3WB1A

Hcgb from methanocaldococcus jannaschii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
b'VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0488
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 57
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb1A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb1A02
1DIOB 2V4DA 2D0PB 3AUJB 1IWPB 5D5PA 4DK0A 2F95B 3WB2A 4DK1A 1T5EA 4L8JA 5D5QA 1UC4B 2F93B 1IWBB 3WB1A 1NBWB 3LNNA 5JJNB 5JJJB 3WB0A 5JJEB 1EGVB 4GYCB 1RSOA 2F1MA 1H2SB 2D0OB 1MMFB 1UC5B 1VF7A 1EEXB 3BRCA 1EGMB
chains in the Genus database with same CATH superfamily
1LUVA 5BSEA 5K3FA 1KSJA 4EG7A 3HXKA 4ANFA 3VPBA 4M9SA 3TLKA 1EUQA 2QN9A 2AE2A 4BLQA 1YJCA 2I2BA 4C76A 3T3DA 1E1RG 2XYQA 1ZLYA 2WWGA 1HWYA 2PJUA 2A33A 4M4SA 4HAZA 1HW7A 1RQLA 3VQWA 3DOHA 5IC6A 4F9GA 2X0IA 4XFJA 2Q68A 2FTKE 1KZYC 4PCVA 3K0FA 2DHQA 1Y98A 4P34A 3I2IA 3PYLA 3BK7A 3O8NA 4H60A 5HE8A 1ZOLA 2R00C 4DMMA 4DV5O 2FZEA 3GLVA 4D4IA 3RYCA 1OASA 2CDRA 3TTXA 3M34A 1CHNA 6REQB 4PRYA 3F96A 4NU8X 4LMRA 4B2YA 1T8RA 3OMIB 4CM7A 5JARA 4OBWA 1XTKA 1HDIA 4AXXA 3I09A 1PR5A 1Y7PA 4JEIA 4Y8VA 1RJFA 1PZFA 4R83A 1MBZA 3AK2A 2CYCA 4YRCA 3N6VA 4KV9A 1ZR2A 3VH3A 2KLBA 4MW3A 1UAGA 4RKWA 2C9OA 1LFAA 1NI3A 1Z38A 4Y9SA 4QDZA 4ZI7B 5LMNO 3AUKA 1L7BA 1QCDA 2ISQA 3QU7A 3OJLA 4J1NA 5MFPA 3WB0A 3STVA 3I73A 1I9CA 4KGDA 5AOCA 3FGZA 3DJYA 3ZI4A 1P29A 1PJ4A 4R8KA 3DLAA 5J4VA 2N47A 3H65A 1GKIA 8ATCA 4O4JB 3TIGA 4HNSA 1AB3A 3B09A 2XT9A 4NBSA 1XMJA 3AHEA 1QYCA 4I1UA 2WAXA 2JLBA 1PD3A 2VHXA 4YCSA 2QTOA 4WNYA 2OZLB 1X1QA 1KA9H 3K9WA 3P0EA 1T36B 2AI3A 4AJEA 3H5OA 3CH5A 4PZUA 3MDSA 2WJAA 4MVXA 2D06A 2RHOA 3ROXA 3C3SA 2VP0A 2X3FA 5DSZA 4QDOA 2XGGA 1NF9A 3EXG1 1JQKA 3SDLA 2WVJA 2V8OA 5I5EA 4WCVA 3W90A 2F9LA 2Z4TA 2SKDA 1WEHA 1CY8A 4G1FA 2YJZA 2WZCA 2CJWB 1O6FA 4I36A 1DP4A 1NXQA 3OU2A 4BFSA 5HQTA 4JR2A 2GA8A 1XK7A 4X62O 3ASOB 4YAFA 3QITA 3PE4A 1UMCB 3HFJA 2BCJQ 1TB4A 3LI2A 4OB6A 3R9KA 5LFAA 4OI4A 3ICCA 4PSKA 4MJ3A 4HNAB 4WX2B 4AJPA 1XD9A 3B6KA 4EFEA 3WJ7A 2ZYDA 3KELA 5D1NA 4IJKA 4J0JA 3COPA 5LA6B 4CV2A 3RAFC 1UJCA 3KR1A 1ZCZA 5KOYA 3DL4A 1CJBA 1V11B 4P6VF 3HRHA 1JVMA 4DXHA 2HWUA 4IJMA 5J4YA 3REGA 2QPAA 1NKSA 2V7VA 1QG0A 3ZLBA 4LYYA 4M36A 1PD1A 2QD1A 1SUIA 3VSDA 3CUUA 2FN9A 3GNQA 2I67A 5EFZA 5FWYB 3M82A 4B6JA 1BROA 3I9V1 4DLWA 3I4LA 3GROA 3SQMA 3I56V 3JYLA 2VL7A 3ZTYA 1Z6YA 1JAXA 2EKBA 4K87A 1DADA 3SZGA 3J7TA 5KUTA 4FT4A 2OZKA 2J9YB 1UOPA 1HDEA 2JBHA 3DMDA 2XAQA 1ODJA 2P2LA 3KFXA 1CHDA 3KR0A 5EZYA 2W0MA 1S4QA 1MOPA 1ZP6A 3W3ZB 2OPBA 3LQ1A 4MRAA 3VTZA 1MGOA 5B2FA 1GTJ1 4B09A 5TT0A 3K09C 1BX0A 1PWZA 5JD4A 2GV9A 4GLXA 4H16A 1KEKA 4A15A 4CF5A 4HWGA 2QPOA 4XQGA 1RJEA 5H59A 4OMFG 5H5NA 2DE0X 4BEWA 4BCCA 4HWPA 3EGXB 2HMUA 1RWWA 3KK0A 3TM4A 3WZLA 1UXJA 3GG9A 1NT4A 1KMIY 3I6IA 2FEKA 4URVR 1HZJA 4QELA 5HFLA 4OH1A 2EDAA 4MYSA 1J0CA 1VL1A 4BYGA 4D9IA 3DAYA 2D5AA 4KIFA 3UMGA 1XALA 4FDMA 3L06A 5CA1A 5A2QN 1NMSA 4BRZA 5KZMB 4XWTA 1I4DD 2CLEB 4W63A 1N2JA 3Q4HB 1UZUA 4IMRA 5I4CA 1OKKD 2C2MA 2JBWA 3LWDA 1PL0A 4IMIB 2F43A 1KECA 3QEMB 3ZRSA 2WIGA 3RROA 2PRIA 4WL0A 5D6NA 3VHXA 3NVMB 3IV9A 1WDWB 3TI9A 2J67A 3RYHB 2FWBA 1DTEA 2HRQA 1PI3A 4HR7A 3DDUA 3FCSB 1G5TA 3OM1A 1EYZA 5IYZA 2P9FA 5FDFA 3SPIA 2I7TA 2OSBA 4C08A 3PQCA 4CKWA 1M66A 1P81A 3MT8A 5CBHA 1RPZA 1UWKA 3R9XA 2XCIA 2P9YA 1DCMA 1V25A 1RCUA 1DRKA 4YV0A 2DQ3A 2P4EA 3A26A 1SUPA 3K0CA 4YRZA 4R1OA 2IFTA 5A5DA 1T0BA 3MGBA 4P5EA 3OFJA 3OX1A 3OBIA 2ZQMA 3GN2A 1CQJA 2I5PO 4Y6OA 1IZ7A 3PFKA 2NVWA 1VQ9V 3A4TA 4I4NA 5G0SA 4HDRB 1WCIA 4BO4A 2B4YA 3WNZA 3BHJA 2KBFA 2R70A 2PUTA 4X1KA 1JWAB 3AERB 4L8FA 2TYSB 3RNLA 3NHJA 2UUAB 1JEOA 3GO4A 3VPHA 4JLVA 3LP6A 3G8BA 3IAAA 3VC3A 1YDFA 1KU6A 5BORA 1XLWA 1GPJA 2XCRB 1YOBA 1GUYA 5IKEA 3ONEA 1SVKA 3L4BA 4NZPA 4ZGGA 1Q7YW 4Z5XA 3T3GA 4FKZA 4NYKA 3E84A 4A26A 3UW1A 2VK8A 5DNDA 4C0BA 4E94A 1M56C 3VO1A 1ZM4A 1U9IC 3VI3B 3CURA 3VUEA 4F2HA 1NXOA 4PWYA 5AD1A 1U2ZA 5CH3A 2BH2A 2H4HA 3WFIA 4PZYA 1XPOA 4Z7NB 2D2FA 4LXYA 3A4NA 3EZXA 4CH5A 4HZ3A 1FBNA 3R3HA 1O5IA 5TC4A 2O3RA 3DBRA 2CK3D 3RAPR 1XRQA 4A0SA 3ZD7A 3RS0A 3DOOA 2W6JD 4JL5A 3W0LB 1J39A 2O3QA 1XPUA 3WB1A 1IMJA 2IEGA 2MMGA 1WDKA 1KJQA 1ZRHA 4RJTA 3C87A 2GT1A 3AV0B 1FE8A 1QU3A 3L74H 1YR8A 2FMKA 3MXOA 4NNJA 1LX6A 2F43B 1Z0JA 3H3XA 2QRZA 3FAKA 2GPNA 5LLSA 3G2HA 2CD9A 4DV7O 5KYVA 4BNKA 3ICVA 5HVNA 3NXKA 4P7FA 4FBGA 3KKQA 4GZMA 2QZ4A 5ESWA 3PT9A 4AN4A 1HZZC 3VQYA 1CT9A 2OLEA 3E9YA 2QIOA 1XVLA 3LFTA 3EASA 3DR3A 1GNSA 5TXGA 3GFTA 2V4MA 2XCUA 3R9XB 4O3FA 1OLSA 4Q7MB 3KU1A 2FRDC 1EG2A 4BKOA 1JP7A 2V7UA 4LZZA 2JHPA 3EWAA 5BMVB 2BD0A 4CIAA 5JH7A 1CUGA 4NTXA 3M9XA 4IIJB 3DBIA 1IOVA 4PSUA 4AKIA 5IAKA 4XIYA 3CVXA 2P65A 1SG0A 2HLDD 1GPYA 4M46A 2CUZA 1WMSA 3R7FA 3E18A 4QU5A 3CG0A 4UHFA 5CNMA 3IC5A 1A95A 3FKJA 4JLBA 4MS4B 2O48X 2HBZA 4KJZA 5CMUA 2ZXWB 3EWSA 4IDGA 2OFWA 2LE0A 1JUDA 4D7TA 4QBFA 3L9DA 1F2DA 1XJ0A 3KEFA 1YTUA 1ZNWA 2ZT8A 5A4IS 5CBPA 4BJ6A 3HJUA 1EBOA 4K9SA 1TOAA 4MVOA 2XQIA 1E2BA 4JC0A 2JCGA 2HRDA 2ZJYA 2PXAA 2G7ZA 5ICMA 1P62B 3IVCA 3LVRE 3ZRXA 1NZFA 1I2CA 2W70A 1L1FA 4II2A 2ICAA 2QE7A 4N0PA 1MJGM 4G5RA 1S02A 3PIRA 1LJ8A 3H0CA 1FNNA 3VZPA 1CZRA 2Z2ZA 1PFUA 4L5IA 3CRAA 4D46A 2VHCA 2CMDA 3AEYA 4EYGA 3I4FA 5E6SA 2WYOA 3SQXA 3V7WA 1ECLA 3NATA 4AJIA 2H92A 4LV6A 1PKXA 3D8TA 3IVAA 1L8AA 1B16A 3X1XA 1V16A 5H81A 2F9FA 2QMQA 3AHHA 1ORTA 4GI3A 3VZRA 4HUQA 3EN0A 2HMVA 3W78A 1GQOA 1IXKA 4YCCA 4KHZA 3GN1A 5LZ5A 1H8HG 4J1TA 5BYJA 1XNRO 1AJEA 4YI3A 3D6JA 5KKCA 4D6YA 2ATCA 3B6EA 3VKHA 1OUMA 1N0WA 3WP1B 2ATKC 1GTRA 4UNSA 3HBJA 1XUQA 1YQTA 3LQRA 1AI5A 4IQ4A 1EFPB 2YKGA 4LWZA 3FFBA 2C31A 1WCV1 2QG9A 2G63A 5T4HA 1YJWV 5FPOA 4F71A 2BOCC 3MWJA 4ZOEA 2R47A 2ZIEA 3DYBA 4K86A 5ALWA 4COOA 4Q5IA 4D25A 2DUJA 3GIWA 3RUFA 2CSUA 5FYQA 2I54A 2Y0PA 3H97A 4MVJI 1TM2A 1NF8A 3BD8A 1BAPA 3OX2A 4X8AA 1CUHA 3Q5GA 1KK0A 1II8B 1FFSA 5C8ZA 5LP1A 1C3OA 4UEQA 2H17A 4JYAO 4F5DA 3AEQA 3OT5A 5FOSA 1XHXA 1L5WA 4BXOB 3F71A 3VVMA 2FSVA 2FMHA 4BQNA 4D4HA 4C6TB 4YVFA 1ZK4A 4ZRMA 2W6CX 4DWVA 1AO3A 3LA8A 1L5NA 5KYWB 1MXFA 1O8CA 2YNMD 4KIUA 4ID9A 2JIZA 3HBAA 2DSNA 4ENWA 3CBQA 4GSLA 4WFGA 3GLSA 1KFCB 2JGNA 2OD9A 5B36A 2PZGA 4LVCA 1NUPA 1N5JA 4FFLA 4YT8A 4DV7B 3MTAA 4ONEA 3S2FA 2DFTA 3OTOB 3GCGA 1SB8A 5BUQA 2VBFA 5KINB 2SICE 3OJCA 2Z6VA 3H75A 3FYCA 3W3AD 5LU9A 5I4IA 1U3CA 1GV1A 3IHTA 4DR3O 3GMDA 1PJ2A 3GFQA 4G27B 4EIWA 3IP1A 2PNJA 2WU1A 3WZMA 3MCZA 4UUAA 4CIWA 2CJYA 4FGJA 2F8TA 1FYDA 3U1VA 4J0DA 4UUJC 4E31A 2EBOA 3ZI7A 2B0CA 5AM4A 3B8HA 4ZV7A 1JI3A 1PYOA 4G3XA 1SY7A 3EZYA 2QG4A 4S3MA 4M7PA 4WD3A 3HVIA 1UJ6A 4M1SA 1FFEA 4C4TA 4PBRA 2K5UA 4OCZA 1NBMG 1XWWA 4IY1A 1AP6A 1NJ1A 3L0IB 5CAEB 1EP3B 1NF2A 3EVEA 3AEKA 4KUGA 1U65A 5GTDA 1AURA 4RTKA 1LZKA 1M5TA 1IY2A 2FFHA 4QOSA 1NJ2A 4RX1A 1TXGA 3AG3C 2DTEA 4WH0A 2CNLA 3OMNB 3CWZA 1ISRA 5A71A 4YDSA 1L5HB 4EY4A 4YCJA 3U3OA 3QV1A 1TU3A 4UZEA 3W5JA 1YEWA 2MSKA 1JCHA 3V4LA 3KXIA 1NMQA 3GWKC 2WJ4A 4QPCA 1K7EB 3C45A 1OYWA 1QVGU 1YD7A 5KQGA 1SZXA 4XSGA 2EFJA 5GJVC 3LY7A 3MT9A 3D7NA 4LXXA 3QPCA 3HQ4O 2JCBA 4Y1RB 3UO8B 4R3WA 1N1MA 2OBLA 1E5TA 2GZRA 1OTHA 4I08A 5BN3B 4Q1CA 3S7ZA 4B3JA 4L27A 1VQ5V 3O4IA 4Q4JB 4LYDA 4KBFA 1GO2A 4IQFA 1IHYA 4KQKA 2ZRLA 1GFSA 4DLAA 5LQMA 1V8BA 3RK4A 4ERNA 1FJ2A 2WZDA 4GGOA 4RTNA 1G5IA 3EDQA 4MS3B 1L7EA 4KAXA 1T2VA 1XEWY 4BB0A 4BO3A 3PQ2A 2D0DA 1Q14A 2VNJA 1PG2A 2GKOA 3T1HB 1ZN7A 1U8FO 3Q0TA 1WZCA 4RF5A 2YX1A 4LTNA 5B7QA 4UE6A 3IIKA 1JBEA 4O5AA 1WP9A 4X24A 1HNXO 4RUFA 5F2KA 4CMEA 3H9BA 1GLNA 5KKNB 3NHRA 5CDUA 5BR8O 4NE7A 4PGMA 2A7WA 4D26A 1T3LA 2W6OA 2ZS7A 1ODIA 1A2BA 4IYHA 3UMMA 1U2DC 5TX7A 3T4DA 3DVQX 4KQMA 3JYPA 3DVLA 3GWGA 1BD4A 4IYJA 2H54A 5CCDA 4MCJA 4ARSA 4EY3A 4G09A 2R7LA 2QP3A 3CEMA 2AC2A 2X0JA 2PO7A 3AW8A 3UKDA 3WWCA 3GUHA 4BRSA 2GZ3A 3WVNA 3PP8A 2NO5A 2C7BA 3KOMA 3IX7A 1CIVA 1UDCA 3BWXA 3KQSA 1OCOC 3OZIA 3I23A 5F76A 3KHSA 5MGBA 3JR3A 1UZNA 1C7JA 1SXJA 1HDXA 4V3BA 4WBXC 1WMEA 1T0UA 1H6AA 1H1DA 3HVUA 3HCEA 2AZXA 3KKNA 2RHRA 1YONA 1E1KA 2Z04A 3MFQA 1PIWA 5A4MS 3F7TA 4I5SA 4MYHA 3GJ6A 4JK3A 4Z8XA 1MCZA 2JJ1A 1CJVC 3UZUA 2WTXA 1TM4E 2PKWA 1SHKA 3PXCX 3E3OA 3JVIA 3GLHE 2YN0A 1SQPH 4Y2XA 2J4CA 3ZVNA 1DC6A 1I9GA 3ZRWB 4F3NA 1BMFG 1SQVH 2NUBA 2QJFA 3QWHA 3M7IA 3CZPA 3GNSA 4AMGA 3AZOA 5LVAA 3D7LA 3Q72A 2NWQA 5LB2A 1OBFO 3G5AA 3AL0C 1I94O 1ULZA 3NKLA 4LQDA 3GCZA 2AFHE 1XRNA 2XUJA 1JIIA 2PLRA 4Y67A 4ZVLA 3NTVA 1ZMRA 4RANA 1JXMA 3CKMA 2OT3B 2KHZA 1EIZA 1KOLA 4UEJA 5K20A 5KX5A 3PYMA 3ZK8A 4F4HA 2XLBA 4DHWA 2BGLA 3I3SR 3EUEA 1K4DC 1WN7A 3FUCA 2JHCA 4P3NA 2J59A 3U4GA 3ZBHA 1D0VA 1BDHA 2NUAA 3TIXB 2HM7A 3AG2B 3P2EA 1FFDA 4X91A 4P1ZA 4Q4LA 2QTBA 1YRLA 3IVMA 5IJ0B 5HBGA 2C8VA 1PX0A 4G81A 2ODTX 4MMXB 1U3FA 1ZY2A 1VECA 1QH1A 1T6XA 3USES 4ZU1X 4CDGA 2C88A 1RM5A 2ZE8A 4IGGA 4LOIA 3DXRA 3A9WA 1PLJA 1EBFA 1TD9A 5KA6A 3LLMA 4CXMA 3RW9A 3OLQA 4U7GA 4LR3A 3G2KA 3OWXA 3COWA 3V80A 4F4DA 1FOEB 4CNBA 1PTJC 3S1LA 2PCJA 3BE8A 4EJ6A 1JJFA 4ZQHA 1PZEA 4MZDA 1QOPB 3SLGA 2ZYVX 1URFA 3TRIA 4S0ZA 1R5NA 1DAPA 2Z1MA 2I8CA 3QIVA 4KFTA 2QN2A 4KMSA 4TMFA 4OHFA 5D01A 3DP7A 3IEVA 3REQA 5C8VA 1EXMA 3FDZA 2CLLB 3IRUA 4UUOA 3KX2A 4BN4A 3ZWVA 2X42A 1ENOA 4JT4A 2G07A 5KHOC 2OV4A 4I4TA 4CIXA 3UEOA 1DPFA 4FX5A 1WOMA 2AJ8A 4G4IA 1KOJA 4LRTB 4ACBA 3NFYA 1VBNA 3IQXA 4IMJB 2HADA 3TIFA 1GRCA 2WIBA 2J7PA 5TB5A 1PR3A 1P4HA 4PA7A 1QBGA 4KUHA 5E0KB 4N8EA 3FM9A 4DIFA 3U7FB 1V1RB 2RCVA 3MVEA 1J99A 1IWOA 1HNXB 4X8LA 4KMOA 3UIEA 4HQ6A 5LP6A 5D84A 3P4YA 4URZR 3MRSA 1F8YA 1SMKA 5BR8B 3TDNA 2VAMA 3MELA 3CE6A 1IL0A 4RAIA 5CR9A 3QVKA 5GV7A 1JR3D 4KO2S 1USKA 5KJCA 1M57C 2DM6A 5CVDA 3UGJA 2IRWA 2ZBQA 1G8GA 5ECGC 1Q19A 3W77A 2ZFUA 3AOEC 4TT3G 4DCSA 4L8VA 3B78A 1AUVA 2CV2A 5BVGB 3UCFA 3MLAA 1FFXA 3BMOB 4YTEA 3KL2A 4FCCA 3STYA 3ASYA 3FOWA 4MUYA 4U0KA 1FJGB 1Z88A 1M54A 1D4OA 2TS1A 1PP9H 3DC7A 1GNQA 4CIYA 4OOEA 2PD3A 1J0DA 3KZCA 4KG7A 4DM3A 4DV4O 4M0PA 3WJ2A 3VOUA 2PGXA 1KZ6A 5EN4A 3EXIA 1XHLA 3IOYA 2YBEA 3I1JA 4RL4A 3RF7A 2C1ZA 4HFNA 4ZVTA 1U0BB 3OBBA 3ZVKA 4UB8Z 2ECFA 1MOFA 2V7TA 2IPXA 1D5CA 4NCHA 2V3WA 1PZHA 3Q4GA 1FXKA 2YJGA 1A9SA 5JCZA 3AESA 1XTBA 5EE9A 2H7XA 4MJXA 1QH1B 1Q6ZA 3HVKA 1ZGHA 4FQ7A 1VJ0A 4YA6A 1K06A 4HDKA 1RSOA 2WB2A 1VKHA 2GH1A 5F2OA 4B3GA 4DWWA 1LEHA 4ZEMA 3DR5A 4WFJA 4YALA 1E61A 4KTTE 1LF5A 3EVNA 2WKQA 4HBGA 2YUAA 1KF0A 3IXMA 2YZMA 4PG5A 2BFBB 3PQ6A 3DE7X 4ND2A 3REQB 2NQ8A 2HH9A 2LDXA 2Q29A 2A0WA 4BP9A 4A6EA 2WM9B 3PGXA 1ZINA 1UKVY 3E83A 1QGAA 3K16A 4BN5A 5E7MA 3D8HA 3H1JH 1M2JA 3CVYA 1G16A 5FR2A 4L4YA 2C00A 2PS9A 3ZYZA 5JJJB 4L6AA 2H5JA 2IIBA 3RU3A 1RSZA 2B0JA 4IHQA 4CUZA 1SU4A 4WVFA 5C8YA 4Q4AA 3NHSA 4L50A 3KT6A 4P8RA 4TVOA 3NV7A 4WOKA 4G2NA 1KK3A 3IH5A 1PRYA 4H7FA 2GD0A 4GZ3A 5ALRA 4DY4A 1IEVA 5I3CA 4PNEA 4GXRA 1FQKA 3RE1A 2ZWAA 3A6JA 1R6XA 3MWFA 1BGXT 4DV3O 2VAPA 5DYGA 3GLFA 2YW9A 3VNSA 3WO0A 4LY6A 4IEEA 3A0HZ 2VYCA 4AZ0A 2QL9A 2PRSA 5I7UA 4EW2A 1KU9A 5M04A 4JSRA 3KSMA 5FP0A 5L3ZA 1DXHA 1QQCA 4TMVA 2JS3A 4KBGA 1L4LA 3L7BA 2PUSA 1HG1A 1PW5A 4GUDA 4GXQA 3DL7A 4W82A 4XDZA 1FSZA 1SG9A 2CVOA 4G1UC 4CQLA 4GZ6A 3SE0A 2IJIA 3ANXA 2J6HA 3K71B 1NDHA 3D02A 1ZVMA 1JEAA 1PSDA 5IXSA 2EVWX 4EO9A 2NU8B 2ZLBA 2IEIA 1B41A 1B8VA 4CQMA 4OJTA 5IYCO 3D8CA 5BT8A 3F9CA 3QUQA 1WG8A 4BWAA 5A5GA 3ZHVA 5LQRA 3UQ8A 1ENYA 1UC8A 2AVNA 4J0HA 5IUJC 3O65A 1OI7A 5GONA 2CEKA 3VDNB 1L7RA 1M1ZA 1U3WA 3INGA 2I62A 3P30A 5LUAA 5E9WA 2IUYA 2XLCA 1FVXA 5IJ9B 3FYUA 3D3WB 4XDGA 2HUPA 1R0RE 4O2AF 1M74A 1JHMA 3RC8A 1L5MA 4DQDA 4A8HA 4ZQCB 1M5UA 2PY6A 3F90A 1KMCA 3GMIA 5L3QA 3SS7X 2HRZA 1GXSA 1N6LA 1G8AA 3D4NA 4YIHA 1OBOA 4K2AA 2Q9LA 3V4OA 1TUIA 3SOPA 1U0RA 1J42A 3NWEA 3TQRA 4JLNA 1ML4A 2CNDA 1VPDA 1H2MA 1NDUA 3PNLA 4C4ZA 1YR7A 5CK4A 3LC7O 4H2DA 3WYAA 1ZBQA 5ILGA 1VCHA 1GT91 4JI8B 1FP2A 1H1TA 3HN2A 3A2NA 3QLVC 3RRBA 2M98A 1CRPA 2DY1A 4NAVA 1HF3A 1SCQA 3HB4X 3T1CA 5JVDB 4G84A 4Y3UA 1PJCA 5FAKA 2CUKA 1W0CA 3EZ2A 1M1NA 1OH7A 4JOQA 1UPBA 4D9GA 1S2GA 1E5VA 1CZNA 3W1EA 1U7HA 1GSAA 3QMVA 3U44B 3G2MA 4EEKA 2YC2C 3I55V 1JYSA 2QVYX 3BIOA 3IR5A 2PQ6A 3ILYA 2AEEA 1U8YA 1X80B 2C3PA 3VPXA 1LBIA 4U7WA 4E2LA 2IE0A 4E6PA 1BXGA 1OI3A 4ZVMA 5L6MB 3NJ8A 1LBQA 3RYFB 1VSTA 3O9VA 2VYQA 4BLUA 1OAOA 1JLRA 3FBTA 3ETCA 7YASA 3AR7A 5JROA 1CXZB 4N76A 2JJMA 4G0MA 2JAPA 1K3TA 4ZJPA 3CIOA 3L6EA 2P35A 2C04A 3I1FA 1O0BA 1EB8A 3JPYA 5TDHA 1EJBA 3CN7A 4I9NA 3LHSA 2F4VB 2YJ5A 5T6MA 2D2IA 3N5CA 3UUGA 1U90A 4PANA 4TQDA 2QR5A 3WOHA 1GWNA 5SZHB 1W5BA 4N6NA 5FPYA 3WLFA 3THXB 4IVNA 1N57A 2QY9A 4TMTA 2E87A 1US8B 3AR9A 2B4QA 4HGNA 4TV8A 5KQMA 1Z8DA 2G0TA 3IE1A 5B7PA 1JPNA 1IZ8A 1XKLA 3D3EA 2YHIA 5MGNA 3FSGD 3MJVA 2WAAA 1QU2A 4TLAA 3ZMUA 2YRFA 4AZVA 3NNSA 3CH7A 4OA5A 1IBLB 1SIWA 1C4OA 1SIUA 4ZALA 2J46A 4OLFA 4BVKA 4EFLA 2ECOA 4JENA 1CX9B 3D3QA 3IP3A 1VLMA 2A30A 3FD9A 1XDGA 5LWHA 2OCCB 1K75A 3TAHA 3JVEA 1XTQA 5AXAA 3DVAB 4CGZA 2EZPA 2IZ7A 5FNZA 4LJ7A 3ZBTA 2VH5R 3CZQA 3CTPA 4FIPC 2FG7C 1NZJA 3OX3A 5ISMA 2GARA 4O0MA 4BX2A 8GPBA 3A6LA 3PC2A 2CE4A 3L8EA 2BDEA 1Z4JA 1NWHA 3TZLA 3OEHA 1O0SA 5BV1A 1U28C 3N76A 1T3HA 1DELA 2CT8A 3M6XA 3A06A 3A3OA 3LLUA 4HHEA 4NJEB 1ZRMA 3BBPA 3D3NA 1DAHA 1GAEO 4LJKA 5DGIA 4ZCTA 3J7AC 4XWWA 2PLNA 1BX3A 1TUBB 4K9LA 4IHKA 5EY5B 3ZCQA 1PS8A 4D9KA 4C20A 3ZLJA 2WWIA 3C6MA 3FAZA 3AIOA 1M1NB 3R23A 5HZHA 5CK5A 3K5MA 4N3NA 3HKBA 2DHCA 3ERCA 1HETA 1YE8A 1RPRA 3OFSA 4BB9A 1YO6A 4NVPA 2HIAA 1P4JA 1UJNA 3B5JA 2FHSA 1QQ6A 1B14A 4OPMA 5HJ5A 2XB4A 3GLGB 3LDGA 5HRAA 1B8OA 4PHZA 2DUUA 4BMVA 2P9JA 4EMTA 3U80A 1MPXA 2HPVA 3L0BA 1GZ4A 1DXYA 4ESVA 3CRMA 2Y1GA 1H0HA 4JJZA 5HZMA 1J5PA 5JNUA 3EVFA 2AS0A 3ELBA 2DH6A 2PSDA 3TTWA 2QWNB 4R7GA 1VSVA 3F7VC 2UZAA 3PKIA 5E3HA 5AI6A 3EF0A 2F93B 4C4RA 2DWEC 1UPAA 3DKKA 2PBZA 4LPKA 3VC7A 4RDXA 1G8FA 2C8JA 2FMIA 5CFOA 1QO7A 1RI1A 1BWRA 3OIGA 2B8JA 2EJVA 4FQ8A 2Q5EA 2ZRNA 5KVQA 2X2FA 1TZMA 1NF3A 3B5EA 4I2NA 4KVAA 4B7AA 3QF7A 3ICEA 4L87A 3IOBA 3PC7A 3B2NA 1WB5A 2C54A 3D0QA 2JASA 4R3UC 4KVZA 1Y1QA 4ZZ3A 5EP1A 3GH1A 3SYKA 5U4XA 3ZH2A 16PKA 4P36A 2EIMB 4LY9A 4US2R 4IJ5A 1EMDA 3K03A 4D8VA 4JGBA 4LWSA 4RGQA 3NVKI 2PBLA 4NH0A 2EW2A 2RGEA 4BIMA 4PLYA 1BQ0A 2Q1SA 4H0NA 5JO0A 1SO8A 3LVFO 1NVAA 4N7BA 4QJ5A 1QFSA 2HA2A 5FUXA 5T3UA 3L6UA 4ROTA 4YP9A 5TVKA 1VBMA 3VR2A 5THKA 1Q1ZA 1ZKDA 3ZJZA 2ZRQA 3I9NA 5U4QA 4FLXA 5BWNA 3TEFA 5J40A 3NBUA 2H2AA 1Q7BA 2PKRA 2N74A 3AF4A 1XTTA 1Z5ZA 2AW9A 2QW1A 2WABA 3O73A 3E89A 1PNOA 2AFRA 4JVLA 4RE5A 2VIIA 1B00A 6ABPA 1E92A 4AU1A 4CM9A 4FI3F 2F3RA 4X63A 2F3UA 3ABTA 5ALIA 2J32A 5CA3A 5EWJB 1FLDA 1JA8A 5ALOA 3TUIC 3FYSA 1CP3A 1O95A 3LX4A 4JQSA 2IXGA 5FNVA 1HC7A 2CDCA 5KEIA 2W8BB 3I37X 3IEPA 1O4WA 5GGYA 4JLAA 4EYOA 3U4DA 1VMIA 1LGYA 3UK2A 5EE3A 4NYMQ 2FR0A 3SYTA 4JBNA 4IW3B 4MLCA 2PFSA 1LBTA 4MUFA 4AXBA 4OD0A 2P90A 2C2OA 3TOZA 4L08A 2PMCA 2DHEA 3CUWA 3DBHB 4ZV9A 4UNRA 1I4EB 3OMLA 2NVBA 3DHWC 2JA2A 3LHDA 3BGSA 3CISA 1JJOA 1KFJB 1RI2A 3V9PA 2C4UA 4FUQA 2RC5A 3ZXSA 1GL6A 4E5PA 3EUFA 1YRYE 2QDKA 4CL2A 1ZN9A 4QA9A 5ALLA 4KEAA 4RV9A 2XEXA 4PLPA 5FYDA 1ELOA 1FYJA 1RJWA 3ZJUA 2P3OA 4Q82A 4B4KA 4MVJD 1Z5VA 3CUVA 1N2ZA 4ETIA 5F9FA 2XXAA 2AWNA 2VRNA 2ZSKA 2ADOA 2ZBRA 4YFVA 1CY4A 3I5XA 4I9HA 3JD2A 2VQDA 3CONA 1NZDA 3AONB 4YY3O 3KKKA 1EEHA 3CX5F 1JYFA 1OIVA 1M34B 1N1DA 3CS3A 3CW9A 1N0IA 4OSPA 1UBGA 1RAFA 1ZH0A 2ALJA 1LTQA 4ALKA 3JQFC 2HIGA 4GFDA 3T34A 2CF6A 3UB3A 1UJWB 1VHTA 4UCTA 1TAUA 1VQ6V 2RAVA 3G7UA 4NYIR 1MZVA 1GTMA 3RSQA 4DCJA 5LXTF 4FWTA 1GDTA 3CYOA 1G3QA 4FE3A 3HB5X 2VAXA 2Z83A 4DAEA 1K8QA 2UKDA 5LZ9A 4F46A 2YQ5A 4CCWA 5DCUA 2IYRA 3RKRA 1LDYA 3PF8A 3BTUA 3NOQA 3PQDA 4Q9DA 3OIUA 1Q50A 5CNJA 2LGWA 3IBGA 4BZWA 1EDEA 4DDKA 2TECE 1XHEA 5IARA 1JVBA 5F1PA 3EZ9A 3TZKA 3HB1A 1JJAA 5BXYA 2EHDA 4F21A 1JMYA 3GJTA 3GP5A 1YI0A 2NPFA 2XOEA 2FEOA 2ZVJA 1HLFA 2H2IA 1T8YA 3PRKE 4QJIA 4D8UA 3ORRA 4IHJF 5CTJA 3UQZA 4P0TA 3B53X 2UUAO 3C3YA 1TGVA 1ZQ9A 2JIPA 1I51A 4NZZA 1XWFA 5K0FA 1R3UA 2P4VA 4FFPA 4MKGA 4G4JA 1JTVA 4ZO7A 5FNVB 2HWXA 2F3SA 5K3FB 4NBVA 2ECPA 2Q3HA 4RLHA 1KYYA 3PC4A 3EY9A 3FLEA 2WQZA 3ITKA 3GGOA 1GKYA 4HATA 1U7TA 1PDOA 2ITDC 3L46A 4OFXA 5DGDA 1N4AA 3KQMA 3ASNB 3QP9A 4CC6A 1S72V 1GG2A 2DYSC 2PSEA 3R3VA 3EFHA 4Y6QA 5FPTA 2YCBA 2QR3A 3BE4A 3K0FB 1NC3A 3VH4A 2IH2A 4ZAGA 4PXYA 1XAHA 4GMDA 1DX4A 3UMFA 1SHZA 2ZJ7A 2CL5A 1PZGA 1IEXA 3C85A 2M6SA 3IIMA 3RYCB 3GJ7A 4HQOA 1TCVA 5L53A 4OGKA 3U9LA 3WK9A 5IWCA 1G60A 2C58A 3VNVA 1SPXA 3CX6A 1QZZA 1X7DA 4B3XA 3KKYA 2YZKA 4BNVA 3WAGA 1FRNA 2XMDA 4E2FA 1Y4SA 4P81A 4WT7A 1FTQA 2WU3A 1QHHA 1QORA 2F00A 4GYCB 5D3ZA 2LTAA 2WHPA 1RP7A 1KKCA 2R86A 5JCOA 3PNPA 2X8JA 1UDBA 2Q6TA 1YHNA 3GGSA 3L18A 1Y7HA 4W4TA 2WJ3A 1P7ZA 2HYIC 4GVLA 4YRGA 1ZSYA 3VV3A 2W90A 4LS3A 2FFJA 4MYCA 5DRTA 4WJLA 4NOKA 3NO4A 1QLJA 4CI0B 1YS9A 5I3ZA 3R75A 2OGTA 2DYRC 4BVFA 3QBJA 2FPGA 5EFOA 4QYIA 4CTJA 3RYTC 1UZLA 5HA5A 2MSNA 5DKFA 1PUIA 3G7SA 1AGXA 1IPFA 2FW0A 4AS2A 1N75A 3RADC 3BD6A 1OB5A 1UKAA 4GKAA 3BXEA 1Y8QA 1KMMA 3JXEA 4BVAA 1RKBA 4R81A 1ZW1A 1N5DA 1KBHA 4YY3B 3DKPA 1IVYA 1O54A 2R8PA 3VR6H 2Z9CA 4EG3A 2P8JA 4NARA 4PRLA 2OHXA 4RKFA 2I6SA 3VOBA 4HWRA 1IAVA 2PCLA 3D4LA 2AJCA 3JVDA 3U7RA 4LDNA 4GIBA 2ZB2A 2A4MA 5I48A 2O8NA 4XA8A 2CXTA 2IYYA 1VXOA 3I4CA 4MWEA 2IVZA 2OCBA 4MVJM 4OH7A 5FPHA 3QEAZ 2Y0CA 4Q7LA 2N1BA 1YVUA 1Y5MA 1GA1A 1GO3F 3VZCA 1BS3A 4IKEA 4OQZA 3DD5A 3NWJA 3FMFA 1IZ9A 4HYOA 1N1EA 2WTAA 5KHKA 1E79A 1TEHA 1EWYA 2QZPA 3CF4G 3NTOA 4XRRA 1P2GA 1VI5A 3T1NA 1WVIA 3ZDDA 4ITUA 1QCCA 4LF9O 4C2AA 4BQPA 4FGSA 5AHOA 5IC4A 4QXMA 2EGHA 2F64A 1E9DA 1CUXA 2B8WA 3V32A 1SQBH 7AT1A 3LW7A 5LD2C 3PN1A 3CLRC 5KSWB 3QV2A 3BAZA 3ZVRA 4AZTA 2C7RA 4WZBE 4H27A 4UCSA 3MIZA 5EZYB 3MC1A 4K8OA 2GEDA 4HDCA 5BXQC 4OV6B 3ZR4B 1Y4MA 4Q02A 3R5XA 2VXCA 3K2BA 1FUKA 1A5BB 3AG1B 4LE0A 3ZZTA 1RXUA 1ZAKA 4UM7A 1SG6A 3KLBA 1L5OA 1S3FA 3OCJA 3JQDA 2I55A 1WZ2A 2H00A 4OJKA 2IV2X 3CCUV 2OZPA 4R9NA 1YZNA 3RVLA 4BMYA 2KI5A 2G04A 3DE1X 4X88A 4KJXA 3WMEA 3NNDA 4AKEA 5CA1B 1R27A 4BJHB 1PZMA 3JQEA 4NK4A 2JFFA 5D2CA 4JITA 4PHCA 4MJLA 4MW2A 3FDIA 1TL7C 4TKUA 1OV4A 2H1IA 2VRBA 1Y8QB 3UMVA 1RPOA 3R0XA 3VHXB 4QOJA 5AJWA 4QOFA 4I6EA 3K04A 4IL6Z 2HR3A 2ZAOA 1H4SA 1NW4A 1N77A 1P9RA 1QLHA 2IE8A 3OTOO 5HM6A 3MSCA 4BR6A 5DM6V 1J2YA 3NTQA 1GEEA 5IYZB 2PX3A 3GV0A 3EGCA 5CXXA 3W6UA 5CLGA 4LZPA 4QUKA 4CKWB 4IXWA 4RHXA 3KOXA 3MWDA 2IJKA 2QRJA 5AKEA 2IHNA 3HDHA 1DT5A 1XNHA 3DM5A 1YIOA 3WBFA 1EVYA 1E6KA 3G8YA 3E1GA 2O5RA 3QEKA 3ZHQA 3CZMA 1EWRA 1QPBA 2RK4A 3GJRA 3MQ4A 1E5DA 1A3CA 3I9KA 3TNFA 1Z5UA 2J48A 2X1MA 4KBYA 4GUAA 2OZVA 2DH5A 1CQJB 3C7AA 4YCLA 1J2RA 4R2KA 3C3PA 3BEDA 3FOCA 1HT2E 2IY9A 3C43A 4MEAA 2P2NA 3RGGA 3AHCA 1WCIB 4YV2A 3LBNA 3V8EA 3PHBE 5K0GA 3DWEX 2V45A 1QRUA 2B5WA 4EGSA 1DKPA 4X1KB 3L7DA 5TS3A 1MEOA 3Q0EA 3K1JA 2GEUA 3SBDA 2OTJV 3ADDA 4RA9A 4H6WA 3TXYA 3IT3A 4A6PA 3LZ6A 1Q0ZA 1FNDA 1N2BA 4QPJA 4EI2A 2XDWA 1GAJA 4ZWNA 2XD9A 3MA0A 2XGJA 3KC2A 1UFVA 4LNUA 1TCUA 1N2XA 2CL7X 4UHHA 3GVXA 5CFPA 4QGAA 2ZM5A 3K53A 2NAPA 3EC1A 3RBVA 2X5XA 1ZD8A 4HWTA 4BTLA 1WXXA 2D2VA 1EESA 2I6XA 1U5BA 2E9SA 4NMMA 3USCS 4L4SA 3B1XA 2G4CA 3SLKA 2WA3A 3E2EA 4YAEA 3VZBA 3S7TA 1QO9A 4DMLA 2XAUA 4BIOA 3H05A 3AK4A 3DBRB 4L9WA 3H9EO 3U26A 3H8VA 5AVVA 2OCLA 4CCYA 4KXRA 3K72B 4B34A 1EUCA 3Q2KA 4LF9B 1PG0A 4NFLA 3P96A 4WA8A 1XQYA 2VPQA 3T1HO 3DGEC 2VCEA 4KE8A 1BTOA 2X4GA 2FZLA 4RK6A 4LRUA 2NO6A 1CSEE 5BR4A 1Z28A 4DW8A 4CLXA 2PZKA 1IU9A 2I29A 2RG7A 5IP5A 3UHPA 4BMDA 5K6TA 1GVNB 2X3UA 2JANA 3ADBA 4BVLA 1BO6A 5T5QA 4JI7B 1RWKA 1ODFA 2X0KA 4OJNA 4ER7A 4QXPA 4PYKA 2QLBA 5CPBA 4OO3A 2X9LA 2YTZA 2PX0A 1J0EA 1J49A 3ICOA 1ATZA 2IHUA 2OXCA 3RARA 3X1MA 1GQQA 1OLSB 1BCSA 2JFGA 4Z4IA 3HDGA 1EH5A 2VP2A 4NABA 1CJUC 2QX7A 3R76A 2JGEA 4OY3A 2VG8A 4NU6A 2XCOA 3HUUA 5JH7B 3LE8A 1U8ZA 4EA7A 3Q8LA 1N2EA 1JLHA 2FVYA 2ZRKA 3T54A 1YJBA 1M2WA 3UGTA 2P7IA 2WQ6A 2JZCA 1Q5PA 1XFDA 3KCNA 4EKEA 3UJ3X 5LGTA 4UD2A 4PV1B 3G0GA 2FDCA 1R37A 3KB1A 2RJZA 3DXXA 2Q5JA 4YEDA 4L5JA 5B5SA 1A8QA 4MPDA 3WYNA 1E7SA 2RHTA 1Y5NA 4N7RA 4QDTA 1M2FA 1BX1A 1NXTA 1VHWA 4NV0A 1LF0A 1Q7CA 4ER5A 4XR9A 3TI7A 1EM1A 2HO4A 4OXKA 5CBPB 1J1UA 1PQPA 3PCTA 4YMIA 2WIKA 2H4YA 2QWXA 3AIIA 3FFAA 4ZVVA 3NPMA 1E1RA 2HAEA 2GDSA 2G38A 2REBA 2V6FA 1QYXA 3T0IA 3TFWA 5E6SB 1W1IA 3FJ1A 3HG7A 5CM2Z 1KYXA 1K33A 4K2HA 1EA7A 1OHHD 3WLLA 1JA1A 1KQGA 1DNPA 2HEGA 2W6PA 1DAIA 1BD3A 2NIPA 1QG2A 1V16B 4EH1A 1NH2B 5J2TF 4HUQB 3WGHA 3BD9A 3IBFA 3KQPA 2ZSDA 1EKXA 3PK0A 2JIZD 2DPLA 4MV6A 4UUBA 3E86A 4PCLA 3WXMA 4IJUA 4Y2UA 2YZNA 3CGGA 5IASA 1NU1H 1SC3A 3NGMA 2N42A 3LX5A 4YMTA 3AO0B 3ABQB 5JYDA 4UKDA 3OLVA 4JBGA 2EV9A 5BV8A 2CBXA 1NJIW 5EC2C 2AG1A 2GD2A 2OG1A 4S0XA 3OZDA 4YDRA 2XA2A 5CN0A 4YYEA 2ZTVA 2W2MA 4YLYA 3NTUA 4OOFA 1FSGA 3IEUA 5CFRA 2I1WA 1YRBA 3CLTC 4QBTA 1ZHHA 3JQPA 3QXCA 2WWVD 1EJ6A 1U9CA 1N6NA 3NVAA 2BN4A 1NJ8A 1SULA 1MQAA 4M1QA 4F9EA 2GAAA 1XAJA 3B1JA 5JFGA 5FADA 1PV0A 4D9CA 1JDVA 3S2EA 2GBLC 3IP8A 2HA5A 1P74A 4BMXA 1C3OB 1ZD1A 3NHPA 1KVRA 1NU6A 3AEQB 2NVOA 2PMEA 1R9GA 3OD5A 4A6DA 1OWOA 3JPWA 5CA0F 4M9ZA 3R77A 1N0NA 1GPAA 2FVXA 5DM70 4EJSA 3Q8KA 3KZMA 2N05A 3HJBA 2AK3A 4OHWA 4L0MA 3FAVA 1V55C 1A9QA 3IQIX 2WJYA 1C0PA 1N9GA 2VDUE 3TINA 5HPYB 1DXQA 5BOSA 3VHQA 2EKZA 4UCUA 3ROGA 1KJ9A 1O8BA 3DMRA 4BV9A 5BW4A 2GRAA 2O50A 2FV8A 4QPNA 2Q50A 1YFKA 3RFRA 3QPDA 3JSNA 4Q18A 3IUJA 3HL0A 1ID8A 4PYMA 4HXGA 2AOWA 3LSUA 3P5SA 3CY6A 2ZUCA 2CE7A 4GNRA 4JHLA 2O2XA 5HF6A 4BO0A 3PL1A 2REOA 4C3ZA 2C84A 5HFNA 1FJGO 1FSSA 3RLFA 1SQQH 2NXJA 1H69A 1K3FA 4XIGS 5H3HA 5HS6A 1M2OA 3C90A 4ZTZB 3R7WA 3RKUA 3R8CA 3AEKB 1LVHA 3ID6C 2P75A 4HWSA 4F8YA 3T9BA 4K6HA 2NTJA 3ROMA 4M76B 3H1IH 3A1EA 5E7IA 2XMSA 4IG4A 3C8ZA 2P9QA 4P5PA 2Y71A 5ERXA 3PPVA 4OGFA 2JKYA 5KHIA 2E4UA 2WSBA 2GTHA 4MQBA 1U5AA 1FY2A 2YV1A 1DX6A 3UKOA 2RHLA 4PX5A 2PUVA 1I7PA 2Y9MB 1E60A 3FY4A 4CEHA 5BNFA 4FHEA 2L19A 3IPAA 3DTYA 4X90A 4TMZA 3R7LA 2WTEA 5A5EA 4IIGA 4BP3A 821PA 5J47A 4ENVA 3COJA 1ONBA 1I24A 4YXFA 1T24A 2PPVA 3HB9A 4R01A 4BO9A 3FVTA 1FPOA 4IDFA 2OXFA 2H18A 1XWIA 1D3AA 1WXGA 1DI0A 1L4UA 4CMJA 3CMAV 1SXJD 5L3VA 3BY6A 3KZVA 2UXNA 2HIHA 5GVSA 4UHKA 3ZV6A 2YV4A 1BHAA 5EJ9A 2I4TA 3L8DA 3PNYA 1T9DA 1C9JA 1LK0A 4EJSB 4P7BA 4TL6A 3WYFA 3IMFA 3S27A 4LHEA 2RDMA 2NTYC 3Q5DA 1SBCA 2JJ1D 2LWIA 5D6OA 4MLDA 4IFBA 1E66A 2W93A 4RZUA 5JIBA 1HNZO 1MC8A 1NQXA 4G0PA 1U02A 1N9GB 3PE3A 4ZGBA 2B82A 5TEWA 3UC9A 3TQFA 6YASA 3CMCO 5D5PA 3FB6C 2H4FA 2Y4NA 3QTLA 1FPMA 1QOQB 1YBHA 3WE7A 3DG9A 1HX7A 1BG6A 3LUTB 2LW1A 3ZHTA 4YAIA 3O2JA 3RC3A 1Y1RA 3A6EA 3E4DA 3OCZA 2GCGA 5AKHA 3S28A 1C4WA 2ZUEA 2BJWA 4C7XA 1RW4A 4OGLA 2FRVA 1FFTB 1JFTA 2WIAA 3LKZA 4PAGA 4CBCA 3H2BA 4WA7A 3LIIA 3FI9A 3KZXA 1BN7A 3FHOA 3LV8A 1SXJB 4W5OA 1BYUA 1Y3CE 1IY8A 3DLTA 5LHGA 3DMTC 5AI0A 4U0JA 1G55A 1XZMA 2OCAA 4B8WA 4MEBA 1ZR4A 4EG8A 2CLOB 4AW9A 1NNEA 4JYBA 3RFXA 1EWKA 3OM3B 2AMLA 5BW6B 2OFFA 4X9QA 3OP4A 2ZDGA 1XE3A 2Y69B 3SN6A 3QHQA 5DBFA 4KYUA 3ET5A 2I2CA 4F4UA 5FI5A 1QQ7A 5KJEA 1IHOA 4YUZA 3WMFA 3SQLA 4ND6A 4MTCA 4TS1A 3L1UA 1MDBA 2VP4A 4RS4A 4GOMD 3JTEA 3F73A 4QUJA 2IJJA 3AJ8A 3HA3A 4MPRA 2C0CA 2VTEA 2XUPA 4HDSA 1T8TA 4YHHB 5JATA 1P1HA 3ZDBA 5IZCA 3KVRA 4BO6A 3D2BA 4XB6B 1CJCA 5KX5B 1BMQA 4EGQA 3L8HA 1V4BA 2AW3A 3CCFA 2Z2KA 1BU5A 1XC7A 3K0SA 2Q9BA 2PBRA 1MIHA 4CETA 1L4NA 1AKQA 2G28A 4JI8O 3I62A 1G8PA 1G291 3O7WA 4S1OA 3UAWA 2XUZA 3MN1A 2NUAB 4JMLA 3GVMA 1NOKA 2AX3A 4AJ9A 3AR8A 1XRMA 3FOBA 2J7PD 4JLUA 4DA6A 3H1PA 5L7YA 3NAZA 4S1PA 2ETVA 2RKOA 4U39A 4UOEA 3GCWA 1KPHA 5JFTA 2GD6A 3N7UA 2NZ2A 4OKSA 3DXRB 1OR8A 2QSZA 3ES9A 5SYAA 1RKVA 3RJZA 4R8LA 1IBRA 5D7NA 1J06A 1AP5A 5FBZA 1J70A 4DEVA 1JHVA 5K8VA 4A73A 1FZQA 1G6UA 4CT0A 2P6OA 3NEYA 4PI0A 2AXQA 2P1RA 2KWIA 3LYHA 3KPUA 3N0WA 1YACA 1W34A 4A1FA 1THMA 3QUSA 5IJZA 2OIEA 3V2HA 4ZT2A 4LRSB 4JI5O 1E8NA 4PC2A 2CLHB 1GFIA 2X2EA 3BZUA 3LU1A 1MTZA 4Y6GB 1T5EA 3FDZB 3HXTA 4WLUA 1WNFA 3EQZA 1HDYA 1AA9A 2BPOA 2DKOA 4HFJA 1E5QA 4O59O 3DOUA 4J76A 3IEIA 5JHGB 2AW5A 3GFOA 3DKRA 3RT1A 1WA5A 4I4TB 4ABTA 2JPDA 4ZI7F 2ORVA 2F4VO 1E9FA 5L7TA 1H5UA 4JA2A 4UQLA 3H99A 1JG4A 4GGMX 4E5VA 1XAGA 4BUZA 4DR2O 5JAZA 2ZJ0A 1BFKA 5KNCA 2R2GA 3ANMA 1HMPA 2ZXFA 4D57A 4JL8A 4MKRA 1T2AA 3QYPA 3GJ3A 4O4JF 4ZMSA 5EP4A 1N6HA 2QMEA 3CKKA 1DO0A 1GFZA 1R8XA 3WDSA 3C5HA 3IE0A 2ILTA 4N41A 2VYVD 1R16A 4LPSA 1XHFA 1HNZB 5LP6B 1IBLO 3P7MA 2CXUA 1Q16A 1SKUA 4G26A 4G28B 4CCSA 1S5HC 2Q6VA 4XSVA 2PGDA 3ZWCA 3OFNG 2Y48A 5F73A 3F8SA 2RI6A 1VI2A 3N2NA 4M21A 2VSOA 2P79A 1IY9A 1LLCA 3VR4H 4W7IA 3PEUA 1HFWA 3TE6A 1QG6A 3HP7A 1PGPA 4B85A 1S8AA 2QPTA 4C0JA 4YAJA 4D43A 1BS1A 1K0FA 1DG1G 2FCRA 3TNYA 1KJNA 4BWFB 1FFXB 1L0BA 5F1OA 5B3AA 3ZWOA 2V7GA 2X7RB 2X58A 4JEHA 2NOAA 3CPJB 5I47A 2ZAMA 2RD2A 4F97A 2HXGA 2H59A 5FBLB 3RVDA 3TL2A 3AP2A 1M5RA 1KYQA 4YRNA 5IKXA 2XASA 2XMGA 1DUSA 3EXIB 3I83A 5F5NA 2ZJFA 3AUFA 2PZMA 5IS2A 4AI6A 5LA6F 1GN9A 2GK7A 2F7SA 4O1HA 2CYAA 2E0IA 4BBJA 1H8HA 3FMOB 1FXKB 4ZHQA 1WQ1R 4JBXA 4NZMA 4EY7A 2R7KA 3AESB 3WGIA 3ICPA 4B33A 3EAQA 4JLDA 3GWZA 3IVGA 5HZKA 3SSNA 1I7QB 3KJGA 3HXLA 3AXTA 4LTMA 2B7BA 4DN6A 3ZZMA 4FHDA 4HDKB 3I6ZA 1RSOB 5JRJA 3SK0A 2HHHO 1C0LA 5JZOA 2IH1C 2VK2A 4ZDKA 1NKDA 1M6EX 2XZPA 2FLVA 1N2SA 5DLDA 2PUCA 4KIGA 1VYVA 1I32A 4D4LA 3IPCA 1HEIA 1T2UA 3OOJA 1KQSU 3OZGA 2GN0A 3A3YA 2BAGA 2JS5A 1CP2A 2HJSA 4PV7A 1C9KA 5NLLA 1M6VA 1DWQA 5MF6A 5J5CA 3WIVA 3MHSC 4HRAA 1DBPA 1E0SA 1G20A 3GEPA 3BXHA 4TVBA 4AY5A 5CNKA 4JY7A 1ZXBA 3PE6A 3ZMSA 3DDZX 4ZT4A 1O6BA 4MV5A 1VHQA 2D1RA 5C8YB 1SUCA 2MJLA 1BNCA 5MN6A 3PGJA 2BE9A 1GL9B 4Q4AB 3IILA 3FLAA 2ZI5A 2RBKA 4GP6A 3QVLA 4YRRA 2QZJA 1KEVA 3V4PB 4OPHA 4MWGA 5BSGA 1MNQA 4FE4A 5CIYA 1JVNA 3Q87B 3H11A 1ZM3A 2ORYA 2ID8A 4PLHA 3BL6A 4D3FA 5KQPA 3GLFB 1CUAA 3L6OO 2VQ6A 1C7RA 4AZ0B 2EX0A 1Z7GA 5CG2A 3DBLA 1EE9A 4BO8A 3JV7A 4R8VA 2EEPA 5AW6A 3VC1A 1ETUA 4JI5B 1KZ9A 5HDQA 4KP7A 3A9UA 2V5UA 1XEXA 5EHNA 2Z1DA 4ESEA 2GFQA 2JZNA 1W2WB 4CQLB 2QORA 2W2VA 3VGPA 2ZJZA 5I7VA 5TARA 2A5LA 3FB4A 1IZYA 2Z2JA 1NBMA 9LDBA 4E2ZA 4HTFA 2PGOA 3WDKA 4L8YA 4F5EA 2QQFA 4PA6A 1DKRA 3AVWA 3F2IA 2VT6A 4DR2B 4FIZA 3PC8A 4CQMB 3CLVA 2XGOA 3S1AA 3IR7A 1MFZA 2XTZA 2CDYA 2AK2A 4OYHA 2OM2A 3JQ9C 4J9UE 4COKA 4OMDA 4YUAA 4XQCA 1O87A 3P9XA 2EGGA 4PC3A 5GONB 4TTJA 1YB4A 4JUCA 4WESA 5JI3E 3A9SA 1CEYA 4ZVKA 1C1DA 2ZWIA 3B38A 5KOHA 1K9MW 1IN4A 3QJYA 1KD1W 3FYUB 3DZDA 3HCBA 2P9HA 3ME5A 3BD7A 4TLDA 4DNFA 1B2LA 1DOZA 2DY0A 4X8MA 5L3QB 3REFA 3H86A 1GXSB 2OOKA 4W9RA 3O3NB 2I3DA 5CURA 2WSYB 4RY0A 4TL8A 4F56A 4JCCA 1W1UA 4RVHA 1Z39A 2O0LA 1WP8A 3CR3C 3KPWA 4IQ0A 5JMPA 2IHJA 1NATA 4LF6B 2QM3A 2OXTA 4YHBA 4TQFA 4NDAA 4NCJA 1F0NA 3BAAA 3N9IA 2F3QA 3I2KA 1Z8FA 1BL8A 2GR9A 2G80A 4BV2A 2GF0A 3F46A 4L9SA 3ZV4A 3W79A 1RAIA 4DNXA 2D3TA 1RIIA 3QX7A 4V3CA 1P4AA 1ZUNA 1TUEA 3ZW7A 4E5KA 1I0HA 1XJ5A 2XQJA 1Y0BA 5JPDA 4CN9A 1VEWA 4N1AA 3RVNA 1CZOA 1BYIA 4AG6A 4BWGA 1KQFA 5IK2A 1Z2NX 3BCSA 2ZRBA 2Q45A 1B26A 5LQAA 2Q8QA 4IQ8A 2BM9A 1EQ2A 4DWJA 4M9QA 3ELYA 4N01A 1E2IA 5FLEX 3ETGA 3H2SA 2MMCA 5TMPA 3L5KA 4O3MA 3TZQA 3H11B 5JZBA 2VPPA 3KE8A 3BOSA 2HHHB 5KYYA 3P9YA 1TQ8A 2OAEA 2Y9PB 3I34X 1BXGB 1VA4A 2DSTA 2MR6A 4WXRA 4OP3A 3AVVA 4PGAA 3F6BX 1QIEA 2CWDA 3LDFA 4UDXX 3NWPA 2EXXA 1B42A 5A9SA 4YRTA 4PIVA 3OQ1A 2HKOA 1VP3A 5JY1A 1YA6A 4Z7QB 2B8NA 5ICSA 2BL4A 3LL4A 2C59A 3D5QA 5G2OA 2NADA 4KFRA 2X13A 1SUEA 3OEHD 5JJIA 4YCMA 4WLEA 1OZAA 3W5VA 3RV4A 3B7WA 4HNUA 4QPZA 1YGYA 1Z25A 1ZD4A 3H5RA 1CJKC 4DILA 4FGWA 3IAM6 1IVNA 5A1TA 3KUXA 3IAS6 1P9LA 5ALSA 4R2LA 2ZT6A 4ZCSA 5ADVA 3FNFA 10MHA 4IJWA 2QLMA 4TV8B 4EYQA 2CLSA 1NAHA 4DUGA 4B6PA 2E82A 1AUXA 3R0QA 5BMVF 4XXHA 3EC2A 2YYZA 5EESA 2YHIB 4IIJF 1VLJA 1RFGE 2Q6OA 4PC1A 1RYHA 1QIGA 1Y6FA 5CVJA 5I8WA 4AKHA 2GEKA 1VIVA 3BJZA 5FLYA 4NBKA 2QRNA 1BMFA 4R68A 1PV4A 1GGEA 1KE1A 2VP6A 1WB7A 3DDWA 3O1LA 4MA5A 4ENUA 2A58A 4WPGA 1OFGA 3FPBA 3B5IA 4Y6LA 1CVRA 2A2ZA 1M8JA 3UICA 4CF7A 2HFJA 2YFKA 4PX2A 3DJFA 4NAHA 1A8IA 1ZIXA 5DBEX 1RYBA 4DG8A 4KVFA 4HYQA 2P2DA 2BJVA 3DKIA 1QP0A 3LQKA 3ILHA 1JIUA 4AG3A 5DASA 3KTAA 5HUHA 4H7HA 6Q21A 4B7EA 4RA6A 2OHFA 3A9VA 1VKJA 4RTJA 4Y2PA 3K05A 5BN1A 5I6DA 5K3EA 2RHWA 4DCUA 2BGIA 4FM1A 3HLKA 2VUHB 5JSKA 1NUAA 2NU6A 1C3LA 4IXDA 3LCMA 4GMKA 3K06A 2YI9A 3HKBB 2PXXA 4NVRA 3HLYA 2D7JA 3KKPA 4HJXA 3CVUA 2QTLA 2XUKA 1GN4A 1TYCA 1SKMA 4OAQA 4HLUA 3A4IA 2EILC 1GKLA 2A9FA 4F1WA 1XGKA 1VFPA 2M6KA 5J43A 1BH2A 1ULAA 3H9GA 3B1YA 3OJXA 4OG2A 2HLNA 1IOLA 2O2IA 1CFZA 1AI4A 4A92A 4MDEA 4YRBA 1NVTA 4KMMA 2O20A 3NEJA 3VR2D 4HEHA 2JVJA 3FUUA 2D13A 2WG1A 1JU9A 2FDXA 2OV3A 3MWEA 4O29A 3UVEA 2OIGA 1JZQA 1X19A 4RKEA 2O0HA 1SD1A 1H2GA 4D81A 4GCZA 3B70A 4MTXA 1E2UA 4CM9D 2X5NA 2OC9A 4KMRA 1IM2A 2R6GA 1SVWA 1DTWA 4D3SA 1DCTA 1C9DB 4BPRA 1RXVA 1ZGBA 2UXDO 4IFIA 4E3WA 1NMXA 1F5NA 1IQRA 3OR6C 2XCTB 5DNVA 2FB5A 2DFLA 3H1EA 1CRZA 2QJ1A 4MLZA 1NW7A 4GP7A 4DMHA 4LE2A 2YY6A 3AH8A 4LWSB 2XUHA 2X6AA 2PEZA 1T0JB 2BEWA 4WGFA 4K6MA 1S5JA 2X9GA 3PWTA 2H8KA 3TKYA 5AM1A 2REXB 3EH2A 2QEQA 5DCLA 4I5EA 3DLIA 3LYUA 4L8LA 1KY4A 1ZVKA 2I7DA 2W11A 1UJMA 5BQ3A 3NR7A 5A3SA 4R1LA 1P0FA 4ETWA 4XZ3A 1AJPA 1FIUA 4X54A 3SD7A 4TT3A 2PXCA 2I78A 1XTSA 3BA8A 5F12A 1KRXA 3BFPA 4R0VA 3VSBA 3CH4B 3NH9A 2O7QA 4RMIA 2CSXA 5LIPA 5DW0A 1P0CA 5C4GB 3ABKC 3K6RA 2NTNA 4CF3A 3KTAB 3NT4A 4DANA 3KDAA 2V6MA 1ENVA 4TS4A 1YDHA 4G9GA 4RA6B 1I30A 4D9HA 2FWMX 2PZLA 2M1XA 3WNCA 5AQEA 2PMKA 3ZKWA 3L0ZA 4M7RA 2A5YB 2VHTA 4R9RA 5IWAB 2O8CA 2XQKA 1RTKA 1P7BA 1ZBDA 3U7EB 2I6UA 4IVRA 1SA0A 4DDVA 2D3WA 2IDMA 1SUWA 2ZWOA 4AY2A 1AA6A 1ZUQA 1YVDA 3U10A 1NY5A 4V1CA 5FTWA 1O9GA 1U3GA 5PNTA 5EJ8A 4WN9A 1B7GO 1SC4A 3QUTA 1XB2A 3OQIA 3K92A 2PPLA 5EBLC 1NNUA 1YCDA 2BRUA 3Q7SA 2C7GA 1Y76A 2O8BA 2KW5A 1JG7A 1JMVA 1QVVA 3SJZA 1JHQA 4JVNA 4H9GA 2WU0A 4ZXFA 4WVLA 1A27A 4EFMA 3U9SA 5K3AA 4FJ0A 4C4OA 1KBZA 4F92B 3HNPA 4GMHA 1B3QA 1XZDA 3U6KA 2WINI 1LTHR 3FZQA 2GK4A 4U2EA 5LC1A 2XXAB 1AQYA 1HOXA 4RHUA 5T41A 4H6PA 4QO8A 1DTWB 3EFFK 1V6SA 4M1ZA 3TK1A 4DLUA 1HY3A 4C3OB 1MVLA 1WCXA 2ADQB 3LF2A 5INTA 4RELA 3SJBC 4TUYA 3KOUA 3LQ4A 1GQYA 3IA2A 1Z29A 3L7MA 3G0IA 4AKTA 1CERA 1XZGA 2HZBA 2Q6KA 4C43A 4L4ZA 2WWFA 2AR9A 4WBSA 5IXJA 2IYEA 5KNDA 2P3LA 3GY0A 2Q67A 3RAGA 3MILA 2ZJ6A 4EHLA 2VJOA 1PLLA 1POWA 4D99A 2C83A 2G0NA 3OGCC 2IYWA 1T5SA 4L8GA 2B21A 2Q0QA 2Z9DA 3FTCA 1X77A 3QVOA 3K7EA 2MOKA 3KJIA 4D45A 3CNOA 4J43A 4L3OA 1Y4DE 2AOTA 5E6UA 1U3UA 4PO8A 8AT1A 2PVCA 3GUYA 3MS7A 5B12A 3UHAA 2MSEB 2C2KA 4NBTA 5CITA 1JKXA 3B12A 2BI4A 2EJCA 5ECDA 5JMTA 1JOYA 4IKOA 3BFJA 2BW0A 1AS3A 2EP7A 4Q3KA 3MERA 4X7MA 5DXAA 2VLBA 5FFFA 1ZESA 3RTDA 9ATCA 3KCQA 1P8JA 1WCYA 4N3CA 1KEZA 1EB9A 3IKJA 3T1QA 5FLKA 3FMIA 2WOOA 4ISCA 5T6BA 2UXDB 3N2YA 5CCBA 3BGIA 1UWLA 4V0ME 4OUKX 4RMGA 2CXRA 5WRFA 4CLOA 3OQBA 4GZRB 2WF9A 2YRXA 3CCVV 1C7IA 3PGMA 1WBDA 3M5DA 4JI4B 4DJFC 1W19A 1M9NA 4ZCIA 4C22A 1T6BY 1V6AA 3OOYA 2VWPA 2L2QA 4Q6GA 2OWDA 2BZ0A 3SFTA 4R1SA 4ZYZA 4MICA 4P22A 3KOOA 3H6GA 2GN1A 4QGFA 2KS6A 4WDRA 1BDBA 5EIAA 4A8TA 5EIBD 4AI8A 3IMEA 4QREA 2ONYA 4FFMA 1FFCA 4HWKA 1W6RA 2OSVA 1NE7A 2J41A 2HJFC 3P9ZA 4V0LA 3UGKA 4FDLA 4IV0A 3STTA 3NG1A 4BAYA 1U2EA 1M1KW 3I92A 3TJRA 5FORA 1K7SN 1P2UA 1J0XO 3PEEA 4JI7O 4AFNA 1QHHB 4QOHA 1LV8A 1GAQA 2WHPB 1WA8A 3X1ZA 5FBVB 2X8JB 3KO8A 1Q95A 3R6LA 2OHVA 3EHBB 5B2ZA 3K96A 1TRHA 1XMQO 2W2TA 1AE1A 3AI3A 4URUR 2VZ8A 4FONA 2ARHA 1Q20A 1WWKA 1HYQA 2O8FA 2WT4A 2DWUA 2P2YA 5JANA 1AV7A 4GZ5A 2VXBA 1G3RA 4OYYA 2CAZC 2HQ1A 3HY3A 4INAA 3RK1A 2FX2A 3FCEA 5I7OA 2Q7DA 2B8EA 4F2GA 3T5CA 4Y1EA 4H0FA 2FPGB 1E79D 5H16A 2OV1A 1TF5A 2GK6A 4QYIB 2BGTA 2WJIA 1ZZEA 3RLIA 3FGOA 3VTAA 4N65A 4R2JA 2TRSB 3O03A 1UXIA 1W2HA 3GJ5A 2DT8A 2P7TC 3PYXA 2AOTB 4WK0B 4RDCA 4WCFC 1DBQA 4AC9A 1AKMA 2GZDA 4Q20A 2C5HA 3KM0A 3H4MA 3BJIC 1K4MA 1Y6RA 3BQ9A 4K81B 4ZYTA 2R8BA 2HN9A 1A88A 3VTFA 3W05A 1IG3A 5H83A 2G8NA 4GEGA 3AGQA 5E2BA 1SOMA 4UUQA 1QP4A 5DI3A 3CMMA 3MOIA 1H1LA 1E3SA 4D9FA 1TMKA 1QE3A 2J31A 2Q0SA 1R0WA 2BR5A 3V6LA 2OORA 2PH5A 3CQ9A 4I9QA 3GRRA 5HJEA 2JH8A 3LUKA 5DIFA 4PFJA 1ZI6A 4JTCB 3O4JA 5A7HA 2Y27A 4W7HA 5EIEA 4P82A 4CVNA 3GLIA 1P2BA 1L6IA 1RC8A 3DH0A 3P9RA 3U4QA 1TLTA 1HYHA 2X9NA 5JUWA 3KQOA 4W5WA 2PQMA 3OIDA 4FUTA 4LHWA 2HWWA 4FYXA 3HYTA 1KAMA 3JQGA 1HMYA 1CEQA 3L1JA 1GRNA 3VXKA 2R6FA 4OXYA 1ULBA 3DUFA 1M8FA 8LDHA 2VUTA 4IFTA 2VF7A 1BZKA 3T9FA 3SFZA 1NONA 2JAQA 2K2WA 3BDAA 2OGUA 3EAGA 1T3ZA 1UKYA 2D5BA 2P6NA 3DBOB 5FFNA 1VMDA 2O7SA 1TF2A 4BDSA 5JLJA 2IU0A 3S3XA 4BZZA 3OI7A 2XHBA 3IB6A 3LCVB 1CYDA 3EBLA 2LUOA 1XMVA 1WY7A 3RFFA 1O96A 4P3XA 1RZUA 5HM8A 3EVBA 5I4KA 5HX7A 4LF5B 4W6QA 1U8TA 1NUUA 1OJHA 3B4SA 1JQBA 1P7PA 4MV0A 3CFYA 3OETA 4I9GA 1NXVA 1L7QA 2IYZA 3HB0A 3DLHA 4JB8A 1NXWA 4F4LA 4DEXA 4HDOB 5C80A 4KO8A 1CNFA 3OT1A 5B3JC 5E1AC 3RRZA 4FXPA 3QLJA 3S3WA 4ALLA 3T94A 5T8KA 3D0KA 4Y7DA 4Y0AA 1DO2A 5KNBA 5GM2A 1XTVA 3SKXA 7ADHA 5HW0A 1CLUA 4WZZA 1RZ3A 4WBNA 2EX3A 2KM1A 4IOKA 1GFWA 1RE1A 3TLGA 3BSSA 5EJ2A 1UQUA 1NXPA 4TRJA 4TKUB 2HJDA 5JYCA 2FG6C 3AB8A 1QDUA 4RE6A 3DKVA 3AF1A 4UREA 3QY0A 2XA9A 4CTMA 5BN5A 2A3QA 4IH9A 2HP8A 2ATXA 1IQUA 1S2LA 3EZ6A 1D0IA 3T9AA 3P2KA 3UW3A 5KTPA 3MOSA 2BKAA 4B4OA 4EZBA 3K0KA 4E13A 5IKPA 2LKDA 1Q3TA 4K9PA 3N7TA 1XMQB 4MI9A 2IEAA 4BOYA 3V9AA 1SKYE 2XOXA 4R7ZA 3T5TA 4BJ1A 3MWDB 5JALA 3JCZA 3HZHA 3KAKA 1Z0UA 3QBTA 2QQ5A 3K0EA 2QI9C 2QE7D 1HSZA 4ND7A 4HMQA 5H2FZ 1AC5A 3BS4A 2PYZA 3L7YA 2MHCA 1MA0A 4C5BA 1PHPA 1NOIA 3TIVA 2O6LA 2GEJA 1CKEA 1XI2A 4HGPA 1VARA 1GPDG 2DPYA 1M0WA 4M1TA 4ZA2A 1G3UA 4G0WA 5SZJA 2FQYA 2YXLA 2VRZA 3FDXA 1NH2D 3O3OB 2R97A 3SJCC 1O9BA 1SD5A 3JWIA 2IBTA 3BTVA 3RABA 1DIOB 4QNNA 5EI5A 1IONA 2Z0AA 3QUCA 4JH0A 4RA9B 4PYIA 3JQBA 1ZK0A 1OIXA 4RTQA 5LDDC 3WNVA 4LXIA 2XNHA 1WX1A 3CCLV 4P2BA 1GUZA 2X22A 1YCIA 2B7LA 1Q77A 4QBHA 4LNUB 4LGVA 5JQGA 4F84A 3BBLA 4E5YA 4A4DA 1Z62A 3ZUGA 1H2AS 4QFMA 1W44A 2JIOA 1PJZA 3IV7A 3KR9A 3P5BA 2Z3ZA 1PDVA 3GZNA 1XX6A 2G9VA 3GCXA 1QCEA 4F9TA 3C8MA 4KFCA 1U5BB 2G17A 4CRWB 4CL0A 3CX8A 3WHKA 2ECKA 2X15A 3PFNA 2A6PA 1N5KA 1MSWD 2NSDA 3OF2A 2FN3A 3OEWA 2EW8A 4UJ3A 4X1YA 4CCYB 1WUTA 7REQA 1N3LA 4E3ZA 1Q0QA 4G0YA 4CC5A 3NC1C 1EUCB 3OSUA 5HUQA 4HNTA 2WB4A 5HZGA 5T64A 5BNZA 2JHFA 3ESCA 4B45A 2NTEA 4EELA 3QXGA 1H2ZA 1J09A 2XJ9A 1QS0A 2FPKA 4PA9A 3LSQA 1W7AA 5DHTA 4BLWA 1EE2A 3L4SO 4O8CA 4OQFA 3JYHA 4IZ6A 3E7DA 2C99A 4RKQA 2XDYA 3PJEA 5JJEB 3E35A 1PX2A 4UD6A 5TGDA 9GPBA 1A4RA 4MLPA 3PDIA 5JAUA 3QI7A 3ST7A 3UT5A 1Y8CA 1TEXA 5TS2A 1N0UA 5F3RA 3HV2A 3OAAG 3KRTA 1Z4PX 5IVPA 1EVJA 1T29A 3LRXA 5JEEA 2HK9A 3RIYA 1VL0A 1W94A 2C94A 1QTIA 4E22A 3BSFA 2VHYA 2YXPX 5KVCA 1BCSB 2JGLA 3NUZA 4QT4A 1EP1B 3DS8A 5JJCA 2GK3A 1E1RD 4IDCA 5C52B 2QRUA 3QQ5A 2EIKC 4HAWA 2V0CA 4C03A 5JVDF 3TQQA 4ENTA 1G3MA 2ZITA 4ZOBA 2H3HA 3KV1A 3UK6A 2WVGA 4HD8A 2IZ6A 3OH8A 3JVUA 3BG5A 1TECE 4I4LA 4X6UA 1ZL2A 3ANLA 2G9ZA 1RP3B 2CJXA 3OX4A 4DLBA 3TD2A 5HF9A 4UUMA 3V55A 3RTGA 3UAVA 4JELA 2GD1O 4UE2A 1ZNXA 1U0JA 5JD5A 1B4DA 2CHFA 2ZB4A 1BS9A 4GOJA 1O89A 1WW2A 4KRXA 1H2LA 4RZSA 2QUIA 4FVTA 4XDHA 2EOAA 4V1CI 1B73A 4NR0A 3FFWA 4P38A 1AXGA 2WHRA 1GM8A 3OZBA 3RC9A 2BHRA 1RPTA 4V2IA 1SVIA 4N23A 2BMAA 1QRSA 5I9BA 2BKEA 2OK7A 1QLEC 1EFHA 3PNVA 5AKYA 1GN8A 5SZIA 3N3AC 3SX0A 4ABMA 3ZVLA 3H5TA 3ABLC 3WV5A 3KT8A 1NW8A 1QC5A 3GZNB 3IL2A 5ED4A 3D6UA 3MF4A 5DEIA 2A84A 1YIAA 1Z5OA 4YHHO 3QHPA 1UEJA 2W2OA 1OLOA 4L5AA 4B6OA 2PYJA 4G37A 3R3UA 4I4IA 3MBIA 3L6CA 4HL6A 2XV1A 4CIBA 4BU0A 1UPTA 4TV9A 4ZDWA 3ZHSA 5K6AC 2O0JA 1RM1C 1ZJ5A 2HV9A 2I3ZA 4QUGA 3KQLA 5HNKA 3WMRA 3E70C 3PA8A 5LIRA 4MR9A 2Q46A 3QGMA 4IYIA 2JLUA 4DV0B 4KRGA 2Z57A 3KYIB 2KMLA 3O6VA 3A1SA 5CP8A 2DX7A 1BDMA 2I91A 1PQWA 2ZSBA 2PWZA 5A62A 3A0BZ 3U1TA 2JLSA 3CUKA 4DLSA 3IQHX 2D2EA 3VYTB 1PS0A 5AVRA 4H1VA 1Z36A 4Q3AA 1T8WA 4W8OA 1R66A 5FWNA 4P58A 5F7ZA 3G8CA 1XKTA 2DC1A 2PL9A 5FOWA 4CKXA 4UMDA 4MV1A 2CB0A 2D1FA 4BUCA 4C05A 5BUSA 5SZKB 1KDZA 2R8OA 4BDTA 3PQ7A 2VA8A 1UMKA 2QR4A 4RK4A 1ETHA 1JDUA 4NSNA 3I2FA 3UWMA 1V43A 3C3XA 3PFCA 1ZG3A 1TJNA 4C88A 5FBWB 3LBIA 3WWPA 1N2CE 3I6BA 3MBOA 3Q7TA 2N04A 3M4NA 4J7XA 3SM3A 1E2JA 1AGNA 1YRQA 3ITNA 3RJ9A 2A8YA 3HZRA 1V7PC 3ABOB 3E8MA 2WG0A 2HU7A 4UCXA 5FV4A 3WGZA 4KPFC 3HADA 1V8PA 1C7ZA 4TPKA 4KE9A 3BC1A 4FEYA 3FAVB 4IAOA 4D8XA 1XZLA 2B2NA 2C29D 3FYTA 4ARBA 1Q84A 5BOSB 1ST3A 1WXFA 1BE1A 3JQAA 3PFWO 2V6JA 3GDOA 3KKEA 1FFYA 2HGZA 3NV9A 5F77A 2HPAA 2O23A 5HKKA 1KKDA 3G6EV 621PA 1OLUA 1OCRC 5ENDA 4XYLA 5BW8A 3JZMA 3FCAA 3ZBQA 4KU4A 2IHBA 1ZI8A 3DQQA 3K9HA 4D5GA 1NHWA 4KWEA 5AW9A 1KOFA 2SCUA 5BWMA 2EBWA 2CZCA 5TQ2A 1T4DA 1H2KA 3ZGVA 1JNXX 5LHIA 4IIYA 5FUMA 2CW5A 3CF4A 1M2OB 3IXLA 3C4VA 4NESA 3R7WB 3UBMA 4BV8A 3HY6A 2Y0DA 1WUKS 3FW1A 4FYKA 3SEAA 1X8KA 3HU5A 1E2QA 4DGSA 4F2PA 2NO7A 1Q6HA 3NDBB 2RB4A 2DTXA 2RN9A 2C2XA 2K4MA 5B3LA 3CCCA 3ZWNA 5CXQA 3OU7A 3WC4A 4BE4A 4Q3BA 3IUQA 5DP1A 2FEWB 4FOPA 4P92A 4B3RB 2HMYB 1BC5A 5JDCA 2D0IA 2XIQA 1M2GA 3CA8A 3R6TA 1TAQA 2VK4A 3F2VA 2ACKA 3DMHA 3OO1A 4IBOA 4JI0B 2HCRA 2INGX 4CDMA 2EJRA 1YZKA 3N59A 4CEHB 3N6XA 5EPEA 1P2TA 2R9VA 5KHHA 2WJPA 3Q2IA 1LRKA 4OHBA 1H2SB 1XXLA 3OQJA 1TA8A 1I1NA 5CHEA 3UM9A 4XI9A 2XUFA 1MMMA 2W00A 3AV3A 4GXTA 4WFEA 3F3MA 1LPAB 4E30A 4LVNA 4LECA 2WKPA 1SC1A 4RESA 1OCZB 1WNTA 1YR9A 4K26A 2RHBA 1Y6JA 3CX4A 1TTHA 1HFKA 4WXYB 4LXHA 3NTLA 4XARA 3OSZA 3JQQA 4W5JA 2V0NA 4ZV4A 1OB2A 2I4IA 4JYZA 4CW7A 2CMFA 5AW4A 5AHWA 1NP3A 3F7NA 1XTUA 1AV6A 1XCLA 3KUDA 4KQ6A 4BC0A 2QENA 2P2ZA 4P4LA 1GL3A 3P4UA 1SXPA 1DAKA 3PTAA 1PYGA 4U9IS 2PL5A 5ALXA 1SUFA 2WVAA 1JIVA 2RGGA 1TM1E 3MCVA 2LP4Y 1AI7A 3I8SA 1F4NA 2ZIXA 4A5UB 1AGRA 1R3IC 3J80A 1F0YA 1I2MA 2H94A 1OCEA 5EIWA 1TMYA 5AUOB 3N8DA 5ETJA 4IDBA 1TU4A 3I76A 5TQ2B 3T7JA 1YS2X 5AJTA 2FSFA 1ANKA 1I2AA 3FWZA 4OLJA 2VSYA 1UQRA 1YVEI 3AEZA 3ADCA 3G2IA 1O9HA 4IIFA 1QQBA 3IDQA 2FFBA 3GJZA 5ALDA 1OCCC 2AI2A 1AQ6A 1K9VF 4Q7JB 5DU2A 3ZCSA 4DB2A 2JGDA 1RWVA 4PPGA 2ISSD 4JOCA 4PQEA 1FK8A 5G0TA 1XV5A 4UCRA 3CZ5A 1E0DA 5JS7A 4MH0R 3WWYA 3QYAA 2O2SA 4IVPA 1QHNA 1B74A 4GWLA 3JYCA 2O6HA 2YY7A 3NUQA 5B30A 1SZJG 5CVVA 1Z82A 2PTGA 4OYRA 1TC2A 2GJ4A 4MVJF 3HUEA 3WLEA 4BZXA 5I45A 2YVLA 4MWCA 3F7OA 1M2KA 1HDOA 2IZ0A 2DN9A 3IFSA 2H0RA 2J45A 4WSOA 4HDSB 3N75A 1LPMA 2XVXA 4ZOLA 5AH0A 3SXUA 3C7TA 1VM6A 3D3IA 1JHOA 1GZDA 2ZJ1A 2XCQA 3RTBA 3TPZA 1RLIA 4LF6O 4MAMA 3CUEF 5FNVF 1GTVA 4DADA 5FD8A 4ECEA 4P98A 1WAZA 4P3YA 3ZHUA 3PXUA 5KA5A 2PA0A 5LQNA 3CUTA 1JBKA 2H57A 4CR7A 2EIJC 2FN4A 3RS9A 4PRKA 4ALMA 4HLCA 4MSWC 4XLZA 4WNIA 1IUKA 1T35A 5DX0A 2J1LA 5DM2A 1R50A 2VOJA 4QATA 4IJ6A 1MX1A 4EI9A 4KAJA 2JGAA 4UQPA 4ZVSA 4XPIA 2ZDIA 2AWOA 2LPMA 3FG9A 2FHPA 5G4LA 3K4QA 4F3TA 3OT7A 2R5WA 3RJTA 2Q1WA 1OV6A 2QHXA 5DNWA 4YXWG 1HEYA 3EULA 2FJ0A 4B47A 4LFAB 4LQCA 4M88A 5C7YA 3ORHA 1UANA 2NPIA 3PIDA 1EGVB 2O2ZA 5J4HA 3W5CA 3S29A 3K8YA 3WSWA 2VQFB 5IT5A 4XUDA 2IS6A 2V7EA 4L0DA 4MT8A 4HFRA 4LMBA 3DV0A 3DCJA 4FB4A 4FJ2A 2QJRA 1XHZA 5DYWA 1U4SA 1DOAA 3A6DA 4KQJA 1IMOA 2AMVA 1OA0A 3TZCA 1W5AA 3C6ZA 3VU9A 1TFRA 3IAFA 3RBXA 3WIOA 2JFBA 4EHAA 1AN9A 3L0YA 2XADA 3U19A 3TTVA 3RRYA 4MGEA 3K70B 2X8WA 2Z8YA 1W30A 1Y9AA 2AKEA 2Y0BA 3ZLVA 5I51A 4KIWA 3BA6A 2WU8A 4CQMD 5K0EA 4RHYA 1D6JA 3G1TA 3R8XA 2ZZNA 4PCAA 2ZOSA 1XAIA 1H8HD 4TN5A 3GB7C 4KUEA 2CDNA 1P6UA 1XRPA 4ZAYA 1ONNA 1YSCA 2IP1A 4UPEA 4NICA 4W5QA 1RQGA 5FWAA 4TROA 2PLAA 5JTTA 4QRIA 2JEOA 4IM7A 3HK2A 2H1SA 1NVEA 3BH7A 3RH0A 2EWVA 1EGAA 3HXOA 5BZBA 1ESDA 1AM4D 5L51A 2ET6A 3VMMA 2V4DA 2V98A 1G17A 1Z6ZA 3I45A 2OYSA 3NIBA 3LGSA 4CEJA 1DJQA 2X23A 2XAAA 5I9LA 2ZCUA 4Q7KA 2ZT5A 3CB4A 3QMMA 4CCAA 3H5IA 1C4KA 1NGSA 2J3MA 4XCVA 2FE1A 2PV0A 1YH3A 3ENWA 3IUBA 1XCOA 1ADYA 1XDSA 2E1RA 3ZWKA 4IXTA 3R24A 4ZHQB 1PFWA 4NCAA 5J4KA 1DJOA 3ZMTA 4G85A 3QKRA 1E1MA 4O0LA 5CBKA 3H2KA 1R2QA 3ECSA 1E89A 3ELUA 5FHRA 3CP1A 3KSBC 3GRPA 3N58A 4BFZA 3O2SB 2WFMA 3FPKA 2HFKA 4CV3A 3G79A 2PZJA 4JEMA 3ZQJA 4Z3OA 4P3PA 1WMFA 3LUCA 1JVSA 1F8UA 2O8DA 2A67A 1H3NA 2R8EA 3DV0B 4EY6A 4EITA 4DPLA 4KXXA 3FROA 1Y3BE 2G9NA 3JAKA 4EA8A 1M6VB 3PQ3A 2GHIA 3A27A 1XREA 2QWOB 4LW8A 4FFBA 5EZYF 4DT1A 2OL4A 4W4LA 1W5EA 4X7RA 2O52A 1K63A 1G20B 3OJWA 2H4ZA 5K8UA 1OFUA 4UHEA 3GMSA 2P6UA 2WTUA 4Z86A 1NBMD 1VQ7V 3VU0A 5IVKA 1C3XA 4PNZA 1G21E 1Z17A 2R4QA 5PGMA 5CDHA 1TLLA 1FTWA 5H9WA 1Z22A 4HBNA 5CB0A 3ZZUA 5L6LB 4REQA 1VE1A 1FDWA 4R8SA 4YS6A 4YK7A 4B40A 1YZHA 4HH0A 1WSBA 4J3FA 1NW9B 2J3KA 1CFJA 1RDFA 4UM9B 1USUA 4KP4A 5CA1F 4I3HA 4IIEA 3GRZA 4P54A 4KB5A 3J81A 2B5VA 1DQYA 5ALUA 2QXYA 2V3CC 3MPOA 3DBLB 3DB2A 2EQAA 4AUMA 3TRKA 2FPIA 1PCXA 3ZX6A 3Q88A 2IYOA 5BXZA 5HGJA 3ZBUA 1TEVA 4YUXA 1CY1A 5ALMA 1XEXB 3Q3IA 4P4UA 4M38A 4MIEA 1F06A 2HJVA 4KXUA 2V7PA 5D86A 4LK3A 4NI5A 4ZVRA 4PDRA 4FZJA 3WLQA 4MRSA 5K3SA 5IYZF 1N5MA 1W88A 4JBYA 4AD8A 1TD1A 1VG8A 1PU2A 3OE4A 3NGXA 2CNOA 2PN1A 1X7GA 3U3XA 4HTFB 3DUWA 3TW8A 1V6CA 3KQUA 4FOSA 2XF2A 2J9FA 3DC6A 4GLLA 4FOLA 5FWDA 1R8QA 1SUSA 3NAGA 2O2YA 4WOCA 3S1AB 3CO0S 4RK7A 2BC9A 3IJ4A 3FIJA 1Q3HA 5IWAO 3I5MA 5LJIA 2BBTA 5P8WA 5I8PA 1OAAA 4ZD6A 2V58A 5IK2D