3WB1A

Hcgb from methanocaldococcus jannaschii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0488
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 57
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb1A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb1A02
1DIOB 1T5EA 3WB0A 5D5PA 1IWBB 3LNNA 2F1MA 2D0PB 2F93B 1EEXB 3BRCA 1UC5B 1VF7A 4L8JA 3WB1A 1UC4B 2D0OB 1RSOA 1IWPB 1MMFB 1EGMB 1NBWB 4DK0A 3AUJB 5JJEB 4DK1A 5D5QA 2V4DA 2F95B 3WB2A 5JJNB 5JJJB 4GYCB 1H2SB 1EGVB
chains in the Genus database with same CATH superfamily
2IU4A 3L6BA 1S2LA 5E38A 5FCDA 1R0BA 5CXQA 4PONA 3JW8A 3SIPA 3VC3A 1CE8B 4MVJD 5CN0A 2WC1A 1G5TA 2PMFA 2A4MA 4FYPA 5CP8A 4G8DA 4B8WA 3WR5A 4ABYA 1M83A 3BN3A 1QF7A 1DKMA 2DQSA 5AI8A 2VDOB 1TO1E 3G3EA 3IV7A 5EBWC 2BEUA 3HNRA 1E5XA 1JIXA 3GFFA 1J39A 4J80A 2EINC 1OTYA 2ZYGA 3FLEA 3TOVA 1U2TA 3WLRA 2EZTA 3V9PA 3UBMA 1V37A 2JFBA 1PU2A 3CNNA 5JD5A 2FZCA 5BP7A 1YZUA 4OLFA 3QJ5A 1X80B 3LT5A 5AVUA 2P2NA 2BLNA 3MTJA 2V7QD 4U8HA 1IXBA 4MUYA 1AVMA 1IN8A 1RQXA 1BD3A 2CW5A 3TMAA 3ZTYA 1MABG 5G2OA 3KSRA 5KX5A 1HDEA 5CGZA 5K7SA 4K8RB 1DRKA 1I3CA 2OWEA 1M2HA 4U7DA 2YC4C 1PL6A 5F5LA 4JBHA 2B82A 1M1NB 1YUBA 4MV0A 4BECA 3DAHA 1Q12A 1E64A 2Y1EA 2XE6A 4RXMA 1JVNA 1NVTA 3S28A 2V6FA 2PKCA 1W0KA 5JQGA 3HBJA 3FYHA 4HYEA 2O6LA 3VYUB 3KLNA 4P82A 3KJGA 4KJXA 1U3DA 1W581 1QVVA 3UEOA 2WRZA 1KP2A 2GTPA 1VI5A 4FBMA 3P0HA 4NJMB 1HPLA 4LJ7A 4E5DA 4LHEA 3WX0A 2JAQA 5JSZB 1VF7A 5D3QA 3KXKA 5LHIA 3EGVA 1UWVA 4Q3BA 4UB8Z 2J3KA 4YAFA 3DPSA 3K9QO 1WV1A 1NQAO 2WKPA 3IJRA 5KINB 4DM7A 3MB8A 3GFSA 1WA8A 2UXCO 3B60A 2G6TA 4FMDF 4PPQA 5M34A 2R8PA 4UHJA 3RVSA 2J0QA 2GYUA 4XVCA 4GX5A 1PNOA 3ZYZA 2OCCC 3W9SA 4QYSA 1TA9A 3L41A 1IN7A 2Q2VA 2O6HA 1OLUB 3LCRA 2QRUA 2AKYA 3GJ6A 5KSYA 2WUFA 2X5KO 2OYQA 3LKZA 2BCGY 2X6CA 1EM8A 2CFTA 3GP3A 1KSFX 1H2KA 3NTVA 1NXQA 1G8JA 2DPHA 2HWKA 3R24A 3DEZA 4GVPA 1QFSA 3H1KH 4D82A 2B0CA 4AJ1A 1Z45A 1E5LA 5CUQA 4LXHA 2HMVA 4FKMA 4N5MA 4JI4O 4G4IA 3V8NA 3NXSA 1UC4B 4Z8XA 1J5XA 4RIGA 4YMHA 2KJQA 4EEKA 4YMSA 4OK3A 4KQCA 4GLLA 1E0DA 3O90A 2V7WA 6ABPA 1AA6A 3L79A 3C6BA 5L3ZA 1KWGA 2PWYA 3WZMA 3NALA 1HOTA 1JG1A 4YAWA 4URHA 2WLJA 4Z1VA 4C3UA 3WK5A 5SY9A 2MSNA 1A50B 4G8CA 2VRCA 3SBEA 2Z2XA 1IN5A 3ELBA 3R20A 1DGSA 5BPHA 4LVCA 4B3CA 2IF2A 3C3WA 4TWBA 5ED0A 4TTAA 1VXOA 1Y7LA 3O3OB 2IQIA 3RT1A 5DEOA 3SJBC 2AB0A 2JEUA 3O8DA 1SCQA 4X90A 5KB3A 1L5HA 2IIVA 4UBLA 2F95B 1O96B 4WCDA 1RPTA 1Q95A 2CVHA 4IKEA 5GMOA 2TSYB 1M2WA 4YJFA 3I8OA 5IASA 1VLVA 1MO3A 1QGZA 2B4QA 3AOGA 4ZKIA 3OSZA 4KPUA 1XEXA 1XMXA 4UNRA 4OXRA 1HE1C 2P4EA 5LA6A 821PA 1NUPA 4RHTA 3IOEA 1Y82A 3OX4A 3ZQJA 1FYDA 1BRTA 1RTTA 3NEPX 4P5EA 5IEJA 3ICQB 1K9VF 2R8BA 4YMLA 3GCZA 1NN1A 3CUYA 5KYTA 4PRLA 1ZOPA 2DSNA 4V24A 5JEEA 2XASA 4YLGA 3R3ZA 3DXXA 1DVRA 3K70B 3TTVA 3QKWA 3W0LB 3IE0A 4J11A 5H81A 3G85A 2CWWA 1JYSA 3T15A 1YZBA 4P6VF 1O94A 1KL7A 4BO0A 1QKJA 2B30A 5A9GA 1SZCA 4GL2A 4JIMA 3BBPA 3LKDA 4HBNA 1F8FA 4PI0A 2Q1XA 1GZUA 1X2BA 5D3KA 4ZQFA 3ZD9A 4KQXA 4M0EA 2IYUA 2ZSIA 2QR5A 4WCFB 3F4LA 4LYHA 2CL7X 2GVDC 5DXJA 3BK2A 1TZCA 3ELDA 1X8XA 1GQSA 1ST2A 1W5SA 1T9KA 4EKGA 1T4CB 2O0KA 5EJ2A 2O4CA 2VSYA 4Y2QA 3CZQA 3CW8X 1TO6A 4YAKA 1KJ9A 3HGQA 1GN4A 2AR7A 3G79A 4LH6A 3AWDA 3TX6A 5GZ3A 1E9EA 3KETA 3ODGA 1J5PA 5IAKA 3TL6A 2OLKA 2NTYC 2QRNA 2MU1A 3ZE7A 1KFBB 1XLWA 4EEXA 3NNSA 4D3SA 2Z1MA 3VR4D 4KLZA 2YIMA 3I5XA 1NMEA 1XHXA 4RL4A 2GBGA 3LQFA 1UBJS 4C6TA 2L42A 4OCZA 1CY2A 2NPFA 3ZLVA 4R3UC 1XTSA 2C2HA 3GRPA 4P32A 1HEUA 3DFIA 2QTNA 5CNIA 1Y8CA 4XWWA 1N1GA 3SC2A 4OKNA 2W4IA 2XMCA 3PUKA 2CFCA 2Z6AA 2PH3A 3D7SA 4PA3A 1SBQA 2FSGA 3BA9A 1K9SA 2I7VA 1W5BA 3QFCA 2PWPA 2XUDA 4Q9AA 3AUXA 2R8OA 4YJGB 1X1TA 1JG6A 4H7IA 2Y0PA 3OTGA 4K9LA 4NCXA 3HJGA 1TQ6A 2BCCH 4CKEA 4MGZR 1GPDG 3LQ1A 2GAOA 3RC3A 3AEYA 1NUTA 5IHPA 4N6OA 2IP2A 5DCLA 4BY9E 4DDMA 4AUNA 5H4GA 1GKKA 2AXEA 3E3LA 2ZIXB 3OBIA 3CLRD 3T7CA 3ZEIA 1Y4AE 5KO2A 1NFQA 2Q5CA 1KK1A 4YAIA 2YOFA 2GA8A 3MSCA 1NBMG 1RDFA 3MT7A 3CVUA 1R6KA 1XD2A 1G5RA 2QUAA 2AEFA 3A0HZ 1QP0A 4OGKA 3DZHA 4EELA 2ZJYA 1G6KA 3VU9B 5ITSA 1PJTA 2F1HA 4QTUB 2HU8A 4MI6A 3N6VA 1NPDA 1QCCA 4L27A 5G1OA 2FGKA 2BE7A 3WLPA 1K97A 2ZROA 3L43A 3ENVA 4QXAA 1TKRA 3QPCA 3UH1A 4N3GA 1GHTA 3WGNA 4FONA 3ASNC 3ZI7A 2IELA 3OZXA 1L4GA 2YHBA 3JASA 5DZSA 5HZMA 5LIRA 5KHAA 1KEUA 2QF7A 5B64A 3OG9A 4PRYA 1NW9B 1Y8QA 1E2EA 4GI1A 2CMFA 2D5AA 2BOBC 2OHGA 2GTSA 2D0DA 4KV7A 3GUUA 4UXJA 4R8CA 1T9HA 2VHQA 2LCIA 4FHGA 3CNHA 4BVKA 4UOEA 3E7XA 5JCPA 1S5JA 3DMDA 4N39A 3CLVA 4DQXA 3D31A 2Z8ZA 1EZZA 3VQWA 1V6CA 5DYIA 4QYIA 1EFTA 4AZ0B 1EGHA 1FNMA 1NXPA 4MUNA 1Q1QA 1AU9A 5IARA 2CMGA 1RXCA 4YEDA 1GG2A 4MULA 5FT9A 2DBYA 3OWHA 3G7UA 2UZ1A 4HDCA 5HDBB 5DNAA 2PLFA 2GK7A 3MTGA 2I62A 5CG1A 2PS1A 3LP8A 3DZDA 4DIOA 1CK4A 3CNQS 1YTLA 3ZU6A 4NCAA 2YTZA 3RVRA 3BXFA 1G4HA 4YJHB 2G6BA 1M0SA 2KQUA 4N5LA 4MVZA 3VOUA 3CVOA 1W85A 5C4MA 2VP4A 4BFCA 3IT2A 1JWAB 1Z33A 4PA9A 1Q6YA 1DQZA 1GEEA 5I8WA 9LDBA 1SVIA 2D8AA 1WULS 2UYCA 5C7OO 2P6JA 3GARA 3U1TA 3ZD8A 4PLGA 1N0NA 1FFXA 2QTMA 3HRKA 3JD2A 3W78A 3KKOA 3SJ7A 4B3BA 5HSGA 4DPMA 3OESA 2BSKA 3C3PA 2BWJA 5D7NA 3MJRA 1T9GR 3NIGB 3CGWA 1SHZA 1IXSB 3WYCA 1QGOA 2FN9A 4KXUA 2QV0A 3TNLA 1ZWKA 4L9AA 2QZJA 5JNSA 3BWDD 2ONYA 4V0QA 2H7XA 3L6OO 4XX1A 3UPDA 1DKLA 1US6A 1JAXA 4FHCA 1C4WA 3OMAB 1U9CA 4NONA 3FW1A 4HGQA 4A2PA 1AKWA 4KN8A 5CA1F 1P19A 2B7CA 3AKZA 1Z13A 2VDWA 2I66A 4M86A 3GLKA 4PA6A 2R7NA 5FWAA 1M0TA 4FR2A 5GTHZ 3AY7A 4DV3B 4O0LA 2WIDA 2GD0A 4NNOA 2F55A 1H9BA 3BCUA 3DP7A 3KQNA 2FEPA 2X5OA 5M7EA 2LKDA 1ZBDA 3EFHA 3MINB 5EUBA 3BH6A 2HHLA 4OQXA 1RIFA 4KLCA 3LBNA 3PHCA 3AUFA 2X5NA 1C5KA 3RE1A 3T52A 1R16A 1RS0A 1YR1A 3G80A 4B32A 1ODFA 2PU7A 2HDOA 1C3XA 4QWMA 3K0GA 2NU8B 1O94C 1GO3F 3NJRA 5H3LA 3P9PA 5DNYB 2O8BB 1RFGE 4JVLA 3NYRA 3O9VA 5E6UB 3ZNPA 3QXGA 2P5YA 1UBSB 1A4RA 5K4HA 2NX2A 1TUEA 3H1TA 3Q4HB 3E4CA 3L7AA 3LX6A 3ED5A 1RADA 3RYCA 2VA9A 4DDWA 1N32B 4RUFA 5HUHA 1WDKA 1YS1X 3RWMB 2DFDA 4TMVA 4WMLA 3VVLA 4D3ZA 2M6SA 3T9FA 4D6XA 1E7RA 3FGZA 2PWAA 4OP1A 2B69A 4HNTA 4OHWA 2F66C 1VCNA 4L8GA 2VJKA 3U3KA 4LZAA 3NC1C 1JZSA 1XQ9A 4HN4B 3TVTA 3WLJA 3IOYA 3OURA 4AROA 2ZUWA 3R76A 2WF5A 4N3BA 3VH2A 1PNKA 2O8FA 1XMQB 5HF5A 3WQHA 3CH4B 5GV8A 2P68A 3QFTA 4TN1A 4RIEA 5FV7A 5LLDA 1BROA 2PZ8A 5DM6V 4JLMA 4U2DA 2CEAA 2B5OA 3RU7A 2CN1A 2H2IA 3EHEA 2HYDA 4HX2A 5C8VA 1VHTA 2JK1A 3W2TA 3PJRA 3BTVA 1WETA 3SJUA 2TMKA 2RJNA 4CQLB 3IEIA 4XW2A 2O48X 2EX4A 4C7BA 3GQVA 1ICEA 5A7HA 2CXNA 5K09A 1K7XB 3OP4A 3JVDA 2ZI4A 1EFUA 5A0FA 3WIDA 4I50F 1JPXA 5G4KA 4E2YA 5KKAA 4FUQA 4KWIA 4ME6A 3GGJA 4O8ZA 2IXBA 2R68A 1GRNA 2G63A 4TSKA 4NZYA 3PENA 1GZ5A 4CC5A 2V7UA 3FY4A 2C78A 2ZDQA 3H6HA 2A6PA 3M83A 5BSUA 3O0DA 4A8TA 3WVNA 1A0OA 3DMGA 1N2SA 1A5BB 1P2DA 1FP1D 2P27A 1OYOA 4P7JA 5EE9A 1Y74A 1F2UB 1YQTA 3I9NA 1I9CA 4P7BA 1NQVA 3X1WA 4HRXA 4YBZA 4ZEWA 4AJIA 1PVVA 5KHOC 4M46A 5KU1A 3SZGA 3ZRVA 2FG7C 1LR1A 3S8YA 3PJGA 4IILA 2O1SA 3M6VA 4BP8A 3CRAA 2QL5A 5MHTA 1UEIA 4RZUA 3LUJA 2J0UA 5H02A 4DQUA 3MEQA 5AM2A 1CG6A 4XRGA 2DWOA 3MHHC 3TBFA 1DDIA 3Q11A 4RS3A 2G8LA 2ODTX 3PLAE 4Y9RA 3GBPA 4ZMRA 2I4RA 1Y5LA 3ANTA 1RZ3A 4CODB 5TVKA 4UAVA 4ABTA 4RHCA 3CCLV 1KKLA 4TRRA 3JPYA 2XT6A 1X77A 1RXIA 2QE7D 4N65A 4F6LA 1TFRA 3OM8A 2R00C 1ISMA 2VCHA 1GRCA 2HC9A 3FVVA 2RIPA 4F9FA 5K0EA 4XUGB 5TPZD 3I5AA 3T61A 5EPOA 2F8LA 3AG4B 1R1DA 4XUEA 4A92A 1WW8A 2JCGA 3I9FA 3O4JA 4AECA 4LF9O 1EB9A 3HCAA 2H4FA 5IZ4A 1QG4A 1O8CA 1W5FA 1K98A 1EM1A 3C1AA 4DKJA 1KD1W 3A6LA 4X66B 1AI4A 1KZ9A 1AE1A 1XRQA 1Z68A 4MQEB 2VG8A 1NY6A 2JRCA 1Z28A 4H7HA 4C08A 1NE2A 2XJ4A 2EG9A 4D9CA 4RMHA 4BKPA 1WS6A 2XDQA 1CUFA 2R79A 3O8OA 2VF2A 3IP5A 1OCRB 4YCBA 3E9QA 3NTOA 2PZSA 3BMQA 5CD9A 1Z47A 4GRAA 2IGBA 2DYSC 5JO0A 3OR7C 1MB2A 1YZHA 2NZWA 4CLOB 1T5OA 4G4JA 3RS8A 1C7RA 3E9YA 1Y42X 2PRKA 4GE0A 3SHWA 1K92A 3WC4A 3H5VA 4B8YA 3FPAA 1E1KA 2V58A 1PYOA 2WLSA 3IVCA 4H33A 4BAUA 3E1KA 3F8SA 4JNKA 2XUAA 3KQHA 2PGLA 1T6XA 2V97A 5H4HA 2XE4A 1HRDA 1R0LA 3DZFA 4CMCA 4YCJA 3PDJA 1KGSA 4UFPA 2VP3A 2H0AA 1YZLA 1J49A 1J8DA 2ORVA 4ZO7A 3VVMA 3A06A 4G86A 5IDWA 3DZGA 5AKKA 2KG7A 3QKSA 2W2TA 3JQFA 1YS4A 2WDPA 5DWDA 1NR5A 4S0ZA 3UQZA 2VPXA 4S2EA 3SXJA 1T2UA 3R6LA 3TBHA 3I3OA 2OORA 2G3YA 2W00A 3A37A 2IOYA 4A2QA 2PD6A 1T36A 2JAOA 2RARA 2QL9A 5BN3B 3MBIA 1IY0A 2D59A 2P1ZA 3DV2A 5K3FA 2A94A 2B9EA 3FDZA 1YRYE 1OT5A 4NXNO 2YHIA 1B42A 4JQOA 4F7DA 1TLFA 3THXB 4KITB 5LFAA 1OCOB 1HLGA 4CEJA 1FXHA 5BSKA 1JG4A 3DLBA 2B1IA 2NMVA 2HU2A 3LF2A 3CX4A 3TLEA 3ZJ4A 3LXMA 5CK5A 3TW0A 2AFRA 2WK1A 3O91A 2GNOA 3HFGA 4C1NA 3K1YA 1EG2A 4M1KA 3DDHA 3O3NB 4OFBA 1PJSA 4REQB 1DQNA 3QW4B 1W0JD 4PG6A 2X15A 3RC8A 2GAAA 4LY9A 3BH7A 2W0MA 2JKVA 3N70A 5DTMA 5CPBA 1GMGA 1BVUA 3ZWOA 2UZAA 1O7JA 1QYRA 4YPVA 3VR2D 5FWDA 2VSXA 5COQA 4QUGA 1JZTA 5AH0A 4IR7A 1YRLA 3AUKA 1UFIA 3VR6D 5FX2A 1E63A 5HF6A 2BP7A 1P2GA 4CV2A 2PA3A 2AD5A 4HQRA 5YASA 3E35A 2QJTA 1JDZA 2GF2A 4Q21A 4K9OA 4OHZA 2R6JA 2AS0A 4DG5A 4WKPA 5EK0A 1GKYA 1PJ8A 5DO9A 4UVEA 3CMEV 1NBAA 3EPRA 1Y1PA 3CMMA 4NCNA 3GV0A 5EFOA 1W19A 2BVNA 2K6GA 4KYVA 3R5JA 4ZO8A 3JQAA 2L18A 3HB5X 3N0TA 1R64A 5LXTA 3T8YA 3VPXA 4L08A 2XV1A 3RAEC 1XKTA 4MO9A 4ZVUA 1L5YA 2J1LA 2G08A 1DOAA 5I01A 4MQFA 1AILA 1A4XA 3I28A 4YCDA 1PR9A 1XA3A 4DDKA 4H0LB 4TYMA 2PBZA 4CC6A 4R0VA 1KDVA 5JWOA 1ZUNA 1NC1A 1L5OA 4JL5A 3EIFA 4HEA1 2HUNA 4PHFA 1O89A 1N9GB 3TUIC 1L5GB 4C7XA 4HGYA 4PM4A 4D9BA 2F43B 4HYQA 3WJ7A 3ZS9A 1SESA 1OKKA 3WA6A 5J2TB 1NUQA 2IZZA 4YJ2B 4Z9FA 3T1OA 2CXXA 4DCOA 3L77A 4Y2YA 1LV7A 3IP3A 4RXUA 2K7FA 4RA6A 5HE9A 3GMIA 1HG0A 4IIYA 3W6OA 4ZYUA 3ZLUA 4BWVA 1OX6A 2JFUA 3RABA 3SDZA 3LSUA 3L4SO 1W88A 3FBTA 1QIJA 4RTKA 3B1KA 2PDAA 2G4CA 3TZHA 2UXDB 4J91A 3AG3C 4Z5XA 1MQ8B 1KDYA 4BBAA 4ISBA 1AZTA 1PUJA 4QNRA 3E84A 3OPYB 2WLTA 3CXUA 4DXWA 3TOXA 3T9EA 2IH2A 3ZBPA 4ALKA 1QGUB 2WILA 3ZMSA 3KVYA 2OVFA 4PYKA 3GP8A 4N8EA 3C6KA 3IPYA 1XTJA 1NAIA 4CXMA 3QPWA 3R9KA 1UPBA 4HT3B 3SYPA 1ZN2A 5HEKA 5ALUA 3ASOB 3Q2IA 1GL6A 5FWNA 3K58A 5SZKB 3HHPA 2I2CA 4BAZA 1CNMA 1HDRA 3EVCA 3LX8A 5KWJA 3KOXA 1NDQA 4YONB 4XGQA 2ZRLA 4X61A 4OK5A 3V97A 1SFRA 3D2AA 1MOSA 4JUBA 1TM5E 4E51A 1BA2A 5HX7A 2YZKA 1VYUA 4PVCA 3CC8A 2PRSA 3LI2A 4DJAA 1YCGA 2E89A 3Q3EA 3K08A 1PKXA 3Q2OA 4CTKA 1S5PA 1NYQA 4A26A 2EIJB 1DGQA 2RCVA 1RXUA 3ZJUA 2W98A 3IALA 1BVRA 4I2NA 121PA 2UUOA 2ZJ1A 3NATA 3FCYA 2AZ4A 4DYVA 2IJKA 2IEBA 4QT0A 5H83A 3UPTA 4K87A 4ZC8A 3STWA 5JEDA 2PIDA 3L7YA 4F38A 1JU9A 4AX8A 2FH5B 1N8NA 1XAJA 1RKQA 1F2TB 2Y27A 5HQTA 5JNLA 3RG8A 1E1QA 5GW7A 3DC2A 3WFVA 1N2CB 4JELA 1SXGA 3PFHA 4FTWA 2FWBA 3STYA 4L4XA 2Y1KA 3K15A 1ZOSA 3BE5A 2WYIA 5J2UF 3GLQA 1TTTA 3CSXA 1N8SA 1VARA 4H60A 5E9WA 1DJQA 4NVPA 2EZ8A 1A7KA 1Q77A 2DB3A 3ORYA 4EGJA 2ZIWB 5LD2B 4BMVA 1WKBA 1K4MA 4NH0A 3OPXA 2OV6A 4XD7A 2IHVA 1K6IA 4I5IA 2V45A 5HRUA 3U10A 2CHVA 2G5TA 4Q4AA 3EGDB 2QX7A 1JPNA 5CB8A 2ZE5A 1IWOA 1T8RA 1MUUA 1PR0A 2GBFA 2MSDB 1E3EA 4Z1MA 4W99A 1WJGA 2O7NA 3F9CA 4DIDA 1GKIA 3H65A 3U0VA 3KZKA 1K06A 1WJZA 1MT0A 1ODCA 5B6PA 4EAAA 1RPRA 1E7QA 1ZK2A 4HUJA 2OTJV 3R2JA 1KBHA 2Q3LA 3T7SA 3DWIA 1VBNA 3Q88A 2IHZA 2GSMB 5EC2C 3O1HB 4N3AA 3PCRB 3JQFC 3H0KA 1GSOA 4JWKA 4B4OA 3UKOA 3KJQA 4MRMB 4AP5A 1WABA 4FE4A 1GAWA 1LC0A 3RRNA 3EQ7A 4ND5A 1NTOA 2OORC 5A4AA 3LUBA 1G9TA 4O4HA 3ZE0B 1RYEA 4CT5A 4NMXB 1MJGA 3BWYA 4P54A 1DXHA 3H8SA 1XP8A 2AMVA 2F1MA 1PT9A 5CNKA 4RY0A 1PVOA 1XAGA 3ANNA 1A2KC 5J43A 3U7IA 3M8AA 1II8B 1VG1A 1PG2A 1BHSA 4OQZA 2GMWA 3ZW7A 3KDAA 4CCYA 3TVDA 2Q1SA 5CFOA 4M1YA 1WXDA 4DJFC 2DT5A 4EW3A 1CZLA 3O74A 4FYVA 3DAPA 2H94A 3RU2A 3E22B 1XVVA 3BGOS 4LQCA 2JA1A 1GNTA 3S5UA 3OT1B 4K9MA 1I6KA 2LP7A 1PE0A 3PGXA 5CB4B 4JI8O 3AL3A 1AHHA 2GN9A 2HTFA 2P6OA 3PUZA 3WGOA 3TB6A 4AG5A 2PX4A 3M7IA 4Y1GA 1ZQ1A 5L3QA 1KI8A 4ZI7B 5DNEA 3ZZ1A 1Q17A 3RH0A 1ZIPA 4BNUA 4BJ5A 3A2FA 3H99A 3WWDA 2HV9A 4C14A 5KNDH 3OMXA 3OTQA 1PR1A 1I8TA 5JQWA 2FP3A 3VM6A 3GLIB 2QN8A 3L8YA 2XECA 3W8NA 4DV0O 4INAA 3PEUA 1G4AE 2O7SA 3ZDFA 3TD9A 3LUGA 3OT4A 2C2WA 4EG0A 2ZRHA 2ODWA 5AI0A 2F90A 3D2BA 5TARA 3THYB 4I14A 2BHNA 4NATA 2C2MA 3WS7A 3OZEA 4H1UA 3QLUA 1IM5A 5CB4F 2HA6A 2XODA 3KB1A 1SOWA 2RGCA 3LU1A 3WNZA 3TJMA 1DAMA 2ZI6A 5T3UA 2RBEA 4BE9A 4XB1A 2ES4A 2J6HA 1N0VC 1P29A 2A5LA 4L87A 5FEMA 4ZI7F 1AR4A 4Z3OA 4GLOA 3C6XA 1T0BA 2O3UA 4IGAA 5AUOB 1VPVA 1MFZA 1H8EG 1P60A 4B3TO 3QTCA 3SPCA 2FRDA 3BF8A 4EPWA 4OLAA 5JC8A 2BDEA 3X2QB 1QTQA 3CFYA 2IBZH 3PYLA 4JD5A 3EWIA 3NKFA 3NZEA 5EQJB 4AILC 4J4TA 4FIDA 5EESA 3ONEA 2BFPA 3QV1A 5TXGA 1D0SA 2VDNB 3WB2A 3NC0C 4R0NA 1P45A 4A9AA 2TECE 5EZYB 3L7OA 3R9IA 3RK4A 3NP7A 1UXKA 2X0FA 2NXNA 1LEHA 1KETA 3CUVA 2WU4A 2H8PC 1GGMA 4DSNA 2R48A 1JFFB 1O8BA 1XCGB 2C94A 4LV6A 4UVIA 2OCGA 3RCBA 5BV8A 1M10A 4AD8A 1GSAA 2JFZA 2C4HA 4JYYA 1QFMA 2KW5A 3OCVA 1P7BA 1TJ3A 1D6NA 3GHHA 1M2KA 2C9OA 1IN6A 4Z7OB 4DZRA 2L19A 1KDOA 4RESA 3TW8A 2AFHB 1T0HB 5DEDA 3SEFA 5FOQA 1E4OA 3EIOA 4H16A 2PQMA 4GC5A 3R09A 1NMXA 4KVGA 5CK4A 3BKXA 2VDVE 2I2XB 4EI7A 3TECE 3NHFA 3TG2A 2KE5A 3F1KA 3ASZA 2VJMA 4OM7A 5G0UA 2PT5A 2LW1A 2JBAA 2R5FA 1ZN8A 4D80A 1BFDA 3U4CA 5IDJA 3MWDA 4JYBA 4CLDA 3OU2A 1YCIA 3OO0A 3KKLA 2WI8A 1DJPA 3HEMA 1PJQA 1FKAO 1IURA 1Z4PX 4BKRA 4RBNA 3B09A 1ZESA 4PGGA 3K70D 4Q34A 3V3TA 4YECA 3A6EA 4E33A 3VDNB 1G41A 3KLBA 2O2CA 3NM5A 4D1YA 3C2QA 3E15A 1V26A 1PQUA 5A05A 3F7YC 1BEZA 3B52X 5GTDA 1UXJA 2CV2A 4Z4QA 3MFQA 1N2CE 4BWFB 1FW8A 1L0NH 3AW9A 4MYUA 1WOYA 1M6YA 2HA2A 4MP8A 5F73A 3AJEA 4F5DA 3OFND 3L4EA 1FFAA 3LNMB 3BD7A 3SQWA 2QG4A 4C3ZA 4ENSA 3WLSA 1U5BA 1KYVA 1RC0A 2AMJA 3Q7RA 5AK0A 2B7LA 2IPLA 2XIQA 2QMUA 3R3WA 1QV9A 1HW7A 3HY3A 3D4IA 5TY0A 3RSCA 1V55C 3PFFA 3D8UA 1V39A 2R8ZA 1VQ1A 4R8LA 4HAOA 3QBEA 5F7JA 1OYWA 3W8RA 3R0ZA 4RSMA 4HFMA 5K3AA 2AUTA 4J8PA 1ZGHA 1YE8A 3ZCRA 2H00A 3LA6A 4DA9A 4DIKA 2CWDA 5JZBA 2ZJ7A 5EUMA 4P4UA 4BGUA 1PS9A 4UAGA 2VT2A 4FM2A 4BNKA 1O6ZA 1QHGA 3RWOA 1Y89A 2A5YB 4CUKA 1U1CA 3U4AA 5IJ9B 4ND1A 3S8MA 3GUZA 3DNFA 2G17A 2DYRC 2YW2A 3LL4A 2RGGA 3PHHA 2PEYA 3CD6V 1VQNV 5AQEA 1LY1A 4NAVA 2UXCB 1QVZA 3D7RA 3ZVRA 4YYZA 2FPSA 2COUA 3LDUA 2ZUVA 4XTCS 7GPBA 3EYWA 4JR1A 3N8HA 4CM1A 4B2IA 4ZI2A 4F3RA 4LYGA 1BCRB 2FUKA 5K9ZA 1GEGA 2A9PA 5D7BA 2BKXA 2LIPA 4J90A 4DNPA 1XMPA 3INYA 2PTHA 2ODAA 3PA6A 1DDOA 3HVJA 4ENPA 3GAMA 2IJHA 2ZJ4A 2EX0A 2I29A 1HV8A 2XTZA 3RYFB 4JI4B 2W0XA 2I1LA 2WWVD 1SO8A 4LJAA 4FMDB 4JBIA 2OZVA 2A9HA 3NHKA 1I4LD 3CRVA 1VJCA 4N5DA 1XHZA 2HBQA 4JLPA 2VHWA 2EBWA 4IIBA 1YXMA 3WFJA 5BYBA 1Q0ZA 4Z49A 3REFA 2WHEA 4OBBA 4RVDA 1J2UA 3GLIE 1ZICA 1MSDA 1WUHS 2TMDA 2IJJA 1MX1A 4BX3A 1X7GA 2EJRA 3TEJA 3B3JA 1P1IA 1R0CA 3CQ9A 4UUPA 4DCPA 1JE1A 4EEZA 5LGNA 4BWAA 2FWPA 5KYKA 3LLVA 4QULA 1VP3A 2O8CB 7MDHA 3N9IA 3D02A 4LOIA 5BN1A 3K79A 1BXRA 1GFZA 4UASA 3DV9A 2WFZA 3S2IA 2R5WA 4GGOA 2VWQA 4YDRA 5DHUA 3DEKA 2PUGA 1ZVKA 1AUQA 1OHHG 2XAAA 5EP3A 1SZTA 1P74A 2PY6A 1KAQA 5FA5A 1E92A 2D3OW 4CV0A 3B3QA 3AUAA 1AXRA 3OCWA 4JJ8A 1B7GO 2QSAA 3QEKA 1FVXA 4JCCA 1PP4A 2WTMA 3EC2A 5FEUA 2MIIA 1F60A 3L0ZA 2PT7A 5H82A 2OCAA 3A6JA 3BD8A 1FTQA 3DOUA 1P1RA 2BM9A 2QQGA 4EUEA 2WJZB 3L74H 5JDIC 2OZEA 2A3RA 4W8HA 2IODA 3H2GA 4UUOA 3QLUC 5ERYA 2G0TA 4MW5A 1YHYA 3UC5A 3SJCA 1GQYA 2ZCEA 5KYWB 1IBLO 1OW3B 3ZVMA 4F3TA 2YYYA 4R2IA 1ZNQO 3L0SA 1S8FA 4MICA 2DM6A 2X7JA 1BWPA 5F1YA 1L5KA 2YQZA 1FU4A 2QX8A 1HE8B 4A2CA 4MVOA 1MO6A 2RHMA 2Z5GA 1N6NA 1MJGM 2VYCA 1C9JA 4TKUA 2R4QA 2FRDC 2NXCA 4F7WA 3JQEA 2QTVA 2DR2A 4AAYA 2AJDA 3ZWBA 5K20A 2QZ4A 3BDIA 1Z74A 2NXJA 4LRTB 5DP1A 1NVUQ 2IXDA 3CG0A 2FGJA 5DGTA 1J8MF 5DHRA 3P9YA 1G9XA 2X3UA 3ROKA 1YEWA 4KQHA 2WDZA 5DTJA 5EIXA 1YJAA 2AFHE 1XPUA 3KU1A 1WSAA 2B2NA 1XTKA 1HE4A 1DPGA 5FWYA 1JQ3A 2V8OA 3HKEB 5JSUA 4NEHB 2ACEA 3DYBA 3WMWA 1NP3A 1LJLA 5D85A 5GONF 1TEHA 1C0EA 3R3UA 2ID8A 2QN6A 3HPLC 1VE1A 4TUYF 1QZXA 1VCMA 1DZIA 1U3FA 2BMFA 3K4PA 4FZ0A 2I78A 2Y48A 1P1HA 2VKQA 2RH4A 2KM1A 1AKUA 3N75A 1WUIS 3IUJA 1W6RA 3GGCA 4EHDA 2OZKA 2XWBF 1G3RA 5LB2A 1L7OA 3ZDEA 1U04A 1JHUA 3K94A 1YDMA 1IRIA 5ALLA 4QARA 4YRFA 5HFAA 1J90A 1GM7A 3FAKA 5K0ZA 4RY2A 4FFSA 3MUOA 1JDSA 4UD6A 4LYFA 3QUQA 3AU9A 1I5OA 1QR6A 1MRSA 2YIVX 1JFVA 1R1BA 4G0MA 5KNBD 1O9BA 3WDSA 1QHHB 3C3MA 3LT2A 3C3XA 4XIGS 5ED4A 1H6DA 3WDMA 5AVXA 3FNHA 3RSHA 4O0MA 1SK9A 3HHEA 4JL6A 3ZG6A 1JEQA 2AK3A 2JIZA 3GRCA 1NC3A 3NBUA 3C7KA 3UAYA 5BMVA 3CJRA 4G09A 4LSGA 4BFUA 3WLLA 2HMTA 5K2MA 4CH6A 3IDQA 3UHFA 4RKQA 2WUDA 3SDSA 3BPZA 4BUCA 3EVKA 1VE7A 1Z2AA 4MSUA 3LGSA 1C41A 3WYBA 3D59A 3ZGLA 4HJRA 4BMZA 2HXYA 4G0XA 3ZTTA 2W43A 2H3EA 4GQIA 4RAOA 4XDKA 2GJ9A 2I8LA 1Q1BA 1O6CA 3A25A 1L4KA 2E7ZA 4ZOLF 3EGXA 3CS5A 2JGKA 1AR5A 2EFDB 2JS5A 1JKFA 3GUCA 4C76A 5TQ0A 1US8B 1QH1B 2YOGA 4G5OA 4QU0A 1Y9EA 2GF0A 2OMKA 5AWFC 3QPAA 4F04A 3GLFA 1ZSPA 4FX5A 3U56A 2OOKA 5FPSA 3ZHYA 3ESQA 3V1YA 3P2YA 4P4SA 2HJFC 1FTYA 4QBGB 4XASA 3MHTA 3QW2A 5BQFA 3KZXA 3JX9A 5KIAA 1F8YA 3DC7A 5LUAA 1F0PA 4IF4A 3BB4A 1L3BA 4D0NA 1FA9A 1YHQV 5JU6A 3HN6A 4CNBA 1P62B 1Q0RA 2I6QA 3TRDA 4QHSA 3DCYA 3HRIA 1E2JA 1NW5A 1DHTA 3HA5A 3BL8A 3H1FA 2SCUB 3DKVA 5DI9A 1WTAA 2EF1A 4BIZA 2W83A 3GRVA 4HDKB 4INOA 4E5UA 1V5FA 3D6UA 2WNSA 1HURA 2AN9A 2BTQB 3ORFA 1N1MA 4EYKA 5ILGA 1QZZA 4EFBA 2XEXA 4HLCA 4US2R 4EY6A 4JZGA 5ALPA 2FFJA 1QC5A 3K7EA 1VHDA 4XM1A 3AFNA 3S4YA 1T5DX 3WMXA 4F60A 1IBKO 1TF7A 1SZJG 5A3JA 2TYSB 3BF7A 5FXMA 5AW8A 1ZAYA 3B3GA 3FN4A 3BRWA 3Q72A 4LBYA 3CX5F 4X1KB 2FP4A 2RH8A 5F4ZA 1K5PA 2CVPA 3ZCXA 3LZDA 1K7YA 3BEHA 2OO5A 3JQRA 2XB9A 3VI3B 4OXYA 3IDSA 5DULA 4KSCA 3BCHA 3HN2A 2HSEA 4B7UA 4MMXB 3ES9A 1N6IA 3K0AA 5FWXA 2XRFA 2A84A 4RKEA 4WZAB 2IH1C 3E0QA 3GF4A 1UBKS 2IW3A 5JD4A 1NYRA 5H6QA 2I4TA 3P9CA 2CLMB 3FCOA 4FYHA 4DJDC 4LFCO 1LD3A 4DKXA 1KY4A 3KWLA 4AI6A 4N01A 1H2AS 2CKMA 4X1YA 4GEKA 1O97C 5D6NA 3GK3A 1X8JA 4HXEB 4RPJA 3QGMA 4J1QA 4JLWA 4WQMA 3QFHA 4J0EA 1Z0DA 5JXJA 1XDDA 5DLYA 3AZPA 3F8TA 1E9AA 1E62A 3T6KA 2ANBA 3O2NA 1AZLA 3TSWA 4MI9A 2HO5A 5I45A 2JLYA 1QH0A 3CCJV 3WBFA 4IO1A 4AL4A 4O02B 4WUTA 1RCFA 6REQB 2ZD9A 1DOHA 1TAGA 1TGVA 1J9GA 5I4KA 2CD9A 1GZSA 1X9GA 1DAHA 3O8RA 3C24A 4TVOA 1Y7IA 3I5UA 5AKEA 2EIHA 2PVSA 1UPCA 1COZA 5J4HA 3BFJA 4DIBA 1ZHHA 3H5IA 5M5BA 1KH3A 1EUCA 3T99A 1CUBA 5A2QA 5DNWA 2WSSD 4HCJA 2G71A 3F7NA 2W2NA 4CHTA 3IX7A 4AU1A 3IEVA 4CV3A 5AFSA 3EQ9A 3VZDA 4QPJA 2NN4A 1IULA 2V7QA 1K27A 4UATA 1RE0A 4K81B 4YQEA 1L7MA 2H85A 1CPYA 2IVFA 4LOAA 3U0BA 2G1AA 1ONPA 1ECLA 4KXFB 1V5WA 3SJCC 4EK9A 2CJFA 3TH5A 5ALOA 3LYHA 4L5CA 3AC0A 2R1ZA 3FLBA 1FFSA 3UA3A 5EMKA 4AQDA 1D2RA 5ISMA 1ZONA 3E8BA 2OAQ1 3Q7EA 5HZGA 1JG2A 5GTIZ 2ANCA 2ZJAA 4PDRA 1AI6A 3E83A 5FFFA 2LKCA 4EA7A 2LV8A 4UVAA 3IMGA 3VNBA 5I9BA 4HTFA 1IZ9A 4ZVOA 4B3GA 4YT4A 1H2BA 2IOFA 3I9V6 4EI2A 4L6AA 2OXFA 2YEVB 3KQTA 2JK5C 2X6QA 4ZCIA 5CJJA 3UXEA 2ITCC 4Q66C 2K87A 3GJ7A 1VQ4V 4FM1A 1TKBA 1Z38A 3HXTA 2W2LD 3RWBA 3FDIA 2EKLA 5CA1B 5JT1A 4I3HA 1HYGA 1X19A 2ZI7A 2XQJA 2DJ5A 3UCXA 4XZ3A 2DUJA 1F20A 4HAIA 4ZO6A 5LGTA 4R83A 1KQOA 3AG6A 4WADA 3UH0A 4YP5A 3R40A 5EJ9A 4H9GA 3I1FA 1BX3A 2C57A 3K1AA 4FFMA 3DT9A 1S3IA 3KWMA 3OZIA 2FTKA 2VPZA 4JBNA 1P5HA 4IXTA 5DBHX 1PJRA 2J0EA 1K73W 4M1OA 1UDBA 2EYUA 1XNGA 3FGOA 1P80A 1G21B 1PR6A 3AEUA 1G1AA 2F48A 3QWHA 4PQYA 3SJQC 5ALDA 4HZUA 3FWYA 2F64A 2FEAA 1V9SA 3UJ3X 3IQHX 4NIMA 3LY5A 3IQFA 3IP6A 3G82C 4GX1A 3F98A 4OPHA 1JBKA 1RQ7A 4YVFA 5LMUB 4M9UA 4KQWA 2C5GA 2I67A 3WGLA 4YS6A 3VMFA 1BQ0A 1AT1A 1LQTA 5T57A 4G0YA 2XOKD 3QFFA 3PWZA 4QBIA 1EX9A 4B48A 3IHWA 1DO0A 2EV9A 3HE3A 5JS2A 3TW4A 5IAEA 4H13B 2CVZA 2VAXA 3SGIA 1M34B 3R0VA 2GZMA 2F8SA 4W63A 1J0EA 1KDPA 4D02A 1FX0B 1V43A 1L1FA 1K33A 1SXJE 1UBTS 3F7MA 3PC2A 3UBTA 1EWRA 3B5IA 4M1MA 1QVAA 5A03A 1YA6A 3O4RA 4BFSA 1TNDA 4XDLA 3OJEA 4B3HA 5IJWA 4TV8A 1FFBA 5L6LB 1E1RG 4J75A 4J6EA 4PEVA 2KB1A 4MS1A 4RK4A 2ZVDA 4K2HA 2CVFA 2DKOA 2ZYVX 2AE2A 2V54A 2A0KA 3C5EA 2BR5A 3U49A 1LW6E 4QEZA 2J3DA 1JLSA 4BV2A 1FDSA 3EH2A 3PD7A 4TT8A 2PE5A 4I50B 4L85A 4H0FA 2IK8A 2YXNA 4H6VA 2PEZA 4Q9JA 4NK4A 3OIGA 4KE9A 1X7YB 4OQEA 1HM5A 5ALFA 5BY1A 4L78A 1JXOA 1QGDA 1Z7YA 2V9PA 1U5AA 1IZ3A 3Q0TA 2DN9A 1RJDA 4JNCA 2EZ4A 4NCJA 2FW8A 2AK2A 2HK7A 2C2GA 1XHEA 4NMWA 1Y3CE 3RSZA 1WXQA 3KVVA 3N2KB 3UUGA 3G8CA 5JV5A 1HRKA 1OI3A 1QCZA 3P9NA 3RIHA 3V7YA 3PFIA 1P0MA 4U2EA 4CR7A 1EN5A 3F9IA 1VRVA 5I47A 4KL8S 5KOJB 3E3OA 3QUBA 1C1XA 3UFXA 3DF9A 3DZIA 1GT6A 2Z58A 5T4HA 1D8TA 1VIYA 1KP9A 2BFCB 3NGXA 1ZHOA 4IZHA 4YQFA 1AZWA 4U2GA 1D2EA 1S1CA 4D81A 1NG9A 3L1JA 2G7MC 1KTIA 3UMFA 4J41A 4WZAE 4KLAA 4G37A 1TO2E 2I87A 2VZLA 1YRAA 2P6MA 1N6OA 1UKBA 4KWTA 2HMUA 4KMRA 1CQJB 2Q0AA 1Q91A 3QQ5A 2ZZMA 3DMNA 1YB7A 2OO5C 3C8MA 3BH0A 4UBKA 1L6RA 4LF9B 1N7IA 3SYAA 3CCFA 1FVOA 5K0GA 5EE3A 3LM8A 3Q8KA 2YV1A 3MMXA 4MV5A 3IKLA 3QO5A 3UJPA 2JJ2G 3R66A 4L73A 4BNWA 1GTZA 1XCJA 5J5VA 3I1YA 4EL5A 3QE9Y 4R05A 2XWSA 2RDCA 4DV1O 5A9SA 3EC1A 3RVDA 1VA5A 2G80A 1JIQA 5F1PA 3R3YA 5HE8A 3BGIA 2P9CA 3ZCPA 1B14A 3R6TA 3CTMA 3OCJA 4ENUA 3OZVA 3UB4A 3IAM6 2OILA 3QWBA 4DXDA 2GWRA 3VR4A 4PV1B 4CKCA 2QK4A 2ZT8A 1ESEA 5TVGA 1G42A 1X7XA 1JSZA 2FMIA 1K7DA 1E6LA 1WCV1 4DUYO 3F5FA 4HNQA 3DXZA 4FYXA 4K6FA 1QZTA 4BMCA 4PW0A 4RC9A 1L8LA 1OAOA 4CKWA 5CX1A 5EGSA 5L6MB 3ASVA 4E07A 4L02A 4R7GA 3JQDA 1VE5A 4MXDA 3SYNA 4YRGA 5C7LO 5TQJA 2FN3A 3HSSA 4YA6A 1FPMA 4ANFA 2JAPA 2H57A 2N75A 3OQ1A 1PJ2A 2WF7A 2I6SA 1KYOF 2NYRA 2P9FA 1GFWA 2BJVA 1UJMA 1U7WA 5DM70 3KTFA 5ALYA 3GRRA 2A5JA 4G07A 4QPJC 3F6SA 1KYIA 4AIRA 1QIEA 3DFZA 3OOEA 4IL6Z 3HFSA 3MLEA 2OK8A 2XUMA 3FX2A 1KQSU 4KQIA 4JSYA 1NZ6A 1CY7A 4BNZA 4J03A 4NXNB 2P9GA 4DNXA 4E6PA 1K89A 4BPRA 1QO7A 3U7FB 3OEWA 1TEVA 4COOA 1ROPA 1V4NA 2DLDA 4TMZA 4R2WA 3QM1A 3AVTA 4EY4A 3NRJA 4HLDA 4OHFA 3FOCA 4PNZA 3SS7X 4MMZB 4NJEB 1NP6A 1JGTA 2H7CA 3OQHA 4J0IA 1U1DA 2DFTA 2I3ZA 4HUQA 2XCRB 2D2IA 4A8JA 2A9FA 4D7SA 1JIVA 1J0AA 5KYVA 4E5KA 2HK8A 3CXRA 4MI3A 1CDZA 2CTQA 1R4NA 2Q4RA 1WB9A 5JH7A 3AJRA 1Z4LA 3STVA 3CLUC 3KT6A 1G21E 4ZVVA 4JT8A 4HSGA 3MCZA 5A4FS 1A9XA 2XXAA 4LXIA 1SEPA 2OV4A 3LXUX 2AJCA 1PZEA 3EXHA 4BB5A 2Q6KA 4E2ZA 3QEJA 4M6WB 1M6WA 2C3YA 1F3LA 2YVQA 5DGIA 1LPMA 3HJTA 4UZFA 3L0YA 1HFKA 3O9ZA 1WCIA 5FBZA 1CIPA 4LV8B 3EMKA 2E48A 4LVNA 1BMFD 1A9PA 5CBGA 4OKIA 1GZ6A 4MW7A 2CJPA 1M34E 3L6RA 5AIBA 5TT1A 1DMSA 4O29A 3N0XA 5KTRA 3O4VA 2WV7A 1D2NA 5EBMC 3WNDA 1U4OA 1RPOA 5H80A 4BO7A 2LFRA 4MJLA 4E5SA 1NN3A 5DSTA 3UAWA 5LL6Y 1YNOA 4AMBA 4FWIB 2FMLA 2BFMA 5HA5A 1P1KA 2VNSA 5MFZA 1G20B 5HP4A 2FEWB 4FEGA 2RB5A 4C30A 1S8AA 4X7MA 2BIFA 5MN6A 8OHMA 2Z4RA 5T8KA 1VC2A 1QQTA 2QNIA 1GN6A 4FB4A 3PL5A 2HMYB 1NW6A 3RJTA 1YTFD 5F23A 1VBKA 3PI6A 4KXXA 3FUWA 1SRRA 2RNBA 1ZIDA 1NOKA 3UPUA 2MT9A 5EWJB 4XA8A 1UBUS 5BSTA 5DHQA 2GM3A 3EC7A 1VB5A 2IE8A 4NU6A 2RHHA 1Y80A 3NX4A 1UDCA 3F2VA 5DGHA 4AG6A 1S01A 1NT2A 5FQOA 3S2SA 5GIOE 1D2AA 3P4UA 2OAEA 4IDBA 4N9WA 4RK7A 1ZUHA 4N1AA 4HX9A 2YBEA 5H16A 2Q3HA 4Q4LA 3OOHA 1ZW1A 6LDHA 4XM0A 1LNSA 3QBDA 4B0OA 4LDNA 1TMGE 2IV3A 1CR2A 5ITWA 2ET6A 2XUPA 1P4AA 1ABFA 4AX4A 4ZOQI 4B74A 1WX1A 5HRAA 3ABKC 1DF4A 1XMIA 4I46A 2IXFA 3C3YA 4CL3A 4B3FX 2FHSA 5JJIA 4HXYA 2Q0OC 5CRIA 1Y1QA 3E5RA 1Z5NA 5GV7A 4Z3KA 3J81N 4ZD6A 1DX4A 4D9JA 2ZSDA 2FR0A 2XD9A 3L4JA 4GXQA 4W8GA 4BZXA 4L9RA 4YH1A 4H4EA 2VTDA 1M5IA 3Q10A 3PHJA 2H2WA 4G1UC 4U6QA 3K2BA 5IN4A 1KZGB 2Q3FA 2GK4A 2H3HA 1ZVQA 4WN9B 2P1RA 4TZTA 3O6VA 4KHPB 4H4DA 3ZIAG 5BURA 1TM2A 1QYVA 1RT9A 3DFFA 3PHIA 1YS9A 2C83A 2EBUA 2A33A 1H2EA 4CKBA 3CEAA 3T5MA 3D6AA 1T3ZA 1YD7A 4ECEA 3WGJA 2CFSA 4YJKA 3SYMA 1JR3E 1ZMOA 1DJNA 4WKOA 3QPVA 3LLUA 5AVVA 3HWRA 1Q86W 4HWKA 1Q83A 3JR3A 4MYDA 4KQEA 2XMDA 1DT5A 4N40A 4N0QA 4RKWA 3MELA 2Q4TA 5DYYA 3ADDA 4O5AA 4DWJA 2YV5A 4MWDA 5DYTA 5JPIA 4LSMA 2AGVA 1VI6A 5A3RA 2JHPA 3SY8A 3H5OA 4WFIA 4BQPA 5JVDF 1UDAA 4C6RA 2BFWA 2ZIOA 2RGWA 3HZHA 4RABA 3HV0A 2FR8A 1FDTA 1UEXC 4IWNA 4PS1A 3AESB 1Y1TA 4FC6A 4EHLA 3TDKA 4OQYA 1TKCA 1MIOA 4ZOCA 4I8DA 4CM4A 4IQ4A 2FLVA 4BFZA 4NBRA 3BWMA 4KXQA 1F1JA 1F5NA 3DS8A 3FMFA 2Q9LA 3OMWA 2XMPA 4B3IA 3OQMA 3DVAA 1NFFA 4DLRA 1IOLA 1MA1A 3DNMA 4IVNA 2KLHA 1OFTA 4K3VA 4L0CA 1PDWA 3GZ4A 1GZ7A 3IPLA 2X1HA 3RN4A 1JYFA 1JIUA 1TVKB 1MX3A 4EWLA 1GNQA 3WKDA 2UYHA 2P9JA 3VPCA 3KTAA 3DUFA 2J67A 3KHKA 1W46A 1Q50A 4IDQA 6PFKA 4JX9A 5FL7D 3UCEA 1OAOC 4D7AA 2WVHA 3MYRA 1ZNXA 1TD1A 1YNSA 5FLKA 3N1UA 1E2UA 3P4XA 1QDLB 1MG5A 5KKNB 5KHGA 5J2UB 1SA0B 2PVCA 4UOQA 3B1XA 4KXYA 3T1VA 9LDTA 1D9XA 3P32A 1ZXBA 1RAAA 4WBNF 1D7AA 5JBIA 5GGYA 5IAOA 3MJFA 3C3JA 1BTOA 4MV7A 1Q14A 3FYEB 3A1DA 2Y76A 1C8KA 1JIIA 4Y1RB 4PI2A 3MOIA 2BF4A 4WI1A 2XCQA 3NORA 1P7GA 1CP2A 3WMEA 3HUEA 1H1DA 3LFUA 3BYZA 5DX8A 4EVRA 3R7WA 1R0ZA 2FCRA 2WPDG 2D1SA 3SZOA 5BR1A 1YIOA 1JMYA 1V3UA 1HNWB 1SZXA 1KIAA 3FFAA 4F2GA 3K32A 1FIUA 3RS4A 2B21A 2CYAA 2Q0SA 4F8JA 1PIWA 2FE4A 4FX2A 1T2DA 4HNHA 3H3JA 2QD4A 1ZZGA 4EW6A 1SZPA 1YF2A 1H94A 3EAFA 1M4UA 1SBNE 1NH2B 1X7DA 5JXWA 3RUIA 3T7EA 4KQMA 3G6EV 3CLRC 1CHNA 4OFWA 2CB0A 3ABZA 4V39A 1V3VA 1U0SY 4M22A 3O9MA 4I4TF 3K3WA 3FHLA 4HWRA 2HKOA 3EVNA 3C8UA 1N4AA 1XZBA 4A8JC 1E9VA 4J7JA 4JI8B 1TUBB 4D8YA 1D1PA 5BVHA 3CN9A 5H3HA 1YFKA 1LPBB 2GN4A 3ABIA 4C4SA 5EZSA 3S3TA 4CM8B 2NUPB 4I3FA 5JOQA 2X6BA 5LBIA 5LDHA 3TO5A 5F77A 3K0FA 4YAGA 3C41J 4XVRA 2IV7A 3EXHC 3VKHA 5CIQA 4C88A 3ZWPA 1KH2A 5F33A 1KQFA 4WLEA 5IFKA 2EX3A 2HJHA 3P9IA 4MUIA 3K5MA 4U4AA 2QE7A 4DV0B 3TXQA 1IZ8A 4IX1A 4AN1A 2BHRA 2RHLA 3B8NA 2Z43A 4JP3A 2BL4A 1NIJA 1G20E 3HMQA 1E32A 1QS0B 3IS3A 5TPZA 2YY7A 2R84A 2FPRA 1YE3A 2DUWA 2HQBA 5BSEA 3CVYA 4JJFA 3GRYA 3STTA 3PEVA 1N5KA 5LP1A 1ZH0A 3SJAA 4EQ6A 2OTLV 1E2IA 3HEBA 1BMDA 5J63A 1JV2B 4PZCA 4RZSA 3EVZA 3I4CA 1N7HA 1GCIA 5IF3A 1BXGA 2CUNA 3LTEA 4E31A 1NMYA 1VGQA 5DK4A 4TTJA 2NYUA 4B3TB 2V4UA 3C15C 3RGBA 1YZYA 2CMKA 3TCUA 1RACA 3AVPA 5I7RA 3N7TA 3LVRE 1VQOV 4I9HA 3FA2A 4NV1A 2J3IA 3OT5A 4OJNA 3WJ1A 6NULA 1ZU4A 1F3OA 2ZP1A 4MCHA 3VDMA 3TW6A 1XZMA 2HJRA 4ILKA 2QKSA 1TCBA 3U4IA 3GB9A 2IEZA 4ZAYA 3KEFA 1DSSG 2YOHA 3INTA 4UUQA 2VJLA 1P9RA 1KGDA 4KO8A 2CXPA 1SB8A 4WOCA 3IKVA 5EYPA 1Y48E 1EA5A 2A59A 1QLEB 2AI2A 4QGHA 4QJBA 1TB4A 4H7DA 3HU1A 1LDYA 4F1KA 1QLHA 4E0BA 5KTMA 4PS0A 3OOJA 1VBMA 2Z09A 1U7ZA 3ROMA 4AZ3A 4IRXA 4BNDB 4G63A 2WIGA 3JVVA 2WZDA 4Y7DA 1JR2A 5K6RA 3S2FA 3HCWA 1QK4A 2H59A 1QO9A 3S2EA 5HF9A 1CBUA 1CLEA 4TQDA 3K5HA 3KR1A 4PYIA 2GEKA 4ON9A 3DWEX 2IRWA 2D4HA 3WKCA 3A11A 4L75A 4QRIA 2CVQA 2W11A 4DR4O 1U7HA 1TYCA 2DQKA 4B6GA 2NUTA 4L9WA 5K0SA 3QUSA 2C7OA 1MC5A 2W6NA 1PL7A 1JQBA 1G59A 2KSDA 3MYYA 4S1TA 4F84A 1I0IA 4KNVA 2W2MA 3DOIA 1QP8A 4C01A 1KDTA 2WTXA 4CMIA 3H7IA 4JGGA 5LPNA 2QVYX 1H4QA 4PFJA 3DB1A 3O47A 4RVCA 1HNXO 2G25A 3CEHA 2NPOA 2MDTA 5AW7A 4RF5A 1SRYA 4MPDA 1F1BA 3R9XB 1FC0A 1U8TA 1CETA 2VHZA 2X8WA 1UKVY 5LYYA 4B5KA 1XHFA 2RH5A 5BN5B 2HCBA 3GPDG 4Y2GA 1W4AA 4I5FA 1SMKA 3W6UA 4PELA 1B1AA 1M7BA 3ZJZA 1VQ9V 4BC1A 3OX3A 1W0JA 3E8GA 3EPJA 3M1IA 1S3JA 2QHXA 3B1YA 3S7ZA 1H22A 3B82A 1T8TA 5BYKA 5JAOA 2F3QA 3TLXA 1W8DA 2JGDB 1I9GA 3VR2A 3U3DA 2FR8C 3KLOA 2FW0A 2RMKA 5EIAA 1AV6A 2BRUA 5JNRA 3VR6A 3SBXA 2VCYA 1Z4MA 1FDOA 4E1BA 4ER7A 5AJYA 3CR3C 1O1YA 2B99A 4QPZA 3HADA 4RSHA 3DKPA 2QPOA 3OKCA 1VL6A 4C07A 1D5WA 3RIEA 4QJ3A 1M54A 4BLSA 5HZKA 1ND6A 3ZDCA 1Z08A 1XVLA 2YXYA 1M56B 2QYSA 2XA2A 3SXPA 4DA6A 2G36A 4V0ME 4X94A 1M2OA 2E87A 3DE4X 1YL5A 1A88A 4Y1EA 4X41A 5I4IA 2YWFA 4ZQGA 4M1ZA 2GD2A 4BRZA 3K5PA 2Y1DA 4FZ5A 4FHFA 1KI3A 5HUJA 3ZHTA 3VOTA 5CBPB 2IA5A 3WSTA 3DXYA 4PHCA 2O57A 1VE6A 4KO3S 4B83A 1C1DA 4XLLA 2I6UA 4F9EA 3CJTA 3TX2A 5BN4B 2YWDA 3N6RA 3PR1A 4ZVLA 2ERXA 5L3RA 4FYYA 2BLLA 3FZEA 3H2BA 4JBGA 3UMSA 3B1WA 4EMBA 4D42A 4YRKA 3NH6A 4O3FA 5KHLB 4FJCC 1C0KA 4OLBA 1MMMA 4Z2AA 3KOUA 1QQ5A 1CXZB 3DP9A 1UMCB 2EIMC 3GVHA 4OMUA 5IZCA 3CPSA 3GFQA 5IUJC 1ODKA 4H7JA 1Z75A 3I12A 3UW3A 2PO5A 4AYWA 1Z0FA 5FOWA 4DLBA 2XQIA 2PX2A 4LECA 4FFKA 2I1QA 2D2XA 4YV7A 4YY3O 1NFRA 3MHPA 1JE0A 3ZI4A 1XX6A 1CY0A 3MWLA 3R4CA 5K0BA 4LYEA 2H08A 4QDUA 4F92B 1P2SA 2XT9A 2Z2KA 3BK7A 5A0TA 4PR0A 4E6EA 4FMBB 4GKJO 3M2TA 5ESDA 1U7DA 1T1SA 4LE1A 4IOKA 2FEKA 3DMTA 5LMCA 3JALB 4B84A 1YQEA 1BA3A 4L8JA 3K0EA 1L5LA 2NZVG 4RMGA 5JPDA 4DJTA 2JGJA 4BEBA 1W0KG 3PG5A 3G2LA 1WSBA 2OUIA 2YXDA 1L3CA 3G2IA 1XROA 3RC2A 3QMVA 1VJGA 3DBIA 1W93A 1C30B 1GZHB 3BMXA 3I58A 3CTPA 5AJHA 1LTHR 1KAOA 2P2YA 5C8YF 1I7DA 3OOWA 2D3WA 5E6RB 3X43A 2ZDHA 3CZRA 2WLIA 4M3NA 1QM5A 1MX9A 2C5EA 4HWSA 3IVAA 1V16B 4OQPA 3IELA 2CLCX 4N5IX 1R74A 3EFBA 3WL3A 2YJ4A 1S3SA 5A2GA 3L8EA 3EG5A 5K8TA 2QM3A 3WLIA 3V2UA 4P35A 5EWLA 1QONA 1SAYA 2HA7A 2A1IA 4R7ZA 3ZHZA 1EDZA 1XILA 3IJEB 3NIWA 3SMQA 2JANA 1U3CA 2DSTA 3OAAD 4PY2A 3NFYA 3KNZA 4OXSA 1G2PA 3ZY4A 3RIMA 2W6IG 5FLXA 2VTKA 3SJAC 4QGSA 4G67A 3KP1A 1IBLB 4NPHA 3HY4A 1XT6A 2TMYA 2JEOA 3T7IA 3AR5A 3Q4GA 3VR0A 3CVXA 4YIOA 4WESB 4KFCA 2HFKA 1YI1A 1MBZA 2X22A 2BJWA 4NV3A 2IUUA 3BMNA 2QKYA 3D6VA 3OZRA 2W70A 4BIOA 3LP6A 1E0JA 1BGYH 4FJ2A 2MMGA 2BW0A 1B74A 2L35A 3GHYA 3KXLA 2O1WA 1R3IC 1E89A 1B04A 4I6EA 3K16A 2YRFA 3K31A 4PLTA 2OGTA 1JP7A 1ORWA 2XNKA 5C32A 5F2VO 3ZHUA 4M9CA 4RHUA 2BHLA 2Q2OA 3RFTA 1TC2A 4RA9B 1JHYA 1QRAA 1NI4B 5FAXA 4B5LA 5JNVA 5D6OA 2OZLB 4ARSA 1KXJA 4P81A 3L6CA 3TEFA 4MW4A 3KPVA 1I4EB 2PZBA 3RB8A 5A5VA 4N6NA 3D3KA 2PBLA 3V7WA 2XZOA 2DETA 4HDRB 3OE1A 3VJLA 3K04A 4PTLA 3I8XA 1W94A 5B36A 1QRSA 1N2JA 3RUPA 4R9SA 4HN9A 5LU8A 4KMOA 2A92A 4IV8A 1OFGA 5HIMA 3ZHXA 2Q69A 4GBED 4QEKA 2H7YA 5KQRA 2D06A 4LF8O 4X45A 3DSQA 4A6DA 4JSRA 2RI1A 4JA2A 2FPPA 4HH3C 4UAUA 4PO8A 3SYCA 3JQPA 5GONB 3FPFA 4M76B 2MYNA 4DXHA 4TUYB 3EEFA 3URMA 2H4WA 1CD5A 1UDRA 5CEFA 1UIMA 1IOVA 1V11A 5T4BA 2DHDA 4WKBA 3TQOA 1SKYB 1UK9A 2CE2X 4G5QA 5H3CA 5DX0A 5B1BB 1GPNA 2X2EA 5B1EA 3FCCA 3R3VA 2BZ1A 2QSYA 3O2SB 5JS1A 1IPEA 3R41A 1IU9A 1TM1E 1U0RA 5C51B 1NXOA 2HRZA 3ER6A 1WUYA 1Q16A 3O03A 2OL4A 1J8FA 2IU0A 2Q29A 3KL2A 5IAGA 2PFKA 2DZDA 4KJZA 3H42B 3WQRA 5JY1A 4S05A 4JC0A 5LZ5A 5JARA 1SCUB 1ISJA 1S3GA 3KR9A 3TEMA 1U98A 1PR5A 3FVWA 2HJVA 1SU6A 3I83A 1KA9H 4XUDA 4WACA 3ESYA 3IAUA 2VBCA 2BRUC 2VFAA 4JGIA 3C98A 3UK7A 4RH1A 3D7KA 1OZGA 3SFZA 2HJDA 4ZALA 4DMGA 1VL0A 3RC9A 1D5CA 4JUIA 4NOMA 5C8XA 4HDOB 3CY6A 2JFHA 5L3CA 4P2GA 4LJ9A 3P9SA 1FNDA 1S2OA 2IHYA 5AVQA 3ETGA 3EMDA 3SX4A 4KIWA 3TFOA 4CM9D 1NF9A 1TQ2A 1ULAA 2CSUA 1ULZA 5C37A 4NLLA 2QORA 3JATA 1MFPA 1QG2A 2ON6A 2QWRB 3N2EA 3NDJA 4ZOLB 3QYFA 5KYXB 4LCUC 4FIZA 5FI0B 2C9CA 4WD3A 2FKXA 1LC3A 4F8EA 4W7IA 4F4DA 3JARA 2EYQA 1H0HA 4DT1B 2GD6A 2EWVA 4TPKA 4QYMA 1FNSA 4AMYA 2JLWA 1R7RA 4XPIA 1M6NA 3OPVA 4M0MA 1CZUA 4UMDA 1PJZA 1IBKB 1RRKA 1BFKA 3M6MD 4MGIR 1TQ8A 5KYUB 2GJ8A 3L5OA 1ZGAA 4CR6A 2AYYA 4B1FA 3ZOKA 3I76A 3W5JA 5EPEA 1HL7A 3E18A 2QP3A 4O25A 2GDZA 1W9MA 5IZCC 4IIDA 1A9ZA 3TIFA 3Q8WA 3UJ9A 1Z6XA 5ILOA 1OSNA 3SHFA 2PUJA 2F4NA 2KKWA 4O4JA 1I4DD 1S4MA 4NENA 4BNGA 5IYZF 1ZINA 3M2PA 1U0BB 3ZDDA 4B4DA 2QM4A 5AJWA 1SXJB 1W1WA 1G66A 1USWA 1JR6A 1EHCA 5IT4A 1KO4A 3D8BA 1K6EA 4DLXA 5CA0A 2QLBA 2H8KA 1WBDA 2UXNA 1YDFA 4ES6A 5SYAA 4A0SA 1VHQA 5LM3A 1OLSA 3F96A 4XX0B 3YASA 4HEQA 4AY4A 4QQ8A 3T3NA 5I7WA 1SKVA 3B89A 3ZGYA 4FWTA 5MGBA 2J3LA 3UWSA 1V8BA 1AKTA 3WSVA 2O7VA 4CMEA 4AF7A 5ES3A 3ZE8A 5IAAA 1XQYA 3O5AA 2YS8A 4Q15A 1A9OA 3U3MA 2E3JA 2RGBA 5B1AC 3VZBA 3V6MA 2C3MA 1NQUA 4URUR 2E5LO 3WOHA 5TB5A 2Q4OA 3ZLBA 1Y8RB 4MW2A 1T8UA 2B8TA 3TXSA 5EHIA 1SQQH 1NQWA 1ORDA 3MJVA 3ZCQA 8GPBA 5ALRA 5IPFA 2WMOB 2VZ8A 4BQFA 3OFNA 5AW1A 2C4WA 2ZT9B 2IUYA 2CCKA 5K0FA 3VKVA 3LVQE 1P2FA 2X0RA 4IG4A 1HE3A 4YREA 4HVCA 1T2CA 3WIOA 4XFDA 4IOJA 3KT3A 4DARA 3H8JA 1YB1A 1R3LC 4TLAA 1L6IA 4N3NA 1UJ6A 2GEVA 4D41A 2BMJA 1UFRA 3ONNA 2AWOA 5AKYA 4UJ3A 4DHEA 2ECKA 4IQFA 4L07A 1Q7YW 4AWAA 1Z37A 3LDFA 1N6RA 3VAYA 3HCDA 3R5TA 4RCYA 1KXZA 1P84F 4BW5A 1DXQA 1JA1A 2WJVA 4Q1CA 2BZGA 5THQA 2HLHA 2PYJA 2HA4A 4I1RA 2QBYA 3I34X 5IBCA 5IM4F 1S76D 1ZDMA 2YJ5A 3C6MA 4FC7A 5DCUA 1UM9A 5B7GA 5AKIA 1EMDA 2HSZA 1QKIA 1NW4A 5E0OA 2BF7A 3D5QA 1Y1KE 4MVJA 5TF0A 3ZHQA 2WWFA 4HEJA 5A0VA 1NURA 3Q6NA 3GCWA 2FOLA 5JFOA 4Y9SA 4LUCA 4MR8B 4BP9A 3HI6A 5ADUS 2P7IA 1XLUA 5DYGA 1T9AA 1ECFA 4RK0A 4QAJA 3DQZA 4MITA 1SQ0A 5BQOA 2JVIA 1SKYE 4JUCA 5CNMA 2N47A 3W77A 5TX7A 4KNWA 1VCOA 3TCNA 2ATCA 4KE8A 5K3EA 1Q7TA 4MS3B 4KB5A 3VR5H 2OO3A 1XU4A 3FRJA 3CC4V 4BZZA 4EH1A 1MB4A 3LX4A 4YMUA 2I54A 3GLTA 4UXIA 2OECA 1D2CA 4ZP1A 3ENNA 3WYFA 4UUBA 4LGVA 1G60A 3W1EA 4FLUA 4BTEA 1WDTA 2IX3A 2WG1A 2R8YA 1Z5OA 4U7FA 3GD7A 5IHXA 3KQLA 2CNNA 3PR2B 1U3WA 1DTOA 3TSOA 1LW7A 4PR3A 3HXPA 2F62A 4FB5A 4ACBA 4PAGA 3SPXA 3V5NA 4EO7A 1SUPA 2XCUA 3UMMA 2G9QA 4FI3F 5MF6A 2OWDA 5L3SA 3VU3A 1QQBA 4JBWA 2VWKA 2Q7EA 3LO8A 2FL4A 1FFGA 4MDEA 2BPOA 4C5CA 2QRMA 1ZLYA 2XUFA 2NSYA 2MYPA 2RHWA 2Z5FA 4LKOA 1VMDA 1MF7A 5LQSA 5G3YA 2FJ0A 1HDCA 5EHZA 3JQQA 3DAOA 4XR9A 1OH6A 1B6TA 4C0HA 3SSNA 1XFAA 3VR3D 1HKHA 1RNLA 4D74A 1I0ZA 3CX7A 1JHMA 2I6GA 1VB3A 5CDUA 3R5HA 2F67A 4X95A 3GGDA 1KK0A 3DF7A 2WM8A 3WRWA 5TIIA 3IAEA 3IMFA 2RB4A 3UK6A 5F3DA 1A95A 2PUDA 4UCOA 2XGGA 5JZ9A 1G7TA 1Q3TA 4EFMA 4MIKA 3U5ZB 1UBEA 4LJRA 3O1IC 1KBZA 1F06A 3VTKA 1XZIA 4GR9A 1LVGA 3Q9SA 4O4IA 1Z4NA 2XIJA 5FRDA 3MGGA 3NH9A 3ICCA 4IIFA 4JF3A 4DBLE 1R50A 4WWHA 4XWAA 3TWOA 2IFTA 1NMSA 5ITZB 1P2VA 2Q8PA 3RJ9A 5EXXA 3U3JA 1O4WA 1A2OA 3K03A 5BUSA 3U4QB 2CBXA 2ZBEA 1EJ0A 4A82A 5AKLA 4D4HA 3PZRA 3IA7A 9MHTA 2WD7B 1TTPB 4DLZA 3NOQA 5IVDA 4JV5O 1V9LA 2PKRA 3HJUA 2FPIB 1E3IA 2B8NA 3K9CA 5GY7A 1T9BA 1VGVA 5ALKA 2D2CB 2BFEB 4BBJA 4N0DA 1DKPA 1QKKA 3EOBI 3GDOA 2GCIA 1YK0A 4PG4A 3KR0A 3I56V 5IM5A 3PC8A 4ETMA 3Q6MA 4MO2A 1UK8A 3MXTA 3FZGA 3CWCA 2EDAA 2IBTA 2D62A 4HDAA 4DW1A 3ZRXA 3WGHA 1OX4B 2XUGA 1D3AA 3Q9NA 4TKMA 4LSZA 1ZAUA 2FB9A 4F46A 4A23A 3HDTA 2GPAA 4POAA 4ZVSA 1QSGA 3DMFA 1EE9A 3EVTA 4X7RA 3Q12A 3VXKA 1RE1A 4QODA 4TLMB 1RAIA 2FMKA 3E82A 3HUFA 4U6SA 2VZ9A 2I7XA 4DV1B 2UYGA 4M0UA 4UU1A 5CB6A 2P6RA 3W79A 4DWVA 1BWRA 5DX1A 3IHTA 1TM3E 3P1JA 4AKSA 4P31A 4I1IA 4ER6A 1XMOO 5CLJA 4PYRA 5JRZA 4JQSA 3GEGA 3H6KA 3I0NA 3CZMA 5KNBA 1T24A 1GP2A 3K1ZA 3TDNA 4EPRA 1ISIA 3N28A 4B44A 4OLJA 1N34O 4CMEC 1HC7A 3BMCA 3T1HO 4DUYB 4HQOA 1P81A 1GRJA 1COWG 1EQ2A 1D2DA 3G17A 1NDUA 2NT3A 3ZXUB 4HDMA 3DCIA 4UE3S 3V7NA 3QVKA 1VSVA 1SXHA 4MS2A 1DKRA 4P5DA 3ZWAA 1V2GA 3H9CA 4MKRA 3TTUA 1AK9A 1IATA 1G6HA 3B2EA 2TRSB 4RAIA 4V3BA 4WFGA 4MVMA 4AY6A 3BORA 4ZJUA 1ZU5A 1KYQA 2WF8A 3ZZ0A 1JHZA 2ZRCA 1L8DA 4RZ2A 5JZMA 2I2FA 3E03A 4EO9A 4HRVA 2CKDA 3MS4A 1U63A 3Q4HA 3L6DA 5K6AA 1DTWB 4PDLA 1NXXA 4MTOA 4LY0A 3QX7A 2QL7A 4K6CA 3BHIA 4D46A 5K8UA 4ZWNA 1Z4JA 4DE5A 1ZCFA 3OECA 1G7SA 3EODA 1SS3A 2QYTA 4Q3CA 4ZQIA 2POCA 4H4CA 1PG5A 1CJTC 2G9RA 2BMDA 1E69A 2REQA 2ESRA 4O3MA 4I4CA 2BEVB 3D6FA 2CXOA 1KEVA 3ZY5A 4GOKA 3WLEA 5B6IA 1V1MA 4OHXA 4NECA 4LC0A 1XV5A 4CQMB 3F67A 4EB6A 4M1QA 4PTZA 2MSWA 1K08A 1FXWF 3T5GA 3VHXB 2WMNB 1VL1A 4WFFA 1Q0SA 3KELA 2WZBA 3LS2A 1UH5A 1GWNA 1UMBB 2BC9A 2ISCA 2Q9UA 4BLQA 1Q3EA 2H9YA 2VEOA 1SKUA 3ZU4A 5HCNA 4G3XA 2XE7A 3VSDA 3ER9A 4GZ6A 4CQLA 3SM9A 3M8KA 1XCLA 5L4LA 5E2IA 3WYEA 3K96A 3D3NA 3L92A 1QRUA 2OM6A 4LRQA 1LV8A 3JRNA 3QWFA 1O5TA 1WP9A 3MWEA 3EUEA 1M2GA 1Q7RA 2C4NA 5TJHA 2ZJFA 2DFKB 2KX7A 2CDAA 2IZ0A 4NKRA 1DEAA 4FHEA 3WL4A 1QB7A 3P9QA 1JB9A 3NCTA 2YZGA 4B9AA 4N41A 4HWOA 1A8PA 2BOCC 1RJ9B 3V48A 4NYJQ 4PINA 2V6GA 5A62A 3F6PA 3ONDA 5KWVA 4URVR 1N78A 2A58A 3UJDA 1SELA 1SQ5A 1LCIA 1YMQA 1I0LA 1IY9A 3RLFA 1L4MA 2WU1A 1KJNA 4YP7A 2DBZA 4BJ1A 1P72A 4O2AF 4YRSA 4UXHA 3AB8A 1IBMO 2GEDA 4D3XA 4Y6QA 2X8JA 4J42A 1NH2D 4JS0A 3UXMA 3K92A 3ZU5A 2EQ5A 3A4LA 1JEYA 1Y6GA 1ENOA 1S0UA 3OZ7A 5KNLA 1G1MA 4CIWA 2KQXA 4M83A 4QOFA 4JDUA 4WPGA 4A3SA 4XJTA 2QT1A 2F1JA 1IMOA 3G2JA 1OC2A 3GVIA 4HBGA 2NNLD 2OC9A 2FKNA 5KWSA 4M37A 1B0UA 1XQXA 4GSYA 2P2SA 1U3VA 2VYVD 2HJWA 2M32A 4OHMA 4ZHQA 1G0OA 3JYNA 1KORA 2VH2A 2Q73A 2WVAA 4QNNA 2OKCA 5LMNO 1NT4A 4O63O 2LJ2A 1XSEA 4BU1A 3O4IA 1QP7A 2ZYWX 4X91A 4V0RA 3OJOA 3JYCA 4EECA 3DONA 1WUJS 4HD8A 3HQ4O 2WM9B 2FEMA 5E4JA 3QF7A 1POWA 1ZYUA 1T35A 4MVJM 1SC4A 3RS0A 4J0JA 2WSSA 1D0VA 5B58C 2Q9BA 3DEJA 3Q3CA 3OX1A 1I36A 4TTVA 5K0JA 3CB4A 2FZ4A 5HS4A 3V34A 5LQJA 1UFKA 1DADA 3RTEA 4F4LA 3ACBA 5CA3A 1YZVA 3OETA 3RT7A 4B73A 5AXDA 4D7TA 2Z6VA 4B7EA 3PNOA 4II2A 3NANA 3SG0A 2EIXA 3CF4A 4H7KA 3ZVNA 2XB2A 1CR0A 2QTZA 1N75A 1RCUA 3HSKA 1JWLA 4B8ZA 1Z7BA 5EXPA 5EXDA 4URWR 3VBCA 2PX5A 1C0LA 3IODA 5IBQA 2GB4A 4I0XA 2GJAA 3RVQA 3O65A 3HS3A 1C2TA 1K0UA 2X40A 1MLDA 4Z99A 4HH1A 2VKTA 3BIJA 5DEIA 2RHTA 4MR9B 3JWIA 3LT0A 4X7BA 2OA0A 3STLC 2VH1A 3KJXA 2XYVA 4BNFA 3ESXA 2W2LA 4LHZA 3SZRA 2B0JA 4N8DA 4A0FA 4MVUA 5T41A 1VSTA 3ZGVA 1MHPA 3ANLA 3BHMA 4CLEA 2Q7HA 3A6PC 3PITA 3LYLA 4GOJA 1T0UA 4J7KA 2G1UA 3HUTA 4FMPA 1OH5A 2PBRA 3EW7A 2Y67A 5JMWA 4LF4O 4KXRA 2CFIA 5IDVA 4L72A 1P7PA 2JVKA 1ARZA 1L7NA 1XJ5A 2OBMA 3TKAA 3EQ8A 2NPIA 1BEUB 4NFHA 4WOPA 5HTKA 3ZNOA 1FJXA 3OHSX 4QFMA 1E3MA 1F38A 3IPRA 1KJWA 5LYJA 4E4TA 4GBJA 1RWMA 1YVEI 2F1RA 3WGUA 2ZB8A 1CJMA 2VXOA 3S3XA 2BGGA 1WV0A 1U7OA 3GYGA 1LB1B 3CF6R 5HFMA 2QKCA 4R8RA 5DGXA 1Z34A 1DC5A 4PHZA 4MQUA 4NYIQ 5JVDB 3ZV5A 3FJOA 1PQPA 5BN3A 1RKVA 4JN6B 5IULC 2Z4TA 4AJPA 1L7QA 1Z2EA 2XRMA 3K5OA 3JQ8B 3SLGA 1Y4SA 4AZTA 1WD7A 3KKYA 2HIAA 4FINA 3K6SA 3BGVA 2OKGA 5B2ZA 1O6FA 3RR2A 2O0MA 1CQPA 2HFEC 1QR8A 3RSLA 3MHSC 3ESCA 4JXJA 4BQOA 1DFIA 2NO4A 4QYWA 4ESVA 1Q6ZA 4QO7A 3E2MA 3KJFA 3DOHA 4O4LF 2N42A 3WB9A 3Q41A 2B5VA 4OH7A 2LRHA 3CE6A 3I2JA 4H18A 2XDWA 3P0EA 3SR0A 3DXRB 4KVZA 1QIFA 1RFLA 1GIAA 2R66A 1CU1A 4CEIB 3TETA 3Q2KA 1XRPA 3FNFA 3IVXA 5GJCA 4EATA 5KAIZ 1IBCA 1N8RW 4Y9UA 4TZ0A 4Z4HA 4BATA 3EDYA 1U02A 3MGBA 3PQ8A 3Q5EA 2C7GA 1K2VN 4TMYA 4U6NA 1S0VA 3KCNA 5IS2A 4ZIRA 3KALA 4LZWA 2HYIC 4XE5A 3DL4A 4P7GA 4QOSA 4RTJA 2AR0A 3MWYW 3K9FC 2PZFA 2NO7A 4I2VA 1ZGJA 1J22A 4M0FA 3AJ9A 3MVEA 1E1QG 1FS6A 4X97A 1L7EA 2EW2A 5DXAA 2W48A 3G89A 5JXHA 2WTUA 3B6ZA 4WBNB 3ZIUA 3VBBA 3ZWXA 4LHYA 2YHAA 2WJWA 3IDAA 4NAHA 4EYOA 3RU3A 1ANKA 4UMVA 3G71V 4R54A 3EFOB 2H29A 4FLEA 5TMDA 3BULA 1YU9A 5BWNA 2CF5A 1F7YA 4A6PA 4NPAA 2PANA 2CUKA 3RU9A 4BO9A 2XITA 3DM5A 1TTQB 3LNNA 3PYMA 3LL7A 3I5YA 4ZAZA 5LQKA 3P4YA 2NAPA 3QELB 3QSYA 2C9YA 2ZWPA 3S2GA 2P4SA 3KZVA 1C2YA 4PC2A 1PQ4A 2Z2JA 1EVJA 2FVXA 1E4EA 1RP7A 2P06A 4I4TB 1WB7A 4RADA 4TSFD 3AUTA 3PFNA 2IYLD 4B46A 1SQSA 5TEWA 1W6UA 2RC6A 2Y66A 1AIPA 3MZ0A 3IV6A 2IS1A 3RS9A 1L5SA 5G40A 3CKMA 3EGOA 3MB5A 3UK1A 4YJ2A 3JZIA 2ZRQA 4JEUA 1QHTA 3FCUB 1B0AA 2OFWA 4X9QA 1X1BA 2R1TB 1ZBQA 3LA8A 2IDKA 3LBHA 4Y0AA 2C0QA 4ZVNA 1ISSA 4DUZO 3BHJA 3ND6A 3I9V1 1WXGA 5BV1A 2HNAA 4WZZA 1NIPA 2BTOA 3M82A 2AR9A 2WNHA 2PN1A 4KACA 2FF7A 5AT1A 2QXTA 3X2FA 3VJKA 2HPAA 1PZMA 1X15A 4YPFA 4C4OA 1ZH4A 1SUAA 1LWNA 3N27A 2PGAA 1U3GA 2BONA 3ZVLA 4XD2A 2YX1A 5FLEX 1F4VA 1PL0A 2P5TB 1PWEA 1CFZA 3N86A 4F4HA 5KHIA 1HUQA 1UK6A 2Z6QA 4FE7A 1FZTA 1UOPA 3RBVA 1DS6A 4AFNA 3ST7A 2E4ZA 3EF0A 5FUXA 1ZNWA 4BZWA 3LT4A 2PGJA 4F91B 2HF7A 4Z0PA 3WDKA 1FP2A 2YIDA 5T64A 2P67A 2FPGA 3W7AA 4TWAA 3ASYA 5KJ1A 2FSPA 1ORTA 4PZ9A 5AM0A 1PFWA 2UVPA 4D25A 1ONSA 1NXVA 3I53A 5AJVB 4AO8A 3EEOA 2JJ8A 3IXQA 3ZLJA 1IM2A 2PUBA 1L5RA 3SF0A 3UIEA 5SYNA 3DE6X 2LDBA 2YJ6A 4C89A 4XJXA 1XLVA 3GT4A 4GP9A 5K0CA 1Z2GA 3KT0A 4IIJA 3FPBA 1QQ7A 2BD0A 1GR1A 4YX9A 1V7ZA 3BIWA 1U9ZA 3R3SA 1N9KA 4E2FA 5JC1A 5CDFA 1G38A 2Z3WA 1CUZA 1OXUA 3ESDA 4GGMX 1KAGA 1SB9A 3WTCA 3F5TA 3K73O 5SY4A 3AVXA 3E3MA 4R51A 4JTDB 1LUVA 1QHEA 4X44A 1FDWA 3G0IA 1HNXB 4RK5A 4EUSA 4HFNA 1ESNA 3UB3A 1F51E 2JD0A 3L0OA 1C3EA 3AUUA 3EIUA 4FVTA 5T8KC 3AEZA 1W30A 3UQYS 2GTAA 1CEXA 1YJ5A 3G13A 1CUWA 4MB6A 5TQVA 2JNWA 4NR0A 4K0RA 1YV9A 3DDUA 1CUHA 4KQ6A 1KOLA 1XYVA 1L1QA 4AT1A 2I03A 4ETIA 1SD5A 1WN7A 5C1DA 3NBYC 1UPFA 4DLUA 1MJNA 2GHYA 1P1FA 1KYXA 1XDGA 4N4AA 1KJJA 3AY6A 1AMUA 4ZV9A 2M6LA 4WNAA 4I6GA 3HCEA 3M81A 3LSYA 1KQPA 1TZMA 1X7ZB 2VPIA 3CUTA 4EHFA 5JS6A 5H9VA 5DHSA 3KKEA 1CQIB 1WMFA 1WEHA 2ZS9A 3WRYA 2PUEA 3SBDA 2Q3EA 3CF2A 3NTRA 4OXQA 1EBOA 1PWXA 1BMFA 4RV4A 2DGDA 4QNHB 3ECCA 3RARA 3D4OA 3CC2V 2H2DA 4LZOA 4U02A 1TK3A 4K2AA 1E3WA 3NTLA 2JRLA 4P0QB 3FWHA 3GG2A 3I9MA 4JASB 4L8LA 5AW2A 5A71A 1IEVA 4HK4A 4KSYA 3R7FA 5CH5A 1ZL2A 1Z8HA 4CTMA 2WLLA 2ZU6A 4UHEA 3M5PA 4OUDA 3FTNA 5G0TA 2OBYA 3OCCA 2CLSA 4JAAA 4XI9A 4LHSA 3HKCA 5JUWA 4PZEA 2LFSA 5IT0A 5H1YA 1CF4A 1YTUA 3DEHA 3DJFA 3K53A 2NQTA 5CTJA 4GGPA 2R8EA 4OUKX 2E74B 2QWOB 3IDZA 3EZYA 1SCIA 3W8EA 2HEIA 3ABSB 2WHPA 2DY0A 1MOQA 3B6IA 4HXFB 1YJ8A 4MZDA 3OEED 4R2KA 4ZKEA 4MPRA 3IOBA 3P9XA 1UMDB 3MW8A 2OCYC 3OT1A 4C7OB 4U5QA 5DNUA 2P9HA 3I5DA 2BOVA 3IAAA 4RCZA 2UUBO 5FBVB 5HIIA 2XHEA 4DCTA 3ZXSA 3LLCA 3MF4A 1EFPB 3WO0A 3RS5A 1AP6A 5TSDA 2JLUA 4OXXA 4N54A 3WJAA 5BXZA 5HUQA 2BCJQ 4YY3B 1ES9A 2Y1GA 3HVUA 2GA9A 1KZYC 4KNYA 3SWWA 5DYNA 5L9AA 3ESRA 2XCSB 4ZOAA 1BZYA 1KEEB 2M7WA 4EYGA 1EK0A 5EFZA 2WY2D 4NY1A 4H37A 2JJMA 1XA0A 3IAM1 1RHUA 2VF5X 4YMTA 1R3DA 4GKJB 1JVSA 1E2MA 1QFJA 2WQ6A 1GTJ1 4MAFA 5FI3A 1KPHA 1E2PA 4IUYA 5J5AA 5FPKA 2IYXA 4A6EA 4BJ6A 1DG1G 5C3MA 2BZSA 1TE2A 2UYOA 5F52A 5KC9A 3B1JA 3KYCB 2AL7A 3AF4A 4UHCA 4FLTA 4KIUA