3AG1B

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 280 k
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag1B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag1B02
4K9JA 3NSYA 2J57A 1M9WA 3ABKB 2GC4C 4G7QB 4F7KA 4E9WA 1BEXA 2IH9A 4AI7A 2ZWNA 1KCWA 1W8EA 2XYBA 4HAKA 3T6VA 1SFDA 5I5MA 1E5ZA 4KNTA 1ZIBA 3S3BB 2VW6A 1E5YA 2P80D 1L9SA 6PAZA 2BP0B 2CBPA 2CALA 7PAZA 2OJ1A 1PNDA 3WKQA 2IDTA 1JZEA 3KW7A 4YSOA 2DYRB 4MFHA 2I85A 1PCSA 1A4BA 3T6WA 4YSQA 1J9RA 3GYRA 4QKTA 4YL4A 1EHKB 3QPKA 1PNCA 4W9ZA 4HALA 1TEFA 4DP9X 1AAJA 1JXFA 4A68A 1OCZB 3WNJA 1ASPA 1W6LA 3NSDA 2VW7A 3SBQA 2IAAC 1E30A 5ANHA 3OQRA 2XX1A 8PAZA 2BW5A 3T9WA 1RZQA 1X9RA 4F2FA 3FSZA 2FT6A 4FAAB 1AS6A 3FT0A 2YXWA 5PAZA 1SJMA 2FQEA 1A8ZA 2UXTA 2VMJA 1NPJA 2YAMA 3PCYA 1BYPA 3KW8A 1WA1X 1KDJA 1BQKA 2FJSA 1GS7A 1J5CA 1AR1B 1J9SA 3OD3A 4TXVB 5TK2A 2XV0A 3MBWB 2PPCA 2QT6A 3WKPA 1OE1A 2GI0A 4CSPA 4DP7X 1DZ0A 4A2EA 2WO2B 1PZBA 4DP0X 3S8FB 2B08A 2UXVA 4DP2X 3DTUB 3V9EA 1OCOB 5AZUA 2BZCA 3H4FA 2B3IA 7PCYA 1SHXA 1AZBA 5AKRA 3FPXA 4YSRA 3AZUA 2BWIA 4GP4B 2Y69B 1MZZA 5I6OA 1CUOA 1ET8A 1SFHA 2XVBA 3NSCA 3T6XA 1AS8A 2GB2A 2AANA 3QQXA 4HHWA 4DPAX 4AKOA 3NSFA 1X9UA 4M3HA 1MZYA 2IDQA 4GP5B 1QLEB 4YSEA 1JZGA 2IWKA 4YSAA 1JZIA 2JFCA 3FU7A 4PCYA 1JVLA 3BVDB 3EH5B 4YSPA 2Q9OA 3ZDWA 4BWUA 1OOWA 1OE2A 3NJFA 3OM3B 4A2FA 1WAEA 1AACA 2ZOOA 2W8CA 1UATA 2PLTA 9PCYA 1BXAA 2IDFA 4BDVB 1JZJA 5I6LA 1ZDSA 3FS9A 1KDIA 1AZRA 2PP8A 4GYBA 1MG3C 4YVNA 2WO3B 1VLXA 2BP0A 3N2JA 3FYEB 2H3XC 3PAVA 1AANA 2FNWA 1SF5A 1ADWA 1AQ8A 4DP1X 3AG3B 1CYXA 3CDZB 3UABA 1J9TA 1ASQA 1NTDA 1RCYA 4CSZA 2TSBA 1E65A 2QPEB 3AW5A 1KCBA 3NYKA 1OF0A 2AFNA 2P80A 1HFUA 1ID2A 1WS8A 2BZ7A 2FQDA 2XV3A 3NP3A 6PCYA 3X1FA 4BWWA 5B1JC 3WI9A 1ZV2A 1URIA 3QJQB 1L9OA 2XXGA 3H4HA 3ERXA 3ASOB 1NWOA 3FSVA 4ZK8A 3AY2A 2XWZA 4E9RA 1RKRA 3ZX1A 2N0MA 3TBBA 4E9SA 1M57B 1OV8A 3T71A 3FYIB 1JXDA 2XX0A 1L9PA 2E86A 1SF3A 1SNRA 3OMAB 1WS7A 3CVCA 2BW4A 2LLNA 1PF3A 1SDDB 3TA4D 1JZHA 3JT2A 1NPNA 2VW4A 4KNSA 2HLEB 3RYMA 2I7OA 3TU6A 1T5KA 2PP9A 1L9RA 1ETJA 2BP8A 1GY1A 4N8UA 3WIAA 2AZUA 4HZ1A 2DV6A 3EH4B 1XMEB 2R7EB 2YAFA 3TASA 3X1BA 3IN2A 3QJVB 1A4AA 1N70A 4NAJA 2YAPA 2XV2A 4BXSV 1R1CA 5B1BB 1BXVA 5I6NA 1MDAA 3GXUB 2EIJB 4JHUA 4G7RB 1IKOP 2PP7A 3NJMA 3ABLB 1GS8A 3QJTB 2CAKA 1AG6A 1JVOA 5B7EA 2UXGA 2EIKB 3FPYA 3FQYA 4BXVA 4HCIA 2NRDA 1NIAA 1ASOA 4PAZA 4L0PB 1RZPA 3UACA 3NJKA 3WG7B 2JKWA 1NZRA 1A65A 1MG2C 1AZUA 2HXAA 4AKQA 4X4KA 3WNIA 4KO9A 1B3IA 2MTAA 1BQRA 2PCYA 3FSWA 3ASNB 3V9CA 1BAWA 1ZDQA 2PPDA 2VSMB 2IH8A 1GS6X 1GY2A 3CDZA 3S3DB 4DPBX 4YSTA 3MX0B 3PAUA 1XB8A 5I6PA 1KYAA 3BQVA 1NDTA 2FT8A 4FA7B 3U25A 5D4IA 1XB6A 2GBAA 1ET5A 5F7AA 2YAOA 1EZLA 3NJJA 3SBRA 1CYWA 3FU9A 1NIDA 1PZAA 3QJRB 1BYOA 1GYCA 1QNIA 2A3TA 2UX7A 2PCFA 3D12B 1V55B 4A67A 2GIMA 4BWTA 4E9XA 4YSSA 5I5IA 1CURA 1J5DA 3ABGA 1A3ZA 5EHFA 2IDUA 4YSDA 3EF4A 5TK4A 1GW0A 3ZBMA 3NJNA 2BHFA 5B3SB 1AZNA 3NJHA 5I5JA 2UX6A 2YAHA 4UF7C 4A2GA 1V54B 1IC0A 3TBCA 2J5WA 4HCFA 3QJSB 2J55A 3NJIA 1SDDA 3FQ1A 2HRHA 3X1EA 3PAZA 3OMNB 1W6WA 4BK5C 4P5RA 2YAEA 3X1GA 1PZCA 4G7SB 2H47C 1GSKA 5PCYA 1BXUA 4E9TA 2EINB 4DP8X 4E9VA 5FC9A 1PY0A 4KO5A 2HRGA 2EIMB 3CG8A 1NIEA 5AFAA 1I53A 4KO6A 4DPCX 4F2EA 3FU8A 3AG2B 1GR7A 1BQ5A 1L9TA 1NICA 1NIBA 2Y1AA 4KO7A 2CCWA 3UAEA 3H56A 4M4RB 2W88A 1KV7A 2HX8A 2GHZA 4ENZA 1PAZA 3CVBA 3PXLA 2AVFA 1AIZA 2QDWA 1TU2A 2GC7C 5I28A 2ZONA 1JOIA 2J56A 4NERA 3AG4B 1HAUA 2FQGA 3JTBA 4HCGA 4KOBA 2X87A 4HHGA 1L9QA 4WTQA 5I26A 2FQFA 2MRYA 2QDVA 4YSUA 1JXGA 2GSMB 1A4CA 4A2DA 1V10A 3PPSA 4DP5X 1ILUA 1FA4A 1IBZA 5LDUA 4E9QA 1JERA 2RACA 1AZCA 1TKWA 3ABMB 4DP4X 1PLCA 2FTAA 3IEAA 5E9NA 2XU9A 4JKNA 3GDCA 1ILSA 2WSDA 2QPDB 5F7BA 4P5SA 3CZUB 3T6ZA 1JZFA 4KNUA 1PLBA 4NB7A 3G5WA 3NJGA 3EHBB 2Q5BA 4QLWA 5I6MA 3L45A 1ET7A 2FWLB 1CC3A 1WA0X 1AG0A 1NINA 1FWXA 2AZAA 1QHQA 3NT0A 4W1TA 3HB3B 2EILB 3FSAA 4BDVA 4RH4A 4EF3A 5B7FA 3IN0A 5D4JA 1OCRB 4AX3A 1NIFA 1HAWA 3HEIB 4GXFA 3UAAA 2YXVA 2XLLA 2XXFA 1ZIAA 4DP6X 1KBVA 2BP8B 2UXFA 2HX7A 1AS7A 5A7EA 4HIPA 3IE9A 2BO0A 1OCCB 2VN3A 3CVDA 4G70B 4G72B 5B1KA 2IWEA 5D4HA 3S3CB 1KGYE 1ZPUA 3NJLA 1PMYA 3X2QB 1FFTB 1PLAA 2DWSA 5B7MA 1N68A 2H5UA 2BWDA 3SQRA 1OE3A 2YEVB 4Q89A 2CJ3A 2HX9A 2YARA 2ZXWB 3QJUB 2I7SA 4UAHA 4A66A 2OV0A 1IUZA 4G71B 4JHVA 3ZIYA 5I6KA 3C75A 3N55A 3FQ2A 1WA2X 3IBOA 2YAQA 1YLBB 2JXMA 4YVUA 2X88A 4E9YA 5B1AB 3NP4A 2PPEA 4KOCA 1SHWA 2VM3A 2XUWA 1F56A 5B1JA 4A2HA 3OMIB 4AKPA 1AOZA 4GP8B 1J9QA 1XB3A 3EH3B 1M56B 3PLYA 2TSAA 1DYZA 2PPAA 3DKHA 3S8GB 1NWPA 2OCCB 2CUAA 1E67A 1KBWA 2IDSA 4AZUA 2DWTA 2IWFA 2YQBA 4GY4A 1TEGA 1IBYA 3X1NA 2PPFA 2DY2A 3SBPA 4N4YB 2VM4A 4Q8BA 4UANA 3UADA 3AG1B 3UGEA 3FU7B 2VSKB 2DYSB 2R7EA 3DIVA 5IY5B 4YSCA 2HZHA 4WKXA 2FT7A
chains in the Genus database with same CATH superfamily
3ECVA 2HPOA 1X5GA 1RUKH 3KNBA 1MQKL 2GC4C 3IMTA 5BRZE 5LXVA 4X64B 3H9SA 4WGVB 3QDMA 3ML8A 3S7GA 4FJ6A 4GLRH 1HINL 3EJQA 1ORQC 3JVGA 3QCVL 4PG2A 2D03H 4Y8AA 1Z5YD 4G6JH 3T6VA 1ZVHA 4OM0H 4XX1E 3T0DA 3T1HO 1PU0A 4FXGB 1XZ0A 4HX1B 3RTQC 5D7LD 2ILLA 4AYEC 5BUGA 1GYAA 4MRBA 1A9BB 1CDIA 2F74A 1KNOA 3ZBHA 1G7MA 4LPUA 3UG3A 2HVJA 7PAZA 2B39A 3ROOA 2XPGA 3G5ZA 2XG5A 1RSFA 4BV1A 2YIBA 4U1GB 1ADQL 3APOA 2ZXBA 3JAKB 3OKKB 5IVNA 5L6YL 2P5EB 5CP3H 4H88H 1N8ZA 4IDJH 4OCLC 5IBTL 4F2ME 4XR8C 3UZQA 2GIYA 2IOOA 2FL4A 1GH7A 3EGSA 1XGZA 5E2WH 1NKOA 3TZVA 3VYOA 4UNVA 1NH6A 4UZUA 3N6YA 4G9FA 4W9ZA 1TG8A 3LHPL 3LZNA 1DL7L 2Y7OA 3ZVVA 3WFVA 1ND0A 3CX5K 2EVFA 1AKJA 4HYOA 2JE8A 1DBKH 3PP3H 1XF4A 4RAIA 3FQNB 4IU3A 1IC5H 3A0HZ 3W2DL 3SBQA 5HYFA 3K0DA 4X6CB 3VXMB 2IAAC 3ULUE 3DOHA 3ETEA 4Q9QH 3GDBA 4N28A 4TNFA 1U92B 3X13A 1QP1A 2X40A 5A7BA 5DD5L 4CADA 1X9RA 1MI5E 2VDNH 4HKBA 4OFPA 3E22A 4FLTA 1AQMA 3QO1B 3RI5K 3FB6A 1H15B 3DRQB 7FABH 1AXSB 2FJFA 1BXXA 2NW2A 3WS3B 2YPLA 4EI6A 1UXLA 2ADPA 4ATTA 5IBLD 1U4EA 3WIHH 2UZYB 3MJ7A 4QRSB 4Y9GA 2IALA 2QPUA 1W72L 5LWYL 2AHYA 1K8DB 3EYOB 4QHLB 1S7TA 1RM1C 1G7IA 1CE6A 4FNSA 5DSCA 4PJCF 1O6VA 5FCSH 2GI0A 4EN3A 1FJ1B 5EPMA 4XCNB 3AGVA 1ZANL 1Z9NA 3QNXB 4JFFD 3L3GA 4DRXA 2B3IA 1L0QA 2KYIA 3CVHB 4PVBA 5EFIA 2WLMA 2H32A 4AGOA 3G6AB 4PRIE 5DVLA 5ADOL 5SWQB 2ICWJ 2PTMA 1MCHA 4NFBA 1NC4B 1VJSA 5FA3A 5DHMC 3T2LA 4OFYA 3RJDA 3BPLB 3M17B 3MO1A 5FYJU 2VE6B 1DF5A 1M05A 5DYFA 2XT9A 3IWUA 4OI8A 5JHDB 5CR1A 1A02N 1I8MA 2E9IA 4HQQL 3CX5F 5F21B 1RPOA 2DJMA 2EABA 4OTXH 4R4NC 1NANI 3KYMB 3P9LB 1J12A 1YRKA 4ODHH 1OE2A 4OLUL 4RMVA 4DVRL 5HSFA 3BDYH 3T65B 3LKSA 3RQ3A 1CQKA 3T77B 2ITDC 1J95A 1ACYH 4N87A 1FCGA 3BXNB 2GKIA 1F58H 3MLWL 3CXHJ 4GNKB 2UY6B 2IDFA 4HGWA 4IRSB 5D5PA 4P30A 3RI5F 1I1FB 1FVEB 1TQTA 2WZ5A 3ATFA 5TE4H 2UVFA 3K5NA 1GW6A 1ZHKA 4S0SD 5F96L 4L3EE 1NDMB 2D0FA 3UYPA 5MEND 1C16B 4YHNB 3MLTB 3VSUA 4FTVE 3DURA 1EX0A 2XFXA 4R3SB 1UJ3A 1UACL 5K9JL 2XACC 3LNHA 4Z76A 2WVUA 4BM7A 1J9TA 4HAGA 1SM3H 4P46B 4Y9BA 4JI8B 1MRFH 2UV3A 1P69B 2V8LA 2R0ZL 4HJTA 4KTEH 4NLHA 1WUZA 1NGWB 3C5JA 2X70A 4LVHC 3B1UA 5CGBA 5FFGA 2CWRA 2XZCH 2XA3A 4MNQB 1KG0A 2V4DA 1XQ8A 3RIKA 5I1GL 1AFVL 3HR0A 4ETYA 1Q1JL 1URIA 1AI4A 3V5HA 2HHHO 4MQSB 2C9SA 4IU2B 4PJIA 4NTWA 5IOPA 1DLBA 1CVSC 2OSLA 3ARRA 4E9RA 2N0MA 1T22A 5E08H 2BVOA 2OTWB 3BPNC 3VVVA 1OV8A 2I9LA 5TDNB 4I13B 3DMMD 3JV4B 4KRPB 3LKPB 1KXTA 1JXDA 5BMVB 3O4LE 4FFYL 2CTPA 2P06A 1SF3A 1O6TA 1UD3A 3A6BL 4RDBA 4LFAB 4KVNH 3CCVV 4ZPTA 5I8CB 3MCYA 1YEHL 4F7CA 2MCPH 3I74A 3ZMRA 4YDLC 1NPNA 3ZCCA 4H44C 3WEBA 1K9TA 5T3ZD 3DX4A 4ANUA 3PL6D 2CD0A 4XPTL 4ZSOE 3WMSA 3TXQA 5FYJH 1KTLA 3QDJB 3QWRD 2RMNA 2B0SL 5FCUH 3C09B 3ZMTA 5EULV 2XV2A 4HUVA 3L5HA 3KNBB 1A7NH 2EACA 1T83C 3QDMB 3C2SA 3U7YL 2P43B 4BD4A 4RWYH 4FNLL 4I55A 5CEXB 2FUTA 1ACZA 1CGYA 1OD7A 1SQGA 4K0KB 3D1MC 1MFCL 1XZ0B 4GKNB 1M7UA 4TT3G 1FORH 1FN4A 2XAGA 3NIDF 4OCRL 1IAIL 3CCSV 3LRHA 1NGXB 2XFGB 3QJFA 1GGUA 2LABA 3F7QA 1KNOB 2DQEH 4G6AC 1G7MB 3QJTB 4QR7A 2HVJB 2PYJA 3ROOB 4M02A 3G5ZB 1YY8A 5B7EA 3D39E 3NIFE 4JRXE 5ICYB 4O4HA 1IO4C 2J2ZA 1OAXH 2BIIA 1N8ZB 3U10A 3L3IB 4WO4C 1NCDL 4HAMA 4CS3A 3UZQB 1WP7A 1VPOH 3EGSB 4HDIB 5E6YA 3IPBA 4W9IC 4OPHA 2H1LM 5DD0H 1LE5B 4KJYA 3PWPD 1AKJB 2XXCB 4I18A 3KCXA 3VXUE 1FAIL 1XF4B 2VSMB 4BELD 2V7QG 4IU3B 5BMFL 5KUMA 1DQML 2YZ1A 4O2CA 1KYUA 4WWKD 5JW4N 4HLJA 4LOEA 5AOMA 1XZWA 2GK0B 3X13B 5C8YB 3D2UB 4MJ6B 3RPIA 1OAQH 3UO1H 2DQGL 4CADB 3K8MA 4FNUA 3BI9X 4HG4J 3MRIA 1XEQA 1FXVA 1CS6A 1DDHB 1UWEH 3E22B 1W9XA 4GSDH 4KKQA 2VC2H 4M6NL 2Q0ZX 2NY5L 5HI4C 4I7ZC 3WJLC 3UG4A 4ODWB 4X89A 3LDEA 4JI5O 5IEKB 3VFUA 2QLYA 2Z35A 3U2SB 1K92A 1K3IA 2NW2B 2HJLA 2YPLB 1JWMA 2VXUH 4AJWA 4X8JA 4IMKC 2HLFD 4IEFA 1KLGB 1D5AA 3UJIH 3VFSA 2ZSVB 3V0FA 3T8XA 2UX7A 1YO4A 3F5WA 4LLVA 4EXPX 1FFNA 1SGKA 2A2QT 2X6VA 3BW9A 3FO2A 2CH8A 1JF1B 1S7TB 1G7IB 3GI9H 4QRUB 4YSSA 4G5AA 2A7BA 2CNYA 4Z7UB 3SKOA 3ABGA 4WUKH 4EIGB 3HZYA 3MYJA 1QKZL 5D72H 3P30A 5EPMB 3RWGA 4NC0B 2K7PA 4WBNB 2A74C 4RAVA 3ABTA 1BOGB 3AXLB 4DRXB 4D6TH 1L7TL 4K3AA 4LK4A 5B3SB 4ZFOB 1KEGL 5BZXA 2Q86A 4LL1A 2YAHA 3F01A 2H32B 3RVXD 2YD8A 5B3JF 3F65A 3UG5A 4PDLA 5T3ZL 4B5ZA 1JYXA 5IFHH 5FA3B 1A21A 2HRHA 4B3RB 4PJ7A 4UM9D 5DWUH 1Y74B 5CF3A 5GRUL 4L8SC 4BFGA 1M05B 4HFUL 2CIIA 4HJUA 1JPTL 1I8MB 5J1AA 5GQBA 1JDDA 2VL4A 4Z77B 1U8PA 4DWHA 4IHJA 2Z9TA 3BP6A 5DURD 3CS5A 3CRQA 1N6VA 2Y9RT 3NTCL 5JQGA 4UM8A 3LOWA 3H1ZA 4OCXH 4RWHA 3OHMB 3EJZC 3L5JA 5TE6H 1NQTA 1WC7A 1B6UA 2CCWA 1YEDA 4HGWB 5I1EH 4MTGA 2AJVH 5BZDA 9CGTA 1IAIM 5CFHA 3WFCL 5J12C 1BGYH 4RAHA 2ZUUA 3VXTA 3BKJL 3CVBA 1Q0YH 3UYPB 2MNWA 2Q76B 3NESA 3HKCB 1J8HD 3LEVL 4Y2OA 4AZ8B 1CFQA 4U6HA 4JFQA 2VDPB 2XFXB 5KYUB 1UJ3B 3MLXH 4O2AA 4OZFH 4ZD3L 6FABH 4Z76B 1BWMA 3UDWA 4KKCD 1Z5WA 5FX3A 3BGFC 4L4TE 3LQZA 3W7UA 4UOJA 1P4RA 5I8OH 4ZFQA 2DDQH 2F2HA 3C5JB 3GEWB 5J2UA 5D7LB 3IJ4A 4A2DA 1U2CA 4R5XA 5DFWH 1NBQA 4FQ2H 3W0WD 1A6VL 5B3NA 4MVUA 1SYSA 1YSCA 5E5RB 1AZCA 3RWFA 4N86A 1SPDA 3B8NA 3NCJH 2E59A 3QI9A 5AZ2L 5KBPA 3CLEH 3KWTA 3MV7E 4LAQH 4PB0H 5D2LA 3V5HB 1MHCA 3ARGA 4MS2A 4JZJC 2K9PA 4ZMXA 5IOPB 2OSLB 1FPOA 4J9YB 1N8RW 4DF9A 1T22B 1HU8A 2BVOB 4QHKI 5IGXL 4EUPG 4LFBB 1ZOXA 4OVVA 4W9CC 5IT9N 2PXYA 3FCBA 4HIJA 4JI0O 3KPTA 2QGBA 4W9LC 4ZAKD 1XILA 4DKAA 5J6GB 4BUHA 1FWXA 5L3BA 4ZPTB 2UUCB 2F54D 3P4NA 4OCNC 2Q87A 4BDVA 1U8MB 4Q9RH 1N4CA 2VLRE 3T0XA 2WWMD 5DC4B 4WFFA 3JALA 2VMCA 4FS0A 4PGZA 1C5DA 1NMBL 1UYWH 3T0VA 5H94A 2V3DA 5JW4Q 3SJCC 5A7EA 4AYBA 1ENVA 2ICEB 3FN3A 2G0KA 5IJKA 2AF2A 1NCUA 1SOXA 3PIQA 1QSFD 1KCKA 5MEQA 1QFUL 1FVCB 3BSZL 4FLHA 3QCTH 1LHZA 4PS3A 1K8AW 2FGWL 1IM9A 4OFVA 4DK1A 3STZB 1CXHA 1CGVA 4I55B 5EBWA 1EHNA 4G8GD 1G9NH 2CJ3A 1Q4NX 5I0VA 4H20H 2NUPB 2PI5A 5IE9A 4MTOA 3CMAV 1FHGA 3FHQA 1FN4B 2P8PA 2R51A 4TQFA 3IFPA 3L7EA 3QJFB 4QNPF 2OXHB 1SY6A 4JRFA 5HYJD 1ONQB 4GUNA 3O2VL 4JFFB 3MUJA 1R1BA 1JIBA 4N2GA 1W91A 1V7NH 4J1UA 5FF6B 4O4HB 5T1DH 5AOZA 4ZTPL 4F4LA 2CKBH 2CRZA 2V5TA 4U1HA 4GP8B 2JKLA 2ZX8A 2QE7G 2A1WH 3AG3C 5JVDA 1BDYA 5ADPL 3LDCA 4I89A 5L9DL 3JATA 3G3LA 1UT2A 2R4SH 3IDNB 4I18B 5FOJA 1EAOA 4GY4A 5C07D 2Z7ZA 5F0MB 1Q5OA 4F57H 4ZX3A 1GMGA 2H2SC 2H3NA 5I1HL 4AG4H 2EYRB 1M7XA 4RCAA 2CHNA 1JZ3A 3BQUC 1LUWA 4AI8A 3B4NA 4FYQA 5EDSA 4OX9O 1SVZA 4H13C 2FK9A 1H9VA 1DFXA 2F53E 5ILTH 3MRIB 3BZFA 1JZ5A 1ZVSA 4IGBC 1FDLH 4OB5H 1M9WA 3ASOC 1H3PL 1WNSA 4I50A 5DJ2B 3LNDA 3ZLQC 4S1DD 1JWMB 4FP8H 3DOIA 3OAAG 4O9HL 4GBXD 2CLVB 4X8JB 3O2DA 3HE6C 3VFSB 1CF8L 1T2XA 4GINA 4NNXA 4ZO7A 3T8XB 4D9LL 4DR3O 3F5WB 3BVUA 43C9A 1DLFH 1FFNB 4KKNA 4ILDA 3BW9B 3FO2B 4NP9A 5GSRA 1D5XB 3LPOA 2FL5A 3HZYB 2OWOA 2G5BA 2NX5A 3RWGB 4ODXB 2IDTA 2UWEE 3G9VA 1H8NA 1N3NA 2H8PC 1SOKA 4U6XA 5T5NG 2X0LA 3H6JA 5LGTA 1BQHG 5LBQA 4Y19A 3WMPA 3W57A 2AKRB 4UIKL 5IROC 2CLZA 4MMXA 3VGDA 3QPKA 1H8HG 4NCC2 3ETDA 1TOXA 4P48A 4KHPB 1XXDC 3MGTA 3TXSA 1NTKH 5BO0D 1SRYA 3JD4A 1S5IH 1Z6JT 2BRRH 4BW5A 2NR6D 2UUDK 1C1EH 2JI3A 2GJ6D 2BP3A 1ROWA 3D8MA 3JZYA 3L3HB 4M1CC 2CIIB 3NSJA 1W6LA 3NSDA 4OT1H 4P9HC 3UEQA 1WT5A 3VGBA 4HPHA 2PTVA 5J1AB 5IQ9B 4XNXH 3TBWB 1BQHA 1U8PB 4TUYA 4LARL 4MJID 1HCVA 2Z34A 4IHJB 3EBHA 5HP5A 1CBVH 5LA6A 1P7QD 1EN4A 2JJTA 3UC0L 3U4AA 4F2FA 5KYWA 5D7IE 2B9AA 5JPMA 3VGAB 4Z18A 3HZKA 2YXWA 1M7IB 4N0UA 1OAKH 1VF6C 2AQSA 2I60L 2VKWA 3MLUH 1BIHA 1WC7B 2VWEE 1SDYA 3LZFL 4FFZA 3PL6B 1YEDB 2P5PA 3QPQC 4EEQA 4GRMA 1MCDA 4PBDA 4BKTC 3VXTB 3WGVB 3OD3A 4PR5A 3OAZK 4X65B 1CFQB 3QJOA 4JFQB 4NPJA 2M2DA 4X20A 2EH8H 2ZTBA 4O2AB 4CU8A 3IJSB 2ENPA 3HC3L 3PHQA 3RL1B 3V0DA 4FXLA 5IB1B 1UEMA 3P0YH 4NQDE 4M29A 3DTUB 1JL8A 3IDYB 5GONA 1A8JH 4LF8O 5EZYA 4FCHA 1WK0A 5J2UB 5KMGB 4W70A 2D31A 4OJEH 2VLLA 1XT5A 1SJEA 4ES9A 4BSJA 2VJXA 4HC1L 3SGEI 2SEBA 5F6IB 4NGHL 3ZE0E 1FHNA 2BDNH 1XCTB 2TAAA 2X2UA 3V6OA 4R26H 3U4KA 2EZ0C 1OAYH 5D2NA 4JFVA 1UM6L 4GLRI 1EDHA 3K2IA 2ED6A 5GGVH 4NQXA 2UXDO 4HZ3A 3VD5A 1MCOH 2QMJA 2P22C 3KYAA 4XOAA 4J42A 1EFRG 5C0EA 3L5WA 4F33A 3BDBA 4WI2A 5IYZB 1JGDA 1UATA 3VTAA 4M43L 3CFDA 4BDVB 3LH2H 5CS7A 5K59E 3FS9A 4HPYL 1D5NA 3UT5A 1AZRA 4LQ1A 3RRQA 1JNLH 4YDIL 5DMJB 3S3JA 1C5DB 5C2BH 2XWXA 2BP0A 4AUJA 3GJFK 4G11A 2FZ3A 1IBBA 1W0VA 4EUPB 2G4EA 1AQ8A 1Q90A 4UT9A 3PIQB 4GUOA 4AGNA 1E42A 2VXSL 4TSBL 1IKFH 1ZHLA 1AVAA 1N59A 3M6DA 4KI5E 2YRBA 4LIQL 3GHEH 4MJHA 1JGLL 1Q9OA 1V3KA 4B9FA 3TYFA 3NCYP 4NI6A 3TTSA 3QO5A 1TEYA 2ZOLB 1T5XB 3RDTC 5E1HB 4LGPB 5FNVA 2YK1H 4DW2H 1U95A 2D3LA 2BS71 2EIMC 3WXVL 4J3TA 2E7CA 2ZICA 3WI9A 1T03L 2P8PB 3R8BB 3FB7C 1QFWL 4GO8A 2ZOWA 4F8PA 4ZMZA 1YJNV 1P4LA 4P2OC 3DOSB 5LCVH 1DQTA 3SPHA 1NWOA 1QHOA 3FSVA 2E75B 5F71A 4J1UB 3NK3A 3MRKA 4L8CA 4BH7B 5D1QC 1TJHH 5GTHZ 3IS0X 5DD1L 2VR8A 5KVMC 1AY1H 2PO6D 2W60B 3GM0A 4L9LA 2BMKA 2KERA 4UM9B 3ULUF 1KU9A 2IOIA 1KWKA 2XVKA 4NN6C 1GSMA 2NR6A 3CVCA 3QFJA 3A21A 3MSPA 3JATB 1K2DB 1IILE 4R0LB 1JZHA 3KL0A 3P2TA 4M7JL 1WB8A 3J81N 2OLDA 4D2NA 5DURB 4PLOB 2OMWB 4PJBF 2P49B 1IC7H 4H25B 5L3DA 1F11A 1I7RA 4YK4B 5LGJA 2P9RA 4OGQB 1OHHG 1S3KL 2EDWA 2UUAO 2Z7WA 2BP5M 1TFHA 3ARSA 3IN2A 3SE4A 1QSEE 2EE2A 2YPVL 4WI3A 4FQQA 4ZT1A 4IOSA 1JGUL 1QI5A 4D7SA 1E40A 3F7KA 2WKOF 5H6RA 3DK0A 4C56D 4CC5A 3CB2A 3B37A 4NQTA 3K58A 3DLQR 3GXUB 4WFGE 2EIJB 4EB6A 1YYCA 3E80A 3GWKC 3WEMA 5C6TL 5I8CA 4G1EA 1I8AA 1TPXB 2J8UB 4ELMF 4W81A 3TJEL 1K34A 3NCBB 3RVTC 3NZUA 3ARPA 3ZMSA 2C9VA 3I3BA 3RWDB 5SWSE 1N10A 2GJJA 1NMAH 3OLEA 4LLYB 3A8TA 5GSRB 1U8QA 1V3MA 4X4XA 5CHNA 5C0AE 4U6XB 2RBLA 3LIZL 1BF5A 4P4RA 3MBED 1S76D 4NIKB 1SHMA 3W0WB 1F3DH 2BIHA 1ZLDA 5DRWB 5JMOC 2CLZB 1AZUA 2HYMA 4TULH 4MMXB 1HE7A 3WHE1 4B6ZA 4ZHQA 2DQTH 3S3WA 2E5LB 2ADJB 4KO9A 4YWGL 4I3RH 4B27A 2NYZA 1OSZB 5CKAA 4CH6A 3MGTB 4L1BA 1N33B 1O9HA 2CDGA 4QHUB 3ZJAA 2ZE7A 1TQVA 1Q0XL 1YMMA 4OZHF 4MVMA 3JARA 1ES0B 1AHMA 3B7SA 3WTUA 1J5IA 4ZAKB 2Q6WB 3B3BA 2J1ZA 4N5UA 2DD8L 2ZWLT 4LF9B 5KYWB 2F54B 3O3AA 5KEZA 2GTSA 5HTSA 1IBKB 5K1JA 1WLEA 3TIEA 4Z3HA 2Y06H 3ULUC 3HZKB 3QYCA 5LGKA 1OCWL 4N0UB 2J12B 1CYWA 3FK3A 5TH2A 2XASA 1BPVA 4GRMB 4N2BA 1QFWM 1ZA6A 5F1NA 1TGOA 1GYCA 4OKVA 3QUYC 1ETA1 1QSFB 1X5AA 4HUWB 5MERA 4M9OA 4U7SA 4X20B 5D6CA 1LO0H 3IT8D 3FTWA 5HDBE 3ILPA 2DWEC 3TNNA 2IDUA 4LCCA 4YXLH 4BH8B 1ZE3C 3VACA 1GW0A 2K9UA 4G8GB 1QABA 5EZOH 4FQXA 3B8SA 2LVCA 3SY0A 1FGNL 1KJ2H 2D31B 1SRDA 1TTAA 2VLLB 1V54B 4BA8A 3KGUA 4KMTH 1CDHA 4QRRE 1SJEB 5BRPA 2JB5H 5HYJB 1PD1A 3VQ2C 3G6DL 1DFBH 1HWHB 3FH8A 5K1VA 3TNMA 1R3HB 4J4PC 4N8PA 3V0WH 1MIMH 4IW4C 3K4ZA 1YECL 1VGEL 1WZAA 4N8VG 5E1AA 3X1GA 2W59A 5KBKA 3CVIL 2EC8A 4JZGA 1D2PA 5PCYA 4F9LA 3SPGA 3G5XA 2C9RA 4M62L 1UTDA 1HXMB 4OGXL 4Y4KD 2W9EL 3BVNB 3PGCA 2YO3A 4J9ZB 2DBLL 5C0EB 3L5WB 1TETH 2F61A 3CDCA 4TSFG 3JYBA 4NKIL 4HWNA 4P59L 5C07B 3U9PL 4WY7H 2Z93A 5CR8A 5AENA 1JGDB 2HG5B 3QZMA 3WTWA 2GY7B 1OEZW 5DJDB 4BFJA 4XVTH 5J1TC 1MZFA 2BTQA 2MHAA 3DGGA 2O93L 2DYRC 1L5GA 1UXWA 4KJQD 4JN2A 3ZU8A 4N8VA 3UT5B 3F7RA 2AK1H 5IMOB 1I82A 1ROCA 3FB8B 4KMLB 4KP4A 1NR7A 2R1XB 2FZ3B 3FZUC 3C60D 2AXTZ 3HCVA 1A4KA 4IOFD 1S5LZ 4KK8C 4PJXE 3D5OF 4BGLA 2OZ4H 3N2GB 1A47A 4R90H 1ZHLB 1N59B 3N43B 5JIMA 2F4VB 3WFBL 5GGTA 5HBBA 1RFYA 4QXUL 2BX5A 4WTQA 1VHPA 4Y16A 3TYFB 4GBXB 1CZ8H 3CFTA 3SE6A 4XNYH 1PZ2A 4B3MO 4YNYB 5FNVB 5EO1A 4JZOB 2A9ML 1U95B 4QT5B 3UZEA 3TVMC 3S88H 5IQ7L 2NDGA 1OGSA 1MIEL 3CSBA 2BSBA 5C6WH 1K3ZA 3MJ9A 3SQBA 4AIZB 2PN5A 2MOQA 3IDUA 4YXKH 5JXAL 3K79A 1P4LB 3MFFA 4Y1AA 2Y07L 5E6IC 2R8SL 2JRIA 2WQWA 3TJTA 4K3EH 3ZHKA 1DQDH 2WC7A 1PM9A 3WNOA 1ZLVH 4FFWC 1Q9LA 3S3XA 4YZWA 5JORA 3QCUL 2VMEA 4TQEL 3FBKA 2AJ3B 4JAMB 2DM4A 4NX0A 5I15L 1CC3A 2CIKA 4LF7O 1GKEA 35C8H 2WQAA 5CA0A 2DH2A 1WD9A 5D5QA 1CFNA 2BY3A 3WN5C 3AWGA 1EZSA 2AP2A 2LP7A 4C4BA 2OSYA 4G6FD 3HVNA 4JY5L 4MXWH 1P7QB 5J0BA 5E1GA 4XXDB 1G6RH 3L1OH 1T0NA 2HJKA 1OTUC 3KE0A 4JO2L 1MAMH 1F11B 1BWWA 4MW3A 1Q9KA 5IWAO 1VQ6V 1E9OB 2QJ1A 3BCCH 2IWEA 4IKJA 4ODUA 2F7QA 2NZ9D 1CDCA 1OTTD 4X1IA 3QJZA 4APQC 2JKNA 1N5YL 5DVPA 1MRCH 1EDQA 3D05A 2WM0A 3HUJA 3UIZA 2DLFL 4EB6B 3IM1A 3BH8B 3DGEA 4G1EB 4AYMC 2J5LC 2DQIH 4A66A 4PG9B 3IMVA 4JFZH 5FHAL 5KG9B 1OARH 4JR9H 3A4EA 2JKIS 5I6KA 5FK9A 3GBEA 1FYTA 2B4CH 3P4MB 2JGUA 1KCLA 2ZD0A 1U8QB 5CHNB 1T1XB 4HIIA 2EYTA 4GW5A 5LYJA 3TA3A 2K1EA 1MHPL 5AAMC 3NP4A 4KOCA 3QEQD 2CR3A 2GABA 4NFCA 2HT2D 5DRZA 1D6VH 1OP5K 1JHLL 2WPGA 4MYWB 5AAWC 4YL9A 4QWWD 4DGYL 4OY9A 3C3SA 5EA0L 1ETZB 2G3XA 2QQQA 4MNHB 2PPAA 3MAWA 3PWVA 2EDFA 4ZHQB 1W0JG 1MEXH 3M07A 4X7DC 4W4LA 3NH7L 2CGYA 3RGHA 3ZKSD 2HKHH 1NCJA 2JQZA 4HS8H 4U7KA 2X4SB 4DV1B 2PNDA 4MJ2A 1L0YA 1K5QA 5IJ9B 2D7NA 1KY7A 1R5VA 3H53A 4NO0D 3RWCB 3JARB 3UBGA 4DGIH 3SBPA 1E4JA 3WDJA 4XVUC 3BEWB 2WP3O 3N1MC 3BABA 5AVRB 3U30B 5DDHB 5LXTA 5CEZL 3QHZL 1AOHA 1K4CB 3O3AB 1TDQA 4DZBA 5BV7C 4FM1A 3COOA 5IB2A 2HJFA 1JDCA 2QGCA 3TC9A 5AVSB 2MSPA 4F7KA 3TCUA 1NU1H 4YDKH 1UT1A 5TH2B 3L4XA 3D36C 3EO0A 3C60A 5F1NB 1ZA6B 1NKDA 2XRAH 1BEYH 4X5WA 3C90A 1I4FA 1E5YA 1I7FA 1B3JA 3EYVB 4YHLL 2F7OA 1RZ7H 2X2IA 2QA4V 3VRLE 3K0GA 2ZKYA 4M8QA 4HG4K 4Y8DC 3VXSA 3TNNB 4OIAA 5EIIB 1IMHC 1PKXA 1LDSA 4FLQA 5E4EB 3H9VA 5TPWH 4NPKA 4PCTA 2VDKH 5AD0B 1GOFA 5IB3A 1UCBL 1F4YL 3LXBA 4DK0A 5E9DE 3OHXA 2R9AA 2EDHA 3NGBC 4ZX6A 1WZMA 2CGRL 5JOPE 1OZ0A 3K5LA 1NS1A 1B0GA 4QOKA 4XGZA 4OD1H 4PJFB 1TZIA 1VGKB 3GIVA 3C9NA 5JW4M 3Q2CA 3ULVE 5DLLA 4A04A 1MCFA 3VWKC 2CJUH 4A68A 5IESL 3HB3D 2HAZA 5E1AB 1EHXA 1CYGA 2R9HD 3WJMB 1KIUA 2VW7A 4RGOL 4XMZA 2HJDA 3M1BA 3GSNA 4W9JC 1T0MA 2N04A 4X8GA 3CDFA 4LOUC 4KL1A 4WHYG 2FWUA 4OLYH 4FMKA 5I19L 3H2PA 1H19A 5IB2B 3ARBA 3ZHDA 1WTGT 3N44B 2DQ3A 4GSRA 2GJZA 4KTDH 2OPCA 3CH1B 2BTQB 3KPMB 4OIIL 4FQJL 2JVDA 3L4VA 4X5LA 4N8VB 1ZXKA 4HMCA 5D5MA 1CD1B 1N19A 3JUYA 5TGBA 4JPSA 5GGSA 5TK2A 3FO9B 1RURH 1N64H 5LJYH 3DSFH 2AXGA 2P5OA 2PPCA 2P3YA 1A4KB 2Y6SD 4IYKA 3ILDA 3KJ4B 3BKYL 1JPSH 1NAML 4C56B 4HD5A 1NI8A 4GT0A 4ZOLB 1H8LA 1JV2A 2CTQA 3TTYA 4Y88A 2PZSA 3CPLB 3KYOA 4GKZA 3H4FA 4P4KA 3V4PL 2CBMA 3X12A 3C5ZA 2Y1ZA 1AH1A 1AQKH 3AQDA 1S3JA 5KVFE 5EO1B 3HKBA 1MZZA 4G7VH 1A14L 2HRLA 2H45A 4Y5YA 1M3JA 4M3HA 2X89D 5I66A 1BSMA 1M5IA 3D9AL 3MBEB 2OL3L 3L81A 3MFFB 1S72V 3HAEH 3U4EB 2WUCH 2ORBH 2PW1B 2JFCA 1ZL8A 4YSPA 3GQFA 4L1TA 4Z9KB 3REWA 2XCMC 4ALAC 1U93B 1YEEL 2FGZA 2W0PA 3NN8A 1AO7D 3FNKA 1B90A 3EOTH 4HCRH 4MVBC 2VAAA 4WGWB 5F89B 1AACA 1AHWC 1CLYH 2CIKB 4E2OA 4X62O 2ADFH 4J28A 5CA0B 1TJMA 1N67A 1CFNB 1H8OA 3HC2A 2XIIA 5H9CA 3N04A 5I6LA 2DMGA 3EVKA 1KDIA 4OGAC 5DJ6A 2OMBA 1MZEA 3MOBH 3A23A 3DTDA 3WFEH 4L05A 5DD3H 2WO3B 3N2JA 3QQ4B 1U3HC 4F7TA 3K8KA 2B1HH 2HJKB 4GQ9H 2AK4D 4F20A 4MXVE 2XWRA 1RPKA 1SF5A 4HXAH 4NUPA 2JK5A 4X6CE 3AJ7A 4G6JL 3IJEB 5JHLA 3A0BZ 4OM0L 3L4TA 5DZOA 1PG7H 3CRMA 4QKXB 1QTYT 4ENED 3ML0A 4K8RD 3WMQA 1QEWB 2ATPA 3DX0A 2YIAA 4U3JA 2YQ2A 4NXKA 3NXSA 3LPPA 5IVZA 3ETQA 5IDJA 1OP4A 2XV3A 3WBDA 1JD7A 3T6QC 4CMMA 4H88L 2FJGB 1EDYA 1XAUA 4IDJL 1HKLH 5FK9B 1LD9A 2PCFB 5E2WL 4TQDA 4UBDC 1LTXA 2DQMA 3ETTA 4GW5B 5LYJB 4GQZA 5I18H 1K5NA 2YI8A 5CP7B 3GUTB 1LUVA 1J5EO 1IE5A 4HIQA 5DRZB 1BL8A 1DBKL 2WBJD 3T3PF 2OTUA 3QDAA 5IMKA 4I2XA 1Q38A 2EO7A 2K3TA 3AITA 3PWVB 4Q9QL 1DBAH 4N2CA 4FQPA 1CGWA 2E76B 5AALA 3VXRE 4MVRA 4RWUA 1KBBA 2VDNL 2X5PA 4ABQA 1KELH 1QNZH 1EEZA 4JKKA 4Y4KB 3ZDYF 1GPOH 7FABL 5LUMA 5EUOA 3BAKA 2MPAL 3DECA 4KX7A 5I8EB 5LXTB 2D7QA 1F18A 2XZQH 3QJVB 1MCNA 4DZBB 4BXSV 3W82A 1GZQA 2EJ7A 2KKWA 5DVKA 5B39B 1QW9A 3G6JF 1KB9J 5JH7A 1FZOA 1R5WB 3IGAB 2CCVA 1R33A 1U3YA 1IBFA 3AU1A 4QCIB 3RBGA 1X7QA 5CJBA 1E6OH 3EO0B 3C60B 3KPRE 4HIXH 2QKIC 2NNFA 2JMRA 1B0RA 4K23H 4MS8C 1QX1A 5CBAB 3LB6D 4MSWC 4YHYB 1W2KT 3K5RA 1NPUA 1P4IH 4FLYA 3BSHA 1UQSA 1XNRB 4U6YA 1JPST 2IQ9H 3FQYA 4W93A 3D3VD 1AD0B 3UP1A 2NRDA 3F8UB 5IB3B 3BHPA 5FUOL 1T04A 2Z4TA 3UACA 2ZNJA 2JKWA 4X83A 3WB2A 3CN3A 1NZRA 3OHXB 1U4FA 4JGJA 2H6PA 4O51A 3NCFB 5IVXB 2X89A 2KZWA 3P1VA 5C3IA 3O6FA 1B0GB 5EBLC 4OTXL 2NY2D 1TZIB 3OGCB 3CHQA 3WHE0 2V2WA 3GIVB 2PCYA 4MNQE 4ODHL 1NCGA 4JTAB 3BDYL 2AEWA 3RGVD 3SDDC 1ZDQA 3MLPA 3OJMB 2X4NA 1KIUB 3CRCA 1F58L 4HJ1A 3RTLA 3GSNB 3UTTD 4EZLA 3FONA 4XCYB 2WIIA 5I1AA 2I32A 2UY7A 3CFUA 5JPNA 2FT8A 5CLYA 4FM2A 4AL8H 1KXVC 5GSVB 4BK5A 4D0BA 1J0JA 4W6YB 1ET5A 1GAXA 1R3JA 4MYPA 2CKNA 4G6FB 4KDTC 1OTSC 5FYLH 1GA2A 1XF3B 3B5TA 1JFQH 3D25B 4LP4A 5CZVH 2RCSH 2AK4A 3EJRA 2WHVA 1MRFL 3MXWH 5D5MB 3V6ZA 1O75A 5TGBB 2HCZX 4TV8A 3GMLA 1I7ZA 2CGZA 4BIZA 3U1SH 3GS4A 5FDWA 3DX8B 2AXGB 4I5SA 2XZCL 2OYKA 5I5IA 4TF4A 3AFLA 1OAUL 1J5DA 3VI3B 1J8RA 4IJ3C 4XB3A 2R0LH 4OZGF 4WTXA 5FGCB 1JV2B 5BY1A 2VLJA 3FSOA 3QWOB 3SGKA 3SYCA 3KYOB 1UA6H 3RTQA 4GKZB 3AT9A 2LU5A 2ZNWA 4OLXH 3EOBA 1WBZA 1X59A 4ATWA 1X5KA 1QWHA 2J5WA 5J5EA 3HKBB 1M6UA 1RULH 2R2HA 5E08L 4MLIA 5IV2A 4F9PC 5IKCA 4Y5YB 1ZRUA 1EJ6A 1W6WA 2CBQA 3WO4B 5I66B 4AK1A 1RZIA 1RP3B 4EPSA 1JN6A 3QEQB 3T0WA 1EO5A 3ARDD 4KVNL 2WBJA 4LEEA 4NQSA 4BFNA 5I8KH 1NAMB 1SEBB 3VQLA 2MCPL 4ADGA 3REWB 3KH3A 3SOTA 4AH2B 4BUGA 4IRJD 4X9QA 3RPBA 4M6OH 2VAAB 3V4PB 1MOFA 3ZMNA 1BMFG 4Z7OF 1CDGA 1NICA 4DV2O 4B3TO 5FYJL 4CMHC 5D7JC 1GGCL 3ENEA 3GBNH 5I6XC 3H56A 1PBYA 2XN0A 4IBYA 4XAWH 5FCUL 3CMOH 5DJ6B 1WWAX 1GZHA 4ZYKB 3D3IA 2D0GA 2OL3B 4KU1A 3KZ8A 4JFUA 5AVVB 4Y5VB 4F7TB 5A3ID 5MEPB 2AVFA 4RWYL 3EOAA 2VR3A 4JI1O 1LK2A 4ICXA 1AI6A 1B0IA 4NQED 1TU2A 2JK5B 4PJ5E 3V5DA 1DVFC 3FTXA 4KDVA 4WFHE 4U1IA 5C2UB 5I28A 3CZJA 3AG4B 1FORL 3QIWC 4TLKA 3KVQA 5A2IH 1HWWA 3ELQA 1P49A 2BH0A 2FQFA 3BUTA 2DQEL 4U3JB 3DPBB 1YJDL 1W15A 5IVZB 1ILUA 2FB5A 5LVEA 3Q05A 2BIPA 4H4NA 1ZJAA 2PW2B 4U6VL 4CMMB 1OAXL 1O7SA 4G6AD 4ZMVA 4HULB 5BZBA 1ILSA 3QA3A 4KUMA 4PWJA 1LD9B 1VPOL 1VQNV 3D3VA 4WI5A 4JY4A 4UYPA 1U3ZA 2KI6A 4BZYA 2OR8A 3CZGA 2V7NA 5DD0L 1XL6A 2IH1B 2I9TA 5E94B 5I75B 4ACTA 2W1NA 5D7EA 3TV3H 5E79Z 5I6MA 4WW2B 2FWLB 4I2XB 4NZ8A 5J7CC 1WA0X 4NT6A 3DV6A 3RGVA 4GO9A 4WFED 4PS7A 3HB3B 1O9GA 2BSRA 3ZKMC 2VXQA 1OAQL 4MNGE 2UXNA 5IJBC 4ONOA 3LEXA 3UERA 1GTFA 4GSDL 4DERA 1UWEL 4LBEC 1QQCA 1TVDA 2IPUK 2VC2L 4MB3A 4KJWD 1G1YA 1EEZB 3J2PA 1FJGO 2BM3A 3FMGH 5GGSY 2Q7YB 3EXJA 2EC9U 1N6QH 4KFZC 2ITDA 4HIPA 3VB9A 4AMKH 3GSXB 5B1KA 4Z7WE 3CYOA 5L0QB 2HWZH 4TNVF 5L2KE 4X8XA 3UJIL 1BG9A 5HI5D 5HHQA 3F5TA 4U7MA 2CHXA 2DWSA 3TGXA 5BCAA 4ZFFB 5JH7B 3GI9L 2ITCC 5D1ZI 5DR5H 4PJ6A 2E3VA 4WUKL 5E9AA 5HDBF 1A66A 1DJIA 1X7QB 3MRRA 4Q89A 3FRPA 2WQ8A 2JIZG 4Z7AA 3U6XS 2YARA 1JPGB 4JASA 3VBBA 1MWAH 1QRND 3B7RL 1B0RB 1RHHA 2GIXA 4G71B 2B9ZA 3ZQWA 1NCWH 4ORZC 1IGJA 3C75A 2WSPA 3WLBA 3GZOA 2JXMA 2Y4SA 5IFHL 1UQSB 2YHGA 1PKQE 4LF4O 2ZNIA 1DE4B 2A6JA 2LLGA 3QORC 2VM3A 2BNQE 5DWUL 4N0CD 3UZVB 4K9EC 5EZLA 5HHVH 1T04B 2AZ0A 1RV6X 2YD1A 2NZIA 1XB3A 1CT8A 2XQYK 4O51B 1RPRA 3TN0D 1UURA 3AY4C 3P3NA 3MUGB 5F6HI 3O6LH 1XBRA 1DK1A 1RJLA 2APFA 4YBQD 1T4WA 2E0PA 3O6FB 1T5EA 5L8JB 1PFCA 2EAEA 2V2WB 4YFEA 2DWTA 4OV5B 3E35A 4ONHA 3ZK0A 4XMPH 4WJKB 4OCXL 1TCMA 2V5YA 2DY2A 4IRJA 5H8DA 2EEFA 2X4NB 3SYAA 5DMKB 4N4YB 2VM4A 5TE6L 3VFVA 3C6LC 1HKFA 2B15A 4UTAA 3FONB 2WIIB 5I1EL 1X5MA 2AJVL 2HA1A 2J6EH 3ATBA 3P3SA 4ZMLA 5H37A 5JPNB 2ZXQA 1YDXA 2HZHA 3T3ME 1Q0YL 3VNYA 4AQ1C 4A55A 5AZEH 5FUZH 2AGJL 3CBKB 4E5XG 3BMWA 2YSUB 2ZWNA 3MLXL 1W8EA 4LRIA 5DHYB 5IK3A 1T2QH 3JSNA 3KWWA 5EN3A 6FABL 2XTJC 2AK4B 3LRSA 5EK0A 3LQAH 1H6EA 1PZDA 4OZIE 2Y4TA 1M90W 3GMLB 4FIPC 4NWTH 1SLUA 1I7ZB 1WICA 2DDQL 2IADA 4FE9A 5DZLA 4X9YA 1TZGH 5FDWB 6PAZA 3E9TA 2WNWA 1T83A 3PDDA 1KEML 1QCEA 2ESVD 1QUNA 2VITA 4FQ2L 4L48A 1XHXA 4V1DE 2Z7YA 4HIHA 1MCBA 2CRYA 1KGXA 4PJGB 1V5JA 1AB3A 3GXMA 1UD2A 2EKSB 3CLEL 3CV5A 3OWEA 4LAQL 4PB0L 1OGAE 4AQ8C 4E5XA 1WBZB 3MODH 3ILEA 3U0ZA 3QEHA 3KS0J 3NA9H 4CSTA 4MTFA 2X4PA 1JJUA 4PJHF 2LW7A 1S9XA 3GKWH 4PY7B 2A6DA 1YNLH 1RZIB 1FIGH 1IEHA 5DEJA 1INDH 1YEIH 4DV6B 2GK2A 2HH0H 3GMMB 3PU7A 1ASPA 1FRGH 3NPSB 3BUIA 3MHHC 2WBJB 4H40A 4NQSB 5GGUB 3T4YA 4G6MH 3S0PA 2WB1A 4Q9RL 3OKEA 1AYRA 4G3YH 1JP5A 1UYWL 5K1NA 1KB5H 1CB4A 5LBSA 1A6AB 3IMSA 4BRVA 2CMRL 4MCMA 3UTSD 3RVUC 1A8ZA 2UXTA 1WN7A 5FO8B 4KAQL 3PCYA 2PR4H 2APWA 3QCTL 1IX2A 2EDJA 1S77D 2X28A 4EZJA 1YZBA 1J18A 4XZ4A 4MHHG 4KKZA 4LPVA 1IQDA 4WKZA 3WJLA 3MV8A 3EOAB 3HS9A 4PS4H 4JFDD 2H26B 1G9NL 3V5DB 1BZEA 3QQ3B 4H20L 3GMOA 4U1MA 4YDJA 4XOBA 1G0DA 1UGNA 2WCPA 3A67L 4DR1B 4JDTH 3HNTH 4YHOH 1U8NA 4NN7B 1XH2A 1CD9B 3P30L 4IMKA 5FAAA 2EYSB 1QSZA 3FN0L 5DYOB 4N21A 3LTVA 4F5CA 5I82A 5LP6B 3VXOB 3IS1X 4JM0A 4I77H 3UM7A 1J0YA 1L6ZA 3D18B 3FPXA 4WU7B 4DKFH 4FRWA 3QF7A 3NK4A 4XI5C 5IMLB 3QEUB 2ZAHA 1SJHA 1ZMYA 2D7TH 2O5NA 3K74B 3MUUA 3VYNA 2H0EA 5ACLA 5T1DL 3A4FA 5J9PB 4JYAB 2A74A 4GPVA 2CKBL 4X64O 4NUJB 3QA3B 4N3UA 3VRIB 1IRAY 3D3VB 1RIUL 4JY4B 2A1WL 1UOKA 3TCXA 5CNHA 3NUKA 5F7DA 3T2MA 1SLXA 1JVLA 2J21A 3ISYA 3TN0A 1SQQH 4MX7A 1VEMA 2R4SL 2WSSG 1H3UA 1EIBA 3NJFA 3HG1E 4HS6A 1JOYA 4F57L 2P5WA 2NY2B 2AEQH 3QQ9C 4L8SA 5AW2B 4NT6B 1XX9C 1W2BU 1WPXA 3RGVB 4AJVA 3AWFA 4N5ED 3QXTA 1LP9B 5HYIA 5J1SC 1P7HL 4HXBH 4OLWH 2BSRB 3M86A 2X4QB 3UTOA 1PV0A 2VB5A 4GG6A 3CRAA 1XIWD 5ILTL 4F24A 3UTTB 2PP8A 2VLKE 4LPCA 3QDGE 1FDLL 2FYYA 2ZQMA 3EJSA 4OB5L 2DQ0A 1XV8A 4YVNA 4ZX5A 5KA5A 5FV2A 3P2BA 4OJFH 4KX9A 3EYUH 1FG9C 4FP8L 2DRUA 2XOTA 1G9MH 3K06A 1DJYA 2FBRA 1CPYA 2YMTA 2Q3ZA 3PJNA 2QQNH 4PJAF 4YQXH 1NLDH 1RCYA 5HHQB 2Q10A 3AB0B 3QH3A 2MOGA 4J3SA 4PVLA 2FCBA 4G8IA 1KCBA 5G4MA 4D8OA 3OR7C 4YY3O 3VRLF 1R3LC 5LN4A 4MAYD 5KOVC 3U0PB 1EPFA 1RSOA 4AYSA 2ESVA 4NJAH 2OMVA 2VC2B 5GJTH 3LKQA 3R18A 4A7UA 2NY7H 5DJZA 1DQLH 2LR4A 4LVHB 1K73W 4O02H 2JXMB 5C0JA 4GUQA 4Q6GA 2NNAA 3K6NA 3JAWA 4IIJB 3U9WA 3TBBA 2NYYD 1S6NA 4E36A 2Y6TE 1N0NA 1M57B 2A6JB 1RHFA 2EC9T 3GSWA 3OPZH 5EZLB 5AYTA 1JZ2A 2BRRL 1C1EL 2F7IA 2AMGA 1CT8B 3HRZC 1O9WA 3QZNA 1FGVH 1U8OB 1Q9WB 4GS7B 4XNXL 2QHLA 3UTPE 5HD8C 3O6MH 3ARDB 3E2HC 1JS4A 4QO1A 1PF3A 4RBPH 4TNWF 3FFQA 1SYVA 2BSTA 3CFIC 4WEMB 4H8HA 3LUTB 5T3XD 4IRJB 1OAKL 1YPZE 4HGMA 2AXWA 1W8OA 1LK3H 3MLUL 2DPKA 4H1LH 1XGTB 4D9QE 4GX5A 1E0OB 5AYUH 3SQOH 1JGVH 1PL3A 3K0WA 1QVGU 2BVUA 5LXGH 1AR1D 4BE6A 3DGCR 2WXFA 5DZJA 4LKCA 2J71A 3UTSA 2AJUH 4FL4C 5I0ZA 5IHWA 4H44B 1EZVX 2OIGA 4NKMA 2P24B 3MHZA 3O9WC 3PWPE 4PP1D 2ERJC 5IK3B 2DI7A 3AK2A 1AXIB 3M7OA 4UWQB 3TO4C 5DUBB 3KCPA 3CCJV 3LRSB 4NQEB 5HYSG 4YHML 3P0YL 1UB5A 1TSHA 4UNIA 4LCUC 1OQXA 2IADB 5ITZA 3OLIA 4ZFZA 5KSUB 2QWNB 1BJ1H 1ORSA 2AXJA 2VITB 2VN7A 5E00B 5K93A 4TTDD 2XZZA 2F66C 2ICWI 3MU3A 1GAFL 2XN9E 3BVXA 4B3VA 3ZSSA 4L0PB 4E5XB 1RZPA 2RFXB 2BDNL 4P2YA 4TYUA 2APVA 5I1CH 3IRCA 4R26L 1NJIW 3AC0A 4ELKB 3MNVA 4OZFB 2QSTA 5HYSA 2X4PB 4RZCA 2DIAA 3PDOA 1L9NA 4JI8O 1JK9B 4OGYH 5GGVL 1HH6A 3MUY1 5DK0B 5B8CC 1MCOL 1N4XH 2H0JA 2X9ZA 2AAVA 4KHXL 2XQBL 1BAWA 3IFLL 3FCTA 4JEGB 2GFBA 3DVGA 4I5BB 3GBLA 3TH3T 1ZS8A 1R46A 4OF7A 1D7FA 4MD0B 4QRPE 2RB8A 3UEZA 3LH2L 5JA8B 5MI0C 1YCSA 1I0HA 4NYLA 3OKEB 3T1WA 1YN7B 2VUOA 1JNLL 4N9GB 3GKZA 4LSUH 1WPBA 4WUUD 1X7TA 2DQFA 3NEOA 1ZHBB 4PB9H 3GMRB 5A2JH 1XIWA 2DMCA 3ZEDA 5MENB 1BF2A 3GHBH 2HTKC 4X6CF 3ALWA 3BQUA 1IKFL 3DETC 3V0EA 3FU9A 5EO9B 3B9KD 4XXCC 4F92B 5E24E 3QJRB 1HEZB 5JQ6H 4M1DL 4U0QB 4YAQB 2WCSA 1RK1A 3HG2A 2F5BH 4I7ZB 1IQDB 1FH5H 1OZTG 3WU1A 1AGCA 5AUMB 4BWAA 2CJTA 2ZE5A 4YO0A 5JW5A 1Z9LA 3DHPA 4DW2L 3GMOB 1CURA 4YDJB 1RJYB 3F7VA 4JLRA 3CP1A 3CQFA 1UVQA 4C8XA 4MAYA 1HNXB 1I7TA 4R50A 1GOHA 1QRNB 2UX6A 3UJJH 1MJ7H 5E70A 5EH1A 2WXRA 2WD0A 4HCFA 3GXTA 1QR1A 2G9KA 5C0CD 1SJHB 2Y7SA 4GW1B 1SDDA 2YUZA 5FM4A 3EBIA 1TJHL 1AP2A 1R17A 1X9QA 1J8HE 2AEOA 2H8PA 3HHSB 3OGOE 4XCEB 5LNEA 2XKNB 1P4BH 4FG6D 5EEZA 4W4NA 1AY1L 1NL0H 1F6AA 1NSNH 4K0KO 1PD6A 3CPWU 2I07A 4A7TA 3JUZA 2DJUA 1HQRB 3TN0B 1BZKA 4FXGC 1MW2A 1PZUB 3VFGL 3VQXA 3DIFB 4L29A 3ZDZE 5FL7G 1AD9A 1G7JA 4CGUB 4HS6B 2ZR2A 1C12B 4KO6A 4F2EA 3P3UA 2MCMA 1ZLUK 1IC7L 5LCVA 1TT6A 4IYHA 4BFOA 1M4KA 3C87A 4K71B 4U1GC 3VG9C 4GG6B 4B97A 5LQBH 5D1ZD 4GQRA 5ID1A 4ENZA 2CKBB 2FYYB 2E7BA 3KEHA 1UH2A 2IBZX 2D8KA 1XBDA 1KP3A 4PA9A 1Y6NR 1WHPA 5BQDA 2GC7C 1D9KD 2AZ2A 3E0GA 4UV4L 4ZXBD 2GJPA 3MLVL 4L2YA 4RMUA 1L9QA 4HUMB 5J12B 4NDMB 2R59A 3AADB 5FM8A 5K33A 1XHZA 2H6UA 2O5XL 1D5ZB 3LSOA 3P3TA 4Z3GA 2VNCA 3BAXA 5BRZD 3Q8CA 3UTQA 1PL4A 2XWDA 3AQYA 1Y76A 1EXGA 3GZQA 4CH5A 4JFWA 2ESVB 3ABMB 4YLQT 4G2AA 4DP4X 5K9OA 4FD0A 1NBMG 3HI5H 1QSFE 1UPGA 5DJZB 1ZA3B 1QBBA 4TULL 5C0JB 4R9HA 4QJ3B 5E6ZA 3LH8A 3NMEA 3U46B 3BGMA 3HTLX 3JAWB 4WW1B 3TBSA 4JFXA 4I3RL 1T21A 3ULVH 1JPFB 4LCYA 1UOWA 3UMTA 2QQKH 4H0LB 3CJHA 2PWDA 3CN4A 3SDAD 4QTIL 1LEIA 4J3OF 1QHQA 3HJEA 4TNGA 4IKNA 2AJXH 4UYQA 4P5MB 3RWEA 4LLQA 5KAQG 1OCRB 4R7XA 4TVUA 1VF7A 2Y06L 2YXVA 4KY2A 1ZS2A 1WZ1H 1OSEA 4KH9A 5GS0H 4KHTH 1DBMH 3W9EB 2FIRT 4Y2DD 3V0VB 3F7PC 3PHOA 4YIQB 3UTSB 4NVPA 4A2MA 3BPLC 1IEBB 5CD5D 5ALBH 1JVKA 4ECNA 3NJLA 1DUYA 4UQBA 3ZRXA 3F58H 3F6LA 4OFKA 5B7MA 3UAFA 4C7UA 4NKMB 5SX4H 2OT5A 1MI5D 5F9OL 1LO0L 1UD8A 4X5XB 4E42A 4YXLL 4B50A 4M93B 2IQAB 4JFDB 1KTJA 3SBWC 3QISA 4UDUB 5EZOL 1BGXH 1BMZA 5ITZB 1TYRA 2WXGA 3A2FA 4NO3B 1WHOA 4PS8A 5HPOA 2XQ0A 1I94B 1ANUA 3RDTA 2JB5L 3I6SA 4UV7H 5CGYC 3B9AA 4KITB 2P28B 1KB9K 3V0WL 2EIDA 1MIML 5C0CA 4OUOA 3FB7A 3L95A 3POCA 4NIYE 4U1NB 2A83A 5H4YA 3SJVE 5AL8A 2TSAA 5CA3A 1VFBA 3MNVB 4IMLA 4P2OA 4RZCB 5F93C 1P7BA 1PYWA 2CUAA 4PRNA 1BCCH 3IF1B 4P46C 4K5PA 4S10A 5C0DB 1HH6B 3WY1A 4J4PD 1CFMA 2K45A 3CLFH 2AQ1A 4A7VA 1IFHH 4PRID 4YHHB 1QO3B 3RE0A 2XTAA 3QULB 3FCTB 2GFBB 1N0LA 4WY7L 4ZNEA 1HHGA 4ZQKA 1QBAA 4ABVA 4XVTL 1A2YA 3DBSA 4JKPH 4H0GA 4UANA 5DQDH 4YZFF 1NCNA 5JNYA 5EEUA 4IHOB 5LLIC 4NYLB 2J8HA 4P9HH 5F2VO 1URZA 1MLCA 3EIFA 2AK1L 4U1KB 1FNSH 4LIQE 4J3OC 1S7VA 4YUEH 1XIWB 2YUXA 2QSCL 4P23C 4J5VA 3EJCA 3KVPA 1XQ4A 4N0FA 1NFIA 2OZ4L 4R90L 3L9YA 3QWQB 3BHBB 4IBSA 2GJ6E 4LFBO 3FHAA 4KRPC 1A7OH 4JPIA 4XX1G 4BSVA 1K3EA 1DN2A 4FLOA 1CZ8L 3O45A 1RK1B 1RJCA 1L9SA 3HHRB 4MJIE 5SX5H 3TT3H 4ZXBA 2UUCO 5JMRA 4IT5A 3EO1B 5KA6A 4UU9A 1HESA 4YO0B 2D7PA 4B60A 5JW5B 4KKAD 2RQ6A 4L3ED 4XNAA 3F7VB 4KUZL 1UZGA 5IW3A 3GXFA 4MA8H 1TQWA 2CXKA 4MAYB 3IXTA 5T1KA 1I7TB 1FL5A 4YXKL 5E7FA 4DVBA 2Z92A 1FYJA 4K3EL 2WW8A 3STBA 3EHBD 1DQDL 2VDLH 3LD8B 1D5IH 1WJ3A 3BO8A 3LSQA 5IG7A 4Z7UF 1K97A 1FC2D 1N7MH 4X99A 5J6HA 3B7UX 2H8PB 3RVVD 1I08A 4CVWA 2DQCL 5IJDC 4PV8A 2Z8WC 35C8L 1AGBB 5GS2H 1KC5H 3JVGC 1NT2B 4PG2C 2I07B 3HS8A 2WBWB 3HW7A 3Q9PA 1ZLSL 1P7GA 2FKXA 2V3EA 3BRGC 1HEHC 3TBYB 1AD9B 2C3WA 4F2MA 2PCPB 5DEGA 4MXWL 2PMZA 1B2YA 2EDDA 2ZSWB 3ZTDC 1AZZC 3NFPB 1G6RL 2NY3D 2IPTH 2HVJC 3L1OL 3JCUZ 4PTTB 4KZCA 4PGBA 1MAML 2WXPA 4KK5C 4FM0A 5I74B 3O4LD 1CTOA 2XKSA 3MN8A 4LNUB 4HMEA 5ID1B 1AJ7H 3HMXH 3UH8A 4Y4FD 5E1IA 4AQAA 1AR1B 1MUJA 1A1OA 4TXVB 5E6UB 1GKOA 3K6OA 4CN6A 3ZHRA 3OKLA 4M48H 4Y1SA 3K72A 3II3A 4FXKC 1N34B 3GXNA 2Q0AA 1TSRA 4OXSA 1O6SA 2DQIL 5CIPA 4JFZL 1ZPLA 2IPKA 1OARL 3RUGE 3QR1A 1ZSDB 1MNUH 3BVVA 3FTSA 2N74A 2BZCA 2IJJA 4PJBA 2B4CL 3ZYOA 1HS6A 5C0NC 2VH5L 4PJDE 2IBGA 1EEYB 2DB8A 1MXDA 3MOQA 4QHKJ 2X6MA 3GGWA 3LSOB 3O41A 3FAWA 1IZKA 2EXSA 4JI6O 3GJFA 1WBYB 2DWEA 2LT9A 1Y76B 4AXWA 2AANA 1D6VL 2WKOA 1CQYA 4N2KA 4AKOA 2G2NA 5LB1A 1MZYA 5DCCA 5K9OB 1IVTA 1U3JA 2BOCB 1BX2B 6CGTA 4PJ9D 2YXLA 4U1LA 3IKKA 4UT7H 2O5ZH 3MAQA 1MEXL 2DOCA 3BGMB 1TQUA 3I75B 5GZOC 1MPAH 4JFXB 4FMFA 4ELMA 2QWPB 1T21B 4YGVB 5INCA 4LCYB 4HS8L 1KQSU 2BNUA 1Y4MA 3A3YB 1Q8IA 3OM3B 2X2HA 4I3SH 3CJHB 1WAEA 4J4PA 4RRPM 1LEIB 1PFOA 1QBMH 3BD3A 4DGUA 5KJ4A 1VIBA 1P1ZB 5KW9H 1XMOB 1GZPA 1HNZB 2QADC 2XBDA 2DI9A 3C2AH 2AQQA 3RWEB 2CM6A 3AAZA 4M6ML 4WK2B 4ZW6A 3MI6A 4PJFE 4GXUN 4HBNA 3MRQB 4NKOB 1S7RB 2JB6B 5B3SC 2VDRH 1Z1WA 2EIEA 3VE0A 1JVMA 5GISH 3ZMVA 2L35A 3VXUD 4WUUB 4YDKL 5DHVA 3G9AB 4X66O 3VA6A 3B9EA 4ODSL 2XRAL 1BEYL 2EDTA 5E8EA 3AK3A 4WV1B 1DUYB 1AQDA 3EFOA 2TSBA 1FF5A 3OKOA 3B9KB 5DA4A 5ITFA 2MOVA 1RZ7L 4PRBB 1QR4A 1W0WB 3BN3B 6PCYA 3FQXA 4X42A 5TPWL 2VDKL 5B1JC 4L3EA 2WBKA 3GEFA 3LHAA 4KTYA 5IMMA 1UEYA 4FTVA 3ZUCA 3VDCA 4PYGA 1KTRL 3GK8H 4LLDA 3V4VA 3JV0A 3HMWH 2A0LC 1COWG 1FPTH 1LGVA 4OD1L 4OBSA 1KCRL 1KXQE 5AKTA 3U0TA 1CP9A 1FFXA 2XWEA 3TVMA 5HGHB 2WOBA 4NUMA 3E6FA 4MKTA 4U4BA 5C0CB 3J80N 2CJUL 2NY0D 3V5KB 4ZMWA 5JO5A 5I73C 3L95B 5TJWK 1TQCB 3VDBA 1A5FH 1OWWA 1EVTC 4WI4A 4IMLB 3R06B 3FUHA 4Q56A 5E95B 2YMXL 4TLTA 3IU3A 1XD0A 4XRCA 3TA4D 1YUKB 4OLYL 3RYMA 1U97A 2FJUB 4JMNA 1N0LB 5L7XH 2JVUA 1HHGB 1KJ2B 1L9RA 4ZQKB 3OQ3B 2VZVA 2AV1A 1A2YB 4KTDL 2Y5TA 3WIAA 5K39B 4NN6B 2XWBA 2WLLB 3QCVH 2B1GA 1MCEA 4M9PA 3WN5A 5KS9B 5IR1B 3O4LA 1YEFH 4B7LA 4WSJA 1S7VB 1RURL 3SE9L 5BOJA 4V11A 5D1ZB 1GHFH 3DSFL 5DZNA 4J7ZA 5HYQA 2QFPA 4Y4FA 5D93B 3RYHB 1JPSL 1KKDA 4JGSA 2ZKOA 4IKKA 1BLIA 4J7JA 3P9WB 1JWSA 3L1EA 5HGAA 1D9KB 3O45B 3B1TA 3GMNB 5DHDA 4ZXBB 4GMTH 4APQA 1XDTT 1PZ5B 4UU9B 1AQKL 4QMEA 3W39A 2CAKA 4RISH 2VN4A 4G7VL 4H0HB 4JG0H 2AERT 3LHPH 2CO3A 3ASNC 1DL7H 1KENH 4PAZA 5BRZB 1R4XA 1BHGA 3LSUA 4D8PB 1JTPA 1MG2C 2WUCL 2ICEC 4L4TD 2ORBL 3W2DH 1TTUA 3LS4H 2BWQA 4LF3A 1NKGA 3UBXG 5IEHA 5DD5H 1D7DA 1WLHA 3FTZA 5AAMA 3L4YA 3STZC 3EOTL 3V9CA 2D2OA 4HCRL 5AVWB 4X1YB 1CLYL 2EE6A 1LO2H 5IBLC 4ZOCA 5ESVB 1IAKB 5AAWA 4HSCX 4DETA 2YXMA 4J41A 1RUPH 2J20A 4K07A 1OOAA 2Z64C 3D39A 2P45B 4JRXA 2ZE8A 1NGPH 3SDAB 3WN6A 3MYZA 1T80A 2Y0IA 1F2XK 3H3PH 3ARQA 3MOBL 5DEGB 3WFEL 3QZPA 5DD3L 4ZW5A 4R2GD 4JAUA 2B1HL 4PWGA 4DAGH 4PGBB 3IC7A 4HXAL 3UBXA 1G7PA 4F37F 3B2DC 1M4UA 3GXDA 5C8JB 1OK0A 1PG7L 1MQ8A 1K9MW 1MFAH 2C4FU 3VXUA 3NDZE 2BIMA 4AQAB 4Y2DB 4F7PB 1A1OB 2A3TA 3MV11 2ED7A 4HSQA 3K72B 4E9XA 3L9BA 3UL4A 5KVGL 5ADOH 1O6SB 2ICWA 3DHMA 3O8XD 1MI5B 5F7NC 3U9UA 4GKJO 4I18C 3D36A 3TBVA 4DGWC 3LV3B 3P9MA 2FATL 2JCCE 2AABH 1ODUA 1IU1A 3QIUD 2VGLM 4K94C 2R69H 3U7AA 1VFAB 5C9JA 3DV4B 4HQQH 5I18L 3LN5A 2N7BA 2LU4A 2BIQA 3OX8A 1UH3A 5GRJL 4AXWB 1BQSA 3CK0H 4AENA 4OLUH 4MDIA 2X44D 4LCWD 1GMEA 1I5XA 2YAEA 1FL6B 2LO1A 5KJ7E 1JJ2U 1R34A 1DBAL 5DEFA 2W9LA 5D70H 2EICA 5INCB 4D7TA 2R1WB 3BWAB 3IRZA 3HZVA 2BHYA 3B7YA 5CEZE 3F5WC 1KELL 2KSDA 2LQRA 5JCOC 5F96H 3TJHD 4DPCX 1F97A 1RH8A 4PRIB 1CXKA 3AG2B 4WI8A 5IVXE 1UACH 5EV7A 2ODHA 3VU2A 1J9CT 5F7KC 1Z3RA 2DLTA 3AAZB 4L3FA 1KV7A 4DK6A 1OP3K 5EOTA 2G30A 2R0ZH 3NPZB 5CSZB 2HG0A 3DX6A 4K7FB 4GKLA 3B40A 4RIRA 1J1PH 4XO8A 2BY0A 2E5LO 1MCSA 4NZRH 2CE4A 4NXSA 4PRHE 5DHVB 2ZKHH 3HKDA 1EFXD 5L4FA 1N33O 4K35A 4Z1MG 3QHTC 5HXMA 5E0QA 5E8EB 5DVMA 4K23L 1AQDB 1TR7A 4JG1H 4BUQA 3OKOB 4B9GA 3DMMC 4DEUA 2F1BA 4MMYA 5ITFB 5I1KH 4K8XA 2F53D 3R7QA 3CN2A 1I3RA 3JBG7 1K6QH 5ABAA 3SDXE 4LF9O 4FF9A 1FFQA 3FUNA 4QGYA 1JQ0A 2IQ9L 5LDUA 2ZX6A 3D52A 3EJYD 1ZEAH 1IBKO 4WFBV 2QVKA 2LU3A 2E9JA 4L3EB 3VGAC 2YIDA 4NO5A 4LWSB 1J5HA 3RY4A 5IMMB 1R5IB 2AQ2A 1DVUA 3PL6C 1B9KA 25C8H 1FFXB 2I27N 4PLNC 3EHBB 3VD7A 5EN2A 2X4TB 5JO5B 2QL1A 3RZWA 2UZPA 1UB6A 3K4DA 1P5VA 4XPTH 1ZSPA 1NM4A 4Z7VE 5ESAB 1QR8A 1IGCH 4NKDB 4MBRA 3UDWC 3IU3B 2V6HA 1THAA 4K3JH 1O7DE 3VQ1C 3WB1A 3QNYB 2VDKB 3IN0A 3MV7A 4UCUA 3IDYC 3N1QC 3CHPA 3UAAA 1SMOA 5HGBA 2VLME 4OAWA 1RK7A 2AV1B 1WV7T 2ICCA 2RIKA 4KMQA 5FFLA 3F04A 5FYLL 1H8SA 3CFJA 4NRYA 1ZX3A 1LO3H 1JFQL 2NY3B 5CZVL 2YA1A 1BMGA 2RCSL 3KLHD 2EDBA 3MXWL 5D4HA 2DEWX 4BK4A 4F8QA 3EUDA 2QWOB 5EU6E 3O4LB 3CSGA 3U1SL 1BZQK 5CINH 1IAIH 2VDQH 3FQUB 1IXBA 3CE1A 3IGFA 3U48A 4QRBA 5A2FA 1WWCA 3NACH 4Y4FB 3CUPA 2AEIT 4JB9H 2FR4A 2R0LL 4F6RA 1QFPA 2VLRA 15C8H 4PV9A 1BM3H 3VI4E 4ZMNA 1RZGA 1UA6L 1JWSB 1KY6A 5HGAB 4OLXL 3ZIMA 4ZSOB 2FO1A 2P4VA 4U3CA 1NCDH 5TFSH 3NJVA 5C92A 1PEWA 5KTEH 1KJMA 4OVUA 4N1HB 2E3CA 3A4DA 1YJ9V 3ZT7A 4WWKC 1HZHH 3GXPA 2PETA 3HE7D 1CGSH 4N2IA 3BFOA 3H1LH 1SHWA 1Y0LB 3KGRA 3VTMA 3BP4B 2C7UA 2X6CA 5BPPA 2J8UF 3TFBA 5EBMC 1AOZA 1VKXB 4DUZB 1DQMH 5LHIA 4NQDD 1LVEA 1U8CB 4FDWA 1GYUA 5I8KL 5CJOL 2O1AA 4V2CB 3VFMB 1KPUB 4PJ9B 3SKNA 2F4VO 1QA9B 4JM2D 2BINA 2DQGH 3MGOB 4M6OL 5IBUG 5KWYC 2HLFC 1IBYA 2NY5H 3LS5H 2IANE 1BBJA 2IXQA 3Q48A 1LDPH 3GNMH 3MUHL 3PGDB 3D39B 3NIFB 3MA7B 1G6VK 3FU7B 3FUMA 2RALA 4XAWL 4BZ1A 2R7EA 2I25N 2XIDA 1WWWX 4NJ9H 1EK3A 1IKNC 4HA1A 3HAEB 1H38A 2C26A 1ETB1 1G7PB 4AI7A 3KAAA 1THZA 2Z8SA 1QR9A 5T5NF 3RVXC 3O3EB 3OZLA 4YR6B 1NBYA 3HFFA 3GSVA 1A6ZA 3VXUB 4XVJH 3ZZLA 5J4MA 1SC5B 3CE2A 1WUNT 5DUJA 2UU9B 3O2WH 2WQSA 1VF5B 3JTSB 2YOCA 2HP8A 2CBPA 2JJ1G 4JFHE 3W37A 1QOKA 2G60H 1EEQA 3ZE1E 2W9DH 4R7CA 2ICWB 2XG4A 2F53A 4R0LC 3WKQA 4K73A 3IAQA 3TBVB 1ML0A 3P9MB 4OQTA 3UCQA 3KW7A 5I17A 1A25A 1H3GA 1XREA 3GLEA 5GRUH 4ASUG 4KI5D 4YSQA 3MNWA 4GAYA 3S96B 3ZDXE 5C9JB 4L87A 4OGQC 3LN5B 4JO3H 4M7KH 1WIOA 4L2LA 4AC2A 4HALA 1JK8A 4MDIB 1U8JA 3WTVA 3GS0A 1LILA 2DM2A 4QYAA 4UTBH 5IHZB 1VQ9V 2C4FT 4WQOA 2AVGA 2KPNA 4XAKE 2NCMA 2EIJC 1MVYA 2NY0B 1XCXA 2UWEA 3BAYA 3L13A 2BNRD 5DEFB 3BT2H 4QI3A 4DR4B 1DO6A 1TPXC 3S4SG 3OQRA 5EBLA 3OJDB 4CC0A 3HZVB 5KANI 8PAZA 3B5HA 1QLFA 5KYXB 1MELA 2CA3A 1UA3A 2NDFA 3EGXA 4KKCC 3BKJH 2FT6A 5ES4B 3ARVA 2X41A 4WHDA 4HJEA 1SJMA 2FQEA 4AMKL 4EZKA 4NM8L 3WY4A 2HWZL 4JDZA 3GI8H 4BHUI 4YDZA 1KDJA 2PTUA 1DUZA 4S2SA 1KPRA 2R2EB 1XXFC 4JO4H 5EU5B 5FKAA 4XWGH 1KXVA 4RIRB 2WAHA 4MMXC 5DR5L 3S4SA 1GJIA 1XGPA 3N40P 1I8KA 4KDTA 1AO7E 3N40F 4XDJA 1S9KC 4JQIH 3IFOA 4GT1A 4KKPA 4TKWA 3QUMA 5DZVA 1NCWL 2EEXA 2OJEA 5AZ2H 5AZUA 3V0HA 1T1WA 1WT5C 2DQ6A 5L88H 5E8NA 3ELAT 1MXGA 1DCLA 1WGVA 4GMSH 4BFIA 4ZAKC 1NDGA 4JFEE 1CUOA 1SFHA 4ZDHA 1ZSHA 1UWXK 4UVBA 1VADB 2B16A 1GGYA 3FTGB 4OLVL 4WSGA 5KX5A 4JQVC 4WFGD 5HHVL 3NSFA 3N43F 4NO5B 4XP5L 2EDMA 2CGNA 1PY9A 3HE7A 2WWMC 1OHZA 4KK9D 4QNHB 4MJJA 3CXDL 3O6LL 5DRNB 3AUWB 3H6AA 3ZHQA 3EH5B 3FT9A 5SWSD 4L4TB 1MWAA 4NQDA 4X5PA 5C0AD 4F9PA 1GRJA 3LDBB 4XMPL 5EN2B 4LDLB 4NAMA 1QFOA 1NMBH 3C5XA 4H5SA 4B9PA 5LBVA 5B1CA 1P5VB 2YUVA 1ZT1B 3II1A 9PCYA 2VRZA 5ID0A 1IGMH 2J6EL 4KI1A 3K57A 3PWJB 2YGQA 1EANA 4JHWH 5DS8A 3S37H 2XVLA 3BIKB 1MG3C 1IIIA 1X3DA 2E8ZA 3K1DA 1FNAA 1QWUA 4R4FH 4X9HA 5FUZL 5AZEL 1BAFL 5HGBB 2IG2H 3T2NL 5HHNA 4A7QA 3CFJB 4NRYB 1E50A 4R2GB 3CDZB 3SE8H 4ACPA 1H5BB 3K2MC 3LQAL 1E3ZA 4L1DA 4G43B 3DTXA 5IQNA 4NWTL 1S0VA 4OQ1A 4E41E 3V6OC 1TZGL 2ETWA 3W7TA 1OGTA 2BVTA 2VQUA 3AW5A 3CUPB 1M9NA 2MJWA 3US0A 4H8PA 1OB1B 2FR4B 2AFNA 4N0YL 3QWNA 4F6RB 1S7UB 2FQDA 1KJVB 3IMUA 4MCYB 4PV9B 1IXMA 3B6SA 5MP6H 2QM4A 1RZGB 4EDWH 3WEOA 1N32B 1I9RH 2R29A 3DX7B 3QIWA 4MJ4A 3O8XB 1I5YA 4ZTPH 2WYIA 2NNRA 2HG5C 1YY9D 3QJQB 2OZNA 3NA9L 4N6RA 3L6FB 4WO0A 4QJFB 4JFYB 2IV8A 4HS3A 2HMID 5ADPH 2BCKA 3QIUB 4PD4J 3GKWL 1GXEA 4CN4A 2XHNA 3FTUA 1YNLL 2F43G 2C7UB 3APFA 4WWID 1FIGL 4Z3FA 5KAIZ 1INDL 3FB8C 1YEIL 2HH0L 3BISA 4YOKA 5C71A 5I1HH 3QG6A 2AHZA 1CFTA 1L8DA 2WLJA 3H1KH 2XVGA 5CBEA 1SNRA 4G6ML 4OZGA 3FQWB 4PA6A 1JG9A 3SKNB 5FYJE 3MTXA 3E3QC 3H9HB 2VMDA 3S3PA 1GO3F 4Z1PA 4S1DC 5C0RH 3LXCA 4QRRD 4JHAH 4U3SA 4GBXC 3VCLA 1IL1A 4AQOA 1BVNT 1ZWIB 1UZ6F 4IS6A 4YN3A 2F8IA 1KGCD 2JH2A 5DJ0B 1JMXA 2PR4L 3IXAA 1L3NA 4LLWA 2R7EB 1MA1A 2YAFA 3TASA 3G08A 4MTMA 1HL4A 3IYLW 2LW1A 3T2QA 3WFDL 3WUZA 2YGVA 1J1XH 4LBEA 4LSDA 2V9UA 1S2EA 5HHPB 4IIZA 4LOFA 1MDAA 1MDTA 2LTQB 2OQJB 1LP9E 4WI6A 5IBUB 4JDTL 3ZN6A 4X6EA 3I56V 3TEYA 4N90E 2YJQA 3K8LA 4M56A 3BVOA 1EFXB 1USQA 3FT3A 3UTTE 1KB5A 3H9ZA 3ZHSA 4YC2B 2DM3A 1TTFA 4J8RA 4PMEA 5D96B 3ZGHA 4BKLB 3RZCD 4DKFL 2ITCA 2A06H 3S35H 1OVZA 1LNQA 2D7TL 1QSEA 2F53B 2FWSA 4GEJA 4NUQA 5E6SB 3ULSA 3T2OA 2K4WA 3K6DA 4PDMA 3FUIA 2OMYA 1ASOA 4YDMA 3K3QA 4LCIH 1B04A 4DR7B 3C8HA 2ARHA 3BIAX 4JE4B 4L8BA 1CLZH 3MNWB 2IGTA 4GAYB 4U1SB 4OD3H 2FLMA 1OF2B 1IEAA 3WO3B 2YRPA 4Q0XL 5JW3H 1U8JB 3OD4A 2AEQL 2XXMB 2PPDA 1AGEA 1IB5A 4WFAV 1X5FA 1I8IA 4HXBL 2UWEB 3BPOB 4OLWL 1GY2A 3T04D 5AOKA 1I9JL 4TUOA 3PAUA 3MLRH 1ZLWK 4DN3H 5JR1H 2QWRB 4X80H 1QLFB 4KGLA 4PJFF 3EGXB 4HU2A 4DV4O 2X09A 4OCWH 4X6BA 1RL1A 2VDMH 4QPJA 2DYPD 1DBJL 1G9ML 1MFDH 1EERB 3L4CA 4KV5E 4PW9A 1PNLA 3U1PA 3RWIA 1WTLA 1DUZB 4S2SB 2FHCA 5EU4B 3U2JA 4YQXL 2L4OA 1NLDL 4NXNB 4JRYE 4EDXB 5F7EH 3LSSA 2QVMA 1WVZA 5D71H 5FKAB 3IE4A 4JZ2A 5EU3B 1XGPB 2WPDG 1I8KB 3N44F 2OULB 4FFVD 3M8AA 1A3ZA 2E6QA 5D7IB 4LF5B 2X7LA 4HC1H 3RYFA 1BIIB 1SDAB 3EG9A 4NJAL 4X7CC 5GJTL 5HDLA 3ZE2B 3D06A 1ZCRA