3H01A

Structure of the c-terminal domain of a putative hiv-1 gp41 fusion intermediate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
54
structure length
54
Chain Sequence
b'EWDREINNYTSLIHSLIEESQNQQEKLEQELLELDKWASLWNWFNITNWLWYIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Role of a putative gp41 dimerization domain in human immunodeficiency virus type 1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
molecule tags Viral protein
total genus 24
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3h01A00
1SZTA 2OT5A 3GWOA 1DLBA 4FIPC 5CMUA 1DF4A 1F23A 1I5XA 1K34A 3B8MA 3P30A 1QBZA 1K33A 4FJCC 4JF3A 4E2LA 5KA5A 5CN0A 1EBOA 5HFLA 2EBOA 3M99B 3MHSC 3H01A 1JPXA 3B8NA 2LP7A 1QCEA 1Y66A 1QR9A 4JGSA 3MHHC 5KA6A 2EZOA 5HFMA 2MK3A 3B77A 5H9CA 4N23A 2EZPA 3CP1A 4N21A 3WFVA 1QR8A 1MG1A 1ENVA 1Y4MA 4JPRA 1JQ0A 1I5YA 3CYOA 2X7RB 1DF5A 3K9AA 4FK5C 2M7WA 1MOFA 2P6JA 4G2KA
chains in the Genus database with same CATH superfamily
1HNXB 3SJCC 3T4DA 4ZI7A 4DV2B 1Y67A 4JI5B 1FD9A 1AJPA 2CH7A 3WG7C 3ZHRA 1NT2B 4J42A 4EB6A 1OJHA 1XEQA 2X6CA 4CS3A 3W7UA 5BR8O 3F7YC 2OCCC 1GM9A 3D3IA 3F5WC 4XDJA 1ZWIC 1Y76B 1FAFA 4LF6O 1E1RG 3FB7C 3CCSV 3HKEB 2P90A 3SYOA 3JD3A 3S3XA 1OCOB 1PPJH 3FFQA 3IC9A 5J9PC 4JYYA 2F4VO 1YJWV 3QF7A 5IJ9B 4F6RB 3JAMN 3BHPA 4TV9A 1N0NA 3RVYA 1SC5B 5JH7B 1VF6C 5EYPA 3W7WA 5DEDA 4LFBO 1ROPA 4MVUA 4R6ZA 2CDYA 5FNVA 3G80A 4TQFA 3ZHTA 3A0HZ 1FPOA 4FLYA 5CBGA 2BOCC 4CBCA 4I4TB 1K4CC 4IIJA 2B5UA 3OEHG 1VF5B 3CE2A 2IU3A 2UUBB 3OGIB 1I94O 4DV4B 3BVOA 4LFCB 1XMQB 3ASNB 4JI0O 3RYHB 4RQFA 5H2FZ 3RFRA 4TSFG 4X1YA 4X65B 1TUBB 3JALB 4B7EA 1WJZA 4ZKIA 4O4IB 4FJCC 2EJ7A 2Y48A 1IBLB 4XDKA 4I50A 3JASB 5K1XA 2EILC 2EIJC 3ETQA 3CRCA 1PP9H 4MW3A 3QG5A 4LNUB 1GH6A 2Q67A 3KG2A 1YIJV 4J7JA 1Q90D 3QNEA 2QKAA 4DRXB 3CCVV 2UU9O 1M93A 3B8MA 5B3SC 3SJAC 2LFRA 1S5HC 4NR1A 2D2CB 1B04A 1K3EA 2IJKA 2PYLA 1FJGO 1KP3A 5GW7A 3JCZA 1KYOF 4RWUA 3RYIB 1M57C 2EIKB 1JJOA 1JFFA 5B1NA 3AK1A 1YZBA 2WLLA 3H1LH 3K9AA 2UUAB 4YY3O 2RN9A 3OT7A 1G1XB 2LQTA 1HR0B 4K35A 3CCLV 5EZYA 4DV6B 3ZMUA 2ZKOA 1GTOA 2GDSA 4U3JB 2FTKA 4AI8A 1VARA 4JAVA 1AB3A 1TA8A 1DTOA 3B4SA 2YDEA 1EN5A 4FPPA 1DF5A 4X9QA 1F4MA 3CRAA 4UV9A 3ETGA 1SA0B 3JCUZ 3E86A 1SF9A 1V55B 5ITZA 4TQDA 2N05A 4JI6O 4UCRA 1VP7A 3A8TA 2P4KA 2X6AA 1NZ6A 3HR0A 4PD4F 1QVGU 2OIEA 3AG7A 1NI8A 1XNRO 4ZOLA 2QM7A 3T1YB 3OGCC 3IGAC 1XNQB 1D5NA 3ZMSA 1IXMA 1AP6A 2HHHO 3ICXA 1YHQV 3ZRSA 2PF4E 3P30A 2FMLA 2W6IG 1HNWO 1ZTEA 5HFLA 3DSQA 2XOKG 3ABMC 1OHHG 4YXWG 3JARA 2H3OA 5EK0A 3CCRV 1KKCA 4GKKB 2W0XA 2ZNJA 4O2AB 2RNBA 2ITCC 3EHBB 4UFZA 1I5YA 1WLEA 2LJ2A 1AVMA 3KCXA 1ZL8B 1H2MA 1YXBA 3AG3B 4PA3A 4HZ3A 3HKBA 1S3JA 2PZSA 4AILC 5LHGA 1BE3H 2RQ6A 4DR1O 1OCCC 1ZSPA 2WLIB 4LCUC 3N2KB 4PV1B 1AI7A 2CTPA 1HNZB 4QE9A 1HWYA 4PA7A 1VQ8V 4FZ1A 4DR6B 4NTYA 4GX1A 3A2FA 1V54B 1PL4A 4B3SO 4X1KA 2JVDA 3EXAA 4HYOA 2R72A 2UXNA 2E76B 2QGNA 3TCUA 4LF4O 4EEQA 1XMOB 3RN4A 2HEPA 1AROP 1EZJA 4YJ2B 2BSKB 1RM1B 3H9VA 5LBQA 2PI4A 1RPOA 5GTHZ 1R73A 4FK5C 1DK1A 2LGWA 4LF7B 1P4RA 1GMGA 1FKAO 1XI1A 2EINC 3ZJZA 4P2ZA 1IBMB 5KMGA 5JVDA 5GONA 3ABKB 1NU1H 4MW8A 3WFVA 4DUYB 3OM3B 3K0DA 1W0JG 3QVNA 5LMNB 4JI1O 4JI2B 1QBZA 4TV8A 3OTOB 1SQBH 1OCRC 3CJHA 2B9ZA 4QJFB 3JATB 1XILA 2UUCB 5LXTA 1M4UA 1P84F 4DK0A 2ZT9B 1F4NA 3G71V 1NR7A 2IJIA 3R66A 4OX9O 2WA3A 1PNLA 3E83A 2YIAA 4O4JA 5LOVB 4LR3A 3RGBA 5IY5C 1G6UA 3N27A 1MNGA 2JEXA 4RO2A 3TGUH 4J7ZA 3BEHA 1R3KC 1QNMA 2YUAA 4LFAO 1MG1A 4NTXA 4ZHQA 5LMUO 3D3QA 2NLJC 3AG1C 1LNQA 2KG7A 3A0BZ 1YJ9V 2X6BA 1PM9A 2OYQA 3I55V 3UCSC 4DK1A 4GUNA 4NKGB 4X88A 5EIBC 5B1BB 4BIZA 4LBEC 4X1IB 5KAFZ 4YHHB 2P4VA 3JAWB 1F23A 2ZIMA 4QPJA 5BY1A 4DV1O 2VQEB 4B3MO 3JAKB 3JSLA 4RQEA 1KMIZ 2JDIG 4CC5A 1LUWA 4TUYA 3SR2C 2YI9A 4JGSA 2BTQB 2QDOA 3BA9A 4X62B 2F1MA 2Y69C 5J2UA 4MVZA 5KUKA 3E2EA 4LF5O 4PDLA 2ADQB 4KHPO 3CX5F 2N04A 3GWOA 5JWPA 2XAQA 4JTCB 3OE7G 3FKSG 4JYAB 4B3TB 2DYRB 1SQFA 3SDLA 2PUSA 1BT8A 1URFA 5DM6V 3CMAV 4UV8A 4FFBA 2XT9A 1Y6XA 3STZC 1FXKB 1BHAA 1XOUA 2VQFB 2ZR2A 5E79Z 1FFTB 2DYSC 5CA0A 3SJBC 1H8HG 3CB2A 3TK1A 1MZFA 3CXHF 5KAIZ 4B3RO 2AHZA 1J95A 4OPAA 4LF9O 3X2QB 3FYEB 3BAAA 2F93B 2ZINA 3WB2A 1U97A 3FD9A 1L0LH 3SJQC 1MSWD 1FFXB 2BTOA 1ZAUA 2ZDIC 2GUZB 4CC6A 5KA6A 3SYPA 1IBKO 4Q20A 2EULA 2JK5C 3K3WA 3IJ4A 3MAQA 4Z2WA 1MABG 3FB5C 3D8CA 3S3WA 3HKCB 1VQNV 1XHZA 3DXRB 4KP4A 2WAMA 5IYZA 1N0JA 4ZIBA 1S0VA 3CC2V 5LP6B 1GM8A 5L3FA 1SQQH 4K3AA 4JAUA 1AR1B 5KHGA 3JYCA 1V9PA 1VIBA 4LWSB 1H2SB 1YSCA 2WA4A 4JYCA 4DUZB 1F51A 4DR7O 2ADPA 3K04A 2KKWA 4NTWA 2VWJA 1HNXO 3ASOB 3H01A 1QR9A 4MVSA 3JD0A 4DV2O 4FZ0A 5L3BA 4X89A 2XNDG 4O4HB 3RYCB 5AG2A 4IYIA 4DV7B 3H1IH 4JI5O 4Z1VA 1ORQC 5IWAB 4NXMB 4BW5A 1ZX3A 3OMAB 2BCCH 3RVZA 2K9PA 2YEVB 2EIMC 1JJ2U 2HLDG 5IJ0B 3CC4V 5FL7G 2Q68A 3B8NA 3OTFA 3SPIA 1XDCA 2HFEC 2Q7GA 3AG4B 5LYJB 5KHHA 1L0NH 2QTSA 3KZIZ 2ZM6B 2Y4UA 4DV5B 1VQKV 1J5EB 2OTJV 3P3PA 1GK9A 3SPGA 5IJ9A 1NJIW 4F6RA 3C3SA 3CCEV 4DR5B 1THZA 3U10A 2KQXA 2X0LA 3M8AA 4CZZA 5JH7A 1YTFD 1V55C 4UCOA 4MTGA 4DO2A 3HB3B 3PN1A 2ZDIA 4JI4B 2MW2B 1K97A 3THOA 4GYCB 1P49A 1KBHA 5LHHA 4JI8B 3BCCH 4I4TA 4I7ZB 4YIPA 1KECA 4PA6A 1P7BA 2UUBO 2EZPA 4GX5A 3K08A 1OCZC 2RJZA 4DV4O 1XMQO 2DMXA 4UXNA 4LFCO 4TWKA 2AXTZ 1FYJA 4X8AA 2NN4A 1U96A 3RYHA 4X65O 3ZMTA 5IYDO 2P06A 2V1DA 2EBOA 4J9YB 1TUBA 3JALA 2VS0A 4U7NA 1RSOB 1IBLO 4WBNB 2AW9A 4O4IA 3OUFA 4X66B 2Z0AA 2F23A 4C7UA 1US6A 4KL1A 3SYCA 4XBFA 2HVJC 1Y4MA 3JASA 3L9DA 2DN9A 1YF2A 4K0KB 4NB5A 1NTMH 1WA8B 2OCHA 4PDVA 2QKCA 3OD4A 5FNVB 4LNUA 3J80N 1KP2A 2DJVA 3E35A 2FYUH 4DRXA 3L72H 1K92A 3CEIA 5LGNA 3GB7C 1KB9F 4UCSA 3RYIA 3VQYA 4FIPC 5H5NA 4IGGA 4WFFA 2UUAO 2DQ3A 3L71H 5IDJA 3ML0A 4J41A 5BXZA 1HR0O 3JD1A 4BR6A 2CUGA 3QO7A 4FLZA 4DV6O 3NR7A 4MVMA 3BRCA 1D5AA 3RYFB 4JTDB 2JGDB 2YIBD 4LF8B 4U3JA 5CB4A 4DV3B 1VF7A 3M99B 3E89A 4I9WA 3C90A 5KUMA 1K7DA 1SA0A 3WG7B 2E74B 4I0XA 3SPJA 4F4LA 1Z2GA 3ETEA 3ZHSA 4NVPA 4W4KA 3E8BA 1R1BA 1JQ0A 1VEWA 1H2KA 1R3LC 2OCCB 5KLVH 3T1YO 1WAZA 1XNQO 5LGTA 4I55B 3LSQA 3GVMA 4NXNB 3E22B 2OIGA 4FLTA 1YJNV 1COWG 3BA8A 3LNMB 1XQ8A 1CEZA 3ZIAG 1OV9A 2NR5A 2F95B 4DYLA 5EBMC 1M5IA 4FFKA 1CXZB 4G27B 1NTZH 4GKKO 2OTLV 3F5TA 1QLEC 1UJWB 4PA4A 4O2AA 4CH6A 4JF3A 4FLXA 1SERA 5DN6G 1ZL8A 1WP8A 3IFXA 2GTSA 3UT5B 2ODMA 5HFMA 1S5LZ 1IZ3A 4GZRB 1N36B 3QO5A 1NVPD 3K5MA 1HNZO 2VWKA 2WLIA 3ZMZA 3N2KA 4O4LB 3SYQA 1MOFA 1R6KA 1FXVA 4DR6O 4ZOLB 4UVAA 4DR3B 3LDCA 1LUVA 3RBZA 1QCEA 4JZ2A 5B1AB 1XMOO 4ABMA 4R50A 1WNSA 4B7KA 3K0GA 2QWRB 3M7MX 4E4EA 1B6QA 1K5SA 3DGEA 4R8CA 4YJ2A 2CTWA 2BSKA 1E79G 4H33A 3APOA 2EX3A 4LF7O 4EKWA 2GV9A 2EZOA 1SQVH 4H13B 4G28B 2PYJA 4YJ3B 1IBMO 1S76D 4O2BB 1PNKA 2BOBC 5E1AC 5L3CA 1K5QA 4BW9A 2QM8A 2P6JA 2XAHA 4DUYO 3T1HB 1M9NA 2C2AA 5KHKA 3I56V 3FX7A 4PELA 3EFFK 5LMNO 3ZS8C 4JI2O 2DYRC 1HP8A 3LNNA 4RUFA 3CCUV 2IH1C 4PI2A 1Y66A 4LH6A 2XHBA 1IDSA 3OTOO 5LHIA 1VMGA 1VQMV 3QO8A 4MS2A 1YITV 2V4DA 1I7FA 2UUCO 1M57B 1N34B 4DR2B 2A0LA 5CA1B 4FM1A 2KSDA 4J11A 4Q6GA 5LA6B 1VQOV 1Q6HA 2UXCB 4FLUA 4TT3G 1S5JA 2LO1A 4BIOA 2Q0OC 3AG2C 3OUSA 2V7QG 4DW1A 1SETA 3VBBA 5JJJB 1RPRA 1KD1W 3VQXA 5KHIA 2OWOA 3QTCA 5GONB 2UXDB 3CRQA 2Q9LA 3ZEDA 3J81N 1Y74B 4LH7A 2WWWA 2HKOA 5KX5A 2Q73A 5BMVB 3CWBH 3RT3C 4X64B 4HNAA 3CJHB 2XAFA 3T2MA 4PA9A 1BSMA 1NS1A 3ZN1A 2PGGA 2QWQB 4Z1MG 4WF9V 4YHHO 3OAAG 5JCOA 2RCVA 4X1IA 3SPHA 2VQEO 3LDEA 3ABTA 5EC1C 4P30A 3ABMB 3JAKA 1SKVA 2QWOB 4X62O 4IT5A 1VQ5V 2BE3A 1JMKC 3FAVB 1NR1A 1SQXH 2QKSA 2ZXWC 1K34A 1YTFB 3ASOC 2P67A 2JS5A 1EM1A 2VRZA 1OCCB 2IJHA 3UO2A 3ZCCA 4CH3A 3CCQV 1GRJA 2MK3A 1T5EA 2P7TC 5C8YB 4JYAO 4AQYB 4B3TO 3OEEG 4JI3B 1SZXA 1ZUQA 4CH4A 1YDXA 1Z5VA 5JQGB 3Q4HB 4IL6Z 2ATKC 3DC5A 2VQFO 3AG4C 3JD4A 4FLVA 2CTRA 2HR3A 3MHHC 1IURA 4GT1A 2PTMA 4L8JA 1VQLV 4MT8A 1EN6A 2R9AA 1KC8W 1H2GA 4J80A 4DR4B 2DQ0A 5J2TB 1BQZA 2UXBB 1JR9A 1R6TA 2ZR3A 4E2LA 1TVKB 4JI7B 3KKYA 1EBOA 1JPXA 3CMEV 1Q3EA 2EINB 3H1HH 2DOSA 3ZHUA 1OCOC 5H9CA 2HJFC 3UQ8A 1Q7YW 3E8FA 1YI2V 1N33B 3G6EV 2CTQA 2Q4PA 1FFXA 1EZVH 4KXRA 2Q0AA 1DF4A 1G4YB 1M56B 3VQWA 4DV0B 2DW4A 1Q82W 1OCRB 1B3QA 1B06A 4PDMA 4QE7A 5JJEB 3K57A 3HKCA 4MVQA 3CPWU 3OR7C 4N23A 2XAGA 5CA0B 3N2GB 5LP6A 1NTKH 4IHJB 3LDDA 1MZEA 3TETA 1R6NA 4RAIA 1JVMA 4LWSA 4DUZO 1D2DA 4W4LA 3HKDA 5IE9A 1AI6A 3ASNC 1CP9A 4JZGA 4OGQB 2JRIA 1PNMA 4DXWA 3K5NA 2DE0X 2Y0PA 3B40A 4LP8A 4DV7O 4G2KA 3K79A 4O4HA 2HP8A 1OZ0A 3RYCA 2ZE7A 1RP3B 5IWAO 4NXMO 1SQGA 4R7CA 1SQPH 1K8AW 1AILA 3MHSC 4X20B 1KQSU 3L73H 4JTAB 2ZCEA 1WB7A 3ZRWB 5FLXN 2D3OW 2A79B 1AR5A 4N21A 5IJ0A 1Q81W 4J7KA 1JCHA 3O65A 4PI0A 2B1GA 1QLNA 2XAJA 2M7WA 4P9PA 3SYAA 5LYJA 2E5LB 4GKJB 1PKXA 1LR1A 1QQCA 2ZM6O 4BWAA 2ZE5A 4F6EA 5K1PA 4DV5O 1IXBA 3ABLB 1J5EO 3UO3A 2EIKC 4J10A 3LSUA 1F7YA 1Y76A 4MTOA 4D6TH 1QR8A 2Y69B 3BFRA 1XUQA 1NVPB 4DR5O 3HKEA 2GSMB 4A5UB 4GX2A 5KA5A 1N32B 4GX0A 2W6JG 3L70H 5EBLC 2R70A 1K9MW 4JI4O 4JV5B 3BPZA 4UCUA 4H37A 3CC7V 4JI8O 4PHZA 5FPOA 4CH5A 4ZI7B 3CSXA 5B5EZ 3K5LA 3T4ZA 2CH7B 4KUMA 1XL6A 3CRRA 4UVBA 1L1FA 4L87A 4EB6B 3FB6C 3WB0A 3ZHQA 1UFIA 2DYSB 1JA8A 3G6BA 5BR8B 3EVKA 3W7XA 4X66O 4RUEA 1M1KW 2LFSA 1RSOA 1YCIA 4WBNA 5JJNB 4LF6B 2CAZC 3LUTB 5B66Z 3HPLC 4I5SA 4K0KO 3AK2A 4UCVA 3CXCU 1WA8A 2UXXA 2F4VB 3TXQA 3DTUB 4AHCA 4TV9B 1BMFG 1AJQA 3AG3C 2YICA 3NXSA 2ZD9A 4U7OA 5BZBA 5EYPB 3CRMA 5B1AC 3E8GA 3ETDA 4LFBB 1I0HA 1TGOA 2LP7A 1MMMA 5CBFA 2YC0A 5B1OA 3U0ZA 5KHJA 2A9HA 3SGIA 4IIJB 2XUMA 3B77A 2FB5A 1H2NA 5L3EA 1V54C 2ZE8A 3ZHVA 2JJ2G 5EC2C 4I9QA 3CYOA 3ABUA 3UKMA 1TAEA 2Z5UA 4WFEA 1IX9A 1I94B 3B2EE 4LF8O 3RYFA 4UUJC 4DV3O 2JGDA 5D5QA 4JI0B 1RM1C 4X1YB 1SESA 2IW5A 1S77D 4K8XA 2M6YA 1CPYA 1AP5A 1AR4A 1XREA 3CP1A 1BHBA 2YIDA 4I50B 2QWPB 2Y0IA 2IJJA 3FB8C 2OT5A 2G38A 3D36C 5CN0A 2AHYA 1XBLA 2EIMB 4PDRA 4BIUA 3OR6C 3ABKC 4MTXA 4NXNO 1NH2D 1BCCH 4MVRA 2ILMA 4I55A 1RFYA 3E22A 3RW0A 1ENVA 2F43G 2RDCA 1TUEB 2UU9B 2Q6AA 2WPDG 4WFBV 3WB1A 5CA3A 3OW2U 1SZTA 2NNUA 3TXSA 3E8HA 4ASUG 2YXHA 1FJGB 1W0KG 2L6LA 3PJSK 1DGSA 1JFFB 3ZN0A 4MTFA 2WLLB 1K73W 5CB4B 1EN4A 2AZ2A 1W2BU 5EIBD 2YI8A 4QNHB 4PJ0Z 4YY3B 1SS3A 5EZYB 1N36O 3CHXA 2A7WA 3J7AU 3UT5A 2QEXV 1VF6A 4I0XB 1PV0A 4UB6Z 4EFBA 3TJTA 1O9GA 2ZE6A 4H44B 1AJNA 1BGYH 2HG5C 1GM7A 4O4LA 2JS3A 1X59A 2RMKB 4DR3O 1VQPV 3W7SA 2R9RB 5DECA 5ITZB 1OCZB 3BABA 4JI6B 1WPXA 3UM7A 2GHYA 1Q6IA 3G67A 1YEWA 3IC7A 1VQ7V 4K8ZA 1QHTA 1A32A 4HBNA 1GO3F 1KUQA 1XNRB 2GTAA 5B1BC 5JCOC 1GAXA 2GBOA 2HHHB 2Q5ZA 2QSAA 3L74H 1HNWB 3KCYA 3JARB 4YJ3A 1NBMG 4ICGA 5IT9N 4TOIA 4O2BA 4WFHA 1P7GA 1WP7A 2IH3C 3BY6A 3T1HO 2DWEC 3F7VC 2EILB 2EIJB 4FLWA 3A0RA 2EJRA 2QTOA 4FVMA 3HKBB 3JSNA 3L75H 3W7TA 3D36A 2QM4A 1K4DC 4QPKA 4DR1B 4KFMA 1N34O 4DR2O 1GKFA 2CGOA 2IU0A 5L3DA 1Q86W 1Q5OA 5CA1A 5B3SB 2UXCO 2ITDC 1NQTA 3P3NA 1FS0G 5LA6A 4X1KB 1L8DA 2Q8VA 4OXSA 4D7SA 1XL4A 4ZBMA 4B3SB 1H2LA 1X4TA 2ZNIA 2WLMA 3ZBHA 2IM9A 1FXKC 1GN4A 2QE7G 4LF4B 3JATA 4WFGA 1AI5A 4CS4A 5A2QN 5CMUA 1HW7A 4CS2A 3G4SV 1BQ0A 2JJ1G 2WLNA 5LL6Y 2YS8A 3AEIA 1H8EG 2UXDO 2PY5A 3OMIB 1Q8IA 1BL8A 2ETNA 1VQ6V 5LOVA 1IVSA 4JAAA 3T1CA 1Y74A 4MSWC 3X2QC 4GCZA 4X64O 1G8MA 1M56C 5KMGB 3H1KH 5JVDB 4P9OA 5BMVA 2FL4A 4QGPA 1GN2A 1MA1A 1K33A 2E75B 4JASA 1Q43A 1PD3A 2WLHA 2HJDA 2O57A 3MDSA 5H6RA 4B08A 4UB8Z 3AK3A 3ZMVA 2F66C 3DC6A 1XHXA 2ZIOA 3OFNG 4UCTA 2HVKC 1VQ4V 4JI1B 4TV8B 4NYKA 2QWNB 1W59A 5H6QA 3H1JH 4FMTA 5D5PA 2CE4A 4J9ZB 4QIWF 3CS5A 3K9SA 5LXTB 2YXYA 2XTAA 1QLEB 1H38A 2H8PC 1I08A 2K1EA 3U11A 3JD2A 5LP6C 2P22C 4U3FH 1GN6A 3JAWA 3FAVA 1M90W 2QA4V 1AI4A 4OX9B 4O4JB 3ZX6A 1NKDA 2WLKA 5KX5B 2BTQA 4AQYO 4JI3O 5LGUA 5C8YA 4HNAB 1QVFU 2N74A 4LFAB 2W0FC 4ZHQB 1FXHA 4YIOA 5IYCO 2KB1A 4H0LB 2KG7B 5JQGA 2AZ0A 5LMUB 3Q4HA 3WU2Z 1EFRG 2A06H 3C3TA 4JPRA 2CGNA 4FM2A 3P32A 3MD0A 2WLJA 2JIZG 4MVOA 4UVCA 4DR4O 2FKXA 2CK3G 1N8RW 3ABLC 4EFEA 2UXBO 4LC1A 5A9GA 1E1QG 5J2TA 4JI7O 1KKDA 1FXKA 5EBWC 3K58A 1TVKA 1N4CA 4WFAV 5GTIZ 2LW1A 4D7TA 1HDJA 2PI5A 4JYBA 4DV1B 3VQVA 4OPHA 2JEUA 2XASA 2Y4TA 4TUYB 4B3MB 1N33O 2L35A 2YXLA 5J2UB 1JX9A 3OMNB 1MSDA 2P5OA 1BS3A 4DV0O 1ZLZA 1WN7A 4LF5B 3RWRD 4KHPB 2E3CA 1UPGA 3K03A 3K59A 3APQA 3LSSA 4FM0A 2X7RB 3K06A 2GUZA 3K5OA 2Q7EA 3VOUA 1YVWA 3I5DA 1I5XA 1VQ9V 3N2GA 4FFBB 3R65A 1Q6UA 3AG2B 4IHJA 1PL0A 2QR4A 2LGQA 2YIBA 3DXRA 1Z5WA 2WSSG 2B1IA 4GLXA 1O9HA 5TISZ 1R3JC 1S72V 3FYIB 1GN3A 3CCJV 1KU9A 2Z3YA 5IY5B 5L3GA 4B3RB 5FPRA 2LW7A 3B09A 3STLC 4IYHA 2A3QA 2ARHA 3CCMV 1SRYA 4LF9B 1QU7A 1NH2B 2DWDC 4X20A 4XDLA 3ZRWA 1DLBA 3AG1B 5CBHA 2ZQMA 1IBKB 3CD6V 5F2VO 2AGAA 2E5LO 4GKJO 4WCEV 1BZKA 2IBZH 1WB8A 2YEVA 3SPCA 1WPBA 4DW0A 3GWKC 2Q7HA 5IYZB 3HKDB 5C93A 3ZRXA 4BAYA 2ZXWB 4HAMA 2JGUA 1JOYA 3IAYA 2YSUB 2QJ1A 2H94A 1N32O 1R3IC 5IYBO 2R9IA 2Q69A 3ZRVA 4JV5O 4DR7B 3O9OA
chains in the Genus database with same CATH topology
3FB8C 1M9NA 2C2AA 2OT5A 3GWOA 2XAQA 3I56V 4PELA 3EFFK 3T4DA 4JTCB 5CN0A 2AHYA 2EIMB 4PDRA 2DYRC 4RUFA 4BIUA 3OR6C 3CCUV 2IH1C 3OE7G 3FKSG 1Y66A 3ABKC 1AJPA 4MTXA 5LHIA 2DYRB 3WG7C 1NH2D 4MVRA 1VQMV 3QO8A 4MS2A 5DM6V 3CMAV 1YITV 2X6CA 4UV8A 3RW0A 3W7UA 1ENVA 3F7YC 2F43G 1M57B 1TUEB 2OCCC 2A0LA 1GM9A 2P6JA 2Q6AA 2WPDG 3D3IA 4WFBV 5CA3A 3STZC 1FXKB 1BHAA 3OW2U 3F5WC 4XDJA 1SZTA 2NNUA 1VQOV 1ZWIC 3E8HA 4ASUG 1W0KG 2ZR2A 1FFTB 4TT3G 2DYSC 3PJSK 1H8HG 3ZN0A 3TK1A 1E1RG 4MTFA 3AG2C 2WLLB 3FB7C 3OUSA 3CCSV 1K73W 2V7QG 2P90A 1SETA 3SYOA 3JD3A 1W2BU 3VBBA 1OCOB 1RPRA 4QNHB 1KD1W 2AHZA 1J95A 5J9PC 3X2QB 3FYEB 1YJWV 2QEXV 2WWWA 3RVYA 1AJNA 2HG5C 3SJQC 1GM7A 1MSWD 2HKOA 2ZDIC 5KA6A 3SYPA 3W7WA 1VQPV 3W7SA 4Q20A 1ROPA 4MVUA 4R6ZA 2R9RB 2JK5C 3K3WA 2XAFA 3T2MA 1OCZB 4PA9A 5CBGA 1MABG 2BOCC 4CBCA 1K4CC 1WPXA 3UM7A 2GHYA 2B5UA 3ZN1A 3FB5C 3OEHG 3IC7A 1VQ7V 1VQNV 4Z1MG 4WF9V 4KP4A 3OAAG 2WAMA 1GO3F 2IU3A 3SPHA 1S0VA 3CC2V 3LDEA 1GM8A 5L3FA 3ABTA 5EC1C 4P30A 3ABMB 5B1BC 3ASNB 4JAUA 4RQFA 1AR1B 3JYCA 4TSFG 1VQ5V 1YSCA 4ZKIA 1NR1A 4JYCA 2QKSA 2ZXWC 1F51A 1NBMG 1K34A 1YTFB 4FJCC 3ASOC 4WFHA 2Y48A 3BY6A 2IH3C 2P67A 3K04A 4XDKA 2EILC 2DWEC 2EIJC 3F7VC 3ASOB 3H01A 1OCCB 2IJHA 3ZCCA 1QR9A 4MVSA 3CCQV 3JD0A 2EILB 2EIJB 3A0RA 4X89A 2XNDG 2MK3A 5L3BA 4MW3A 2P7TC 2EJRA 2QTOA 3OEEG 1ORQC 2Q67A 3W7TA 3D36A 3KG2A 1K4DC 4QPKA 1YIJV 4KFMA 4BW5A 3OMAB 3QNEA 3CCVV 3RVZA 2YEVB 3B8MA 5B3SC 1GKFA 2EIMC 1JJ2U 2HLDG 2IU0A 2LFRA 2ATKC 5L3DA 1S5HC 1Q86W 3CC4V 5B3SB 1K3EA 2IJKA 5FL7G 2Q68A 3B8NA 3AG4C 1KP3A 2ITDC 1NQTA 3JD4A 5GW7A 3SPIA 1FS0G 2HR3A 3MHHC 3JCZA 2HFEC 4GT1A 4OXSA 1XL4A 3AG4B 4ZBMA 1VQLV 4MT8A 1M57C 2EIKB 2WLMA 5B1NA 1KC8W 1H2GA 1FXKC 2WLLA 2DQ0A 2QE7G 3K9AA 4WFGA 1AI5A 5CMUA 2ZR3A 3G4SV 4E2LA 2JJ1G 1VQKV 2WLNA 1EBOA 3CCLV 2OTJV 3AEIA 1H8EG 1JPXA 3CMEV 3OMIB 2EINB 1GK9A 3ZMUA 3SPGA 1GTOA 1BL8A 1OCOC 1VQ6V 2FTKA 1NJIW 4JAVA 5H9CA 2HJFC 3CCEV 1DTOA 1THZA 3E8FA 3T1CA 1Q7YW 1YI2V 4MSWC 3G6EV 3X2QC 2X0LA 4FPPA 4GCZA 1DF5A 4CZZA 1YTFD 1F4MA 1G8MA 1M56C 1V55C 4MTGA 4P9OA 3ETGA 4UV9A 4DO2A 3HB3B 1DF4A 2ZDIA 1G4YB 3E86A 1M56B 1K33A 1V55B 4JASA 1K97A 1PD3A 2WLHA 2DW4A 5H6RA 1Q82W 5LHHA 1OCRB 4QE7A 4PDMA 3ZMVA 2X6AA 1QVGU 3OFNG 1KECA 2HVKC 1VQ4V 4MVQA 4PA6A 1P7BA 3CPWU 3OR7C 2EZPA 4GX5A 4N23A 2XAGA 3K08A 2QM7A 1OCZC 3OGCC 3IGAC 5H6QA 4UXNA 3ZMSA 4FMTA 4TWKA 1IXMA 4J9ZB 4QIWF 4X8AA 1YHQV 3ZRSA 3LDDA 3P30A 1QLEB 3ZMTA 2W6IG 1H38A 2H8PC 5IYDO 3TETA 1R6NA 5HFLA 2K1EA 2V1DA 1JVMA 4RAIA 3JD2A 2EBOA 4J9YB 2XOKG 3ABMC 1OHHG 4U7NA 4YXWG 1AI6A 3ASNC 2QA4V 1M90W 1AI4A 5EK0A 3OUFA 3CCRV 1NKDA 1CP9A 3EHBB 2ITCC 2WLKA 3SYCA 4XBFA 2HVJC 1Y4MA 1PNMA 4DXWA 1I5YA 1WLEA 4LP8A 3AG3B 3K79A 4G2KA 4PA3A 1OZ0A 4PDVA 4HZ3A 5LGUA 1S3JA 4R7CA 5LHGA 1QVFU 1OCCC 1K8AW 2W0FC 2WLIB 1KP2A 3MHSC 1KQSU 4LCUC 1FXHA 5IYCO 4JTAB 1AI7A 2KB1A 3E35A 3ZRWB 4QE9A 1HWYA 4PA7A 2D3OW 1VQ8V 2A79B 1EFRG 4N21A 1Q81W 1K92A 1JCHA 4GX1A 4JPRA 1V54B 2B1GA 3P32A 1QLNA 5LGNA 2XAJA 3GB7C 2M7WA 3MD0A 4P9PA 2WLJA 2JIZG 4HYOA 3SYAA 4FIPC 4MVOA 2UXNA 3TCUA 4UVCA 1PKXA 4WFFA 2CK3G 1N8RW 2DQ3A 5IDJA 3ML0A 3ABLC 1AROP 1EZJA 4LC1A 1E1QG 1KKDA 3ABLB 3JD1A 1FXKA 1RM1B 5EBWC 2EIKC 3QO7A 5LBQA 4WFAV 4MTOA 2PI4A 1RPOA 4MVMA 1QR8A 2Y69B 1R73A 2PI5A 4JYBA 4JTDB 2JEUA 2XASA 4FK5C 1NVPB 1P4RA 2GSMB 1GMGA 4GX2A 5KA5A 4GX0A 2W6JG 1JX9A 2EINC 3OMNB 4P2ZA 5EBLC 3ZJZA 3M99B 3E89A 4I9WA 1K9MW 5KUMA 1K7DA 4H37A 3ABKB 3CC7V 3WG7B 4MW8A 3SPJA 4F4LA 3K03A 3WFVA 3ETEA 3OM3B 3K0DA 3E8BA 1JQ0A 3LSSA 2X7RB 1R3LC 1W0JG 3K06A 2OCCB 3T4ZA 3VOUA 4KUMA 1XL6A 4UVBA 5LGTA 1L1FA 1I5XA 4L87A 1VQ9V 1QBZA 3LSQA 1OCRC 3FB6C 3R65A 1YJNV 2DYSB 1COWG 3LNMB 4QJFB 1CEZA 3ZIAG 3AG2B 1PL0A 1F4NA 3G71V 5EBMC 1NR7A 3W7XA 2WSSG 2IJIA 2B1IA 1M1KW 4G27B 4RUEA 1PNLA 2LFSA 3E83A 2OTLV 1QLEC 1R3JC 1UJWB 4PA4A 3LUTB 5IY5C 4JF3A 3HPLC 1S72V 3FYIB 4I5SA 3CCJV 2JEXA 2Z3YA 5IY5B 5L3GA 1SERA 5DN6G 4RO2A 3CXCU 3BEHA 3IFXA 1R3KC 3STLC 2UXXA 5HFMA 3CCMV 1SRYA 3QO5A 1NVPD 1NH2B 3DTUB 2DWDC 1MG1A 1BMFG 2WLIA 1AJQA 3AG3C 3NXSA 3ZMZA 2NLJC 2ZD9A 3AG1C 4U7OA 4XDLA 3SYQA 1MOFA 1R6KA 1FXVA 3ZRWA 1LNQA 1DLBA 5BZBA 1YJ9V 2X6BA 3AG1B 5CBHA 2ZQMA 3I55V 4UVAA 3LDCA 3E8GA 5B1AC 3CD6V 3ETDA 3RBZA 2LP7A 1QCEA 5CBFA 5B1OA 5B1AB 2A9HA 4R50A 4WCEV 4X88A 3B77A 3K0GA 5L3EA 2YEVA 3SPCA 1V54C 5B1BB 4BIZA 2JJ2G 4LBEC 1B6QA 1K5SA 3DGEA 3CYOA 4R8CA 5EC2C 3ABUA 3UKMA 5C93A 2Z5UA 3ZRXA 4WFEA 1E79G 4H33A 4BAYA 1F23A 4QPJA 2ZXWB 4RQEA 4HAMA 4UUJC 1JOYA 2JDIG 2YSUB 4EKWA 1RM1C 2H94A 1SESA 2IW5A 4JGSA 1S77D 1R3IC 2EZOA 2R9IA 5IYBO 2Q69A 1CPYA 4G28B 2Y69C 3ZRVA 1S76D 3CP1A 4MVZA 5KUKA 1BHBA 1PNKA 3E2EA 2BOBC 5E1AC 4PDLA 5L3CA 1K5QA 2IJJA 2QM8A 2XAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZT A;  2OT5 A;  3GWO A;  1DLB A;  4FIP C;  5CMU A;  1DF4 A;  1F23 A;  1I5X A;  1K34 A;  3B8M A;  3P30 A;  1QBZ A;  1K33 A;  4FJC C;  4JF3 A;  4E2L A;  5KA5 A;  5CN0 A;  1EBO A;  5HFL A;  2EBO A;  3M99 B;  3MHS C;  3H01 A;  1JPX A;  3B8N A;  2LP7 A;  1QCE A;  1Y66 A;  1QR9 A;  4JGS A;  3MHH C;  5KA6 A;  2EZO A;  5HFM A;  2MK3 A;  3B77 A;  5H9C A;  4N23 A;  2EZP A;  3CP1 A;  4N21 A;  3WFV A;  1QR8 A;  1MG1 A;  1ENV A;  1Y4M A;  4JPR A;  1JQ0 A;  1I5Y A;  3CYO A;  2X7R B;  1DF5 A;  3K9A A;  4FK5 C;  2M7W A;  1MOF A;  2P6J A;  4G2K A; 
#chains in the Genus database with same CATH topology
 1HNX B;  3SJC C;  3T4D A;  4ZI7 A;  4DV2 B;  1Y67 A;  4JI5 B;  1FD9 A;  1AJP A;  2CH7 A;  3WG7 C;  3ZHR A;  1NT2 B;  4J42 A;  4EB6 A;  1OJH A;  1XEQ A;  2X6C A;  4CS3 A;  3W7U A;  5BR8 O;  3F7Y C;  2OCC C;  1GM9 A;  3D3I A;  3F5W C;  4XDJ A;  1ZWI C;  1Y76 B;  1FAF A;  4LF6 O;  1E1R G;  3FB7 C;  3CCS V;  3HKE B;  2P90 A;  3SYO A;  3JD3 A;  3S3X A;  1OCO B;  1PPJ H;  3FFQ A;  3IC9 A;  5J9P C;  4JYY A;  2F4V O;  1YJW V;  3QF7 A;  5IJ9 B;  4F6R B;  3JAM N;  3BHP A;  4TV9 A;  1N0N A;  3RVY A;  1SC5 B;  5JH7 B;  1VF6 C;  5EYP A;  3W7W A;  5DED A;  4LFB O;  1ROP A;  4MVU A;  4R6Z A;  2CDY A;  5FNV A;  3G80 A;  4TQF A;  3ZHT A;  3A0H Z;  1FPO A;  4FLY A;  5CBG A;  2BOC C;  4CBC A;  4I4T B;  1K4C C;  4IIJ A;  2B5U A;  3OEH G;  1VF5 B;  3CE2 A;  2IU3 A;  2UUB B;  3OGI B;  1I94 O;  4DV4 B;  3BVO A;  4LFC B;  1XMQ B;  3ASN B;  4JI0 O;  3RYH B;  4RQF A;  5H2F Z;  3RFR A;  4TSF G;  4X1Y A;  4X65 B;  1TUB B;  3JAL B;  4B7E A;  1WJZ A;  4ZKI A;  4O4I B;  4FJC C;  2EJ7 A;  2Y48 A;  1IBL B;  4XDK A;  4I50 A;  3JAS B;  5K1X A;  2EIL C;  2EIJ C;  3ETQ A;  3CRC A;  1PP9 H;  4MW3 A;  3QG5 A;  4LNU B;  1GH6 A;  2Q67 A;  3KG2 A;  1YIJ V;  4J7J A;  1Q90 D;  3QNE A;  2QKA A;  4DRX B;  3CCV V;  2UU9 O;  1M93 A;  3B8M A;  5B3S C;  3SJA C;  2LFR A;  1S5H C;  4NR1 A;  2D2C B;  1B04 A;  1K3E A;  2IJK A;  2PYL A;  1FJG O;  1KP3 A;  5GW7 A;  3JCZ A;  1KYO F;  4RWU A;  3RYI B;  1M57 C;  2EIK B;  1JJO A;  1JFF A;  5B1N A;  3AK1 A;  1YZB A;  2WLL A;  3H1L H;  3K9A A;  2UUA B;  4YY3 O;  2RN9 A;  3OT7 A;  1G1X B;  2LQT A;  1HR0 B;  4K35 A;  3CCL V;  5EZY A;  4DV6 B;  3ZMU A;  2ZKO A;  1GTO A;  2GDS A;  4U3J B;  2FTK A;  4AI8 A;  1VAR A;  4JAV A;  1AB3 A;  1TA8 A;  1DTO A;  3B4S A;  2YDE A;  1EN5 A;  4FPP A;  1DF5 A;  4X9Q A;  1F4M A;  3CRA A;  4UV9 A;  3ETG A;  1SA0 B;  3JCU Z;  3E86 A;  1SF9 A;  1V55 B;  5ITZ A;  4TQD A;  2N05 A;  4JI6 O;  4UCR A;  1VP7 A;  3A8T A;  2P4K A;  2X6A A;  1NZ6 A;  3HR0 A;  4PD4 F;  1QVG U;  2OIE A;  3AG7 A;  1NI8 A;  1XNR O;  4ZOL A;  2QM7 A;  3T1Y B;  3OGC C;  3IGA C;  1XNQ B;  1D5N A;  3ZMS A;  1IXM A;  1AP6 A;  2HHH O;  3ICX A;  1YHQ V;  3ZRS A;  2PF4 E;  3P30 A;  2FML A;  2W6I G;  1HNW O;  1ZTE A;  5HFL A;  3DSQ A;  2XOK G;  3ABM C;  1OHH G;  4YXW G;  3JAR A;  2H3O A;  5EK0 A;  3CCR V;  1KKC A;  4GKK B;  2W0X A;  2ZNJ A;  4O2A B;  2RNB A;  2ITC C;  3EHB B;  4UFZ A;  1I5Y A;  1WLE A;  2LJ2 A;  1AVM A;  3KCX A;  1ZL8 B;  1H2M A;  1YXB A;  3AG3 B;  4PA3 A;  4HZ3 A;  3HKB A;  1S3J A;  2PZS A;  4AIL C;  5LHG A;  1BE3 H;  2RQ6 A;  4DR1 O;  1OCC C;  1ZSP A;  2WLI B;  4LCU C;  3N2K B;  4PV1 B;  1AI7 A;  2CTP A;  1HNZ B;  4QE9 A;  1HWY A;  4PA7 A;  1VQ8 V;  4FZ1 A;  4DR6 B;  4NTY A;  4GX1 A;  3A2F A;  1V54 B;  1PL4 A;  4B3S O;  4X1K A;  2JVD A;  3EXA A;  4HYO A;  2R72 A;  2UXN A;  2E76 B;  2QGN A;  3TCU A;  4LF4 O;  4EEQ A;  1XMO B;  3RN4 A;  2HEP A;  1ARO P;  1EZJ A;  4YJ2 B;  2BSK B;  1RM1 B;  3H9V A;  5LBQ A;  2PI4 A;  1RPO A;  5GTH Z;  1R73 A;  4FK5 C;  1DK1 A;  2LGW A;  4LF7 B;  1P4R A;  1GMG A;  1FKA O;  1XI1 A;  2EIN C;  3ZJZ A;  4P2Z A;  1IBM B;  5KMG A;  5JVD A;  5GON A;  3ABK B;  1NU1 H;  4MW8 A;  3WFV A;  4DUY B;  3OM3 B;  3K0D A;  1W0J G;  3QVN A;  5LMN B;  4JI1 O;  4JI2 B;  1QBZ A;  4TV8 A;  3OTO B;  1SQB H;  1OCR C;  3CJH A;  2B9Z A;  4QJF B;  3JAT B;  1XIL A;  2UUC B;  5LXT A;  1M4U A;  1P84 F;  4DK0 A;  2ZT9 B;  1F4N A;  3G71 V;  1NR7 A;  2IJI A;  3R66 A;  4OX9 O;  2WA3 A;  1PNL A;  3E83 A;  2YIA A;  4O4J A;  5LOV B;  4LR3 A;  3RGB A;  5IY5 C;  1G6U A;  3N27 A;  1MNG A;  2JEX A;  4RO2 A;  3TGU H;  4J7Z A;  3BEH A;  1R3K C;  1QNM A;  2YUA A;  4LFA O;  1MG1 A;  4NTX A;  4ZHQ A;  5LMU O;  3D3Q A;  2NLJ C;  3AG1 C;  1LNQ A;  2KG7 A;  3A0B Z;  1YJ9 V;  2X6B A;  1PM9 A;  2OYQ A;  3I55 V;  3UCS C;  4DK1 A;  4GUN A;  4NKG B;  4X88 A;  5EIB C;  5B1B B;  4BIZ A;  4LBE C;  4X1I B;  5KAF Z;  4YHH B;  2P4V A;  3JAW B;  1F23 A;  2ZIM A;  4QPJ A;  5BY1 A;  4DV1 O;  2VQE B;  4B3M O;  3JAK B;  3JSL A;  4RQE A;  1KMI Z;  2JDI G;  4CC5 A;  1LUW A;  4TUY A;  3SR2 C;  2YI9 A;  4JGS A;  2BTQ B;  2QDO A;  3BA9 A;  4X62 B;  2F1M A;  2Y69 C;  5J2U A;  4MVZ A;  5KUK A;  3E2E A;  4LF5 O;  4PDL A;  2ADQ B;  4KHP O;  3CX5 F;  2N04 A;  3GWO A;  5JWP A;  2XAQ A;  4JTC B;  3OE7 G;  3FKS G;  4JYA B;  4B3T B;  2DYR B;  1SQF A;  3SDL A;  2PUS A;  1BT8 A;  1URF A;  5DM6 V;  3CMA V;  4UV8 A;  4FFB A;  2XT9 A;  1Y6X A;  3STZ C;  1FXK B;  1BHA A;  1XOU A;  2VQF B;  2ZR2 A;  5E79 Z;  1FFT B;  2DYS C;  5CA0 A;  3SJB C;  1H8H G;  3CB2 A;  3TK1 A;  1MZF A;  3CXH F;  5KAI Z;  4B3R O;  2AHZ A;  1J95 A;  4OPA A;  4LF9 O;  3X2Q B;  3FYE B;  3BAA A;  2F93 B;  2ZIN A;  3WB2 A;  1U97 A;  3FD9 A;  1L0L H;  3SJQ C;  1MSW D;  1FFX B;  2BTO A;  1ZAU A;  2ZDI C;  2GUZ B;  4CC6 A;  5KA6 A;  3SYP A;  1IBK O;  4Q20 A;  2EUL A;  2JK5 C;  3K3W A;  3IJ4 A;  3MAQ A;  4Z2W A;  1MAB G;  3FB5 C;  3D8C A;  3S3W A;  3HKC B;  1VQN V;  1XHZ A;  3DXR B;  4KP4 A;  2WAM A;  5IYZ A;  1N0J A;  4ZIB A;  1S0V A;  3CC2 V;  5LP6 B;  1GM8 A;  5L3F A;  1SQQ H;  4K3A A;  4JAU A;  1AR1 B;  5KHG A;  3JYC A;  1V9P A;  1VIB A;  4LWS B;  1H2S B;  1YSC A;  2WA4 A;  4JYC A;  4DUZ B;  1F51 A;  4DR7 O;  2ADP A;  3K04 A;  2KKW A;  4NTW A;  2VWJ A;  1HNX O;  3ASO B;  3H01 A;  1QR9 A;  4MVS A;  3JD0 A;  4DV2 O;  4FZ0 A;  5L3B A;  4X89 A;  2XND G;  4O4H B;  3RYC B;  5AG2 A;  4IYI A;  4DV7 B;  3H1I H;  4JI5 O;  4Z1V A;  1ORQ C;  5IWA B;  4NXM B;  4BW5 A;  1ZX3 A;  3OMA B;  2BCC H;  3RVZ A;  2K9P A;  2YEV B;  2EIM C;  1JJ2 U;  2HLD G;  5IJ0 B;  3CC4 V;  5FL7 G;  2Q68 A;  3B8N A;  3OTF A;  3SPI A;  1XDC A;  2HFE C;  2Q7G A;  3AG4 B;  5LYJ B;  5KHH A;  1L0N H;  2QTS A;  3KZI Z;  2ZM6 B;  2Y4U A;  4DV5 B;  1VQK V;  1J5E B;  2OTJ V;  3P3P A;  1GK9 A;  3SPG A;  5IJ9 A;  1NJI W;  4F6R A;  3C3S A;  3CCE V;  4DR5 B;  1THZ A;  3U10 A;  2KQX A;  2X0L A;  3M8A A;  4CZZ A;  5JH7 A;  1YTF D;  1V55 C;  4UCO A;  4MTG A;  4DO2 A;  3HB3 B;  3PN1 A;  2ZDI A;  4JI4 B;  2MW2 B;  1K97 A;  3THO A;  4GYC B;  1P49 A;  1KBH A;  5LHH A;  4JI8 B;  3BCC H;  4I4T A;  4I7Z B;  4YIP A;  1KEC A;  4PA6 A;  1P7B A;  2UUB O;  2EZP A;  4GX5 A;  3K08 A;  1OCZ C;  2RJZ A;  4DV4 O;  1XMQ O;  2DMX A;  4UXN A;  4LFC O;  4TWK A;  2AXT Z;  1FYJ A;  4X8A A;  2NN4 A;  1U96 A;  3RYH A;  4X65 O;  3ZMT A;  5IYD O;  2P06 A;  2V1D A;  2EBO A;  4J9Y B;  1TUB A;  3JAL A;  2VS0 A;  4U7N A;  1RSO B;  1IBL O;  4WBN B;  2AW9 A;  4O4I A;  3OUF A;  4X66 B;  2Z0A A;  2F23 A;  4C7U A;  1US6 A;  4KL1 A;  3SYC A;  4XBF A;  2HVJ C;  1Y4M A;  3JAS A;  3L9D A;  2DN9 A;  1YF2 A;  4K0K B;  4NB5 A;  1NTM H;  1WA8 B;  2OCH A;  4PDV A;  2QKC A;  3OD4 A;  5FNV B;  4LNU A;  3J80 N;  1KP2 A;  2DJV A;  3E35 A;  2FYU H;  4DRX A;  3L72 H;  1K92 A;  3CEI A;  5LGN A;  3GB7 C;  1KB9 F;  4UCS A;  3RYI A;  3VQY A;  4FIP C;  5H5N A;  4IGG A;  4WFF A;  2UUA O;  2DQ3 A;  3L71 H;  5IDJ A;  3ML0 A;  4J41 A;  5BXZ A;  1HR0 O;  3JD1 A;  4BR6 A;  2CUG A;  3QO7 A;  4FLZ A;  4DV6 O;  3NR7 A;  4MVM A;  3BRC A;  1D5A A;  3RYF B;  4JTD B;  2JGD B;  2YIB D;  4LF8 B;  4U3J A;  5CB4 A;  4DV3 B;  1VF7 A;  3M99 B;  3E89 A;  4I9W A;  3C90 A;  5KUM A;  1K7D A;  1SA0 A;  3WG7 B;  2E74 B;  4I0X A;  3SPJ A;  4F4L A;  1Z2G A;  3ETE A;  3ZHS A;  4NVP A;  4W4K A;  3E8B A;  1R1B A;  1JQ0 A;  1VEW A;  1H2K A;  1R3L C;  2OCC B;  5KLV H;  3T1Y O;  1WAZ A;  1XNQ O;  5LGT A;  4I55 B;  3LSQ A;  3GVM A;  4NXN B;  3E22 B;  2OIG A;  4FLT A;  1YJN V;  1COW G;  3BA8 A;  3LNM B;  1XQ8 A;  1CEZ A;  3ZIA G;  1OV9 A;  2NR5 A;  2F95 B;  4DYL A;  5EBM C;  1M5I A;  4FFK A;  1CXZ B;  4G27 B;  1NTZ H;  4GKK O;  2OTL V;  3F5T A;  1QLE C;  1UJW B;  4PA4 A;  4O2A A;  4CH6 A;  4JF3 A;  4FLX A;  1SER A;  5DN6 G;  1ZL8 A;  1WP8 A;  3IFX A;  2GTS A;  3UT5 B;  2ODM A;  5HFM A;  1S5L Z;  1IZ3 A;  4GZR B;  1N36 B;  3QO5 A;  1NVP D;  3K5M A;  1HNZ O;  2VWK A;  2WLI A;  3ZMZ A;  3N2K A;  4O4L B;  3SYQ A;  1MOF A;  1R6K A;  1FXV A;  4DR6 O;  4ZOL B;  4UVA A;  4DR3 B;  3LDC A;  1LUV A;  3RBZ A;  1QCE A;  4JZ2 A;  5B1A B;  1XMO O;  4ABM A;  4R50 A;  1WNS A;  4B7K A;  3K0G A;  2QWR B;  3M7M X;  4E4E A;  1B6Q A;  1K5S A;  3DGE A;  4R8C A;  4YJ2 A;  2CTW A;  2BSK A;  1E79 G;  4H33 A;  3APO A;  2EX3 A;  4LF7 O;  4EKW A;  2GV9 A;  2EZO A;  1SQV H;  4H13 B;  4G28 B;  2PYJ A;  4YJ3 B;  1IBM O;  1S76 D;  4O2B B;  1PNK A;  2BOB C;  5E1A C;  5L3C A;  1K5Q A;  4BW9 A;  2QM8 A;  2P6J A;  2XAH A;  4DUY O;  3T1H B;  1M9N A;  2C2A A;  5KHK A;  3I56 V;  3FX7 A;  4PEL A;  3EFF K;  5LMN O;  3ZS8 C;  4JI2 O;  2DYR C;  1HP8 A;  3LNN A;  4RUF A;  3CCU V;  2IH1 C;  4PI2 A;  1Y66 A;  4LH6 A;  2XHB A;  1IDS A;  3OTO O;  5LHI A;  1VMG A;  1VQM V;  3QO8 A;  4MS2 A;  1YIT V;  2V4D A;  1I7F A;  2UUC O;  1M57 B;  1N34 B;  4DR2 B;  2A0L A;  5CA1 B;  4FM1 A;  2KSD A;  4J11 A;  4Q6G A;  5LA6 B;  1VQO V;  1Q6H A;  2UXC B;  4FLU A;  4TT3 G;  1S5J A;  2LO1 A;  4BIO A;  2Q0O C;  3AG2 C;  3OUS A;  2V7Q G;  4DW1 A;  1SET A;  3VBB A;  5JJJ B;  1RPR A;  1KD1 W;  3VQX A;  5KHI A;  2OWO A;  3QTC A;  5GON B;  2UXD B;  3CRQ A;  2Q9L A;  3ZED A;  3J81 N;  1Y74 B;  4LH7 A;  2WWW A;  2HKO A;  5KX5 A;  2Q73 A;  5BMV B;  3CWB H;  3RT3 C;  4X64 B;  4HNA A;  3CJH B;  2XAF A;  3T2M A;  4PA9 A;  1BSM A;  1NS1 A;  3ZN1 A;  2PGG A;  2QWQ B;  4Z1M G;  4WF9 V;  4YHH O;  3OAA G;  5JCO A;  2RCV A;  4X1I A;  3SPH A;  2VQE O;  3LDE A;  3ABT A;  5EC1 C;  4P30 A;  3ABM B;  3JAK A;  1SKV A;  2QWO B;  4X62 O;  4IT5 A;  1VQ5 V;  2BE3 A;  1JMK C;  3FAV B;  1NR1 A;  1SQX H;  2QKS A;  2ZXW C;  1K34 A;  1YTF B;  3ASO C;  2P67 A;  2JS5 A;  1EM1 A;  2VRZ A;  1OCC B;  2IJH A;  3UO2 A;  3ZCC A;  4CH3 A;  3CCQ V;  1GRJ A;  2MK3 A;  1T5E A;  2P7T C;  5C8Y B;  4JYA O;  4AQY B;  4B3T O;  3OEE G;  4JI3 B;  1SZX A;  1ZUQ A;  4CH4 A;  1YDX A;  1Z5V A;  5JQG B;  3Q4H B;  4IL6 Z;  2ATK C;  3DC5 A;  2VQF O;  3AG4 C;  3JD4 A;  4FLV A;  2CTR A;  2HR3 A;  3MHH C;  1IUR A;  4GT1 A;  2PTM A;  4L8J A;  1VQL V;  4MT8 A;  1EN6 A;  2R9A A;  1KC8 W;  1H2G A;  4J80 A;  4DR4 B;  2DQ0 A;  5J2T B;  1BQZ A;  2UXB B;  1JR9 A;  1R6T A;  2ZR3 A;  4E2L A;  1TVK B;  4JI7 B;  3KKY A;  1EBO A;  1JPX A;  3CME V;  1Q3E A;  2EIN B;  3H1H H;  2DOS A;  3ZHU A;  1OCO C;  5H9C A;  2HJF C;  3UQ8 A;  1Q7Y W;  3E8F A;  1YI2 V;  1N33 B;  3G6E V;  2CTQ A;  2Q4P A;  1FFX A;  1EZV H;  4KXR A;  2Q0A A;  1DF4 A;  1G4Y B;  1M56 B;  3VQW A;  4DV0 B;  2DW4 A;  1Q82 W;  1OCR B;  1B3Q A;  1B06 A;  4PDM A;  4QE7 A;  5JJE B;  3K57 A;  3HKC A;  4MVQ A;  3CPW U;  3OR7 C;  4N23 A;  2XAG A;  5CA0 B;  3N2G B;  5LP6 A;  1NTK H;  4IHJ B;  3LDD A;  1MZE A;  3TET A;  1R6N A;  4RAI A;  1JVM A;  4LWS A;  4DUZ O;  1D2D A;  4W4L A;  3HKD A;  5IE9 A;  1AI6 A;  3ASN C;  1CP9 A;  4JZG A;  4OGQ B;  2JRI A;  1PNM A;  4DXW A;  3K5N A;  2DE0 X;  2Y0P A;  3B40 A;  4LP8 A;  4DV7 O;  4G2K A;  3K79 A;  4O4H A;  2HP8 A;  1OZ0 A;  3RYC A;  2ZE7 A;  1RP3 B;  5IWA O;  4NXM O;  1SQG A;  4R7C A;  1SQP H;  1K8A W;  1AIL A;  3MHS C;  4X20 B;  1KQS U;  3L73 H;  4JTA B;  2ZCE A;  1WB7 A;  3ZRW B;  5FLX N;  2D3O W;  2A79 B;  1AR5 A;  4N21 A;  5IJ0 A;  1Q81 W;  4J7K A;  1JCH A;  3O65 A;  4PI0 A;  2B1G A;  1QLN A;  2XAJ A;  2M7W A;  4P9P A;  3SYA A;  5LYJ A;  2E5L B;  4GKJ B;  1PKX A;  1LR1 A;  1QQC A;  2ZM6 O;  4BWA A;  2ZE5 A;  4F6E A;  5K1P A;  4DV5 O;  1IXB A;  3ABL B;  1J5E O;  3UO3 A;  2EIK C;  4J10 A;  3LSU A;  1F7Y A;  1Y76 A;  4MTO A;  4D6T H;  1QR8 A;  2Y69 B;  3BFR A;  1XUQ A;  1NVP B;  4DR5 O;  3HKE A;  2GSM B;  4A5U B;  4GX2 A;  5KA5 A;  1N32 B;  4GX0 A;  2W6J G;  3L70 H;  5EBL C;  2R70 A;  1K9M W;  4JI4 O;  4JV5 B;  3BPZ A;  4UCU A;  4H37 A;  3CC7 V;  4JI8 O;  4PHZ A;  5FPO A;  4CH5 A;  4ZI7 B;  3CSX A;  5B5E Z;  3K5L A;  3T4Z A;  2CH7 B;  4KUM A;  1XL6 A;  3CRR A;  4UVB A;  1L1F A;  4L87 A;  4EB6 B;  3FB6 C;  3WB0 A;  3ZHQ A;  1UFI A;  2DYS B;  1JA8 A;  3G6B A;  5BR8 B;  3EVK A;  3W7X A;  4X66 O;  4RUE A;  1M1K W;  2LFS A;  1RSO A;  1YCI A;  4WBN A;  5JJN B;  4LF6 B;  2CAZ C;  3LUT B;  5B66 Z;  3HPL C;  4I5S A;  4K0K O;  3AK2 A;  4UCV A;  3CXC U;  1WA8 A;  2UXX A;  2F4V B;  3TXQ A;  3DTU B;  4AHC A;  4TV9 B;  1BMF G;  1AJQ A;  3AG3 C;  2YIC A;  3NXS A;  2ZD9 A;  4U7O A;  5BZB A;  5EYP B;  3CRM A;  5B1A C;  3E8G A;  3ETD A;  4LFB B;  1I0H A;  1TGO A;  2LP7 A;  1MMM A;  5CBF A;  2YC0 A;  5B1O A;  3U0Z A;  5KHJ A;  2A9H A;  3SGI A;  4IIJ B;  2XUM A;  3B77 A;  2FB5 A;  1H2N A;  5L3E A;  1V54 C;  2ZE8 A;  3ZHV A;  2JJ2 G;  5EC2 C;  4I9Q A;  3CYO A;  3ABU A;  3UKM A;  1TAE A;  2Z5U A;  4WFE A;  1IX9 A;  1I94 B;  3B2E E;  4LF8 O;  3RYF A;  4UUJ C;  4DV3 O;  2JGD A;  5D5Q A;  4JI0 B;  1RM1 C;  4X1Y B;  1SES A;  2IW5 A;  1S77 D;  4K8X A;  2M6Y A;  1CPY A;  1AP5 A;  1AR4 A;  1XRE A;  3CP1 A;  1BHB A;  2YID A;  4I50 B;  2QWP B;  2Y0I A;  2IJJ A;  3FB8 C;  2OT5 A;  2G38 A;  3D36 C;  5CN0 A;  2AHY A;  1XBL A;  2EIM B;  4PDR A;  4BIU A;  3OR6 C;  3ABK C;  4MTX A;  4NXN O;  1NH2 D;  1BCC H;  4MVR A;  2ILM A;  4I55 A;  1RFY A;  3E22 A;  3RW0 A;  1ENV A;  2F43 G;  2RDC A;  1TUE B;  2UU9 B;  2Q6A A;  2WPD G;  4WFB V;  3WB1 A;  5CA3 A;  3OW2 U;  1SZT A;  2NNU A;  3TXS A;  3E8H A;  4ASU G;  2YXH A;  1FJG B;  1W0K G;  2L6L A;  3PJS K;  1DGS A;  1JFF B;  3ZN0 A;  4MTF A;  2WLL B;  1K73 W;  5CB4 B;  1EN4 A;  2AZ2 A;  1W2B U;  5EIB D;  2YI8 A;  4QNH B;  4PJ0 Z;  4YY3 B;  1SS3 A;  5EZY B;  1N36 O;  3CHX A;  2A7W A;  3J7A U;  3UT5 A;  2QEX V;  1VF6 A;  4I0X B;  1PV0 A;  4UB6 Z;  4EFB A;  3TJT A;  1O9G A;  2ZE6 A;  4H44 B;  1AJN A;  1BGY H;  2HG5 C;  1GM7 A;  4O4L A;  2JS3 A;  1X59 A;  2RMK B;  4DR3 O;  1VQP V;  3W7S A;  2R9R B;  5DEC A;  5ITZ B;  1OCZ B;  3BAB A;  4JI6 B;  1WPX A;  3UM7 A;  2GHY A;  1Q6I A;  3G67 A;  1YEW A;  3IC7 A;  1VQ7 V;  4K8Z A;  1QHT A;  1A32 A;  4HBN A;  1GO3 F;  1KUQ A;  1XNR B;  2GTA A;  5B1B C;  5JCO C;  1GAX A;  2GBO A;  2HHH B;  2Q5Z A;  2QSA A;  3L74 H;  1HNW B;  3KCY A;  3JAR B;  4YJ3 A;  1NBM G;  4ICG A;  5IT9 N;  4TOI A;  4O2B A;  4WFH A;  1P7G A;  1WP7 A;  2IH3 C;  3BY6 A;  3T1H O;  2DWE C;  3F7V C;  2EIL B;  2EIJ B;  4FLW A;  3A0R A;  2EJR A;  2QTO A;  4FVM A;  3HKB B;  3JSN A;  3L75 H;  3W7T A;  3D36 A;  2QM4 A;  1K4D C;  4QPK A;  4DR1 B;  4KFM A;  1N34 O;  4DR2 O;  1GKF A;  2CGO A;  2IU0 A;  5L3D A;  1Q86 W;  1Q5O A;  5CA1 A;  5B3S B;  2UXC O;  2ITD C;  1NQT A;  3P3N A;  1FS0 G;  5LA6 A;  4X1K B;  1L8D A;  2Q8V A;  4OXS A;  4D7S A;  1XL4 A;  4ZBM A;  4B3S B;  1H2L A;  1X4T A;  2ZNI A;  2WLM A;  3ZBH A;  2IM9 A;  1FXK C;  1GN4 A;  2QE7 G;  4LF4 B;  3JAT A;  4WFG A;  1AI5 A;  4CS4 A;  5A2Q N;  5CMU A;  1HW7 A;  4CS2 A;  3G4S V;  1BQ0 A;  2JJ1 G;  2WLN A;  5LL6 Y;  2YS8 A;  3AEI A;  1H8E G;  2UXD O;  2PY5 A;  3OMI B;  1Q8I A;  1BL8 A;  2ETN A;  1VQ6 V;  5LOV A;  1IVS A;  4JAA A;  3T1C A;  1Y74 A;  4MSW C;  3X2Q C;  4GCZ A;  4X64 O;  1G8M A;  1M56 C;  5KMG B;  3H1K H;  5JVD B;  4P9O A;  5BMV A;  2FL4 A;  4QGP A;  1GN2 A;  1MA1 A;  1K33 A;  2E75 B;  4JAS A;  1Q43 A;  1PD3 A;  2WLH A;  2HJD A;  2O57 A;  3MDS A;  5H6R A;  4B08 A;  4UB8 Z;  3AK3 A;  3ZMV A;  2F66 C;  3DC6 A;  1XHX A;  2ZIO A;  3OFN G;  4UCT A;  2HVK C;  1VQ4 V;  4JI1 B;  4TV8 B;  4NYK A;  2QWN B;  1W59 A;  5H6Q A;  3H1J H;  4FMT A;  5D5P A;  2CE4 A;  4J9Z B;  4QIW F;  3CS5 A;  3K9S A;  5LXT B;  2YXY A;  2XTA A;  1QLE B;  1H38 A;  2H8P C;  1I08 A;  2K1E A;  3U11 A;  3JD2 A;  5LP6 C;  2P22 C;  4U3F H;  1GN6 A;  3JAW A;  3FAV A;  1M90 W;  2QA4 V;  1AI4 A;  4OX9 B;  4O4J B;  3ZX6 A;  1NKD A;  2WLK A;  5KX5 B;  2BTQ A;  4AQY O;  4JI3 O;  5LGU A;  5C8Y A;  4HNA B;  1QVF U;  2N74 A;  4LFA B;  2W0F C;  4ZHQ B;  1FXH A;  4YIO A;  5IYC O;  2KB1 A;  4H0L B;  2KG7 B;  5JQG A;  2AZ0 A;  5LMU B;  3Q4H A;  3WU2 Z;  1EFR G;  2A06 H;  3C3T A;  4JPR A;  2CGN A;  4FM2 A;  3P32 A;  3MD0 A;  2WLJ A;  2JIZ G;  4MVO A;  4UVC A;  4DR4 O;  2FKX A;  2CK3 G;  1N8R W;  3ABL C;  4EFE A;  2UXB O;  4LC1 A;  5A9G A;  1E1Q G;  5J2T A;  4JI7 O;  1KKD A;  1FXK A;  5EBW C;  3K58 A;  1TVK A;  1N4C A;  4WFA V;  5GTI Z;  2LW1 A;  4D7T A;  1HDJ A;  2PI5 A;  4JYB A;  4DV1 B;  3VQV A;  4OPH A;  2JEU A;  2XAS A;  2Y4T A;  4TUY B;  4B3M B;  1N33 O;  2L35 A;  2YXL A;  5J2U B;  1JX9 A;  3OMN B;  1MSD A;  2P5O A;  1BS3 A;  4DV0 O;  1ZLZ A;  1WN7 A;  4LF5 B;  3RWR D;  4KHP B;  2E3C A;  1UPG A;  3K03 A;  3K59 A;  3APQ A;  3LSS A;  4FM0 A;  2X7R B;  3K06 A;  2GUZ A;  3K5O A;  2Q7E A;  3VOU A;  1YVW A;  3I5D A;  1I5X A;  1VQ9 V;  3N2G A;  4FFB B;  3R65 A;  1Q6U A;  3AG2 B;  4IHJ A;  1PL0 A;  2QR4 A;  2LGQ A;  2YIB A;  3DXR A;  1Z5W A;  2WSS G;  2B1I A;  4GLX A;  1O9H A;  5TIS Z;  1R3J C;  1S72 V;  3FYI B;  1GN3 A;  3CCJ V;  1KU9 A;  2Z3Y A;  5IY5 B;  5L3G A;  4B3R B;  5FPR A;  2LW7 A;  3B09 A;  3STL C;  4IYH A;  2A3Q A;  2ARH A;  3CCM V;  1SRY A;  4LF9 B;  1QU7 A;  1NH2 B;  2DWD C;  4X20 A;  4XDL A;  3ZRW A;  1DLB A;  3AG1 B;  5CBH A;  2ZQM A;  1IBK B;  3CD6 V;  5F2V O;  2AGA A;  2E5L O;  4GKJ O;  4WCE V;  1BZK A;  2IBZ H;  1WB8 A;  2YEV A;  3SPC A;  1WPB A;  4DW0 A;  3GWK C;  2Q7H A;  5IYZ B;  3HKD B;  5C93 A;  3ZRX A;  4BAY A;  2ZXW B;  4HAM A;  2JGU A;  1JOY A;  3IAY A;  2YSU B;  2QJ1 A;  2H94 A;  1N32 O;  1R3I C;  5IYB O;  2R9I A;  2Q69 A;  3ZRV A;  4JV5 O;  4DR7 B;  3O9O A; 
#chains in the Genus database with same CATH homology
 3FB8 C;  1M9N A;  2C2A A;  2OT5 A;  3GWO A;  2XAQ A;  3I56 V;  4PEL A;  3EFF K;  3T4D A;  4JTC B;  5CN0 A;  2AHY A;  2EIM B;  4PDR A;  2DYR C;  4RUF A;  4BIU A;  3OR6 C;  3CCU V;  2IH1 C;  3OE7 G;  3FKS G;  1Y66 A;  3ABK C;  1AJP A;  4MTX A;  5LHI A;  2DYR B;  3WG7 C;  1NH2 D;  4MVR A;  1VQM V;  3QO8 A;  4MS2 A;  5DM6 V;  3CMA V;  1YIT V;  2X6C A;  4UV8 A;  3RW0 A;  3W7U A;  1ENV A;  3F7Y C;  2F43 G;  1M57 B;  1TUE B;  2OCC C;  2A0L A;  1GM9 A;  2P6J A;  2Q6A A;  2WPD G;  3D3I A;  4WFB V;  5CA3 A;  3STZ C;  1FXK B;  1BHA A;  3OW2 U;  3F5W C;  4XDJ A;  1SZT A;  2NNU A;  1VQO V;  1ZWI C;  3E8H A;  4ASU G;  1W0K G;  2ZR2 A;  1FFT B;  4TT3 G;  2DYS C;  3PJS K;  1H8H G;  3ZN0 A;  3TK1 A;  1E1R G;  4MTF A;  3AG2 C;  2WLL B;  3FB7 C;  3OUS A;  3CCS V;  1K73 W;  2V7Q G;  2P90 A;  1SET A;  3SYO A;  3JD3 A;  1W2B U;  3VBB A;  1OCO B;  1RPR A;  4QNH B;  1KD1 W;  2AHZ A;  1J95 A;  5J9P C;  3X2Q B;  3FYE B;  1YJW V;  2QEX V;  2WWW A;  3RVY A;  1AJN A;  2HG5 C;  3SJQ C;  1GM7 A;  1MSW D;  2HKO A;  2ZDI C;  5KA6 A;  3SYP A;  3W7W A;  1VQP V;  3W7S A;  4Q20 A;  1ROP A;  4MVU A;  4R6Z A;  2R9R B;  2JK5 C;  3K3W A;  2XAF A;  3T2M A;  1OCZ B;  4PA9 A;  5CBG A;  1MAB G;  2BOC C;  4CBC A;  1K4C C;  1WPX A;  3UM7 A;  2GHY A;  2B5U A;  3ZN1 A;  3FB5 C;  3OEH G;  3IC7 A;  1VQ7 V;  1VQN V;  4Z1M G;  4WF9 V;  4KP4 A;  3OAA G;  2WAM A;  1GO3 F;  2IU3 A;  3SPH A;  1S0V A;  3CC2 V;  3LDE A;  1GM8 A;  5L3F A;  3ABT A;  5EC1 C;  4P30 A;  3ABM B;  5B1B C;  3ASN B;  4JAU A;  4RQF A;  1AR1 B;  3JYC A;  4TSF G;  1VQ5 V;  1YSC A;  4ZKI A;  1NR1 A;  4JYC A;  2QKS A;  2ZXW C;  1F51 A;  1NBM G;  1K34 A;  1YTF B;  4FJC C;  3ASO C;  4WFH A;  2Y48 A;  3BY6 A;  2IH3 C;  2P67 A;  3K04 A;  4XDK A;  2EIL C;  2DWE C;  2EIJ C;  3F7V C;  3ASO B;  3H01 A;  1OCC B;  2IJH A;  3ZCC A;  1QR9 A;  4MVS A;  3CCQ V;  3JD0 A;  2EIL B;  2EIJ B;  3A0R A;  4X89 A;  2XND G;  2MK3 A;  5L3B A;  4MW3 A;  2P7T C;  2EJR A;  2QTO A;  3OEE G;  1ORQ C;  2Q67 A;  3W7T A;  3D36 A;  3KG2 A;  1K4D C;  4QPK A;  1YIJ V;  4KFM A;  4BW5 A;  3OMA B;  3QNE A;  3CCV V;  3RVZ A;  2YEV B;  3B8M A;  5B3S C;  1GKF A;  2EIM C;  1JJ2 U;  2HLD G;  2IU0 A;  2LFR A;  2ATK C;  5L3D A;  1S5H C;  1Q86 W;  3CC4 V;  5B3S B;  1K3E A;  2IJK A;  5FL7 G;  2Q68 A;  3B8N A;  3AG4 C;  1KP3 A;  2ITD C;  1NQT A;  3JD4 A;  5GW7 A;  3SPI A;  1FS0 G;  2HR3 A;  3MHH C;  3JCZ A;  2HFE C;  4GT1 A;  4OXS A;  1XL4 A;  3AG4 B;  4ZBM A;  1VQL V;  4MT8 A;  1M57 C;  2EIK B;  2WLM A;  5B1N A;  1KC8 W;  1H2G A;  1FXK C;  2WLL A;  2DQ0 A;  2QE7 G;  3K9A A;  4WFG A;  1AI5 A;  5CMU A;  2ZR3 A;  3G4S V;  4E2L A;  2JJ1 G;  1VQK V;  2WLN A;  1EBO A;  3CCL V;  2OTJ V;  3AEI A;  1H8E G;  1JPX A;  3CME V;  3OMI B;  2EIN B;  1GK9 A;  3ZMU A;  3SPG A;  1GTO A;  1BL8 A;  1OCO C;  1VQ6 V;  2FTK A;  1NJI W;  4JAV A;  5H9C A;  2HJF C;  3CCE V;  1DTO A;  1THZ A;  3E8F A;  3T1C A;  1Q7Y W;  1YI2 V;  4MSW C;  3G6E V;  3X2Q C;  2X0L A;  4FPP A;  4GCZ A;  1DF5 A;  4CZZ A;  1YTF D;  1F4M A;  1G8M A;  1M56 C;  1V55 C;  4MTG A;  4P9O A;  3ETG A;  4UV9 A;  4DO2 A;  3HB3 B;  1DF4 A;  2ZDI A;  1G4Y B;  3E86 A;  1M56 B;  1K33 A;  1V55 B;  4JAS A;  1K97 A;  1PD3 A;  2WLH A;  2DW4 A;  5H6R A;  1Q82 W;  5LHH A;  1OCR B;  4QE7 A;  4PDM A;  3ZMV A;  2X6A A;  1QVG U;  3OFN G;  1KEC A;  2HVK C;  1VQ4 V;  4MVQ A;  4PA6 A;  1P7B A;  3CPW U;  3OR7 C;  2EZP A;  4GX5 A;  4N23 A;  2XAG A;  3K08 A;  2QM7 A;  1OCZ C;  3OGC C;  3IGA C;  5H6Q A;  4UXN A;  3ZMS A;  4FMT A;  4TWK A;  1IXM A;  4J9Z B;  4QIW F;  4X8A A;  1YHQ V;  3ZRS A;  3LDD A;  3P30 A;  1QLE B;  3ZMT A;  2W6I G;  1H38 A;  2H8P C;  5IYD O;  3TET A;  1R6N A;  5HFL A;  2K1E A;  2V1D A;  1JVM A;  4RAI A;  3JD2 A;  2EBO A;  4J9Y B;  2XOK G;  3ABM C;  1OHH G;  4U7N A;  4YXW G;  1AI6 A;  3ASN C;  2QA4 V;  1M90 W;  1AI4 A;  5EK0 A;  3OUF A;  3CCR V;  1NKD A;  1CP9 A;  3EHB B;  2ITC C;  2WLK A;  3SYC A;  4XBF A;  2HVJ C;  1Y4M A;  1PNM A;  4DXW A;  1I5Y A;  1WLE A;  4LP8 A;  3AG3 B;  3K79 A;  4G2K A;  4PA3 A;  1OZ0 A;  4PDV A;  4HZ3 A;  5LGU A;  1S3J A;  4R7C A;  5LHG A;  1QVF U;  1OCC C;  1K8A W;  2W0F C;  2WLI B;  1KP2 A;  3MHS C;  1KQS U;  4LCU C;  1FXH A;  5IYC O;  4JTA B;  1AI7 A;  2KB1 A;  3E35 A;  3ZRW B;  4QE9 A;  1HWY A;  4PA7 A;  2D3O W;  1VQ8 V;  2A79 B;  1EFR G;  4N21 A;  1Q81 W;  1K92 A;  1JCH A;  4GX1 A;  4JPR A;  1V54 B;  2B1G A;  3P32 A;  1QLN A;  5LGN A;  2XAJ A;  3GB7 C;  2M7W A;  3MD0 A;  4P9P A;  2WLJ A;  2JIZ G;  4HYO A;  3SYA A;  4FIP C;  4MVO A;  2UXN A;  3TCU A;  4UVC A;  1PKX A;  4WFF A;  2CK3 G;  1N8R W;  2DQ3 A;  5IDJ A;  3ML0 A;  3ABL C;  1ARO P;  1EZJ A;  4LC1 A;  1E1Q G;  1KKD A;  3ABL B;  3JD1 A;  1FXK A;  1RM1 B;  5EBW C;  2EIK C;  3QO7 A;  5LBQ A;  4WFA V;  4MTO A;  2PI4 A;  1RPO A;  4MVM A;  1QR8 A;  2Y69 B;  1R73 A;  2PI5 A;  4JYB A;  4JTD B;  2JEU A;  2XAS A;  4FK5 C;  1NVP B;  1P4R A;  2GSM B;  1GMG A;  4GX2 A;  5KA5 A;  4GX0 A;  2W6J G;  1JX9 A;  2EIN C;  3OMN B;  4P2Z A;  5EBL C;  3ZJZ A;  3M99 B;  3E89 A;  4I9W A;  1K9M W;  5KUM A;  1K7D A;  4H37 A;  3ABK B;  3CC7 V;  3WG7 B;  4MW8 A;  3SPJ A;  4F4L A;  3K03 A;  3WFV A;  3ETE A;  3OM3 B;  3K0D A;  3E8B A;  1JQ0 A;  3LSS A;  2X7R B;  1R3L C;  1W0J G;  3K06 A;  2OCC B;  3T4Z A;  3VOU A;  4KUM A;  1XL6 A;  4UVB A;  5LGT A;  1L1F A;  1I5X A;  4L87 A;  1VQ9 V;  1QBZ A;  3LSQ A;  1OCR C;  3FB6 C;  3R65 A;  1YJN V;  2DYS B;  1COW G;  3LNM B;  4QJF B;  1CEZ A;  3ZIA G;  3AG2 B;  1PL0 A;  1F4N A;  3G71 V;  5EBM C;  1NR7 A;  3W7X A;  2WSS G;  2IJI A;  2B1I A;  1M1K W;  4G27 B;  4RUE A;  1PNL A;  2LFS A;  3E83 A;  2OTL V;  1QLE C;  1R3J C;  1UJW B;  4PA4 A;  3LUT B;  5IY5 C;  4JF3 A;  3HPL C;  1S72 V;  3FYI B;  4I5S A;  3CCJ V;  2JEX A;  2Z3Y A;  5IY5 B;  5L3G A;  1SER A;  5DN6 G;  4RO2 A;  3CXC U;  3BEH A;  3IFX A;  1R3K C;  3STL C;  2UXX A;  5HFM A;  3CCM V;  1SRY A;  3QO5 A;  1NVP D;  1NH2 B;  3DTU B;  2DWD C;  1MG1 A;  1BMF G;  2WLI A;  1AJQ A;  3AG3 C;  3NXS A;  3ZMZ A;  2NLJ C;  2ZD9 A;  3AG1 C;  4U7O A;  4XDL A;  3SYQ A;  1MOF A;  1R6K A;  1FXV A;  3ZRW A;  1LNQ A;  1DLB A;  5BZB A;  1YJ9 V;  2X6B A;  3AG1 B;  5CBH A;  2ZQM A;  3I55 V;  4UVA A;  3LDC A;  3E8G A;  5B1A C;  3CD6 V;  3ETD A;  3RBZ A;  2LP7 A;  1QCE A;  5CBF A;  5B1O A;  5B1A B;  2A9H A;  4R50 A;  4WCE V;  4X88 A;  3B77 A;  3K0G A;  5L3E A;  2YEV A;  3SPC A;  1V54 C;  5B1B B;  4BIZ A;  2JJ2 G;  4LBE C;  1B6Q A;  1K5S A;  3DGE A;  3CYO A;  4R8C A;  5EC2 C;  3ABU A;  3UKM A;  5C93 A;  2Z5U A;  3ZRX A;  4WFE A;  1E79 G;  4H33 A;  4BAY A;  1F23 A;  4QPJ A;  2ZXW B;  4RQE A;  4HAM A;  4UUJ C;  1JOY A;  2JDI G;  2YSU B;  4EKW A;  1RM1 C;  2H94 A;  1SES A;  2IW5 A;  4JGS A;  1S77 D;  1R3I C;  2EZO A;  2R9I A;  5IYB O;  2Q69 A;  1CPY A;  4G28 B;  2Y69 C;  3ZRV A;  1S76 D;  3CP1 A;  4MVZ A;  5KUK A;  1BHB A;  1PNK A;  3E2E A;  2BOB C;  5E1A C;  4PDL A;  5L3C A;  1K5Q A;  2IJJ A;  2QM8 A;  2XAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...