3H01A

Structure of the c-terminal domain of a putative hiv-1 gp41 fusion intermediate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
54
structure length
54
Chain Sequence
EWDREINNYTSLIHSLIEESQNQQEKLEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Envelope glycoprotein gp160
publication title Role of a putative gp41 dimerization domain in human immunodeficiency virus type 1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
total genus 24
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3h01A00
3MHSC 1QCEA 1QR9A 1QR8A 4FIPC 2EBOA 1EBOA 4FK5C 5HFMA 3H01A 4FJCC 1Y4MA 2M7WA 1ENVA 1MG1A 2EZPA 3M99B 2P6JA 5CN0A 1SZTA 4N23A 4JF3A 2MK3A 1Y66A 3K9AA 5CMUA 3GWOA 3B77A 1JQ0A 1QBZA 5H9CA 3CYOA 3P30A 1I5XA 4JPRA 3B8NA 5KA6A 1DF5A 1JPXA 3MHHC 5HFLA 4N21A 2OT5A 4E2LA 5KA5A 2X7RB 1DF4A 1MOFA 4G2KA 1K33A 2EZOA 2LP7A 1DLBA 1F23A 1K34A 1I5YA 3CP1A 3WFVA 4JGSA 3B8MA
chains in the Genus database with same CATH superfamily
1P4RA 3QTCA 4F4LA 3JD4A 1XHXA 4RO2A 1JFFA 1MNGA 1YVWA 5CBHA 3HKCA 4JI8O 4UCSA 1DK1A 4JYYA 2BTOA 4RQEA 2JRIA 2A9HA 3ZS8C 3PJSK 5FNVB 1N4CA 1QR9A 3OTOO 4DV7O 5DEDA 2HP8A 4OPHA 4WFFA 1HDJA 4JI8B 2ZM6O 2EINC 3ZCCA 2E5LB 1ZUQA 2FKXA 3SJCC 3H1IH 2QA4V 3OE7G 4K8XA 1QBZA 4D6TH 3E35A 4PA4A 4JAAA 1SS3A 1R3IC 2N04A 3EFFK 4PV1B 2ZM6B 5FLXN 1R6TA 1VQLV 5B5EZ 3CX5F 3CCSV 4QGPA 3R65A 2EIJC 2IU0A 2OTLV 1SRYA 3CRAA 4JAVA 1N32O 5IY5B 1OCOB 4TQDA 4GT1A 3B8NA 2KQXA 1BHBA 4B3SB 4YJ3A 1VIBA 2F23A 1GO3F 3N2GB 3CMAV 1P7BA 3UQ8A 2YXYA 4GKJO 3JAWB 1XNQB 1VF6A 1SA0A 1RFYA 3E83A 5LHGA 1G4YB 3RYCA 4CH5A 2CDYA 4PDVA 4J9YB 3FKSG 4X66O 3GVMA 2LFRA 1AI5A 3THOA 2OWOA 1OCZB 2HR3A 2DMXA 3FB7C 2Q7GA 1WB8A 4PA6A 5H6QA 1QCEA 3ABLB 2ZE6A 5CBGA 1KD1W 1VQ5V 2YEVA 2JGUA 3I56V 4WBNA 4I50A 4CH3A 2IM9A 3W7SA 2LGWA 3RVYA 4X1IA 5TISZ 4X64B 1JOYA 1SETA 1KBHA 2QWNB 2HJDA 5KAIZ 1I08A 5C8YA 4TSFG 2P7TC 4TUYA 4NXNO 2QTOA 1COWG 4LR3A 4JYCA 4UCVA 2BOCC 4NTYA 3WB0A 3CPWU 3B77A 2FTKA 3TK1A 2ZXWB 4JYAB 1SERA 4IHJA 3SR2C 4NXNB 1EZVH 4JI4O 1WPBA 2QM7A 2EJRA 4J7JA 4TV8A 4JI0B 1AI6A 2ZE5A 3PN1A 2P67A 3HKBA 3N2KA 1JQ0A 4JI4B 3FYIB 1H2MA 4O4JA 2WLMA 1RM1C 5HFLA 1NVPB 4DV6O 2Y0PA 1L0LH 3VOUA 2JGDA 3RW0A 5HFMA 5KUMA 2PUSA 2DWDC 3A0BZ 4JI5O 1VF6C 4MTGA 3JD3A 3OUSA 1OCCC 3RBZA 5LA6B 3MDSA 3HB3B 4ZKIA 3CEIA 5DN6G 4NTXA 1K33A 4DR6O 1VQ6V 5A9GA 1TUBA 2Y69C 2ZCEA 5LHIA 4LFAB 4FJCC 1MG1A 4L8JA 1OJHA 5CMUA 2CTWA 4DR6B 5GTHZ 3ZJZA 3H1JH 5JH7B 5K1XA 5LBQA 2UU9O 2QTSA 1ZWIC 1N8RW 2HVJC 3SYPA 2RDCA 2Q67A 3CS5A 1HR0B 3CSXA 2QGNA 4P30A 4DV1B 3R66A 4JTAB 4O4IA 1GAXA 3D3QA 5A2QN 1MA1A 1XBLA 2QWRB 1PPJH 4QPJA 4IYIA 1FYJA 4LFCB 1TVKB 1URFA 2DYRC 3K9SA 2BTQA 4O4HA 1ZL8A 2JJ1G 4DV3O 3APOA 4PD4F 4XDJA 1WPXA 4UB8Z 5JCOC 2KB1A 1M9NA 1VF7A 2F66C 1AJPA 3ABUA 4YJ2A 4F6RB 4J41A 3ASOB 1BL8A 2DW4A 2YI9A 1M56C 4DV3B 3OTFA 1K9MW 4QNHB 3SJQC 3STLC 1BGYH 2GUZB 1EN5A 2YIBD 4CC6A 4LF7O 2WLIB 3JALB 3HR0A 2EIKC 4HAMA 4KFMA 4QIWF 3DC6A 1XHZA 1S5JA 3IJ4A 2QKAA 4LF7B 1FD9A 4H13B 3DXRB 1R3LC 1VQPV 3T1HB 2Q9LA 3ZRVA 2OCCC 3JYCA 5B1NA 1NT2B 2YIAA 3VQYA 1N36B 3KCYA 1SQFA 2Q5ZA 2ITDC 4UFZA 5JWPA 4OX9B 2E3CA 3T2MA 1KQSU 4C7UA 1AR4A 1TAEA 3Q4HB 3OM3B 4FPPA 1GN4A 5FNVA 1VQ4V 4X9QA 1FKAO 1BSMA 2DYSB 1I5XA 2UUBB 3IFXA 1JVMA 4PDMA 1MABG 2IJJA 4FFBB 4JGSA 2YICA 1QLNA 1Q90D 2WPDG 5DECA 3W7WA 4EB6B 1M57B 3K5OA 2EULA 4R6ZA 1YXBA 1RP3B 1ZTEA 3AG3C 4JI3B 1EM1A 1WA8B 4KHPB 1P49A 5E79Z 2EZOA 4YIOA 5EK0A 3ZHTA 4WBNB 3K58A 4B3RO 4HBNA 1MMMA 1AR1B 4PA3A 1QHTA 3E86A 4WF9V 1EZJA 3QO7A 1BQ0A 2HG5C 3N2GA 3EHBB 4UVAA 3VQWA 2HKOA 2RNBA 3JAWA 1OCRB 1SKVA 3T4DA 2QEXV 4WFGA 2YDEA 3WG7B 2WLJA 1TGOA 1NZ6A 3HKDB 4FIPC 1GK9A 1EBOA 1Y6XA 4MT8A 3OAAG 4DW0A 4LF5O 4PDLA 4BIOA 3FX7A 5JJEB 1D2DA 4GYCB 4MVZA 4DR2O 4JI1O 4HZ3A 4Z2WA 2EILB 2FL4A 5KAFZ 3K0GA 1DLBA 1K4CC 1PM9A 1AR5A 3RT3C 3CCVV 2F43G 4JI1B 3K79A 1HNWO 4LF4B 1XQ8A 5L3BA 1SZTA 1UFIA 3ZMVA 1XNRO 4DV5B 4J10A 1S3JA 1IXBA 1YJNV 2AZ0A 3SPIA 2ZT9B 3LSUA 4OGQB 1IBLO 3OUFA 4FLZA 2V1DA 5K1PA 4I55A 4K3AA 4X8AA 2RCVA 2CTQA 3ZRSA 4P9PA 2HHHO 2BSKB 2ILMA 2F95B 3MD0A 2YUAA 1OV9A 3ZMZA 2G38A 3G4SV 5IY5C 1OCOC 2VQEB 3ASNB 1G1XB 2Q7HA 4H0LB 4N23A 1MSWD 3L73H 4X65B 5EC1C 2X6CA 5B66Z 4K8ZA 5DM6V 3AG2B 3K0DA 2W0FC 4UCOA 4LNUB 5BR8O 3L75H 1G6UA 2X7RB 1MOFA 2Z5UA 4PJ0Z 4GUNA 3ABTA 4JI6O 2P4KA 1AP6A 4DR5O 4ZHQA 5IDJA 4ZOLB 4J7ZA 1H2SB 2Q6AA 2DQ3A 2JS5A 1OCZC 4YIPA 2MK3A 4LFBO 1JA8A 3ABLC 1KB9F 2Q0AA 3STZC 1WN7A 2UXBB 3RFRA 5KA5A 1SQVH 1ZSPA 3I5DA 1K92A 2BCCH 3JATB 2ZNJA 1XMOB 1F51A 4DW1A 3H1LH 5JH7A 4BW9A 2R9IA 5EZYA 5LOVB 3ABKC 4UCTA 2P06A 4J11A 2E76B 4IGGA 4WFHA 4MTFA 3G6BA 4J9ZB 2NLJC 5KUKA 2P5OA 1XMQO 2Q0OC 3BY6A 2ZXWC 1TVKA 4UUJC 5IE9A 2LFSA 2WAMA 4EEQA 4AILC 4P9OA 1GM7A 2AW9A 1L0NH 4JZ2A 5CA0B 4MS2A 4AHCA 1YIJV 1AB3A 1FXKA 2YXLA 1VF5B 2W0XA 4F6RA 3JAMN 3OW2U 3BAAA 3FAVB 1XEQA 2GBOA 5KHGA 1AI4A 1B04A 2GUZA 2EZPA 4UXNA 1W0JG 2WLIA 3JALA 1J5EO 1Y66A 3W7TA 2QE7G 3CC4V 3OTOB 2F1MA 4DV7B 2WLLA 3L70H 4X62O 1NH2D 1SQXH 1ROPA 2ZR3A 3JD1A 4GKKO 1J5EB 3RYHB 4B3TO 3DXRA 4UVBA 1D5AA 4FZ0A 3K06A 3P32A 3TETA 2HFEC 1N34O 4U7OA 1GH6A 1US6A 1IBMO 1KP2A 4X62B 5B1BB 4GKKB 4K0KO 3EVKA 4E2LA 1U96A 3HKEB 3Q4HA 4DR1O 4B3MO 2Q73A 1N34B 1VARA 1N32B 2QJ1A 5LYJB 2UUCO 2QR4A 4FFBA 4YHHO 2JVDA 2R70A 4DR1B 2IU3A 4UCUA 3ETDA 4F6EA 4GKJB 3FD9A 4EB6A 1Q43A 1IVSA 3VBBA 1BT8A 1K34A 1THZA 5C93A 4DUZO 1R1BA 2HLDG 2QDOA 1IXMA 1Y76B 1QR8A 1WA8A 2EBOA 5B1AC 1Y4MA 5EBMC 4JAUA 3BA8A 4BIZA 5ITZB 4X66B 4AI8A 3CCMV 1Y74A 3M7MX 4DUZB 5KA6A 1XREA 2P22C 3SDLA 1GN3A 5BMVB 3ABKB 4G28B 1PV0A 3JCUZ 1F23A 3ASOC 5CBFA 1WP7A 3A8TA 1BQZA 5EYPA 2PF4E 2FB5A 1PNLA 1I0HA 3ETQA 4DUYO 1NS1A 2OCHA 3WB2A 2ZIOA 3HKDA 4AQYO 3CYOA 2H8PC 3MHHC 4JTCB 2Q69A 4I55B 4DV4O 2X6AA 5J2TB 4U7NA 3F7VC 3OR7C 3QO8A 4UB6Z 1Y67A 1WLEA 3VQXA 2AHZA 1YZBA 4Z1MG 5GONA 4MTOA 1YTFB 4O4LA 3C3SA 2DQ0A 4JF3A 3G6EV 1P7GA 2RQ6A 2EIMB 1JX9A 4A5UB 3ML0A 1CXZB 1JJ2U 1R73A 1YI2V 3JSNA 3RYFB 2A06H 4R7CA 1X4TA 2HJFC 1H2NA 2DYSC 5KHHA 3JASB 1ENVA 3ZX6A 2LW1A 3K9AA 4DV6B 2WLKA 2GDSA 1I94O 3TCUA 4PDRA 1UJWB 4ZHQB 2R9RB 2R72A 4FLUA 4KL1A 1M57C 4JI5B 2UXCO 2IJHA 2HEPA 5B3SB 2BSKA 5KHKA 4Q20A 4QJFB 2LW7A 3E8HA 4DYLA 2CGNA 3ZHRA 5L3GA 1IZ3A 3BFRA 4DR7O 1NR1A 3IC7A 3RYIA 3CCQV 1Q81W 1BMFG 2DN9A 4PA7A 1CP9A 1Z5VA 3C90A 3OMIB 4ASUG 4TWKA 5EZYB 4MVQA 2Q7EA 2ADQB 3WFVA 1K7DA 5JJJB 2R9AA 1HNXO 3ZN0A 4GCZA 4LNUA 1HNZO 1OCRC 2XASA 3WG7C 1F7YA 1SQPH 2UU9B 1QNMA 1VQKV 5B1AB 1HNXB 2OT5A 4ZOLA 1NJIW 3BPZA 2XNDG 3E89A 3CCJV 2QM8A 4X1YB 2EILC 3BRCA 4WCEV 1FXKB 4DV2O 2QKCA 1T5EA 3JATA 2ZIMA 3T4ZA 1H38A 3ZIAG 2K1EA 3K59A 2ODMA 5LOVA 5IYBO 5JQGB 1XI1A 4B08A 2Y4UA 1SESA 5CA3A 2A3QA 1AILA 4CS4A 3G80A 1G8MA 1VQMV 1N33O 2IJKA 2WLLB 5LMUO 3AG1B 4OXSA 1LUVA 2WA3A 4DRXB 4QE9A 4PELA 5EIBC 5CA0A 2XUMA 3O65A 3B4SA 4DK1A 4PI2A 5IYZB 2XAHA 5LMUB 4FFKA 1R6NA 2IW5A 3FAVA 1CEZA 4RWUA 3A0RA 1QU7A 5D5PA 3OMAB 3KZIZ 4X20A 3ASNC 4DR3O 2VQFO 1F4NA 1K8AW 5BXZA 2P4VA 1SZXA 4J80A 3AG2C 4FLVA 4LWSA 5L3CA 1Z2GA 1BE3H 4KUMA 4TQFA 1BS3A 4DR3B 3T1YO 1B06A 2H3OA 1HW7A 3I55V 2VQFB 1KKDA 2ZKOA 3BEHA 3L72H 2AXTZ 3RYHA 3TJTA 3SPGA 1Q86W 2K9PA 3D3IA 4R50A 1H8HG 4W4LA 4I4TB 1GTOA 3CP1A 4GLXA 3S3WA 4DR4O 3CCEV 3OR6C 1Y74B 1YEWA 2WWWA 3CB2A 2CH7B 3E2EA 2E75B 3HKEA 4XBFA 4RUFA 5IYDO 1YJWV 3E8GA 3GB7C 4O2AB 4MVRA 3CHXA 5EYPB 2ZE8A 4MW3A 1Q82W 1QQCA 3D36A 2QWQB 5LYJA 3DGEA 4B3RB 1SQGA 2BOBC 2PTMA 1FFTB 3L71H 3MHSC 3U10A 2B5UA 1W59A 1YSCA 2WA4A 2N05A 4GZRB 1VMGA 2PYLA 3CE2A 1Y76A 2NN4A 5FPOA 2W6JG 3AG7A 5KLVH 3IAYA 2CTRA 2E74B 5GONB 4J42A 3K08A 4I7ZB 4JI2O 5ITZA 4MTXA 3AG4B 2Y48A 4O4LB 1Q6IA 3K5NA 4LF5B 4LF8O 2RJZA 4DR2B 1NQTA 1W2BU 5BMVA 1H2KA 1SQQH 4NKGB 1R3JC 1YDXA 4JI2B 2QWPB 3K03A 4DV0O 4UV8A 5J2UB 4QPKA 2ZNIA 1HNWB 1J95A 4ABMA 2W6IG 5LGUA 3E8BA 1K4DC 1DGSA 1XNRB 2DE0X 2FYUH 5GW7A 2C2AA 5F2VO 2ZE7A 5J2TA 4B7EA 1IBLB 4XDLA 5H9CA 3ZMUA 3TGUH 1VP7A 3W7UA 2X0LA 3E8FA 4WFAV 3FFQA 3B40A 4FM1A 1V55B 5B1BC 3RYIB 2CTPA 2HHHB 3CD6V 2B1IA 5H6RA 4NXMO 4MVOA 3RYFA 4L87A 5LXTA 5LMNO 1PKXA 2CUGA 4E4EA 1QLEB 3SJBC 2F4VO 3JASA 1KUQA 1QVFU 1JMKC 4EFBA 4BIUA 4FLXA 1P84F 3JSLA 4H44B 2JJ2G 3D36C 4JI7O 1NU1H 1PP9H 4X1KB 3SPHA 1RPRA 2F4VB 3IC9A 2XAJA 1H2GA 4NR1A 5BR8B 4JI7B 3BVOA 2OTJV 4JPRA 2UXDO 1E1RG 3LDEA 4JI6B 1KC8W 1FFXB 3SPJA 4DR5B 4W4KA 1H8EG 1OZ0A 2YXHA 4IYHA 3CWBH 1MZEA 4B7KA 2CGOA 2YIDA 1S76D 4LFBB 3QF7A 1GM8A 3UKMA 2M7WA 1FPOA 5IJ0B 1AVMA 1KP3A 3BA9A 1NI8A 3OT7A 2PY5A 4NTWA 3NXSA 1JPXA 1VQ8V 3CRCA 1DF4A 3TXQA 2UUAO 1IBKO 1D5NA 3K3WA 2UXNA 2YIBA 1XILA 2IH1C 4DO2A 2ZQMA 4TOIA 2Q4PA 3J7AU 1PNKA 1PL0A 1V54B 2KSDA 4MSWC 1IBKB 3U11A 1XMQB 4WFBV 4CBCA 1LUWA 1PD3A 4X88A 1ZX3A 4MVSA 4X1YA 2D2CB 5IYCO 1RPOA 1R6KA 4HNAA 2EIMC 3J80N 2A0LA 1EFRG 3SYOA 4MW8A 4X20B 1I7FA 4LH7A 5JQGA 1E1QG 3SYQA 1BZKA 2WLNA 4U3FH 2E5LO 4OPAA 3OFNG 4I5SA 4ZI7B 1N0JA 4LWSB 2LP7A 3QG5A 3A2FA 4LF6O 1NR7A 1CPYA 3X2QB 2UXXA 2ITCC 2JEUA 4DRXA 2F93B 3FB8C 2JS3A 5LP6B 4LF6B 5B3SC 2NNUA 3F5TA 5IYZA 1DF5A 1NTZH 4IIJB 3DTUB 4MVMA 4FLTA 4G27B 4B3TB 4BR6A 2VWJA 1MZFA 3OEHG 3TXSA 5KX5B 4EFEA 4B3SO 2IJIA 2VRZA 2HVKC 1Q6UA 4X89A 1H2LA 1IBMB 1B6QA 3JARA 3ZEDA 1XNQO 4LC1A 3LNNA 1JR9A 4K0KB 1Q7YW 1DTOA 4PA9A 2AHYA 2BE3A 1AJQA 2QWOB 4B3MB 2YS8A 3ABMB 1VQOV 1VEWA 2UUCB 4YHHB 1SC5B 3P3NA 1FAFA 1R3KC 3RWRD 2DJVA 4CC5A 2JIZG 4I4TA 2GTSA 3FB6C 1K73W 2Y4TA 3FB5C 4IT5A 1W0KG 2CH7A 4LH6A 1SQBH 2Z3YA 1FXKC 3C3TA 3AK3A 4O2BB 4TV9B 4O2AA 4X64O 1VQ7V 5CB4B 2OIEA 3LDDA 4P2ZA 4YXWG 1A32A 1AROP 1GM9A 3GWOA 2OYQA 3ZBHA 4RQFA 1K97A 1FS0G 1VQ9V 4RAIA 3KKYA 5KMGB 4JZGA 3BABA 5GTIZ 4JYAO 3AG1C 3AEIA 4DUYB 2GTAA 1IX9A 3LNMB 3UO2A 2VWKA 3UM7A 4AQYB 3ZN1A 4JI0O 3SJAC 1RSOB 4LBEC 1LNQA 4DV4B 1S77D 2CK3G 3IGAC 3WB1A 1EN4A 3K5MA 3CCUV 3OGIB 3SGIA 3UT5B 5CA1A 1WP8A 1X59A 2IBZH 1NKDA 1QVGU 5JCOA 5LXTB 2DWEC 2A7WA 4JYBA 3JCZA 3CJHA 1KKCA 3JAKB 4I0XB 4D7TA 5J2UA 1ZAUA 3LSSA 3P3PA 2NR5A 4LP8A 2KKWA 4GX2A 4N21A 4KP4A 5JJNB 2EINB 3E22B 2KG7B 1Q8IA 1I94B 3JD0A 4KXRA 2B9ZA 2AZ2A 2EJ7A 1YTFD 3L74H 1JCHA 4LFAO 2RN9A 1XUQA 3F7YC 2UXCB 3HPLC 3F5WC 1GKFA 3UCSC 2RMKB 3G67A 2QM4A 2EIJB 1NVPD 3LSQA 3J81N 1E79G 1L1FA 1M1KW 4DR7B 4PI0A 4UVCA 2QKSA 1U97A 1HR0O 4DV1O 1Z5WA 2JK5C 2LO1A 4X1KA 3CXHF 4GX5A 3CRQA 4FLWA 2XAGA 5IJ9A 1HNZB 4LFCO 5KHIA 1PNMA 2ZDIA 3B09A 2M6YA 4GX1A 1YHQV 4U3JB 3CC2V 1FFXA 3ZHVA 1L8DA 5AG2A 1Q6HA 3ZHSA 4ICGA 3AG4C 1V9PA 2CE4A 4TT3G 3RN4A 5JVDA 2FMLA 4HNAB 1LR1A 5IJ0A 4G2KA 1JFFB 4FZ1A 3APQA 2XHBA 3CCRV 4J7KA 2ZD9A 3LUTB 1EN6A 4DV2B 3HKCB 4DXWA 4H33A 3K04A 1GN2A 1OHHG 5EBWC 3ZMSA 5BZBA 1O9HA 4BW5A 4ZBMA 3JD2A 3QO5A 2ETNA 2XT9A 1M93A 3BHPA 3VQVA 3RGBA 1K3EA 2IH3C 2YI8A 3ZRWA 2MW2B 1TA8A 1IDSA 3UO3A 4JV5O 2XOKG 4MVUA 1YF2A 4JASA 1B3QA 3T1HO 1YITV 4ZIBA 1N33B 3AK2A 2YSUB 4I9QA 5LGTA 3WU2Z 3NR7A 5LGNA 1N36O 3OMNB 5KHJA 1V55C 4OX9O 4JV5B 1Q5OA 1M90W 4H37A 5H5NA 4WFEA 2L6LA 4CH6A 3JARB 2UUBO 3B2EE 1QLEC 1XL4A 1S72V 3CRRA 1RM1B 1YJ9V 4ZI7A 4YJ3B 1ZLZA 1F4MA 3RVZA 3ZMTA 4NYKA 1WJZA 2JEXA 1GMGA 1SA0B 4CS3A 1GN6A 2A79B 4JI3O 5LP6A 1OCCB 2Q8VA 3RYCB 4KHPO 2XAFA 3OEEG 2ZDIC 1NBMG 3T1YB 4IIJA 3D8CA 3FYEB 3M99B 5J9PC 1S0VA 5FPRA 5KX5A 1NTKH 2Q68A 3ETEA 3ZHQA 1WAZA 2ZINA 3EXAA 5EBLC 2Y69B 2LQTA 3P30A 3SYAA 4DR4B 2YEVB 3CC7V 4HYOA 2ATKC 4I50B 1M4UA 3H1KH 5CN0A 4X1IB 2D3OW 1KYOF 1XL6A 4NVPA 4FMTA 5C8YB 1SF9A 3MAQA 4TUYB 3M8AA 1KU9A 3N27A 5L3DA 1N0NA 2VS0A 3KG2A 2V4DA 2EX3A 2DOSA 4RUEA 1V54C 1KMIZ 2LJ2A 1S5HC 4Z1VA 3G71V 3ETGA 1FXVA 3AK1A 3CRMA 3LDCA 4IHJB 2DYRB 2WSSG 3SPCA 1KECA 4LF9O 5H2FZ 2XTAA 5B1OA 5CA1B 3CCLV 4O2BA 3K5LA 4XDKA 3OD4A 4TV9A 3O9OA 1FXHA 4TV8B 5CB4A 4LF4O 1XDCA 2JDIG 2XAQA 4LF8B 4UCRA 3A0HZ 3CJHB 4CH4A 4DV5O 2H94A 3HKBB 1FJGO 3CMEV 4LF9B 3N2KB 2LGQA 1M56B 4PHZA 4O4JB 3GWKC 3H01A 1M5IA 5EC2C 1WNSA 5E1AC 5KMGA 2PI5A 4DV0B 5IT9N 3X2QC 3DSQA 4YY3O 1FJGB 4UV9A 2JGDB 2EIKB 3DC5A 1TUEB 1XOUA 2WLHA 1MSDA 5FL7G 5D5QA 1RSOA 3W7XA 5L3FA 2X6BA 5LP6C 1Q3EA 3OGCC 3BCCH 2Z0AA 4FK5C 4QE7A 3U0ZA 4YY3B 2GHYA 3L9DA 2O57A 3UT5A 1GRJA 1O9GA 2OCCB 5LL6Y 2ARHA 2VQEO 4DK0A 3T1CA 1IURA 2PZSA 1S5LZ 2P90A 3SYCA 1TUBB 4I0XA 3JAKA 2AGAA 4X65O 2QSAA 3H1HH 2OIGA 2V7QG 1I5YA 4NXMB 3H9VA 2ADPA 4LCUC 2PGGA 3QVNA 1K5QA 5LMNB 3ABMC 2P6JA 1PL4A 2L35A 3E22A 1UPGA 5LHHA 3ZRXA 5IJ9B 4R8CA 2KG7A 5EIBD 4EKWA 1WB7A 5IWAO 1ORQC 4BWAA 1AJNA 2YC0A 3ICXA 4O4IB 4FLYA 1AP5A 2PYJA 1YCIA 1K5SA 5LA6A 1NTMH 3AG3B 2UXBO 4Q6GA 4IL6Z 2CAZC 3QNEA 3CXCU 4D7SA 5JVDB 4I9WA 2BTQB 4O4HB 1ZL8B 2N74A 5IWAB 1XMOO 2UXDB 1AI7A 1BCCH 1VQNV 4K35A 4JTDB 1HWYA 5BY1A 4BAYA 1JJOA 4CZZA 1HP8A 4YJ2B 4FM2A 2ZR2A 1BHAA 3ZHUA 3K57A 4FM0A 2GV9A 4CS2A 3ZRWB 4NB5A 4FVMA 5L3EA 2Y0IA 4GX0A 2UUAB 2B1GA 3KCXA 3S3XA 4U3JA 2PI4A 2GSMB 1NH2B 3B8MA
chains in the Genus database with same CATH topology
1P4RA 3CCVV 2F43G 4F4LA 3JD4A 1SESA 3K79A 3LNMB 5CA3A 4RO2A 3UM7A 3ZN1A 4LBEC 1LNQA 1G8MA 1SZTA 3ZMVA 5L3BA 1VQMV 5CBHA 2IJKA 2WLLB 3AG1B 4OXSA 1S77D 1S3JA 2CK3G 3IGAC 1YJNV 3SPIA 3CCUV 4QE9A 4RQEA 4PELA 3OUFA 2A9HA 1NKDA 1QVGU 3PJSK 2V1DA 2DWEC 1QR9A 4JYBA 2XAHA 4X8AA 3JCZA 4WFFA 1R6NA 2EINC 3ZCCA 2IW5A 3LSSA 3ZRSA 1CEZA 2QA4V 3OE7G 3A0RA 4P9PA 1QBZA 4LP8A 3OMAB 3MD0A 4GX2A 3E35A 3ASNC 4N21A 4KP4A 4PA4A 3ZMZA 2EINB 1F4NA 1K8AW 1R3IC 3EFFK 3G4SV 5IY5C 1OCOC 1VQLV 3AG2C 3ASNB 3JD0A 5L3CA 3CCSV 3R65A 2EIJC 4KUMA 2IU0A 2OTLV 1SRYA 4N23A 1MSWD 1YTFD 1JCHA 4JAVA 3I55V 1KKDA 5IY5B 1OCOB 3BEHA 2X6CA 5EC1C 4GT1A 3F7YC 5DM6V 3AG2B 3B8NA 3HPLC 3F5WC 1GKFA 3K0DA 2W0FC 3D3IA 3SPGA 1Q86W 1BHBA 4R50A 2X7RB 1H8HG 1MOFA 1GO3F 2Z5UA 2EIJB 3CMAV 1NVPD 1P7BA 3LSQA 1GTOA 1E79G 1L1FA 1M1KW 3CP1A 3ABTA 3CCEV 3OR6C 2WWWA 4UVCA 5IDJA 3E2EA 2Q6AA 2DQ3A 3E83A 4XBFA 2QKSA 5LHGA 1OCZC 1G4YB 4RUFA 5IYDO 2MK3A 1YJWV 4PDVA 3E8GA 2JK5C 3ABLC 3GB7C 4J9YB 4MVRA 3STZC 3FKSG 4MW3A 1Q82W 5KA5A 4GX5A 2LFRA 3D36A 1AI5A 3DGEA 2XAGA 1OCZB 2HR3A 1K92A 3FB7C 2BOBC 1PNMA 4PA6A 1FFTB 2ZDIA 5H6QA 3MHSC 1F51A 1QCEA 2B5UA 3ABLB 4GX1A 5CBGA 1YSCA 2R9IA 1YHQV 1KD1W 3CC2V 1VQ5V 2YEVA 3ABKC 4WFHA 3AG4C 4MTFA 3I56V 4TT3G 4J9ZB 2NLJC 5KUKA 2W6JG 3W7SA 3RVYA 1JOYA 1SETA 4G2KA 3K08A 4MTXA 3AG4B 2Y48A 3CCRV 2ZD9A 3LUTB 3BY6A 2ZXWC 4TSFG 2P7TC 4UUJC 4DXWA 4H33A 3K04A 2QTOA 5EBWC 1NQTA 1COWG 1OHHG 2LFSA 2WAMA 3ZMSA 5BZBA 1W2BU 4JYCA 4BW5A 2BOCC 4ZBMA 3JD2A 3QO5A 1GM7A 4P9OA 3CPWU 4MS2A 3B77A 1R3JC 2FTKA 3TK1A 2ZXWB 3K03A 1K3EA 1YIJV 1SERA 2IH3C 1FXKA 4UV8A 3ZRWA 4QPKA 3OW2U 2XOKG 1J95A 4MVUA 2QM7A 2W6IG 2EJRA 5LGUA 4JASA 1AI6A 3E8BA 1AI4A 1YITV 1K4DC 2YSUB 5GW7A 5LGTA 2C2AA 2EZPA 2P67A 4UXNA 1W0JG 2WLIA 1Y66A 5LGNA 3W7TA 3OMNB 4XDLA 1JQ0A 5H9CA 1V55C 3ZMUA 2QE7G 3FYIB 1M90W 4H37A 3CC4V 2WLMA 3W7UA 2X0LA 1RM1C 5HFLA 3E8FA 1NVPB 4WFEA 4WFAV 2WLLA 1NH2D 3VOUA 1ROPA 2ZR3A 3JD1A 1V55B 1QLEC 5B1BC 1XL4A 3RW0A 1S72V 5HFMA 1RM1B 5KUMA 4UVBA 1YJ9V 2DWDC 3CD6V 2B1IA 5H6RA 4MTGA 3K06A 3P32A 3TETA 3JD3A 3OUSA 2HFEC 4MVOA 1F4MA 3RVZA 1OCCC 4L87A 4U7OA 3ZMTA 3RBZA 1PKXA 1QLEB 1KP2A 3HB3B 2JEXA 5B1BB 1QVFU 4ZKIA 1GMGA 4BIUA 4E2LA 5DN6G 2JJ2G 1K33A 2A79B 1OCCB 1VQ6V 2XAFA 3OEEG 2ZDIC 1NBMG 2Y69C 5LHIA 4FJCC 1RPRA 3FYEB 3SPHA 3M99B 1MG1A 5J9PC 1S0VA 2XAJA 1H2GA 5CMUA 3ETEA 2Q68A 3ZJZA 2IU3A 5EBLC 2OTJV 3ETDA 2Y69B 3P30A 4JPRA 3SYAA 1E1RG 3LDEA 1KC8W 5LBQA 2YEVB 3CC7V 3SPJA 3VBBA 1ZWIC 1N8RW 1K34A 1THZA 2HVJC 5C93A 4HYOA 3SYPA 1H8EG 2HLDG 1OZ0A 2ATKC 2Q67A 1IXMA 1QR8A 2EBOA 1S76D 5B1AC 4P30A 4JTAB 1GM8A 1Y4MA 2M7WA 3UKMA 5CN0A 5EBMC 4JAUA 1KP3A 2D3OW 4BIZA 1XL6A 3CCMV 4QPJA 4FMTA 5KA6A 1JPXA 3NXSA 1VQ8V 2DYRC 5L3DA 1DF4A 3ABKB 4G28B 3KG2A 2JJ1G 5CBFA 1F23A 3ASOC 1V54C 4RUEA 3K3WA 4XDJA 1WPXA 1S5HC 2UXNA 3G71V 3ETGA 1FXVA 1PNLA 2KB1A 2IH1C 3SPCA 3LDCA 2DYRB 2WSSG 4DO2A 1KECA 1M9NA 2ZQMA 1AJPA 3ABUA 1PNKA 5B1OA 3ASOB 1PL0A 1V54B 3CCLV 1BL8A 2DW4A 4MSWC 4XDKA 1FXHA 1M56C 3CYOA 4WFBV 4CBCA 1K9MW 4QNHB 1PD3A 2H8PC 2JDIG 3SJQC 3MHHC 4JTCB 4MVSA 4X88A 2Q69A 2XAQA 3STLC 2X6AA 5IYCO 2H94A 1RPOA 2WLIB 1R6KA 3CMEV 4U7NA 3F7VC 1M56B 3OR7C 3QO8A 1WLEA 2EIKC 4HAMA 2AHZA 2EIMC 4KFMA 3H01A 2A0LA 1EFRG 4QIWF 3SYOA 4Z1MG 5EC2C 4MW8A 4MTOA 5E1AC 1YTFB 2PI5A 2DQ0A 4JF3A 3G6EV 3X2QC 1E1QG 4UV9A 3SYQA 2EIKB 1TUEB 2WLNA 2WLHA 2EIMB 5FL7G 3OFNG 1JX9A 1R3LC 4I5SA 1VQPV 3ML0A 1JJ2U 1R73A 2LP7A 3W7XA 1YI2V 3ZRVA 2OCCC 3JYCA 5B1NA 1NR7A 2X6BA 4R7CA 1CPYA 3X2QB 3OGCC 5L3FA 2HJFC 2UXXA 2ITCC 2DYSC 2JEUA 4FK5C 4QE7A 2GHYA 2ITDC 1ENVA 3T2MA 1KQSU 2OCCB 3OM3B 3FB8C 3K9AA 2WLKA 4FPPA 5B3SC 3T1CA 1VQ4V 2NNUA 2P90A 3SYCA 2DYSB 1I5XA 3IFXA 1DF5A 4PDRA 3TCUA 1UJWB 2R9RB 3DTUB 1JVMA 4MVMA 4PDMA 4G27B 1MABG 2V7QG 1M57C 1I5YA 2IJJA 2IJHA 3OEHG 4JGSA 5B3SB 2IJIA 4LCUC 1QLNA 2HVKC 2WPDG 1K5QA 4Q20A 4X89A 4QJFB 3W7WA 1B6QA 3E8HA 3ABMC 5L3GA 2P6JA 4LC1A 1M57B 5LHHA 3ZRXA 1NR1A 4R6ZA 1Q7YW 3IC7A 4R8CA 3AG3C 3CCQV 1Q81W 1DTOA 4EKWA 4PA9A 1BMFG 2AHYA 1AJQA 4PA7A 1CP9A 1ORQC 3OMIB 4ASUG 1AJNA 3ABMB 4TWKA 2EZOA 4MVQA 1VQOV 1K5SA 5EK0A 3WFVA 1K7DA 3AG3B 1AR1B 3QNEA 3ZN0A 3CXCU 4PA3A 4GCZA 3E86A 1OCRC 4WF9V 1EZJA 1R3KC 3QO7A 4I9WA 2HG5C 2JIZG 3EHBB 1AI7A 2XASA 4UVAA 2HKOA 3WG7C 3FB6C 1K73W 1VQNV 1VQKV 3FB5C 1W0KG 4JTDB 1OCRB 5B1AB 3T4DA 2OT5A 2QEXV 2Z3YA 1NJIW 1HWYA 1FXKC 4WFGA 4BAYA 3WG7B 4CZZA 2XNDG 2WLJA 3E89A 2ZR2A 1BHAA 1VQ7V 4FIPC 1GK9A 1EBOA 3CCJV 2QM8A 2EILC 4MT8A 3OAAG 4WCEV 1FXKB 4PDLA 3LDDA 3ZRWB 4P2ZA 4YXWG 4MVZA 1AROP 1GM9A 3GWOA 5L3EA 3T4ZA 4GX0A 2B1GA 4RQFA 4HZ3A 1H38A 3ZIAG 2K1EA 2PI4A 1K97A 2EILB 1FS0G 1VQ9V 4RAIA 2GSMB 1NH2B 3K0GA 1DLBA 1K4CC 5IYBO 3B8MA 3AG1C 3AEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS C;  1QCE A;  1QR9 A;  1QR8 A;  4FIP C;  2EBO A;  1EBO A;  4FK5 C;  5HFM A;  3H01 A;  4FJC C;  1Y4M A;  2M7W A;  1ENV A;  1MG1 A;  2EZP A;  3M99 B;  2P6J A;  5CN0 A;  1SZT A;  4N23 A;  4JF3 A;  2MK3 A;  1Y66 A;  3K9A A;  5CMU A;  3GWO A;  3B77 A;  1JQ0 A;  1QBZ A;  5H9C A;  3CYO A;  3P30 A;  1I5X A;  4JPR A;  3B8N A;  5KA6 A;  1DF5 A;  1JPX A;  3MHH C;  5HFL A;  4N21 A;  2OT5 A;  4E2L A;  5KA5 A;  2X7R B;  1DF4 A;  1MOF A;  4G2K A;  1K33 A;  2EZO A;  2LP7 A;  1DLB A;  1F23 A;  1K34 A;  1I5Y A;  3CP1 A;  3WFV A;  4JGS A;  3B8M A; 
#chains in the Genus database with same CATH topology
 1P4R A;  3QTC A;  4F4L A;  3JD4 A;  1XHX A;  4RO2 A;  1JFF A;  1MNG A;  1YVW A;  5CBH A;  3HKC A;  4JI8 O;  4UCS A;  1DK1 A;  4JYY A;  2BTO A;  4RQE A;  2JRI A;  2A9H A;  3ZS8 C;  3PJS K;  5FNV B;  1N4C A;  1QR9 A;  3OTO O;  4DV7 O;  5DED A;  2HP8 A;  4OPH A;  4WFF A;  1HDJ A;  4JI8 B;  2ZM6 O;  2EIN C;  3ZCC A;  2E5L B;  1ZUQ A;  2FKX A;  3SJC C;  3H1I H;  2QA4 V;  3OE7 G;  4K8X A;  1QBZ A;  4D6T H;  3E35 A;  4PA4 A;  4JAA A;  1SS3 A;  1R3I C;  2N04 A;  3EFF K;  4PV1 B;  2ZM6 B;  5FLX N;  1R6T A;  1VQL V;  5B5E Z;  3CX5 F;  3CCS V;  4QGP A;  3R65 A;  2EIJ C;  2IU0 A;  2OTL V;  1SRY A;  3CRA A;  4JAV A;  1N32 O;  5IY5 B;  1OCO B;  4TQD A;  4GT1 A;  3B8N A;  2KQX A;  1BHB A;  4B3S B;  4YJ3 A;  1VIB A;  2F23 A;  1GO3 F;  3N2G B;  3CMA V;  1P7B A;  3UQ8 A;  2YXY A;  4GKJ O;  3JAW B;  1XNQ B;  1VF6 A;  1SA0 A;  1RFY A;  3E83 A;  5LHG A;  1G4Y B;  3RYC A;  4CH5 A;  2CDY A;  4PDV A;  4J9Y B;  3FKS G;  4X66 O;  3GVM A;  2LFR A;  1AI5 A;  3THO A;  2OWO A;  1OCZ B;  2HR3 A;  2DMX A;  3FB7 C;  2Q7G A;  1WB8 A;  4PA6 A;  5H6Q A;  1QCE A;  3ABL B;  2ZE6 A;  5CBG A;  1KD1 W;  1VQ5 V;  2YEV A;  2JGU A;  3I56 V;  4WBN A;  4I50 A;  4CH3 A;  2IM9 A;  3W7S A;  2LGW A;  3RVY A;  4X1I A;  5TIS Z;  4X64 B;  1JOY A;  1SET A;  1KBH A;  2QWN B;  2HJD A;  5KAI Z;  1I08 A;  5C8Y A;  4TSF G;  2P7T C;  4TUY A;  4NXN O;  2QTO A;  1COW G;  4LR3 A;  4JYC A;  4UCV A;  2BOC C;  4NTY A;  3WB0 A;  3CPW U;  3B77 A;  2FTK A;  3TK1 A;  2ZXW B;  4JYA B;  1SER A;  4IHJ A;  3SR2 C;  4NXN B;  1EZV H;  4JI4 O;  1WPB A;  2QM7 A;  2EJR A;  4J7J A;  4TV8 A;  4JI0 B;  1AI6 A;  2ZE5 A;  3PN1 A;  2P67 A;  3HKB A;  3N2K A;  1JQ0 A;  4JI4 B;  3FYI B;  1H2M A;  4O4J A;  2WLM A;  1RM1 C;  5HFL A;  1NVP B;  4DV6 O;  2Y0P A;  1L0L H;  3VOU A;  2JGD A;  3RW0 A;  5HFM A;  5KUM A;  2PUS A;  2DWD C;  3A0B Z;  4JI5 O;  1VF6 C;  4MTG A;  3JD3 A;  3OUS A;  1OCC C;  3RBZ A;  5LA6 B;  3MDS A;  3HB3 B;  4ZKI A;  3CEI A;  5DN6 G;  4NTX A;  1K33 A;  4DR6 O;  1VQ6 V;  5A9G A;  1TUB A;  2Y69 C;  2ZCE A;  5LHI A;  4LFA B;  4FJC C;  1MG1 A;  4L8J A;  1OJH A;  5CMU A;  2CTW A;  4DR6 B;  5GTH Z;  3ZJZ A;  3H1J H;  5JH7 B;  5K1X A;  5LBQ A;  2UU9 O;  2QTS A;  1ZWI C;  1N8R W;  2HVJ C;  3SYP A;  2RDC A;  2Q67 A;  3CS5 A;  1HR0 B;  3CSX A;  2QGN A;  4P30 A;  4DV1 B;  3R66 A;  4JTA B;  4O4I A;  1GAX A;  3D3Q A;  5A2Q N;  1MA1 A;  1XBL A;  2QWR B;  1PPJ H;  4QPJ A;  4IYI A;  1FYJ A;  4LFC B;  1TVK B;  1URF A;  2DYR C;  3K9S A;  2BTQ A;  4O4H A;  1ZL8 A;  2JJ1 G;  4DV3 O;  3APO A;  4PD4 F;  4XDJ A;  1WPX A;  4UB8 Z;  5JCO C;  2KB1 A;  1M9N A;  1VF7 A;  2F66 C;  1AJP A;  3ABU A;  4YJ2 A;  4F6R B;  4J41 A;  3ASO B;  1BL8 A;  2DW4 A;  2YI9 A;  1M56 C;  4DV3 B;  3OTF A;  1K9M W;  4QNH B;  3SJQ C;  3STL C;  1BGY H;  2GUZ B;  1EN5 A;  2YIB D;  4CC6 A;  4LF7 O;  2WLI B;  3JAL B;  3HR0 A;  2EIK C;  4HAM A;  4KFM A;  4QIW F;  3DC6 A;  1XHZ A;  1S5J A;  3IJ4 A;  2QKA A;  4LF7 B;  1FD9 A;  4H13 B;  3DXR B;  1R3L C;  1VQP V;  3T1H B;  2Q9L A;  3ZRV A;  2OCC C;  3JYC A;  5B1N A;  1NT2 B;  2YIA A;  3VQY A;  1N36 B;  3KCY A;  1SQF A;  2Q5Z A;  2ITD C;  4UFZ A;  5JWP A;  4OX9 B;  2E3C A;  3T2M A;  1KQS U;  4C7U A;  1AR4 A;  1TAE A;  3Q4H B;  3OM3 B;  4FPP A;  1GN4 A;  5FNV A;  1VQ4 V;  4X9Q A;  1FKA O;  1BSM A;  2DYS B;  1I5X A;  2UUB B;  3IFX A;  1JVM A;  4PDM A;  1MAB G;  2IJJ A;  4FFB B;  4JGS A;  2YIC A;  1QLN A;  1Q90 D;  2WPD G;  5DEC A;  3W7W A;  4EB6 B;  1M57 B;  3K5O A;  2EUL A;  4R6Z A;  1YXB A;  1RP3 B;  1ZTE A;  3AG3 C;  4JI3 B;  1EM1 A;  1WA8 B;  4KHP B;  1P49 A;  5E79 Z;  2EZO A;  4YIO A;  5EK0 A;  3ZHT A;  4WBN B;  3K58 A;  4B3R O;  4HBN A;  1MMM A;  1AR1 B;  4PA3 A;  1QHT A;  3E86 A;  4WF9 V;  1EZJ A;  3QO7 A;  1BQ0 A;  2HG5 C;  3N2G A;  3EHB B;  4UVA A;  3VQW A;  2HKO A;  2RNB A;  3JAW A;  1OCR B;  1SKV A;  3T4D A;  2QEX V;  4WFG A;  2YDE A;  3WG7 B;  2WLJ A;  1TGO A;  1NZ6 A;  3HKD B;  4FIP C;  1GK9 A;  1EBO A;  1Y6X A;  4MT8 A;  3OAA G;  4DW0 A;  4LF5 O;  4PDL A;  4BIO A;  3FX7 A;  5JJE B;  1D2D A;  4GYC B;  4MVZ A;  4DR2 O;  4JI1 O;  4HZ3 A;  4Z2W A;  2EIL B;  2FL4 A;  5KAF Z;  3K0G A;  1DLB A;  1K4C C;  1PM9 A;  1AR5 A;  3RT3 C;  3CCV V;  2F43 G;  4JI1 B;  3K79 A;  1HNW O;  4LF4 B;  1XQ8 A;  5L3B A;  1SZT A;  1UFI A;  3ZMV A;  1XNR O;  4DV5 B;  4J10 A;  1S3J A;  1IXB A;  1YJN V;  2AZ0 A;  3SPI A;  2ZT9 B;  3LSU A;  4OGQ B;  1IBL O;  3OUF A;  4FLZ A;  2V1D A;  5K1P A;  4I55 A;  4K3A A;  4X8A A;  2RCV A;  2CTQ A;  3ZRS A;  4P9P A;  2HHH O;  2BSK B;  2ILM A;  2F95 B;  3MD0 A;  2YUA A;  1OV9 A;  3ZMZ A;  2G38 A;  3G4S V;  5IY5 C;  1OCO C;  2VQE B;  3ASN B;  1G1X B;  2Q7H A;  4H0L B;  4N23 A;  1MSW D;  3L73 H;  4X65 B;  5EC1 C;  2X6C A;  5B66 Z;  4K8Z A;  5DM6 V;  3AG2 B;  3K0D A;  2W0F C;  4UCO A;  4LNU B;  5BR8 O;  3L75 H;  1G6U A;  2X7R B;  1MOF A;  2Z5U A;  4PJ0 Z;  4GUN A;  3ABT A;  4JI6 O;  2P4K A;  1AP6 A;  4DR5 O;  4ZHQ A;  5IDJ A;  4ZOL B;  4J7Z A;  1H2S B;  2Q6A A;  2DQ3 A;  2JS5 A;  1OCZ C;  4YIP A;  2MK3 A;  4LFB O;  1JA8 A;  3ABL C;  1KB9 F;  2Q0A A;  3STZ C;  1WN7 A;  2UXB B;  3RFR A;  5KA5 A;  1SQV H;  1ZSP A;  3I5D A;  1K92 A;  2BCC H;  3JAT B;  2ZNJ A;  1XMO B;  1F51 A;  4DW1 A;  3H1L H;  5JH7 A;  4BW9 A;  2R9I A;  5EZY A;  5LOV B;  3ABK C;  4UCT A;  2P06 A;  4J11 A;  2E76 B;  4IGG A;  4WFH A;  4MTF A;  3G6B A;  4J9Z B;  2NLJ C;  5KUK A;  2P5O A;  1XMQ O;  2Q0O C;  3BY6 A;  2ZXW C;  1TVK A;  4UUJ C;  5IE9 A;  2LFS A;  2WAM A;  4EEQ A;  4AIL C;  4P9O A;  1GM7 A;  2AW9 A;  1L0N H;  4JZ2 A;  5CA0 B;  4MS2 A;  4AHC A;  1YIJ V;  1AB3 A;  1FXK A;  2YXL A;  1VF5 B;  2W0X A;  4F6R A;  3JAM N;  3OW2 U;  3BAA A;  3FAV B;  1XEQ A;  2GBO A;  5KHG A;  1AI4 A;  1B04 A;  2GUZ A;  2EZP A;  4UXN A;  1W0J G;  2WLI A;  3JAL A;  1J5E O;  1Y66 A;  3W7T A;  2QE7 G;  3CC4 V;  3OTO B;  2F1M A;  4DV7 B;  2WLL A;  3L70 H;  4X62 O;  1NH2 D;  1SQX H;  1ROP A;  2ZR3 A;  3JD1 A;  4GKK O;  1J5E B;  3RYH B;  4B3T O;  3DXR A;  4UVB A;  1D5A A;  4FZ0 A;  3K06 A;  3P32 A;  3TET A;  2HFE C;  1N34 O;  4U7O A;  1GH6 A;  1US6 A;  1IBM O;  1KP2 A;  4X62 B;  5B1B B;  4GKK B;  4K0K O;  3EVK A;  4E2L A;  1U96 A;  3HKE B;  3Q4H A;  4DR1 O;  4B3M O;  2Q73 A;  1N34 B;  1VAR A;  1N32 B;  2QJ1 A;  5LYJ B;  2UUC O;  2QR4 A;  4FFB A;  4YHH O;  2JVD A;  2R70 A;  4DR1 B;  2IU3 A;  4UCU A;  3ETD A;  4F6E A;  4GKJ B;  3FD9 A;  4EB6 A;  1Q43 A;  1IVS A;  3VBB A;  1BT8 A;  1K34 A;  1THZ A;  5C93 A;  4DUZ O;  1R1B A;  2HLD G;  2QDO A;  1IXM A;  1Y76 B;  1QR8 A;  1WA8 A;  2EBO A;  5B1A C;  1Y4M A;  5EBM C;  4JAU A;  3BA8 A;  4BIZ A;  5ITZ B;  4X66 B;  4AI8 A;  3CCM V;  1Y74 A;  3M7M X;  4DUZ B;  5KA6 A;  1XRE A;  2P22 C;  3SDL A;  1GN3 A;  5BMV B;  3ABK B;  4G28 B;  1PV0 A;  3JCU Z;  1F23 A;  3ASO C;  5CBF A;  1WP7 A;  3A8T A;  1BQZ A;  5EYP A;  2PF4 E;  2FB5 A;  1PNL A;  1I0H A;  3ETQ A;  4DUY O;  1NS1 A;  2OCH A;  3WB2 A;  2ZIO A;  3HKD A;  4AQY O;  3CYO A;  2H8P C;  3MHH C;  4JTC B;  2Q69 A;  4I55 B;  4DV4 O;  2X6A A;  5J2T B;  4U7N A;  3F7V C;  3OR7 C;  3QO8 A;  4UB6 Z;  1Y67 A;  1WLE A;  3VQX A;  2AHZ A;  1YZB A;  4Z1M G;  5GON A;  4MTO A;  1YTF B;  4O4L A;  3C3S A;  2DQ0 A;  4JF3 A;  3G6E V;  1P7G A;  2RQ6 A;  2EIM B;  1JX9 A;  4A5U B;  3ML0 A;  1CXZ B;  1JJ2 U;  1R73 A;  1YI2 V;  3JSN A;  3RYF B;  2A06 H;  4R7C A;  1X4T A;  2HJF C;  1H2N A;  2DYS C;  5KHH A;  3JAS B;  1ENV A;  3ZX6 A;  2LW1 A;  3K9A A;  4DV6 B;  2WLK A;  2GDS A;  1I94 O;  3TCU A;  4PDR A;  1UJW B;  4ZHQ B;  2R9R B;  2R72 A;  4FLU A;  4KL1 A;  1M57 C;  4JI5 B;  2UXC O;  2IJH A;  2HEP A;  5B3S B;  2BSK A;  5KHK A;  4Q20 A;  4QJF B;  2LW7 A;  3E8H A;  4DYL A;  2CGN A;  3ZHR A;  5L3G A;  1IZ3 A;  3BFR A;  4DR7 O;  1NR1 A;  3IC7 A;  3RYI A;  3CCQ V;  1Q81 W;  1BMF G;  2DN9 A;  4PA7 A;  1CP9 A;  1Z5V A;  3C90 A;  3OMI B;  4ASU G;  4TWK A;  5EZY B;  4MVQ A;  2Q7E A;  2ADQ B;  3WFV A;  1K7D A;  5JJJ B;  2R9A A;  1HNX O;  3ZN0 A;  4GCZ A;  4LNU A;  1HNZ O;  1OCR C;  2XAS A;  3WG7 C;  1F7Y A;  1SQP H;  2UU9 B;  1QNM A;  1VQK V;  5B1A B;  1HNX B;  2OT5 A;  4ZOL A;  1NJI W;  3BPZ A;  2XND G;  3E89 A;  3CCJ V;  2QM8 A;  4X1Y B;  2EIL C;  3BRC A;  4WCE V;  1FXK B;  4DV2 O;  2QKC A;  1T5E A;  3JAT A;  2ZIM A;  3T4Z A;  1H38 A;  3ZIA G;  2K1E A;  3K59 A;  2ODM A;  5LOV A;  5IYB O;  5JQG B;  1XI1 A;  4B08 A;  2Y4U A;  1SES A;  5CA3 A;  2A3Q A;  1AIL A;  4CS4 A;  3G80 A;  1G8M A;  1VQM V;  1N33 O;  2IJK A;  2WLL B;  5LMU O;  3AG1 B;  4OXS A;  1LUV A;  2WA3 A;  4DRX B;  4QE9 A;  4PEL A;  5EIB C;  5CA0 A;  2XUM A;  3O65 A;  3B4S A;  4DK1 A;  4PI2 A;  5IYZ B;  2XAH A;  5LMU B;  4FFK A;  1R6N A;  2IW5 A;  3FAV A;  1CEZ A;  4RWU A;  3A0R A;  1QU7 A;  5D5P A;  3OMA B;  3KZI Z;  4X20 A;  3ASN C;  4DR3 O;  2VQF O;  1F4N A;  1K8A W;  5BXZ A;  2P4V A;  1SZX A;  4J80 A;  3AG2 C;  4FLV A;  4LWS A;  5L3C A;  1Z2G A;  1BE3 H;  4KUM A;  4TQF A;  1BS3 A;  4DR3 B;  3T1Y O;  1B06 A;  2H3O A;  1HW7 A;  3I55 V;  2VQF B;  1KKD A;  2ZKO A;  3BEH A;  3L72 H;  2AXT Z;  3RYH A;  3TJT A;  3SPG A;  1Q86 W;  2K9P A;  3D3I A;  4R50 A;  1H8H G;  4W4L A;  4I4T B;  1GTO A;  3CP1 A;  4GLX A;  3S3W A;  4DR4 O;  3CCE V;  3OR6 C;  1Y74 B;  1YEW A;  2WWW A;  3CB2 A;  2CH7 B;  3E2E A;  2E75 B;  3HKE A;  4XBF A;  4RUF A;  5IYD O;  1YJW V;  3E8G A;  3GB7 C;  4O2A B;  4MVR A;  3CHX A;  5EYP B;  2ZE8 A;  4MW3 A;  1Q82 W;  1QQC A;  3D36 A;  2QWQ B;  5LYJ A;  3DGE A;  4B3R B;  1SQG A;  2BOB C;  2PTM A;  1FFT B;  3L71 H;  3MHS C;  3U10 A;  2B5U A;  1W59 A;  1YSC A;  2WA4 A;  2N05 A;  4GZR B;  1VMG A;  2PYL A;  3CE2 A;  1Y76 A;  2NN4 A;  5FPO A;  2W6J G;  3AG7 A;  5KLV H;  3IAY A;  2CTR A;  2E74 B;  5GON B;  4J42 A;  3K08 A;  4I7Z B;  4JI2 O;  5ITZ A;  4MTX A;  3AG4 B;  2Y48 A;  4O4L B;  1Q6I A;  3K5N A;  4LF5 B;  4LF8 O;  2RJZ A;  4DR2 B;  1NQT A;  1W2B U;  5BMV A;  1H2K A;  1SQQ H;  4NKG B;  1R3J C;  1YDX A;  4JI2 B;  2QWP B;  3K03 A;  4DV0 O;  4UV8 A;  5J2U B;  4QPK A;  2ZNI A;  1HNW B;  1J95 A;  4ABM A;  2W6I G;  5LGU A;  3E8B A;  1K4D C;  1DGS A;  1XNR B;  2DE0 X;  2FYU H;  5GW7 A;  2C2A A;  5F2V O;  2ZE7 A;  5J2T A;  4B7E A;  1IBL B;  4XDL A;  5H9C A;  3ZMU A;  3TGU H;  1VP7 A;  3W7U A;  2X0L A;  3E8F A;  4WFA V;  3FFQ A;  3B40 A;  4FM1 A;  1V55 B;  5B1B C;  3RYI B;  2CTP A;  2HHH B;  3CD6 V;  2B1I A;  5H6R A;  4NXM O;  4MVO A;  3RYF A;  4L87 A;  5LXT A;  5LMN O;  1PKX A;  2CUG A;  4E4E A;  1QLE B;  3SJB C;  2F4V O;  3JAS A;  1KUQ A;  1QVF U;  1JMK C;  4EFB A;  4BIU A;  4FLX A;  1P84 F;  3JSL A;  4H44 B;  2JJ2 G;  3D36 C;  4JI7 O;  1NU1 H;  1PP9 H;  4X1K B;  3SPH A;  1RPR A;  2F4V B;  3IC9 A;  2XAJ A;  1H2G A;  4NR1 A;  5BR8 B;  4JI7 B;  3BVO A;  2OTJ V;  4JPR A;  2UXD O;  1E1R G;  3LDE A;  4JI6 B;  1KC8 W;  1FFX B;  3SPJ A;  4DR5 B;  4W4K A;  1H8E G;  1OZ0 A;  2YXH A;  4IYH A;  3CWB H;  1MZE A;  4B7K A;  2CGO A;  2YID A;  1S76 D;  4LFB B;  3QF7 A;  1GM8 A;  3UKM A;  2M7W A;  1FPO A;  5IJ0 B;  1AVM A;  1KP3 A;  3BA9 A;  1NI8 A;  3OT7 A;  2PY5 A;  4NTW A;  3NXS A;  1JPX A;  1VQ8 V;  3CRC A;  1DF4 A;  3TXQ A;  2UUA O;  1IBK O;  1D5N A;  3K3W A;  2UXN A;  2YIB A;  1XIL A;  2IH1 C;  4DO2 A;  2ZQM A;  4TOI A;  2Q4P A;  3J7A U;  1PNK A;  1PL0 A;  1V54 B;  2KSD A;  4MSW C;  1IBK B;  3U11 A;  1XMQ B;  4WFB V;  4CBC A;  1LUW A;  1PD3 A;  4X88 A;  1ZX3 A;  4MVS A;  4X1Y A;  2D2C B;  5IYC O;  1RPO A;  1R6K A;  4HNA A;  2EIM C;  3J80 N;  2A0L A;  1EFR G;  3SYO A;  4MW8 A;  4X20 B;  1I7F A;  4LH7 A;  5JQG A;  1E1Q G;  3SYQ A;  1BZK A;  2WLN A;  4U3F H;  2E5L O;  4OPA A;  3OFN G;  4I5S A;  4ZI7 B;  1N0J A;  4LWS B;  2LP7 A;  3QG5 A;  3A2F A;  4LF6 O;  1NR7 A;  1CPY A;  3X2Q B;  2UXX A;  2ITC C;  2JEU A;  4DRX A;  2F93 B;  3FB8 C;  2JS3 A;  5LP6 B;  4LF6 B;  5B3S C;  2NNU A;  3F5T A;  5IYZ A;  1DF5 A;  1NTZ H;  4IIJ B;  3DTU B;  4MVM A;  4FLT A;  4G27 B;  4B3T B;  4BR6 A;  2VWJ A;  1MZF A;  3OEH G;  3TXS A;  5KX5 B;  4EFE A;  4B3S O;  2IJI A;  2VRZ A;  2HVK C;  1Q6U A;  4X89 A;  1H2L A;  1IBM B;  1B6Q A;  3JAR A;  3ZED A;  1XNQ O;  4LC1 A;  3LNN A;  1JR9 A;  4K0K B;  1Q7Y W;  1DTO A;  4PA9 A;  2AHY A;  2BE3 A;  1AJQ A;  2QWO B;  4B3M B;  2YS8 A;  3ABM B;  1VQO V;  1VEW A;  2UUC B;  4YHH B;  1SC5 B;  3P3N A;  1FAF A;  1R3K C;  3RWR D;  2DJV A;  4CC5 A;  2JIZ G;  4I4T A;  2GTS A;  3FB6 C;  1K73 W;  2Y4T A;  3FB5 C;  4IT5 A;  1W0K G;  2CH7 A;  4LH6 A;  1SQB H;  2Z3Y A;  1FXK C;  3C3T A;  3AK3 A;  4O2B B;  4TV9 B;  4O2A A;  4X64 O;  1VQ7 V;  5CB4 B;  2OIE A;  3LDD A;  4P2Z A;  4YXW G;  1A32 A;  1ARO P;  1GM9 A;  3GWO A;  2OYQ A;  3ZBH A;  4RQF A;  1K97 A;  1FS0 G;  1VQ9 V;  4RAI A;  3KKY A;  5KMG B;  4JZG A;  3BAB A;  5GTI Z;  4JYA O;  3AG1 C;  3AEI A;  4DUY B;  2GTA A;  1IX9 A;  3LNM B;  3UO2 A;  2VWK A;  3UM7 A;  4AQY B;  3ZN1 A;  4JI0 O;  3SJA C;  1RSO B;  4LBE C;  1LNQ A;  4DV4 B;  1S77 D;  2CK3 G;  3IGA C;  3WB1 A;  1EN4 A;  3K5M A;  3CCU V;  3OGI B;  3SGI A;  3UT5 B;  5CA1 A;  1WP8 A;  1X59 A;  2IBZ H;  1NKD A;  1QVG U;  5JCO A;  5LXT B;  2DWE C;  2A7W A;  4JYB A;  3JCZ A;  3CJH A;  1KKC A;  3JAK B;  4I0X B;  4D7T A;  5J2U A;  1ZAU A;  3LSS A;  3P3P A;  2NR5 A;  4LP8 A;  2KKW A;  4GX2 A;  4N21 A;  4KP4 A;  5JJN B;  2EIN B;  3E22 B;  2KG7 B;  1Q8I A;  1I94 B;  3JD0 A;  4KXR A;  2B9Z A;  2AZ2 A;  2EJ7 A;  1YTF D;  3L74 H;  1JCH A;  4LFA O;  2RN9 A;  1XUQ A;  3F7Y C;  2UXC B;  3HPL C;  3F5W C;  1GKF A;  3UCS C;  2RMK B;  3G67 A;  2QM4 A;  2EIJ B;  1NVP D;  3LSQ A;  3J81 N;  1E79 G;  1L1F A;  1M1K W;  4DR7 B;  4PI0 A;  4UVC A;  2QKS A;  1U97 A;  1HR0 O;  4DV1 O;  1Z5W A;  2JK5 C;  2LO1 A;  4X1K A;  3CXH F;  4GX5 A;  3CRQ A;  4FLW A;  2XAG A;  5IJ9 A;  1HNZ B;  4LFC O;  5KHI A;  1PNM A;  2ZDI A;  3B09 A;  2M6Y A;  4GX1 A;  1YHQ V;  4U3J B;  3CC2 V;  1FFX A;  3ZHV A;  1L8D A;  5AG2 A;  1Q6H A;  3ZHS A;  4ICG A;  3AG4 C;  1V9P A;  2CE4 A;  4TT3 G;  3RN4 A;  5JVD A;  2FML A;  4HNA B;  1LR1 A;  5IJ0 A;  4G2K A;  1JFF B;  4FZ1 A;  3APQ A;  2XHB A;  3CCR V;  4J7K A;  2ZD9 A;  3LUT B;  1EN6 A;  4DV2 B;  3HKC B;  4DXW A;  4H33 A;  3K04 A;  1GN2 A;  1OHH G;  5EBW C;  3ZMS A;  5BZB A;  1O9H A;  4BW5 A;  4ZBM A;  3JD2 A;  3QO5 A;  2ETN A;  2XT9 A;  1M93 A;  3BHP A;  3VQV A;  3RGB A;  1K3E A;  2IH3 C;  2YI8 A;  3ZRW A;  2MW2 B;  1TA8 A;  1IDS A;  3UO3 A;  4JV5 O;  2XOK G;  4MVU A;  1YF2 A;  4JAS A;  1B3Q A;  3T1H O;  1YIT V;  4ZIB A;  1N33 B;  3AK2 A;  2YSU B;  4I9Q A;  5LGT A;  3WU2 Z;  3NR7 A;  5LGN A;  1N36 O;  3OMN B;  5KHJ A;  1V55 C;  4OX9 O;  4JV5 B;  1Q5O A;  1M90 W;  4H37 A;  5H5N A;  4WFE A;  2L6L A;  4CH6 A;  3JAR B;  2UUB O;  3B2E E;  1QLE C;  1XL4 A;  1S72 V;  3CRR A;  1RM1 B;  1YJ9 V;  4ZI7 A;  4YJ3 B;  1ZLZ A;  1F4M A;  3RVZ A;  3ZMT A;  4NYK A;  1WJZ A;  2JEX A;  1GMG A;  1SA0 B;  4CS3 A;  1GN6 A;  2A79 B;  4JI3 O;  5LP6 A;  1OCC B;  2Q8V A;  3RYC B;  4KHP O;  2XAF A;  3OEE G;  2ZDI C;  1NBM G;  3T1Y B;  4IIJ A;  3D8C A;  3FYE B;  3M99 B;  5J9P C;  1S0V A;  5FPR A;  5KX5 A;  1NTK H;  2Q68 A;  3ETE A;  3ZHQ A;  1WAZ A;  2ZIN A;  3EXA A;  5EBL C;  2Y69 B;  2LQT A;  3P30 A;  3SYA A;  4DR4 B;  2YEV B;  3CC7 V;  4HYO A;  2ATK C;  4I50 B;  1M4U A;  3H1K H;  5CN0 A;  4X1I B;  2D3O W;  1KYO F;  1XL6 A;  4NVP A;  4FMT A;  5C8Y B;  1SF9 A;  3MAQ A;  4TUY B;  3M8A A;  1KU9 A;  3N27 A;  5L3D A;  1N0N A;  2VS0 A;  3KG2 A;  2V4D A;  2EX3 A;  2DOS A;  4RUE A;  1V54 C;  1KMI Z;  2LJ2 A;  1S5H C;  4Z1V A;  3G71 V;  3ETG A;  1FXV A;  3AK1 A;  3CRM A;  3LDC A;  4IHJ B;  2DYR B;  2WSS G;  3SPC A;  1KEC A;  4LF9 O;  5H2F Z;  2XTA A;  5B1O A;  5CA1 B;  3CCL V;  4O2B A;  3K5L A;  4XDK A;  3OD4 A;  4TV9 A;  3O9O A;  1FXH A;  4TV8 B;  5CB4 A;  4LF4 O;  1XDC A;  2JDI G;  2XAQ A;  4LF8 B;  4UCR A;  3A0H Z;  3CJH B;  4CH4 A;  4DV5 O;  2H94 A;  3HKB B;  1FJG O;  3CME V;  4LF9 B;  3N2K B;  2LGQ A;  1M56 B;  4PHZ A;  4O4J B;  3GWK C;  3H01 A;  1M5I A;  5EC2 C;  1WNS A;  5E1A C;  5KMG A;  2PI5 A;  4DV0 B;  5IT9 N;  3X2Q C;  3DSQ A;  4YY3 O;  1FJG B;  4UV9 A;  2JGD B;  2EIK B;  3DC5 A;  1TUE B;  1XOU A;  2WLH A;  1MSD A;  5FL7 G;  5D5Q A;  1RSO A;  3W7X A;  5L3F A;  2X6B A;  5LP6 C;  1Q3E A;  3OGC C;  3BCC H;  2Z0A A;  4FK5 C;  4QE7 A;  3U0Z A;  4YY3 B;  2GHY A;  3L9D A;  2O57 A;  3UT5 A;  1GRJ A;  1O9G A;  2OCC B;  5LL6 Y;  2ARH A;  2VQE O;  4DK0 A;  3T1C A;  1IUR A;  2PZS A;  1S5L Z;  2P90 A;  3SYC A;  1TUB B;  4I0X A;  3JAK A;  2AGA A;  4X65 O;  2QSA A;  3H1H H;  2OIG A;  2V7Q G;  1I5Y A;  4NXM B;  3H9V A;  2ADP A;  4LCU C;  2PGG A;  3QVN A;  1K5Q A;  5LMN B;  3ABM C;  2P6J A;  1PL4 A;  2L35 A;  3E22 A;  1UPG A;  5LHH A;  3ZRX A;  5IJ9 B;  4R8C A;  2KG7 A;  5EIB D;  4EKW A;  1WB7 A;  5IWA O;  1ORQ C;  4BWA A;  1AJN A;  2YC0 A;  3ICX A;  4O4I B;  4FLY A;  1AP5 A;  2PYJ A;  1YCI A;  1K5S A;  5LA6 A;  1NTM H;  3AG3 B;  2UXB O;  4Q6G A;  4IL6 Z;  2CAZ C;  3QNE A;  3CXC U;  4D7S A;  5JVD B;  4I9W A;  2BTQ B;  4O4H B;  1ZL8 B;  2N74 A;  5IWA B;  1XMO O;  2UXD B;  1AI7 A;  1BCC H;  1VQN V;  4K35 A;  4JTD B;  1HWY A;  5BY1 A;  4BAY A;  1JJO A;  4CZZ A;  1HP8 A;  4YJ2 B;  4FM2 A;  2ZR2 A;  1BHA A;  3ZHU A;  3K57 A;  4FM0 A;  2GV9 A;  4CS2 A;  3ZRW B;  4NB5 A;  4FVM A;  5L3E A;  2Y0I A;  4GX0 A;  2UUA B;  2B1G A;  3KCX A;  3S3X A;  4U3J A;  2PI4 A;  2GSM B;  1NH2 B;  3B8M A; 
#chains in the Genus database with same CATH homology
 1P4R A;  3CCV V;  2F43 G;  4F4L A;  3JD4 A;  1SES A;  3K79 A;  3LNM B;  5CA3 A;  4RO2 A;  3UM7 A;  3ZN1 A;  4LBE C;  1LNQ A;  1G8M A;  1SZT A;  3ZMV A;  5L3B A;  1VQM V;  5CBH A;  2IJK A;  2WLL B;  3AG1 B;  4OXS A;  1S77 D;  1S3J A;  2CK3 G;  3IGA C;  1YJN V;  3SPI A;  3CCU V;  4QE9 A;  4RQE A;  4PEL A;  3OUF A;  2A9H A;  1NKD A;  1QVG U;  3PJS K;  2V1D A;  2DWE C;  1QR9 A;  4JYB A;  2XAH A;  4X8A A;  3JCZ A;  4WFF A;  1R6N A;  2EIN C;  3ZCC A;  2IW5 A;  3LSS A;  3ZRS A;  1CEZ A;  2QA4 V;  3OE7 G;  3A0R A;  4P9P A;  1QBZ A;  4LP8 A;  3OMA B;  3MD0 A;  4GX2 A;  3E35 A;  3ASN C;  4N21 A;  4KP4 A;  4PA4 A;  3ZMZ A;  2EIN B;  1F4N A;  1K8A W;  1R3I C;  3EFF K;  3G4S V;  5IY5 C;  1OCO C;  1VQL V;  3AG2 C;  3ASN B;  3JD0 A;  5L3C A;  3CCS V;  3R65 A;  2EIJ C;  4KUM A;  2IU0 A;  2OTL V;  1SRY A;  4N23 A;  1MSW D;  1YTF D;  1JCH A;  4JAV A;  3I55 V;  1KKD A;  5IY5 B;  1OCO B;  3BEH A;  2X6C A;  5EC1 C;  4GT1 A;  3F7Y C;  5DM6 V;  3AG2 B;  3B8N A;  3HPL C;  3F5W C;  1GKF A;  3K0D A;  2W0F C;  3D3I A;  3SPG A;  1Q86 W;  1BHB A;  4R50 A;  2X7R B;  1H8H G;  1MOF A;  1GO3 F;  2Z5U A;  2EIJ B;  3CMA V;  1NVP D;  1P7B A;  3LSQ A;  1GTO A;  1E79 G;  1L1F A;  1M1K W;  3CP1 A;  3ABT A;  3CCE V;  3OR6 C;  2WWW A;  4UVC A;  5IDJ A;  3E2E A;  2Q6A A;  2DQ3 A;  3E83 A;  4XBF A;  2QKS A;  5LHG A;  1OCZ C;  1G4Y B;  4RUF A;  5IYD O;  2MK3 A;  1YJW V;  4PDV A;  3E8G A;  2JK5 C;  3ABL C;  3GB7 C;  4J9Y B;  4MVR A;  3STZ C;  3FKS G;  4MW3 A;  1Q82 W;  5KA5 A;  4GX5 A;  2LFR A;  3D36 A;  1AI5 A;  3DGE A;  2XAG A;  1OCZ B;  2HR3 A;  1K92 A;  3FB7 C;  2BOB C;  1PNM A;  4PA6 A;  1FFT B;  2ZDI A;  5H6Q A;  3MHS C;  1F51 A;  1QCE A;  2B5U A;  3ABL B;  4GX1 A;  5CBG A;  1YSC A;  2R9I A;  1YHQ V;  1KD1 W;  3CC2 V;  1VQ5 V;  2YEV A;  3ABK C;  4WFH A;  3AG4 C;  4MTF A;  3I56 V;  4TT3 G;  4J9Z B;  2NLJ C;  5KUK A;  2W6J G;  3W7S A;  3RVY A;  1JOY A;  1SET A;  4G2K A;  3K08 A;  4MTX A;  3AG4 B;  2Y48 A;  3CCR V;  2ZD9 A;  3LUT B;  3BY6 A;  2ZXW C;  4TSF G;  2P7T C;  4UUJ C;  4DXW A;  4H33 A;  3K04 A;  2QTO A;  5EBW C;  1NQT A;  1COW G;  1OHH G;  2LFS A;  2WAM A;  3ZMS A;  5BZB A;  1W2B U;  4JYC A;  4BW5 A;  2BOC C;  4ZBM A;  3JD2 A;  3QO5 A;  1GM7 A;  4P9O A;  3CPW U;  4MS2 A;  3B77 A;  1R3J C;  2FTK A;  3TK1 A;  2ZXW B;  3K03 A;  1K3E A;  1YIJ V;  1SER A;  2IH3 C;  1FXK A;  4UV8 A;  3ZRW A;  4QPK A;  3OW2 U;  2XOK G;  1J95 A;  4MVU A;  2QM7 A;  2W6I G;  2EJR A;  5LGU A;  4JAS A;  1AI6 A;  3E8B A;  1AI4 A;  1YIT V;  1K4D C;  2YSU B;  5GW7 A;  5LGT A;  2C2A A;  2EZP A;  2P67 A;  4UXN A;  1W0J G;  2WLI A;  1Y66 A;  5LGN A;  3W7T A;  3OMN B;  4XDL A;  1JQ0 A;  5H9C A;  1V55 C;  3ZMU A;  2QE7 G;  3FYI B;  1M90 W;  4H37 A;  3CC4 V;  2WLM A;  3W7U A;  2X0L A;  1RM1 C;  5HFL A;  3E8F A;  1NVP B;  4WFE A;  4WFA V;  2WLL A;  1NH2 D;  3VOU A;  1ROP A;  2ZR3 A;  3JD1 A;  1V55 B;  1QLE C;  5B1B C;  1XL4 A;  3RW0 A;  1S72 V;  5HFM A;  1RM1 B;  5KUM A;  4UVB A;  1YJ9 V;  2DWD C;  3CD6 V;  2B1I A;  5H6R A;  4MTG A;  3K06 A;  3P32 A;  3TET A;  3JD3 A;  3OUS A;  2HFE C;  4MVO A;  1F4M A;  3RVZ A;  1OCC C;  4L87 A;  4U7O A;  3ZMT A;  3RBZ A;  1PKX A;  1QLE B;  1KP2 A;  3HB3 B;  2JEX A;  5B1B B;  1QVF U;  4ZKI A;  1GMG A;  4BIU A;  4E2L A;  5DN6 G;  2JJ2 G;  1K33 A;  2A79 B;  1OCC B;  1VQ6 V;  2XAF A;  3OEE G;  2ZDI C;  1NBM G;  2Y69 C;  5LHI A;  4FJC C;  1RPR A;  3FYE B;  3SPH A;  3M99 B;  1MG1 A;  5J9P C;  1S0V A;  2XAJ A;  1H2G A;  5CMU A;  3ETE A;  2Q68 A;  3ZJZ A;  2IU3 A;  5EBL C;  2OTJ V;  3ETD A;  2Y69 B;  3P30 A;  4JPR A;  3SYA A;  1E1R G;  3LDE A;  1KC8 W;  5LBQ A;  2YEV B;  3CC7 V;  3SPJ A;  3VBB A;  1ZWI C;  1N8R W;  1K34 A;  1THZ A;  2HVJ C;  5C93 A;  4HYO A;  3SYP A;  1H8E G;  2HLD G;  1OZ0 A;  2ATK C;  2Q67 A;  1IXM A;  1QR8 A;  2EBO A;  1S76 D;  5B1A C;  4P30 A;  4JTA B;  1GM8 A;  1Y4M A;  2M7W A;  3UKM A;  5CN0 A;  5EBM C;  4JAU A;  1KP3 A;  2D3O W;  4BIZ A;  1XL6 A;  3CCM V;  4QPJ A;  4FMT A;  5KA6 A;  1JPX A;  3NXS A;  1VQ8 V;  2DYR C;  5L3D A;  1DF4 A;  3ABK B;  4G28 B;  3KG2 A;  2JJ1 G;  5CBF A;  1F23 A;  3ASO C;  1V54 C;  4RUE A;  3K3W A;  4XDJ A;  1WPX A;  1S5H C;  2UXN A;  3G71 V;  3ETG A;  1FXV A;  1PNL A;  2KB1 A;  2IH1 C;  3SPC A;  3LDC A;  2DYR B;  2WSS G;  4DO2 A;  1KEC A;  1M9N A;  2ZQM A;  1AJP A;  3ABU A;  1PNK A;  5B1O A;  3ASO B;  1PL0 A;  1V54 B;  3CCL V;  1BL8 A;  2DW4 A;  4MSW C;  4XDK A;  1FXH A;  1M56 C;  3CYO A;  4WFB V;  4CBC A;  1K9M W;  4QNH B;  1PD3 A;  2H8P C;  2JDI G;  3SJQ C;  3MHH C;  4JTC B;  4MVS A;  4X88 A;  2Q69 A;  2XAQ A;  3STL C;  2X6A A;  5IYC O;  2H94 A;  1RPO A;  2WLI B;  1R6K A;  3CME V;  4U7N A;  3F7V C;  1M56 B;  3OR7 C;  3QO8 A;  1WLE A;  2EIK C;  4HAM A;  2AHZ A;  2EIM C;  4KFM A;  3H01 A;  2A0L A;  1EFR G;  4QIW F;  3SYO A;  4Z1M G;  5EC2 C;  4MW8 A;  4MTO A;  5E1A C;  1YTF B;  2PI5 A;  2DQ0 A;  4JF3 A;  3G6E V;  3X2Q C;  1E1Q G;  4UV9 A;  3SYQ A;  2EIK B;  1TUE B;  2WLN A;  2WLH A;  2EIM B;  5FL7 G;  3OFN G;  1JX9 A;  1R3L C;  4I5S A;  1VQP V;  3ML0 A;  1JJ2 U;  1R73 A;  2LP7 A;  3W7X A;  1YI2 V;  3ZRV A;  2OCC C;  3JYC A;  5B1N A;  1NR7 A;  2X6B A;  4R7C A;  1CPY A;  3X2Q B;  3OGC C;  5L3F A;  2HJF C;  2UXX A;  2ITC C;  2DYS C;  2JEU A;  4FK5 C;  4QE7 A;  2GHY A;  2ITD C;  1ENV A;  3T2M A;  1KQS U;  2OCC B;  3OM3 B;  3FB8 C;  3K9A A;  2WLK A;  4FPP A;  5B3S C;  3T1C A;  1VQ4 V;  2NNU A;  2P90 A;  3SYC A;  2DYS B;  1I5X A;  3IFX A;  1DF5 A;  4PDR A;  3TCU A;  1UJW B;  2R9R B;  3DTU B;  1JVM A;  4MVM A;  4PDM A;  4G27 B;  1MAB G;  2V7Q G;  1M57 C;  1I5Y A;  2IJJ A;  2IJH A;  3OEH G;  4JGS A;  5B3S B;  2IJI A;  4LCU C;  1QLN A;  2HVK C;  2WPD G;  1K5Q A;  4Q20 A;  4X89 A;  4QJF B;  3W7W A;  1B6Q A;  3E8H A;  3ABM C;  5L3G A;  2P6J A;  4LC1 A;  1M57 B;  5LHH A;  3ZRX A;  1NR1 A;  4R6Z A;  1Q7Y W;  3IC7 A;  4R8C A;  3AG3 C;  3CCQ V;  1Q81 W;  1DTO A;  4EKW A;  4PA9 A;  1BMF G;  2AHY A;  1AJQ A;  4PA7 A;  1CP9 A;  1ORQ C;  3OMI B;  4ASU G;  1AJN A;  3ABM B;  4TWK A;  2EZO A;  4MVQ A;  1VQO V;  1K5S A;  5EK0 A;  3WFV A;  1K7D A;  3AG3 B;  1AR1 B;  3QNE A;  3ZN0 A;  3CXC U;  4PA3 A;  4GCZ A;  3E86 A;  1OCR C;  4WF9 V;  1EZJ A;  1R3K C;  3QO7 A;  4I9W A;  2HG5 C;  2JIZ G;  3EHB B;  1AI7 A;  2XAS A;  4UVA A;  2HKO A;  3WG7 C;  3FB6 C;  1K73 W;  1VQN V;  1VQK V;  3FB5 C;  1W0K G;  4JTD B;  1OCR B;  5B1A B;  3T4D A;  2OT5 A;  2QEX V;  2Z3Y A;  1NJI W;  1HWY A;  1FXK C;  4WFG A;  4BAY A;  3WG7 B;  4CZZ A;  2XND G;  2WLJ A;  3E89 A;  2ZR2 A;  1BHA A;  1VQ7 V;  4FIP C;  1GK9 A;  1EBO A;  3CCJ V;  2QM8 A;  2EIL C;  4MT8 A;  3OAA G;  4WCE V;  1FXK B;  4PDL A;  3LDD A;  3ZRW B;  4P2Z A;  4YXW G;  4MVZ A;  1ARO P;  1GM9 A;  3GWO A;  5L3E A;  3T4Z A;  4GX0 A;  2B1G A;  4RQF A;  4HZ3 A;  1H38 A;  3ZIA G;  2K1E A;  2PI4 A;  1K97 A;  2EIL B;  1FS0 G;  1VQ9 V;  4RAI A;  2GSM B;  1NH2 B;  3K0G A;  1DLB A;  1K4C C;  5IYB O;  3B8M A;  3AG1 C;  3AEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...