3WB1A

Hcgb from methanocaldococcus jannaschii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
b'VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0488
molecule tags Transferase
source organism Methanocaldococcus jannaschii
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
total genus 57
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb1A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb1A02
2F1MA 2V4DA 1H2SB 1NBWB 1EEXB 1T5EA 4L8JA 3WB2A 1EGMB 4DK0A 1MMFB 2F95B 3AUJB 5JJNB 1DIOB 2D0PB 1UC4B 4DK1A 1IWBB 3BRCA 2F93B 3LNNA 5D5QA 5JJJB 4GYCB 1IWPB 5D5PA 3WB0A 3WB1A 1RSOA 5JJEB 1EGVB 2D0OB 1UC5B 1VF7A
chains in the Genus database with same CATH superfamily
1E9SA 4IQ0A 4NBKA 4Q3CA 1KXZA 1DDOA 1OXUA 1W7AA 2ZGVA 3J7AU 2GV9A 4GW3A 1NWHA 1DBVO 4CT4B 3MD0A 2BGIA 4ENTA 5M04A 2VZLA 2WMOB 1MX9A 1Q84A 2X0EA 2R00A 3KEOA 4K03A 4RKFA 1UP6A 2B61A 3GVMA 1BXKA 3ZY2A 3C5WP 3A7EA 3IAS1 2A0KA 3KC2A 3UK6A 5KNCH 4UAUA 1DO2A 4KU4A 4G5YA 2PUEA 3ESAA 2W00A 4CLHA 3SYPA 5KYYA 1V4BA 2HT6A 1C9EA 2ENWA 4JQCA 4X6YA 5AM5A 3P97A 4R54A 4ITVA 1QKKA 3JQDA 1X39A 3F5WC 4PBSA 4CM5A 3RVPA 5LP6F 3CBQA 3I01M 5C32A 1UBUS 4PRLA 1NNEA 4Y1RA 5KC8A 2QI9C 3D36C 1JU4A 2HCFA 4OXQA 4CM8B 2Z3YA 3OZBA 4EK9A 1Q86W 3D7MA 4IJWA 2VDWB 5F7ZA 2ADMA 2HP8A 2B8EA 3HVJA 1E6CA 1WV0A 1UMBB 1S3JA 2A86A 1WNSA 1KMNA 2DQZA 2P77A 4BMZA 3QVOA 3ZGXA 2VRCA 4QGFA 3TRDA 1SU7A 2XJ4A 4FEGA 3LK6A 3OE7G 1L7MA 4J0EA 2CUTA 4WTOA 5D00A 1SQ6A 1OLXA 5J5VA 4O5AA 3N7TA 5AKLA 3VR6H 2KS6A 3NBAA 2DB3A 1FBNA 4MGHA 4BNGA 5M34A 4HPXB 1A04A 2AFHE 4CUZA 4BNNA 4E7PA 1PJAA 3KJGA 1TCCA 1C9YA 4FQ5A 5HKLA 1W5SA 1V11A 4LYDA 2X5XA 1XHXA 1PX2A 2NAPA 5K4AA 1RM5A 1WW3A 1AUQA 5HIKA 2R1TB 2VP5A 3KT8A 3UUGA 2J6HA 5JAMA 2QNRA 3U3DA 3G2KA 4D25A 1JR9A 3IXMA 3DOHA 4P3XA 4AYXA 1T0BA 3U6BA 5DBEX 5LXTB 4F9GA 2YN0A 3ICEA 1S5PA 4TYWA 2FZCA 2D7DA 3U3JA 5A06A 2FK7A 1G5RA 2X23A 3SHQA 2F8LA 3O91A 3DAYA 3DMPA 3AKEA 4MKIA 4EZBA 2A0LA 4GOMD 1PI3A 3B70A 4LJ7A 4DV3O 3PI6A 1LZKA 4UTXA 1SOAA 4OP1A 1YJCA 1HDXA 5DLEA 2I54A 1OC2A 2B83A 2H16A 1QG0A 2J3HA 4XEUA 4YI3A 3AFGA 2IJKA 1X3LA 1D1TA 4BV8A 1EUDA 5E1OA 2HSGA 4YAKA 3PXEA 1C9MA 5DN6D 1DKPA 1DDIA 3CR8A 1A8SA 1OIVA 1BWSA 2QRNA 4DMCA 2ZSJA 2L69A 3DJFA 5DEOA 3WGIA 2ATKC 2A5JA 2AT1A 5D87A 1WMSA 4Y1FA 1ENYA 5DGDA 4XGNA 3OEEG 2GEBA 4FT2A 3S5UA 1JV2B 4IGFA 4Q5IA 3NM5A 1T91A 1BEEA 3FB4A 5BYAA 5FWNA 5J23A 2ONJA 2H1CA 1V41E 2V7VA 3H5TA 1U5BB 3ZDQA 1YNOA 2FFHA 3S70A 1Z88A 2ZB2A 5BPFA 2COEA 3EGOA 4DR6O 2JD1A 1O94A 3AHJA 3EOAI 2RQ6A 4L4SA 5ALQA 1PWHA 5BMVB 4M76B 4RHFA 2NUBA 1MW8X 4XE5A 2P6JA 4KTVE 2CLKB 3SQWA 4M9ZA 3P5SA 4IL5A 1W4ZA 3V1MA 2OQRA 4P83A 5JDCC 5K6TA 3VYTB 1B8VA 1UBMS 2I78A 3DNMA 4CLXA 4E5VA 3R9WA 4PSCA 4NQRA 3NZEA 2HYIC 5HJ7A 1R0CA 1Z0SA 4YJ2F 1P62B 4M0CA 3WSTA 2ZJBA 2VXOA 4J7UA 4EPTA 1CNFA 1CYEA 5AKKA 1LQUA 3KKOA 1E9AA 1AMOA 3OQMA 4FDLA 4ZT3A 1K7XB 2O3RA 1RZRD 3ZGZA 3R66A 1EFTA 1HDRA 1VQNV 3DZCA 4EJFA 1ZUHA 3QFHA 4H15A 3MGAA 4BFCA 2HJFC 1SVOA 1XRSB 1QLJA 4HFRA 4CM1A 2ZBRA 5E7MA 1RHMA 2A67A 1EAMA 3OD5A 1V7QA 2RB4A 1D0SA 1IQPA 2AX4A 2JFFA 2BM8A 1IDSA 4A6DA 1MGOA 4JI2B 3IOBA 1Z22A 3OPYB 4XWYA 2B3TA 5A4FS 8MHTA 2N46A 3CXRA 1VCHA 4UBIA 4O2AA 5AK3A 3W05A 4IYHA 3OEEA 3W3AH 1GIAA 1TQDA 2IDZA 4AF7A 5C4MA 2W2KB 1GN2A 1IBLO 1JXAA 5DLDA 1R66A 8LDHA 4IDPA 1O96B 3NEPX 1WVMA 2V4ZA 1K92A 2H2AA 2Y77A 3UHPA 4Y2YA 4ACBA 1OA1A 3EIHA 3C3DA 3G2MA 4JCOA 3U4QA 1BDJA 3N87A 4I19A 1SCNE 2WR8A 4L9WA 1T43A 4N6NA 3CMEV 4C22A 4IO1A 3PI7A 3A3NA 3TQQA 3UG6A 4DIEA 2WTAA 2EVWX 1CUBA 4WPGA 3WB9A 1E9EA 1Z07A 4TWRA 1R9JA 3APQA 3FR7A 2OP1A 3SZUA 2B36A 2IXDA 5K99A 1N4CA 1U7ZA 2I3AA 2V7BA 3LIIA 4DSUA 1TXGA 5IBRA 1PYOA 1J90A 1FSPA 1D9ZA 1P45A 1ES9A 5T8KA 4ZCMA 1NOKA 3KXPA 1DKMA 1PUIA 3CH5A 2CFSA 3M8KA 2Q49A 4HAWA 2RI0A 3D81A 3W8DA 2I1LA 1IHOA 4ZKEA 2WKQA 2IXAA 5F7JA 1UBOS 5A3VA 3VR4H 4AL4A 4PQEA 2HGZA 2NZWA 1MORA 3PD1A 3GJ7A 1DJLA 1CUXA 3W2EA 4OI4A 5ICSA 1UZAA 3KSRA 3RT9A 3R8XA 3OUTA 1DKOA 1SZCA 3AUUA 5ALNA 2XR1A 5TMPA 3WNBA 3N0VA 3KSDO 1X1BA 4DLSA 1A88A 4KRXA 3WGJA 1RM0A 4OQYA 1XVUA 5IAJA 5LP1A 3A9VA 3L7OA 4DQUA 4LE0A 1FNCA 2EILB 3THXA 2E5WA 2ES4A 2VSYA 3HYSA 1ACJA 1NVKA 1EG2A 2QN3A 1FQKA 2G72A 1TUGA 3C74A 3D02A 4NOKA 3V1UA 4R9SA 1YZTA 3LXXA 5JUWA 4YV7A 2EIMC 1Q0ZA 3RS7A 1RPOA 1Q90D 4FFNA 3G82C 3GOHA 1IOZA 3PWKA 4XIFA 3X1JA 3SDBA 4FM0A 1WZCA 4MUBA 5EC8A 1J5XA 3HZRA 3Q3IA 3ETNA 3WSWA 4KWCA 2H06A 2PUWA 3HP1A 3FBTA 3M4NA 3QXSA 5B37A 1XCLA 3UGTA 5KOIA 4POOA 1X4TA 2PZAA 3M83A 1X38A 4LG1A 5JI3E 4E12A 3FCYA 2JEXA 3N2IA 1WXFA 4LJKA 1QYXA 2OGWA 3O6VA 4GX0A 2R8RA 2R6HA 4JZGA 1JKJA 2CDBA 2OP0A 4FM2A 4GX2A 1XC7A 1U7OA 3MGKA 1Y5RA 4EVQA 3EXEA 3IAM1 2X2EA 1V35A 2EKLA 4FNGA 5JWOA 2Q6LA 3QU7A 5JYDA 2CXQA 1W6RA 3JQGB 1GPLA 2W6ZA 3Q9UA 2G5TA 2I03A 1UC4B 4L0MA 3LYLA 1DIAA 3FOBA 3TM5A 3VV2A 3NHRA 2JCVA 4GLLA 5JDIC 1OGJA 3GXBA 3GUYA 4JELA 3JCZA 2H31A 1GRQA 2EF1A 4M9CA 1XVAA 2F1KA 3H17A 2R6FA 4JLVA 1QRTA 3S2ZA 1CUDA 2HQBA 2UYGA 4XDJA 1FJ2A 2WUEA 5EBLC 3LBYA 3O2JA 3TEFA 3KB1A 3TRFA 1V6AA 4EX7A 1S0UA 3OF2A 5FIUA 5CMLA 1JG4A 2ZVJA 2F3UA 1XZKA 3IP5A 1G3RA 3PJEA 4IQGA 3K9LA 3NHPA 3ABOB 9GPBA 4OB6A 5KYTA 2DR0A 5C80A 5LVAA 1DKRA 1SWWA 4K6GA 2GAOA 5AR1A 4DG9A 3ICWA 3C7AA 3YASA 1BDHA 2ZJ7A 5LP6C 3FX7A 1QS0B 1VTKA 4U7GA 2EZ8A 2OVBA 2QSJA 5DYTA 2BHTA 2HLPA 4ZIBA 1GH6A 3BA9A 2Y68A 3EZLA 2AZ0A 3IA2A 2DTDA 4QAQA 5AVVA 3EEIA 2N47A 1YIOA 2BOVA 3IAAA 4JJKA 1TYBE 3CF4G 3VU0A 2O1EA 3KYCB 3D2BA 2G7MC 2AG1A 4MVJA 4DW0A 3W5HA 1FTNA 1PFKA 1Y5MA 2BM9A 3F7OA 4XX1A 4UFOA 3PXUA 5FL7D 4JVNA 3ZOKA 4DCMA 4AQYB 4E21A 1AV6A 3IJ5A 4HAUA 4P86A 5BNFA 2B94A 1QO9A 3TIFA 3KHKA 4KI0A 2BDUA 3TGLA 1DFIA 1XRPA 3ZVLA 1Y8ZA 4L3OA 1KERA 1KDOA 2AGVA 4QELA 5IW8A 5C5IA 2DWUA 1NQWA 3P0JA 4R1MA 4CC5A 5CA1F 1FNNA 4J7AA 4BO4A 1GZ7A 5IF3A 1TA9A 4PPGA 1QRAA 3Q7RA 1K5QA 5D5PA 3ZGYA 5FWYB 4EW2A 4P81A 1E3LA 2GFQA 3PENA 2Q5EA 3H83A 3W1VA 4KFTA 4FGWA 3UJ3X 2DJIA 1NW8A 2HA6A 4LXXA 1SXHA 3ZYZA 3GEMA 3H5VA 1OCCC 1WP4A 2TRSB 2EQAA 1N32O 1P4HA 3TE6A 3INGA 4RD1A 4TZ0A 1VOTA 2P11A 2ZZKA 4G1MB 2ILTA 1R4AA 2GM4A 2MSKA 3TL2A 1W36D 3D36A 3Q0TA 5EZSA 1IEVA 3U81A 1ZA1A 2CHQA 3IAXA 1RXSA 1CRQA 4QQNA 3U7FB 1MB3A 2EG5A 5AOCA 4ZO9A 3CO0S 4JA0A 3IULA 3P45A 2GT1A 2CWWA 3M1LA 3OX1A 4MI6A 2VT3A 4QHSA 2I7TA 5EJ8A 1EFRG 4IL6Z 4PI0A 4OFWA 1A8HA 4DR5B 1MP0A 2YXHA 2BT4A 1W8DA 4H1UA 4RHEA 4YP6A 4X60A 4NG4A 1KOGA 4AMBA 5KNDA 1EHIA 1RR6A 2HF2A 3KO8A 1RYEA 2XAGA 4DARA 1RZVA 4EFEA 3PB3A 1KQFA 4Q19A 5SY6A 4KODA 1NBHA 1EQAA 3IPXA 2H5JA 3IAUA 2R65A 1KVUA 2E4ZA 4QJ5A 5KPJA 2ZSIA 4C0KA 5T8KC 3L5KA 2VHQA 1E5LA 4DM3A 3FCOA 3U16A 2WAXA 3VZSA 2HPAA 1QK3A 1TJYA 1XZIA 1Q57A 3MUFA 3LBIA 2VNAA 2X7JA 6NULA 3T0FA 3BK7A 2NW6A 1GCGA 2ACWA 3W78A 3DHYA 4MDYA 3WLHA 1QHTA 2G80A 4HNQA 2O19A 4LF6B 1WLEA 1B6TA 1VKRA 1PT6A 1XQ6A 2H7XA 2RHDA 3GD5A 3V9AA 4D6PA 5EJ9A 1KRWA 3IBYA 4CE6A 2CNNA 1L3IA 2BN4A 2IZ7A 2J9XB 2PKRA 3IP8A 4O8ZA 2PXAA 1YQ9A 4GIBA 3PX7A 2HFKA 3B48A 3PUJA 2YV4A 2NTVA 2GTPA 3VPHA 1CLUA 1QFMA 4ND7A 5MN6A 1HGXA 1W9MA 3I12A 1WVGA 2VAXA 4LRWA 5THKA 5IKXA 2B1GA 1VJ1A 3LPNA 2QKCA 2GKSA 1NLMA 2P78A 3PQFA 5DV9A 1CEEA 1GL6A 1L7BA 1N5OX 4MWCA 3ZCRA 2QGZA 4BQRA 2L2QA 2OK7A 4M7PA 4YRPA 4BB5A 5E6SA 2QTZA 1L6RA 4BRSA 2C4KA 4OJNA 1N8KA 3EQ7A 4R8SA 4NXNB 4XGRA 1LX6A 5E3JA 1IM8A 4YJGA 4ED9A 4ENWA 1IK6A 1QR9A 1NSYA 2E21A 4DV4B 4JH0A 4PLHA 4ZI7F 1TVKA 1T3HA 7MHTA 3E82A 4RD4A 1D2MA 5CUQA 3CUTA 4DJ5X 5CFNA 2ZRHA 2FOLA 4F1WA 1NIJA 4ZFNA 1Z9BA 5CG2A 1QP4A 4LYFA 2B6HA 3OZFA 1J0DA 1P4AA 1V8PA 3ZWYA 4E94A 4MWGA 1L5HA 3P2EA 3ZBTA 1U96A 2R5WA 2BP7A 4ESHA 2OZLA 1CNEA 1PZFA 2PANA 1DIRA 3JPYA 2MSCB 4MQ4A 4QFMA 3NBYC 3ZE7A 4ARZA 2GJ9A 5AKGA 4JYZA 3E5NA 5SZIA 1NXSA 4CL3A 2OPHA 4F3RA 2REQB 3NPAA 3ZY4A 2ZXUA 2QKAA 4FMTA 2DPLA 5EAIA 2WMDA 3RIXA 5KEIA 2H94A 1S6YA 5KYXA 3RUDA 1DK1A 1JDJA 1JEQA 4OQDA 4QBGB 4XLZA 5JD3A 4BEVA 3LGAA 1SG6A 1Y6XA 5IJ0B 2D8AA 2MR6A 3LHIA 3FNGA 1ZLYA 4RJIA 4JTAB 1BGWA 2IYUA 4Z86A 5EPUA 2WVHA 2I87A 2KBEA 5EI5A 5LUBA 4UEJA 5AD1A 1PP4A 4OP3A 3SJUA 2ESRA 3X1WA 4HSGA 1HR0B 3IAS6 4B7CA 5LFAA 5HJ5A 1EBOA 2GAJA 4L50A 1JJAA 1RLOA 2FR0A 3EZ6A 4MULA 4TRNA 2E6UX 2GX6A 2WA1A 3C5VA 1CV2A 4WNAB 1XTSA 2FPIA 2IUYA 1YJ5A 3AFHA 4PFSA 2N0SA 4UU1A 4YQEA 2XAAA 4UW9A 5K5EA 1KSJA 3L8FA 1O96A 3KSMA 4JYPA 1SQPH 5TS3A 3IE2A 2P0AA 4TPKA 2GD0A 1HE2A 4IR7A 1GT6A 2ZJ5A 4HDNB 3WISA 3H84A 4RF4A 5DMHA 4CEHB 1UC8A 5CW1A 4JVMA 5HS6A 4UDOA 2HRQA 3VUFA 2GXQA 4FW9A 5KKNB 3PUZA 2C2BA 4QIWF 1U1IA 2M98A 2C7RA 1H3EA 4KQMA 1TU3A 2XUQA 1R4NA 1BT8A 3KV3O 4RA6A 4PA4A 3AB3A 1EB9A 4BGUA 4FCTA 4QDKA 3WIVA 2OC4A 3GB7C 1XMOO 4EB0A 3L4SO 4KLCA 5EXTA 2OXCA 2BC9A 1O87A 1IWOA 3RFXA 2IU0A 4RY8A 8ABPA 3QTCA 3DC5A 4R2JA 1U2TA 3QIAA 1KO1A 3S8EA 2R6CA 1G41A 2V7QA 3CLKA 1XAGA 3TZQA 4DLVA 1JMKC 2ZSBA 4HGOA 4JYCA 1M6WA 3QX3A 4HB3A 4JLPA 1E0KA 2VF7A 3RBZA 4HNSA 1T5TA 3ZHTA 4JAVC 3TIVA 1VMKA 4N39A 2R70A 2IY8A 4HQ6A 5TVGA 1NH2D 1WTCA 3GT4A 3R0QA 4QEZA 4RPIA 4WNYA 4YP7A 4XOIA 3RRFA 3WQRA 1Y6GA 2HREA 2GAIA 3IAFA 4ID9A 1CUEA 3AR4A 4IVQA 3DC6A 4LRQA 3QUCA 2ID8A 2VZ9A 4KG7A 5K3BA 2PUDA 5FUVA 1W0KG 4DV0B 1Z0JA 1LK5A 1XTJA 3KJXA 2ADFA 1IOVA 3MT0A 4HB4A 4ZCPA 3T4PA 4ND8A 3S8MA 1KQ3A 1FUUA 5JMOA 4NE7A 2DSTA 2YZMA 3MFYA 1K66A 3AKYA 4JLUA 5IP5A 4D9EA 1AKUA 3LCMA 1A69A 1LBIA 3DWFA 1TZCA 3TK1A 2PS9A 1O8BA 1RYDA 3L0SA 3VH3A 3RB8A 4HDMB 4Z0HO 2FP3A 3DWIA 1V8OA 2QY6A 1ZJ6A 2VQ6A 4G5GA 4UE2A 4XLLA 1XQ9A 2R9RB 3M6AA 3RTAA 1K4YA 1SKVA 4HL6A 5FUQA 1Q0TA 4TM8A 1CEXA 4A36A 4BJ6A 2BKVA 3FNRA 2CTPA 1GQ2A 3VPBA 4DIOA 1VJ0A 1KU9A 1KDRA 1CYDA 1M34A 1WDLA 2B78A 3GELA 3H42B 3PTLA 1PSWA 2X8AA 5KS2A 1M8FA 2PYDA 3GJ5A 2EFDB 2AC4A 3IDOA 1ULHA 3HY4A 1WCXA 5DW3A 4LKOA 5E3HA 5A4IS 4R2WA 3B5JA 2R1VB 2C29D 1H8HG 3H87A 4IF4A 3KELA 4C76A 4CMIB 3FFTA 1CERA 3BDIA 3GFPA 4BMYA 1QE0A 3GA7A 3QGMA 2QM0A 3RAJA 1E7YA 3W2IA 5CDHA 3OMXA 2FU5C 3GLRA 2XUOA 1A96A 1R6TA 5C46F 221PA 5FO1A 1RAEA 3EY9A 5JD6A 2BRUC 1RLTA 4Z9YA 5JJCA 5DB4A 3UIEA 1TFRA 4L6AA 5KTRA 3DUFA 3OQIB 2QM7A 1FQWA 2VDUE 1JBKA 1OI7A 2DHDA 2ZIUB 3CB4A 1E1QA 5FKJA 2E4YA 3JZFA 3SIXA 4X7PA 1M5TA 1KE1A 3AMVA 4JP2A 1AC5A 2J5BA 1PO7A 2W6MA 2O1WA 4MUMA 3V8VA 4GQIA 4K3VA 3TLKA 3QXGA 4M0LA 5EQFA 2C5HA 1B04A 3BIXA 4RQUA 4ZC1A 2PQ2A 5G0WA 3C3YA 4AZWA 1MX3A 1VLQA 4UNNA 3HP4A 2Z5UA 3BILA 3LRPA 1CUCA 3KM0A 2QX8A 4E31A 5U9CA 1A9QA 1A50B 2VTBA 1H6DA 3WMWA 1FFSA 1Z36A 3ZU2A 1Y3DE 2ZIAA 2OXIA 4NZPA 1NJFA 3UT6A 2YWEA 2BMWA 1EESA 1DCKA 4DVJA 1UC5B 3HDTA 3RFRA 5KA6A 2X8JA 4MAFA 3SJBC 1TMOA 4WKBA 5EBMC 2G1JA 4W9MC 4BNKA 1I5XA 5CX1A 1CHNA 3KU4A 3LCUA 4S1WA 4MX8A 5A5DA 2VHVA 4XGKA 2QM4A 1Z7WA 1CUUA 1DLBA 4Y8VA 1C2YA 4D9CA 3GDGA 4E6PA 2CTQA 8OHMA 3PWTA 3SZGA 2F8SA 1GPYA 4NTZA 2H9AA 2VTDA 3TGPA 5I6DA 4K0KO 4YJFA 1FRVA 2AQIA 2VH5R 3S40A 2ITDC 1Q1EA 2QLBA 2VFAA 1GV1A 2A2ZA 5K8JB 1TQ8A 4RHCA 2ZB3A 3C7DB 3WIOA 4EBFA 2XMRA 4J2OA 1AXRA 3IIIA 1V4VA 1NH2B 3L40A 4KGDA 4OHYA 4EHNA 3BMOB 4JBNA 3U0ZA 5BPHA 3FTEA 4YGXB 2NVUB 2OKCA 4GKVA 1HWYA 1R1BA 3GRCA 3OAAA 3PDIA 5DM6V 3E2PA 2UVPB 1BHQ1 1NNSA 1VHLA 2JH3A 5I9TA 4YV2A 3P9XA 4HPWA 2ZIWB 4RJTA 3CVVA 3NT2A 3MWKA 1RWBA 1UPFA 1W85A 1XJQA 2EBFX 3DS8A 2P27A 2UYQA 1MMFB 4PCVA 4AKGA 2YDEA 1N2CA 2EYUA 2H6EA 4H4CA 3FYDA 4EY7A 1P5JA 4BVGA 1IY9A 3L71H 1PLKA 4UVIA 121PA 1XNJA 2XYVA 2A9OA 5AKIA 2BEJA 1ND5A 1SIUA 1U31A 2WPNA 3HN6A 4AXXA 2PMCA 5KYWB 5KOHA 2FPRA 2OHFA 4DB4A 3U31A 1J09A 2ORVA 1TM7E 8AT1A 3W1EA 3ZHOA 4AKTA 1V3TA 1NX6A 4C0HA 3LUTB 4QWWA 1CNMA 2PSSA 1G17A 3N39C 3SJQC 1NJ2A 3ZG6A 4CF3A 2G9UA 3K1TA 3A4MA 3VFDA 1TLFA 2B4AA 2H5IA 1T2UA 2PWBA 2FW8A 2VUSA 4RGYA 3PYXA 5CLGA 5E7IA 4O6VA 2IYFA 4FFOA 2P2YA 4NBVA 2H3OA 1ZM3A 2D2XA 1RCTE 3IPCA 3JYOA 2CCGA 3NDPA 3TQHA 5K6AA 3MAQA 4OBWA 1LJUA 1RQRA 1LX7A 3M6VA 3EGDA 1X1QA 1ZIXA 2WBLC 1YB7A 4JMLA 3WIEA 4DV0O 1I7NA 4QUKA 3RSQA 2DYRB 4AM8A 2WSMA 3P2MA 1H22A 5EXDA 3RC7A 3LLCA 3SI7A 3IP6A 4FILA 3WI7A 3E5RA 3V4RA 3OJCA 2C8KA 1W25A 2YYZA 1C4WA 3H2KA 4D9GA 2QMHA 4I6EA 1EPUA 5U4XA 5E4FA 1RPRA 4IUCS 1E5QA 5CYPA 3MOSA 3VOBA 4AS1A 1S2GA 4MMYB 3UCSC 5JPIA 4DDWA 4AI6A 3H9CA 4WZ6A 1CX9B 1U9JA 1Z6XA 2OV4A 4IHKA 1D2HA 2DECA 2F43B 1MAUA 3DZ8A 3TCKA 1AKQA 4KRGA 1NVPD 1BEUB 5BOVA 3LRTA 4POAA 3WAKA 3EPRA 3WBBA 5BSFA 1SU4A 3B60A 2XBUA 4W4LA 4LJ6A 1IRIA 2O3UA 3GHYA 2FETA 2IYRA 2P8JA 4GZ6A 3N2KB 4IIJB 2DOSA 1BHO1 1E2HA 2ZBFA 3BH0A 4HZUA 4HXYA 4K0RA 2ZJ4A 5DSXA 2VJMB 2ZREA 3P52A 2A92A 3L6DA 3VJMA 4UHKA 4BBPA 1S8FA 2WJZB 1NJ6A 1FLDA 4NMMA 1F48A 2BP7B 2P4SA 4PM4A 1B0AA 1B76A 4YRQA 4F6RB 5FBZA 3KVRA 3E8FA 5FL3A 3UT5A 3H9VA 2VT7A 1NVVR 4L4RA 5ED0A 1GRNA 1JX9A 5JHHB 1X7ZA 5HFMA 4Q3BA 2DBRA 3DZIA 5AKYA 1HOXA 4Q37A 4E4RA 1WO8A 5C8YA 1IBLB 1RQNA 3WQQA 4XWKA 3K2BA 1JA8A 3DLPX 3DYBA 3MTDA 3NPMA 3R5JA 2JGEA 3IMGA 2FR1A 3SJZA 2X9NA 4M1MA 4MYRA 1JLLA 2CE4A 3MFQA 2XUAA 1TADA 3RT3C 4BAYA 1Q15A 3DBHA 5C8DA 3EQZA 1OV4A 1SZPA 4H7IA 4ZPXA 1EQ2A 1I7PA 4IUBS 4QOJA 1VLHA 1P4GA 4YCMA 4FKBA 3CS3A 3H0KA 3RHTA 2IK8A 2H8KA 2ZBUA 1JF8A 2Q7HA 3ORYA 2AVNA 4X88A 3GPDG 3EA0A 1EE1A 1SU6A 3N2KA 4IIJA 2A4KA 2CHUA 3DUWA 4LOAA 3T7IA 2YASA 3BJZA 4C78A 5IFKA 4R3UC 5LBTA 3K70B 3MG9A 4QYIA 1AGNA 4X62O 3CKLA 4K9DA 4O0LA 4FD2A 3CM0A 5ECWA 2CFOA 1U7HA 3LQ2A 3RC3A 4AMZA 3OPQA 2JBWA 3PPXA 2UXDB 1IUOA 1ENOA 1JGTA 3D6NB 4RFVA 4D80A 3SGIA 4CEJB 4LQ4A 3QE2A 3O0DA 3CTPA 3G80A 2WIDA 1FQOA 1SIBE 2GAAA 3QE3A 4QD3A 2OG1A 2J46A 2VRWA 2ZR8A 3B2EA 3ET5A 1ODLA 4LOKA 4WA8A 2PI4A 1B16A 5M29A 5FWXA 3R7WB 4E3ZA 1E2QA 1KO5A 5JSYA 1WEHA 2NXEA 3MCWA 1SPBS 3PDUA 4LI3X 1VF7A 2O6HA 3UV6A 4C2AA 3PLNA 2A1TS 5KLVH 1B15A 5DKFA 3NXKA 1QH8B 1H2MA 1ZGBA 3U2QA 3NEAA 1JFRA 4JC0A 2FH5B 3JSNA 4RYLA 4BC0A 1XTRA 3N0WA 4JBWA 3C24A 4OU4A 2D5AA 4TMZA 4RAOA 1I7FA 1DKQA 2REOA 4DLXA 1M74A 1V7PC 3M49A 2A79B 1SKMA 3WG9A 2OBXA 4GOXA 3AFNA 4DUYB 1FZQA 1VLZA 3AJ9A 3TW8B 1GN8A 3KUDA 2F43G 1C8LA 2NQTA 3P9QA 4MUHA 1X1CA 1FS6A 2VAMA 3WLAA 1ZH6A 4BMVA 1L8LA 2WWYA 1MO5A 3RYIA 1VEWA 4GU5A 1R0WA 1ATZA 1RTTA 3M5PA 1PNKA 4UCVA 2ZKOA 5EYPA 2P9CA 2CNDA 3RT7A 3UWDA 1OZGA 2RHTA 5EHQA 4ER5A 1J8MF 2Z8XA 2J0EA 3IVGA 5AMXA 3CA8A 1PFVA 4X3CA 2P7TC 3T54A 3WQBA 4YRIA 3X0DA 2ON6A 4Q4AB 3JYQA 3HLYA 3U3KA 1AS2A 3UK7A 1LLCA 2INGX 3K6RA 1R0KA 1YZQA 3AU8A 3CLRD 4K6FA 1PLLA 1NATA 1GYQA 3C3BA 3EAFA 5GM2A 2O7VA 3PIRA 3QBJA 1B6QA 5G4KA 2V8OA 1RHJA 4YJ3A 3H05A 4IDQA 3C85A 5CNMA 4B08A 3DTTA 2FSHA 3G7UA 4BDTA 3SQLA 3BMNB 4F9EA 2P1RA 2ERCA 2WB4A 1C0LA 5D1HA 2EZTA 2VNSA 3IQWA 1BD4A 4BNLA 3NAQA 4M54A 1L7VC 4UMFA 1M7GA 2ZR0A 3RUFA 4ZGWA 4ZODA 2Q1UA 3E7PA 2CDYA 3CVUA 2PYLA 2Y1DA 4QNHB 1QYWA 4WXHA 2R8YA 4ZBMA 1KPGA 1UBRS 1U4OA 5DRTA 2HXGA 3I9FA 3PRKE 3KWFA 3N86A 2B69A 4QE9A 4TROA 4EG5A 4C5BA 1RI5A 5C34B 3RPEA 2Y4NA 1FFXA 2YI9A 2F93B 2TS1A 3HQ4O 1LI4A 2LFRA 2WFLB 1HTWA 3LLUA 3MNFA 2QLNA 3OUZA 1X94A 3FUTA 4FOPA 1Q0RA 2CLSA 2VSOA 4HDOB 4LXHA 4B8ZA 4UFZA 3MXTA 1W94A 4FFBB 4BNXA 2MSDB 4M9SA 5DCLA 5E6UB 4DQXA 1WXDA 2NG1A 4Q3EA 2O5EA 2KHZA 2HUPA 3VVMA 5IVIA 3MSCA 5I7HA 2RJZA 3PS9A 5J2UB 1P33A 4IVNA 1K08A 4BYMA 1KMCA 2QL6A 1SUPA 4OHFA 3ASZA 4YJ2B 4J0KA 4IWYA 2H85A 4QGAA 1AA9A 3MWEA 4KDFA 3NTXA 4M55A 4XWWA 2OEPA 4NFSA 2X3FA 4WNIA 2AW9A 4DIMA 1NXTA 3UOGA 2IH4A 3ZV5A 1YV9A 4YIKA 4GL2A 4PN7A 5CB4A 1RHUA 3QSGA 3ZWAA 1EAYA 2WLNA 5E79Z 4FOTA 3M3DA 2FW6A 4N7JA 1D6JA 4ZRDA 5CFMA 4XIJA 1W73A 5ENDA 3DSRA 4QBIA 5ALDA 4ZRNA 1A1VA 5H4HA 4LJSA 2RH5A 3GRUA 3QK7A 3HJFA 3B2QA 4DUZO 1U2PA 4DHWA 3I39X 1YONA 1G6UA 4JAVA 3TINA 4CIBA 3CZPA 3EOBI 1KU0A 1X42A 1AKVA 1C3LA 1VYUA 4KO2S 1SUFA 4IPTA 3RGGA 4C3VA 1R6AA 1OWLA 3CWZA 3G0GA 2LE0A 3I58A 3TSZA 4W5OA 2H1OA 4OM7A 5IYCO 4NWIA 3QJGA 4TKVA 5ABPA 2F48A 4W7IA 4WZAE 1XDBA 3RSCA 4ZMBA 3WNVA 4WFFA 3T94A 3D6UA 2H51A 4R01A 2R48A 5B7PA 1UOPA 2B92A 3AEQA 2NV2B 1KC1A 3L9WA 4JNKA 2IHJA 5A0VA 1KI6A 2I6TA 2Y92A 2NVUA 2HA0A 2WSSA 3FF1A 3MTIA 2QGFA 3DKKA 4L3VA 4QPPA 4ZT2A 3N74A 1G4AE 4LY0A 3DV9A 5DEIA 1T8UA 3ETLA 3NBMA 1WXEA 4FLFA 5BOSA 4R1UA 1YJAA 2FV8A 1M1YE 2OILA 5CURA 1ZQ1A 1J1ZA 2MSNA 3DVRX 4I1RA 5IUKC 5IAGA 2NUTA 5F9FA 4QFDA 2CK3A 5JASA 2ADOA 2O06A 2ZVPX 3BRWD 3HPRA 4TT3D 1NQTA 1ORHA 3GP3A 3WIDA 2YVKA 5LJIA 4CKXA 4FHCA 3RSGA 2YYAA 4RTJA 1KYYA 2IYZA 3EXIB 3MJDA 4KYTA 4UFNA 4X7BA 1RZ3A 2FLKA 2HA5A 5FBVB 3HABA 1BE8A 5DXFA 4IV5A 3UHJA 1L4FA 3EGIA 3DM5A 3QOXA 4HXEB 1K7SN 4MR8A 3QEJA 2X0FA 2FWBA 4I55A 4Y6QA 1ZK1A 2D0OB 2HU7A 2JKZA 5FEUA 1XUOA 1IVSA 2JAOA 4GDMA 1OXTA 3BWVA 3M34A 1DT5A 3HKBB 3PJGA 1GSOA 1GPUA 5SV2A 2OHXA 2XLCA 5LYJB 1DG9A 1GA4A 3FDIA 3FTCA 4K1XA 4BU0A 5JS1A 4DEYA 5HRCA 2WWHA 3P4YA 3QXXA 4OVKA 1TJNA 4TN1A 4EHAA 1N36O 3C14C 1Z2GA 3EGCA 3SZMA 1V6CA 1ZDMA 3EQ8A 4E1BA 5B6JA 1BQEA 1T1JA 4LY6A 1X9HA 3HDQA 2C1ZA 1R6DA 4R6XA 5LIRA 1ISFA 1Q0SA 1VHDA 1EN4A 3A0BZ 3GW8A 2XMPA 3IUMA 1NBMD 2FQ1A 4LOJA 3LTEA 1LBEA 5EPOA 4TV8F 1DQRA 3WLFA 3OF3A 1SVKA 2QTRA 3AOEC 3I4CA 2NO5A 5LBQA 1ZRHA 3C87A 2G0TA 3R75A 1E3EA 1LJ8A 1ZM7A 3G23A 4RC9A 5AI0A 1VKJA 4YCDA 1HDGO 1FU7A 2C4TA 2OORC 1Z15A 3NV7A 3D6HA 3HVUA 4XIIA 1RDFA 3PUHA 1Q6HA 2XA9A 4F46A 4Q9HA 1G2OA 1RAIA 1R4ZA 1E0SA 3VDQA 3ANTA 3OZTA 3PPIA 3QBDA 1L5VA 3PR3A 3B9RA 4MVJE 1H2GA 1KYQA 5HZKA 4PG7A 4WKPA 3KZMA 1KRHA 2P91A 1J5EO 4X66O 1L9XA 3OIVA 5LU8A 2W11A 2R6ZA 1XQYA 4Z9BA 2EOAA 1RAFA 2GLXA 3KTAA 2ZWVA 5IPFA 1Z35A 2XGGA 4GBGA 2NU8B 3WGQA 3WNCA 4C0XA 3LWNA 4BKQA 1MTOA 4JI0B 2R7KA 4HG2A 3OP1A 3ZWNA 4B82A 1W2HA 1FMTA 1M8GA 2K1EA 2CD9A 2WYWA 2EX0A 5EZQA 2OAGA 1GM7A 4YO8A 3V8EA 5IZCA 4GDFA 1IXYA 1SQXH 3C8DA 2NYAA 1QVGU 3S3TA 4Z54A 3FLBA 2VH1A 2BH9A 1JQJC 2FZWA 3DEKA 1JR3D 2PO7A 4WHMA 3RFTA 3MF4A 5GTIZ 3F49S 3GLHA 2WOOA 4RFLA 4GHWA 5F4ZA 3N8IA 3O26A 4YDSA 1LDBA 1GR0A 1RHQA 1G8PA 3F9RA 3PL1A 5HWSA 4FMCB 2R0QC 4J1TA 1QV9A 1HYEA 1D0VA 3APOA 5K0LA 3NB0A 3VZRA 5AQEA 2R79A 3BCRA 3NTUA 1CJTC 1W87A 2HSWA 1M7BA 1PLJA 5CHYA 2ZITA 4N49A 5JV5A 1QF9A 1WABA 1RWOA 4YQZA 1AQYA 10MHA 3SYOA 3K5WA 5JSHA 2A3RA 2OESA 3IE1A 3G71V 2JFBA 2NOAA 2QB5A 2VAWA 2Z95A 3FWYA 3FMIA 3FWZA 1P3Y1 4OGLA 3OE7D 1RJWA 5AHOA 2W70A 3WZMA 4RTOA 4RSGA 1J2EA 1ODTC 4QBKA 4EX6A 1JEYB 2XUGA 2WHXA 3ZZUA 4Q3OA 2D5CA 1QYIA 1RYYA 3AZQA 3VH4A 1K6EA 5CYGA 1PR9A 1EK5A 1KEPA 3PF8A 5K1XA 2B25A 4MPDA 4Q3KA 2BI8A 1S4QA 1GRVA 1YBMA 1GPBA 2A57A 3IBGA 3W3AD 1QR6A 2GCOA 3C70A 4DLRA 4DUPA 4FFMA 5IDVA 1VKHA 4OI1A 3ZXXA 4UMVA 3W6PA 4E70A 1OI3A 5DGXA 3WGNA 1M8JA 2PUHA 3TZEA 3DEAA 4EKDA 3N0XA 5G40A 1ZHHA 1HT1E 1P9LA 3FUUA 3NH6A 3HN7A 4UAJA 1IN4A 2ADPA 1Y82A 1DFGA 3AK4A 3DD1A 3HM2A 3KZ1E 3KZXA 5DSTA 2JBAB 1H38A 3GMTA 3L79A 5FHRA 3FYUA 3GG9A 3STYA 3WYFA 2IJGX 2W7TA 3KOMA 2C9ZA 1VPLA 2QR5A 2X8LA 3M4ZA 3OEHA 2ONYA 4KVAA 1II9A 3L01A 4O1MA 4QGHA 2QMUA 3VPFA 4NXNO 3ZDDA 4R9VA 3HKDA 1IH8A 1U0GA 2EIJC 2C7VA 1T10A 5F12A 2I80A 3HLTA 5E9JA 1QMPA 5TISZ 1KJZA 5FUYA 5BMOA 5ITVA 2Q6KA 5C93A 3T15A 2GPJA 5DP1A 1P2FA 1JB1A 4O3MA 1BH2A 2WLIB 5CP8A 4ZO7A 1OWMA 1YZBA 3KTOA 4M8KA 1U65A 3N2LA 2O8FB 1U28C 1OI4A 2ETXA 3NO4A 4I55F 1PW7A 3JAKB 2YS8A 1XL6A 1RADA 1Z7BA 4XW2A 5BUQA 4D9MA 4B3SO 4RL6A 2QF7A 3ONDA 2BCEA 1DCMA 1RC0A 1XCJA 5JNLA 1KY4A 1V37A 2V6MA 2ZI3A 2XKKA 3H8VA 1ISIA 2P4QA 2V0CA 4JKIA 3CP1A 4MVZA 2YCBA 2PH3A 2PKQP 3DVQX 1LC0A 1T9KA 3PCRB 4H7JA 1NJSA 5ERXA 5ADWA 3GZTB 1QIEA 5HKKD 2BFFB 1XK6A 4BZWA 1SUWA 4U7HA 2A7WA 3HKCA 1SEVA 4OGQB 3LC1O 4TKUA 4YMGA 1CQJB 3QEAZ 4I4CA 2J9GA 5AXBA 1TK9A 1WU7A 2GEDA 4ND1A 3TTXA 1M33A 3QNUA 4L8WB 3X1DA 1IXMA 1H0HA 3RFFA 5IJAA 1Y4ZA 2GK3A 2XGJA 3DF9A 1UEIA 5DHTA 2Q69A 3E3AA 3PGKA 3OE1A 3JQ8A 1W30A 2IC5A 1OSNA 4DCCA 4ZT5A 4OHXA 2ANCA 5J40A 1YVPA 2ZBQA 3ROEA 2PD3A 3Q7PA 3IQHX 2D2CB 1KBOA 1NVVQ 4LA4A 1VA4A 2WF8A 3HB0A 1XDSA 2R87A 4GMXA 3PC8C 4FI3F 5DZSA 1CY2A 1F4NA 1LBTA 1I4DD 2VDNB 1EN5A 3U7RA 1N5JA 3SMVA 4GZ3A 2IEIA 1Z83A 2QVXX 1GSIA 2C31A 3U26A 1RJ9A 4E88A 4P22A 4NEGA 2ZAGA 3Q8WA 3DDWA 5E7JA 5IU6A 3SVLA 1Y4UA 5HUJA 3HHPA 4JFRA 2PNFA 3ZR4B 1Q1QA 4MYUA 2BBWA 4ND2A 4TKMA 4BQSA 4DMGA 2ILMA 1F8UA 5TIIA 1RVDA 3EVCA 5DPMA 1JHOA 3H3XA 5HIAA 2YFYA 3EPLA 4RTPA 1L0LH 1JAZA 5DULA 4L2IB 5HJ2A 2FMUA 2O7SA 2ZDHA 5I9SA 3T7CA 5AW6A 3OY2A 5CK4A 1AMUA 3L6RA 1R9MA 1MPTA 4GFDA 1KEWA 2GJ4A 4QSMA 4BS9A 1F2UA 1OPXA 3O8OA 4L4ZA 4EG8A 1PJRA 2E82A 4NYMQ 5TPWA 1QHEA 3UN1A 3GEIA 1KOLA 3LKVA 5CVEA 2QW8A 1EUDB 5FRDA 5C1DA 1JWLA 1MZVA 3BYZA 1UJMA 2Q5HA 3DPSA 4AX4A 4H18A 5I4CA 5GGYA 1XYVA 3G3EA 3WNZA 2I0FA 1KJ8A 1SM4A 1S2LA 3GB9A 4LMRA 5DIZA 2IYYA 2ZIMA 2P62A 3H4VA 3JYHA 4UATA 3SSNA 2H4HA 1WULS 3V9PA 5JD4A 3ZWQA 5AK4A 4ZYVA 2IVFA 5LGTA 5KUTA 3QX8A 3A10A 3ESRA 4NS1A 3W5BA 4MHTA 5GMOA 2CNWA 1RLMA 3DPIA 1FRNA 4TMTA 3LP8A 4GH5A 1AGXA 3W7UA 4HVAA 4DHEA 3R0IA 3OEHD 4UM7A 5HQTA 3F7NA 3CXUA 3VVLA 3QTLA 4UD2A 2C54A 3SFZA 4ER0A 1ZOIA 4K6HA 3ASNB 2UUBB 2FPSA 4M4SA 4G6ZA 3UMMA 3Q2KA 3DZGA 5THQA 1UFRA 2I2FA 1O4WA 2R68A 2QLMA 3NHMA 1ZAUA 1JNXX 1W8IA 1YS1X 4B76A 1QOQB 1K97A 2B2CA 3P5BA 1EVIA 1P17A 1AR1B 5T57A 3O8QB 2ZJ2A 3F9IA 4NOLA 2XNSA 3K1AA 2AFRA 2RAVA 2WG0A 1KAQA 1NBMG 2PIAA 1NBOA 3D3WA 1OLXB 3QQPA 3L6EA 1RXWA 1SQ0A 3BXZA 4BQQA 4ARSA 4GBED 4EO9A 3DMRA 1L4NA 4IFTA 1Y33E 3L82B 4UXJA 3TVTA 1AN9A 4C5CA 2NSHA 3X43A 4DWJA 5KOHB 3U4MA 1P75A 5TARA 1OCRC 4F97A 3NANA 4WF9V 3DOCA 1HEYA 3IESA 1ZUD1 2YMQA 5DM1A 1PNRA 3SFTA 1DBSA 2IHYA 4X20A 3U9LA 4A91A 4BOYA 1GGHA 1QNMA 2AJLI 5AVYA 5JS8A 2Z43A 1TU4A 2WV7A 3PTZA 4ZU1X 2ZUDA 4R2KA 1HE3A 5AOBA 3LQ4A 1UJWB 3Q87B 1PKEA 2QUIA 3I5MA 1F38A 3JTEA 4MHOA 2GD6A 1ATIA 4LXUA 5AM4A 4ZYUA 1U0RA 1IN8A 4GI2A 4WFAV 5KSOA 4DA9A 4TQAA 1FP4A 4YRTA 3P9IA 4RCYA 3MT8A 4L7QA 5AHWA 1TF5A 1A2BA 4OV6B 2WWIA 3VMMA 5IASA 3AC0A 4E2ZA 1IEQA 1QHGA 3NHZA 4PS1A 1AHHA 3EDOA 3E22A 4LXGA 4G0WA 3ZLVA 2C3UA 3CLRC 4LPSA 4Y0AA 2J59A 1WKCA 4AAYA 3TAUA 4C20A 4JUFA 3F7YC 1FDSA 1XZHA 4FHZA 4BECA 2X19A 2Q7GA 1DBWA 2ZJFA 4N3CA 3KVOA 1PZMA 5HDBB 1E2KA 1MFPA 2ASEA 2DUUA 1CIJA 1PR1A 2BFBB 2PXXA 2IY7A 5TSDA 1DG1G 5C8ZA 3MQ2A 2WJHA 1O8CA 2FG5A 1YJBA 2W2VA 2WFAA 4PEVA 2HW8A 4PYKA 1R5OA 1M76A 1W76A 4UKDA 1IY0A 1VQ8V 5JSKA 3THXB 1QZTA 4AJOA 5JQGB 2BONA 2BEWA 4YLGA 1NQXA 2C5LA 5EWJA 2QR2A 2OQ2A 5FHQA 1DIBA 4DN6A 2XMBA 3NAZA 1KK0A 2GZDA 4TSFA 1TYCA 5EKDA 5H81A 4YMTA 1RPTA 1KH1A 2V0NA 4H3VA 3KKYA 4YWHA 3ZN1A 1CQZA 3ES9A 1NI4B 2QUAA 2LCQA 1GUZA 4YP5A 5T3YA 2D0PB 4P0QB 4N48A 1FS0G 2GCGA 1EZJA 1MX5A 4QX6A 1V2GA 1WMAA 4RACA 4YH1A 3WXBA 4IHJA 3BD6A 1A7JA 4CV3A 1QGZA 2P8SA 1P80A 1XVTA 4WESA 4TLCA 4ZYYA 2Q2WA 1YHZA 2XKAA 3OO0A 2RAUA 3OFNG 2XZTA 4BIZA 1K7DA 1UJBA 1RE1A 4J90A 3CX7A 5JTUA 3QFCA 3TDKA 3EVBA 2AFIB 3QKSA 3A1DA 4G07A 2O5CA 2GF9A 2KG7B 2ODQA 2GKOA 4JFAA 1EJ2A 1M34E 1NDUA 1YI8A 2C2HA 3K6KA 4QYXA 3HBNA 2A0YA 5C2JB 2D3OW 1V16B 2F1OA 1JN0A 2OOKA 2HLHA 3CE9A 4Y9DA 1BFUA 2ATEA 3BJIC 4TXJA 4I9HA 2WINI 4UV8A 4DCVA 1VI5A 1RABA 2PGJA 1PYGA 2C7BA 2X22A 4RDHA 4GZ5A 1V1JA 2AG5A 1MV5A 1RCUA 1YZFA 3GFOA 3AI7A 3BPZA 4C0JA 2O48X 4GBJA 3WWYA 2GCOB 1E0AA 3V42A 4LV6A 1U9IA 4HYOA 1ZU5A 1OCZC 3CZ5A 4H1VA 3VVCA 3T3OA 2FSVC 2ILVA 1V2HE 4DG5A 2DQKA 4ZEWA 2DERA 1N92A 3H3JA 3F3SA 2Q8VA 1M10A 2E7ZA 2R8PA 4LJ4A 5DHFA 1KJIA 2EERA 3D3NA 5J2TF 1AS0A 5EZ5A 3LDEA 3DOFA 3ER6A 3K03A 3H3FA 4HBNA 9ABPA 5KOJA 1EVLA 3ELBA 3FYUB 4D92A 3G6BA 2FR8A 2ZDGA 3F74A 1U94A 3EGWA 1U1CA 1VL0A 1CS0B 1CSEE 2WHRA 3OZDA 4GKJO 1RWVA 4AQDA 4BAUA 4X1OA 3D3IA 1LFDB 4PLPA 4ICGA 4EQ6A 4RLQA 1E79G 3R4CA 4P35A 4URZR 3IB6A 3ZDXB 3TXAA 2A3QA 4Q4LA 1YXMA 1ZVQA 3AM5A 3FOWA 3HO1A 4XASA 5D01A 2J0UB 3EZ2A 3EDMA 3AM1A 3AR7A 2DH6A 4MPTA 2FEPA 1RM1B 3FLEA 7GPBA 3H65A 1ZNXA 4BNZA 3ERCA 2XUJA 1GVNB 2YJNA 3BM5A 1QFYA 3DZKA 5EGNA 4PW0A 5EZYF 5JCJA 2IS6A 1WDWB 3NT4A 2WE8A 1J5PA 3BZUA 3GRZA 1WB8A 3SDZA 1YDXA 1ECJA 2OHVA 2Q3DA 4LGYA 1FD9A 2CDAA 4MYTA 3ETJA 3E7FA 5FADA 1EDOA 3W3AA 4PGMA 4OLHA 3GJQA 1DG3A 1J2TA 3RCBA 4EH1A 3SAJA 3H1JH 2YIAA 1ROPA 2ZUSA 4LZAA 4F8EA 3ZCCA 1N8NA 3QX7A 3WL6A 1BD3A 4KMSA 2D8MA 2HGSA 3O3MB 4V0LA 3REOA 3UKJA 5IEBA 4ERNA 2FEAA 2AMJA 2XA1A 4WIAA 2Y1OA 1YAJA 3P27A 2HFJA 1PK8A 2V4DA 1TPZA 1YE3A 3BTSA 4KX5A 1NT2A 5EWLB 2V1DA 2ZDIA 3GWOA 2COUA 1RYFA 2H7YA 2TYSB 2YHIA 1HEUA 1II8B 4GKBA 4IFIA 5E2IA 4M1OA 5SYAA 4D0RA 6PFKA 3DXYA 3H9EO 2ZRPA 4YA6A 4URHA 3SHWA 4NCHA 2OGTA 1L8QA 4CM4B 1H0SA 1RMYA 2C3MA 2JCSA 3LT5A 4I0WB 1TVCA 3NDBB 1XHZA 4BAZA 1RS0A 1JZSA 3INTA 3QEKA 1IY2A 2FMFA 1C7ZA 3AVUA 2YYYA 1YAHA 2BDEA 3ZV6A 2IIVA 2I33A 5HKOA 3ZDCA 2DBZA 1EWKA 2P5OA 4AS3A 4CHGA 4NS4A 2IPNA 3CRAA 2Q4DA 1ZJ4A 1FB5A 3DKVA 3MAAC 3IVAA 4OQ4A 1RSZA 2FPKA 2XEDA 3GBPA 4DRXB 1F0YA 1ZISA 4IZHA 2R9AA 4JL6A 2WE7A 2CJXA 5BN5B 4RIGA 4BN4A 1A9YA 1P1IA 1IK4A 3KEFA 4DRYA 3OUFA 4GXTA 4YMIA 5F52A 5CBPA 2QD2A 1N5RA 1ID8A 2RCVA 2FXVA 2J3LA 4MEAA 1C30A 2DM6A 1WA8A 4Y2JA 2XCSB 1ZGGA 3HDJA 1C0KA 3D3JA 2R2GA 4I81A 2VBCA 3B13B 4PYJA 3SSAA 5KTNA 2J9YB 2X9GA 3I6IA 3DW1X 2NNLD 4FWBA 3OZXA 5H9WA 1J4AA 3K8OE 1NYLA 2E49A 2GVNA 3CSDA 5IJWA 2WUDA 3A6DA 3IDQA 4BFVA 3BT7A 3JARA 2XUKA 3TLBA 4CM8A 1BHSA 1PE0A 1KXJA 5JO0A 2QRHA 3I92A 1F2UB 3O8OB 2E5FA 1BQ3A 3QBVA 2A0XA 2OBFA 1NXOA 4WFBV 4DGSA 3BBLA 4CR6A 1T3TA 2O2JA 4JTDB 4WN9A 4GOND 4U7NA 1YNSA 1H94A 4DLNA 1VE7A 3M7MX 3PLAE 5JLJA 2JGRA 2QAJA 4BP8A 4DMMA 4ZPJA 4LHXA 4NV0A 1M57B 5M3BA 3B7WA 2NYRA 3LDHA 1R16A 3E5MA 1GZ6A 2BHNA 4U7TB 1VQ5V 1ZOPA 4E03A 3FTNA 5ITWA 2X6CA 2R1TA 1RACA 1S2NA 3ED5A 1BE3H 4KXYA 5DLQC 3TX6A 5K1PA 1SKAA 2AVDA 1NW9B 4EF5A 1Z39A 3AOGA 1Y67A 4LP8A 4XUDA 3WLNA 5J4HA 5HF6A 2XQIA 2G6BA 1NL3A 5CTJA 2PL5A 5JS6A 2ATXA 4E1VA 3UB3A 2I6QA 4ES6A 1EFDN 2GFIA 2GPYA 3TNYA 3MJHA 4QU0A 5JSQA 1ZI8A 4ZV7A 1JQBA 1ZC3A 1HO3A 3G2PA 4BJ3A 1WUTA 1X86B 3UJDA 1KVQA 3C1AA 4NTWA 1NLUA 1VSQA 5AIAA 5DFAA 3SX0A 3QVUA 5DVZA 1PJ4A 4AN1A 1LPAB 4NULA 3EEOA 3RS8A 5AKZA 5CFZA 2WTEA 3K58A 4YJDA 3AVYA 4BKUA 1NIPA 2XQFA 4MJ3A 2X40A 2AN9A 4MP3A 4XQGA 2GDSA 3ILVA 2ATVA 4R9RA 1MO6A 3S7ZA 5DNVA 3FZGA 4Y7DA 2ODNA 1L4KA 1OLUA 5DHRA 3A9UA 4DPLA 2I7XA 3AG4C 2PZLA 3DVSX 3PFHA 2WM9B 1XHEA 1W47A 3THSA 3UXEA 2I76A 1GILA 4YR9A 3V7FA 2JG3A 4PICA 3LT2A 3QVVA 4O2BF 4NR1A 4PHCA 2V3VA 2CH7B 2B1QA 2CSUA 2ZPAA 3CG4A 1N2OA 4KOEC 4OQFA 5F77A 4FMCF 3RFUA 4J7KA 1VJRA 4QXMA 3FMFA 5AUQA 4MVQA 2AQKA 1CJVC 1AI7A 2WWRA 4M1EA 2XNHA 3N70A 3R3VA 4ZAWA 1Z47A 3OTOO 3D7LA 4HLCA 1OX4A 1V71A 3AESB 1E1RD 4K9MA 3OMLA 4MR7B 5ALWA 3GV0A 3TECE 4BDSA 1J00A 4G2KA 3W5IA 2W71A 1R2QA 2DMRA 2FN7A 1J2RA 3H2JA 1JQDA 2EKPA 2PUSA 1Z6TA 2FX2A 1M2WA 1OOEA 1SC6A 2H1WA 2CGNA 3HNPA 1QLHA 3NHWA 4H7DA 1T1SA 2QPAA 1ZQ9A 3H5WA 3HKBA 3IHWA 3KS9A 5A03A 2FOXA 1GL9B 2J09A 4INZA 3A0HZ 4HSEA 2J5XA 5F51A 3E9NA 5C31A 2EP5A 2VNJA 1DBPA 1KWKA 3COSA 2J4CA 5BUZA 2BKAA 1W59A 3B2EE 1B6SA 1WW2A 3D59A 4LECA 3WLKX 2QV0A 3FDZA 3T3MB 2DPYA 3ON5A 4WVFA 3DV0B 4ZEVA 1P29A 3OPYA 2PKEA 4GEKA 3PGVA 3U4GA 3LRXA 5LYJF 2AZXA 5K3CA 4GKJB 2XUZA 1GQOA 3UO8B 1NTOA 3OFND 4WZBE 4JSYA 1VBFA 2GH1A 3UYKA 4QPDA 1UBSB 5REQB 2ZM6O 4JTCB 2Z2YA 4LXTA 4PRKA 4TTAA 3TDNA 3V8PA 3O31A 2OZEA 4JJAA 3GJTA 1SB8A 5EJFA 5SICE 2WQZA 1XO1A 4M37A 3ZD7A 2RIPA 3WQHA 2H4JA 2VK8A 4CTJA 4EGFA 4IKOA 3L4BA 2DFNA 5D51S 2QQ5A 4KX3A 1RCFA 2XNKA 5FJIA 4DMLA 1X7YB 1DF5A 1GQQA 2BEVB 3KKLA 1P1HA 2Y2VA 3MERA 3UXHA 2JS7A 1ZM4A 2WHYA 4QUHA 2PV7A 4IVRA 2LD4A 5ES4B 2ZKIA 1FLAA 3E7DA 3VQTA 1HE8B 2FJUA 2IBMA 1BE1A 1HG1A 2F6RA 3EDCA 1JR3E 4J0JA 3TQTA 2QRLA 2CJPA 2HV8A 4CIAA 4KO1S 2IYLD 2RGYA 3EC7A 1KDZA 2QRVB 2D2EA 5K0NA 3TQRA 4UHHA 2HO5A 4B3HA 1ZVVA 2PZGA 1L5LA 2PG3A 4RZ3A 3T4ZA 3HY6A 5DN6A 3FTFA 3IDAA 2H0AA 1AD2A 3DFFA 1QZZA 3F3MA 4HRVA 3P3NA 4MTXA 1NBEA 1KZHA 1XVVA 3FFAA 1KKLA 1YKGA 4JLKA 2GWHA 2QLJA 5DOZA 3ROQA 4KAFA 4EF4A 4RDXA 4XD7D 2ETNA 3DFMA 3TVDA 1XJCA 1SXIA 3CW2A 4HHEA 2QQFA 1YUMA 4P9NA 4XRRA 4KIJA 4TRMA 5AW0A 1B3RA 3QU5A 3V6MA 4FLWA 1R0RE 3HJHA 2P3OA 4AJIA 2PE5A 1X7YA 1OWNA 3BF8A 1CC1S 2BDTA 3B85A 4J0GA 1NHWA 3LC7O 1SD2A 3FZNA 3WKDA 2HVJC 3K4QA 4QOSA 4RDIA 3M5DA 3QVGB 5BW8A 4HX9A 3IJRA 3LQ1A 3IHLA 4URWR 3BA8A 3AF1A 4PQRA 4YPOA 4KQJA 5K0EA 1AMNA 1VPWA 3NBQA 2H2FA 1MXFA 2BFAA 4P31A 1XVIA 4EUKA 2IDKA 2BFDB 2D00A 4YK7A 1PJQA 1Y89A 3AHDA 4P3PA 1K2VN 1N2CE 3ET4A 4LHWA 3W7XA 5HVNA 1SKUA 1L5FA 3FPLA 4E5PA 3WS7A 5CITA 3AGQA 1QP8A 4IDGA 3NWOA 4NYIQ 4QDOA 1SOVA 3KLOA 3TOCA 5BNWA 2QLTA 5HM6A 1ZRMA 5LOVA 2G1PA 1R50A 1ZJJA 5CFPA 1FTQA 1QHIA 3H2SA 4MQEB 2P90A 1CD5A 1P2UA 1YQQA 3IIMA 3WICA 1NURA 2ECKA 3GFSA 4NYIR 2WMNB 4FK5C 4LNUA 2ZI6A 4LBWA 4TMFA 4E2XA 3G8CA 1ESZA 4KZPA 1QGYA 2Y0IA 3AF5A 4ZAYA 5L3DA 3EZXA 2ZSHA 2RI6A 2FB9A 2CBXA 3JVVA 2JH9A 3MRSA 4ND8B 4I0XB 1CUJA 3QVJA 4P3OA 2ONZA 2PWYA 4PZZA 4Q4JB 4F3NA 1UAAA 4KDRA 2QX9A 1GPH1 2XZPA 1E18A 1IN7A 1OTYA 1MG0A 1T5LA 5CBGA 1DL5A 1LPPA 3QVGA 4IRUB 1SQFA 3RROA 1MKYA 4Q16A 3TLGA 1NBWB 2VJOA 3C6XA 3H8JA 3UUFA 4PNHA 2KW5A 1AN0A 1SMKA 3IC7A 1EWTA 3LKZA 4GXQA 3DT8A 4GXNA 4P4GA 1QG6A 2ZUFA 2L0XA 3E9DA 3S27A 1WY7A 1EP9A 3V1LA 3VO8A 4DDTA 5H8WA 4P7GA 4I50F 5JAQA 3V2UA 3V48A 4D8TA 3KUXA 3HJRA 1JPXA 3TCXB 2C4NA 4FLUA 3ROKA 5C18A 3IKTA 4M1WA 4AWXA 3G8AA 3B1KA 4GSLA 1WETA 1XWIA 5DU2A 3KQTA 4OI0A 5DHAA 1WAZA 3TFWA 4CMIA 4TS3A 1T3GA 3DKIA 2E6KA 2PV0A 1J9GA 3GDFA 1K2WA 3JD1A 1II8A 1Z4OA 1EI9A 1EK2A 1JIQA 1ZWLA 3GJ3A 3WBJA 4DR2B 5I01A 4YYZA 5K1ZA 4BBZA 2Q1YA 3KJEA 1FSSA 3QPCA 4ZGBA 5D1NA 2R8EA 2F1MA 3OIYA 1DRKA 4LC9A 5KMGB 2V3WA 2BH2A 3TG2A 1YZNA 5J5AA 1AO0A 4G09A 2FX5A 1UKAA 3QWAA 5F33A 1XDGA 4EP1A 4UCOA 1D5AA 1DC4A 2RKOA 3IKMB 4LDQA 4C6HA 1HYBA 2JA2A 1FOEB 4WKCA 1UPXA 5E2AA 1AQNA 5ALMA 1T4DA 1J99A 1MV8A 1ORQC 1B4DA 1DP4A 4JY7A 3EY4A 1V54C 2BZ1A 2Q46A 3E8SA 4OA5A 4D41A 5DTJA 3VPCA 5AM2A 4EB6A 4K9LA 3CIOA 1SETA 1D2CA 4N0QA 5I7FA 5LQUA 3SBXA 4AJLA 1XK7A 4CZ2A 5FLXN 2FVXA 5DBHX 4UARA 4EA8A 4KGZA 4BUJA 3NHAA 2ZXFA 4QUEA 1RZRA 4OQNA 2A9JA 1R88A 2FDRA 2IP4A 4LWOA 3WU2Z 1ST2A 3L75H 3OZUA 4JEIA 3U3OA 1PX0A 1U4SA 3D8RA 4C7OB 1OILA 1YL7A 3NBZC 4F93B 3CWCA 1PDOA 1CUIA 3C0KA 2XDQB 3TTUA 4AC9A 1GA6A 4PXAA 5G3YA 3U3ZA 3GJ4A 4BXOB 3CNNA 2L18A 2OHJA 3ZDFA 5GADl 3JRWA 2WAOA 1XXHB 3WE7A 4UUBA 5FD8A 4P2BA 5TQ0A 3PQ3A 2HWKA 5DDIP 4ANFA 4FLYA 4FW8A 3BJMA 1C0PA 2J4DA 3N58A 1IY1A 1V5EA 1FQJA 2VDWA 3FVVA 1A9OA 1CZRA 2CDCA 2WNIA 4M0UA 1XBTA 4LXYA 4P58A 4TMYA 3WL8A 3ZZ1A 1MQSA 2L17A 3OZ7A 1MB4A 5CT5A 1YFZA 2A9QA 4N7RA 2FNAA 5GWXA 2ZRAA 1K7YA 3DTNA 3FX2A 4JBIA 5JU6A 2MINB 4OG2A 4GR5A 4K8OA 3QPWA 1XQVA 1ZD1A 1VGRA 1GSHA 1P19A 2JHGA 2ZUCA 5LMUB 4CQNA 4DLBA 2JHCA 2KYRA 2VH2A 3SXUB 4ZVVA 4EHBA 3C16C 4RADA 3X1ZA 3DQZA 3VC1A 4DJTA 1OQAA 1KI2A 4X93A 2DHQA 3QF4A 1AZTA 1V3UA 4PDVA 2JCYA 4RPKA 1JA9A 4J0FA 5AI8A 5ALEA 3LTNC 3L4KA 3PC8A 1E2IA 2HAEA 5KX5F 5CCXA 1G20E 1RYBA 1XF9A 3CJTA 5FR1A 3WOHA 4PFJA 4IYRA 3IDZA 5HHTA 2GLUA 3G1UA 3BMQA 1DE0A 4YRMA 2XBMA 2IJJA 4G5HA 4TWZA 5CR9A 5EQDA 3KHUA 4WFEA 4YDRA 3OZGA 3I6MA 3EVZA 1ZIDA 4GPBA 4H13B 4QBHA 4CKCA 5L4NA 1F17A 2PWAA 4FJ1A 2OYRA 1DTWA 5IJXA 1T4GA 3JVEA 4NZZA 3G9UA 5ECYA 3OWXA 3X2QC 3VHQA 4CQJA 3VKHA 3IRVA 4JLDA 5KVAA 3OT5A 2H2WA 2XWBF 3EZ9A 4DR4B 1QV6A 2IGTA 3K8QA 3OWHA 5E8RA 2JEZA 1VRVA 2YXPX 5FR2A 5K8VA 1E2MA 4P8RA 4S05A 3EB9A 1FW6A 3Q2OA 1PZHA 3RKRA 1M1NA 3MBKA 3EXG1 1MEOA 2J87A 1FFDA 3TNLA 1U04A 3KEQA 2A9RA 3VUEA 2BM1A 3NBUA 3BL8A 2JLRA 1XP5A 1EBBA 3BQ9A 4FVTA 2EX3A 1E92A 4WJKB 4JI3O 4G2TA 1G7TA 3ZUGA 1PU2A 3ML0A 1OX4B 3AESA 3KFVA 4MR7A 1Z6YA 1KVTA 2IX9A 5FORA 1B8OA 3VX3A 4U2FA 4P92A 2REQA 3KFXA 3VZBA 1FRZA 5ALIA 1GTSA 5EP2A 4GWLA 4WXYB 3T7KA 2FSPA 1E2JA 2R4TA 5LHGA 1QIJA 2Y05A 1Z34A 4E5NA 1JLSA 2ZM6B 1I0IA 1JB9A 4MIKA 5IZ4A 5BW6B 1PR6A 3UG7A 1D6SA 3C6KA 3LY9A 4IIJF 2LCIA 2ZSFA 2DYRC 2HWWA 4TUYA 1MZPA 1FUIA 1TTTA 1QUFA 4CQLA 2B0JA 1X8LA 5D3MB 1NYQA 2BFWA 2EP7A 4GKKO 5B66Z 1TGVA 4L95C 3FN4A 1FTGA 4NKGB 3L1IA 3MAJA 1Z4QA 4DIBA 4YUAA 4WOPA 4MSUA 1DKLA 1EVYA 5AHRA 4BP1A 1TYEB 1VQOV 5EWMA 1M2NA 3K5LA 3U37A 2W0MA 4TKLA 3UEOA 1Z0IA 4FHDA 2L19A 1RU3A 2R8XA 3C7TA 3EXHB 4NJMA 3ZZMA 3KDPA 1D5CA 4YRBA 1TOAA 2IPOA 1L4EA 2NNUA 1ZJYA 3MHSC 5ELMA 1G2PA 5AYVA 1H2BA 3RDPA 4FDUA 5TF4A 5GIPE 5K2MA 1H2WA 3WMXA 2JPDA 4JI6O 3WADA 4YRAA 4IGGA 1C14A 1YDEA 1IHPA 5JPDA 3MWGA 3SC3A 1UFKA 4DJJA 3GARA 4M98A 1K06A 2KSDA 5DXJA 2BGRA 3SYLA 3V1KA 1SUEA 1O6ZA 3OZCA 5JBIA 2JJ1G 1JPNA 3O3OB 4F3KA 2WDZA 3R3ZA 3T12A 4YROA 4UVBA 5I7WA 2G6TA 2HB6A 2ZSKA 4QLAA 4RA9A 5CYFA 2ZUVA 4BRUA 4EGJA 4UM9B 1M7HA 3CX3A 4UCWA 3EAGA 2ZWMA 1K7EB 2GEJA 5DLPA 3PRJA 4DFDA 4ECAA 2QRVA 4PO8A 3D5EA 1HDZA 2GM5A 3DE4X 1ECFA 2NYVA 4XUGB 5DHUA 2WWVD 1BH6A 3NWPA 3HUTA 3RC2A 4M2LA 4D99A 3MCTA 4OF4A 4OHWA 3DAPA 1XBLA 5IVDA 2CXOA 1NVUQ 3CGWA 3ZIUA 2ZWAA 4XPIB 3CKYA 2E9SA 5HCNA 3JAMA 4WFJA 2BF4A 1G0OA 2NLOA 4XARA 4EATA 1SJ9A 3THRA 4TLMB 4CTNA 4Z49A 1QBZA 1MENA 1B6RA 1NPTO 4ZTZB 3MRXA 4HCJA 4PC1A 5C7LO 1CE8A 3SJCA 5CCEA 1Q3KA 2DKNA 3PDCA 3UY4A 3PL5A 4TYPA 2WU8A 3RODA 4HADA 4WGFA 4K3UA 5DYYA 4AJHA 4TVSA 3QE4A 2HYDA 3Q3GE 3QLUC 3X1KA 2WJYA 4KMRA 1Y9ZA 2A1TR 2GBCA 3ZRXA 1QC5B 1YDWA 4PN3A 4A8TA 2NVOA 2XRMA 1XTPA 3JYLA 1U6KA 4HFJA 3GJSA 5AXAA 2I7CA 721PA 4JI0O 4QASA 4Q7QA 2PZBA 5ESRA 4UNIA 1WXHA 2FK8A 2CSXA 1E6KA 3GLIB 2BR5A 2XCTB 5IF9A 5BVGA 4PLWA 1CQIB 4L0DA 4URUR 1JSXA 2C61A 2OV3A 3K3PA 3G2HA 1RXCA 4JU8A 4HKTA 2BOCC 2HWUA 1MOQA 5FI1B 3EC1A 1FFYA 5CM2Z 3GNQA 2WD8A 3AHHA 2XXAB 1L9KA 2PZ8A 4UNQA 2AL7A 3P71T 5LB2A 1TK2A 3FIJA 2BSXA 3H2YA 3ZX4A 4F2WA 1KZ4A 2W4QA 2N3ZA 2A1UB 2DFDA 3GIDA 4FS3A 1JALA 2G7ZA 1BCRB 2LKCA 1DTOA 1I0ZA 2ZS9A 4UVHA 4Y1EA 2X4IA 5ALUA 4LNUB 1SVLA 4ZAFA 3FNEA 3JYCA 4ZVPA 2ORED 5CDFA 4A26A 4ETMA 3HB3B 2ZANA 4NB5A 3L05A 1Y4MA 3FZYA 3OG9A 5EA2A 3H01A 1DX9A 4MVXA 3V2IA 5A7HA 5F2EA 2NU9A 2P9TA 5AJHA 1OLSB 4IIFA 4X0EA 5FLKA 4F6EA 1IN5A 1VCIA 2G09A 1M1XB 1WBJB 3EWAA 5G02A 1XLTA 2V58A 2O2EA 3B82A 4GEGA 4TKVB 5AVXA 5FH9A 2ZXWC 2A9KA 1CVRA 3QKIA 2ECPA 2W6CX 4BB0A 1NF9A 1DKNA 3G8DA 3EHBB 3IUPA 3BGDA 5L3QB 4MDFA 2FFRA 1G59A 3GUHA 2HTFA 3F6YA 4RVFA 4GUAA 4EAAA 2C58A 3LCRA 3O47A 4HDKA 4P7JA 2BMFA 2FEKA 4P80A 4P4UA 3TJMA 5BSEA 5FV4A 1RKXA 3IURA 4QDJA 1ZA2A 3WL4A 4AJ1A 4ZCRA 1DADA 1GQSA 3SG0A 3UH0A 1P9OA 4I5DA 1KQSU 5C4GB 4BATA 5JNSA 4LX8A 1N3LA 5ALJA 2G5GX 1U0TA 3KALA 4C0LA 2ZR9A 3GGCA 4GLFA 3O83A 4LDPA 2VJKA 1IMOA 1ZCBA 2C9MA 5KC9A 4O4JA 2X8JB 3CT4A 3ANMA 3PKIA 2CE7A 1BOFA 1RPAA 3G5MA 4AMYA 4A5OA 2Y0PA 4H37A 1FS4A 4R51A 2J5KA 3PEVA 2OA0A 3GJRA 4ZOEA 4A16A 4DW8A 3LT4A 1DXQA 4UHCA 5CA0B 1AB3A 1JZQA 2AEJA 4BN0A 2HPZA 2NO1A 1HQYE 4CCYA 3KYDB 4QNMA 2OQIA 4H27A 4NESA 4OGFA 3ME5A 2D13A 2C5SA 4UNPA 2X4GA 1G18A 5TEWA 2W2OA 2W2MA 5L3ZA 1INLA 1VSVA 1NPYA 2HH9A 4DCJA 5H9CA 4KBGA 1E2LA 4LHZA 3FH0A 4Z4GA 2VYVD 2WZCA 2C42A 3BWMA 1QJ4A 3F6SA 1H9CA 2AX3A 1IM2A 2ORWA 2R47A 3COWA 3N75A 1JVMA 4R1OA 4RS4A 3ZQ4A 2H48A 2C8JA 3EF0A 2AK3A 1AIPA 2BGKA 4WN3A 3N28A 4F3TA 2CYAA 5CD1A 1VQ9V 1F1BA 4J0DA 3G88A 5AO9A 1HM5A 3GLHE 3ZDYB 1CUVA 1KJQA 2H2DA 3RYFA 3KHSA 4QDXA 4OHMA 2GEFA 3U39A 2RK6A 1ECLA 1I4LD 2GPAA 3E3LA 1XLVA 4RS3A 5FI5A 4NCIA 2QN8A 3O0TA 3OT1A 4QGPA 4NYKA 1CDDA 2N75A 2ZR2A 4PWYA 5J1TB 5CHEA 4EI8A 1G8FA 5JZVA 3A9SA 3UVEA 2P4HX 1S72V 3GA0A 2EV9A 3RK1A 4MB6A 2O2YA 3PC2A 3B8MA 1SBCA 1K98A 3ND9A 1DJOA 5KCMA 4K86A 1FUEA 1N2JA 1U9CA 3JWJA 3RNLA 3QJ5A 3VPDA 3COYA 3DL2A 3PJDA 3VJLA 3STXA 1LS1A 4CIDA 2X0DA 1UBGA 3DE3X 4E51A 3QF7A 2FY8A 1ZO8A 4RU1A 3GRRA 3M1YA 3G67A 3P9PA 3EVTA 2ZSAA 3ZMTA 1UPCA 4BFLA 3RRJA 2GZHA 2NU6B 4G1CA 3TUIC 4UBNA 4NU8X 5FUMA 1PFUA 4MCJA 2BGTA 4R31A 5D3QA 2XUIA 1NAHA 3VNAA 1YDMA 3EYAA 4DBLE 3F3YA 3JRNA 3D4OA 1QCZA 1RXEA 3L1KA 4MI1A 1I5OA 2R62A 2QVCA 3VU1A 1LR1A 2LFSA 1GYRA 2PBRA 4AJ9A 5JJ5A 4Q0MA 5TGZA 2QLFA 5H3LA 2GZSA 1DXYA 4A15A 2IW5A 4JL8A 4ZVNA 1R0LA 2NUTB 2BY4A 2PZKA 2QL7A 2X0NA 3KIPA 4NYJQ 3PVCA 2AJTA 1U1FA 1PS0A 4AW9A 2PX3A 1JDNA 3T3HA 4X9QA 2H4XA 1KBZA 3ZLTA 5DNEA 5FULA 1WMBA 5B5SA 3TYXA 1YRQA 4JIMA 1VRWA 2PJRA 2JF0A 2IP1A 1F4PA 2NQ2C 2JDIG 2WWGA 4FIDA 4F45A 3ADOA 3RUHA 4B7EA 1XTZA 1HQCA 5CJJA 3ZMSA 1NBAA 1V5FA 4FJ2A 3GL9A 4JSTA 2H3HA 1UL1X 2P65A 2SKEA 4OK5A 4RWEA 2IW1A 1I30A 1XELA 1KOFA 4JKYA 3RHFA 1AXGA 2VJLA 3ZD6A 5FLYA 4C0QC 2BMVA 4OIFA 2EULA 5IDWA 1FPOA 2OK8A 3BAFA 3PRYA 2CJWA 4ZAVA 1UOOA 5BVHA 5BR4A 4RM2A 5B4VA 5EIXA 4S0ZA 4IIEA 2M6RA 1RPZA 1I94B 2C9YA 2AYYA 2J8ZA 4B4VA 5I9IA 3KSZO 1G2IA 2ZRNA 3O8RA 4LH7A 1G5QA 1I08A 3KCNA 1S5LZ 2PGDA 4Z8XA 4MAAA 3UCXA 5TT1A 4GX5A 3IEKA 2Q7EA 3PKJA 4R41A 1BJRE 2QA5A 1QVVA 4C06A 3VQWA 1R8QA 4X45A 4DLWA 1HNZB 2D2FA 1H42A 2C9BA 3OCVA 1E1QG 5KYKA 1HFJA 4HWPA 1L5KA 4XDKA 1NNLA 1W5AA 1E3TA 5IM5A 2OM2A 3SY8A 1LFAA 4NZNA 3IPLA 3ZWWA 3ICOA 3JQ8B 4H2DA 3SF8B 1TT5A 4JI3B 3DJYA 1GPWB 1WXIA 4RXUA 3ELWA 3SD7A 1GTG1 3C4QA 3IGFA 3JR7A 4ZV9A 4EW1A 1YZGA 3B3FA 4PONA 1L1RA 4XXHA 3DONA 3T7RA 2X4DA 1KYVA 2D0IA 3LUCA 1G7CA 1W1UA 2UKDA 1GZSA 2OHHA 4CCAA 3LUFA 4P4LA 2F66C 3E8BA 3DOIA 1KKCA 2NXJA 2ZWOA 3KPUA 2GO1A 3EQ2A 1U2QA 3TW6A 4BUZA 3OOHA 4P4NA 2Z6AA 1CU1A 2Q6VA 4Y2SA 4FFSA 1MZEA 4GMGA 4IJQA 2AB0A 4LE1A 1B2RA 4HBZA 2QM8A 1F23A 1Q92A 2O52A 2OHIA 3Q1KA 4FQ7A 2K2WA 2XUDA 3QKRA 5BT9A 3M3HA 3IQXA 2FUG1 5AW1A 1E9FA 4TWBA 4XDGA 1QUEA 1TX4B 1ZL2A 3QUQA 1DAKA 1SVMA 3STTA 3GEBA 1WZIA 3IP9A 3KZOA 2VDRB 3PHBE 4G4SP 1XPUA 1G2QA 4E4TA 4RUKA 3GJ8A 4PC2A 2PFGA 3MHHC 1K68A 4BFZA 4Q7JB 2RHRA 2WQ6A 4NMWA 1H6AA 1NULA 3ZHQA 1CQJA 2O7RA 4GMHA 2Z2ZA 4Q93A 2V6FA 3LHKA 2XE8A 5J2TA 4E3WA 5L3CA 5DTRA 5BXYA 3S8YA 3ROFA 1Z26A 3A6EA 4WDQA 1BRMA 1G21B 5EMLA 4GM0A 1AB5A 1PCXA 1D2DA 3BCSA 3E27A 1TQ4A 2G3YA 3ABQB 4TL7A 3E23A 4J0CA 4CI9A 1KVRA 2WUVA 1DBIA 1ADGA 1R5BA 3BMCA 3ABLB 4IRMA 5T64A 3WO0A 5K2OA 1KZGB 4LYGA 1JEYA 3PE3A 3ZZTA 1K5PA 3K0HA 5ELXA 4Q48A 2ATIA 4KUGA 2R8ZA 3TZ6A 1E9RA 3WIUA 2WTNA 1ZH4A 1QVFU 2VRCD 1PNOA 1P49A 4NV3A 1VE5A 1A95A 2E1RA 3VDMA 3EIQA 2XE6A 2PSJA 3EW9A 4TLLB 1X7XB 4WK4B 4QUAA 3T5CA 2XOKA 4AJ2A 4BO2A 5IULC 1I7DA 4G56A 1M0TA 4EELA 4YONB 2QN1A 1BDBA 3KZIZ 3CF4A 3MZ0A 4JJFA 4UU0A 5BY2A 1P2GA 4QUIA 4Y2TA 4KNVA 1PNVA 1PL4A 3Q4HB 4XQCA 3NCTA 3WYGA 1F51A 1NYRA 3V4VB 2CMFA 2I22A 4DSAA 1ZR2A 3M2PA 4NP6A 1S3FA 2MR5A 4B6EA 2AZ2A 3ESXA 3ADBA 4TSFD 3GLIE 2RCNA 3T1HB 4I5SA 1P0MA 1KDVA 1RD4A 3A2MA 1G8MA 3KPWA 2XXAA 3B2NA 1XALA 3HKDB 1K5SA 2RC5A 2TMKA 2DUNA 2FF5A 4P3NA 4HZGA 3IUBA 3BQMB 1LUWA 1Z37A 1AO3A 1P2SA 3WRXC 2XV1A 2FSIA 3S99A 1VM6A 2ZYDA 5B2FA 1MNQA 1XFAA 2X0RA 3U17A 3WP0A 4R0MA 3K5MA 2NZJA 4JI4O 2QM3A 3UWPA 2G28A 4CG1A 4UTZA 1G4YB 4UHBA 4UUAA 3P20A 1VKZA 1A4RA 4ID3A 4RGQA 3WTCA 1SCKA 2B98A 3PE6A 4FFLA 1Y63A 3G02A 1YH3A 3B9QA 1GG9A 1W0KA 1P3JA 4PG6A 1GCIA 3DYIA 3MJ4A 4NBNA 3VO9A 1IOLA 2IEBA 3PT9A 1SFRA 4LY9A 2D3WA 1UANA 1WIWA 4WFIA 4DWOA 2C2GA 3S2IA 1TO1E 3EGXB 4RTNA 5KHJA 1KQOA 2VJQA 3DLHA 1XMQB 3IA7A 2P6NA 3NRJA 3LUGA 4JP1A 2YNMD 2WI8A 4DV2O 3ILSA 5L7WA 4TYMA 5DGHA 1JDTA 3FG9A 4HF7A 4EJ0A 3E35A 1QQ6A 3FB6C 3K0SA 5F4BA 5DNWA 1VDMA 3LY5A 2QWPB 5EERA 1D2NA 1FNSA 1XU9A 1Q12A 1ZCZA 3BFKA 1YBVA 3KDSE 5DM2A 3ILHA 1JIIA 4X6LA 4KGVA 4ENRA 1P4RA 1CY1A 1FYXA 2NZXA 4LISA 4LCUC 2G0AA 5GOZA 4PJ0Z 1XIVA 4FIZA 4U2GA 5J2UF 1TUEB 2DBQA 3ZS9A 4J16A 5KHHA 3D54D 4FFRA 4G8DA 3ZD8A 5BR8B 2ZB8A 1YCFA 1Z68A 1Q83A 2H5EA 2PMBA 5ECDA 2IWHA 3PP8A 3S68A 3O8LA 2PUBA 4DQDA 3EZNA 1C50A 1EFVA 1QVAA 3AERB 3DXRB 1KEVA 4ZANA 5AFSA 6YASA 3JSLA 1R7RA 1L5MA 1U3TA 1GU0A 3QW2A 1HE1C 1L8OA 4OXSA 4PSAA 2O4UX 1DS6A 4HAYA 5K51A 3SPGA 2I99A 4W63A 3USES 4BMSA 2AD1A 5BMVA 2HHAA 3IFSA 3OIDA 4IBOA 4KHZA 3UWKA 4F4CA 1M56C 2UZAA 3T7EA 3V8QA 4KQIA 4CM9D 3PLRA 1LXCA 1GN4A 1G9SA 2GJKA 3JWGA 1GFWA 1TMYA 4N8DA 4LPKA 1ODSA 2Y1EA 1ZLXA 1NQUA 3TKLA 1Z4JA 3WLJA 2OZPA 5IN4A 2ODAA 2ZSUA 1I4EB 2G8LA 1U8UA 3B1FA 4OJQA 1BGVA 3ZDZB 3ZXIA 3ZX5A 2QI9F 5EP1A 3UOAB 3ONWA 5EIAA 2J45A 2CZCA 1TLTA 2M6LA 4B44A 1U99A 5BSUA 1M5RA 2HY7A 2UYYA 3C6BA 2RH4A 2JFQA 1XZJA 1XZLA 2IQIA 2V45A 2C0PA 4WNCA 2DPHA 1NSFA 1ZCFA 4TMXA 1L7NA 2GSMB 3HR7A 4HWGA 1W46A 1SEPA 1GADO 1M6VB 1WCIB 4IXNA 4FC6A 1YGYA 1OR8A 2CCJA 2FMXA 1N2GA 2CEAA 3NEYA 4MLCA 4TLAA 1OW3B 4QOGA 4J76A 1ENZA 3D2AA 4K6KA 3B4SA 2Y4OA 5AKHA 5IYBO 1GXSA 1KYXA 1SXJA 2I9PA 1DTSA 3IHTA 3RBXA 2PR2A 3HNRA 4EPYA 3RRYA 3RIHA 1IPHA 3K1JA 1TQ2A 4EDFA 4HDQB 3PQEA 4CWAA 3LCCA 4NCBA 1D7OA 1U81A 2G1UA 4W7HA 2F55A 1L4HA 1XZPA 3DWGA 3JZDA 1S1MA 2Z2KA 4X5OA 1ESEA 3ZU6A 1DWPA 1HMPA 1Q11A 2VF4X 4H7FA 4V02A 3R9IA 3W77A 4WL0A 3S81A 2EEZA 3CLUC 2G8NA 2EG9A 1SRRA 3Q6MA 4HQ0A 2EJTA 3WHKA 2WJ3A 5J4KA 3K6SA 2EBWA 3RVJA 4D74A 5THXA 3M6MD 2FJ0A 2BGJA 2RHMA 5DTQA 3R41A 2BFEB 1GQFA 1Z18A 3E9MA 3TN7A 4WOJA 4EUHA 2D1SA 3U1TA 5IMBA 5DBFA 2R86A 2AI2A 2YFKA 5JALA 1EXWA 3OOJA 3I1YA 3R3HA 3HBLA 1QQBA 3OZRA 1GQRA 3T5BA 4A10A 4LHEA 3SXUA 3RG2A 4F38A 2QTCA 4QDTA 1XUQA 5KZMB 3WXMA 1YJNV 4CKBB 3MTEA 1VP7A 2P5SA 1LSJA 4Z5XA 3KKZA 3OLCX 5AKEA 4PINA 4WXRA 5SY4A 1SCAA 1HL7A 5K3SA 3ZVMA 4WBSA 2QTFA 1O6FA 3FBWA 2HK7A 1IBKO 1B8PA 1QIDA 3B7GA 5TR9A 1ORDA 2YEVB 4JI8O 1JVSA 1RP1A 1L7QA 3CLSC 3VYRB 1EHYA 3BEHA 4YQFA 5HNKA 4CM7A 1I7LA 1E6EA 1AZWA 4XZ3A 3D8TA 3PYLA 2RGCA 3N7AA 1A4UA 4H6WA 2E75B 2OV1A 3W4JA 2DWDC 4OU5A 3WA6A 4E1AA 3TETA 5L53A 2ZJOA 4JJGA 3AWIA 3E03A 3IUSA 1OCOC 1KUQA 1U8XX 2FYUH 2VCHA 4K05A 2LKDA 4G8CA 3C8ZA 2C2XA 5KI6A 3VYUB 4YAFA 5JNUA 1J20A 2YCLA 5ALOA 1QORA 2JASA 4Q4HA 4BNDA 4URVR 5K3DA 2XB9A 1GY8A 4ZCTA 3K0DA 4FFKA 3A28A 1HNXO