3WB1A

Hcgb from methanocaldococcus jannaschii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0488
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 57
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb1A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb1A02
3WB0A 2D0PB 4DK1A 3LNNA 5JJJB 4DK0A 1DIOB 1VF7A 5JJNB 3WB2A 5JJEB 1IWBB 1H2SB 1UC5B 5D5PA 2V4DA 1UC4B 2F1MA 2D0OB 5D5QA 1T5EA 1MMFB 3BRCA 3WB1A 4L8JA 1EGMB 1EGVB 2F95B 3AUJB 4GYCB 1RSOA 1EEXB 1IWPB 1NBWB 2F93B
chains in the Genus database with same CATH superfamily
1LRLA 1UWLA 5LP6A 3R7LA 3L01A 3D02A 2ZWPA 2X42A 1YQWA 2J41A 2H8PC 3L6CA 4F21A 2DPHA 1HMYA 3VC3A 2QD1A 1OIVA 3VZQA 1XCPA 5BP7A 4JYAO 2VSOA 5T57A 3L8MA 1UOPA 2BKUA 1QG0A 3EG5A 4LC9A 3FHTA 3GGGA 1DRWA 4LY3A 3ND6A 5DO9A 1PU2A 1ZNWA 1HT0A 1R9JA 3HKBB 4RSMA 2PEZA 1IBMB 4TX1A 5AHOA 1I2BA 5ALJA 3EVCA 1PJAA 3JQEA 5AIAA 5T6MA 2PQMA 1AF7A 1KZ7B 3O74A 3ZJTA 3HYSA 1HLGA 5BWCA 1I7NA 2Q99A 1CQIB 3C7DB 4FVMA 1SJ9A 1QHYA 4XLTA 1BNCA 4RIFA 3F3KA 3UUGA 4DV1O 1R0LA 4IZHA 2XYQA 1A76A 2GEDA 3PL5A 5ALSA 3IRVA 4RCVA 3PPIA 4XVQA 2ZKLA 1USVA 3EE6A 2QTVA 1BDIA 2QTLA 1RYNA 4HWKA 4DJ5X 1GO3F 2QTCA 2R65A 2GXSA 1ACLA 3H7IA 4GUDA 4XX0A 2Q6IA 5KTYA 5K0ZA 1KDOA 2D5IA 5LMZA 1L7NA 4OGKA 1MH1A 5EJ9A 1M2EA 3DF7A 3H5LA 1BZKA 4ZO6A 1BHAA 2BSKB 3JYQA 2V54A 2QAJA 2G9NA 3SZGA 2QB5A 5TQJA 4Z49A 3DS8A 2ZT9B 1X3SA 2XJ9A 1RQ7A 3MCAA 4QODA 1KPGA 4RNCA 3UJCA 3K09C 5B1NA 2WD7B 1CY7A 1CLUA 3V80A 1H22A 1DDIA 2OXEA 2ZCUA 4UDYX 3VH3A 4G8CA 1X14A 5I48A 3CS5A 2OGZA 2P5TB 1QPZA 3EXIB 1KQ3A 5IM5A 5IT9A 3LF2A 4ADSG 2QWRB 2YFYA 3C90A 2ORVA 4PZAA 2YIDA 1QGYA 3UXMA 2QJFA 4FN5A 3ZLBA 1X1CA 4ZZ0A 2R47A 1IAQA 1TMYA 5D3MA 4B7KA 2DPXA 3QVMA 2CH7A 4EI9A 4U7TB 4NENB 2VH2A 3KLMX 1IHUA 4CYMA 1TZKA 5AK4A 3DB1A 1RPOA 4J10A 2R1TA 3AO0B 3K72B 1UWCA 4RH0A 2Z3ZA 2LCFA 2K6GA 3VNVA 1CJUC 4HX9A 2P5OA 4BIOA 2W11A 4LXGA 2YIBA 3ANXA 5C53B 3SJAC 1N2ZA 2GTAA 2FSVA 5JRDS 3C4JA 4BY9E 1AR4A 2I71A 3DQPA 4TTAA 4G09A 4B4KA 3FB5C 4J9ZB 4MKFA 2EFCB 3A2KA 3GRPA 2XBUA 1A8QA 3RV3A 4GM4A 3MWEA 3KJZA 5ALLA 2M1ZA 2GD2A 1O0CA 4F9FA 3PX2A 1POWA 2ODPA 3EAQA 1U2GA 5E3JA 1O57A 4BVJA 2QTVB 3DLCA 2WJHA 2H2GA 5A2QA 1Z7BA 1XL4A 1G2IA 4B43A 4RAQA 1LBHA 4XX0B 1EGHA 4FFNA 1SHTX 4TWBA 5JO0A 1GUDA 3H0KA 1X1DA 1MC1A 4UOEA 1TJPB 1MVNA 4KN8A 4DQVA 2P6NA 4QJIA 3H8WA 5CEEA 3SN6A 3UBTA 3TNLA 1T8YA 1DQNA 5CH5A 4XJTA 1AHPA 3NUQA 1LPOA 4PQEA 2EW8A 4QAJA 3BF7A 1YT5A 4IDCA 4ON9A 3N70A 3UT5A 3DO8A 2L6LA 1QDLB 4BQPA 2MYNA 3OM1A 3U9LA 2OG1A 3EPRA 4OXXA 3A6FA 5BXYA 3MJFA 1KZ9A 3C24A 3NOOA 2E18A 1NLYA 4I2NA 4IHQA 1GDHA 5IHXA 1SY7A 2EF0A 4Z4HA 4BGDA 3VOBA 4R2JA 4A9AA 2HQBA 3VU9B 1RM3A 4FINA 4LAFA 5JMWA 4LSWA 3G5LA 4DJFC 3ONFA 4PDVA 1EE1A 3IPLA 3UT6A 1VSVA 2DWCA 1BX0A 1PD3A 4KGXA 1EJ2A 3LBHA 5DN9A 1S77D 3D4PA 4HNVA 3SSOA 1CUXA 5MDHA 4BE9A 5D3MB 4K6OA 3QKTA 2WWTA 3E4CA 4UU7A 3KZVA 1KVUA 2DKFA 3D7RA 1NXTA 1CBUA 4HX5A 2CBZA 2BAGA 3K9LA 2ZUFA 3CX3A 2DLNA 1O95C 5REQA 5CLLA 1BE0A 3EW9A 4KQHA 1N5IA 2ZDIC 1P60A 3BGDA 3HS3A 2IITA 3WX0A 1I36A 2XAUA 4FFBB 1NBMD 1PDOA 1SKQA 1I1OA 5E7QA 1VCNA 1NQOA 4AZTA 3NB0A 3HP7A 3NM6B 1C0IA 2HBRA 4J91A 1ZPDA 5DU2A 3MWEB 2HA5A 3GNSA 4J7AA 4U3JB 1NBME 4YN3A 1MSDA 1ML3A 1YTLA 4DC1A 1N6IA 5TF0A 1DQPA 2DQ4A 3KL2A 5G0SA 2JA1A 1XF9A 1X80A 2UXBB 4QBGB 5JSFA 4KODA 2Q1SA 3AKDA 2JASA 2CF6A 4AXBA 4GZ5A 3OIGA 4ITUA 3HFSA 1NPTO 1Q14A 1NJSA 1AZTA 1JKIA 3ZNOA 2HF7A 4C03A 3F2VA 4C0JA 2R87A 2DR2A 1JFSA 2FYUH 2ECOA 4IH4A 5EIWA 1EM1A 1JFRA 4QNHB 2OKGA 1T25A 2Z2XA 3UA3A 5HOQA 3T3IA 3H11A 1LGYA 3IC7A 1EK5A 1N9GB 3RBZA 3B5EA 2QP4A 3FPHA 5F21A 4RVFA 3BXHA 3WK8A 1I7FA 5G3YA 5CB8A 3UT5B 1XHFA 2GEUA 3ETJA 4U2DA 1GKLA 2VC2B 3UHPA 1RE0A 1ZCAA 2PRZA 3GG2A 1JQ0A 1D6SA 3FNGA 4IS2A 4JP8A 1ZOIA 5JC1A 4Q9LA 1B74A 1V54B 4YRIA 4BWFB 1HUQA 4KO3S 2BJVA 1XTIA 4OHOA 2PSJA 1BS3A 1YTFD 1ZVQA 3K9HA 5A05A 3TLCA 4LSMA 2DPYA 1ORQC 2XCSB 3UV7A 2WLHA 4ZIBA 3DNPA 3UWOA 3FPGA 3UATA 3PFKA 3ETEA 1E3TA 1RM0A 1SQ5A 3LVRE 3FWYA 4DY6A 4ZCMA 5T4BA 4NJMB 1A88A 4HBGA 1CSEE 3GAAA 1JILA 3IXQA 5CBKA 3NWEA 4UAVA 4FIDA 2QJTA 2KWIA 4JLJA 2D1RA 1ZONA 3HVHA 3KDPA 1XWIA 1JMKC 5A5VA 3D0KA 4WX2B 4PA9A 4JODA 1IATA 4P30A 5HQTA 4G1FA 2D59A 4PY2A 4BLRA 2WP8J 1T4BA 4RMJA 4KWCA 2V4MA 3GVIA 4DCUA 4NCNA 4M87A 1DO2A 1OILA 5B4UA 2NMVA 1GLNA 1R37A 1GU7A 4H77A 1SQFA 1Z4LA 3AI2A 5CT8A 4GZRB 1G8MA 4A0HA 3FLAA 3GHYA 3C97A 4URUR 1QIHA 1N2JA 4DIDA 1JR4A 1GDTA 4U7FA 5SY4A 2JBAB 4GR9A 2FG5A 2E4AA 1JFTA 3TQFA 2G0NA 2G40A 3HYTA 1PYGA 5HEKA 1L7BA 2LQTA 3UWMA 3RREA 3I01A 3OEHD 4FFKA 3S8MA 3F74A 5CFZA 3ZI0A 3S99A 4FMDF 1GTMA 3CKYA 2DQSA 4JL8A 1I8TA 4NMMA 5JYBA 2FPIA 1VLJA 1VRWA 3KZNA 3AINA 3PNSA 3KQMA 4FFRA 1MA1A 1CNEA 5KNCD 5JXIA 3NYIA 2JIZD 3KZIZ 4F85A 1QGUA 1IN1A 4FSXA 5DRYA 3B3QA 3MELA 2Q4PA 5DNUA 4AS3A 4B83A 3A1WA 3RC3A 4TTTS 1IAVA 4TL6A 2PGJA 1QONA 4PVDA 2VNJA 1MW8X 3TNFA 3PVZA 3AVPA 2ZJ2A 1GL3A 3K1AA 3HM2A 2FFBA 4DJEC 4QJBA 2FX2A 5LXTF 3CA8A 5CAEB 1EFRA 4LF6O 5B1IA 4JI8O 2H4WA 4HT3B 5AK0A 1ECJA 4TS9A 1GRJA 4Y6RA 2LJ2A 2EW2A 1FRVA 4WZAA 5HHTA 4R6ZA 3F7MA 3BD8A 1J9GA 2ZUUA 3DO5A 3OZXA 1PFQA 1NN0A 3GDWA 3RU3A 5DGTA 2A4MA 2E9SA 3EOBI 4O3MA 3EULA 1PE0A 4CV1A 2OAP1 3DOJA 2PQ2A 3ZBHA 2LV8A 4UZFA 1H0KA 5FORA 2G76A 4J07A 3LDCA 2ICAA 1W85A 4JOCA 2F8SA 1XVVA 3CG4A 1KYQA 3W6ZA 3WK4A 3OZEA 3GFQA 4AY4A 3D6TB 2JGIA 1P61B 3RKUA 5JVDF 3GARA 3WL8A 3M2PA 5LBIA 3UGKA 4PBSA 1J90A 3D8TA 3CT6A 3WGIA 1CR1A 4IGEA 2I3AA 5KVAA 2V6JA 2DG2A 5FF9A 1PEKE 3FFQA 5FUMA 3KCNA 4AY3A 1IZYA 3Q7TA 5KUMA 1IX9A 3ULKA 1YB4A 3WFZA 1EX1A 1JIXA 1M73E 1WOYA 3R7WB 1OV4A 5K8CA 3NXKA 4DMRA 1XMOO 2NVUA 2F8TA 3F7NA 4IOLA 3IEPA 2N04A 1S7GA 4IIYA 4EYSA 4EFDA 4K3UA 1EUCA 4D9MA 3L0IB 1VE9A 2PGAA 1IY1A 1I5OA 2E5LB 3ER6A 3EVTA 5IC6A 1NU6A 1EBFA 2G9ZA 4WMLA 1QQBA 3RYCA 1VRCA 2NAPA 1PYDA 4R1TA 3IC9A 4NP6A 5AJHA 2CZQA 1K8QA 5HE8A 4OKIA 5U4XA 1OROA 5B4VA 4JR2A 2R1VA 3PD7A 4H7DA 1QGUB 2DFLA 4AVYA 3NANA 3V1YA 3PIIA 2V1DA 2WJVA 3U4GA 4AJEA 1GCIA 5HP4A 1G2QA 1KYWA 4XUGB 2W6JA 5HS6A 4EB0A 3D6VA 3WGQA 4RCYA 4KPUB 4A8JB 3HCOA 4RVDA 3BCRA 3N05A 3G1TA 1KKDA 5BQOA 1XVLA 4YQEA 1O58A 4DGSA 2V5AA 1YVPA 2PEYA 1UH5A 3AEQA 3C4QA 2PH1A 2WKPA 4E09A 3OKCA 5AXDA 5IAEA 3Q12A 2CDNA 1O9GA 4UC0A 1WNTA 4MVCA 3E0XA 4TWKA 1QRAA 3QJGA 4Q0MA 4E2ZA 1OREA 4D4MA 4QARA 4D3SA 1TTTA 2EKBA 2ZB7A 3B1VA 4OD0A 1RXYA 3VX4A 1VL2A 3BRWD 2F3PA 3G6KA 2NTEA 1L4EA 4Z3DA 1W85B 1TO2E 2BR5A 4KVAA 4UAJA 1Z26A 4IHJA 2IHJA 4FFLA 2ERYA 1N2HA 1PS9A 4RHTA 3ZWWA 4MPRA 2C3YA 2QSUA 1DEHA 1AMOA 4YRFA 4CM6A 1U4SA 1KNXA 3GU3A 2Q7HA 2OO7A 4HBNA 2PMBA 3CWBH 2F2TA 1WSAA 4QPDA 1UAGA 1JAXA 3BWDD 1LF0A 3PUKA 2XCTB 4U7GA 4DRZA 3CTMA 3O4IA 3DEJA 2FPWA 5NLLA 2FSHA 1WB4A 4I1SA 1AI5A 1NN5A 4RC9A 3C3JA 1Y1TA 4LMRA 2X2FA 2I6UA 5JXJA 3VOUA 1PNRA 1C14A 4ZC8A 5TMBA 2A30A 3B13B 3B1FA 3G4SV 2WF7A 4JQCA 3T3MB 4PIPA 2QV7A 5T5QA 5AVTA 4NBTA 1KKUA 5C9ZA 2PLRA 4YUYA 1EE9A 3JAMA 4RJJA 3ONDA 1ADCA 3RYCB 3F98A 2FPLA 1GZ4A 2PM8A 2VOEA 3Q8XB 3DG9A 3DTUB 3PS9A 2GSMB 3ZGYA 2C61A 2BSAA 4H0LB 1I4DD 1H1LA 5B58T 1WP9A 2P9EA 3QKSA 1UBUS 4FZ3A 3PHHA 3THXB 4X7BA 3PI6A 1CQJB 3RC7A 1J5EB 1IE3A 3A4NA 3MBIA 1Y7LA 3P9SA 5I7UA 2F55A 1YR3A 3K73O 2H4YA 3KZKA 1NP6A 4G5FA 1KARA 4BQOA 1DC6A 4EBFA 3FYUA 2ATEA 3ICPA 1I2AA 4FZ5A 1UK8A 2JS7A 4G01B 3IALA 1V3UA 5M34A 1X7HA 2IDMA 3DBLB 2AB0A 3C8ZA 1ZM2A 3T99A 1EP2B 3ABZA 1A32A 3AEQB 3WIBA 1H6DA 1L4KA 3MINB 2NWQA 3PHIA 5HFNA 4BS9A 3SJCA 3CZMA 4XPIB 4P81A 2X9LA 4QUHA 4RH3A 4XWYA 5FKJA 4B34A 2R00A 4ZEVA 1A2QA 3LHKA 5PGMA 4QWWA 4LRYA 4W8OA 4XVCA 3RPEA 4EUNA 2HLDD 4FMPA 1RQPA 2JFGA 1EWTA 2PZGA 3THOA 1OCRB 4QQ8A 3VO2A 1XJ0A 2QLJA 1AUQA 3AEZA 2ENUA 2VJOA 4OPAA 4L9SA 4ARUA 3PJGA 4N6NA 4LVCA 2A5GA 2H7VA 3GIDA 4JI4O 4FX5A 4C4AA 5AJYA 1IQ0A 2ADFA 3DJYA 3WHIA 1SUBA 2RKOA 4R8KA 4JJAA 1SKAA 2YVAA 5ADUS 2Q68A 1T0IA 2AC2A 3MJCA 4CTOA 2IPOA 5COAA 3I30X 2PD4A 4IVPA 2PLAA 4EEQA 1VLQA 5ICEA 3KHSA 5FP0A 5BURA 3O1LA 2PJUA 5IYZA 3KQLA 4C2UA 1Y7PA 2QYOA 4ISBA 2PY6A 5KTRA 4P3KA 4R31A 2EAUA 4C4YA 5FFFA 4IMPA 3F6PA 3SEAA 3STLC 2BTQA 4CDRA 1JWBB 1I08A 1H1LB 1RC1A 2Q3LA 2CEAA 3QKSB 4UTXA 1X86B 1QLEB 5SZJA 3H9BA 4QSHA 2QWOB 3D6FA 4RD3A 2CYAA 2HIGA 1U7OA 1BSMA 2YJ5A 5B3JC 3DGFC 5CDTA 4AX8A 1HT3A 3U0BA 1AH2A 2KBEA 1FRQA 2ADQB 3QF7A 2C78A 5L3SA 3MTBA 4FLEA 2WIKA 5C8YB 3A9SA 2Q3DA 3CCEV 3AVXA 5A0FA 3FAVA 1G9XA 3LDEA 1UDXA 3RVOA 1QOPB 1AK2A 5LBUA 1WIWA 1L4GA 4PA7A 2H6EA 3PHBE 1IK6A 4KMSA 5KVSA 5JYCA 4N0QA 1RJGA 3T3OA 1O4VA 3F5MA 1QQCA 2RAUA 3REQA 1KL7A 3OEHA 5CNKA 2IOQA 1ZU5A 4QU0A 2JFNA 1SG0A 3ZZTA 1KAQA 4M55A 1EBOA 5FDFA 3MOGA 4J0CA 3E5HA 2HF2A 3ZHVA 3P0RA 3LT2A 1FXUA 3V42A 1PZEA 2BKAA 4MRNA 2V97A 4UW9A 2HPAA 3I6BA 2JIZA 5FL3A 3A70A 4NWIA 2ORWA 1YJ9V 3LX8A 3BDVA 3JVVA 4RZXA 1EMDA 3KOWA 3VR2D 3ORFA 4TKLA 5FWDA 4NBSA 4YMHA 3ZMZA 1RTTA 2WTXA 1JMYA 1CERA 5FPHA 3UBMA 4WFGA 2COUA 4Y1EA 1BMTA 1SIOA 2YW9A 3FLMA 3PDWA 3NTRA 1JR3D 4M1EA 1BS9A 4Q3KA 3HVRA 1GNPA 1OPXA 4MB6A 1M7HA 3STHA 3W5VA 1FDWA 4WI1A 1YTFB 1OJ7A 1PBTA 4ESOA 2JZCA 1R3KC 4EG5A 1J39A 1ENOA 3ZXYA 4RABA 1YS6A 3O4FA 1HYQA 3FETA 5B1HA 4Y9RA 2EINB 3Q72A 1TUBA 4V2IA 1JFFB 5IYZB 1E0DA 1ECGA 1PWXA 4L51A 3QVVA 3ZGXA 1JR3E 4UATA 4V38A 1HP8A 5K8LA 2RHRA 1RC0A 1QRTA 2R8PA 4XVHA 5AESA 2BTQB 3CC8A 4YR7A 4AZVA 4DV6B 3L71H 2IJGX 4V3CA 4ZJPA 4JBHA 4FNGA 3L7LA 1CY2A 5EHGA 1YVEI 5EJ6A 3D8NA 2LWIA 2IF2A 4RM3A 3SXUA 2HW8A 2QL5A 1Z5WA 1TF7A 2QA5A 1KU0A 4GMGA 1HNWO 4AD8A 3T06B 3OA2A 6CHYA 5LSAA 2Z2KA 4YHHO 3V46A 4ZEWA 3FAVB 1COWG 2ZBGA 3ZHQA 4XQCA 1L7AA 4MUEA 4BMXA 1DIHA 3ANSA 1VQOV 2JK5C 1ATZA 4AM8A 1UP4A 2XRMA 1CDOA 1FP4A 2DHQA 1XYVA 2DYKA 5HJ2A 5ECGC 4X1IA 4QGAA 1THMA 3AG4C 4I0WB 3DLHA 1FOEB 5ECYA 1ECLA 3QO5A 3REQB 2C7QA 3QUCA 3DYIA 5L3ZA 1RQRA 1KAOA 3STYA 4Q15A 2YJ3A 3IBSA 4FYWA 5DW0A 1KEZA 1O97D 3EZYA 4W5TA 4A1FA 2IFTA 4CKWA 3ZHTA 3H3JA 4OMDA 2PY5A 2OM2A 4NKGB 4BO3A 1J2TA 3HADA 3LGSA 1M72A 1DKLA 1K4CC 1WXEA 2Q49A 3ZV4A 4YREA 1RDFA 2JKZA 4U2FA 2ITCC 3WU2Z 4J0FA 1NQXA 3KXPA 5FEMA 4P7JA 2GO1A 1JPUA 3WNCA 2REBA 1AZSC 1PR2A 1YZBA 1A3CA 2H59A 3WA7A 1M5IA 1XHZA 4ZRDA 2O8FA 2HSGA 4YFVA 3U2QA 1MDFA 1A98A 4L2IB 2QG9A 1CR0A 1QKIA 3IEVA 1KAEA 5K45A 2QAGC 4B8ZA 4EKGA 3V1LA 4JEUA 4JXJA 2POQX 4K9DA 4EJSC 2E89A 1YE5A 1N77A 1BD3A 3ZCCA 3K5WA 3CBGA 4CM4A 2F4VO 3JCZA 4B3MO 3TSOA 1K89A 4OGGA 2HVKC 3SF8A 2FPOA 3KAPA 1BVHA 4DLZA 1GITA 3EVGA 3RRYA 3NBZC 1K7DA 2ATCA 2JHFA 1FNCA 4PYQA 3DWGA 3RIEA 5D51S 1OWLA 2CDYA 4BGUA 1JB1A 2X3FA 2JJ2G 1VHQA 2OM6A 4DRXB 3AOEA 4U2CA 2WSSD 3GLGE 3AUSA 2VP3A 1AZLA 1QVRA 2WVJA 4HWGA 1DJLA 4DMGA 4RACA 3RAFC 4EOGA 4JSTA 4X1IB 4XD2A 1PR5A 1I7DA 4MUBA 5CM2Z 1F3LA 2ZD9A 3WG7B 2VF7A 4O1IA 3OZFA 5JW6A 3FIJA 3DE0X 1HEUA 5GJWC 3HB4X 4G28B 2GCPA 3RANA 5A3JA 1X15A 4UB6Z 3PDHA 2FZCA 2L42A 4BUJA 4HAMA 1J22A 4WWHA 4HVCA 3C5HA 1U99A 1PVOA 3QQPA 1Y6RA 3NT2A 4A6EA 1SPXA 4QTZA 2BY4A 2AE2A 1XXLA 4MARA 5CJPA 2XVMA 5A5GA 3T5GA 3R7NA 2I6XA 4I5SA 1D9ZA 1LBSA 6NULA 1AHNA 3HNRA 4I0XB 2P41A 7MDHA 2Y92A 1WZEA 5BNIA 4AO8A 3WWOA 4JYYA 3JQFC 4M1MA 4QOJA 3MT0A 5KOIA 1UXGA 2IH5A 5AXAA 1Q3TA 2O8FB 1FU8A 3K1TA 2WLNA 1FSSA 1N4AA 5J4YA 2GQ0A 4ZYZA 2GKOA 4HLUA 3DB2A 2ACWA 3MS4A 2H7YA 2N0SA 4LWQA 2PD3A 4YCNA 4M0UA 3S6JA 3L93A 2LFSA 1XZBA 4EQ6A 4ZJUA 4CM4B 3S1AB 1CUJA 4DCGA 3F49S 5B1SA 2VOJA 4Z7JA 1GA4A 3FUXA 1LI5A 3ZMUA 3WA6A 1QAQA 3OD4A 2ZR0A 1EZZA 2PKYX 1KDTA 1FNNA 4PZEA 4KE9A 5AFSA 1S72V 3EY9A 2HLDA 3I6IA 2DLDA 2FZVA 1YU9A 1HORA 4RXMA 3KJGA 4EHBA 4FZRA 2B5UA 1E0SA 3EMDA 2YICA 3PKJA 1GT6A 4B84A 1H5QA 4ONEA 3EQ8A 1PHPA 2WABA 2YJGA 3ODPA 3AQ4A 2WSSG 2Q1WA 1VPVA 4WZBE 4DXDA 4EVIA 2LR0A 3ZQ6A 4BZQA 4XIIA 1E9FA 2DWUA 4MUXA 3LP5A 4D0SA 3BK1A 4HQRA 3Q85A 2AGVA 3R9KA 3SLKA 2OGSA 4Z1OA 4XDKA 5A04A 3DBRA 2PBZA 3R5KA 2BIFA 5FTWA 3H1IH 2CSXA 5JRJA 2AC4A 3DDOA 1MN6A 1UFVA 2P3LA 4EB6B 1XB2A 3AEXA 3UC5A 2UXNA 3AKCA 1KYZA 1EZJA 5JCJD 3OEED 4JYMA 3ZEIA 1VOTA 2ZZNA 3GA5A 3I1YA 5DVZA 3DKIA 2JGDA 5C4MA 2HMWA 2ZYIA 2G08A 3IP5A 1G8HA 5EZSA 1YAJA 2C2OA 2P9BA 2GPTA 1R4MB 3K96A 4HRXA 2GKGA 5C4GB 5CT6A 4CEIB 3O47A 1XRRA 4RH1A 3EWAA 1NSFA 1E5DA 4R5MA 4ZWNA 2AQHA 4B6GA 4DDWA 4ZT3A 4MVXA 2C2YA 4DR2B 3CRAA 4UMFA 4ZJYA 5ITSA 3CR3C 4ZPXA 4JC5A 1V26A 4Q5IA 3KPWA 5JSYA 1W0JG 5ESRA 1KPIA 2FWNA 5DTRA 1UPUA 5K0LA 1JKJA 2DBZA 3EGDB 4CBCA 1N3YA 3GJ0A 3CCJV 2NGRA 3H2KA 1FDRA 2H8GA 2B0JA 3ZPXA 2VRCA 4MVJP 4OJTA 1GP2A 4CTMA 4Y2HA 3A26A 3JXEA 1YVRA 4II2A 2M98A 4RHXA 1C3OA 3U3MA 5HZGA 1DPGA 2HMTA 1XQ9A 2QTZA 2YZMA 1A82A 3U5TA 2YUIA 3HEMA 4Z9FA 1JX9A 3ADOA 4WA7A 4RWZA 1FPMA 1UPBA 3ZCPA 4AL4A 4UHBA 1SC5B 1N57A 4M1OA 4P34A 2ONCA 1XZAA 3LBYA 1G9TA 2FOXA 3AG5A 2X6BA 5KHIA 2P4HX 4H35A 1PWYE 3KG2A 1NVEA 1TQDA 2NUPB 2ZI9A 3REGA 1XXHA 2NSDA 2XD9A 1KYOF 2FKNA 4NOJA 4JT8A 3AESA 1KEPA 2Q8QA 1AN9A 2EFDB 1K9SA 4DT1A 2QZPA 1E3JA 3AEKB 3RT7A 4H31A 4M1TA 3WL5A 5IH7A 3QYJA 1L1EA 3RT3C 5H70A 3DBRB 4H7FA 5IDVA 1K9VF 2VQ6A 4MKXA 1GUYA 2XBMA 3Q8WA 2L82A 4H17A 4RIIA 4QOEA 3PNOA 4BWYA 2MSCB 4Z7NB 5TMEA 4R16A 3DAYA 3KUXA 5MN6A 3K1ZA 4CL8A 4QDTA 2SCUB 4H16A 2EVWX 3G2MA 1X7GA 1GNVA 3WQRA 3KJQA 3WK7A 1NFQA 1UPGA 1F2DA 3WDKA 5DCWA 2JGDB 1SCKA 3PNMA 1Y82A 3RJZA 2PAAA 3E6AA 5A4FS 5E4FA 1P18A 4YRSA 3AVWA 4E4EA 3JWJA 1P33A 3T9BA 2B9ZA 1JKXA 2G4LA 2HA3A 3T5AA 4CFSA 4B4UA 1HYEA 1PS8A 1NMQA 4JQSA 4P2GA 1T36B 4YFYA 3HKBA 2RGNC 5DYGA 1DQYA 2IH2A 3OZUA 1QF6A 3H3XA 2V58A 3RODA 4MITA 1YEWA 1ZGZA 4JAUA 4D8TA 4Q4JA 3RRBA 5AKIA 2XX3A 5HDBB 3NDBB 2QROA 3IGAC 3QW2A 4ZCRA 3VI3B 1NKSA 1ESNA 1G41A 1TM5E 4UE3S 4JKOA 3HWWA 3RARA 5KTNA 1QJ4A 5F7JA 5EIFA 3TR5A 4ZYTA 2Q3JA 2P9JA 3M4XA 4FDAA 1XR3A 1JKJB 5HMLA 4HYOA 2AT1A 1RCUA 4M9XA 2OLJA 1PO7A 3G71V 5K3SA 3CIOA 5CD9A 2C2AA 4X8AA 4DPMA 1C3OB 2CDAA 2RAVA 3PF8A 1NYQA 4LHSA 1SCDA 3VR6D 3LM8A 3U4DA 2FB5A 1PSZA 2AN5A 3FB7C 3K0SA 4UBJA 2AN1A 3AR3A 3LSYA 3M83A 2VJNA 4PX9A 4BNJA 1XJ5A 4HX2A 2ORED 3T1YO 1SESA 4FMBB 3AXTA 3P9XA 4N8DA 3G0CA 4RXUA 2BSKA 4GMDA 4TV9B 1XXHB 4N76A 1JJOA 1I32A 2UVPA 3TSYA 4PG5A 3ABIA 3C43A 3SYAA 1KY3A 4RK6A 4DT1B 5ITZB 1T8TA 3CE2A 3EASA 1ZH8A 2X0FA 4GI5A 1FFTB 4DV0B 5K20A 1JG2A 5H2FZ 2PZAA 1RNLA 2FKXA 1L4HA 4EWLA 4LYJA 3AG1B 4DM4A 2QRPA 3EXIA 4MLCA 4JYPA 5DX0A 4PZ0A 2DWEC 1UFIA 4CDNA 5KX5A 1ABFA 3SKXA 5B64A 2R97A 3UB4A 5KIAA 3BXEA 3T7TA 3JQPA 2P3QA 4J9UE 1JVSA 3QEAZ 4RJIA 1RM4A 3HO8A 4Q01A 2CLCX 4UMVA 4EECA 1W35A 3IMCA 2PV7A 3GWGA 1NTOA 4NENA 5CVTA 4JVOA 3AK2A 1MX9A 3PGLA 3JQ9C 1M0TA 3UYKA 1H94A 4FKZA 1RLJA 5DN6G 3ZCQA 4OY3A 4GQIA 2AZXA 3OU2A 2IUSA 2FW9A 1KFBB 4G67A 2ZROA 2YVQA 3CXUA 2E2WA 4Q4JB 3R3UA 4Y2JA 1T4DA 3AHCA 1EWQA 4PA6A 3FHOA 4OXQA 2O2JA 2HL6A 1GFZA 3KOXA 1FTSA 4BX3A 4PN3A 2E0IA 3GUHA 1E2LA 1GDDA 1UC9A 4PN7A 1DCFA 2AEFA 3P9ZA 3EH1A 4KBGA 2WPNA 1FNBA 1ZN9A 4TRJA 4WESB 2CZCA 1UF9A 1VGQA 1CNFA 4PAMA 4M76B 5I5EA 1U5AA 1WBJB 2MOKA 2JW5A 3K2QA 3OCUA 1C0LA 1THZA 1JSCA 1WCV1 1RI5A 1TLTA 3MCUA 2HRZA 1YK0A 3N8KA 2O1EA 3IV6A 2XAJA 3E8GA 1GO2A 4X60A 3DT6A 3I56V 2PH5A 2AEEA 4MPPA 4L95C 2C7GA 3EAFA 4IYIA 1H2BA 1V2HE 2QTRA 1SBCA 3DXYA 2GN4A 1OBOA 1V55B 1RJ9B 4FFOA 3DEAA 3JYCA 3NEYA 1LBIA 2XA1A 2PGXA 2UVPB 1FMLA 5A4DA 4AKIA 3FB8C 2GZHA 4WV3A 2VNHA 3SVZA 3Q3VA 5BR4A 4POAA 1EXMA 4IOKA 2CVFA 2RG7A 9MHTA 4WOKA 1TX4B 3CV3A 1C7RA 3VNUA 1DTWB 2CD9A 2BISA 2DECA 3VU9A 2GEKA 3SQWA 2TECE 1LTHR 2V5VA 3TLZA 5KX5B 4NCXA 1IN5A 2QX4A 2GO7A 4C0KA 1LVGA 4NAUA 4W5QA 5JDCC 3GXBA 2WHQA 3DHNA 4RTPA 3NTUA 3I2KA 1K6XA 4MOWA 2DFKB 2YRWA 3GLUA 1V47A 3W6PA 3GLGB 4LFBB 4L08A 3KSAC 4DXHA 3E15A 3DZKA 2WD9A 4QHSA 2VBFA 3LKDA 3LUPA 4TLLB 5JS6A 1IEVA 2G9UA 4QUAA 3VH1A 1B26A 3ENKA 1MMFB 2QUHA 3CNNA 2QD3A 2IUYA 5FBLB 1KMNA 1V4BA 4FFBA 2YZNA 5AVZA 4TYNA 2Q3EA 2AZMA 1U7UA 2VUHB 1TKCA 2YHIA 1XZQA 3BHIA 3T1TA 4A2QA 3IQEA 2H3HA 4PM4A 1GG5A 1T0PA 2HC9A 2BHNA 1UKZA 1K3EA 2YN2A 3C39A 4OI0A 2GBCA 3LUAA 5AJWA 4II7A 4U3JA 4XYLA 1E64A 4G4IA 1XK6A 2BI8A 4YECA 4JBXA 3TPZA 5JJKA 5BSGA 4JLOA 4ZEXA 1GPH1 4Q9JA 4Y1FA 4DV2O 1NSYA 1D0SA 3HXKA 1C9DB 1U1CA 3SR3A 1HSOA 1J8DA 4ISCA 1B6QA 1VI5A 3N75A 4NXNO 2R96A 3AL0C 5IS2A 3CVYA 1CWUA 5JYEA 3TR0A 3VJLA 4AQDA 4ZV4A 3KLOA 3ETQA 2Z9BA 3DP7A 2G1AA 3GA0A 3HN7A 2MW2B 3ZHXA 1KTIA 4U3FH 1WX1A 2ZSFA 2JLZA 3EDQA 4NCAA 1ZZEA 2HTFA 4V39A 1MSWD 1N9GA 3GJQA 4D9BA 1YVDA 3T4XA 2VYNA 1PD1A 3DGEC 4O8CA 4YRAA 2Y0DA 1V45E 3JPWA 2ZBRA 2WJPA 3WGUA 3J81A 2LGWA 3H5IA 1QHXA 2IW3A 4L72A 1JIVA 3I64A 4PAQA 3EF3A 2Y2VA 1NVKA 5EQTA 4NYJR 5EC2C 3K05A 1E5VA 3D64A 2XQIA 1C7IA 3W7WA 3FZYA 2GZAA 2B7BA 2XQGA 3WS7A 5JPIA 1Z0FA 5G4LA 4V24A 3ZXXA 3H4IA 1P1BA 3S2GA 2G17A 5IJXA 1QP0A 3PE3A 1XZHA 4WZBB 3PXGA 4RGVA 4V0LA 1A04A 3QTTA 1Z5ZA 4NJMA 3RTDA 1CC1S 3Q11A 1J0CA 1KUQA 1NSTA 3PTLA 4WJKB 5EIEA 3ZWMA 1ZD5A 1JBQA 1T9CA 4B0PA 2GYYA 5FRDA 2WTEA 3PEVA 5DNYB 4OQMA 2HJGA 3AG7A 2BI7A 2DRIA 3W05A 4K8OA 1TO6A 4KUHA 3SPXA 1AJQA 1FDUA 3ETHA 1FXKC 5L95A 1UPXA 3A4MA 1IDOA 3CN7A 3D6MA 2YHIB 5KVQA 3OX3A 4CJXA 1XTJA 3PN1A 4ASUG 2MYUA 1EBUA 4X66B 1LS1A 1N5JA 3AW9A 2B1IA 4KRGA 5CMUA 5JTUA 3EW7A 4ALIA 4O33A 6LDHA 1Q0ZA 1D2DA 1PGJA 3OE4A 4G3XA 3I1JA 2A9VA 1RRGA 4QKQA 2GJ4A 1GD1O 1DKRA 2IYSA 1KJZA 4DIMA 1IRIA 2JBAA 4IXNA 2V7QG 4UVEA 4RFVA 1SN7A 2XT6A 3SPGA 4PQRA 3G1UA 2W2PA 4GWLA 3H2IA 1WY5A 3H5RA 4DB2A 1E1RA 1NI3A 3V8EA 1ISIA 4F3CA 1GVHA 2R6AA 4OJKA 3OM8A 3DPUA 1U3TA 3L8FA 2JFXA 3KOUA 4FMCF 2IBSA 1WP4A 2R8XA 1C0EA 4WK2B 2XOKG 4DL9A 3ZVNA 3VKGA 2OEPA 3VPCA 1G42A 4IYJA 5I51A 5B2ZA 1T0UA 4AP6A 1G1MA 4WLVA 5JDIA 2AEJA 2DUUA 1QHHA 5FI1B 3C74A 3T1HB 3RVNA 2LE0A 3FOWA 5AKJA 3RC2A 3WLJA 2V45A 2Q0AA 1P4AA 3K5IA 5CAEA 4O29A 2G8LA 1L8AA 3R0XA 3D7SA 5A5DA 3B4SA 2DR0A 1G2OA 1T35A 4JLMA 2X6CA 4X9QA 1O77A 2PTHA 1VSQA 4ABMA 1U28C 1JG3A 1NR5A 3RRZA 3OE7D 2OHHA 4Y6PA 3EXHA 4NBVA 3OIUA 2SICE 4ESHA 4H0CA 3IAYA 3I8XA 3ORHA 1AS2A 3JWPA 3KBBA 1SBYA 3QE0A 4TTSA 4D4KA 1JZSA 2FQXA 1DT3A 3P2YA 2IODA 1YBMA 2B92A 1A69A 2BYTA 2W0MA 4MW4A 3GZ4A 3ZGZA 4F04A 4EZIA 1RRVA 1G8AA 1YDEA 3EVZA 2AJLI 1T9ZA 5ECDA 4PDRA 2AHYA 2R6CA 3OTWA 4F45A 1JNYA 4M21A 5IJ9A 4KREA 1Y34E 3FOEC 1JJBA 4Y9UA 3AK3A 1KR2A 4NAVA 3TWOA 2C04A 2ZXEA 2I22A 1D09A 1ND6A 4QPCA 3R7WA 1ZJ4A 3JZDA 4AJNA 4R1PA 3F6CA 2AW3A 1HDXA 3WL6A 1R0WA 2QE7G 3LDAA 3CWQA 4WZ6A 4GDMA 3QXHA 2P1ZA 1M4UA 4UNRA 1QKKA 3MWJA 4W7SA 2XPCA 2HK8A 3HR0A 3HO6A 3L1VA 4ACAA 4A3SA 2PJRA 3GMSA 4C4XA 4QLAA 4UBMA 2NO6A 1IUNA 3TQIA 1QVVA 4NZPA 1MRZA 2IVZA 4MZXA 4L6CA 4UDOA 3WRYA 2B4TO 4AI8A 4PC3A 3V8QA 4MA4A 5EWMB 4IT5A 5FUYA 3UANA 1JEOA 4AKGA 2BEVA 3OC0A 1B43A 1PJLA 1V96A 2VPYA 3J81k 1L5QA 2YHAA 1LW7A 5F12A 4FSHA 4GSKA 3CNQS 5K0NA 1RQ2A 1UDCA 5B1BB 4CKEA 2BMJA 1OLSA 1A5ZA 3W4JA 4K35A 4HWRA 3V1KA 4KPUA 4Z9XA 4A8JA 2HCFA 1QHHB 4ABTA 3ASNC 3MJ4A 4FLWA 5EKSA 3UNXA 1G8JA 1T5SA 2C5HA 2FUG6 1JA0A 1ZAKA 1OCCC 3IUBA 3QPBA 3FB4A 1FFYA 1E1NA 1LFDB 3U7HB 4I1YA 2ILTA 4UNIA 4QUJA 3OE7G 4CMIA 2Z5VA 2GDZA 5CFMA 3EXHB 1JAZA 3QU9A 4AY5A 1CRZA 4KAXA 4URZR 3UXHA 1DWQA 1QR9A 1A7KA 3N53A 2I3BA 4RD2A 5CB4F 2YXHA 3ESQA 1REQA 5H8WA 4ZICA 3RSQA 1YJQA 1QS0A 2K9PA 3P0FA 3SHOA 4IQ0A 2C2XA 3G88A 4CTKA 2FHPA 4BATA 1B1CA 3ZU3A 3WOVA 1O2DA 1S0UA 4KWIA 1X8LA 4NOLA 1TMOA 5JZMA 2QMOA 4IIGA 3VU8A 4S1NA 2ADOA 1ZKDA 4P0TA 3TJMA 3CTPA 3S5UA 2PQ6A 3WMWA 5AK5A 5HOEA 5IJ9B 5CYGA 3K4PA 3LDGA 1S4QA 4OXIA 3ET5A 2F3QA 1EDEA 3AU9A 3UGQA 1TXGA 2H5LA 1ZEMA 3NAZA 4XYEA 3EEQA 4HP8A 3W2HA 4CL0A 3UM7A 1IMOA 3ZE6A 1GM5A 2UVQA 4CQNA 1T5TA 1MJGM 3IR6A 1WO8A 1Y8QA 1H2MA 1GGKA 1ZI9A 1GTL1 4LRUA 1JU9A 3W7AA 2HSEA 3CRVA 5EUQB 3F6RA 1M7GA 5K0EA 5FEUA 2UAGA 1KSFX 1FDOA 3Q2KA 1OBHA 1U6IA 1VF6A 2PT6A 4ANFA 2PMFA 1CLEA 1L5HA 2BEVB 3HU1A 5B7QA 1XHEA 3THXA 1KYIA 1IU9A 1CQJA 1W2WB 1NVTA 4X1OA 1SQSA 4CKEB 3C1AA 5BRNA 1OLSB 2QNIA 4B73A 2IYXA 3KR0A 1AV7A 4Q93A 1RACA 3FTEA 4E2WA 2VHYA 4Y1RA 3PA6A 1OSNA 4Q66C 3SMQA 1GV1A 1LC0A 5D5PA 3DBLA 4CCAA 3AB7A 3QOWA 5LQUA 3PWKA 2ODBA 2WJZB 4N03A 4Y6LA 1WCXA 2MMCA 4B3JA 3MINA 4MS2A 1ZBDA 2EOAA 5DRTA 5CTAA 4EMSA 1RAIA 4CMIB 4LVUA 1L7VC 3CX4A 4MV7A 2Z5UA 1FPQA 4XPIA 4EW1A 4I9QA 1RHMA 1DXQA 1REQB 5EIBC 1QHNA 1GN4A 3AUXA 5JC8A 3LZDA 1U9IA 1QS0B 1O8CA 3LC0A 4JI6B 3C4VA 1E9VA 2W2MA 1KMHB 3FPSA 3LZ6A 3HCPA 5IVPA 3R44A 5B1YA 2GD0A 1MO5A 3CUVA 5J4VA 5DTIA 4DCSA 1YDFA 3ESAA 4IOJA 1GAWA 2PYJA 3R3XA 1JG1A 3R40A 4ARCA 1SD5A 4ERXA 2Y1KA 3OCJA 4LHXA 2B37A 3KPJA 1V25A 1X7XA 4DS3A 1CUBA 2GBLC 1BEZA 1NOIA 2FWMX 5FWYB 4TSRA 4QASA 2ZTSA 4FKBA 3DHWC 1GZDA 1YL5A 5I01A 1R8YA 3ANYB 2HCJB 3OQVA 4WXYB 3R66A 2OCAA 3LA6A 2RHDA 4L87A 4N4AA 3CH6A 3GEHA 4JC0A 4YMWA 1Y98A 3VDMA 5ECWA 2C0CA 1KJIA 2RQ6A 1G1XB 3D8SA 3QPWA 1C30A 1Y8QB 3A3OA 4A8HA 4QLOA 4AU1A 1EFTA 2FPGB 3R24A 1Z12A 1QKJA 3L0ZA 2O5EA 3U7QA 3IS3A 1FJGO 5FXMA 2PS1A 3EA5A 4GYJA 4NDZA 1WB5A 4KW7A 1Q82W 2ESRA 1L5HB 3R0QA 2NW6A 2CWDA 4Q18A 1U6KA 4FX2A 3KXKA 4L7VA 2HUNA 4LZOA 3BIXA 4HNRA 1HK7A 1FS4A 1NBMA 3KNZA 3JZFA 5DBHX 3WIVA 4C22A 2WJJA 3G6WA 2YS6A 5L3VA 3A2NA 2NR5A 1QQAA 4NK4A 4PPNA 4OHFA 3SF0A 5C8YA 1X0VA 1GTZA 2BZ0A 3LO8A 1V3TA 5CFQA 2P79A 3B85A 4Y1RB 3B3GA 1PLKA 5B1AB 3DE2X 3K08A 2O50A 1L1FA 1Y9ZA 1C8VB 1U0FA 3AG3C 3JY6A 2ECFA 1SVOA 3IMGA 3DD1A 3L8DA 3SP1A 2HRDA 2MYPA 5HA5A 4RIGA 2WJ6A 4Z4GA 2FLWA 1C3VA 3T1OA 2NQ8A 3IT3A 4IL5A 1IHDA 4X88A 2BV3A 4OSEA 2FX5A 4MVQA 1MOQA 1R6KA 3RAGA 1DC7A 3O1HB 1S8NA 3OE1A 4ETMA 4KJXA 2GASA 1L5WA 1XQWA 1TC2A 3SQOA 1F0PA 1KXZA 3KUCA 4WKPA 1HE4A 1MHPA 4DMKA 4RWEA 4Y0NA 5D5QA 3JVIA 3H2ZA 4Q00A 1EN5A 1YWGO 4XW2A 4BCBA 3CLTD 3OM3B 5ALYA 1UKEA 4LCUC 3VXKA 3QITA 2AN9A 2XUDA 2Y3IA 3ZC3A 3EUFA 2I7TA 2LW7A 4XDJA 3JZMA 4HFNA 2OQVA 1X7XB 1KSHA 2GNPA 2HXGA 4QXOA 2MSKA 7GPBA 1KR5A 1Y6JA 4N65A 2HA0A 1P3JA 5EOVA 3JU3A 3ANTA 4HNHA 3L74H 3ZWQA 1T6BY 2OHJA 4H6XA 1VKZA 1P4SA 4PW0A 3PUZA 3VJKA 3QEJA 2CLIB 2JRIA 2PX8A 1AO3A 5MGBA 5JV5A 2J9YB 1C30B 3S0JA 4G8DA 4G26A 4YRZA 2V65A 2NT4A 4YMVA 3NHBA 2GTPA 3O9ZA 1Z0AA 1JFFA 4JNCA 3U7QB 1JXOA 4H15A 4QJ5A 3KD3A 1K92A 1TVKA 4YMUA 5JR3A 5AP9A 1CY0A 1NMEA 1XELA 4INOA 2B4QA 3ZK8A 3PC4A 3C3WA 2VZ0A 2X0EA 3K53A 4YONB 3ZDDA 2Q4BA 4KIGA 5H6RA 5DM0A 3BFJA 2NO1A 3A2MA 1VPTA 2ZXWB 3AIOA 3OT5A 3RNLA 1RLOA 1YRBA 3G0BA 2VNAA 2EEZA 3AW8A 3BSWA 2AR9A 2DYRC 1OIWA 2I62A 2C9DA 2EBOA 3H1EA 2OSVA 1COWD 4NCKA 4D7AA 4KXVA 2JFHA 3CZCA 4AG5A 1JV2B 1CKEA 1EQAA 1H42A 1MFPA 5WRFA 1SUEA 3QENA 5G41A 1FFHA 1I6WA 4CG0A 3M1AA 5LIPA 2A4KA 1P4HA 5CBFA 2R70A 1JYSA 3EWIA 3MC1A 3M5CA 5T7BA 4A0GA 4FHCA 4XB2A 3ZZ1A 3VGPA 3USCS 1FJ2A 1DU4A 3WHKA 3V7YA 4CCYB 3QUTA 1BW9A 3HWX1 4M1SA 3BXPA 4UBOA 1DX4A 3VDRA 1RI4A 3ZV5A 4U7NA 4P6VF 2IZ5A 4L73A 3IH5A 2Q9AA 5TB5A 1YS2X 3B51X 4CDGA 3REFA 3VYSB 5KNCA 3DMFA 4XCVA 1DTSA 4LQCA 2M6SA 4IG4A 1QANA 4GP7A 4Z4IA 4KB5A 3T1NA 2DVMA 4OXKA 1JA9A 4BMCA 4K6FA 3PQ5A 3ZN2A 5JAQA 2YXYA 4PLVA 2FA9A 2O7SA 3K7EA 5LQAA 4KXYA 4L2IA 3W4IA 1EK6A 4HO1X 2JLXA 1PR9A 2H1FA 2E37A 5D6OA 2HJHA 1PG0A 1VQ8V 1OPRA 1W48A 3FJYA 3C8HA 2Q62A 4EG0A 3LMKA 1HV8A 2A7XA 1QTNA 1BYIA 1S8OA 4MQFB 4GWKA 2R9IA 1OXTA 4B2PA 1S1CA 4EG3A 3H2HA 5JXHA 2CMKA 3DE5X 4CKCB 1TVKB 5LU9A 2YWJA 2FGJA 3F6SA 4J7ZA 5EVJA 2O0KA 2JFPA 1P62B 4B9EA 2Q5JA 1QTIA 4NPHA 4H7JA 3ZV6A 2IPAB 2R1UA 2WJIA 3ZVLA 3HUDA 4AP5A 1E7MA 4M1QA 3LBNA 3LSUA 5H4GA 5AW9A 4OJMX 3W3AH 4Y2UA 3LLUA 2JJ2D 3ADKA 4H60A 4DRXA 1AQUA 2FLVA 3KR9A 1AN0A 3MWDB 4M3NA 4OHKA 4NXMO 3PKIA 3W5AA 1QXSA 4FP9A 3H4VA 1P1CA 4MW0A 3DZDA 3C1TA 3KWMA 4QG7A 5IE9A 3RTAA 3CNBA 5LNK6 2OLEA 1NNLA 3VHLB 4BGVA 3I0ZA 5F35A 1OQAA 4P53A 1XA3A 4B2YA 4M9QA 2C57A 4LF5O 3HHEA 4RETA 1JI3A 1CUFA 1BW9B 4YRMA 4XX1A 4HMPA 1OYOA 3AGPA 1A7JA 5F51A 3MT7A 2A9PA 2X86A 3UV6A 5F9FA 2AMJA 2OECA 3BRSA 1VL5A 1RHQA 1R3IC 5EE1A 1XHXA 3AUYA 4DOMA 3ZTWA 4QBFA 4NYIR 5C32A 5AXBA 4JYZA 5E7MA 3VSDA 4NS4A 3AMVA 1Z9BA 1AKMA 4C6HA 4P9PA 3PF9A 4I0XA 4NBNA 1BHSA 2VHZA 2PFKA 3VKWA 2CF5A 4KYVA 1UJWB 1OI7A 1NMYA 1EGVB 3IQIX 1C81A 4CR8A 1GSOA 3MB8A 3PXXA 2B4KA 3JCUZ 2VWKA 3BIWA 1JH9A 3KEMA 5BNFA 4HQFA 4C7VA 4FWBA 3DHVA 3PE6A 2H4XA 2UUOA 5BRJA 5BSVA 3GFOA 5DOZA 1N2EA 3GVXA 5LQJA 3H8SA 2RGAA 2QLBA 5JVDA 1RTKA 1VI6A 1AKQA 4TYQA 4AG6A 3S1AA 3K3WA 1E9RA 2IDJA 4N5IX 4M7PA 4ZQHA 5GONF 3BRWA 1W0CA 5L3CA 3PC6A 1WF6A 3E61A 3L6RA 5TQ2A 1U2EA 2BGKA 4JB2A 4NF2A 4O4IA 2CV2A 5KU7A 1FMCA 4NV0A 1LY1A 2KQXA 3Q8LA 4JENA 3DKRA 4W9RA 4AF7A 3D0QA 1OFVA 4XDLA 4I9GA 3AG2C 1I9GA 5JJBA 1QBZA 1P5RA 3OOWA 2OG2A 1NJ5A 1NU8A 4MKRA 3A6KA 4FMDB 3WG9A 4LECA 2PXXA 2HM7A 2WLSA 4JV5B 1AKVA 1DWPA 4URYR 4HGYA 1GM9A 1GTG1 1TYCA 1Z38A 4BP8A 1RRKA 2NOAA 3P9RA 5B37A 3ON5A 4I5GA 5DLQC 3RAEC 2X4IA 1SHLA 3FDIA 3T38A 5AI5A 2GTSA 3LP8A 3MMNA 5TQVA 2GCGA 1FQWA 4C4RA 2VDKB 1A5AB 1L6RA 1YS7A 4Y8VA 4YPFA 2G83A 1X94A 3G49A 3MRXA 4Z4FA 1IWPB 3GA7A 2BMDA 4F8JA 4BNWA 1RZRD 3CC4V 2GZDA 3O2QB 1T6XA 1XEAA 5BN5A 2R48A 1M5RA 4U4AA 1ORHA 1NXXA 4EB6A 3X1DA 3ZBQA 4JLVA 4GVLA 5CLJA 5K4AA 5LXTB 5CTJA 1AUPA 4OP2A 1J00A 2XYPA 5L6MB 1ZJZA 3L6BA 4QQKA 5I7SA 2ZUWA 3KE8A 4XRRA 3J7TA 1XDZA 4RESA 1R4MA 1F8UA 2ZRMA 1C0PA 2HI0A 1IBKO 2DFDA 4AY6A 1KY2A 4CEIA 1C5KA 4MYRA 3LK6A 4KDEA 4AIRA 1TA9A 3OEWA 3R6LA 3GH3A 2XVXA 1F2UB 3ECSA 1ODFA 5J1SB 4Q16A 4WE3A 4QJ4A 1JQDA 1FZTA 3H1BA 2LGJA 2V7EA 4IJVA 1G16A 5DE3A 3X0DA 3L06A 2V8BA 2N9UA 4EL0A 4LF4O 5JVDB 1M1ZA 1HETA 5ICSA 4K8ZA 1W0JD 2MIIA 3KQKA 1EG7A 3NFYA 3MQ4A 4RE5A 1GK9A 1CZOA 3L8HA 2FB9A 3SBEA 4NTZA 3EGDA 5KHHA 3GB7C 1OX6A 3IURA 2Z1MA 1V39A 5HTOA 2HBQA 3EBLA 1E2GA 3T8YA 5FR1A 5TQ2B 1W4CA 4O4IB 3RROA 1FP6A 3ZRWA 4UU0A 3CEIA 4MP3A 3RO7A 1P80A 3D81A 5BQ3A 1S96A 1HR0B 1HE1C 2HLHA 2IPLA 2O3JA 5F2VO 3SYTA 1JW9B 1DI0A 1PFUA 1K88A 3TL6A 1MX3A 2NUPA 4KQ9A 4HADA 1S9HA 2A0KA 3FSRA 3QLVC 3OOJA 1U0LA 1Z37A 2FETA 4UFZA 4XM0A 2A3QA 2EX0A 4YQZA 4JPRA 5IJWA 1FP1D 4OGFA 3AEKA 4CTNA 5A62A 5TXGA 5IFKA 5T4EA 4RSRA 5F7XA 2B21A 1OKKD 2IA5A 2W48A 2Y1XA 3A9RA 1PNVA 3DDNA 2P3SA 4OBWA 3X1YA 4TXJA 3C5EA 3SX4A 2X3YA 3M8KA 1FX1A 3U3JA 2IC5A 3CVVA 2Q4OA 4MUHA 4U2KA 3FY4A 3PJEA 5BN5B 4BRUA 2WHXA 3BXXA 1VYVA 1GTJ1 2SCUA 2Q0SA 2YSUB 4YH1A 2O48X 4QPJA 3BAZA 2XAHA 1FSPA 1NTMH 4L0QA 2ZRJA 2XIQA 5ERYA 1I3LA 3SPCA 2G9RA 4NQZA 3E0QA 5EPUA 2UYGA 2JA2A 2R25B 3SFZA 3CB4A 3EWSA 1NKDA 4CIVA 2UZ3A 4QTUB 2W70A 4BV3A 1R15A 2L17A 3LWNA 3QEBZ 1G21E 1T36A 1OH8A 1WB8A 3S3TA 5G3ZA 1EI9A 3SHQA 3FMGA 4WBNF 1MGOA 4YLEA 3BE6A 4F4FA 2V7WA 3FTCA 4R51A 4C87A 3FDFA 1PLLA 3WKDA 1T5BA 3GH1A 1WPGA 2AJTA 2AMLA 4BFSA 5KREA 5TVGA 1H2YA 4IMRA 3DSRA 3ZVRA 2ZJAA 1BOOA 1HNZO 1PCXA 5DISB 2ZT6A 1WMDA 4QGPA 1K8ZB 5EAIA 4HLNA 10MHA 2FN9A 4EBBA 1RW4A 2Q4RA 4FLMA 1I6MA 1VBKA 3WZMA 3NEJA 4PC7A 2BGUA 5AKLA 2RBKA 3EVBA 4J29A 5HGXA 1U8CB 1RYFA 5JADA 3AWIA 3ZRWB 3NPAA 2OXIA 4C2BA 4GI2A 4NATA 2QVXX 1B06A 2ROQA 5K0JA 1FLNA 4OUDB 2PPLA 8LDHA 2TS1A 4YJGA 3QTCA 3ROQA 2ABWA 3M33A 3RTCA 3L0DA 4AO7A 3HGMA 2DSNA 1RVDA 3FJ1A 2L2QA 3VR2A 4WECA 3RU2A 2GPBA 4TV9A 5EJ8A 3L79A 4XAQA 4I7EA 5BYAA 1H3FA 1LTQA 2HNKA 1TM2A 1OH6A 5AOCA 1QBGA 3KIPA 4HAZA 4WOCA 3FVTA 3K03A 1FP7A 5ITZA 4JOBA 5FV4A 1JR3A 1GL9B 1Z2CA 2GH1A 3F5TA 1KRWA 1PDVA 3SJBA 1N7JA 1T9BA 1T3ZA 3LY8A 1K5HA 5LD2C 3VC1A 1VKRA 4M88A 5FWNA 2NO0A 1OFGA 3HN6A 5FD8A 3MYYA 3TB4A 2IELA 1W46A 2HIHA 5EXTA 1TPYA 2YV3A 4TKVB 4RZIA 2YBEA 1ZHHA 1XWWA 2G07A 5GV8A 5CPBA 3PJSK 5IC4A 4RTMA 2Q2OA 4Y0AA 3EVEA 1XP5A 3TRKA 1STOA 3WXMA 1J5XA 1PGOA 2J9XB 3BGIA 5DDIP 2XDWA 3OD1A 4I7ZB 2D4AA 3ZQJA 1MG0A 6ADHA 2VQEB 4QXRA 3LQ2A 2NXWA 4XQ0A 5DN6D 1VJGA 1EWYA 3RS3A 1NUTA 5E38A 1JQEA 1I4OA 4OIFA 1TZJA 3R6DA 4RTOA 2DTDA 1YZFA 1UR5A 5EEGA 1V8ZA 5DXFA 1ZNZA 3A6DA 2YW2A 4B6QA 4FE7A 2VSXA 4EGQA 3K9QO 2GNAA 3NORA 3SSAA 2H1CA 3ZHZA 1YZNA 2C1ZA 1X8XA 5HG0A 5FLKA 5AQ1A 2QR4A 2EKLA 4GPEA 3U3ZA 1V43A 4RO0A 3G8AA 1SVWA 1J1IA 4ILEA 1W4ZA 2R8YA 1RWNA 1DELA 5BT8A 1KOFA 3N2LA 4MLDA 4WESA 1CIJA 3ZMVA 2ODTX 4YNBA 3WFIA 4QE9A 4X71A 1QYRA 3R77A 2VH5R 1VHTA 4RDXA 4KYUA 4LOHA 4OSOA 3HJCA 4PZUA 3OZWA 4PXSA 5JU6A 4ZHSA 1JIKA 3KKPA 4R1SA 3Q15C 4GEGA 4YJGB 4RK0A 1HC7A 3R3WA 3N6RA 1F9EA 4KAAA 1UBFA 4KQIA 3V1MA 3UFXA 1RJ9A 1IHYA 1QK5A 3Q8MA 1VKHA 2VXCA 3H97A 3PIRA 2VPIA 1IL0A 1ZN8A 4ZU3A 7MHTA 2VI5A 5ALDA 4DR4B 1O95D 4Q4DA 2Q0HA 1NXSA 2CDBA 1TZMA 1ITZA 2QLNA 2WV7A 1WV0A 3P94A 1ZK0A 2D2FA 3PPWA 2WDZA 3O0DA 5A3SA 1N8RW 5E8JA 4XRGA 2D3TA 1TQHA 4AJLA 3STTA 1ABEA 3V7NA 3QMWA 4REQB 2J32A 1YKFA 1DTWA 4HDSB 3LVFO 3ZWPA 3RUEA 5IY5B 4FZJA 3LUBA 1NBEA 3VR1A 1FLAA 3GVHA 4M98A 1XPJA 1R6UA 3NDPA 4OK3A 3BWXA 5B5SA 2OBXA 2QKAA 4OHZA 1PGPA 4J7KA 4MIOA 4I5DA 5BV8A 5DBOA 4I9UA 3FGZA 4L07A 1WPBA 3OA0A 1UKCA 1VZ3A 2Z6QA 1O94C 3GLGA 3WTBA 1PT6A 4E2XA 3E8FA 1BVUA 4YDRA 1ZAYA 3O8RA 1PHRA 2WLLB 4YXFA 1XD8A 2WPDG 3VPFA 5TE9A 4LTNA 2GYWA 5CVDA 1A95A 2WSSA 1P6UA 3LUTB 1BDMA 1WU7A 1ONSA 2W0XA 1FVXA 2IH3C 1KQSU 4FC6A 2AR0A 2ZU0C 2ZI5A 1RKBA 5EQDA 3D8UA 2WIJA 4P33A 3KAJA 5GP1A 3V4RA 5HCUA 4GHWA 2RI0A 1YR1A 4U0JA 4HVAA 3B5JA 4F2PA 1YR2A 4PA3A 3K9SA 2WVAA 2ZI7A 3H99A 1OCOB 3ZCRA 1NXWA 2AQIA 1BWPA 3GUZA 4LFCO 5L3GA 1KFJB 3DDHA 4B7EA 5CX1A 2B3DA 1CF4A 5LLTA 4P2ZA 1TL7C 4LYAA 2QWNB 2UUPA 4QOGA 1G63A 3IE0A 2ZS9A 1R6TA 2JCXA 3DXFA 4W7HA 1JJAA 1IXRC 5DW3A 1PJTA 4DRYA 5JNVA 3EBPA 1BSVA 1KU6A 3GV0A 4UFPA 3ZHBA 2P69A 3QPCA 3MFQA 2ACEA 5FBVB 3UFXB 3JSNA 3DZHA 4CPDA 1C4WA 1MNAA 2PZSA 2HO5A 4HF7A 1YU6A 1LV7A 3I9LA 1GRCA 1H2EA 2VDQB 1A2BA 2XECA 2Q9CA 1GG8A 3O8CA 4DZTA 1OH7A 2QSZA 1NT2A 2EW1A 3BL5A 1PL8A 3I39X 2YY7A 2A0UA 4TQGA 4D82A 2W42A 4ENTA 3TO5A 3MM4A 3SQDA 4W8HA 4PAOA 4FVTA 3BXOA 4EATA 3GEIA 4MWCA 1WXDA 3AY7A 4N40A 1QYVA 4P93A 3NHRA 2ZDQA 3R6TA 4E30A 5COBA 1NBWB 3OQPA 5I7VA 2GHIA 4KMRA 3ZGOA 3NHZA 2NIPA 2VZEA 1Z5NA 1LPBB 4L50A 1ENYA 3LK7A 2F1JA 2Q7GA 3TUJC 4B5KA 2XHEA 3FNQA 1GQFA 2IEGA 1T4MA 2NU8B 4RL6A 4ZV7A 3S40A 3HJAA 1KC8W 1M7BA 4WZBA 4ZU1X 1S6YA 2JEXA 3AK1A 1NR7A 3EIHA 4TL8A 3V32A 2HCRA 4IMJB 3K0CA 4YV7A 4WCFC 3BK2A 4Z3OA 2QMUA 1NF2A 3B6IA 1NT4A 3RYHA 3X1WA 5AKEA 3BPSA 1JHRA 1GNLA 3IQWA 3TD2A 3KBOA 3WKAA 5GVSA 2Z4SA 3ESZA 4W1QA 3LCCA 1W4RA 3MG9A 1VECA 5G1NA 5AVJA 2W6IG 4K87A 1DC3A 5HRUA 3VJRA 3SNKA 2WB4A 4U6SA 3K4HA 4ASUD 4CGYA 4LVNA 4LF9O 1C7FA 1T9AA 4PI0A 4F4IA 1K63A 1WNSA 4NNPA 3RVZA 2JFFA 4F0JA 2BEUA 2YC0A 4MVJH 4RWUA 3UMVA 2NO7A 4B2IA 3N86A 4G0WA 5CX1B 1LLFA 4C43A 2V7QD 3AF4A 5EGNA 2IUEA 3LC1O 3O3MB 4HGPA 3VH4A 2XUGA 3JQRA 3ASUA 4NCBA 1MJFA 5JCJA 3OEEA 3MWGA 1UT5A 3NEAA 4YP5A 4HDMB 5JSKA 4PX3A 3QFSA 4YR9A 2BT4A 3SWWA 5H3HA 3GK3A 1BHO1 4TKZA 3CU5A 3WL7A 1UXIA 3E2IA 3N8GA 5JARA 2OFPA 1JHVA 3U0VA 4PS0A 4F4DA 1EFUA 4RO2A 2O3SA 4HVTA 1GARA 3UHAA 4YRQA 3UXYA 1NT2B 1S89A 2ZBDA 2CE4A 3C7TA 2JHGA 2XOKD 1XNRB 3OF3A 1MXHA 3EGIA 2XE4A 1AX9A 1U3VA 3I3SR 3W1VA 4KK3A 1NP7A 3QA3E 2XD4A 3OHMA 2MU1A 1T9GR 1SIUA 4YLGA 3ZRXA 1DMSA 2ZVPX 1UJMA 3A6ZA 5AKHA 3TRFA 2WYWA 4FNMA 3PGVA 2PX4A 2YRXA 4RV5A 3QXJA 3G3EA 4KH1A 1HKUA 3WFVA 1K7SN 1DV1A 3H3FA 2Y1DA 2FMTA 4OV6B 2OB2A 3OZIA 4O08A 5IMBA 4G5QA 1DJQA 2WSLA 4GYKA 1N75A 3VNBA 3DDZX 1B0ZA 4B3IA 2CXXA 3AM5A 4U9HS 4MAMA 3FAZA 2VP4A 4FM0A 3NH9A 2ZI3A 3EXFA 1FY2A 4TMVA 3MJRA 1ISRA 3RYHB 3UJ3X 2WVGA 5C80A 1F4VA 1HYHA 4E5MA 2G1PA 3L0SA 1CF9A 4EGCB 4DDUA 2O5RA 1A5SB 2IYRA 2POCA 4N1AA 3F3MA 3EA0A 3GRZA 5JWRA 1ZH0A 2JKYA 1ZJYA 4FEYA 2NO4A 2WWVD 4KX3A 2IP1A 2C97A 1XNGA 3EPJA 3TXQA 3IP6A 4RGYA 1EZ1A 5JJEB 2XCQA 1MU0A 2BEUB 4KMOA 4OFBA 4C88A 1TT5B 1CUAA 4MWEA 2QE7D 2QRQA 4ND4A 1FSZA 2A6PA 3TRIA 3UKOA 1CNMA 2ZIAA 1EVIA 3UWSA 3VA7A 1NG9A 1QBKC 3ANMA 3B6MA 4GX2A 2ACVA 4F11A 1Z2NX 1ARZA 5CDGA 2B1JA 2VPQA 1XCMA 2I7CA 5B12A 2I9KA 4ZJZA 2P2DA 1B7GO 1ULTA 1JR6A 2DSTA 3L7BA 2ATKC 1K06A 2GJAA 1UBTS 2GYUA 2O0MA 4OQ4A 2CV0A 4B75A 3Q7SA 3IPRA 4URFA 4Y18A 5EWMA 1RBZA 5FFNA 5I7FA 3OGIB 3AY6A 5DSTA 4D96A 2DPMA 4YUZA 2CL7X 2XMZA 2C7BA 4B87A 2O57A 2VNIA 3R5JA 3P2OA 1ZN7A 4YJ3A 5LLSA 4L8GA 3BEDA 2VBIA 3L8EA 2Z8ZA 5KKCA 2CHEA 1ZLYA 1U98A 1G8PA 3LT5A 1H0SA 4WCVA 2C20A 1RWPA 1T3HA 1M9NA 2HHLA 1DKNA 3PX3A 4FM9A 2B25A 4U6NA 4KKXB 4DUYB 5BQ5A 3NU1A 3STVA 3U10A 2FSPA 2VYFA 2HJWA 1ULZA 1OFUA 3SBOA 1N4DA 3K16A 1TJ4A 3HCCA 4WW0A 1NC3A 4I1OA 2GUWA 4RZ3A 3S29A 3VR6A 1SXHA 3H5WA 3M5PA 4Q1CA 1V41E 4OPMA 3ORQA 2A06H 2FVYA 3N6VA 4H7KA 1LC3A 1NLMA 4IDFA 3OTOB 3EXFB 2AD1A 1EQ2A 1H2AS 4YCJA 4EP1A 5CGZA 3F90A 4LXIA 1TFRA 5FNZA 3VNQA 3GGCA 4N3GA 2B9EA 4EAQA 1YDMA 5E8RA 5A6SA 3EIOA 2YXEA 4UREA 4BO7A 5K0FA 3W5DA 4KTTE 1XDSA 1YJ5A 2QGZA 1FLDA 3ASOB 4Q1FA 5EGSA 3IQGX 3KKOA 5ALXA 2OV4A 2EJRA 2CVPA 4LWPA 4DCMA 4D9HA 2UXCB 3S4YA 3U62A 5DBEX 4EG8A 4DCVA 1PVDA 3RH0A 1Q5OA 2EP5A 2I4TA 1Z18A 2VAWA 2H51A 2CXSA 3WJ7A 4O2AA 4NONA 3UK2A 5FTNA 1U0OC 2OO3A 1SCUA 3NP7A 2QEQA 2W58A 1QK4A 4H7PA 2OCLA 4DW1A 1KHTA 1TK3A 1CP2A 4EHIA 1VE5A 3ZJZA 4ZAGA 3AH8A 4UTPA 2HSWA 3JQAD 4A15A 2VP0A 4YI3A 3ELYA 3MF4A 2NP6A 3E05A 1TD1A 1NVGA 1YRQA 4G1MB 1YL6A 3WGZA 2Y27A 4REOA 1OX4A 2OWOA 2R4UA 3IESA 1KEEB 3E9EA 3CRQA 1OYWA 4QXMA 3CF2A 2ZR7A 3QI7A 4OMCA 1CP9A 2QP9X 2EJWA 2XKJE 3I12A 1SURA 4DR7O 2Y76A 1Q81W 4YJ3B 2ZVQX 3NHYA 3GWOA 3L7AA 3LYAA 2CW5A 3TL3A 1RI1A 2F93B 4IZ6A 3SYPA 1NLZA 3D59A 1YDGA 5IP5A 4MQ5A 4J7XA 1FUIA 2JGUA 2AW5A 4LYFA 3DC7A 4OLBA 4IQGA 3ESBA 4G63A 5AVQA 4B5LA 4A82A 3W2TA 4QNRA 4AWXA 3ZGLA 4BBJA 1XZEA 1JQAA 1T91A 4RZHA 2B30A 1Y6GA 1P1IA 4WFEA 1T2DA 3O3CA 2Q4EA 4MTOA 3AEIA 4EFBA 2VNSA 2V3VA 5JSQA 1FVFA 3WB0A 5I9IA 3SHVA 3F3SA 5DX8A 5P8WA 1G66A 2AN3A 2Q5HA 1Z5VA 1NUUA 4UARA 3HDGA 4UCUA 4UXJA 1KMHA 1P0MA 1E3SA 3G2JA 3RVDA 2JFWA 3INNA 3PYXA 4GZLA 4HDOB 1XN1A 4JXKA 3E4DA 2X1HA 5A6SB 1VG0B 4KP4A 2WA4A 5A3RA 4YV2A 2RGCA 4HOYA 3G2OA 4QHYA 4ZBMA 3D43A 4QOFA 3DM9B 5BV7A 2Q8NA 4W7IA 2GTHA 4RX1A 4BJ1A 3GFFA 2I3GA 5FWYA 3BB4A 2Z9CA 5IJZA 2WT9A 1D6MA 2PUJA 1PD0A 4O2AB 4D46A 1SCUB 1YZVA 2B5OA 4W6ZA 2EBFX 2XZPA 1YOBA 2ZWAA 4I99A 3H7AA 2A9JA 1TCVA 2O3UA 4H4EA 5DFAA 5HUHA 1CJMA 4KHPO 1Y8RA 1RU3A 3CF4G 2FPGA 1V1MA 4QPZA 2DYSC 3U49A 3OTIA 4EVSA 3OY7A 4PSCA 3V4LA 4K9KA 4U5XA 1JKFA 4M0LA 5FTMA 2ZDGA 3C3TA 2FLKA 3TR6A 3IQFA 4DADA 2HFEC 3ZOKA 1IOLA 2D1YA 4DXAA 1OX4B 2PX2A 1FMFA 3E27A 2H3OA 4ZCTA 4NECA 1R74A 5J4HA 2JI9A 3VMMA 1IOWA 2XCRB 3E7FA 2BFDA 3PWSA 4PNEA 1NIJA 3Q5EA 2VP6A 2V7BA 3AL3A 2MR5A 4EPYA 2QW1A 4I08A 3W9UA 3GDGA 4PDLA 2AIRA 3BXGA 4ALLA 4BVAA 3KS9A 4B45A 3R5SA 3D5QA 4C7OA 4DF3A 2H7XA 4IIJF 4HEQA 1HTBA 4FTWA 1Y4SA 3FWHA 4UHJA 1ODJA 3DHYA 1SB8A 1B0UA 2WD8A 1N8TA 2CHUA 3TRDA 3GN1A 3ZJVA 1WG8A 2IXDA 1ZC3A 4Y2SA 1J2RA 5KYXA 3PNYA 5H9VA 2CT8A 2GGSA 2AL7A 5BNWA 1C2YA 3R76A 5CW2A 3TZHA 3HLTA 4E3ZA 3AI7A 3QSYA 4ITRC 3TJZA 2ZJ4A 3BJZA 4KACA 4BE7B 2OCYC 4G1VA 3O1JC 3UJAA 2Y66A 4QUBA 4ACBA 3PDJA 1B2LA 1RMQA 5KYTA 2PUFA 3DMNA 1XMPA 3M2TA 3OD5A 1GAEO 4S1VA 3IAM6 1YQQA 2FWJA 4A2CA 1BGVA 1RP7A 1KIMA 2ZUVA 4PGFA 4MO9A 5KWJA 1J20A 3HP1A 5A9RA 1ESMA 3DF9A 3DMRA 2X8LA 4FDVA 3RRXA 3KVOA 4B6EA 1IZ0A 1BCSA 5JMPA 1YB1A 3P7MA 3RSZA 2ZT5A 4BN0A 5H7XA 2PYZA 1W94A 3CLKA 1Y8RB 4AQ7A 1V1MB 1RHUA 1FU4A 3K92A 1O6GA 3KT3A 3DOCA 4FDUA 1I7LA 3UEOA 3MQ2A 1MJGA 4ZVLA 5JANA 1D7OA 1U2DC 4CF6A 2JHPA 5CIYA 4DCCA 1ACMA 4GZMA 2Z6AA 1NVPD 3BHMA 1KKMA 4OXSA 1YE8A 2BD0A 1AQNA 1ROPA 1DIOB 1SUDA 5J40A 2OFOA 3FW1A 3BE8A 1BFKA 2BFDB 3C5WP 4PELA 5IVKA 5K3OA 1D6JA 3ZG6A 2A9OA 4LK2A 1I3MA 4KQ6A 5J5CA 4RM2A 2WFLB 4C7OB 4PGMA 4JQOA 3K1JA 1E99A 4XGRA 1XJQA 4ZQEA 4Y6GB 4JJEA 4IS3A 1TJ3A 4BKQA 3RUFA 5DHPA 1GKFA 1QIFA 2CFOA 4FZVA 2WZQA 3L0BA 3X2SA 2YXDA 3I2GA 3L9XA 5KYXB 1OX5A 3AP2A 1K8AW 4E1AA 2QL9A 3I23A 1TFUA 4CCYA 2C58A 2IE8A 3W2IA 1QR8A 1ZK1A 2ZT7A 5L3RA 1TAGA 4EEKA 4Y6QA 5DGXA 3JTMA 5J3JA 1JHOA 2O1XA 1E3LA 1UL1X 2AXQA 1SS3A 1J06A 4CODB 5GIOE 3U31A 2K7ZA 4KFUA 4E4TA 1V8OA 4URWR 4Z4EA 3QMPA 3QLUA 2KE5A 3OZRA 3GI1A 1EP1B 4Q3AA 1UUFA 5K4HA 1J09A 1GA1A 4A4DA 4YEDA 3HKEB 4HK4A 3I61A 2OZPA 2RCVA 5DLPA 4BYMA 1TZBA 4N0DA 2P7IA 4LWSB 3K9AA 3NCHA 2VT7A 4XLLA 3QBEA 2E1RA 2HJVA 1BCSB 3PUHA 3BAAA 1W44A 4TYPA 3L5KA 2E4ZA 1Z4PX 1O96A 1S9DA 3OE7A 4MQFA 4PJ0Z 2B8TA 5EJAA 3F2IA 3BH0A 4UB8Z 2JFYA 1IUPA 3QWIA 4R84A 1NUHA 3AF3A 4CKCA 1S2IA 3PC2A 3OJLA 2ZIFA 5KAMA 2QM3A 2R5NA 3WDLA 3Q1KA 5K6AC 3TEFA 2HRQA 4K9MA 4EO9A 4BFVA 1C9NA 1SELA 4QDOA 1PR4A 2IEIA 2BCCH 1YB6A 3PPYA 1KDRA 1N3LA 2YS8A 4HWOA 1HLFA 2HPVA 3RVSA 1WTAA 3S8YA 2TYSB 3DPIA 4LXUA 4QQFA 3AR6A 4C3VA 1VMGA 5CM9C 3EXAA 3CZAA 3IVAA 2QZJA 3MWDA 1J8YF 5TQ0A 3DXZA 2G25A 3RIXA 3BQ9A 1G3RA 1N2XA 4KCGA 4YJKA 2BZ1A 4BLWA 4PEVA 4OL0A 1UT8A 3D2BA 2K87A 2NU9A 4KV7A 5CVJA 2JS5A 5BSUA 4XFJA 4IVNA 1PFWA 4DV7O 3AHIA 5L3QA 1X4TA 2QXUA 3WGMA 4CQJA 2IS2A 2AXEA 1Z47A 3HJFA 1GKKA 1R0XA 3X44A 5EJ5A 1RKUA 4HS9A 1A8HA 3WXBA 2ILMA 2WKRA 3JQAA 4I3GA 3CVJA 4DYHA 3MB5A 5AMXA 1X8KA 2EDCA 1Z16A 3C3MA 4LVOA 1RVV1 4ZARA 4YV1A 3W5SA 1N34B 4JCCA 3GJZA 1Q50A 5CCBA 1AJPA 1R6BX 1U9ZA 1RAEA 1Q0PA 4FUTA 3QVKA 1KXJA 5A02A 1NQVA 4AFNA 1MTZA 2J5BA 2XNHA 1IC6A 1S2DA 3L82B 4AZ0A 4YMSA 2C59A 1KETA 3SFVA 5KHOC 4D57A 1QLNA 4EEXA 4MS3A 1LWNA 2Q28A 2PGLA 4O5OA 3IUSA 3EK2A 2QN3A 1YA6A 1BE8A 5T4HA 4XCXA 3IHTA 2ZWOA 1O4WA 4UV8A 3GJXC 3HG7A 3WK5A 5D3ZA 1K2WA 4OLHA 1O96B 4UMDA 4FXOA 3T1VA 3FOZA 3I1IA 2XUJA 5LIRA 3ZU4A 5I9TA 4O8ZA 1HDJA 2FZ4A 2CJXA 3WOHA 4PBRA 4MGKR 1W87A 1WQ3A 2ZRQA 4MRVA 4OIMA 5AOBA 2RGWA 4WPGA 1DG3A 3QVLA 2W71A 4FYXA 3CSXA 2YI8A 3PCRB 3C6ZA 1SBTA 1AMNA 3COSA 3BABA 3EZLA 1VP3A 4FYPA 3QX3A 4IDQA 2FR8C 4Q47A 2K2WA 2B35A 1W76A 1ZL0A 1Y5LA 3K20A 2A79B 4LQ4A 4F1KA 4OX9B 3S2EA 2OCGA 5EVCA 4H18A 3SLGA 1OAOC 5GAJA 4OH1A 3IEIA 3TG2A 1EDDA 4K3VA 4UFNA 1MHTA 3RHTA 3JQQA 5TQ0B 4ND6A 4GKVA 1NXPA 1XTSA 3AI3A 3UH1A 1TM3E 1YF2A 3CJRA 5DHRA 3HL0A 1QUFA 1EUYA 1YD7A 1CUGA 5JJIA 3VSAA 2NU9B 1ENPA 3TLKA 4HTFA 2X0NA 1N36O 4M9ZA 1KK1A 5L3QB 3LDUA 2GZ2A 4D9GA 4P4SA 3R9WA 2VHTA 4ZQCB 2CFTA 4D5GA 1GU1A 3PA8A 1KH2A 4JJ7A 5LMUB 1YZGA 1VL6A 4FMCB 1RIFA 3G17A 5KNBH 4WY5A 1W4BA 3T3HA 1L9KA 4EPWA 4ZU6X 2BGWA 5TEWA 4NPCA 1CZRA 4UHEA 3JQAB 4TTPA 4ARBA 4IDPA 3KUDA 4FFWA 4GMHA 2XZDA 5JFOA 3VAYA 3LFTA 3NVDA 1RM5A 5LXTA 4UE2A 5BUZA 1EFHA 3QG1A 3ITEA 2K2QB 4LV6A 3QYFA 1VXRA 1V6AA 5TIIA 2ZWMA 1KAMA 3E86A 5EPOA 2AG1A 4MV3A 3DQZA 4AZ0B 2JZNA 3RFFA 4MHSA 1T24A 2E74B 2AZ0A 4FHZA 3H1TA 2FEKA 1RSOB 4MS3B 1F2UA 1ZOSA 2NM0A 2AUNA 3VPXA 3WRXC 2DE0X 3CEPB 1SU4A 4D0LB 1VG8A 1ZD9A 2OHXA 1KI8A 4FLUA 2IXBA 4P3XA 2KMLA 3OT1A 4U2GA 1JEJA 4BFTA 1E1LA 3EPHA 3SYMA 4CKYA 1U9YA 4D99A 3WLLA 1G6UA 2BCEA 2Z43A 4JAVC 5IKMA 1R0BA 4JZKA 1C7QA 2NV6A 3T4EA 4R2LA 3A0UA 4H3HB 5JG7A 2H9YA 4GFDA 2Z1DA 2QN6A 1VBNA 4JDUA 3HBMA 3LHIA 3KVRA 3ZY6A 1HL3A 1ZQ1A 5KNDH 3BEOA 3T0GA 1ORRA 4DR1O 5IBCA 5LU8A 3HR4A 1K4KA 4P38A 4UAUA 1GGMA 2Y1FA 4AJHA 1SVUA 2MSEB 3EGOA 2XQVA 5F76A 3OLVA 1NA5A 3D1LA 1K27A 1UK6A 3PYMA 3G0GA 1ADFA 1H93A 2CC2A 5AKYA 5LMCA 1VYTA 4JJIA 2E5FA 3L4SO 1LJLA 1I3CA 1A9XA 4EKYA 1QFYA 3PFFA 2Z3YA 1GADO 1OLOA 1N6NA 1AD2A 4M0CA 1E4YA 4IXMA 3O8OA 2Y8EA 2NTYC 3UJNA 4EX6A 2R86A 4FU0A 1CHDA 1XEWY 2Z98A 3UOWA 3KQHA 4HTFB 2C5SA 2PT7A 2IJKA 4TMZA 1RYMA 2WZDA 3DULA 4LXQA 4P4SB 4OM8A 4X8LA 3LT0A 2EQAA 4DA7A 1SETA 4NARA 3KOZA 2OVFA 3MUNA 4P92A 1T26A 3KQWA 4X94A 3JQ6A 3K70D 2YY5A 5D87A 1QYIA 2DBRA 4E5NA 2AZTA 1BG6A 3LKVA 2RKBA 3GFBA 4QO8A 3E3AA 2GZ3A 3SS8A 2B36A 2GHRA 3WLEA 4INZA 4KFSA 4QYTA 1KDVA 5I7RA 2DJIA 1E9SA 4BECA 4ARAA 2X77A 4I4IA 1PFKA 2J85A 3UG6A 3WO0A 3CH5A 1KZ4A 2VPXA 4OQNA 5YASA 4ZQIA 2V7GA 4R2HA 4HR7A 4ZZ1A 4BWAA 4WVFA 5IDYA 4XH9B 1Z5UA 1RWOA 5CB4B 3B53X 3GJ3A 2YZ2A 4I9FA 1DLIA 3IC5A 1XD9A 5BN3A 3JQBC 2WKWA 4AJOA 1AZWA 1XU4A 1IBCA 5M3BA 4R1UA 4N54A 3OT1B 2VEOA 5FO0A 3M1IA 4TT3D 2B98A 4B3TO 3RVLA 4OQYA 1YZHA 3OQIA 3D6AA 5PNTA 4CMHA 1KEKA 3O1IC 5EL0A 2AKYA 3ILHA 4B3HA 1RYDA 4FOTA 1NJFA 2QW8A 1EAYA 2DW4A 1U8UA 4P32A 2UUCB 5LPNA 2XTJA 2D2EA 5G0UA 5JJNB 4TYYA 3V9AA 4AF6A 3ZV3A 5E6UB 3SU8A 3OU7A 3PC3A 3CMMA 2LTAA 3GZTB 3LCJA 3T7DA 3QGMA 2DQ0A 4OUDA 2CNKA 3H8VA 4DO2A 4X1KA 1BKYA 2AH5A 2IGTA 2QGNA 2O4UX 4J1QA 1JPJA 1T5IA 1KC3A 1OF1A 3ZQ4A 3UOAB 3NR7A 2BUBA 2GOYA 3T94A 3D1JA 2RCNA 2GDSA 4OMUA 1ONPA 1A9XB 2LW1A 3TECE 4HGOA 1CUEA 2GK4A 2RHOA 3HJHA 2FH5B 1HH4A 3I9NA 4BOYA 4Q34A 3ABLC 1U3UA 2UXDO 3O8OB 2FZ5A 1M2WA 3ENWA 3NIFB 1KIFA 4OLAA 2EP8A 3OCWA 1NNI1 4MH0R 4YVFA 1UPAA 5DI9A 5T8KA 2IV2X 4X1YA 5JHHB 3VYUB 4PLTA 3ICQB 1Q1AA 3IOMA 2DR3A 2YMLA 3N74A 2CGEA 2BBSA 3AG4B 1SR8A 5C81A 4TKVA 5DZSA 4Q6GA 4OO3A 5KINB 1PK8A 4GLXA 1IPEA 4GMXA 4LZJA 3ZRVA 5KKNB 2EFGA 5I8WA 2REXB 2NLOA 4MQBA 4F3TA 1C9JA 4X7MA 2G77B 3GJSA 1XLTA 5K0SA 4KIWA 1NMXA 5KZMB 2F66C 3IAUA 1NVPB 5GVRA 3DFIA 4WADA 4CMAA 1E89A 3QP9A 1Z4JA 5EP1A 4LK3A 4RKEA 1COWA 5HUQA 3VR4D 4QULA 1BGWA 1J07A 3I42A 4UEWA 5BN3B 1XKQA 4DAEA 1G19A 2HNBA 3K5HA 3M0EA 1JHPA 1UDBA 4DNPA 1IQRA 3H9JA 5LKRA 2VFAA 4M54A 3B1YA 3K6KA 2OESA 3U4IA 3BIOA 4QNNA 1E63A 4OX9Y 4TT3G 4RK5A 3K57A 3OQIB 4KQJA 3DQQA 3BCSA 1OZAA 4Y9DA 4W63A 3W90A 1VJDA 4KJZA 3R7FA 1RPZA 1E2MA 2QPLA 4O0LA 1AY0A 2ZRNA 1WZIA 4CNQA 7REQA 4M0DA 4XI9A 3ROGA 3BL6A 3I9FA 4TRNA 4U7WA 4PPFA 4BO0A 3N5KA 1DOAA 2QTMA 4ND3A 4NOKA 1CR6A 1H0HA 4DJAA 2F9FA 3PDIB 1ZRMA 4AT1A 1QIKA 4YAKA 4IPTA 3INRA 2C9BA 5G4KB 2VUTA 1QGAA 2XA9A 4X1KB 3TQQA 2GRJA 1OASA 1FRNA 4HFRA 4BKOA 1DIAA 5C5DA 1GGJA 3GJRA 3R1IA