3AG1B

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 280 k
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag1B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag1B02
4L0PB 2AFNA 5FC9A 2HX9A 2CBPA 2PPAA 4E9SA 4NB7A 4UF7C 4G7SB 3X1EA 1ASQA 1PY0A 4ZK8A 4BWUA 1NIBA 2HRHA 1JVOA 4BXSV 1KCBA 4TXVB 2I7SA 3PXLA 4DP4X 9PCYA 1IUZA 3NJHA 3ERXA 4DP6X 1WA0X 5PCYA 2BP8B 1QLEB 3QJRB 4GYBA 5D4JA 1RZQA 3SBRA 4CSPA 1XB8A 2IWEA 5A7EA 2XV2A 1KV7A 3TASA 3EF4A 5I5MA 2GSMB 1JZJA 2Q5BA 4GP5B 3AY2A 1JXDA 4DP7X 2HLEB 2FQFA 3AG2B 2DY2A 2CAKA 1SDDB 3CDZB 3ASNB 3QJUB 3NJKA 1NINA 3MX0B 1WS7A 4X4KA 2HZHA 3X1BA 3QJSB 1PAZA 4YVNA 4AKOA 3BVDB 2FQDA 3AG4B 2AANA 2TSAA 1SHWA 3QJQB 5E9NA 1HAUA 3FU7A 2IDFA 3T6XA 4KNSA 5I6NA 1NIEA 1SFHA 3UAEA 1UATA 1BQKA 2B3IA 1JZHA 1A4BA 4Q8BA 1SNRA 1TEFA 3JTBA 2GHZA 3EH3B 3X2QB 4AKQA 2YAQA 4DP2X 1OCCB 1AS7A 1PMYA 2BP8A 1PZCA 2YAMA 2QPDB 2DYRB 1URIA 2FT6A 2PLTA 2UXGA 2XV0A 4GP8B 5AFAA 1PZAA 2XVBA 2FTAA 1IKOP 2P80D 3FU9A 3FYEB 1NZRA 2FQGA 1R1CA 3QPKA 4DP9X 1WA2X 2HX7A 3KW8A 2BZ7A 4HCGA 3FT0A 1L9SA 4G70B 4E9YA 4W9ZA 4WTQA 2XV3A 5I28A 1I53A 3PAZA 4DP8X 1T5KA 3IE9A 1OCOB 3NJJA 4JHUA 1GR7A 3GDCA 4HIPA 1SHXA 3H56A 2EIKB 2CJ3A 1ET7A 4A2EA 1E5YA 2IDQA 1GSKA 1KDIA 1OE3A 2IWFA 5TK4A 4DPCX 2PPEA 4BK5C 1ZIBA 1GS6X 1E30A 1M57B 2PCYA 3FSVA 1ASPA 3IN2A 2VSMB 2BW4A 4P5SA 1A4CA 3EH5B 1NIFA 3T6VA 1SF5A 3T9WA 2NRDA 1AACA 1F56A 2IDUA 4DPAX 1CUOA 1MZZA 3OM3B 1J9SA 1DYZA 4K9JA 3NJMA 3WKPA 3TU6A 1JVLA 1TKWA 4E9QA 3FPYA 3FSWA 2VSKB 4UANA 1J9TA 4YSEA 3DKHA 3UGEA 1KBWA 4E9TA 2FNWA 2GI0A 2OCCB 5AZUA 5EHFA 1NPNA 3V9EA 1AANA 3EHBB 2VW4A 4G7RB 7PCYA 8PAZA 1E65A 4KNTA 4YSAA 4W1TA 1JZGA 1OF0A 3X1NA 1GY1A 3UABA 3OQRA 2EINB 1PCSA 2UXVA 2VW6A 3QQXA 3WNIA 1BQRA 2J5WA 4M3HA 5I26A 1MG3C 4HCIA 4GXFA 1CYWA 1JXFA 1AZNA 2IH8A 2X88A 4E9WA 3N55A 7PAZA 3ABLB 3FQ2A 2FWLB 2EILB 3IEAA 2HRGA 2QDWA 3JT2A 2BWIA 4KO9A 3CVCA 3FQ1A 2ZXWB 1QHQA 4A2HA 1J5CA 4KO5A 5I6OA 5AKRA 5I6LA 1N70A 2BWDA 4QLWA 1AIZA 2BP0B 4AX3A 1SFDA 1SF3A 1OV8A 1A3ZA 1PLBA 5F7BA 5B7MA 3IN0A 4WKXA 1L9TA 1V54B 2TSBA 4A2DA 1HFUA 4BDVA 3FS9A 3EH4B 4ENZA 4PAZA 1X9RA 5B1JC 1AZBA 2DV6A 1M9WA 1ZV2A 2RACA 4YSSA 1AOZA 3FSZA 3QJTB 3FU8A 1W6LA 3NSFA 4YSOA 1XMEB 1HAWA 2XUWA 3CVDA 1JZIA 2QDVA 4DP5X 3IBOA 3TBBA 3S3DB 4PCYA 1RKRA 5IY5B 3ABKB 2ZONA 1ILUA 2Y1AA 4MFHA 4HHWA 1ZIAA 4KOBA 1OE2A 2BHFA 3NJLA 4A2GA 2QT6A 2UX7A 1VLXA 1TU2A 1OCZB 5B1JA 3NT0A 1FWXA 2IAAC 2DWTA 1RCYA 1BAWA 1V10A 4HHGA 1SDDA 3CDZA 1PNDA 2AVFA 2LLNA 3FPXA 2Q9OA 4QKTA 3X1GA 4YSPA 2YAOA 1OE1A 1ZDQA 2BP0A 4YSCA 1NDTA 3S8FB 3QJVB 3PCYA 3L45A 3NP3A 1OCRB 1ETJA 1NWPA 5I5JA 4G71B 1N68A 2FT7A 3BQVA 3FSAA 2XWZA 3AG1B 1NIAA 2HXAA 4E9VA 1WAEA 4AI7A 2P80A 5B3SB 4YSRA 5D4IA 5B1KA 2AZAA 1CYXA 1W6WA 5I5IA 4YSUA 1BEXA 1RZPA 2YXVA 2VN3A 1JZFA 3FYIB 2CUAA 2JXMA 1ET8A 1V55B 1A4AA 2DYSB 4GP4B 3OMNB 3WI9A 5B1AB 1XB3A 1OOWA 2XXFA 3N2JA 1AG6A 2XXGA 3TA4D 1X9UA 3DIVA 2X87A 3NYKA 3RYMA 4AZUA 1IBYA 2I85A 4JHVA 2IDTA 4EF3A 1PNCA 2YARA 3NJFA 2PP9A 2EIJB 4DP1X 1A8ZA 1EHKB 3AW5A 2VW7A 1GY2A 1KDJA 3OD3A 5D4HA 2IDSA 2Y69B 2JKWA 2GC4C 5PAZA 2WO2B 4F7KA 1AS6A 1NWOA 4RH4A 3D12B 2YAHA 1BXUA 2MRYA 3ZIYA 3NJNA 1ZPUA 1SJMA 4HAKA 4KO6A 3ABMB 1WS8A 1PLAA 3TBCA 2FJSA 4A2FA 4A67A 4NERA 2WSDA 4Q89A 2WO3B 2YAPA 2UXFA 2B08A 3ABGA 2XX0A 3FU7B 4CSZA 4E9XA 4N8UA 5TK2A 4HCFA 2YXWA 4G72B 1L9RA 1CURA 4DP0X 2PP8A 1FA4A 3G5WA 4BWWA 3PAVA 3NJIA 2J56A 3C75A 1M56B 3ASOB 5F7AA 2R7EB 4YSTA 1AS8A 4FAAB 1KCWA 1L9OA 5B1BB 1BYPA 3WIAA 1GS8A 2PPDA 2XLLA 2JFCA 1BYOA 1IC0A 2VMJA 2GC7C 1ID2A 1J9RA 3NSYA 3PAUA 3X1FA 2VM4A 4NAJA 1AQ8A 3HEIB 3CZUB 4GY4A 1NPJA 4JKNA 1NIDA 5I6PA 3S3CB 3DTUB 1MZYA 1GW0A 4YL4A 2UXTA 3H4FA 4YSDA 3NP4A 5I6KA 4UAHA 4YVUA 3KW7A 2A3TA 2PPFA 3T6ZA 1L9PA 1KGYE 3OMAB 1ASOA 1KBVA 2GB2A 4E9RA 1XB6A 3SBQA 2VM3A 1DZ0A 1WA1X 3HB3B 1PF3A 3CG8A 4HALA 4N4YB 3ZDWA 2ZOOA 1BQ5A 2GBAA 3AZUA 4YSQA 1MG2C 1NICA 3AG3B 3T6WA 1A65A 1B3IA 1GYCA 3U25A 5B7EA 2I7OA 1ADWA 2OJ1A 1AR1B 1J5DA 1ZDSA 4A68A 2EIMB 1AZCA 2YAEA 1NTDA 4KOCA 2XU9A 5LDUA 2DWSA 3PLYA 2R7EA 1KYAA 2UX6A 4DPBX 1TEGA 2YAFA 3SBPA 2CALA 3NJGA 3S8GB 3OMIB 1PLCA 1JERA 1AAJA 1YLBB 2PP7A 2BO0A 1JXGA 2PPCA 1E67A 2XX1A 2E86A 2XYBA 5B7FA 1W8EA 6PAZA 1JZEA 4KNUA 1MDAA 2J55A 4BXVA 3UACA 2J57A 2W88A 1EZLA 3NSCA 1BXVA 3H4HA 1AZRA 3FQYA 5I6MA 2GIMA 3V9CA 2HX8A 2QPEB 4F2EA 2FT8A 3ZBMA 2H5UA 3NSDA 2N0MA 3UAAA 2BZCA 3PPSA 1QNIA 1FFTB 4G7QB 4M4RB 1AG0A 2BW5A 2PCFA 4P5RA 2FQEA 2H47C 3GXUB 1CC3A 4KO7A 3T71A 1GS7A 3GYRA 1ET5A 3S3BB 2IH9A 1ILSA 2H3XC 3WG7B 1L9QA 3WNJA 3SQRA 2W8CA 3CVBA 4BWTA 2CCWA 2IWKA 2AZUA 4F2FA 2YEVB 3UADA 1BXAA 1PZBA 3ZX1A 1E5ZA 3MBWB 1AZUA 1JOIA 4HZ1A 2OV0A 2YQBA 2ZWNA 5ANHA 4AKPA 3WKQA 4BDVB 6PCYA 1J9QA 4FA7B 4A66A 1IBZA 2MTAA
chains in the Genus database with same CATH superfamily
2OSLB 1WF5A 4WV1B 2AQQA 3APCA 1UFUA 5C0AD 4PS4L 2IQ9H 3CJHA 1UA7A 1JI1A 1OLLA 4MYPA 5ESAB 4KFMA 4G9FA 1AE6H 2VLRD 3GIZH 5LVEA 1QNZH 1TTBA 2B4CL 1XH0A 2V5RA 3RHWF 3S88H 1K5WA 4M5ZH 4QO1A 2WZ0A 3UBXI 3UH8A 3MJ8B 1CXFA 2DYPA 4EVNB 1OF2A 4D7PA 3TFBA 1WBZB 1MLCA 4S0TD 2G38A 2UXCO 2JJVA 2JCCB 4NT6A 2DQEL 1KJ2L 4MA3A 4PRIA 3VD7A 5DD0H 2NY2C 3P3YA 4Z77A 3LKRA 5TE6L 3TASA 2BVQA 2Y5TA 3A21A 1IURA 5AOKA 3S6CA 5CBAA 3ARFC 4N0FB 1XGUB 3HG4A 3VRLE 3T1HO 1RP3B 2QHRH 4LOUD 2YRBA 2FWUA 3PJSK 1JDDA 4MAYD 5D7IB 4BZ1H 5KVDH 5KW9H 1XCXA 3ZSTA 4CBPA 4MLSA 3HR6A 2F2HA 1KTDA 5A3ID 2KI6A 1Y66A 1G87A 4ORGA 1WICA 4TL4A 4I9XA 4X66B 3IU4H 1J18A 5MI0B 3HMWL 4WLCA 1PAZA 2I24N 5I9QC 5SWSE 4J28A 1C5BL 1J5HA 5FGCB 4LSPH 1QR1B 1B2WL 3FOMB 4A5UB 2DQIL 1SQFA 2UZIH 5BVPH 2C1PB 3TONA 4HISA 1R33A 3E2HC 3J81N 5HY9A 3DPBB 4OZFH 1RUAH 5JOFB 5AVSB 4N90D 4NHCL 2Y3AA 5FO8B 1GK9A 2XN9B 1NKOA 1KLFB 4JAAA 3WFBL 4AMXA 2W60A 1YPZB 2Y06L 3DHUA 5FW8A 3QULB 3NFPB 5DVMA 3JTBA 4WNQA 2FIRT 4G1MA 1Q9LA 3IF1A 4IKIA 3V4VB 3WS3A 3MFGB 1IGFL 2LFRA 4WFBV 1AROP 2ZSWA 5SX4H 4J27A 4F58L 2UZYB 1XMOB 4OJCA 2QGEA 3QUGA 2OYKA 4N8PA 2HG5C 1MVFA 4HS3A 4LAQL 5DFVC 2VQTA 3LDEA 2WXRA 4MNGB 4O02L 2FO8A 3WMQA 5AB2A 1NCCL 3O2WH 1I7TA 1W0KG 2WYZA 3AQXA 3CCHA 4N2KA 1FJGO 1ZHNB 3FYEB 1NZRA 4QRUB 4X5XB 1NGWB 3IWUA 3HBZA 1MG1A 4FADA 4OF6A 4U0RB 2D03H 3A6BH 4DP9X 3DUUB 1LNUA 2XYCA 2APWA 3QWRD 4PREA 2BVOB 3WAJA 4JHAH 3D51A 3BMWA 3FDWA 3GSNL 4G70B 4O4YH 4KJYA 5D4QA 3IU4L 3RYCA 3WS6C 1S7RB 3FCSB 4ZMQA 4BZ2L 3KPQB 4ZFFA 4GSRA 1T5WA 1NCDH 1GOHA 2MOQA 4G6FB 2X28A 5BQ7A 3O3EB 5I15L 2F4VO 3BP5A 3BZ4A 4F9LC 1BZ9B 1MF2L 2BY0A 4UUJC 1ONQA 4ZSOA 5C0RL 3JD3A 4BKLA 3CCLV 3L5WA 4RSYA 4IEFA 1GN3A 5JCOA 1M93A 1UZ8A 1KG0B 2WUCH 4UM8A 2CJSA 3HNSH 4FQ2H 1L0XA 2IDUA 4KKCD 2XN0A 4HNAA 4IIJB 3J07A 1F4MA 4U1KB 4WFFE 1DBAL 3RYHB 1DYZA 3OAYH 1R3LB 5I76A 2WSKA 5EU5A 4O9HL 2X6BA 5C08B 3K6FA 5AAWC 3X14A 4LHUD 3JXAA 4WJ5A 2EXYC 3RIAF 4OXSA 4G8EB 5CSGA 3S37L 3SDXE 5A43C 4Y5YB 2IO5A 3SPGA 3PNRB 4PLKD 3BKCH 3QI9C 4E36A 4IBTA 1L4IA 3MLUH 2AXHA 3HZMA 5C07A 4XI5C 4JO5A 2CZNA 1F90H 1X5ZA 3SBWC 2NR6C 3Q9QA 4AYID 2CLZA 3GI8L 3L6FB 1SF9A 2VW6A 3ICXA 1AXIB 4I55A 5C08D 1A02N 3OGCC 4HXBH 4N8VB 4LFAO 3LRGA 4K7PL 1IQDA 3KPNB 4PJGB 3AS2A 1BQHB 4XXWA 1WBYA 4F2MA 1KB5B 3ARGA 3MBXL 3SZ6A 3O4OB 5DM6V 4FEMA 4OLVH 5EF1A 1TJMA 1LL1A 2DI8A 2QDWA 2CU9A 3O6FA 1T1WA 5DRNB 1YN6B 1SEQH 3DPDA 2VXTH 4Y4FB 1PFCA 5BZDA 1G9MC 1R3IL 2BDNH 2VDPL 3G5XB 4HFUH 1KSRA 3PF2A 3ECVA 4LIQE 4GKNA 4FZ1A 1TTGA 3HI6H 4POUB 2YSSB 3QC5X 3ULVC 1IVSA 3GRGA 4QXWA 1RZIA 1I5XA 2YEVA 3QO1B 4F33A 5F7BA 3W0WE 5LGYA 1ZL8A 3B6SA 4EUPB 4YLCA 2HEPA 1C16A 1CIUA 4EI6B 2C4FU 4QGTA 4Z95L 5IJVB 4P9OA 1OWRM 4TT3G 1D7BA 2GHWB 1R3HB 3GMMA 3EH1A 3MACH 3MLUL 2X3AA 4XMLL 2F54A 3S36H 4NSKB 1QO3A 3I5DA 2AJXH 3OHXC 3UBHA 4ONGH 3HKDB 4U1MA 3HE6A 5DO2D 3F7YC 3R7QA 2VUKA 5ID0A 3KYMB 5B39A 2EYRB 4A7VA 3L3HA 2ZUQC 4BZYA 3KJ4C 1FAIH 1Z9MA 1ZS2A 2X0VA 2VMEA 3JBG7 4FYTA 4HXBL 2YUAA 1QA9B 2Y7SA 5AW0B 4OCYL 2MCG1 3I2CH 4Z76A 1N36B 2NT1A 1Q9WA 3LKSB 4NN5C 1EZSA 1XGYH 1CQKA 1ZIAA 2D4DA 3H1JH 4L4VB 4PJAB 3NACH 3RVXD 4WWPA 1SERA 2UX7A 1NFDE 3CDCA 3IU3B 3ZHQA 1NLBH 4DR4B 5GSRA 4PGJA 3Q6FB 4HZLB 4NYLA 3B3BA 3EFDL 3Q8FA 4HFUL 5B21A 3D8CA 1W9XA 4UQEA 5I82A 3EDFA 2D7TL 2KZKA 3W11C 1Y67A 1BAWA 2G5BB 5HYSB 2XTJC 2P49B 3X1GA 2ENSA 3BISA 3V4PL 3ZE1B 1JPSH 4YSPA 2YAOA 3WKML 3O2VL 1RERA 2QR0B 4HEME 3LZFL 3CHSA 3PCYA 1JZ8A 1JNNH 1P1ZB 4AM0A 1X9LA 1CFSA 5F2VO 1FIGL 3VFMA 1YJ9V 3I50H 3QF7A 3C90A 4ZMVA 1ORSA 1JWMA 3I75B 1IEAB 1MUJB 4RVBA 2BSCA 2LOEA 3VH8A 3IWVA 2UY7B 5FYJD 2KB1A 3ZHTA 2A83A 4PJ7F 2IBZH 1W6WA 3EFOA 1BLIA 3WNKA 2VDQH 5AAMA 4BUHA 4QO1B 3HN8A 4QRTA 1J1XH 3LJ3A 5E9DB 3OLIA 2QWNB 1ESOA 1GIGH 1MLCB 1JAEA 2DWDA 3A22A 1QBZA 4F8LA 4HULB 2NX5A 1QKZH 2QQNL 2J5LB 4P3WA 1D5MB 4PRIB 2CDEA 2X87A 2R9HD 4PLJC 1NLBL 1ZT7B 3DO4A 2BVQB 2CGRL 2Y5TB 3DX2A 2EO7A 1CICC 3AW5A 3D4ZA 1X4TA 5T5FH 3I02B 2FCBA 3MLVH 4NQCA 2H1XA 2JKTM 3LZPA 4QAMB 5E9DD 5HVHB 1JN6A 2YSTA 2JCWA 5B1AC 4YOKA 2DYPD 3S3SA 1KTDB 2MRYA 2YAHA 4JREB 3AB0C 2VDMB 4RNRB 4K4KA 1NT2B 2NUPB 4XX5A 1HYSC 1CL7I 4MCMA 1NGYA 4Z7WA 3D4GA 4L29B 1IGCL 4DR7O 1GZPA 4PRID 2N01B 2AV1A 2FLBT 3MCG1 3VFTA 1KLUA 3IDJB 4FEIA 4OZGA 2NXZB 4QIRA 4Q89A 5EA0L 1JPGA 4Y1TA 2X0WA 2XZAH 3ROOA 1KIPB 4MX7A 5C0FB 1KZQA 3ULUC 5JJEB 5HY9B 1MJ8L 1P5VA 3V0WH 5I1AA 3VI3A 5ICYA 4O5LL 4ODTL 4FD0A 5AVWB 4TWKA 4XB7A 5E8EB 3E8UL 4YJZL 3RFZA 4WNQB 4PWEA 4HU2A 1Q9LB 3BJLA 1UD4A 2FZ3A 4EB6A 1SESA 4AG4L 1L9OA 3NDZE 3VD3A 4MMZB 4F57H 4S1DD 2NXZD 5DC0A 1GS8A 3M8OL 2APFA 2XTJE 1CD1B 1WTGT 4JZGA 2VQ4A 3L54A 1SHMA 3CCHB 1IAKA 4EE2A 2D4FA 3DVIA 3TN0C 3FUJA 5J6SA 2R51A 3GMQA 2JV6A 4JKNA 4OTXL 4UMSA 3QB7C 3BCDA 2K8QA 4FNLH 3WUZA 4OZ4A 3FFCA 1LNUB 4HJ0D 4PJBE 1TUBA 4UINH 3CHXA 1YEIH 2LAGB 4KJYB 3O0RH 1QEWB 3FU0A 4DSYA 3ZGHA 3TIEA 3RYCB 3VSTA 4PDLA 4OM1L 3TH2T 3C5JB 2R56H 4BQ6A 2X6UA 4EZJA 2MFNA 3N6YA 4FX5A 5F1IA 4POZD 1XMQO 2VM3A 4KDWA 4XE0A 5J12B 2AHIA 5AYTA 3OGOE 1J8HB 4UQ3B 1WJ3A 1S9YB 3IDYC 2AJYH 1IBKO 4GO6B 4R7XA 4K71B 4N20A 1AIFB 1EANA 2OMZA 3V0WL 1ONQB 4YWGH 3RWGB 5FW7A 2CRMA 4BKLB 3L5WB 1RLWA 1Q5OA 1V7MH 2HT2D 5B8CC 2IQAB 4UM8B 1UZ8B 4K8RD 5EEYA 2NYYD 4IOSD 1QHOA 5IY5C 1SLUA 4HNAB 2BSDA 2XU9A 3PQYE 1DHKA 3VX0A 1N6QH 2R7EA 3BP7B 5ALBL 2IV8A 2XWJA 2FHBA 1AI1H 1FG9C 1EZVX 3LEVL 4FHJA 4HUWB 3NJGA 3VMOA 4DRXA 2PWGA 4WJ5B 5IYDO 2YIDA 5IF0B 1LTXA 4UCUA 4UZUA 4P3CL 1ZHKA 1B2YA 2K6WA 3BFRA 2DDQH 2CR3A 1HH6B 1XNRB 2A0LD 3HZMB 3DGEA 4LL4A 3IDUA 4Q58C 5F9WB 2QADB 1VMGA 2VSDA 1R24B 3TJHD 4M4PA 1WAZA 2CLZB 4KKBD 3F6JA 1U8IA 3G7TA 1N19A 4I55B 4Q6GA 4O4HA 2BSBA 4G6AD 2R56L 3FRPB 1IQDB 1WBYB 3WY4A 2XHNA 3PPSA 4TV9B 1R5WB 1HHIB 1OKEA 2FX9H 3GXNA 5A2IH 4QGPA 2BW5A 1KCVH 2XFXB 3ORJA 4J3OH 1V7ML 3T71A 3F7QA 2PGGA 1GXEA 2FLRT 1GPOH 4QRFA 4W81A 3LKOB 3QQ9D 3OD4A 4X4MA 4XMPH 4GT7A 1DBBL 1JPST 4OU3A 5CLZA 4BWTA 1VA9A 4XPHH 2F1MA 1N7MH 1AI1L 1SOSA 2YEVB 2NY5H 4H8WH 4LXFA 5DT1H 4F2FA 5D7LA 5C3IA 1NCAH 5K9QI 2YJQA 4HPOL 3O6LH 4L05A 2IPTH 4Z7WF 3ARGD 2ZE7A 4RQQA 1AP6A 3B6SB 4HZ1A 4TNFA 2DKUA 2VXVH 2XQYA 4LRNH 4PW9A 3BPOB 4XP9H 5KTEH 3K6SA 5C9JB 4X1YB 3SQBA 1IL1B 3AQDA 1SEBA 5DZVA 4CGUB 3GMLA 1J5OH 4KJPD 2GY5A 3CN2A 1XR8A 4HC1H 3OR6B 3UJTL 5ADOL 4OCNC 2ADYA 3HZKB 4GRWB 3VI3F 3HE7B 1PY0A 2JJ1G 2B20A 2VXUH 3VGAB 1ITCA 3VD0A 4KHXH 1LGVA 5B39B 1MCPL 1YEKL 3BA9A 3O2DA 1A1NA 5E8OB 4MBRA 1UGNA 4M62H 1KJ2A 5F6HJ 1A6VH 1EUUA 5HVFB 4GS7C 5H4ZA 5D9SB 3NTCH 4LDCA 1IGMH 4ANVA 1QYGL 3SKJL 4GYBA 4Z76B 4ZO6A 1JYXA 4EKJA 4CJ0A 3D0VA 1XB8A 5AL8A 5GGQH 3L5IA 4GLRI 4CC5A 4KGLA 3TJEL 3WIHL 3BO8A 5GSRB 3HE6D 3I6GA 1RHHA 3EGXB 5CMUA 4NYLB 2EBOA 2Z1PA 3K4AA 2QMKA 2PWFA 5CJ5A 5ECGA 4ZFZA 5CN0A 5CZXC 2BIMA 4ZTOH 3KBFA 2G3NA 1B9ZA 2HFEB 2JK5C 2BJMH 2NY5L 3O4LE 4UBDD 3UERA 4KKAC 2VABA 2UVEA 3RVYA 2VDLB 3EOYG 4FQ1L 3MRGA 1HYRC 4UB0H 3DURB 4X7FC 5CCGE 4KDTC 4AW4A 2AABH 3BVDB 4DV7B 4ODXB 2FQDA 4WHTA 4AM0B 4NEHB 3VFMB 5LYJB 4JCLA 4KTEH 3KYOA 2EKJA 1JWMB 3FTUA 1BM3L 3A24A 4HIEA 1OL0A 2IDFA 3M07A 2ZE8A 3EJZC 1RJYA 4QTIH 3RI5K 3CCEV 2WCPA 2A83B 2AW9A 5EOCL 4HHAA 3LRLA 4LIQH 4UQ2A 4CH3A 5K1JA 1S9VA 2PN5A 4O02A 2IXQA 2LU7A 3TO2A 3EDDA 1KLGB 3KPSA 5CLYA 3CSGA 3GRWL 1E7UA 4HP5A 1FXKB 1CYGA 5EC2B 1M6UA 2BNUA 5GGQL 3F12A 2ARJB 4ICWA 3GBNL 2CDEB 4ZFQA 3T2NH 4A6YH 4XDLA 3GSNA 2FQGA 4JANA 5BS0A 1ZWIC 3B40A 1FIEA 1CL7L 5I73C 4IIQA 3ILQC 2GTWA 5BZWA 3Q4HB 5SV4A 3JWOC 4NQCB 4HCGA 4BZ2A 4Y7MA 1JN6B 2MWCA 5ESQA 1TTFA 1UASA 5LCVH 1BVKA 1TENA 1U8MB 3RX8A 2ICES 1IM3A 5G2NA 1KTCA 1ZTXH 3LKQA 1B3QA 1BGYH 2Y4TA 4ZHQB 3O6KL 4N1EA 4WFEE 1PFOA 3FQNA 1NGYB 2AABL 4HAFA 1GZPB 1WD8A 4X66O 5DJYA 2D7NA 3VFTB 4LP8A 2WXMA 5AVXB 4BK5C 3CDYA 3K5OA 1MHPL 1WFJA 4OZGB 5GRJH 4X62B 1MFEH 4GI6A 4HSCX 1VJSA 4RMUA 1A4CA 4M7ZC 3J7HA 3ROOB 2AZ0A 3MZGB 3Q5TA 4N24A 4QTIL 1HNGA 4PU2A 1I08A 4AL8H 1FCGA 3E38A 3ZYZA 4JPKH 4NQCD 1Q90A 3P32A 4Z3EA 4AMWA 1JYNA 1F56A 3WXWH 4LIQL 5MENA 1KBHA 4Q52A 4FZ0A 4JI3B 5KG9A 3GKWL 3RFZB 1UEYA 2CSPA 1E40A 3PGDB 3JARA 5IQLA 2ICWJ 2FZ3B 4EB6B 3K57A 3FQWB 5E2VH 4WFGE 3CFJB 3TU6A 3BRCA 4DEPC 1PZ2A 1P4BL 4N85A 3TP4A 4PJIA 3BPZA 2ZKWA 4PGCB 5AG8A 1IC5L 4EFEA 4C56A 2VLKA 1XMOO 3T2NL 1OOAA 2XPGA 3TEWA 5ALCH 1UH3A 5T3ZD 3GXMA 1IAKB 1FFOB 4Y9EA 3GMQB 1FVCA 5BOJA 4XPBL 1KB9K 4BFBD 3E7JA 3RWRD 2MW2B 1DDTA 4OZ4B 5TE4H 3AREB 3FFCB 3FB8C 5CCHE 5I8OL 5BZZA 1BHBA 5I0WA 4GH7B 3NIFF 2H2SD 4KPHL 2IALA 1BQRA 3H8NA 3OBAA 4GIAA 1QAWA 2J5WA 4OLEA 3CFKB 2W0LA 5DFWH 4UQAA 3GPSA 3DYPA 1AZNA 1R6TA 5F1IB 4JL2A 5IQ9A 3U0PA 4OD1L 3ZHVA 2I9TB 1RPUA 3LS5H 1MCHA 5GRJL 4KQ3H 4AIXA 1EO7A 2Q76A 3D2TA 1F6LL 2XZCL 1LNQA 2EEAA 3AS3A 2OMZB 3RGVA 3SE3A 5MP6H 3FFCD 3K5RA 2V4DA 3NH7H 5I1EL 4APQB 3I55V 1TLMA 3QUZB 3MOQA 2W0FC 4FCHA 1YJWV 2UUBB 2HT4C 3QQNA 4AJYV 2IGFL 4I7ZC 1EN5A 4R83A 1QFHA 5I8KH 5IOPA 2M8XA 2GJ6E 1EAPA 3CFTA 4HIIA 2YUZA 4PGBA 1H3XA 3UTQB 1SLVA 2E6PA 1XX9C 2BSKA 1ZHKB 5AQ0A 2AQPA 5EO1A 3SR2C 1YRKA 2WLHA 4APQD 1B0RA 3NSFA 32C2A 4YSOA 1XMEB 3B2UC 2FLMA 3QUZD 2CRZA 5IQ7H 3ML8A 4P3DB 3QWQB 2QSAA 1KPVA 1QR9A 3TFKD 1N8ZB 3O9OA 1P4LA 4JO2H 5JZ7D 4U1HA 1KBKA 1U8IB 1U96A 2JXMB 4O4HB 4YDKH 2E9WA 3CRCA 3N2KA 3VXQB 4M9PA 1W80A 1CTOA 1G9ML 2GG1A 4KKNA 4CDGC 5C3LD 1KEMH 1T89A 4ELME 2W9EH 2FRGP 4HHWA 4HIXL 5CWSA 5DVOA 5AW4B 1A7QH 1BAGA 1YJDH 4D3CH 2WPGA 2MCPH 4ZZKA 3TVMC 4G80B 3V4PA 2VR5A 4H5SA 4KI5E 3GTVA 1C08A 4YDVA 3HUJB 3S5LB 4BH8B 2R8SL 4PTUA 4HUKB 2VDRH 2XRAH 1XBLA 1KC5L 1T22B 3F64A 3PS6A 4N8CL 1BE3H 3X2QC 4RGNE 4P4RB 4LZKA 1NCWH 4G8IB 5I5RA 1YAIA 3CVHH 4ANUA 2ZDIC 5I8KL 3TBSA 4QE9A 3LSUA 4FC3E 3OXRA 1FZKA 2Q6WA 1FJ1B 5D7LB 2DL9A 3FO0H 1U6AL 4LLVA 3CRQA 5IDJA 3GGWA 3UBXA 4D8PA 3MV7A 5IB4A 2VLJB 4JHZA 2CE4A 3P4MA 1MELA 4N0CC 3SQBB 3WDIA 2AXFA 1SEBB 4NQQA 4AGPA 5C0NC 1FVDA 3GMLB 4WHYH 2OZNA 4H20H 1AR1D 1LEIB 1ZT1A 5B3SB 5HDBF 2DIAA 5ACMA 3DOIA 4DEWA 4YBQD 3TXAA 5C0DB 3TEZA 2WVVA 1IGYB 3ZTCC 1LQBC 5E5RB 4HG4K 2QL1A 5ANMB 1IBGL 1AQDA 5C2BH 2CUAA 5D7LD 2CHWA 3FQUA 1ZTMA 2QGNA 2BVPB 1JZ7A 4KRPB 4GP4B 1U8HA 5I18H 3F7LA 2VLJD 5CJXC 1OOWA 4ZUUA 2NQ3A 4F7TA 1B0IA 3N2JA 4N22A 4PJIF 3D0VB 3T4YA 4JCMA 1N5YH 3IKKA 1N36O 4AZUA 1IBYA 1OTTC 2FX8L 2ZXGA 4M93B 4Y19E 1IBMB 1RHHB 3VXNA 4U1GB 2P5WA 1K8DA 2HRPL 1KDJA 5JMRA 3CXDL 4FJCC 5HFMA 3GSUA 3BFWA 3FCUB 4MCYB 4ZFZB 4Z7AA 4KRPD 5FFGA 3VFSB 1NWOA 3CVHL 3KG2A 4HAKA 1WAAE 2VABB 2BHYA 1HR0B 3FT9A 5E1QA 1TVBA 3BIAX 2BS71 3MMEB 4MA7H 3QDJA 4OGAC 4XXCA 3SDAB 3S5YA 3N1GC 4DFHA 4L9DA 3VXMB 4WHTB 4YIQB 1IBLB 3BIKA 4LQ1A 1AO7A 1PCXA 3E89A 1D2OA 1H3WM 3H3KA 3P0VL 4DTGH 2JB6A 2Q20A 2EDKA 4HIEB 5AKVA 3ISWA 5G5DA 4ALAH 4LCYB 4E9XA 4FA6A 5HJBA 3L5HA 4LCVA 4RRPG 2EDBA 4B3MB 3MRIA 2VLLA 2RCSH 3LH2H 3LD8C 3PJSA 4U0QB 5EOCJ 1GHFL 3R06A 3WLBA 4PBWD 2NY3C 3C08H 1MCLA 2MNWA 1U93B 5I18L 1CGVA 3EO0A 3RW0A 1AS8A 2I26N 3TO2B 2A2QT 3MR9B 4JKMA 2DQJL 3B2EE 1EJOH 1N18A 3BUYA 2AXWA 3LMJL 3GSWA 1O7SA 2XLLA 3H2QA 1BYOA 2BNUB 4FLOA 4HEPG 5EDXA 3K6OA 3X1FA 4RFNB 4KKLC 1KENL 4O2EA 1WZAA 3D52A 3NCYP 1I7ZB 3VFGH 3RL1B 3VD5A 4L9LA 5HGBA 1A4JB 3OX8A 4YL4A 4ZODA 2H3NA 3KGUA 2A9HA 3RYIA 1CLZL 4XVSL 1VIWA 2YD9A 3VXUB 1QCEA 1GZQA 5B1BC 5F1KC 2F58H 15C8H 5IVXE 5BO0D 1U91B 3R0NA 3LKQB 3QH3B 3ULUL 4LRIA 4XVJH 1SMDA 4K3EL 4MNQA 3FQNB 3QXAB 4HA1A 1JPTL 3G08A 4PRNA 1G9HA 3T4AC 4DCQB 3ESNA 5JQ6H 5DWPA 4EMZA 2OM5A 4HALA 5HHME 1JGLH 1YSCA 2GBAA 1U2HA 5DU7A 5GGSA 1SXNA 5FAAA 4OLYL 2H41A 4M48L 4LCUC 2JKXA 2R27A 4WCYL 5KHJA 3F7VB 5FM5O 2I7OA 5B7EA 4JFEE 1OSYA 3DX4A 3GSRA 2W07A 1IM3D 3AAZA 3RWCA 4HFWB 3CH8A 4RMBA 4EBQL 2NLJC 3JARB 5AVQB 5FUCE 4ZS6D 3AABA 5DRXB 3VVWA 3DO7B 4NM4H 4OBRA 1EJOL 2R9IA 1DBMH 4EPSA 3BZDA 3S35H 3S8GB 2ZICA 2N04A 4NWTH 3S5ZA 1UA6H 4Q74A 4EI5A 1YLBB 5KYWA 2H2PC 1HP8A 1UURA 3QXDB 3AG3C 4OCWH 4PJDE 1P84K 2FEDD 2VLKB 4ZUSA 2JJTA 2C9PA 4DAGH 2XPGB 3WMSA 3PFQA 4ISVA 4KXRA 5F3FA 3MRNB 1G1YA 3DX7B 5M7QA 1P6AB 2EIMC 2JKJA 3T09A 1FVCB 4J1UA 5MEND 4WWKA 5BXFB 4JKPL 3IPBA 4EXKA 5DWUL 1I85A 2IALB 1I3RB 3ARDB 2X0LA 2R70A 1IBHA 4C56D 3TV3H 4EN3A 2VLKD 2IH3C 5IQ9B 3GJFH 1HL5A 2DJ4A 2A9NL 2VDPB 3IFOA 3KL0A 1U3HB 1K4DC 2DTML 2Q76B 5CCKH 1VF7A 1EJ8A 2O5XL 1F4NA 2VRAA 3CNKA 2ADQB 1JFHA 3RGVB 1PD0A 3UG3A 4HWBH 2V0AA 3K8KA 4W4KA 1D3CA 3F83A 5D2LF 5E99H 5SWSA 1UWXH 4Z7OB 4R4FH 1K5NA 4KTYA 5CB4A 1WPCA 4G1EB 2G5UA 3C6EA 1BD2E 5D7JA 4GMSH 3D0LB 4HIIB 1U3HD 2YQBA 2IAMA 4G7YL 1FGNH 1F58H 3Q43A 2BY3A 1HSAB 3JASA 1XEUA 2Y4SA 3CFUA 3RGVD 1AP5A 4X65B 1KNOA 3CSPA 1QRNE 1T0MB 3ULSA 3VU1A 5ICZB 3TM6A 2ERJC 5ICXA 2JS5A 4MJIE 1WGOA 4ZK8A 3IGAC 3QC6X 3C2AL 1XNRO 3U83A 1KPVB 1F11B 1UC6A 4D7TA 3HFFA 3EJQA 2EDNA 4HWNA 4U1HB 4ENED 3ABMC 1TXKA 2WQUA 1IUZA 1IDSA 4HBQA 1DF4A 1XL6A 3NGBC 5DD1H 3PGFH 3FTVA 2VZSA 3ZR5A 3WIHA 1KGJA 3OWRA 5DEFB 3SBRA 3PYCA 4FLYA 4HKJA 3DSFL 3PDOA 4AV0A 2BY2A 4K7PX 4X4XA 1D5IH 1FHNA 3P4OB 1YZZA 2CWRA 1OM3H 4AYSA 3EYFB 1RUPL 4H5SB 1JI2A 1RZGB 1C08B 1VQLV 2NY0C 4YDVB 2LVCA 3PAYA 3AT8A 1NOAA 3LNNA 3BPNB 4O4LA 4DV6B 5E99L 5D5QA 3BSZH 3BWUF 1MZFA 2AV7A 3H9SA 2X6VA 3TBSB 3T2OA 1FZKB 2Q6WB 4L3FA 5E6IB 3NCFB 4OFYA 4B3VA 3VTMA 3GGWB 1XZWA 3MV7B 3NIGE 2OT5A 1HINH 3P4MB 3V6ZA 4CMHB 3LQAC 5FS5A 5HFLA 3CFCL 1XSKA 1FVDB 3OPZL 1KCUL 3VYOA 3RBZA 2WA4A 4WFFA 2XT1B 3FQRA 3ARFA 3ME0A 3UAEA 1NEZG 2A9CA 1RXLA 4PRDA 3Q44A 4H0LC 3VXSE 1DQQA 3GRWA 1DEDA 3K5SA 3JWNH 1TEFA 4G6JL 4PB0H 5KVGL 2ESVE 5E6ID 5D2NE 3B8YA 2FEEI 3SDXA 4C54A 2BX5A 2Q5ZA 3ZN1A 3L08A 4K3GA 4JFXB 4YEFA 1ZD6A 4G8GE 3MV7D 1KYOJ 2YC1A 2BOBB 3Q6GH 5FA3A 2Z1KA 5T5NF 1WSST 4ZUUB 2K9PA 4GP8B 4PR5A 3G4SV 2JWYA 1ID5I 4JBSA 3ZL4L 1KQSU 2R9RB 1I8LC 2WQAA 5DJDB 4BFIA 4TLUA 1OM3L 4R3SB 5M95B 4KH2A 4U3JA 4DVBB 3CVIH 1R1CA 2LW1A 4PJ9C 2YI8A 1R3KC 1ETB1 4P59H 1K8DB 1XD1A 1RJLA 5GJTL 1L5GA 5GRYA 2R1WA 3OB0K 1FH5L 5IYBO 3HKBA 1WFTA 4YEEA 3RNKB 2Y0PA 3GO1H 1GC1L 5C93A 1KC8W 4DP8X 3MBEC 3IE9A 4B9JA 1YEWA 4NKGB 4HCRL 4XXDA 4LLDA 1DO5A 1TVBB 1U8OB 2V7NA 3MRHA 1SHXA 2AJUL 3H56A 3QDJB 4M1CC 4KXBA 4OJEH 3LZLA 1E5YA 1R47A 3RDTB 5DJ2B 3WJLC 5HHNB 5BMVA 1OE3A 3VRLF 2IANE 2HG5A 4L1SA 2F93B 4DV7O 2CKNA 3QT2A 5FYLH 5IHZA 2UU9B 5D6DC 2ICWB 2FJGA 1N0JA 2JB6B 2NOYA 1I1AC 4DV4B 5G5DB 2DZEA 3ZKXB 5FFLA 1W72H 3R18A 4L2YA 2XACC 4W9HC 3W0WA 5FM5M 3QHZL 3L1OH 1OCOC 2BIOA 4TV8B 1UACH 2ZOLA 1SRDA 4KX8A 4N5UA 2YWYA 4TNWK 5DMIH 2WZPA 4FKEA 3S36X 4IL6Z 3WLBB 3EJSA 1DEEA 3QDJD 4NUGH 4C4KT 2YK1H 4P5TC 3EO0B 1HCZA 3QISA 2CCLA 4P05A 1YQVL 3WS6A 4LF8O 4G8FB 1MW2A 1YAZA 4XBGB 2WPDG 3UMTA 3GSWB 4MD0A 4P04A 3JWOL 2VYRE 2X4TB 3M45A 4ODVL 4UYPA 4W68A 3VQXA 3QEGL 1FZMA 2CIIB 1VQ4V 2KG7A 4O4IA 1SPDA 1YDPA 3CVIL 4N5ED 4O2EB 4X6CE 5DJ8A 3VE0B 4E42A 3K3WA 3QIWB 2XPYA 4L9LB 4LT7A 4UUJA 4F9LA 7PCYA 3B83A 3IGUA 2E7LA 4B5EA 1PZ5A 1OSPL 3QHFH 5AYUH 4EIUA 3IK2A 3QA3A 3DRTA 2AJ3B 3U1PA 1PCSA 2CBTA 2H9GB 5BR8B 5IJKC 5GRZA 4Y4KC 3KPRB 1MJ7H 1NFDA 5I23A 3BD3A 4GXUN 2YD4A 4DQOH 1LP9B 4IK6A 4LSDA 1XF2B 1MAKA 4JV5B 2LGQA 1TGOA 4Q9CA 2R1YB 1BQZA 5AAWA 7PAZA 1IIIA 1P53A 3SGKA 2J8UE 5EBLC 4PS7A 3RA7H 4AQAA 4QGYA 4WGKA 3WTSA 3R8BB 1C5CL 3B2XA 3QIWD 4Q9QL 4HXAH 2BWIA 1G43A 4YUEL 4ZMLA 3QI9A 3UO3A 1W72L 4X62O 5K1XA 5ESVB 1CLOL 2EINC 1EXUA 1CLYL 2AJVH 3GSRB 2W07B 4LVOB 3SBWA 5GXBB 2NR6A 3EG9A 3AAZB 3RWCB 4LVNC 3MLXH 1M05A 4XN8A 1UJTA 5GGTH 3V52L 4JASA 3P2TA 2PYEE 2IBZX 4MNQD 5IBUB 4JI3O 4PD4K 3THML 3OGCA 3IN0A 2WTPA 3MRMA 3U0TB 3GHEH 4ODUB 5KYWB 4J11A 2EE0A 2ZCZA 4Y2DC 5B1JC 5LBVA 1NMBH 4L3EE 4KJQC 4ISVB 3K5LA 1AOZA 1CDIA 1CS6A 2EYSB 4GQRA 2DLFL 2ZKHL 4QCIA 4WWKB 1BZDA 3AROA 2X05A 3C12A 4OJFL 4RWYH 4GG8A 4KK6D 5T3XE 3S3WA 1XWVA 5E8PA 2WXJA 3PJNA 4IJTA 3UYOD 3UC0L 4XTRD 5JPMC 1I8MA 3VW3L 2DMXA 4DQOL 1OK0A 5FA4A 3ABKB 3ETSA 2L0DA 1U4EA 4WEMB 3M7OA 4X8GA 3CUPB 4LSRL 4EO5A 5C7XL 2HVBA 5IYZA 2EUVA 2BHFA 1KCRH 1OP5H 3RA7L 1W0VA 3BY6A 3LXCA 3WJMA 1NKGA 4Q7DA 4GFXA 3O9WB 4X6FB 3FO9A 4FF9A 4QWWD 4LLQA 1P49A 4WWKD 1OSEA 3TYGL 3QWNA 1ZTEA 2WLLA 1N12A 2NY6D 2AVFA 3F7YA 4WFHE 2E75B 5SWSB 1U3YA 1M9NA 2H94A 1OE1A 4HLJA 5DJXB 1ZGLP 1BS3A 2QPSA 4V1DA 2W5PA 5CB4B 4FFVD 4NRXA 4EN3D 2UUBO 1TMCB 3VQLA 5D7JB 4R0LC 1EGJH 2V5TA 5F96L 3MYJA 3IJ7A 1S5HC 1WFMA 1XCWA 1ETJA 2O5ZL 1KB9J 2WZAA 3B7TA 5DRWA 4ZTPH 3H01A 3JASB 2FX7H 4IYIA 2E8YA 3BAIA 4MXQD 1FDLL 1SQ2N 1AJ7H 3ULSB 1YEJL 4AYGA 5MEPA 4YSRA 5D4IA 4TYUA 5B1KA 1UKSA 3DA0A 3N5AA 5SWSD 1G7HB 4P9PA 3F8UB 1INEH 3GZQA 3QGVA 1JZFA 1K85A 1ET8A 1OGTA 3I9PA 4Y1AE 5GZND 1H8HG 2CMRL 3QR1A 4RFOH 2E56A 4DXWA 1VQ8V 2JNZA 2PW2A 5D7JD 3V0VA 5I2IA 5KA5A 3FQWA 1L3NA 5C92A 3UCSC 3OG6B 4KXAA 2A73B 4QRRE 3J80N 2CKBL 2ADJB 2L4OA 3AG1C 3X12B 1PX8A 4HKJB 4YS4A 4IHOA 3KXFA 3NYKA 3VO0A 4JY5L 1PNCA 3CVHA 5D1XC 1OAUH 2YZ8A 3JV4B 3LKPA 1BJMA 3N06B 4GMTH 4MHHG 4X9IA 1JMXA 4LU5L 1MI5E 4O4LB 4AQYB 1AFVH 1WE5A 5IROA 1AR5A 5FNVA 2AV7B 1SJMA 1CR9H 3QRBA 4MMYB 4LLMB 3M1OA 1JQ0A 2YGQA 1NFDF 5IQNA 4OLWH 3TBTA 1L9MA 1PLAA 3QEQE 1JHLH 3ZE0B 3FB7B 5TJWK 5HXMA 1HOEA 3DUHA 4L5FE 4NQDB 4I1NB 3V6ZB 4Q6IC 2F7OA 4PQXA 1GMEA 1TEYA 3RWDB 5F72S 2FEEL 4J6IA 1CXLA 1LWRA 4UTBL 4UT6L 3FQTA 4JG1L 4UM9A 1ZHLB 2DWEA 3FQRB 3ARFB 3ME0B 1FFXB 1GTNA 1XH1A 1CICA 5DTFA 3SE8L 4QPKA 5KANG 2XA3A 2EECA 3SDCB 4BWWA 1DQQB 4X98A 2OMUA 3SDXB 2A6JA 3GSXA 4OFYD 4AEIL 1GN6A 4JGMA 4ETYA 1BT8A 2WQRA 3V5DB 4JVPA 2B1IA 2A6KB 2YC1B 4F27A 4D2NA 4KUMA 3R0MA 4CN1A 3QZWB 5DUBB 5FUZH 1FPTL 4ZXBB 1T5XB 1XV8A 3CHOA 4BFIB 3HI1B 4WFFD 5AVTB 3QBTB 4R2GC 3EYUH 3UP6A 3ARFD 1Q94B 2J1WA 1GGCL 1B4JH 1E4KC 1N10A 3UROR 1M56C 1RJLB 5F3BA 5IT2H 1LXMA 3NESA 2R1WB 1IBMO 4E41E 5EU6E 5B3JE 3NP4A 4XPGH 2ZXAA 2YXMA 3VFNA 1SQMA 3UTSB 4HLEA 3ULVF 1SUJA 1PL3A 2WXKA 4XXDB 3H6JA 1XR9A 4YR6B 4PS3A 4JFFE 2V7NB 4LLDB 1UCBL 3ZUCA 4ZXBD 2WNGA 4LQFH 1DLHB 4M1DH 5BV7H 3FK3A 1HR0O 4DGIH 1EH9A 2WY3B 8CGTA 5E5MA 4P5MB 5IKCA 5AENA 1PAMA 3F84A 1BQLH 1PVHA 4HV8A 1A65A 2FJGB 2G4EA 5B38G 4JKLA 3W5MA 1IBLO 3ATEA 3TN0A 4EQ2A 1A32A 2ZNJA 4MT8A 3GQFA 5KYYA 3MGAA 5LAXA 4KOCA 1BFOA 1IZKA 4PJ8B 1NCHA 4BFRA 2IG2H 4BWAA 1DEEB 2CK3G 1EEYB 1TEGA 1HDMB 2CHDA 4JFOB 5EIIG 4A6YB 5KVEE 2CALA 1QU7A 3K7UA 3M86A 2QWPB 4P2RE 3CBRA 5EBWB 1I9JL 3ARVA 1F45A 5DFVD 4KVNH 4BCYA 1UH4A 1RURH 4IHJA 3BHBA 4JY4A 4P0DA 2E86A 3KYNA 4KGJA 3VXTA 5E0QA 2KG7B 1D5BB 5ITZB 3R4DA 3OHMB 1MDAA 3W0WD 4H44B 2EDTA 3IXTA 3VRJA 1K8IA 3IETA 4PJ8D 4X6EA 4AV5A 4IJ3C 2WZPD 4YJ3A 5LHHA 1PZ5B 3A4AA 3DTDA 4EZLA 5B8CA 3DRTB 3T8XB 4AUJA 1CFMA 3CN0A 3LRSA 2BMKB 1H3GA 1MAML 3DROA 5KYNA 5EUOB 4E5XA 3WSQH 3PP3H 5IMLB 1I8AA 1REIA 3A67L 5EZPA 3ZTJG 1YEEL 3TV8A 2D3VA 2FVNA 4AQAB 1EZUA 1X5KA 5CZVH 2O5YH 1U8QA 2R29L 3DJ9A 2J21A 1RVFL 3PFUA 3FX7A 3O4LA 2GABA 3U46B 3UTTE 3QQDA 3QVAA 4FTVB 4JVWA 1D9KC 1G7PB 2VCOA 4WNJA 4R5VA 1EXUB 4I3GA 2DH2A 3FUNA 4NXSA 2V5MA 3B37A 4L8SB 3EG9B 2C7UB 3CVBA 3T3ME 4MTGA 3C09B 4G43A 2ETWA 4R7DA 4HH9A 4LEXL 5C7ZA 3PXJA 4WW2C 5ILTL 2NTFA 1QUPA 2VC2L 3K2MC 4IGBC 1SQQH 1MCWM 1NBZA 4A66A 2BVEA 1MSWD 4LESA 3Q7JA 1YUHA 3SDYH 1NFIA 2CK0L 4ZO8A 1TCRA 3MODL 1UB6A 1SVCP 1RJCA 3HAEA 1GW6A 1DJZA 3HMXH 1L7TH 2FHCA 4QCIB 2NR6D 2LW7A 2HJLA 4IM8A 3RTQC 5L4IA 3P9LA 4MCZA 1F4YH 1A4KA 2P43B 4ZX5A 5IWLC 4GG8B 5DQJB 1Z7JA 1DJXA 1II4E 3GEFA 2XWTA 1G9NH 2B5IC 4X7SH 1E9OB 3EYVB 3UJIH 5JW3L 5FA4B 5IJBC 2BP8B 3NIDF 4PSRA 4ZIBA 5GS1B 5IYZB 3ARSA 5CP3H 3RWJB 3U4KA 1W0VB 3MXVL 4Y2OB 3UPCA 3FO9B 4ZMPA 3BABA 3C5ZC 2E9GA 3QDMA 4DP7X 3OKLB 1JDAA 4U33A 3ULUF 1C8PA 2VQ1A 1C7TA 3AG2B 2WLLB 1JNHB 2OR8A 4WFEA 1DVQA 2WXNA 5D7KE 4J41A 4P9HC 1GGYA 2DIBA 3UCRA 1NINA 2ZNIA 4R4BA 4DW2L 2CTWA 3BE1L 3C6SA 3F85A 3VFPA 2YIHA 5JXAH 2ZWLT 3QNZA 2X7RB 2VN4A 1HKFA 4LSTL 4HWEH 1V3MA 2IJKA 4RIRA 1LEKB 1ACZA 3G6AA 1RUMH 2C34A 4U1NB 1ZLUK 3UL4A 1IV8A 5DRWB 1VF6C 4TQPA 4JLRB 4C55A 3PP4L 2DQ6A 2OTUA 2RIKA 5MEPB 1L7TL 4XN2A 1Z5WA 3VQWA 4X65O 2FYVA 2Y7QA 1GOGA 1LO2H 1N64H 5HYJB 1RFYA 3LDCA 3F7RA 3LDDA 1OHZA 1UM6L 2FATH 1ZT4B 4JJHA 2H7WA 4H1LA 4PJXF 5ADPH 3K08A 5FLVA 3FB6C 2G4GA 1VQPV 2BNQA 3NZHL 1PMYA 2X7LB 3IFLH 5E7FA 2WYIA 3HG5A 5FKPB 3CFDB 5IJ9B 1PZCA 3LNMB 3J7AU 3Q3GA 2R83A 1LK3H 1O6TA 1Z2GA 4KDTA 3FHEA 4IHOB 2VDRB 3CP1A 1K3EA 1JNLH 4PV8A 4PJBB 3EYSL 1YI2V 1THAA 1H8LA 3FU9A 2OX5A 3CVHB 1W2BU 3PN1A 3FU5A 4OJYA 3QCUL 4X8JA 5EC1B 3S96B 5I19H 3BC9A 4HCRA 4CW1A 1XGQB 1SYVA 1DL7L 5IBTL 1A3RL 3STZC 4JM4L 3WFEL 3QW9A 4XB3A 3LQAL 1G5GA 3WFVA 4F92B 3QSKB 4PJCF 2BHUA 5LA6A 2B1OA 4XR8C 4U3SA 1HHKA 1S78C 1GSKA 2WQVA 5TK4A 2WVTA 3GIVA 4P07A 4ZAKB 4YIOA 2APBA 4G5ZH 2P6JA 3G5VA 2EXWC 3MOAL 3VRIA 3PQYB 2HUEA 1VKXA 1CB4A 4JO1L 3O11B 4UM9B 4DR3B 1ZWIA 2DWEB 4PYHA 2GJ6A 4JG5A 4WRLA 2NRDA 4DUWA 5IROD 1FYTE 2CM6A 1DQJA 1E8YA 4Y9CA 1KB9F 2E76C 4ONFL 3GZKA 4BSJA 1MVUA 1UXWA 1A66A 3WEOA 1J87A 3DUSA 2R23A 4FQJH 3VXOA 1Q8MA 2XA8L 4KK8C 3U7YL 1AC0A 4ZAKD 1M57C 3FSWA 4J12A 5IM7A 3DKHA 2QTEA 1U8JA 2GK0A 3PQYD 5IMMB 1I5YA 4BK5A 3QFJA 1AANA 3ZDZB 4UM9D 2EJ7A 5LBQA 5CJOH 1J5IA 2VW4A 1CICD 5HGHA 1S8DA 1AVMA 3BOVA 4KNTA 4LARH 3GB7B 5F3BB 2BWQA 5DK0B 4FKHA 4JYAB 4K5NA 3IJEA 4G7VH 2HFGH 2UXVA 2EUXA 2OKMA 3MV11 5T3XL 2J44A 1TMQA 4CVZA 7FABH 5JJNB 1L1FA 1HYSD 3LSQA 2GV9A 2RA1A 4S11A 3UAFA 4DKFH 1A7PH 1FGVH 1MEXH 1IIKA 4N6RA 3IFXA 2FWLB 5E5MB 5IKCB 4ZQKA 1VFMA 3X13B 1GYAA 4CZZA 3QRFM 4UI2A 1RSOA 2ZKOA 1Q9KB 4QMEA 3KYKH 2A7BA 2E27L 4BH7A 4TVSa 4B7EA 3HS9A 1FV1B 2APSA 2Q6AA 2UU9O 4PA9A 2KBGA 3CFIC 1EDHA 4G2KA 2X2UA 5I6OA 4DV4O 3APNA 2MTPA 3PWPA 5INDA 2Q8AL 3FF7A 3T0BA 1FNEA 3FB8A 1Y1UA 1Z5LB 4GRLB 3P3PA 2P24A 3P02A 2Z4QB 1L9TA 2W81C 1DVFB 2P8MA 4JY6B 1BSMA 1HEZB 2RB8A 4FFBB 3HG1E 1IXBA 3K1DA 5FYKL 1D5ZB 1FNSL 4F24A 1T6WA 1RIHH 1PEZA 3KYNB 3OEHG 1M9WA 1H3VA 5I8CA 1E1RG 1V3LA 5ITFA 4XNUL 4D0BB 1NC2A 3T0EB 4HQQL 1SJEB 2OXHA 5E00A 3MLSH 5HI3C 2C9AA 1VPOH 3M46A 1K8IB 3IETB 4X6EB 3VRJB 5BJTB 4XNMB 4YJ3B 1PD1A 4PJ7B 3FO2A 3EFFK 2AXJA 4GRLD 4H13C 2IJHA 1L0PA 3T5WA 1J8KA 1OIOA 1UENA 3RWHA 2QA4V 2JKIS 5IY5B 2W0FA 2Z34A 5EO9B 3BSGA 4JQIL 3SPIA 1JGVH 2L7UA 2DQGL 2H3OA 2GSIA 1QG3A 5BR8O 4I3SL 5GTHZ 3QYMA 2Y1AA 3CPLB 4AH2A 4YQXH 1H15B 4Z5RB 2PO6C 2VIRA 4XWGL 3HI5L 2D3LA 4JV5O 1F3DH 4O51A 4XBMA 1AXSA 4OCRH 1URZA 4UCFA 1WAAA 1MIML 4QRSA 2F8XC 3DARA 3JATA 4U2ZA 2O57A 1EJ6A 3BAXA 5CINL 3K71A 3E1ZA 1T21A 1F42A 1TTRA 1FZJA 4JN2A 2V2WB 5D1QC 1QBML 4ADGA 4XBEH 4OF0A 5ELIA 1BDYA 1SQXH 1UWGL 3L45A 2A1WL 1KWKA 2G2NA 1RJZA 1OCZC 4L5FL 2EDMA 1DDHA 1WISA 1KGIA 3RLSA 1MCRA 4AM0Q 4YHZH 1UKQA 4U7KA 5DSCA 1P7KB 3O4LD 4MAZA 1A7OH 1M2OA 3DOSB 3GSQB 5KZCB 2P4VA 3TVMA 2P80A 1UB6B 4NX0A 2DL2A 1HE7A 2B8OT 1NEPA 4J42A 4XMWA 3P9LB 5KA6A 1A4KB 3GJFB 2CKBA 2ICEC 1NGPH 1FFNB 4HSQA 1OHHG 3ZQXA 2ZDIA 3GBMH 2L3BA 3BRFA 4AE1A 5KVEH 3BAEL 5F9AC 3S0PA 1OPGL 2Z91B 1EHXA 5EU7C 4NZJA 5J13C 2VAAA 3BGFC 3QG6A 3UOAB 1UB5A 3LPWA 2YIAA 3ZDXF 5KZCD 1LO3H 4DR2B 2ARJQ 1T6VN 1S7SB 5DDHB 1YMME 2K70A 4K15A 1NJIW 4L8CA 3MJWA 5IVXA 4ONOA 4MBOA 1ERNA 1XEQA 1TQSA 2VQ1B 3LKNB 5FLXN 4PD4J 2WO2B 5CJQL 1AS6A 3DV4B 2I9LB 4X1KA 4HK0B 5JVDB 3GLDA 3QIUB 4JDTH 4PUBL 3VFPB 1Y18A 3L8QA 3P2BA 1K33A 3B34A 2QSCH 4LLAA 4M61A 4UT6A 4MAUL 4UTBA 4ZD3H 4RIRB 2D8KA 1IXMA 2R4RH 3T0VA 1ED3A 3V5HB 2F8OA 2EE2A 2OTWA 3IB4A 4DGYH 5D1ZB 2IU3A 2K7PA 5TH2B 2OTUB 5LXTB 5EORH 5L7XL 2WXFA 3B9KC 4WFED 4MSWC 3ZZ1A 2WKLA 3Q05A 1E1QG 5HYIA 3QIUD 5EUKB 4GSXA 2QSQA 3S7GA 1ACYH 1DQKA 4PJDA 5FCUL 4OSUL 2QKIB 4WTZA 5FR3A 1ZKAA 1DQML 3MNDA 4AJWA 3BHPA 3Q5OA 3D39A 5KVEL 4M6OL 2LT9A 4AC4A 4K23L 5DK3A 3HS0B 3Q3GB 3HKEB 2NN4A 5TFSH 3D0AA 2F1EA 1QWHA 5FGRA 2CIKB 4OLZL 1SJHA 5EF0A 4J8QA 2XJKA 4FM0A 5D1ZD 1Z3GL 5T1DH 3ILEA 3PU7A 1VF5B 3BIBX 1AQ8A 4PWHA 5D1QE 2PABA 4YDZA 4MJ6A 2WOBA 2K0RA 4WFGD 4MVBD 4X5PA 3L13A 4LF4O 1C5DA 1XI1A 2WXLA 3KBHE 4ZFOL 2HMIC 3H4FA 1XNQB 2WGNB 5DCCA 1LWJA 2CHZA 1OB1A 4UAHA 2BS9A 3PWJB 3U2IA 3WEXA 2O61A 4Z0XB 5DHEA 4A37A 2GTSA 5LA6B 2Y48A 1KGYE 2AGAA 1VFBA 2GB2A 4JPWL 3SBQA 1HHKB 5CLTA 2QWQB 4ZOBA 2KSDA 5E2UH 4BA8A 4BSWB 3U0ZA 1NOFA 4JZJC 4X7TA 1BEYH 2XIBA 1JX9A 2QM7A 1KTLB 3N42F 1P84F 1B3IA 3TWCH 3EJZD 1S9WA 2Y7NA 5HJGA 1ADWA 2GJ6B 2A9MH 4Y5VA 4XCNB 3ZMEA 4NQSA 2DWSA 1P0SE 3FUMA 2B15A 5HVWA 5DS1A 2FUQA 4ZRGA 4A7TA 5IREA 1Z3RA 4FE9A 5JNYA 4PWFA 5EYPA 5DEGA 4LLYA 1S5IL 2GK0B 2KQXA 4MJIA 3T4AA 1BHGA 5EOTA 4XP4H 1BVLA 4JE0A 3ZRCC 2GJ6D 3UDWC 5KSBB 4M7ZB 2W88A 1S8DB 5HGHB 1R4XA 3ILQD 2ZD9A 4M3JA 4N2BA 4LCUA 4K0OA 4BK4A 3FQYA 4O2BA 1F0LA 1ZLSL 4ELMB 3ILDA 4KX7A 1CK0H 4OD3H 3RYFB 4OGYH 5IGXL 2JB5H 2DW4A 1WC7A 3SGEH 4GQ9L 1BAFL 1Q4NX 1QSEE 2R29A 1P4IH 4WY7H 4HOMA 5AOLA 1PKQE 3MRFB 2AXGA 1W72B 3K03A 2A06H 2BZCA 2OMWB 2BOCB 2D2CC 3DECA 3KR3H 1QLRA 4ZQKB 1I1CA 3BFOA 2PCFA 2Q10A 4R90H 2CNYA 4RGNB 4W4NA 2JJUA 4L8BA 1M6OB 3TWCL 1CG9A 1MNUL 1T04B 3LNDA 1BIHA 3NK4A 1T6BX 1CFVH 3U9PH 1CO1A 4X6BA 3HC3L 3VWJC 1GL4B 3QUMH 3W5NA 2H3XC 3L95B 3HIZA 4GG6B 1KECA 1A7NH 5L3DA 2KH2B 2AZUA 4J8RB 3ZUNC 3NPSC 1F2XK 1I7RA 2P24B 3O6MH 4KI5D 4XNBA 4DN4H 2EABA 1HILA 1OAZH 2R4SL 2WBWB 1B0WA 4J2XA 5AZ2H 3DVGB 4RGND 2IH3A 2V8MA 1L3WA 1QABA 4HSAC 3RPBA 3VXSA 3ULVH 3TT3H 1K4DA 1OW0C 2HX9A 1HW7A 3JVFC 3O3DB 1XHHA 4MJHA 4ZX6A 5E00B 2CTPA 1T7WA 5JORB 1I3GH 1C9SA 4G8GA 2X5PA 3HG0A 2EDLA 1DBKL 2DM4A 3ZYOA 4Q4IA 4UILH 4EDWL 4OD3L 4GEJA 1X5IA 2WXGA 4Z3GA 1ETZA 4EIZC 2Q87A 1JV5A 5D5MF 1FN4A 4LEOA 4Y19B 3L4XA 3QJRB 5DHVA 3PE9A 4Q20A 3JAWA 1XGPB 3WOVA 4CBZA 1NGQL 4WV1C 5JPNB 5L88H 4QNHB 4KKQA 4GAYA 1VQMV 4PJ5A 4R90L 2MH4A 4H8HA 1S9XB 4LOUC 4R96B 1CXKA 4NN6B 1VERA 1BF2A 1AXSB 2XQBH 4PCTA 3BVTA 2Y6TE 5H2BB 2FQFA 5E8DH 3K71B 1E90A 4WSJA 3MTRA 1T21B 4X20A 3IGAA 4JDVA 2HT4D 3D69A 1D6VL 3MX0B 4Y19D 1NAMH 4ODWA 3KLSA 2HZHA 5BZBA 3O6ML 3X1BA 3FC8A 1OTSC 5H35A 1DQVA 5C6PB 1N6UA 3KZ8A 1VZGA 4FLSA 4XC3L 3SEPA 3OAAG 3VNZA 2I60H 4RLDA 1HCYA 3CJJA 1YNKH 3VD2A 2AEWA 5CP7B 1WP7A 2C4FT 3NEOA 4QY8A 4PY8I 3BEVA 5MI0C 2BPBA 3L5JA 2CKBB 3LN5B 4JFZH 1X4ZA 3EJYC 3K91A 3NCBB 3X2QB 3P4LA 4YDJA 4B9GA 2QFRA 4B27A 4C58B 5C9KA 1RZ8B 1TQVA 3FFOA 4HIJA 1QQDB 1WQVT 1J1PH 2QPDB 5IR1B 2F53A 4AVHA 2G2PA 2UXGA 3A5VA 5JQGA 1OZTG 2IV9A 4TOYL 5I1CH 5I24A 4JPQA 2VAAB 1BA9A 4P9HL 1NI8A 4WUUE 5FLUA 3VDBA 3TVMD 3ZSSA 2P80D 5H94B 1INQA 3BN3B 5IVXB 3OKDB 2YMOA 5HYQA 3HNVH 5KS9A 1A5FH 1B0GA 1JA8A 1YYLL 1JRHH 4GIOA 3NR7A 3T2MA 5IMOA 1HVXA 1ZOXA 2AEIT 2DQ3A 3PAZA 2J8UA 1XCQA 3KPPA 1Y18B 4RDBA 4TNWF 2RNBA 4NRYB 1AGBA 2CJ3A 3U4BL 5LQBL 1X7TA 4X9GA 3IFPB 3Q8CA 1OAKH 2UY6B 5CFAA 5KANI 1GS6X 3L71H 4N0CD 4JFEB 4CBCA 2DF3A 4LCWB 4U0RC 4RMQA 5C0ND 3OKKA 1I8LA 3CCSV 3RX7A 1YNKL 1VACB 2F68X 3OL2A 5F9OL 2PYEA 3V5KB 5D6CB 1VAHA 4KKCC 2VDOH 1R3KA 5BUPA 3ZL1A 3CIAA 3U48A 1U9KA 5HHMD 4F8OA 4P49A 4PJDB 3REVB 1J9SA 3BVWA 2B9AA 3KCPA 3TTYA 4H8QA 4PSPA 1H8SA 3BPLC 3NJMA 1PNMA 4L3EA 4M7LH 2JIXB 3EXJA 3MBEA 4LL9A 5CKGA 2ZUXA 4U4IA 4PJFF 1J9TA 3STLA 4OUOA 5H37A 5EZYB 4JFED 3A6CH 2ZXBA 3RURA 3WJLA 1TYEB 1F3RB 1NPNA 3JV0A 2JKLA 3X3FH 3EHBB 2Y07H 5TGBB 4MJ6B 4G7RB 4OQTH 4ELKB 5D6DA 1N34B 1TJGH 3GEWB 4IHBA 5GS0H 2Z3YA 1I1AA 3FB5B 4FI8A 1Z9OA 4Z7VE 1R3LC 1ZCRA 3ARUA 1FRGL 4IMKC 5IB5A 2CLVB 4MDJA 2XSKA 1M3JA 1WD9A 1ZS8B 2JIXD 4JPSA 3RL2B 4Q97A 1JWUA 4Y5YC 2NY3B 1ICTA 4P5TA 4JFQB 1OAKL 3UO8B 3NK3A 4XDKA 1NDGA 5EU4B 2XN2A 3EHBD 4OY9A 1RZ7H 3DJRA 1ZA3A 1DN0B 2D31A 4WFHA 3ZMUA 2FGZA 4P9ML 4WTWA 1I1FA 4CADA 5ABDE 1S9WB 3CC7V 4UOW0 1DSFL 5BNXD 2A6DA 2BH0A 3AMLA 5AAPA 5F7NC 4X99A 1S7TA 3ZO9A 3L3OA 1BD2B 4Y5VB 2DQCH 4GUPA 2LGWA 4DR3O 4YIPA 3MRCA 4V33A 2HUHA 1HZHH 1N2RA 2RD0A 2NY3D 4WI9A 2XN9E 3BW9B 3D3VA 4PTTB 5IJKA 5B7MA 1IT9H 1IKNC 1SS3A 3CC2V 4Y4KA 1KUQA 1V54B 5GGVY 1QRNB 1BZQK 2AJZB 4MA8H 3A6CL 5DEGB 3CMAV 1X9RA 4NP4H 4OZHF 4Y4FC 4OUUB 4CN6A 1AZBA 3G5YB 4B7IA 5LXVA 5EOTB 2RACA 4KKLD 5I1KH 1N3NB 5EBLA 3H9YA 5C0EB 1AZZC 1BD2D 3QDAA 4JQIA 1GGTA 1EWHA 1MRFL 3WIIL 5CKAA 2WCSA 4O2BB 3TBBA 2YQGA 4QRRA 1VQ9V 2HN7A 4HWZA 3TBVA 5LNEA 4XCCH 4RWUA 4JYAO 1QRND 4X5LA 1JGDA 4X80L 4MJID 3BXNB 3UO1H 2B59B 5KMGA 2AXGB 4K0KO 1ZVSB 5SV3A 3MFFA 1KELH 5MHSE 1MI5A 1RV6X 5AWNH 1A9VA 4Y2DA 2AKRB 1J1OH 4G11A 4LPXA 4LP4A 5B1JA 1HI6A 3TXQA 2BS8A 5DZAA 1CG9B 1NOLA 2ED9A 4CU7A 3SGDI 5A2LH 1PG7L 2GIXA 4KUCF 4LKXA 1YUKB 4R97B 4BFOA 5KS9F 2ORBH 3QEQA 2HFFB 3T04D 3W39A 2LLNA 2VC2B 5FDYA 3NIGB 2JVUA 2FUTA 4UCSA 4AK1A 4Z7UB 3RVZA 3SY0A 2XZQH 5JPMA 3IDMB 4L4TE 1JOYA 1HILB 3NEEA 3R19A 5KSUB 1GGUA 4XP5H 2H2PD 2GPZA 5DS8B 2NUTA 4LFHG 4XX1G 4EZKA 2QTOA 2DD8H 2FT7A 4FP8L 6FABL 4GX1A 3VXSB 3D87B 4O2AA 5C6TL 1WAEA 4H25A 2FR4A 4CILA 3I6KA 2ESVB 5D2NB 2PXYB 3DWTA 5DURD 3FJTA 5DXWA 4G8GB 5IB3A 4MJ2A 2LFEA 4XPFL 4GKOA 5E7BA 4O58H 4QHUA 2VN3A 1XDCA 2IIJA 1CLVA 2GEQA 1M7XA 2YS8A 2BSTB 1ETZB 1HSBA 1AILA 1FN4B 4TM9A 3GMPB 2P8LA 4KWUA 5C0JA 4URKA 1FZOB 1YJNV 4ZUWB 4R84A 3VXSD 4XNYL 1KELL 4E4EA 1S5HA 2R9HC 3Q2NA 1A6ZB 4YHML 1XFPA 2ESVD 4N9OB 1RFDH 2PXYD 2KUTA 5L8JB 1JPEA 4UNIA 1AKJB 4R8CA 2ZUSA 5AB9A 3UQ8A 1HHHB 4G8GD 4L48A 4R8WH 4XZUA 3MJ9L 1MCDA 1UWEL 2LLGA 5DC4B 2CO4A 2CAZC 3OXSB 1BPVA 3EVKA 1GKEA 2Z8VC 3ARBA 4AIZA 4AXWB 1MW3A 1R17A 1LE5B 3IDGA 1Q9OB 4X20B 4JDVB 3VQYA 3HR5A 5KSVA 2CO6B 2YR3A 3E22A 3ABZA 3IT8D 2IANB 3MLYL 3ABMB 4ODWB 2XZQL 3REWB 1FI8C 2J5LC 1SA0A 4ODBD 4JO8A 3OJMB 4XP5L 2ZF9A 3LNFA 3MRDB 1JCHA 5I74B 4F3FB 4FTDA 2GTZB 4AK2A 4ZPTB 5FDWB 4M6NH 2QSTA 4J6RH 1KU9A 5DD3H 3FTSA 3UZQA 4TTGA 5HI5D 5HVHC 5C6WH 2WA3A 2AVGA 5D1XA 4ZUVB 2NY1B 2PI5A 2VXSH 2Y1ZA 5CBFA 1WA8A 1NAKH 4P57B 4P2RA 5IEKB 2QELA 3BEVB 4GOSA 2IAND 1M7DB 4JRXE 2OXGA 5E5UB 3QORB 2J6EH 4YDJB 5I16B 5F7AA 5I71B 2Z0BA 3TCUA 3BVNB 4M7LT 4S1DC 2E47A 3BT0A 1SLWA 5E5LA 1E27A 4X6CB 4QXGL 1TYJA 3ZU8A 2DW5A 3QQ4B 1LO5A 2WD0A 2P52A 3ZXAC 4H33A 4XVTH 4LASH 2Q73A 2IWGA 4FQIL 1A1MB 1RFDL 4FRWA 2OI9C 4ZFOA 1RULL 2HCZX 1CIDA 3VFUB 3CZUB 4H26B 4L4VE 4PJAE 4Q6IA 5IK3A 2EVFA 5FKAA 1GCFA 3DBSA 2NY0D 5TE7H 5I6PA 4UVCA 4DR2O 1WHOA 4OD2A 3VYPA 2E9BA 3QORD 1N0LA 2WIIA 2EVGA 4KXZI 3UPRA 3KW7A 1QFUH 4MMZC 2J8UB 1HK6A 1RU9H 1XCQB 4ESKA 3U9UA 1GGBL 1AGBB 1W59A 4NUJA 1XB6A 2H4EA 3PPEA 4O2FB 3W38A 6TAAA 3UTTA 3N1QC 2NYZA 2IC2A 3GJEA 2NZIA 1EDQA 4J6RL 1RAMA 1BQ5A 2DJMA 2OL3H 3L3JB 1NICA 1FKAO 4JZ2A 2XTAA 1AZVA 2P06A 2BVTA 3L7EB 1G84A 3KEDA 3QR2A 1RZJH 4KUCD 2HKHL 2HT2C 2C1OB 3U25A 4K8RC 2NYYC 2ZCLH 4IKNA 4POYA 5I1DB 5T1JA 2XG5A 4TVPE 4N2NA 1E4KA 2X89A 4KHTH 1Z5HA 3UTZB 2W59A 5L2JB 1G7QA 4XP1H 5FO9A 1XGRA 2CDYA 2QJDA 4UT7H 4ECNA 5J12C 4DPBX 3SDDA 3SBPA 3UP1A 5EZJA 5LGUA 1H2NA 4L3EB 5J1AB 3OZLA 3OMIB 3STLB 1PKXA 5ITBL 4K71C 2W91A 2F8VA 3AXLB 3KPOA 3Q2VA 4OZFG 4XVTL 2DQFA 3HW7A 4BHUI 3SPCA 3ZTJH 4TUUA 2A0LC 3RPIA 2DQTL 4N1CA 2PYED 4LDLB 3UACA 1SXZA 3L3DB 3P4NB 2WBXA 3SPHA 1I1AB 5FYJU 3UFIA 4YC2B 1JHKL 3FT2B 4DGVH 1PSKL 2LTQB 3DJSA 4WHDA 3TTSA 3N2GB 1HS6A 2G75B 4OB5H 4W9KC 2V37A 1MXGA 2V2TA 4G6AC 3HJ0A 4L3ED 3C9NB 1BLNA 5F7DA 4PV9A 2EH7H 3V9CA 4PLOB 3GSOA 4KQ4L 4MXWH 5KBDA 1JWUB 4M1CD 1ZLWH 3BUBA 1W0YT 4ZX3A 1MQKH 3R65A 4U31A 3QJFA 4FN0A 4ZOAA 4YXKH 3H1HH 1RHFA 1NDGB 4HIHB 4J3XA 4BINA 2YC0A 5D8JH 5T3XD 2PUQT 2QADC 4HMEA 2D31B 2L6LA 2P26A 4CU8A 2LQRA 3WY3A 1CC3A 1I1AD 3ZE2F 5HGDA 2WLIA 1VFAA 2LABA 3V95A 4A7QA 2X70A 1TTCA 3PIQA 5F1SA 2AJSL 2ZUWA 2A6DB 4GKSA 4QXUH 4UOW1 5C8YB 1S7TB 3H7BA 3L3OB 3QUYB 2BSRA 1DLFH 4ZDHA 3FONA 2EJRA 2CCWA 2IWKA 1FNLA 3KZIZ 2JKRM 4Z8FL 3ZX1A 4QRPE 2WXQA 4ZX4A 1JGUL 2QQLL 2Q0AA 2XUMA 4GLXA 3BDXA 3S8WA 2R2EB 1NJ9B 5IB1A 2JRIA 3PWLA 5H4YA 4EKXA 5KN5A 3DTXB 3KMDA 1KYDA 2X4RA 2FH8A 4GW5A 1IBZA 4NKDA 1NMCB 4WFHD 5SX5H 1E4WL 5KAQF 4UIKH 1RK1A 5F0PB 4CGTA 4YAQB 3FTXA 3O41A 3OW2U 2CQVA 2K9FB 4ONHA 1CE6A 3DVNB 2OMVA 4Y1AB 4TV3A 3HN3A 3VDCA 4XNAA 3R1GL 1D9KA 4X88A 4BXSV 2DJVA 2Z93B 4DP4X 1AOHA 3DYOA 4QRRB 1NL0H 2BFVL 3TBVB 3T8VA 4Y4KD 1Q0YH 2R0LL 3DX9A 4WK0B 3BPOC 5B1NA 4NZUL 3G04A 1K72A 1O6VA 1T4WA 4WW2A 1H5BA 1I4FB 3FD9A 1NTZH 3OR6C 2IWEA 2XV2A 3U79A 4IGBA 3WFZA 3MFFB 3RZCC 5HTSA 3KVQA 4DIXA 3HE7C 2X2IA 4Y1AD 2JJSC 3VGAC 3D07A 3ZHUA 3C8KA 1LE9A 3D3IA 2HLFD 4EI5B 4NUQA 4ZOCA 3ML0A 5HD8C 1J8HE 4I4WA 1CVSC 5CIPH 5DLLA 5FO7A 4QTFA 3HHRB 2CA3A 4QRRD 2DY2A 3MRQB 3QEQB 5IW6A 2VISB 5JIPA 4IBWA 3RTQA 4ZJ9A 5IWLA 3EFFA 2BIPA 1JG9A 2VWKA 1CZ8H 5C8JA 4X7DC 4YO0A 3BKYL 3U1SH 5I0XA 1MI5D 4JI2B 1EBAA 3MRRA 3HLKA 3E3QC 4Y2DD 4OBSA 1LVEA 3ZVVA 2H32A 2N7AA 25C8H 4KJQD 4XHJC 1CFQB 4JI4B 3ETEA 1S3KH 3FU7A 4K94H 2FR4B 1YEHL 3T3MF 1BFVL 4L18A 3HC2A 3VXRB 5I6NA 2ZQKA 3QEQD 1A2YA 1HHJA 4NXNB 2HFEC 3C5ZA 3FMGL 5IB3B 2XQ0A 1KBPA 1VSCA 1M71A 1IAIH 3CZFA 5G4OA 4N2IA 1U8CA 4ADIA 5C1MB 3ZCCA 3ZMSA 2GHZA 1AD0B 3TF4A 4IBVA 4JG9A 1EFQA 3EDJA 2YEQA 1UT9A 1YNTF 5GONA 2GKIA 3BH8A 2UVFA 3RVVD 1IC1A 2YUWA 3W57A 1HSBB 1CP9A 2AEQH 2AP2A 2MNUA 3JVGC 2GCYA 3T4ZA 2Y1YA 3ZS8C 3ATAA 3BGAA 5C0JB 2PLTA 4H8VA 1PZAA 5E4IA 1S5HB 4X89A 3BKML 4N0YH 4XZ4A 4E41B 5EU6B 1PX4A 2FL5A 1VF6A 2EDXA 2UXDB 5CUSH 3RWEA 1ENVA 2K6ZA 4OJDH 1H0DB 3RB5A 2F7RA 1DR9A 4JFFB 3ARBB 4WIQA 4AIZB 4G42A 5FPIA 5J6GA 3CCJV 4MJ5B 4E9YA 4W9ZA 5L3CA 4KDVA 1DJHA 3GMRB 1BGXL 4FMVA 1FXKC 2KC0A 2PYFA 5EC2C 2ZCHH 2P67A 1SA0B 1TNMA 1P5UB 3FB6A 4PBVC 3DMMB 3CC5A 3U1SL 1DJGA 2H1PL 3N85L 1KF9B 1EAQA 4FYQA 4E41D 2ZG2A 5EU6D 4M6ML 4EDXB 1ZGLA 1ASPA 1SY6L 3TF7C 4IDLA 1AGFB 1NBQA 2KKQA 3EH5B 1IRAY 3H55A 3ZN0A 1CXHA 1OPOA 1TG8A 3IJYA 3MUUA 5CEYA 3UZQB 4JFFD 3ARBD 2B1HL 3BN9C 2EDRA 1WA8B 1BX2B 1WB7A 1Y4MA 2OXGB 3HG1A 3JZYA 3STZA 4I0CC 1BREA 1COBA 2R15A 2UZXA 3P30L 4J5VA 3CXCU 3EZ8A 2QTSA 2VO5A 4JRFA 3RU8H 2D3NA 3CD6V 2P3YA 3WY1A 3GXPA 4H88H 3CSYB 2AQSA 1LO5B 3KLLA 1SMAA 4FLXA 2PR4H 4BR6A 3ZRSA 4JFTA 2YD2A 3ARTA 4KKRA 4U1LA 5BO1L 4YNYB 5IK3B 2WKOA 3RDJA 3ETBJ 4MD5A 2ILLA 4P2RD 3C87A 3PWUB 4R5TA 5AKTA 2OK0L 2RJMA 3E3QE 1N0LB 3JCZA 2H2SC 3Q1SL 4HS6A 5AZEL 3FT4A 5CJBA 3IFNH 4UT9L 1Q82W 3NA4A 3SE9L 4S2SB 1OV9A 5IW1B 3HBGA 1U8PA 3AU1B 3B3IA 3NQIA 1CT8A 3ECBB 2WWWA 4HKBB 5LB1A 3UTTB 4WW2F 4W9CC 2VAJA 1T0NB 1WIUA 5I1JH 4DT2A 1EBOA 3GJEB 4YGVA 1J95A 1GJIA 3WFCL 1IQWL 3AREC 1QLEH 5EFIB 2ZXWB 4W9EC 1CCZA 4R2GB 4AENA 2VR6A 4D0CB 1ROCA 2X1OA 2Y2WA 1ND0B 2ZKXA 3CDGA 4BIKA 2NQCA 1N0NA 1SBSH 2HWZH 5FO9B 1VP7A 2NPLX 4QHNA 1VENA 4PI0A 1PNKA 3QR0A 5CBEA 3ATBA 2VERN 4FERA 3SDDB 1FO0H 4LC1A 2A4EA 5EZJB 3UTTD 5EZLB 4QHMA 4WKXA 1NGXB 3NFNB 3I3EA 4J80A 3ZEDA 4HGWA 2QV2A 2X4OA 4NO5A 5EEWA 1M4KA 3BFQG 2E6QA 4X4ZA 5DJAA 4OVUA 4ZT1A 5CZRA 3TPUA 5E2TH 5L2KB 3KWVA 4U6VL 1OAQH 4R2GD 4LNRA 4APQC 3NEXA 5GGRA 3QUZC 4JJ5A 4L8JA 1A9EA 3KNBB 4F5CE 2X89D 2HA1A 3U4AA 4MVOA 1SDYA 1JZIA 3RWIB 3TFKC 4LFBB 1R46A 1U3NA 5JZ7C 2HPTA 1N34O 2ZZUT 35C8H 3GSVA 4NDMA 1BZKA 2F0CA 3SDDD 3VM5A 5C2UB 1K6QH 2YLHA 5F7DB 5GRUH 5JH7A 3TBYA 4B5ZA 1HEHC 2FK9A 1ZLZA 4J2QA 5B4MD 3KCYA 4J7JA 2GJRA 4MFHA 5E51A 1IX9A 5CGBA 1F6AA 1QPPA 2Z92A 3NJLA 2R72A 1A14L 4FQHB 4RGOH 3TA3A 3QDGA 1EZJA 1WB8A 2FH6A 1KN4L 3FRUA 2XWEA 2PF4E 2O30A 3F58L 3UG5A 1KB5L 5JTWA 1Z1WA 5AYQA 1JJUA 2R59A 4IRSB 5KAIZ 1VFAB 2X70B 1Q1PA 3B7RL 3EJCA 1DTUA 4GINA 4ZI8A 3HG2A 4GKSB 4HHGA 4JFVA 4PGEB 5TDNB 4CH5A 1SDDA 1MREL 4DESA 1DUZA 3OAUH 4X4YA 2K4AA 4M43L 2QEJA 1KJ3H 2WMPA 1XBDA 2ZOWA 4JRLA 4R50A 2BP5M 4ANKA 1YIJV 4I4TB 3FOLA 1P7QB 4HUVB 2F5AH 5I5JA 2ZXEB 2P46B 5IB1B 2IBZY 3M1BA 5C09E 5KN5B 4N2AA 1G7MA 2VKWA 5D7KD 2IEPA 2V17L 2WBKA 2BP3A 1JS4A 5E4EB 5MERA 1RK1B 2DTSA 1I8IB 3F3HA 2GITA 4IRSD 2PO6A 2DN9A 4XN5A 4NPYA 1CDHA 3ETDA 2VRKA 4YBQC 3WFHA 4JFPB 2YD5A 4PG9A 4K3AA 4FA8A 4ZPVB 4CDHA 4OCXH 2WWKT 2XAHA 5D70L 2PCPB 2YS4A 12E8H 2DPKA 1KACB 5ID1B 2PTUA 2X1PA 3N44B 5GRUL 3IMUA 1H3PH 1WK0A 2EDFA 4RISL 5KLVH 1QD0A 3GLAA 4FXKA 5D1QA 5CA0A 5F1NA 3NFSL 2BCKB 3MJ9A 1H5BB 5KVMC 1CPUA 1HQRA 4MB1A 5DD5L 3TT1H 3UYPA 1CU4H 5B3SC 4YFLF 3CFEB 3WGUB 4NJ9L 1EFXB 1OT4A 4AYDC 4L1BA 3P3UA 4KTDH 4X9FA 1Q7YW 1D9KD 1NKRA 4I4WB 2GUOA 2R69H 1HNZB 3CK0L 3L2NA 5FO7B 4IYKA 3FCTB 4KRPC 2CTRA 3MYZA 4RWHA 5IESH 5DR5L 1CGSL 5DQ9A 3TGUH 2VMDA 4ZW3A 4ACTA 2ICEA 3D4CA 4AVKA 2WQSA 1XF5A 4R7CA 4U6YA 2XAFA 5C8JB 3EOBA 4OIAA 5EBMB 5FPRA 3I3DA 3QXVA 4IGBD 3MRJA 1J7VR 1V3KA 3AK2A 3QP3A 4M93C 4QHLA 3TBWB