3WB1A

Hcgb from methanocaldococcus jannaschii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0488
total genus 57
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb1A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb1A02
1MMFB 5D5QA 1IWBB 1EEXB 2F95B 3WB0A 1UC5B 1T5EA 4L8JA 2V4DA 1IWPB 2F1MA 2F93B 3BRCA 1H2SB 1NBWB 2D0PB 3WB1A 5JJNB 5JJJB 1RSOA 1VF7A 5JJEB 1EGVB 4DK1A 4DK0A 3AUJB 1UC4B 1DIOB 5D5PA 1EGMB 3WB2A 2D0OB 4GYCB 3LNNA
chains in the Genus database with same CATH superfamily
1MO2A 1JWAB 1CG6A 1P5ZB 2FGKA 4BQSA 2DOSA 3JTMA 2JF0A 4K81B 4XEUA 1FXUA 1L4BA 4P7FA 1RAEA 3CF4A 5D51S 2DMXA 3SVLA 5KTKA 3PFNA 2WP8J 1EFAA 3BHPA 3OJFA 1HKUA 1Y76A 1Z36A 2Z58A 4LBVA 1LQTA 3GJSA 4RM3A 2LKCA 2Z8YA 3NDRA 1REQB 1H4VB 4A2QA 1BX3A 2DC1A 5LXTA 4X0EA 1Y66A 1E96A 3WBBA 1X7YB 2OOSA 3GB7C 3MRTA 1IOZA 1DRUA 1Z6XA 1ZD9A 2YXEA 5F5XA 3OVMA 4ZHQA 4V38A 2P2NA 1GN3A 2WYHA 4RPLA 1QHEA 4HK4A 1PT8A 5DM4A 1VPEA 3DXFA 2PE5A 3EBPA 1ORHA 2EW8A 4M1SA 4FP9A 4P84A 2HMUA 4Q3DA 4R8RA 4UTOA 1L5KA 4H59A 4Q15A 5DLEA 2HC9A 2GPAA 3E9RA 4EX6A 2RK4A 4L50A 4A5SA 2OCGA 2NZYA 1FSPA 3EFOA 3L8GA 4RK0A 4QDTA 1NH2B 4YVFA 2ORIA 3L1IA 1RC8A 3UYKA 1BHBA 1NS1A 1NMSA 1O57A 4D98A 5B7GA 5C46F 3UUEA 3JZIA 4KR9A 3CJQA 1JEDA 3UVEA 1KJYA 4R40A 4B43A 1N34B 5IF3A 4W8HA 3U7GA 1NF8A 1G38A 3OOYA 1Q12A 3RVZA 3ZIAG 1N32B 2EBUA 2VBGA 4IQGA 1G9SA 2QD4A 3FG9A 1D09A 2YNMA 5DWQA 3VA7A 4V0NA 4MZXA 3K58A 1VI2A 3QE9Y 3I58A 9ATCA 4PHGA 1KRXA 1HDGO 3NOQA 4MW4A 3RPEA 5JNWA 3P5BA 4JEHA 1DRWA 4N7RA 2EX3A 2SKDA 4CKWA 3GLHA 1BCSB 2W4MA 1MB2A 3A4YA 3CISA 3IHTA 3K1TA 1G8YA 4Y6LA 4UEKA 1QFSA 3TL6A 5F7JA 3K70B 5KSWB 1LWOA 4PX2A 3ABMC 3AESB 4D6YA 5TISZ 3IBCA 4YRCA 1QS0B 1ZYUA 1EFCA 4MW2A 1W0JD 5ELMA 3GAFA 4CKBB 1G18A 1F7YA 1ZD8A 2JEZA 3BRWA 5SY6A 3A2NA 3SYPA 4KXRA 3HO6A 4B4OA 1GNVA 3MGGA 5CLIA 5IWAB 2LIVA 5KTTA 3NGMA 4J75A 1C0PA 3R9WA 2IX9A 3GAMA 4JX9A 1KETA 2AJ8A 3L8HA 4DGSA 1S02A 5IH7A 3E9DA 4NHEA 4ALLA 2DY0A 4Z1MA 6ABPA 1VCOA 2FV8A 3KU4A 1AK2A 4YMWA 1X9GA 1ZBQA 4EG4A 4ZV4A 4MV3A 2VDJA 4FHEA 3A4TA 4KV9A 5HJ5A 1O95A 4G8CA 4CMBA 1SU6A 3GLQA 1HFJA 2J9XB 4MW3A 1YE5A 2EC5A 1CR1A 3LE8A 3DVAA 4JBNA 4UHKA 1TD9A 2W6MA 4W1PA 4D74A 2WYVA 4UTVA 3AHEA 3VHLB 3WV5A 2AF4C 3RVMA 4WAUA 4ZWNA 4I5GA 1PHRA 1WY5A 1YQQA 3A1EA 1CUDA 4G23A 2WLSA 4D96A 2XMCA 1P9WA 1RPTA 2CDCA 2JIPA 2WZBA 2WFZA 4PELA 1M7BA 2VZ9A 4GQBA 2EX0A 4WN3A 2NADA 2OGWA 3RK1A 4REMA 5C5EA 3EEOA 1L7MA 4DBLE 4ZYTA 2XADA 1I2CA 2HU2A 2HQBA 1I6KA 1XKXA 3DNMA 4B6FA 1KI3A 4BZXA 1QQCA 3JQ6A 3BMOB 4YB8A 2AG8A 2OHOA 3CNLA 3FUXA 3EFOB 1KYIA 4LK3A 4KBGA 4U0KA 4BNVA 2F67A 2Q7OE 3WGVA 3ZJ5A 4ZGGA 3A6KA 3OFVA 1E9EA 2YN0A 2NUTB 2NSHA 1FSZA 3GMTA 4D4GA 1YI2V 3U5TA 1WA5A 3JQ7A 4UBOA 3HL0A 3R5HA 4YYZA 4PLYA 4QVKA 3C43A 1VLLA 1J0DA 5LNK6 4ESOA 2VBFA 3ND9A 4KR3A 3QPCA 1RT9A 4K9SA 4BEVA 4F9EA 4FIPC 2SKCA 3QUBA 1U8XX 1WOYA 1ZOSA 1X92A 2Y9PB 4KYTA 5KDLA 4LQ4A 1A2BA 3CR3C 4LMBA 1OA1A 4UXIA 1NBMD 3T4UA 4CMHA 4F6LA 1KY3A 3MC1A 5JCPA 3EUWA 5D00A 4B81A 2YEVA 5L7TA 1EWVA 1QGUB 2PMEA 3SF8B 2AZDA 2VDPB 1O8CA 2AC4A 3JQPA 1NQAO 5L45A 1QH8A 3E86A 3MMPA 2DEUA 4JHLA 1SOVA 2E87A 1FTQA 3H6GA 3D59A 1W36D 4P7KA 1THTA 5K5EA 4PGHA 4M8NE 3ZNQA 1XL1A 3C3MA 2O8BB 2CXQA 3NTLA 3A27A 5A03A 1HPLA 5BSMA 2W6ID 3VPXA 3H0CA 2BKUA 3FROA 3E7WA 4UV8A 3ES9A 1CLEA 4DDVA 1GCGA 1W88B 1L1QA 3GFSA 3SHFA 3E03A 3F8SA 2QZZA 1RXWA 1E2KA 3QTLA 4PAQA 2QV7A 3NKVA 1VJ1A 4DV0B 2V6JA 5K0ZA 5F2VO 3K79A 1R9NA 1R4ZA 5FAXA 3FW1A 1DLBA 1T3HA 4RA6A 4YLYA 3EWNA 1T2CA 3LVRE 1M2FA 2ARKA 2JLYA 3U4HA 4XOIA 3DKIA 4JI3B 1ZN7A 4PJ0Z 3W1VA 3WB2A 3NB0A 1QQTA 3QLUC 2X86A 4DTIA 3MGBA 4ZDIA 2WJIA 1D0VA 1OCRB 4ALIA 2BBWA 1ZH0A 3L7AA 4NXNO 4K0KB 4K6FA 3IA2A 3H1AA 4FUTA 3PT5A 1KHHA 3VU1A 1NN3A 1QQ6A 3WL7A 1CUEA 3ZLUA 2GR9A 2XR1A 3IP9A 2ZJOA 1UBFA 1FVHA 4ZREA 4NB5A 2DPXA 4WY5A 1XQVA 5FHRA 3NATA 5IXJA 3JQFC 2Z3ZA 1P49A 4ACBA 1NONA 1ZNWA 5EKSA 1J21A 2BKLA 2KYRA 2X8BA 4DNOA 4IJKA 2W43A 4FLMA 5A0VA 1BFKA 1F6WA 1TC1A 2ZJ3A 4K7JA 5KHAA 5DP2A 2CMKA 3IDZA 2A30A 4KQIA 4OAQA 3ZCPA 1ZHHA 4KJXA 4XB6B 3R3XA 3QF4A 3C39A 1QG4A 1S5PA 4Y2HA 3DEIA 4UHHA 3OT1B 2HIHA 4AKSA 3GQBA 5DIFA 1AB5A 1Z12A 2KE5A 1B06A 2PV7A 2HLPA 4MW8A 2I7VA 3BDAA 3DFUA 4IQ8A 4IAOA 3RUAA 1QAOA 4YXWA 4DCVA 3BF7A 6LDHA 5JZSA 3CRCA 5JXGA 4AO8A 2CMDA 4H08A 1XT6A 2LGWA 4FYXA 2J9GA 4INJA 1FVFA 1W0KD 2F23A 3KZ1E 5CYFA 1JFFB 3AJRA 3C7AA 2AV6A 4LC9A 4EMBA 1N78A 1J23A 1M1NB 3Q5GA 5AM2A 3LSUA 2A0UA 3G59A 4RVGA 2Q3HA 5JCXA 2GBPA 2O2DA 7YASA 4OQDA 1QBGA 2QTAA 3Q87B 3UWPA 4RTKA 3W7SA 2BR3A 4TKUA 2O2GA 4D4LA 2SHKA 1PNKA 3KS9A 3REQA 3BDIA 3GG9A 2C4KA 4JTCB 4DR3B 1GSOA 3OSUA 5SZKB 5JXHA 2GM4A 2C9ZA 1VARA 3F9IA 1E59A 1OFUA 3ZDEA 5HX7A 2YYZA 2B6NA 5C0OE 2YSUB 3ILVA 3QHQA 3WU2Z 2P62A 3ZX5A 2JGNA 1UEIA 2LDBA 3NRCA 1QF7A 5JAHA 2O8DB 4DQ0A 1Q1BA 4A03A 4A23A 5KOJA 1CJKC 2BW0A 3B9BA 2PRIA 4E4EA 2FZEA 4MUGA 5K1XA 1ZNXA 5JRDS 2VK2A 2R6AA 3FM9A 2OGUA 4E7PA 3M6VA 4FEGA 2R44A 1H23A 2RC5A 2VNIA 2TMYA 2W0SA 2PRYA 3EVAA 3ZWKA 1GTJ1 4TZTA 4ZYYA 1TX4B 3MERA 5IT9N 1JQ5A 1H6AA 2ZB4A 4BJ6A 5JXIA 4F4CA 2J45A 2Y2UA 3T7JA 4D7TA 3SXUA 5AKIA 1E61A 4JYCA 2IL1A 4EW6A 4GS5A 3N9IA 2I34A 4P53A 5DHTA 5DHFA 3HN2A 4JBIA 4WUVA 1QE3A 3KVRA 3LS2A 4ASUD 3QUQA 5K03A 1HZZA 4KQXA 2CDBA 2PRSA 1NATA 3G9QA 3PFWO 2C4HA 3VJLA 2HBZA 2RGEA 4N6NA 2BFMA 2G25A 3OZUA 2Z5LA 4AYWA 4I6JA 5GGXA 4AZ0B 3GG2A 3OCZA 1JA1A 4JDPA 5JCOC 4C1NA 4NJEB 1FNCA 3IMEA 3EG9A 2MT9A 1HFWA 2BMAA 4WVLA 3QTTA 3O4IA 4RPHA 3PUYA 1QOPB 1U0FA 3CRQA 1MG5A 1WPGA 2JBWA 2QNIA 4B48A 1RMQA 1GIAA 1W76A 3HP4A 2GXQA 2Z3WA 4BNNA 5CEJA 1FU8A 1Z5OA 3MCVA 3D43A 4JQZA 4MA0A 4LBZA 2YJ3A 5IBPA 4GNKA 4I1IA 1G8KA 4S1PA 4LKRA 2DTXA 4GKAA 2W42A 1YL6A 3Q4HA 3KT3A 1V7QA 5AXBA 4KPFC 3D8NA 2H3OA 4RFVA 3K9WA 3B7PA 3OCCA 3L04A 5JCJD 4IGFA 2N75A 1RKQA 2PVSA 4R1OA 1FCJA 1Q7CA 4JI7B 2QXYA 3OPYB 4PVCA 4B4KA 1UPTA 3K15A 5GJWC 4MV8A 4BFWA 4IS2A 1Z45A 3I04M 2C0QA 2JGFA 2H51A 3FNIA 2E49A 2FX2A 3B5EA 3MAAC 4HFMA 2IS4A 5LOVF 2NMVA 2QD1A 5A05A 1MZPA 3OM3B 1UOPA 2UKDA 3C41J 1NLYA 1FX0B 3WFVA 4U5XA 4EARA 2EEZA 2O52A 1WTAA 3V9PA 1K9MW 1Q3KA 3FYTA 3IQDB 3S1LA 3EOBI 1SHTX 1DELA 5KNCA 3ZHVA 2A9RA 4FHCA 2C9CA 2PZBA 4MW0A 1FYWA 4U3JA 2I2XB 4JJ6A 4QGSA 4PO3X 1RLIA 2WE8A 3FYUA 5JTTA 3GA7A 3EPHA 2XJ4A 4FR5A 4EQ6A 4J80A 1U65A 3OEHA 2VDLB 3BSSA 3HYSA 1B42A 4DIOA 1VDZA 3E5HA 2HU5A 1I1NA 3U0VA 4D9EA 2PTMA 2D0PB 4DMUB 2JLCA 4M8LA 1SZDA 2VJPA 3PKZA 1HNNA 1U3TA 3RYFA 3EMBA 2OD9A 4FDVA 4LY9A 4RJJA 1H6BA 1Q0RA 4DE5A 1IJBA 2WWTA 3W5UA 2AX3A 1VZ2A 5ERXA 4Q7KA 2BJVA 5ER9A 3FFXA 4JOBA 4RD2A 2XUZA 3AUYA 3QVVA 3VMFA 3G80A 1XRMA 4R4JA 4BGUA 5EBWC 1OLSB 1KDOA 2PWPA 5E1OA 4D97A 5DTRA 4DSTA 4YCNA 3AVYA 1YJWV 1R0YA 1TO6A 1TUEA 1VQOV 1FNDA 1N0IA 2YCLA 3SC2B 1TA9A 2ZQMA 3Q0TA 4FNOA 4HADA 3IV9A 2O2EA 3IUQA 4LYDA 4P3OA 4TT3A 5C9ZA 2JFZA 4MUAA 2YZNA 3PJDA 2BEVB 3O73A 1ZINA 5ICEA 4ZOCA 3IEMA 1DIBA 4EFLA 4XX0A 3URMA 4LCJA 3H16A 1GUZA 1AB3A 3BA6A 1PNQA 1QO7A 3KJEA 2EKPA 3NRBA 5LPNA 1IM2A 4WXRA 5I45A 1GA1A 3IBYA 4H4EA 4W1QA 4B6EA 3KBBA 5L3DA 1EWYA 4D8UA 4I4NA 3SZGA 3P9QA 4YRBA 1ODCA 2DOKA 2ALJA 2Q8NA 2QEQA 3IA7A 1LF0A 3CCEV 1HDRA 3IYLW 3SXJA 3R7DA 3JD3A 1RCFA 3NG1A 2P9GA 3K0KA 3M81A 4X8AA 2QRVB 3AVXA 2ZDIA 2FA9A 3CZ9A 1XFDA 3HBAA 4JH0A 4YCMA 2Z6QA 1V1RB 2RG7A 1FSFA 5CD9A 4OTZA 2LWIA 1DIHA 2R65A 4D4HA 1IJFA 3BVPA 1YU9A 3GDOA 3ICXA 2B1RA 3I34X 4E7OA 1LH0A 2D3OW 4LRUA 4O1MA 4X45A 1CCWA 3DCYA 3FIJA 2GN4A 3G1WA 2Q5CA 4TN5A 3ECAA 3U62A 5I7RA 2V55B 4V0RA 1QVVA 3DBRA 2G70A 2QF7A 2IT1A 2KPOA 3UCXA 2WF9A 5JJJB 3DT9A 1GZ7A 4CIBA 5H4GA 1Z16A 2X6CA 1L9XA 2P6OA 2Q0HA 3B51X 3PHHA 4R2MA 5MGBA 4M1WA 2BC9A 1LDBA 3C5CA 3SR0A 5GQSA 1NXVA 4FHFA 1UDWA 2JAWA 3BD6A 2PCJA 3FDZB 5KX5F 2Y1EA 4HH1A 4HS9A 4W7HA 5LWHA 1PF7E 4R69A 3I05A 3IUSA 2I22A 1CUFA 2VK1A 3IEUA 2HVKC 4TSFA 5EIOA 1HLPA 1XQXA 4JTDB 4H6XA 4MQBA 2SKEA 1WZIA 4MV1A 2Y1FA 3E9NA 1CNMA 1T9AA 4H1WA 3L4BA 4QATA 2N42A 2B69A 2CLSA 4M55A 1NIPA 1ADYA 4Q7LA 1I2AA 1TZBA 3REOA 3V4OA 3OUSA 1JQJC 3Q2IA 1QGAA 5E9WA 1OH5A 2W8ZA 2IOYA 4WCVA 4E3WA 5BSEA 3X0DA 5C34B 2BFEB 1QB7A 2GJSA 3PPVA 4I4IA 4RDIA 5C7LO 2RCNA 1Z7YA 3R4VA 2WV7A 2OYSA 2X14A 3UXEA 3WWPA 3BJZA 1SCUB 1Q20A 4KN6A 1F6DA 3VO2A 4OSOA 3PP8A 5DW0A 3MMXA 3WI7A 3T1YO 1SXJA 1WMBA 2GCOA 2P4HX 4F96A 4LNUB 3F49S 1HRDA 4FDMA 2X7XA 1S01A 2UAGA 3TD6A 5L3QB 1GNTA 4RTNA 4NFHA 4Q1VA 1W19A 1KEKA 1KNXA 3CLUC 4IEIA 2ZDGA 4W9NA 4MSWC 2P9YA 2W2VA 3G0BA 2JCSA 1UDAA 3ANMA 5T6BA 3AOGA 4GW3A 2FXVA 4NXNB 4K0KO 1QDEA 2W58A 3T4PA 1N9ZA 2QYOA 1SKVA 3DFFA 3DUWA 4QU5A 4XTRA 1MZFA 2JB9A 1KWGA 3ABKC 5BRJA 1V9SA 1Y4UA 3GZ4A 2C7PA 3T7IA 1RWBA 3G23A 3GBVA 2C1EA 4UAUA 5LLSA 3WWOA 2Y3IA 4ZAGA 3MW8A 1YGYA 3ZJZA 3H13A 3OIFA 4MVCA 1I0IA 3TYXA 2DTEA 1KKDA 3BXOA 4J0QA 4LW8A 1B4DA 3BILA 4X5OA 4ZVMA 3TLBA 3CRRA 3CZMA 1IXRC 4OHBA 1JQ0A 1HDEA 1LF5A 3SYLA 4AK9A 2CKDA 3IVGA 3G5LA 5EIAA 1H05A 3SZLA 2WPDA 3E7DA 1W75A 3SSAA 3OQ1A 3BB3A 1XCMA 2OO5A 2PD3A 4ARBA 1QLEB 3AETB 3EBOA 3EBLA 4WXPA 4YRRA 3ZBTA 2QTRA 4KUGA 2FDRA 2BSAA 2IHKA 2VQSA 1NT2B 3RC1A 3ZGZA 2WVHA 1C7JA 5B6IA 4EVQA 4MS4A 3W7WA 4OCZA 3WQSB 1NRIA 3BGOS 4V03A 3URKA 1LZLA 1NP3A 3GVXA 3HR8A 4ZOLA 3X43A 5EK0A 2WU8A 3DLCA 3NIBA 4HWTA 4GM0A 1D2AA 5E6UB 5I5EA 3GDHA 1KK3A 1PDVA 1YJQA 4LOHA 4D9GA 2YXBA 5T64A 2CDAA 3C0KA 3RSFA 3A04A 2ZSKA 2V54A 4FSHA 1DOAA 2WFLB 2H5EA 1AI6A 3D7KA 4N0QA 4QYSA 2YVUA 4O4HA 2NZVG 4RAOA 1Y3AA 3WHPA 5AESA 2FRXA 1S5LZ 2WWWA 1A0OA 1BMFA 2R1TA 3ANNA 3HXLA 3QVWA 5DRYA 5TE9A 1JUDA 3MS7A 4DHEA 1I6WA 3A6EA 4F93B 1T26A 2PUFA 1TKRA 2ZJ6A 2H4YA 3IULA 1G291 4LNHA 3TSZA 4Q16A 4E09A 4FVMA 1V0JA 1G66A 4O2LA 5LZ9A 1X2EA 3D02A 3L7CA 4D8YA 1Z6QA 4NENA 5HVNA 5EESA 5BSRA 1PL0A 1R1DA 4MQEA 1IBLB 1K0UA 4EB6A 1C5KA 2CB9A 3BCUA 2GVZC 5I9MA 1TXGA 3HEMA 3ZE7A 2XAFA 2VZ0A 4WEOA 5D01A 3QITA 5TPWA 1UJ2A 1V45E 1ZD4A 1TAEA 1T0PA 2PGNA 3IUNA 2XNDG 4HPJB 4KO8A 2XW6A 4WLNA 1Z7EA 2OXEA 2R48A 2ZSBA 3ZOKA 3G68A 1TGOA 3K0FB 2IC5A 1XEWY 2DAPA 3LL7A 1TMYA 1L9KA 4MW9A 3ER9A 3MGKA 1JPXA 4GPIB 4ENRA 5DBFA 4QRDA 2P2LA 5GTDA 2FMTA 1LW7A 4DLVA 3U4MA 2VDWA 1N5LA 5FOWA 3OT7A 4M0LA 5BOSB 1XMXA 5CD1A 1JB9A 1W93A 2R7LA 1RQNA 1QIGA 2CTPA 4B3TB 2FN3A 4KAJA 2M1ZA 3JYLA 3PFGA 3U9LA 2BTOA 3D7SA 1MGPA 2C9BA 3RBXA 3I52A 1E1KA 2SNIE 1Z88A 4QGBA 4OHCA 1RWVA 3VKWA 3WKBA 4PAWA 4YN3A 1ZDMA 4R8MA 1ESEA 4E21A 4HQ0A 3SN6A 3MIIA 5FUYA 1CW2B 4GPTA 3EVTA 2WMNB 1Z73A 1P17A 3VKFA 2X9QA 3J80A 1E79A 4E13A 2HF8A 2WMDA 5DTEA 5CT6A 5HG0A 5L3ZA 1K4DC 1RI2A 3AWIA 3SF8A 4ZZ1A 5I7FA 1CR2A 2VA9A 3CKKA 4MI9A 1ZUD1 4BIZA 3LDGA 4WCFB 1Q19A 4N5HX 3RREA 5E6RB 2FWJA 5KJ1A 2YWDA 3NM6B 2B83A 5C7OO 1B3BA 2BEWA 2E2WA 4HL6A 1AKYA 4TL6A 1EJBA 3HR4A 2ONJA 1NZ6A 4ENPA 1Q95A 1HKHA 1JXMA 1WMDA 3A4LA 4DM4A 1M6YA 2OXRA 3KQYA 2OCHA 4YC7A 3ENWA 3GRPA 5CVEA 5CCDA 4WFBV 1ZISA 2OMEA 1FSGA 3W04A 1G41A 2PKQP 1LNSA 1XQYA 2JD0A 5CMLA 3RBVA 4UU0A 4XTCS 2ZBEA 3ISJA 2FPPB 4J6FA 4RANA 1EFUA 4I55A 1IEVA 3Q5DA 3IEVA 4NCHA 4N82A 3RIGA 2VJQA 3Q4GA 3S0JA 3VQTA 5HUHA 1BXKA 2Q69A 1XYVA 4FBMA 4JAUA 4LMRA 3DT8A 1VIMA 3DFMA 3ZY5A 1AJEA 1DHRA 2XVMA 4IDPA 4MTCA 4MVJD 1GFIA 3QY0A 4KV7A 1O95D 4LPSA 2VEOA 4OSEA 3WP1B 1C41A 3WNVA 4CLRB 1XMJA 3H01A 4HH3C 4L75A 1MTZA 4LTMA 1A7AA 3L4SO 4PF1A 4QQRA 2FF7A 3ESQA 3EXEA 2D6FA 4WN9A 1ADFA 1N9GA 5IBRA 2JW5A 3PHCA 2UUCB 1YO6A 1PTKA 3ZRWB 4GO1A 5KZMB 4IXDA 4KGVA 3T0FA 3GFPA 1KMIZ 1L5GB 2HAEA 2IF2A 3ASZA 4ICIA 3ZWYA 4AJNA 1B6TA 3GUZA 3OR6C 5IDWA 4CV1A 1KIFA 4BO9A 2OM6A 2YJNA 3U7HB 3HJAA 5AUQA 3VR4H 1NBOA 2OZVA 2YYAA 4JBWA 3BE8A 3H9EO 1T9BA 4QREA 4RELA 4AZVA 4D82A 2QE6A 3VYRB 4DA4A 2J9FA 4OI4A 1KI1A 1Z2NX 1ZMBA 3QEOA 4XWAA 4A73A 1ZLXA 3ETJA 4IYHA 4GOXA 5CYOA 4HYOA 1HZJA 1N1MA 4FDUA 1JZQA 3MK31 3VU3A 4Z1VA 2B4RO 2J6IA 4Q3CA 5DHAA 1DQZA 3AG2C 1KKUA 1TU4A 2DQYA 2VHVA 2Y1CA 3TZHA 1P2GA 1ZW6A 3NOVA 1E6MA 2QDKA 3ABIA 1W6UA 4B3RB 1XVIA 4X41A 1YHQV 1VLMA 3GJTA 4CLOB 2ZLBA 3NCHA 2DU8A 2R00C 3CXCU 1ULSA 1SBCA 2XVZA 3QBTA 3DR5A 3A8TA 4QQFA 1OGYA 2O20A 1YZFA 2R2AA 1PGPA 3HCFA 1I10A 4EABA 5JH7B 1CU1A 1PG0A 1PNMA 3H11B 4JY7A 2P1DA 3TI7A 3AEKB 2Z95A 5BVGA 3RT7A 1QTNA 2ZTUA 3KV3O 3VTFA 4ZAFA 3HXTA 1QVZA 3WGNA 1P5HA 3GWGA 3NWJA 4GXTA 1X6VA 2IQ5A 2GD2A 4N01A 3OT4A 1RYFA 3M33A 1N2CE 3SFTA 2QQFA 5B4UA 3IBFA 3JSAA 3P96A 1KO4A 1UAAA 4TT3G 1XTUA 1VC2A 3E9MA 4GGMX 4HDKB 3EQZA 2PZEA 5BN1A 3AG4C 1J24A 1T9GR 2WKPA 4MO2A 5ECDA 3UNXA 3PE6A 2HIAA 421PA 3DQZA 3ADPA 4IV5A 4PV7A 5KJFA 4KE6A 3S5JA 2QTVB 5CBFA 2D7JA 3ZY2A 4AMYA 1WMFA 2IOQA 3NTOA 1W0JA 4IXMA 5B3SB 5ITZA 2R3SA 2ZQYA 1DUIA 4FCCA 2XEDA 2ZT6A 4QU9A 4XQ9A 5AKGA 5ERGB 3Q3EA 3TPZA 1NVBA 2ZWOA 2W2MA 3FY4A 1XHFA 1J1ZA 3O1LA 4MLCA 2VNKA 3SYCA 2WJYA 2K2WA 2G9UA 1B76A 1DEKA 1KYQA 2RDMA 3EMVA 4HATA 1QO9A 3LDDA 1WG8A 2IJJA 2JFXA 3IP8A 4F2WA 1P7YA 2AIRA 4F11A 1X4TA 1NTOA 5AHWA 2WYUA 4DLUA 5A9SA 3NUQA 1ZAYA 1EN5A 4KI0A 2D8MA 1WDMA 3H42B 4GYJA 2X8WA 1OXSC 1G2QA 4NZMA 4CN9A 3RJ9A 4EW2A 5KA6A 3CVXA 1DKNA 3QPDA 3BMCA 3CUVA 5EZYA 1JX9A 3L7LA 4R8VA 3COJA 4WY8A 1N5DA 2CDYA 2DBZA 5FV7A 5LXTF 1OB5A 2NP6A 1G21A 1Z4LA 4IX1A 1XA0A 1ISMA 5IZCC 2IYLD 2JJ2D 3PEWA 1HNWB 1I5RA 4HH0A 2REXB 3A1DA 3GC6A 5J63A 4CCSA 1C1HA 2CZQA 4X90A 2NYUA 2FETA 3PGXA 1JE1A 3IGAC 4YP9A 4XYLA 3GP8A 1XJWA 4BN0A 3R74A 3EZXA 5B5SA 1BC5A 2EERA 4MKRA 3C4QA 1L5YA 3QXGA 4PC7A 4IKOA 5IUJC 1PSDA 1LTQA 2AMYA 2VDNB 1H69A 5IXSA 5KVCA 1XEXB 1PGOA 2DF8A 1L5FA 3O4FA 3W3AA 4FFLA 5DW3A 3RV3A 2Q0QA 2F1MA 3EWIA 1JNYA 1W1UA 3CC4V 1ZX3A 5HK8A 5ALDA 2R68A 1KO1A 3D0KA 4ASUA 4YIOA 4JEIA 4NYMQ 2UU9B 2DQSA 3EH1A 5ES4B 2AB0A 1N2GA 5EJ7A 5JBQA 3I5MA 1EAYA 2O8EA 3EC1A 5CPFA 3TCNA 1PTJC 4YT4A 3D4LA 4MAMA 1SC1A 3NHFA 4FMPA 5KU1A 5KYWB 4UAVA 4HMOA 5NULA 3AESA 3V4VB 1P77A 2GK6A 3TEFA 4TQDA 2ECKA 1G8GA 1O4VA 4NCXA 1MEJA 1EK1A 1WF3A 1ZZEA 2VEDA 2C84A 2K4MA 4L7VA 5K0LA 4AG5A 4XDGA 4NH4A 4C9BA 4I9QA 1P74A 4E03A 4F5EA 5HKAA 1VQ4V 1I33A 3A9TA 3E1GA 2XXBA 3OU2A 1OTXA 5ALXA 2FJ0A 3BB4A 3VC3A 4HGYA 4LFAB 3P52A 1SCIA 1RM3A 3DEFA 1AG9A 1KYYA 1Z4NA 2EZTA 1E66A 3S3WA 5LMNO 4IFEA 3K6SA 1KORA 3AEQB 4GBGA 4UBIA 4X97A 2J31A 4XD7A 3UANA 2O23A 4C4RA 4BQEA 1KU6A 4KPGA 1KAOA 3ABUA 4Q6GA 1XCGB 2B5OA 4QUGA 1KI7A 2QM7A 3G8YA 2ZE6A 3CLRC 4BTEA 5A62A 2B7LA 2BE7A 1Y8QB 4X85A 4RQTA 3SNKA 1USUA 1YK1A 4OI2A 5ALUA 5KVQA 3I83A 2XTMA 4ERNA 1JWBB 2A1UA 3SXPA 2AI1A 4G9BA 3LH5A 4DR6O 1ZMOA 1KOGA 1UJCA 1VKOA 4DR4O 2A33A 2PL1A 3LSTA 3FPSA 2ZI9A 3HS3A 3GLGB 4TMWA 2YQZA 3ZHUA 3NKFA 2I5PO 4DUZB 2QTCA 3U09A 3T5CA 4I5SA 4TV8B 1QZUA 2XB6A 4IOKA 1J49A 1Y7PA 3OZ7A 3R3WA 4CBVA 3H9CA 1N5IA 2Q4EA 1SETA 2CV1A 1IXZA 4QJFB 1MV8A 1N6RA 1WU7A 2A7XA 1VG8A 2GBOA 4HNAB 2DWCA 1SC4A 2NZJA 3G9TA 3L0CA 3H1GA 4L8VA 3KYJB 5EXPA 2G40A 4C4TA 1KFCB 4FK5C 3T5BA 5DFAA 1E7SA 3AL3A 1U2DC 3WYDA 4CFSA 2H8KA 1P7BA 2WKQA 2Z57A 4I5DA 4FX2A 1FP4B 1YA8A 3JATA 1WM1A 4BWAA 2JIQA 1NF9A 1PEDA 3EA0A 2XECA 3E7XA 4J7AA 3PQ8A 4QOIA 1YXMA 1P2UA 4RF2A 4X6UA 3R7NA 1LPPA 5EUMA 1WHSB 2FFBA 5IVIA 3R7BA 2BPOA 3EULA 4MUBA 3ZHZA 1A4UA 4CM9D 5SICE 4OLAA 3BFVA 4QO8A 4RACA 5G1OA 3VR3D 5LUAA 3DF7A 3I1JA 1D6JA 4JMLA 4UD2A 5H02A 4E5DA 3FYEB 4PO8A 3JQGA 3ZIDA 1KARA 4NENB 3DFKA 3RS4A 3KJZA 4GP9A 4GBJA 1AMNA 1XZFA 2E82A 1HP8A 4L8GA 3VJKA 1A8SA 4GCZA 1MR3F 3PC4A 3PQ7A 1TD1A 1UDRA 4HDMA 4NF2A 4OHFA 5CEEA 2HTEA 1YRWA 2C5FA 4HDOB 3U10A 5FJIA 3ZBPA 1S7CA 4BBZA 2JIOA 5K8CA 1SQBH 1FQKA 2J4FA 1WY7A 2QENA 3KQNA 2A9PA 3T3PB 4TYQA 1YS1X 3EE6A 2BZ1A 3LAWA 2RHHA 3EGIA 5HE8A 2FPWA 3E61A 1I5YA 4FEAA 1JHYA 3D4OA 2EW2A 4ZTBA 3IRUA 5AVZA 4I1OA 2Q9AA 2ZRFA 3G1TA 4KLZA 1E1CA 1S2MA 2QG6A 3BPZA 3OQIA 3BL6A 2NUAB 1D6SA 2GAOA 3HDTA 1ZQ9A 4ND3A 3TMKA 3QFCA 4K86A 2RB4A 4ER5A 4UCWA 2N46A 2XAHA 1KXZA 3GYBA 4IILA 1QP0A 2O2JA 3Q3VA 2XD9A 3IURA 1LDYA 2Q3LA 3WRXC 1KPHA 4BGDA 3KNZA 4FR0A 4KR2A 3W5AA 5HZGA 5G2OA 3O9OA 3Q6MA 3AB7A 4B71A 1ECLA 4DM3A 5KNBD 1YF3A 1BT8A 3LX4A 3OZIA 4XIIA 1CJBA 3PFBA 1T5BA 3A6LA 3PNQA 1VQKV 2YXLA 1EI9A 4IIBA 4BQIA 5J4KA 2D2EA 4L6IA 4BS9A 1PM9A 4LH6A 3I9JA 5EAIA 3RF6A 4WNAA 3SWWA 1RYDA 1K08A 2VP3A 3LWZA 2Q73A 3ICVA 1XRRA 1YC5A 3T95A 4IL6Z 3RN4A 2Y1XA 5CPBA 1QUEA 4P7JA 4QUDA 5K4AA 2WU0A 3F0TA 4YUVA 1O4WA 1Q0ZA 2G4VA 5D87A 2QT0A 2VP4A 4O2BB 5F23A 4HBZA 2GKSA 1DHTA 2XVAA 1IM8A 3F3KA 4LJYA 2OZLB 4RNCA 1L4GA 2QWOB 2FZGA 4UPDA 3RTBA 4AVYA 3E48A 1MMMA 4N8SA 1DFGA 4P98A 4TL7A 2EIMC 1NP6A 2WG0A 3ZR4B 5DXAA 2RGYA 3JCZA 3HWRA 1EVLA 1RADA 4CKZA 2AZTA 5HPYB 2XAJA 1GTMA 1RAGA 1UQUA 1YBVA 3M6FA 3O90A 3KDAA 5EPUA 1RM4A 4ARVA 2C92A 3F46A 3PKJA 3Q5EA 4NQRA 1P4SA 5FWXA 1LTHR 3QY9A 2F3PA 3GLFB 2O5VA 2OB1A 3UB2A 3VHXA 1TQ8A 1I36A 1DWQA 2BGRA 4FXOA 2ETXA 4GWGA 4XVCA 4KQKA 1P0MA 1QIHA 2AN5A 1RE1A 3COVA 3N0TA 2Q99A 1HFEL 1ODKA 4OKIA 4JNKA 2FE1A 2JK1A 3QUSA 2H29A 4MWSA 3P4UA 1U7OA 2DYRB 3GVMA 4CLRA 4RTRA 1X3LA 4AX8A 1Q3TA 1XCOA 2GZHA 4HNHA 1E3MA 4I3GA 3RC7A 5E7IA 1WUTA 2CH7B 4OQNA 4XIFA 1C0EA 1KAMA 1PL8A 3TKYA 4BQOA 4DB2A 4AYXA 5BR8B 1MXFA 1ISHA 1W47A 2G83A 2GX6A 3TXQA 3RVYA 4PG6A 1VQ8V 1P0QA 1NUSA 1E4EB 2QR5A 4E94A 2GCIA 4MVJE 4H13B 3LCMA 1BDBA 1IN1A 5J2UB 1DC7A 2ZNJA 3WDSA 1AQLA 3UAWA 2DRIA 3IXLA 4CG2A 1XD9A 2H7XA 1WVGA 1UT6A 2H1VA 3Q3CA 1GO2A 1B14A 2KW5A 1DG3A 4B7KA 4R2KA 3TR5A 5LQDA 1HOXA 1YAHA 1ZGHA 5DHUA 5IDVA 1HYGA 1MXHA 1X15A 4CEIA 4L3WA 1QLNA 2X2PA 4UVIA 3E3OA 3ROQA 5KAIZ 5CITA 4G89A 3OEEG 3Q9NA 4WK6A 3SKYA 3WQRA 2ASVA 2Q8QA 4FPXA 2XZDA 4AF6A 5FWXB 3MBIA 3FCXA 4LAFA 4BQRA 5JC8A 4C0AC 5JNRA 1E89A 2H1OA 1LV7A 4HTFA 1GA6A 3U4DA 3L7JA 3QX8A 1YZTA 4A0RA 2EZPA 2MK3A 2D8AA 2YWXA 4AG6A 1MJ5A 2RHBA 3X2QB 4JXJA 4ZT4A 4UQOA 3V2HA 5BQFA 2EIXA 4LC0A 5JG7A 4EB6B 2MSKA 3QO8A 4QPJA 1ZJ4A 4L6CA 3N58A 5E1BA 4JI5O 4DYDA 1EWTA 2PFKA 4HEHA 3CSXA 3TTUA 3RAGA 4CQJA 2QN2A 2IU6A 2V9CA 3SJQC 2D1QA 2IXDA 3TSOA 4OP1A 3BIWA 5J47A 5DT2A 2Q1SA 1ZGJA 3GX1A 3GMIA 2MSLA 4IIYA 1HNXB 4RWZA 2A5LA 3L75H 4WK0B 3QKSB 4X20A 4AHCA 1LDMA 2P69A 2XCUA 5J5AA 3RRZA 2BEKA 4ZJZA 2HKOA 1CY2A 2VYND 1D8AA 4AURA 3A9VA 3LWDA 2XUOA 5F1OA 3D0OA 2EBOA 1GPDG 1RU3A 2FKAA 1TIPA 1PZMA 1DBQA 3P9YA 1RR6A 2B99A 3R6WA 5HIIA 1YITV 1WXEA 5IJAA 5EJ6A 4P4SA 3HXQA 5B3SC 4CTNA 3CQ9A 4DUGD 1G1MA 3COYA 1Z17A 4CF5A 4CYMA 1V96A 3UMSA 3CMAV 3EXG1 1V6SA 2BVNA 3MYRA 2GRUA 4J0IA 1NWHA 1J2RA 4GPD1 5EHXA 4LR3A 4I9FA 4BJ5A 1R4AA 3QFTA 4CS4A 2YDXA 1ZA2A 1B6GA 2GETA 3FMIA 4KLRA 4L15A 1QLEC 4Y1RA 3SIPA 3VUFA 1XOUA 4BNJA 1AF4A 4BMCA 2JHGA 1VIDA 5TS2A 1XTVA 2WLNA 1HT3A 5DBGA 1QP4A 1TVKB 4ND1A 1X86B 5HKLA 1IHPA 1EESA 1GSIA 2UXCB 1CD5A 4LXYA 1NU6A 4LF6O 4IV0A 1TYDE 1Y1TA 2OORC 3B38A 4DV7O 2GD1O 1EU1A 3NGXA 1HG0A 3ADBA 4ABTA 3V7FA 3E7FA 5L3GA 2BGIA 4I19A 5BV0A 4MRPA 4BEBA 4EHKA 1DJOA 4ZBMA 4C88A 1EBUA 2PD4A 4I1PA 2EJ7A 3NCTA 4NIMA 3PGLA 5HRAA 3TFOA 2ZR9A 3B13B 2Y0DA 3AW9A 4XM1A 4YCCA 4XWOA 3Q2OA 2B36A 1KZYC 3DZFA 1LRLA 2V6MA 2FMFA 3QFSA 1R4MA 1T9DA 3WL4A 1OKKA 2HYDA 2JGJA 4HF7A 2VKTA 4ZICA 4NFLA 4M9CA 3EXHB 2IPXA 4Q3KA 4DCUA 4HNVA 2N74A 1PQWA 1OKKD 2ZYTX 4N65A 1O5OA 2TECE 1XZLA 3Q15C 4J1TC 1HLDA 4X8HA 4XJVA 1JHUA 1PK8A 1TRHA 3B1FA 5ULLA 1S2GA 4P4GA 2R70A 3C3SA 1BRMA 1XEXA 4YJHA 1G4YB 2B1QA 2QVLA 2R97A 4XGRA 3IIJA 3TLMA 1SEPA 3UJ3X 4ZMSA 1TYAE 4CUZA 1X38A 1I51A 1ZPDA 2GBLC 2HF7A 3VISA 4D26A 4K5QA 2VHJA 4DA7A 4GOOD 2O54A 3UO3A 3J81N 2WAMA 4NNPA 3RJ5A 2FSHA 3HBFA 2F1OA 4OX9O 1MFPA 1N7HA 2BCJQ 1JLHA 3ZCCA 5JMTA 3PJSK 3TWOA 3AUAA 3O8LA 3C5VA 5D2CA 3I28A 4XZ3A 5L4SA 3GB9A 1NMQA 2V7WA 2AUNA 2F48A 1J09A 3L8YA 3OPQA 5CK4A 3VOTA 4PN7A 4X1YA 4ZKIA 4BVBA 3A6GA 4YAUA 5J2TA 2DHRA 3V1KA 3UKJA 1J2EA 3EWSA 3OC6A 2E6KA 4UZEA 4BNTA 1TL7C 2W6CX 2G1JA 5DMHA 2PKRA 4YUXA 3AGPA 3EGVA 3OC0A 3RW9A 3IEKA 1NJ2A 4H35A 4X61A 4O6VA 5DU2A 1CQJA 4BFTA 4WL0A 2HGSA 1JJBA 1DXQA 1XA3A 4DBZA 1ANKA 4ZQEA 1YL7A 3UMFA 1X87A 3KFXA 2LFRA 2IBSA 1OHHG 2FFRA 2IS2A 2J0SA 1IIRA 5SZIA 2R7MA 3OP1A 4JWTA 5HGXA 5L4NA 1A4IA 4CMCA 5B3LA 5CYPA 2XOXA 4UDOA 4WEQA 4F1WA 3FTCA 3HJBA 5FQOA 2PUCA 3R6TA 1SCAA 4X3OA 1PWYE 4H7JA 4HWGA 5IWCA 2XYGA 1ZN2A 3W9UA 3FCUB 4H1HA 5BWCA 1QO0D 3G1UA 1U7UA 3PYXA 4RPGA 4BLOA 2VFAA 1QYDA 5AW6A 1G5HA 3GLIE 1W44A 3L0PA 1J39A 1U6JA 1PJCA 2GZAA 5B1NA 1P1KA 4DR7O 4AKTA 4DO2A 2FSUA 4A8JC 5TF4A 3GPIA 3L7BA 1J1UA 2PY5A 4HWOA 3I2YX 4FM9A 4MVRA 4DJEC 4V2IA 5HYVA 2XUGA 4TQUS 1SXHA 3O6VA 4WFAV 5K0JA 3R3JA 2DULA 1IDSA 3GVIA 4QFCA 5BURA 4R9SA 4LHEA 1CIVA 3WRYA 1K5HA 2IYYA 1GZDA 5M7EA 1U5AA 4WBXC 4TVSA 2HPVA 2NTVA 3KT0A 3ONNA 4L6AA 5HQJA 3ZGNA 1V3QE 4QDUA 4IDDA 1RRMA 1UBMS 2K1EA 1SXJE 1VE3A 3EIWA 1VHJA 3EB9A 1DK1A 4N40A 4Z8XA 2BGGA 3DD1A 5IG2A 2H3EA 1YB6A 2HWUA 1ZI8A 1F1JA 2G9ZA 2VHZA 3SG0A 3B3AA 4CI0B 2ZCEA 3NW9A 1YH3A 2HJHA 3AUSA 2UV8A 3F4LA 4MEAA 1PEYA 4RKRA 3UJ7A 3L4JA 3HKCA 1L2TA 1B2RA 5U4XA 3X1ZA 1PIWA 4BNWA 4HOYA 4AILC 4EIWA 4M22A 3BUSA 3R1IA 1BU5A 2VPXA 4A9AA 1VF7A 3WG7C 1KDYA 1IJKA 3CVWA 1G0NA 3M1LA 4S1TA 5AJYA 3I8OA 1C7FA 1O96A 1SULA 5SZHB 3VC2A 3R65A 5COQA 4BMXA 3ZJ4A 4EDFA 5DNAA 5EIHA 2OIGA 4WJLA 1M0EA 3F7VC 1FMJA 4RD0A 2BHNA 3R8XA 4D02A 4MPDA 2VYNA 5CAEA 2B9ZA 4FYYA 5FYDA 2FEOA 2W6ZA 4BLWA 4E2FA 2QJFA 1OBCA 1JA0A 1RJWA 3C4JA 3L6OO 3B12A 3OX4A 3ZYZA 5KC8A 1SXPA 3ID6C 3EFEA 1CRLA 1AKNA 4N23A 2QRHA 4P34A 2GN8A 3DLAA 4N47A 3BA1A 5KUMA 4KP4A 2E7ZA 5D5HA 3STWA 5T7BA 3A9SA 1OGJA 4FILA 1OIXA 4RKQA 5TR9A 1T4CA 4MR8B 1ZIPA 5PGMA 3DMPA 4UM9B 5D7BA 2VHQA 3V7UA 2JAPA 1PT6A 4ZODA 5JD6A 2QN8A 3O5AA 4M36A 1JB1A 1I1QB 3BAFA 2F55A 1YSCA 2VQ6A 1WRBA 3LX8A 3OQIB 2IH3C 1RLMA 2ZYDA 2VHUA 3QYFA 5FJJA 2XMGA 4NCBA 1B15A 2K7ZA 3PENA 4W9NC 3BJEA 1OIVA 5KPJA 5E4JA 3JYQA 1F3OA 2LUOA 3V6LA 5HQTA 5GGYA 2ZRQA 3ND7A 3FJYA 3ZK9A 4ETWA 5JJIA 5DI3A 1RXEA 3E8SA 2GZMA 2XUHA 1T2NA 3GLVA 1Q6YA 2DPHA 5G53C 3IAS1 5BT9A 3LXMA 3ZGOA 4K03A 2I3DA 4OUKX 4MRMB 3P2OA 3L8DA 3HZZA 1G6KA 3JYHA 3HPQA 4ZMRA 4R2WA 2FL4A 3KQOA 2O7RA 2P5SA 4QT0A 2EYQA 5AW9A 3NFRA 3MAGA 2DH6A 5CGQB 1GM8A 3DBIA 2YXNA 3T38A 3HEBA 4IZIA 2F64A 4QXQA 2ZDHA 5JWOA 2J1LA 4K6HA 2R1ZA 2AI3A 3IOCA 3KQSA 1Y9DA 4GZMA 3LUGA 2FKNA 2NU6B 2ZTMA 1P0PA 3RSZA 2B5WA 2WSIA 2QJRA 3KALA 4N0MA 5IYZA 1KHTA 1MX9A 5F51A 3SQNA 3L05A 1V6CA 1DKUA 1XZ8A 3TNJA 2P65A 1GQYA 2YBDA 4BN5A 1NGSA 2QTBA 3CPEA 1MAAA 4WQMA 2H94A 2WF8A 3IUPA 1QAMA 1UKVY 2Y99A 4H7DA 3TJZA 4YI5A 3ZE0B 4DHWA 3QXXA 4DT1A 3ZQ6A 1Q1NA 2BCCH 1GT91 2JAHA 5BR1A 1X7YA 4TPKA 1C9KA 1ND5A 2WU3A 4HDSB 4DCOA 1C29B 2YASA 1SQ0A 4JK3A 4UCRA 2R5WA 3K1ZA 2OUIA 1UQTA 2LIPA 3PGJA 2P22C 1QNFA 3QO5A 2J3HA 4IVNA 5FBZA 3CEHA 1NUUA 2AQHA 4P8RA 1EN4A 2C04A 1C3OA 2FFHA 3EAFA 3GJ6A 2EJVA 3LW8A 1ZOOA 4H44B 5G0VA 4DMRA 1KBQA 1UANA 1U1EA 1BCSA 3EYWA 3KLNA 2J6CA 1XEWX 2E4XA 5HM8A 3W5DA 3I5YA 4PCAA 3LDAA 4RW0A 3ZGLA 4CV0A 1UFVA 2Q28A 3VZQA 2CE7A 1KYXA 1TCCA 4MYRA 2BKAA 4PNZA 4E5MA 2MWMA 4MUXA 4TWBA 5ILOA 4CQLA 4X9XA 2X1VA 3FN4A 3U3XA 4AZTA 4RH3A 3PQ2A 2B34A 2ZRLA 1MW8X 5CXSA 1VBNA 4NG5A 3AFMA 3R44A 3STYA 3EY9A 1NWCA 5EBLC 4PG5A 3ER8A 3DLTA 4TZ0A 1QSGA 4QZVA 3SMQA 3H5IA 2JAOA 5JR3A 1R18A 1H2HA 5CJJA 4RMGA 4Y2SA 4FZRA 1FBNA 2YIAA 2HV8A 4KIFA 2EFDB 3LF2A 3GLHB 1T35A 4NCJA 5K2MA 1PR9A 1IQUA 2CJYA 3AK4A 3I6IA 3SK0A 4CMEC 4ZCIA 5IKPA 1SQXH 3K1JA 3PTAA 4RY9A 1QZXA 4JLVA 1ZSPA 3B2NA 3PQEA 4LJKA 2FH5B 2HHLA 2FDXA 1RRCA 3KDPA 5CGZA 4CC6A 1GT6A 3PU6A 4U8GA 2GYWA 3OU7A 4PLWA 4UEWA 1Q0TA 2H2HA 2JBAA 4H7PA 3ZRVA 2JFWA 3K59A 4HGOA 3APOA 1DAHA 3CYFA 3SNHA 3UAXA 4QULA 1G21B 4MI1A 1Q0LA 3FUUA 1G3QA 3OURA 3B1JA 3HCRA 3LDHA 5FBQB 3U4CA 1WN7A 3WB9A 3M1AA 3UJNA 2CNLA 4MKHA 3DTTA 2H0QA 4E5KA 3KJXA 4H7KA 4J10A 1NVDA 1NW7A 3C6XA 1NQWA 2PD6A 3BD8A 3AR6A 3LIPA 2JIZD 1WMSA 3K0CC 4JJIA 4ZYLA 1A9TA 1FE8A 1WP4A 2UUPA 1P72A 1UZAA 2IZ5A 3S68A 1CY6A 4PW0A 4X7MA 1XXHA 3K9GA 1O97D 3L74H 2WWHA 4D79A 1SR8A 3IUBA 3D3KA 1RXIA 1Q0PA 1M6WA 3U17A 4HO1X 4NOMA 5TS3A 4CM9A 4RHTA 2D62A 4D0SA 2Q3DA 1M2EA 4MYDA 1U2PA 4RHFA 2ZZMA 4ZVPA 2EP8A 3N2ZB 4LI0A 5FI5A 3SC4A 4AMGA 1CDZA 1Y0BA 3UMCA 5EP1A 4KHPO 4K9PA 4OX9B 1AI5A 2OHFA 2IF0A 3K6JA 1MBZA 2JD2A 1XR3A 2HXSA 3U3OA 4L07A 1UOQA 1MH9A 1JQEA 2I4MA 1Z0UA 4NICA 5GOTA 1QGYA 4N3CA 5FT9A 1UDBA 4IWYA 5LLTA 3TTXA 4DGQA 4ENWA 1Q17A 3PUJA 2DR3A 3FMVA 3RFVA 5EWJA 3SOZA 4NFSA 2JDIG 3OR7C 1IULA 1X1TA 4B7CA 4C3UA 1SPXA 4OL0A 3NTUA 1AURA 1XWWA 2JVIA 4L27A 1KKMA 1UMBB 4BEJA 4NXMO 4LG1A 5HIJA 2CHUA 1UQRA 1R4MB 3VU9B 4C7BA 4MO9A 1WCIA 4N54A 1X8JA 1E2HA 1R66A 4GLLA 4M89A 4ETIA 1ESZA 3EZ7A 4GR9A 5KQSA 1S77D 4D4MA 2ONYA 4OHPA 2VH2A 3CUWA 4AZSA 2A3RA 1EZVH 3GGPA 4TV9A 4P33A 4KRGA 3I01A 1K68A 3RYCA 5CIWA 4PDRA 1NM5C 2PMBA 4V2UA 4YMHA 4KFUA 1YBFA 2FPMA 2CCGA 4LTDA 4M1MA 4EUSA 2HM7A 4CCYA 1NBMG 3UHFA 5I9LA 3FYIB 3WISA 5DNYB 1COZA 1TLFA 1EFDN 1X1EA 1XJQA 4EMSA 3MJTA 3V8PA 5CP8A 3GDWA 1ZIDA 1HG1A 5FF9A 4FM2A 2O8FB 5AR1A 5EZ6B 1DFHA 5IX8A 3CXUA 1J42A 2GD6A 2VP6A 2ORWA 1EDEA 3C16C 1X2BA 1M2GA 5C8VA 2F3TA 3PRHA 3UAYA 3N2EA 1ODIA 5TF0A 4HT3B 1KI9A 4OJMX 4PLCA 4EMTA 3T9FA 5KQMA 4ZU3A 1YFLA 1D6MA 4R9VA 1R6NA 2IHVA 3LC0A 3GZNB 2V97A 3T7KA 4QBGB 2JARA 1UIMA 1XP5A 4TWZA 5ALZA 5C1PA 3K20A 5H5NA 4WLEA 3BIXA 4G8JA 3WJ7A 1DIAA 4RK6A 2HRBA 3CG4A 1THGA 1G8FA 1CQJB 2B30A 1N0VC 3OX2A 1MABB 4P82A 2AFVA 4ND7A 1KZGB 2AF3C 2EBHX 3U7EB 3ZY6A 4B45A 2R96A 1GUYA 1QF6A 1AK1A 4RPIA 1KVRA 4URUR 5CM9C 2X9VA 1HFKA 2RCVA 1NVEA 5BN5A 2O5EA 5K09A 4YCBA 2YJGA 4YECA 1FX1A 2NUPB 2O1WA 2QX9A 3MDSA 3MJCA 5HXAA 5MN5A 5CCXA 1E9FA 1F2TB 4LSMA 4ZJUA 4FOLA 3N2KA 1K7CA 4OJKA 1WP9A 5IPFA 4K8ZA 4CG0A 3C3BA 4DXHA 4RAIA 1H93A 4OJTA 3VO8A 4MIYA 1WXWA 1E7MA 1FUKA 2VTEA 4WT7A 5BV8A 5AW4A 4KKXB 3KX2A 4C76A 2Y27A 1JN0A 4Y2VA 3B2EE 9MHTA 1QOZA 3WLIA 1D2DA 3EJ6A 2XJ9A 5DOZA 4D1YA 4XCVA 3HH8A 4ZT3A 4OLBA 2CFCA 3QP9A 1IBCA 1KJZA 4X54A 2QB5A 5BYAA 2ZE8A 3LSQA 1P5FA 2EIMB 1VMKA 2AEJA 2H1FA 3RS0A 4F1JA 1RRFA 4LN1A 2X8AA 3CXRA 3E53A 4IHJB 3SBXA 5B7NA 4TV8F 3NHLA 4JZKA 5K1ZA 4EFNA 4MQEB 2F6RA 2J0VA 4KNWA 5DNEA 3LA8A 3ONFA 3HSYA 1Q83A 1JFFA 3B6KA 1B26A 3A3OA 2BELA 1TCVA 4QU8A 5JNLA 2VAVA 1T34A 4KL8S 1A96A 1ZOLA 4RQBA 3G7NA 1GN8A 1JRLA 1U8EA 2B8EA 1Y1QA 3GUCA 2GI4A 3R9XB 2PMFA 3F3SA 2PA0A 1T3TA 2GUGA 3I5UA 5F3RA 3SJCA 3VRHA 3EFHA 4Z2AA 2EFJA 2GPNA 1DOHA 2FWNA 2QY6A 4TXLA 1QRSA 3A11A 2Z83A 3EG5A 4DILA 2G6BA 3EQ6A 2IODA 1AB6A 1Q0SA 3DYBA 4CODB 5KWIA 3LHDA 1YVWA 4MUYA 1B1CA 3ED5A 2CVZA 3TCXB 3IELA 2POQX 1A76A 1AKWA 1B8UA 2O0JA 3B78A 3N6VA 4G86A 3ZV5A 4LYAA 1HORA 1EG2A 3IVAA 1CV2A 3TM5A 4IJ5A 2QGNA 1NVVR 1V37A 1T24A 4ML3A 3E70C 3WQHA 1PHPA 1MPTA 2BFPA 3NHKA 1NPYA 4BVHA 5A7FA 2N05A 3RODA 1V25A 5H8WA 3ABTA 2WDPA 2A5YB 3N0XA 5LP1A 4EKWA 2AFHE 3LDFA 2OCAA 5E3JA 4ZALA 4FX5A 4WFKA 1JFTA 4RFSB 3GCZA 1XZBA 1YQDA 2WMOB 4TL8A 3UHAA 3RVSA 1AHHA 3EVCA 5K99A 3ORSA 1U9CA 3E9CA 5LMCA 1YIOA 2OTJV 1AXEA 2QLMA 3RM3A 3CHYA 5LHGA 1NI3A 5JYCA 4Y6RA 3GARA 1G3RA 4E4YA 1HEUA 3EF1A 2VTBA 4K6KA 1R73A 4MJ7A 3TNFA 4B3TO 4BP9A 2XI4A 1E6WA 3U48A 2C7BA 3D6MA 1WOMA 2C0CA 4IICA 5ICGA 4X1KB 4RJIA 4JEMA 3V1NA 3DPIA 3QV2A 1HLFA 3BXGA 1GSHA 3DYIA 3FI0A 4ZZ3A 5JIBA 2ZBGA 3HYLA 4GX1A 1E3JA 4IDNA 4N8EA 3BT7A 1E9BA 2VQ3A 4TKZA 3NOXA 1I0HA 1T0UA 2OBYA 5FBKA 2Q7DA 1JH9A 4UEOA 3BMQA 4MICA 2PA3A 2XHBA 4IIJB 3SE0A 2QP9X 3ICWA 1Y8RA 2W6PA 5HP4A 5GMOA 1Z0DA 2IU3A 1G20E 2RK6A 1AGNA 4ZARA 4DVGA 2P4VA 4AY2A 4JJGA 1KMMA 2HLNA 3BIFA 2O7QA 4OP2A 5IYBO 1GNQA 4Z9AA 2DLDA 3ROZA 4YV2A 4B2IA 8OHMA 4A8TA 5EWMB 4BFUA 5HZHA 3ZZNA 5I5GA 3AY3A 2ZVPX 1DO0A 4U7NA 3C3AA 3ONDA 4IYIA 1ADCA 2QE7A 4B80A 2DE0X 3I01M 3RYFB 5KWSA 1VPWA 1P81A 3AK2A 1JXAA 5CA1F 1WV1A 5HDQA 4CCAA 5F35A 1S8OA 1W5TA 2I99A 2QLFA 4HWSA 3VTKA 3MHPA 5G41A 3ETEA 2W0MA 3JW8A 1KDTA 2R8EA 3PJGA 4L5IA 4MH0R 5LOVA 4MEJA 4URYR 1IPHA 3V2UA 3H9QA 2XGGA 1G8SA 3LZ6A 5AI5A 1EGAA 8ABPA 2P6NA 2NU9B 5JQGF 3JTEA 4NYIQ 3ZWXA 3RADC 3C3TA 2XMDA 2IA5A 2YV1A 5I48A 3CX6A 1E62A 3D2CA 3IUYA 4J07A 1L8LA 3H05A 4OHKA 4TXMA 4UBMA 5ALWA 2C2KA 4HMPA 3K16A 4YJGA 3NPMA 4AUEA 4URXR 5M2QA 3D6FA 4X6LA 4J1SA 4NL4H 1Y1RA 3C3CA 4MVJA 4N5NA 4CIWA 3JVDA 4HQKA 1BHO1 2CL5A 1FRFS 1TAGA 2OCXA 3KK0A 2BYTA 1CB0A 5AP9A 3S5UA 2XZOA 1PL7A 2BI8A 3K1AA 2W5UA 3AI1A 1XU4A 1T1IA 1LRJA 1DBWA 1JEAA 2PUWA 2CXRA 1GKLA 4TWIA 4DC0A 5EWJB 5MN4A 4CH6A 1SC9A 3Q7EA 4U39A 5A4DA 1QNLA 2ODAA 4KXVA 2O0KA 2WD8A 4H2DA 3CCJV 2WQ6A 3HXMA 4A2CA 3M1IA 4NONA 4A0GA 3LPLA 4CHTA 4FLVA 2OXFA 1SKAA 3GPDG 3TLAA 4FNAA 3WGOA 2X7JA 3AUKA 3V4RA 4J1TA 4BLQA 4UU8A 1SBZA 4HGRA 3PXAA 4CH3A 1C9DB 1DEAA 2Y66A 3PNMA 2BUAA 5I9SA 3CB2A 1AZSC 1DDGA 4MGKR 3RS3A 4EA9A 2XPCA 1M83A 2MSCB 1YIJV 1S8FA 5G4KB 3SM3A 1MX1A 4LOLA 1MENA 4WOPA 1H1TA 5LBTA 1XL0A 3RFUA 4F3TA 3AM5A 1UPUA 5TQ0B 4CQLB 2IE0A 3ICCA 4G4IA 4NOLA 3T5PA 1HRKA 1FZQA 1C1DA 2BL4A 2CL7X 2PV0A 2RKOA 3L92A 3VR6H 2VDWB 5I47A 2ZZKA 4ARZB 2A9HA 3HKCB 4JU9A 1L7VC 3D6TB 4QWMA 2AOTA 3ZN0A 2F4VB 1G2PA 3RTEA 1MRSA 4FGKA 2QMUA 1HT1E 3WY9A 1W0KA 3FYUC 1GL7A 4JJFA 3W2IA 3QYAA 3NBXX 4OLFA 3AEUA 4BZZA 1E2BA 3IUMA 3F7YC 3CHXA 1SQ5A 1TVCA 2KWIA 3OF5A 2WHRA 2P41A 1XZHA 2VTVA 2VWGA 2HIGA 2WICA 5HFJA 1FRQA 1HNZB 3WC4A 1IG3A 2VJOA 2VRWA 2FQQA 3CURA 3STVA 3UK1A 4PSCA 3I4FA 2I4OA 2I2FA 1SMKA 1OWOA 1VCHA 1AO3A 1O1YA 1FF9A 3A3KA 3GFGA 3N8DA 1GP2A 3NTVA 1XU7A 2WJWA 3NP9A 4IZOA 1QGDA 2WLKA 3CCBA 3HMQA 4UB8Z 5EMMA 2XUIA 2A9FA 4H0NA 5FI1B 4F4HA 1A5ZA 2WUEA 1WETA 5K0BA 2QQGA 4BVJA 3OIVA 4LZWA 1AK9A 2I6UA 1MO5A 1S7GA 1RP1A 5KX5B 2QSZA 5CB6A 3U61B 4NEQA 4B8ZA 1ZZGA 2FOLA 2X77A 2BLLA 4TV9B 5CVTA 3M4YA 2AOUA 1MV5A 3GGJA 4UUMA 5A9RA 1R5OA 3C70A 3CJHA 4OHUA 3DXZA 3VKHA 3GFFA 1B93A 3Q7SA 2C7RA 1GK9A 3ZHCA 2VLBA 1BMFD 2MR6A 3HCNA 3N39C 4L8WB 1XX6A 2BUBA 2XT0A 3GD5A 4NK4A 4RQUA 2IUEA 3AB3A 3I73A 3V4ZA 1UBJS 5A5FA 1SZCA 1E5LA 1BXRA 2JS7A 3AR2A 1JCHA 2HY7A 2H2DA 5CBPA 3AERA 2GVDC 4KMMA 1Q50A 5HA5A 3ZTYA 2DQ3A 4LXTA 3CRVA 1K4KA 4BX8A 1DP4A 1OAOA 4NHOA 5ALYA 4ZMBA 3DGEA 5JDIA 1YEWA 5F98A 1JA9A 1V1RA 3WLOA 3DTUB 1A5AB 3FPAA 3PFFA 4BCDA 2OL4A 4GMDA 1BX0A 3CCMV 2BFCA 4O2RA 3T52A 3NLLA 4D9HA 3IR6A 3Q72A 2HPZA 3KJFA 3PC2A 1LY1A 4XGKA 3RLFA 5BSHA 4OFZA 1XFAA 1N4DA 6NULA 4Q7QA 4KUMA 4NATA 1RQXA 2JIZA 5T41A 1WZCA 4EEKA 1FXWA 1KGDA 2N9UA 4S35A 5KTMA 2H4FA 3DDNA 1AH2A 5JCOA 1F48A 2CJWA 4QRHA 3ICQB 4TVOA 3GLUA 4OQEA 4LECA 2M6SA 1JWLA 3CSDA 4EG0A 4DV3O 2X23A 1C2TA 4PFJA 2HG5C 3IHKA 1AV7A 1FMLA 1BOFA 1HMPA 1QK3A 5ANRB 2IHTA 5L40A 3BABA 1WHSA 5A06A 1JQDA 1MDBA 1TKCA 1VTKA 3I2KA 3OZCA 4D3ZA 1X7XA 2QSUA 4AJIA 1SPBS 1U9IA 5L3VA 4BWFB 1CUWA 5FXMA 3O4GA 4AS1A 2GKGA 5KOHA 4EY3A 5AVUA 3K04A 2WHPA 4Q1AA 2GN6A 1XHEA 3F6YA 4GDMA 4M76B 2AS0A 2Q5EA 2YEVB 2HN9A 4UEQA 3I9V1 2TRSB 2ZSHA 4L5CA 1N0UA 5G3YA 2MSEB 4BNFA 4GOLD 5BYBA 1F4PA 3W77A 2ZJ2A 3EDOA 4WBSA 1W5SA 3HLKA 5KAFZ 3LQRA 1MO4A 3E82A 4HDRA 5T3YA 3S1AB 2FMIA 4AP5A 4C0QC 1U28A 2ARHA 4JI6O 1KK1A 1TMGE 4NE9A 3HGQA 4IV8A 2I33A 1NZFA 2B21A 3PR1A 4NECA 1P0IA 1WB5A 2VDOB 5E2BA 2ABWA 4GYCB 1PJ3A 4XIGS 1JF8A 1MUUA 1SZJG 2Z9BA 2Q0XA 1AI7A 5ES3A 2VF2A 4CNBA 2P30A 1NF2A 2V1UA 2B6HA 1R4NA 1XVAA 2VQEO 1KYVA 2ZUCA 1FNBA 4CEJA 4KO1S 2Y48A 2C9YA 3W5CA 1WSBA 3D4IA 3CCSV 1UBSB 4G5YA 3U19A 3WAJA 4H7IA 1AUXA 4Y6OA 5EKTA 4M60A 5F2OA 3ZDAA 4FIDA 5AXCA 2GYVA 3IDAA 1NBHA 3TIFA 2QV0A 1NXPA 2P8JA 5JO9A 4EY5A 3WK9A 2YR0A 4TUYA 2NGRA 5C1OA 3NBUA 1II8A 2YIJA 4WX2B 1FRVA 2X2FA 1FRZA 3BXHA 2FHPA 5B3AA 1YCIA 4AECA 1OV6A 3PF9A 5FLXA 3IVMA 3GH3A 1VB5A 3OJWA 3DDSA 3OOWA 3IR5A 2DUNA 4N5LA 4Z4EA 1LBHA 1SQVH 1QG0A 4UBLA 4PFSA 1QH0A 4ER0A 3DXYA 1XNJA 3H4MA 3X3HA 521PA 1OX6A 1JR3D 3GT3A 5JAOA 1YTFD 1QFYA 2D7CA 3ZQJA 2H0RA 3OIYA 1XV5A 2Z2YA 1HSZA 2VXBA 1RZ3A 2Q4RA 4BNDB 4D42A 5IS2A 1PL4A 4O0MA 3T4EA 3WLKX 3P45A 4OO3A 1LC3A 4TMFA 4QDZA 2QR4A 2XRFA 4GRDA 2F59A 3RUEA 1RLUA 1XLUA 4U00A 1R3UA 4WINA 4JYYA 4DA6A 5KNCD 2WY2D 2CTRA 3DVSX 4M53A 2RMKB 1EFVA 5FTWA 1L3BA 1F4NA 3DDOA 1I32A 1ODFA 2C07A 1JJIA 2ZIMA 1G1AA 4WCEV 1D7OA 2FEMA 2XY4A 1B3RA 3CM0A 1SXIA 3NHAA 4Q0MA 2GARA 5LA6B 2QW0X 3AJDA 4I9HA 4IOJA 1NJ1A 3D8BA 4KIGA 3KHKA 1L1RA 4Q3OA 3DHVA 5SV2A 2ZTHA 3OPMA 2FWIA 3LO8A 3TNDA 5LQUA 2QRPA 2VWQA 3FHOA 4EPXA 1W87A 2XRMA 3MWYW 4MVUA 4N0EA 4DUYO 1JR3E 2ID8A 4TKUB 5K51A 3MSXA 2GEBA 2ZS7A 3C1OA 1B00A 3FCAA 4MX8A 5KOHB 3G7UA 3MNFA 3M6WA 5M34A 3QA3E 1II8B 1SN7A 1PGJA 2X5JO 1EBOA 5ALLA 3K70C 4AQ7A 1JDZA 2RHCA 2OUKA 3FX2A 3NHMA 2OAP1 2DW4A 1E5XA 1ULZA 4RADA 4R6XA 4E5NA 2GUZA 4Q39A 1T2AA 3QOXA 4EGFA 4GM1A 4TLAA 4WVFA 2XWPA 1P9LA 3H8JA 3RTAA 4G1MB 4KVAA 1DC3A 2PKXA 3NMUF 2NLJC 2A57A 3BULA 4JFAA 4YAKA 2FPPA 5KHOC 3O3OB 3HYTA 1BVRA 4FOSA 1EXVA 4CGZA 2YQ5A 3DMRA 4LV5B 1GKKA 3T7SA 3KEFA 4ZIRB 3V33A 1GVHA 4LE0A 4D44A 3KZXA 4Q9AA 4R1SA 3O03A 2J3KA 2KQUA 4YO7A 5L6LB 5L7WA 5GM1A 1NJFA 2JCVA 4YDHB 4LDQA 1AR4A 3Q12A 1TJYA 1WZUA 4TQGA 2BRUA 2CSXA 3QRWA 3I5XA 2Q5IA 5F1PA 1U9JA 4C1BA 1EWQA 2RGRA 5TARA 3NIFB 3O8BA 4EUNA 4D25A 4P86A 1R0BA 4JUDX 2R1TB 2WM8A 1HE5A 1WSAA 5AOVA 3D6NB 4YUAA 3UMRA 4FWTA 4G0OA 2RBKA 1Y8RB 2CXTA 2Q6IA 4BPBA 2YIBD 3P30A 1QIJA 2CVQA 4FW8A 3UWKA 3THXA 4BL5A 2QL6A 4LF4B 2WP0A 1TMOA 4NYKA 3TLKA 3GDGA 2FKXA 1CUCA 2AKEA 3TW8B 2M6YA 3T3EA 1GRCA 1XAJA 4JITA 4C2AA 1ZRHA 5JVDA 1VM6A 1S3FA 4BO2A 2ODPA 5LYJB 2OCLA 2O5CA 4QAJA 4XGQA 3UHPA 3EPPA 5TEWA 3SX2A 1C3JA 1DZIA 4POOA 4Y2XA 3JZDA 2VH1A 4P5DA 1P7CA 1DU4A 4MZDA 4H18A 2G9NA 3V2GA 1Z22A 4XYBA 4CIDA 4PLVA 3HCWA 1QR2A 4E2ZA 1VGRA 4B5LA 5H3LA 5EYPA 2G04A 2VPZA 2V7EA 3K0FA 4IYRA 5B58T 2XNHA 4DDWA 4YQFA 5TVGA 1EMDA 1Q15A 4OPMA 5HJEA 5C8ZA 1EDBA 1NTMH 1KE1A 4RF3A 1VE6A 4BOYA 2UYHA 3CZPA 4G41A 3AVOA 4C5CA 1KP3A 1P45A 2E4UA 5K6AC 1BXRB 5T5QA 4I9WA 3B60A 1JHXA 1DAGA 2ISSD 3EA4A 5M3BA 2O2ZA 1V11B 4GC5A 1ONNA 4QLAA 4BV8A 1GPBA 1ZA1A 1I01A 1J33A 4RO0A 4E5PA 2I0FA 3K4QA 3LQ1A 5BPFA 5ITZB 5IJ0A 4RNDB 4KSCA 1IOLA 1R64A 1Z5UA 4D3FA 1H9AA 2XOKG 3B1ZA 4LY0A 4GKKO 5FULA 3YASA 3PB3A 3THRA 4AW9A 1NNUA 4EZIA 1SVKA 4WUTA 3VC7A 1QS0A 2RHDA 1JHVA 3INNA 5LIRA 4LP8A 3H83A 5KBYA 1IEXA 5A3QA 3THXB 4WACA 3BTSA 3TBHA 1IAQA 1PWHA 2ZYGA 2R9VA 3GLGE 1YR8A 3C3PA 3E9ZA 3ILHA 2FX5A 4S0ZA 5DLYA 2CV0A 2Q5LA 4DY6A 4F3CA 2GWHA 3UYLA 4HNTA 1NM5A 3QZUA 3WMFA 4DSAA 1IUNA 2PY6A 4YGYA 2Z1NA 3VDQA 2I3ZA 2X1MA 4AJ1A 4DC9A 3EPJA 3A6ZA 3E5RA 1CVIA 4CEIB 1H8EG 3OZFA 1IDN1 3QE4A 3WGKA 3RG8A 4DCJA 5I9IA 1RACA 1PT9A 1LU9A 2FPIA 1C8BA 3FAVA 1UPBA 2FJPA 2W4QA 2XV1A 2ZUBA 2YXPX 3BIOA 2WU4A 821PA 3UFXB 5IY5C 3QOWA 2B92A 4MR7A 3IBTA 1IB6A 1UMCB 1XCLA 1VSVA 4RAQA 3VPDA 1JVMA 4E5YA 1LW6E 3KKEA 4JP8A 1GM9A 3IP6A 4PICA 1JQBA 3AK3A 2WINI 3BORA 3EODA 3QMPA 4P4TA 4QOJA 1EFTA 3RSHA 1WXGA 3L01A 1PEKE 1BIFA 2AOTB 3DP7A 4Q9DA 5A5VA 4IIUA 2SECE 2FUG1 1MO3A 4P32A 3FHCB 1YVDA 3PGKA 3OM8A 3AQIA 3CGWA 1H2GA 4F5WA 1WSDA 5BQ3A 3F5MA 4Q3AA 1NQOA 1QFXA 2VATA 3T0GA 3L0DA 3G8AA 3CUKA 3QKRB 3ZH2A 4CQMB 2ILVA 3RBZA 1N5KA 2HMTA 1NKSA 3OMWA 4BMVA 5BUQA 3F5TA 4FFDA 3A2KA 1EIZA 1VP9A 2JJ8A 4UMFA 4S05A 5KCMA 2AHRA 1VFPA 2Q4DA 2AFIB 4BTVA 1NQVA 5DOVA 3ZHTA 3AG3C 1L4YA 3SS9X 3UAZA 3QLVA 2AG0A 4OQXA 2A6PA 4KPYA 3RVQA 2HDOA 3D7RA 3GJRA 3I2JA 1AC5A 1FP6A 4C3VA 1P31A 1COWG 2O3TA 4X89A 2ZUDA 2FE4A 2QLNA 4XUGB 4XDZA 5EKUA 3VNQA 3FTQA 5I7EA 1Y5IA 1DAOA 2P9CA 3KYCB 4G1BA 4INAA 3G3EA 4ZCQA 3H1LH 1HSOA 2XKAA 1TA0A 1GZVA 2JGMA 1KFJB 2VXYA 3IILA 1G6UA 4F45A 1WDWB 4J0JA 1Q6HA 3CVUA 2G17A 3IT1A 4L08A 4HH4A 3DWEX 1TK9A 4YHHO 4PQYA 4ZI7B 2HT6A 2RHGB 5H6QA 1OLUB 2JLBA 3V3TA 4QHTA 4V3CA 1LPOA 4LRQA 5KJCA 4U5QA 3LT5A 3F7MA 5JCZA 5E2IA 4KXMA 5EE9A 4F9FA 1SH7A 4L16A 4Q6BA 1I7SB 5CLQA 4QFDA 5AVVA 1XL4A 2CHEA 1E5DA 2FSSA 4MKZA 1QCEA 1Y74A 1ZIYA 2O8BA 1LUAA 3KXLA 4PYLA 4ND8A 3T15A 4BGVA 1I3CA 5C53B 3DDZX 3O75A 5JAUA 2Q6VA 1HF3A 2EHJA 3LYLA 4P5PA 4QICA 4UOZA 5A5EA 1BQ3A 3H1HH 1XALA 2CK3A 2JJ1G 3A05A 4JP2A 4M37A 3UHJA 3WXBA 4D45A 1USGA 3K0HA 3TZLA 2A9JA 3GJ3A 1VG9B 4LMPA 4K87A 1YRBA 2D5AA 5K8LA 2HEGA 3W7UA 4KE8A 1TM5E 2JHAA 4XB2A 4C3ZA 2PKWA 2QGZA 5HK9A 2GLTA 1D2CA 4KLCA 4N0DA 1XMVA 4IY1A 4PGMA 5K0GA 3DTVD 2WYIA 3EHEA 4F8JA 2Z2XA 4ZYWA 2EKZA 2NP7A 1RW4A 1FYJA 2O2CA 1XQ6A 3SJUA 4ARAA 4GKKB 4TMZA 2F3QA 3R7FA 1YOBA 4QYIB 4DG8A 1L8XA 4FYIA 1QE0A 3G9ZA 3MCTA 1EK0A 1AMOA 4HDRB 4IDHA 1EQUA 5F7ZA 2YY7A 1KNQA 4IZ6A 1I80A 4DJDC 3D3QA 2WSSD 5JMOA 1TVMA 3CLTC 1P44A 2CVFA 4GVXA 2ZYAA 3HHPA 3S2GA 4Z4GA 3UAVA 4ALMA 2IW3A 3EQ9A 4F8EA 5J4YA 3SQWA 4C05A 4J7ZA 5BQXA 1E9AA 4RXTA 4XIYA 4KYVA 2UXCO 3STZC 3VTZA 4Y2QA 3GT4A 2BR5A 4MIKA 1E20A 2NZWA 3KXDA 4MR9B 4EF5A 3PC8C 4QNRA 3AM3A 4CN8A 4EO7A 3KSDO 4KGZA 1CRZA 4YQYA 3DTVA 1EP1B 4A0QA 1GG9A 2GDJA 3ZK7A 2EKDA 3AKYA 3MJRA 4M1TA 3IDOA 3X1JA 2D5BA 3DZHA 2PO7A 1BVYF 2ZBFA 4NNJA 4AD8A 3RAFC 2NACA 4ZAYA 4S3MA 1J8MF 4WNIA 5BY2A 5HKKA 4D0LB 1YFJA 2ENWA 3DNPA 2QU7A 2RGWA 3PG5A 4MUNA 5BW5A 4S1VA 4JUCA 2V9PA 4BVLA 1L5SA 2QVBA 2GPTA 4MJXA 4ZKDA 5B55A 3PNBA 2PMDA 4QJ3A 4ZHSA 5FA6A 3Q7RA 3TUZC 4YBRA 2SCUA 1U7ZA 3N2LA 5FPPA 3NOOA 1FDSA 2W6JA 5JAZA 3RK0A 3BFJA 1SZTA 3I0ZA 4ON9A 1HE8B 1HYBA 1YJCA 2WQ7A 4AN4A 2XZPA 3OJLA 3REGA 5HZKA 5AI9A 3CF0A 2FOXA 5FNVF 2NQ2C 5J40A 1FQJA 1KF0A 1QWOA 2EU8A 3HBNA 3JQAB 3JVIA 4L9RA 4OHMA 2L42A 1U1FA 2QRUA 1ZLZA 2XF2A 4JWKA 4NZNA 5BR4A 3D6JA 3M3HA 3T7AA 2O2YA 2WIFA 3LGAA 3M4NA 3NBYC 2ZT8A 1IAVA 2EWVA 1ES9A 1K92A 3KO8A 3CNHA 2O6LA 4LF5B 3CRW1 4ZQBA 4UHEA 3EZLA 1KGSA 3BQ9A 3Q8WA 3IX7A 3LHFA 2B8NA 3W3ZB 5LL6Y 1F3LA 1EDOA 2BFDB 4ID3A 2OV1A 3WIBA 5DCWA 4LF4O 2D4HA 3W34A 1YS7A 5TEVA 2OQRA 3S2UA 3IAXA 3E5MA 2ET6A 1Q22A 3WYCA 1GUDA 3LECA 1HE3A 1T9ZA 3QPBA 3U7RA 5EIWA 2IP1A 1ST2A 5IBQA 4O8ZA 2EBFX 5CXQA 4B32A 2WR8A 5CFZA 4DNQA 1ZHOA 1YAJA 3RJTA 4B9EA 1BG6A 2HHCA 4Q4LA 3MQFA 1S96A 4X1OA 3NVKI 1OYVA 2J67A 3PC3A 3CNOA 3A1SA 4KC0A 1EP9A 1TT7A 3QEKA 5DDIP 4LBWA 3X1YA 4M8SA 3S2FA 3WBFA 3HY4A 4JASA 1QVAA 1P1RA 3CWCA 1SUIA 3FPJA 1ZD3A 4GZ3A 1SCJA 4MVJH 1T2FA 3PVCA 4KWEA 3W5VA 2O07A 1YVRA 2SCUB 3E27A 4J0GA 4AUNA 5HSGA 1LXCA 2NO1A 1V54C 1A2OA 1OX5A 3IKMB 1QGZA 3A0BZ 2DZDA 4XWWA 1H85A 1DC4A 2IDKA 3GJ0A 2P6UA 3HU5A 4I1RA 3SXUB 4W4KA 1OILA 2G9VA 3EQ2A 3I4CA 4LOJA 4U9UA 4JUAA 4NMMA 5FL3A 1Y89A 4EENA 5LHIA 4PZUA 5GADl 1Z18A 4OK6A 4CMIB 3SY8A 2J30A 1NVFA 4XDKA 1QFMA 3I72A 4QRIA 3FOBA 1GMGA 1GTG1 1NI4A 3GFQA 3SI7A 3FR8A 2V7TA 3PXXA 3BL8A 5JBIA 4MUKA 4RZ3A 2Z30A 2FG5A 3OP4A 3BWXA 2QM8A 2VQEB 1A50B 1QK5A 2ZWMA 4JB3A 3WRXA 3ILXA 4CMEA 2D1TA 1YQTA 1AQYA 3FNEA 4CM1A 3OU6A 4L3OA 2RARA 1D2EA 1P5RA 1QG6A 2J3EA 2FVXA 1M2WA 2XYPA 4KPUA 1DKQA 1GKIA 2JGEA 5CB4B 3AF4A 3QXJA 2BSKB 4G1EB 4MOWA 1YGPA 5U1PA 1YB4A 2G1UA 3BX1A 4DWVA 4YUYA 4K9DA 1ZUNA 5D3MA 4PGAA 2XNJA 3CB4A 4GOND 1C2YA 2KLBA 1G17A 5DN6G 3DW1X 4C7XA 4FONA 2LNDA 5JS8A 5IDJA 2P2CA 3DO5A 3EFBA 4KJZA 4C4ZA 1WCIB 5G4LA 1MJNA 3FZNA 5E7JA 1VL0A 5IN5A 5KUTA 1P91A 3K6KA 4CJXA 2QNBA 4K6CA 3CCCA 4M9QA 3AY6A 4OXKA 4TS1A 4UVDA 3UCSC 2VG8A 3HSKA 4GI3A 3C8MA 3NIGB 4ZVQA 4V1CB 2L17A 4OKNA 4BB9A 4RE5A 4TXJA 4CM8A 3ZVNA 1BJRE 4CKEB 4F92B 3SIWA 3BFRA 3ND8A 3NT4A 4J76A 3OZRA 1WJGA 2YW9A 1R27A 3IERA 2ZJZA 3L06A 1BU8A 2JJYA 4K6GA 5AM0A 1DGSA 3C7CB 2XUPA 2CZGA 1ZP6A 3FNGA 4X60A 3PRJA 4LYEA 3UPTA 3ASUA 1F4VA 2OPHA 2EDAA 1BFUA 1NT4A 4G2TA 1JTVA 2CNOA 2ETNA 4DDKA 5U9CA 5GOZA 3JZMA 3T12A 3C3JA 4DPMA 3BBLA 5GZ3A 4B7ZA 4I5EA 3KZKA 1NAHA 3EN0A 1FJ2A 3L73H 4MB2A 1M1XB 1JIVA 2Y2VA 4H6VA 2BV3A 5JH7A 4EDHA 1RJGA 2C4UA 2VSQA 4LJ9A 4UVHA 1UP6A 2QX6A 1ENYA 5ETJA 1BCCH 4WNAB 2IUUA 1CJSA 3DEAA 2O3SA 3R7WA 4R0NA 1DZ3A 1G6Q1 1KFBB 1YDFA 3ESXA 3FUCA 4KK3A 4U7PB 3IDSA 3PD7A 3LBYA 2WAYA 5KNCH 3OOEA 1ZCJA 3FKSA 4QD3A 1TUEB 1EXWA 4HB4A 4BNKA 3HKEA 3PIDA 3HJTA 5GONB 3BZUA 1YBMA 2VR1A 1QHYA 1J1IA 4UMDA 3HKDA 3V97A 1KERA 2D5LA 1P73A 4P9PA 1PFWA 2HBQA 3NHJA 2PTGA 4J0HA 4CM6A 4A5UB 2MW2B 4GSYA 1TJPB 2GFHA 1IPFA 2QSJA 3OA2A 5CA1A 1MAHA 2NXEA 3O8DA 2P9EA 2NSDA 2ZT9B 1DRJA 2R8XA 3QMVA 2AOUB 2J7PD 1SVMA 3KYBA 1Z35A 5REQA 3KCQA 1UJNA 3C98A 4DR1O 1B41A 4TTTS 4BB0A 4Q24A 3SBEA 2Q4PA 3BGWA 1TAUA 2NNLD 4S2EA 2R0QC 3CLSD 1V2GA 1KQFA 4JLSA 3CKMA 3JQBC 5KINB 3DM5A 3PX7A 3G2NA 3DQPA 2QX4A 3T9EA 3AGQA 4Q9HA 1VLQA 3HCEA 1SVOA 1T1EA 1VHWA 3ZY3A 2AI2A 2FTKA 16PKA 1B8OA 2WWFA 5DK6A 3B9RA 1DB3A 2G5TA 2NW6A 4RLQA 3FHJA 2ZYVX 4TRRA 1Q1EA 4A1OA 1P18A 2FPSA 1SHUX 4FFNA 3QKRA 4JYAO 4N5IX 3SBDA 4BWVA 3F73A 2PSSA 2NXWA 4IQFA 3F5SA 4XGIA 1RP7A 4EQZA 4Y67A 4Y0VA 1T5DX 3VX3A 2Y4TA 1XJ5A 3CW8X 2CL0X 4FQ7A 1TAQA 2OCBA 2RBGA 2NV2B 2B4AA 4MTOA 3U4GA 5FFMA 2I6XA 1JIKA 4UDNA 5E4YA 1NVVQ 1B04A 3ETLA 3A1WA 1N6OA 3INTA 1FP4A 1BOOA 2RGDA 3GZJA 3HZOA 1I7LA 4EHHA 1HYQA 2GWRA 1P1IA 3FWZA 2ZSUA 5AUPB 5KREA 5FHQA 2HF9A 3LKZA 4J2TA 3EX7C 4DRXB 4WERA 4BMDA 2C1ZA 5LQNA 2PWBA 1CQIB 2UZ4A 1BWRA 1NFQA 2AXPA 2ZR3A 1JLLA 1SFRA 2UZ0A 3U7QB 4U2FA 3U44A 2H00A 3HVKA 1H2XA 4L2IA 4U2EA 4AB1A 2VUHB 1V11A 2EG9A 3HBLA 2HP8A 3FWYA 3VH3A 4KUHA 1W0KG 3BTOA 3KB1A 1N34O 1A04A 3DVAB 2IEDA 3GJ7A 4I7ZB 5LMUO 4KRXA 4DAEA 4JI8B 3D4PA 3BCCH 4D3SA 2IHJA 3HB7A 3LF1A 3CF4G 4YP7A 1QNMA 2EW1A 2QWQB 5EIBD 1U31A 1YI1A 2QRVA 1XKQA 3QTBA 2HJSA 4QBTA 3E2IA 1GZ6A 2QNRA 4G2NA 1P62B 4M8KA 1VGVA 4WY2A 2HVJC 1AUOA 1V8ZA 1ULHA 1TJNA 5H2FZ 3G0GA 1RM1C 2H1CA 4IT5A 3QX9A 1F9AA 2DFKB 1RPAA 3U11A 1H2EA