3AG1B

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 280 k
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag1B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag1B02
3H56A 4BXSV 3TASA 4WKXA 1FA4A 2IH9A 2VM4A 1IBZA 3FT0A 2PPDA 4F2EA 1M9WA 1R1CA 4AX3A 2GC4C 2FQFA 3BVDB 3FSZA 1N68A 1PAZA 4HZ1A 1QLEB 1TU2A 1AOZA 1GS6X 1JVOA 3PCYA 3TBBA 3SQRA 3NP4A 2ZXWB 4E9QA 4G71B 1PZCA 1ET5A 1XB6A 4GP5B 5I6OA 4HHWA 4MFHA 3NJNA 1BQRA 1KYAA 1WA2X 1M56B 3H4FA 1OE3A 4AKQA 4GP8B 1AANA 2XVBA 3RYMA 2I85A 1HFUA 4G72B 4M3HA 4AZUA 3QJVB 4FAAB 1BXVA 2HXAA 2BZ7A 3NSCA 2QT6A 4DP2X 5I5MA 1NIEA 1ZDSA 2CBPA 4JHUA 5D4JA 2DWSA 3FU7B 4GYBA 3NT0A 1V55B 3BQVA 4DP6X 1ILSA 1FFTB 2YXVA 1NIBA 1AZBA 2EIMB 5FC9A 5B7EA 3WKPA 3ASOB 5TK4A 2Q9OA 1X9UA 4E9XA 2HX8A 3QPKA 4F7KA 2R7EB 3CVDA 2YAQA 3PXLA 1ILUA 2BP8B 5LDUA 4KOBA 2FNWA 5I6PA 2XXGA 1NPNA 5I6KA 2JFCA 2W88A 3NSDA 4AKPA 1CYWA 2PP8A 3T9WA 1WA0X 1BEXA 2XWZA 1OCZB 2IDQA 2PPEA 2BW5A 3AW5A 1NICA 2FQGA 3D12B 1SDDA 1N70A 4TXVB 2XXFA 8PAZA 4AKOA 1WS7A 3NJJA 4HIPA 2CAKA 3QJTB 3AZUA 3NJLA 4E9WA 3ASNB 1DZ0A 4Q8BA 3UADA 5A7EA 3AG2B 1OOWA 3OMIB 1L9PA 4BDVB 2XYBA 2XX0A 1SF3A 2H47C 3IBOA 1ZIBA 4BWTA 3EHBB 1ZPUA 1NPJA 4HCFA 1ET7A 1HAUA 1GYCA 1MZZA 2CALA 3H4HA 1SF5A 4HCGA 2GB2A 4E9TA 4HAKA 3EF4A 1E65A 3X1FA 3DTUB 1PNCA 2AZAA 2I7SA 1SDDB 1WAEA 3QJQB 2FTAA 3SBPA 1SFDA 4KNUA 4YSEA 9PCYA 1XB8A 2LLNA 2WO2B 2X87A 5PCYA 2H3XC 5I5IA 1ZV2A 4UF7C 5PAZA 3UAAA 3DIVA 1RCYA 1J9SA 1NINA 1SHWA 5F7AA 4YSCA 1W6WA 1TEFA 2OV0A 3TA4D 3L45A 4GXFA 1BXAA 3IN0A 4E9RA 1NIFA 3IEAA 4BWWA 4W9ZA 1AG6A 4YSOA 1CUOA 4BK5C 3JTBA 2AFNA 3MX0B 5I5JA 1JZHA 2ZWNA 5I6NA 1SFHA 2TSBA 3G5WA 1J9TA 3OD3A 1EZLA 2J5WA 2DYRB 1KV7A 5TK2A 3CDZB 4BXVA 1EHKB 1KCBA 4GY4A 4N8UA 1TKWA 4DP0X 4DP9X 2PPAA 4M4RB 2I7OA 1A8ZA 2IDTA 4ZK8A 2VN3A 3AG3B 1JXDA 1NZRA 1AG0A 1E5ZA 1JZFA 4YSSA 7PAZA 2RACA 3UABA 2VW6A 1I53A 1CC3A 3NYKA 2FT6A 3NJGA 1KCWA 2AZUA 1NDTA 1CURA 2IDSA 3T6VA 3QJRB 3GYRA 2BW4A 4CSZA 2UXTA 3FQ2A 1URIA 1A65A 2FT8A 1ASOA 4N4YB 2XV3A 2P80D 2HZHA 4G7QB 3WNJA 4A2DA 1A4CA 2GSMB 1A3ZA 3UGEA 1KGYE 1BYPA 4A68A 4A2GA 2XV0A 4W1TA 1KDJA 7PCYA 3ZBMA 4DPBX 2ZOOA 3PAUA 2PCFA 2OCCB 2J57A 3HEIB 2VW7A 1NWPA 2Y69B 1PF3A 3N2JA 1SNRA 1OE2A 2DY2A 1MZYA 3KW7A 4RH4A 1BQ5A 1GS7A 2B3IA 3QJUB 2BHFA 1SHXA 2Y1AA 2IAAC 3FS9A 3PAZA 1A4AA 1J9QA 3FU8A 3AG1B 2EIKB 1ETJA 1MG3C 2X88A 3AG4B 3S3CB 2IWFA 3NSFA 4BDVA 1L9TA 1FWXA 1JOIA 2HRGA 3FPYA 4HCIA 1PZBA 1KDIA 2BO0A 2TSAA 4HHGA 3OQRA 1GW0A 3TU6A 3DKHA 3GDCA 5IY5B 1JERA 3IN2A 2GHZA 1PZAA 3WG7B 4YSRA 5B1JA 2VM3A 1ASQA 1BAWA 4YVUA 1L9SA 1W8EA 2PP9A 2R7EA 1AIZA 2FT7A 1NWOA 1L9QA 2GC7C 1OF0A 3UACA 2BP8A 4AI7A 3CZUB 4KNSA 1PY0A 4NB7A 2BP0A 2WO3B 3ZIYA 3EH4B 4UAHA 1E30A 4E9VA 2Q5BA 3FQYA 4L0PB 4P5RA 3U25A 1JZEA 2XLLA 1IKOP 1TEGA 4A2HA 4KNTA 3ABLB 2DV6A 1IBYA 4WTQA 1V54B 1L9OA 3NJHA 2BZCA 3KW8A 2XV2A 3V9EA 3S3DB 1AACA 1NIDA 4DP5X 3EH3B 3FU7A 1AZNA 3PPSA 1PMYA 2HX7A 2DYSB 2EINB 1DYZA 2NRDA 4YSDA 3FPXA 3HB3B 2IWEA 3QQXA 3CDZA 2JXMA 2GIMA 5EHFA 3CVCA 3FYEB 3T6XA 4DPAX 4YSTA 2YQBA 4FA7B 2OJ1A 2YAPA 3GXUB 2DWTA 2YAEA 2YAHA 1PLAA 6PAZA 3FQ1A 1RZPA 1ET8A 1IC0A 1X9RA 2A3TA 2QDVA 3NJKA 1ID2A 3T6WA 5AZUA 3OMAB 4YSUA 2FJSA 1CYXA 4PCYA 3X1GA 1OCOB 2HRHA 3V9CA 3ZX1A 3MBWB 1KBWA 1NTDA 2CCWA 2PLTA 2VSKB 3TBCA 1AAJA 2CUAA 2VW4A 3ABKB 5D4IA 2FQDA 2E86A 1QNIA 3S8GB 2FWLB 2P80A 2AANA 2UX7A 1L9RA 1VLXA 2EIJB 4KO5A 5B1KA 1GY2A 3EH5B 4X4KA 1PLCA 2PPCA 1GR7A 3CVBA 1MG2C 4DP7X 4PAZA 1NIAA 1W6LA 2ZONA 3JT2A 1YLBB 3X2QB 2BWDA 3SBRA 3AY2A 3NP3A 5F7BA 2YAOA 3C75A 4BWUA 2FQEA 2XX1A 1GSKA 2UX6A 3NJFA 2VMJA 4QKTA 5B1BB 1BQKA 3N55A 2QPDB 1SJMA 2GI0A 2MTAA 4YSPA 1M57B 3WI9A 1OE1A 1JXFA 1MDAA 4G7SB 4YL4A 2IDUA 2UXVA 2W8CA 2HX9A 4P5SA 1E67A 3NJIA 2UXGA 1AS6A 4CSPA 4ENZA 4NERA 3S8FB 1F56A 3FU9A 4DP1X 4NAJA 2J55A 3FSAA 4JHVA 4JKNA 5B1JC 2EILB 2PPFA 2IWKA 2UXFA 2GBAA 3ABGA 4GP4B 4YSQA 1OCRB 5E9NA 2QDWA 1BXUA 1T5KA 1E5YA 3UAEA 1JXGA 1JZGA 2XU9A 1AQ8A 3ZDWA 2AVFA 1OV8A 2H5UA 3T71A 4DP8X 1ZDQA 3PLYA 3OMNB 1QHQA 1XB3A 1ADWA 3X1NA 2IDFA 4QLWA 1JZIA 1RZQA 3NSYA 5AFAA 6PCYA 4HALA 2YAFA 4A2EA 5D4HA 2PCYA 3SBQA 3FYIB 5B3SB 1J9RA 2JKWA 3X1BA 1PCSA 4UANA 4A67A 1A4BA 3IE9A 3NJMA 4EF3A 1B3IA 2CJ3A 2J56A 5I6MA 4YVNA 5I28A 1ZIAA 2YAMA 4G70B 4KO9A 3WIAA 2HLEB 2IH8A 2QPEB 3QJSB 4Q89A 4E9SA 2BP0B 4E9YA 1J5DA 3T6ZA 4A2FA 4F2FA 3OM3B 4G7RB 1AS8A 3CG8A 3ERXA 2WSDA 2BWIA 1ASPA 5B7FA 5AKRA 1AZRA 1AS7A 2PP7A 1BYOA 1WA1X 1XMEB 3S3BB 4DPCX 5I6LA 1RKRA 1UATA 2VSMB 4DP4X 1GY1A 5ANHA 4KO6A 2YARA 3PAVA 1JVLA 2XUWA 3ABMB 1GS8A 1AR1B 4YSAA 4A66A 1AZUA 2MRYA 3FSWA 3WKQA 2YEVB 1OCCB 1JZJA 1WS8A 5B7MA 1AZCA 5I26A 4KOCA 3WNIA 1KBVA 1IUZA 1HAWA 5B1AB 2B08A 1PNDA 2N0MA 4K9JA 2YXWA 1V10A 3FSVA 1PLBA 4KO7A 3X1EA 1J5CA
chains in the Genus database with same CATH superfamily
4F9LA 3ARTA 3CCHA 3GI9L 3CUPB 3MUZ1 3D39B 3X17A 4EI5B 3EUDA 4IOIB 1IBFA 5EBMC 1MHEA 1QSEB 4KJWD 3K06A 4Y2DC 1NGXA 4J2QA 3I6KA 5F96L 4Y2DA 3U7YL 2EBOA 4Z7VE 2YQ2A 5GJTL 1FE8L 3SBWA 2WB7A 5D7IF 1MSWD 1KY7A 1LE5B 3DUUA 1TQVA 3D06A 4OCLC 1BREA 1FLRL 3BVDB 2Q8VA 4U7MA 3R4RA 1YUKB 3ZTCC 3QZWA 3RG1C 2CUGA 3TBBA 1RU9H 3FCTB 3GZKA 3RY4A 2ZUYA 5DJAA 1OM3H 3VI3B 1QLEC 2FJFB 4UTAA 4E9QA 2P22C 5DUJA 4WWKA 5F9OL 1QSZA 1UWGL 1VHPA 2VLJD 3EDKA 2C26A 4XBEL 1A1OB 3THML 4R6ZA 3C5ZB 5F9WC 2Q1EA 1XBRA 4H20L 4GT1A 4IDJH 3UC2A 1FBIH 5HGBB 3OTOO 2H1PH 4MVBD 1I1AB 4LCWA 1A7NH 1E8ZA 1S2EA 3QI9A 4MWFA 4F7CB 2HXAA 2OM5A 3AITA 1YN7A 4NI3A 1VARA 2BSDA 3ZMNA 1BV8A 3B2XA 2DWSA 4DR2O 2DEWX 1EAPB 4G8GE 1UUSA 1EBPA 4ZNEE 4M8QA 2AXWA 3M86A 4LL9A 1Y74A 3CRAA 3CFQA 5ES4B 2YKKA 5ABDE 3HW7A 2G5BA 4L48A 1DEEB 5KYXB 4AK2A 2EIMB 4PJ9B 3V6OC 3HPJA 4V2CB 4LHUB 3BQUA 3SHSA 2PY5A 1AQKH 5D7KE 3IS0X 3SPJA 4HC1A 2V5TA 1X9UA 5FPRA 3TETA 1GVIA 5DD5L 1EO8L 4DGIL 1NC2B 4BGDA 5EPMB 2X1OA 3M7OA 4UCSA 3IC7A 4LHUD 3K6SA 4PJ7E 2OFQA 1K4CA 1PSKL 3UTTB 1SZXA 1DFBL 1BD2D 3NMEA 1AR4A 2EDTA 2FNWA 4FZ0A 5L4IA 5J2UA 4NWUL 2JFCA 4FQIL 2CK0H 3NSDA 4N2NA 1PEZA 4P2QA 5AOLA 2GHYA 1I3GL 3UTPD 1S7WA 3HBGA 4F9PC 5I1KL 2EVIA 1XFPA 2BW5A 2PPEA 2Y07H 2B1IA 3ARFB 4P4RB 4PRHD 3GS7A 4D94A 1UXSA 5DECA 1ZVSB 5DHVH 4AYSA 4GBXB 4JL1A 2J2ZB 1PD1A 3AZUA 4U6HB 1KIRA 4YDNA 4ZJ9A 3UADA 4BCYA 2VOTA 5A7EA 4MMXC 4HUMB 1IV8A 5FFLA 2QQKL 2ICWI 2B4CH 4MJIA 3RGVD 4PJFF 1J5EB 1E40A 1MEXL 2PR9A 5A2CA 1BBDL 4ZX4A 5IV2B 3EHBB 5KAQF 2ENYA 4YJ3A 3TTYA 4AEIH 1FORH 3TEZA 4YJ2A 4Z3TA 4CADB 1ZTXH 4Y19E 1H8NA 4XPHH 1TUBA 1J0ZA 2OTJV 3A6CH 3HE7C 2Y9RT 4QXTA 3T2LA 5IP4A 1R3JA 3AXHA 1ZWIC 1KIPA 3MNWB 3U0PB 5E6IB 1M7XA 9PCYA 1M93A 1BQSA 3D07A 1IL1B 5HHOE 2AHIA 2CLRA 4PJ8B 4WW2A 4FCHA 2VMFA 5DYFA 4JRYB 5C86A 3B2UC 3QFJE 5LJYH 3CK0L 1NUDA 4KTDL 1EEYB 1H8LA 1MCPL 5BZDA 4X5LA 4OD2A 2E3VA 3HS0B 1MJ8L 1DQML 3IGAA 2ZWNA 3PGCA 4U3XA 4L3CA 2DYRB 2X2IA 3M46A 2YD9A 1ULVA 2DBJA 1KT2A 4HWZA 1I9IH 4U6YA 3B2DC 3IRZA 3GLEA 1GAFL 4BXVA 3LNEA 3O6FC 1ZLUH 3QJXA 2VCOA 3LIUA 1WZ1L 1XGUA 2E0PA 4QRRD 1R24B 3VFNA 3JSLA 4J41A 4I18A 3VFRA 3HZVA 4O4JA 1IBMB 1JIBA 4UUJC 3MCYA 2IDTA 2ZT9C 1D9KB 4G9FD 2XN0A 3DSQA 5E5LA 3ULSA 2BXYA 2OX5B 4FCAA 4KDTA 3UABA 3UZEA 1FF5A 5EORL 3IYLW 1KC5L 3B9DA 1U2HA 4EZLA 4L5FE 3BJ91 3KPPB 4LFAB 1KCWA 3VRLE 3ASOC 4Q7DA 4P05A 3PE9A 3FUEA 4NNYB 4ONGL 3ZQ9A 4AENA 3RYFA 3OT7A 1FNEA 1PQZB 1XIWD 2ZNIA 3CCJV 1JPEA 4YGAB 3C3SA 4ZHQB 3FB6A 2LT9A 2ZE0A 2W95A 3L08A 1URIA 4PJIE 3CN0A 3TBVA 4Z7NB 5EDSA 1XZWA 1FJGB 4AK1A 4F5CE 1C8QA 1IGTB 2YI8A 1Y0LB 3NPSB 1ZHKB 1SERA 1AMYA 3RGBA 1ZLWK 3QNYA 5E6SB 1KDJA 4FFYL 1Q0YH 1CK0L 2Q7GA 2V9QA 4DPBX 5DHDA 2FATH 4JPIA 4RMVA 4CKQA 3EYOA 4CN6A 5KWYC 3EFDL 3N27A 4HXAL 4NP4H 2Z8VC 4FQXD 1MZYA 4MNHB 3N2KA 1YPZA 3WE1A 5C3IA 3QFJA 4ETQA 4UNUA 4PY7A 2F95B 3U2JA 2FEDC 3Q6FB 2EYRB 3OXRA 3US9A 2GHWB 4HMCA 2WZ5A 2HLAB 3L3DA 3WLWD 1BECA 3AG1B 1Z0NA 1IFGA 5C0BE 2D7NA 4GUNA 2YK1L 3MRLA 4FKHA 3S36H 3SPVB 2WKGA 2E9WA 1JGLH 2WTPA 5E7FA 4WFED 5B39B 3LMJH 4UAOC 4Y19A 3RWGB 4OCWL 1JV2B 5ACZA 3W5NA 3L75H 1BX2A 3B3BA 2WXOA 1W72B 2FX8H 4WY7H 4AYFB 3FL7A 1E9OB 2R15A 4HCIA 4UCUA 9CGTA 2TSAA 4QOKB 2HKFH 2FBRA 3V7AG 3CD6V 4WNQA 3UTSB 4LFCO 5CD5D 4F37K 4LPUA 3GMMA 5L3DA 1ADQH 3VQYA 2NQCA 4MCNA 5FGBA 3RWCB 5B38A 2P7TB 4DESA 5DJYA 2QTSA 1BFTA 5DURD 3ZXAC 4XHQA 1JMZA 2V2XB 5D71L 4ZOCA 4I0PA 3LB6C 3OKEB 4WI0A 3FB5C 4LSUL 1S5IH 3C5SA 4CC5A 1NWOA 2ZD9A 4K3JL 2Q8BH 4JI6B 5BVJB 1TIUA 1Q90D 2IPKB 4XWOD 1LO4H 4IBQA 3QJOA 2WO3B 3FMGH 2EKSA 3QZPA 3X13A 3CCLV 5E2TH 1NAKH 4F8LA 4ODBD 1DGSA 4NQCE 3T08A 3K5OA 1JHLL 1N64L 2XLLA 3B8MA 4OFKA 2YD2A 3QORA 4Z0BH 4B9JA 5D5PA 3MXVH 1ZE3H 4Q9RL 5EU6D 4UTBH 4JZGA 1AP2B 1W0KG 4FP8L 1S9WB 5C97A 1IZKA 2YA0A 4BFKA 3FU7A 4L8BB 4YBHA 4KHPB 1A1MB 3WJLA 1PMYA 2DN7A 5C6TH 3F85A 5C7XH 1SC5B 2KS0A 2WHVA 4KKCC 1C5BH 3O6LL 1IC4H 5IWLA 3UX9B 4ZMNA 3EDFA 5SV3A 4QWWD 4A63A 5A2QN 4J5VA 4KK9C 3SJVA 2ERJB 3SGEI 1X6NA 1MW3A 3S4SB 5JMRA 3TJEH 5BVPH 3ABZA 2YAPA 4CBCA 2YAEA 1F13A 3VYPA 1T89A 3NCYP 4PJ5D 1ZLDA 4B60A 2MOVA 3MAWA 3RGVC 4D9QD 4LP8A 3N50A 5EF1A 3MLSL 1MFEL 1TTAA 5A6LA 4WWKD 2HFFA 2ZXDA 1XSIA 1XNQO 4LNRB 1KLUA 2JK5A 3G71V 1I7UA 1LGVA 4R2GC 5T3XE 1CI5A 5D6CA 3VDBA 2D2CC 1QPXA 3D69B 3IFLL 3HE7D 4L29B 4PJ5E 4ZMLA 3IM1A 3M8OH 3VRLF 1ZRUA 4JY6A 4F8QA 1JI1A 3WNKA 4CVZB 3ALWA 3AREC 1V7ML 2OTWB 1MLBA 2E86A 2AK1L 4HUUA 1JBJA 4X9FA 4JM2D 4YGVA 2JS3A 4H40A 3ULUL 2P80A 2QELA 1PDKA 4XBPA 1WBZB 1ZA6B 2DJMA 1AI7A 1N19A 1P2CA 1P9MC 2DEYX 2R0WL 3G5VA 1GY2A 3QHZL 4JN2B 3E3QE 4LF4B 4FL4C 3ZIMA 4AGQA 3TNNA 2WXRA 4TNEA 1HQ4A 2EYSB 3OR7C 4R0LA 5H8DA 1MA1A 5KJRL 3H6JA 3ZMZA 2PO6D 3T04D 4YHML 1BEYL 2R0LL 3G6AA 4E41D 1U93A 2QKIC 5DRZB 5HHOB 5FX3A 4PCTA 4IW4C 5DZJA 3FFCB 4QO1B 4EDWH 3WV0A 1LEKB 4F3FB 2VXSL 4HCRL 2HPOA 4XNDA 3C5ZC 3MROA 5AW1B 4IRZH 4RUEA 3E2HB 3MJ9L 4TT3G 1CFMA 1ZWIB 5T5NG 4YR6B 1U8LA 2NY3D 3LZOA 1DVYA 5K1VA 5ANMB 1NLDH 5IQ9A 3EJJX 5DUMH 1PG7L 4F2ME 1HQRA 2LJ2A 1F4WH 4OI9A 2MCMA 1C7SA 3EDDA 4JLRB 4F6RA 4OFYA 3IMSA 4CSPA 4ENZA 4LR3A 3Q01A 4MTFA 3CFDA 4PU2A 3IU3B 5JIQA 3RGVA 4FABL 1CGVA 1T89C 2DWEC 3F04A 5B1JC 1WFNA 4K8RL 3CS5A 3O3UN 4WFEE 1E5UI 1WJ3A 2NLJB 2GBAA 2CR6A 5E8EA 5EIIG 4U1JB 3QYMA 4HW6A 1RZIA 4NUPA 5K59F 2UUDK 1GKOA 3MLRH 5BW7C 1SYSB 3G6BA 5J12C 2OSLB 1KIUB 2Z3YA 1E5YA 3BVXA 4JFFD 2ZPKH 4NQDB 3WDJA 1AQ8A 1ETZB 1O6SA 3HE6B 2YXHA 3BVNB 3HC0B 1J7VR 4LCYB 1GK9A 3K4ZA 1LO0H 1KXQE 2HT2C 2WXHA 3BIKB 4XXWC 4FQJL 1V05A 3LPFA 3QR2A 4FQXC 5ALCH 5ADPL 1L3WA 5CCKH 5HDOA 3DBSA 4ALAC 3RKDC 2RALA 4JM2F 4TRPL 3S3JA 4NO3A 3WEAA 3BWUF 1F3DH 3ME0A 4DGYH 5J9PB 4LF3B 4AQYO 2YEQA 4ZXBA 3CFCL 1INEH 2QSCH 2Z0AA 2ZG2A 3CFDB 4NO5A 3ROLB 3DTXA 3GZQA 4IMKA 3U6RB 4PI2A 2OMZA 5DQDL 2K6WA 3UG5A 2YUWA 5J4MA 2CLVA 3OGCC 3U4KA 5CBAA 1YJWV 1HQRB 3JWDC 1HXYA 2A0LD 4NQVB 3L9DA 2QKIA 1I9JL 3AS2A 3FMGL 3K91A 3QDJE 4FULA 4P2YA 5LAXA 2XNAA 4OFIA 1QBML 1NMAH 4XODA 2N01B 1TJHH 4UI2A 1FH5L 1A7OL 5D1ZB 4I48B 5EC2B 4I3SH 4NKOB 3T65B 2WQUA 1SESA 1K3EA 5LHHA 1TTGA 5FKPA 5E00A 3IVKB 5DRZA 2FO4B 1P7BA 1A4KB 3ARGD 3WJJA 4FM1A 3AACA 2ZXCA 1FYTB 2VSMB 3BCDA 1GC1H 1Q9WA 3G6AB 2QA4V 2X40A 3RTQB 4CILA 5G4MA 3E9TA 4N5ED 5BRZA 1AR1B 2VITA 2GTAA 3T0VA 1GCFA 4TVPD 5I18H 2DOCA 5D72H 5DEFA 4HWEH 5E1IA 1NMCC 4GX5A 3DXRB 5JXED 3C6LA 1N7ML 1WG3A 5C0DB 4LAQH 4QD2E 3LNMB 1NQBA 3MRRA 2OMVA 3UDWC 5GS0H 4UCVA 1EA9C 3FRUA 1W16A 1KTCA 2QHLA 3O4OC 5D7LB 1XNQB 1JWSA 3WTXA 3P4OB 4J28A 3H56A 1AP5A 1JV5A 5AAWC 1Y6NR 3QCTL 4OSUH 1LXMA 5DD6B 1I8IB 5FNVB 4Z3IA 2FCBA 4ZBJA 4EE2A 3VA6A 4QWWC 4X9BA 4KUCD 4NN7C 1R1CA 2XT1B 4H1LB 1K8IA 2HYMA 2YPKA 4NN6B 2IGFL 2FNBA 3RZCC 1T1ZB 3MCKA 4KDWA 2XIBA 2YKLH 4OKVB 2Y7QB 1Z0MA 3NP4A 2BVQA 5HHXH 4LSVL 2O6PA 3TH3T 5LNGA 5EK0A 1XO8A 4M43L 2ADIB 1N9PA 3DX3A 2HG5C 4OV5B 4HOXA 4MNQD 4X9GA 4PW9A 4UQ3B 4M8UA 1AI6A 1M56B 3TO4A 4K35A 3CVHB 3L4UA 1QHTA 2DBLH 5JUEL 4AYEC 4YHYB 4KX9A 3N2GB 4MBRA 2YXFA 1AC6A 1ID5I 1M4KA 2NY5L 2LGQA 3WB0A 3RBGA 3MLYL 2CXKA 3VO0A 4NM8H 4NQTA 5JW4M 3QORB 5EFIB 3KYAA 1TJXA 5K1XA 3GI8H 1OTSD 1T83A 2Q86A 3NCXA 1WCQA 1U8PA 3BXNB 4KJQD 3N3EA 4QIRA 2EECA 3MV8D 4LASH 2EIJC 4R97C 2CPCA 1SZTA 5E1HB 3UT5B 4Y5YB 1AGCB 4L4TB 2X89A 2ZAIA 3QRGH 3Q8BA 2HT3C 1EZVH 1IGMH 5I76B 3DXAE 1CD0A 4QRTB 3D1MC 3OKEA 4M5YL 1BVOA 4PELA 4DO5A 3VCLB 4KTDH 2O5XH 2JJSC 3PS6A 5LDUA 4OJYA 3QDHA 1X5AA 5FUZL 1Z9PA 1A3RL 2AJXL 3C5ZD 3L4YA 5DQ9B 4HS6B 3ZU8A 4PJGB 2W88A 4YEFA 5C0NC 2I9TA 1E7VA 2YRBA 3S0PA 5FB8A 1GTNA 3HNSL 4PLOB 3COOA 4Z76A 3KVPA 4G11A 2FEDD 4U1LB 1ZGLB 2CGYA 1I3GH 2A4CA 4NYKA 1JZ4A 1WS7A 5LGKA 1WLHA 3RWJB 2OSYA 4FPPA 4N2BA 3SPVA 3ABTA 4I7ZC 4MQXC 1IEAB 1MWAA 5SWQB 3VYNA 2UUBB 1OHHG 1QBBA 4KZEH 1NH2B 4XOBA 2UXDO 4JY5H 3KYMB 4NAMA 3CZEA 5FLUA 4HCGA 2GB2A 4HA1A 8FABA 5L3FA 4FJ6A 3FTUA 1J0IA 4YDMA 3NH7H 1UM6H 1SJHA 4EFEA 4HAKA 4PTUA 5CJ5A 3TPKA 2CHDA 2F93B 3TLRA 2FTAA 1A5FL 2IH1A 4IKLA 2RN9A 1NC2D 3PAYA 3GRGA 4OCYL 4XOCA 2ZSVA 1RCYA 4PJBF 1AQDB 1J9SA 3UJJL 3ABUA 3FTVA 3C60B 2XASA 2NNAB 4JANA 3SGDI 1G9MH 1G7IB 3D39E 4R3SB 1JR9A 1BW8A 5F0JB 1PD6A 5A7BA 2CA4A 4QRPE 5H4YA 4F7TA 1H2LA 1EGJH 1UC6A 3G5YA 4YSOA 4BE5A 1KWGA 4ODVL 1JGUL 4TKWA 5B1OA 5I1AA 4H5SB 4WEUD 4G80A 4HD9A 1FPTL 2GCYA 3E35A 3O11B 1UWGH 5GSVB 1EERB 2FD6H 4DR4B 4DP0X 4OLUL 5IFHL 1DZBA 4ZYKA 2R1YA 2VDKH 3B7YA 3OF6A 4HSQA 3LRHA 1JNHB 3BT2H 2HKOA 4GKNB 5HHNA 4OT1H 2V2WB 1TGOA 3RYHA 3VD0A 2UUAB 3G5ZB 4FFKA 1PZ2A 3ARBB 5KUMA 1NZRA 2PGGA 2OCFD 2VN5A 1BMZA 1OPOA 5EEXA 1PZ3A 1I53A 2N7BA 3HHRB 1MQKH 3RI5F 2ARJA 1R47A 2DQUH 3SB3A 4TV9A 1OANA 2IH3A 2IDSA 4WWKC 4Y89A 3UL4A 1NL0H 1P84J 2AJVH 2BW4A 3KDMA 3BAIA 4M7ZC 4FYQA 3CU1A 4FMVA 4R2GD 3MJ9A 2OSWA 3HRZA 2CRIA 2QR4A 4JRYA 3JARA 1LTXA 4PS4H 2K8MA 5GS0D 5HGDB 1OP4A 5EU3A 4GSXA 3M07A 3P30H 2A77L 4XNAA 3T2OA 2IG2L 2X70A 1QFUH 2B7DT 4X8CA 5DJ8B 1M05B 4NFBA 4DZBB 3K03A 2R29L 5I1IL 4JM2C 2P6JA 3PAUA 5F3HB 4P4KA 1FYJA 1H2KA 4R7DB 5DJCA 1N18A 1WFOA 2YQ3A 4QR7A 1MY5A 1TT6A 1QSFB 4UM8A 3QIBA 3QJUB 2VDMH 4K7FB 5FEBA 1PG7X 4MJ5A 5FS5A 2ID5A 5ESAB 1MCSA 3GLDA 4MMZC 1Q9OA 3E22A 4B7LA 4X4ME 1J5OL 4GG6F 5CR8A 2XWBB 4X62O 2R4RL 1QQCA 3TX4A 4BFFA 4AEHL 3S48A 1JGUH 4BIOA 1J18A 3HR0A 3O8XD 1ETJA 4ZUTA 5EF3A 3BW9B 1JUFB 2EDJA 3SPCA 1UXSB 4NPKA 3RDJA 3A0BZ 2HP4A 3ZMTA 2HR3A 1S7VA 1ORSB 4BDVA 3T0DA 25C8L 2VDPB 3QDJB 3NA9H 4S1DD 4P2QE 4EEEA 1JGVL 1L0QA 5JHDA 3LRSA 5E23A 3D7PA 1U8JB 2NY3C 3EJSA 4YSRA 1N8RW 1KP2A 4PRAB 4GG6B 1DN0B 1ZY9A 3UTTA 2GTZA 3LZFH 4YHPA 5I16B 1BQHG 3N43B 3ZKXC 3UYPA 5IMMA 3FN0L 3RY5A 2UXCB 3T1HO 3AWGA 3OKDB 5LGYA 4UT6L 1ZT7B 3FN3A 2LFRA 1YEIH 3I75B 2WN3A 4OAWB 4OGYH 5E0QA 3BRGC 1NMCB 3HAEH 5C09A 2YRZA 5KVFH 4A7UA 1J8HD 4P07A 1FAFA 4JZ2A 2YD5A 1H3XA 3QRBA 1B6UA 4D8PA 1OAQH 4P5RA 4M1DH 4YX2L 5JXEA 5T1LA 4J1UB 4HX1B 2O6EA 1FVCB 2KL6A 1V54C 1T2QL 3MREB 4LFHG 1F2QA 4A7GF 3KJ4B 3CFJB 1ES0A 4Z7NF 5JZ7C 4GQQA 1LDPL 3MV8E 4KDTC 4EN3C 3O9WC 4WUUB 4V1DE 4JI2B 4OSUL 4WWID 4HSCX 4Z78A 4YHNB 3QUMA 2X6AA 4NB5A 1AZNA 2ATPA 4V1DA 5HJGA 2CO2A 1DYZA 3KHQA 4KGLA 4YSDA 1AH1A 1M7UA 3GBEA 4UQCA 3VFTB 2KBGA 2UUAO 2O5XL 3SYCA 3V6ZA 4XVSL 4BQ8A 1CU4L 1Q72L 5JXAL 3EJZD 4WWNA 2OMBA 5DJAB 3D4YA 3FCTA 3EF7A 4GIPD 2BMKA 2DWTA 1US6A 2YAHA 4YXLH 4YDVA 1MIML 3FUFA 3GTTA 5BUGA 5JVDA 2BNRA 4PRDB 4FERA 2O5YL 2OR7A 3T6WA 4K7PX 4FA6A 3GSQB 3WCYA 2V0AA 1JI2A 3JV6A 2FJSA 4NLHA 4PCYA 4N87A 5LBSA 1GC1L 2ORBL 4DTGH 3KLHD 2FR4A 2AC0A 4P5MB 2OYPA 1IC7L 4OM1H 1WHOA 3WNLA 3W5MA 2IAND 3RVVC 1RLBA 1W9XA 4O2AA 2ILLA 4HT1H 1TITA 2EDLA 2WXPA 4Y4KC 3HCVA 1AE6H 2FQDA 4S1SH 5CGTA 5TGBB 3BD3A 4ES8A 4FZ8L 5IJKC 1OZUA 3E8GA 3JWNH 4GS7C 5EU6E 1VMGA 1XMOO 4Y8AA 4KO5A 2UU9O 3QUXC 3EH5B 3HHMA 1PLCA 3CDGB 1I7ZB 1TQBC 2NXYB 4J7JA 2J20A 3DDFA 3FT2B 3L4VA 4B3EA 4EI0A 2OMXA 2BDNL 3L5XL 3MOBL 2WLNA 5IIEB 5E4IA 4QTIL 2F53B 5D7SL 3DX8B 4U31A 3DK0A 3E8UH 3Q5OA 4P2OB 4BWUA 1CFVH 1HIMH 4M7LT 1RUPL 5GXBB 3SE9H 4FQJH 2ZX9A 2NPLX 3QWNA 3QXTA 4WK2B 4JPVL 1A2YA 2RQ6A 3E3QC 1BQ0A 4AI8A 3MFFA 3AJ7A 2ZPKL 2R1XA 5GONA 1WGOA 2A4ZA 1WQVT 2GSIB 2YPVA 1D6EA 5EBWA 1C5CL 2XTJD 4G7SB 4NRYA 5I0XA 1QSVA 2WLYA 2UXVA 1U9KA 3MJWA 4OQTL 3OAUH 2G2RB 1QI4A 4TV3A 4Y4FD 1UZ8B 4ZFQA 1WT5C 2UXCO 3SE3C 2NX5E 4HWEL 1SOXA 3Q3GB 1KCVH 1MXGA 3BQUC 5LNDA 4LLVB 3BKJH 4FNLL 5KSAD 3SQOH 4GMTH 3WU2Z 5SV4A 1H9VA 5INCB 1F4YH 1W72H 1COBA 2ZXQA 3GUTA 4RFEB 3PWLB 5AW9B 4XN2A 4JDTH 3WNOA 3BYTA 5KHKA 2OKMA 4ZODA 5E8PB 4ZNCD 4MCZA 1GH6A 1DVFA 3TBSA 3JD2A 1WVZA 1JXGA 5CBGA 3D18B 4ORGA 3DX7A 3HAEA 5I73B 2P8PB 3UBXB 4JAUA 2Z4TA 1I1YB 4RMQA 4I3SL 3IAYA 4IL6Z 2HHHO 4P23A 2PTTB 5EH1A 4NUJA 5DJ0B 2B3RA 3P9MA 4JVWA 4WI8A 5FV2A 3T3ME 4HZLB 1KTDB 2EE9A 4N24A 3TC9A 3SODB 3ULUF 3B2VH 3D3VD 2HT3D 4HKXA 3A3YB 1S7XA 1LD9A 1ZPLA 4M6NH 4FLQA 1A9BB 4WTZA 1G43A 4K0KB 5FYKU 5FIEA 2FL5A 3WHXA 1U8MA 4K3EL 3NZ8B 3KG2A 4MLIA 2QEXV 4D9LH 2A74A 1TFPA 2BP5M 4KVCL 3MC0A 3VVWA 1I94B 3L73H 1ZS8B 3WIAA 4ZFOL 3QJFA 2YUVA 2DQIL 4W9GC 4HJJH 4JE4B 4WFGE 4JGMA 2LU5A 4M9OA 1Y1UA 5LHDA 1P1ZB 3G9VA 4YIQA 3CZLA 4GXUM 2XFXB 3T0EB 3TGXA 2CDGB 1TZAA 2C1OB 5FECB 3ECQA 3U0WH 3B9EA 5FCUL 2SEBB 4JI8O 3QNFA 4LKCB 2NY7L 5LXGL 4W4OA 3L7EA 5BZBA 4EZMA 3B3IB 5E9AA 2YMXH 3ABMB 2VDQB 4Q6YA 4HC1H 4JO2L 1SDYA 1D7BA 1XI1A 1IBBA 2EXWC 1T22B 3FQ4A 4Y9BA 1LEGA 4ELMA 3O0LA 4U33A 4Z7UB 3B2PA 4HIXL 5B7MA 3GSXB 4LLQA 5B1AC 4POZC 4UQAA 4TMPA 1BWWA 1V10A 4OZGF 5D6DC 1TTCA 4GKSB 3X1EA 1XMQB 4PWKA 5J13C 2I60L 1DEDA 1QUNB 1O7DE 1V5JA 1CLZH 2DQHH 1KG0B 5L2JB 3C08H 4MMZB 2JE8A 1IBKB 5HDBE 4UTBL 1QNZL 1HL8A 3KXFD 4GKZB 5CKGA 3N1MC 2BY1A 3HBQA 4UCFA 2CKBB 3EJZC 1DVTA 1N64H 2A9DA 2MTPA 4FXLA 1JVOA 1EH9A 3PWNB 4Y16B 3MLXH 3U7WH 1EDYA 2R29A 3JYBA 3HG2A 3W56A 5JYLA 4DEUA 4R7NA 3VD4A 4LDOB 4QF1B 4H8QA 5DMKA 2A9AA 2CHXA 2UZXA 1KYAA 4YHYC 3NCYS 3A47A 4GAYB 1M56C 2XTJE 4UIMA 4GIAA 3ATBA 4H25B 4P2OC 5DDHB 4FAAB 1BXVA 3KPNA 1BG9A 2A38A 1YQVH 1ADQL 4JDTL 4IRJA 1HR0B 1PNKA 5L9DL 1NLBL 3MJGX 2LQRA 5SWSB 3ZN6A 1NOLA 3S3SA 4GYBA 2DYPA 1JHKH 4MJ4A 1GPOL 1ILSA 2DM2A 5E4AA 3CAFA 3CH1A 4HIEB 4LCIL 5TE6L 2WXIA 2FZ3A 5J2TB 3FH7A 2VXQH 2RCSL 3U0TA 1QD0A 1L6XA 5DQJA 2WAMA 5FC9A 4ZFOB 2FLBT 3WKPA 2AAVA 3GBLA 5CZXD 3CZJA 4Y5YC 1IBGH 1UCTA 3DMMA 1ZX3A 4X64B 1H3GA 1I7RA 1UQSB 2R7EB 4NKIL 4L3EE 1KOAA 4JPRA 2B1AH 4NM4L 3LKOB 2ED6A 2MHAA 2VISA 5HDBF 4GBXD 4EBQH 2NTFB 1QRKA 3DX6B 4KVPA 4LVHC 3TFKC 5I6PA 1OT4A 4WU7B 2ZP0T 4EI6A 3ULVD 2DQ6A 4IEFB 1JOYA 2XG5A 1JL8A 1NDMA 4LF5O 3EYFA 4FJZA 1ZSDB 4K8ZA 1HI6A 4FNLH 1U8IA 3FUJA 3T2NH 2BSBA 3O4LD 1OAXL 2Y0SA 2MQ0A 4AXWA 4KQ0A 5E08H 5FA3B 1N6VA 5L4FA 4NOFA 3II3A 2DWDA 4K5LA 2E56A 2QMKA 3BQUD 5JDSB 1ZIBA 4J3OH 5KOMC 4X1YA 4JM0A 1U4FA 4ZTOH 4PSRA 4J10A 3ZDXE 1TQCB 3QDMD 5D1ZC 2OTPA 3HNTH 4AJYV 3UEQA 1MZZA 1FFRA 4MCYA 3OF6D 1ACCA 4GB9A 3HR5A 5A2JH 3DTUB 1PNCA 1VF5B 4OZFB 3TZVA 1XEQA 1JF1A 2X87A 4HQQH 4C57C 4UINL 5I5IA 3UAAA 1OXYA 1JPFB 2HKFL 2RH0A 2XG5B 3BIBX 2UXDB 4OZGB 4EIZC 3MRFA 2LW3A 2IAMA 3J80N 1HDMA 4DK0A 2OV0A 2F5AH 2M6YA 4BW5A 4J3OD 4TOYH 3SYQA 2GI7A 1AR2A 1F6LL 3DIDA 1IT9H 3VXSD 3IEAA 1KPRB 2ZYIA 5H6QA 5CB4A 2BVOA 1YEDA 2BOLA 3IFOA 2ZUQC 5CM1A 3ZJAA 4EB6B 1X6LA 1PKOA 4DV5O 1BLNB 1CDJA 5DLMH 1MFAH 3NIGF 4O2CA 4D0DA 2MCPL 4O9HH 3MNDA 4YUEH 2JXMB 1T04B 3O9WD 4PBVC 2EX3A 3S8WA 1E1QG 1XAKA 2DLGA 3GMNA 2HP8A 4NDMB 3LSQA 1N2RB 1WPBA 3VXMB 4XPGL 1RURL 4G6MH 3U0TB 5LN8A 4KK8D 3ZGHA 5L6YL 1KFAH 1HC1A 1NCWL 1CXLA 4ZK8A 3OV6A 4GW4B 3ARGB 4NZRH 3C8KB 4U1MA 4DCQA 4N2KA 4DV4O 3H1LH 4QHMB 2V3EA 4IBYA 2E76C 4H25A 3LEXA 3UFIA 1PKXA 4M4RA 5I74B 1SOKA 2PYEB 4APXA 4B7EA 1S7TA 3BN3B 3NABH 4G6AC 4QF1A 3GS0A 4UB8Z 3ISWA 3QDGE 3S35L 4F57L 3ZL1A 5DMKB 1E79G 4BKTC 5F1OB 4G42B 5I0WA 1TQWA 1YO4A 3QUZC 4TTDC 1IXBA 1D5ZA 1MCLA 4G7QB 2VXTH 4P59H 3UTSD 2VR4A 3DJ9A 4FXGA 4MTGA 4I1RA 3MO1B 3ZMSA 4H8HA 5B8CC 3KKYA 5D2LA 3ROOB 1UXWA 3SDDD 3KPTA 4YHHO 3BH8B 4FNQA 3HG3A 2C3VA 1BAFL 3BH9B 2QVMA 4GQ9H 4MAZA 1MCWM 4J8RA 2ZE5A 1CFTA 3ZHRA 2XQBH 4N2FA 4DFIA 1BQ5A 1WZ1H 2UY7A 5C0RL 2CLZA 2A73B 3BSZA 4JFWA 3GT6A 2CGZA 3TCLA 1MRDH 4ISVB 4U1HA 4Z7QE 5KVFL 2QJDA 1TQTA 4W6XB 3SZKC 2VQUA 3A0OA 2ZOLB 1QYGL 1RP3B 3DX1A 3MR9B 3RDTB 4DR2B 5J8OA 2K3TA 4KZCA 4NN7B 4XNYH 4YFDB 1A32A 3QB7C 3V4PB 3O3EB 4KJYB 2WBKA 4AC2A 1OAZH 1RUQH 3ARBC 3BJLA 1WO2A 3DNKA 3DX0A 4J4PC 4OKDA 4OZIB 1U30A 3Q2WA 4IS6B 1IQWH 5T1LD 1FJ1B 4E5XB 4XZ4A 1JOIA 1DBBL 1G9NL 2HRGA 3B3IA 1YEJH 4X1IA 1F1AA 2L8AA 4GRLC 2XQYG 3E8FA 1PZBA 2IVFC 4PREA 3BH9A 5DRXB 3L3KB 3TU6A 1MF2L 4P2OD 4X6BA 5ITBH 5DZOA 2VKXA 1NMBH 5FECA 3CC2V 2JB5L 4L5FH 5I6OA 4LLUA 1JGDB 2PP9A 4YIQB 2AV7B 5EUOE 4AGPA 2X41A 3WAKA 3RDTC 2QGEA 4AEEA 3APFA 3HIZA 2BP0A 4HP5A 4N0YL 4PGDB 1IGJA 4ONFL 4TNWK 2FL4A 2IH3C 4XX5A 5I8KH 5GIRA 2AJYL 2ED7A 2Q5BA 4L0PB 1N4XH 1F00I 3F7LA 3LEXB 1E3XA 4WSJA 2YUZA 4XTRD 1A7RH 1DVSA 2UUCO 1QQDB 4OPHA 3PGDB 4I3RH 3L1EA 4X5RA 5FYLL 3IDXH 4C56A 4J3OF 3GINA 4GW4A 1HKFA 4DW2H 5E5UB 4HJGB 2HFEB 3O41B 4Z7QF 5B21A 3GI9H 4CNIA 1YNTF 4NUJB 3EH3B 5DJ0A 3ZT7A 1UCBL 4XCFH 3VXMA 2W0XA 3UBXA 1QBZA 3OE7G 3FQTB 1DJIA 1S5HB 2FJGA 1LUWA 1S4IA 3OAYK 4NDMA 4ZOBA 5DFWH 5J1SC 2JKXA 3N91A 4NFDA 1AXTH 4JFPB 2D2CB 1FHNA 4R4FH 1FPTH 5KBPA 3V6OE 1MJ7H 4P8QA 5E99L 2A6DA 3MUGB 4EB6A 1TSRA 5EUKB 4K94H 1EHLH 5JJJB 1CDCA 1KPRA 4XN7A 4NXMB 5INCA 2A3TA 4LLVA 5EG6C 3IJYA 2WLHA 1KN2H 4D0BB 4J42A 5IJVB 3I3BA 4JPKL 4LP4A 4QTHA 1WWWX 3V9CA 1A7PL 4MGXA 2R2BA 1ACYL 2V5SA 5BR8B 2AEQL 4I4WA 2CHWA 2A6JB 2R1XB 2Y7SA 3MFFB 3JAWA 5E1AC 3VFWA 5IHZB 3CC1A 1SN0A 3HJ0A 4G6FB 1VF7A 1G1CA 3N40F 2OL3H 4X99A 4WGKA 1TETH 3CE1A 1FP5A 1F02I 3HZMA 3D9AH 5D96C 4G2AA 1SLVA 3MYJB 4XPAL 2JJWA 3DJZA 3JT2A 1QP1A 4PG2A 5FA3A 4DKTA 5IT2L 2QSAA 3B7SA 5T3ZL 4FS0A 2DIBA 3VFOB 2YSUB 4DF9A 4DRXB 2YAOA 2X3BA 5HVFB 3Q1SL 3QC6X 1M2OA 1UFIA 1ZSDA 3OKNA 4LLDA 2WOYA 3ZN1A 1TQCC 2F53E 3CXFA 3CDGA 1DVFD 2C3WA 1Y6XA 1Y6KR 3IWVA 1PJWA 1DLBA 1GHFH 2MHAB 2VISB 1OQOA 4RISL 1VQ9V 3S35H 1KB9K 1NFDF 2VLJA 5HYJD 3WKQA 4AIEA 1FRGL 1JXFA 1YY8A 1B3QA 3KR3L 4Y8DC 4PJ9D 1U6AL 1KBBA 3DMMB 1HE8A 4ODTL 1FFNA 1JPSH 2B1OA 1HE7A 3CMOL 1E67A 1MAJA 3IK2A 5FYLD 4ERSH 5AB2A 2FR4B 5EU4B 3S98A 3ZDZB 3ARDB 3L95A 4LFBB 1UWYA 3KNBA 4Z7VA 3CNKA 4Y2NA 3FB8C 4FZ1A 4HIEA 4JKNA 3Q5TA 1OGTA 5JVDB 1OAKH 3DOSA 4ELMF 4PV9A 2OW7A 2PCPB 1NT2B 1WCBB 3UTTE 4MS8D 1JNJA 1F11A 4GP4B 3AT0A 4IRJB 1MFNA 2IXQA 5CCHE 5GRVK 5DDHA 2J73A 3V6ZB 3KEHA 2E4TA 3FTSA 3ZDWA 3KM1A 1D5IL 4MB5A 4G8AC 1ZDQA 5F8QC 3HRZC 2VO8A 4GAYA 5C9JA 1RULL 4PCSA 1J0YA 5AD0A 4EPSA 3DROA 3W1ZA 4YHNA 2WP3T 1UURA 1IT9L 2VZVA 5CIPA 2DPKA 2WN2A 4NPYA 1TTFA 3TA3C 1C7TA 5IQ7L 2LGNA 5EIIA 1FFPA 3L9BA 1ES0B 1ZLVH 5CZXC 2ERJC 1VENA 4MVQA 2IADA 2C7UB 2XN9E 4NC0B 5I1GL 3OPZH 4HLZG 5T1LB 3SBQA 4DO2A 4FZEL 4UANA 3H53A 4X6DB 3VTMA 3MV9B 5GRUL 4R97B 3CJHB 1WD8A 4RGMB 4NKDB 4XPGH 1BSMA 2B14A 1EFRG 1DQQB 2Y4TA 1X5FA 1IGCH 3EGSB 3LAFA 2ATAA 2X5PA 1AKJD 4MVMA 1KG0A 4NQEB 4OAWA 3RTQD 2ZCEA 1ZV5A 2CKNA 4O9HL 1ZT7A 5B1CA 3CG8A 2RB8A 3PWPA 4J3WA 4BFRA 1OD9A 2Y2YA 4F92B 5IMMB 1DL7H 4O58H 3B5TA 1AS7A 2NNRA 2YBRA 4JN1H 1XMEB 4PRAA 1N7MH 3WNMA 3BKYL 2QSVA 1IZ3A 1B0WA 3GSXA 3L5WA 4HPHA 5I6LA 5JHDB 2WIMA 1XHXA 1CF8H 3BAEH 3HBZA 4B9FA 2NT0A 3HKEB 1XMOB 1I8UA 5GGVH 1E4KC 2ZNWA 1RPQA 3RX8A 4HS3B 5MEPB 2AJZA 1GKEA 3PL6A 2YJQA 5KG9B 5I19L 5J5EA 4H8WH 3UTZA 4EBQL 2A9NL 5B1AB 5K9JH 3CHOA 4NTYA 4JI1O 2CDGA 3MRCA 5DJXB 4KO7A 3QR0A 4K7FA 4JG5A 3WUZA 1NBVH 4PA7A 2YPVL 4JMNA 4K0OA 1PYWB 3CBJB 2WBXA 4UM8B 1HH9B 3V5DA 3U1PA 2E59A 3MBXL 4Z7AA 5DJCB 3Q2VA 1ZS8A 4J7RA 4XVTH 5DZPA 2X9YA 4NQDD 4DZBA 4MXQC 5IVZA 1KZQA 2XZCL 4BSWB 5E1AB 3GHEL 1U42A 3GXIA 1ZHBA 3TIDB 5JO5A 3KVDD 3OAYH 2OTLV 1JCHA 2OR8A 3BT0A 5IYZB 3CFCH 4TLKA 4IK7A 2NNUA 2R72A 1MVFA 1PZCA 3D4ZA 3EGDB 1UGNA 4ZXBC 2OZ4H 4B3RO 5JNYA 2GTQA 3NQIA 5CCKL 1Q0XL 5ADPH 5LLIC 2ZXEB 2LLGA 2B1GA 2ITCA 1ZT4A 1FDLL 2XVBA 4XZUA 5CP7A 1FKAO 3CDYA 5D7JD 1RUKH 1WWCA 4Z3FA 2Q73A 1J8HA 3QJVB 2MQGA 3Q43A 2MQCA 2Y06L 1DSFL 1BM7A 4GXVL 4M5ZL 4X5PA 4MASA 2YXVA 2W1NA 3ISYA 2R1YB 4PJFE 3SGKA 1Z9LA 2BRRL 3LIZH 1FYTE 2K78A 3IT8D 3CH8A 4UZSA 2A9ML 5GSVA 3ELAT 4LFAO 2B77A 2G2RA 5BXFB 5IYCO 1UYWH 1YA5A 1KCSL 1OAJA 3OZ9L 3ETTA 1K97A 4N9GA 5EBWB 4PR5B 4QNPF 2R23B 4N90E 3H9HA 4QY8B 4PGEB 3FO0H 4P9HC 1HESA 1ZLWH 4WFHA 4Z7WB 1VPOL 4NOBA 2GK0B 2Y24A 4JANB 1LK2B 4OF7A 4RBPK 5I6KA 2I32A 1FNSH 1HH6A 4ICWA 4HEPG 3INOA 1AQDA 1ZAGA 4GLRI 2DM4A 3BCCH 3T9WA 4K3HA 2W60A 2XWZA 4MTMA 1UGKA 2PWHA 2IDQA 1ZV9A 3AW5A 4DHLA 4X62B 4OGAD 5GGUA 3OAWA 5C6PB 5DU7A 2Y48A 4X6FA 2IANB 5D1XA 5JW4Q 1ITBB 3VXSA 3CFMA 5I75B 5TJWK 2DQMA 4EEQA 5AVUB 3MRQA 4MA1C 4R26H 1WB8A 3BP7A 4K15A 1A6ZA 5JW3L 3F6JA 5E6UB 3WY3A 4W9JC 2I5YL 3BGMA 4LCUB 2YPLA 5DUPH 1Y18B 5CBEB 1SF5A 3CP1A 1MWAB 2AZ0A 4FNPA 5SWQA 4PLNC 2L0DA 3MOAL 1VQMV 2DKUA 4ZMPA 4D9RE 5ITFB 3S34H 5JLZB 4FFWD 4CS2A 4GUPB 1NMBL 2WV3A 4U1LA 4UQEA 2BY2A 1KCLA 3BCFA 5ITBL 4P5MA 2XV6B 4QOKE 3DIVA 4B96A 2ZF9A 1RXLA 3PXJA 3JV6B 4M6OL 4DW0A 2EDDA 4Z3GA 1E50A 3DARA 3HVDA 1T6VN 1JGIA 5DHXB 2JS5A 4PRDA 4NVPA 2E47A 4X8AA 5EIBC 2P8LB 1A22B 1FYTD 1H8EG 1PL3A 2ITFA 1RVFL 4KKAC 3TN0D 5EO9A 1EZJA 1JZHA 1AGEB 1MREH 2QQLL 5F96H 4GKJB 1CE1L 1YTFB 1LJMA 4I87A 2RQ8A 2K6YA 4EUPA 5HGHB 1EHKB 4OB5H 1K73W 5C0AE 2CO4A 5EEUA 4GH7B 3EOBA 1M7DA 1DDTA 4TSBL 2G2PA 3QUMB 3OR6C 4BIUA 2GFBA 2LP7A 1JXJA 1Q6UA 4TNFA 4WI3A 3V0WH 3AG3B 1NPUA 5HJDA 5E4OA 3K71B 4KI5F 5HD8D 5KX5A 3WKNA 4TUKL 3IRPX 4HX1A 2ZX8A 4J1UA 4JHAH 1Q9LB 3DC0A 3FQUA 3RX7A 3WFEL 3EJRA 4KHPO 1AYOA 1GZQA 3K74B 3KGUA 4DGWC 5IREA 1YEEH 2ZOTA 1VIWA 2XUMA 2WCSA 3KLLA 1XQ4A 2Z31B 4JAAA 1WF5A 1XGRA 1GW6A 1T0MB 1YN6A 4OUUA 1CURA 3Q4HB 2HSIA 5F7DB 4OV5A 3FQ2A 1KBGL 4LSUH 2ZX7A 2HZHA 2K7QA 2ITDC 4LLYB 2GSMB 2PUSA 3S3XA 4G59C 3GS4A 5F0PB 2EC9U 2EDMA 4MXWH 4KDVA 2G38A 4P2ZA 1LHZA 4M02A 3ZEDA 3SDCD 4PV8A 1Z9MA 4ZFGH 3LRSB 4YHZL 5DRWB 1XBLA 1F58H 2DWEA 3MBXH 2H45A 3QDJA 3I2CH 4OCSH 2ZKOA 5CEZL 4OLXL 4XH2B 4E41A 1V3JA 3L5XH 1J1OH 4L8SA 2ZD0A 1GS7A 4LPYA 4X7CC 1SHXA 3BEVB 5L2KE 4PRID 1HL5A 4MT8A 5CILH 3IKCA 4LPTA 4TLSA 3E22B 2IAMC 4FG2A 2FB5A 3GWKC 3B7RL 1FZMA 5D70H 3ZUCA 1TYEB 2O61B 5DVNA 3AG4B 3S3CB 2EE2A 5T5NF 3DA0A 3HKFA 1A6WL 1DVFC 4XC3H 3TOPA 2ZYRA 1FWXA 3EFDH 2HMIC 3GMLA 3S88H 4B9GA 1KJ2A 3FFCD 4G1MA 1PLGL 3MJ7B 4HUVB 3RTQA 4OFYD 4L9LA 3V6FB 1T21A 3N1FC 1CK0H 3F00A 1H0DA 3IN2A 5BOJA 2ZQKA 5FYKH 5IQ7H 4XC3L 4KZDL 1TNNA 4ODUA 2BDNH 3MOBH 5E00B 2HVBA 1G8MA 3DI2B 3HKBB 4XAWL 3WIHA 3KYKL 6CGTA 5HGDA 4APQC 2YK1H 4BSJA 4PP2B 3PNWB 2UXBO 4R5VA 3ECVA 2G60L 4AI7A 4XVSH 3SJAC 2O57A 4GJTB 1YITV 2BSSB 1WIUA 1TVHA 4UMGA 5DK0A 2L3BA 3MRNB 1NGYB 3ZYOA 3WU1A 4JQVC 4TV9B 1XL6A 4NQVA 4F2MA 4PA6A 1VDGA 5F9JB 2CLVB 1VFBB 2ARJB 3IKKA 2CHZA 3WFEH 1HJBC 1DR9A 3U6RA 4WUKH 2K1EA 5CP3H 2P5OA 3A21A 3DTXB 3QEQE 1ZLUK 1WYJA 4P2RB 2VRZA 1HWWA 1M42A 2XIDA 3ARBA 1RPRA 3NJHA 3OG6B 4FFYH 3KW8A 3QQ3B 4YX2H 1JWMA 5SX5H 5HHNB 3S3DB 3ZTJH 4Q74A 1NFKA 4DP5X 3LQMA 2VAJA 3DK2A 3T0XA 2DYSB 1U8KA 5FM4A 1RUML 3ZMUA 4P5TD 4RSVA 4BIKA 1U3HC 4KKRA 3BVNA 2ATKB 1O6SB 2LFEA 1K6QL 1KIUA 4NQDA 5BRQA 1G6VK 2V9UA 4R8WH 4X6CB 4XP5L 1NUFA 3L3JA 1HJCA 3C9NB 3QUXB 3UBGA 1PD0A 5HHVL 2YQGA 2D0HA 3HOGA 6PAZA 3K2IA 1MFDL 3VXUD 5F72S 4F7TB 2VQEB 1G7IA 4UVAA 4PJIF 2NNAA 1YY9D 3ZKNC 5CSZB 1P49A 1UACL 4PGBA 2ENSA 1NCJA 4KZ0A 5IT2H 1JNNH 4H0GA 4I2XE 4EVNA 1HXMA 4JFXB 2WA3A 3LTVA 4F6RB 2Q6AA 4BJLA 3V4VL 2GJRA 4IYKA 4WCEV 1BOGA 2HAZA 5GGRA 5MP6L 3D2UD 3QORC 3WBDA 3TBCA 4GQPH 1XF3B 3K0WA 4B3MB 1JHTA 1BHBA 3ABKB 1Q0EA 1D5BA 4MAYD 4XPHL 5D4IA 1ZWIA 2W92A 3K5MA 2X7RB 4ZFZB 2FDBP 4DR6O 2QQLH 1AQMA 5EBLA 1VLXA 1D5XA 1HHIA 3HRPA 2JKTM 4TUUA 1BD2E 2YEZA 5I6XC 1AQHA 1NI8A 1BD2B 1IKNA 3MLZH 4IBTA 1A25A 4YLBA 2Q8AL 1FV1B 5DC9B 1EJFA 1VEMA 1H3PL 5J6GB 1NAMH 3BMVA 3CVBA 4HDIB 1A7PH 2XSKA 4ZQTA 4BCZA 3JAKB 3KHOA 4RAVB 4KKZA 4DKFL 4I0PC 1C5DB 4DV6B 1I7TA 1RPOA 1ZSPA 2W5PA 3BI9X 3GJEA 4DV7B 1G7JA 2D3JA 4MD5B 3W0WE 2ZE6A 5HVHC 1N34B 1FL3A 3FONA 4P46A 5CCJA 1D3CA 4UT9L 1KXTB 4Z76B 1K92A 5I1HL 1TZGH 2LVEA 3ARSA 2EILC 3NCBB 3F7KA 5FB8B 3M99B 4KNQA 4Q9CA 5FXCH 2GBVA 4HS6A 1MWOA 1P2CB 2BCMA 3APQA 2VLRE 1YEGH 5MHSE 5TISZ 2QV2A 1PDKB 2DTML 3JUYA 5B3JE 1T4KB 4FJYA 1W2KT 4LFHD 4Z8FL 2F1BA 1UWFA 2A7BA 1OGAB 4KXZI 1MDAA 3DUSB 2VDML 3FCBA 5D93B 4OF6A 1G0YR 2HVJB 3B37A 3T1FA 3M17B 3PV6A 3B1TA 3NTCH 4E0RB 5GGSY 4MSWB 4WIQA 4L1LA 4YEEA 4ZS6D 3V8OA 4JV5O 1I7UB 3AQZA 4OPAA 4Y0GA 4EI5C 4MTOA 1ZSHA 3GGWB 2X4SB 3W57A 2AJ3B 3HN3A 2VUYA 4L9LC 4UQ2B 5IB1B 2XWTA 2NLJC 1HEHC 4OLUH 4AQ8A 3CFKB 4RQFA 2H1LM 3SJVB 4CH3A 1JFHA 3N2GA 4LDLB 3TXQA 2SODB 2UUCB 4WFBV 1U3HB 4PJXA 3EBHA 3O6MH 3L70H 1TEYA 1WDAA 1YNKH 4NQSA 4X80H 5D7IE 2ICWJ 3CZGA 1A1MA 5KBLA 2WZ0A 4O00A 2W65B 4O51B 2IIJA 3GKWL 2AXHA 2DQIH 4RX4A 1N4CA 4QXWA 5AFAA 3BZEB 3UZQA 3LIZL 2OIGA 1XUQA 2ZINA 3QUYA 3T1HB 1N59B 3F3HA 1COWG 2NYYC 1SJXA 2UXBB 2YPKB 5KSAA 4H1LA 2EIMC 3VQXA 2JIXA 2J56A 2EKSB 3X13B 4GX0A 1AD0A 2VSCA 4JFDA 2P4KA 1JAEA 5I8CB 4PLJC 1XR8A 3AQYA 3VI4B 2VQ1A 4AJWA 3BX7C 5JMOC 1JPTL 2QSTA 1UJWB 4ANWA 3MXWH 1FNHA 3HC4H 3FO2A 4APQB 5IJDC 3S37H 2W0FC 4I0PB 5CINL 4FNSA 3FRPB 4M7ZB 4MHHG 2WM0A 2G0LA 5DJYB 5MP6H 1A6AA 4HH9B 1AHWA 4Y1TA 4Z0XB 2DH2A 3VWKB 4MQSB 3BKML 4APQD 1S3JA 2P06A 3I9GH 3UTSA 1IM3D 4IHOB 4I50B 1GGBH 1RMFL 3MJ8A 5EA0L 3BVUA 4JHBA 3DRQB 5I1LA 5G4OA 3ZDXF 4LRNL 3BEWB 4A66A 5ACZB 5BRZB 2YUAA 4WJ5A 3L74H 1RY7B 3BSGA 4M48L 1MDTA 2C4FT 2AZ2A 1X5YA 3GO1H 3IS1X 3OR6A 4YS4A 1E6OH 5GHWL 2R9RB 1K6QH 5FKPB 5EIVA 4N3TA 4PY7B 5KVFE 2ALAA 2OL3A 5KN5A 4WEEA 5AW7B 1RH8A 1IAOA 4QRSA 1K8DB 2OMTB 4FQ2L 4I48A 5D1ZA 5JPNB 4FXTA 1SA0A 3LDDA 4F7PB 3IMUA 2R9IA 4RDQF 1VF5C 4N0RA 1R5VA 1YZBA 3WFVA 3P9WB 1YNLH 1U8OB 1MXDA 3GZPA 5F7MC 5B5EZ 2K70A 4Y4HB 5JOPD 2DJSA 3MRPB 1SVBA 4MCMA 3QRLA 4MMXA 3FOMB 4KKAD 4BZ1L 3LDBB 4G8FA 3WXVL 3FSZA 2AK4D 2GY7B 1Y0LA 1IIKA 4ATWA 2XTAA 1GS6X 4MA7H 3GPSA 4U0QB 2LU4A 3LRGA 3O2WL 4Q0XL 2J8UF 1T03H 2XACC 4BM7A 5J9PA 3TBVB 1NGWA 5CHNB 1FZKB 1ZT1A 1PG7W 4RRPG 4OLZL 4AMKL 2IQ9L 3QNEA 3RYFB 2WYZA 1DBAL 1J87A 1MCEA 2XN9D 3OX8B 1BQHA 1AANA 2QV4A 3PQYE 5A16B 2NUPA 4YWGH 3HC0A 1N3NB 3Q2CA 4FZ8H 1PFCA 4AZUA 5CD5C 2I27N 4H4NA 2IJ0C 5EC1B 2X0WA 3IJ8A 4YLQT 3I84A 1RZIB 3ULSB 1AKJB 4NCC2 3VWJD 4UUJB 2KLTA 5I74C 1NCWH 3BQVA 3MACL 4O4JB 4MQTB 4HQQL 1W0YT 3GB7B 3BISA 1ECZA 3IETB 3BLBA 4NHUA 3VFNB 3MV9D 1UWXK 2WVVB 3CE2A 4NM8L 3D3IA 3WAJA 4Y5VC 1OTTD 3IDMB 1HZHL 1KPVA 5F9DC 2P7TC 5B7EA 1MCHA 1MCDA 3S6CA 1BF2A 4DV6O 1WFUA 2WAQA 4M29A 3QEHA 4X42A 3EDJA 4YDZA 4BQBA 3IGAB 3A22A 1WAAF 3SY0B 5IOPB 4TQIA 2VR7A 3PXLA 4K3DL 4QRRE 2ZG1A 4OD2B 1EEYA 5IOKA 1ILUA 1HZKA 2DMCA 1FFOA 1IJ9A 5F3BA 1H3VA 3IJEB 1S3KH 3P3RA 1NANH 3AG4C 4JRWA 1TQSA 3FT4A 1G6RA 3H7LA 4M7KL 4TOYL 4C59B 2VERN 3QUYC 4OR1A 4ZUUB 4PJ7A 1JNLL 2XA3A 4QYOA 4UINH 3QUML 4KKCD 1I85C 1MUJB 2EXTA 4N0UA 1IEBA 2V9TA 3U0PA 4ZX6A 3NZSA 4WTWA 2WXQA 5ID0B 2ZJSH 2OXHB 4NTXA 3HE7B 2YR3A 2CAKA 1BZQK 4QXTB 1QBLH 5CJQH 2YO3A 2OMYB 4PLKD 1B6QA 5JWPA 4YY3O 2BCCH 3ARDD 4YE0A 3RPIA 3LZPA 2BIMA 1T7XA 4R0LB 1L4IA 3ATDA 1SEQH 2H4EA 3TNNB 2QZQA 5LXTA 3KCPB 3SE4A 4EI5D 4FMTA 2W81C 3C2AL 4HCFA 4B27A 4G6JH 3G5VB 2R69H 4JN2A 4MJIB 1LO2L 4RFNB 5DD1H 5I1JL 1YEEL 1BS3A 1YMMB 3F84A 1CDGA 4XBPB 4M5SA 3MLUH 4UDUB 1XH1A 3GRWA 1LP9E 5DSCA 5E08L 2VJ8A 4HUUB 1A14H 4GBXA 2OTWA 4UB6Z 4AE1A 1H15B 2FX9H 1SFDA 1CLVA 2HG5A 4N0UB 1OB1B 1IZJA 2WO2B 5TE6H 1B9KA 3ECBB 3Q48A 4ZUUA 3QNXA 3SDXB 1NINA 1NS1A 1VQLV 1KLUB 2OZNA 1MI5E 4XMZA 5EBWC 2D9QB 3S5LA 5A9GA 1W6WA 3N40P 4J23A 3TA4D 3UOAB 1GTFA 1BXAA 5F3BB 4TRPH 1FFOB 2BFGA 1GJWA 4XBMA 3JCZA 2XJLA 5JDJA 1KEML 4X80L 1NC2A 2Q0OC 1GGTA 3HC4L 3KXFE 1C16A 1JPTH 1XNRB 3BEHA 2E74C 2TSBA 4HFUL 4JL2A 4OX9O 5A6MA 5HYJA 1AXTL 3RIFK 1LWRA 1XILA 3AROA 3CDZB 5CA0A 1VF6A 3HPJB 3IDMA 1X59A 3OHXA 1G6RH 4GY4A 2HLFC 4PJBB 3U30C 1I9JH 5FO2A 2CK3G 5T3ZD 1NCGA 1EN4A 2HB0A 4UIKH 3VTTA 3F7YC 1YVLA 3V5KA 4M62L 2Q6WA 5FYJU 4N26A 1A8ZA 1DJXA 4LOFA 5FYLH 4HEPA 4M7LH 4QXGH 3H42L 4GNKB 1RFYA 1BFVH 2WGXA 3KPMB 3W39A 5I1DA 4MWFB 3QI9B 3JXAA 4GAGH 5IW1B 4W70A 3PP3K 4LL1A 4ABMA 3P4NA 4ZPVA 4G7YL 5LGHL 3L2LA 1BQHB 4ONFH 2Q76B 4GINA 2ARHA 4PI0A 4GKKO 2ZIOA 3HPLC 3GSWA 5JHMA 4RLDA 3QYNA 1YY9C 3LZRA 3ZKND 1FZKA 1YNTB 5JPNC 3CSPA 3C6SB 2AEWA 2A6KA 1YEGL 2BNQA 3ML9A 2D3NA 4UV4L 5F3FA 3QJZA 4XCFL 1MW0A 1A6PA 2K8QA 2WNWA 3RT3C 2F7IA 1BZ9B 3DUUB 4K8RH 3TXSA 2FKXA 3AAZA 4M93C 3US0A 4KITB 4FABH 3CBKB 3LN4A 4TPRH 1PVHA 2AHYA 3C8DA 4WNQB 4Y2DB 4Y1AB 4ZW6A 3CHQA 4HETA 5IROC 4IOIA 4W4NA 1MW2A 3RA7H 4IDLA 4F7PA 1SA0B 5HPMA 2ODHA 4QMEA 3W7XA 1B0RB 4GSUA 2XRAL 1K3ZA 3MBEB 1IAOB 4QRSB 1AI5A 4I77H 3SE3A 4E68A 5A2KH 1AFVH 2NY6D 1DQLL 2H7WA 2D4DA 1G7PB 3PAZA 3L9RA 4FLTA 3BPZA 2MMXA 3JV4A 1RZJH 3A4AA 3OXRB 2P8MA 4PW4A 5T1KD 4MVZA 2X2UA 4WHYH 3ATEA 4W9EC 3C8HA 1MG3C 2ZCHH 4MDIB 4TYUA 4N3UA 5JA8B 2WBWB 4EKJA 5EV7A 4Y5XA 3F65A 1K2DA 1ND0A 4OIAA 2XAGA 4LCVA 5I1LB 4JFDD 4UCRA 2D7PA 3DRQA 2J6EA 5DGQA 3EYOB 2X4QB 5DHVA 4I50A 1A4JA 2BIOA 4X7SH 3DKHA 4X6DE 1DP0A 4ALAH 1DFXA 4O02A 4RZKA 1K4DA 2W0KA 2XAQA 3PP4H 4RFOL 4KJWC 4RGNE 2AXGA 2KT6A 4Z0XA 3VWKA 5EZYB 1P0SE 2QPSA 3G3LA 5E6IC 1VGKB 2JI2A 1DTUA 4CVXA 4P57B 1P4BH 4APQA 4LEXL 1FNAA 3H7BB 2EIZA 2BM3A 4YIOA 35C8L 3FU6A 4FG0A 1XR8B 4KK5D 2OZ4L 1EFXD 2I07B 3DBXB 5IYBO 2GIYA 1GOFA 2F58H 4C55A 1W0VB 2JIXB 3L48A 3U2IA 1SJVA 3ZVVA 4AJ0A 5KANI 4PD4F 4Z5RA 5IW1A 2JB6A 3C6LD 2F6AA 3L71H 3DURA 1BAFH 4XRCB 2IBGA 4Y4HC 2C9UA 1NCCL 4OGXL 2M1KA 1GM8A 1V54B 4DR1O 4Z0BL 1BG1A 2ZOWA 3HG1E 2ZR3A 3T4YA 3GK8H 3V9EA 1FLTX 3MRBB 1AACA 1NIDA 1HINL 3AG7A 1SXBA 2PNDA 4MW3A 1NAKL 2ZCLH 1XGUB 3DV6A 4HSAC 43CAB 1KTLB 1YZZA 1A3RH 2AAAA 2AJXH 4NQSB 4N2IA 1TSHA 1FG2A 5CA0B 3CDZA 4MS2A 4TULH 1KT2B 1NOAA 4JM4L 4U6YB 3BUTA 3VSQA 1IC4L 2VC2L 4I1PA 4PVNA 1N67A 3D8MA 1C16B 3QXDB 4LSTH 4QHUA 3PGCB 5L4MA 1TZ8A 4ORZC 3UBFA 1E4WL 1P9MA 5IB1A 3MRGB 3MU3A 2CDYA 5BZDB 3QF7A 5EC1C 4JZJC 4XAWH 3RL1B 1FYHB 1RZPA 2X4SA 4YHLH 1R5WB 2Y3NA 3ETBJ 3JV5A 3DHMA 3GSUA 4B0MB 2P5ED 3NCFB 3NCCB 2ZNXA 3KDPB 4GAFB 4LRIA 3QNXB 3SDXA 2DAVA 1J0HA 2JTYA 4UTCA 2QMJA 3M17A 3PV6B 1UXMA 1M4UA 4ZMWA 2PI4A 2HG5B 1NTDA 5E2TL 2DQJH 5KTEH 2XXCB 3ZE0E 1PS3A 1H15A 2D7TL 5SWZD 3SN6N 4GLXA 5IZ7A 5EZOH 4RMTA 5JQGA 4M8RA 4W9FC 4YJ3B 3JVGA 3WJMA 4X4KA 4K8RD 2X53A 2X4PA 4OCXL 4F58H 3KJ4C 2E7CA 3RUGF 4AVHA 43CAA 3BPLC 4P46B 3UP1A 3JASA 3K2KA 5FYKD 2OXHA 4JKKA 5JW4R 4PJ5B 1G6UA 5CA1A 2VE6A 2YIBA 4P4RA 1MUJA 1Z2KA 3Q2LA 3LPOA 2C9AA 1TZHA 4KH2A 3B9KB 4PB9L 4PM1A 2DE0X 3KPRE 3CN3A 3T0WA 1FO0H 1BZ7B 2J44A 3FTGB 4OD3H 2JF1A 4UYPA 2YIHA 5J2UB 4FLVA 3FT4B 1D5XB 4LWSA 4EZJA 1QR8A 2WZ6A 3B9KD 4EUPH 2NY1D 4PRNA 1K4CB 1GYUA 3DDGA 2ZG3A 1S6NA 4GMSH 5EPMA 3OTTA 2Y5TB 4RX4D 2G75A 4NXMO 2BLFA 2FEJA 3ULVE 4OZHF 3K04A 1HINH 1U3NA 1JG9A 1NGQH 5JH7B 1HILB 2BHYA 1EN5A 1KPVB 1IBKO 1BVZA 2I24N 2ORBH 2VLKB 2BY0A 4DTGL 2GBUA 1DEEA 2OIEA 4BK8A 4JZJA 4NAJA 1Y74B 4IRJD 3GB7A 3GXPA 3TEWA 3CMOH 3SKOA 4ERSL 1VF6C 4DW1A 4JI3O 3V7AE 2VDOL 4L3AA 1RZKC 4GI6A 5CSBA 4ZMZA 1D5NA 4B53A 1BXUA 2X4RB 5MI0B 3K5SA 4F7CA 4FQQB 1F6AB 2HFEC 5A16A 1QZ1A 2X2JA 3OX8A 3N85L 1CGTA 2GTWA 4JDVA 1MVUA 1JZ8A 3J7HA 1TZIA 5FA4B 3DJTA 1P5VA 3M1OA 3TT1H 1A1OA 3VI4F 5H35B 3DECA 3QQ3A 4WAFA 4YK4C 3QCVL 5CU9A 3QO7A 5D1QE 5IVXF 1HHGA 1ETA1 3VI3A 5ILTH 1ZHNA 4HALA 1F4XH 3FTWA 4PJAB 2YAFA 1U95A 4A2EA 2WWKO 4TTGA 5HP5A 1TCMA 1RI8A 2LU3A 2A79B 3X1BA 1OZTG 3FO9B 1LE5A 2NY2C 5F9JA 1BAGA 2WK2A 4F2MB 2ZM6O 4UBDC 2ADQB 3B40A 2F58L 2HLEB 1TVHB 5DK0B 3SSGA 5AOZA 3AUVA 3LDBC 1FORL 4F8NA 4JW3A 5D1QC 4PP2A 2OMWB 4DUZO 3ERXA 4NP9A 5ESQB 5DJ6B 1RVFH 1FNGA 2E27L 4BZ2H 2V4LA 1I8MA 1CQYA 4MAUH 2E3CA 4K5OA 1LO5B 1CVSC 5DEZA 4I0CC 4OLYL 5E70A 3RLSA 4NNXA 5CN1A 1UA3A 5EZLB 2KI6A 3KPRB 5H4ZA 5FM5M 4HIHA 4WJ5B 2XUWA 1ZANH 2CKBL 3GMLB 2UXNA 2JJTA 5MEND 5HYSG 1QLEL 2FECI 2NY3B 2BS9A 2B59A 3VNZA 2ZDIC 2X4TB 4J2XA 4NXNO 1IAIL 4WO0A 1IDSA 1T6BX 4U3JB 3M1BB 4N8CL 5F7HA 4JGSA 4ZUSA 2VN4A 1HAWA 1FZOB 4FFTA 3DMMC 4YFLI 3UTQA 2N0MA 2ZKMX 1SQBH 5LGTA 3JATB 3GPEA 2WNGA 2XWRA 2YBGA 4HBQA 2KSDA 1WFTA 5HVWA 3K6IA 3FO2B 1MOFA 3L5JA 4R50A 4JYAO 3DRTB 4RGND 2GABA 1KB9J 2VL5A 1QOKA 4HJJL 4E41B 4JRXD 1MJJB 5E2WH 2A9MH 1FA4A 2B0SH 4L18A 2R8SL 4Y19D 2DZEA 1H8OA 1LDSA 5F9AC 4KHTL 1P1VA 4F2EA 1NBZA 2R29H 3LN5B 3OR7A 4PJ6A 4AIXA 2COVD 4M5ZH 5FWRA 3R8BB 2WOBA 4PVMA 1TU2A 3ALXA 5HXMA 2N04A 3PCYA 4UTAH 1KMGA 1Z5VA 1RSFA 4NO0A 4W4KA 4G71B 2AXJA 3OKLB 1M6OB 2W80C 1CXEA 1XB6A 4GP5B 3UZQB 1A0QL 4AWJC 2VQFB 3BZEA 1JF6A 2ETNA 2A1WL 2AEOA 2Q0ZX 2W65A 3D0VB 3Q4HA 4JV5B 4O51A 2EADA 5D96B 5HHQB 5D7LE 3I6SA 1EO8H 5AOMA 7FABH 2GDSA 1HFUA 4N8VB 3J7AU 4HUXB 1NVPD 3O3BA 5BQ7B 1BFVL 3SJBC 1L5GB 2V5YA 5IUCA 1ZDSA 4JAMA 1FFXA 1NFDA 3IDIB 5IB5B 2XVGA 2QADB 4JE0A 2XZCH 4WI9A 1Q94A 3S3WA 3V4VB 1M7DB 3EOBB 2FX9L 3AU0A 3FUHA 3Q06A 4FG4A 2Z7ZA 1IBLO 1LMIA 2B9ZA 1MFEH 2YGQA 4N0FB 3RVWD 1NDGA 3NRQA 3IGUA 1DQTA 4HK3N 4OQTH 4DV7O 3WFCL 2OCJA 2E9GA 2WWOA 1BZKA 3BAYA 3DUSA 3FH5A 2HEPA 4LIQE 4NUGH 5GJSL 3EZJB 4RGMC 4UOW1 2L7QA 3R06A 4FLZA 1KB5L 1R0AL 4LESA 5FPOA 2BP8B 3O6LH 2ESVA 4JGUA 1WTLA 1AIFB 1O6VA 1UEYA 4TNWF 5H37H 2JGUA 1EEZA 4AKPA 4DOHB 1CYWA 2YD3A 5KMGB 3J27A 4ABVA 4BFEA 2NY1C 1OCZB 4TNVF 3GLAA 1JP5A 3QXUA 4PBWD 4UM9D 4ZRGA 3ZUNC 5JLZA 3QVAA 3Q8CA 4JKMA 4MDJB 4N22A 4P59L 1BM3L 5MERB 5B3JF 3CC5A 4OVUA 3NJLA 3RVYA 4X7TB 3OMIB 3UAJC 3RIKA 1S3KL 1NANI 2YPLB 3W9EB 4HYOA 4KX7A 2YPVH 3RX5A 1XF2A 2XZAH 3BA8A 3QNZB 1MVYA 5I2IB 1FV1A 4IRJC 4M5YH 2AI0L 3KGRA 1WBYA 4XMVA 5G5DA 2JJUA 1HNGA 3MRQB 5TDPA 1K85A 4FL4B 4D6TH 2ZUSA 3LS4H 3H1HH 3SYPA 1JHTB 1XF3A 5F9WB 1GGYA 4FXKC 5E6ID 2OJZH 4JVUA 1NGZA 4EDXA 1BOGB 1L8DA 1XZ0B 5SX5K 2PO6A 3L3HB 1F97A 3DSFL 4JFXA 1QI5A 2XKSA 2CMRH 4HEME 4G8GB 1J9CT 2CRZA 2F66C 1FH2A 2X05A 2VJ0A 5CSZA 1GN3A 4JG1L 3G9AB 4IT5A 2J8UE 2ZWLT 3W81A 4E9RA 4HWBH 4BWWA 5HHPA 4FJCC 2F1MA 4MNGE 1U91B 1O5PA 3VYOA 2P49B 3DPDA 3H9YA 4MX7B 1NUGA 1FXKC 4XCEB 3K8KA 5I5JA 4HK0A 3G5WA 4X6CA 2L35A 3FAXA 2V5MA 2AEIT 1ZS2A 2BERA 2G5UA 5E5MB 5T5FA 4F9LC 4FI8A 4G2KA 1BCCH 1AR1C 3E6FA 2YGPA 2GUZB 2N3JA 1V55C 1Q1JL 1YMHB 5EWIH 3O9WB 3WGUB 4GLRH 2LE9A 1MG1A 1LM8V 5FGCB 2ITDB 5FHBL 1E9QB 2PPAA 2JLPA 3E6HB 3MLVL 2XICA 4D7TA 4WU5A 4KK6D 3VX1A 2IGFH 4FM2A 2I7OA 4BZ1H 2GQHA 1GIGH 1KXVA 5EOTA 4PG9A 4KK9D 4P2RA 3CXHF 4ACPA 1T0OA 5KHIA 7PAZA 1PZ5A 2DKMA 1VAHA 2NY5H 1J8HB 2WWKT 1KUMA 1WJZA 3PNRB 1I5YA 2XPYA 4Q6IA 1U33A 3MV11 2F7QA 2DBLL 1DBAH 1E0OB 1JN6A 2ZOKA 3GLZA 4AOFA 5I1EH 3SDAA 5T1KA 3EGDA 3MODL 1RHHA 5EEVA 4C83A 3PNWA 4X83A 1BJMA 3F83A 4WO4D 5E4EC 1ZHBB 3VQ2C 1Y4MA 5KYUB 1JK8B 3ARED 4ODUB 5IVZB 3ZTJG 1QU7A 2OMNA 3ZE2F 1NM9A 5JQ6H 2JRIA 1T21B 5T3ZH 3V6FA 3UG3A 1Y66A 1GGBL 1RMFH 4CBZA 2EJ7A 5LBSH 2CH7B 3BWZA 1KJ2B 4FNRA 1P7GA 4HUCA 3PQYD 2DY2A 2JWYA 2WTRB 1PYWA 4RH4A 43C9A 5AALA 4N5EC 4B3MO 4UM9B 5IWAB 5DN6G 2OR9H 1FZMB 4BH8B 1GAFH 2CBOA 3FT9A 4NKIH 1CG9A 5ISZA 1Z5HA 4ZMXA 4HKZA 5AKVA 1QR1B 3TL5A 1IBGL 3PGFH 3SDDA 5J7CC 4X88A 4JI7B 3KLAB 3RVTD 1QBMH 3CMGA 4PS3A 3ULUE 1TJGH 5EU5A 1RFDL 5ETUA 1DQMH 3BY6A 4QT5B 3AG1C 2QWQB 3SPHA 5CLXA 4RA0C 1IC5H 3N6YA 4XH2A 3Q1SH 3LXAA 4RNRA 4G8IA 1EMTL 4ZUVA 2ENJA 2HCZX 3FOLB 4FDWA 1GW0A 4HHGA 1DLFH 3FRPG 4L8DA 3VXUB 4AC4A 4HBNA 3F12A 2GHZA 3EG9B 5B22A 4UQBA 4G9FA 1PZAA 1XTLA 5IG7A 4S1RH 5IUSA 3APNA 3ZL4L 3LH9A 3L3GA 3IJSB 2EIKC 3WY2A 1BAWA 3WXWH 1JQ0A 5D9SA 3RWIA 2OL3L 1OP9A 2B15A 1CFSA 1YMME 2GC7C 2H3NB 3C09B 3I3DA 4P3DA 3SD5A 3WKML 2BSEA 3ZHSA 1FL6B 1GMIA 5EOCH 3EGSA 4X7FC 3RVWC 4FIPC 3OJDB 4XPBH 3SCMC 1BBDH 4AUYA 1WP7A 2Z31A 1TUPA 2BFVH 4NKDA 3EH2A 2AEQH 3ULAB 2K3HA 5BJTB 1E30A 2HH0L 1BPLB 3FQYA 1JMKC 1H2SB 1K3IA 3FQUB 3BESR 3M1CA 1OP5K 4B5ZA 1LQSR 2GT9B 4JPKH 3IDNB 3MNZA 5TE7H 5D93C 1KCUH 2DQTL 4PJHA 3DO7B 4J4PA 1HOCA 4GFTB 4WK4B 3K71A 4FTVD 1QPKA 5I1IH 3AG3C 3P3NA 4AYDC 5J6HA 1FHGA 1G1XB 4JFUA 2FEEL 4H88H 2Y6SD 3HLKA 5MEQB 3T1YB 5ALCL 3N06B 5C70A 4NQED 5E56A 2XWDA 1DFBH 3ZDYF 1Q86W 1NL0L 3B2EE 4OZ4A 4H8UA 1P4IL 5DO2D 4YSTA 5HHOD 1F11B 3PHAA 5EO9B 2NZIA 5ICYA 2WPDG 5IVXA 3WEMA 1HEZA 2IU3A 1J88A 1LWJA 1Q81W 2A0LC 3BP6B 2GJ6B 3GJFK 2P8LA 3J07A 2WLIA 2DD8H 2DL2A 3MRIB 4N0CD 4TQ8A 3VXMD 5KSBE 1R5IA 4Z7VB 3KNBB 4NN5B 4CJ0A 4EN3B 4Z2WA 2VGLM 4YHMH 4OLYH 1IM9B 2EYTB 4BA8A 4I55B 1DBBH 1G9NH 2J12B 1N4XL 3KL0A 3RWFB 3UERA 3BT2L 3FB6C 5C8JB 4IRSA 4RFNC 5C0ND 1B6DA 1H3PH 2PLTA 3BHBB 4GZRB 3SE8L 5MENB 2C1PA 1ZLSL 1AAJA 1JF5A 2HFGH 2VLJB 1BF8A 4JM2B 3WTTA 1N34O 2ZUWA 2DTMH 1EZUA 1L9RA 4OTXL 2ADYA 2CIIA 3MJ9H 1O0VA 2WVTA 1FBIL 3V55A 4HV8B 1PKQA 3BGMB 4O4IB 3BAAA 2A1WH 3MN8A 2QKAA 1K7DA 3BP7B 4ZDHB 5IB4B 3S3PA 2YA2A 2MQ3A 3FKUS 3VM7A 3VI3F 4DRXA 1AO7D 3KMDA 5C0AA 4UTAL 3D52A 5DK2B 3UJJH 4AQYB 1UACH 1A47A 4X6FB 3NP3A 3DMMD 2D7QA 1C9SA 3D85D 3PIQB 1YEJL 4ELKA 4JO3L 3AQXA 3Q44A 4N20A 3FBKA 4X9QA 5CGYD 1AI1L 5I75C 5LVEA 3W11D 3EGXB 3QSKB 2W0LA 3FFQA 5B1B