3H01A

Structure of the c-terminal domain of a putative hiv-1 gp41 fusion intermediate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
54
structure length
54
Chain Sequence
EWDREINNYTSLIHSLIEESQNQQEKLEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Role of a putative gp41 dimerization domain in human immunodeficiency virus type 1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
molecule tags Viral protein
total genus 24
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3h01A00
3B8MA 5KA5A 1QBZA 3H01A 3P30A 4FJCC 3M99B 1SZTA 1QR8A 1K33A 2MK3A 4E2LA 1QCEA 1EBOA 1DF4A 3MHHC 2OT5A 4N21A 2EZOA 3CYOA 3CP1A 5CN0A 1I5XA 5HFLA 2EBOA 2M7WA 4FIPC 2LP7A 3K9AA 3MHSC 1ENVA 3B77A 1Y4MA 1JQ0A 4JF3A 1QR9A 5H9CA 1I5YA 5HFMA 1MOFA 1K34A 3WFVA 1Y66A 5CMUA 1DLBA 4JPRA 1F23A 2EZPA 4G2KA 5KA6A 2P6JA 4FK5C 1DF5A 4JGSA 4N23A 3B8NA 1MG1A 1JPXA 2X7RB 3GWOA
chains in the Genus database with same CATH superfamily
4GKJO 2XASA 4FLTA 5JVDA 1YTFB 2EX3A 3RYCB 2WLHA 1Q86W 3DC6A 4CC6A 1BCCH 4IT5A 4LH7A 1NJIW 4H37A 2QTSA 4X89A 4PI0A 1VQMV 4I4TB 1GK9A 3SPIA 4DV6B 5LMNO 1QQCA 1Q81W 1L0NH 2R72A 3QG5A 4CS4A 4NXMB 3CC2V 3ZIAG 3CRAA 1N36B 5LHIA 2E74B 2B9ZA 1HDJA 2XTAA 3WB2A 2RN9A 2HJDA 4J9YB 3E83A 1J95A 4BR6A 4MVOA 3VQXA 2AZ0A 1PPJH 2UUBO 3EVKA 3Q4HA 2HP8A 3M7MX 5K1PA 1AJPA 1X59A 2QR4A 2MK3A 1R3IC 3ASOC 3FB5C 2OIGA 1Y74B 4B3TB 2YSUB 5KHHA 3ZN1A 5D5QA 5DEDA 2XAFA 1N33O 2DW4A 4JI4O 1R3JC 4B3RB 3JASB 3QO7A 3ETDA 4UCUA 5LP6C 2CTQA 4EB6A 3CCEV 1AVMA 4I7ZB 4BIOA 2LW1A 2ZE8A 4AQYO 3TXQA 1K9MW 1Z5VA 3OR6C 2NR5A 4JYAB 4O2BB 2BOBC 1N32O 4CH6A 4DO2A 2Q73A 4KUMA 1SZXA 1XI1A 4FM2A 2IJIA 2YXLA 3E8FA 1AI6A 4PA4A 1H8EG 2Q69A 3ZRVA 1QLNA 4GLXA 1GO3F 3ASNB 2LP7A 3MHSC 5L3CA 2WAMA 1GM7A 4W4LA 2RMKB 2Q9LA 3G67A 1Q6UA 1PL4A 5EYPA 3OTOB 4F4LA 5E79Z 1R1BA 5EC2C 3ZHUA 3HKEA 3BVOA 1DF4A 1JFFB 3STLC 4DUZO 2L6LA 4PHZA 3CRMA 2XT9A 1UFIA 3ETQA 2CH7B 3JD4A 1GTOA 4O4HB 2WLLA 5F2VO 2K1EA 1CPYA 1ZSPA 3H01A 1AR5A 1A32A 1NT2B 5LXTA 1PNMA 1H2GA 2LFRA 3RYIB 3FD9A 3W7TA 3GVMA 1OCRB 5BY1A 3ZMZA 3DSQA 4JI1B 3JAKB 2XHBA 1Y6XA 2Y48A 5KA6A 1HNXO 2F66C 4LFCB 3J81N 1XBLA 1R6NA 4LNUA 4GKJB 1JJ2U 2N74A 5CBFA 4EEQA 2F43G 5EZYB 1SF9A 3L72H 1XMQB 3T1YB 3OR7C 2A0LA 2YDEA 2GTSA 1XEQA 2PGGA 3SJQC 4UFZA 1NR1A 4XBFA 3RW0A 2ZT9B 2P4KA 3SYCA 3FYIB 5LMNB 2B1GA 3GB7C 3N2KB 5B66Z 3ABTA 2ZINA 4QPKA 1ZUQA 3ASNC 3CXCU 3CX5F 4PDMA 5A9GA 1ORQC 1YCIA 1O9GA 1NU1H 5LOVB 1EZJA 2PYJA 1CEZA 3E8BA 1P49A 3RFRA 1GN6A 3T4ZA 4OGQB 1THZA 1JVMA 4BIUA 2FB5A 4AHCA 4LCUC 3KG2A 4NYKA 2JDIG 4ABMA 5JCOA 2W0XA 1WJZA 2WLIA 2CDYA 1IZ3A 3OEHG 3OT7A 1N34O 1BE3H 4PA9A 2YXYA 4X1IB 3SPGA 3RYHB 4DR2O 1MOFA 3L71H 1N33B 1XHZA 1VQ8V 1F7YA 4JI4B 2R9IA 3CS5A 4UCTA 4RAIA 3HR0A 1GM9A 2DWEC 1Q82W 3QO8A 2UXBO 4D7SA 2Y4UA 1OCRC 1I7FA 4MTOA 2P5OA 4X65B 3UM7A 5KHJA 2D3OW 3VBBA 4UB8Z 3VOUA 4F6RA 4ZI7A 2JVDA 2BSKB 1KB9F 1RSOA 3CB2A 2XAJA 2H3OA 2A06H 4GX0A 4TQDA 4DR1B 1M93A 1N32B 4H44B 1YI2V 4OX9O 2VWJA 1FJGO 4J7ZA 3JD1A 2C2AA 4B7EA 3HB3B 1FXKA 1G4YB 4FZ0A 3CMEV 4HZ3A 2L35A 1XOUA 2RNBA 3B2EE 5CA0A 5J9PC 1Y76A 2XAHA 1NBMG 4DXWA 1R6TA 3M99B 5B5EZ 4ICGA 4PA3A 1YJNV 3FFQA 1QVFU 4DV0B 3K03A 2AXTZ 1TUBA 4QIWF 4P9OA 5KUMA 1IBKO 4DV3O 1SA0B 4NTXA 4LF9B 2KG7A 4R8CA 1L8DA 3JALB 4TV9B 3ZMTA 5BR8B 1ZL8B 5LGNA 1GH6A 2GTAA 1SKVA 5IJ9A 5IWAB 4UCSA 3B4SA 1EN5A 3CC7V 4CH5A 1VQ4V 1Y4MA 5JQGB 4QPJA 1GRJA 1WA8B 1KBHA 4LF8O 1S5LZ 4DR6O 1KKDA 1V9PA 3CCMV 2E5LB 2WLMA 4PJ0Z 1HNXB 2KSDA 4TUYA 3TXSA 3JAWA 4NXNO 4RQFA 3F5WC 4K35A 3T1HB 1K5QA 1MA1A 3ABKB 5BMVA 3X2QB 4GX2A 1ZAUA 3W7UA 4FLWA 1S3JA 1WP8A 4LBEC 5KAFZ 1ROPA 3C3SA 4CH4A 5JJJB 4GYCB 4UV8A 2X6AA 2QKAA 3EHBB 3OMAB 4NXMO 4O4IA 1B6QA 4MT8A 5EBMC 1AI4A 4X64B 5CBGA 1N36O 1HNWO 1SERA 4DV4B 2CE4A 3CMAV 1NH2B 4LF7B 1SQVH 3K06A 1TA8A 4K8XA 4WCEV 4ZHQA 2OWOA 4MTGA 5EIBD 1GN4A 4UUJC 3E22B 1XNQB 3MHHC 4DUYO 4X88A 4LF4O 1B3QA 1L1FA 1N34B 1BGYH 1RFYA 4YY3O 2BTQB 4QE9A 4JI6O 4X1YB 3WFVA 1FFXB 4B3RO 4DR2B 1BMFG 3JARB 4B3MB 4I55A 2ZXWB 5KMGA 5LA6A 2OTLV 1H2KA 3E8HA 4GT1A 5GTHZ 4NKGB 4YIPA 2UUAO 2UXBB 2PUSA 2R9RB 1M9NA 4EKWA 2YI9A 4H33A 4JYAO 1XDCA 4X20A 1AP6A 3ZRWA 3N27A 4ZKIA 4Q20A 3X2QC 2PTMA 3JATA 4CH3A 4JI7O 1FJGB 3ZN0A 3ABMB 1IXBA 1P7GA 4KFMA 3LSUA 4I9QA 3E35A 2QTOA 2VWKA 2YUAA 3K79A 1COWG 4BW9A 5IYDO 2ZE7A 3ZRXA 1Q8IA 2QGNA 1FKAO 2VS0A 2CTWA 2KQXA 4I0XA 2QWRB 2EZOA 1FFTB 2Y0IA 3H9VA 3CCLV 3WU2Z 2AZ2A 1H38A 3BFRA 3OFNG 3CEIA 3BAAA 5EBWC 1IBKB 1BHBA 4DV3B 3K0DA 4JGSA 1CP9A 3ZCCA 4U3JB 1GN3A 3G6BA 4FLYA 1KUQA 4MSWC 1GKFA 2B1IA 4O2AB 4J11A 4MVSA 3ETGA 3K9AA 2E75B 2QWQB 5LYJA 1E1QG 2FKXA 5FNVA 5J2UB 2ZXWC 2FL4A 2HHHO 1S76D 3E89A 4DR5O 2EJRA 3RWRD 5H2FZ 4X9QA 2ZNIA 5LP6A 2ATKC 1TVKB 4NXNB 3CCVV 1KP2A 5IJ0B 3SJCC 2ZNJA 5JVDB 1XMQO 3SR2C 3T1YO 2IU0A 1B06A 2UU9B 4CS2A 3SPJA 4YJ2A 4DW0A 4DW1A 4K0KO 3CCUV 2HVKC 3FYEB 1TUEB 1M57B 4YJ3B 5LHGA 3FAVB 5GW7A 4N23A 3ABMC 1QBZA 3FX7A 3LSQA 5L3BA 3WG7B 2IJKA 4JI0O 1HNWB 1D5AA 1Q90D 2IW5A 4LH6A 1AB3A 2PI4A 4JYBA 4TOIA 5B1BC 4I50B 1R3LC 1K34A 5ITZB 4UCRA 1QU7A 1KKCA 1URFA 1MNGA 4UVAA 4RQEA 3ZS8C 1YITV 3Q4HB 2Q7HA 1VIBA 1LR1A 2JRIA 4H13B 2Q0OC 4DUYB 4LF4B 4YIOA 1VQKV 2M7WA 1VARA 3W7XA 1XILA 1S77D 4YY3B 2XAQA 4RO2A 3K58A 4JI6B 3RYFB 2OTJV 1BQZA 1KECA 1Y74A 1SC5B 2JIZG 3A0BZ 1TAEA 5CN0A 2UUAB 3OM3B 2X6CA 4X65O 3L74H 1QR9A 3JASA 5LGTA 4HNAB 2HJFC 1W0KG 3APQA 1WNSA 5KHKA 4R6ZA 4DR1O 1JCHA 1VQ7V 4FFBB 1AI7A 4X62B 4UVBA 2ZCEA 2EILB 2XNDG 4JI7B 3RVZA 5B3SB 3KCXA 4HAMA 2RDCA 1M57C 3VQWA 1SQQH 3O9OA 4O2BA 2CUGA 3HKDB 3JD0A 2AGAA 3P3PA 1IBMB 3HKCB 4WFHA 1F4NA 2YEVB 1RP3B 1H8HG 4CZZA 3BEHA 2QSAA 4MS2A 1JPXA 3WG7C 2MW2B 2QM7A 5JH7A 4U3FH 3K5MA 1PL0A 2CGOA 2GUZB 4DV0O 4PA6A 1EZVH 2PI5A 3KZIZ 3L70H 4LF9O 5H9CA 1I5YA 1IBLB 5BR8O 1OCCC 1K4CC 4G27B 2XAGA 1IX9A 3ZHSA 2LJ2A 3OMIB 1JFFA 2WLLB 3SYQA 4BWAA 2CH7A 4XDJA 4RWUA 3TK1A 5IWAO 4O4HA 2QKCA 4MVQA 1YTFD 2DOSA 5LXTB 1CXZB 2QJ1A 1Y66A 1M1KW 1DLBA 2E5LO 2HHHB 2ZM6B 3CHXA 1MMMA 5DM6V 5L3GA 1VF6C 4DR5B 1VQLV 2UXXA 1PNLA 3RYIA 3T1HO 1Q5OA 4J7JA 2HG5C 3OW2U 2IM9A 1M4UA 3F7VC 4K0KB 3JAKA 4PI2A 3G80A 1VEWA 2DYRB 3E86A 3IC7A 3B8NA 2EILC 5EZYA 5B3SC 1W2BU 5H6QA 5KHGA 4X64O 4I9WA 4AI8A 5KAIZ 1K73W 4B7KA 4JI0B 4DV4O 3JD2A 4LF7O 2V4DA 1GN2A 1NTKH 5CA1B 4A5UB 2UXCB 2JGDB 1EM1A 2LO1A 3BHPA 4DV2B 2GHYA 1XQ8A 1Q43A 2X7RB 4UCOA 3N2GB 1XNQO 4FZ1A 4PDRA 3KCYA 5LOVA 1JMKC 3FB6C 4DR7O 3PJSK 1H2LA 3HPLC 1TGOA 3THOA 2YC0A 2W6JG 4B3MO 2ZDIC 1AR4A 3SJBC 1KD1W 1EFRG 2QEXV 1D2DA 4O4LB 5D5PA 1VQ5V 2N04A 2GV9A 2ZR3A 2NNUA 2A7WA 3BRCA 4X1IA 3L75H 5AG2A 1IXMA 4YXWG 1QLEB 2BCCH 5C8YB 5LHHA 3H1HH 4JI2O 3K3WA 1K5SA 3J80N 3SYAA 2DYSB 3GWOA 3UCSC 1RSOB 2WSSG 1SQFA 5KA5A 5J2TB 1XREA 1V54B 2K9PA 2DYRC 2BSKA 2OYQA 3IC9A 3UQ8A 1FXKB 1BZKA 1YJ9V 2RQ6A 1NI8A 5EBLC 1Q6HA 4LC1A 4MVMA 4LFBB 2AHZA 3B8MA 3AK2A 3UO3A 1Y76B 4MW8A 1UPGA 5KX5B 2Q6AA 2ZIMA 1ZLZA 3A8TA 3M8AA 4BW5A 2NLJC 2V1DA 4RUFA 2N05A 5B1NA 1TUBB 3IGAC 2LGWA 4WBNB 3JSLA 5BXZA 1NKDA 4FK5C 1DGSA 5IDJA 1QNMA 4K3AA 4IIJB 5GTIZ 3QTCA 2EULA 5JCOC 1LNQA 1SQGA 2WA3A 5IYZB 2W0FC 1NVPB 3QO5A 3R65A 1SA0A 4TT3G 4R7CA 2X0LA 3AK1A 1K4DC 2GSMB 3JALA 3SYOA 4CC5A 4PD4F 4TV9A 2ADQB 3O65A 3LDDA 3G4SV 4FM0A 2EIKB 4DK1A 1SETA 4LF5B 1ZX3A 3LDCA 1IVSA 1AJNA 1K33A 3CCRV 4DYLA 3LUTB 2OT5A 1BSMA 4KL1A 1K8AW 5JQGA 1QLEC 5EIBC 1WA8A 1HP8A 2DQ0A 2UU9O 3W7WA 2PF4E 4AILC 2VQEB 2A3QA 3ZEDA 1WB8A 3AG7A 2YIBA 2DYSC 4JI8O 2O57A 4Z1MG 1FD9A 3RGBA 4F6EA 1JA8A 4G2KA 1ZWIC 4TV8A 1V54C 2VQFO 2X6BA 3DXRB 1WPXA 5DECA 3OAAG 4LWSA 1GAXA 1FXKC 2ARHA 2JEXA 2HEPA 3HKBA 2RCVA 1RM1B 2OIEA 1FXHA 2XOKG 2ZD9A 3P32A 2P06A 2Q0AA 2Q7EA 4P2ZA 5KLVH 1Z5WA 1FYJA 2JK5C 2LW7A 1LUVA 4NR1A 2D2CB 3H1JH 2F1MA 1NQTA 3ZHTA 1N0NA 1AI5A 2BTOA 4O4JB 4DR7B 5LGUA 3G6EV 3NXSA 3FKSG 1U96A 4EFEA 1MG1A 3E22A 2ITDC 5BZBA 1XL6A 3ZHVA 2Y0PA 3QNEA 5LA6B 1OCZB 2DJVA 4IHJB 3CJHB 4DRXB 2G38A 5L3DA 4X1YA 2QM4A 1FFXA 2EIKC 2QWOB 3JARA 3JCZA 4JI2B 4JI5O 5HFMA 4FMTA 4XDLA 2YS8A 3ML0A 4UB6Z 2FYUH 4X62O 3K5NA 5B1OA 3ZBHA 4DR4B 1J5EB 3AG4B 2YICA 1IURA 1YF2A 2AHYA 5A2QN 1E1RG 1MZFA 2V7QG 4RUEA 1YEWA 1IBMO 3OEEG 1U97A 4X1KB 3LNNA 5CB4B 1VQPV 4ZOLA 1SQXH 1YHQV 5B1BB 3SGIA 5KHIA 4LP8A 1G6UA 4MTFA 4FLUA 1HR0B 2A79B 2XUMA 1RM1C 1KYOF 1Y67A 5HFLA 1MSWD 3CD6V 1WLEA 2WLJA 3AG1B 3TJTA 5B1AB 5GONB 1S0VA 5KUKA 3ZMVA 4FLVA 5TISZ 1IBLO 4H0LB 2P7TC 4FVMA 1P7BA 1E79G 2Y4TA 1OZ0A 4CS3A 2YIBD 1AJQA 2EIJB 1G1XB 1D5NA 4P30A 3CYOA 2JJ2G 4GKKO 1BHAA 1I0HA 2NN4A 4PDVA 4FLZA 4U3JA 3UT5A 4NTYA 2HR3A 3G71V 1N8RW 3RBZA 3DGEA 4E2LA 5IY5B 1VF7A 4O2AA 2ZM6O 2YIAA 1K3EA 3K5LA 1OCZC 3AEIA 4D7TA 5IE9A 1VF5B 3BA8A 5C93A 4LFAO 3LSSA 3CCSV 4JASA 3CP1A 4ZIBA 3D8CA 3P3NA 3AK3A 2JEUA 5J2UA 3ZMSA 1M5IA 2ILMA 4GUNA 4YHHO 4JV5O 1SS3A 3EFFK 4YJ2B 2LFSA 3R66A 3KKYA 5H5NA 4JI8B 5CMUA 1F23A 3A2FA 2QDOA 1TVKA 5IJ0A 3RYCA 2IH1C 4WFAV 2VQFB 3AG4C 2JGUA 2ZQMA 3L73H 3MDSA 4I4TA 4YJ3A 4LR3A 5LBQA 2UXCO 3FAVA 2UXNA 5IYBO 4PA7A 2WLKA 2R70A 4DV2O 3SJAC 3I5DA 4Q6GA 1DTOA 2PYLA 3P30A 3DTUB 2CAZC 1I94B 1OCCB 3K04A 4OXSA 2DWDC 3AG1C 3T1CA 5B1AC 3K08A 1HNZO 4I50A 4FIPC 5ITZA 1JQ0A 1SESA 4WFFA 4PDLA 2F4VO 2OCCB 1BT8A 1H2SB 2EZPA 2P6JA 3AG3C 3D36C 1FXVA 2EIJC 3TCUA 2OCHA 4DV7B 3MAQA 3S3WA 3CPWU 4EB6B 1GM8A 4EFBA 2IJHA 3QF7A 3RYFA 3WB1A 2E3CA 5IY5C 4JI5B 1OV9A 2ADPA 3F7YC 1N0JA 4J80A 2UUCO 1F51A 1VF6A 1Q7YW 1QCEA 1W0JG 2CTRA 1EBOA 3ICXA 4KHPO 2QM8A 3C90A 4HNAA 4BAYA 1P84F 3T2MA 4LF6B 1XMOO 4J9ZB 4OPHA 4FFBA 1XHXA 2Z5UA 3ABLB 5EK0A 1VQ9V 3B40A 4LFBO 2P67A 3OUFA 2WLNA 3SPCA 4IYIA 3UKMA 4WFBV 5EYPB 4R50A 4FJCC 2KB1A 4JZ2A 3SPHA 4JTCB 3JSNA 4TWKA 5JH7B 4DV5O 4MTXA 3HKEB 3HKDA 1R3KC 2P90A 3HKCA 1NR7A 4PV1B 4JAUA 3RVYA 2HKOA 2YEVA 1ENVA 1GMGA 1T5EA 1B04A 3BPZA 3CSXA 3OGCC 4I5SA 3E2EA 3W7SA 3H1IH 4UV9A 1Z2GA 2GUZA 1KU9A 1YIJV 3OUSA 2H94A 3A0HZ 1F4MA 4GKKB 1VP7A 1RPRA 4K8ZA 2UXDB 2OCCC 1XUQA 5FPOA 3D3IA 4LF5O 4J7KA 2F93B 3CRCA 1H2MA 4QNHB 4FLXA 2ZDIA 4NB5A 1JX9A 2WPDG 4LFAB 3OTFA 1S5HC 4G28B 4LNUB 4ASUG 1MZEA 2HLDG 2VQEO 4YHHB 4JV5B 1FPOA 2JS5A 4U7NA 2CGNA 4JI3B 2JJ1G 2FTKA 4JYYA 2YI8A 3IJ4A 1YJWV 3CC4V 4ZBMA 3GWKC 4Z2WA 5IT9N 2BOCC 3ABLC 1XL4A 1O9HA 3N2KA 2IU3A 4NVPA 2ITCC 4QJFB 3VQVA 4XDKA 1M90W 4IL6Z 2A9HA 5CA3A 4UXNA 4JTDB 4E4EA 3UO2A 5CA1A 4N21A 3A0RA 5CBHA 2JGDA 1XNRO 2WLIB 5EC1C 1HNZB 1IDSA 3ETEA 1V55B 5L3EA 2GBOA 4DV1O 2F4VB 2QE7G 1YVWA 2M6YA 3N2GA 2UUBB 1VQ6V 4DK0A 4GX1A 3CRQA 4X66O 2WWWA 2EIMB 2YIDA 4QGPA 1AROP 3RYHA 1KC8W 3B77A 2B5UA 3BA9A 3IAYA 1K7DA 1G8MA 5LMUO 1S5JA 1KP3A 2W6IG 4O4LA 4F6RB 4MVZA 4ZI7B 1I5XA 2ODMA 1JJOA 2CK3G 2UUCB 4JZGA 1VQNV 2JS3A 1BQ0A 1VQOV 4DR4O 2Q4PA 1J5EO 4KHPB 5C8YA 3CRRA 2R9AA 4C7UA 2P22C 3L9DA 4AQYB 3S3XA 1XMOB 4B3SO 5J2TA 4NTWA 3OD4A 3WB0A 2F95B 1L0LH 5CA0B 1RPOA 1X4TA 4J10A 1HR0O 1DK1A 1AP5A 1LUWA 1PP9H 4OPAA 4JAVA 4DV5B 1KMIZ 2IBZH 1M56B 1SQBH 1H2NA 2QWPB 3BY6A 1ZTEA 1WP7A 5FL7G 1UJWB 4HBNA 4GZRB 2KG7B 3ZMUA 5KX5A 1BL8A 3STZC 3D3QA 4GX5A 3B09A 3OGIB 1PD3A 3ZX6A 4UCVA 1V55C 4DR3O 4DUZB 4L8JA 4HYOA 3NR7A 5JJNB 2QA4V 2BE3A 4WBNA 4CBCA 5FPRA 3J7AU 3BABA 1FAFA 5IJ9B 2DQ3A 1S72V 2LGQA 4IIJA 1NZ6A 3EXAA 1ZL8A 2DE0X 2ETNA 3JAMN 5IYZA 1OJHA 2EIMC 4IGGA 1QR8A 3FB7C 4KP4A 5JWPA 2KKWA 2CTPA 4TUYB 2AW9A 1K92A 3JAWB 1WB7A 1KQSU 5LL6Y 3K57A 1MABG 3ZHRA 4JTAB 5BMVB 5E1AC 2IH3C 3U10A 2FMLA 2VRZA 3I56V 2F23A 2HFEC 4KXRA 1NTZH 4MVUA 4IYHA 4TV8B 1VMGA 1YDXA 1SQPH 5IYCO 1US6A 3K0GA 4MW3A 4QE7A 4O4IB 1YXBA 4BIZA 4J41A 4LWSB 1R73A 1BS3A 1OCOB 2Q5ZA 3AG2B 1NTMH 4TSFG 2Q68A 4DV6O 4X8AA 4J42A 3HKBB 3I55V 4JI3O 2ZKOA 3DXRA 4JAAA 4Z1VA 5K1XA 1WPBA 2YXHA 1EN6A 3C3TA 4ZHQB 3DC5A 1I94O 1M56C 3ZHQA 2EJ7A 1HWYA 2ZIOA 2DMXA 3T4DA 1XNRB 2Y69B 3JD3A 1N4CA 4WF9V 4D6TH 4UVCA 4DV1B 3U11A 2EINB 2Q67A 1PNKA 4DV7O 3TGUH 3LDEA 4I55B 5KMGB 2Z3YA 3H1LH 4W4KA 4O4JA 4B3TO 1QVGU 4X66B 2GDSA 1SRYA 2BTQA 2WA4A 1W59A 2E76B 4P9PA 3QVNA 4JF3A 1WN7A 2Q8VA 1R6KA 5LMUB 4JPRA 1NS1A 2LQTA 3RT3C 2ZE6A 4TQFA 4FM1A 4X20B 1Q6IA 3CE2A 4IHJA 3CJHA 4WFGA 1MSDA 1PM9A 4DRXA 3ZRWB 3JYCA 3JATB 1WAZA 3K59A 4LF6O 3IFXA 3APOA 4JYCA 3ZRSA 4B3SB 4GCZA 1DF5A 3RN4A 4L87A 2QWNB 3ABKC 1AILA 3MD0A 4ZOLB 3VQYA 3SDLA 3CXHF 3CCJV 4OX9B 4MVRA 4PELA 2ZE5A 1OCOC 1PV0A 3E8GA 1AR1B 3AG2C 1EN4A 3K9SA 2RJZA 4X1KA 2ZR2A 4I0XB 3FB8C 5CB4A 3CWBH 3F5TA 4FFKA 1NVPD 2PY5A 1QHTA 3OTOO 3ABUA 1P4RA 1YZBA 3BCCH 5L3FA 5DN6G 1JOYA 1OHHG 3SYPA 3ZJZA 2HVJC 2Y69C 3AG3B 3PN1A 4DR3B 1YSCA 2DN9A 5GONA 3ASOB 1JR9A 2H8PC 1HW7A 2UXDO 4WFEA 3OMNB 5JJEB 2EINC 3OE7G 3K5OA 4B08A 5LYJB 5H6RA 5FNVB 3UT5B 1Q3EA 3D36A 1K97A 1SZTA 4U7OA 3TETA 5LP6B 2PZSA 1FS0G 2EBOA 2QKSA 2P4VA 3H1KH 4FPPA 2Z0AA 5FLXN 4LF8B 3JCUZ 4JI1O 1NH2D 2IJJA 4DR6B 3U0ZA 3LNMB 2Q7GA 4LFCO 1I08A 1PKXA 3CCQV
chains in the Genus database with same CATH topology
2WSSG 5KA5A 2XASA 1YTFB 1YIJV 3OUSA 4UUJC 1V54B 2WLHA 1Q86W 3MHHC 4X88A 2H94A 1NJIW 4H37A 1F4MA 4X89A 1L1FA 2DYRC 1RPRA 2OCCC 1VQMV 1FXKB 1GK9A 1YJ9V 3D3IA 3SPIA 4QE9A 5EBLC 3WFVA 4LC1A 4MVMA 1Q81W 1BMFG 2ZXWB 2AHZA 4QNHB 2ZDIA 3B8MA 2OTLV 3CC2V 3E8HA 3ZIAG 4GT1A 1JX9A 2WPDG 4MW8A 5LHIA 1S5HC 2Q6AA 4G28B 4ASUG 2HLDG 4BW5A 4J9YB 2NLJC 2V1DA 3E83A 4RUFA 2R9RB 5B1NA 1J95A 4MVOA 3IGAC 1M9NA 4EKWA 4H33A 1NKDA 4U7NA 4FK5C 5IDJA 3ZRWA 1AJPA 2JJ1G 2FTKA 1LNQA 4ZKIA 2MK3A 1R3IC 4Q20A 3X2QC 3ASOC 3ZN0A 3FB5C 3ABMB 4KFMA 2W0FC 1NVPB 3QO5A 3R65A 1YJWV 3CC4V 2YSUB 4ZBMA 4TT3G 4R7CA 2X0LA 1K4DC 2BOCC 2GSMB 3ABLC 3SYOA 3ZN1A 3E35A 2XAFA 1XL4A 2DW4A 2IU3A 3LDDA 3G4SV 1R3JC 2ITCC 2QTOA 3K79A 2EIKB 4QJFB 1SETA 1COWG 5IYDO 3QO7A 4XDKA 1M90W 3LDCA 2A9HA 3ETDA 3ZRXA 5CA3A 4UXNA 1AJNA 1K33A 4JTDB 3CCEV 3CCRV 3LUTB 2OT5A 4N21A 2EZOA 3A0RA 1FFTB 1K8AW 1QLEC 3CCLV 2DQ0A 5CBHA 1H38A 3W7WA 2WLIB 5EC1C 3OFNG 3ETEA 1V55B 5EBWC 5L3EA 1K9MW 1BHBA 2DYSC 3OR6C 3K0DA 4Z1MG 2QE7G 4G2KA 1ZWIC 2BOBC 4JGSA 1CP9A 3ZCCA 1V54C 1VQ6V 4DO2A 2X6BA 4KUMA 4GX1A 1WPXA 4MSWC 1GKFA 2IJIA 3E8FA 3OAAG 1AI6A 2B1IA 4PA4A 1H8EG 2WWWA 2Q69A 3ZRVA 1QLNA 2EIMB 1FXKC 1GO3F 3ASNB 4MVSA 2JEXA 3ETGA 2LP7A 3K9AA 3MHSC 1AROP 5L3CA 1KC8W 2B5UA 3B77A 2WAMA 1GM7A 1E1QG 1FXHA 2XOKG 2ZD9A 1K7DA 3P32A 1RM1B 1G8MA 2ZXWC 1KP3A 2W6IG 4F4LA 4P2ZA 4MVZA 1I5XA 1S76D 3E89A 5EC2C 2EJRA 2CK3G 1VQNV 2JK5C 2ATKC 1VQOV 3CCVV 1KP2A 1DF4A 3STLC 1NQTA 2IU0A 3SPJA 1AI5A 3CCUV 3JD4A 1GTOA 2HVKC 5LGUA 3FYEB 3G6EV 1TUEB 1M57B 3NXSA 5LHGA 2WLLA 3FKSG 5GW7A 4N23A 2K1EA 1MG1A 1CPYA 2ITDC 3ABMC 5BZBA 1QBZA 1XL6A 3H01A 3LSQA 1RPOA 3QNEA 5L3BA 3WG7B 2IJKA 1OCZB 1PNMA 4JAVA 1H2GA 1M56B 2IW5A 2LFRA 2PI4A 5L3DA 4JYBA 3BY6A 2EIKC 3W7TA 1OCRB 5B1BC 1R3LC 3JCZA 5FL7G 5HFMA 4FMTA 1K34A 4XDLA 3ZMZA 1UJWB 3ML0A 5KA6A 2Y48A 3ZMUA 4UVAA 4RQEA 1YITV 1BL8A 3STZC 5B1OA 1R6NA 1JJ2U 4GX5A 5CBFA 1PD3A 2F43G 3AG4B 1V55C 2AHYA 3OR7C 4HYOA 1VQKV 2M7WA 2A0LA 2QA4V 1E1RG 3W7XA 4CBCA 1S77D 3SJQC 2V7QG 4RUEA 1NR1A 3OEEG 4XBFA 3RW0A 2DQ3A 1S72V 2XAQA 3SYCA 3FYIB 4RO2A 1VQPV 2B1GA 2OTJV 3GB7C 1YHQV 5B1BB 3ABTA 1KECA 4QPKA 4LP8A 2EIMC 2JIZG 1QR8A 3FB7C 3ASNC 4KP4A 3CXCU 4MTFA 2A79B 4PDMA 1K92A 1RM1C 5CN0A 1KQSU 5HFLA 1MSWD 3CD6V 3OM3B 1ORQC 1WLEA 2WLJA 1MABG 2X6CA 3AG1B 1EZJA 4JTAB 1QR9A 5B1AB 5E1AC 1CEZA 3E8BA 5LGTA 1S0VA 2IH3C 2HJFC 1W0KG 5KUKA 3ZMVA 3T4ZA 3I56V 4R6ZA 2HFEC 3GWOA 1THZA 1JVMA 1JCHA 2P7TC 4BIUA 1VQ7V 1P7BA 1AI7A 1E79G 4MVUA 4LCUC 3KG2A 4UVBA 2JDIG 1OZ0A 5IYCO 1AJQA 2WLIA 2EILB 2EIJB 2XNDG 3K0GA 3OEHG 4MW3A 4P30A 4QE7A 3RVZA 5B3SB 4BIZA 3CYOA 4HAMA 1M57C 2JJ2G 1R73A 4PA9A 1BHAA 1OCOB 3AG2B 3JD0A 4TSFG 2Q68A 4X8AA 4PDVA 4WFHA 1F4NA 3SPGA 1MOFA 2HR3A 3I55V 2YEVB 1H8HG 3G71V 1VQ8V 1N8RW 3RBZA 2R9IA 3DGEA 4CZZA 3BEHA 4E2LA 3WG7C 4MS2A 1JPXA 5IY5B 1K3EA 4RAIA 2QM7A 1OCZC 3AEIA 1M56C 5C93A 1GM9A 3LSSA 3CCSV 1HWYA 1PL0A 2DWEC 1Q82W 3QO8A 4JASA 3CP1A 4PA6A 2JEUA 1OCRC 4MTOA 3T4DA 3ZMSA 2PI5A 2Y69B 3UM7A 2D3OW 3JD3A 3EFFK 3VBBA 3VOUA 2LFSA 5H9CA 1I5YA 4WF9V 5CMUA 4UVCA 1F23A 1OCCC 1K4CC 2XAJA 2XAGA 4G27B 4GX0A 3OMIB 2EINB 2WLLB 3SYQA 2Q67A 2IH1C 4WFAV 3AG4C 1PNKA 2ZQMA 1YI2V 3LDEA 2Z3YA 3JD1A 1QVGU 2C2AA 4XDJA 3HB3B 1SRYA 3TK1A 1FXKA 4MVQA 1YTFD 1G4YB 4P9PA 5LBQA 4JF3A 3CMEV 4HZ3A 2UXNA 5IYBO 4PA7A 2WLKA 1R6KA 1Y66A 1M1KW 1DLBA 4JPRA 1DTOA 5J9PC 2XAHA 1NBMG 5DM6V 5L3GA 4DXWA 3P30A 1VQLV 3M99B 2UXXA 3DTUB 4WFGA 4PA3A 1YJNV 1OCCB 1PNLA 3K04A 3ZRWB 4OXSA 2DWDC 2HG5C 3AG1C 3T1CA 1QVFU 3OW2U 3K03A 5B1AC 3K08A 3JYCA 4QIWF 4P9OA 4FIPC 5KUMA 3F7VC 1JQ0A 1SESA 3IFXA 2DYRB 4PDLA 4R8CA 3E86A 4WFFA 4JYCA 3IC7A 2OCCB 3ZRSA 4GCZA 2EZPA 3ZMTA 2P6JA 1DF5A 4L87A 3B8NA 3ABKC 3AG3C 1FXVA 2EILC 2EIJC 3MD0A 3TCUA 5B3SC 5LGNA 1W2BU 5H6QA 3CCJV 4MVRA 4I9WA 4PELA 1OCOC 3E8GA 1AR1B 3AG2C 1K73W 3CPWU 3JD2A 1GM8A 2ZR2A 2IJHA 3FB8C 3CC7V 1VQ4V 1Y4MA 4QPJA 1NVPD 5IY5C 3ABUA 1P4RA 1KKDA 2GHYA 3F7YC 3CCMV 2WLMA 2X7RB 5L3FA 5DN6G 1F51A 1JOYA 1OHHG 4RQFA 3F5WC 1Q7YW 3SYPA 1QCEA 3ZJZA 1W0JG 2HVJC 1K5QA 1EBOA 2Y69C 3ABKB 3AG3B 4PDRA 2QM8A 3FB6C 3X2QB 1YSCA 3ASOB 4GX2A 4BAYA 3W7UA 1S3JA 2H8PC 3PJSK 3T2MA 4WFEA 3OMNB 4LBEC 3HPLC 4J9ZB 1ROPA 2EINC 2Z5UA 3OE7G 2W6JG 3ABLB 5EK0A 1VQ9V 5H6RA 4UV8A 2P67A 3OUFA 2WLNA 3SPCA 2X6AA 3UKMA 3D36A 2ZDIC 3EHBB 3OMAB 1K97A 4WFBV 1B6QA 4MT8A 1EFRG 4R50A 4FJCC 5EBMC 1KD1W 2QEXV 1SZTA 1AI4A 2KB1A 3SPHA 4JTCB 5CBGA 1VQ5V 4TWKA 4U7OA 1SERA 2ZR3A 3TETA 4MTXA 2NNUA 1R3KC 2P90A 1NR7A 3CMAV 1FS0G 1NH2B 2EBOA 2QKSA 4JAUA 3RVYA 2HKOA 2YEVA 1ENVA 3K06A 1IXMA 4YXWG 1QLEB 5LHHA 4FPPA 3K3WA 1K5SA 1GMGA 1NH2D 3SYAA 2IJJA 4WCEV 3LNMB 3OGCC 4I5SA 3E2EA 4MTGA 3W7SA 2DYSB 1PKXA 3CCQV 4UV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8M A;  5KA5 A;  1QBZ A;  3H01 A;  3P30 A;  4FJC C;  3M99 B;  1SZT A;  1QR8 A;  1K33 A;  2MK3 A;  4E2L A;  1QCE A;  1EBO A;  1DF4 A;  3MHH C;  2OT5 A;  4N21 A;  2EZO A;  3CYO A;  3CP1 A;  5CN0 A;  1I5X A;  5HFL A;  2EBO A;  2M7W A;  4FIP C;  2LP7 A;  3K9A A;  3MHS C;  1ENV A;  3B77 A;  1Y4M A;  1JQ0 A;  4JF3 A;  1QR9 A;  5H9C A;  1I5Y A;  5HFM A;  1MOF A;  1K34 A;  3WFV A;  1Y66 A;  5CMU A;  1DLB A;  4JPR A;  1F23 A;  2EZP A;  4G2K A;  5KA6 A;  2P6J A;  4FK5 C;  1DF5 A;  4JGS A;  4N23 A;  3B8N A;  1MG1 A;  1JPX A;  2X7R B;  3GWO A; 
#chains in the Genus database with same CATH topology
 4GKJ O;  2XAS A;  4FLT A;  5JVD A;  1YTF B;  2EX3 A;  3RYC B;  2WLH A;  1Q86 W;  3DC6 A;  4CC6 A;  1BCC H;  4IT5 A;  4LH7 A;  1NJI W;  4H37 A;  2QTS A;  4X89 A;  4PI0 A;  1VQM V;  4I4T B;  1GK9 A;  3SPI A;  4DV6 B;  5LMN O;  1QQC A;  1Q81 W;  1L0N H;  2R72 A;  3QG5 A;  4CS4 A;  4NXM B;  3CC2 V;  3ZIA G;  3CRA A;  1N36 B;  5LHI A;  2E74 B;  2B9Z A;  1HDJ A;  2XTA A;  3WB2 A;  2RN9 A;  2HJD A;  4J9Y B;  3E83 A;  1J95 A;  4BR6 A;  4MVO A;  3VQX A;  2AZ0 A;  1PPJ H;  2UUB O;  3EVK A;  3Q4H A;  2HP8 A;  3M7M X;  5K1P A;  1AJP A;  1X59 A;  2QR4 A;  2MK3 A;  1R3I C;  3ASO C;  3FB5 C;  2OIG A;  1Y74 B;  4B3T B;  2YSU B;  5KHH A;  3ZN1 A;  5D5Q A;  5DED A;  2XAF A;  1N33 O;  2DW4 A;  4JI4 O;  1R3J C;  4B3R B;  3JAS B;  3QO7 A;  3ETD A;  4UCU A;  5LP6 C;  2CTQ A;  4EB6 A;  3CCE V;  1AVM A;  4I7Z B;  4BIO A;  2LW1 A;  2ZE8 A;  4AQY O;  3TXQ A;  1K9M W;  1Z5V A;  3OR6 C;  2NR5 A;  4JYA B;  4O2B B;  2BOB C;  1N32 O;  4CH6 A;  4DO2 A;  2Q73 A;  4KUM A;  1SZX A;  1XI1 A;  4FM2 A;  2IJI A;  2YXL A;  3E8F A;  1AI6 A;  4PA4 A;  1H8E G;  2Q69 A;  3ZRV A;  1QLN A;  4GLX A;  1GO3 F;  3ASN B;  2LP7 A;  3MHS C;  5L3C A;  2WAM A;  1GM7 A;  4W4L A;  2RMK B;  2Q9L A;  3G67 A;  1Q6U A;  1PL4 A;  5EYP A;  3OTO B;  4F4L A;  5E79 Z;  1R1B A;  5EC2 C;  3ZHU A;  3HKE A;  3BVO A;  1DF4 A;  1JFF B;  3STL C;  4DUZ O;  2L6L A;  4PHZ A;  3CRM A;  2XT9 A;  1UFI A;  3ETQ A;  2CH7 B;  3JD4 A;  1GTO A;  4O4H B;  2WLL A;  5F2V O;  2K1E A;  1CPY A;  1ZSP A;  3H01 A;  1AR5 A;  1A32 A;  1NT2 B;  5LXT A;  1PNM A;  1H2G A;  2LFR A;  3RYI B;  3FD9 A;  3W7T A;  3GVM A;  1OCR B;  5BY1 A;  3ZMZ A;  3DSQ A;  4JI1 B;  3JAK B;  2XHB A;  1Y6X A;  2Y48 A;  5KA6 A;  1HNX O;  2F66 C;  4LFC B;  3J81 N;  1XBL A;  1R6N A;  4LNU A;  4GKJ B;  1JJ2 U;  2N74 A;  5CBF A;  4EEQ A;  2F43 G;  5EZY B;  1SF9 A;  3L72 H;  1XMQ B;  3T1Y B;  3OR7 C;  2A0L A;  2YDE A;  2GTS A;  1XEQ A;  2PGG A;  3SJQ C;  4UFZ A;  1NR1 A;  4XBF A;  3RW0 A;  2ZT9 B;  2P4K A;  3SYC A;  3FYI B;  5LMN B;  2B1G A;  3GB7 C;  3N2K B;  5B66 Z;  3ABT A;  2ZIN A;  4QPK A;  1ZUQ A;  3ASN C;  3CXC U;  3CX5 F;  4PDM A;  5A9G A;  1ORQ C;  1YCI A;  1O9G A;  1NU1 H;  5LOV B;  1EZJ A;  2PYJ A;  1CEZ A;  3E8B A;  1P49 A;  3RFR A;  1GN6 A;  3T4Z A;  4OGQ B;  1THZ A;  1JVM A;  4BIU A;  2FB5 A;  4AHC A;  4LCU C;  3KG2 A;  4NYK A;  2JDI G;  4ABM A;  5JCO A;  2W0X A;  1WJZ A;  2WLI A;  2CDY A;  1IZ3 A;  3OEH G;  3OT7 A;  1N34 O;  1BE3 H;  4PA9 A;  2YXY A;  4X1I B;  3SPG A;  3RYH B;  4DR2 O;  1MOF A;  3L71 H;  1N33 B;  1XHZ A;  1VQ8 V;  1F7Y A;  4JI4 B;  2R9I A;  3CS5 A;  4UCT A;  4RAI A;  3HR0 A;  1GM9 A;  2DWE C;  1Q82 W;  3QO8 A;  2UXB O;  4D7S A;  2Y4U A;  1OCR C;  1I7F A;  4MTO A;  2P5O A;  4X65 B;  3UM7 A;  5KHJ A;  2D3O W;  3VBB A;  4UB8 Z;  3VOU A;  4F6R A;  4ZI7 A;  2JVD A;  2BSK B;  1KB9 F;  1RSO A;  3CB2 A;  2XAJ A;  2H3O A;  2A06 H;  4GX0 A;  4TQD A;  4DR1 B;  1M93 A;  1N32 B;  4H44 B;  1YI2 V;  4OX9 O;  2VWJ A;  1FJG O;  4J7Z A;  3JD1 A;  2C2A A;  4B7E A;  3HB3 B;  1FXK A;  1G4Y B;  4FZ0 A;  3CME V;  4HZ3 A;  2L35 A;  1XOU A;  2RNB A;  3B2E E;  5CA0 A;  5J9P C;  1Y76 A;  2XAH A;  1NBM G;  4DXW A;  1R6T A;  3M99 B;  5B5E Z;  4ICG A;  4PA3 A;  1YJN V;  3FFQ A;  1QVF U;  4DV0 B;  3K03 A;  2AXT Z;  1TUB A;  4QIW F;  4P9O A;  5KUM A;  1IBK O;  4DV3 O;  1SA0 B;  4NTX A;  4LF9 B;  2KG7 A;  4R8C A;  1L8D A;  3JAL B;  4TV9 B;  3ZMT A;  5BR8 B;  1ZL8 B;  5LGN A;  1GH6 A;  2GTA A;  1SKV A;  5IJ9 A;  5IWA B;  4UCS A;  3B4S A;  1EN5 A;  3CC7 V;  4CH5 A;  1VQ4 V;  1Y4M A;  5JQG B;  4QPJ A;  1GRJ A;  1WA8 B;  1KBH A;  4LF8 O;  1S5L Z;  4DR6 O;  1KKD A;  1V9P A;  3CCM V;  2E5L B;  2WLM A;  4PJ0 Z;  1HNX B;  2KSD A;  4TUY A;  3TXS A;  3JAW A;  4NXN O;  4RQF A;  3F5W C;  4K35 A;  3T1H B;  1K5Q A;  1MA1 A;  3ABK B;  5BMV A;  3X2Q B;  4GX2 A;  1ZAU A;  3W7U A;  4FLW A;  1S3J A;  1WP8 A;  4LBE C;  5KAF Z;  1ROP A;  3C3S A;  4CH4 A;  5JJJ B;  4GYC B;  4UV8 A;  2X6A A;  2QKA A;  3EHB B;  3OMA B;  4NXM O;  4O4I A;  1B6Q A;  4MT8 A;  5EBM C;  1AI4 A;  4X64 B;  5CBG A;  1N36 O;  1HNW O;  1SER A;  4DV4 B;  2CE4 A;  3CMA V;  1NH2 B;  4LF7 B;  1SQV H;  3K06 A;  1TA8 A;  4K8X A;  4WCE V;  4ZHQ A;  2OWO A;  4MTG A;  5EIB D;  1GN4 A;  4UUJ C;  3E22 B;  1XNQ B;  3MHH C;  4DUY O;  4X88 A;  4LF4 O;  1B3Q A;  1L1F A;  1N34 B;  1BGY H;  1RFY A;  4YY3 O;  2BTQ B;  4QE9 A;  4JI6 O;  4X1Y B;  3WFV A;  1FFX B;  4B3R O;  4DR2 B;  1BMF G;  3JAR B;  4B3M B;  4I55 A;  2ZXW B;  5KMG A;  5LA6 A;  2OTL V;  1H2K A;  3E8H A;  4GT1 A;  5GTH Z;  4NKG B;  4YIP A;  2UUA O;  2UXB B;  2PUS A;  2R9R B;  1M9N A;  4EKW A;  2YI9 A;  4H33 A;  4JYA O;  1XDC A;  4X20 A;  1AP6 A;  3ZRW A;  3N27 A;  4ZKI A;  4Q20 A;  3X2Q C;  2PTM A;  3JAT A;  4CH3 A;  4JI7 O;  1FJG B;  3ZN0 A;  3ABM B;  1IXB A;  1P7G A;  4KFM A;  3LSU A;  4I9Q A;  3E35 A;  2QTO A;  2VWK A;  2YUA A;  3K79 A;  1COW G;  4BW9 A;  5IYD O;  2ZE7 A;  3ZRX A;  1Q8I A;  2QGN A;  1FKA O;  2VS0 A;  2CTW A;  2KQX A;  4I0X A;  2QWR B;  2EZO A;  1FFT B;  2Y0I A;  3H9V A;  3CCL V;  3WU2 Z;  2AZ2 A;  1H38 A;  3BFR A;  3OFN G;  3CEI A;  3BAA A;  5EBW C;  1IBK B;  1BHB A;  4DV3 B;  3K0D A;  4JGS A;  1CP9 A;  3ZCC A;  4U3J B;  1GN3 A;  3G6B A;  4FLY A;  1KUQ A;  4MSW C;  1GKF A;  2B1I A;  4O2A B;  4J11 A;  4MVS A;  3ETG A;  3K9A A;  2E75 B;  2QWQ B;  5LYJ A;  1E1Q G;  2FKX A;  5FNV A;  5J2U B;  2ZXW C;  2FL4 A;  2HHH O;  1S76 D;  3E89 A;  4DR5 O;  2EJR A;  3RWR D;  5H2F Z;  4X9Q A;  2ZNI A;  5LP6 A;  2ATK C;  1TVK B;  4NXN B;  3CCV V;  1KP2 A;  5IJ0 B;  3SJC C;  2ZNJ A;  5JVD B;  1XMQ O;  3SR2 C;  3T1Y O;  2IU0 A;  1B06 A;  2UU9 B;  4CS2 A;  3SPJ A;  4YJ2 A;  4DW0 A;  4DW1 A;  4K0K O;  3CCU V;  2HVK C;  3FYE B;  1TUE B;  1M57 B;  4YJ3 B;  5LHG A;  3FAV B;  5GW7 A;  4N23 A;  3ABM C;  1QBZ A;  3FX7 A;  3LSQ A;  5L3B A;  3WG7 B;  2IJK A;  4JI0 O;  1HNW B;  1D5A A;  1Q90 D;  2IW5 A;  4LH6 A;  1AB3 A;  2PI4 A;  4JYB A;  4TOI A;  5B1B C;  4I50 B;  1R3L C;  1K34 A;  5ITZ B;  4UCR A;  1QU7 A;  1KKC A;  1URF A;  1MNG A;  4UVA A;  4RQE A;  3ZS8 C;  1YIT V;  3Q4H B;  2Q7H A;  1VIB A;  1LR1 A;  2JRI A;  4H13 B;  2Q0O C;  4DUY B;  4LF4 B;  4YIO A;  1VQK V;  2M7W A;  1VAR A;  3W7X A;  1XIL A;  1S77 D;  4YY3 B;  2XAQ A;  4RO2 A;  3K58 A;  4JI6 B;  3RYF B;  2OTJ V;  1BQZ A;  1KEC A;  1Y74 A;  1SC5 B;  2JIZ G;  3A0B Z;  1TAE A;  5CN0 A;  2UUA B;  3OM3 B;  2X6C A;  4X65 O;  3L74 H;  1QR9 A;  3JAS A;  5LGT A;  4HNA B;  2HJF C;  1W0K G;  3APQ A;  1WNS A;  5KHK A;  4R6Z A;  4DR1 O;  1JCH A;  1VQ7 V;  4FFB B;  1AI7 A;  4X62 B;  4UVB A;  2ZCE A;  2EIL B;  2XND G;  4JI7 B;  3RVZ A;  5B3S B;  3KCX A;  4HAM A;  2RDC A;  1M57 C;  3VQW A;  1SQQ H;  3O9O A;  4O2B A;  2CUG A;  3HKD B;  3JD0 A;  2AGA A;  3P3P A;  1IBM B;  3HKC B;  4WFH A;  1F4N A;  2YEV B;  1RP3 B;  1H8H G;  4CZZ A;  3BEH A;  2QSA A;  4MS2 A;  1JPX A;  3WG7 C;  2MW2 B;  2QM7 A;  5JH7 A;  4U3F H;  3K5M A;  1PL0 A;  2CGO A;  2GUZ B;  4DV0 O;  4PA6 A;  1EZV H;  2PI5 A;  3KZI Z;  3L70 H;  4LF9 O;  5H9C A;  1I5Y A;  1IBL B;  5BR8 O;  1OCC C;  1K4C C;  4G27 B;  2XAG A;  1IX9 A;  3ZHS A;  2LJ2 A;  3OMI B;  1JFF A;  2WLL B;  3SYQ A;  4BWA A;  2CH7 A;  4XDJ A;  4RWU A;  3TK1 A;  5IWA O;  4O4H A;  2QKC A;  4MVQ A;  1YTF D;  2DOS A;  5LXT B;  1CXZ B;  2QJ1 A;  1Y66 A;  1M1K W;  1DLB A;  2E5L O;  2HHH B;  2ZM6 B;  3CHX A;  1MMM A;  5DM6 V;  5L3G A;  1VF6 C;  4DR5 B;  1VQL V;  2UXX A;  1PNL A;  3RYI A;  3T1H O;  1Q5O A;  4J7J A;  2HG5 C;  3OW2 U;  2IM9 A;  1M4U A;  3F7V C;  4K0K B;  3JAK A;  4PI2 A;  3G80 A;  1VEW A;  2DYR B;  3E86 A;  3IC7 A;  3B8N A;  2EIL C;  5EZY A;  5B3S C;  1W2B U;  5H6Q A;  5KHG A;  4X64 O;  4I9W A;  4AI8 A;  5KAI Z;  1K73 W;  4B7K A;  4JI0 B;  4DV4 O;  3JD2 A;  4LF7 O;  2V4D A;  1GN2 A;  1NTK H;  5CA1 B;  4A5U B;  2UXC B;  2JGD B;  1EM1 A;  2LO1 A;  3BHP A;  4DV2 B;  2GHY A;  1XQ8 A;  1Q43 A;  2X7R B;  4UCO A;  3N2G B;  1XNQ O;  4FZ1 A;  4PDR A;  3KCY A;  5LOV A;  1JMK C;  3FB6 C;  4DR7 O;  3PJS K;  1H2L A;  3HPL C;  1TGO A;  3THO A;  2YC0 A;  2W6J G;  4B3M O;  2ZDI C;  1AR4 A;  3SJB C;  1KD1 W;  1EFR G;  2QEX V;  1D2D A;  4O4L B;  5D5P A;  1VQ5 V;  2N04 A;  2GV9 A;  2ZR3 A;  2NNU A;  2A7W A;  3BRC A;  4X1I A;  3L75 H;  5AG2 A;  1IXM A;  4YXW G;  1QLE B;  2BCC H;  5C8Y B;  5LHH A;  3H1H H;  4JI2 O;  3K3W A;  1K5S A;  3J80 N;  3SYA A;  2DYS B;  3GWO A;  3UCS C;  1RSO B;  2WSS G;  1SQF A;  5KA5 A;  5J2T B;  1XRE A;  1V54 B;  2K9P A;  2DYR C;  2BSK A;  2OYQ A;  3IC9 A;  3UQ8 A;  1FXK B;  1BZK A;  1YJ9 V;  2RQ6 A;  1NI8 A;  5EBL C;  1Q6H A;  4LC1 A;  4MVM A;  4LFB B;  2AHZ A;  3B8M A;  3AK2 A;  3UO3 A;  1Y76 B;  4MW8 A;  1UPG A;  5KX5 B;  2Q6A A;  2ZIM A;  1ZLZ A;  3A8T A;  3M8A A;  4BW5 A;  2NLJ C;  2V1D A;  4RUF A;  2N05 A;  5B1N A;  1TUB B;  3IGA C;  2LGW A;  4WBN B;  3JSL A;  5BXZ A;  1NKD A;  4FK5 C;  1DGS A;  5IDJ A;  1QNM A;  4K3A A;  4IIJ B;  5GTI Z;  3QTC A;  2EUL A;  5JCO C;  1LNQ A;  1SQG A;  2WA3 A;  5IYZ B;  2W0F C;  1NVP B;  3QO5 A;  3R65 A;  1SA0 A;  4TT3 G;  4R7C A;  2X0L A;  3AK1 A;  1K4D C;  2GSM B;  3JAL A;  3SYO A;  4CC5 A;  4PD4 F;  4TV9 A;  2ADQ B;  3O65 A;  3LDD A;  3G4S V;  4FM0 A;  2EIK B;  4DK1 A;  1SET A;  4LF5 B;  1ZX3 A;  3LDC A;  1IVS A;  1AJN A;  1K33 A;  3CCR V;  4DYL A;  3LUT B;  2OT5 A;  1BSM A;  4KL1 A;  1K8A W;  5JQG A;  1QLE C;  5EIB C;  1WA8 A;  1HP8 A;  2DQ0 A;  2UU9 O;  3W7W A;  2PF4 E;  4AIL C;  2VQE B;  2A3Q A;  3ZED A;  1WB8 A;  3AG7 A;  2YIB A;  2DYS C;  4JI8 O;  2O57 A;  4Z1M G;  1FD9 A;  3RGB A;  4F6E A;  1JA8 A;  4G2K A;  1ZWI C;  4TV8 A;  1V54 C;  2VQF O;  2X6B A;  3DXR B;  1WPX A;  5DEC A;  3OAA G;  4LWS A;  1GAX A;  1FXK C;  2ARH A;  2JEX A;  2HEP A;  3HKB A;  2RCV A;  1RM1 B;  2OIE A;  1FXH A;  2XOK G;  2ZD9 A;  3P32 A;  2P06 A;  2Q0A A;  2Q7E A;  4P2Z A;  5KLV H;  1Z5W A;  1FYJ A;  2JK5 C;  2LW7 A;  1LUV A;  4NR1 A;  2D2C B;  3H1J H;  2F1M A;  1NQT A;  3ZHT A;  1N0N A;  1AI5 A;  2BTO A;  4O4J B;  4DR7 B;  5LGU A;  3G6E V;  3NXS A;  3FKS G;  1U96 A;  4EFE A;  1MG1 A;  3E22 A;  2ITD C;  5BZB A;  1XL6 A;  3ZHV A;  2Y0P A;  3QNE A;  5LA6 B;  1OCZ B;  2DJV A;  4IHJ B;  3CJH B;  4DRX B;  2G38 A;  5L3D A;  4X1Y A;  2QM4 A;  1FFX A;  2EIK C;  2QWO B;  3JAR A;  3JCZ A;  4JI2 B;  4JI5 O;  5HFM A;  4FMT A;  4XDL A;  2YS8 A;  3ML0 A;  4UB6 Z;  2FYU H;  4X62 O;  3K5N A;  5B1O A;  3ZBH A;  4DR4 B;  1J5E B;  3AG4 B;  2YIC A;  1IUR A;  1YF2 A;  2AHY A;  5A2Q N;  1E1R G;  1MZF A;  2V7Q G;  4RUE A;  1YEW A;  1IBM O;  3OEE G;  1U97 A;  4X1K B;  3LNN A;  5CB4 B;  1VQP V;  4ZOL A;  1SQX H;  1YHQ V;  5B1B B;  3SGI A;  5KHI A;  4LP8 A;  1G6U A;  4MTF A;  4FLU A;  1HR0 B;  2A79 B;  2XUM A;  1RM1 C;  1KYO F;  1Y67 A;  5HFL A;  1MSW D;  3CD6 V;  1WLE A;  2WLJ A;  3AG1 B;  3TJT A;  5B1A B;  5GON B;  1S0V A;  5KUK A;  3ZMV A;  4FLV A;  5TIS Z;  1IBL O;  4H0L B;  2P7T C;  4FVM A;  1P7B A;  1E79 G;  2Y4T A;  1OZ0 A;  4CS3 A;  2YIB D;  1AJQ A;  2EIJ B;  1G1X B;  1D5N A;  4P30 A;  3CYO A;  2JJ2 G;  4GKK O;  1BHA A;  1I0H A;  2NN4 A;  4PDV A;  4FLZ A;  4U3J A;  3UT5 A;  4NTY A;  2HR3 A;  3G71 V;  1N8R W;  3RBZ A;  3DGE A;  4E2L A;  5IY5 B;  1VF7 A;  4O2A A;  2ZM6 O;  2YIA A;  1K3E A;  3K5L A;  1OCZ C;  3AEI A;  4D7T A;  5IE9 A;  1VF5 B;  3BA8 A;  5C93 A;  4LFA O;  3LSS A;  3CCS V;  4JAS A;  3CP1 A;  4ZIB A;  3D8C A;  3P3N A;  3AK3 A;  2JEU A;  5J2U A;  3ZMS A;  1M5I A;  2ILM A;  4GUN A;  4YHH O;  4JV5 O;  1SS3 A;  3EFF K;  4YJ2 B;  2LFS A;  3R66 A;  3KKY A;  5H5N A;  4JI8 B;  5CMU A;  1F23 A;  3A2F A;  2QDO A;  1TVK A;  5IJ0 A;  3RYC A;  2IH1 C;  4WFA V;  2VQF B;  3AG4 C;  2JGU A;  2ZQM A;  3L73 H;  3MDS A;  4I4T A;  4YJ3 A;  4LR3 A;  5LBQ A;  2UXC O;  3FAV A;  2UXN A;  5IYB O;  4PA7 A;  2WLK A;  2R70 A;  4DV2 O;  3SJA C;  3I5D A;  4Q6G A;  1DTO A;  2PYL A;  3P30 A;  3DTU B;  2CAZ C;  1I94 B;  1OCC B;  3K04 A;  4OXS A;  2DWD C;  3AG1 C;  3T1C A;  5B1A C;  3K08 A;  1HNZ O;  4I50 A;  4FIP C;  5ITZ A;  1JQ0 A;  1SES A;  4WFF A;  4PDL A;  2F4V O;  2OCC B;  1BT8 A;  1H2S B;  2EZP A;  2P6J A;  3AG3 C;  3D36 C;  1FXV A;  2EIJ C;  3TCU A;  2OCH A;  4DV7 B;  3MAQ A;  3S3W A;  3CPW U;  4EB6 B;  1GM8 A;  4EFB A;  2IJH A;  3QF7 A;  3RYF A;  3WB1 A;  2E3C A;  5IY5 C;  4JI5 B;  1OV9 A;  2ADP A;  3F7Y C;  1N0J A;  4J80 A;  2UUC O;  1F51 A;  1VF6 A;  1Q7Y W;  1QCE A;  1W0J G;  2CTR A;  1EBO A;  3ICX A;  4KHP O;  2QM8 A;  3C90 A;  4HNA A;  4BAY A;  1P84 F;  3T2M A;  4LF6 B;  1XMO O;  4J9Z B;  4OPH A;  4FFB A;  1XHX A;  2Z5U A;  3ABL B;  5EK0 A;  1VQ9 V;  3B40 A;  4LFB O;  2P67 A;  3OUF A;  2WLN A;  3SPC A;  4IYI A;  3UKM A;  4WFB V;  5EYP B;  4R50 A;  4FJC C;  2KB1 A;  4JZ2 A;  3SPH A;  4JTC B;  3JSN A;  4TWK A;  5JH7 B;  4DV5 O;  4MTX A;  3HKE B;  3HKD A;  1R3K C;  2P90 A;  3HKC A;  1NR7 A;  4PV1 B;  4JAU A;  3RVY A;  2HKO A;  2YEV A;  1ENV A;  1GMG A;  1T5E A;  1B04 A;  3BPZ A;  3CSX A;  3OGC C;  4I5S A;  3E2E A;  3W7S A;  3H1I H;  4UV9 A;  1Z2G A;  2GUZ A;  1KU9 A;  1YIJ V;  3OUS A;  2H94 A;  3A0H Z;  1F4M A;  4GKK B;  1VP7 A;  1RPR A;  4K8Z A;  2UXD B;  2OCC C;  1XUQ A;  5FPO A;  3D3I A;  4LF5 O;  4J7K A;  2F93 B;  3CRC A;  1H2M A;  4QNH B;  4FLX A;  2ZDI A;  4NB5 A;  1JX9 A;  2WPD G;  4LFA B;  3OTF A;  1S5H C;  4G28 B;  4LNU B;  4ASU G;  1MZE A;  2HLD G;  2VQE O;  4YHH B;  4JV5 B;  1FPO A;  2JS5 A;  4U7N A;  2CGN A;  4JI3 B;  2JJ1 G;  2FTK A;  4JYY A;  2YI8 A;  3IJ4 A;  1YJW V;  3CC4 V;  4ZBM A;  3GWK C;  4Z2W A;  5IT9 N;  2BOC C;  3ABL C;  1XL4 A;  1O9H A;  3N2K A;  2IU3 A;  4NVP A;  2ITC C;  4QJF B;  3VQV A;  4XDK A;  1M90 W;  4IL6 Z;  2A9H A;  5CA3 A;  4UXN A;  4JTD B;  4E4E A;  3UO2 A;  5CA1 A;  4N21 A;  3A0R A;  5CBH A;  2JGD A;  1XNR O;  2WLI B;  5EC1 C;  1HNZ B;  1IDS A;  3ETE A;  1V55 B;  5L3E A;  2GBO A;  4DV1 O;  2F4V B;  2QE7 G;  1YVW A;  2M6Y A;  3N2G A;  2UUB B;  1VQ6 V;  4DK0 A;  4GX1 A;  3CRQ A;  4X66 O;  2WWW A;  2EIM B;  2YID A;  4QGP A;  1ARO P;  3RYH A;  1KC8 W;  3B77 A;  2B5U A;  3BA9 A;  3IAY A;  1K7D A;  1G8M A;  5LMU O;  1S5J A;  1KP3 A;  2W6I G;  4O4L A;  4F6R B;  4MVZ A;  4ZI7 B;  1I5X A;  2ODM A;  1JJO A;  2CK3 G;  2UUC B;  4JZG A;  1VQN V;  2JS3 A;  1BQ0 A;  1VQO V;  4DR4 O;  2Q4P A;  1J5E O;  4KHP B;  5C8Y A;  3CRR A;  2R9A A;  4C7U A;  2P22 C;  3L9D A;  4AQY B;  3S3X A;  1XMO B;  4B3S O;  5J2T A;  4NTW A;  3OD4 A;  3WB0 A;  2F95 B;  1L0L H;  5CA0 B;  1RPO A;  1X4T A;  4J10 A;  1HR0 O;  1DK1 A;  1AP5 A;  1LUW A;  1PP9 H;  4OPA A;  4JAV A;  4DV5 B;  1KMI Z;  2IBZ H;  1M56 B;  1SQB H;  1H2N A;  2QWP B;  3BY6 A;  1ZTE A;  1WP7 A;  5FL7 G;  1UJW B;  4HBN A;  4GZR B;  2KG7 B;  3ZMU A;  5KX5 A;  1BL8 A;  3STZ C;  3D3Q A;  4GX5 A;  3B09 A;  3OGI B;  1PD3 A;  3ZX6 A;  4UCV A;  1V55 C;  4DR3 O;  4DUZ B;  4L8J A;  4HYO A;  3NR7 A;  5JJN B;  2QA4 V;  2BE3 A;  4WBN A;  4CBC A;  5FPR A;  3J7A U;  3BAB A;  1FAF A;  5IJ9 B;  2DQ3 A;  1S72 V;  2LGQ A;  4IIJ A;  1NZ6 A;  3EXA A;  1ZL8 A;  2DE0 X;  2ETN A;  3JAM N;  5IYZ A;  1OJH A;  2EIM C;  4IGG A;  1QR8 A;  3FB7 C;  4KP4 A;  5JWP A;  2KKW A;  2CTP A;  4TUY B;  2AW9 A;  1K92 A;  3JAW B;  1WB7 A;  1KQS U;  5LL6 Y;  3K57 A;  1MAB G;  3ZHR A;  4JTA B;  5BMV B;  5E1A C;  2IH3 C;  3U10 A;  2FML A;  2VRZ A;  3I56 V;  2F23 A;  2HFE C;  4KXR A;  1NTZ H;  4MVU A;  4IYH A;  4TV8 B;  1VMG A;  1YDX A;  1SQP H;  5IYC O;  1US6 A;  3K0G A;  4MW3 A;  4QE7 A;  4O4I B;  1YXB A;  4BIZ A;  4J41 A;  4LWS B;  1R73 A;  1BS3 A;  1OCO B;  2Q5Z A;  3AG2 B;  1NTM H;  4TSF G;  2Q68 A;  4DV6 O;  4X8A A;  4J42 A;  3HKB B;  3I55 V;  4JI3 O;  2ZKO A;  3DXR A;  4JAA A;  4Z1V A;  5K1X A;  1WPB A;  2YXH A;  1EN6 A;  3C3T A;  4ZHQ B;  3DC5 A;  1I94 O;  1M56 C;  3ZHQ A;  2EJ7 A;  1HWY A;  2ZIO A;  2DMX A;  3T4D A;  1XNR B;  2Y69 B;  3JD3 A;  1N4C A;  4WF9 V;  4D6T H;  4UVC A;  4DV1 B;  3U11 A;  2EIN B;  2Q67 A;  1PNK A;  4DV7 O;  3TGU H;  3LDE A;  4I55 B;  5KMG B;  2Z3Y A;  3H1L H;  4W4K A;  4O4J A;  4B3T O;  1QVG U;  4X66 B;  2GDS A;  1SRY A;  2BTQ A;  2WA4 A;  1W59 A;  2E76 B;  4P9P A;  3QVN A;  4JF3 A;  1WN7 A;  2Q8V A;  1R6K A;  5LMU B;  4JPR A;  1NS1 A;  2LQT A;  3RT3 C;  2ZE6 A;  4TQF A;  4FM1 A;  4X20 B;  1Q6I A;  3CE2 A;  4IHJ A;  3CJH A;  4WFG A;  1MSD A;  1PM9 A;  4DRX A;  3ZRW B;  3JYC A;  3JAT B;  1WAZ A;  3K59 A;  4LF6 O;  3IFX A;  3APO A;  4JYC A;  3ZRS A;  4B3S B;  4GCZ A;  1DF5 A;  3RN4 A;  4L87 A;  2QWN B;  3ABK C;  1AIL A;  3MD0 A;  4ZOL B;  3VQY A;  3SDL A;  3CXH F;  3CCJ V;  4OX9 B;  4MVR A;  4PEL A;  2ZE5 A;  1OCO C;  1PV0 A;  3E8G A;  1AR1 B;  3AG2 C;  1EN4 A;  3K9S A;  2RJZ A;  4X1K A;  2ZR2 A;  4I0X B;  3FB8 C;  5CB4 A;  3CWB H;  3F5T A;  4FFK A;  1NVP D;  2PY5 A;  1QHT A;  3OTO O;  3ABU A;  1P4R A;  1YZB A;  3BCC H;  5L3F A;  5DN6 G;  1JOY A;  1OHH G;  3SYP A;  3ZJZ A;  2HVJ C;  2Y69 C;  3AG3 B;  3PN1 A;  4DR3 B;  1YSC A;  2DN9 A;  5GON A;  3ASO B;  1JR9 A;  2H8P C;  1HW7 A;  2UXD O;  4WFE A;  3OMN B;  5JJE B;  2EIN C;  3OE7 G;  3K5O A;  4B08 A;  5LYJ B;  5H6R A;  5FNV B;  3UT5 B;  1Q3E A;  3D36 A;  1K97 A;  1SZT A;  4U7O A;  3TET A;  5LP6 B;  2PZS A;  1FS0 G;  2EBO A;  2QKS A;  2P4V A;  3H1K H;  4FPP A;  2Z0A A;  5FLX N;  4LF8 B;  3JCU Z;  4JI1 O;  1NH2 D;  2IJJ A;  4DR6 B;  3U0Z A;  3LNM B;  2Q7G A;  4LFC O;  1I08 A;  1PKX A;  3CCQ V; 
#chains in the Genus database with same CATH homology
 2WSS G;  5KA5 A;  2XAS A;  1YTF B;  1YIJ V;  3OUS A;  4UUJ C;  1V54 B;  2WLH A;  1Q86 W;  3MHH C;  4X88 A;  2H94 A;  1NJI W;  4H37 A;  1F4M A;  4X89 A;  1L1F A;  2DYR C;  1RPR A;  2OCC C;  1VQM V;  1FXK B;  1GK9 A;  1YJ9 V;  3D3I A;  3SPI A;  4QE9 A;  5EBL C;  3WFV A;  4LC1 A;  4MVM A;  1Q81 W;  1BMF G;  2ZXW B;  2AHZ A;  4QNH B;  2ZDI A;  3B8M A;  2OTL V;  3CC2 V;  3E8H A;  3ZIA G;  4GT1 A;  1JX9 A;  2WPD G;  4MW8 A;  5LHI A;  1S5H C;  2Q6A A;  4G28 B;  4ASU G;  2HLD G;  4BW5 A;  4J9Y B;  2NLJ C;  2V1D A;  3E83 A;  4RUF A;  2R9R B;  5B1N A;  1J95 A;  4MVO A;  3IGA C;  1M9N A;  4EKW A;  4H33 A;  1NKD A;  4U7N A;  4FK5 C;  5IDJ A;  3ZRW A;  1AJP A;  2JJ1 G;  2FTK A;  1LNQ A;  4ZKI A;  2MK3 A;  1R3I C;  4Q20 A;  3X2Q C;  3ASO C;  3ZN0 A;  3FB5 C;  3ABM B;  4KFM A;  2W0F C;  1NVP B;  3QO5 A;  3R65 A;  1YJW V;  3CC4 V;  2YSU B;  4ZBM A;  4TT3 G;  4R7C A;  2X0L A;  1K4D C;  2BOC C;  2GSM B;  3ABL C;  3SYO A;  3ZN1 A;  3E35 A;  2XAF A;  1XL4 A;  2DW4 A;  2IU3 A;  3LDD A;  3G4S V;  1R3J C;  2ITC C;  2QTO A;  3K79 A;  2EIK B;  4QJF B;  1SET A;  1COW G;  5IYD O;  3QO7 A;  4XDK A;  1M90 W;  3LDC A;  2A9H A;  3ETD A;  3ZRX A;  5CA3 A;  4UXN A;  1AJN A;  1K33 A;  4JTD B;  3CCE V;  3CCR V;  3LUT B;  2OT5 A;  4N21 A;  2EZO A;  3A0R A;  1FFT B;  1K8A W;  1QLE C;  3CCL V;  2DQ0 A;  5CBH A;  1H38 A;  3W7W A;  2WLI B;  5EC1 C;  3OFN G;  3ETE A;  1V55 B;  5EBW C;  5L3E A;  1K9M W;  1BHB A;  2DYS C;  3OR6 C;  3K0D A;  4Z1M G;  2QE7 G;  4G2K A;  1ZWI C;  2BOB C;  4JGS A;  1CP9 A;  3ZCC A;  1V54 C;  1VQ6 V;  4DO2 A;  2X6B A;  4KUM A;  4GX1 A;  1WPX A;  4MSW C;  1GKF A;  2IJI A;  3E8F A;  3OAA G;  1AI6 A;  2B1I A;  4PA4 A;  1H8E G;  2WWW A;  2Q69 A;  3ZRV A;  1QLN A;  2EIM B;  1FXK C;  1GO3 F;  3ASN B;  4MVS A;  2JEX A;  3ETG A;  2LP7 A;  3K9A A;  3MHS C;  1ARO P;  5L3C A;  1KC8 W;  2B5U A;  3B77 A;  2WAM A;  1GM7 A;  1E1Q G;  1FXH A;  2XOK G;  2ZD9 A;  1K7D A;  3P32 A;  1RM1 B;  1G8M A;  2ZXW C;  1KP3 A;  2W6I G;  4F4L A;  4P2Z A;  4MVZ A;  1I5X A;  1S76 D;  3E89 A;  5EC2 C;  2EJR A;  2CK3 G;  1VQN V;  2JK5 C;  2ATK C;  1VQO V;  3CCV V;  1KP2 A;  1DF4 A;  3STL C;  1NQT A;  2IU0 A;  3SPJ A;  1AI5 A;  3CCU V;  3JD4 A;  1GTO A;  2HVK C;  5LGU A;  3FYE B;  3G6E V;  1TUE B;  1M57 B;  3NXS A;  5LHG A;  2WLL A;  3FKS G;  5GW7 A;  4N23 A;  2K1E A;  1MG1 A;  1CPY A;  2ITD C;  3ABM C;  5BZB A;  1QBZ A;  1XL6 A;  3H01 A;  3LSQ A;  1RPO A;  3QNE A;  5L3B A;  3WG7 B;  2IJK A;  1OCZ B;  1PNM A;  4JAV A;  1H2G A;  1M56 B;  2IW5 A;  2LFR A;  2PI4 A;  5L3D A;  4JYB A;  3BY6 A;  2EIK C;  3W7T A;  1OCR B;  5B1B C;  1R3L C;  3JCZ A;  5FL7 G;  5HFM A;  4FMT A;  1K34 A;  4XDL A;  3ZMZ A;  1UJW B;  3ML0 A;  5KA6 A;  2Y48 A;  3ZMU A;  4UVA A;  4RQE A;  1YIT V;  1BL8 A;  3STZ C;  5B1O A;  1R6N A;  1JJ2 U;  4GX5 A;  5CBF A;  1PD3 A;  2F43 G;  3AG4 B;  1V55 C;  2AHY A;  3OR7 C;  4HYO A;  1VQK V;  2M7W A;  2A0L A;  2QA4 V;  1E1R G;  3W7X A;  4CBC A;  1S77 D;  3SJQ C;  2V7Q G;  4RUE A;  1NR1 A;  3OEE G;  4XBF A;  3RW0 A;  2DQ3 A;  1S72 V;  2XAQ A;  3SYC A;  3FYI B;  4RO2 A;  1VQP V;  2B1G A;  2OTJ V;  3GB7 C;  1YHQ V;  5B1B B;  3ABT A;  1KEC A;  4QPK A;  4LP8 A;  2EIM C;  2JIZ G;  1QR8 A;  3FB7 C;  3ASN C;  4KP4 A;  3CXC U;  4MTF A;  2A79 B;  4PDM A;  1K92 A;  1RM1 C;  5CN0 A;  1KQS U;  5HFL A;  1MSW D;  3CD6 V;  3OM3 B;  1ORQ C;  1WLE A;  2WLJ A;  1MAB G;  2X6C A;  3AG1 B;  1EZJ A;  4JTA B;  1QR9 A;  5B1A B;  5E1A C;  1CEZ A;  3E8B A;  5LGT A;  1S0V A;  2IH3 C;  2HJF C;  1W0K G;  5KUK A;  3ZMV A;  3T4Z A;  3I56 V;  4R6Z A;  2HFE C;  3GWO A;  1THZ A;  1JVM A;  1JCH A;  2P7T C;  4BIU A;  1VQ7 V;  1P7B A;  1AI7 A;  1E79 G;  4MVU A;  4LCU C;  3KG2 A;  4UVB A;  2JDI G;  1OZ0 A;  5IYC O;  1AJQ A;  2WLI A;  2EIL B;  2EIJ B;  2XND G;  3K0G A;  3OEH G;  4MW3 A;  4P30 A;  4QE7 A;  3RVZ A;  5B3S B;  4BIZ A;  3CYO A;  4HAM A;  1M57 C;  2JJ2 G;  1R73 A;  4PA9 A;  1BHA A;  1OCO B;  3AG2 B;  3JD0 A;  4TSF G;  2Q68 A;  4X8A A;  4PDV A;  4WFH A;  1F4N A;  3SPG A;  1MOF A;  2HR3 A;  3I55 V;  2YEV B;  1H8H G;  3G71 V;  1VQ8 V;  1N8R W;  3RBZ A;  2R9I A;  3DGE A;  4CZZ A;  3BEH A;  4E2L A;  3WG7 C;  4MS2 A;  1JPX A;  5IY5 B;  1K3E A;  4RAI A;  2QM7 A;  1OCZ C;  3AEI A;  1M56 C;  5C93 A;  1GM9 A;  3LSS A;  3CCS V;  1HWY A;  1PL0 A;  2DWE C;  1Q82 W;  3QO8 A;  4JAS A;  3CP1 A;  4PA6 A;  2JEU A;  1OCR C;  4MTO A;  3T4D A;  3ZMS A;  2PI5 A;  2Y69 B;  3UM7 A;  2D3O W;  3JD3 A;  3EFF K;  3VBB A;  3VOU A;  2LFS A;  5H9C A;  1I5Y A;  4WF9 V;  5CMU A;  4UVC A;  1F23 A;  1OCC C;  1K4C C;  2XAJ A;  2XAG A;  4G27 B;  4GX0 A;  3OMI B;  2EIN B;  2WLL B;  3SYQ A;  2Q67 A;  2IH1 C;  4WFA V;  3AG4 C;  1PNK A;  2ZQM A;  1YI2 V;  3LDE A;  2Z3Y A;  3JD1 A;  1QVG U;  2C2A A;  4XDJ A;  3HB3 B;  1SRY A;  3TK1 A;  1FXK A;  4MVQ A;  1YTF D;  1G4Y B;  4P9P A;  5LBQ A;  4JF3 A;  3CME V;  4HZ3 A;  2UXN A;  5IYB O;  4PA7 A;  2WLK A;  1R6K A;  1Y66 A;  1M1K W;  1DLB A;  4JPR A;  1DTO A;  5J9P C;  2XAH A;  1NBM G;  5DM6 V;  5L3G A;  4DXW A;  3P30 A;  1VQL V;  3M99 B;  2UXX A;  3DTU B;  4WFG A;  4PA3 A;  1YJN V;  1OCC B;  1PNL A;  3K04 A;  3ZRW B;  4OXS A;  2DWD C;  2HG5 C;  3AG1 C;  3T1C A;  1QVF U;  3OW2 U;  3K03 A;  5B1A C;  3K08 A;  3JYC A;  4QIW F;  4P9O A;  4FIP C;  5KUM A;  3F7V C;  1JQ0 A;  1SES A;  3IFX A;  2DYR B;  4PDL A;  4R8C A;  3E86 A;  4WFF A;  4JYC A;  3IC7 A;  2OCC B;  3ZRS A;  4GCZ A;  2EZP A;  3ZMT A;  2P6J A;  1DF5 A;  4L87 A;  3B8N A;  3ABK C;  3AG3 C;  1FXV A;  2EIL C;  2EIJ C;  3MD0 A;  3TCU A;  5B3S C;  5LGN A;  1W2B U;  5H6Q A;  3CCJ V;  4MVR A;  4I9W A;  4PEL A;  1OCO C;  3E8G A;  1AR1 B;  3AG2 C;  1K73 W;  3CPW U;  3JD2 A;  1GM8 A;  2ZR2 A;  2IJH A;  3FB8 C;  3CC7 V;  1VQ4 V;  1Y4M A;  4QPJ A;  1NVP D;  5IY5 C;  3ABU A;  1P4R A;  1KKD A;  2GHY A;  3F7Y C;  3CCM V;  2WLM A;  2X7R B;  5L3F A;  5DN6 G;  1F51 A;  1JOY A;  1OHH G;  4RQF A;  3F5W C;  1Q7Y W;  3SYP A;  1QCE A;  3ZJZ A;  1W0J G;  2HVJ C;  1K5Q A;  1EBO A;  2Y69 C;  3ABK B;  3AG3 B;  4PDR A;  2QM8 A;  3FB6 C;  3X2Q B;  1YSC A;  3ASO B;  4GX2 A;  4BAY A;  3W7U A;  1S3J A;  2H8P C;  3PJS K;  3T2M A;  4WFE A;  3OMN B;  4LBE C;  3HPL C;  4J9Z B;  1ROP A;  2EIN C;  2Z5U A;  3OE7 G;  2W6J G;  3ABL B;  5EK0 A;  1VQ9 V;  5H6R A;  4UV8 A;  2P67 A;  3OUF A;  2WLN A;  3SPC A;  2X6A A;  3UKM A;  3D36 A;  2ZDI C;  3EHB B;  3OMA B;  1K97 A;  4WFB V;  1B6Q A;  4MT8 A;  1EFR G;  4R50 A;  4FJC C;  5EBM C;  1KD1 W;  2QEX V;  1SZT A;  1AI4 A;  2KB1 A;  3SPH A;  4JTC B;  5CBG A;  1VQ5 V;  4TWK A;  4U7O A;  1SER A;  2ZR3 A;  3TET A;  4MTX A;  2NNU A;  1R3K C;  2P90 A;  1NR7 A;  3CMA V;  1FS0 G;  1NH2 B;  2EBO A;  2QKS A;  4JAU A;  3RVY A;  2HKO A;  2YEV A;  1ENV A;  3K06 A;  1IXM A;  4YXW G;  1QLE B;  5LHH A;  4FPP A;  3K3W A;  1K5S A;  1GMG A;  1NH2 D;  3SYA A;  2IJJ A;  4WCE V;  3LNM B;  3OGC C;  4I5S A;  3E2E A;  4MTG A;  3W7S A;  2DYS B;  1PKX A;  3CCQ V;  4UV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...