3AG1B

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 280 k
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag1B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag1B02
4HHWA 1PF3A 3H4HA 3ZBMA 4EF3A 3V9CA 1BEXA 1RZPA 2A3TA 1ADWA 3FU8A 3QJRB 1J9SA 4DP2X 1TKWA 2IWEA 1KYAA 2Y1AA 4GP5B 3MX0B 2BW4A 3T6VA 3UAEA 1BAWA 3IBOA 1ZV2A 2HRGA 3NSFA 1QLEB 3WKQA 6PAZA 1E65A 1OF0A 1GY1A 3T6ZA 4DPBX 1SNRA 4YVUA 4YVNA 1QHQA 3ASNB 2IDFA 5FC9A 2TSBA 3S3CB 3FU7A 3PCYA 2CAKA 2I7OA 3ABGA 1GYCA 2PCFA 3PXLA 2YXWA 1IC0A 3FS9A 4PAZA 2CALA 3FPXA 3T6WA 4DP0X 3S3DB 3UADA 1ILSA 3X1EA 5B1JC 4DP8X 1MG3C 1SFDA 1NZRA 2UXVA 3QJUB 5AFAA 2CBPA 3GXUB 4A2EA 1XB6A 2BO0A 2YAOA 1PZAA 4A67A 1A8ZA 1PLAA 1AG0A 2LLNA 2PPAA 2BW5A 5AZUA 1J9TA 3CVCA 1MZZA 2QDVA 2IWFA 5I5MA 1L9QA 4BWTA 1J9QA 2IH9A 4KNSA 2FTAA 2EILB 3ZX1A 4KNTA 5TK4A 3FT0A 1GY2A 2XV0A 4E9XA 3FSZA 3ASOB 4FAAB 4ZK8A 5PCYA 1MDAA 4Q8BA 6PCYA 4KOCA 1AAJA 3CZUB 3NP3A 4E9YA 2PPFA 4RH4A 1KDIA 1A65A 3UABA 1JVOA 1IBZA 1R1CA 3AY2A 2XLLA 1FFTB 2AFNA 2JXMA 3PAVA 3AW5A 4PCYA 3FU7B 1SF5A 3OMNB 1AS8A 5I26A 1GS6X 2WSDA 2Y69B 2PCYA 2W88A 4G7RB 4HZ1A 2CCWA 4GYBA 1NIFA 1I53A 3NJJA 2BWDA 2VW4A 3DIVA 2RACA 4GY4A 1AZNA 1A4CA 3X2QB 1AS6A 3IE9A 1ZPUA 4YSCA 1AG6A 2FT6A 3AG1B 3ABMB 1BQ5A 1GS7A 4W1TA 3S8GB 1E5YA 2FQEA 2VMJA 1ET7A 1N70A 3N55A 4YSUA 3NSDA 1NIBA 2JFCA 3FU9A 1ID2A 1OV8A 3NSCA 4NB7A 1AOZA 2GBAA 2DY2A 5IY5B 1M57B 2BWIA 4YSSA 4F2FA 1FA4A 2YEVB 5A7EA 1V55B 2GSMB 2GI0A 1E67A 2QDWA 3WNJA 2PPDA 4YSRA 5D4JA 1RCYA 1AANA 4UAHA 1AZCA 1SDDB 2MTAA 1WS8A 3S3BB 4TXVB 1PZCA 1AZBA 1IBYA 4BDVA 1URIA 1SF3A 1JZFA 3D12B 4K9JA 1JERA 8PAZA 9PCYA 1SJMA 3QJVB 4BWWA 2IDTA 3SBRA 1RKRA 2B3IA 2MRYA 1ZIBA 1SDDA 2ZWNA 1N68A 1MG2C 1AS7A 2UX7A 4AKOA 3FPYA 1JZEA 1GW0A 2YQBA 1NIDA 1A4AA 2IDSA 1SHWA 3CG8A 4G70B 3S8FB 3MBWB 5B3SB 1FWXA 1WA2X 1DYZA 1W6WA 4GP8B 1NPNA 4Q89A 1ET8A 2H3XC 2UXFA 1IKOP 2FT8A 1QNIA 2BP8B 2BP8A 1X9RA 5ANHA 3QQXA 1BXUA 1VLXA 3TBBA 2OCCB 3U25A 4HALA 5F7BA 5I6KA 1B3IA 1JVLA 1L9RA 3GYRA 5E9NA 2PP8A 3NJHA 2OJ1A 2VSKB 2XU9A 4HIPA 4DP5X 2P80A 2VN3A 4BWUA 4KO9A 3IN2A 4F7KA 1BXVA 1EZLA 5I6PA 3TBCA 2UX6A 2CUAA 2XWZA 4AI7A 2TSAA 1OCOB 2XV3A 2FNWA 4GP4B 4KOBA 1KDJA 3OMIB 4HAKA 4A68A 2IH8A 3DTUB 1NWOA 4JKNA 7PAZA 3SQRA 3PAUA 3UACA 2I85A 3NJNA 2B08A 5B1AB 3QJQB 1J5DA 4G7SB 4L0PB 3WG7B 4P5RA 2UXTA 4MFHA 1PLBA 1JOIA 1NTDA 1AR1B 1NICA 1OE1A 1W8EA 2FQFA 2VW7A 1L9PA 4M4RB 4X4KA 2PP9A 3HEIB 2XX0A 3CDZA 2YAMA 2ZOOA 1PLCA 4BK5C 1ZDQA 4YSDA 1YLBB 3NP4A 3QJTB 3KW7A 5B1JA 1PMYA 3X1GA 3X1FA 4CSZA 1NPJA 2VW6A 3WKPA 3CVBA 1ASQA 1JZGA 3SBQA 1TEGA 2IDQA 3WNIA 3NJLA 3JT2A 1AACA 4KO5A 5B7FA 2GIMA 2EIJB 5AKRA 2HLEB 3NJFA 2EINB 5PAZA 1GSKA 1JZHA 2CJ3A 1A3ZA 1BXAA 4A2DA 2VM3A 1HFUA 3CVDA 3WIAA 4A2FA 2HX8A 1DZ0A 3FYEB 4F2EA 2AZAA 2EIMB 1GS8A 3JTBA 3AG3B 4KNUA 3NT0A 3NJMA 3RYMA 1J5CA 4YSPA 1OOWA 4YSQA 2Q5BA 4E9QA 1ZIAA 5D4IA 1PZBA 1NIEA 1ZDSA 1AQ8A 1JXFA 1CC3A 3FSVA 4UF7C 1OE2A 1PAZA 1V10A 3NYKA 3SBPA 2I7SA 3OD3A 3OM3B 4DP6X 1OE3A 1HAWA 2BHFA 2UXGA 5I6MA 3NJIA 1L9SA 3ZDWA 1JZIA 1XB3A 2IAAC 1M9WA 2XV2A 4JHVA 4QLWA 2X88A 5EHFA 3EH4B 2DWSA 1V54B 2P80D 1WS7A 2YAEA 4BXSV 2QPEB 2QPDB 3KW8A 1T5KA 1PNCA 2Q9OA 3EF4A 2FJSA 4WKXA 2GHZA 4JHUA 4QKTA 3TASA 4YSOA 1OCRB 3EH5B 2EIKB 2YXVA 4YSEA 4YSTA 1WAEA 1A4BA 3AZUA 3EH3B 2DWTA 2ZONA 5I6OA 1CUOA 3UGEA 2H5UA 3PPSA 1XB8A 2R7EA 3UAAA 2W8CA 2ZXWB 1JXGA 4FA7B 2XYBA 1BQRA 1L9OA 3C75A 3V9EA 5B7MA 3H4FA 4A2HA 4HCIA 3EHBB 4BDVB 4NAJA 1BQKA 3DKHA 4HCGA 2NRDA 4NERA 3WI9A 2WO2B 1CYXA 2GC7C 3FQ2A 2XUWA 3NSYA 4AZUA 4E9TA 4M3HA 5I5IA 1PCSA 4G71B 4A66A 1KV7A 3FSAA 5I6NA 2AZUA 1E5ZA 3QPKA 3NJKA 1E30A 3L45A 3T9WA 4E9WA 2J57A 3NJGA 5I28A 1RZQA 2WO3B 2PPCA 5B1KA 3X1BA 4E9SA 2J55A 1OCZB 4HCFA 2FWLB 4YL4A 1KBVA 2XXGA 7PCYA 1KCWA 2J56A 4E9VA 1WA0X 3ABKB 4GXFA 2YAFA 2YARA 4HHGA 4KO7A 5TK2A 3QJSB 2BP0A 1AIZA 2FQDA 2DYRB 3IEAA 2IDUA 1CYWA 2E86A 4AX3A 1JXDA 5F7AA 1PNDA 1M56B 2PPEA 1XMEB 3X1NA 1W6LA 2JKWA 1ASPA 1MZYA 2HXAA 1TEFA 1HAUA 4DPAX 3ERXA 3TA4D 4AKPA 2J5WA 1X9UA 2OV0A 4WTQA 3FYIB 2HX7A 3T6XA 3BVDB 2N0MA 4N8UA 2YAPA 1KCBA 2DYSB 4BXVA 1J9RA 4G7QB 1SHXA 3FQ1A 4E9RA 2FQGA 1TU2A 5I5JA 4CSPA 1WA1X 3AG2B 2XVBA 3FQYA 1IUZA 1GR7A 1UATA 3OQRA 1ASOA 3N2JA 4KO6A 3BQVA 2PP7A 1ILUA 3T71A 1NWPA 2H47C 3HB3B 2QT6A 3TU6A 2DV6A 4DPCX 1KGYE 2VSMB 3FSWA 2BP0B 5LDUA 1ET5A 2GC4C 1OCCB 4A2GA 1JZJA 3IN0A 4G72B 3CDZB 3ZIYA 3OMAB 2HZHA 4AKQA 1ETJA 2IWKA 2FT7A 4N4YB 2AANA 5D4HA 4YSAA 1BYPA 2XX1A 1NDTA 1NINA 2YAHA 1KBWA 4DP9X 5B7EA 3PLYA 2YAQA 4DP1X 2PLTA 2VM4A 4UANA 2HRHA 3G5WA 2BZ7A 2GB2A 5B1BB 4P5SA 1CURA 2BZCA 1SFHA 5I6LA 3GDCA 1NIAA 1L9TA 3H56A 1AZUA 4DP7X 1EHKB 2HX9A 1BYOA 1PY0A 3ABLB 4W9ZA 1AZRA 3PAZA 2X87A 4DP4X 1F56A 2R7EB 2XXFA 4ENZA 2AVFA 3AG4B
chains in the Genus database with same CATH superfamily
3JARB 2NY0B 1KELH 4U1HB 1HXYB 4ZDHB 4GKJO 4OKDA 3VFTB 1YVWA 2F8XC 4R4FL 3FU8A 3HUJE 2P7TB 3CP1A 3V4LA 4ZFOL 1O9GA 4BZ1A 3OTTA 3ECVA 1AOHA 3PQYD 2PO6D 5AD0B 1YQVL 1I3GH 4PGEB 1VQ4V 1AVAA 4DKFL 1K97A 2NW3A 3NCYP 3O6MH 5IV2B 4NRXA 2EKSB 1N0LA 2ODMA 3NSFA 3SCMC 1S46A 2WYIA 4I0PB 2P42B 1SOQA 2PNDA 3KM2A 4KMTH 3S8WA 2P06A 2SEBA 1DJIA 5BS0D 1F0LA 3S4SG 4N2IA 3D36C 1MCOH 3TT3H 3RWGA 4J2XA 4DVBA 4G1MA 3SKOA 3KDPB 3PCYA 1QYGL 2H8PA 1OPGH 1I8UA 2D03L 2PCFA 4PJ5D 4QNHB 4FFYA 1FFOA 1T89A 4ONFL 3M8OH 3K5LA 4WTZG 3HE6C 2NY6B 4P59L 3OF6A 4FQXB 4DP8X 2E9GA 4YLCA 2CE4A 3ILDA 2E56A 2IJHA 1G9EA 5D5MB 1F3JA 1ZSDA 5BZBA 2X4SB 4UINL 2RFXB 5CA0B 3AWEA 5DUPL 3IWVA 3CB2A 3GIVB 2QKAA 3C08L 5JO5B 3SYQA 5DHVH 2FLRT 3QW9A 4AJWA 5BUGA 5KJRH 1N34O 5KAFZ 3QXUA 1AGCA 2EQDA 4QRPB 3LRLA 4HOMA 5LMUB 3MUZ1 3ZE2B 4PV9A 5C0GA 3E83A 4MD0A 3G6DH 3AGVA 1S7TA 3PHOA 4QRQB 5DU7A 3T0EC 2YRPA 2Y25A 1G7QB 3K2IA 3HIZA 3MGOA 2ZKHL 3BHPA 2D0FA 5FUZH 3L74H 4HEPG 3N40F 5PCYA 3VFGL 2IBZH 3RYFA 3HMXL 3VFMA 3FCGA 1QX1A 3T2OA 3ISRA 3EXAA 3KPOA 4DV5B 2PPFA 1BVLB 4XBEH 1HZHL 4KY2A 3AQYA 3B9AA 3BZFA 3CPLB 4LLVB 1P6WA 4K5MA 3ZRSA 4QHKJ 1USQA 3Q9QA 4NDMB 2YPVA 3AW5A 3F01A 4LPVA 2HFTA 5JVDB 3JQOB 4JN2B 2PI5A 1AGBB 4F15C 4DO2A 3CRAA 1TQBB 2HKFH 3ULSA 1IILE 3VW3L 4E41E 4J8QA 4KXRA 2F74B 3OJ2C 3WGUB 3L9DA 1J0KA 2LLLA 5GJSH 1NOLA 5JQIB 5H2BA 3UZQA 4JFPA 2VW4A 2ZUXA 4L29B 4CBCA 3NFSL 1JNNH 3NVQA 1SVZA 2W59A 4Z1PA 4XNMA 5A7BA 5IK3A 1W0JG 2BVPB 4OT1L 3WNNA 2ICWJ 4LMQE 1A66A 4HD9A 2R9HD 4WUUB 4ZMNA 1U93B 2VMJA 3TPUB 5JHAA 2X2YA 1F42A 2WNXA 2VDNL 3ZYJA 1NEZB 3KPRE 3KR3L 4QRSB 1YSOA 4LFHD 1YEKL 3TGXA 2ENQA 4KQ3H 2YEVB 4PRPE 3ME0A 1T22B 3ROOB 2VUYA 5IR1A 1G6VK 3ARFD 4UI2A 4Z7WF 2EVIA 1FL5A 4U1MB 2X0LA 2ZSWB 3FRPG 4I55A 2X4UA 3OKKB 5D4JA 4LAQL 1QD0A 4ZMYA 2UUCO 3WJLA 4WW2F 4QRSA 1IGCH 1SQBH 4I77L 4OD1H 1HZLA 2V7QG 2ODHA 4UILH 4X6FA 3Q0HA 4L9LB 1JZFA 1NFDA 4KROD 4KAQH 1HNXB 4M9PA 5F7MC 3RY6C 1JZ4A 4MA1B 4JZJA 4GQZA 4CW1B 5HGBA 1AKJA 2RB8A 2YPLE 1EMTH 5LCVA 5TQ2L 3BFRA 9PCYA 3ULUF 5IVXB 2MRYA 4XOCA 5DMIH 3WMPA 3GLZA 5A2AA 3TO4C 5JW5B 1NM4A 1G0DA 2XG5A 4JAUA 5LL6Y 1ETA1 3MDJA 2IALB 2Y23A 4WHYG 2NTSP 5C0CE 7FABH 1OAUH 2H94A 2NTFB 4RSVA 5MP6H 2COQA 1I85C 1EJOH 4XX1E 4Y1SA 1NL0L 4AH2B 3P3SA 2ED7A 3EJYC 3QXTA 4MWFA 4I1PA 1MEXH 1WV7T 4F3FA 5AG2A 3APOA 1SPDA 5D8JL 4KHTH 2XBDA 4LLVA 2CDGA 2Q0OC 3DMMA 4PJHF 2C26A 2Q8BH 1XHHA 1XTMA 2P8MA 4JI2O 3D52A 5F1KC 3E89A 4W4OA 3WFDL 4WY7H 2O6EA 3OWEA 1IKOP 1H3WM 2FT8A 3ZMNA 3WU1A 1HSBB 2J5LB 4HYTB 2GK0B 4DGIL 3LMJH 5ANHA 3U4BH 1G7MA 4P2QE 2VJ8A 3IJYB 4L8BB 3U25A 3SQOL 2XWCA 4GUOA 4YNYA 1QFWH 3MRNB 4PY8J 4QY8B 4J3WA 2B2XL 4NOFA 5IB5B 1NAMB 1OQOA 1FDLH 1MNNA 1KG0A 1YEEL 1NMBH 3IN2A 1OTTD 3LS4L 4LCCA 4D9RD 1A1OB 3H42L 4AI7A 3TYGL 5J56B 3DXRA 4YAQB 1ZVSB 1MCQA 1OW0A 4ZFGL 3PRZA 4PJGB 4QHUA 3ARWA 2AK4D 4XX1G 3CX5K 2IH8A 4GLRH 4PJ5B 2EJ7A 1HL8A 4JMNA 4LFAB 3NJNA 5B1AB 1NCWH 3DVGB 3LUTB 3Q2VA 3AS3A 4KKNA 1NAKH 1T03L 5C0AA 4IJ3B 2F53E 4EKJA 1DF5A 5I1HL 1PLBA 3V8OA 3J80N 1KBGH 2PR4L 3HI5H 4NZTH 4X80H 2XQYG 3LZLA 2BOLA 4R4BB 4Y5YC 2YPLB 3RVXC 2M26A 3IKKA 1GKOA 2F8IA 2XHNA 3LTVA 4I3RH 4BK5C 5IJ9B 1IVSA 2OULB 2DL2A 2ZOLA 4M6MH 5D1ZI 4P9OA 2ZKWA 2RA1A 3SE9H 2VW6A 1G9ML 1YEFL 2CUIA 4J3BA 2CR0A 2DM4A 2K3TA 1K34A 1CXHA 1PKQB 3C9NB 2XN9B 4IU2A 3NJLA 1A6TB 1QZNA 3WFZA 3F7RA 5BCAA 1YUHA 3RNKA 3DUHA 4IHJA 4D0BB 4L4VD 2OW7A 4EO5A 6FABH 2E5LB 5HHXL 5AOLA 3P9MB 3D50A 1BQLL 2YXHA 1NMAL 5K9KB 2VLRD 5FYJU 1E4XH 1JZHA 4MJ4A 4JI3O 5JUEL 5BW7A 4HISA 3IXTA 2F18A 3WNKA 4TQPA 2WLKA 1DQMH 4A7UA 1YIJV 4XCCH 3H53A 5GHWH 3FYEB 3ZKND 1PEZA 2E8YA 5HYIA 5F7YC 4NNPL 3AG3B 4B9PA 3N9GH 1Z2KA 2D7TL 3ZT5A 5IMMA 3QO1B 1RZJC 1J8HD 4YSQA 3IPBA 2JDIG 3VTMA 5BOZG 5EBGA 4AT6A 1HC1A 5EDXA 4ECNA 5JWPA 1QSFE 1T1XB 1JWMA 1FP5A 1QO3A 4A39A 4N3UA 3BFQG 1Q72H 2I5YL 1TG8A 2LW7A 1M9WA 3HAEG 3QQDA 4P3DA 1I7ZA 5GGQH 3FQRB 3DSQA 5IEHA 3OUFA 1OAYH 2JQAA 3SO3C 3MR9B 3U0PB 3COOA 5KYWB 4M5TA 4OTXH 5GZOC 1R3HB 4DIXA 4WRLA 3TETA 1CYGA 3GMLB 3TCLA 4WEBL 4W6WB 4AQ8A 3EF4A 4CJ0A 1OAQL 1O7SA 1QLRA 5LO7A 1OCRB 4R84A 3NACH 2BS8A 5LG6A 3ARPA 3L3GA 5D71H 1AD0B 4YSEA 3RP1A 3VWJA 4PA9A 2GBOA 4FQQA 1XQ8A 4I5BA 3VQMA 1D7CA 1G7JB 4JFTA 2B77A 3K72A 2LTQC 2VXQA 3ASWA 5K59E 5D2LB 4CAGA 3DJRA 4Y9EA 3TWCH 3OXSA 5DUPH 2VC2B 3VRJA 2XYBA 4KKRA 4QAMB 1BQRA 2W0FB 3EO9L 5DYOA 3SO5A 5C09B 1MKFA 4IIQB 1NMBL 2IGFL 3UOAB 2DZEA 4GG6F 3EHBB 2R2HB 3PYCA 1UH2A 4CS3A 2P8LA 3M17A 1N5YL 3IJ7A 3GEWB 3THMH 3F6IA 2X1XR 2OTUB 3UTPD 1KF9B 4NN6B 2JKLA 2D0HA 1ADQL 1UB5A 3DOHA 4IKNA 5F97E 4HS8H 3EYFB 4AGQA 5LNDA 3GWOA 4M7KH 3ARGA 4MVZA 4E9WA 4B3VA 1D9KB 3O11A 4WW1B 4P2AA 3RI5K 1L7IH 5CLWA 2QEXV 2Q68A 5J13B 1P5VB 4PJFB 1SZTA 1MNGA 2Y7QA 3G04B 4YL4A 4GG8B 5C0CD 1S77D 2N7BA 4HGWB 3RU8H 3QUZC 1LUWA 4MCMA 4NGHL 3KBFA 2H3OA 2UZIH 3O6FA 4AK1A 4BFKA 3HNVL 3UCRA 1NFIA 4ANXA 1VIBA 2YK1L 1OB1B 5E0FA 4JI8B 1Q3EA 3BDBA 3CBRA 1S7RA 4QXTA 3WDIA 2C9SA 3CZLA 2LFEA 1N7MH 1S0VA 3OX8B 5BQDA 1MFDL 1S5JA 1DFBL 3PGDB 5C70A 5JHDD 3ULVD 1KEML 3KLAA 3L8QA 1OD9A 5MENB 3GM0A 5DUML 4MA3A 3IGUA 5IK3B 3LN9A 3RY6A 5CGYC 3F00A 3FYIB 3E8HA 2P1YA 1AR2A 2DQ3A 3MCKA 2P5EB 3BVDB 5A6MA 1C16B 1DEEA 5AWNH 4F57L 1KQSU 1M42A 4D9QE 3N5AA 1MIML 2OA9A 3HVNA 4G7QB 2IH3C 3EO9H 2YA2A 4LIQE 1Z66A 2FEJA 3ARVA 3HR6A 5JOPE 4E9RA 3I6SA 2MFNA 3KYOA 4L1BA 2AJXL 4F80A 12E8L 4DV4B 1KJMA 1WA1X 1MCWM 1WP6A 3UTQA 3NIGF 2PMZA 5IR1B 5DRNA 1CI5A 5E24E 1IGTA 3BQVA 1ZE3H 2J1YA 4YHIB 3GMQB 3N2KB 4JL1A 3M1BA 2DQDL 4HAGA 3MLWL 4EEQA 4EUPG 1WCBB 1T2QL 3A5VA 4XCFH 5I8KL 3FB6A 3I75B 1DBML 3LNGA 5D70L 4QRRB 1G6RH 2X0UA 2BP0B 2Z8SA 4FM0A 2QQLH 1X7QB 3P4OA 3D0VA 4OV5B 1JHLH 1OCCB 1NUNB 1RIUL 2EYTB 2R0ZL 2WWMD 4FFBB 1XV8A 2WKLA 2F7PA 2ZUQB 1OCZC 3IN0A 5D7IE 4E5XB 3HG0A 4U6VL 1A7NH 4H33A 2JH2A 3U6RB 5EOCH 5AALA 3DX7A 4Z7QE 5IB2A 1QLEL 4J3TA 4OF5A 5D9SA 1EZVH 2VISB 3QBTB 5C0GB 1KFAL 43C9A 4DZ8A 1S8DA 5BUAA 1UWXH 1SY6A 4JPSA 5DC4B 1HWWA 5IW1B 3OGCC 1MFAH 2NZ1A 2WNGA 2Z0BA 2CHZA 3T65A 4GIOA 4TSCL 4YFLI 2KDGA 1GZHA 4YDLC 1L0LH 5DHXB 3O4OC 4P5SA 5DJXB 1IEHA 4LCWD 4KHPO 3VI4E 4EUPH 1CURA 2DMGA 2BZCA 2DMHA 4Z7UB 2CO6A 1T5WB 2EDTA 3KPQA 3F58L 3ZHVA 4XNUH 3MHSC 4WDIA 5B66Z 4B3RB 1S7RB 2X0VA 1CFMA 4AL8C 4WI3A 3TCUA 4LWSB 5HYQA 4PJHE 1JHLL 3ZE0E 5CEZL 1GGBH 2NT0A 3V9CA 1BAFH 2FYVA 2XWTB 4AJVA 2QGDA 2CJTA 2A3TA 2W07B 1P53A 4DR2O 5FA4B 1VHPA 4DP2X 5K9OB 3MNVB 5F7LB 5IGXH 4YXWG 4JFUA 3ZYZA 5JO5A 1BREA 5IVZB 1ZV2A 2PF6A 1FZJB 2C2AA 1I1AA 5GJTL 3TH2T 1VPOH 2R1WB 2CGRL 4MQXD 1A3RL 5TE7H 4NO3A 3UG5A 1AR5A 4OUUB 5DJDB 2QHRH 2A7WA 3L70H 2Z93A 2B3RA 4G6JL 5KVEH 1EIBA 2TSBA 4AC4A 3QQ3A 3FU7A 1IC7H 3POCA 2CAKA 4PRNB 4KGLA 4TSAL 4ELME 2EIDA 4OPAA 4ZO9A 4DGYL 1IBKO 1IC0A 5JW5A 4KZEL 3WD5L 4YHHB 3KJ4C 3E3QC 2YUAA 5IT2L 4FIPC 5L2KB 1BMWA 1YYLH 4HOZA 2BOBB 1G4RA 2ZX8A 3S3DB 4WWKB 3GSUB 3S3SA 1AR1D 1MH5A 1NZRA 1OVZA 2ORBH 2XY2A 3BAWA 3MROB 2RTTA 4MMXC 2DM7A 3W39B 4A2EA 4BE6A 3EW3B 2IG2L 3KD4A 5JPNC 2ITCC 3DURB 4ETQA 3DGGB 5AD0A 1U8IA 1PFOA 2E7CA 5FXCH 3NIFE 4DESA 1JF6A 3RI5F 1UKTA 4I55B 3FDWA 3QCUL 2PPAA 5EV7A 3DI3B 1P7HL 2FH8A 2X38A 3D08A 4O9HL 4M7JL 4H13C 3JALA 3BSGA 1SN5A 5TE6H 3C5JB 2VS0A 5F8RC 5BXZA 4LLQA 1KCSH 1AQDA 3S35L 3JTSA 1CDYA 1B0GA 4PJIF 5TK4A 2R1YA 5IEKB 2GUZB 1QTSA 3AGWA 5CZVL 4J23A 5JJNB 1BDYA 2B5IB 4BHUI 3S35H 1AAJA 5DS8B 1YNKH 3K5OA 5DVLA 3CVIL 5GS1C 2PWEA 1K33A 2M1KA 2ZSVA 1ZEAH 1NCTA 4N2AA 5J6GB 3NK3A 1R1CA 4LGSB 2Z91B 3TZVC 4AQAA 4V33A 3IDUA 5D7SL 3HBPA 4YJZL 3EOTH 1HYSD 4U1IB 5LN4A 4P5KA 3A4DA 3VTTA 5FPIA 2IG2H 3L4CA 1IGIH 1GHFL 4HFUL 3QIBD 2DN7A 4DWHA 1RLWA 1KLUA 4HNAB 2W88A 4K71C 2AKRA 1JNLL 4MHHI 5HDRA 5ABDE 4PJ9A 2BNRB 1RPKA 4KKBC 4TOYL 2HFFA 3OKLB 4WLCA 5T1KB 4OCSH 5E2VL 1IX2A 1OAJA 3IFNL 2DQFA 2I27N 1K8AW 2V3EA 3ABMB 2UY7A 3H6AA 2HEPA 1FN4B 2CBOA 1T6BX 2AZ2A 1JF1A 1I8KA 3INOA 2X4UB 3OKKA 4KPHL 3ULVE 1S76D 1HILB 3PQYA 4AOFA 3B43A 2V5SA 1MNUL 1VERA 3RJDA 3PG2A 2PN5A 1D6VL 2O61B 3SODB 3RWHA 4PJEA 4FQ2H 4YQXH 4Z76A 1CVSC 1RK7A 3QIBC 1VEOA 4HFWA 1QQCA 3FQTB 1YJNV 4YXLL 4AEFA 2RMKB 4LEBA 4J2QA 4XNUL 5DA0B 4QRRD 2V2XA 4KDTC 5JW4R 1RCYA 4R4BA 4I0PC 5L3EA 5EEUA 1ZPLA 2A9ML 1L0XA 5CFAA 5CEZH 3QORC 1NLDH 1O6TA 1URIA 5FWQA 3UZQB 1JGEA 2X6CA 2BFGA 1U8PB 3LH2H 4I18A 4J8RB 1GYVA 5JOFA 2DQ0A 1Q9WB 1HIML 3JWNC 4PDMA 4TQIA 2YOCA 4MB4A 5EDSA 4FF9A 1N68A 4FCAA 1E4WL 5HHPB 4RIRA 4LVEA 3QDJA 5AW0B 5IQOA 2UX7A 1KN2L 3RHWK 5AOKA 2J43A 3M07A 1YAZA 1DVFC 1RIUH 2R0ZH 5B3SC 2P28B 4WHTB 2P43B 2XSKA 5JR1L 1SEBB 4B6ZA 2H1LM 4XMVA 4PJEB 4X9QA 1CFBA 3S3XA 4TOIA 1I8MA 3MBWB 4ENEC 3D09A 4DV2O 2D9CA 3L17A 1DYZA 1QLEH 4XB8A 5IV2A 1OGAE 4L8SC 2OPCA 3MACL 1MREL 5JMRA 4OGZA 2QKIC 3K4AA 2ZYHA 4LL1A 3RGBA 3NA9L 3SY6A 3MGTB 3TM6A 3CH1B 1HEHC 5BVJB 4B9IA 2ZYIA 4UOW0 3ECBB 3MFGB 4BH8A 2HTKD 3DX4A 4LSQH 5D7JA 1E6OH 4HWEH 4HALA 3OKLA 2O30A 1TSHA 4LZKA 4X62B 2ADPA 2WLJA 2HLFC 2UZXB 1NCOA 2YPVH 2ZXAA 3MJ7A 4RNRB 5INDA 1A9VA 4P9HL 4W6YB 1HU8A 4OV6F 4X0KB 1DK1A 2A5UA 3QZOA 2Y69C 2YDEA 1E2VA 3P30H 1OLZA 4GAYB 4HV8B 4U2YA 3B2UC 2NTFA 4R8WH 3OTOB 4G9FA 1SHMA 3KL5A 4X4ZA 2AJXH 1BOGB 2X3CA 4X2UA 5HD8D 3EAKA 1NWOA 4KKLC 4XWGH 1E8WA 3I9AA 2HLAB 3L5IA 1VACB 2G9KA 3PAUA 4B60A 4JK0D 4RDQF 2QHLA 4PJ9B 4N85A 1G9NH 3R8BB 1SEQL 3R4DA 4QRBA 3WY1A 5DK2B 3NCJL 2ATPB 4PJIE 1KACB 3U36A 1D5RA 1TQWA 5IFJA 1CGVA 4PA4A 3W9DB 4FPPA 1KEMH 2PP9A 3B2MA 3VXTB 5FF6A 5ID1B 1AI4A 3QQ3B 5IYDO 3D85D 4UVAA 1PMYA 1FXHA 3L13A 4GG8A 4JO4L 4JFWA 3RAJL 5BVPL 2GJRA 4HH8A 3TJEL 2IW5A 2GUOB 2W60B 1BPLB 3ZS8C 3KPSA 3OKYA 1VQ9V 4GI9A 4J3VA 4NI6A 2ADIB 3QZMA 4WBNA 4GO9A 4HQQL 5I1EL 2HUEA 4FADA 4X7SH 3W7TA 1DBBL 2NY4B 3JASA 1KLFA 2V8MA 3NCYS 4F20A 1OTTC 2PO6C 2KZBA 5I66B 2AEWA 1BWMA 4JTAB 3UTZB 4ADIA 3CCLV 1C5DA 3MBXH 3MO1A 3O45A 4KX8A 5JW4N 4LLUB 1XH1A 4PGDA 1IGFL 5LYJB 4JRXD 5D1QB 4Q2ZA 1BXAA 1VACA 1OP3H 1XWVA 3NA4A 1M90W 1ZS2A 3ZRVA 3C87A 4R8WL 4RMVA 5D7LA 2OTWA 1RUPH 3QWOB 3JWDL 4YK4C 3VI3B 3VQWA 4XN7A 5ICYB 4YO0B 4B9FA 4NEHB 3UIZA 5J1AB 2XZQH 3FMGH 4P2OA 4IRSB 4TV9B 4UUJB 1I1YA 2HJLB 3DXAD 1MVUA 5TFSL 1ZIAA 3P0YL 3V0HA 3STLB 2UWEA 4HPOH 3CLEH 5AB2A 1GC1C 1GAFH 4ZAKD 4OM0L 2H1XA 1M56C 4LFBO 1WE5A 4J3OH 3IFPB 3IMTA 5E9DA 1S8DB 5LNEA 3VFMB 1T66C 3GKWL 1HI6B 1OTUC 4GLXA 2X4OB 5K1XA 2Y0IA 4B7EA 3EO0A 3MLZH 1IGJB 2OMVB 5H4ZA 4R3SA 1EZVX 2VXTH 2XT1B 3MGOB 4KUZH 5KSUA 3GSOA 5JDSB 3BP6A 2DWSA 2PCPB 4YOKA 3H2WA 1OLLA 2R1XA 5FO7B 1JRHH 5C8JA 1YYMH 4L5FL 5CNHA 3HE7A 5L4MA 1T5WA 2QV4A 1PY4A 3ETQA 4JI0O 5KHHA 3HR0A 2CO7A 3CFDA 3QHZH 5K9OA 1TVBA 3IKCB 1WA8B 4ILDA 4TUYB 3AK2A 2YC1B 2JS3A 3V4VL 5IHUL 1WCBA 4PGBA 5GSVB 4HYOA 1DLFH 4PJXF 1AI1H 1BQHG 4K2UH 5IMMB 4G7VH 4H0IA 4WI6A 4EVNA 3L54A 4QOKE 4V1DD 5GISH 4HUVA 2VDOB 1JUFA 1BQLH 3VFUA 3K04A 3RN4A 3WHE0 3VA2C 2APBA 1Q0YH 1AKPA 1H8HG 2YXLA 1RP8A 2E76B 1UH4A 3ULVL 3U6RA 2AEPH 4QRRE 4BDVB 1TF4A 1FZJA 4MAYB 3VYPA 5FW7A 1AGDA 2ZWKA 4DO6A 3UO3A 3LN4A 3ULUC 3N44F 2NRDA 3E8GA 3GTTA 4NO0A 4PV8B 4CVWA 4K7PL 2DIEA 4WO4B 1BHAA 1QACA 3B7YA 3C5ZA 4JI6O 4Y2OB 2GABA 3VFGH 3IDIA 4D0BA 1F86A 2GFBA 4R9HA 3W56A 5HSFA 1MDTA 3GC3A 2P24A 2LJ2A 1P7QB 2CRIA 5HHNA 2X4NA 4TUUA 4OJFH 3OB8A 2D2CB 4BWAA 1TLMA 2VKWA 1IQWH 2NQ3A 1XILA 2FX9H 3QRFM 1C7SA 3BP7A 3M46A 1YTFB 3WY3A 2IOIA 4KUZL 3BN3B 1TQBC 1NR7A 1MAKA 2XACC 3HAEH 3L7FB 4N9GB 2NZ9D 2VLKD 3KPQB 1YEFH 4FXKA 5AVTB 2F19L 2QGNA 1H3VA 1P7KA 2YARA 4FLWA 2LO1A 1CBJA 2YLKA 1S78C 3IJEA 4ZMAT 1H0DA 1GIGL 4Z6AT 2Y4SA 4LRNL 1PNDA 2JGDB 1XDCA 4RUFA 4RFOL 2LQRA 5FM4A 1M4UA 4JAAA 3B8NA 1BVKA 3S37X 1V05A 1M3JA 2XWXA 3N27A 1U8NB 3JBG7 4OQTL 2P5EE 3O2VL 4JO1L 2WLZA 5DRNB 1I31A 2XAHA 1LP9E 4I0XA 1UWXK 2ZAIA 1ZTEA 5AAWC 1JMZA 1IO4C 4UM8B 1FO0B 3KYOB 1ZVSA 2ZE8A 3BPOB 3BPOC 5KVFE 1KB9F 1KXQA 4FLRA 3CNKA 4U7SA 4FYSA 3GMPA 5ANMA 4AJ0A 1H8LA 3AG2B 2ADJB 3FQYA 1IUZA 2I9TB 3CCHA 2CH8A 3B2PA 3V5KA 4M6OH 5HPOA 2OI9C 3B8SA 3BT2L 3EYQD 4EB6A 2ED9A 3QJHA 3BPNB 5IQLA 7CGTA 2E9WA 4ZUUA 1EGJA 3TNMB 3PNRB 4R2GB 3NZSA 1OV9A 1ESOA 2Q7AA 3REVB 3MZTA 3PABA 4BJLA 4XO9A 2NR6C 4R3SB 5EC1C 5JDSA 5TQ0L 1L3WA 4D0CA 1NFIB 5KVFH 2YPKB 1FFNB 1IRAY 3PGFH 2Q7EA 2B8OT 2ZD0A 3GZKA 4OSUL 5BV7C 2RQ8A 4XN4A 5DD1L 4A7TA 3MFFB 3DMMB 5EIIA 3D69B 2WC7A 2J4WL 3ZIYA 1E9OA 1KBBA 2X4PB 2AJZB 3L9YA 1BS3A 1BVNP 3OMAB 2BRRH 1E5BA 4PRDA 3FO1A 4XWOC 5D7IB 3UYPB 1VFAA 2D4FA 3GJFB 2C3HA 3OLEA 4MDRA 4N4YB 3KDMA 3U46B 5J5EA 2LT9A 3ASNC 2EECA 4KHTL 5HHOD 3ZHTA 3O6FC 2NUTA 3D39B 1TJMA 4WO4C 2YAHA 1VA9A 2ICCA 4R7DB 4XI5C 1AXSA 1Y07A 2I60H 3E8BA 4HJIA 4OQTH 4RMBA 3OJMB 1BF5A 3OLIA 5A2JH 4DP1X 2APFA 2X4RA 3QDJD 4YDKH 2PETA 4GRMB 5DURD 5GRUH 1CN4A 5ACLA 2VABA 5HGBB 2NQDA 4NHCH 4ZRGA 3VFVA 1EPFA 1EN4A 3R1GL 1IBGH 4XO5A 4BGDA 3QZPA 3RGHA 5IG7A 3MRLA 4I87A 5C6TL 1HHIB 4KY1L 4NO3B 1YNLL 5GRZA 2VQFO 3LSUA 4WUKL 2R1WA 3A6BH 25C8H 4NBXB 2ILLA 3P3TA 1T6WA 1HDMA 5CMAB 1UD4A 2FWSA 3K80A 2OMUB 4I4WB 5ABZA 1AXTL 1NBYB 3V6ZB 1E6OL 1RZPA 3AITA 1P4IL 2XJKA 4GKSA 1KYAA 1V27A 4JANA 1QLRB 3LDBB 5D5PA 4ZXBC 4QRAA 1FIEA 5FNVA 3KH3A 2HVKB 5AOZA 5CP7B 3UAEA 4IU2B 2XZAH 4OB5H 4YBHA 5E7FA 4RQQA 4EKWA 1TPXC 1ENVA 1Y7VA 4NX0A 5DEDA 1F4HA 4R83A 1W80A 3FUEA 3VXMA 3Q3GB 4E41B 1OF0A 1P9MA 2Q7YA 4JKPL 1KPVB 2RNBA 2A4ZA 5I5RA 3DWTA 3KVQA 1KC5L 1VGEH 3UT5B 5IYCO 1DQDL 1HH6A 4X64B 2H0PA 3ATFA 3UCQA 2HKFL 5J06A 1MCLA 1P2CB 3D8MA 2DYPB 4OFQA 2XVGA 3SDXB 1GYCA 1X5GA 3V6FB 3EJRA 2BC4B 3HS0C 1XT5A 2XAQA 3ABZA 4ANVA 1QSEA 4GT0A 4AQ1A 3GLAA 4UT6H 2CLZA 2CLVB 1M05A 1UYWL 1ZX3A 4TVPH 2YQ3A 5IBTL 2VXUL 1TUEB 3EYVA 4PCTA 3VCLA 3ZJAA 3RT3C 1IBDA 2A9DA 2HVJB 1PPIA 2XTJB 1KZYA 4L5FH 3KS0J 5CR8A 4CGTA 1M2OA 1TVBB 3LPWA 3QZWA 4QXGL 4XAWH 3ARDC 3KXFE 3VH8G 5BQ7B 5FO8A 1RUQH 4FMFA 4MXVF 1BZ9A 4JMXA 3I85A 3VI4B 3QR2A 3I56V 4L4VE 5BVJA 2BVTA 5TDPB 3QUHA 4B27A 2YGNA 1TQSA 2N3JA 3Q5TA 2B4CH 5FUZL 2NLJA 3L3JB 3E1F1 4TQ8A 1I9RL 4YDJB 4Q8BA 4EI6A 5IHWA 3ILPB 5JH7B 3J7AU 1S7QB 3ZDZF 4R8CA 4DUZB 1DL7L 2NUPB 4ZMQA 3CSBA 4JQVA 1A65A 4H25B 5DEZA 3W7UA 3VAEA 5EFIB 2VDKL 2DQDH 4OGAC 3RTQD 2G2RA 4A7GA 3JXAA 3MTXA 1U58A 4TV9A 1WICA 4UUJA 1S72V 1JZ5A 1NGYB 1YMMA 4B95C 3MLVL 1C16A 1MAMH 3WE6A 1Q9OA 5GQBA 3ABKC 1AS8A 1QW9A 2DQJL 2WBJB 2X4QA 4FXTA 2GTWB 4N22A 1TVKA 1MW2A 5DRXA 3V4PH 5AAMC 1LWRA 1V3KA 1CL7L 2BFVH 3MRNA 3RRQA 1N36B 3QFJD 3T2QA 1H3TA 2DI9A 4K3JL 3R19A 4KVPA 3CN4A 5T1JA 2BPBA 1AG6A 3WELA 3CC5B 4KK9D 1K4DC 3U30C 1A1NA 3LRGA 1DVFA 4PI2A 5JJEB 2A83A 3LH9A 4Y4FC 4M29A 2SEBB 3DTXB 4ICWA 1AQMA 4Y16B 1NIBA 2OMYB 3FU9A 1F4NA 1ID2A 1LL1A 2G9HB 2GSIB 4NWTL 4GCZA 5FV2A 4XDJA 1UACL 1S7XB 4L8SB 1XF1A 4WQOA 1U95A 5E9DE 1I1AD 3P2BA 5KBMA 3OLDA 4L9LC 4XAKE 1E67A 3LKSB 2OIEA 3BHBB 2QDWA 3AUVA 4LPCA 1SYVA 4CADB 3FN0H 4UCVA 3ATDA 3EYFA 3SGJC 4F7EB 4NUMA 4QRPD 5IMKA 4G7YH 1QPPA 3ZR6A 4BA0A 4K07A 5ADPH 1SDDB 2HVBA 1Q90A 4RMSA 3LXAA 2IC2A 5FYJD 2VE6A 2ENYA 5IESL 2YBGA 4MNQD 4RGNE 1MG1A 1UJ3B 3PPEA 1GN6A 2UYLB 1V55C 2ZCLL 1F6FB 2P8PB 4GUQA 2AKRB 2HFGL 3FB8B 5KVGH 3O2WL 4JAMA 5IQ7H 3SDAB 2OSYA 5D2LF 3A4AA 1AI5A 1VQ5V 5AVYB 3UO1L 2OXHB 1A4JB 1RIVL 4U3CA 1DVYA 1U2HA 3MD0A 1QNMA 4U3JA 1TYEB 5DYFA 1J1XL 3PWLB 3OL2A 1I5YA 4M48L 2IAMA 3ZMTA 3NJXA 3W3BA 1A4AA 1J5HA 3U7AA 1KJ2L 5I66A 4ZUTB 3NAAL 5AYTA 3IDXH 5D96B 4HIIA 1CICA 3NSJA 1FWXA 1U2CA 5IROD 2DLFH 35C8L 2GUYA 2JKJA 1QWHA 3QDGE 4KVCH 3WS6C 1OAXH 2VE6B 3MACH 5I1GH 4H1LG 1F3DJ 1WN7A 4H26A 4NFBA 1HQ4A 3CWGA 2YD3A 2Z31B 4DR3O 1U3HB 1LWHA 4LRIC 1QBBA 5C0JA 3VFSA 1MI5D 1YEHL 4F6EA 4YY3O 1QBMH 4B5EA 2OM5A 1AQHA 1JIBA 5EZPA 3ZUNC 1VLXA 1MI5A 3SDAC 5DUJA 1QLNA 1AHWB 3SGKC 3Q6FB 4MYWB 3ZTNL 1KUMA 1VQKV 1FH2A 1JXJA 2H1PL 2OXHA 1MFBL 3GYRA 3NDZE 1WITA 4ISVA 4JZOB 2OBGA 4PY7A 1FO0A 1AXIB 1I75A 4M8RA 2CRMA 2OJ1A 5GRYA 3T0WA 2DWYA 1FBIH 2VN3A 2VR6A 3WFCH 2E6QA 3VD0A 4XCCL 3KZIZ 1T3FA 3HC0A 4JEGB 4Y16A 2B1HH 3ARSA 1BXVA 3RZCC 4Z7OE 1KKDA 5DSCA 3UPCA 3T0EB 5E4EB 5BRZE 5I71B 3L3IB 4MLSA 2D3NA 5E1IA 1JD7A 3DTUB 2AEQH 2ZKMX 3FBKA 5IB3B 3CFBA 1T2JA 4UU9A 4X0NA 1YA5A 5LCVL 3L7FA 1IAKA 4N9GA 4P5RA 2V9QA 4PJ5E 4CH6A 1F3DH 4S1SH 1AHWC 1M1XB 2DQTL 4G6KH 4OZ4A 1GKEA 4IEFA 1F90H 1SS3A 3OXRA 1P0SE 3IVKA 4RRPG 2YUZA 2I24N 1F41A 3SPIA 3FX7A 1A7NL 4N8PA 5AAWA 2WQAA 1BZ8A 1P49A 1RZFH 3K7UA 5ICZA 3NIGE 1I7FA 1F6AB 1UXSA 3SPGA 1SZNA 3BH4A 4KK9C 5I8CA 3LKQB 4KVNH 4JO3L 3JATA 1PZ5B 1HJCA 4A2LA 5FL7G 4KFMA 1NTKH 3CGTA 5EZLB 3PFUA 1RD6A 5F1NB 5JW3H 1FL3B 4P5TC 4XPTH 1PZ2A 5D1QE 5AKRA 2BXYA 3VG0H 2HLEB 4OAWB 2WXMA 5I1KH 2J25A 2Z7ZA 4YL9A 4ZDHA 4XVJH 1H2SB 2LGQA 4LCWB 2CCLA 4M8UA 3C6EA 3ZKMD 4DVRL 5DJXA 2Y07H 2V7HA 3L5JA 4JFSA 1YEEH 4FJYA 3TPKA 3H7BA 3OKMA 1I1YB 1GS8A 2HJLA 3B7RL 3B3IA 2JKTM 4I48B 3CFDB 4OCLC 5FDYA 4F7MB 2I25N 1CG9B 1FZKB 3AU1A 3NT0A 3VQ1C 1TITA 2XOTA 4PJCE 5AVRB 2W1NA 3VE0B 4JY4B 5D4IA 1NIEA 1X44A 4L0YA 2MW2B 1EFRG 3QDAA 3WUWA 3QPQD 1KJVB 1VEMA 5L8KB 2H8PB 3SBPA 4TUKL 2BVUA 5JXED 1F13A 2DQHH 4FFBA 2CCVA 2I7SA 3O8XA 3STBA 4BV1A 3K03A 3QNXB 1MAJA 5DF0A 5MEPB 4NGHH 1COWG 2BHYA 4LF5O 3O6KL 3TIEA 1KLFB 4S1QL 4GRWE 3K8MA 3TV3L 3QFJE 1UT9A 5BVPH 3ARRA 2BIMA 2HAZA 3US1A 4JI5B 2OP4L 3W7WA 4AEIL 4KROB 2XWDA 4XXCC 1JR9A 3QPXH 3IDJA 4WGKA 5EO0A 5KVEE 3K0DA 5I1DB 2HFFB 2DE0X 1DBKH 4CGUB 4WWPA 2GCYA 2P5EA 2Z4TA 3SKOB 5BR8O 3IGAA 1FFXA 5CN3A 5HHQA 5MP6L 4KK6C 3VXME 3V9EA 2RAMA 2N74A 4MD5A 3REWA 3SQBA 5KWYC 1GJIA 2FJGB 1IDSA 5ACZA 1A6ZB 4FLQA 1RZKC 3UTSB 1RZIB 4Q52A 1KCLA 5JORB 4NAJA 3VXMB 2XTLA 5JCOA 4NERA 1CYXA 3BW9A 3QFGA 3K06A 1U30A 1T1WA 2F8VA 2FH6A 3IFXA 1ACXA 1X5JA 3NSYA 2KPWA 3KWWA 4F8PA 2FLBT 3SDXF 2EILC 3U10A 4GKSB 4HS3A 3UTTA 3EBIA 1WFNA 2J3SA 5DCCA 1MPAL 3X2QC 2J57A 4XN9A 4GG6B 1AVMA 2VNCA 2GUZA 2HT2D 2RMNA 3ME0B 3BYYA 3ZCCA 4ZUSB 3W0WD 1BLIA 1QZ1A 5EBMA 1M5IA 2GJ6A 1LTXA 1AGFA 4LF4O 4K7PH 4BCXA 2Q76B 4X5PA 4MTGA 5C0DB 4ZO8A 1XGQA 4N2EA 4U1LB 5GRJH 5T5NG 1AHKA 4LWSA 4NIYE 3JAKA 2BVPA 2W92A 4AX3A 1HKFA 4K3AA 5LGTA 2ZG1A 2BNRD 3FU0A 2VDNH 5LBVA 3HB3C 4TKWA 3UP1A 4JF3A 5LNGA 4NLAA 4KRNA 4PJ8C 3CXDL 4ZNEA 3M7FB 3RL2B 2V9UA 2XWRA 3BZEB 3QXVA 1RUML 3V5KB 3HA0A 1EFQA 4AXWA 3UYRL 2OKMA 3U7WL 3BVVA 3ZKXC 4C56E 3ALWA 4G6MH 4HBCL 5CN1A 2MNJB 5I82A 5LXVA 2XPGA 4YUEH 5D72L 2Q4PA 1GTOA 4QXVA 1FQ9C 2WQRA 2HTKC 4YN3A 1D7DA 1F4WL 3DIFB 5T3ZH 2XIBA 4TUJA 2WV3A 3R06A 1GR7A 1T1YA 4LSQL 1OTSC 3BPNC 2YKKA 3MA7B 5GGUB 3NCBB 5DJ0A 4ZMLA 2WTPA 4MAUH 4HZAA 4D2NA 2AQTA 1A2YA 2PCXA 1X5AA 4XCFL 4HD5A 4CU6A 4WUUD 3GUFA 5CBAA 2ZOWA 1RURH 3T1FB 4BFJA 3QF7A 3BABA 2A6JA 3ZMRA 3VSTA 3APQA 1AIFB 1ZHBA 3SKNB 1KIRB 3R8QA 5DD3H 2DEWX 5LDSA 1CFSB 3R0MA 1JPGA 2H0EA 5DT1H 5J13C 3WLBB 4HCRH 1I9IH 5JW4Q 5FO8B 1SJHB 4DN3H 5BNXD 4NJ9H 2YD8A 5HGHA 1AJ7H 1VQMV 3R0NA 4FNUA 4PRBB 4X80L 4BKSC 4NUJB 1L6PA 1OSEA 2R15A 4YSAA 4TM9A 5FCUH 4S1SL 1K4DA 8CGTA 2CGYA 2FIKA 4ONFH 4RX4D 5C0BA 3SPVA 5KSAB 1VQNV 4FTVA 3ZIMA 3B6SB 3PLYA 1FGVH 3BQUD 4OD3H 1RU9H 4AGOA 2PLTA 2CD0A 3QJFB 1MFDH 1N2RA 1CD1B 1NCAL 3QUYC 1QR1B 2HT4D 4TTDD 5GRUL 4B3MB 2CTRA 1JV2A 1Q43A 2NZ9C 5EH1A 3RUGF 1IAIH 2HN7B 2NNCA 5K9KA 3US0A 2VLRE 4YJ3A 4TL4A 4FFWD 3U7YL 4EZMA 3T3PF 3GSWB 3IJSB 4F8NA 5KYXA 3KPRA 1W59A 4HQQH 2X87A 2EZPA 2A73B 2R7EB 3DROB 3K2KA 1SY6L 2WXIA 2AVFA 1PD6A 3UADA 1H6TA 5CJ8A 1FAIL 1LE9B 4NZRH 2PWFA 4PIRF 2XI9A 1TOXA 3TO2A 1PL3A 2QPUA 4P3CL 3SDYH 1TKWA 4I18C 4HAFA 1EQWA 4IJTA 4KPHH 3MUGA 4ZJ9A 4KKAD 3PIQA 4ZI7B 2OK0H 1B0RB 2QQKH 3MI6A 4XMPH 1NVPB 1BAWA 2DQFB 4HIXH 1Q0EA 5E2WL 4BK4A 1EGJH 3U79A 2DD8H 1ZXQA 1YQVH 2VYRE 3MRKA 1TVHB 4DKFH 5IIEB 1KNOB 1U91B 3CCQV 1GY1A 2FL5B 4DPBX 1YY9D 2VN6A 3MA7A 5GGUA 1KKCA 4BZ1H 1INDL 3Q8FA 5IYBO 1GJUA 4N8VG 4P5MB 1KENH 1A9BA 2N1TE 3ZK0A 4JB9H 5B5EZ 4I2XA 4FQJH 3VFRA 4B3MO 1J7VR 4ZSOE 3MRQA 2E3CA 4A37A 5IB4A 4M7LT 3EFFA 2WXHA 2YIDA 1S9YB 1HOCB 5KOVC 1AMYA 4P2OB 4OM1H 3WEBA 4MJID 1FH5L 2DDQH 4YO0A 2H6PB 1QEWB 3OR7B 5EU5B 5J3HD 3P0VL 3GXUB 2DLEA 3Q44A 5DD5H 3SDDD 3V7AE 5GGRA 3ARFB 3TEWA 4XPTL 5AKSA 3WLWC 3JSNA 3TEUA 1D9KD 5TGBA 4PJ9C 3VXUD 5L3FA 2AJZA 5CXPA 1UA6L 4HJ1A 2LLNA 4PI0A 3CFKB 5ADPL 2ZCZA 2X4OA 4JO8A 2QDVA 3E1ZA 3HZVB 4WHDA 1L9QA 2QDOA 1J9QA 1QBAA 1A6VH 1GGYA 1BZEA 5I0DA 3WAJA 2OWOA 1MQKL 1HSBA 4OZIA 3ECQA 5IROA 4BIKA 2FL5A 1TQCB 1ES0A 3I6KB 4QYAA 4QT5A 4Y1AB 4YK4B 2P52A 2LVEA 5IE9A 4P8QA 2HPTA 1XR8B 2OJEB 3MCG1 2UU9B 3AT8A 1G1CA 2DQTH 2CMRH 2VAAB 2GUOA 4NQDE 3L4YA 4XRCB 3T77B 1NTZH 1T7ZA 2XN9D 5LP6C 2B15A 5DLML 2XLLA 43CAB 4JRWA 1KY6A 2WLMA 2N59A 4TPRH 3CJHB 5K1PA 1HHGA 2JXMA 3GGWB 4Q74A 1DVTA 4N25A 3TH3T 1L0NH 1E9QB 2FUTA 4EMZA 4LLUA 3KMDA 4JDZB 3UBHA 1GS6X 3MLPA 5DLLA 4MMYA 4M5SA 1V7ML 1OGAB 2PY5A 4PMFA 1WSST 4ZW5A 4G7RB 2PGGA 1PS3A 2ICEA 4CDGC 4GFTB 1CIDA 1HNGA 3A2FA 2J2ZB 5JHDE 5JW3L 4GXUM 2ZUVA 3BX7C 3U4EA 5BV7L 2QLYA 4YSCA 4HKZB 3D18A 1JFFB 5HYJD 2VZ3A 5DD0L 4CC4A 1M3IA 3VXSB 4FM2A 1PZ3A 5MEQA 3QNFA 4OLUH 3BRDA 2LGWA 1WAAE 4UTAH 1MA1A 3NOIA 4LF4B 2NLJB 2W0LA 3L3JA 1M57B 3Q4HA 5KVGE 4BFBD 4I3RL 1NC4A 3ZE2F 4HZLA 5FFLA 3BRCA 5F9JA 2YEVA 2N4IA 2R0WL 3ZHUA 1IARB 3SE3C 2JEUA 5EMYA 1QRNB 3APMA 4X6CB 2ADFL 1FJGB 5EG6C 1CGTA 2UWEE 1U8OA 5A40E 5LXGL 1VZIA 4IBYA 4F9LC 3P4OB 3UP6A 4UB8Z 1RULL 4C4BA 4CILA 4RGNC 5TH2A 4HXAH 1A6AA 1AANA 1K5SA 4MRBA 1NGXB 3ZE2E 4LQFL 1D6EB 5IUSA 5JDJA 3WB2A 3B4SA 1V8HA 2GW5A 3I75A 4HBQA 4TXVB 4WFHE 4XAWL 1Z5YD 3RURA 3ZQXA 3BAXA 2F53B 4MAYD 5IDJA 3LQMA 4EDWL 1QQDB 2YJLA 3QQ9C 4G9FB 1OF2B 4EDXA 1DJZA 5C9JB 4MA1C 4NQEE 1BJ8A 3AS2A 3RW0A 3F04A 2V0AA 1FDLL 4LCUC 5CD3B 5JIKA 4FXLA 1YHQV 2Y1YA 4MSWB 1BD2B 2A9CA 1JHTA 4Y5XC 2QKIB 4FZEH 2IPUG 4D9LH 1KCVL 5C0RL 4U6VH 4XMLL 2WXGA 2WIMA 5GW7A 4M5YL 5C07E 4OAWA 3IRCA 3RVTC 4PB9H 3NR7A 3EADA 3S3WA 3PDOA 3HUJF 2QQLL 3NGBB 4AVJA 3S8FB 1ZWIA 5B3SB 3DNKA 4XN5A 3UMTA 1NJ9A 3DIDA 3QHTC 2OSLB 1R3JC 1ZSPA 4DW0A 2M6YA 3SPCA 4U0RB 4OD2A 3KWVA 3HW7A 4BEIA 2A0LC 4LF5B 2KSDA 1QAWA 1LO5B 1JDDA 4WVRA 3GVMA 4OLZH 3V10A 3RFZC 4JFOA 1CF8H 2WWNA 3VFNB 4LLMA 4PREB 4APXA 3LKOA 3HJ0A 4R6UA 2IFGA 1NL0H 3L95B 4FI6A 5B38A 2IU3A 1AGCB 1K8IA 1URFA 3MRRA 1H8SA 3T3ME 2CJUH 2KYIA 1O9VA 2XPGB 3DJZA 2FGWH 5I9QC 2EDMA 3EDJA 3FT2A 1Q5OA 3G71V 4G6AC 3FQ4A 4KHXL 4HS3B 1IIKA 4HHAA 4WWKD 2FEDC 4FQXD 1MFCH 3CFBB 2ZP8A 4KAQL 4FOMA 4M5YH 2IGFH 1RFYA 1MJUL 4NQCD 3TO4A 2NT1A 4HAKA 4A68A 2EAEA 2HLDG 2EXWD 5D1ZA 2NDGA 5DVPA 5SV4A 5I9QB 4JZJB 2PCFB 3OZKA 1WTLA 2DKMA 2I07A 3P3RA 3QUYB 4LEXL 2VRZA 1GA2A 1J5DA 4G7SB 4N1EA 4P23C 3O4LB 3PU7A 3NPSC 4NHUB 3R7QA 2Z9TA 4XN2A 2GQHA 2AAAA 4P2YA 3UGXA 4GIAA 1MWAA 1WPXA 4N2BA 4G27B 4P2QA 4H0HB 1Q8MA 1PX4A 3D48R 3VGHA 1UWGH 2ZOOA 1AHWA 1ZDQA 3OSVA 1YITV 1CGSH 3WDHA 1MJ8H 1P1ZA 3QJTB 3IJYA 1BIIA 1BQHA 1WO2A 3DSNB 3L1OL 1FPTL 5E03A 3X1FA 5LA6A 1BD2E 2ZF9A 3TESA 4ODSL 3U2IA 4K71B 4IL6Z 3AB0C 3PABB 1LNUA 1R0AH 2HRPL 3KG2A 2VDLH 3KYNA 1ZA3A 1YDPB 3T4AA 2QGEA 4MWFB 3OKNB 1ZKAA 3MXWH 5F70A 1G5AA 1YVLA 1L7TH 1IAMA 2IQ9L 3DDGA 5ELIA 4N28A 4JFVA 4JO2L 4OF6A 2F95B 4Z0XA 3IPEA 2PYED 4P2QB 4Y4KB 4GUNA 5BRPA 2X7LA 3IK2A 3VWJB 1FO0H 5G2NA 4LF8O 3BCCH 3UZVA 3ASOC 4I3SL 4ZFFB 2ZQMA 3OHMB 3DTDA 3AM8A 3CFIC 5IVXA 5D71L 3V52L 3BGMB 1IE4A 1JE6A 3ZRWA 1PDKB 2ZINA 2VITA 2YPVL 3BKYH 4LOFA 4NDMA 1DUZB 4FZ8H 5SWSA 3KLDA 4AGPA 1DBJL 2FGZA 3LYRA 4X6FB 5E95B 5I2IB 2Z3FA 3EFDH 5JOEA 5M94B 2CO4A 4B7KA 3EYUH 3FU5A 4KI5F 2J8UF 4NXKA 3VFWB 4LLDB 4N0CD 1YECH 4PRNA 4IBTA 3ZN6A 4IGGA 5D70H 1R4XA 4UDTB 4AGMA 4FRWA 3MHZA 4F7EA 2UXDB 3RX5A 4XZUA 1LK2B 2J88H 4PDRA 4I9WE 3ZQWA 3QZLA 4P4KD 3OEHG 4DR3B 5L7XL 4L8CA 3DBXB 2VDML 1H3PL 1NCCH 3CMOH 1V54B 5I0VA 2WXJA 2P80D 3SE9L 1WS7A 2Z92B 1S9XA 4QXUL 5I30H 3TBYB 1F3RB 5A43C 1RZFL 2RCSL 2QPEB 1SMDA 1ZT7A 1EUTA 3WN6A 4HLZH 1QRND 4QRPA 4ZQKA 1DTUA 1CIUA 4XP9H 3EDFA 1N3NA 1WAAA 1TENA 1W91A 3ZTEA 1ZVHA 3VD4A 4AMKH 4XR8C 4PWIA 5H2FZ 4F58L 5B1BC 1IAII 2GVYA 3KLHD 4HHAB 3K5SA 5C09E 2HA1A 5EO9A 2GTWA 3CFCH 2XWEA 2D2OA 2UXBO 5EBWC 1JPSL 2WBJA 4P07A 1JJUA 3MLTA 4K5OA 1U58B 3V6OA 4FLTA 1E40A 1RVFH 3H42H 4XODA 4PJ8A 3AQZA 3NABL 2CJUL 3ZL4L 1A7QL 2Y4UA 3EOTL 1BCIA 5KS9A 4WFHD 3WFCL 4FQCH 4ZMZA 3JYBA 4MJ6A 1XZ0B 5B1OA 3FSAA 3MLUL 2AI0L 1BMGA 3FRUB 4RISH 1ROPA 3L45A 2CNZA 3QDME 3NESA 5DD1H 2OR9H 4E9SA 4PELA 1R6KA 1VFOA 3TBWA 2OMWA 1JFQL 1RZJH 2XTAA 3QEGH 4FLHA 3T0AA 4YWGH 3VI4A 3MLZL 3VXRD 1PL4A 4Q6IC 4UCRA 1X5FA 4MB1A 4BBWA 1BD2A 3T4AC 1QKZL 4HWNA 2BP0A 2W38A 1CFVL 1XBRA 3ZHRA 2M8XA 1TFPA 3ARED 1KCVH 4LL9A 4D9LL 1SMAA 1IVTA 2BOBC 2DL9A 2PXYD 5IJ0B 2WKGA 3X1NA 2ADYA 1AROP 3F7VA 2HXAA 5T1LB 1EJ8A 2BSEA 1H6EA 4S0TD 1N36O 5TFSH 3HAEB 3P0VH 3DYOA 3ZDYF 1HL5A 3EUUA 5CJXA 1X9UA 4OCYH 4WTQA 2A9HA 4BK5A 1KU9A 5E79Z 1FJ1A 1NDGB 1UOVA 2ESVB 5HGGS 3D4CA 1YYLL 5GONA 3PWUB 3WN5C 4LOEA 1A4JA 5FK9B 3NRPA 1FZMB 3L4TA 4MT8A 4IOIA 1TU2A 2EE3A 4JREB 3INUH 4GBXD 4OFIA 1A6PA 2HH0H 3OQRA 3QWRA 4APQD 1HE8A 5F9AC 5C0JB 5GS0H 1H6FA 2Q69A 1JVMA 4H2CA 3JVGC 4XXWA 1NFDB 5EZJB 1KCSL 2KLRA 1DGSA 1YPZF 2EEFA 4I0PA 2HVJC 1YXBA 1X3DA 4DGUA 3KPTA 4KRPD 3FCUB 3W81A 2HVKA 5FYJE 2SODB 1I1RA 1E28B 2O6DA 4XMPL 4ELMB 1CGXA 2HR3A 3UTQB 1G7HA 4Q0XL 2EDDA 4KQ3L 4AH2A 3KKYA 3QRGH 5D1ZD 4U1SA 2HP4A 4G72B 4DR4B 5ICXA 3F64A 1PNKA 4JZ2A 3TO4D 2J2ZA 3DETD 2YEZB 3F12B 4BW5A 4R96A 3JARA 3U1QA 4BE5A 4A5UB 3ZQ9A 4EIBA 4ZMTA 1ZLSH 2CKBB 1UURA 5D7KD 2YZ8A 1A7BA 1QI4A 2NNAB 3VMOA 2ZE7A 1XGYL 4Y2DC 4HJJL 4YHOL 3NRQA 2R4RL 4DP9X 3NIFB 1SDAB 3IMVA 1BT8A 2DIJA 2IQAB 2VM4A 1KCRH 1R3JA 1TPXB 4A2MA 3G5WA 5E2UH 1WT5C 5FKPB 3B2EE 9CGTA 5KVEL 2KG7B 4LPWA 4P2QD 3WHE1 2ID5A 2VAAA 4IIQA 2ZUYA 4YJ2B 2RN9A 3QHFL 4M1CC 3WYRA 3UPRA 4HBCH 3KJ6L 2K45A 1E4JA 2HX9A 2HUHA 5B8CB 5A2KH 4W9ZA 2V5YA 1AZRA 1KFAH 3I6KA 4F58H 3CPWU 3ESPA 1CP9A 1P7GA 2YWYA 4UT9H 2J6EA 1BBDL 2G60L 2R0LL 2CDEA 2YEZA 3L1EA 4FI8A 4R4NC 3RNQA 3V4UH 3QIUC 3L95A 4Q0XH 4NO5B 2H6UA 4HUWA 1QBLH 2R69A 2WK2A 2G5UA 4P5MA 2DWEA 1G7HB 4LCVA 5D5MF 1MFEL 2FL4A 2ERJC 3G5XA 3MCLL 4G5AA 1MUJA 1U8HB 3D2UA 4E0RB 4EN3D 2X70A 3KPNB 2FZ3B 4O58L 3AMKA 4GRLA 3BD3A 3KLSA 1ZT4B 3MC0A 4NKIL 4ZS6D 5TE4L 2H45A 5B3NA 5HYQB 2FX7H 3EJJX 4KKAC 2D7PA 1KGWA 2XVKA 1ZOXA 3DHJA 1O6SA 4E42A 5I1CH 2BCMA 1KP2A 2OZ4H 4LGRB 4P3DB 3K2UL 4P2RE 1JJOA 1A6WH 4ZW8A 3CHRA 1FVEA 1RSOB 2NSQA 3NZ8A 1B9KA 3PXLA 4M43H 4R0LC 4Z0BL 3K5NA 2AMGA 5CD3A 2MPAL 3LS4H 3DMMD 1EXUB 4Z7QF 3RB5A 1OTSD 3VVWA 5KYXB 5L3BA 2CALA 1FFRA 1B4JL 3JTTA 3CZGA 4K3HA 3UYRH 2FHCA 2F08A 4OCNC 4X20B 2UXVA 2WKOA 3ZY7A 5ADOL 4JN1L 1H3XA 4MTMA 1WDAA 1M6UA 1EN5A 5E8OB 3S36H 1QRNE 1MCPH 5D4QA 1J1OL 4OF8A 3HKDA 2BNQA 4J9YB 1EUUA 2ZG3A 1FYTE 2VIRB 5ISZA 1E5AA 3SKJH 4KHXH 4HG4K 1TKWB 4HP5A 3FOMB 2Q3XA 4JR9H 2KUTA 1MZFA 1PX3A 1JA8A 3G6JF 5LXTA 4YLBA 4OLXL 1DBAL 1HCZA 4RFEB 5F9WB 4Z7UE 4LRIA 4B0MB 3LEVH 3ZMVA 3DVIA 4MA7H 4RDQG 4LCIH 4QKXB 4LNVA 3HC2A 5FW8A 3EGXB 2GFBB 3RTLA 3W0WA 3LRKA 2X2JA 2QWNB 4DV0O 1J8HE 1YEDB 5C08D 1SVCP 3ALXA 4IIQC 1RVFL 4PCSA 3AY2A 1KEGH 3LSOB 5TQ2H 4GKZB 3E6HA 3SPVB 1LEKB 3D30A 2DOCA 1CFTB 2FYYA 4X4MA 2WBXA 3ZDZB 4JG9A 5EU3A 4Y2DA 3KWTA 3WNOA 2ARJA 3U2JA 4S0SD 2CCWA 3F7QA 3HC4L 1E6JL 1UD8A 2QVMA 3GK8L 4E68A 1HINH 4XXDB 5E8PB 4X7SL 3UBXA 1FG9C 2A2QT 2AJVH 2JB6B 2P5WB 3GBNL 4TF4A 4R90L 4KDVA 1E90A 2ZOUA 1WWBX 3B34A 1AJQA 4Z7NB 4MGXA 2FQEA 3RVWC 5CEZD 4AVIA 2JJUA 2R56H 4WFFE 1HWGB 1QVGU 3TJEH 1L7IL 3NSCA 3VFTA 4KJYA 3PHQB 3JD1A 4NWTH 3NA9H 1GOFA 1C8QA 2J1WA 1FA4A 1EEQA 4BH7A 4S1DC 5J9PC 1U8HA 2H8PC 2Z1KA 2FECL 3D2UB 4S1QH 3TBVB 5AVSB 3L5XL 4OT1H 2Q76A 3GB7C 4N0RA 5J3HC 3QZWG 1B4TA 5DEGA 4QXGH 4AL8L 4PLOB 2OTUA 3DGCR 5E1AC 5EIBC 4QJ3B 4GQQA 1ETZB 1WAZA 5GGSB 4JJHA 4S1DD 1NCBH 5T3ZL 1OSPL 4M6OL 3JVFC 2VQEO 2EIEA 2X9XA 3VWKB 2EO9A 1KPRB 1T66D 1T7YA 1XQ4A 1DDHB 2GKIA 3QNZA 1KECA 1LMIA 4ZAKC 4KXCA 2AJSL 8PAZA 1ZLWK 1SBBA 1Z5LB 3QJVB 1RKRA 2BIQA 3VI3A 3KBHE 4XXDA 5SWSE 4BFOA 5L2KA 3ULUD 3FO1B 3ZE1B 1M9NA 5J12C 4WKZA 4I5BB 4AG4L 5DJCB 5KBPA 1UGNA 3FCTB 2K1EA 4K8RC 4AKOA 1DJSA 2ALAA 3TYFA 2CIKB 4GLRI 5D1XA 1MCRA 5LGHL 3DHUA 2FD6L 3IDNB 5CLTA 1K6QH 4YGVB 3MNWB 3JAMN 4R7CA 3UAFA 3W5MA 2VDLB 1WC7B 4UQ2B 1NCIA 1KGUA 3QUZD 3STLC 1JPST 2CJSA 2XAJA 3VFPB 3I9GL 3DO7B 3UJJH 4ZI7A 4Q89A 4I8DA 3H3KA 2H3XC 4QHLA 3CN0A 3EYQC 3P9LA 3P32A 5LHHA 3QFDA 2BP8A 4YFDB 1SDYA 3TO2B 3E2HC 4YQXL 4AY0A 1NGPL 1ZTMA 3HC3L 4IHOA 4ICXA 5DRZA 2ZR3A 5EBLC 1R5IA 5LWYL 4HWBA 2CBTA 5E6RB 4QF1B 4XBGB 4I50B 5MEOA 1IGYA 3NJHA 5DQJB 4NHUA 1NEZA 4DP5X 5HGDB 2P80A 4XVUD 3EJZD 2R39A 3CVHL 3DXAB 3VFOB 3JAWA 2UXXA 3KPSD 4Z1MG 2VLMD 2HJFA 4IOIB 5I6PA 1EZLA 4IYHA 2HT3C 1GCFA 3WY4A 4JG0L 1RL1A 4QPEA 5FUCE 4NQVA 3OUSA 1RZKH 3OMIB 4QDGA 1O0VA 5I16A 2XETA 5C0CA 2Q73A 5DHMC 3STZB 1BQ0A 4ZFGH 2FIKB 5HDOA 1DQQB 5CKGA 4P2CG 3GXDA 4NPYA 5E94B 1AKJD 3US9A 2UXTA 1QOKA 4IMLA 2HFEA 1ZLSL 43C9B 3BEVB 3IDGB 3LZOA 4FQJL 2X9WA 3L75H 1W8EA 5BMFH 1L9PA 4IHJB 4TVPE 4GEJA 2IFFH 2DYSC 3ESUF 3GPSA 3LZPA 5MEPA 2V6HA 3GIZL 1FC1A 1ZGLP 3P0GB 5HHNB 2HFEC 3NP4A 3MUHL 4ODWB 4ONGL 5D1XD 4KI5D 2A6JB 2EDEA 1VJSA 2XV6B 2DJUA 2PABA 2GY7B 4ZUWB 1EH9A 1CQKA 5KN5A 1XF2A 5K9JH 5AG9A 3TLRA 1ASQA 2PR4H 3WNIA 3TGUH 2IH1A 2VH5L 3BLPX 3CQFA 3FSOA 5CBGA 1DANU 1PJWA 4A6YA 4PJEE 3I84A 4J3XA 5CBEB 1XCQA 1UZ8B 3FFCE 3ZHKA 4NC1E 5ENWA 1VQ6V 2R56L 3BQUB 4R50A 1E43A 1FAIH 4OLWL 3DX8A 3PE9A 3DIFA 4RQEA 2DEYX 2NR5A 4MNGE 1OAUL 3ZDXB 1AFVL 2Y07L 3WMQA 4RUEA 4PDLA 3P4NB 1Q9WA 3QP3A 1MCKA 2IXQA 3DX3A 5DZAA 4JQXA 1RFDH 3HNTH 3RJQB 1KGJA 2DIBA 4KKQA 5J1AA 3ROLB 3N44B 5IBLC 5EYPB 3QUXD 4EOWL 1NDMB 4X6EB 1SRDA 4X8AA 1KG0B 4YSPA 4XE0A 3KYMA 4P99A 3ML8A 4HDIA 4ZQKB 5T1KD 3PWVA 4JI5O 4N26A 1S7WB 1UM4H 4MNQA 4CU8A 5IZ7A 3L4UA 1RHHA 2HJFB 4JM2B 2FEDD 1HP8A 1HI6A 2ZD9A 3CZKA 3A6OA 3QXWA 4K8RD 5GJTH 4F5CA 2HCZX 1JZIA 3BH8B 2GEQA 4I0PD 1HCFX 4ONGH 4XTRD 5T1LD 3HZKB 4Z7AA 1Z1WA 4X6BA 5DQ9B 4GXVL 1S3KL 2G2NA 1N6QH 2DB8A 1HILA 1F90L 3PQYB 8FABA 3SJQC 3P77A 3K9SA 4PJDF 5E1GA 5ICYA 2JK5A 3K6FA 2UY7B 2EIZB 4IQHA 3TXQA 1NBMG 4XOEA 4YHYB 1A4BA 2IIJA 4GMTH 5IFAL 2B59A 5HYSB 4FYRA 2UVFA 5F3HB 4K3JH 4FG4A 1TTAA 4DQAA 3ORJA 1T3FB 2ZTBA 4OCWL 4MMYB 1JXGA 1IC7L 4N0UB 3T4DA 4F2MB 4ZX4A 3ZMSA 5FGCE 4CDHA 2Y2TA 5EORH 3C3SA 5B7MA 3S88H 5DTFB 1UZGA 2E76C 3HS0A 4P5TD 3TWCL 4AMKL 1K8DA 1OW0C 5FIEA 1AJPA 4OZGF 3U9PH 1P84K 4JVWA 5LHDA 3O3AB 4LCCC 3UFIA 3D3VD 3W57A 3ZDYE 3BVXA 2ITDC 3WN5B 3DOSB 3IETA 4L4TE 1ZA3B 2GJ6E 2AZUA 3ELAT 3OKOB 1U8CA 3BAIA 1BMFG 3S34H 3ZN1A 1JGDB 1X5MA 1QVFU 2A0LA 1PKOA 4V2CB 3VM7A 1NCBL 3IJ9A 1VP7A 3LKRA 5DQ9A 1GRWA 4WFGE 3VDAA 4AUUA 1G6RL 2VSDA 3HMXH 4NQUA 5I28A 1GGBL 1VZGA 5FHAH 4MZRA 4WFFA 3EDKA 3HKEA 1RV6X 3FQWA 4ODXA 5F8QC 4PSRA 4FL4B 1F8TL 3Q06A 4XOBA 4QGTA 4OX9B 1EEZA 1NEUA 2UY6B 1ND0A 3RPBA 2R9HC 2QMJA 2B1IA 2NCMA 2VQ1B 3CFMA 3EFDL 3QG5A 1U95B 5I23A 4DGVH 4FLXA 5F7AA 4ETQB 1LEGB 3BUYA 4NP9A 3VE0A 5LOVA 1YJDL 1CLOL 4MHHG 3HS0B 3T2LA 4UOW1 3BKCL 3GJEA 4OQTA 3ERXA 3PHAA 4PW3A 3U7WH 5KS9B 1BFSA 5HJ3A 5CU9A 3KCWA 4RNRA 1S7SA 2N0MA 1ZTXE 3RYIB 2OR8A 1AHMA 4W9GC 4XBEL 1UTDA 3GXTA 3KS0H 3F7LA 5IMKB 4JI4B 4LSPL 5C6PB 1GVIA 3JD4A 5DRXB 3T2NH 4J5VA 2Z93B 3L71H 4GO8A 3H55A 4Z3GA 2YD9A 2CWRA 2OSXA 2ZXCA 3TBVA 1DBKL 4NC0B 3RE0A 1ACCA 3PWPA 5DMYA 1JGEB 2FR4A 1I1AB 3A8TA 2OK0L 5JPNB 3KPLA 2ITFA 1TAEA 1IZKA 4HSCX 3U83A 4WNQB 1LO5A 4G82A 4ZIBA 1YMHA 5HY9A 3MV8B 1XNQO 1NCGA 4WWKC 1J0JA 1E79G 1HVXA 1L5GA 1LD9B 6TAAA 2WQWA 4YDIH 2A7BA 2Y7LA 1N4XH 3QRBA 5C3TA 4J9ZB 4XVOA 3MLTB 3ECWA 1J12A 3N2GA 4DW2L 3BEVA 3Q6GL 1RK0B 2OMTA 3THML 3HKFA 4WFEA 5D4HA 1VESA 1BYPA 2FYYB 1F3JB 2BS9A 2XTJE 2YOAA 4P05A 5I1HH 4L18A 2YQGA 5H35B 4JI1O 1NINA 1A7OH 3LEXA 4OCSL 4KI5E 3WTUA 2ZCEA 4CSSA 1K4CA 2XCMC 1I4FA 5DZVA 1FGVL 2N0KA 4OD3L 4LH6A 3GLDA 2HRHA 3AAZA 3N0AA 4TSBL 5T5FH 4LLAA 5L4JA 1PAMA 1WCQA 4TV8A 1IBKB 5HGAA 2W81C 3HPLC 5D96C 4EDXB 4QRTA 1Z9PA 1WNSA 5A6IA 2FCBA 1H15A 4Y19E 3LJ3A 1QSEB 4WNSA 2LV4A 1DQJA 1RLBA 2ATKA 3VD7A 3PAZA 2X09A 3NIDF 2EVJA 1UZ8A 2FB4L 3LY6A 4L8CB 5I1GL 4AHCA 2FTAA 1PF3A 4S10A 4OZHA 2P4KA 4JO4H 3GBEA 2X40A 4R7NA 3RAJH 2H9GB 4OV5A 3LEVL 3SQOH 3GMRA 4LFCO 2C5DC 2ZSVB 5T3XE 4JM2C 1I7UA 2KDYA 3MRMB 5CZVH 2OTJV 2E6PA 4UOZA 4ELKA 4PJBF 3NCFB 3S5YA 5GGTA 2P22C 3T6VA 1SRYA 2LVCA 2H0JA 3CVHA 1M6OA 3B2UD 3MUY1 4QJFB 4M7JH 3PV7A 4HJGA 2EXSA 2R0WH 4JM2F 4M4RA 2Q8BL 4PRAB 1QFPA 2K1MA 3JTTB 1TYJA 4B3RO 1MFEH 3O9OA 1H2MA 5CUSH 4BK8A 5DVNA 4M7LH 3DVNA 2PI4A 3MNMA 4ZUVB 3KVPA 1ETB1 3G80A 4JRYD 1NKDA 1QLFA 1W72H 4HT1L 2Z34A 5G5DA 3TX4A 2WAHA 1HNZB 1URLA 2GJZA 4KHPB 4LBEC 4NB5A 3B09A 5BV7H 2G2PA 4MSWC 5CIPA 2C4FT 4L1DA 1KV3A 1UD2A 5IT2H 1YF2A 1PG7H 2BSKB 3L2LA 3IAQA 4N2CA 3UAJC 1EAPB 2WXPA 1IB5A 3BAEH 3MYZA 1DR9A 2VDNB 3WIIH 4A67A 3A4FA 4XNYH 4E0RA 1H3GA 3MLRH 3GRBA 1N59B 4CZZA 5EC2C 2NY7H 3BQUC 3C5JA 3MJ9A 2B0SL 1Q1JL 2AMUA 4WFHA 1FYTB 1V3MA 4PG9B 4IKKA 4RGNB 2B0SH 2YGQA 3RA7H 5JLZA 1YYML 1O9ZA 2ADGB 2G9HA 3E8VA 3H54A 3ASOB 5JIQA 1YEHH 4KP4A 4X99A 4LF9O 1FFNA 2BK8A 2C7FA 4PJ7E 5CB4B 1U9KA 3WG7C 1XGZA 2EDBA 3OZ9L 4OGXL 3F7VC 1D3CA 5AOIA 3UABA 3OHXC 3FO2A 2ETWA 1IBZA 2YUXA 4JGSA 3TJHC 4B5ZA 3P4MA 4DV4O 3LVEA 4N24A 5GHWL 1J8HB 1XF5B 1FS0G 3BPLC 4YHPA 5E6IC 4YE4H 4JG1H 4NR1A 1KBPA 4AZ8B 4PCYA 1W72L 3LIUA 3AABA 3ARGD 2P90A 2X4QB 4XPGL 2ZWSA 5CJ5A 1ZHNA 2PCYA 5F6IC 5AUMA 2C34A 4N68A 3VW3H 2JI2A 4PRDB 1KTCA 4D6TH 5HHXH 3MRRB 4HWZB 4Y4HD 2CO6B 3TYGH 5J2TA 2ZXBA 1P4LB 4J6RH 5E1HB 1FC2D 5KVGL 3B5GA 1NC2B 4NKMA 1BQ5A 2EDXA 1M7IB 4JFYB 4X5WA 1LP9F 1UOKA 5L2KD 4GO6B 3F8UB 4BFEA 1DHKA 5FB8B 3O65A 2KQMA 5L9DL 1NC4D 1XSKA 3WSQH 4QOKD 4IMKC 1E2WA 5KW9L 5DJYA 1TJGL 2QQNH 4NENA 2VDLL 2WLLA 4JW3A 4O4LB 5J6SA 4WU7B 4OY9A 3L5XH 2G5BA 2F7RA 3E2HB 3D4ZA 2VERN 5KHGA 4UBDD 5KSBA 4IRZA 3FO0H 1FVDA 2NXZB 2ZE6A 4WU5A 4H0LB 4F6RA 2VQFB 4IRSC 4O2FA 3MOAH 3OJDB 3KWUA 1PGRB 1TNMA 2ZT9C 1DSFL 4RMRA 5CINH 1IBYA 2K6YA 1QCEA 2DMXA 1KYOK 4UCOA 1SY6H 3BYTA 5EWIH 1KIPA 1BBJA 1LO0L 4ZXBA 5HJBA 1M7IA 1JERA 3L3HB 1YMME 5DJ2B 5LHIA 2EC8A 1EXUA 3H0TB 2MPVA 4QO1B 2HFGH 1IM9B 1G9NL 2VWEE 3JWDH 3OJDA 4H1LH 1NBCA 3VUAA 1E1RG 3FTXA 5EZYA 3V4PL 3QDMD 5T3XL 1ADQA 4K15A 4XMKL 1O7DC 3LN5A 1G6RA 1BM7A 1FE8L 3GB7B 3MGAA 3QDGB 4JDEA 3MSPA 4CS4A 4XBGA 1YUHB 3RNKB 1K9TA 3VXRE 3WFBH 1U8LA 1EAQA 3UBGA 2DLIA 2UUDK 2FYUH 2WGNB 3LS5H 3UTOA 2G4EA 4GBXC 5CO1A 2WUCL 4LSUL 1XZ0A 1TDQA 4WO4A 3VMNA 3RVZA 3LRSB 1X9RA 4AMWA 4MBRA 1CF8L 3WS3A 3TF4A 2E0PA 4HKJB 1WB7A 2FHBA 4HX1A 1VKXB 4F91B 2XASA 3MKKA 4NYLB 3D4YA 1LQSR 1KB5L 1GTFA 5DJ0B 1MRCH 5CILH 4JR9L 5D1XC 2GBTA 4PJBB 3CD6V 1SLXA 4PWGA 5CHNA 5IMOA 5HJDA 3KPRD 4LMQI 5T3XD 2OL3H 4GSQA 4PJ5A 1U2YA 2ITEA 2UWEB 4JI7O 3M17B 5FGBA 5IJKC 4NZUL 5GISL 4ZW7A 3G5ZA 4QXTB 2XRAL 2XKSA 2VL5B 4UIKH 5EUKA 4NRZB 1MCNA 1MLCA 2ED6A 2I85A 3KM1A 4HWZA 2E75C 2Q8VA 1OT4A 4EPSA 4XPHL 3U46A 1O5PA 4B50A 1JNHA 2FDBP 4XPAH 5D7IA 4F8QA 3OGCB 3FT3B 1CR9H 1NTDA 3UBXI 1P5VA 5J89A 1Q0XL 4AGLA 4ZOLB 2K7QA 3CDZA 4XZUB 5DWPA 3AS1A 4HS6A 1DUYB 1YLBB 1Q6IA 3CCEV 3L3GB 4LQFH 1MLBA 2J1KA 2VXTL 3H6JA 2F5BL 4HIHA 2LLGA 1N12A 4OZFB 1CDUA 4CSZA 1MHEA 5EBMB 4LC1A 3ARBD 4FLUA 3TVMD 2CO1A 5F0JB 2IPTH 2JB5L 2P8LB 4X4XB 1X4TA 4FE9A 4ZUUB 3TNMA 1AE6H 2V17H 1EX0A 2E4TA 2H26A 3B9KB 4MZ2A 3DOSA 4KMQA 2O72A 3TP4A 1MXGA 5DWUL 4LSTL 3CCHB 3KBEA 1ZK9A 3EOBB 2BZDA 4EN3A 2OTLV 3OHXB 2XAGA 2P9RA 1E5UI 2Y5EA 4UB0H 4A2DA 4DR1B 4DOHB 1MFAL 3SYOA 2D31A 1UXWA 1F4XH 1HFUA 2KLTA 1XAKA 2KC0A 4UT6L 4JAMB 2ATPA 3NFNB 1INEH 4LPXA 1EV2E 4ZODA 3N42F 5E70A 4HAMA 1S7UA 2EDNA 4UIKL 4YDMA 5HGAB 4NPKA 1FGNH 5T1DL 1OM3H 1FXKB 1J5CA 5EPMA 4PJBE 5HVWA 4EXKA 4Y2NA 3RGVD 4NI3A 4RWUA 2YGOA 3G6JA 4RRPA 5JXAH 4DFIA 3ZHQA 1S5HB 3QQDB 3K59A 2K78A 4M5ZH 4N8CH 5KTEL 4J80A 1XI1A 2DMBA 3LS5L 4KMTL 1IC4H 3FQUA 3IXAA 4MAZA 3TN0D 3T0DA 2N01B 2IAAC 3E35A 1EFXD 4PIBA 3EOAA 4YBLB 4P2RD 1VF7A 4UVBA 5ID0A 2G75A 2XTSA 3BPZA 2NXZD 5HYJE 1K4CC 1OAKH 4PLNC 1A6UL 3EFFK 4GXVH 3ZIAG 1H38A 1BLNA 3WTXA 3PGFL 1E9PB 5LGJB 3RFRA 3DTXA 5HJGA 2CR3A 2W0KA 4Y2OA 5F44A 4RWYL 2E6JA 5GGRY 2X3BA 3LDCA 5E8DL 1OARH 4X9GA 1I7UB 3EH5B 3QI9C 1KXQE 4J3SA 3TIDA 3ZMEA 5C0FA 4DRXB 2WYTA 3PQYE 3AG4C 2DTMH 3DV6B 1K4C