3AG1B

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 280 k
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag1B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag1B02
3T71A 1NIAA 4DPAX 2HX8A 2FWLB 3C75A 2Q9OA 4YSSA 4GP5B 1JZGA 4PCYA 1CURA 1KDJA 5I5MA 2OCCB 2A3TA 4PAZA 2PCYA 4GYBA 3WKPA 3UAAA 2P80D 3KW8A 4E9RA 2XYBA 2BW4A 4AKOA 4A68A 1CYXA 3X1EA 1NDTA 2XX0A 2QPDB 2FQGA 4CSZA 5I5JA 1TEFA 1RZPA 1TKWA 2PPFA 2VN3A 4KO5A 4G7SB 3OMAB 1TU2A 1YLBB 3UABA 1JXDA 3EH5B 2QT6A 2HZHA 1AZCA 3QJTB 3NJJA 3ZX1A 3S3BB 1A4AA 2BZ7A 3WNIA 4KOBA 4P5SA 1GY1A 1BXUA 1SDDA 4YSAA 3H4FA 5A7EA 3WI9A 5AFAA 2BWIA 2PPEA 3FQ1A 5B1BB 2IWKA 1DYZA 3BQVA 1A3ZA 2ZWNA 1J9TA 3NJNA 1MDAA 3NJIA 3NSCA 2VMJA 4AZUA 4YSQA 1MZZA 1ZDSA 2UXFA 1J9QA 2IAAC 1WS7A 2PPDA 1OF0A 1W8EA 5I6MA 4TXVB 1L9TA 2BW5A 3OD3A 1ZIAA 2I7SA 4DP2X 1IBZA 2X88A 1PZAA 3OQRA 5E9NA 4BK5C 1AZBA 2WSDA 1V55B 1JZIA 2B3IA 4UANA 3EF4A 2PPAA 1AG0A 1BQKA 1L9OA 1PMYA 3FU9A 3N2JA 3FS9A 2VSMB 3T9WA 3L45A 4JHVA 1KBVA 4UF7C 1M9WA 3G5WA 4F7KA 1F56A 1KBWA 1WA0X 4KNSA 3MX0B 4GXFA 2VW6A 4HHWA 2UXVA 1ASOA 3T6ZA 1SHWA 3DIVA 4BXVA 1KYAA 2GC7C 5B1KA 2OJ1A 2YEVB 2HRHA 4E9XA 3ERXA 3FQ2A 4AI7A 3TU6A 3CVDA 3PPSA 4JHUA 4BXSV 1KDIA 2R7EB 2VW4A 4A67A 3S3CB 9PCYA 2XVBA 1SNRA 1BQRA 2XV0A 3MBWB 4E9YA 2DYRB 1E67A 2QDVA 2AZUA 1AS6A 4KOCA 1J5DA 2PLTA 3SBQA 1BQ5A 4E9TA 2CUAA 3IN0A 3CG8A 4BWWA 1GS7A 4GP4B 4M3HA 1NPJA 4DP9X 1WS8A 3V9CA 2BZCA 4DP8X 3AG1B 4YL4A 5D4HA 1I53A 3ABKB 2B08A 4HALA 1BXAA 1URIA 3EHBB 2GI0A 4YSTA 2EINB 3FPXA 1OCCB 1AS8A 2XWZA 5B7FA 1TEGA 2DY2A 3N55A 1JVOA 5B3SB 3T6XA 1BXVA 1PY0A 3NP3A 1JOIA 5IY5B 3X2QB 4Q89A 1BEXA 3WIAA 4A2HA 2FTAA 3AG2B 2YAEA 2GBAA 2PCFA 1KCWA 1IC0A 2HRGA 2IDUA 3PAUA 4L0PB 3ABGA 3IEAA 4N4YB 2YAOA 2PP8A 1N68A 2IDQA 1XB8A 2XXGA 1OV8A 2JKWA 2CALA 4RH4A 2WO3B 1NIEA 1CUOA 1N70A 3ABMB 1A4BA 1PZCA 4BWTA 4DP0X 1ILSA 3OMIB 3ZDWA 1ADWA 3SBPA 3ZBMA 3TBCA 5I6PA 1SF3A 4F2EA 4BDVB 1L9RA 2R7EA 3X1BA 1NWPA 2IWFA 2YXWA 4E9VA 3HEIB 3IBOA 2CCWA 3GXUB 3QQXA 2TSAA 2RACA 1SFHA 1SHXA 2FT6A 4EF3A 4YSEA 3ABLB 2DV6A 3NYKA 4G70B 5I26A 1W6LA 2PP9A 3QJSB 3FSZA 3H56A 4F2FA 1VLXA 2J56A 3D12B 4YVNA 3GDCA 3QJRB 4A2FA 1UATA 3QJUB 1QNIA 1SF5A 1ZDQA 4AX3A 3AY2A 4HHGA 2Q5BA 3BVDB 3HB3B 2N0MA 2XUWA 1QHQA 1M56B 1AG6A 2VM3A 1CYWA 4NERA 4X4KA 5I6KA 2XX1A 4YSPA 4JKNA 4W9ZA 1GW0A 2OV0A 3KW7A 2BP0B 3UACA 3DTUB 1HAWA 4G71B 3TA4D 4A2DA 1HFUA 2J5WA 4KO7A 4DPCX 8PAZA 1FWXA 1L9PA 5B1JA 4BWUA 2XLLA 1OE1A 2J55A 2GHZA 4BDVA 3ASOB 2Y69B 1IUZA 4E9QA 3PAVA 2AZAA 2AFNA 3AZUA 1X9RA 2JFCA 4AKPA 1BAWA 2YAMA 1PNCA 1IBYA 1OCRB 5PAZA 1JZEA 2NRDA 2IWEA 1AZUA 1NIDA 1NTDA 1GY2A 3X1FA 1PNDA 2AANA 2BWDA 2PPCA 5ANHA 1PLCA 3FU8A 1KGYE 2GSMB 2I85A 3PLYA 1AZRA 4KO6A 1GR7A 2E86A 4N8UA 4FA7B 2QDWA 3NSYA 1OOWA 1ZPUA 3FQYA 4W1TA 1NINA 2J57A 2BP8B 1W6WA 1L9QA 1J9RA 1SJMA 2HX9A 2YAHA 4KO9A 5EHFA 2EIJB 1IKOP 2CJ3A 4ZK8A 1KCBA 2XU9A 4E9WA 2FQDA 3H4HA 2UXTA 1ASQA 3RYMA 2FT8A 3NJHA 2VSKB 3OMNB 2UXGA 2YARA 5I28A 2XV2A 3IE9A 4G72B 1A65A 3NJGA 2BP0A 3SBRA 4KNUA 1ET5A 1RKRA 4DP5X 4MFHA 2X87A 3FU7B 1L9SA 2UX7A 2H3XC 3EH3B 3NJLA 1PLBA 1AS7A 2ZXWB 2IH9A 2EIKB 3OM3B 4CSPA 2FQEA 4YSUA 1RCYA 1GYCA 3QPKA 1AZNA 3FPYA 4DP1X 2H5UA 1OE2A 3V9EA 1OCOB 2VW7A 1PCSA 3AG3B 4G7QB 1ET8A 4NAJA 1XMEB 2Y1AA 3X1NA 5FC9A 3X1GA 2JXMA 2LLNA 4K9JA 3IN2A 3NSDA 3PXLA 4DP7X 3S3DB 1DZ0A 5D4IA 4YSOA 6PCYA 1QLEB 4WKXA 2QPEB 1MZYA 2EIMB 2DWSA 2YAPA 1SDDB 3DKHA 3GYRA 1GS8A 5I6NA 3AW5A 5TK4A 3CVCA 3PCYA 1WA1X 1EHKB 3S8GB 1NICA 4WTQA 1MG2C 3T6WA 1KV7A 1ZV2A 1JERA 4HCFA 4NB7A 3TBBA 2GC4C 3QJVB 5B7MA 1CC3A 2HXAA 4DP4X 3PAZA 2W8CA 1XB6A 3T6VA 1AACA 1R1CA 1V10A 1WA2X 4YSDA 2PP7A 3FU7A 1ZIBA 1SFDA 2YAFA 4E9SA 1ET7A 2XXFA 3NSFA 5F7AA 1ILUA 5I6OA 2HLEB 1J5CA 4AKQA 3NJFA 4UAHA 5LDUA 4HAKA 4YSCA 1AANA 2YAQA 1A8ZA 3CDZB 3JT2A 2I7OA 1AAJA 2DYSB 5I5IA 1M57B 1NIBA 5TK2A 4G7RB 3S8FB 1GSKA 2BHFA 3CVBA 1PLAA 3QJQB 5B7EA 4M4RB 2IH8A 1AQ8A 1HAUA 1XB3A 3FSWA 4A66A 2YXVA 1JZJA 1B3IA 1AR1B 2H47C 3NJMA 4P5RA 3ASNB 6PAZA 2UX6A 3NT0A 2P80A 7PAZA 3FYEB 3FYIB 5B1AB 1NWOA 3U25A 4QLWA 1V54B 1JVLA 1PF3A 5AZUA 2TSBA 2IDTA 1NIFA 3NP4A 1JZHA 2MTAA 4KNTA 2FJSA 2W88A 2AVFA 2CAKA 2XV3A 2ZONA 2IDFA 4Q8BA 1RZQA 3CDZA 4YVUA 1MG3C 1E30A 1OCZB 4HCIA 1X9UA 3JTBA 2ZOOA 2GB2A 4HCGA 3AG4B 1GS6X 1J9SA 1PAZA 2DWTA 2MRYA 1FFTB 1A4CA 3WKQA 1JXGA 4YSRA 2HX7A 4A2EA 1ID2A 1OE3A 5I6LA 1AOZA 3WG7B 1E5YA 4A2GA 1E65A 3TASA 2CBPA 3CZUB 5F7BA 3WNJA 4DP6X 3EH4B 5PCYA 2BO0A 5D4JA 4QKTA 3UAEA 4HZ1A 1EZLA 4GY4A 2EILB 3ZIYA 1AIZA 7PCYA 2FT7A 2FQFA 4HIPA 1ASPA 1ETJA 1BYPA 5AKRA 2IDSA 3FSAA 1NZRA 3UGEA 2YQBA 3SQRA 1PZBA 1BYOA 1E5ZA 3FSVA 3NJKA 2BP8A 2FNWA 2VM4A 1JXFA 1T5KA 1FA4A 3FT0A 4GP8B 2GIMA 2WO2B 5B1JC 4ENZA 4DPBX 4FAAB 1NPNA 1WAEA 3UADA 1JZFA
chains in the Genus database with same CATH superfamily
1F3RB 3TCTA 1SQQH 4ECNA 2J4WH 3WN5A 2BVUA 1GA2A 4NNXA 3P4OB 1TTAA 3SDCA 4G8FB 1G7HA 4NJAL 3WTSA 3IAYA 5DS2A 2P5PA 5KVFL 1URLA 2B7DT 2XIBA 4G2AA 3GS0A 3CFUA 3OF6D 3OPZL 4JR9L 4W6WB 3SE4C 2WHVA 1VFBA 3OGOE 4N2FA 1T21B 5TQ0L 3HW7A 4CC1A 4QRRD 3X1EA 2OR9L 3TVMC 3PQYE 2EE0A 4ZZFA 4JFDE 3FAXA 3W7XA 4LH6A 1LWRA 2XXCB 2CUMA 3GMRA 1RZPA 2YZ8A 1I1AC 2CG9X 4X1IB 5BRZB 3RU8L 4G6ML 3JT0A 5FB8B 3OMAB 1LWHA 1I9IH 1EZSA 1QASA 2XG5A 1DO6A 3V6OC 4KDTA 4JFYA 5EU3B 1CU4H 2EIDA 3X14B 5IOKA 4UINH 3T3ME 1IC4L 5AVYB 4L3ED 2AEIT 2A4ZA 4JPVH 3RHWF 2BVEA 3FQWA 4HX1A 3UZEA 3ZK0A 1K72A 4H88L 4L4VB 4ZFZA 5HGGS 4LDEB 4V1DB 3W0WB 2R8SH 2W81C 4QOKE 5B8CB 5C2BL 4WIQA 5EULV 1Q3EA 2N1TE 3QBTB 3VWKD 5KBKA 3BKYH 5GS1A 1HHGA 2CH7B 1C1EL 4AV5A 5I76A 3II2A 4MZ2A 1D3CA 1D5IL 4M6OL 1OXYA 5D7JD 3BDXA 5B38G 4RFEA 1Z5LA 4FFVC 4X80H 2IAAC 1RPKA 5FA4A 2N74A 4MVQA 3E8BA 3C5XA 4NQXA 4TXVB 2XY2A 4IBWA 3F5TA 3ATDA 2DMGA 2KZ1B 3MR9A 5KSUA 1UD5A 2ESVB 3L4VA 4PY8J 5F96L 5I1AA 5SWZD 4PP2A 1JX9A 4QUOA 4UIKL 3S4SG 4XE5B 4R3SA 2DEYX 4Z5RB 4BSWB 1ZHLA 1Z7JA 4PW4A 1KIUB 2VR7A 1IC7H 2Q3ZA 2FUTA 1CGUA 4OKVB 2X2UA 1SY6L 3L5XH 3QJFA 4JFXA 3SE4A 3NCJL 1O9WA 3G9VA 3ARPA 4OF5A 4QXGH 5CSBA 4LHQB 1XQ8A 2GUOA 2BSSB 1MAKA 1M7DB 1CPYA 2A74B 3TVMA 3VMPA 3TEUA 1SM3L 2HLDG 4UV8A 1RIHL 3KXFE 2VITB 2XJLA 1I1AA 1I3UA 1Q0YL 4XMWA 3FZUC 3HG5A 4NO2A 4KKBD 4R0LC 1CFNB 1WCBB 3TP4A 1LO4L 3MCLH 4MXVF 3I5DA 1NAKH 5JQGA 3V6OA 1S9YA 4BJLA 3WJMA 3BH9A 4PJ5B 3GBML 4BE5A 5HGHA 1FGVH 4YDVB 1QRNA 1D5ZB 3ME0A 4NO0B 2GJ6D 3UTQB 3IN0A 3N0PB 4OLXL 1RSOA 4ANVA 4TN9A 1OTSD 1NCDL 2VDPL 2XTLA 4U33A 1LL1A 4EDXA 3IMRA 3TGUH 4F8NA 4OM1L 2P5EA 3IFOA 3ZE0B 3MA7B 1WB7A 3BP4B 2DQDL 3CZKA 2ZCLH 3ARRA 3K5OA 5AW8B 1FN4B 2VLJD 1AS8A 1OY3B 2BNRA 4AXWA 1IAII 1PY0A 3E6FA 3NP3A 3FO0H 3Q44A 3NCBB 3T8VA 4DUWA 4OTXH 4W9GC 3LEXA 4Q89A 3LNMB 4GQ9L 5F7YC 4FHJA 3D30A 1K33A 2FTAA 1ACYL 3D3IA 3TO2A 3TT1H 3MCKB 4JL2A 2E6QA 4WKZB 1IEAB 1TVHB 4XO9A 3JWOC 4PG9A 5FYLD 4HEPG 4ABVA 4RZCA 3DXRA 3P40A 4OF0A 5C07E 5DRZB 4DR5B 1DFBH 4LF7O 1S7WA 3VXNA 7CGTA 3ISRA 3EDKA 1BHAA 4MMZA 4PD4J 5LBSH 3RVTC 2VXTH 3JD0A 3SN6N 4DUYB 5KS9F 5I15H 3TPKA 4CNIB 4WENB 1NBZB 3P77B 4X7TA 2AHYA 4U3FH 3QDHA 3KMDA 3LEVL 3H9HA 2AK4E 3GHBL 3IVKA 4DZ8B 1L9RA 1BD2E 4LLDB 4EUPA 3FUIA 1KJ2A 3S3SA 4K35A 4DVBA 4QY8B 3D4CA 3IBOA 4LKCB 5DS8B 1JGDB 4MWFB 2DBLL 3JWDH 4P3WA 4Q6IC 1E4WH 1ZA6B 2CLVA 3D3VA 4KPHH 3MVSA 3PDOA 5D2NA 4R0LA 4RGMB 3E2HB 1R19A 1IGML 2FT6A 5D9SB 2RCSH 4Z7WB 3D39E 1OT1A 4WI2A 4H0IA 3GZOA 3GBNH 1N34O 4E5XA 5E2WL 1YCSA 2CDGB 2DPKA 5IFHH 1N5AB 3LKQB 5IP4A 2B2XL 3SPCA 3PWUA 3QEQD 4G80B 1A2YB 2Y7SA 4AILC 1MJJA 4C59B 3AY2A 2O61B 2VZ1A 3DSNA 1LILA 1MRCL 1YYCA 1MFUA 5EU4A 1LNQA 4B27A 3CMAV 3IU3A 3OAUH 3OL2A 2IH3B 5EN3A 1I8KA 2X9WA 1UXLA 1FL3B 3IXTB 4MAUH 4FGMA 3ZBHA 4J3OH 2OYMA 4PJFB 4Z95L 4YE4L 1GW0A 3M8AA 1E2WA 2EIZB 3CHSA 3GSNL 4KHPB 2AGJH 4NC0B 1SXSA 3WXWH 2FYYB 5MENA 1A7PH 1A21A 2L04A 2V37A 4QO1A 1K8IB 2L7JA 4BZ2A 5KX5B 4LSVL 4E41E 4MTXA 2CKNA 5CZXD 3PWLA 4HGMA 3N2GA 4DRXB 4HG4J 1LWJA 2IADA 2XLLA 2IWGA 3BSHA 3ETBJ 4PLOB 1QUPA 2VZOA 3FOMA 5IMKB 2QSTA 3E8GA 5HDOA 2X9YA 2MPAL 1CDHA 2B5IB 2HJLA 2IXQB 1E7UA 2AZAA 2JVUA 1X9RA 4N2EA 4LLMA 4QHPA 1JHKH 5F70A 1JZ4A 1J95A 3UTPE 4JFPA 3ARYA 3VJ6B 1OCRB 1ZSDA 3RKDD 3ZE1B 3CSXA 1CLZL 4RCAA 3UTZA 1JVKA 3GHEH 1M1XB 1HNWO 2AEQL 5J2TB 4MD4B 1CTNA 1U8NB 2P8LB 2M8XA 4XB8A 1NIDA 4R97C 2ENQA 2OL3A 3B7SA 1J05B 1G7JB 4JDTH 2ED6A 4E2LA 4AK1A 4LCUC 5KVEL 4RMUA 1MLBB 4DV5B 1KBHA 3O3DA 2QGDA 4Q6IA 4XNQA 5D6CA 3QCUL 2PMZA 4GRMA 4O4LA 1OB1B 1OGTB 5BRZE 3MNZB 3QQ4B 4X5QA 3VFRA 2FHCA 3JUYA 4G8IB 3MRQB 4TQEH 3MZTA 1LO5A 1AQDA 5C09D 1M05A 5D7KD 4AIZB 2Z8VC 3B2VH 4TOYL 5A9GA 1N7MH 35C8H 2JV6A 4IOFD 4X20B 1FFOB 3U0TA 2FT8A 3DROB 2UXGA 2BOCB 2EIKC 2WXHA 1QCEA 1PNKA 2D03L 3T77B 4OBSA 2VABA 3SBRA 4DKFH 1L5GA 3F85A 4LDLB 4L4VE 2XN9D 4V1DE 1NAMA 3EHBD 3FU7B 4N2DA 5INDB 3W0WE 4GKSB 2IW5A 3BAKA 3VO0A 1UVQB 1F5WA 2DLFL 2UU9B 3C2AH 4GUPA 5IB1B 4OFYA 4OZ4A 2EDHA 1KJ3L 2IH1C 1GYCA 3PY9A 2JJVA 3TJPA 5GJSL 3MACH 2IG2L 2R2CA 1QBMH 1XGZA 2G75B 2IFFH 3CPLA 4CC0A 5ESQA 5FYKD 3ECBA 1BBDH 3UH8A 4NKOB 4A6YA 3OMZA 4OUUA 4P5KA 4PDRA 4NAJA 1XMEB 2OTPA 2F8IA 1QVOB 3P69A 2ESVE 5FC9A 1HCZA 1AHKA 3PGCA 1CXHA 1KGXA 3WLBB 4BK5A 2R69L 5IJ0B 4K9JA 3AK1A 1KNOA 3O41A 4BK8A 5C7XL 5JOFA 5LGJA 2ED9A 1LE9A 4PUBL 3SKJH 3LUTB 1YUHA 2OI9B 1YO4A 4WK2B 5GGRY 3VMOA 3WS3B 2MTPA 2QPEB 4WHTB 1B9KA 1P2CA 4MJHA 5FNVA 4QJ4B 3SQOL 1G0DA 2PWGA 3HLAB 4X6BA 3GXPA 5IMOB 4W9IC 4KTDL 2JS3A 3NRQA 3FCSB 1IIIA 4Z7OB 3QNZA 2FEEL 3ULUH 1NANH 3GIVB 4MVZA 5CBAA 4W81A 3DRQA 4PIRF 3RDTB 3OAAG 3MA9L 4JYYA 4W9FC 1RXLA 3ZRCC 3MMEA 4YIPA 4O2BB 3SYOA 2P48B 4HDIA 4JRYD 5K9QI 3FCGA 4PJ5E 1HTYA 3KDPB 1XGTB 3GMMB 4OLZH 5B39B 4PJ6A 1ET7A 2R4RH 5JW5A 1IFGA 2XXFA 4AQZA 3CQQA 4LPWA 1NJ9B 1GOHA 3PGDA 5DURB 4F7TA 4LCIH 3QRFM 4OB5L 4KTGA 1QHOA 5GGQL 3DHUA 3ZE0E 4AKQA 5FYJH 1KC5H 2LE9A 1K2DA 4DV1O 4UAOC 1PG7H 1U3HB 4O2CA 1SVZA 4D0BB 1BAFH 1D9KB 3WEBA 4GRLB 1AHMA 2QEJA 4X0KB 3I2CH 1YY8B 1I82A 3MJWA 1WE5A 5ESAB 1KEMH 5DI8B 1Z9SB 2GBTA 1SLXA 1KZYA 2I7OA 4Y2OB 3UP6A 2X40A 4XBMA 2NQDA 4WFEA 3FU0A 3WDIA 4G7RB 3I6GB 4LF8O 4FZ1A 1T5WB 3NPSC 5AOZA 1DUZA 5IB4A 5C1MB 4WZ9A 5I1LA 4N28A 5CUSH 4KJYB 5FDWB 5K69A 3RTQD 3D8CA 4NDMA 3PWNB 1B2WH 1ROCA 2QKCA 1RUAH 3FSWA 5E23A 5AOMA 1N6QH 4RA0C 3ZN1A 5HP5A 2NSXA 2F93B 4Y9BA 4JMNA 1K8AW 4NN5C 5AW4B 2Y7LA 4G6KH 1SYSA 5CU9A 2HFEA 4JI6B 5HJ3A 3WL9A 1AJQA 1QEWA 3VQ2C 4BFNA 4A7SA 2QQQA 1FDLH 1DANT 1A6WH 1JTPA 3B9AA 4HEME 4OCXL 1TGOA 2Q68A 5B1AB 1A4KA 3TNNB 3HKZA 3O2VL 4B9CA 1Q9WB 4Z7WE 4HIEB 1X59A 4JI5O 5E4EC 3DURA 1I8MB 1C08B 2AZ2A 4NUPA 1NIFA 4ZI8A 3WYRA 1GCYA 2D3JA 4XMVA 3UOAB 3HG3A 3D87B 4HIXL 2WLLA 2WQSA 5HDQL 4DN4L 2AVFA 2HVKB 2FR4A 1GRWA 1BFVL 5E8PB 3U6XA 1MLCB 4NXMO 1NGXB 2VRQA 3ARBB 2F1EA 4QHNB 3AY4C 4WHCA 4F7EA 4B5ZA 3KVPA 4A7VA 1KCUL 1E30A 3MLUL 1BF2A 4D8PA 1XNQB 5C0RH 3EYOA 3VA2C 2CLZA 2JGDA 1W8OA 2UYLB 2YO3A 3FT2A 4PJFE 2X2IA 4KHXH 2EILC 3WG7B 2E6JA 1LP9B 3BHBA 4FQ2H 1NUDA 3WMSA 5IIEB 3TF4A 3ULVF 3V5HA 4DESA 2Q1EA 4BAYA 4XP9L 1UCBH 5F0MB 2P4AB 4LLVB 2VXVL 2QJDA 1H6EA 5C0CB 5JO5A 4ERSH 1UYWH 3P9LA 2GSGA 2DQUL 3RYIB 4F7PA 4XI5D 4R6ZA 5LBQA 3MRMA 1WH0A 3FN0H 4X99B 1JNLH 2W9EH 1E4JA 2BK8A 2GW5A 4K7PH 5E8NB 3ETSA 4YJ2B 4L87A 1MIML 5IVXA 2CH8A 1FV1B 3U4KA 1P4IL 3HKDA 2Y6TE 4Y5YC 3GXFA 2PW2A 5T3XL 2HKAA 5AKRA 5T33H 3L70H 2NYYC 3L3IA 5KHHA 1FGNL 3ZE1E 4QRPB 2AXGA 2JB6B 4JFHE 4QRTB 5KYUB 4MT8A 4GLXA 1L7IH 1KENL 1YYLL 5LXTA 4K5OA 4XCFH 1JV2B 3K71B 1FAKT 4LEEA 5HGAB 5KHGA 1DE4B 3E83A 2V6HA 1IBKB 1MWOA 3CLEL 2WN2A 4BQ6A 3WB2A 3H7BB 3K04A 2FATL 2QQKH 3B09A 2QHRH 1BSMA 4AQYO 4WFHA 2HX8A 2IJHA 4ZRGA 4FFZH 1E6JH 1KYDA 1RZIB 3ARGD 2DIJA 3DOIA 4J12A 3T1WA 4CS4A 5LGTA 4YSSA 3B3IB 1SOKA 4X6DB 3DYMA 2YS4A 3PE9A 1RU9H 1HE8A 2XYBA 3EO0B 3OKNA 3AY4A 1VSCA 3VI3B 3EXAA 3AM8C 3BUIA 3BPNB 4XXCC 2FIKA 2APWA 4J11A 5EFIB 3D33A 3B8NA 3ENEA 2VDQH 1YEIL 1GJIA 1KU9A 4EN3B 2QBWA 2BVYA 4JREC 1DQJA 3MRJA 1WZAA 3VB9A 1HHJA 2X6CA 5CA0A 1TIUA 1IIKA 2BOBB 2WLMA 2CO6A 2HZHA 3H3BC 4X7SH 4ZUWA 1GZPB 4FZ0A 3CUPA 1Z9LA 3C12A 3D18B 4HD5A 3B2DC 2Z31D 3U9UB 4KOBA 5IHZA 1BXUA 4HC1A 1JPFA 1R34A 4UT6A 1NC4D 1T80A 5IF0B 4YSAA 3ZRVA 3CVHA 3SPGA 1J8SA 1ZEAH 4BH8A 4BQ9A 1AKJB 4MNHA 1UA7A 2RFXB 1QABA 5DEDA 3QXAA 2DICA 4JY6A 1F8TL 1MDAA 2APFA 3RGVD 5LXGL 1CFQA 3HZYB 4MA7L 1FXKB 3JV6A 3NR7A 5DUMH 3EXJA 1ZAGA 5ADPH 1FVEB 1WS7A 2XQYK 2HH0H 1WLEA 4MCZB 4ACTA 4BZYA 3GWJA 3CXDL 4K0KB 1XDTT 3KGSA 1MHCB 1LXMA 2I7SA 4UQDA 4Z7OE 3DA0A 4LSQH 3IBEA 4G1EA 4MB1A 1YY9D 4TL5A 1AZBA 1VQKV 2LVEA 4OZHF 3CFBB 2UUBO 2R9HD 2PGGA 3BGAA 5AW3B 5GHWL 4YLCA 2MQ3A 4U7MA 3QUMB 3CSBA 3N43F 3WGUB 2IDCA 1RP3B 1ECZA 3I75A 1EX0A 2X1QA 4JO4L 4EQ2A 3ZMTA 4KNSA 1LEGA 4XXCA 2ITEA 5BMVA 1UM4L 3LAFA 5I9QB 3T09A 1Q5OA 4QXUL 3U7WL 3T6ZA 1A5FH 3KLKA 3R8BB 4JQXC 5D8JH 3CU1A 2V4DA 4LNUA 3SSGA 4RNRA 3U6RA 4ENEC 5FLVA 4JO3H 3N42F 1SA0B 4OCSL 4OLUH 4Y19A 4IRJC 2NY2C 4MYWB 4BXSV 2Z92B 2X6VA 4O4JA 2Y3NA 3MBWB 4NN7B 3UMNA 1WZ1L 1BCCH 2O5XL 4CMMB 4Z3TA 1KPVB 1URFA 5B3SC 1BQ5A 3MGOB 4YFLI 5ELIA 3PHOA 1OAYH 5DQDL 5CNHA 4YX2L 4C57C 4D0DA 4M48L 1JSYA 1QQDA 1LNUA 4JRXD 5TISZ 3V0DA 1VF6C 1BXAA 1MVUB 5DJAB 3WD5L 3BKCL 1F4YL 2P8MA 2XWZA 1GC1L 4RAIA 4UCRA 3HNTL 2OMTB 4FQ1L 1F90L 5DEGA 2Q0AA 5KBNC 2P44B 1DJHA 4WBNB 2Q7YB 2IV9A 3BQUD 1ZY9A 1S4IA 3WTUA 1V7NL 3KCPB 5ALCH 2DI9A 4JAAA 5CGYD 3Q5OA 3ZU8A 4U3CA 3O0LA 1OSYA 4WO4B 1TF4A 4W68A 4WV1C 3OLEA 1KB5L 5HJDA 2ROYA 1AQKL 3JBG7 3RWGA 3P02A 4Z0BH 1VQPV 4NRYB 4YNYA 1ECYA 3G67A 3KWVA 4YHPB 1DL7L 4L3AA 5DEFA 3TTSA 3CRAA 5AZEH 5K33A 3SBPA 4YR6A 2BRRL 1MRFL 3BWUF 5FW8A 3MRKB 5IBTL 1CBVL 5DK3A 3RWCA 1Y1UA 4LC1A 1DBJH 3V0WH 3QDJB 4GX5A 5CHNA 3EAKA 4E0RA 3JARB 5CBHA 4JQXA 4AGOA 2PXYC 2BHUA 3I9AA 4ZS7L 4H5SB 1M1SA 4FHKA 2ZKHL 1SEBA 3BDYH 5DZPA 1T0OA 3VXUB 1ZLVK 1QHPA 1SFHA 2Q73A 1SHXA 4N90D 1WPXA 4YH6A 4G3YL 2J8UA 4PJEA 2C1OB 3MHHC 5EO1A 1JE6A 4MASA 1LP9E 1DJGA 2VQ4A 4HJSA 1H0DA 3BO8B 5F0JB 1A7RL 3TVMD 4DZBB 5HHMB 1MCBA 4FQCH 5F6HJ 4AGMA 1I1AD 5C0CE 3SJBC 5LLIC 1DQLH 1OQOA 3IDMB 3MLZL 3SJAC 3VD4A 4NGHH 2JI1A 1HYRC 1XSOA 1VF6A 3K7UA 4FQHB 4DW2H 1U8HB 4HKXA 4URKA 1T89C 2NUPB 3QP3A 1R33A 1QRND 3CN3A 4NKDB 1THZA 4KKLC 4G6JH 5C0AB 4W9ZA 3LRMA 1VFAA 4QRPE 3WU1A 3CCQV 2BP0B 2BX5A 2ETWA 1K8DA 3E9UA 2P5ED 4OCRH 1RY7B 4AIEA 1QBAA 2N05A 5T5FL 3QH3B 4UB0L 4HAGA 3L4WA 1BQHB 2BNRD 5CD5C 4WV1A 5AAWC 3QZMA 2GTWB 4H37A 1H5BB 3J27A 3LJ3A 3MRIB 5I16A 5HFMA 3RBGA 4DAGL 1KP2A 3IJHB 4ODXA 1OCWH 1XH0A 4FFVD 2PTMA 4ONFH 1KFAH 3VOUA 2VLLA 4YXWG 3L54A 2R29L 1JZEA 5LAXB 4M8QB 4PJCB 4X6DE 2IWEA 1F4XH 4UMSA 5ICXA 4L8SC 5KSVB 1JF5A 4F7MB 3VI3E 4GSRA 4OFQA 3VE0A 1PNMA 2PXYA 4GAJH 4MZRA 4R8WH 2X4QA 1S5IL 1GR7A 4G82A 3AXHA 2VXUL 1G6VK 4PD4F 1ZPUA 4AQEB 3ZUNC 2NNAB 2DOCA 4A7TA 3MXWH 3JD4A 1DJZA 2G5RA 1SRYA 4ZK8A 4B9PA 4HSQA 4WWOA 3OD4A 5IT9N 4YN3A 1CS6A 1R5IA 3A23A 3LRHA 4PY8I 2YARA 1A22B 1IAIM 4K7FB 3D3VD 3FZUD 5BV7L 5C0FB 1ZHKA 2Y2WA 4JO2H 3GSWA 4K3EL 5E08H 1MCLA 4GQZA 2O57A 4ODWA 1X5JA 4K8ZA 5F0LB 4JPRA 1MI5A 4PYHA 3VFOB 4AENA 5T1KB 4AJ0A 2ODMA 4G9DA 1RIVL 1T89A 4X98B 5AVSB 2BJMH 1J5OL 2J1ZA 1ND0A 2BC4B 4DR4B 4A7GA 2CQVA 4IRZA 2CIKA 5FO8A 1E9QB 3PV6B 3QI9B 3Q8FA 1I1FB 2C9XA 1U3JA 2ZG2A 4KAQH 3U0WL 3FNKA 4ESKA 2WBWB 4LB8A 4HIJB 5MHSD 4GAYA 1FLRL 2YGPA 4FP8L 4OD3L 4CDGC 5AAWA 2DQTH 2Z0UA 1O7VA 3VSTA 2YA0A 5FLXN 4IDJH 1SQBH 3HPLC 1GGCH 4PJXB 4DSYA 4PS4H 1N36O 4D7PA 2P47B 4JZJB 1DZ0A 4FYQA 2Q7EA 5D4IA 2F8VA 4F9PA 3F7LA 2DQJH 1DQIA 2ZDIA 1HXYA 1RZKL 1RUPL 2FGWH 4KK9C 4L8SA 4P23B 3QIWB 3ZTEA 2KSDA 2AEPL 5I23A 3RVTD 3ETBF 4F92B 4I48A 4E42B 1Q94A 3FTWA 3DYOA 3TCLB 4ASUG 3QFDA 4NB7A 3KDMA 3VXPB 1K5NA 4GG6F 5FK9A 4S0TD 1DR9A 4KX8A 2WNGA 1HWGB 3IC7A 3NEXA 3S4SA 4HIIB 5TD4A 5KUKA 2UV3A 4Q9QL 5EEYA 4NPKA 5DJ2A 2ZT9C 1AQHA 4I2XB 3W1ZA 4BR6A 2QTOA 1MCKA 1NGYB 3MHZA 3JYCA 4E68A 3TK1A 2ZSWB 2GIYA 5ADOH 2EC9T 1G1KA 3US1A 5LQBL 1SDYA 2AQ2A 2V5YA 4N0YH 3ZIAG 1MCWW 4PRDB 4GW1A 4QRRB 5HI3C 2X7LA 4X66B 4IOSA 1F11A 3AT8A 5KG9A 3HI1B 3NJFA 4MQ7A 1XVSA 3GPSA 3ARWA 3GC3A 3L6FB 3EOBB 4JDZA 2EAEA 4JQIL 5BVPL 3GUTA 3EGSA 1EJOL 1FZKA 1GYVA 4H4NA 2VKXA 2GPZA 2FD6H 5IFAH 3OZ9H 4L3EB 3GPEA 1VQ8V 2EDKA 1X44A 4N20A 1QR1A 4XVSH 1R3IL 3SO3C 5J9PB 3HPLA 1AR1C 4OFYD 1I9JH 3GM8A 2BHFA 4G8EB 1DVFC 1QBLH 2BE3A 4M56A 4KXBA 5IB5B 1KTKE 1XSKA 1AGDB 3VWKB 3WE1A 4RMTA 3WKML 4F33A 2GT9A 1B3IA 4ZTPH 3KL5A 5D7JB 3QO8A 2H47C 3CFEA 4FCHA 3HHSA 4N8VB 5L9DH 3QDJE 2QSAA 2ZNWA 1PP9H 3RQ3A 1FFNB 1H3PL 2ICEB 3BGFB 3VFSA 4OM0H 3QG5A 5SWZB 2UZXA 1JYWA 1DQMH 2PTTA 4K3JH 3U25A 2Q76B 2J1WA 1UWYA 2COQA 2VZSA 3VXUE 5JORB 1ES0A 1NKOA 3JYBA 4NKMA 4OLEA 4YGVA 5DJDA 3BEVB 3NP4A 4YZFE 4DW1A 4RRPM 5JHLA 5L6YL 1AHWB 4PRPD 5HHME 3AG4C 1NGZB 1XCTA 4K9EH 2YK1H 2IDFA 4Q8BA 4Z78B 1YHPA 1FIEA 2VJ0A 1NBYB 2D2CC 4FZEH 4UB6Z 1KCRH 3L5JA 3UGXA 1WPCA 1SZTA 4NHUA 3AS2A 4HWNA 2AW9A 1OCZB 1SHMA 4U2ZA 2ZCKH 1JZ8A 4K3AA 4DR7B 3BN3B 4AMKH 1E43A 2G0LA 4R4BA 3G5YA 2HMIC 5IFJB 1HXMA 4OAWA 4WFFE 5C0AE 1J18A 4WHYG 4A2GA 3FQUB 2QM7A 3TBVB 1O7SA 3BPOC 1VESA 1O7DC 4I4WB 5HHNB 1HOCB 2GJ6B 1W8NA 4NZUL 1TKWB 5F9AC 1HNYA 5K39B 2OIGA 2F7OA 1B88A 3ARVA 3HC4H 1TYEB 4IJ3C 3RWEA 3BFQG 5D71L 3UAEA 4L8CA 1DVFA 1CGTA 2HG0A 5J1SC 5DLLA 1KXHA 5DDHB 2VLJB 1AP5A 1RH8A 5DT1H 5LWYH 5F7DA 4RA3A 4AT6B 4M62L 2EYRB 1R5VA 4OZGB 4WFED 4PJCE 2C9RA 4G6FD 4JY5H 4H13B 4KL1A 1VFUA 2IQAA 2MEJB 4DN3H 3LMJL 2X4TB 4X7DC 1XBRA 3RX9A 2E9WA 1MELA 2YBRB 1ZLSL 4NI6A 3BVXA 4U6XB 4MVOA 3RDJA 4KVPA 4OCWL 4K3DL 4GPVA 5BZXA 1Q90D 2I5YH 4JUTA 4XT1C 4DGVL 3BUPA 1PYWA 2YPVL 2VDQB 5K9JL 4X5RA 4J3SA 1J0JA 2HLFD 2BH0A 1GYAA 3H1HH 4WGVB 2FHFA 4N2IA 1CURA 3IJYB 5I1DB 3AADB 3C08L 4ZIBA 4LEXL 4JI1O 2DM2A 1JUFA 2YGOA 3WMPA 2J2ZA 1KIRA 4XHQA 5KAQF 1A6AA 1NDTA 4O5LL 2L3BA 1UZ8B 2L4OA 4YXHL 4GBXC 3E8UL 4HD9A 5E8OA 3IDYB 5TE7L 2DLGA 1KTDA 5E70A 3ZRWB 4YXKH 3C5SB 2Z8RA 2I9TB 1HILB 1ODAA 3N0AA 2OMYB 1L3WA 2UWEF 4C4BA 3EJJX 3QEQB 2LV4A 5HYJD 3D69B 5KSBF 3KPRA 4TSFG 4GX1A 2ZWLT 4GUCA 4PJXE 4QTIH 5LYJA 2LTQC 3T1YB 2HG5B 4HGWB 2PPEA 4GUOA 1HZHH 3LV3A 2B3RA 4X6FA 1OGAD 1ZT1B 5T3ZL 4IU2B 1U97A 1JGEA 1ZT7B 4BQBA 4LLYA 1BZDA 1S9WA 1WBZA 1W72A 1IU1A 1WRFA 1WBYA 1FHNA 2W94A 2ADYA 3ZZSA 2AS5M 2UXFA 3LEYH 1J9QA 5EUOF 3UT5B 1H15A 2EZ0C 3ZEDA 2QKIC 3GMQA 4LIQL 3FUNA 2CDFA 1SMOA 2W65A 2AJSH 3JD2A 2YMXH 3OD3A 1ZIAA 4U1NA 3KLLA 3KWUA 1I0HA 1K3EA 4Q6YA 1HQ4B 1E2ZA 1EEZA 3KHOA 3WIFB 2HFFB 5ECJE 1LQBC 3JAKA 4RWYH 5KS9A 3OUSA 5LGHH 4I2XE 4FLZA 3PRZA 4TULL 1HT6A 1KN4H 2NY5C 1NEUA 4MYPA 3UC0L 4NUGL 1NMAH 3UO2A 4UF7C 4LAQL 2JGUA 1SPDA 5LMUO 4WFHD 1DN0B 3GO1H 4QRRE 2R2EA 4BKSC 2V7QG 1JWMA 3G80A 4QGYA 4IBTA 3QRGH 1RULH 5B1KA 2W95A 2AJ3B 4PLJC 3H9YA 4E9XA 3SKOB 4LPYA 2V17H 1WVZA 5C09B 4LU5H 3ABKC 1S0VA 5FF6B 5GGTL 2QWNB 1SNRA 3OAYK 5HJBA 4F80A 4ONGL 2AABH 3L5WA 4L3EE 5FM5M 3B8YA 3R06B 2CK2A 4WWKC 3MNVB 3QQ3B 1XXFC 4J1UA 3I02B 1I53A 2IM9A 1PDKB 1PQZB 1N6VA 2XN9B 4IHOB 3EHBB 2VR8A 5IQ9A 5TGBA 4EUPH 3FPXA 3ZQWA 3JD1A 2DY2A 3F7YC 4RUFA 3UQ8A 3JTSB 4HJIA 1FNHA 5CB4A 5A6LA 1KMGA 3B6SA 3TEYA 5J0BA 2BVQA 3O0RL 3UERA 3UBXB 1XAKA 4NO3A 3SYCA 1N8ZB 2EDLA 4NIKB 2F95B 2X70A 2WAMA 5FO7B 2DQ0A 5A16B 1HDMA 2QKIA 1TJXA 2EDNA 1IC0A 3FUEA 1L6XA 1DSFL 2NYYD 2PI5A 4MBRA 5SWZE 3MOAH 2VDML 5I30L 4X9FA 1AI4A 2YD5A 4TLUA 1OV8A 3BGMA 3WIHL 4HUKB 2WO3B 4B3MO 1PZCA 3K6DA 3BZFA 5F1SA 4KHTH 1ILSA 2FJHA 5IW3A 3TH2T 4GAAA 3EYUL 3NCYS 3N44B 2W0PA 3JVGC 1GJUA 2K1MA 4HF5H 4MX7A 4NNYA 1BJ1J 1OB0A 2YXWA 1BF8A 3QJHA 4ZUSB 1CR9L 4ABQA 5AVQB 5JIPA 4I18B 2I07B 4XZUA 2TSAA 3N41B 4XXDA 1ETA1 3FOLB 2VN4A 1A1OA 3TBTB 3GXIA 5EIBC 2J8OA 4QYOA 3VH8B 4JRYB 3U7AA 4KQ4L 1DJXA 1LD9B 4P99A 5AWNL 4OX9B 3FFCA 3FSZA 3H56A 5I2IA 2OS7A 3P2BA 4OSUL 3K03A 5F89A 1RZ7H 4M7LH 1OEZW 5KSAA 2GFBB 4LO9A 4WWKA 2GJ6E 5IJVB 2B5UA 2AAVA 3TO4C 1M53A 1ZSHA 2IVFC 3LIZA 4HV8A 3REVA 4Y19D 3BUQA 4JKPH 3QRBA 4NERA 5I1IH 5JXAH 1VCBC 5LO7A 2VLJE 2OL3H 3HC3H 2VDNL 2ZINA 3F7YA 2P3YA 4PS3A 2XX1A 4P05A 1A64A 4JKNA 3L7FB 4U1IB 1T5XB 4NQEA 5E5MA 4OZGE 5E5UB 5EU6A 5F88B 5H37G 1KTJA 3B9VA 5CJXA 1U8MA 3ALWA 3L5IA 2R0ZH 3QS2A 4WNQB 5MEQB 3MROB 5KYWA 3QUHA 5K9OA 4DGIH 5AB0A 5TPWL 1DBKH 3GB7B 5IHWA 4ODHH 5I0VA 3G71V 1F3JA 4HS3A 3HVNA 1GGIL 1OP9A 5FYLE 2WVSA 3CLFH 2PNDA 2P7TB 3ASOB 4M1DH 2CJUL 1JHTB 3DJ9A 3UROR 5GRYA 3FQRB 3PAVA 1RIUL 4P3DA 3RTQB 2FBOJ 2YAMA 3VQ1C 1EA9C 4F2MA 4HWUA 1TAEA 4GKJB 3D25B 2WBJC 2KT6A 3F6IA 4HISA 2XAHA 4JHBA 4NRXB 4O9HL 2A73B 3QVNA 3RRQA 4ES8A 3LRGA 2PYEA 4F5CA 4Z76A 3HZVA 1AP2B 4KFZC 5ANHA 4LOVA 1PLCA 1HEJC 2J73A 2PCPA 4Z77B 1AH1A 4MDIB 1MXDA 3C6SA 2WLNA 3QFGA 2G5BA 1PG7W 4JJ5A 5EUKA 3VGEA 2QGBA 3IRCA 2XA8L 1LQSR 3EBIA 4M3KB 5EC2C 5IG7B 2K9FB 1SUHA 3UG3A 4WUKH 1P5UB 3Q1SH 3UPAA 1J88A 5KBLA 1PLGH 3E9TA 3HRZC 1IXMA 1NM9A 1PL3A 1XGYH 1MUJA 3NJHA 1VA9A 1S7RA 4YHZH 4J39A 3QEQE 1M9NA 3MLWH 4ENED 3TO4A 3OX8B 2VLKA 1G7LA 2F18A 5JW4M 1O6SB 3TESA 4NQCA 3HE6C 4J41A 2NY2D 3LSOA 4IRJD 2V9UA 4MFHA 4NZRL 2ADGB 2VISB 2Z91A 3S34L 3ZL4H 4EXPX 1B0WA 4P59L 3JV4B 3PJSK 2Q2LA 5BZWB 3H54A 1AILA 4ODUA 2L7UA 4BFEA 3TZVC 3LD8C 3UJTL 4PWFA 2E5LB 3JWNC 1DTOA 5IHHA 3VGBA 4DV6B 3QUGA 5JA9A 2ZCHL 5IKCA 4PCKA 4XO4A 3MRGA 3S3WA 3ULVC 2UVEA 3AWGA 1XOUA 5IJ9A 4FMTA 4QRQB 5DF0A 5L0QB 1T66C 4XPFH 4YDJA 5L8LB 3FSOA 4TOIA 1AGCA 1J8KA 4ALAL 1MSPA 4WY7L 3VFTB 3DSQA 4TL4A 2JXMA 4L0YA 4LVOB 3DBSA 3VXQA 1AVMA 3WJLC 4QMEA 2WIIA 3MRPB 2GUZB 4HXAL 1RZFL 6PCYA 2GEEA 3L5HA 5MI0B 1QLEB 2WBJA 3EJYC 4U1LA 5I0ZA 3D3QA 4RETB 3U46B 5B3NA 1F4MA 1A3RL 4X9QA 5AW1B 2WYZA 1GS8A 4CS2A 2UXBB 2O93L 1YEJH 2XC8A 3PCYA 4XCEA 1JP5A 1KJMA 2PABA 1XMQO 2LQTA 1MZFA 3QG6A 1N3NA 4JCLA 4AZ8A 4PD4K 3LHPL 1TUBB 1XCXA 4JY4B 3AMLA 1KLFA 3MRRA 2EVFA 3LN5A 5E2JA 1CP9A 4FLUA 3RWRD 4X7CC 1ZVHA 3ARGB 1SXNA 3TXAA 1ZHNA 5EIIG 1ZUQA 1D7CA 5TDNB 4YSDA 1A1NB 5C09E 2EYTA 4UUJB 3M1BA 3FQTA 5D7KE 3UX9B 2PP7A 43CAA 3HRZA 4YJZL 4DV4O 4TSAL 1HJCA 2VIRA 3BW9B 2PXYD 3HI5L 4TSCL 1YEDB 1JPEA 3PUCA 3L95A 4NP9A 3WY3A 2VQ1A 1NSNH 4Z8FL 2Q69A 3HE6A 1ILUA 1UJ3C 1XX9C 2HRLA 4UV7H 1J5CA 1CIDA 2XN9E 2FX8H 3BC9A 1E8YA 2CRZA 2GKIA 4NN6C 1Q9KA 5JYMA 1G6RA 3QAQA 5LBGA 4AEHL 4AL8C 3TZVA 1RURL 4ZMVA 2E46A 5J6HB 4K8RC 4LL1A 5DGQA 3DX3A 3KYOB 2WA4A 1FNSH 1BGXH 1CDIA 2IBZX 2ZR2A 5ERWA 1DBBH 1MI5D 3BVNB 4G59C 5FYKE 5H94A 3NCXA 1KBGL 2GHYA 1PFCA 3VW3L 2Z31B 2FLBT 3OXSB 2Y72A 4XBGA 2F15A 4KKLD 5EIVA 1NC4B 1K5WA 4GKZB 3WJLA 3BP5A 2WXLA 3SDYL 1FCGA 4I1NB 2LW7A 4UQ3B 1NM4A 1UASA 1HAUA 1SZNA 5F6HI 2ZOUA 2XFXB 3FO2A 4CKQA 5DQ9A 3AAZA 1QA9A 3MSPA 3RGVB 3D09A 5EU7E 1MFBL 1INQA 1I8AA 4IM8A 1J12A 1OPGL 3CC2V 3PIQB 4AYFB 1N5YH 4QNPE 3F00A 1AO7A 6PAZA 5AOJA 2OKMA 4N5UA 4XE0A 5JIDA 3WTTA 2LT9A 2ZXDA 3VGAB 4FC3E 1T83A 4TUYB 4LF7B 1F13A 3OG4B 3FYEB 2GQHA 4V2BA 5FPOA 1F97A 3N9GH 3JATA 4L5FL 4PVLA 2F7RA 1NGPL 3BXNA 5IYZA 3ELAT 3NJXA 1P7KA 2MH4A 1N59B 4JRYE 3GSQB 2PCFB 2EJ7A 2GJZA 1CE1H 5AVRB 1KGWA 2PR9A 4R4FH 1IKFH 2CBQA 2LAGB 3IFLL 2NR6C 5BZZA 1SEQL 1TCRA 3WN5B 3ZIMA 4EI5C 4NNXB 5KBPA 1UJ3A 3FUFA 1U58B 3QHZH 4JI4O 3FTZA 2W0KA 5BY1A 2AJVH 3QZWB 1BQUA 3DI2B 3UC2A 1PAZA 1N34B 3L4UA 3PGFH 1DN2A 1I3VA 1JXGA 4RMBA 1NH6A 1HNXB 1E5YA 4UTBL 3CRMA 2VDKL 4Q9RH 4FXKC 4CL7A 3EH4B 1EHAA 3GMRB 5D7EA 1L9NA 2FSEB 1SVBA 4X8JA 3RWJA 1JBJA 4U7SA 2GTAA 1IGCL 1Y6MR 3CPUA 3LZFH 4YHKH 1ZTEA 3OEHG 3T1FA 4JRXB 5CA1A 5D93C 3D0AA 4OCMC 3ZIYA 2XG5B 1GCFA 3BRFA 3U2IA 4JFYB 1HHKB 2YD4A 4FLTA 1VJSA 2Z1PA 3V0HA 5MERA 1UWGH 3CMOL 3QEGH 5FM5O 1TA8A 3UTSA 3FQWB 4HX1B 3BQUB 1ZJAA 2XBTA 3GTNA 7FABL 3UYRL 2FNWA 2XICA 3ROLA 1FYTA 1Y6XA 2GITA 5J11C 2QGCA 1JRHH 4DK5A 5M94B 2NQCA 3CXFA 3DLQR 4MAZA 1WAEA 3D85A 1HHGB 1FIGH 4MCNA 3SGEH 4OZHA 2WUCH 3OHMB 4WU7A 3TFKC 1C16B 4KK9D 1G7IA 2YXHA 1M2VB 5CJOH 4YHLL 4K7PX 1Z5LB 5FA4B 4CS3A 4UT6H 1HHHA 4NQXB 3DECA 3CVHH 3ZHUA 2R83A 2YPKA 3WGVB 4PAZA 4BFJA 1CI5A 1P6FA 3BWUC 5I1AB 2NR6A 1TZAA 3WKPA 2YD0A 3BAIA 4PP2B 4EI5A 2BWQA 4M4PA 4POZC 3GSRA 3EG9A 4NENA 4R3SB 2VE6A 1HHIA 3L9DA 5FECA 3DSFL 3CCRV 2LFGA 3P4NB 4PJAF 4K15A 1RJYA 2I9LA 1XSJA 4U3HA 2R70A 1BP3B 4O02H 3UO1H 1WFNA 3VRLE 1N4XH 1WAAE 4JFXB 3N2KB 3CSYA 2FE0A 5EG6C 4K07A 1JGIA 5G4OA 2GUOB 1F3DH 4Q56A 5HI3D 3TVMB 1BPVA 1WLHA 4FXKA 3VXRA 3T08A 1MG1A 1BOGB 1GZQA 3P0YL 4G5ZH 2BY1A 2OSLA 1I1AB 2F5BL 4PRNA 1A4AA 5F7EL 2EXWC 3DHMA 1ZL8A 4NO2B 3KJ6H 2AJZA 3QT2A 4ZOCA 1I8LA 3CN2A 5SX4H 4BHUI 3ZN0A 3VXSA 1VAHA 5J6GA 4NSKA 5IQNA 4AJYV 1S9YB 3WJMB 4R26H 1I7UA 3ARZA 3BH9B 4B7LA 1HIMH 5HGHB 1QRNB 1AI1H 2Y06L 2CGOA 2DEWX 2ZWNA 3ME0B 3F7RA 1E1QG 4OQTH 2JKLA 3T4ZA 4LQFH 1RSOB 1IZKA 5E8EA 2VMJA 1AR1D 8FABA 5LOVA 4XC3L 2ZYSA 1DVFD 3SJCC 5AW5B 4BA0A 1HCVA 2P5EB 1SXBA 1F6AA 3BZDA 3UG5A 1ZGLA 1FYJA 3LNIA 1OSPH 2BNRB 3ZDYB 2F1AA 2OCHA 2DMCA 5I8KL 4DP2X 4KUCF 1B06A 1KELL 2RIKA 4AITA 1Q72H 3LEXB 5E00A 5MEOB 1JV5A 1U36A 1AG0A 1OT2A 1PMYA 1TMCB 4XAKD 3TO2B 1R6TA 4WTWA 5IOPB 3VQWA 1F0LA 2VSMB 3IDXH 3V52H 1KBVA 4M5YH 4PG9B 1NL0L 3AQZA 4RZCB 3DXRB 2HHHB 4QRFA 1SQGA 1MSWD 2P24A 3L3JA 4PJ7F 4ZW7A 3RX7A 3W82A 1S7WB 2A38A 5FV2A 3VXNB 4MMZB 3CZGA 4NHCH 2F7PA 2NNFA 1ZMYA 4PR5A 3NACL 3TXSA 2GC7C 1VERA 4X7TB 1K9MW 1FFPA 3H9HB 4XVTH 5B21A 1FKAO 4KH2A 3PP4L 2NQ3A 2NDFA 3UCRA 3IVKB 1QPXA 1CL7H 2FDBP 3BKMH 1V3KA 4P3CL 4EUPB 1KJ2B 1LO3H 4DVBB 1MFAH 2XETA 4RDQF 3UYOD 5H2BA 2EINC 2XTJC 2AZUA 4ONHA 4J7KA 1NTZH 2X6AA 2CLVB 3D3VB 4UT9A 1WZKA 1FNEA 3PDOB 4R0LB 1GS7A 3JCZA 1NBCA 1TTBA 2HMID 5IY5C 4ETQA 4DV1B 5K1JA 3V4LA 3ZKSD 4OZIB 4KRLB 4E5XB 3VX1A 1CF1A 1DLFH 1TEGA 3EOAA 5AOKA 4GEJA 3P3NA 1O5PA 3LSSA 1GGBL 2FJUB 2VLRD 2CGRL 3PWUB 3DX9A 5KHJA 1MVFA 4M93C 5AKSA 1MJJB 3V7MA 3WNMA 4FI7A 3PJSA 4U2YA 4M8RA 1QI4A 3DSNB 2GCYA 3PNWA 2YSTA 3TGXA 5EU4B 5JQ6L 3IU3B 3KEHA 4UQCA 1I8KB 2NUTA 4BFRA 2OLDA 1MHPH 2A6JA 4N4YB 5GGVL 1N68A 1R3KA 3S5LG 1C7SA 5AB1A 1WG3A 4XOBA 2CLRA 4LCWA 1LDPL 4QO1B 1K3IA 1K5SA 2VR6A 3H3PH 2Q6WA 5ILTH 3KYKH 1IAOB 2W07A 3N2GB 2IGLA 4U6VL 5HHXL 2IADB 4UV4L 3O2DL 3FOMB 1NCTA 3WXVH 2AEOA 2QV4A 2CO1A 5EF3A 3CFMA 4P4KC 4E9VA 3PP3K 5FFOA 2HJLB 4I3SL 1ORSA 4LLMB 2ZD0A 1GMGA 1EERB 5GS0H 5CZVH 3NN8A 4JFPB 1S7UB 4KI5C 2CCLA 4L3CB 4XMPL 5FCUL 3UTTA 1MVYA 3UTZB 3RGHA 1YEEL 5FFGA 1EMTL 1T5EA 2WP3T 4CU8A 3T0EC 1SQPH 1AR4A 1A7NH 2OL3B 3HUJF 2WB7A 4GBXD 3M7OA 4XNXL 3OZLA 1QKZH 4TVPD 4YVNA 3GDCA 3O3DB 4Q6IB 2OYKA 4EVNB 5D6CB 4Z7VF 3WNOA 4XMKL 4UQEA 4X9IA 4GRMB 5HYEA 4O4LB 2P67A 1U2YA 2I32A 5F9JA 1XR9B 3BVDB 1CF8L 4JRXE 3P3RA 4I8DA 1M05B 5CEZH 1BHGA 1T6WA 3IFPA 5E8DH 5DJXA 1RV6X 3CZJA 3U0TB 1PIFA 2PW1A 4U0RC 1VADA 4PBXA 3HOGA 2Y69C 3GWOA 2F43G 3T2NH 2J25A 1L5GB 2RH0A 4NO5A 1KCSL 4HZ3A 2W9LA 1YPZA 1BHBA 3GHPA 4KO7A 1FO0A 4ZMXA 2IC2A 5J7CC 3U48A 2OZ4H 1NKDA 1AC0A 1NAMB 1QW8A 1FWXA 1L9PA 2G9HB 2MPVA 2V7HA 3EGDA 4MDRA 4MLIA 5GIRA 4F8LA 3U36A 5E9DA 4GUPB 2Y07L 4OD2B 4OZ4B 5FUCC 2OP4L 4EB6A 4FYRA 4HETA 1OZTG 3ULSA 2DYPA 4HWEH 5I1KL 2O5ZL 1K5QA 5CCKH 1PX8A 3DWTA 3HG1D 1BAWA 2EZ0D 4LPXA 5ESQB 3ECBB 3LQZA 4A6YB 1E4XL 4OUUB 2XI9A 1KKDA 3LZPA 1U92A 2G0KA 4JG0L 5D7SL 2WY3B 2IQ9L 4LSSL 5AZ2H 3CSTA 4DVRH 1ZVNA 3PGCB 4IRZH 4ZFFA 4PG2A 1KNOB 2PWHA 3O41B 5JOFB 4U6YA 4AGQA 3QO1A 1LE9B 1HL8A 4AQYB 3HPJA 4GG6A 3DX6A 1S77D 2ZUTA 3T65A 2V2WA 2BINA 1I9RL 3FTGA 4N8UA 4IHJA 3MQIA 4UILL 3FO9A 3AB0C 1P2CB 5GZOA 4G43A 1NINA 1GAFH 1X5KA 4LHUG 4PDVA 5FNVB 4N90E 4R97B 4UOW1 4KO9A 4KTYA 3OJMB 3F83A 3QG7L 4LCUB 4X6BB 1MREH 2UXTA 4RDQG 2XSKA 2CPCA 3UO3A 1KCLA 3QW9A 4PRPB 1B3JA 3QNZB 1OZ0A 1PGRB 4PLJD 5CBAB 3DTDA 4PGZA 2EO9A 3OLIA 3MMEB 3V6OE 3P4MA 2YRLA 2DOSA 5LL6Y 3FFCD 5F1NA 2CO2A 5DZVA 2EE2A 3NJLA 2WXFA 1BG9A 3QORC 2CE6A 2EIKB 1QRNE 1XWVA 2JH2A 5KSAD 3AU0A 4FFWC 4LCCC 5JW5B 1EVUA 4WWKD 1FUNA 1RCYA 3KS0J 3QPKA 2LGQA 2LLLA 3PGDB 5T1DL 1QNMA 3H01A 4EDWH 2P5EE 2J8HA 1D6VH 2EDYA 3DGGA 3GS4A 4P46C 5HI4C 4A38A 4JTCB 5KHIA 1Q86W 2BSBA 1E5AA 2BNRE 3IMBA 3ZDYE 1OJHA 3FB8C 4O2CB 2IH1B 3GBLA 2EE3A 2X44D 4NQED 2WGXA 5EU6D 2CKBB 5GSVA 4WAFA 3G5VA 5GPRA 2K70A 3IKKA 4X8GA 1C12A 1NOFA 2C3GA 2CBTA 3V7AE 3NRFA 3VSUA 3LXBA 4RDBA 1ERNA 3ZGIA 4NX0A 3NFSL 1YCIA 1WWCA 4G6FB 3FFDA 4HJGA 5DYFA 5TK4A 1DUZB 1WAZA 5I1LB 1QSZA 2OJEA 2DTSA 3KVQA 4NDMB 5IT2H 3V6FA 2C2AA 4H8QA 2UUBB 2J1YA 5CAYB 4LSTH 3GM0A 2XKSA 3KNBA 1NFKA 1L3NA 4PBVC 1R1CA 1KCVH 2PYED 4OGXH 5D1QC 3M1OA 2P4VA 1SYSB 4C54A 5KAIZ 1QEWB 3UAJC 3MOBL 1JF6A 2K8QA 4NUMA 1M2OA 1CFSA 1RPQA 3D3VE 4M61A 1A4KB 4H8WC 1DDTA 2IAMC 5EIBD 1QWHA 3PF2A 1J11A 3DDFA 1VQNV 2EKSB 2HLEB 3FB5C 2TAAA 3DURB 4HPYL 5EN2A 3INUL 3GMLA 3QORA 5D72H 4NZTH 2WLLB 1PBYA 4X6EA 1WBXA 5F8QC 1BBJA 1P4BH 1PJ9A 3BE1H 3ZUCA 2FR4B 2X5PA 2W9DH 2HVJC 2XWTA 3TO4D 1IFHL 3NZHL 2HPTA 2VLKD 1CD1A 4X0NA 5CMAA 1HE7A 4FXGC 2G2NA 2BDNL 5AENA 4NQCD 4DR3O 2FEJA 4PCTA 3AGWA 3V79C 1GKFA 1AVAA 3IGUA 2F23A 4D8PB 2Q5ZA 4S1SH 4UAOB 5MHSE 5HYJB 5IYBO 4R90H 2MKLC 3FB8A 3EYOB 4V11A 1FE8L 2F8OA 2CLZB 2JGDB 1P4LB 1AQMA 2E6PA 3C6LC 3FT2B 2XWBA 4B9YA 4DCQA 1GSKA 5JDSA 4WSJA 3BHBB 3APFA 3B5TA 5DC9B 1KGIA 4XB7A 5GSRA 3VFNB 3V5HB 2YC0A 1XAUA 3BYTA 1FFXA 1UD6A 4M5ZH 1I8IA 1OGAB 2FSDA 4P9ML 1KBPA 1S3RA 3LNEA 5JO5B 3WTVA 4JNXA 3P9LB 4F7PB 3BLPX 1FZJA 3S35L 3NPSB 1JZDC 3MRMB 3WFHA 1BL8A 1JGVL 1XREA 5CWSB 2OPCA 5IVXB 2ZYIA 1QMUA 1MN4A 4JYBA 1SETA 2LGWA 3HKDB 1A6ZA 1BMZA 1BZ7A 2BCKA 2DI7A 2EO1A 3NTCH 2PW2B 4UI2A 2E74C 1EBPA 1IAIH 2Y36H 4ADIA 3HZKA 3L3IB 3U7YH 4Y4FA 2WBJD 4HT1H 3DXAA 2AXGB 3QR1A 4RGOL 5DC4B 5AZUA 3O3AB 4MZ3A 5LXTB 1TPXC 4HHAA 4NN5B 4KX9A 5DHVA 3NH7H 5FOBA 4ZFGL 2P6JA 3E22A 1F4AA 5I0WA 4O4YH 4DKEL 1INDH 2FJSA 4MXWL 1LUWA 1WC7A 4YUEH 3RB7A 4XPAH 1RZJC 1XL6A 1MKFA 1D5RA 1UD8A 4L23A 5DK2A 4KZEL 3JSNA 2YD2A 2C1PA 2UY7A 5E4EB 3FB5A 4WW1A 2LJ2A 1EAJA 3WDJA 5J4MA 2E7HA 5SWSA 1DEDA 2SODB 1TNMA 1GTFA 3KEDA 3AT0A 1PVHA 2PY5A 3L1OH 3OKNB 4KVCL 2DJSA 2WCPA 3IB4A 4LF4O 3PFQA 5E6RB 4FXGA 1EO8H 3HE6D 5GONA 1GHFL 2FIKB 2UWEA 5TQ2L 1AKPA 4LQ1A 2UZIL 4ATWA 1OSZA 2R1YA 2HRPL 3BVUA 5KSBA 4TVSa 1J1XL 3C6LA 3TZVD 1JMKC 3QXWA 1T03H 3CXHF 1DQJB 2EILB 1DEEB 3MBEC 3TURA 1QLNA 1HHJB 4ISVA 3ULVD 3GKWH 1MAMH 2HJDA 1ASPA 2CO6B 2DLEA 3CUPB 4LPCA 1UOWA 2RR3A 1T66D 2R69A 1H3UA 4KGLA 2R4SL 1BLNB 2WW8A 1GIGH 1G87A 2K4WA 3U2JA 5IHZB 5EUOA 2QQNH 1XEQA 1JPFB 3S97C 4L1LA 4L1HA 1X5MA 4NZ8A 1NFDF 2DI8A 5B5EZ 4Y5YB 3S98A 1MJ8H 4ODVH 3ZKQD 1ZLVH 1DDHA 1Y74A 3EJYD 2N56A 5FW7A 5F93C 3EDJA 2VSDA 5JPMC 4LSRH 5H35A 1CFQB 5DS1A 4GINA 1QACA 3CCUV 3JV6B 1XMOB 2CTWA 3EOYG 3S0PA 4LRNL 2VMCA 5JHDA 5AOIA 4AW7A 1JJ2U 2HT3C 3NAAL 4U3JA 4PRPE 2XVGA 5L2KA 4HXBH 1F1DA 4E9RA 4G5AA 1CLYH 4ZSOA 3LZNA 4RWHA 4DGYH 5K1XA 1B4JL 3PL6C 3VFVA 2GYSA 3R7QA 1YMMA 3QB7C 1W72H 2H0EA 2QPDB 2VJ8A 3O6FA 3WNPA 5KEZA 4Y9FA 1JTTA 3K80A 3I75B 2ZR3A 4XNZC 5I6XC 5DGRA 5FIEA 1TETH 2HCZX 1A7OH 2AJUH 4PJHF 4WEMB 4S1RH 1XFPA 1X4TA 5DN6G 3VFPA 4TUJA 1L0PA 3Q2CA 3ES6A 3HFML 4LNUB 3Q8BA 1MIEH 4RNRB 3U6RB 1CD9B 1EJ6A 1F02I 4XP1L 1RI8A 1RMFL 2O72A 4JREB 1VEWA 5DD3H 3MBEA 4K8RD 5TE4H 1FRGL 4Y19B 4AIOA 2FH8A 4ATTA 1E3ZA 3KLDA 5A7EA 2V33A 2BWIA 4KRPC 3VM5A 4X6CF 4HWZA 4O4JB 1YEWA 2PTVA 3RPIB 2PF4E 3SOTA 3WHE0 1K4DA 4KV5E 1E28A 1XL4A 4TVPH 3IE4A 3KPLA 5JHMA 3PHOB 4D0DB 4WFEE 5IBLC 4AZUA 2VXQH 3G04A 1QQDB 4Y9EA 1LNUB 2GY7B 1A0QH 3S37H 3VSQA 4LPUA 5I6MA 2UUDK 2ICWJ 4KXAA 3MLVL 4FG2A 2XOTA 3IDGA 1N36B 1O6TA 2VZVA 3CC5A 3GXNA 5GGRB 2EADA 4XO3A 3UTSD 5C3LD 2DH2A 5EH1A 1X9LA 2JELH 1U8LA 1HEHC 3EF4A 2AV7A 3SDDC 1BZOA 5A2QN 1ZCRA 1YEGL 2JB5H 2BNQD 3SDLA 4X9GA 3FS9A 3CFCL 4HVBA 3GSUA 4PJ0Z 3BUDA 4RFOH 5AYUH 4OFIA 4F7KA 4P2OC 3PL6A 1A6VH 1XQ4A 3UTOA 3RWGB 3IGAC 4YXLH 4KXZH 4OGYH 4YNYB 1N18A 1QVFU 1XF1A 5EZYA 4O58L 2A9NL 1U8CA 4X80L 5DEFB 4WJKB 5DD6A 3T3MF 1W59A 1TJGL 2BERA 1JYXA 2Y0PA 4YR6B 4MW3A 4EFBA 2NR6D 3ERXA 4L2LA 3U82B 3RWCB 2FL4A 5AAPA 5IB2A 4LSPH 4N0UA 1S3KL 3R1GL 1YQVL 4EI5D 3VTAA 5CHNB 1S5JA 2VW4A 4PW9A 5DZJA 5GZNC 4E0RB 2OZNA 3RI5F 4R5TA 2CMRL 3FT4B 1SEBB 4ICGA 5HYJE 2NY5H 4FL4C 2E56A 1C8PA 3N50A 3I6KA 5EWIL 4IRJB 1YEKL 2J8UB 2NY2B 4GT0A 4PJEB 5EO1B 1URIA 3BZEA 1H0DB 5HY9B 2HKHH 3VXRD 5B7FA 2IO5A 3QUXC 3N55A 1MNUH 3GZPA 5B3SB 4KUMA 4YEEA 1OGAE 4XCYA 4MVUA 3JALA 2X12A 3FB6C 4NKIH 3TONA 3JV0A 1G0XA 3QUML 5DD0L 1JWUA 1BW8A 1GM7A 1N33O 4FULA 4L8DA 3VXSD 4QRSA 3GRGA 2LW1A 5J06A 5IVXE 4HKXB 2HRGA 4JG1L 5JVDA 3MHSC 4L0PB 4XP4H 3MFFA 2HJFC 3IEAA 1KY6A 4HH9A 3ABZA 2L0DA 2WQVA 3SCMC 3TYGL 4HKZB 1LHZA 2E7MA 1KZQA 3SDDA 1II4E 1FBIH 3SGKA 3LIZH 4OT1H 5L4IA 2BSRA 2VUKA 4QD2E 4O2AA 2WJ7A 2F53A 3ZDWA 5ACZA 3F01A 1OAQH 4WV1B 3CRRA 5DR5H 4EZMA 5I16B 4P2OA 4FI6A 2E75C 1LYQA 3VQMA 4WFHE 3TFKD 4B3SO 3IGAA 4ODXB 5BO0D 1H38A 1UM6H 4KUZL 4F4LA 2RACA 2VLLB 4DV0B 1AE6L 4AW4A 2DV6A 1S9VB 3DK0A 3O6LH 3KBPA 5GZNA 4POZD 5I26A 2XN1A 1M56C 2QSCL 3VE0B 1W0JG 3EFDH 3NIDF 1VLXA 1Y0LA 2PXYB 4FXTA 2DS4A 3OKDA 5EMYA 2LP7A 1EDQA 2F4VB 4P0DA 5B1CA 2VDRB 2YEZA 2N0MA 3U11A 5EYPA 4U1SB 1H9DA 3QUXA 5L88H 2ZUXA 3D51A 1R5IB 4QXVA 5I1GL 1X4ZA 1AJ7L 4CZZA 2EXWD 4TQFA 1MHHA 4FM0A 1ZHKB 3CD4A 1GN6A 3GSWB 4PJBF 1RFDL 5JOEA 2DQCH 1EN4A 2KB1A 1TZ8A 1GC1C 2RCSL 3S35X 1UA6H 2XASA 5JH7A 1MI5B 3GBNL 3Q7JA 5EORH 8PAZA 2AJYL 2F68X 4G9DB 4JPIA 3OBAA 1GH6A 1ND0B 2HJFA 2WQ8A 3PAYA 4LF3A 4UIMA 5AW7B 3SCMA 5FYJU 2GHZA 5FO8B 2FNBA 5KVGH 3AZUA 2WXQA 4GRWF 1T6BX 3IMSA 2FWUA 4YJ3A 1G9ML 1NBMG 4J42A 1IBYA 4PTUA 3I3DA 3MCYA 2FX7H 2GTZA 2J88H 4GAYB 2ODIA 4YFEA 5FPIA 1LK2B 4KH9A 3KPPB 4XC1L 3EOTL 3X1FA 2YD1A 3IU4H 4Z23A 1H3GA 5EBLC 1ZXKA 1NEZA 2PPCA 3QWQB 3TPUA 4GXUM 5I71C 1FAIL 4WJ5B 4AGNA 3WFDH 1G9NL 5C6TH 1L9MA 2OTUB 2E0PA 4NYKA 1JFHA 1GPOH 1J9RA 1HXYB 1L0QA 1SJMA 1L9QA 4L8SB 1XGUB 4Z2WA 3V5KA 4JI1B 3HJEA 4I48B 1WAPA 2XDHA 1Q94B 2ZXWC 3KDMB 1K5NB 2ADQB 2ADJA 3U0ZA 4JZGA 3GHEL 2F6AA 1EUTA 3S4SB 4I87A 1LDSA 4Y19E 1NVPD 1I75A 1E8WA 5DJ2B 5D1XC 5ACLA 4NM8H 4XN1A 4DO6A 2XTJD 2EEDA 2H3XC 3EH3B 2E9IA 4OFPA 4P8QA 3VB8A 4CJ1A 3K2KA 1T0MA 2C3VB 3K2UL 3NIFF 2H5UA 1OCOB 1JD9A 1F11B 1VGEH 2HKFH 4W9DC 5KG9B 4EOWH 4MQ7B 1HZKA 2A1WL 3VXMA 4FQLH 4UVCA 4JDZB 5AYTA 5C9KA 2EUZA 2CPUA 5ITBL 2GIXA 5FUOL 3H9VA 3GUTB 1DQKA 4DKFL 3U9WA 4U49A 1SGKA 4OV5A 1FZKB 6FABH 4PJIF 5HDBF 4BCYA 5CD5D 5D4QA 4PB0H 4M1GH 1KB5A 1GRJA 1QU7A 4FTDA 2UXCO 3QISA 4HK0A 3WELA 2A77L 4UQ9A 3BIKA 3C2AL 5E9DD 1QR1B 1G6RH 2O5NA 1LO2L 3HPLB 5L2JA 3JUZA 1UWEL 1FNFA 3ZE2F 3RA7L 4IRSC 2LW3A 1QBML 1K9TA 5FHAH 3AROA 4JO8A 4LEOA 3V5DA 1SBSL 4KXDA 2AK1H 1BIIA 4ZQTA 4EN2A 4D3CH 1NLBH 3B2UC 4F33B 3E3QC 2GT9B 2WNKA 4FD0A 4M6NH 5I73C 2FJFB 4B97A 4AC4A 4P4KD 2DN9A 3HHSB 2FTKA 4ZW5A 1XHXA 3M8OL 4NQVA 4JAUA 3VFSB 4KI5D 3C09C 3I9IA 1UXSA 2L7EA 5G2NA 2PTTB 2ZG1A 5F7AA 3ZT6A 2GABA 5GZOD 3HA0A 3IF1A 2BY3A 3CDYA 1ES0B 4M03A 5E2UL 1BA9A 1DJYA 4PJEE 2J8UE 2ZT9B 2WBKA 2XZZA 4NKMB 5D1XA 4P4RA 2ZE6A 3US9A 4Z3FA 1IXBA 3QIUC 4UAHA 2WQUA 3OGCC 2ZKOA 3Q3GA 5E6SB 1KTLA 4J3BA 3U30C 4A39A 2B59A 4GT7A 5DJ6A 4YSCA 1XCTB 3LHAA 4JI7O 4LSUH 3VFGH 2A5UA 1G84A 4PPTA 3CPWU 4I7ZC 4LLUA 4NHUB 2VR9A 2EECA 3CDCA 1HSAA 3D0VA 3GMPA 1IQWL 3BWAA 3WTXA 1QR9A 5BRPA 3U1SL 1X7SA 4R4BB 5D96C 1BREA 3G5YB 2X4PA 4OAWB 3VTMA 4I4TB 1KPRB 1XZ0B 2EH7L 3ASNC 2HTKC 3EUDA 3HAEG 3NZ8A 1E5BA 4ZBMA 1UACL 3WEXA 3EVKA 1AQ8A 3O6KL 3UKMA 3QYCA 2RCVA 1J5EO 1TQBC 3SO3B 3CRQA 1XBLA 4L8CB 1V54C 1AR1B 1H8EG 1SUJA 3KM2A 4XWGH 4AL8H 4I9WA 4A04A 3CXCU 1DVFB 4UOQA 4I5SA 5CN0A 3ILEA 4IRSA 3LDDA 2X0VA 3MLTA 4UM9A 3ARUA 4B7IA 2NY1C 3BT2H 5AB2A 4JTDB 1T4WA 5FWRA 3LS4L 4Q74A 5DHDA 4ZFOA 4U6HA 1PD0A 4BK4A 1BMGA 2OW6A 3S5LA 1R5VB 2WANA 3SGIA 2IQAB 3LPFA 3OSKA 2TSBA 3AG7A 3FAVB 1E9OA 4N8CL 4XCCH 4NP4H 2IDTA 2VDOH 4M29A 3N1PC 2ZKXA 1HW7A 5FOJA 4B9ZA 4PA6A 3HBGA 4F9LC 4V2CB 1RUAL 3MOQA 3MJ9H 1RVFL 3BKJH 3CDZA 1PYWB 1OKEA 1IGIH 4TWKA 1XNRB 3IMWA 3QIUA 2Z8WC 4BE6A 2GB2A 4OLWL 1JPGA 3AG4B 4P2RA 1J9SA 5ENWA 1CCZA 2Z35A 1JNNL 4ZUTA 2WPDG 1JUFB 2GSIA 2D2CB 3ZDXB 1Q6HA 1KLUA 2AZ0A 5C92A 2J2ZB 1KIRB 1EHLH 5ID0A 1A6AB 3CZUB 1MJ7L 4JYCA 3RAJH 2ENPA 1MI5E 4JGMA 1Y4MA 3H53A 2NXYC 2PYFA 4B0MM 3VD9A 5E8OB 4FLYA 1SN2A 3QORD 4S1DC 4YAQA 4XDKA 4W4OC 4PRIA 1KTDB 4FFWD 4MTMA 4BCZA 4DXWA 1EZLA 2NXZC 4YHML 4N5EC 5L3EA 4HJ0C 4IBZA 1AIZA 1EO5A 2FT7A 4OGAC 3N6YA 3BPOB 3ZT7A 1E3FA 5IE9A 5HI4D 2B14A 2QQLH 4P46D 1BYPA 2IDSA 2VLRB 1PKQA 4AG4L 1AIFB 3K3QA 2WVUA 3AVEA 3G6JF 3TA3C 2XHNA 4IJ3B 2A06H 3LKRB 2VXSH 5EEVA 4PV8B 2IGFL 5LYJB 4KHXL 4GP8B 1A9EA 4LDCA 2QSQA 5H5NA 1WF5A 2J21A 1TJHL 3MODH 1G0YR 2BSKA 1J48A 1JGEB 3HHRB 3MUUA 1NIAA 4WQOA 1P6AB 5EIQA 4JHAH 1WBZB 3ATBA 1W72B 3IPBA 1DVXA 1WBYB 2IIJA 3M17A 4RBPK 4H25A 3VU1A 1U0QA 1H15B 3L3KA 4OLVL 2CRIA 5F6IC 2CDFB 2W65B 4F9LA 5T33L 2MKWA 2H1PH 1JPSL 5B3JF 4OVUA 4Y4FD 5ISZA 3MNWA 3DXAD 4PJ7A 1EEZB 1WPBA 2JK5C 5D1QD 2ENSA 1ZT4B 4J3OC 4WTZA 3QARA 2PYJA 1BM3H 4NC2B 3JAKB 5D7IF 5EZIH 5KS9B 3E1F1 3UAJD 2A83A 1OWRM 1OARL 4LHUA 3HJ0A 3FU3A 1CK0L 4D6TH 1QFWH 3W9EA 1O5DT 2IAMD 3C60C 3NZSA 1NOLA 1WV7T 4JFSA 4DETA 1YJDH 2R2EB 2D7TH 32C2A 2LGNA 3CXHK 1JWMB 3MUY1 4GBXB 1AZCA 3WU2Z 2NY7L 4JQIA 4GAGH 4L4JA 4N68A 5CJQH 3L71H 5CEXA 3ZX1A 1RAMA 5LBSA 4X62O 3ZE1F 3JAWB 4FABH 4W4OA 5DHYA 4NT6A 1IFRA 5SWSD 4JV5O 5DMGC 1EBAA 4KQ3L 4PS8A 2Q8VA 3QXDA 4XRCA 5FYLL 2F08A 3MV8A 5E03A 1J7VR 5IVZA 2JJUA 2FX9H 1S72V 4NJ9L 1SESA 3MNDA 5TF0A 3LY6A 3TJHC 3VXTA 1UXWA 5IUCA 4BV1A 2VDQL 1A3ZA 3REWA 3L5WB 3TA3A 2WNXA 4TPRL 1V3JA 2PTUA 1B0GA 3DARA 2DKUA 3C6LD 5I19H 1AB3A 2LTQB 2H3KA 3HCVA 3C9NA 1YJNV 4EPSA 3QK0A 1IVSA 1X5GA 2ZXQA 4MJ5A 5TGBB 1JPXA 3RY5A 3KGTA 4DEUA 4DQAA 5IQ9B 4B53A 4C58B 3WTYA 4QJ3B 1A7QL 4AMWA 3DI3B 4K94L 3FU5A 1CFBA 2BVQB 4XODA 3MLSH 1W2KT 2LU7A 2KZBA 4NO3B 4UANA 3HG1B 5BR8O 1I94B 4KBPA 4LLQA 1N19A 2B20A 4WWPA 2VAJA 4U1GC 5J3HC 2FB4L 1P1ZA 2QKIB 4GXVH 3WY4A 1HL5A 3K74B 3HTLX 4LVHC 1XMQB 5ICYA 4CH5A 3NDZE 3H6JA 1NCJA 2Q20A 2QVTA 2Q4PA 3MYZA 2JK5A 2RD0A 4JFUA 2QLVB 3BGMB 3WFEH 3NK4A 4JASA 1IL1A 1IC5L 2B4CH 4HUCA 3BZFB 1IVLA 2PI4A 3M86A 5JHDD 2FJHB 3HNSH 3QNYA 3BRDA 1SQXH 5L2KD 4DV4B 4NNYB 1WJ3A 4MX7B 3C60A 3TNMA 3OG6B 3HUJA 3S7GA 2XXMB 3WOVA 5KOVC 3S3CB 4OF6A 3QJHB 4O4HA 1YMMD 5D2LF 2VH5H 4JFOB 4Z7VA 1A1OB 4DP9X 1MHEA 2JKNA 3FRPG 4JMXA 2D73A 3ABKB 4NJAH 4QYOB 4Z3IA 4QWWC 5HHOA 2EDMA 4TV9A 2CUHA 3FFCB 2QTEA 5I2IB 3SHSA 4PWIA 3ALPA 4P5TC 4QF1A 4H8UA 3OPZH 5F89B 5KSAB 2R1WA 4JR9H 4WWKB 5TDOA 4WGKA 3VWJC 2EX3A 5TQ0H 3TIDA 4HV8B 2OR9H 2WGNB 3MBED 4A2HA 4PGCA 3KPOB 2AV1A 1UFIA 3GEWB 2GBAA 3ULUC 3CZNA 3IAQA 3F7YB 1E8ZA 3RU8H 2YAOA 4G6MH 4OD1H 2V2TA 4UVBA 3ZMRA 4NQEB 2HFGL 5E5MB 1COWG 5EU6B 3X3GL 1FVDA 2YI8A 1U8MB 1EEUA 1IC4H 4XAKE 2BFVL 5ESVA 5K9OB 4HFUL 4IIZA 2YPVA 3ZBMA 3RIAF 1VQMV 1SF3A 1F3JB 2WJ5A 4HS3B 3SOBL 4N8PA 1T22A 5TJWK 3FO1A 4H88H 3TT3L 3ARFC 4N0CC 5DQJA 3MGTA 4WHYH 4CVXA 3CK0L 4ZUUA 4EIBA 1U95A 5A43C 5C2BH 4R84A 3OKEA 5ALCL 1U91B 4G2KA 3HBPA 1FO0H 2HT3D 2Q86A 4TM9A 4HLJA 2ARJQ 4AK2A 1C1EH 1A6PA 3RI5K 2Q10A 1WFJA 1D5IH 4M6OH 2NY0C 5AW6B 4TTDC 2WLZA 2IPTL 4DV3O 2PYEB 3LXAA 3ZDXE 1BQSA 3PL6D 3HZVB 3Q1EA 1EN5A 3V0VB 2Q6AA 1VQOV 4JPKL 2K9UA 4KX7A 5F96H 2PCPB 4P2YA 5FYKL 1IGJA 3F84A 5KWYC 5EUKB 4CC6A 4JI4B 2G5BB 2Z0BA 4FJZA 4JJ5B 4UIKH 1ZGLM 4MXVE 2Q5BA 2YUXA 4G8GD 1KBBA 4DEPC 3RNQA 1O7DE 4P5TA 2ZUYA 5C93A 1R75A 1SY6H 1MUJB 2BP3A 2CO3A 3C5ZC 2LU4A 2VLRE 3NCJH 1P7HL 1YEFL 1JZ2A 1YUKB 5C0JA 3TO4B 5GRXG 1QFUL 1QSEA 4G71B 2VLKB 4XO8A 1G7LB 4FLSA 5LNEA 4B9KC 3O8XC 3O4OC 4NQCB 1HCFX 1SM3H 4DK6A 3LSOB 5MP6L 4KRPD 3UPRA 2Z91B 1RIHH 3K46A 2WVVA 5E79Z 2N1KA 1Q0YH 2VWEC 3PWJA 2IANA 4OF8A 4ORGA 4RX4A 4UYQA 4O2FA 4ODUB 2A99A 1LO4H 3OAZH 2OSYA 5D7JC 5IBLD 2FO4B 3GBEA 2DIBA 5IKCB 3GBMH 4AKPA 3WAKA 4HYOA 2WYTA 5IJ9B 1MF2H 2YSSA 3GTVA 1CXZB 3OQ3B 2CD0A 3QULB 4YDJB 3ZL2A 3TTYA 2VDPH 1NCDH 1XH3A 3CU7A 3O3BB 3ARFA 4AM0A 5LNGA 2KQMA 1NTDA 4OM1H 5HYSG 4K71C 5CR8A 3VXQB 2DQDH 5C0GB 3ZKNC 3SDDD 2ARJA 4JI3O 2TRYA 2GSMB 5KS9E 4LLAA 3S3JA 3UM7A 4ES9A 1Y18A 3OT7A 2F53D 2WBJB 4U1LB 4GLRI 3LSUA 1SJHA 3FQYA 3K4AA 4GQ9H 1W6WA 4B0MB 4XGZA 4JO1L 4TUKL 4P2OD 4BWAA 2CJ3A 4XCEB 1HQRA 1KCBA 1KJMB 2Y22A 4BUHA 4YO0A 1ACYH 3QG6B 1N3NB 1P49A 2OM5A 4AZ8B 5CSZA 2D7NA 4XVJL 5IBUB 4TVPE 3OMNB 1Z1WA 3MRRB 4YMPA 3DV4A 3LN5B 2IOOA 2OW7A 1D5MA 1M4KA 1S7TA 1UKQA 5GGTA 3WO4C 2H3NA 2VL5A 2YA1A 5IMMB 5EC2B 1ZHNB 4YQXL 1EH9A 2EYTB 5GZND 3FQTB 3AG3C 43CAB 3HRZB 3G08A 3BRCA 2GHWB 2VIRB 4M43L 2P5WA 3C5ZA 1B0RA 2J44A 3LEVH 5FGBC 3K72A 3GHBH 2I25N 2BCMA 3L95B 1XF3A 3KG5A 2VQ1B 3QPQC 3V8CA 3VAEA 2C26A 3HE6B 1BM7A 3NCMA 2QWQB 3Q2LA 2DBLH 4ZMZA 1WFIA 3I9GL 2ZAHA 4JFEA 3OE7G 1Q9KB 3QUXD 1G6RB 5CP7A 3WFCL 4PGEA 3TZVB 3LD8B 4KXRA 3ZMZA 3X1NA 1CGVA 1IGMH 1F1GA 5B39G 4LKXA 2OA9A 4OLYH 1P5VA 1F51A 1C5CL 2D3OW 1BVLB 3IDJA 5I0YA 3HG1E 4JGUA 1W0VA 2OULB 3BAYA 2B2XH 5H94B 4DKDC 4DNLA 2F0CA 2YEVA 1CBJA 3SCMD 1ICTA 1SDDB 4B3RO 5CGMA 3IRZA 4GMTL 1NICA 2JI3A 4W9JC 4XN4A 3T6WA 1FL6A 4KAQL 1CG9A 4MCMA 1JERA 4DFHA 3B1TA 2GC4C 2E7CA 4HQQL 1JGLH 3FO2B 4ZW6A 3HKCA 4Z95H 5T8IA