3E35A

Actinobacteria-specific protein of unknown function, sco1997
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
269
Chain Sequence
b'DPQDLYTWEPKGLAVVDMALAQESAGLVMLYHFDGYIDAGETGDQIVDQVLDSLPHQVVARFDHDRLVDYRARRPLLTFKRDTWSDYEEPTIEVRLVQDATGAPFLFLSGPEPDVEWERFAAAVGQIVERLGVRLSVSFHGIPMGVPHTRPVGITPHGSRTDLVPFEEAQVPGSAEALVEYRLAQAGHDVLGVAAHVPHYVARSAYPDAALTVLEAITAATGLVLPGIAHSLRTDAHRTQTEIDRQIQEGDEELIALVQGLEHQYDAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SCO1997
publication title Structural and phylogenetic analysis of a conserved actinobacteria-specific protein (ASP1; SCO1997) from Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Unknown function
total genus 85
structure length 269
sequence length 274
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e35A02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e35A01
3W7WA 1YTFB 1S3JA 2HR3A 3W7XA 3BY6A 5GW7A 4G4SP 1NVPB 3E35A 3GAAA 3WZ2A 3W7TA 2P90A 3D3IA 1RM1C 3IC7A 3W7SA 3MNFA 1NH2B 2WAMA 5CA3A 3VR0A 3W7UA 4HAMA
chains in the Genus database with same CATH superfamily
1PUIA 5G4KB 1WXDA 3MBIA 3OO1A 2QRGA 3RB8A 4DPMA 1SQQH 4YEDA 1YHNA 1FFGA 5CFZA 2G5PA 4LXTA 2BPOA 2QAJA 1B0PA 2D06A 1DKUA 3L04A 1CF4A 2ZKIA 1RIIA 2JK1A 5HUHA 5LP6F 4HH4A 3MWYW 1J49A 4FZJA 4X6UA 2ROQA 3ZU2A 2MSCB 3ORRA 5B1BB 4MR8B 4KACA 1PNKA 3MAGA 4F4IA 3M5WA 3F3YA 5DRYA 1QG6A 2ETNA 1WB5A 1OV4A 3NKLA 5C5CA 1KDYA 4M60A 5C3MA 1A50B 3DVLA 3RLFA 2NN4A 4DUYB 8ADHA 4GZ3A 4J0KA 4KVGA 1KTVA 4M8SA 5AKXA 4C6SA 4DNFA 3JAMA 2HJWA 2FN8A 4ZVLA 5EWMA 3W1EA 2Q68A 2I3ZA 1P7PA 4HFJA 1ZNWA 1B8UA 3A9CA 3DBRA 3C1OA 1Z45A 3DL4A 1MABA 3UHFA 3I42A 1W4CA 4Y2GA 1CJVC 2HI0A 1KRHA 3I28A 1L4KA 4Z5XA 3PJEA 1LNZA 1DUSA 3SYCA 5I5EA 4W4TA 1B8VA 2I91A 2P3OA 3L74H 5LGUA 4QARA 2XWSA 5ILOA 3HKEB 2RG1A 4E15A 4KMOA 3ZNQA 2VXCA 5EZYF 1NKSA 1JN0A 3OCXA 1GTJ1 3Q3IA 4AUKA 1P7WA 3MJFA 3VR6A 2IHTA 3AXSA 4JLUA 4HEQA 2UKDA 2QV0A 2WA2A 1WIWA 4CTOA 4P7JA 5TARA 1BCSA 4I5DA 3BPZA 4C7BA 4KE8A 2QZSA 5E2BA 2C3PA 1KI3A 4CKWB 2ZUTA 4D8YA 4ZU3A 1JMYA 3N5KA 3SBEA 3R4VA 4DM4A 2PXAA 4DR7O 2AFHB 3RUDA 3KTOA 1Y74B 4P86A 3ZE1B 3GRVA 3RTAA 3NBQA 2ZUVA 4C7KA 3O4FA 3T8YA 3LGXA 4MVSA 3DD1A 2XWJI 5AW2A 2QRHA 4YRAA 2NUTB 4N0DA 2XXBA 1X7XA 1PZNA 1GSHA 2W2PA 5TEWA 1M1YB 5BSVA 4DW0A 5TISZ 3PZRA 1ADFA 1G66A 1DBQA 3IS3A 3GNSA 4DWOA 1MJFA 1P0IA 2GJ8A 3ID6C 4IBOA 1J0DA 2YVQA 2AOUA 4OQDA 3L6OO 2C9DA 3PCTA 1A2OA 3B6MA 3PPYA 3TPFA 4CKXA 4O2AB 3W5HA 3CH4B 1K0UA 2PH1A 5AM4A 5TJ9A 3K5PA 4YY3O 4EGCB 4NWIA 4EKEA 2XITA 4DSUA 4X95A 3P2IA 1GG5A 1KI8A 3R0IA 4UHBA 2A9QA 1GZ7A 4LEIA 4BRZA 1I6LA 3FROA 1AO0A 4NOLA 5EYPB 4PN7A 1FS4A 3FGOA 2LGWA 2ZPAA 2JAPA 1X14A 5KINB 5A4IS 1ODIA 3RS9A 2IKSA 1SGWA 2QXUA 3KDPA 4TYQA 1YGYA 4G8DA 5EVJA 4U2FA 2PUCA 1M5TA 4KL1A 2PO7A 1MZFA 3SGIA 5JIBA 3CPJB 2PMDA 4UNPA 3RHFA 2PAAA 2WRZA 3Q7TA 5CEJA 1U02A 3VTZA 1Z2AA 3EVNA 2IH5A 1K73W 1NVEA 3JQAA 3R0QA 621PA 1SK8A 2NSYA 4DV0O 3LDGA 2POQX 5H16A 2OP0A 1EI9A 1CF9A 3H9UA 3P9KA 2CXRA 1LTKA 3NGXA 4QXMA 3C3AA 4JI6B 4UFZA 4A8JA 4AJIA 3SOZA 1ZM3A 1W85A 3R7SA 5ECWA 1K4CC 3GF4A 3KOYA 4IIHA 4N41A 4JY7A 4W5NA 4LJSA 2YY7A 1XHLA 5K1PA 3ZX5A 2NZWA 3LPAA 2GAFA 4DMKA 1ZD3A 1L0LH 1H5UA 5EGSA 1NMSA 3RYFA 3RPEA 2VCEA 1T2DA 2JL1A 1C7JA 3GEHA 1CZUA 1SUIA 1ZJWA 4HFNA 1DIHA 2I2AA 1TTQB 1CRLA 4IRMA 1NMYA 4EFMA 2H9YA 4B17A 1U11A 2WMYA 2ZBQA 1PX2A 4LJYA 4CL2A 2UYGA 3W5CA 4J3JA 1W76A 2B78A 4YRGA 2R5WA 2BISA 3FMGA 2D13A 4J2OA 3TZLA 5TC4A 2YVLA 3PT9A 3PD7A 1WABA 2NZ8A 3NG1A 4G27B 1E2NA 2VDLB 4HZGA 1TVKB 3GFVA 3Q7PA 3V8RA 1N8KA 2ODBA 4PXSA 3TTYA 3G8BA 5DEIA 1ANKA 3HWWA 2SKEA 5JNRA 2MSDB 3O2NA 4JI1O 3ESQA 2MTBA 2AZ4A 1IBLB 2RGAA 1RQ2A 1N7JA 5BMVA 3FSEA 5DYGA 3U4DA 1DC3A 4B2IA 4P7FA 5IVIA 2G83A 4KTVE 2HHHB 1VQNV 3LT2A 3EHBB 3PXCX 1MC8A 2ODAA 2CL6X 3K2BA 1PTJA 5ALOA 3M9WA 4PHGA 3H9GA 4ND7A 3HCFA 4A5SA 1B93A 4UATA 5EFOA 4I19A 2GPTA 2DUNA 4ITVA 2VTDA 3LH5A 2P5UA 3UUWA 2ICAA 3CX7A 3M3DA 3OF3A 3BWCA 4JFRA 1S72V 2FDXA 2I8AA 3W6OA 4W6QA 1QCEA 2ZTLA 4ZOQI 1TKAA 3GT7A 2GA8A 4LFBO 4K6FA 5JI3E 2VLIA 4HR7A 5EPEA 2G5CA 2JGEA 1RACA 4NKRA 3T1OA 4J7XA 5ULLA 3TL3A 2BR4A 3FUVA 1S0UA 2RONA 1FJGB 4NZOA 1P2DA 3UUGA 2EKLA 3VJKA 4ZGGA 5EWMB 1NW8A 4DBLC 2C2WA 4OO3A 4JJEA 1U28A 5KSPA 3ZNNA 2NLOA 1Z75A 2VFAA 4Y2SA 4XM0A 2X42A 3DBRB 4WK2B 1BAPA 4XDYA 1OWPA 4FJCC 5KYNA 3GP8A 2EDAA 1MABB 1XHZA 2P6PA 2ZQMA 2QSYA 3TSCA 4DUZB 2Z8ZA 4XYBA 5DNCA 1MVOA 3L0BA 4H1TA 1WXXA 3UJCA 2YDYA 2OGZA 4EHBA 1AQLA 5EQDA 3EUFA 3OMIB 2XCIA 2Q9AA 1IB0A 1G20E 1EWRA 2QT9A 1GU7A 2PJDA 2PRSA 4ER6A 2HAEA 1CR1A 3ENWA 4YQYA 2FOXA 1I51A 3WSWA 3L7AA 1G2OA 1XDBA 4H0CA 1VBMA 4ZI7F 1NJ1A 1N8SA 3ZTTA 3F2VA 1EZ4A 2OCAA 5CG1A 4DV1O 3NHBA 1A71A 1JA1A 4ZJUA 2ILTA 1ZX3A 2FPLA 2QN8A 2YHAA 2ZSUA 1Y6FA 3WLTA 4Q39A 2Q3HA 3FJOA 3LX6A 1BCSB 4FE4A 3BB1A 1YZLA 1S0VA 3D2AA 2IUUA 2R87A 2JFUA 1OCCC 2P2SA 2AEFA 1R9NA 2WTMA 4NYJQ 2RHCA 4H44B 2PS1A 4NJEA 1M90W 1BGWA 4D57A 1SCUA 1E2EA 1M8GA 4K9NA 2GWRA 1RJDA 4GS5A 5TMPA 4RD6A 1U04A 2QM7A 1X7XB 1L5SA 3GYBA 3WGMA 4N7RA 3ZGLA 1SEVA 1DWOA 3I5MA 2Z5LA 4L0QA 1J0CA 2AOUB 3QU5A 5HIJA 2OVFA 2CAZC 2MR6A 3PHBE 2QLJA 1U5CA 1TA9A 3L9WA 4RVGA 4Q9HA 5FOWA 1AUPA 1P77A 1H2LA 4CH3A 4UUAA 1SHKA 2P8SA 3K9NA 1JJFA 1NKDA 5CVVA 1E2MA 2P78A 4C0XA 3D5TA 3THXA 3MIZA 1AGYA 1M76A 2F4NA 2MJLA 2Q3JA 2Q0SA 2QM4A 4GWKA 3TR6A 1ODJA 2E9SA 2YI9A 3N2YA 4I2VA 2VQ3A 3R9XA 3QU4A 4GCZA 4TMTA 4KLAA 2XT6A 1VE3A 3ZEAA 1I94O 3D7RA 3INGA 4XKJA 4IMJB 3FWYA 3AF6A 4KJXA 1GQSA 3L18A 4QJIA 5LUBA 3VHXA 1UZNA 4MTFA 1G5QA 4GI7A 1QONA 5HJ7A 4JI4B 3JQAB 2G9UA 2OFWA 4DM3A 1YCHA 4RIEA 4XTCS 3KXDA 3SVZA 3DPIA 1Q0ZA 3V8NA 3THWA 4KXYA 1PNLA 1G7SA 3O1JC 4B2YA 1SPXA 1Z07A 3LY9A 4ZZ0A 1W85B 5KYGA 3H8WA 2IXBA 1NTRA 3AL2A 1EZ1A 4WKOA 3SQMA 3IDAA 1JHDA 2AZXA 4BYMA 2A6PA 3RAPR 1E9RA 1L4MA 2FCRA 3ZMZA 3NHRA 1BGYH 4YHHB 3RYFB 1JXMA 2R6ZA 3LCUA 1FU4A 3PDWA 2Q49A 1F6BA 3LYLA 2RGYA 4IAOA 5KUTA 4Z2WA 4RHYA 3ABRB 3T0FA 4JLVA 2QIPA 2NO7A 5DU2A 2W0MA 2WWGA 4IM7A 4O4HF 3N5CA 3GEEA 3H9QA 3TX6A 1R8SA 2B36A 1PWZA 2XB6A 1MDFA 2GT1A 1ORRA 2BUBA 3Q3JB 3OIFA 3TVTA 1VMDA 4QQKA 1WETA 1CZLA 3WMFA 2VF7A 1YJ5A 1QNLA 5BMVB 2H7YA 1QF7A 2EWWA 3B3AA 3SF0A 1XFAA 3PRHA 1YR9A 4MGZR 3D3JA 1UAGA 2F67A 5JJCA 4QL3A 3RAEC 4Z86A 4G0WA 3B7GA 5I9TA 3KFLA 2ZROA 4FS8A 4OUDA 1PPJH 1FFHA 3GMIA 1D2DA 2ID8A 4RGQA 1UFRA 5FPHA 2ZU6A 1EG2A 4JVSB 2QSUA 4X88A 5ADHA 4S1NA 1BMFD 4HDAA 3HB1A 1LVUA 4BNMA 1N6PA 4FFVA 3UVEA 5FAXA 2E37A 4LF7O 3QVUA 1RHQA 3Q11A 3M70A 4FSDA 2ZI5A 1DPGA 1ZL2A 4A4DA 4WXRA 1ZC4A 3EGCA 2C7QA 4MICA 2CXXA 1KJNA 1XNQB 4OLHA 1CJTC 1QHSA 2GZ1A 3VNUA 4MARA 3CNLA 1THGA 4IL5A 3N0VA 2N9UA 4KIWA 3K9FC 1BQ4A 3QVSA 1V5EA 2EC5A 3BJRA 4XGNA 4ISCA 2ZG6A 4MV1A 3H1KH 2Z57A 5DSXA 1NURA 3PQ3A 2NSLA 1TFUA 3MT8A 3X1JA 4RD0A 1GKUB 2V7BA 1Z6XA 2OK7A 1E3IA 1WUIS 3UWSA 2O2HA 3KKOA 2QL5A 5AKLA 4U5XA 3G0BA 2YRWA 1RQXA 1L0BA 4QE7A 1SK9A 4KFUA 2H7VA 2QE6A 5TNXA 4JPRA 1KGSA 1YQEA 2WTXA 3WWYA 1N92A 3LNTA 4AVYA 4NXNB 1KI6A 3W6NA 2H0QA 4NXMB 4H4CA 1S4QA 1YCGA 2FW6A 2NAPA 4ZV7A 1UXIA 4TVSA 4L8JA 1U4SA 3H7AA 4J1SA 1DF5A 4GMFA 1U7TA 1TO1E 3ZQ4A 1WF3A 3NNSA 4ZMSA 4F1KA 1TIKA 3WLEA 3D8BA 4AWAA 2HA6A 2P6RA 4NJEB 4NMHA 5DLEA 4DFDA 1WKCA 2F3QA 2JKZA 3EC2A 4LHYA 2DSNA 1G9TA 1SCUB 3GJTA 3CUVA 2D2VA 3DD5A 4QUIA 1ZH6A 4K2HA 1FXWF 4YYZA 5LQDA 3PE6A 1V8ZA 3DZDA 4M0PA 4HQRA 2CXPA 4UBIA 3KETA 4KGZA 5HRCA 2ZJBA 1NYQA 4CQLA 1JILA 3DOUA 3DDHA 2KBEA 1IUKA 2J45A 1N77A 4D02A 5IY5B 2J3MA 1UDXA 1T9DA 3DBHA 1P4GA 2I3AA 4JJAA 1E1NA 3G2HA 1C81A 3RUCA 4MEJA 1JXAA 3KQUA 2WG1A 3VO2A 3CM0A 4F4HA 4ROSA 4ZJZA 2WWFA 5FWDA 1TDJA 3W5DA 5FDFA 1GDDA 3VU0A 2NWQA 4X20A 4BV9A 4PZYA 3WQHA 1DC5A 1GSIA 2QX8A 1MJGA 2OBFA 1GZHB 1E66A 4LFAO 2XI4A 4MWZA 1W36C 1DTSA 4E11A 4QXRA 2Z5GA 4EKYA 1I3NA 1XTVA 3C6MA 4OOEA 3TM5A 3CURA 3ZE8A 3X1WA 4AO7A 3FKSG 3MUNA 5G02A 1Y8ZA 4ZO7A 2ONCA 3CH7A 2N1BA 3G13A 3Q85A 5BSUA 3CVYA 4HVLA 3VHXB 1WXEA 3U40A 3C5EA 5ARCA 1MOQA 3GIWA 1RZRA 1VL1A 2PBRA 3BTVA 1AI7A 2R9AA 4CG2A 2RG7A 3I9JA 2P5SA 3TCKA 2BLNA 1KETA 5KREA 5JSUA 2YS8A 3ETQA 3THWB 3PFWO 3GFRA 1C0IA 4LE0A 1UUFA 3KUUA 4C7MA 5LMUO 1I1NA 1PEYA 2YASA 5TR9A 3EXHC 5E1DA 2IX9A 2B8NA 1NZJA 2OGUA 4W9NC 3U3JA 4CTNA 2X77A 3SJBA 4XPZA 3V4LA 1TYAE 2IOYA 3MLAA 4V3BA 4PAWA 4B74A 2CDNA 1KWGA 3E03A 2QENA 2H65A 2FHSA 3RFVA 4YUZA 3JWIA 3QYPA 3BWVA 3EIFA 3MN1A 4QA9A 3U3KA 1VQOV 3H2YA 1OC2A 3CX4A 3OPYA 5FL7D 1RP7A 1ULBA 2RSLA 4L3WA 3V4FA 2OO7A 1T0JB 4R05A 4Q02A 2YN2A 3SCZA 1Q14A 3PEYA 3FSJX 1VQ5V 4RDCA 3CCRV 3G1WA 2C8VA 4EG6A 1E3SA 1AKYA 4HN9A 2NW6A 3Q8KA 3F71A 3UQ8A 4NCJA 2ZJOA 2ZRJA 5CT4A 2XOKA 1QANA 4X8OA 3T5MA 1KQSU 3JS5A 1YB6A 2ODEA 3H5LA 5J5AA 1IG0A 1PR1A 3RK1A 3HYLA 4OATA 3KALA 3U1BA 3R3JA 1A8QA 3BF7A 5CX4A 5A2GA 4JI5O 2J59A 2I4OA 2FR8C 4XDHA 2KMLA 4PSDA 1N2JA 3K3PA 2YYAA 1E63A 1MB3A 1Y6JA 2C03A 2GPWA 4A2PA 4NMLA 5CT9A 1Z2OX 1SC5B 3OZVA 1N2BA 3R40A 2L0XA 3TR0A 4OUDB 2WUFA 4IIBA 1AQYA 4F6EA 1S3IA 2PKWA 1QE5A 3W9SA 2QX9A 4FXOA 1W5BA 2BFDB 2XTJA 1EFRG 5I7SA 4LDZA 1JWAB 3T1VA 5MN4A 3ONDA 5BSMA 2GPSA 2E0IA 2Q29A 1OXUA 4W99A 1QMGA 3EY9A 2FLVA 1GRCA 1OE0A 5TF0A 2GA9A 3KLNA 4PEVA 1AI4A 1AJEA 5C0OE 4EATA 4WBSA 4KE7A 3D4NA 1XVLA 1FBTA 1HORA 2CFRA 4PC7A 4ZBMA 5TX7A 3TSYA 4HH0A 1RAHA 2EP8A 3QTTA 5EHQA 2XUIA 3NCHA 1M1XB 4Z7NB 3BKWA 3UM7A 3GGDA 3HMKA 1VKNA 3PIRA 1E5XA 2OV6A 1W581 4P3KA 3KQMA 4TRRA 1DO2A 4JI8O 4BKMA 4MINA 2IUEA 2VNJA 1K08A 4H7HA 5EBMC 3KPUA 1A8IA 5I01A 1JU3A 1G8KA 1RPNA 1N5LA 2Z2XA 3FBTA 1ZHHA 4O02B 5AKIA 1V0JA 3BFRA 3CRAA 3OVMA 4DMRA 2N04A 2FLKA 4K40A 3BDVA 3T0IA 2DB3A 2JLVA 5E1MA 1WA8A 4BWVA 2NU8A 1E92A 2Y2VA 5ALMA 2FN7A 4N4AA 2RK4A 1BE6A 1CQXA 2DG2A 5EKXA 3U0ZA 1KI6B 3SBDA 1OJLA 4U6SA 1V8BA 1AHNA 3RUHA 3VKGA 1A8SA 2ZSEA 4EO7A 3PNMA 3P0HA 1KARA 4KFSA 1TJ3A 5WRFA 1W44A 3ABSB 1ZY2A 5JDCC 1FFYA 4RBNA 2WU4A 1DXYA 3NR2A 1LDNA 2X9NA 1UBEA 2ERYA 4KVZA 4FDAA 3GJ0A 4QVIA 2VN8A 1NBMD 2FZ4A 4BMNA 4GX5A 4NAHA 1TZ2A 1RJWA 4JQZA 3LC7O 5D6NA 1ABFA 2IP2A 3OAAA 3V8VA 1JF8A 3AUYA 5AVZA 4A6XA 4HAIA 3N74A 2OYQA 4CQLB 4RW0A 3OEHA 5CYFA 1X1QA 2JGDA 4H3KB 3GJ4A 4KIFA 4BNHA 2X7RB 2F6RA 3UAWA 4NEHB 3BCUA 5DHAA 4WFHA 1TD1A 4C21A 1N1MA 1U7XA 4GMDA 3M4NA 3P26A 1OFTA 2IXGA 6CHYA 3D8SA 4WRRA 2XGGA 1QQAA 1HQKA 1VL2A 5JXGA 1NNEA 2EYQA 3N9IA 1L5QA 3A8TA 4X20B 3F6RA 4HDOB 1Q1NA 3TNLA 1A98A 2GF2A 3QKUA 3A4MA 2W37A 3FUWA 3FPJA 3DDUA 3PQDA 3TW8B 4ID9A 5ALVA 2X8WA 2JIZG 4QSMA 2H11A 2ADMA 4CKEA 2GRUA 2F1MA 2NSHA 2QF7A 3OIVA 3ABKB 3H2BA 2UUAB 2GAIA 1NAHA 2C4KA 3MRSA 4YXWG 2C1EA 3RH0A 5J2UA 2XGSA 1W49A 3ASVA 4P80A 3UHJA 4YWJA 4QTZA 2OB1A 2AOTA 3L6UA 1U2GA 3WB1A 5B7NA 4OHKA 1YRHA 4L9AA 3RVPA 1FCJA 3QVXA 1K7XB 1M1NA 5DM0A 1CY6A 4M1EA 5I7RA 3T38A 4ZZ3A 4F4DA 3WYDA 3ESXA 4LV5B 2P2ZA 3MCWA 4DV7O 4QTTB 3WKCA 3T5DA 1H0SA 1OLUB 4J2HA 2G0NA 4E2XA 1R4MA 4QODA 4XYMA 4EVRA 2Q1WA 4PQEA 2GCOA 4GOJA 3DAYA 4KV9A 3AVTA 3IAM6 1I0IA 2PJRA 3VU3A 1QO0A 4D56A 5JS8A 1GCGA 4OJQA 1NUAA 2CHUA 4KPUB 1W6UA 2JHAA 4DV2O 1ZG3A 1QIFA 2HYIC 3B2NA 1NMXA 5IBCA 1UZUA 2JRCA 3R5HA 2I4RA 1US8A 1XCBA 4POAA 2I6UA 4PYRA 4RNCA 1H8HD 1O95D 1DEHA 3LUTB 4JGGA 3LBAA 4JOCA 4Q16A 4L6AA 4N0QA 4B6FA 1IMJA 2IZZA 4B34A 1A2BA 1M2EA 1I8TA 4FMBB 3B1VA 1AIPA 1JB1A 4WJLA 3ZWNA 3X1KA 3JSAA 3IUNA 4Y2XA 2Z3ZA 1IHUA 1L5HA 2IDJA 4UPVA 1A2QA 2WE8A 3PTAA 5EXTA 4C87A 4QPCA 1WUTA 2BBSA 1KJJA 2FF5A 2XEXA 2PUDA 3GWOA 4L22A 1BYUA 1QPGA 3TAHA 5DYWA 2HPZA 2AD5A 1DMSA 4MUKA 1V6CA 3Q9LA 4KR6A 1GV1A 4I8XA 2NV6A 3UK0A 4E7OA 3K1AA 5BV0A 4V0LA 1M0EA 4DK0A 3M6XA 2FEKA 4P92A 3KQHA 4KB5A 4DARA 3SIPA 1MW8X 1BC5A 2IS6A 5LJLA 2ECKA 3V3KA 1JXOA 4BFXA 3KSRA 4QKQA 4D43A 2F00A 3W7BA 3KZNA 4K28A 2NV2B 1XZBA 3OUZA 5KPDA 1CNFA 1FX1A 1DGSA 4GGPA 1TE2A 1VG0B 5CA1F 1E2IA 5DTEA 4XCXA 3NFRA 4G56A 4DCVA 2BEUA 5J4KA 2A5FA 2B9EA 4NDZA 1T6ZA 4HH3C 4U3FH 1JYSA 1W88A 1PVDA 1U2QA 1Y8QA 3L7DA 2TS1A 4L8WB 2MYNA 4M49A 3K35A 1CERA 3E5RA 1Y1QA 3V4PB 1E1YA 3BGWA 4YONB 1SXQA 1QMPA 3CNEA 3HADA 2VPZA 1OCZB 3N7AA 2IEAA 4MW7A 1QU2A 1DZIA 3RIYA 3HC7A 1I3KA 2C92A 3BMCA 1UPCA 3KB2A 3OECA 3RRYA 1OI4A 4RHFA 5DGXA 3WE7A 5DK4A 3H1GA 5KHHA 1M6EX 3FAVA 2L2QA 1QAMA 1XZGA 1XHXA 1WU7A 4DJEC 2C5AA 4BVLA 4AKEA 1WA8B 2Y67A 1JBEA 3T9FA 1V7CA 5KU7A 2C20A 2WVHA 2NU8B 1HI9A 5DCYA 1HT1E 4EJ6A 3BTSA 5G1OA 5LLTA 2R6JA 1E7QA 1JXQA 3A4TA 2LKCA 1CUIA 1BZKA 3W5JA 4HPXB 5JJLA 1XZEA 3GJQA 2ADPA 1Z9BA 1Q0PA 4KO4S 3E89A 3CEIA 1YZQA 3OBBA 2QP9X 3HK2A 5LHHA 3J7TA 3H6KA 5DJ5A 2RCVA 4U2DA 3DC7A 1PSWA 2H07A 3O1IC 2HM7A 3IT0A 4W8OA 3URMA 1J5EO 1ECLA 4MPDA 1X42A 1AS0A 3IUSA 4NHEA 5EK0A 1PFYA 1KPGA 1UK9A 4IJKA 3D5EA 3LDEA 1NU6A 2QTLA 2YJ3A 3LC2O 4RD4A 3Q0EA 2JGDB 5DLPA 3PQCA 4KQCA 3UZUA 2CDRA 1Q0LA 4XGRA 1S8FA 2V1DA 4PI0A 4EVQA 2O52A 4BUJA 3OMAB 2NP6A 3J7AC 4O4JF 1YK1A 1HBJA 4EK9A 3UNXA 1QR6A 1LPMA 5JXIA 2FJUA 2OKGA 3EAGA 3TBKA 1U81A 2QVXX 1XC7A 1UL1X 2FL4A 1EM1A 4MVJA 4J80A 5BW6B 5TXGA 3EFOB 2YWBA 3HPQA 3TVDA 3GMDA 4HDSA 1NY6A 5J2TA 5FD8A 3IVCA 3K09C 3C6ZA 2PMFA 3AXTA 1DAOA 4AYWA 1ATZA 3NASA 2ZPUA 5BN3A 2AYYA 1Y4AE 2PMEA 1T2AA 4TV9B 2ZR8A 4J0QA 4RANA 4JDPA 4TQGA 5L3BA 5G41A 2Y71A 4Q00A 5J2UB 3W06A 3VKUA 4R2JA 2O7NA 3MBKA 2AOTB 3HKDA 1UT8A 4CMEA 7ADHA 2J9XB 2WA3A 1U8XX 5DLQC 3PQFA 3J81A 1QB8A 3CWZA 3EYWA 2PLFA 3MYYA 3ZWCA 1A0OA 3SKVA 1ZA1A 2XJ4A 1JKIA 4OU4A 3SNKA 2V3CC 2M1ZA 4JA0A 1R4MB 4BZPA 4YR7A 1P7CA 1V5WA 2P9TA 3HWX1 4M7RA 2GETA 5AK4A 3IJ5A 4LY3A 1FRZA 4I9GA 5JCJD 2YNMC 3QFTA 4OK3A 1VP9A 4IEEA 2J7PD 4I81A 3EUAA 1US8B 3G5UA 3TIVA 1ZN7A 4LNAA 3IP8A 4R2XA 1YI0A 2GVNA 1BU8A 5L3GA 3EPHA 3UG6A 3WVNA 1NJFA 3R74A 4D8UA 3H1BA 2X0RA 4JJGA 1AE1A 1G19A 1XQYA 4YTEA 1J56A 1FSFA 1FTQA 2QZ9A 4MVOA 4B0PA 4NU8X 3QTCA 1L5HB 2IHZA 4W1PA 2Q9UA 2F1RA 2JGMA 3M6IA 3LHDA 5D2CA 3OEWA 4YWHA 3KQVA 4YCLA 5CITA 3LD9A 5JD5A 1M9NA 2QRJA 4BVJA 3OU7A 2W2TA 1XEWY 2E1RA 3UWKA 3VQVA 4RY8A 2E4UA 1SAYA 5EJGA 5KOHA 1DBPA 3GLKA 2A78A 1JIQA 3K1AB 4BKRA 1ZCJA 5JXJA 3KZCA 3BA6A 4G26A 1YULA 2XE8A 1GA1A 4UXNA 3WMGA 3C6BA 3QVGA 3ZD8A 4DLWA 3LGSA 1NBHA 1T34A 1EP9A 5AXDA 4I14A 1ILWA 2QG9A 3H16A 2H4WA 3HBFA 3GRUA 3DXXA 3MCZA 4HB3A 3IERA 5JD3A 3HFJA 3W0LB 3D8UA 1ID1A 1U8AA 4NOMA 5D3KA 2ES4A 2F7SA 2EZOA 2BEUB 3KK0A 2I99A 1AXGA 5LYJA 4DR7B 4DWWA 2FYTA 2QL7A 4P36A 4IUBS 1W88B 5HRUA 4KDFA 3AESA 4UV9A 1Y8QB 2HGZA 2HY7A 2DGDA 3EEYA 1VPWA 1IXBA 3U10A 4LTNA 1W0JG 1U2DC 1TCBA 2BM1A 1PYDA 1MQ8B 3AEUA 1R50A 4PSVA 2QU8A 1LB1B 4C89A 5IT0A 2Q9BA 4WCDA 3FLEA 3KBBA 3IIIA 2Q3EA 1PN3A 3OFJA 3BMCB 4MA5A 4DHWA 2OB2A 1BN7A 4HMOA 2R25B 1ECGA 1KZ1A 2BFPA 3IQEA 1SD2A 2WE7A 1WTCA 4YY3B 1EUCA 1TZJA 4L27A 3FAVB 4A5UB 5CRIA 1O0BA 4ZQIA 4ALMA 5A7GA 5L53A 4UC0A 4L73A 1ZN9A 4BFZA 1K5DA 3GPCA 2RHGB 1IAQA 1X7YA 3DE4X 4BQNA 1X8XA 4DCJA 1SOAA 3GP5A 5JAQA 1WLSA 1IATA 4I9HA 2G9RA 4DLRA 3WHIA 4TUYA 5HVNA 3NDBB 3FKQA 3V1MA 2GZAA 2ON6A 4P6VF 1KXJA 2PSFA 1FS5A 5ALJA 4V02A 1T5SA 1G8SA 2VDWA 2YZGA 5DHPA 2IBMA 2E4ZA 1RWXA 4UXIA 5TGZA 2UYQA 2C96A 2A0YA 1S2IA 1FA9A 3MJTA 5JYEA 4QEZA 1R0LA 5DBIA 1U80A 1V9PA 5KYWA 3BA1A 3V5NA 2QV7A 3VYSB 1NVTA 4DV0B 3IUBA 3BZUA 4TMZA 1JFFA 2X0EA 2YVKA 2CXSA 2PLNA 4EVSA 1N3IA 4C0HA 2CY0A 2DECA 2JEOA 4ER5A 2EILC 2DUMA 1D1QA 3FD9A 3E48A 1G59A 3ZHQA 3FYDA 3UGJA 1RWNA 4HL6A 2WIFA 2XNDD 4XVCA 2DUWA 3CINA 1QNMA 3O1HB 3FNGA 5D85A 1M6WA 4JYAO 2J9FA 3QHAA 1JEEA 2RFLA 1P5JA 4PC2A 3VOUA 4EL5A 1GQYA 3SX0A 2J33A 4HDSB 4C0BA 4EMUA 4WLOA 2R7KA 3L0CA 3AK1A 4ZZIA 1UC4B 5KEIA 5EHGA 3GWGA 1WB7A 4DBLE 5A5FA 1SBQA 2BOVA 5HQTA 5BN3B 2NAFA 1HT3A 3L0PA 3AR4A 3PKJA 4XB2A 3EEOA 1NXTA 1H6AA 4MGEA 1Z34A 1BDIA 3OCJA 3FWPA 2A88A 3WBBA 1P29A 4KO3S 5B1SA 4UCQA 2IV3A 1NZ6A 5EXEA 1CC1S 4JI1B 2HLDG 3ILVA 4CM1A 4C6RA 1KJWA 3L70H 3ZG6A 2BCGY 5B3SC 4GLOA 3JVVA 3NAMA 3AY0A 3C6KA 4X41A 4LF5O 3CWQA 1UZLA 1H8EA 1AN0A 2CNKA 4ZHQF 5C7YA 2WSIA 4YMGA 3JRXA 3WRXC 2PUSA 3IILA 1C8LA 3OCWA 4LFBB 2GN4A 2RC6A 3QNWA 5IVDA 5HR5A 4OYYA 5JPDA 4MLPA 3U62A 3TSOA 3ZWQA 1ZH8A 4KN6A 2BHLA 3L46A 3F5SA 1GZVA 3DEIA 4TLAA 3C3BA 5EJAA 1W4RA 1RJEA 1XTQA 5F21A 4RFSA 1N1DA 4UZEA 1DUIA 2PKEA 1A9XA 1TQHA 3O2SB 1EQAA 4ZOLA 3T9EA 5LQNA 5SZKB 3EEIA 4HD8A 2ZB4A 4UQPA 4F5ZA 1W7AA 3RUIA 4GMGA 1PJTA 3U2QA 1RXCA 2R48A 5BORA 4HATA 3E9DA 3TLJA 3BIWA 4BRWA 2P27A 5ICMA 4S05A 2C42A 4CQMD 4E2LA 5AKYA 3IULA 5ISMA 3L49A 1H65A 3C8ZA 1T2NA 4BQPA 3U56A 5IAAA 1ZIPA 1JTVA 1IURA 5KOHB 3CS5A 4RACA 1SFRA 3AKEA 2XHEA 2CD9A 3OI7A 2Q62A 2QG6A 4JJFA 2G36A 2XECA 2WWTA 4WZZA 4QX6A 4MR7A 4CM5A 4QLOA 1L4EA 2SECE 3D7SA 4LBVA 5J47A 7YASA 1SZTA 1EFPA 1Y3IA 3QVGB 4DV1B 3FJ1A 2HK6A 3DZ8A 2X86A 1AV6A 4HNGA 4KN8A 5L4SA 4GR5A 3K0AB 2OZEA 1ZRSA 4NB5A 4KQ1A 3NRJA 1VJDA 3NTLA 5K8LA 4UVHA 4W1RA 5I3ZA 1HDYA 3KL2A 2WWRA 2IT1A 2DWPA 3HDQA 3SBXA 3EHDA 2WQZA 3FPHA 5LYJB 5IVPA 1SMKA 3LCVB 4G1CA 2VYND 2WYOA 1CRPA 3AESB 3D6HA 2QROA 1PV0A 4JSYA 3AOEA 3H11A 4IDCA 1H2GA 3KVYA 2OYCA 2QTMA 5GJBA 3AEUB 5G40A 4D6PA 2JCBA 3ZDDA 1AKVA 4Y6OA 4N6GA 2I29A 4IGAA 1UJ5A 1B6SA 4TM8A 3IGAC 1ITZA 3TETA 3GZTB 2CN1A 4GI3A 3LS2A 3ZXSA 3T7KA 4H9GA 2OWOA 3E7PA 3KSMA 3QEAZ 2IS2A 1PR5A 4UCFA 1XYGA 2VT2A 4KXMA 3TXYA 3K8OE 3INNA 1N0VC 3HCBA 1MX3A 3GLHA 4I0XA 4LYAA 3OZIA 4HLDA 4WZBB 2MSLA 4UQLA 1X7YB 3HB4X 4RK4A 4MUYA 4D7TA 2VK4A 4URHA 1B0ZA 1DJNA 2OXRA 1U98A 4YAUA 1V3VA 3PRJA 3WLLA 1HDZA 4P34A 3HG7A 2ZI4A 3HDVA 5SY9A 5C7OO 1O0CA 1RRKA 4TUYB 2N1MA 2AZ0A 2HFKA 1X8LA 4Q7JB 3WNDA 2BKUA 3KZIZ 5F77A 2V7PA 2G28A 3L5OA 3A37A 1CDOA 4LMRA 2WICA 1LNSA 2VDWB 4BXOA 4J29A 5I47A 2AQHA 4WXPA 3G6BA 3ITKA 1QHYA 3WMEA 3QMPA 1E96A 1XT6A 4BIZA 4ZXPA 1I7FA 5KHGA 4MDHA 3P7MA 1DKOA 4KI0A 5KYWB 2ZB3A 2ZSDA 1X2EA 2EJUA 2AE1A 5GM2A 1GTRA 3SJQC 1L2TA 5HKKA 4QGPA 4ZRMA 1JFFB 2HT1A 3H8JA 1ADBA 4Z4CA 2GRJA 1HDIA 3C7AA 1A76A 5TB5A 3GX1A 1S5PA 4OOFA 5ALUA 2BKXA 2ZPTX 4QXAA 2QK4A 5H6QA 3WYEA 1CUUA 4UBMA 2F55A 3K4PA 1TJ5A 4GWLA 4ZOCA 2YMPA 1L5LA 2Y77A 3E0QA 1QVRA 1AKMA 2ZBFA 5B58C 4IMRA 1F4MA 3BIFA 4ILKA 2I7XA 1RBZA 4FJ2A 2C98A 2J9FB 4QQRA 2GXQA 4I5SA 4UUJC 2BGIA 3T06B 5GV7A 2W48A 5CLGA 2OWDA 3WGLA 4Q6GA 5LL6P 3AETA 3R0ZA 5HBGA 1Z88A 1G38A 3VQTA 1JFRA 3TXSA 4QFMA 4ZEVA 1QAOA 3NAGA 1NQ5A 4KXXA 3ULKA 4MVWA 4JS0A 4HF7A 3LAWA 1Q7TA 3NC0C 2QTRA 2VQDA 4DQLA 1QQ6A 1SG0A 2OGTA 2AXEA 2H16A 1OH8A 4DR5O 1TEXA 4OV6B 4EPRA 4TN1A 4IH9A 2JK0A 1YZFA 3IR5A 1YRYE 1K2VN 4M1OA 5BXQC 5EIHA 4EG0A 4U39A 2GKOA 2X6AA 3GVMA 4ZO4A 2NNLD 5CW2A 3BHIA 5AJXA 2ZB7A 2P9FA 3OZFA 2ZRAA 3MTQA 5JDIC 5HJEA 2EWMA 3NAQA 4ETWA 2PD6A 2WPDD 2ZITA 5EE3A 5H02A 4B6SA 4IKOA 1VI2A 4NBRA 2WHPA 4KCGA 3VYRB 2HRBA 1G42A 1U3WA 1UINA 3KWMA 4W5HA 5FNVF 1K7DA 2VJCA 1ODKA 4KR9A 5D5QA 1QDLB 4UMEA 1OVGA 2P4SA 3L1JA 3ORFA 2VQEB 2M6LA 4OYRA 5LGNA 1V6AA 4NK4A 1OB5A 2VWGA 3PB3A 4DKXA 1DBWA 1BOOA 4X60A 2XT9A 4QDJA 1IJEA 1S2GA 2Y4UA 521PA 4OHZA 4NYKA 1IEVA 1JU9A 4DW1A 4XLZA 2Q5QA 2Y6VA 3SEFA 2O2YA 4PONA 5H7XA 2BFOA 2J6IA 1TZMA 4EYOA 3CVUA 4OFZA 1XTBA 1LX7A 5GOZA 4LF7B 3ZWDA 3I23A 3DCNA 5BXZA 2Q7HA 4E2FA 4RFSB 2FI1A 1A9XB 2DQ0A 3NTUA 1TVEA 3TLKA 4ZOLB 4I1IA 4GXRA 4LV6A 4PTZA 5LKRA 1VP7A 5GPBA 1ZCZA 3N87A 3U81A 3HM9A 1RLIA 5IJZA 5B1AB 2RGNA 3IDFA 3HA2A 4MQBA 4QUGA 3IC5A 1L4YA 1XPUA 3A36A 4B46A 4PO1A 4N23A 4KQXA 3N0TA 3K59A 1E69A 5EP1A 3NVDA 4O33A 4XPIA 5IF3A 1G5RA 3GARA 2RGXA 3KBOA 2EIJB 1YR7A 1J23A 2AZMA 4G97A 1C9KA 3GJYA 4P98A 1CY2A 1XLVA 4MR7B 3I2KA 3B1XA 4QVGA 2XNSA 1HNWO 3WLKX 2HBZA 3RS8A 4BV2A 1YR3A 1W1WA 1ZUIA 2WILA 3QKRA 4Z1MD 3CSDA 3FTNA 1SB9A 1R5NA 3VI4B 3AJ9A 2EQBA 1XCLA 1GZUA 2W8ZA 3N0WA 3DR3A 1D2CA 1KRXA 4W9MC 1PWHA 4L4UA 1IX9A 2QPLA 3HL0A 2XZDA 5E9WA 3Q72A 1K63A 1OYOA 3QEOA 3FA2A 1E7SA 1RCUA 2JCVA 3JD4A 1YASA 3IQIX 4W63A 4I5FA 5IDWA 5CNMA 3ZWMA 1EXNA 2X1HA 4PLPA 2HJHA 5IF9A 4ZJPA 1OBFO 1MMFB 2ZYTX 1U1EA 4PA9A 3H11B 1TAEA 2CL5A 5EJ4A 3GNQA 4EW2A 3I8XA 3PGXA 5ITZA 3M5DA 4A8JB 3G6EV 2AK2A 4ETMA 1XQWA 5AD1A 4U9IS 3VDRA 2ZRHA 2BGUA 3WLHA 5HKBA 5LP6C 4MYDA 4Q4LA 4IDAA 2BMWA 1MNGA 4RTJA 3WK6A 2I6GA 2CDCA 2W6JG 2VP9A 3KQNA 2QLBA 4IVPA 5IP5A 5TSDA 2WLLA 1OPRA 2VAXA 1GQFA 3GLHB 1URPA 4RMHA 4DHEA 4L87A 4L72A 3WNVA 4D9GA 2YXHA 1W94A 1JR3E 5AUPB 4O4LA 4EHJA 3E9RA 4AJJA 3P0JA 2B83A 4WY8A 1ISJA 5IC4A 4RUFA 2VTKA 2XYVA 3AM4A 2M9MA 4ZO8A 4LFAB 2XMZA 1T0IA 3WFVA 2R47A 3U48A 4B4WA 4DCNA 1Z33A 3CCCA 3EGVA 3QP9A 3O7WA 4OHCA 5JOQA 4BXOB 1UK6A 4ZHSA 2QI9F 3UXYA 3E58A 1X1RA 3LNMB 3MUEA 2P1DA 4QO7A 2WJGA 2Y4OA 2CYAA 1MOZA 1K6XA 2OHVA 4NR0A 4BNWA 2GTSA 1E1DA 5EUBA 1Y34E 2BYTA 5A5GA 4MGKR 3R5XA 3APOA 4DMLA 4WT7A 1NUSA 3AKDA 2IYUA 4TLMB 3ZE2B 1D6SA 2FCAA 2X14A 2IOQA 1T2VA 1H0HA 1JDBB 2QR5A 2XUKA 5MDHA 5EMHA 1YQGA 5LMUB 5JANA 1YJXA 4R6WA 3ZW8A 1HV8A 3PWKA 3TX2A 1Z7YA 4M1QA 3OM3B 3PVCA 4YHBA 5CIWA 1SU6A 1XDZA 2JPDA 4RJTA 1JB9A 5EP2A 1L7XA 1JHRA 4GEKA 3MOIA 2A0KA 2VJNA 3U16A 3AETB 4IKEA 4O8CA 4I8IA 2XZTA 2C2XA 1V26A 1PFWA 4D5EA 4GG1A 1SUAA 3QG1A 3LOPA 5K6RA 4OI2A 5E4JA 3CLTC 3CS3A 1YJWV 3IUPA 2PGLA 1MT0A 1EMDA 2VDVE 4PX3A 1DLBA 1FQKA 4A36A 3ABLB 3B2EE 1Y7IA 4IQ4A 1W96A 1H9BA 4DBVO 3ZCRA 3SN6A 4Z3OA 5G4LA 2G5TA 3DL7A 2JZNA 3T41A 2QTOA 4P4NA 5BSGA 3EXG2 4U00A 3TLYA 5A3QA 1UDCA 3RK4A 4JI5B 3FDJA 3CLRC 1IBSA 2B7BA 1DOZA 1N34O 3N27A 4Q05A 2WLJA 3PNQA 3G0HA 4J16C 2B82A 2WHPB 3RAFC 4UDNA 2XMDA 3QYJA 3GVXA 5CH3A 3OZCA 4KNYA 4EKIA 2OFPA 1I4OA 4XQ0A 1XE3A 3S1AA 1IRIA 2D0PB 3L4EA 1QHTA 2GUWA 4Y6QA 4GW3A 1P91A 3QWIA 3RFCA 1PV1A 4RSHA 1OASA 4HTAA 4EG1A 2GPJA 1VOTA 4YJDA 3M99B 4RV4A 4OQZA 5ESDA 3R5KA 1YVRA 4C5CA 2E21A 3FPBA 1NSTA 4G0VA 1YQXA 3ZZUA 4LRYA 3MMSA 5I45A 3KX2A 1YIAA 3ZXIA 3B6IA 1U8ZA 2GASA 2C58A 1P4JA 5DCUA 3G2IA 1G20A 1IY8A 1RABA 3OUTA 6GPBA 4XUCA 2QY6A 5JPCA 1BGXT 4QULA 1ZGGA 2C1ZA 3PF9A 1OBVA 3EOBI 4KXVA 3W2FA 1G63A 4L6IA 4IJVA 4EJ2A 3V1UA 2CUZA 4EW1A 5L45A 2X0DA 4K86A 1X19A 4JI8B 3ZWKA 1M75A 1PK7A 4W82A 5DWVA 4EO4A 2R5NA 1P60A 1G3MA 1DRVA 1FDUA 4DLBA 2JBAA 2PH5A 2JFYA 4PSAA 4YV1A 2BCCH 4XPIB 3I04M 2FUKA 2W0SA 3NQ41 4B80A 1UEIA 5EP4A 4KR2A 3S2GA 3QV2A 1Z12A 1QE0A 2VS1A 2B5VA 3WQBA 3H1TA 4AXBA 5KNBA 3A11A 3ZBQA 2OG1A 5DISB 3RKUA 3THXB 5DM70 4NBTA 5CVTA 1UBJS 3QKRB 2PFKA 3AZPA 4BO1A 3UOAB 4NCAA 1TU0A 3R9XB 4JI3O 3NETA 3CX6A 5CBKA 4PDRA 5JADA 4E4RA 3VZBA 5ESWA 2JH8A 4HAWA 2ZULA 5H81A 1S3JA 4YJ3A 1F5SA 2IZ5A 1DRJA 5CTAA 4RELA 3Q1KA 5IJ9A 1L7QA 4LF9O 3E7XA 4L5CA 3AERA 2VPPA 1CP9A 4CLRA 3CHXA 1FXKC 3LHKA 4KGXA 2YRXA 1QGED 1AGXA 4F04A 3EZNA 1PSDA 1M2WA 1FSGA 2NP7A 2HDWA 4I1YA 3VHLB 5JISA 1W5AA 2FX3A 5F5NA 5A2QN 4DDTA 3CF4G 5ITZB 3I6BA 4TSRA 5U9CA 3G5AA 2O3SA 5GOTA 1PI3A 2QAIA 4YUWA 16PKA 1PR3A 4UTVA 3ITEA 4GXTA 3TLZA 5A9GA 3VPBA 5B30A 4TS3A 4UHJA 3BIJA 2JI7A 4TMWA 1PG0A 3NTXA 1XFDA 3CG4A 2QT0A 2Q41A 2WLLB 3A1WA 4H08A 2W2LD 1KO1A 4HQOA 5EINA 1P1JA 4N7MA 1G5FA 3B1YA 5J58A 4J7JA 2QWQB 1Q5PA 4ONEA 1P1HA 2HFJA 2WA4A 1E1RD 1ZR4A 4O4LB 4B3RO 4AMVA 5FEMA 1P0MA 3QEBZ 1WOMA 5BN4A 3OG9A 3R7BA 1ZCAA 2ZK7A 3LIIA 1P0CA 2LCIA 2A94A 3JPYA 1RWQA 3TLGA 2XXJA 4OQ4A 2PIDA 3RFTA 3ZN1A 3VUFA 1R66A 3TRHA 2DLDA 5EOVA 1J8YF 3VVCA 4QYIA 2XRZA 3QLVC 1YRBA 2ZM6O 2FMFA 3MHPA 1U2RA 1VF7A 4O2BA 1ENOA 1XCJA 2W6QA 4F6LA 3L8GA 3DTNA 4FKZA 4W9NA 3DMTC 3JQBA 5JSQA 3TL2A 1AMUA 1OYYA 3ZNOA 1JQDA 1SC9A 2CEAA 5G0TA 5HCUA 1HZZA 2IGBA 5TPZA 3AB3A 4YT5A 3ZHBA 4DV7B 3M2PA 2GNAA 3SLGA 2HEGA 1JR3A 1U63A 2FH5B 4CG3A 2PGGA 3OJCA 1W5FA 4R2IA 2PO5A 3E8GA 4WCVA 1N7GA 2NG1A 3WQSB 4NQZA 4DV2B 2VPQA 2ZXFA 3MSCA 1YJNV 4CHGA 1V1MA 2XYQA 3VR5H 1B6TA 3WB2A 4GVPA 1GP2A 4JAVA 3NTQA 3WADA 2I2DA 3FYCA 1A9ZA 4J7KA 4KP4A 3HEAA 3CIFA 1AR5A 4WOBA 4BNYA 3DKKA 2GMWA 3B9QA 3TI9A 3IT3A 2UXNA 4X8AA 2H1SA 4RMGA 3L73H 2VSQA 4LXXA 2O8BA 4BP1A 1TVMA 2RB5A 4D46A 4IVQA 1KHTA 2F62A 2Q2VA 1Q74A 5L3FA 4OBWA 3LDDA 4JP5A 5I4CA 2VNIA 2ZUWA 2OQ2A 2X1LA 2J3JA 2G9QA 4P08A 2JH3A 4OK6A 5HZHA 3IT2A 1VE6A 1RCTE 4DGQA 4ZVNA 2XTNA 4KQKA 4M1YA 4H6XA 2ZINA 3PXAA 4F11A 1GA6A 1Y9JA 2VWPA 3MYRA 4QHYA 3S1AB 3FSGA 4I3HA 5HPYB 3FRHA 1VLJA 4DA4A 4B6PA 1IYZA 2ZR7A 4DA8A 1TOAA 1F8XA 4OP2A 4RAQA 2IEGA 3COYA 4U6NA 4A91A 3S8MA 5K45A 3DDSA 3QWFA 1NBEA 1SXJD 3L0DA 3NJRA 3W1VA 4GQBA 5ENVA 3HJRA 2HMUA 2TMKA 4O2RA 2J1LA 3VQYA 3UJPA 2QZZA 1D7OA 1G20B 5E1OA 4YMVA 3UW3A 4L8FA 3WGUA 1OBHA 2WKSA 1XZDA 4Y9UA 3EQ8A 1E20A 4FLFA 2H3EA 3F67A 2B5UA 3ZYCA 4MVYA 1QBGA 1VCNA 3GA5A 2BFBA 2CTWA 3OSUA 4TL7A 2NX2A 2CNLA 1IU9A 1XG5A 1TJYA 3BGVA 1WAZA 3NWOA 3CCQV 4BAUA 1JSRA 3DBHB 3ICOA 1MO3A 3I37X 3LLCA 3FETA 3RSCA 1SQBH 1OD6A 2VUTA 4JK3A 1DBSA 4B47A 2JBAB 3AU9A 5B64A 3OBIA 3VC2A 3F5WC 1NOKA 2DQZA 4FCVA 1VKZA 1EN5A 2CYBA 4PR0A 3WLJA 2PKYX 1U3DA 1CE8A 4PLGA 3C5HA 4EBFA 2NPOA 2VHUA 3T7JA 4ALNA 2HWKA 4QOEA 5LUAA 3I9FA 4HQLA 4Z8YA 2DU8A 1QP7A 1I4LD 2C2MA 3FLMA 4L5IA 3O4VA 4RZIA 3WKBA 5L95A 1XRRA 4RF3A 1HLGA 2R96A 4DJ5X 1GUAA 3LL4A 4R54A 2ZZMA 3H5RA 1E3LA 1S9DA 3SR3A 1F7YA 4ICIA 1LRLA 2YZKA 4YJ3B 3DTVD 3TS1A 2C97A 1USUA 5IJ9B 4JBHA 4ZMBA 4L8LA 1MMMA 1F0PA 2LUOA 2YZMA 4MOWA 3AERB 2L35A 4AFNA 4RGBA 4CLRB 5F76A 4EZIA 5DRTA 3AHJA 2QSJA 3HE3A 2PMWB 1KEZA 3FB7C 1J5EB 3OM1A 1P5ZB 2J48A 3SP1A 2PBZA 4IUYA 2ZKLA 3O38A 4TTIA 1H4TA 2IYLD 1XEAA 4TSFG 2YIAA 4D3ZA 4AQYO 5H83A 5LDHA 1E64A 1S6YA 2GNPA 4P83A 1AQJA 4PW0A 3IAAA 4GP6A 4R71A 4MI3A 5LBUA 3H84A 3BVOA 4AKIA 2FKXA 3BN3A 5C9ZA 2CUGA 2VR1A 1JDJA 3OPYB 3DTUB 1PBTA 1ZVKA 1T9BA 1N2EA 2XX3A 2GS9A 4DUGD 1BJKA 4N18A 2HVKC 1TRHA 1JR4A 1A3CA 2XVAA 3ZK9A 2JDIG 5BN4B 2EL7A 2H4HA 2WM9B 5BPHA 5AI4A 5DTJA 2H1RA 2QJWA 3E84A 2F9LA 3FCAA 2VNKA 3TGPA 2ZCEA 3LF2A 3TLGB 3LY5A 2XAQA 4EOGA 3NWBA 9GPBA 1Q20A 3I0ZA 1RYYA 1YUBA 4RPKA 1WXGA 4QYIB 2Y0EA 2ZIVB 3GPLA 2O1EA 5ILGA 2H17A 3TECE 2VXYA 5AUNB 4O2BB 4GM4A 3S2IA 1LC3A 2TMGA 4IJWA 5CDFE 2X6TA 3ITDA 4MULA 4COOA 2X3FA 2WA1A 3TQRA 4GPEA 3K06A 4UREA 1Y9EA 3O3CA 3ENKA 1USWA 1X86B 2NPFA 1IQ0A 3SYPA 1ZI6A 4F97A 4TRMA 3FY4A 4WOKA 3QNUA 3DM9B 3N2EA 2PRJA 1NR1A 3VO1A 4UB6Z 4EYSA 2FETA 1OI3A 4UM9B 4CLOA 1LI4A 2WSSG 2I9KA 1A9OA 2IEZA 1E2GA 5FFFA 2BSQA 4AKGA 2EARA 3BMOA 1Y4DE 4D6YA 4TQ9A 5KI6A 2Z2JA 1Z47A 2IHYA 3SPHA 2YWDA 4H60A 2LTAA 3O9VA 3KRTA 4QECA 1U9CA 3GROA 1MKYA 2XAJA 1GARA 3NLLA 4Q4HA 3VJMA 4PCVA 2FOIA 4XIJA 3N2IA 2GHTA 1G17A 3NOOA 3ES9A 4EELA 2ISSD 4IFBA 1CLEA 4QTYA 2OESA 5KO2A 1D5CA 3DOOA 1MJNA 2JI4A 2H57A 3LQKA 1WP9A 1CV2A 4RK6A 2ECQA 5FUWA 4C5AA 2HB6A 2VOEA 3SEAA 3MWJA 3ZVKA 2Z43A 3PEFA 1HDCA 1PQUA 3AW9A 4PC3A 2CC2A 5AVUA 4GMHA 5ED4A 4ZU6X 3T5AA 2ZBGA 3JYHA 2V6JA 1AZWA 2Z4SA 2WLHA 2N3ZA 1RWMA 1D2RA 4OQLA 1AF7A 2WJAA 4DADA 5AH0A 4JL8A 3R4CA 3DXRA 1Q11A 4GM1A 1E9AA 3P9SA 4PYJA 5AI5A 1JLLA 4N5LA 3VJRA 4EMBA 1WR8A 2WT9A 4GXQA 4FD3A 1OLOA 3V6MA 1ENPA 3TTVA 4WNAA 2QR2A 3T15A 4CFSA 4RA9A 3QTLA 4C06A 3SYQA 1XWWA 2B61A 5DTIA 3OX2A 5AM5A 3HSKA 5DEDA 1KDTA 2XB4A 2X5NA 3ZV7A 3CXCU 4PFQA 2OXEA 3QHQA 2KJQA 2G5GX 2IU4A 1NUPA 3TB6A 2WU3A 1KDOA 4L4RA 4UJ3A 1D5WA 2J6HA 1XX6A 4HPJB 4K8ZA 2BFBB 2A7WA 3QJGA 1WZEA 2PRYA 2WP8J 3NU1A 1IHOA 3H3FA 1L4LA 3FD8A 4BMYA 1DKLA 1RD4A 3JYQA 3D02A 3DBOB 3M8AA 3PUYA 1LPNA 2GN2A 2F8MA 1BDBA 3K92A 5H5NA 4KTTE 2J85A 3HR4A 2VJOA 4D99A 3QVOA 2GDJA 5FADA 1CE8B 3T4ZA 4BP8A 3ZU4A 6Q21A 2QD3A 1NQXA 1RCFA 4H35A 4NNPA 4KFMA 2B99A 5H59A 4D9KA 4CTKA 2EINB 3U3XA 3BFPA 1XA0A 5FOUA 2G80A 3TSAA 4IH1A 4DSZA 3ICPA 1JHXA 4ECEA 4OMUA 2IUFA 3BGDA 4CKEB 3GR6A 5HEKA 2VDRB 1I7LA 1RSOA 4DMFA 1EJ0A 3O31A 2H4XA 5JAZA 3OE7D 3OQOA 1VKJA 1DXQA 2WSLA 1OI2A 4F7WA 1G5PA 1U6KA 5AHXA 3AEKA 1M1NB 1N4DA 1L7DA 3WK4A 1MAWA 2XUJA 4OGGA 3C3PA 2O0KA 4QIHA 3TQSA 3G2MA 1FRFS 1QHFA 3PKIA 1KU6A 5GY7A 4DMUB 4YRFA 2LIPA 1KYZA 4PYKA 2D1RA 1IZYA 2XCQA 4FHZA 2GCOB 4DVGA 2E4AA 2CK3D 1ACLA 2ZSHA 2JIQA 1V4NA 3Q2OA 2ZAIA 1J2YA 4E5VA 2CZCA 4P31A 2DYSC 3OJWA 3EGDA 1XWIA 4C76A 2VWJA 4P38A 2ATEA 1YDWA 2MHCA 4PINA 5H1YA 1P7ZA 2QN3A 2R8OA 4LJ5A 1EWYA 4QOGA 3GRFA 1YMQA 3GOHA 1ESCA 3PHLA 2K1EA 3F5QA 3FR8A 3RHTA 2M98A 3R3ZA 4JYAB 5F7JA 1YAJA 3ZIAG 1JPVA 3INRA 2WDPA 2FX2A 4YAKA 1JQKA 5K4GA 2ZCUA 5F7XA 1Z18A 2EDCA 4J3NA 1NXPA 2VUHB 2FZEA 2LCFA 3NEYA 4F6CA 2HF7A 2QU7A 4ZGWA 1JYEA 3K0CC 2QN7A 2HXSA 4FE7A 3OC6A 3IPXA 3CEMA 3Q5GA 2R00C 3ROQA 2J0SA 3CVOA 3NRCA 1HETA 3FNEA 1UBCA 5BQ5A 2B2XA 3KNZA 4K7JA 1RM1C 1QOPB 4FLXA 1JZTA 1K9VF 2VXOA 2Y1EA 3HHPA 4LOJA 4LN1A 4Q9AA 3ER9A 4MV0A 1U3CA 5CD9A 2WAXA 1RHMA 3VSCA 4Z53A 3IEIA 4CWAA 2GXUA 2NXJA 3VAZA 2MK3A 4EUFA 4R8MA 1DCTA 3CLUC 1T6NA 5K0JA 1VJCA 3ECCA 2P5OA 4GSKA 4KVFA 3CVVA 2REBA 4CLOB 2YW9A 2LPMA 2V45A 4Q4JA 4ZVUA 1N6NA 2QRLA 5EE5B 3AI3A 3ND7A 3BMOB 1DT5A 2O23A 3WSVA 2HUNA 4DCOA 2RKWA 1ZHFA 3OFND 3C39A 5ITVA 1V45E 1KKCA 4HJXA 1ZOSA 4Q4HB 5IYDO 1IN8A 4R1TA 4CE6A 2I80A 1K27A 2ZS8A 4LA4A 4R1PA 2K6GA 5CDFA 4ODIA 4YRDA 3D0RA 4F5WA 2B1IA 3X43A 4EHNA 1R9GA 1XZMA 3RC9A 1JSLA 3CW8X 4RJIA 1ZM7A 4RTQA 3ESAA 3KQKA 1O94D 4C2TA 1I3LA 2HEPA 4J9VA 1VQ6V 2OA0A 4LYDA 4ZCLA 2O8CA 4DV5O 3MWLA 3I01M 5AVYA 4CRWB 1D09A 1UMCA 5L3RA 3GUYA 4EBBA 3K9SA 2J5XA 4LGVA 1WDTA 2I78A 3OZUA 2FFJA 3F7NA 3M6UA 4CIXA 4TVBA 4JUIA 2QX4A 3JD0A 2V97A 1JQ0A 1PDWA 5E4TA 5DNAA 4PIVA 3G7NA 3MJHA 2O2GA 3DXRB 3AK4A 2GXAA 1FOEB 2GKGA 2B5WA 3WO0A 3WWOA 3FFTA 3HO8A 3F73A 4EGSA 5MF6A 1XTJA 1RHKA 4JUAA 1C80A 3EK2A 5TY0A 1L5VA 5IS2A 1HE3A 5BR7A 4WNAB 1NN5A 2QE7D 1BHJA 4RA9B 1UT6A 1WHTA 2J3EA 4Y2YA 1FBNA 4YT8A 5AVRA 2O2EA 2OBBA 2J8ZA 2GDZA 2FA9A 4YCAA 5HTKA 1G291 1PQYA 3BXOA 4QPNA 3WV5A 1LU9A 4EPXA 3R66A 4B7AA 1E1QG 4K6HA 1GPBA 1LFDB 2VA8A 1XNHA 3FPGA 4F4JA 3IUEA 3DBLA 4P2GA 4TYYA 3ONEA 3HVUA 2HR1A 3VC3A 4URYR 2BE3A 1FUEA 3CPHA 1Y6QA 3DAFA 1OXMA 1C7ZA 4TGLA 1FDVA 3ZZMA 4LXYA 1XTZA 4J6FA 1UJ4A 4TKZA 2JFGA 1YL7A 5CLHA 3H9CA 4DDWA 1A8HA 1IXMA 2C0PA 3RBAA 5GWXA 4ZAWA 1DB3A 3ZGXA 1FNDA 5KZMB 4K6GA 2B37A 5J2TB 1Y7HA 3RIXA 4RLFA 1J22A 2O2XA 3PIDA 5K5EA 4B3TO 3NYRA 4PZ9A 2O3QA 3Q12A 1Y42X 4DR6O 4DVJA 3CQ9A 1YO6A 3STTA 1RSOB 2IOHA 3EC7A 1Z6PA 4F6RA 1YL6A 4KZKA 3BCCH 1CU1A 3HB3B 3R5FA 3FLBA 1IOLA 3HBNA 3F8WA 3RVDA 3K5HA 2P1ZA 3NUZA 3HKDB 5EJEA 1SOVA 3AEKB 4B4DA 3ROPA 2FPXA 1R5JA 4EMTA 2QAGC 1NNUA 3Q3GE 2QVBA 3DMDA 1K92A 1MV5A 2XNCA 1AJPA 4OHUA 2JS7A 2JZCA 4F1JA 2A9KA 5LU8A 2RNBA 1CXZA 3DMPA 1C29B 4UUBA 1OQAA 2WJ3A 3D3NA 2VRCA 1OIWA 3HLYA 2B5OA 1O4VA 2PF4E 4OJTA 2HWWA 4A0GA 4EB8A 1PDVA 1T8UA 2XMBA 1D1PA 1GDHA 3CZCA 1XD2A 3GXBA 5JS6A 1JSZA 5FOSA 4UBJA 1L7OA 1IHPA 3EGDB 3QKIA 1WM1A 4FK5C 2XKKA 2J4CA 3WKAA 2OL4A 2ODQA 4IKPA 4XDGA 5IXJA 1ZHOA 4Q34A 4GDFA 2GK4A 2Q3DA 4BLWA 2DWOA 4HZ3A 1N2OA 2H8GA 3R5JA 3L06A 2OTLV 1ESMA 3O8LA 4FM0A 3E53A 3IHTA 5JFOA 4JX9A 4EYEA 4P81A 3EZ9A 3S2ZA 2ZQZA 3IDSA 3GNTA 2YV5A 1DKQA 1TM7E 1UKAA 1SEPA 2FMIA 4YECA 5ICGA 1F51E 2YHIA 2DBVO 4WFBV 1MP0A 4LX0A 4DR5B 4KLZA 1K7CA 5FQNA 1IQPA 1MB4A 2FZKA 3FUUA 2RH4A 3LIPA 2MYPA 3AVVA 3A70A 4BN0A 1N2HA 5BY1A 4LRWA 5A4DA 3RGBA 1V2HE 1QLEB 2A5LA 4MA4A 3SZ3A 4JR2A 2NNWB 1PLJA 3EJ6A 2OZPA 2X6CA 1VSVA 4C9BA 4D97A 4P54A 1XDSA 1RRPA 4IMPA 4LDNA 5DGHA 1YMVA 4P0QB 3ANLA 1QHGA 3KKMA 4DEXA 2ZBRA 4ASUG 2BLLA 1L8LA 1E5TA 1GN2A 3ROTA 2V3VA 4LOIA 4XX0A 1LR1A 3JTEA 1KOJA 3AUFA 3F0TA 2BGTA 1LI5A 3ZHZA 1XTTA 2YS7A 4IIJF 4CIDA 4H17A 2BDUA 3RLIA 1ISGA 3GH3A 2GLTA 1N0UA 4P53A 5C81A 4CVNA 4FLEA 2GBOA 3RJMA 4BBPA 3NOXA 1SHZA 4Q4JB 5LQJA 4ESVA 1MEOA 3CZ5A 2BGNA 1KQFA 4AHCA 1A72A 4R2MA 3LXXA 2IDMA 5TT0A 4ARSA 3BZBA 2FQWA 1K3UB 2LFRA 5CA0F 1P3Y1 4YP0A 1WXWA 1BMDA 2X3UA 3P9XA 4UBNA 1YS6A 4L7QA 4D9BA 4DNPA 3H86A 3MAAC 1Z5UA 4HNUA 4OSOA 3EPLA 3CEPB 1GN6A 4DR2O 1N8RW 3EZGA 2VZEA 4TS9A 1B1AA 5AJUA 2YMLA 1R6KA 1JLKA 4MCAA 2O8CB 1ZOIA 3OD4A 3UC9A 4RORA 4HMQA 5JMPA 1UMCB 1GL6A 1EUCB 5KNCA 1LPSA 4DRXA 4QUAA 4MW6A 4GRDA 3E3OA 4MDYA 3IALA 1U3TA 4C4ZA 2H06A 4XFKA 3K9CA 4PHFA 4GE3A 1AS3A 2OAP1 3SM3A 1VGQA 2Z4TA 3I9KA 1HNWB 4BC0A 3B8NA 5IKXA 5LHGA 5U1PA 2CBXA 2PL1A 4K9KA 4QVKA 1OWNA 5AFSA 4CHTA 3CA8A 5IJAA 1GPUA 5A0FA 1I94B 3K1TA 1KKUA 3LQ4A 3IVRA 5D87A 4H6PA 4Y0VA 2YIDA 1WHTB 4ZAGA 4N7BA 2IYYA 4JB8A 3O7MA 4WFGA 4C4OA 2FSVC 1RMTA 4BZXA 3KP1A 3ZHTA 1EQ2A 5FQOA 2PX5A 1B6GA 1VMEA 3TFOA 5HZMA 5M3BA 4HQKA 4PHCA 1EE2A 4BJ1A 1KD1W 2C2KA 1G9XA 3OKPA 4GKVA 3DBLB 3TW6A 4MMYB 3P94A 3S99A 1EJ2A 2R79A 4WXEA 5HXAA 4WHMA 1O6GA 5DYYA 1AA6A 3MA0A 4X6XA 2ADQB 4H1WA 1ADJA 4ZVMA 4LGMA 3FKSA 5CFNA 1KO7A 1DF4A 4TWIA 2ENWA 1A9YA 4XQCA 4Z2YA 3G71V 3IP7A 2JASA 3IUYA 3G0GA 3NHKA 3AHFA 2XYHA 1RI4A 1KJ9A 1CDDA 4Y6SA 1ESEA 3PGJA 3H1AA 3IFXA 3QOYA 1IQUA 3DC2A 4MVRA 1RS0A 4J9UE 1P6XA 4Z3KA 1G7CA 4X8LA 1QDEA 4B9AA 1YI2V 1G5IA 2X2FA 4OPHA 3FHCB 2OFXA 4F6RB 3OHSX 5BVGA 3H18A 2WINI 1RYZA 4MTXA 1I4EB 3QKSA 4FS3A 3TG8A 1AUVA 4QQ8A 5ADWA 2WB4A 3C3EA 3HZHA 5ALTA 1YJAA 3DCJA 4UV8A 5IZ4A 3CG0A 1B06A 3STWA 2CXHA 4EWLA 3RWOA 3DE7X 1BQ3A 4QFDA 3R7AA 4OYHA 1CXZB 1JBQA 1QIGA 3VZRA 5FOQA 1I5RA 2E5WA 1BJRE 2RAPA 4A10A 1QF9A 4CF4A 3T0GA 3KYJB 1BQZA 5FHQA 1SKMA 1HDEA 1KFCB 1XD2B 1YFLA 3ZOKA 3HYRA 2PEYA 5KMGA 4GOKA 5FI0B 2IWHA 5AQEA 2I6XA 3D4LA 4QAJA 4LI3X 1R1DA 4MKRA 4XAQA 3JQDA 4IJ6A 5I9SA 3QPWA 3T9BA 1W52X 1JH9A 5ADVA 5HJ5A 1OILA 1Z38A 3RW9A 4DLNA 3AB7A 4GXNA 3H1FA 4NCXA 1KC3A 3A9TA 2BGJA 2G63A 3RK0A 3MOGA 1E98A 2YHIB 3KD3A 4M9RA 1B16A 1OXSC 2QPTA 2HA0A 3IHKA 1H2BA 5H3LA 1TUBA 2W11A 2XLBA 4BGUA 3ZIDA 3ADBA 3WGIA 4QELA 1TZBA 1G3IA 5BMOA 5C18A 2E7ZA 3V9AA 3DSRA 4BNVA 4F96A 4LK2A 3HWSA 1EFRA 3VR3A 4R69A 4HI0E 3ZRSA 4YLEA 4H1UA 5CAEA 3U4HA 4AZ0A 4X0EA 4UU0A 2WVJA 1J2JA 3E18A 1N34B 1YB2A 3Q87B 2FXVA 3UCEA 1D6JA 4ZTBA 3WLFA 4Q5IA 4KXLA 2XVYA 2VF8A 1EFPB 4I55F 2CE2X 2WWVD 2MDTA 1KOLA 3BVPA 1TM3E 2Q5JA 4MUGA 2EKQA 1FXUA 1YDHA 2UYOA 2X8BA 4XX0B 1JPUA 2JK5C 1NBWB 5FFMA 2JCGA 1R6TA 1F1BA 1ND6A 2NYRA 2VI5A 1NJ6A 3DYVA 2JLSA 2ZYGA 3GGSA 4HSEA 2N05A 3A26A 2PV7A 5JT1A 4FGKA 1QR8A 1UBTS 4DANA 3KYCA 4NZZA 4TXNA 2Q6TA 4UAVA 1GU0A 3QUQA 4XRRA 5HWSA 2CHVA 4FYWA 1T4MA 2H2GA 3KPYA 3OPXA 4QUJA 3CRRA 1TGOA 2ORIA 2YJ6A 3MTDA 5I4BA 3HV2A 4UHHA 2IJKA 3FTPA 4KK3A 3I4CA 4F0JA 2EJVA 3AL0C 4YT4A 3O4HA 3M4XA 1E8DA 2H4JA 3P9CA 3HUFA 2H1OA 4F8YA 4DRXB 4CIWA 3KU4A 1RM3A 3C14C 3SWWA 4I0XB 1MIHA 1SKBA 3IBFA 2CLFB 2CE4A 3DE2X 2CCJA 3NV9A 1FFXA 4IWNA 2A57A 5T6MA 1OGJA 1XPRA 2E85A 5ARDA 1Y4MA 3DZFA 1N0WA 1H2ZA 4KPYA 3SZUA 1LWNA 1SQSA 3AQ4A 4XD7A 4Y30A 4JI3B 2NVBA 4HDKA 2FAXA 1WZ2A 2XMSA 5AOVA 1RHJA 1A97A 4MQMA 1WO8A 3FAKA 5IM4F 4LF9B 2GN0A 4PNZA 4HGRA 4BHTA 4C04A 2J4DA 3DZIA 1CZOA 2JRLA 3QMMA 1E0AA 3DHVA 3WGNA 3WRWA 1JA8A 2Q5LA 4AJEA 5DBGA 1OHHD 2HJSA 3AP1A 4N3BA 4OVKA 1DHTA 1DCFA 2QLMA 1P81A 3J81k 2FZ5A 2IOFA 4ZAVA 3DYIA 1UKZA 1GPDG 1AUXA 1RHRA 1U0FA 2CNNA 3A3OA 3IQDB 3FVTA 2I4NA 2W90A 3FFAA 2JIZA 3NUQA 4WFIA 4MYSA 5F51A 2DSTA 1V71A 1XVVA 1CZKA 2D0IA 5DNWA 4RK5A 3K0DA 4YXWA 1UOQA 1JAZA 5FKJA 3C3KA 2DBZA 4A3SA 2JB9A 3UKOA 3LTNC 4QXQA 1ELOA 3CR8A 1G6Q1 2EWVA 3N6RA 3ST7A 5FUQA 3AHHA 3KYBA 3R3XA 2O0HA 4G5GA 4B3RB 4AWBA 5LOVA 5F3RA 3S29A 2YHBA 5NULA 4AUEA 4Q9DA 2P4EA 1XLUA 2LGJA 4E5NA 4GOXA 3VDXA 1AM4D 3GRZA 4M37A 1X8KA 2QUBA 3OFKA 2G8LA 5BVGB 4NH4A 4R8RA 4CS2A 3SICE 1BS2A 5FBQB 1PSZA 4DC9A 3B70A 2AV6A 2ZM6B 3RHZA 1ZMTA 5JARA 4JBXA 2DQSA 3QVLA 2FMKA 2H29A 4J0HA 4B3JA 4Z6KA 3LECA 3F7OA 2FGJA 1NSFA 4V39A 4R6XA 4EJMA 5DXJA 3FYTA 3MINA 4QYWA 2IH2A 1T3SA 2V03A 3B40A 3OTQA 3NFYA 4G0MA 4K0KO 1HNZO 4J43A 3B89A 4BCBA 2AUMA 4LYGA 2HW8A 1LJUA 3M4JA 5EGNA 5KMGB 4NE2A 1AROP 4HPWA 2YUIA 2O1WA 1QZTA 3UYKA 1YCDA 1WMDA 3MJEA 5KB3A 1I10A 1MVLA 3LKZA 2UZ1A 2EZ9A 5CT5A 1YXMA 2PS9A 3WOHA 4AICA 1KFBB 2Q27A 4G86A 3C1AA 4MJ7A 2QZPA 4CV0A 5EMJA 3ZU6A 1GILA 5IANA 5KAMA 1H3FA 1NULA 3FZYA 4ZDIA 3WR5A 1UFKA 4RVHA 4QUEA 2NXNA 3JU3A 4H7EA 5TJHA 4IVRA 1LGYA 4UCVA 1TUBB 4JMPA 4OFBA 4DW8A 3L01A 5LNK1 4Y0NA 3E5HA 1RYDA 4UBOA 4MW9A 5HBRA 4FFDA 3HCPA 5D01A 1L3BA 1RAIA 1HYEA 1JQAA 4ZWNA 2FJ0A 3DOFA 5CAEB 2WAAA 1MB2A 3VNSA 3LVBA 2ZR3A 3OX4A 1UPAA 4AZ0B 4HGOA 1BWRA 3U4MA 1OCCB 1N6KA 4KMRA 1Y1SA 3L71H 3LT1A 2YFKA 1H2EA 3K8ZA 3I39X 3OF5A 1TGVA 3GA0A 1QX3A 3HTXA 5K1ZA 3NOVA 4PZDA 2VLBA 1SBNE 2VHXA 3A2FA 4BFWA 3QKTA 1EFVA 5JATA 3NIGB 2EGGA 2V98A 2H1LA 5JJ5A 1ORDA 3LC1O 2QLFA 3VYUB 2KB0A 3U7QA 4KPEC 5K8IA 4WBNF 2BJVA 4YIOA 4G1BA 2IZOA 1BXZA 5LB2A 2VF2A 4IIFA 2CUKA 2R8RA 1II0A 3ZXYA 1XAHA 1H2XA 5ESRA 3B6EA 3SK0A 2LZ0A 2HSGA 3MNFA 2B1GA 3KYCB 2BGMA 4EA8A 2C59A 1RJGA 4EY7A 1DJQA 1W46A 4YAIA 2P41A 1Z2CA 1Y1PA 4JDUA 1E9EA 1QH1A 2VHYA 2BEKA 4M9SA 2OILA 5LA6A 3TNYA 2BIFA 3KHSA 4L75A 2XGOA 4J3FA 1VLMA 1PQPA 1UC9A 2QRVA 2OIGA 4MKXA 3E83A 1L7BA 3GWKC 4EECA 3PLAE 1K34A 3UJDA 4BZWA 5ITWA 4G6ZA 3VBCA 1VQLV 5CPFA 5CB4F 5EKUA 4Q0MA 3QTBA 3JYPA 4ZQBA 4MP6A 1PD1A 1KSHA 4M22A 3U6KA 3AJRA 2FXIA 1FFXB 2GPNA 1O5OA 1JQ3A 1U3VA 1XZPA 4R1UA 1XOIA 1LSSA 3B77A 1IVYA 2Z1DA 4R2WA 4DB4A 5JROA 2ZUFA 5MN5A 4IH4A 4W8GA 4BKQA 5DLYA 2XPCA 2G40A 1C0PA 2DFTA 1T1JA 2V54A 4HGZA 3RRMA 1Y1RA 4DLXA 1AGNA 4CG0A 3PUXA 3UMJA 3EXHA 4BX3A 3OQVA 2ZRMA 5JAHA 5ITSA 3ZZTA 2GAAA 1V9CA 3PFGA 3KR2A 3F6CA 2CZGA 2Y68A 1WU8A 4DR1O 1X1BA 1G8FA 3R0VA 3ACDA 5CVJA 3ZOZA 4HDMA 3A6ZA 4H0LB 4BIOA 1C1YA 4AQYB 1YU6A 4WLNA 1JEOA 4HX9A 3KKYA 3CLHA 4CH4A 4BLOA 1JDUA 1IHXA 2V7EA 1Q6UA 1N5JA 4HUQA 3OLZA 5DCLA 1U65A 4PHZA 2WNIA 1C9YA 4IO1A 4UTNA 3K5OA 3IDOA 4YUXA 1P84F 1OYVA 1TW2A 1IJBA 3VNRA 5IUNC 2R65A 1AB6A 4G2TA 1E0SA 2A9JA 4ZYYA 4JR1A 4S0XA 3QE3A 4D3FA 5COBA 2YI8A 5LOVB 2VNSA 1NGSA 4TT8A 3IR7A 3IKTA 2FR8A 4EX7A 1XRJA 4K8RB 1W4LA 1SHLA 1XMVA 4RVSA 4FOLA 3IV7A 2ODTX 4HNAA 1WWKA 2P9CA 3MQFA 2YZNA 3V4RA 3GVHA 4CBVA 4YP7A 4XYLA 2O7VA 2D2IA 2G1JA 1N2ZA 3BXGA 3B6ZA 2P77A 1X7ZA 3GEDA 4ZO9A 3MGAA 3EULA 5I48A 1NTMH 2OCCC 4EUSA 4BWYA 1DDGA 1NF2A 1SVLA 3UXHA 3NVMB 4ALLA 3IAHA 4DE5A 3AK2A 2ZSIA 1NFQA 1LPAB 4NTXA 1NW9B 3E9EA 1V5FA 3MINB 3UFBA 4MVCA 6ADHA 3H2ZA 3NCTA 1NM5C 1M6HA 3EYAA 4EENA 1F2TA 2P7HA 4FE3A 4AIRA 4H27A 4FB4A 3PR2B 4JNKA 1B00A 3N39C 4N03A 3H5AA 1EK2A 5T4BA 4CKYA 3HN6A 4OLAA 4QBKA 2EVWX 3B7PA 3B2EA 4OX9Y 3GGJA 2JZOA 2ODPA 4ZAZA 1K5PA 3KXKA 1SOMA 2UZ1B 1QX4A 2WTNA 1QP4A 1TFRA 1Z7WA 4LVOA 4YYEA 2GBLC 1JHPA 3ZLBA 4UM7A 3COPA 3GRRA 1P9NA 5HFAA 4LY6A 1PWEA 2WJVA 3PD0A 4TZKA 1PJ8A 5EJ5A 1EGVB 1WDLA 1GN4A 4LE1A 2XZLA 2GWHA 3WJAA 2ZRCA 3DW3X 2YKGA 3AI1A 4RY0A 3OMXA 3TPZA 4EX6A 2R4UA 4JBGA 2QMUA 5E79Z 1GL7A 4G0NA 4BKPA 1M7HA 2NO4A 2MIIA 5H9CA 3B6KA 1LXCA 1OCEA 3U4IA 4GKKO 4WE3A 2I33A 2GZDA 3CX5F 4WSOA 1A8UA 3M3PA 4IQ0A 1P1RA 2OV1A 5FUYA 3THYA 1C9EA 1G2IA 4QZVA 2V9PA 3FPSA 2WD9A 3B1KA 4FILA 5IHXA 5KC9A 5JDCA 3W3AH 1YHZA 4I4TF 4LZNA 2RHHA 2V9CA 4B6QA 2GH1A 1AKTA 4LI0A 4AF6A 2JLCA 5HM8A 3DKVA 3EE6A 5D86A 4MLCA 4D96A 5AKZA 1CPYA 1KYIA 1W0JA 3NHSA 1O5IA 2C3OA 3JZMA 1OGYA 3CC8A 1EFVB 2KBFA 1RU3A 1G6OA 2VZ9A 2Q3BA 1XBTA 3CZQA 2QKAA 5IKMA 5B1NA 3QIAA 3U7QB 1Q90D 2CNWD 5AHWA 2XAGA 2V9ZA 6LDHA 1GSAA 3H99A 5LU9A 4MKFA 3K70C 2QI9C 3EGEA 3E4CA 2WZBA 2OOKA 4PVCA 3MMXA 2G7ZA 3NYQA 3V1YA 4RIIA 3UENA 3PFKA 4FGSA 3Q7SA 2R7AA 1QH1B 1ODFA 1FMCA 1YDEA 4V2IA 5LA6B 2ZETA 4HXEB 5JZOA 4M7WA 2M32A 1XKLA 1DEAA 3MERA 4YRLA 2XUGA 5FPSA 1V16A 3ONVA 4UCRA 3EVEA 2C5BA 4N8DA 4L50A 1SQ0A 1NQOA 3BREA 2PYDA 8ATCA 2OV8A 2CLHB 1QYCA 1ONNA 1LS1A 1AURA 2W2XA 2VDNB 2BFFA 1T9KA 1W36B 3B36A 4GZRB 4KQIA 2F2TA 2PZMA 3NIWA 1G9SA 2J3HA 1WUJS 1LBSA 4OHFA 1L8DA 2REQA 3HJUA 3F6PA 1GGNA 2EKBA 1XGKA 3MRTA 3OT5A 3ND8A 2ECFA 3TQTA 1D2GA 1XTUA 2GD0A 1SZDA 5BQFA 3QPAA 4UAUA 3KELA 1AA9A 2FQ1A 5AKJA 3QXGA 5MN6A 4MUFA 4HAXA 2CFCA 3IAS1 2JJ2G 2E55A 3ZBUA 1BX3A 2YUTA 4M46A 1YKFA 2UXCO 2HNBA 2VAVA 4DR3O 3EXHB 4BO4A 3AHIA 4D4JA 4MWCA 3FCSB 1ZEJA 4UEQA 3HY3A 3IOBA 5THKA 4BP3A 3QEJA 3R7NA 1QCYA 2J9ZB 2Y1XA 3CLSD 1SC3A 3PXUA 4RAIA 1FSZA 2QY9A 3PDIA 4NE7A 1JU4A 4EFEA 2C95A 4QICA 3DL0A 4HDMB 5JAPA 1X59A 4XFDA 4L9WA 1VMGA 4BFTA 1TAQA 2VHVA 3HJBA 3FDIA 3NALA 2DP4E 3DZHA 4HUQB 4OH7A 1VIYA 1JIUA 3LLUA 1XZFA 4IJQA 2V59A 1V1MB 3QWHA 3RAJA 1OTHA 5CCEA 1JG3A 3ZJ4A 2JS3A 2ID4A 5B5SA 4K05A 3ZX4A 1RYMA 2HWXA 5KWJA 5KWVA 2MMGA 3P9YA 3G0DA 4WLVA 1XZIA 5TMDA 5GZ6A 3ZCQA 4HNTA 1J07A 3LWZA 4UASA 1Q84A 5BQ3A 2EULA 1CJBA 1TAHA 4HNAB 4F60A 1U96A 3SPCA 4G0YA 3AVXA 2O8BB 1R6BX 1L1EA 1PLLA 4YQEA 3ANMA 2YR0A 3D4PA 4EGQA 5AVQA 2QN9A 1JA0A 1ZUNA 1X7ZB 4ENTA 1P0PA 1KP9A 5IULC 2C77A 5JO9A 2HKOA 3K15A 3AG2C 1XRMA 1KJIA 2P7TC 4E5PA 4MDEA 3LE8A 2FDCA 3RVZA 1UQUA 3T4EA 3ETHA 3HZRA 2H5LA 1PR4A 3OOJA 1RAAA 4NCBA 2OHGA 3NHFA 4B5KA 1E79D 2X1MA 4R7TA 2EJBA 2EKPA 1L5OA 1F2TB 2KM1A 2ZE7A 3USCS 4N6NA 4Q4AA 5BN5A 2C84A 4ZVRA 3RC3A 2OKCA 2V58A 3EZXA 1IN4A 4DA0A 2FUG1 2NZUG 4QAQA 1DDIA 3KUXA 1ZK0A 3EX7C 1H0RA 1Z82A 3KKPA 5H2FZ 1KU9A 1EUQA 1YDGA 3IVMA 5F64A 4AZVA 1QFJA 4TKMA 1X7GA 3BFKA 2JI9A 2LIVA 1H5QA 4R7ZA 1GU1A 4IDFA 3CVWA 1JJVA 4BPBA 3IP6A 3THSA 1ZQ1A 1S8NA 4HRXA 1EK1A 3IQHX 4N21A 1VG8A 3HSSA 5K51A 3GL9A 3EWNA 3E6AA 1ZM9A 1T4GA 4NHOA 4EO9A 4UNSA 4ENRA 3T5TA 5JPIA 3P9QA 1VE5A 4X91A 2EFEB 2SICE 4DCPA 4KYUA 5FPKA 4DV5B 1O9HA 3SC2A 2IV7A 4GUDA 1YH3A 5D00A 1XEQA 1L5RA 4FGWA 4MKHA 1KGDA 4RZHA 3W4KA 1RYBA 1RPZA 5J5VA 1J24A 1UQTA 4K1LA 3ZHVA 1LSJA 4IGGA 4TV8A 4PR3A 4BMSA 2VDPB 4NI5A 4JI2O 2ZRPA 2YICA 1DSSG 3B85A 1PHPA 1R6UA 1U99A 3REFA 1XLTC 4FLTA 2HEIA 1P2BA 3E5NA 2HRRA 5FI1B 1GV0A 5A1TA 2C3YA 1CCWA 2WFAA 4OBEA 3V46A 1JS1X 4KSBA 1GQQA 5B7GA 1AV7A 5LB4A 6YASA 1Y6GA 1SIOA 3TH5A 1RAEA 1M2FA 4YDSA 1G8MA 4FLZA 2OGWA 2PMBA 3DF9A 2R60A 1IQRA 5TQ0A 3CY6A 1WUHS 3I9V1 2XA1A 4YDHB 2EX1A 4WDRA 1WD5A 1ECPA 1V16B 1KMMA 821PA 1HE1C 5B3KA 3BD9A 2ZB2A 1DVRA 2GCGA 3G0IA 1IXYA 2C07A 1BSVA 5EUCA 4MCHA 1M5RA 2QUZA 2FUEA 3C90A 3RTGA 3EDQA 2Y27A 1RR6A 1COWD 1B0UA 3HJNA 5JQGA 3K09A 3BB4A 4LYHA 4LJ6A 1ZO8A 4QG7A 3H04A 1XNJA 5LIPA 1OY1A 5HK8A 1Q21A 3NBYC 1Z56C 3KVOA 1TM5E 1UZAA 1KYQA 3PC2A 4D26A 2REQB 2Q5IA 5A4JA 3T7SA 4CIAA 5EAIA 3U31A 3DHWC 3ZY6A 3BRQA 2KLHA 5L3QA 4BVFA 5BNWA 2ZUBA 3FGZA 2HK7A 4B3TB 3KVVA 4OXRA