3H01A

Structure of the c-terminal domain of a putative hiv-1 gp41 fusion intermediate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
54
structure length
54
Chain Sequence
EWDREINNYTSLIHSLIEESQNQQEKLEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of a putative gp41 dimerization domain in human immunodeficiency virus type 1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
molecule tags Viral protein
molecule keywords Envelope glycoprotein gp160
total genus 24
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3h01A00
1Y4MA 5KA6A 3MHHC 4G2KA 1QBZA 1JPXA 4N21A 2LP7A 3P30A 4N23A 1K33A 2EZOA 4FK5C 3B8MA 4JPRA 1QCEA 3GWOA 4FJCC 1QR8A 3CYOA 1JQ0A 1MOFA 3B8NA 4JF3A 5CN0A 1MG1A 1DF5A 1I5YA 2OT5A 5KA5A 1EBOA 3MHSC 3M99B 1ENVA 1I5XA 1K34A 2X7RB 1QR9A 2EZPA 5HFLA 1Y66A 3H01A 3B77A 2M7WA 5CMUA 1F23A 2EBOA 4JGSA 5HFMA 3K9AA 3CP1A 1DF4A 2P6JA 3WFVA 1DLBA 4E2LA 4FIPC 2MK3A 1SZTA 5H9CA
chains in the Genus database with same CATH superfamily
5JH7B 3E83A 3K5NA 1LNQA 4DR6B 2UUCO 3LDDA 2CGOA 4IL6Z 2EULA 5ITZA 3SYPA 3QO7A 2F4VB 2IJIA 5E1AC 5LHHA 3ZHSA 3QO8A 5JJEB 1VQ9V 4K0KB 1R3JC 4CZZA 2BSKA 2UXDO 2F43G 1XQ8A 3RVZA 3SYQA 1RPRA 4MTOA 1V55C 4PJ0Z 1R1BA 5IJ9B 4QE9A 4MTGA 1H2MA 1M90W 3CXHF 1PPJH 2OIGA 3CCEV 3ASOB 2ZM6O 3ZS8C 2HVJC 2HR3A 1H2LA 4X1IA 4X8AA 3CSXA 3JD4A 4JI1O 2E5LB 4BIZA 1U96A 1B6QA 1PL4A 2Q9LA 5KLVH 1AR5A 2UUCB 2EIKB 4X65B 5GONA 2Q7EA 2CAZC 5DEDA 4YHHB 1AP6A 3UT5B 2NN4A 2PY5A 4JV5B 4G2KA 3JALB 5B3SC 1FD9A 2QA4V 2EZOA 4P9PA 1QLEB 4OPHA 3ZHRA 4BIOA 1XI1A 1JX9A 4O4IB 3G80A 3VQXA 4YHHO 4U3FH 1MA1A 3CMAV 1H2SB 1WPXA 5C93A 4TOIA 2DYRB 2XAGA 2UXNA 2EINC 4EB6A 2JVDA 4J7ZA 2WA3A 3W7SA 3CC7V 5L3EA 4L8JA 2X7RB 1Q8IA 3A0RA 4U7OA 5AG2A 4RO2A 5ITZB 3WFVA 1RM1B 1KUQA 1DLBA 5BR8B 2LO1A 3OTOB 1PL0A 4KP4A 4ZHQA 5LYJB 1Q86W 3HKEB 5F2VO 4Z1MG 3MAQA 3CEIA 3JYCA 4YJ3B 1YXBA 1TVKA 3DC5A 5LMUB 1R6NA 2UUAB 4K0KO 3ETQA 1GH6A 1HR0O 1AP5A 3DGEA 3UKMA 1RSOA 2XAJA 5CMUA 1F23A 3JD0A 5LYJA 3OE7G 2P6JA 3BCCH 1ZL8B 4FFBA 2PI4A 4PDRA 3H01A 3ABMB 2QWNB 5KHGA 3AG7A 1NTMH 2YIBD 4K8XA 2QWOB 1XHXA 1VEWA 3U11A 3FYEB 1DF5A 5B3SB 4UCRA 3IFXA 4BAYA 5B1NA 1COWG 1J5EB 4TT3G 3ZRWB 3ASNB 1SZXA 1S72V 1GTOA 1K5QA 3M8AA 4JI2O 1BHBA 3FD9A 4JI7B 5J2TA 2AGAA 2CTWA 4MVRA 4DRXA 1AILA 4OPAA 3ZBHA 5IY5B 1S3JA 4NTWA 3IJ4A 4PDMA 2VQEO 1QVFU 1YDXA 3JAWA 5KHIA 1Q5OA 4H13B 3OMAB 2MK3A 5L3GA 3T2MA 4WFGA 4GYCB 1P7BA 1I7FA 1OJHA 4U3JB 3JCUZ 3QTCA 1L8DA 1VQ5V 3K03A 1SERA 3NR7A 3OGCC 4EB6B 4X1KB 2ZT9B 1IBKB 2ZE6A 2F93B 2LFRA 1AI7A 2GUZB 4ZHQB 2OWOA 2YI8A 3GWKC 3G6EV 4UCOA 2D3OW 2R9IA 2JGDB 1DK1A 2BOCC 1IXMA 3SYOA 2DWEC 1M56C 1DGSA 2HJFC 3BPZA 3CE2A 2PF4E 2QM8A 4TV9A 4HYOA 5EBWC 3RT3C 1BQ0A 1MZFA 4IYIA 4PA6A 2EIJC 4FM1A 2N04A 2A9HA 4X62B 4NXNO 5CB4B 1NU1H 1ZTEA 4PA3A 4OX9O 3RYCB 4LFBO 4TUYB 1GRJA 3ZMSA 2P7TC 1AJQA 2LQTA 3ZRSA 5JCOA 1XNRO 3DTUB 4UCVA 3E35A 1L0LH 5KHJA 4JI0B 3JAKA 1IBLO 3ICXA 4N21A 1N34O 1TGOA 1WB7A 2IJHA 4IHJB 1D5NA 4J11A 4UV9A 1P84F 5IJ0A 2QEXV 1DTOA 1E79G 5DM6V 4B7KA 2JRIA 1V9PA 5LMNB 3TCUA 4O2BA 1W59A 1YJ9V 1OHHG 4O2AB 2ARHA 2KG7A 1M1KW 3SDLA 4YY3O 4DR1O 2Y48A 1YTFB 1QCEA 4H0LB 3E8BA 1P7GA 3RYIB 2W0XA 5TISZ 3T1YO 2W6JG 2YEVA 5KX5A 2DJVA 4PDVA 1NKDA 2M6YA 3CC4V 3N2GA 5KHHA 3BEHA 2AHZA 1SQQH 4JI1B 4ASUG 5JH7A 4MS2A 1YITV 1DF4A 3KKYA 5K1PA 4CH6A 3HKDB 2UUAO 5LMUO 4N23A 3ETGA 1GM8A 3U0ZA 2WAMA 1WAZA 3JALA 5D5PA 1I94B 1Y74A 5CN0A 1XMQB 4JI8B 1N33B 1FFXA 3ZRVA 5BR8O 1XL6A 1KKCA 2HHHO 3G6BA 1TUEB 4CC5A 2ZDIA 3QF7A 4WFEA 4C7UA 3MHHC 2Y4UA 2UXBB 3W7XA 4LF5O 2IU3A 4MW8A 3CYOA 1JFFB 3FFQA 1NVPB 3JATA 5J2UB 1I5YA 1SS3A 3LNNA 3K59A 2H3OA 2CTRA 4CH3A 5FNVB 4DR5O 3AG1C 1VMGA 2N05A 4I50A 3ABLB 4PI0A 1VQ8V 3CCRV 1RPOA 4MVSA 3BFRA 5B1BC 3N2KA 2F23A 4O4LA 2XTAA 4O2AA 2Y0PA 1ENVA 3QG5A 3RYFB 4UFZA 2IU0A 2JDIG 3ZHTA 1BZKA 2QTOA 4X89A 4DW0A 3T1HO 5LGNA 1FYJA 1THZA 4EFEA 5H9CA 2JS3A 4B3RO 2Q73A 2FMLA 2DYSB 5BMVB 1GN3A 2EIMB 4ICGA 1K33A 4GUNA 2ZQMA 3E8FA 4YXWG 1EFRG 4NTYA 3R66A 4QNHB 2WLKA 4MVOA 1R6KA 2HG5C 3CRMA 1KC8W 4TQDA 4DV4O 2JS5A 2F66C 3L9DA 2XAHA 1KB9F 4JTAB 4EKWA 2JJ1G 4UCUA 1YJNV 1HNZO 2UUBB 1HNZB 2UUBO 1WB8A 5LA6B 1JJ2U 2KSDA 1RM1C 1MG1A 2DYRC 4JYYA 2N74A 1NI8A 2NR5A 3CPWU 4X20B 2OCHA 4NKGB 1OV9A 1AB3A 1Q82W 1H2KA 3F7YC 4LF9O 4I7ZB 1L1FA 1JPXA 1EN4A 1BHAA 3K3WA 4UXNA 3MD0A 1BQZA 1EZJA 4X1YB 5JWPA 1FAFA 5LOVA 1R3IC 2WLLA 1XILA 3BA8A 3STZC 4GLXA 1HNWB 5J2TB 4DK0A 4FIPC 4JI2B 1ORQC 1A32A 3QO5A 5LP6A 1Q81W 1XBLA 4FJCC 1J5EO 3OGIB 2YIAA 4I0XA 4JV5O 3AG1B 4JZ2A 2DE0X 2GDSA 4LBEC 4HNAB 4DR5B 1YTFD 1PKXA 2DMXA 4RAIA 3RN4A 5KMGB 4LNUA 1QNMA 1SZTA 3ZRXA 2FL4A 1S5HC 1N34B 3VOUA 2Q0AA 4TWKA 5EC2C 1GM7A 4TV8B 5J9PC 1OCZB 1N0JA 3CB2A 3OAAG 5KHKA 3ABKB 4O4HB 3B40A 4JTCB 3ZN0A 5LXTB 4RWUA 2UXDB 4GX5A 2ZCEA 1BL8A 1GMGA 1AVMA 3SPIA 1LUWA 1Q7YW 1NZ6A 5IE9A 3JASB 4O4LB 1S5LZ 2ZNIA 1Y66A 1XDCA 1SQXH 4DYLA 4LWSB 5LP6C 2YXHA 3CP1A 2HEPA 3E22B 3H1LH 3P3PA 3ABMC 4WFAV 4QPKA 3DXRA 4LC1A 1VF5B 1VF6A 4FMTA 5LHGA 2V1DA 3CCMV 1VQ6V 3ZCCA 3MHSC 3CHXA 2OTLV 1IXBA 5FL7G 4JASA 3UM7A 1FXKC 1XUQA 1PP9H 4PHZA 4LF8O 4DV0B 5C8YA 1KKDA 4J9YB 3P32A 4B3SO 2VQFB 4WBNA 4JI0O 2Q4PA 3R65A 3T1CA 3I5DA 5JVDA 4LFAB 2UXBO 2ZR2A 4LFBB 3DSQA 4X1IB 1VQNV 2ZM6B 3AK3A 2WSSG 3LDEA 4I55B 3OR7C 3RGBA 2DOSA 5JVDB 3SR2C 5DN6G 3OM3B 4F6EA 4B3MO 4DV1O 3AG4C 2CGNA 1E1QG 1NH2D 3E8HA 3FAVA 4ZKIA 1F7YA 5C8YB 4Z2WA 3CRCA 5A2QN 3JAKB 1FXHA 5CBHA 1VQMV 1SQVH 3IGAC 4X20A 1KBHA 4R6ZA 2OT5A 4BW9A 3RVYA 3CRQA 1H8HG 1VIBA 2JGUA 3DC6A 3ZMUA 1IBMB 4JZGA 4PV1B 1K3EA 4W4LA 2PTMA 1XNQB 3UO3A 5CB4A 2Z0AA 3FB7C 3F5TA 1IDSA 5LOVB 2F1MA 4FLYA 2YXYA 3I55V 3CRRA 1CEZA 3CXCU 1BS3A 4X66O 3A8TA 4E4EA 1GN2A 1K4DC 1YVWA 1MMMA 1Q6IA 4IHJA 4G27B 1Y76A 5LXTA 2LP7A 2ZNJA 4KL1A 3IC7A 4JF3A 1N36O 5JJNB 5LA6A 4UB6Z 5KUKA 4X66B 4RQFA 3RYIA 4ZBMA 1BGYH 4WFFA 4KXRA 1W2BU 3S3WA 1Y6XA 4U3JA 1FXKB 1KD1W 2BTQB 3BABA 5B5EZ 2EILC 1F4NA 1CPYA 1TUBB 4DUYO 2X0LA 3JARA 2QDOA 2YXLA 3STLC 1OZ0A 1OCOC 4KUMA 3JATB 2P22C 2Y4TA 5BMVA 2ZR3A 1EM1A 3FKSG 4TQFA 3K9SA 5GTIZ 2XAQA 1UJWB 1PD3A 1FXVA 2YS8A 3OT7A 3FYIB 1SF9A 1PNMA 4RQEA 5LP6B 1V54B 1VQ4V 3JASA 4DV1B 2YIDA 1JQ0A 4Q20A 1N32B 4FLWA 3T4ZA 1VQKV 1JCHA 5JJJB 2Y69B 4NXMB 1HNXB 4I0XB 4DR4O 5H2FZ 2M7WA 2QGNA 3SPCA 3D36A 3ZIAG 3HKEA 1I94O 4PD4F 1B06A 3RFRA 4H33A 2CTPA 4PI2A 2NLJC 3CD6V 3UT5A 1OCZC 4DR2O 4DV7O 3KG2A 4OXSA 3ML0A 5EZYA 1M57B 2QM7A 4HBNA 5CBFA 2F4VO 2XT9A 4CH4A 2BE3A 4F4LA 3P3NA 4JI7O 3B09A 1ROPA 4JGSA 1XEQA 2QTSA 1IURA 1NT2B 5H6RA 5IJ0B 1GN4A 1BSMA 5CA0A 3FB8C 4YY3B 4DR1B 3HKDA 1XNRB 3T1HB 1YIJV 4J10A 2DQ0A 4XDLA 3AG2C 2PI5A 2IBZH 4GKJB 3A2FA 2LW1A 3ZEDA 1YF2A 2ZE8A 4LCUC 1IBLB 1UPGA 2LGWA 3VQVA 2E5LO 4I9QA 4NVPA 5GONB 2IH1C 4R8CA 5B1AC 5CA1A 3B77A 4ABMA 4QE7A 1R73A 2YEVB 5L3BA 1MABG 4J41A 5BZBA 1NJIW 1NR7A 2LGQA 1US6A 4I50B 4BR6A 3K04A 4XDJA 3ZHQA 4I4TA 4X1KA 2BSKB 1WNSA 4MTXA 3X2QC 3CCVV 5FPOA 1GK9A 2P06A 3K08A 2CUGA 2KB1A 5EC1C 1N4CA 5B66Z 4DRXB 5JCOC 1GN6A 2A3QA 3ZMTA 1ZLZA 1J95A 1K8AW 4XBFA 2GTSA 1QLNA 4DR7O 4YJ3A 4JI4B 2BTOA 3ZRWA 3D3IA 2VS0A 4GX0A 3TXSA 4FZ1A 1H38A 2GBOA 3AK1A 4JYCA 4DO2A 3KZIZ 3H1IH 2V4DA 3EVKA 3W7WA 1SESA 1ZAUA 5IYZA 3ZX6A 1QQCA 3B4SA 5EK0A 4CS4A 3RYCA 5EYPA 5LHIA 3RBZA 1PNKA 1RFYA 2ATKC 2UXCO 4MT8A 4JAUA 1OCRC 5B1AB 3GWOA 3SYCA 1HNWO 1MOFA 2ZXWC 2QKSA 2R9AA 1V54C 3OFNG 1AI6A 2ODMA 3C90A 3CJHA 3EFFK 2JEUA 4KFMA 3C3TA 4O4IA 3CC2V 1WN7A 1GM9A 5KAFZ 4J80A 3I56V 4J9ZB 1BT8A 2RDCA 4DR3B 2UU9B 2E76B 1T5EA 4KHPB 4FM0A 4J7KA 1Z5WA 4P30A 2V7QG 5IYZB 1AJNA 3LSQA 4X1YA 2LW7A 5FPRA 3QNEA 2X6AA 4UV8A 4PA7A 3TETA 4JYBA 3OTOO 1QBZA 3G4SV 4D7TA 4JPRA 3BY6A 4NXMO 4DV4B 2PYJA 1XMQO 4UCTA 3K58A 1N32O 3CJHB 1F4MA 2OTJV 1UFIA 4AHCA 1W0JG 3CCQV 2ZINA 1LUVA 3ETEA 3RYHB 1NH2B 1CXZB 2Z5UA 3W7TA 4PA4A 4DUZB 2ZIOA 1CP9A 4YIOA 1SA0A 1XMOO 3TXQA 3A0HZ 1V55B 4QIWF 2F95B 4OGQB 4RUEA 3OUFA 1KP3A 2BOBC 2WA4A 2JGDA 2ZXWB 3UCSC 4FLVA 4FZ0A 2L6LA 1TAEA 2GUZA 4L87A 3P30A 4R7CA 5IWAB 2YUAA 5EYPB 1MNGA 3H9VA 3S3XA 4ZI7B 2NNUA 3SYAA 4X65O 2QKAA 1K4CC 3ZJZA 5GTHZ 4JI3O 2YC0A 3T4DA 4DV5O 1M4UA 3E8GA 1D5AA 2AZ0A 1PM9A 1ZL8A 4FFBB 5EBLC 3SJCC 5B1OA 1YCIA 1B04A 1AJPA 4MTFA 4K8ZA 1XMOB 5IT9N 4FLTA 3ABKC 4W4KA 3JAMN 4B7EA 1H2GA 1HDJA 4DV2B 4WFBV 4I4TB 1TUBA 1O9HA 3O9OA 3PJSK 4WFHA 2EINB 2QE7G 2W0FC 2HJDA 2XAFA 3SPGA 3JSNA 4LH6A 3L70H 1FJGB 1G8MA 4LF9B 4TV9B 4LF4O 2P4KA 3VQYA 3Q4HB 2A06H 3OR6C 4XDKA 4EFBA 4MSWC 1K73W 3THOA 1URFA 1BMFG 2YIBA 3OUSA 3IAYA 3AEIA 2FTKA 2ILMA 3CWBH 2XASA 1QHTA 1S76D 4B3MB 4UVBA 3SPJA 4JYAO 2B1IA 1YEWA 5E79Z 1Z2GA 4CBCA 4UB8Z 2DW4A 4LH7A 4I5SA 4DV5B 3OW2U 4I55A 2OIEA 4JI3B 4FVMA 2EX3A 3D8CA 3KCYA 1SQFA 4LFAO 3K5OA 4QJFB 2ADPA 1X59A 4MVUA 2XNDG 4B3RB 4QPJA 3FAVB 5IWAO 2A79B 3LUTB 4X64B 4AQYB 4O4JB 4CS2A 3HKBB 3WB0A 2VQFO 2K9PA 2R9RB 3CCLV 2UXCB 2KQXA 1NQTA 4NR1A 4R50A 3K5MA 1H2NA 5JQGA 4GX1A 1EZVH 3DXRB 1X4TA 3E86A 1PV0A 3FX7A 1Y67A 3N27A 3D36C 5IYCO 1VP7A 1I5XA 2HVKC 1S5JA 1VQLV 4TUYA 4B3TO 5FLXN 4DR7B 2WLIA 4JI6B 2CE4A 3WU2Z 2GSMB 4LF4B 1Q3EA 1FJGO 2HP8A 1WPBA 3GB7C 3L74H 5KA5A 2EILB 3W7UA 2WPDG 4UVCA 1GKFA 2L35A 3ZMVA 1WA8B 1OCOB 1G1XB 5IDJA 1KQSU 2WWWA 1I08A 3ZHVA 3SJAC 3J80N 3BHPA 1R3LC 4U7NA 5CBGA 4IGGA 4KHPO 1XREA 4F6RB 1QLEC 1S0VA 3B8MA 2FB5A 1NVPD 3LSSA 4CC6A 4H44B 1K9MW 3HKCA 2WLMA 3QVNA 4DK1A 4GKJO 5CA0B 2EIMC 5D5QA 3EHBB 3NXSA 2JK5C 2ZIMA 3WG7B 4LF6O 4AI8A 2Q7GA 1H8EG 1KECA 1WP7A 2E3CA 1Q6UA 3B8NA 1L0NH 5LL6Y 1O9GA 1R6TA 1RSOB 4P9OA 4BWAA 2CH7A 2LJ2A 4JI5O 3HB3B 3J81N 2YICA 2QWQB 1TA8A 1JVMA 2P4VA 2AHYA 1N8RW 2IJKA 5CA1B 2WLLB 1NR1A 4DR2B 5EIBD 2UXXA 2O57A 1SC5B 1GO3F 1XL4A 2CDYA 1MSDA 5K1XA 4LF5B 2B5UA 3SGIA 4GCZA 4EEQA 4MVMA 2B1GA 2G38A 4H37A 5EIBC 5IYBO 2P5OA 3OMNB 1M93A 4DR4B 1Y76B 5L3DA 4GT1A 4DV2O 2Q68A 4JI8O 2DN9A 1HW7A 2AW9A 4NB5A 5KMGA 3U10A 1B3QA 4YJ2B 2VWJA 1JMKC 1FS0G 4B08A 2ITCC 1Q90D 3H1JH 3G71V 1NTZH 2QR4A 2DWDC 4FPPA 2KKWA 2QWRB 4YIPA 4FK5C 1SKVA 3L75H 2Q7HA 5BY1A 3UO2A 4LFCO 4YJ2A 3APQA 4ZIBA 4D6TH 1YJWV 2GV9A 1JOYA 1Z5VA 2PZSA 3BVOA 5LGTA 2GTAA 2Q5ZA 1JJOA 3B2EE 1VF7A 1SQGA 2JEXA 3K06A 3CMEV 1K5SA 5KUMA 4FM2A 1HP8A 1ZUQA 5LMNO 4I9WA 2IM9A 4FLXA 2MW2B 1WP8A 4HZ3A 1N36B 4Q6GA 4JTDB 1QR9A 1SQPH 3H1KH 3JARB 2EZPA 5HFLA 2EIJB 5IJ9A 1FKAO 3JSLA 4PA9A 3ZN1A 1EN5A 4AQYO 3JD1A 4X64O 5KA6A 4WBNB 3TJTA 2E75B 4DW1A 4LNUB 5KAIZ 1ZX3A 1M56B 3SJBC 1MSWD 1NS1A 1BE3H 1KYOF 1VARA 2ZD9A 4JI4O 2B9ZA 5LBQA 5J2UA 3OMIB 3SPHA 3ETDA 3Q4HA 1VQ7V 4MVZA 1HNXO 1KP2A 3AG2B 3K9AA 3LSUA 1HWYA 5GW7A 4AILC 3PN1A 4TSFG 4DV6B 3FB5C 3K0GA 1R3KC 2DYSC 2HHHB 4Z1VA 3M7MX 4K35A 2VWKA 2JIZG 4A5UB 2XOKG 5H6QA 4PDLA 4JI6O 5EZYB 4IIJB 3LDCA 2CK3G 4BIUA 4FLZA 4LR3A 3K5LA 1IX9A 3ZHUA 5CA3A 1ZWIC 2RMKB 4JAVA 3WB1A 1IBKO 1AROP 2A0LA 2DQ3A 1F51A 4DUYB 1K92A 2RNBA 4ZOLB 1SRYA 2HLDG 5DECA 4TV8A 4FFKA 3UQ8A 3OTFA 2P67A 1OCCB 1OCCC 3ASOC 4ZI7A 2R72A 2H94A 4LF6B 5BXZA 1M57C 4IYHA 2P90A 1G4YB 3CRAA 3AG3B 3WB2A 4CS3A 4QGPA 3K57A 2BCCH 2ZDIC 3OEEG 4IIJA 1YSCA 3CCSV 4LF7O 2GHYA 2AZ2A 3D3QA 1AR4A 2Y0IA 4P2ZA 3E22A 4DV3O 1K7DA 2PYLA 1M9NA 3N2GB 2ADQB 1FPOA 1VF6C 1JA8A 2RN9A 2Q67A 3HPLC 4GKKO 3M99B 5FNVA 4WF9V 2OCCC 2OCCB 3C3SA 1IBMO 2X6CA 1AI5A 4K3AA 2IW5A 1YI2V 3HR0A 1N33O 2A7WA 3LNMB 3FB6C 4MVQA 3N2KB 2Q8VA 1HR0B 1S77D 2QSAA 2PGGA 3CCJV 2Q69A 1LR1A 4X88A 1OCRB 1EN6A 2QKCA 1N0NA 2R70A 1K97A 3J7AU 1SQBH 2XUMA 2K1EA 1BCCH 3IC9A 2EBOA 1AR1B 3A0BZ 3T1YB 4ZOLA 3JCZA 3BA9A 1M5IA 1NTKH 2KG7B 2Y69C 3RYHA 3O65A 2YSUB 5B1BB 2LFSA 3K79A 1GAXA 4GKKB 4UUJC 1QVGU 3CS5A 3L71H 1VQOV 1XHZA 2RCVA 4O4JA 2D2CB 5LGUA 3L72H 5KX5B 4MW3A 1E1RG 4F6RA 2QJ1A 5L3FA 2ZE5A 2EIKC 4DR3O 4B3SB 2VQEB 3H1HH 1AI4A 4LF8B 3X2QB 2Q6AA 4G28B 3ABLC 5A9GA 4IT5A 2IJJA 3ZMZA 1PNLA 2HFEC 1NBMG 1YZBA 3TGUH 4DV7B 2E74B 4FLUA 4E2LA 1Q43A 2XHBA 4LP8A 3G67A 3OEHG 1KMIZ 4OX9B 1U97A 2WLIB 2AXTZ 1P4RA 4J42A 3GVMA 4DUZO 2ETNA 4X62O 4NXNB 4O2BB 2Q0OC 4UVAA 1YHQV 2YI9A 1QU7A 3JAWB 3TK1A 2CH7B 1FFTB 2CTQA 4DXWA 4X9QA 2ZE7A 3L73H 1XNQO 1K34A 3MDSA 2YDEA 2W6IG 1ZSPA 2EJRA 4PELA 5HFMA 2H8PC 4LFCB 2RQ6A 1RP3B 1IVSA 1WLEA 3ASNC 3RWRD 1KU9A 2HKOA 5L3CA 1JR9A 3JD3A 1MZEA 1QR8A 2X6BA 4B3TB 4BW5A 4HNAA 3AG4B 3AG3C 2PUSA 2ITDC 3HKBA 5IYDO 1TVKB 4WCEV 3VBBA 1SA0B 5IY5C 3RYFA 4O4HA 4DV6O 4NTXA 3E89A 3VQWA 1Y4MA 4DV3B 2FYUH 2IH3C 3KCXA 2BTQA 5H5NA 1FXKA 3OD4A 2UU9O 3EXAA 5JQGB 3HKCB 3AK2A 4UCSA 1W0KG 4LWSA 2JJ2G 3JD2A 4DR6O 4LF7B 3ABUA 1VQPV 3F7VC 2WLJA 3CCUV 1G6UA 4RUFA 2WLNA 2QWPB 2QM4A 1XOUA 4CH5A 2Z3YA 2OYQA 3CX5F 2VRZA 2C2AA 3BAAA 3SJQC 1JFFA 3APOA 2FKXA 3WG7C 1SETA 4GX2A 1P49A 4DV0O 4JAAA 2RJZA 4JI5B 1FFXB 2WLHA 4NYKA 3E2EA 3BRCA 4HAMA 3ABTA 1EBOA 2EJ7A 3RW0A 1Y74B 1Q6HA 1WA8A 1I0HA 4D7SA 4J7JA 1D2DA 1IZ3A 2ZKOA 5EBMC 3F5WC 4JYAB 4GZRB 1WJZA 3K0DA
chains in the Genus database with same CATH topology
1JVMA 2DYSB 4LCUC 2EIMB 1K33A 2AHYA 2ZQMA 3E8FA 3E83A 4YXWG 1EFRG 1LNQA 1N8RW 2IJKA 2WLLB 1NR1A 4QNHB 3LDDA 2WLKA 2UXXA 4MVOA 3SYPA 1R6KA 2HG5C 2IH1C 3QO7A 1KC8W 1GO3F 4R8CA 2IJIA 5E1AC 1XL4A 5B1AC 5LHHA 3B77A 4QE7A 2B5UA 1R73A 2YEVB 5L3BA 3QO8A 4GCZA 1MABG 5BZBA 2XAHA 1NJIW 4MVMA 1VQ9V 1NR7A 2B1GA 1R3JC 4H37A 4CZZA 5IYBO 3K04A 4XDJA 3OMNB 4JTAB 4EKWA 2JJ1G 1YJNV 5L3DA 2F43G 3RVZA 3SYQA 4GT1A 4MTXA 3CCVV 3X2QC 1JJ2U 2Q68A 1RPRA 4MTOA 1GK9A 1RM1C 1MG1A 1V55C 2DYRC 3K08A 2KB1A 5EC1C 4QE9A 3CPWU 4MTGA 3ZMTA 1M90W 3CCEV 1J95A 1K8AW 3ASOB 4XBFA 1Q82W 1QLNA 1FS0G 3F7YC 2HVJC 2HR3A 2ITCC 4X8AA 1L1FA 3G71V 1JPXA 2DWDC 4FPPA 3JD4A 1BHAA 4FK5C 3K3WA 4UXNA 3MD0A 3D3IA 4GX0A 3ZRWA 4BIZA 1B6QA 1EZJA 1H38A 4JYCA 1YJWV 1JOYA 4DO2A 2EIKB 1R3IC 2WLLA 3STZC 1SESA 3W7WA 5LGTA 4FIPC 5EK0A 1ORQC 4G2KA 3QO5A 5LHIA 3K06A 2JEXA 1PNKA 3RBZA 5B3SC 3CMEV 1Q81W 2ATKC 2QA4V 2EZOA 1K5SA 4MT8A 4P9PA 5KUMA 4JAUA 1OCRC 5B1AB 3GWOA 4FJCC 4I9WA 1QLEB 3SYCA 4HZ3A 1MOFA 2ZXWC 2QKSA 1V54C 3OFNG 1AI6A 1JX9A 3AG1B 4JTDB 1QR9A 3EFFK 2EZPA 4LBEC 5HFLA 2JEUA 2EIJB 1YTFD 4KFMA 1PKXA 3CMAV 4RAIA 4PA9A 3CC2V 3ZN1A 3JD1A 1GM9A 1SZTA 3ZRXA 1WPXA 5C93A 3I56V 5KA6A 4J9ZB 1S5HC 2DYRB 2XAGA 2UXNA 3VOUA 1M56B 1MSWD 4TWKA 2EINC 5EC2C 2ZD9A 4P30A 5LBQA 2V7QG 3W7SA 1GM7A 3CC7V 5L3EA 1AJNA 2X7RB 5J9PC 3OMIB 3SPHA 3LSQA 1OCZB 3QNEA 3ETDA 1VQ7V 3A0RA 2X6AA 4MVZA 4U7OA 1KP2A 3AG2B 3K9AA 3OAAG 4RO2A 4UV8A 3WFVA 1DLBA 1RM1B 4PA7A 3TETA 1HWYA 5GW7A 4TSFG 4JYBA 3ABKB 1QBZA 3G4SV 1PL0A 3FB5C 4KP4A 3K0GA 1R3KC 1Q86W 2DYSC 4JTCB 3ZN0A 4JPRA 3BY6A 4Z1MG 3JYCA 4GX5A 2JIZG 1R6NA 2XOKG 1BL8A 1GMGA 3SPIA 5H6QA 1F4MA 1Q7YW 4PDLA 2OTJV 1Y66A 3DGEA 3UKMA 2XAJA 1W0JG 2CK3G 3LDCA 5CMUA 1F23A 3CCQV 3JD0A 4BIUA 3CP1A 3OE7G 2P6JA 3ETEA 2PI4A 4PDRA 1NH2B 3H01A 3ABMB 3ABMC 2Z5UA 4WFAV 5CA3A 1ZWIC 4QPKA 3W7TA 4PA4A 4JAVA 4LC1A 4FMTA 1AROP 2A0LA 2DQ3A 1F51A 1K92A 5LHGA 2V1DA 3CCMV 1VQ6V 1SRYA 2HLDG 3ZCCA 1CP9A 3FYEB 1DF5A 5B3SB 3MHSC 1V55B 3IFXA 4QIWF 4BAYA 5B1NA 2P67A 1OCCB 1COWG 1OCCC 2OTLV 4RUEA 3ASOC 4TT3G 3OUFA 1KP3A 2BOBC 2H94A 2ZXWB 3ZRWB 3ASNB 1S72V 1GTOA 1K5QA 5FL7G 4JASA 1M57C 1FXKC 4L87A 3UM7A 2P90A 3P30A 1G4YB 4R7CA 3AG3B 1KKDA 1BHBA 4J9YB 3P32A 4MVRA 2NNUA 2ZDIC 3OEEG 3SYAA 5IY5B 3R65A 1S3JA 1YSCA 3T1CA 3CCSV 4PDMA 1QVFU 1K4CC 2GHYA 3ZJZA 3T4DA 3OMAB 2MK3A 5L3GA 3T2MA 3E8GA 4WFGA 2ZR2A 1P7BA 4P2ZA 5EBLC 5B1OA 1VQNV 1K7DA 1M9NA 2WSSG 3LDEA 1AJPA 4MTFA 1VQ5V 3K03A 1SERA 2Q67A 3HPLC 3OR7C 3ABKC 3M99B 5DN6G 3OGCC 1H2GA 3OM3B 4WF9V 4WFBV 2LFRA 2OCCC 1AI7A 2OCCB 3AG4C 2X6CA 1AI5A 1E1QG 3G6EV 2D3OW 1NH2D 3E8HA 2IW5A 2R9IA 1YI2V 3PJSK 4WFHA 4ZKIA 2EINB 3LNMB 2QE7G 3FB6C 2BOCC 2W0FC 4MVQA 1IXMA 2XAFA 3SPGA 1FXHA 5CBHA 1VQMV 1G8MA 3SYOA 1S77D 2DWEC 3IGAC 1M56C 3CCJV 2Q69A 4R6ZA 3OR6C 4X88A 2OT5A 1OCRB 2HJFC 3RVYA 4XDKA 2QM8A 1H8HG 1K97A 4MSWC 1K73W 3ZMUA 4HYOA 5EBWC 1K3EA 2K1EA 1BMFG 3OUSA 2EBOA 4PA6A 2EIJC 3AEIA 2FTKA 1AR1B 2XASA 3FB7C 1S76D 3JCZA 2A9HA 2Y69C 4UVBA 3SPJA 2YSUB 4PA3A 5B1BB 3I55V 2LFSA 2B1IA 1CEZA 3K79A 3CXCU 4CBCA 4UUJC 2DW4A 1QVGU 4I5SA 1VQOV 3ZMSA 2P7TC 1K4DC 1AJQA 3OW2U 5LGUA 3ZRSA 4MW3A 1E1RG 3DTUB 3E35A 5L3FA 4G27B 4QJFB 2EIKC 4MVUA 2XNDG 4N21A 2LP7A 2IJHA 4QPJA 3IC7A 4UV9A 1AI4A 2A79B 3LUTB 2QEXV 1DTOA 3X2QB 2Q6AA 4G28B 4JF3A 3ABLC 1E79G 2IJJA 3ZMZA 1PNLA 2HFEC 1NBMG 5DM6V 5KUKA 2R9RB 4RQFA 3TCUA 4ZBMA 3CCLV 1YJ9V 1OHHG 4WFFA 3K0DA 1W2BU 1NQTA 4E2LA 4R50A 1FXKB 1KD1W 4LP8A 3OEHG 2EILC 1M1KW 1F4NA 1CPYA 2Y48A 4GX1A 1YTFB 2WLIB 1P4RA 1QCEA 2X0LA 3E8BA 3E86A 4UVAA 1YHQV 3STLC 3TK1A 1FFTB 4DXWA 2W6JG 1OZ0A 1OCOC 2YEVA 5IYCO 1I5XA 1K34A 4KUMA 1NKDA 2HVKC 4PDVA 3CC4V 2W6IG 1VQLV 3BEHA 2AHZA 2EJRA 4PELA 4ASUG 4MS2A 1YITV 2ZR3A 2H8PC 3FKSG 5HFMA 1DF4A 2WLIA 2XAQA 1UJWB 1PD3A 1WLEA 1FXVA 3ASNC 4N23A 3FYIB 2GSMB 2HKOA 1PNMA 5L3CA 3ETGA 1GM8A 4RQEA 2WAMA 1V54B 1VQ4V 3JD3A 1QR8A 2X6BA 3GB7C 1JQ0A 4Q20A 4BW5A 3T4ZA 5CN0A 1VQKV 1JCHA 5KA5A 3AG4B 2EILB 3ZRVA 2WPDG 3AG3C 1XL6A 2ITDC 2Y69B 3W7UA 4UVCA 1TUEB 5IYDO 1GKFA 4WCEV 3ZMVA 2ZDIA 3VBBA 2M7WA 5IY5C 1OCOB 3SPCA 4WFEA 3E89A 3D36A 3ZIAG 5IDJA 1KQSU 2WWWA 1Y4MA 3MHHC 4H33A 2IH3C 3W7XA 1R3LC 4U7NA 2NLJC 3CD6V 5CBGA 1FXKA 2IU3A 1QLEC 1S0VA 3B8MA 4MW8A 1OCZC 1NVPD 3CYOA 3LSSA 1W0KG 1NVPB 3KG2A 2JJ2G 3ML0A 4OXSA 3JD2A 1K9MW 1I5YA 3ABUA 1VQPV 3F7VC 2WLJA 1M57B 2QM7A 3CCUV 5CBFA 2WLMA 4RUFA 4F4LA 2WLNA 3AG1C 1ROPA 4JGSA 2Z3YA 2EIMC 3ABLB 2C2AA 3SJQC 5H6RA 1VQ8V 3CCRV 3EHBB 3WG7C 1RPOA 1SETA 3FB8C 4GX2A 4MVSA 3NXSA 5B1BC 2JK5C 3WG7B 1H8EG 1KECA 2WLHA 3E2EA 3B8NA 1YIJV 4HAMA 3ABTA 1EBOA 3RW0A 1ENVA 2DQ0A 2IU0A 2JDIG 4XDLA 4P9OA 3AG2C 5EBMC 2QTOA 2PI5A 3F5WC 4X89A 5LGNA 3HB3B 1THZA 5H9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y4M A;  5KA6 A;  3MHH C;  4G2K A;  1QBZ A;  1JPX A;  4N21 A;  2LP7 A;  3P30 A;  4N23 A;  1K33 A;  2EZO A;  4FK5 C;  3B8M A;  4JPR A;  1QCE A;  3GWO A;  4FJC C;  1QR8 A;  3CYO A;  1JQ0 A;  1MOF A;  3B8N A;  4JF3 A;  5CN0 A;  1MG1 A;  1DF5 A;  1I5Y A;  2OT5 A;  5KA5 A;  1EBO A;  3MHS C;  3M99 B;  1ENV A;  1I5X A;  1K34 A;  2X7R B;  1QR9 A;  2EZP A;  5HFL A;  1Y66 A;  3H01 A;  3B77 A;  2M7W A;  5CMU A;  1F23 A;  2EBO A;  4JGS A;  5HFM A;  3K9A A;  3CP1 A;  1DF4 A;  2P6J A;  3WFV A;  1DLB A;  4E2L A;  4FIP C;  2MK3 A;  1SZT A;  5H9C A; 
#chains in the Genus database with same CATH topology
 5JH7 B;  3E83 A;  3K5N A;  1LNQ A;  4DR6 B;  2UUC O;  3LDD A;  2CGO A;  4IL6 Z;  2EUL A;  5ITZ A;  3SYP A;  3QO7 A;  2F4V B;  2IJI A;  5E1A C;  5LHH A;  3ZHS A;  3QO8 A;  5JJE B;  1VQ9 V;  4K0K B;  1R3J C;  4CZZ A;  2BSK A;  2UXD O;  2F43 G;  1XQ8 A;  3RVZ A;  3SYQ A;  1RPR A;  4MTO A;  1V55 C;  4PJ0 Z;  1R1B A;  5IJ9 B;  4QE9 A;  4MTG A;  1H2M A;  1M90 W;  3CXH F;  1PPJ H;  2OIG A;  3CCE V;  3ASO B;  2ZM6 O;  3ZS8 C;  2HVJ C;  2HR3 A;  1H2L A;  4X1I A;  4X8A A;  3CSX A;  3JD4 A;  4JI1 O;  2E5L B;  4BIZ A;  1U96 A;  1B6Q A;  1PL4 A;  2Q9L A;  5KLV H;  1AR5 A;  2UUC B;  2EIK B;  4X65 B;  5GON A;  2Q7E A;  2CAZ C;  5DED A;  4YHH B;  1AP6 A;  3UT5 B;  2NN4 A;  2PY5 A;  4JV5 B;  4G2K A;  3JAL B;  5B3S C;  1FD9 A;  2QA4 V;  2EZO A;  4P9P A;  1QLE B;  4OPH A;  3ZHR A;  4BIO A;  1XI1 A;  1JX9 A;  4O4I B;  3G80 A;  3VQX A;  4YHH O;  4U3F H;  1MA1 A;  3CMA V;  1H2S B;  1WPX A;  5C93 A;  4TOI A;  2DYR B;  2XAG A;  2UXN A;  2EIN C;  4EB6 A;  2JVD A;  4J7Z A;  2WA3 A;  3W7S A;  3CC7 V;  5L3E A;  4L8J A;  2X7R B;  1Q8I A;  3A0R A;  4U7O A;  5AG2 A;  4RO2 A;  5ITZ B;  3WFV A;  1RM1 B;  1KUQ A;  1DLB A;  5BR8 B;  2LO1 A;  3OTO B;  1PL0 A;  4KP4 A;  4ZHQ A;  5LYJ B;  1Q86 W;  3HKE B;  5F2V O;  4Z1M G;  3MAQ A;  3CEI A;  3JYC A;  4YJ3 B;  1YXB A;  1TVK A;  3DC5 A;  5LMU B;  1R6N A;  2UUA B;  4K0K O;  3ETQ A;  1GH6 A;  1HR0 O;  1AP5 A;  3DGE A;  3UKM A;  1RSO A;  2XAJ A;  5CMU A;  1F23 A;  3JD0 A;  5LYJ A;  3OE7 G;  2P6J A;  3BCC H;  1ZL8 B;  4FFB A;  2PI4 A;  4PDR A;  3H01 A;  3ABM B;  2QWN B;  5KHG A;  3AG7 A;  1NTM H;  2YIB D;  4K8X A;  2QWO B;  1XHX A;  1VEW A;  3U11 A;  3FYE B;  1DF5 A;  5B3S B;  4UCR A;  3IFX A;  4BAY A;  5B1N A;  1COW G;  1J5E B;  4TT3 G;  3ZRW B;  3ASN B;  1SZX A;  1S72 V;  1GTO A;  1K5Q A;  3M8A A;  4JI2 O;  1BHB A;  3FD9 A;  4JI7 B;  5J2T A;  2AGA A;  2CTW A;  4MVR A;  4DRX A;  1AIL A;  4OPA A;  3ZBH A;  5IY5 B;  1S3J A;  4NTW A;  3IJ4 A;  4PDM A;  2VQE O;  1QVF U;  1YDX A;  3JAW A;  5KHI A;  1Q5O A;  4H13 B;  3OMA B;  2MK3 A;  5L3G A;  3T2M A;  4WFG A;  4GYC B;  1P7B A;  1I7F A;  1OJH A;  4U3J B;  3JCU Z;  3QTC A;  1L8D A;  1VQ5 V;  3K03 A;  1SER A;  3NR7 A;  3OGC C;  4EB6 B;  4X1K B;  2ZT9 B;  1IBK B;  2ZE6 A;  2F93 B;  2LFR A;  1AI7 A;  2GUZ B;  4ZHQ B;  2OWO A;  2YI8 A;  3GWK C;  3G6E V;  4UCO A;  2D3O W;  2R9I A;  2JGD B;  1DK1 A;  2BOC C;  1IXM A;  3SYO A;  2DWE C;  1M56 C;  1DGS A;  2HJF C;  3BPZ A;  3CE2 A;  2PF4 E;  2QM8 A;  4TV9 A;  4HYO A;  5EBW C;  3RT3 C;  1BQ0 A;  1MZF A;  4IYI A;  4PA6 A;  2EIJ C;  4FM1 A;  2N04 A;  2A9H A;  4X62 B;  4NXN O;  5CB4 B;  1NU1 H;  1ZTE A;  4PA3 A;  4OX9 O;  3RYC B;  4LFB O;  4TUY B;  1GRJ A;  3ZMS A;  2P7T C;  1AJQ A;  2LQT A;  3ZRS A;  5JCO A;  1XNR O;  3DTU B;  4UCV A;  3E35 A;  1L0L H;  5KHJ A;  4JI0 B;  3JAK A;  1IBL O;  3ICX A;  4N21 A;  1N34 O;  1TGO A;  1WB7 A;  2IJH A;  4IHJ B;  1D5N A;  4J11 A;  4UV9 A;  1P84 F;  5IJ0 A;  2QEX V;  1DTO A;  1E79 G;  5DM6 V;  4B7K A;  2JRI A;  1V9P A;  5LMN B;  3TCU A;  4O2B A;  1W59 A;  1YJ9 V;  1OHH G;  4O2A B;  2ARH A;  2KG7 A;  1M1K W;  3SDL A;  4YY3 O;  4DR1 O;  2Y48 A;  1YTF B;  1QCE A;  4H0L B;  3E8B A;  1P7G A;  3RYI B;  2W0X A;  5TIS Z;  3T1Y O;  2W6J G;  2YEV A;  5KX5 A;  2DJV A;  4PDV A;  1NKD A;  2M6Y A;  3CC4 V;  3N2G A;  5KHH A;  3BEH A;  2AHZ A;  1SQQ H;  4JI1 B;  4ASU G;  5JH7 A;  4MS2 A;  1YIT V;  1DF4 A;  3KKY A;  5K1P A;  4CH6 A;  3HKD B;  2UUA O;  5LMU O;  4N23 A;  3ETG A;  1GM8 A;  3U0Z A;  2WAM A;  1WAZ A;  3JAL A;  5D5P A;  1I94 B;  1Y74 A;  5CN0 A;  1XMQ B;  4JI8 B;  1N33 B;  1FFX A;  3ZRV A;  5BR8 O;  1XL6 A;  1KKC A;  2HHH O;  3G6B A;  1TUE B;  4CC5 A;  2ZDI A;  3QF7 A;  4WFE A;  4C7U A;  3MHH C;  2Y4U A;  2UXB B;  3W7X A;  4LF5 O;  2IU3 A;  4MW8 A;  3CYO A;  1JFF B;  3FFQ A;  1NVP B;  3JAT A;  5J2U B;  1I5Y A;  1SS3 A;  3LNN A;  3K59 A;  2H3O A;  2CTR A;  4CH3 A;  5FNV B;  4DR5 O;  3AG1 C;  1VMG A;  2N05 A;  4I50 A;  3ABL B;  4PI0 A;  1VQ8 V;  3CCR V;  1RPO A;  4MVS A;  3BFR A;  5B1B C;  3N2K A;  2F23 A;  4O4L A;  2XTA A;  4O2A A;  2Y0P A;  1ENV A;  3QG5 A;  3RYF B;  4UFZ A;  2IU0 A;  2JDI G;  3ZHT A;  1BZK A;  2QTO A;  4X89 A;  4DW0 A;  3T1H O;  5LGN A;  1FYJ A;  1THZ A;  4EFE A;  5H9C A;  2JS3 A;  4B3R O;  2Q73 A;  2FML A;  2DYS B;  5BMV B;  1GN3 A;  2EIM B;  4ICG A;  1K33 A;  4GUN A;  2ZQM A;  3E8F A;  4YXW G;  1EFR G;  4NTY A;  3R66 A;  4QNH B;  2WLK A;  4MVO A;  1R6K A;  2HG5 C;  3CRM A;  1KC8 W;  4TQD A;  4DV4 O;  2JS5 A;  2F66 C;  3L9D A;  2XAH A;  1KB9 F;  4JTA B;  4EKW A;  2JJ1 G;  4UCU A;  1YJN V;  1HNZ O;  2UUB B;  1HNZ B;  2UUB O;  1WB8 A;  5LA6 B;  1JJ2 U;  2KSD A;  1RM1 C;  1MG1 A;  2DYR C;  4JYY A;  2N74 A;  1NI8 A;  2NR5 A;  3CPW U;  4X20 B;  2OCH A;  4NKG B;  1OV9 A;  1AB3 A;  1Q82 W;  1H2K A;  3F7Y C;  4LF9 O;  4I7Z B;  1L1F A;  1JPX A;  1EN4 A;  1BHA A;  3K3W A;  4UXN A;  3MD0 A;  1BQZ A;  1EZJ A;  4X1Y B;  5JWP A;  1FAF A;  5LOV A;  1R3I C;  2WLL A;  1XIL A;  3BA8 A;  3STZ C;  4GLX A;  1HNW B;  5J2T B;  4DK0 A;  4FIP C;  4JI2 B;  1ORQ C;  1A32 A;  3QO5 A;  5LP6 A;  1Q81 W;  1XBL A;  4FJC C;  1J5E O;  3OGI B;  2YIA A;  4I0X A;  4JV5 O;  3AG1 B;  4JZ2 A;  2DE0 X;  2GDS A;  4LBE C;  4HNA B;  4DR5 B;  1YTF D;  1PKX A;  2DMX A;  4RAI A;  3RN4 A;  5KMG B;  4LNU A;  1QNM A;  1SZT A;  3ZRX A;  2FL4 A;  1S5H C;  1N34 B;  3VOU A;  2Q0A A;  4TWK A;  5EC2 C;  1GM7 A;  4TV8 B;  5J9P C;  1OCZ B;  1N0J A;  3CB2 A;  3OAA G;  5KHK A;  3ABK B;  4O4H B;  3B40 A;  4JTC B;  3ZN0 A;  5LXT B;  4RWU A;  2UXD B;  4GX5 A;  2ZCE A;  1BL8 A;  1GMG A;  1AVM A;  3SPI A;  1LUW A;  1Q7Y W;  1NZ6 A;  5IE9 A;  3JAS B;  4O4L B;  1S5L Z;  2ZNI A;  1Y66 A;  1XDC A;  1SQX H;  4DYL A;  4LWS B;  5LP6 C;  2YXH A;  3CP1 A;  2HEP A;  3E22 B;  3H1L H;  3P3P A;  3ABM C;  4WFA V;  4QPK A;  3DXR A;  4LC1 A;  1VF5 B;  1VF6 A;  4FMT A;  5LHG A;  2V1D A;  3CCM V;  1VQ6 V;  3ZCC A;  3MHS C;  3CHX A;  2OTL V;  1IXB A;  5FL7 G;  4JAS A;  3UM7 A;  1FXK C;  1XUQ A;  1PP9 H;  4PHZ A;  4LF8 O;  4DV0 B;  5C8Y A;  1KKD A;  4J9Y B;  3P32 A;  4B3S O;  2VQF B;  4WBN A;  4JI0 O;  2Q4P A;  3R65 A;  3T1C A;  3I5D A;  5JVD A;  4LFA B;  2UXB O;  2ZR2 A;  4LFB B;  3DSQ A;  4X1I B;  1VQN V;  2ZM6 B;  3AK3 A;  2WSS G;  3LDE A;  4I55 B;  3OR7 C;  3RGB A;  2DOS A;  5JVD B;  3SR2 C;  5DN6 G;  3OM3 B;  4F6E A;  4B3M O;  4DV1 O;  3AG4 C;  2CGN A;  1E1Q G;  1NH2 D;  3E8H A;  3FAV A;  4ZKI A;  1F7Y A;  5C8Y B;  4Z2W A;  3CRC A;  5A2Q N;  3JAK B;  1FXH A;  5CBH A;  1VQM V;  1SQV H;  3IGA C;  4X20 A;  1KBH A;  4R6Z A;  2OT5 A;  4BW9 A;  3RVY A;  3CRQ A;  1H8H G;  1VIB A;  2JGU A;  3DC6 A;  3ZMU A;  1IBM B;  4JZG A;  4PV1 B;  1K3E A;  4W4L A;  2PTM A;  1XNQ B;  3UO3 A;  5CB4 A;  2Z0A A;  3FB7 C;  3F5T A;  1IDS A;  5LOV B;  2F1M A;  4FLY A;  2YXY A;  3I55 V;  3CRR A;  1CEZ A;  3CXC U;  1BS3 A;  4X66 O;  3A8T A;  4E4E A;  1GN2 A;  1K4D C;  1YVW A;  1MMM A;  1Q6I A;  4IHJ A;  4G27 B;  1Y76 A;  5LXT A;  2LP7 A;  2ZNJ A;  4KL1 A;  3IC7 A;  4JF3 A;  1N36 O;  5JJN B;  5LA6 A;  4UB6 Z;  5KUK A;  4X66 B;  4RQF A;  3RYI A;  4ZBM A;  1BGY H;  4WFF A;  4KXR A;  1W2B U;  3S3W A;  1Y6X A;  4U3J A;  1FXK B;  1KD1 W;  2BTQ B;  3BAB A;  5B5E Z;  2EIL C;  1F4N A;  1CPY A;  1TUB B;  4DUY O;  2X0L A;  3JAR A;  2QDO A;  2YXL A;  3STL C;  1OZ0 A;  1OCO C;  4KUM A;  3JAT B;  2P22 C;  2Y4T A;  5BMV A;  2ZR3 A;  1EM1 A;  3FKS G;  4TQF A;  3K9S A;  5GTI Z;  2XAQ A;  1UJW B;  1PD3 A;  1FXV A;  2YS8 A;  3OT7 A;  3FYI B;  1SF9 A;  1PNM A;  4RQE A;  5LP6 B;  1V54 B;  1VQ4 V;  3JAS A;  4DV1 B;  2YID A;  1JQ0 A;  4Q20 A;  1N32 B;  4FLW A;  3T4Z A;  1VQK V;  1JCH A;  5JJJ B;  2Y69 B;  4NXM B;  1HNX B;  4I0X B;  4DR4 O;  5H2F Z;  2M7W A;  2QGN A;  3SPC A;  3D36 A;  3ZIA G;  3HKE A;  1I94 O;  4PD4 F;  1B06 A;  3RFR A;  4H33 A;  2CTP A;  4PI2 A;  2NLJ C;  3CD6 V;  3UT5 A;  1OCZ C;  4DR2 O;  4DV7 O;  3KG2 A;  4OXS A;  3ML0 A;  5EZY A;  1M57 B;  2QM7 A;  4HBN A;  5CBF A;  2F4V O;  2XT9 A;  4CH4 A;  2BE3 A;  4F4L A;  3P3N A;  4JI7 O;  3B09 A;  1ROP A;  4JGS A;  1XEQ A;  2QTS A;  1IUR A;  1NT2 B;  5H6R A;  5IJ0 B;  1GN4 A;  1BSM A;  5CA0 A;  3FB8 C;  4YY3 B;  4DR1 B;  3HKD A;  1XNR B;  3T1H B;  1YIJ V;  4J10 A;  2DQ0 A;  4XDL A;  3AG2 C;  2PI5 A;  2IBZ H;  4GKJ B;  3A2F A;  2LW1 A;  3ZED A;  1YF2 A;  2ZE8 A;  4LCU C;  1IBL B;  1UPG A;  2LGW A;  3VQV A;  2E5L O;  4I9Q A;  4NVP A;  5GON B;  2IH1 C;  4R8C A;  5B1A C;  5CA1 A;  3B77 A;  4ABM A;  4QE7 A;  1R73 A;  2YEV B;  5L3B A;  1MAB G;  4J41 A;  5BZB A;  1NJI W;  1NR7 A;  2LGQ A;  1US6 A;  4I50 B;  4BR6 A;  3K04 A;  4XDJ A;  3ZHQ A;  4I4T A;  4X1K A;  2BSK B;  1WNS A;  4MTX A;  3X2Q C;  3CCV V;  5FPO A;  1GK9 A;  2P06 A;  3K08 A;  2CUG A;  2KB1 A;  5EC1 C;  1N4C A;  5B66 Z;  4DRX B;  5JCO C;  1GN6 A;  2A3Q A;  3ZMT A;  1ZLZ A;  1J95 A;  1K8A W;  4XBF A;  2GTS A;  1QLN A;  4DR7 O;  4YJ3 A;  4JI4 B;  2BTO A;  3ZRW A;  3D3I A;  2VS0 A;  4GX0 A;  3TXS A;  4FZ1 A;  1H38 A;  2GBO A;  3AK1 A;  4JYC A;  4DO2 A;  3KZI Z;  3H1I H;  2V4D A;  3EVK A;  3W7W A;  1SES A;  1ZAU A;  5IYZ A;  3ZX6 A;  1QQC A;  3B4S A;  5EK0 A;  4CS4 A;  3RYC A;  5EYP A;  5LHI A;  3RBZ A;  1PNK A;  1RFY A;  2ATK C;  2UXC O;  4MT8 A;  4JAU A;  1OCR C;  5B1A B;  3GWO A;  3SYC A;  1HNW O;  1MOF A;  2ZXW C;  2QKS A;  2R9A A;  1V54 C;  3OFN G;  1AI6 A;  2ODM A;  3C90 A;  3CJH A;  3EFF K;  2JEU A;  4KFM A;  3C3T A;  4O4I A;  3CC2 V;  1WN7 A;  1GM9 A;  5KAF Z;  4J80 A;  3I56 V;  4J9Z B;  1BT8 A;  2RDC A;  4DR3 B;  2UU9 B;  2E76 B;  1T5E A;  4KHP B;  4FM0 A;  4J7K A;  1Z5W A;  4P30 A;  2V7Q G;  5IYZ B;  1AJN A;  3LSQ A;  4X1Y A;  2LW7 A;  5FPR A;  3QNE A;  2X6A A;  4UV8 A;  4PA7 A;  3TET A;  4JYB A;  3OTO O;  1QBZ A;  3G4S V;  4D7T A;  4JPR A;  3BY6 A;  4NXM O;  4DV4 B;  2PYJ A;  1XMQ O;  4UCT A;  3K58 A;  1N32 O;  3CJH B;  1F4M A;  2OTJ V;  1UFI A;  4AHC A;  1W0J G;  3CCQ V;  2ZIN A;  1LUV A;  3ETE A;  3RYH B;  1NH2 B;  1CXZ B;  2Z5U A;  3W7T A;  4PA4 A;  4DUZ B;  2ZIO A;  1CP9 A;  4YIO A;  1SA0 A;  1XMO O;  3TXQ A;  3A0H Z;  1V55 B;  4QIW F;  2F95 B;  4OGQ B;  4RUE A;  3OUF A;  1KP3 A;  2BOB C;  2WA4 A;  2JGD A;  2ZXW B;  3UCS C;  4FLV A;  4FZ0 A;  2L6L A;  1TAE A;  2GUZ A;  4L87 A;  3P30 A;  4R7C A;  5IWA B;  2YUA A;  5EYP B;  1MNG A;  3H9V A;  3S3X A;  4ZI7 B;  2NNU A;  3SYA A;  4X65 O;  2QKA A;  1K4C C;  3ZJZ A;  5GTH Z;  4JI3 O;  2YC0 A;  3T4D A;  4DV5 O;  1M4U A;  3E8G A;  1D5A A;  2AZ0 A;  1PM9 A;  1ZL8 A;  4FFB B;  5EBL C;  3SJC C;  5B1O A;  1YCI A;  1B04 A;  1AJP A;  4MTF A;  4K8Z A;  1XMO B;  5IT9 N;  4FLT A;  3ABK C;  4W4K A;  3JAM N;  4B7E A;  1H2G A;  1HDJ A;  4DV2 B;  4WFB V;  4I4T B;  1TUB A;  1O9H A;  3O9O A;  3PJS K;  4WFH A;  2EIN B;  2QE7 G;  2W0F C;  2HJD A;  2XAF A;  3SPG A;  3JSN A;  4LH6 A;  3L70 H;  1FJG B;  1G8M A;  4LF9 B;  4TV9 B;  4LF4 O;  2P4K A;  3VQY A;  3Q4H B;  2A06 H;  3OR6 C;  4XDK A;  4EFB A;  4MSW C;  1K73 W;  3THO A;  1URF A;  1BMF G;  2YIB A;  3OUS A;  3IAY A;  3AEI A;  2FTK A;  2ILM A;  3CWB H;  2XAS A;  1QHT A;  1S76 D;  4B3M B;  4UVB A;  3SPJ A;  4JYA O;  2B1I A;  1YEW A;  5E79 Z;  1Z2G A;  4CBC A;  4UB8 Z;  2DW4 A;  4LH7 A;  4I5S A;  4DV5 B;  3OW2 U;  4I55 A;  2OIE A;  4JI3 B;  4FVM A;  2EX3 A;  3D8C A;  3KCY A;  1SQF A;  4LFA O;  3K5O A;  4QJF B;  2ADP A;  1X59 A;  4MVU A;  2XND G;  4B3R B;  4QPJ A;  3FAV B;  5IWA O;  2A79 B;  3LUT B;  4X64 B;  4AQY B;  4O4J B;  4CS2 A;  3HKB B;  3WB0 A;  2VQF O;  2K9P A;  2R9R B;  3CCL V;  2UXC B;  2KQX A;  1NQT A;  4NR1 A;  4R50 A;  3K5M A;  1H2N A;  5JQG A;  4GX1 A;  1EZV H;  3DXR B;  1X4T A;  3E86 A;  1PV0 A;  3FX7 A;  1Y67 A;  3N27 A;  3D36 C;  5IYC O;  1VP7 A;  1I5X A;  2HVK C;  1S5J A;  1VQL V;  4TUY A;  4B3T O;  5FLX N;  4DR7 B;  2WLI A;  4JI6 B;  2CE4 A;  3WU2 Z;  2GSM B;  4LF4 B;  1Q3E A;  1FJG O;  2HP8 A;  1WPB A;  3GB7 C;  3L74 H;  5KA5 A;  2EIL B;  3W7U A;  2WPD G;  4UVC A;  1GKF A;  2L35 A;  3ZMV A;  1WA8 B;  1OCO B;  1G1X B;  5IDJ A;  1KQS U;  2WWW A;  1I08 A;  3ZHV A;  3SJA C;  3J80 N;  3BHP A;  1R3L C;  4U7N A;  5CBG A;  4IGG A;  4KHP O;  1XRE A;  4F6R B;  1QLE C;  1S0V A;  3B8M A;  2FB5 A;  1NVP D;  3LSS A;  4CC6 A;  4H44 B;  1K9M W;  3HKC A;  2WLM A;  3QVN A;  4DK1 A;  4GKJ O;  5CA0 B;  2EIM C;  5D5Q A;  3EHB B;  3NXS A;  2JK5 C;  2ZIM A;  3WG7 B;  4LF6 O;  4AI8 A;  2Q7G A;  1H8E G;  1KEC A;  1WP7 A;  2E3C A;  1Q6U A;  3B8N A;  1L0N H;  5LL6 Y;  1O9G A;  1R6T A;  1RSO B;  4P9O A;  4BWA A;  2CH7 A;  2LJ2 A;  4JI5 O;  3HB3 B;  3J81 N;  2YIC A;  2QWQ B;  1TA8 A;  1JVM A;  2P4V A;  2AHY A;  1N8R W;  2IJK A;  5CA1 B;  2WLL B;  1NR1 A;  4DR2 B;  5EIB D;  2UXX A;  2O57 A;  1SC5 B;  1GO3 F;  1XL4 A;  2CDY A;  1MSD A;  5K1X A;  4LF5 B;  2B5U A;  3SGI A;  4GCZ A;  4EEQ A;  4MVM A;  2B1G A;  2G38 A;  4H37 A;  5EIB C;  5IYB O;  2P5O A;  3OMN B;  1M93 A;  4DR4 B;  1Y76 B;  5L3D A;  4GT1 A;  4DV2 O;  2Q68 A;  4JI8 O;  2DN9 A;  1HW7 A;  2AW9 A;  4NB5 A;  5KMG A;  3U10 A;  1B3Q A;  4YJ2 B;  2VWJ A;  1JMK C;  1FS0 G;  4B08 A;  2ITC C;  1Q90 D;  3H1J H;  3G71 V;  1NTZ H;  2QR4 A;  2DWD C;  4FPP A;  2KKW A;  2QWR B;  4YIP A;  4FK5 C;  1SKV A;  3L75 H;  2Q7H A;  5BY1 A;  3UO2 A;  4LFC O;  4YJ2 A;  3APQ A;  4ZIB A;  4D6T H;  1YJW V;  2GV9 A;  1JOY A;  1Z5V A;  2PZS A;  3BVO A;  5LGT A;  2GTA A;  2Q5Z A;  1JJO A;  3B2E E;  1VF7 A;  1SQG A;  2JEX A;  3K06 A;  3CME V;  1K5S A;  5KUM A;  4FM2 A;  1HP8 A;  1ZUQ A;  5LMN O;  4I9W A;  2IM9 A;  4FLX A;  2MW2 B;  1WP8 A;  4HZ3 A;  1N36 B;  4Q6G A;  4JTD B;  1QR9 A;  1SQP H;  3H1K H;  3JAR B;  2EZP A;  5HFL A;  2EIJ B;  5IJ9 A;  1FKA O;  3JSL A;  4PA9 A;  3ZN1 A;  1EN5 A;  4AQY O;  3JD1 A;  4X64 O;  5KA6 A;  4WBN B;  3TJT A;  2E75 B;  4DW1 A;  4LNU B;  5KAI Z;  1ZX3 A;  1M56 B;  3SJB C;  1MSW D;  1NS1 A;  1BE3 H;  1KYO F;  1VAR A;  2ZD9 A;  4JI4 O;  2B9Z A;  5LBQ A;  5J2U A;  3OMI B;  3SPH A;  3ETD A;  3Q4H A;  1VQ7 V;  4MVZ A;  1HNX O;  1KP2 A;  3AG2 B;  3K9A A;  3LSU A;  1HWY A;  5GW7 A;  4AIL C;  3PN1 A;  4TSF G;  4DV6 B;  3FB5 C;  3K0G A;  1R3K C;  2DYS C;  2HHH B;  4Z1V A;  3M7M X;  4K35 A;  2VWK A;  2JIZ G;  4A5U B;  2XOK G;  5H6Q A;  4PDL A;  4JI6 O;  5EZY B;  4IIJ B;  3LDC A;  2CK3 G;  4BIU A;  4FLZ A;  4LR3 A;  3K5L A;  1IX9 A;  3ZHU A;  5CA3 A;  1ZWI C;  2RMK B;  4JAV A;  3WB1 A;  1IBK O;  1ARO P;  2A0L A;  2DQ3 A;  1F51 A;  4DUY B;  1K92 A;  2RNB A;  4ZOL B;  1SRY A;  2HLD G;  5DEC A;  4TV8 A;  4FFK A;  3UQ8 A;  3OTF A;  2P67 A;  1OCC B;  1OCC C;  3ASO C;  4ZI7 A;  2R72 A;  2H94 A;  4LF6 B;  5BXZ A;  1M57 C;  4IYH A;  2P90 A;  1G4Y B;  3CRA A;  3AG3 B;  3WB2 A;  4CS3 A;  4QGP A;  3K57 A;  2BCC H;  2ZDI C;  3OEE G;  4IIJ A;  1YSC A;  3CCS V;  4LF7 O;  2GHY A;  2AZ2 A;  3D3Q A;  1AR4 A;  2Y0I A;  4P2Z A;  3E22 A;  4DV3 O;  1K7D A;  2PYL A;  1M9N A;  3N2G B;  2ADQ B;  1FPO A;  1VF6 C;  1JA8 A;  2RN9 A;  2Q67 A;  3HPL C;  4GKK O;  3M99 B;  5FNV A;  4WF9 V;  2OCC C;  2OCC B;  3C3S A;  1IBM O;  2X6C A;  1AI5 A;  4K3A A;  2IW5 A;  1YI2 V;  3HR0 A;  1N33 O;  2A7W A;  3LNM B;  3FB6 C;  4MVQ A;  3N2K B;  2Q8V A;  1HR0 B;  1S77 D;  2QSA A;  2PGG A;  3CCJ V;  2Q69 A;  1LR1 A;  4X88 A;  1OCR B;  1EN6 A;  2QKC A;  1N0N A;  2R70 A;  1K97 A;  3J7A U;  1SQB H;  2XUM A;  2K1E A;  1BCC H;  3IC9 A;  2EBO A;  1AR1 B;  3A0B Z;  3T1Y B;  4ZOL A;  3JCZ A;  3BA9 A;  1M5I A;  1NTK H;  2KG7 B;  2Y69 C;  3RYH A;  3O65 A;  2YSU B;  5B1B B;  2LFS A;  3K79 A;  1GAX A;  4GKK B;  4UUJ C;  1QVG U;  3CS5 A;  3L71 H;  1VQO V;  1XHZ A;  2RCV A;  4O4J A;  2D2C B;  5LGU A;  3L72 H;  5KX5 B;  4MW3 A;  1E1R G;  4F6R A;  2QJ1 A;  5L3F A;  2ZE5 A;  2EIK C;  4DR3 O;  4B3S B;  2VQE B;  3H1H H;  1AI4 A;  4LF8 B;  3X2Q B;  2Q6A A;  4G28 B;  3ABL C;  5A9G A;  4IT5 A;  2IJJ A;  3ZMZ A;  1PNL A;  2HFE C;  1NBM G;  1YZB A;  3TGU H;  4DV7 B;  2E74 B;  4FLU A;  4E2L A;  1Q43 A;  2XHB A;  4LP8 A;  3G67 A;  3OEH G;  1KMI Z;  4OX9 B;  1U97 A;  2WLI B;  2AXT Z;  1P4R A;  4J42 A;  3GVM A;  4DUZ O;  2ETN A;  4X62 O;  4NXN B;  4O2B B;  2Q0O C;  4UVA A;  1YHQ V;  2YI9 A;  1QU7 A;  3JAW B;  3TK1 A;  2CH7 B;  1FFT B;  2CTQ A;  4DXW A;  4X9Q A;  2ZE7 A;  3L73 H;  1XNQ O;  1K34 A;  3MDS A;  2YDE A;  2W6I G;  1ZSP A;  2EJR A;  4PEL A;  5HFM A;  2H8P C;  4LFC B;  2RQ6 A;  1RP3 B;  1IVS A;  1WLE A;  3ASN C;  3RWR D;  1KU9 A;  2HKO A;  5L3C A;  1JR9 A;  3JD3 A;  1MZE A;  1QR8 A;  2X6B A;  4B3T B;  4BW5 A;  4HNA A;  3AG4 B;  3AG3 C;  2PUS A;  2ITD C;  3HKB A;  5IYD O;  1TVK B;  4WCE V;  3VBB A;  1SA0 B;  5IY5 C;  3RYF A;  4O4H A;  4DV6 O;  4NTX A;  3E89 A;  3VQW A;  1Y4M A;  4DV3 B;  2FYU H;  2IH3 C;  3KCX A;  2BTQ A;  5H5N A;  1FXK A;  3OD4 A;  2UU9 O;  3EXA A;  5JQG B;  3HKC B;  3AK2 A;  4UCS A;  1W0K G;  4LWS A;  2JJ2 G;  3JD2 A;  4DR6 O;  4LF7 B;  3ABU A;  1VQP V;  3F7V C;  2WLJ A;  3CCU V;  1G6U A;  4RUF A;  2WLN A;  2QWP B;  2QM4 A;  1XOU A;  4CH5 A;  2Z3Y A;  2OYQ A;  3CX5 F;  2VRZ A;  2C2A A;  3BAA A;  3SJQ C;  1JFF A;  3APO A;  2FKX A;  3WG7 C;  1SET A;  4GX2 A;  1P49 A;  4DV0 O;  4JAA A;  2RJZ A;  4JI5 B;  1FFX B;  2WLH A;  4NYK A;  3E2E A;  3BRC A;  4HAM A;  3ABT A;  1EBO A;  2EJ7 A;  3RW0 A;  1Y74 B;  1Q6H A;  1WA8 A;  1I0H A;  4D7S A;  4J7J A;  1D2D A;  1IZ3 A;  2ZKO A;  5EBM C;  3F5W C;  4JYA B;  4GZR B;  1WJZ A;  3K0D A; 
#chains in the Genus database with same CATH homology
 1JVM A;  2DYS B;  4LCU C;  2EIM B;  1K33 A;  2AHY A;  2ZQM A;  3E8F A;  3E83 A;  4YXW G;  1EFR G;  1LNQ A;  1N8R W;  2IJK A;  2WLL B;  1NR1 A;  4QNH B;  3LDD A;  2WLK A;  2UXX A;  4MVO A;  3SYP A;  1R6K A;  2HG5 C;  2IH1 C;  3QO7 A;  1KC8 W;  1GO3 F;  4R8C A;  2IJI A;  5E1A C;  1XL4 A;  5B1A C;  5LHH A;  3B77 A;  4QE7 A;  2B5U A;  1R73 A;  2YEV B;  5L3B A;  3QO8 A;  4GCZ A;  1MAB G;  5BZB A;  2XAH A;  1NJI W;  4MVM A;  1VQ9 V;  1NR7 A;  2B1G A;  1R3J C;  4H37 A;  4CZZ A;  5IYB O;  3K04 A;  4XDJ A;  3OMN B;  4JTA B;  4EKW A;  2JJ1 G;  1YJN V;  5L3D A;  2F43 G;  3RVZ A;  3SYQ A;  4GT1 A;  4MTX A;  3CCV V;  3X2Q C;  1JJ2 U;  2Q68 A;  1RPR A;  4MTO A;  1GK9 A;  1RM1 C;  1MG1 A;  1V55 C;  2DYR C;  3K08 A;  2KB1 A;  5EC1 C;  4QE9 A;  3CPW U;  4MTG A;  3ZMT A;  1M90 W;  3CCE V;  1J95 A;  1K8A W;  3ASO B;  4XBF A;  1Q82 W;  1QLN A;  1FS0 G;  3F7Y C;  2HVJ C;  2HR3 A;  2ITC C;  4X8A A;  1L1F A;  3G71 V;  1JPX A;  2DWD C;  4FPP A;  3JD4 A;  1BHA A;  4FK5 C;  3K3W A;  4UXN A;  3MD0 A;  3D3I A;  4GX0 A;  3ZRW A;  4BIZ A;  1B6Q A;  1EZJ A;  1H38 A;  4JYC A;  1YJW V;  1JOY A;  4DO2 A;  2EIK B;  1R3I C;  2WLL A;  3STZ C;  1SES A;  3W7W A;  5LGT A;  4FIP C;  5EK0 A;  1ORQ C;  4G2K A;  3QO5 A;  5LHI A;  3K06 A;  2JEX A;  1PNK A;  3RBZ A;  5B3S C;  3CME V;  1Q81 W;  2ATK C;  2QA4 V;  2EZO A;  1K5S A;  4MT8 A;  4P9P A;  5KUM A;  4JAU A;  1OCR C;  5B1A B;  3GWO A;  4FJC C;  4I9W A;  1QLE B;  3SYC A;  4HZ3 A;  1MOF A;  2ZXW C;  2QKS A;  1V54 C;  3OFN G;  1AI6 A;  1JX9 A;  3AG1 B;  4JTD B;  1QR9 A;  3EFF K;  2EZP A;  4LBE C;  5HFL A;  2JEU A;  2EIJ B;  1YTF D;  4KFM A;  1PKX A;  3CMA V;  4RAI A;  4PA9 A;  3CC2 V;  3ZN1 A;  3JD1 A;  1GM9 A;  1SZT A;  3ZRX A;  1WPX A;  5C93 A;  3I56 V;  5KA6 A;  4J9Z B;  1S5H C;  2DYR B;  2XAG A;  2UXN A;  3VOU A;  1M56 B;  1MSW D;  4TWK A;  2EIN C;  5EC2 C;  2ZD9 A;  4P30 A;  5LBQ A;  2V7Q G;  3W7S A;  1GM7 A;  3CC7 V;  5L3E A;  1AJN A;  2X7R B;  5J9P C;  3OMI B;  3SPH A;  3LSQ A;  1OCZ B;  3QNE A;  3ETD A;  1VQ7 V;  3A0R A;  2X6A A;  4MVZ A;  4U7O A;  1KP2 A;  3AG2 B;  3K9A A;  3OAA G;  4RO2 A;  4UV8 A;  3WFV A;  1DLB A;  1RM1 B;  4PA7 A;  3TET A;  1HWY A;  5GW7 A;  4TSF G;  4JYB A;  3ABK B;  1QBZ A;  3G4S V;  1PL0 A;  3FB5 C;  4KP4 A;  3K0G A;  1R3K C;  1Q86 W;  2DYS C;  4JTC B;  3ZN0 A;  4JPR A;  3BY6 A;  4Z1M G;  3JYC A;  4GX5 A;  2JIZ G;  1R6N A;  2XOK G;  1BL8 A;  1GMG A;  3SPI A;  5H6Q A;  1F4M A;  1Q7Y W;  4PDL A;  2OTJ V;  1Y66 A;  3DGE A;  3UKM A;  2XAJ A;  1W0J G;  2CK3 G;  3LDC A;  5CMU A;  1F23 A;  3CCQ V;  3JD0 A;  4BIU A;  3CP1 A;  3OE7 G;  2P6J A;  3ETE A;  2PI4 A;  4PDR A;  1NH2 B;  3H01 A;  3ABM B;  3ABM C;  2Z5U A;  4WFA V;  5CA3 A;  1ZWI C;  4QPK A;  3W7T A;  4PA4 A;  4JAV A;  4LC1 A;  4FMT A;  1ARO P;  2A0L A;  2DQ3 A;  1F51 A;  1K92 A;  5LHG A;  2V1D A;  3CCM V;  1VQ6 V;  1SRY A;  2HLD G;  3ZCC A;  1CP9 A;  3FYE B;  1DF5 A;  5B3S B;  3MHS C;  1V55 B;  3IFX A;  4QIW F;  4BAY A;  5B1N A;  2P67 A;  1OCC B;  1COW G;  1OCC C;  2OTL V;  4RUE A;  3ASO C;  4TT3 G;  3OUF A;  1KP3 A;  2BOB C;  2H94 A;  2ZXW B;  3ZRW B;  3ASN B;  1S72 V;  1GTO A;  1K5Q A;  5FL7 G;  4JAS A;  1M57 C;  1FXK C;  4L87 A;  3UM7 A;  2P90 A;  3P30 A;  1G4Y B;  4R7C A;  3AG3 B;  1KKD A;  1BHB A;  4J9Y B;  3P32 A;  4MVR A;  2NNU A;  2ZDI C;  3OEE G;  3SYA A;  5IY5 B;  3R65 A;  1S3J A;  1YSC A;  3T1C A;  3CCS V;  4PDM A;  1QVF U;  1K4C C;  2GHY A;  3ZJZ A;  3T4D A;  3OMA B;  2MK3 A;  5L3G A;  3T2M A;  3E8G A;  4WFG A;  2ZR2 A;  1P7B A;  4P2Z A;  5EBL C;  5B1O A;  1VQN V;  1K7D A;  1M9N A;  2WSS G;  3LDE A;  1AJP A;  4MTF A;  1VQ5 V;  3K03 A;  1SER A;  2Q67 A;  3HPL C;  3OR7 C;  3ABK C;  3M99 B;  5DN6 G;  3OGC C;  1H2G A;  3OM3 B;  4WF9 V;  4WFB V;  2LFR A;  2OCC C;  1AI7 A;  2OCC B;  3AG4 C;  2X6C A;  1AI5 A;  1E1Q G;  3G6E V;  2D3O W;  1NH2 D;  3E8H A;  2IW5 A;  2R9I A;  1YI2 V;  3PJS K;  4WFH A;  4ZKI A;  2EIN B;  3LNM B;  2QE7 G;  3FB6 C;  2BOC C;  2W0F C;  4MVQ A;  1IXM A;  2XAF A;  3SPG A;  1FXH A;  5CBH A;  1VQM V;  1G8M A;  3SYO A;  1S77 D;  2DWE C;  3IGA C;  1M56 C;  3CCJ V;  2Q69 A;  4R6Z A;  3OR6 C;  4X88 A;  2OT5 A;  1OCR B;  2HJF C;  3RVY A;  4XDK A;  2QM8 A;  1H8H G;  1K97 A;  4MSW C;  1K73 W;  3ZMU A;  4HYO A;  5EBW C;  1K3E A;  2K1E A;  1BMF G;  3OUS A;  2EBO A;  4PA6 A;  2EIJ C;  3AEI A;  2FTK A;  1AR1 B;  2XAS A;  3FB7 C;  1S76 D;  3JCZ A;  2A9H A;  2Y69 C;  4UVB A;  3SPJ A;  2YSU B;  4PA3 A;  5B1B B;  3I55 V;  2LFS A;  2B1I A;  1CEZ A;  3K79 A;  3CXC U;  4CBC A;  4UUJ C;  2DW4 A;  1QVG U;  4I5S A;  1VQO V;  3ZMS A;  2P7T C;  1K4D C;  1AJQ A;  3OW2 U;  5LGU A;  3ZRS A;  4MW3 A;  1E1R G;  3DTU B;  3E35 A;  5L3F A;  4G27 B;  4QJF B;  2EIK C;  4MVU A;  2XND G;  4N21 A;  2LP7 A;  2IJH A;  4QPJ A;  3IC7 A;  4UV9 A;  1AI4 A;  2A79 B;  3LUT B;  2QEX V;  1DTO A;  3X2Q B;  2Q6A A;  4G28 B;  4JF3 A;  3ABL C;  1E79 G;  2IJJ A;  3ZMZ A;  1PNL A;  2HFE C;  1NBM G;  5DM6 V;  5KUK A;  2R9R B;  4RQF A;  3TCU A;  4ZBM A;  3CCL V;  1YJ9 V;  1OHH G;  4WFF A;  3K0D A;  1W2B U;  1NQT A;  4E2L A;  4R50 A;  1FXK B;  1KD1 W;  4LP8 A;  3OEH G;  2EIL C;  1M1K W;  1F4N A;  1CPY A;  2Y48 A;  4GX1 A;  1YTF B;  2WLI B;  1P4R A;  1QCE A;  2X0L A;  3E8B A;  3E86 A;  4UVA A;  1YHQ V;  3STL C;  3TK1 A;  1FFT B;  4DXW A;  2W6J G;  1OZ0 A;  1OCO C;  2YEV A;  5IYC O;  1I5X A;  1K34 A;  4KUM A;  1NKD A;  2HVK C;  4PDV A;  3CC4 V;  2W6I G;  1VQL V;  3BEH A;  2AHZ A;  2EJR A;  4PEL A;  4ASU G;  4MS2 A;  1YIT V;  2ZR3 A;  2H8P C;  3FKS G;  5HFM A;  1DF4 A;  2WLI A;  2XAQ A;  1UJW B;  1PD3 A;  1WLE A;  1FXV A;  3ASN C;  4N23 A;  3FYI B;  2GSM B;  2HKO A;  1PNM A;  5L3C A;  3ETG A;  1GM8 A;  4RQE A;  2WAM A;  1V54 B;  1VQ4 V;  3JD3 A;  1QR8 A;  2X6B A;  3GB7 C;  1JQ0 A;  4Q20 A;  4BW5 A;  3T4Z A;  5CN0 A;  1VQK V;  1JCH A;  5KA5 A;  3AG4 B;  2EIL B;  3ZRV A;  2WPD G;  3AG3 C;  1XL6 A;  2ITD C;  2Y69 B;  3W7U A;  4UVC A;  1TUE B;  5IYD O;  1GKF A;  4WCE V;  3ZMV A;  2ZDI A;  3VBB A;  2M7W A;  5IY5 C;  1OCO B;  3SPC A;  4WFE A;  3E89 A;  3D36 A;  3ZIA G;  5IDJ A;  1KQS U;  2WWW A;  1Y4M A;  3MHH C;  4H33 A;  2IH3 C;  3W7X A;  1R3L C;  4U7N A;  2NLJ C;  3CD6 V;  5CBG A;  1FXK A;  2IU3 A;  1QLE C;  1S0V A;  3B8M A;  4MW8 A;  1OCZ C;  1NVP D;  3CYO A;  3LSS A;  1W0K G;  1NVP B;  3KG2 A;  2JJ2 G;  3ML0 A;  4OXS A;  3JD2 A;  1K9M W;  1I5Y A;  3ABU A;  1VQP V;  3F7V C;  2WLJ A;  1M57 B;  2QM7 A;  3CCU V;  5CBF A;  2WLM A;  4RUF A;  4F4L A;  2WLN A;  3AG1 C;  1ROP A;  4JGS A;  2Z3Y A;  2EIM C;  3ABL B;  2C2A A;  3SJQ C;  5H6R A;  1VQ8 V;  3CCR V;  3EHB B;  3WG7 C;  1RPO A;  1SET A;  3FB8 C;  4GX2 A;  4MVS A;  3NXS A;  5B1B C;  2JK5 C;  3WG7 B;  1H8E G;  1KEC A;  2WLH A;  3E2E A;  3B8N A;  1YIJ V;  4HAM A;  3ABT A;  1EBO A;  3RW0 A;  1ENV A;  2DQ0 A;  2IU0 A;  2JDI G;  4XDL A;  4P9O A;  3AG2 C;  5EBM C;  2QTO A;  2PI5 A;  3F5W C;  4X89 A;  5LGN A;  3HB3 B;  1THZ A;  5H9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...