB 1Z5UA 5AJVB 3IVGA 3GO4A 3NOXA 1BD4A 3I1IA 3R7WA 2JZCA 2R25B 1P1CA 1P7YA 2L69A 4ZT7A 4DR2O 3JQAA 3ILVA 4IXMA 4JI4B 1SUIA 1K98A 1PVOA 2IBTA 4QLOA 4FKMA 3OEHD 1OLXA 5FO1A 5J4LA 5GIOE 1TJPB 3S2GA 2C7BA 4GCZA 3SF8B 4X6UA 2Q1UA 3RVLA 1JT2A 3KVRA 1ZMTA 2QWNB 2V5UA 4ND7A 1Z34A 1DHRA 2Y1WA 4HDNA 2LO1A 4ER0A 2D7JA 2IKSA 5IW8A 1W0KD 1ISRA 1VMEA 2ZQZA 3B8EA 2PBLA 1C5KA 2WLNA 4IHQA 3WMXA 3OKAA 2QRKA 3K3PA 5KVCA 2X0FA 2GJSA 2XD4A 4F9EA 1BQZA 1QUFA 2G9ZA 1WSWA 1XI1A 1CT9A 1LUAA 3GVMA 3MFYA 3HUEA 3D3WB 2CVPA 3V8NA 2B2CA 5JY6A 3N5CA 3QXXA 3LFHA 2ZYTX 3NHUA 2UUAB 5IT0A 2FPPA 1K63A 3HJUA 2MSDB 4E5UA 2KX7A 4WJZA 5EWJB 1TU0A 3D8TA 2F3SA 3GWGA 1BGVA 3KHKA 4MWZA 3G85A 1R6DA 3HCEA 1YONA 5EJFA 4OK6A 3ZWWA 1NE2A 2CZQA 2WUWE 4K03A 4LX8A 1RLMA 3VYVA 4QXRA 4M54A 3ADBA 2GAAA 2PO5A 4LYGA 2C4WA 5KA6A 2DQYA 3VTKA 5B37A 4HMPA 2C5SA 4FSDA 3KELA 4CMEA 5D3MB 5BXZA 3ULKA 2N3ZA 1A71A 2JJ2G 4LF8O 5A9SA 5F23A 3LUPA 4HPXB 5ALJA 2BTEA 2VWJA 1DOAA 4D2IA 4BEWA 4EW3A 5GIPE 2BUAA 2J5BA 3Q1LA 2V0CA 4RHUA 1UT8A 1Z75A 4DMCA 2X3UA 5I9NA 3FMOB 1YE8A 4WA7A 2ZQMA 4TZKA 2YVKA 2D2VA 5E8JA 1NVDA 1B3BA 1B0PA 3IIJA 5LP1A 4O4HB 1KI6B 1I2ZA 3IGAC 1SBHA 3SZLA 1RI2A 3RBXA 4Q24A 3LRPA 1DKUA 1PNMA 5HRCA 1SBQA 2DFPA 2VNKA 3FROA 3X43A 2G3YA 4Z3OA 1S76D 2QSJA 3PGVA 1H0HA 2Z1MA 3Q5EA 1TVKB 1YXMA 2QA5A 5FJJA 3TW8B 1QUEA 1P80A 1T4MA 5LP6A 3BIOA 1T4GA 1LPBB 2XADA 2LV8A 3HXPA 3R8FA 4K9DA 4RMNA 5HF5A 3L0ZA 4ZWNA 1QYXA 1IL0A 2A78A 1UZAA 4YO8A 1U1DA 3SK0A 4WDQA 2GCPA 1P18A 1FX0B 4DTIA 2XXJA 4JLKA 4ISBA 3ZIAA 3IUSA 4FSHA 1YBFA 2ZIFA 4LYYA 4GKKB 2Z30A 4ZJPA 3CF4A 1NYQA 2ACEA 1A8UA 3FKSD 5TMPA 5JDIA 1RMTA 5KYUB 1RQXA 2NU9A 4C0XA 1O5TA 1XTIA 3NM4A 3TQTA 3AKDA 5G0VA 4JI1B 1O5IA 2XQFA 2YRWA 4BNNA 1SG9A 1ZD1A 3OIYA 2RGNA 5F5NA 4MB0A 1M2OA 1ZCJA 4HDQB 2OYQA 4LDRA 1W8IA 1ADYA 2OBNA 3ET5A 1GGKA 5M2QA 5BN5B 1KR5A 1KMIY 2WW8A 4EFBA 4QU9A 5JAQA 1GEGA 3QENA 2BGRA 4NVPA 4NYMR 1JAXA 3I0MA 1XD2A 3GGOA 3HL0A 4J90A 3LVFO 1GPDG 1KE2A 3DFUA 2QVLA 4PVDA 4OH1A 4BW9A 2NNUA 3BIXA 5FUVA 3USZA 4FGUA 4KC0A 4AJEA 4BXOA 3QE2A 2FHSA 2W6MA 5KINB 1RJEA 4OGLA 5EYPA 1FNBA 4B87A 2JK0A 2EIJB 4H0FA 2WA2A 4JJ8A 4OHCA 4CN9A 4MVJH 1S8FA 1UPTA 1ZM3A 2KSDA 3UG6A 4YFYA 5LUAA 5DIFA 3OUFA 2GXSA 4GICA 4KXXA 2MOKA 3ORFA 3AI3A 3NTUA 5G1PA 5CX1A 3QY0A 4ZDIA 4K6GA 1KZYC 1IB6A 3DXFA 1NQXA 2UUAO 1ZWKA 2C0CA 4YRMA 4K87A 4YCCA 1FTWA 2XAJA 4MWOA 1OPXA 4D9JA 4PA6A 1G8JA 5F3RA 1EVEA 3ESYA 1GRCA 1J25A 2J5KA 1T2AA 3GJ6A 3TKAA 1TQHA 4GMGA 4Z1MD 4XVRA 2Q3EA 4TXHA 2MMGA 1G9SA 4JTCB 4X89A 3SEFA 3HE3A 3K6SA 3ZDAA 3WGZA 3CVWA 4G25A 1YF3A 1JR2A 2FXVA 2HLHA 1GZ5A 4WZBE 1JA8A 3RBAA 1K68A 4CT4B 1VE3A 1PR5A 3T5GA 2GYUA 2CFSA 3MXTA 2N75A 1XPOA 1HKHA 3MIZA 2NU6B 2WZQA 1PAUA 3TTWA 4HATA 1F4PA 3W7TA 4IQ8A 3ZIAD 4MDEA 1ODKA 5CIWA 3CIOA 2WLJA 4IDQA 3CVOA 3PSAA 4FGSA 4JGGA 4FOLA 3R8CA 1D2DA 1WXXA 1E77A 5MN4A 2Y68A 2Q3FA 3H13A 3S27A 5BV8A 1X1AA 4UV8A 4ENUA 3I3OA 1L1RA 1SUSA 1L4MA 2VQEB 1BZKA 2GPBA 4FR0A 4CKEB 2A5YB 3C5VA 1WDTA 4ESVA 3ASYA 4YCSA 1UXOA 3CNOA 4WHMA 1WEKA 3ZTTA 3UHJA 5T6BA 4OI0A 4BYMA 3TN7A 4HS4A 4JBXA 1JQDA 2ZRQA 2Q1SA 1FFXA 4KQWA 1PVVA 2XD9A 4RCYA 1L5HB 5JQGA 5IAJA 3T9DA 5EMJA 5BMVA 2FEMA 4IGFA 2FFAA 5J2TA 1KC3A 2WVGA 3IFXA 2XCUA 4BJHB 4I4IA 5HEKA 1XV5A 4E5YA 1PEAA 4NK5A 3EVAA 2Z4SA 2FPRA 5LKRA 2F9LA 3UK0A 5JAUA 3CCRV 3KE8A 4MVCA 4CNQA 5HFJA 3J7TA 5IMSA 2ZTUA 1RI3A 2VKTA 2DYKA 2KB1A 1QTRA 2QNRA 1LFDB 3B3GA 3ANNA 4L51A 4DXWA 1UFQA 2W48A 2IYXA 1MNQA 2OBMA 2UUBO 1JR9A 5F7OA 5DI3B 2J0EA 2OIGA 3GU3A 4Q5IA 1P4AA 1XZBA 3LDAA 3GC6A 1E60A 3T4ZA 2A9RA 4P98A 2BFBA 3H5RA 3KQQA 4JKIA 4PCAA 1KA9H 4PTZA 1ECGA 2A5FA 3IX7A 1YI0A 4B6QA 3F74A 2I3AA 3T5MA 1MO6A 2QUIA 1KO5A 2PH1A 3Q7IA 1L4GA 1SPXA 3FCEA 1J95A 3S44A 3DJFA 3GRFA 4I7ZB 1FY2A 4KSBA 2BFDA 3HB1A 1Z5ZA 1N1GA 4C3VA 1Y7HA 1V41E 1BOOA 5LYJB 4UARA 5LZ8A 3IQWA 4JLOA 1Q16A 3KL4A 1NURA 2JIMA 3QBEA 5IAAA 2QX4A 1Q7YW 4AP6A 1QJCA 1XUOA 1IRXA 3IB6A 4RELA 3ICCA 3E22B 5TGZA 1VF6A 2XT6A 3PA6A 1VHDA 5AKXA 3R7DA 3WQSB 1WUYA 5DT2A 1GV0A 2CLMB 2L82A 3IE1A 3F0TA 4M0DA 3EE6A 2ZXUA 3E8GA 2VRWA 2F3UA 2H1VA 4MVJD 3MMSA 3M5PA 3ZK7A 4YIPA 4OHYA 3TKYA 3TX2A 3SZRA 5DTIA 1TO6A 1FFBA 3CO0S 2ZNIA 4C03A 2J0VA 3WLMA 3KT0A 3K1YA 1SKVA 2VZ0A 5IUKC 3OZUA 1C0IA 1F8FA 1W6RA 4OJMX 4XRGA 1ZL8B 1X9IA 4JT4A 1PJQA 3D1JA 1U0TA 3UAWA 2MT9A 4QYWA 3I2KA 5KQSA 2K2QB 4BO8A 4BO6A 3EGEA 4WX2B 2Q5HA 2JW5A 3UUWA 4ESOA 2IHNA 5C31A 2QR2A 1L7RA 5FWNA 1UOQA 5H5JA 3LV8A 1J8DA 4KW7A 1NXXA 1M90W 3EF1A 3G2NA 4F5EA 5E7QA 2FOIA 1NTOA 5C5IA 4YJGB 5IVHA 2KSQA 3VPFA 3B2NA 2FWNA 5EZ5A 2HWYA 3Q7QA 3PPVA 1NVWQ 2EINB 4PM4A 4LPSA 2X0JA 3R5JA 4Y6OA 3ETDA 1DQPA 2K2WA 1KU9A 5IF3A 5K1ZA 3BF7A 4CH5A 3EHBB 1X13A 4NNPA 2ASEA 3QIVA 1I7PA 1IRIA 1SQ0A 2Y99A 2BY4A 2JBWA 2BFAA 2C4MA 4C5AA 1P0CA 4EG0A 1DXOA 1UJ4A 1JFRA 2AOVA 3KYCB 3RPEA 4ZYVA 1A76A 4DDHA 1UDAA 4TWIA 3ISTA 3ZPXA 2QRHA 1B41A 2O57A 1JT9A 1Q15A 2ORIA 1J33A 3DT6A 1KF0A 4IIBA 4ZK6A 1ONBA 1Y33E 3RUPA 1AROP 2OBFA 2WVHA 4BDSA 1A2BA 3HU2A 5I9TA 5G41A 3NKLA 4J7JA 4MWSA 1AK1A 3CWBH 1SD2A 5KNBA 3ASVA 3B9QA 1XA4A 1Q74A 1XMPA 1RQNA 3DOJA 1O1YA 2P4UA 2ZTHA 4YBRA 4QGGA 4MIEA 2I6QA 1ADJA 5FD8A 5HZHA 2X9GA 3QWFA 3SPJA 5TIIA 4R50A 2JNWA 1G1XB 2PG3A 1GTSA 4FFDA 2CFRA 2ES4A 4R1NA 4AHCA 2JK1A 3KCNA 2X5OA 4US2R 1JJFA 1JU4A 4LZLA 3P9ZA 1NVXQ 2P65A 3QA9A 1PJRA 4BV9A 2Y1FA 4RJ2A 5L4SA 4TMZA 3D81A 3MJSA 4MR8B 2XEDA 3ZVNA 1KBHA 2QY9A 4UHKA 2CL5A 3CXHF 2VOJA 1Y3CE 2X4DA 2ZITA 5U9CA 1ILWA 4JI6O 3MQ2A 3I9KA 1EQ2A 4P3XA 2H2HA 1Q17A 4M1KA 5KYTA 4P4SB 1WUJS 1CNFA 1W9MA 3VO1A 4E4TA 5H9CA 4H27A 1BZYA 4IJ5A 2H6EA 5JJLA 1MAAA 2AZTA 1TVEA 4R71A 5CMUA 4HB4A 4QEDA 5GY7A 1PJTA 2JLYA 4S3MA 1GKIA 5B57C 3HWWA 3ACCA 3W5AA 2C9DA 4ESEA 2H1OA 1WWKA 4MQLA 2FKXA 4DM3A 4BQIA 4AMUA 2SCUB 1K27A 4Z4HA 1PNOA 1F0PA 4P1ZA 2IDMA 3HWX1 1T15A 3RO7A 3AEQB 3G9ZA 4RPJA 2D2EA 4RSHA 3CZ4A 2I03A 4FNMA 1SCUB 5TPZA 2GZSA 1IDN1 3JAWB 2PT6A 3IVXA 2F6RA 4Q03A 2W6ID 1WW2A 2GN1A 2WMYA 4K46A 3DQPA 3JR7A 2I33A 2XUPA 6ABPA 1L5YA 2HDHA 3AG1B 3H0EA 2Y1OA 3K59A 2NN3C 3D8SA 1VRVA 3ADKA 2OGUA 4WSOA 1TD9A 4US0R 3VGJA 5JWOA 5ES3A 4D56A 1DLBA 4I0WB 4L87A 2AS0A 2DRIA 4GI3A 1VARA 2JLBA 3W04A 1U7OA 3HCRA 1OLUA 4OX9O 3NRBA 3PCTA 1MB3A 4NJEB 1DI0A 4WK4B 1T6YA 3SEQA 3AU8A 4M4SA 1RXVA 1KYVA 5AI9A 2P6RA 1DC6A 1US8B 1GG8A 2GPNA 2JFOA 1EDEA 1I36A 4YMUA 4CEJB 4LBYA 2PQ6A 3TLEA 3FFBA 3UGJA 2QE7G 1RW4A 3S3TA 4AW9A 5CM9C 4PGHA 4UASA 1UCFA 2VQSA 4J42A 1KJWA 3DCYA 4H6XA 5F76A 1QYRA 3UK6A 1W59A 4IHJB 3QOYA 2FR1A 3EIWA 2YWEA 1T3GA 3N8GA 4Z9BA 5JYCA 1E9RA 1G1MA 2FPXA 2W93A 5FYDA 3CXUA 3W9UA 2F43A 1IK4A 3V1KA 1OAAA 3E58A 4JA0A 3MJTA 1XMOB 1V3TA 2J9ZB 4MHOA 3OZSA 4R0VA 1WZIA 3CLUD 3SKXA 4H0LB 2JHCA 1KOLA 2RKWA 3H75A 3B38A 1BH2A 1UM9A 2ALJA 1L9XA 5IK2D 4KHZA 2AZ2A 3UAYA 2OSBA 4RQFA 2GEKA 3EBOA 3M4YA 3KTFA 4G0NA 3ZWAA 2CLHB 1U8YA 1T8PA 4P7JA 1GDTA 1HYGA 1BXGB 3VTZA 4FBGA 4QOFA 3E4DA 3GLFE 2CGNA 4CR8A 1G4UR 4LWSB 1MIOA 2P2GA 3V2GA 1SZTA 4QAJA 3P0JA 2IIBA 4W5WA 4GZ6A 1O8CA 2CLOB 3GROA 3VZBA 1V9PA 3KFLA 2XVAA 3T6KA 2GDSA 3K0DA 1U2QA 4LJLA 3ELBA 1DXYA 5HK8A 1Z2CA 3AERB 1YB4A 3ESDA 1DCFA 3EPKA 3EZLA 3QELB 3JQFC 4C5BA 4KI7A 5TPZD 3C5EA 1AS3A 5A6VA 1SKYB 4KQEA 4PG6A 3BDVA 1PK7A 4O8CA 4OGQB 3QHAA 3ISVA 3IUQA 3F90A 2AVDA 4IIJF 3T5AA 5K6AA 3RAGA 3MTIA 4YJFA 1BFDA 1RBQA 4KQ2A 5HZMA 4I3HA 1YR3A 3LXXA 4M3NA 3KOMA 4BNKA 3O8DA 4ZKIA 3HYLA 1LLUA 3ANTA 1KMMA 1GOTA 3QX9A 4EUFA 2HM7A 2WHYA 4XUDA 3RR2A 4FHDA 1QSGA 2B8NA 4PHHA 3F9RA 1MVOA 2ORYA 2FETA 3AT1A 1RAAA 4HFRA 1UPXA 4E4RA 8ATCA 4LRTB 3EXHA 1E4EB 2IXFA 3RYFA 2YMLA 2OILA 1ZDMA 4LZOA 1E0DA 2A9JA 4PE5B 1GGNA 1GKLA 5IYCO 2MYNA 1P1FA 4J1QA 4HNSA 1CR4A 4ISCA 1PV0A 3N8NA 4A2PA 4DBVO 2R8BA 4C4SA 4MYTA 1TD1A 2X77A 3L6DA 1TJYA 1Y80A 3D7MA 4MINA 1Z4NA 5L6LB 1JPNA 2YXPX 3P9QA 1IM5A 3WLRA 4RGVA 1SUPA 3AZOA 2W4MA 4B3RB 3LYUA 1O6CA 1EUCA 2FZVA 5ITSA 4BKQA 4ZTZB 2WJZB 2JKYA 5K3FA 3SE7A 2IC5A 1W2WB 2EFDB 5CYOA 1KP2A 4PSDA 1NLUA 1UDRA 2CE2X 3D43A 3OOYA 4ETWA 4H16A 3V4SA 3H16A 3U61B 3ROPA 1EJ2A 3M49A 3GG9A 4GC9A 1U6IA 1FDWA 4KIGA 2XYQA 2Y1GA 2CZGA 1SIBE 4FZVA 3PGMA 5CB4A 4Z9XA 5AJTA 3L3BA 1SIWA 3A0RA 3T52A 1NKVA 3ZCVA 2YV4A 1WBDA 1ZWIC 1N8KA 1D9XA 2P2CA 1G8HA 4WADA 1KU0A 4LZZA 4EENA 3VKUA 5CIQA 3ABSB 4HAIA 4KR2A 4MVXA 1RJFA 2HCBA 5CXUA 4RFLA 4X62B 1E5DA 4W63A 3B3QA 3QXHA 1B6RA 3AXSA 2MIIA 4NICA 2P79A 2QM4A 1QMGA 5JR3A 4H17A 4QLAA 3BCSA 1XZQA 4FIZA 3QITA 2RHJA 2IM9A 1XCJA 4NZYA 3DKRA 4G27B 1QHIA 3FB5C 5DNDA 2I3GA 2A0YA 2YVQA 3PDHA 2GF2A 3M6XA 3IQFA 4MP3A 3U0BA 5ICGA 3QVXA 3KNZA 2R79A 1SVNA 3FUVA 2HVJC 1C4XA 1LRKA 4HQ6A 4RF2A 1XEFA 1KEEB 2CXSA 1KI3A 1H2GA 3ADOA 2X5XA 1O58A 3E9DA 4PYMA 4ZAYA 1M2JA 4JB0A 1ECBA 4X9XA 4X93A 5L3CA 3ZS8A 4LUCA 1XF1A 3DZ8A 1FIUA 2YY7A 3OF5A 5ELXA 1BCRA 1EQAA 3EZNA 4KACA 3D7RA 2B94A 5AO9A 4Q3NA 3DWFA 1OH8A 3ZCUA 3GMSA 4XYGA 2E85A 2I3BA 1SVKA 1N33O 5B3AA 2HBQA 3CZCA 2YHSA 3TM5A 3MW8A 4HDAA 3K0GA 1ZHHA 2CFOA 4UFNA 2HP8A 5K0FA 1ODJA 1E1RA 1NA5A 3LW8A 5FI0B 1J49A 3QVJA 2HY7A 3OE4A 3FFQA 1TEHA 8OHMA 4YC7A 2E5LB 1HA3A 1TMOA 2A0UA 2FZLA 3TH5A 2NAFA 1SK8A 4OHXA 2IQIA 1H3FA 4Q34A 1QR6A 2JCXA 3Q7RA 3EZ2A 1S6YA 3U4AA 3KV1A 3B3JA 4B3GA 4PICA 4B6JA 3AG7A 4HUJA 2P5TB 3IULA 1NG9A 1Y5NA 4UTPA 2PR7A 3E7WA 4GLJA 3A6LA 5FQOA 1KYTA 1VLJA 2FPIB 4WKBA 3CE2A 3R9KA 2F55A 2CYAA 1AI7A 1RPZA 3S2YA 2EJBA 3FHTA 2MJLA 1IBRA 4DY4A 5KSYA 4DABA 1Z0AA 4YJDA 4JJZA 4HRVA 3J81A 5H3LA 5KQMA 1KTIA 3NJ4A 4U9HS 5NULA 1YJBA 3H1JH 3HCPA 5LZ5A 4DIMA 4D96A 4RANA 5BSVA 4BMYA 4B79A 3A0UA 5IY5B 4OFXA 4ARIA 3W34A 4X65B 4KB5A 3EXFA 4UCRA 3UT6A 4O25A 1XL4A 1ZNXA 5CYPA 1UOOA 1GCOA 4QDUA 1D5NA 3Q3CA 2EHJA 1XZEA 2FQXA 3I4FA 1V26A 2QTTA 1IJBA 4REMA 3MJFA 4WCVA 4ENQA 4NONA 1DJLA 2HSJA 3KG2A 2DBYA 4QPCA 1F3OA 1NLZA 1C7EA 2FMFA 3ACDA 3GLFB 3MUNA 1TL7C 1ZGZA 1UP4A 1EX9A 2ZZMA 3SZGA 5JBNA 2CXXA 2VTEA 3IVAA 2AW3A 3HY3A 3I4CA 3BH0A 1NDUA 3HV0A 5JG7A 1G59A 1T5LA 4C4AA 2WLLA 2CBZA 2NYVA 4Z99A 3RH0A 1ZHFA 2EF0A 4UE3S 2WOJA 1P19A 2BMFA 3SHQA 2QA4V 1Y9EA 3AY6A 2XTMA 3NEAA 4HZIA 4XQ0A 4X62O 3WYAA 4WLEA 3RFVA 3RJ5A 4RENA 3CS3A 3U5TA 1UMBB 2XOKA 4ROSA 5BWLA 4DQLA 1OCCB 2DR0A 2QSAA 1YKGA 4U2CA 3RABA 3OE7D 4KHPO 4OJQA 3TOZA 1NY5A 4KQGA 3B1XA 4RORA 3H05A 4B3TB 1VECA 4QDKA 1S3IA 3TUZC 4NCIA 1WB4A 3EQ6A 3ZE8A 1Q14A 3WOVA 2C2MA 2OZKA 2PKQO 3T7RA 1HE1C 4PGMA 4L5CA 1U81A 4PFSA 4B6RA 1NYRA 1ZYUA 3LUDA 3B20A 2R66A 3O8QA 2GZMA 5DTJA 1SUWA 1AILA 3N0WA 3QFCA 4L8GA 4KCGA 5GADl 1JTFA 4XLTA 3OCCA 1AJEA 3O31A 2G07A 3C1UA 4KQJA 3QGMA 3OM8A 5K45A 5ARBA 1AR4A 3U1BA 1CJTC 1L8OA 4OBEA 4M0FA 3UEOA 4TN1A 1GYQA 3DKPA 2W70A 4ZVNA 1E6KA 4DW8A 4KRXA 3ZRSA 1GO2A 4RZSA 4OPMA 3BRSA 4DBLE 5CYGA 4IEEA 2OAQ1 1BEUB 1P4SA 1THZA 4JUBA 2E76B 3C6KA 1SKMA 1OREA 5CEEA 3JYQA 5AM2A 2IYQA 1E9SA 4CF7A 3SYNA 2IJIA 2EG5A 3U7HB 4EKWA 3L7CA 2BEUA 1PUIA 3ZV4A 4M86A 2O06A 4DLPA 3KLBA 1SVMA 1FSSA 3KJQA 3S2EA 1EJ6A 3SYRA 4BNZA 2QY6A 4RY9A 1Z2EA 3VHQA 5FEMA 5LA6F 3O6VA 3AK2A 4TRJA 3HXLA 4FI3C 1YS1X 4DMUB 4DAEA 4RKFA 4K3UA 2O5RA 2C4NA 1TYZA 5LQKA 2DYRB 3ZX4A 4XEHA 3A4VA 1ZKMA 4FM2A 3MOGA 4CV0A 5AKJA 4K2AA 2ZRGA 5K0LA 4GYWA 1L0LH 4LRWA 3DVAB 5LZ2A 1E9DA 2ZJ7A 4X65O 4CF3A 1DQSA 4LCEA 2QTAA 1F38A 4BB0A 2YJ3A 4EEQA 2IEZA 5E8RA 2FMLA 2P9QA 5K2MA 4ID3A 3X1MA 2H51A 3PITA 2HJWA 4N0DA 2ZR2A 1H6DA 3LUHA 5EIAA 5I5GA 3SPXA 1WB7A 3FOZA 5BSRA 3KQHA 2EEZA 5BT8A 5LSAA 4KK4A 1HWYA 2Q9AA 1M1YE 1GKUB 3MEQA 3NC0C 1YVRA 1TUBA 5IG2A 1M34E 3A04A 1IVNA 4RPKA 4LN1A 4GXQA 4X54A 4B3BA 2IH1C 4ZYTA 4G0ZA 3TM4A 5TR9A 3NPMA 5KSWB 1SQVH 4DC0A 4IL5A 2QQFA 3P71T 3H1KH 1PZMA 3QLJA 4IVRA 3C8ZA 1CB0A 1N32B 1NBIA 1JHOA 3H4IA 1GSIA 1QH0A 1XBLA 3MS4A 1M2VA 5TQ2B 1UBOS 1V96A 2QD2A 4W6QA 4FIPC 3LI2A 2ZJAA 1GU1A 4TYNA 1CEEA 5FKJA 3Q5GA 5JHGB 4BRSA 2DM6A 3F3SA 3PC8C 1ZK3A 4S35A 4ECEA 2I71A 1R1DA 1R4MA 2V6FA 5AHKA 3ZXXA 1XZJA 3TLJA 1Y8AA 2O1EA 1I7LA 4NSNA 2GBLC 2X8WA 2CXTA 1E1YA 2X42A 5EWLA 1QDEA 5C7OO 1SXGA 1Y8QA 3DFMA 1WCWA 1KVTA 1XJQA 4KBFA 1T3ZA 3GEPA 1ENPA 3TLMA 3NASA 2BGMA 4TMYA 1FF9A 4TQDA 1X7ZA 2X8BA 5G02A 3FNIA 3ZNNA 3AP1A 5ITZA 2YNMC 4EGSA 4F7DA 1TB4A 5LMZA 1FXKA 2I8LA 1TA4A 1YJ8A 1QFXA 2YW9A 5L51A 3ZXUB 4PG7A 2WPNA 4Q00A 1H9AA 2XB2A 1JYFA 5CDSA 3WK9A 1KQGA 3DDUA 3DQQA 3IDOA 3PIRA 1LX6A 1NBHA 1XDWA 3LSYA 1YOVA 4N0PA 3TTXA 2X14A 3F2IA 4JHXA 4QYSA 3V32A 3NHWA 3L1HA 4UHBA 3DBRA 5D2CA 4A15A 1L7XA 4AO8A 2HI0A 1U1EA 2FPOA 3ILHA 1BXZA 5E6RB 2K4MA 2PHZA 1PN3A 3A6PC 1Z17A 8ABPA 1Y1RA 1R66A 3LBYA 1S01A 1NU8A 3FCAA 1EGVB 3MD9A 1JXOA 3OZWA 4MNTA 1B8UA 1MGPA 2XAQA 4H08A 3TUJC 4I2NA 3BXPA 4HWSA 3RTCA 1JFTA 1JR6A 4WUVA 2RKOA 2BF7A 1VMKA 5KNDH 3A9CA 3L0YA 2VDQB 1EWTA 1ZVMA 4WASA 2P69A 4YIHA 2NLJC 4BWFB 1I3CA 3SYPA 1MOPA 4QGPA 4YH1A 1WKCA 5IEJA 2WV7A 5IKEA 2ILTA 1XKQA 2PT5A 5BN4B 3R0IA 3O4RA 3SM3A 1ZH2A 2ZETA 2EP7A 2BFCA 2UXNA 5J47A 5TT1A 4Q66C 2BKEA 1W5TA 3KQVA 3B3AA 4RPHA 4RY2A 1P77A 4COOA 5T8KC 1QANA 1U7TA 1O87A 2MTBA 3RSCA 2XYVA 4NZ9A 2GK7A 1I32A 2BEWA 4YALA 2WF8A 1ENOA 1AGPA 1VFNA 2HKIA 4BZQA 3K30A 1LS1A 1YMUA 3ZS9A 2O2HA 2QRMA 1E7SA 3ROFA 1DAGA 3HJFA 4JQOA 3NDBB 4BVJA 2PD6A 1D07A 1Z07A 3HFGA 1I3LA 1KMIZ 2O5CA 4L5BA 2IEIA 5FUYA 3HJNA 5DF1A 3KOZA 10MHA 4WNIA 2DETA 1E99A 1FTGA 1M1XB 2XAUA 4R51A 2RDMA 2VDJA 4Z1OA 2FEKA 4A1FA 2RCYA 3OLWA 4B31A 1UXKA 4L22A 4D57A 3LCCA 3KB6A 3OT5A 4FMDB 1YA8A 3K6JA 3KZNA 3RW9A 5L3QA 2X2FA 3QOXA 3AEUA 3JRWA 3IR6A 5BSKA 4JX8A 1FQJA 2H07A 2J0UB 4PIPA 4DV0B 1E18A 3K96A 4FGJA 1Y3AA 2ZTSA 3VQTA 5KNDA 1F14A 1N32O 1OI2A 1D03A 1HQKA 2ZYVX 3GLKA 4QREA 5B3SC 3I09A 1T9GR 4FTWA 2HYIC 4CTJA 4M9QA 4OHPA 3WA6A 3DEJA 4G5YA 4Q7KA 4WTOA 4QZVA 1DU4A 4MYCA 4XJVA 3OPXA 5GJCA 4WCFA 3X0DA 2FEPA 4BNDA 2B1GA 2Z2KA 5GONA 1XTKA 4CLDA 4GOMD 2R5FA 2J59A 3NBMA 1OH5A 1CQIA 4GH5A 3HJGA 1RM1B 3RW0A 2NSYA 4CUZA 1JEJA 3MMNA 3BFKA 3CRCA 3I9FA 1LDMA 2BOBC 1HE5A 5C8YF 3KLPX 3UC5A 4MQ5A 1BGWA 3GGPA 5JJCA 3ET4A 4A8HA 3WBJA 3CMMA 1ADGA 3MF4A 1I4TD 4FX2A 1A9QA 5FLYA 3TXXA 1EU1A 3L6UA 1JIXA 1DBWA 2AFHA 4HC4A 3C4VA 4BU1A 2O3SA 2ZSBA 2IITA 1BKYA 5K2OA 4IPTA 2FZWA 4PCVA 3OM3B 4D8XA 1NFRA 5HIIA 4UM8B 2GEBA 3OOEA 4DYDA 5A1TA 4WOCA 3OT7A 1TX4B 4EVRA 4J6FA 4DZZA 1KNXA 4EJ6A 3UPUA 2J9FA 5J23A 4O1HA 3REOA 3UMJA 1DGQA 3UATA 3LK6A 4LWQA 3U3DA 5JCZA 1B6GA 2X7XA 4HRXA 4E5MA 4X44A 5TISZ 2G71A 4ZRMA 4NBVA 1XNQB 5GWXA 3PRKE 3L0IB 2Q6VA 1VJGA 1J90A 3Q3HA 3I6YA 1XX6A 3NBUA 3NYWA 4M1QA 5T4FA 4O2AB 1C7QA 2H4HA 2BE3A 4A16A 4RH1A 2O2GA 1QIFA 5CXQA 2BR5A 5FJIA 3IAHA 1II0A 3ST7A 1ND6A 1DT5A 1U3WA 1DIOB 2WHPB 1EX1A 3BD7A 1HNZO 3BFRA 1KO1A 4WERA 1TO1E 5L7TA 3DVSX 4QAQA 1KMHB 3EIUA 3W8RA 1EVZA 1GPNA 1LBHA 4D7SA 4PS0A 4PHTA 1QNFA 3SHWA 3N2LA 1DHTA 1VSVA 1M1YB 4A3SA 3GF4A 3K73O 4C2UA 1THMA 1M34B 1R0LA 1AF4A 2P62A 4NBSA 3IJEB 3NEYA 1SQQH 3N2IA 4OBWA 2QQ0A 4LC0A 4ZHQA 2E4AA 2YHIB 2WZDA 3ZCXA 1PFWA 3PPXA 1MIHA 3H2SA 2NUTB 2HEIA 3D36A 1N7JA 3TUIC 3LFTA 2OT5A 4F3NA 3E7DA 5A02A 4YPFA 1XREA 4M1TA 3THWA 1DIBA 4MV0A 2NUPB 1F12A 3KZOA 5PGMA 2O8CA 3ZRWB 2B8WA 5CT9A 3RRBA 5FPPA 3UHPA 4KXQA 3CLRC 1IE3A 5CVCA 3FVVA 3HP7A 4Y0NA 3LHKA 4UZEA 2M6SA 4HQFA 4BNMA 3P0IA 2GYVA 2FK7A 4S12A 3JV7A 4LY3A 3CX3A 5FRDA 3TIVA 1EDZA 2G9VA 4I7EA 1X2BA 2ZWOA 2CGEA 3JR3A 1ULZA 2YZ2A 1E3DA 4C87A 3JQAD 4FCTA 2ZVJA 4M49A 1NAIA 4OQDA 3OQHA 3IAM6 2VUIB 2GYYA 5DTEA 3WGUA 4BMSA 1E5VA 3DNFA 2ZR9A 3AP2A 5IBQA 4L3OA 4PI0A 1G55A 3D02A 3UAVA 4X60A 1IBMB 3ZRVA 5FOTA 4YRZA 4G1MB 3FPEA 3I52A 4GX5A 2CHQA 3V1YA 1T2FA 2OHIA 4ZAXA 1PSWA 5JEDA 1Q7BA 2BGNA 1NMZA 4MUYA 3OSZA 1ZK1A 7REQB 4BATA 2CLFB 4FEYA 2Q3CA 2ZBQA 1CETA 5TPWB 3BBLA 4X90A 3NTVA 2B83A 4W4TA 3T3GA 4RK1A 1BMFA 4BYGA 1KDPA 3L4JA 4BNVA 5CDFE 3NRJA 1XWFA 3PNKA 4Z54A 4PA7A 3RCBA 2JJMA 2QOEA 1Q7CA 1X1QA 1HSOA 3JQRA 2GV9A 3P2KA 4JI4O 4DQXA 4OQFA 2WAMA 3L9XA 3F5WC 3KZXA 2WSYB 4IFTA 1M6WA 1TGOA 3SBDA 3KQOA 3Q3VA 1N3LA 2YCBA 3WKDA 1IZ3A 2GD6A 1P6XA 3GWOA 1YJ5A 4DIUA 3I04M 4HTFA 4AO6A 2MINB 2H17A 3G1UA 4HDCA 1SXPA 1Z4PX 4U02A 1UINA 2YC0A 4QNMA 4Z0PA 1CG6A 3K70D 1A27A 3FNGA 1EFRA 1R00A 5L3FA 5LNK1 2IP4A 3KOUA 2A4MA 1M74A 4QVIA 3MT7A 1PGPA 1XNQO 3WJ1A 1Z7EA 1ZH8A 1X1SA 1DF4A 1VLHA 1VJDA 4ZQHA 1XU4A 4INJA 2NZXA 2XECA 2UUOA 1EGMB 4IUCS 1FFYA 3CM0A 4QASA 4Q6BA 4IDAA 4TXNA 2Z6QA 4C0LA 1NMQA 2GRUA 5E38A 1JS1X 1SHLA 3PICA 1OB2A 3ZDEA 4BB6A 2W71A 5IABA 4RS4A 4I3FA 4Q4JB 2FDRA 2Y4TA 5FI1B 3TBKA 4AROA 1R0RE 4NXNB 2O3RA 1TMKA 3MTDA 2BFEB 4KTVE 4II7A 5HFAA 1RAHA 3WZMA 2G72A 4JI0B 4V0SA 3PIIA 4TN5A 2WFLA 1A9OA 4CRWB 3JD1A 1U2TA 1V4VA 4GWLA 5CPBA 3TNYA 1XRNA 4QGBA 1WBBA 4K7JA 5HRAA 1O6GA 4KGVA 4WLFA 3EDQA 4DSOA 2IS6A 1QGAA 3C3YA 2NZJA 1OBVA 4NYKA 3R8XA 4FPXA 3AHHA 1NW3A 3MAGA 5K0TA 3RF6A 1K7SN 2I0FA 3O8OB 1OE0A 5EUCA 4QARA 3VO2A 1YI2V 1E3IA 1M1NB 3C6ZA 3EYWA 2L42A 2A92A 1SHTX 2NPFA 2C3YA 1BMFD 5IJ0B 3L70H 1IWOA 3T4EA 4M89A 4M8SA 2XUAA 3CLTD 4PI2A 3BQNB 3F5SA 2JEOA 2WFMA 4XE5A 2CDYA 1L7QA 3HI6A 3G0BA 4UMFA 4XIYA 4BVLA 1RKXA 4Q05A 2QGFA 1SCKA 4Q7JB 4TWAA 2YZMA 3QYJA 4KR3A 2X6BA 3NYIA 3IC9A 3ABTA 1VQNV 5AKLA 4ZIBA 4QOJA 2VAMA 5JJ5A 4Y2RA 4CQMA 4U39A 1Z68A 1N34B 2EJ7A 1X1BA 3MRTA 2QTGA 4GKKO 2QP9X 5C9ZA 1BHQ1 4N12A 3B9RA 2P11A 5CA3A 2RBKA 1EFRD 1NAHA 4ZXFA 4UBJA 3BQ9A 1VBNA 1D1QA 4JI1O 2P2SA 5ALIA 2C3OA 3SHOA 1URFA 2WLMA 5KYXA 5G3ZA 2DR2A 2H1LA 1G7CA 4RZIA 1N25A 1FP2A 5DM6V 2ZE7A 4B3CA 3MT0A 2XTNA 1B6TA 2ZJ0A 3B5IA 4BCCA 4NJMB 2X6QA 3U31A 1LI7A 2D0OB 1CULC 3ORHA 4KN8A 4UBOA 1J1IA 2R1UA 5AVJA 4DMFA 1L4UA 4PO3X 4DQUA 3N2GB 1PJ8A 3HY6A 3MTBA 4K88A 5DMXA 5AOBA 1T0UA 4AX4A 1TTTA 3UO2A 1MJNA 4QNHB 3KTDA 1JQ3A 1ODIA 1ZI6A 2BHRA 1HT1E 4DA7A 1E3JA 1RT9A 4M9CA 1HDOA 5F3DA 2QZJA 2YHUA 1EN4A 2UZ0A 4IJUA 5AK3A 1LK7A 4I8XA 4FR5A 1QRSA 1M57C 3IVRA 1K8ZB 3I28A 4PIVA 1ITZA 3LCRA 4BEBA 3RIHA 5EK0A 1WVIA 2TS1A 2ZYAA 4CCSA 2MHCA 2PUWA 5KTRA 3SY8A 4NENB 5FLEX 4BCBA 1ZUNB 1JV2B 4CZ2A 5GVSA 3B82A 3HB9A 1ZOLA 5JATA 2TRSB 4HH3C 3A9TA 4Z86A 1MX9A 3TR6A 4C78A 3ZDBA 2QTVB 4MRRA 4W5OA 2CLCX 4IDOA 3SJZA 5DNUA 5TC4A 3I5AA 4XWWA 5KTYA 2W8ZA 5FWYA 4JBHA 1R8YA 1GM9A 4MTXA 5E2AA 3BJEA 1R6AA 2CDBA 4HFNA 2A84A 1F8UA 3CEJA 1M33A 4ASUG 3O9VA 1XAIA 3TZEA 1DTOA 1Q82W 3HKEB 5CT6A 1MVLA 2QPOA 3ZJUA 4PWYA 4YCMA 4R2JA 1O94A 5ALQA 2GLTA 4G2TA 4EPWA 4BRUA 1URPA 1YU9A 4TYPA 4E1VA 1GTJ1 1R9JA 5CFMA 4C3OB 2K1EA 1B16A 2FZCA 1ZN9A 3PGLA 1IY2A 5DTRA 2IODA 5KNBH 1H1DA 3COYA 4CQMD 1ONSA 4KU4A 3K7EA 4H37A 3CP1A 4BV2A 3T7DA 4URUR 1VMGA 1Y4AE 2QRJA 3LYLA 2DUNA 2BOCC 4LRUA 4MQEA 4B4VA 3BAFA 1J1UA 3I23A 1FDUA 1G8GA 4YREA 3LPDA 4M7WA 2VQEO 1AIPA 4B44A 5KYYA 5L6MB 3RV3A 1HEYA 2FRXA 2CKDA 4H7DA 5A1JA 2IPXA 4FLWA 5DWQA 4A26A 3EGOA 4WK6A 1MJGA 4YAFA 5AVZA 4Q9HA 4NY1A 3W5DA 3WGTA 4OO3A 1DFIA 1KZ6A 4LQDA 1XPUA 3FCUB 1OXUA 3PDIA 1WE2A 2MMCA 1KMNA 3VR3A 1OWLA 3H4TA 4L6CA 3BTVA 4FK8A 5HZKA 3SYAA 1OAOA 2IF0A 4F3TA 2RGXA 1DBIA 4RMGA 5DNAA 1XD9A 3ONEA 2FL4A 3DV0A 1RD4A 5JANA 5LQDA 1UEIA 1JLKA 3NG1A 2EXXA 5LIRA 5K0SA 4EUEA 2O8EA 1TEVA 4C01A 1OUMA 3ZVKA 3M6AA 4C08A 4NBUA 4K3AA 1S5LZ 3U4GA 1RXYA 3Q6NA 1OTYA 1S3JA 4LEIA 2QG9A 1NXTA 2PMBA 3AW9A 1G18A 2QMUA 4EQ6A 4FVMA 3FETA 1PS0A 1QX3A 3KPWA 1DWOA 1U1GA 2D62A 3G59A 1I6LA 1YCHA 1AD2A 4IICA 4IQ4A 1T3SA 2C61A 2EARA 4LGCA 1B8VA 4YRBA 3IEIA 2ECQA 2B98A 4XLLA 3SGLA 4XPIB 5CDTA 2QE6A 5FTMA 1MQSA 4OI4A 4JC5A 5ITWA 2ZCJA 1ETHA 2JLCA 1HW7A 2Z0AA 1MORA 1OJ7A 1V5GA 2C7VA 4WZBB 2BGIA 2G83A 3P8ZA 3IP5A 2UXCB 4P36A 4QBHA 4JC8A 1P7BA 2E49A 3PVZA 1D5WA 1UQRA 5JZOA 4XX1A 1RJDA 1O94D 1MF7A 4MICA 1V6CA 1NBAA 4LXHA 4PV7A 4C21A 2X2PA 4BGIA 121PA 1PW5A 3P9PA 5CA1B 1IFXA 3CBQA 3A2LA 3HKBA 1M3SA 1TQ8A 3COSA 3BD6A 1NQWA 3ITNA 1YF2A 2GEDA 2VQFB 1J2UA 1BQ3A 4I9GA 3TXYA 1G63A 1NN0A 3H18A 3GRZA 3V34A 1GDHA 4XPZA 2E48A 3GWKC 3DEYX 4RADA 3TTUA 4ZN6A 5DYYA 2GNPA 4CKBB 2VJAA 1UK7A 3H6KA 6CHYA 9LDBA 4LDJA 3P2MA 4U2KA 4GM0A 4QU5A 2QRVB 3RSSA 4PCUA 1VCNA 3T34A 2XLCA 4GRDA 3W79A 5EJ9A 4XIJA 2YW2A 3R20A 3GX1A 3B6JA 4GMDA 2CDNA 1GZSA 3I0NA 3T95A 3E8HA 2PAFA 2BIFA 1YZLA 3JAKA 2C29D 4CBCA 3MWFA 3D8CA 3N1UA 3RTDA 3HRHA 3MWDB 1X7HA 3N2KA 4P84A 1P1HA 5CEJA 5EXEA 4EB0A 3U7IA 2IU0A 3ESCA 5EN4A 3C8UA 3RGBA 4FGLA 4FOPA 5B7GA 2JIQA 2Q6LA 1JEYB 4FLTA 2VJDA 4Q3KA 3WLNA 2RJZA 1CK4A 1CR2A 3PD1A 4DR4B 2Q6AA 2RNBA 2WLSA 2CVFA 5FUXA 4Q4DA 1N5LA 1LSSA 2FEOA 3G5MA 3ZV3A 4KL8S 1FXVA 5EC2C 5KNBD 2ZRHA 4QUDA 1IXKA 1OIVA 3GLHA 4NX2A 4PZ0A 1I30A 4UCUA 2HWKA 2P5SA 2I8AA 5D1NA 3VM6A 4H9GA 3V1UA 3JX9A 2CN1A 3TS1A 4OAOA 4E08A 4AAYA 4TWZA 3IP1A 4XYLA 3MGKA 3LOQA 3C7CB 3HTXA 1AP6A 3GDFA 4LNHA 2JIZA 1WUIS 2P41A 5HS6A 1Z6QA 4LZNA 4FYXA 1VDZA 1EFPA 3GNQA 3I1FA 2C9BA 1JBKA 2VDOB 1UJMA 1T24A 2ZSKA 4YGXB 2HHJA 4I1SA 4R0NA 1S4MA 3RSLA 3A4YA 5AW2A 1X8KA 1HEUA 2JAQA 5BSUA 3KQUA 3N2YA 1ZJ5A 1PGNA 4Z8YA 5KCMA 1SQPH 4KGDA 4QULA 3ZQJA 3MLBA 4GQIA 4IJWA 4CR7A 1I2MA 3E0QA 4EHDA 1WLSA 3RGWS 3JSNA 4JJEA 4DA9A 4D3DA 4FYYA 3L4BC 4QUGA 2Y0IA 1CERA 1C4WA 3IALA 1R0SA 2GNOA 2PWZA 1NT2A 2NUBA 1YTUA 1GM5A 3WFZA 1YSCA 3AESB 1YACA 2QVZX 3HR8A 3O93A 1ENZA 1H94A 3KUDA 4TM7A 5E9JA 3BGWA 2AF4C 2TECE 3GDOA 1BDIA 4GKJB 1XTPA 2J3QA 4FUQA 2B35A 3NKVA 1W73A 4RTRA 3FPBA 3FHOA 4L9SA 4G8CA 1NI4A 5KYVA 4C0SA 2DKNA 2ADPA 1KQPA 2SKEA 1OHHG 3R7NA 1F2TA 4LIPD 1Z5PA 4UV9A 1EZ1A 2VQFO 1T0IA 5FBKA 3CV3A 3DDSA 2HTFA 2C04A 5I9MA 4UDYX 2Q62A 3MT9A 2WYVA 4DCCA 2UZ4A 3KT3A 2P9GA 1E1MA 1H6BA 2FW7A 5ICFA 3PFNA 3PQ6A 4OHKA 5CBFA 3LNCA 4ICIA 1RAIA 1QO9A 5BWNA 2YRXA 5ELMA 2Z5FA 3OOJA 4UREA 2EFHB 2XWPA 5EP2A 4DWOA 4KJZA 1U2DC 1YK1A 3ICVA 1IPHA 1M8KA 3E5MA 1Z2DA 5FI5A 5JTUA 1LQTA 3F73A 1GTVA 4ODIA 1K7FB 2ZIUB 3CB2A 3L18A 2J1LA 1UMCB 3E7XA 2IHTA 4EGQA 1ULTA 2X13A 3TB4A 5J2UA 2GD2A 2Y6UA 3B6EA 1PWXA 4J1TA 1U28A 1UEJA 3NCHA 4FXPA 1XRQA 3WRXC 4QE7A 1BSVA 3RRNA 4A6PA 1FNDA 2I87A 4QELA 1GG9A 2QDOA 3BABA 3EB9A 2C1ZA 1Q81W 3DE7X 1YRAA 1NVVR 1U2PA 1XTJA 2PCJA 1XVVA 5B6JA 2WSMA 4MRSA 4LKRA 2PL5A 1Z6PA 1WQ3A 3E81A 1RCTE 3FYDA 4HDKB 5JCJA 1PQWA 3RKUA 3OIWA 3P19A 3GFOA 3ZHVA 3J81N 1F7YA 2ZIXB 2H57A 1RYZA 2QBYB 1SA0A 3G5TA 3ZOZA 5HTKA 1BCCH 3M1IA 2DP4E 5F1KA 1TAHA 2DB3A 5JAMA 3RC3A 3TRKA 3R3VA 2A5JA 4ZCRA 2WF9A 3AVUA 3INYA 1MAUA 4QOEA 2K9PA 2X9NA 3R1IA 2EIXA 4KE9A 5KTOA 1Z7BA 2VDWB 2C2HA 3CCLV 1JYEA 3DP9A 5EZQA 3PCRB 1DX4A 2OCGA 5FI3A 3E05A 1E64A 1L3CA 1XMOO 2OO5C 1NVMB 1R0WA 1DEKA 2XVYA 1N2BA 1H2YA 3ZU5A 4Y6PA 4WFIA 2A33A 1PT9A 3Q7PA 3K6RA 3ORQA 4NCKA 5D6OA 3UMRA 4EZBA 4DEVA 4KP4A 1RBMA 2N0SA 4RETA 2GAIA 1H2WA 2A1TS 1CPYA 4KO2S 1R3IC 3KWJA 1B3QA 1WUTA 2AXQA 4IIEA 1UH5A 1AQ6A 1ZGCA 4ENTA 1WIWA 2RGWA 3OOHA 3RU9A 1GL7A 3ASUA 4CETA 2BHLA 4E22A 1T13A 2VZLA 2GN2A 5JMOA 1XCOA 4QTUB 4PZLA 5IVPA 4R2XA 3KKEA 2XR1A 2O8FA 2G8NA 3L41A 2R60A 2EKQA 1TLFA 2RDCA 2OWDA 3WBKA 4QOHA 4P82A 4L7VA 3ZBUA 1U5BA 2X9VA 2CL0X 2NT4A 3R3XA 1DFGA 5JRJA 3VH2A 4I9HA 2UUCB 4XSGA 2RGEA 3MWLA 4XGRA 4Q3LA 1ZGAA 4GKJO 5AVUA 3REGA 4HS9A 2B8JA 3AEZA 3TL3A 4YLEA 2NZWA 1WMBA 4FD2A 3QF4B 1EXDA 4EY8A 2OFWA 1CY2A 4JJ7A 2Q5FA 4YRTA 5I7OA 3H11B 3IP6A 2PYIA 1YCFA 3NBXX 3PUZA 4LBZA 1RZUA 1YQQA 2GZ1A 4Q9DA 2YFKA 4WBXC 5IKOA 4XXHA 3QKSA 1KZ1A 2FUG6 1RZRA 1S2MA 3OI7A 2OUIA 1H1TA 1MHPA 5MDHA 5AM5A 4PZ9A 1V8FA 1VG1A 1RXUA 4D1YA 3BJZA 3D3IA 1USIA 4BKUA 2O2IA 2UYOA 5IASA 3JQQA 4S2UA 4O4HF 2HMWA 4X91A 1XEQA 2R6AA 3EOBI 2J08A 3RC1A 5BQFA 3ZDYB 4BKOA 3OQPA 1H2LA 3WHIA 3CA8A 4PO9A 4S0ZA 2NUAA 4JASB 3RT7A 3FJ1A 2WG0A 1RNLA 2BRUC 2C03A 4I8DA 2PPLA 1QKIA 4UVBA 1QFJA 1KH3A 3TZ6A 3C70A 3O75A 5IT9A 1OX4B 2D7CA 4UOQA 2E4XA 2EBUA 1JHAA 4P93A 1KEWA 1X8LA 2FZ5A 1JMKC 2BJHA 3IBTA 4XOUA 4ZCPA 1YS4A 4UOEA 4M46A 4B7CA 1K0FA 4R8CA 5JT1A 1NVPD 4AX8A 4B08A 4WY8A 4LWPA 1FYXA 1KMCA 3L7OA 3ZXIA 2NTJA 2V0NA 1D8TA 4B3RO 2DYSB 4QXAA 4MUIA 4B71A 4DLBA 3RWMB 5LQRA 1SKUA 2QVCA 5IBRA 1AH2A 2OPHA 4LHXA 2BCJQ 4N6GA 3HXKA 2C0QA 1F1BA 2M1ZA 3ZQUA 3ZW7A 5EXXA 4PZEA 3RRYA 5TJ9A 2GB4A 5BWCA 3HNRA 3OAAG 3OIGA 5ALHA 4EW1A 1M5RA 3EDYA 4BN5A 3UJHA 4KR6A 1S7GA 1VP7A 5FA5A 4L57A 4W4LA 4EI7A 1NXWA 4TTQA 4BLOA 1KI8A 1UR5A 3RFCA 4P80A 2P06A 4IEIA 3DB2A 3T1HB 4EUNA 5BR7A 2PX8A 1O2DA 4KQKA 3WWDA 4RQUA 3WYBA 3VSAA 5JASA 2DSTA 5E7MA 1KO7A 1FBNA 3FCYA 1XRSB 4TTSA 1L7AA 4KV9A 1FQKA 5KX5B 1OWPA 4MS3A 1R0KA 3FUTA 3JWGA 3F7TA 3W77A 1GDDA 4YCJA 4ALMA 5KPDA 3CEMA 4RA9B 4E07A 2Y69B 1DDOA 5A4FS 2OUKA 4IGGA 1AB5A 2QX8A 1CLUA 2NP6A 3KSAC 3OBBA 5MHTA 4F4HA 5TEVA 3RG8A 4HWKA 5JW6A 1RZRD 1E1RD 4KQ6A 4R7CA 1EFDN 3EEYA 4JDUA 1PDOA 4PU0A 3BHNA 4CYMA 4C4OA 5B64A 4A0FA 1Y7PA 1H38A 1UBSB 1N2SA 2IV7A 5CN0A 2ZATA 1K7YA 1NW7A 2V9ZA 1NNI1 4H33A 1GUBA 5AKHA 5I48A 1SUEA 2FPLA 3N07A 2VN8A 3ECAA 2V9PA 2UUCO 3K5LA 2X1MA 4PQGA 4H7EA 1KPIA 1G66A 3PSHA 1GSHA 1JNXX 1AXGA 1GZ4A 2VI5A 1BHSA 5EJEA 2Q4PA 1LNQA 1KFEB 1XDCA 4NBRA 1JFSA 2EILB 2HQSA 2WU8A 3WG9A 4C9BA 1T3LA 2BM9A 1JLHA 4FFKA 2XQVA 5JNWA 2AFRA 1REQB 3GJRA 4UFPA 4N5IX 3MWGA 4KUEA 1EM1A 4LAFA 2YWRA 4XUEA 3VSBA 2FW9A 4MWCA 2IZZA 2HPHA 3EYAA 2KWIA 4ALKA 4UDOA 4LJAA 4QGAA 1H6AA 2CMFA 2QJTA 1GMGA 1JKMA 1WM1A 1V47A 3QFHA 1XMQB 4BQFA 4CKYA 3QG1A 3OEWA 5DNVA 1QZUA 1JEDA 1MH1A 3HFRA 4CDRA 3FCCA 2E5LO 3FWZA 2WTBA 5CDYA 3DMTA 4WXRA 2E3JA 3IAS1 2J6HA 1QBGA 3BFPA 2WNIA 4E5KA 1I3KA 2V98A 4AP5A 3FOWA 2B1JA 2D8MA 3BFXA 2RFLA 4N65A 4MHTA 1X8XA 5AP9A 5U4XA 4J1SA 4G4SP 3P0EA 5IN5A 2FMHA 4TTVA 1Z0SA 4B47A 2WJ4A 3U44A 5DE3A 2WUFA 2HU2A 4RIGA 5KREA 1C3JA 2AN1A 4LCUC 3DL4A 4Z49A 3TEFA 3LWDA 1JLLB 3FYTA 2I7TA 1UKBA 5C8ZA 4LYHA 3L79A 1LF5A 5FWAA 2ANBA 4QGHA 4U5XA 3OM0A 4MVJI 3EIXA 1RHUA 1T5DX 1DT3A 3CTMA 4Z4QA 1OXXK 1X94A 2LDBA 2JAOA 3NORA 1YC5A 4M0LA 2XOKD 1FDIA 2HL6A 1Q90D 1WXFA 1W5AA 4FS8A 4I99A 3U81A 1U6JA 3L74H 2C2XA 3MJVA 5AVTA 4DLXA 5EHZA 5B4VA 4QBKA 3OWOA 2Y8EA 2GF9A 1KAMA 3CCBA 2RJOA 2VTKA 5DK4A 4E7PA 1GRQA 2G25A 1IQUA 5I4KA 4OH7A 4AQ7A 4F93B 4RZ2A 1OX6A 1NOKA 3RU3A 1UPGA 2EJTA 1G20A 1UFVA 3T1HO 1ZJJA 1CF4A 3EGXB 3P9NA 3SZ3A 4P9OA 3EWIA 2F23A 4RMIA 4ALLA 3E70C 3F7YC 2LIPA 3GJ8A 3IMFA 4WI1A 3P94A 2AL7A 1SU4A 3H3JA 4OMCA 3AM5A 1FP4A 1ZNZA 1E5QA 3TNLA 4ESHA 1JJVA 3ED1A 5F51A 4FLYA 3G0OA 5B2FA 4NE9A 1SOAA 5K0GA 1H2MA 1ZW1A 3KYBA 3KYDA 4QUAA 3CNLA 3ENQA 4B3TO 1QCYA 5LYJF 1I33A 1OCRC 2OQIA 4YAEA 5FOQA 3GPCA 4KQCA 4YAIA 2VHTA 4Z4GA 4FVTA 1W5BA 2H2WA 2JFZA 4OYLA 1V3UA 3VNVA 5KTPA 2XNHA 3GZ4A 5HIMA 2QZSA 1SVSA 1K4DC 2Z3WA 3AW8A 4YUZA 2DOSA 1Q1AA 1BVYF 4WNAB 3H0CA 4J8PA 5KKAA 3WKEA 5HQ3B 3IP9A 3IFSA 5G4LA 1Q1GA 4JENA 3D8RA 3CZPA 1AR1B 2YOGA 3NWOA 4US1R 1GHTA 3PL1A 3TCKA 5MFPA 3LDCA 5JWPA 3TFOA 1J70A 3KEMA 4W9MC 5I7RA 1LLCA 1QVWA 4Q47A 2V74B 1CE8A 1ENYA 1YD7A 4FFMA 4ANFA 2R6HA 2YHAA 1YJAA 4W8GA 4GC5A 5EIHA 3QQ5A 3QK7A 1W581 1GGFA 1CKEA 3LBIA 1Z6AA 2BSXA 3I12A 5SY9A 4B81A 1PQUA 2D1YA 1B26A 4D9CA 1S5HC 2HA7A 3LQFA 2C3MA 4FJ1A 3LQYA 3NM6B 3A6FA 1FNNA 3WB0A 3DMHA 2CK3G 3TIGA 4IDFA 5KNCA 2G09A 3KCXA 5DXJA 4J75A 1OFUX 4IOJA 1JFFA 3OHMA 3LNNA 1ZLZA 2ZBDA 3JARA 3LUAA 3IXMA 4RKWA 2NQ8A 4ILEA 1GARA 3UA4A 2W6ZA 4NVRA 3AU9A 3K09A 2Y67A 2XMDA 2ITDC 2H5EA 1N2CE 3D3KA 2QI9C 1XJCA 3OKCA 5AKYA 3GRPA 3R5KA 3H9JA 3ND6A 4O4IB 1GH6A 2HPZA 2FLKA 2N9UA 2D5AA 9ABPA 1Y3DE 4BGDA 5D84A 4R1LA 3HFJA 5CHEA 4CC5A 1NH2B 3ANYB 4YRIA 4R01A 1RRMA 4IDBA 4CIBA 3VRHA 1U7DA 4C6TB 4HLUC 4YV2A 1FSPA 1QYIA 2F95B 3UMCA 1CQXA 4NYIQ 2G1UA 2ESRA 4WCEV 4OP1A 1K88A 1IZ7A 3T54A 1I7NA 5JXHA 3OTOB 4TTTS 4D4IA 3ABKC 3S8EA 4P34A 1CRLA 4LDAA 2Q21A 3KZ1E 1WP7A 2JLQA 5HA5A 3C3PA 1AO3A 4RU1A 2V7QA 5JQWA 3MCVA 3HH8A 1M73E 4NCBA 5H82A 3PC3A 2Q9BA 2MYTA 3SJAA 3O1HB 3Q4HB 2GM5A 3ZZ1A 2WA1A 1ULBA 5ALDA 3BRCA 2AG1A 3ZQ6A 3H19A 4R2HA 1KC8W 2H65A 1TQ4A 2IH2A 1UBLS 2PLRA 1OCZB 1U04A 4IIXA 3HJRA 4DCGA 4LNUB 2BYTA 2V58A 3K4PA 1RYEA 3GW8A 5U4QA 3CR7A 5KHGA 2HF2A 1NDHA 4PHZA 1TQ2A 1FNMA 2ZSAA 2UZ1B 3KOXA 3D3QA 5E9QA 4ACBA 1M1KW 2DFLA 1C30A 3T9EA 4Y1EA 1G7RA 2X58A 1A8IA 2C2YA 4B8YA 2DQ0A 2OG2A 1U1CA 4CVNA 4EG6A 3TLCA 5FLXN 1C3LA 1ZICA 2I6XA 1H1LB 1IG3A 4UHFA 3SGIA 4XOIA 3L8CA 3F1LA 1TCBA 1VLLA 1A9RA 1U97A 4CLRA 3FNHA 1CZKA 3RQSA 4BLSA 4BC0A 3QLVC 1TRHA 3PFKA 2PJZA 2ECPA 2C84A 1FL9A 3B2EA 3K0AA 7MHTA 4OQXA 3NWBA 1VHLA 5AUPB 1F4NA 1WW3A 2JFPA 5HKOA 2FSVA 3W7UA 3KYJB 1GN4A 1SEVA 1S2IA 2Z9CA 3PHCA 5L3VA 1E7RA 3AFMA 4D99A 4URWR 4ZZ0A 2LR0A 3LXUX 4HBNA 2OLKA 1QAOA 1YC2A 1OU0A 4FDTA 5K20A 1BGYH 4RWUA 2PUVA 4D6YA 4UU1A 3GLGE 1VM6A 1E1CB 2C54A 4IGAA 2W6JA 2OC9A 3OO0A 1W4LA 3CU5A 3KQMA 2DG2A 4PPNA 2QN1A 4LCBA 2LQTA 2NNWB 2HLDA 1CF2O 3CF2A 2XIQA 1ESNA 4EHIA 4M7PA 5CCDA 1UK8A 2HYDA 3LT0A 3GI1A 1A8HA 1R2QA 2CUKA 1RWBA 8GPBA 2ZB3A 1J20A 1UMKA 1IY1A 2NO0A 3BVPA 3DGEC 1J9GA 4QJIA 4UXHA 1W48A 3LIIA 2J9GA 4P35A 5JDCC 4L4XA 1VMDA 3D6JA 1CFZA 3H1LH 4MUXA 1USWA 5JEEA 2XB8A 5KNDD 3P0RA 3O2SB 4IF4A 4JT9A 1PP4A 3QOWA 1U96A 5KWIA 3Q2KA 1KDVA 2PFGA 2X0RA 4GPIB 1HT3A 3CR3C 2EJCA 1WKBA 4JOCA 4LHEA 1S2NA 4IHJF 3L8ZA 1R5JA 4J80A 1UWKA 3S2UA 1I08A 4I55B 1EX6A 2NO9A 4C7XA 1A7AA 5BWMA 3QVUA 2V55B 4DO2A 3LT2A 3IBCA 1MB9A 2GKOA 1R64A 4HB0A 5ALVA 1RLUA 4ITVA 5JFOA 4BLVA 3WNZA 1U8FO 1H05A 3QUCA 1CQJB 5JNLA 1ZH6A 5AVSA 2WB2A 3K1JA 4DV0O 3KJXA 5A9RA 2JGDB 1CD5A 1UWLA 3ZH2A 1PFGA 1X38A 1MT0A 3KBOA 3QFTA 3DTTA 5JAHA 3QNMA 1UM8A 3L72H 4IYRA 2IEDA 1JIVA 3GVXA 3TF5A 1XK7A 2YZNA 3QV2A 1OLSB 2DJ5A 3OM1A 4K8RB 5B66Z 1K4KA 3VQVA 1PJZA 1Y82A 3TLYA 2WK1A 1KAEA 1WNFA 4W5HA 3R23A 1FDOA 3BQMB 4JK3A 3SOPA 3PZBA 2AV6A 2VDUE 2RMKA 4BTLA 4CS2A 1X80A 4R0MA 2TSYB 4EGAA 2BDTA 5FLXA 1IZZA 1IXYA 2XWBF 3EWSA 2FFBA 5DX1A 2ZRFA 1J09A 1GPKA 4L2IB 4EJMA 2H9IA 3QI2A 5KKNB 1EWRA 3WKCA 2PSEA 1JF8A 3KAJA 4WK2B 3AKEA 5KB3A 1V1RB 2GUZB 3L7YA 2W6JD 4RC9A 3PTAA 5KIAA 2QX6A 2B20A 4IMPA 2GOYA 3L71H 1B8NA 1UJ5A 1M2KA 5F21A 1Y3FE 4AF7A 3E89A 4MW7A 4LZAA 3VOAA 1K5HA 3KB8A 2AQKA 1NMEA 2F67A 3W6NA 3Q9SA 2RHMA 3UB4A 4NDZA 2VP9A 3QLUC 2XUHA 2CLSA 4Y2JA 4ND2A 4NZPA 5KDDA 5DNWA 3DLPX 3THYB 1WQ4A 1J5PA 1SVUA 1MPXA 2WSIA 2NLOA 1U2SA 2I6UA 1Q57A 1VG0B 4FHEA 1PG2A 3PXBA 1Q2UA 5B3KA 1PR3A 3KJHA 1N2CB 1AI4A 1THGA 5IWAB 4F86A 3EIHA 3ESBA 3N05A 4BNYA 1O4WA 1BWRA 1A72A 4YP6A 2A0XA 3EIOA 1XKTA 3MQ4A 2EL9A 4BFLA 4GNRA 2OZLA 1JU3A 4CMKA 1PT8A 1YR1A 3DOIA 3KRTA 2C20A 5F98A 3AFHA 1ZKDA 5FPOA 2WWHA 4F21A 4KREA 3BOSA 2GZAA 1BHBA 3BMCB 1N3BA 2PRYA 3L4KA 4LDPA 2IYPA 3IV9A 5I4BA 2HPVA 3DGFC 3HL4A 4CM6A 2REBA 5KAPA 4X1KA 4CT5A 4G1CA 4W1QA 5A6SB 4C7KA 1WO8A 4X6LA 4V03A 1UKZA 2H3OA 4RGBA 3WP1B 2FI1A 4AD8A 4BVBA 5BVHB 1LV8A 2R7NA 3B40A 4UMEA 1RM0A 2HN9A 1Q1BA 1R4NB 4XTRA 3A3NA 1JA9A 3I9V1 3SR3A 1DS6A 5AW9A 4NCJA 1YZFA 1NQOA 1AZWA 5DHRA 4TS3A 2Q9UA 3UTDA 3I53A 2ZCVA 5J4YA 5H8WA 4MP8A 4PANA 3OUTA 5EXPA 4Y3UA 2FX5A 3AIMA 2R6R1 2BUBA 1VEWA 1J99A 4JC4A 3MIIA 5FLKA 3A4NA 4B3IA 3TJTA 1U0EA 1S96A 4QOIA 2OHFA 1XP5A 5KU1A 3QSYA 4WFAV 5EIBC 1FXSA 4BIUA 3Q8KA 4EG3A 3E4CA 4H3HB 4PHGA 2I2CA 2B4KA 4H4EA 4AF8A 2WLHA 1SGWA 2WD7A 2QB5A 1PV4A 4GYJA 5ER9A 5EQFA 2BT4A 2D8AA 2IU4A 3NBFA 4GL2A 4H3VA 1NJ8A 1VRCA 3AV3A 1IBMO 4A0SA 1F8GA 1XRPA 4KITB 4CG0A 3AEXA 1F9EA 1NZDA 1KVSA 4IIJA 4YUYA 4BUCA 2D2CB 4BBAA 4F38A 2R85A 2AWOA 2GCOA 4FS3A 4LXQA 1NNLA 4JR0A 4I50A 1DB3A 1QZTA 3EXIA 3A2FA 5BUZA 2D1TA 2GBIA 4OXSA 3M83A 1D4FA 1NF3A 4DM4A 2G4LA 3OGIB 1WQ1R 3K31A 4KN6A 1SVOA 1A1SA 4P3OA 4A8PA 4F0JA 5JZBA 4Z7NB 2OAP1 3GIWA 2CDRA 3H87A 4MYHA 1CZNA 1J24A 4MYUA 4CF6A 5EXSA 2VPQA 1TOAA 2FMUA 2H5IA 1BO6A 1J6UA