3H01A

Structure of the c-terminal domain of a putative hiv-1 gp41 fusion intermediate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
54
structure length
54
Chain Sequence
EWDREINNYTSLIHSLIEESQNQQEKLEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Role of a putative gp41 dimerization domain in human immunodeficiency virus type 1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
molecule tags Viral protein
total genus 24
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3h01A00
3K9AA 1I5XA 1JPXA 4N21A 3B77A 5HFLA 1SZTA 2M7WA 1DF5A 5CN0A 1MG1A 5KA6A 4FK5C 4G2KA 1QBZA 1Y4MA 3MHSC 3P30A 4JPRA 1DLBA 1ENVA 2EBOA 2MK3A 3B8NA 5HFMA 1JQ0A 3MHHC 1QR8A 1EBOA 1K33A 4E2LA 2P6JA 1I5YA 5H9CA 4FJCC 1F23A 4FIPC 3M99B 1K34A 2LP7A 3CP1A 2EZPA 2OT5A 4JGSA 3B8MA 1MOFA 3CYOA 2EZOA 3WFVA 4N23A 1Y66A 1QR9A 2X7RB 3GWOA 5CMUA 1DF4A 3H01A 4JF3A 1QCEA 5KA5A
chains in the Genus database with same CATH superfamily
1BQ0A 1KC8W 3BAAA 4OX9B 1R1BA 2CUGA 1M9NA 1XILA 3CWBH 1YCIA 1SRYA 4R7CA 3ASOB 1KB9F 4UXNA 2AZ0A 2P6JA 3E83A 4DW0A 1WA8B 1Y76A 4JI8B 4LFAB 1OCOC 5B1BC 1DF4A 5KMGB 4K0KB 5B1AB 3ZIAG 1FFXA 2JS3A 3DXRB 4FZ0A 4JI0O 1OCCB 3VBBA 4PDLA 4FK5C 4BIZA 5L3CA 1VF7A 1URFA 3GB7C 3E8GA 3CXHF 2V7QG 3RYCB 1VQLV 5KX5B 4DV2B 4RAIA 1JA8A 1JCHA 4D6TH 4TQDA 1VQ6V 1PV0A 1N34O 4QGPA 3AG4C 5GTIZ 4JYAO 1J95A 2QKAA 5BZBA 1MSWD 1VIBA 4MTXA 2EBOA 1JFFB 5EC1C 1HNXO 3RVZA 3JCZA 5EYPB 1R6KA 3ZHQA 4LR3A 4BR6A 2FYUH 4DK1A 1DGSA 3JD2A 4YY3O 3ZX6A 1Q82W 4O2AA 3N2GA 4O4IA 1SETA 2BCCH 3AG7A 2ETNA 5BR8O 2W6IG 4H44B 3JYCA 2EIKB 4DXWA 3T4DA 3RYIA 4O4JA 1BCCH 5CBHA 1F51A 4AQYO 3IC9A 2ZKOA 3ZMUA 2ZDIA 5E1AC 1R73A 2QSAA 3DC5A 2YDEA 1HNXB 1BSMA 3FB7C 1AR5A 1D5AA 2M7WA 3F5WC 4JYBA 4DK0A 1H2LA 4J7JA 1N4CA 5KHIA 1K33A 2JGDB 1Q43A 3ZHUA 3OT7A 2B1GA 5BY1A 1XNQO 3W7TA 4AQYB 4J9ZB 3JAKA 3W7XA 3OTOB 1N33O 2YSUB 5LOVB 2JK5C 3K3WA 2XNDG 3W7SA 2YEVA 1LUWA 4B3TB 4PELA 1GN3A 4GT1A 1KQSU 2WA3A 4DR6B 2ODMA 4YJ3B 1RPOA 4O4LB 5HFLA 4DO2A 1QLEC 3IGAC 2W0XA 1Y67A 1K7DA 3OEEG 1NH2B 4G2KA 1W0JG 3IAYA 1R3LC 4B3SB 4X88A 4GYCB 4J11A 3K9SA 1WNSA 2GHYA 3UCSC 4OXSA 4JTDB 4X66O 1U97A 3BCCH 4FLTA 4KP4A 2Q0OC 2ZT9B 1UPGA 4FLWA 4FLUA 1XMOO 1DTOA 3MAQA 4JI6B 2GBOA 1WPXA 3ZHTA 3I55V 3I5DA 2V1DA 1SQVH 5FL7G 1NTZH 2B1IA 3O65A 4X64O 1EFRG 2F95B 3LNNA 1FFTB 1R3JC 2EJ7A 1GO3F 5IYBO 5ITZA 4UVCA 1UJWB 2HHHO 3SPGA 4GZRB 3TXQA 1IX9A 4DR5O 4KL1A 3ZRVA 4WFAV 4XBFA 1P7BA 5B1AC 2Q9LA 3SGIA 1S5LZ 3T4ZA 4MTFA 1UFIA 2LJ2A 3CCMV 2GUZA 4X64B 1VQPV 3H9VA 3S3WA 4NKGB 3F7YC 1WB7A 4FVMA 2IJKA 5KHKA 2HFEC 3EXAA 3OMNB 1H8EG 4L8JA 2YXHA 2XAGA 2UUCO 1GN2A 3OMAB 3VQYA 2JRIA 5LP6A 1AB3A 4PI2A 2LFRA 4QE9A 4RUEA 5EBWC 3E35A 1TA8A 2LGQA 4FM2A 4TV9A 1BGYH 3AEIA 1I7FA 4MS2A 1TUBA 1RPRA 5JVDA 4LCUC 1N0JA 3P30A 3STZC 1ZWIC 4JAUA 3FB6C 1NVPD 4DR7B 3J80N 3G67A 2DWDC 3K04A 3T1YO 2JGUA 3D8CA 2UUCB 1NI8A 1S5HC 1Q81W 2CTQA 2EIKC 1BQZA 4H37A 1XNRO 1QVGU 3B09A 2PYLA 4QNHB 4U3JA 1XL4A 1GH6A 3OR7C 2P4VA 3ABKB 4GKJB 3CJHA 3RW0A 2HEPA 1YITV 4X8AA 1FYJA 1K3EA 2EZPA 2X0LA 4TQFA 4NXNB 4GX5A 2DE0X 2Q8VA 2A06H 1R3IC 5KLVH 1QU7A 1H38A 1R6TA 1NTKH 1AR1B 4B3RO 1AP5A 3QNEA 4NVPA 2YXLA 3JD0A 1F4NA 3LNMB 3FAVB 5TISZ 2D2CB 5DM6V 4LP8A 4O2AB 4WFBV 3OUFA 3QF7A 2DOSA 3K5NA 5EBLC 2Q7EA 3SYCA 2YS8A 4JV5B 3RYFA 3RYIB 1IURA 2RJZA 4O4JB 4PHZA 1QVFU 2CTPA 1IBKB 1S77D 3APOA 1K5SA 1L0LH 2DQ3A 2IBZH 1BL8A 2LP7A 1NR1A 5IYCO 1L8DA 3ZHRA 4CS3A 3FB5C 3THOA 1AI6A 1SQXH 2UU9B 5JH7A 2XASA 5B1BB 3UKMA 1V9PA 5GTHZ 2VWKA 1F23A 1U96A 2F4VO 4ZI7B 3JAKB 1MOFA 3RGBA 2UXCO 2AW9A 1I08A 2HP8A 2IJHA 3ABLC 2YEVB 2YI9A 4JI3B 3UT5A 1IXBA 3E22B 1K5QA 3LUTB 3C3SA 4J7ZA 2P06A 1VP7A 2ATKC 3FFQA 2IU3A 4JI5O 4DR1O 2E3CA 3L72H 1RFYA 2KQXA 1VQ8V 1MMMA 5EK0A 3OUSA 2OIEA 2HLDG 2RN9A 2QKSA 5IY5B 2P7TC 4DV1O 1KP3A 4A5UB 2WWWA 1DLBA 4YJ2A 2NLJC 3B8NA 4IT5A 4U7NA 4JAVA 3CEIA 5L3GA 1BHBA 1Y66A 4H13B 1FS0G 1Q5OA 3KCYA 2XT9A 4GX0A 3OAAG 1LUVA 4MSWC 5LXTA 4WBNA 4JI5B 4DV0O 4JI2O 4LNUA 4X1YA 2EILB 4P9PA 4K8XA 4NTWA 1ENVA 2VQFO 2E74B 4DR2B 3WG7B 1G8MA 1E1QG 4FZ1A 2VQEO 3E86A 4UFZA 5CB4A 1E1RG 1WPBA 3WFVA 2WLLA 5ITZB 4HAMA 1K92A 4EKWA 3K9AA 1MZFA 3ZS8C 2UXDO 4EFEA 1MG1A 1IBLO 4KHPO 4IHJB 2UXBB 3P32A 2NN4A 1HR0O 2PI5A 3SPCA 3D3IA 3Q4HA 4CH5A 4DYLA 2WLMA 4P30A 3CCSV 2DYRB 2R72A 4X89A 3TGUH 2GUZB 3B8MA 3BY6A 4LWSA 1ZL8B 5IJ9B 3H1LH 2ZCEA 4F6RB 1I5XA 3ABKC 4MVQA 3CSXA 5LP6B 3CRQA 3CC2V 2K9PA 3E89A 1AI5A 2HVJC 2UXDB 4UB6Z 2UUAO 3ZHSA 1LNQA 3W7WA 4JZ2A 4JI1B 1TVKA 1YJWV 4TV9B 4OX9O 1KUQA 4MW3A 1TUBB 1Q6UA 4K35A 1O9GA 1S0VA 3OFNG 2C2AA 3ZRXA 3SR2C 4B7EA 1GRJA 3OM3B 3TK1A 4JYCA 4JI8O 3A2FA 2Q69A 4LFAO 4ZOLA 1QLNA 1R6NA 4K0KO 3AK2A 4PJ0Z 3CCJV 1MNGA 2JJ2G 3A8TA 2OCHA 4ZHQA 1GN4A 3QG5A 4UCUA 2QGNA 4U3JB 5H6RA 1JPXA 4TUYA 5JJNB 2ZDIC 5KHJA 3EVKA 3CCQV 3U0ZA 3CJHB 3SJAC 1XQ8A 3KZIZ 4J10A 4RQEA 2XAFA 4FLXA 4GX2A 4TOIA 4E2LA 5IYDO 3K5OA 2X6CA 4DV2O 2WA4A 4X1IA 2W0FC 4B3MB 2OTJV 2ARHA 2ZINA 1ZLZA 1VQOV 5EIBC 3SPJA 3JAWB 4GCZA 2ZNJA 2HG5C 3VQXA 2EIMC 3SPIA 4P9OA 2R9IA 4O4HA 4LC1A 1HNWB 2JJ1G 1PL0A 2MK3A 1EBOA 1G4YB 2RCVA 4U7OA 5A9GA 4WFHA 5FNVB 5IYZB 2OTLV 3W7UA 2Q67A 5CMUA 5B1NA 3RYFB 4DUYB 3SDLA 1NS1A 2UUBB 1M93A 1EM1A 3BHPA 3AK1A 1F4MA 4HNAB 2CTRA 3CCVV 4PA7A 4DR4B 3K0DA 3FYEB 2ZR2A 5IY5C 1SQPH 1YDXA 4Q6GA 1CP9A 1VQ5V 2PY5A 2QWQB 1HWYA 3ETGA 5H5NA 1PKXA 5JH7B 2F93B 5J9PC 1Q86W 1GN6A 2AZ2A 2YXYA 4EFBA 1L0NH 4X20A 2HR3A 1JJ2U 2DYSB 5D5QA 5DEDA 3JSLA 1FPOA 2YUAA 4AI8A 3P3PA 3X2QC 4ZKIA 3OTOO 1FKAO 3AG1B 2EILC 2BOCC 2YI8A 4MTOA 4DW1A 2ZR3A 3WG7C 4B3TO 3SYQA 2Q73A 3NXSA 4MVOA 2WLJA 2LW7A 4LF7O 3IJ4A 2QWPB 2P4KA 5E79Z 5HFMA 1NBMG 4DR6O 2AHYA 4WFEA 3CHXA 4R50A 3JALA 1BE3H 2HJFC 2QR4A 5LYJB 1TGOA 4FLVA 1YTFB 4B3SO 3D3QA 1BT8A 4YJ2B 1SA0B 1NU1H 1AI7A 1ORQC 2DYRC 4WCEV 4D7SA 5IT9N 2ITCC 1YSCA 1V54B 2RNBA 4O2BB 3CB2A 4U3FH 4LF7B 2GTSA 4JI6O 2WAMA 5LP6C 2O57A 1S76D 1I94O 2KG7A 3QO5A 2Q7GA 4X1YB 5CA3A 1FJGB 3L70H 4NXMB 3BEHA 1SQBH 2E5LB 2A9HA 4JZGA 5KAFZ 2CH7A 4LFCO 5A2QN 1K97A 5KHHA 5L3BA 1NQTA 1IBMO 1MABG 1FXKA 5DN6G 5BXZA 4J42A 1QCEA 3CCUV 3CPWU 4PA9A 2QM8A 5L3FA 4DRXA 1HDJA 2PTMA 1I94B 4IGGA 2P67A 1QR8A 3ABLB 3ZEDA 1KKDA 2XUMA 3WB0A 2ILMA 5D5PA 4PDRA 2WLNA 4LFCB 1ZUQA 1BZKA 1YXBA 1P7GA 2BTOA 1DF5A 4UV8A 1IBMB 3BA8A 1OV9A 3GWKC 2VRZA 2K1EA 3DGEA 4ZIBA 4W4LA 1F7YA 1TVKB 3N27A 3AG3B 2IH3C 3OTFA 4JASA 2Y48A 4UB8Z 2KB1A 3ABTA 1K8AW 4TV8A 1N8RW 2OYQA 3OW2U 3H01A 5KUMA 4EB6B 4WFGA 3T1HB 1OJHA 1AROP 3QO8A 4DR7O 3JARA 5LHHA 5J2TA 1PPJH 4ZOLB 5IJ0B 5FPOA 4CH4A 4DV4O 1NVPB 1ZAUA 1HP8A 4ZHQB 2YICA 3CC4V 4F4LA 4TUYB 3BABA 4GKJO 3E8HA 3ZRWA 3JATA 3DSQA 2Q68A 2V4DA 3M8AA 2Y69C 1Q90D 4NXNO 1JQ0A 3OE7G 1Y76B 4X1IB 3SPHA 3QTCA 2Y0PA 4N23A 2Y0IA 5KUKA 1FFXB 5H6QA 2LGWA 1Y74A 4DV4B 3DTUB 2DYSC 1FAFA 1XMQB 3ETQA 2N04A 4MT8A 3U11A 4JPRA 1B06A 1CPYA 3AG1C 3RBZA 2FMLA 4QPJA 4FFBA 1KD1W 1AP6A 4JV5O 4UCRA 1AI4A 2LQTA 3S3XA 2QTSA 3H1HH 4N21A 2EJRA 1IBKO 2H8PC 1M4UA 1NR7A 4X9QA 3B40A 1ROPA 4TT3G 5B3SB 1XREA 5LA6A 2YIDA 1OCZB 4RUFA 2KKWA 1Q6HA 3CXCU 3C90A 5K1XA 3AK3A 4K8ZA 3T1CA 1WA8A 3C3TA 1XL6A 4MVMA 5JJEB 3N2GB 2UU9O 4J9YB 4O4IB 3H1JH 2XOKG 5JCOA 3G6EV 4I5SA 1Y6XA 3DXRA 4X20B 1V54C 5JWPA 1IZ3A 4WFFA 2WPDG 3BVOA 4UVAA 2PZSA 5LMUB 4GKKB 4DV5B 4K3AA 4JTCB 4X65O 1YF2A 2B5UA 2Z3YA 4DUZB 1RSOA 3OMIB 1EN6A 4IYIA 4DV3B 2FTKA 4LF8B 3RYCA 3B2EE 5KX5A 4JI3O 2LO1A 2CK3G 4CH6A 4PV1B 4QJFB 2YC0A 1H2NA 4OPHA 4LH7A 2CGOA 5LBQA 3KCXA 2DW4A 1E79G 3WB2A 1PNLA 3JALB 3F5TA 2VWJA 4FIPC 4CBCA 2AXTZ 2EIMB 1KU9A 4H33A 2HJDA 4D7TA 4BIUA 1GAXA 2GTAA 3N2KA 4ASUG 1VF6A 4G27B 4Z2WA 1WN7A 4X65B 4OGQB 1VQ7V 1OHHG 3L75H 4YXWG 4FLZA 2ZE5A 1HW7A 3LSQA 5LGTA 1K73W 3ZCCA 1GKFA 4DR3B 1RM1C 3HKEA 4P2ZA 3CC7V 2AHZA 5IWAB 3M99B 4R6ZA 4PI0A 2OCCC 2OT5A 4IYHA 5LGUA 1GMGA 2A0LA 2KG7B 4JI4B 4DR2O 2EINB 2A3QA 1G1XB 1S72V 3AG3C 3JCUZ 2CH7B 4UCOA 3FB8C 4NTYA 4CC5A 4CH3A 1VARA 3JD1A 2LW1A 4RO2A 4LBEC 3JSNA 3ZHVA 4JAAA 3U10A 3H1IH 1NZ6A 3X2QB 3R66A 3SJQC 3B77A 2UXBO 1SZTA 4DRXB 1M56B 5LOVA 1ZTEA 1Q7YW 3ZN0A 1SZXA 3WU2Z 2DQ0A 1SQGA 4GX1A 3ZJZA 5H9CA 1OZ0A 3K03A 3CX5F 4LF4B 1AJQA 3PN1A 4X1KA 4CZZA 4OPAA 3HKDA 2QE7G 4MVUA 2AGAA 2IH1C 3M7MX 2CE4A 3E2EA 3D36A 4JI1O 4LF5O 3ABMC 4YHHB 1AILA 3HKCA 5BMVA 2Q7HA 3HKBA 4I55A 1M90W 4TV8B 1K34A 5CA1A 1VQMV 5K1PA 3SYAA 2X6AA 1BHAA 3JARB 4PA4A 1YIJV 1D2DA 1W2BU 1YEWA 2PGGA 4MW8A 2F43G 3RFRA 2CGNA 3K58A 2XAHA 3P3NA 4UUJC 4MVZA 4LF5B 1H2MA 4JGSA 1QQCA 2WLIA 4NB5A 3SYOA 2W6JG 5LMNB 1WLEA 3ZRWB 3JD4A 4AILC 4BW5A 5JVDB 1P84F 1B6QA 2QWOB 3JATB 5B3SC 2ZM6B 5EZYA 1OCZC 1US6A 4TWKA 3IFXA 3NR7A 1QBZA 1Y4MA 4LF9B 1Z5VA 1PP9H 3K57A 5C8YA 4B3MO 3ABUA 4FPPA 3CCLV 3RN4A 5JJJB 1IXMA 4MVSA 1HNWO 5AG2A 2UXXA 2WLHA 3CRMA 2VS0A 4RQFA 2H94A 4I0XA 1B04A 1M57C 3K0GA 4DV6O 3LDDA 4FFBB 4DV7B 4R8CA 3GVMA 3VQVA 4DUYO 2UUBO 3RYHA 2JS5A 4IL6Z 4DR4O 4PA3A 4LFBB 5LA6B 4UCSA 3J81N 3K5LA 3CS5A 4KXRA 1N36B 4KUMA 1XDCA 4AHCA 5EBMC 1YI2V 2IJIA 1PM9A 4DV6B 1DK1A 1ZX3A 2R9RB 3CMAV 4IIJA 3TETA 4HBNA 2NNUA 4LF6B 1EN5A 1G6UA 2P22C 2X6BA 4B08A 5GONA 1AR4A 3L74H 3MDSA 4MVRA 1RSOB 2JIZG 2Y69B 4LH6A 2EINC 2WSSG 3SYPA 3QO7A 1AVMA 4Z1VA 3ML0A 1OCRB 5B1OA 3K59A 5KA6A 2FKXA 3WB1A 1FXKC 1KYOF 2YIBD 4JI0B 2XTAA 1PD3A 2Q6AA 2ZXWB 4NR1A 3N2KB 3FAVA 1YZBA 3K06A 1M56C 2N74A 1JJOA 2ADPA 4PA6A 1XBLA 2DMXA 2GV9A 2XAQA 2R9AA 3UT5B 2F1MA 2QWRB 2BSKA 3CRRA 4UCVA 5LL6Y 3HKEB 1N34B 3PJSK 5DECA 3ASNB 4HYOA 1GM8A 4JYAB 4X62O 3LDEA 5EC2C 4W4KA 2CTWA 3BA9A 1TUEB 2F66C 4I7ZB 3KG2A 1H2GA 1H8HG 4B7KA 2DN9A 3UM7A 1KKCA 1WAZA 4TSFG 1FJGO 4NXMO 1RP3B 4JTAB 2E5LO 2QKCA 1QHTA 3OGIB 2OWOA 4YY3B 2P90A 5CN0A 3CMEV 2BE3A 4J7KA 5BR8B 3ZN1A 4Z1MG 2RDCA 2E75B 5C93A 2JEUA 4JYYA 4L87A 1FXVA 1PL4A 5IDJA 2BOBC 2RMKB 1YJ9V 2MW2B 4ZI7A 4X62B 5LXTB 4WBNB 4JI7O 2D3OW 3AG2B 2PI4A 5IE9A 1B3QA 3TXSA 4LNUB 4WF9V 2QDOA 3FYIB 3E22A 1LR1A 5CB4B 4X1KB 2PUSA 3HKDB 2WLLB 4UVBA 1XEQA 1XNQB 1YTFD 3SJCC 5KHGA 3K08A 1IVSA 3L9DA 1X4TA 4J80A 3E8BA 1SC5B 3HKCB 1VQ4V 5JQGA 1N33B 4JI7B 5BMVB 1Z2GA 4BW9A 4I9WA 1M5IA 3HKBB 3Q4HB 4I55B 5CA1B 3KKYA 1W0KG 3T1HO 1S3JA 2ZE8A 4LWSB 4NYKA 1RM1B 1V55C 4MTGA 1R3KC 2YIAA 3ZBHA 2E76B 2QEXV 2OCCB 1NH2D 5L3EA 1MA1A 3FX7A 1TAEA 3E8FA 1XOUA 1SS3A 1XHXA 3LDCA 4PDMA 2WLIB 3CP1A 4ZBMA 3ASOC 3FD9A 4UV9A 3ZMVA 5EZYB 2QM4A 2M6YA 2Z0AA 3HPLC 2H3OA 4X66B 3ZMZA 1XMOB 5C8YB 3OR6C 1Q8IA 4IHJA 5JCOC 2IW5A 4XDJA 1I5YA 1JVMA 4J41A 5CA0A 1OCCC 1FXHA 1SERA 5F2VO 1XMQO 3GWOA 3R65A 4GUNA 1ZL8A 5IJ9A 3A0RA 1J5EO 4F6RA 2BTQA 1VMGA 4I0XB 1SKVA 1S5JA 5GW7A 1K4DC 5FPRA 3JAMN 4PD4F 1SESA 2HHHB 4DR5B 2A7WA 1OCRC 4KFMA 3RYHB 1SQFA 3ABMB 2ZE6A 1QR9A 3MD0A 3CE2A 1VF5B 3JASA 1JX9A 3FKSG 1THZA 2WLKA 2PYJA 2OIGA 4O4HB 1VQ9V 2ZXWC 5LHIA 1NT2B 1VF6C 1XUQA 1J5EB 2HVKC 1L1FA 3JD3A 5J2UA 1K9MW 2LFSA 1SF9A 4E4EA 1NJIW 4CS2A 4IIJB 2QM7A 5H2FZ 4FM1A 4JF3A 3ZMTA 3G71V 4I50A 3ASNC 4I4TA 1AJPA 2Z5UA 4XDKA 1W59A 5GONB 5LMUO 4GKKO 4DV5O 1KMIZ 1KECA 1CEZA 3CRAA 2QWNB 4HZ3A 1H2KA 3BPZA 4DUZO 4DV3O 4LF8O 1EZJA 3LSUA 3APQA 3T1YB 3L73H 5KMGA 2Q0AA 2ZIMA 3JAWA 1MSDA 5CBGA 1XNRB 4H0LB 2QTOA 2EIJB 2ZE7A 5B5EZ 2NR5A 1FD9A 2YIBA 3AG2C 4FLYA 5FNVA 1GTOA 1XI1A 1M57B 3BFRA 5IYZA 4BIOA 2GSMB 4BAYA 1CXZB 4QE7A 4RWUA 2EX3A 4DR3O 2BSKB 4CS4A 3RWRD 2ZIOA 4YIOA 5IWAO 3H1KH 3RT3C 4HNAA 4YIPA 1JFFA 2ZNIA 4FJCC 3OEHG 3G4SV 3UQ8A 4B3RB 2DJVA 4JI4O 4BWAA 5EYPA 3D36C 1N32O 4Q20A 3T2MA 1I0HA 1NTMH 3K5MA 1JMKC 1HNZO 4I9QA 1OCOB 3LSSA 3ICXA 1PNMA 1VEWA 2G38A 4FFKA 3K79A 4G28B 4QIWF 1WJZA 3CRCA 1XHZA 1M1KW 2FB5A 1KBHA 1VQKV 2P5OA 3TCUA 1N32B 4UCTA 2KSDA 5EIBD 1KP2A 2L6LA 2RQ6A 3HB3B 1YJNV 3AG4B 1HNZB 4LF4O 3VQWA 2L35A 2JGDA 2QJ1A 1FXKB 4F6EA 2B9ZA 1P49A 3VOUA 1WB8A 3ZRSA 2Y4TA 2JEXA 2F4VB 2Q4PA 4GLXA 5LYJA 4YHHO 1X59A 2FL4A 2UXCB 5JQGB 1EZVH 3BRCA 5LGNA 2CAZC 2CDYA 1SA0A 5L3DA 4NTXA 3TJTA 1Q3EA 3O9OA 1VQNV 1WP8A 2A79B 4O2BA 1GK9A 2EULA 3CYOA 5B66Z 3EFFK 4QPKA 4FM0A 5KA5A 1Z5WA 3I56V 2QA4V 2JDIG 4DR1B 4YJ3A 4O4LA 3DC6A 2ZD9A 2Q5ZA 4XDLA 3MHSC 3ETDA 1JOYA 2IJJA 2PF4E 3MHHC 4CC6A 1GM7A 4DV1B 5LMNO 4PDVA 2ZM6O 3RVYA 3G6BA 3UO2A 2JVDA 1JR9A 2XHBA 4ICGA 4LF9O 2IU0A 1YHQV 2DWEC 3CCEV 1T5EA 5J2TB 3B4SA 1AJNA 1ZSPA 4EEQA 4DV0B 1WP7A 2R70A 4JI2B 5CA0B 3HR0A 1BMFG 2ZQMA 1YVWA 2GDSA 3EHBB 2VQFB 2F23A 3UO3A 3ETEA 3L71H 2EZOA 3IC7A 1IDSA 2VQEB 2BTQB 1P4RA 4ABMA 3J7AU 1SQQH 2HKOA 4DV7O 3ZMSA 3CCRV 1NKDA 1A32A 1Q6IA 2UXNA 3QVNA 5KAIZ 1BS3A 1MZEA 1D5NA 1QLEB 1H2SB 2N05A 1IBLB 1PNKA 4KHPB 3OD4A 2ITDC 3F7VC 3OGCC 1HR0B 3JASB 3SJBC 1Y74B 2X7RB 4LFBO 4C7UA 2XAJA 3G80A 4EB6A 2EIJC 1N36O 5CBFA 1COWG 1N0NA 1V55B 3A0BZ 5J2UB 5IJ0A 5FLXN 3STLC 2ADQB 4FMTA 1EN4A 3CD6V 3A0HZ 1QNMA 1GM9A 5LHGA 2UUAB 4LF6O 1K4CC 2Y4UA 2IM9A 1O9HA 4I50B 4I4TB
chains in the Genus database with same CATH topology
5EK0A 3DTUB 2DYSC 3OUSA 2D3OW 1KC8W 3AG2B 2PI4A 2HLDG 2QKSA 5IY5B 2P7TC 1M9NA 4WF9V 1SRYA 4R7CA 3ASOB 4MT8A 1KP3A 4JPRA 3FYIB 2WWWA 1DLBA 2NLJC 1CPYA 3B8NA 4U7NA 4UXNA 3AG1C 3RBZA 2P6JA 4JAVA 3E83A 5L3GA 4QPJA 1KD1W 2WLLB 1BHBA 1Y66A 1FS0G 1OCOC 1AI4A 4UVBA 5B1BC 1DF4A 5B1AB 3ZIAG 4GX0A 3OAAG 4MSWC 4N21A 1YTFD 2EJRA 3K08A 2H8PC 1OCCB 1NR7A 4PDLA 3VBBA 4FK5C 3E8BA 2EILB 4P9PA 4BIZA 1ROPA 5L3CA 1VQ4V 4TT3G 1ENVA 5B3SB 4I9WA 1OCZB 4RUFA 3WG7B 1G8MA 3GB7C 1E1QG 3E8GA 3CXCU 3E86A 1W0KG 2V7QG 3T1CA 1S3JA 1E1RG 1VQLV 1XL6A 4MVMA 3WFVA 2WLLA 1RM1B 4J9YB 1V55C 4HAMA 4RAIA 2XOKG 1K92A 4EKWA 4MTGA 1JCHA 1R3KC 3K9AA 3G6EV 1VQ6V 2QEXV 4I5SA 3AG4C 2OCCB 1NH2D 1V54C 1MG1A 5L3EA 1J95A 3E8FA 5BZBA 1MSWD 4MTXA 4WFFA 2EBOA 2WPDG 3P32A 5EC1C 4UVAA 2PI5A 3SPCA 3RVZA 3JCZA 3D3IA 3LDCA 4PDMA 1R6KA 4JTCB 2WLIB 2B5UA 2WLMA 3CP1A 4P30A 2DYRB 2Z3YA 4X89A 3CCSV 3B8MA 3JD2A 3BY6A 3OMIB 2FTKA 1Q82W 4ZBMA 3ASOC 4UV9A 3ZMVA 1SETA 2CK3G 3HPLC 1I5XA 3ABKC 4MVQA 2W6IG 3ZMZA 3JYCA 2EIKB 4DXWA 3CC2V 3T4DA 4QJFB 3E89A 5LBQA 3OR6C 1AI5A 2DW4A 2HVJC 5CBHA 1F51A 1E79G 1PNLA 1LNQA 3ZMUA 2IW5A 4XDJA 3W7WA 1I5YA 4FIPC 4CBCA 2EIMB 2ZDIA 1JVMA 5E1AC 1R73A 1YJWV 4H33A 1OCCC 1FXHA 4BIUA 1SERA 4MW3A 3GWOA 4ASUG 3FB7C 3R65A 4G27B 3A0RA 1S0VA 3OFNG 2C2AA 2M7WA 3ZRXA 1VQ7V 1OHHG 3F5WC 4JYBA 4YXWG 5GW7A 1K4DC 3OM3B 3LSQA 3TK1A 4JYCA 5LGTA 1K73W 3ZCCA 1GKFA 1SESA 1RM1C 2Q69A 1K33A 1QLNA 1R6NA 4P2ZA 3CC7V 2AHZA 2B1GA 3M99B 3CCJV 4R6ZA 3W7TA 1OCRC 4KFMA 2OCCC 2OT5A 5LGUA 2JJ2G 3ABMB 1QR9A 3MD0A 1GMGA 2A0LA 4J9ZB 1JX9A 3W7XA 3FKSG 5H6RA 1JPXA 1THZA 2YSUB 2ZDIC 2EINB 2JK5C 2WLKA 1S72V 3AG3C 3CCQV 3K3WA 2XNDG 1VQ9V 3W7SA 2ZXWC 5LHIA 2YEVA 3FB8C 4RQEA 2XAFA 4GX2A 4E2LA 4PELA 2HVKC 1L1FA 5IYDO 2X6CA 3JD3A 1K9MW 3JD1A 4GT1A 1KQSU 2LFSA 2W0FC 1NJIW 4RO2A 4LBEC 2QM7A 2OTJV 4JF3A 3ZMTA 3X2QB 1VQOV 1RPOA 3SPJA 3SJQC 3B77A 5HFLA 4DO2A 3ASNC 3G71V 4GCZA 1AJPA 1SZTA 1QLEC 2HG5C 1M56B 2Z5UA 3IGAC 4XDKA 2EIMC 1K7DA 3OEEG 1Q7YW 3SPIA 1NH2B 3ZN0A 1KECA 4G2KA 2R9IA 4P9OA 4LC1A 1CEZA 2JJ1G 1W0JG 2DQ0A 1PL0A 2MK3A 4HZ3A 4GX1A 1EBOA 1R3LC 1G4YB 4U7OA 4X88A 4WFHA 3ZJZA 5H9CA 1OZ0A 1EZJA 2GHYA 2OTLV 3K03A 4OXSA 1AJQA 2Q67A 4JTDB 3W7UA 4CZZA 4KP4A 5CMUA 5B1NA 2QE7G 4MVUA 1DTOA 2IH1C 3E2EA 1WPXA 5CBGA 3D36A 2QTOA 1F4MA 3ABMC 2EIJB 3I55V 3CCVV 2V1DA 4PA7A 5FL7G 2B1IA 3K0DA 3FYEB 1M90W 1VQMV 3AG2C 1K34A 1EFRG 1GTOA 2ZR2A 1M57B 5IY5C 3SYAA 1FFTB 1R3JC 1CP9A 2GSMB 4BAYA 1VQ5V 2X6AA 1GO3F 3ETGA 1HWYA 4QE7A 5IYBO 1PKXA 1BHAA 4UVCA 1UJWB 4PA4A 5J9PC 1Q86W 1YIJV 3SPGA 2HR3A 1W2BU 1JJ2U 2DYSB 3ZRVA 4WFAV 4MW8A 2F43G 4XBFA 1P7BA 3X2QC 4ZKIA 5B1AC 4FJCC 3OEHG 2XAHA 3G4SV 3T4ZA 4UUJC 4MTFA 4MVZA 4JGSA 2WLIA 3SYOA 3AG1B 4Q20A 3T2MA 3CCMV 2EILC 2W6JG 1WLEA 1VQPV 2BOCC 3JD4A 3ZRWB 4BW5A 1B6QA 4MTOA 5B3SC 3F7YC 2ZR3A 2IJKA 1OCZC 3WG7C 2HFEC 1OCOB 3SYQA 3OMNB 4TWKA 3LSSA 1H8EG 3IFXA 3NXSA 2WLJA 4MVOA 1QBZA 1Y4MA 1PNMA 2XAGA 3OMAB 5HFMA 2LFRA 1NBMG 2AHYA 3ABUA 4QE9A 4WFEA 4FPPA 4RUEA 5EBWC 3CCLV 3K79A 4R50A 3E35A 4G28B 4QIWF 1IXMA 2HJFC 1M1KW 4MVSA 3AEIA 4MS2A 1VQKV 1RPRA 3TCUA 2UXXA 4LCUC 2WLHA 1YTFB 1KP2A 4RQFA 3P30A 2H94A 3STZC 1M57C 3K0GA 1ZWIC 3HB3B 1AI7A 1ORQC 2DYRC 4WCEV 1YJNV 4JAUA 2ITCC 3AG4B 3LDDA 1YSCA 3FB6C 1NVPD 1V54B 4R8CA 2DWDC 3K04A 1FXKB 1S5HC 3VOUA 1Q81W 2WAMA 2EIKC 3ZRSA 2JEXA 4H37A 1S76D 1QVGU 3QO5A 5CA3A 4QNHB 4PA3A 1XL4A 3BEHA 2A9HA 3OR7C 5LGNA 5L3DA 3ABKB 3RW0A 1K97A 1VQNV 1YITV 4KUMA 4X8AA 5L3BA 5EBMC 1K3EA 2A79B 1YI2V 2IJIA 2EZPA 2X0LA 1GK9A 1NQTA 3CYOA 4GX5A 3EFFK 4QPKA 1MABG 1FXKA 5DN6G 2R9RB 3CMAV 1R3IC 1QCEA 5KA5A 3CCUV 3TETA 2NNUA 3CPWU 4PA9A 3I56V 2QA4V 2JDIG 1H38A 2QM8A 2ZD9A 5L3FA 2X6BA 4XDLA 3MHSC 3ETDA 1JOYA 2IJJA 1AR1B 3QNEA 3MHHC 2P67A 1QR8A 3ABLB 3JD0A 1GM7A 1KKDA 1F4NA 3LNMB 4MVRA 4PDVA 5DM6V 4LP8A 2JIZG 4WFBV 4PDRA 2Y69B 3OUFA 2WLNA 2EINC 2WSSG 3SYPA 3QO7A 3RVYA 5EBLC 3SYCA 3ML0A 1OCRB 2IU0A 1YHQV 2DWEC 3CCEV 5B1OA 1DF5A 4UV8A 5KA6A 1AJNA 1FXKC 1QVFU 2K1EA 3DGEA 1S77D 1K5SA 2DQ3A 1PD3A 2Q6AA 3AG3B 2IH3C 4JASA 1BMFG 2ZXWB 1BL8A 2ZQMA 2Y48A 2LP7A 2KB1A 3ABTA 3EHBB 1NR1A 1K8AW 5IYCO 3K06A 3ETEA 1M56C 2EZOA 1N8RW 3IC7A 3OW2U 4PA6A 3FB5C 3H01A 5KUMA 1AI6A 4WFGA 2XAQA 1P4RA 2HKOA 1AROP 3QO8A 3ZMSA 3CCRV 1NKDA 2XASA 5B1BB 5LHHA 3UKMA 2UXNA 3PJSK 3ASNB 4HYOA 1GM8A 1QLEB 3LDEA 1PNKA 5EC2C 1F23A 1NVPB 2ITDC 3F7VC 3OGCC 1TUEB 3KG2A 1H2GA 1H8HG 3UM7A 1MOFA 4TSFG 3CC4V 2X7RB 4F4LA 4JTAB 2XAJA 2EIJC 2IJHA 3ABLC 3E8HA 3ZRWA 2P90A 2YEVB 5CN0A 3CMEV 2Q68A 5CBFA 1COWG 1V55B 1K5QA 2Y69C 3LUTB 3ZN1A 1JQ0A 2ATKC 3STLC 4Z1MG 4FMTA 3OE7G 3CD6V 3SPHA 2JEUA 4L87A 5C93A 1FXVA 5IDJA 1GM9A 2IU3A 5LHGA 2BOBC 1YJ9V 4N23A 1K4CC 5KUKA 1VQ8V 5H6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9A A;  1I5X A;  1JPX A;  4N21 A;  3B77 A;  5HFL A;  1SZT A;  2M7W A;  1DF5 A;  5CN0 A;  1MG1 A;  5KA6 A;  4FK5 C;  4G2K A;  1QBZ A;  1Y4M A;  3MHS C;  3P30 A;  4JPR A;  1DLB A;  1ENV A;  2EBO A;  2MK3 A;  3B8N A;  5HFM A;  1JQ0 A;  3MHH C;  1QR8 A;  1EBO A;  1K33 A;  4E2L A;  2P6J A;  1I5Y A;  5H9C A;  4FJC C;  1F23 A;  4FIP C;  3M99 B;  1K34 A;  2LP7 A;  3CP1 A;  2EZP A;  2OT5 A;  4JGS A;  3B8M A;  1MOF A;  3CYO A;  2EZO A;  3WFV A;  4N23 A;  1Y66 A;  1QR9 A;  2X7R B;  3GWO A;  5CMU A;  1DF4 A;  3H01 A;  4JF3 A;  1QCE A;  5KA5 A; 
#chains in the Genus database with same CATH topology
 1BQ0 A;  1KC8 W;  3BAA A;  4OX9 B;  1R1B A;  2CUG A;  1M9N A;  1XIL A;  3CWB H;  1YCI A;  1SRY A;  4R7C A;  3ASO B;  1KB9 F;  4UXN A;  2AZ0 A;  2P6J A;  3E83 A;  4DW0 A;  1WA8 B;  1Y76 A;  4JI8 B;  4LFA B;  1OCO C;  5B1B C;  1DF4 A;  5KMG B;  4K0K B;  5B1A B;  3ZIA G;  1FFX A;  2JS3 A;  3DXR B;  4FZ0 A;  4JI0 O;  1OCC B;  3VBB A;  4PDL A;  4FK5 C;  4BIZ A;  5L3C A;  1VF7 A;  1URF A;  3GB7 C;  3E8G A;  3CXH F;  2V7Q G;  3RYC B;  1VQL V;  5KX5 B;  4DV2 B;  4RAI A;  1JA8 A;  1JCH A;  4D6T H;  4TQD A;  1VQ6 V;  1PV0 A;  1N34 O;  4QGP A;  3AG4 C;  5GTI Z;  4JYA O;  1J95 A;  2QKA A;  5BZB A;  1MSW D;  1VIB A;  4MTX A;  2EBO A;  1JFF B;  5EC1 C;  1HNX O;  3RVZ A;  3JCZ A;  5EYP B;  1R6K A;  3ZHQ A;  4LR3 A;  4BR6 A;  2FYU H;  4DK1 A;  1DGS A;  3JD2 A;  4YY3 O;  3ZX6 A;  1Q82 W;  4O2A A;  3N2G A;  4O4I A;  1SET A;  2BCC H;  3AG7 A;  2ETN A;  5BR8 O;  2W6I G;  4H44 B;  3JYC A;  2EIK B;  4DXW A;  3T4D A;  3RYI A;  4O4J A;  1BCC H;  5CBH A;  1F51 A;  4AQY O;  3IC9 A;  2ZKO A;  3ZMU A;  2ZDI A;  5E1A C;  1R73 A;  2QSA A;  3DC5 A;  2YDE A;  1HNX B;  1BSM A;  3FB7 C;  1AR5 A;  1D5A A;  2M7W A;  3F5W C;  4JYB A;  4DK0 A;  1H2L A;  4J7J A;  1N4C A;  5KHI A;  1K33 A;  2JGD B;  1Q43 A;  3ZHU A;  3OT7 A;  2B1G A;  5BY1 A;  1XNQ O;  3W7T A;  4AQY B;  4J9Z B;  3JAK A;  3W7X A;  3OTO B;  1N33 O;  2YSU B;  5LOV B;  2JK5 C;  3K3W A;  2XND G;  3W7S A;  2YEV A;  1LUW A;  4B3T B;  4PEL A;  1GN3 A;  4GT1 A;  1KQS U;  2WA3 A;  4DR6 B;  2ODM A;  4YJ3 B;  1RPO A;  4O4L B;  5HFL A;  4DO2 A;  1QLE C;  3IGA C;  2W0X A;  1Y67 A;  1K7D A;  3OEE G;  1NH2 B;  4G2K A;  1W0J G;  3IAY A;  1R3L C;  4B3S B;  4X88 A;  4GYC B;  4J11 A;  3K9S A;  1WNS A;  2GHY A;  3UCS C;  4OXS A;  4JTD B;  4X66 O;  1U97 A;  3BCC H;  4FLT A;  4KP4 A;  2Q0O C;  2ZT9 B;  1UPG A;  4FLW A;  4FLU A;  1XMO O;  1DTO A;  3MAQ A;  4JI6 B;  2GBO A;  1WPX A;  3ZHT A;  3I55 V;  3I5D A;  2V1D A;  1SQV H;  5FL7 G;  1NTZ H;  2B1I A;  3O65 A;  4X64 O;  1EFR G;  2F95 B;  3LNN A;  1FFT B;  1R3J C;  2EJ7 A;  1GO3 F;  5IYB O;  5ITZ A;  4UVC A;  1UJW B;  2HHH O;  3SPG A;  4GZR B;  3TXQ A;  1IX9 A;  4DR5 O;  4KL1 A;  3ZRV A;  4WFA V;  4XBF A;  1P7B A;  5B1A C;  2Q9L A;  3SGI A;  1S5L Z;  3T4Z A;  4MTF A;  1UFI A;  2LJ2 A;  3CCM V;  2GUZ A;  4X64 B;  1VQP V;  3H9V A;  3S3W A;  4NKG B;  3F7Y C;  1WB7 A;  4FVM A;  2IJK A;  5KHK A;  2HFE C;  3EXA A;  3OMN B;  1H8E G;  4L8J A;  2YXH A;  2XAG A;  2UUC O;  1GN2 A;  3OMA B;  3VQY A;  2JRI A;  5LP6 A;  1AB3 A;  4PI2 A;  2LFR A;  4QE9 A;  4RUE A;  5EBW C;  3E35 A;  1TA8 A;  2LGQ A;  4FM2 A;  4TV9 A;  1BGY H;  3AEI A;  1I7F A;  4MS2 A;  1TUB A;  1RPR A;  5JVD A;  4LCU C;  1N0J A;  3P30 A;  3STZ C;  1ZWI C;  4JAU A;  3FB6 C;  1NVP D;  4DR7 B;  3J80 N;  3G67 A;  2DWD C;  3K04 A;  3T1Y O;  2JGU A;  3D8C A;  2UUC B;  1NI8 A;  1S5H C;  1Q81 W;  2CTQ A;  2EIK C;  1BQZ A;  4H37 A;  1XNR O;  1QVG U;  3B09 A;  2PYL A;  4QNH B;  4U3J A;  1XL4 A;  1GH6 A;  3OR7 C;  2P4V A;  3ABK B;  4GKJ B;  3CJH A;  3RW0 A;  2HEP A;  1YIT V;  4X8A A;  1FYJ A;  1K3E A;  2EZP A;  2X0L A;  4TQF A;  4NXN B;  4GX5 A;  2DE0 X;  2Q8V A;  2A06 H;  1R3I C;  5KLV H;  1QU7 A;  1H38 A;  1R6T A;  1NTK H;  1AR1 B;  4B3R O;  1AP5 A;  3QNE A;  4NVP A;  2YXL A;  3JD0 A;  1F4N A;  3LNM B;  3FAV B;  5TIS Z;  2D2C B;  5DM6 V;  4LP8 A;  4O2A B;  4WFB V;  3OUF A;  3QF7 A;  2DOS A;  3K5N A;  5EBL C;  2Q7E A;  3SYC A;  2YS8 A;  4JV5 B;  3RYF A;  3RYI B;  1IUR A;  2RJZ A;  4O4J B;  4PHZ A;  1QVF U;  2CTP A;  1IBK B;  1S77 D;  3APO A;  1K5S A;  1L0L H;  2DQ3 A;  2IBZ H;  1BL8 A;  2LP7 A;  1NR1 A;  5IYC O;  1L8D A;  3ZHR A;  4CS3 A;  3FB5 C;  3THO A;  1AI6 A;  1SQX H;  2UU9 B;  5JH7 A;  2XAS A;  5B1B B;  3UKM A;  1V9P A;  5GTH Z;  2VWK A;  1F23 A;  1U96 A;  2F4V O;  4ZI7 B;  3JAK B;  1MOF A;  3RGB A;  2UXC O;  2AW9 A;  1I08 A;  2HP8 A;  2IJH A;  3ABL C;  2YEV B;  2YI9 A;  4JI3 B;  3UT5 A;  1IXB A;  3E22 B;  1K5Q A;  3LUT B;  3C3S A;  4J7Z A;  2P06 A;  1VP7 A;  2ATK C;  3FFQ A;  2IU3 A;  4JI5 O;  4DR1 O;  2E3C A;  3L72 H;  1RFY A;  2KQX A;  1VQ8 V;  1MMM A;  5EK0 A;  3OUS A;  2OIE A;  2HLD G;  2RN9 A;  2QKS A;  5IY5 B;  2P7T C;  4DV1 O;  1KP3 A;  4A5U B;  2WWW A;  1DLB A;  4YJ2 A;  2NLJ C;  3B8N A;  4IT5 A;  4U7N A;  4JAV A;  3CEI A;  5L3G A;  1BHB A;  1Y66 A;  4H13 B;  1FS0 G;  1Q5O A;  3KCY A;  2XT9 A;  4GX0 A;  3OAA G;  1LUV A;  4MSW C;  5LXT A;  4WBN A;  4JI5 B;  4DV0 O;  4JI2 O;  4LNU A;  4X1Y A;  2EIL B;  4P9P A;  4K8X A;  4NTW A;  1ENV A;  2VQF O;  2E74 B;  4DR2 B;  3WG7 B;  1G8M A;  1E1Q G;  4FZ1 A;  2VQE O;  3E86 A;  4UFZ A;  5CB4 A;  1E1R G;  1WPB A;  3WFV A;  2WLL A;  5ITZ B;  4HAM A;  1K92 A;  4EKW A;  3K9A A;  1MZF A;  3ZS8 C;  2UXD O;  4EFE A;  1MG1 A;  1IBL O;  4KHP O;  4IHJ B;  2UXB B;  3P32 A;  2NN4 A;  1HR0 O;  2PI5 A;  3SPC A;  3D3I A;  3Q4H A;  4CH5 A;  4DYL A;  2WLM A;  4P30 A;  3CCS V;  2DYR B;  2R72 A;  4X89 A;  3TGU H;  2GUZ B;  3B8M A;  3BY6 A;  4LWS A;  1ZL8 B;  5IJ9 B;  3H1L H;  2ZCE A;  4F6R B;  1I5X A;  3ABK C;  4MVQ A;  3CSX A;  5LP6 B;  3CRQ A;  3CC2 V;  2K9P A;  3E89 A;  1AI5 A;  2HVJ C;  2UXD B;  4UB6 Z;  2UUA O;  3ZHS A;  1LNQ A;  3W7W A;  4JZ2 A;  4JI1 B;  1TVK A;  1YJW V;  4TV9 B;  4OX9 O;  1KUQ A;  4MW3 A;  1TUB B;  1Q6U A;  4K35 A;  1O9G A;  1S0V A;  3OFN G;  2C2A A;  3ZRX A;  3SR2 C;  4B7E A;  1GRJ A;  3OM3 B;  3TK1 A;  4JYC A;  4JI8 O;  3A2F A;  2Q69 A;  4LFA O;  4ZOL A;  1QLN A;  1R6N A;  4K0K O;  3AK2 A;  4PJ0 Z;  3CCJ V;  1MNG A;  2JJ2 G;  3A8T A;  2OCH A;  4ZHQ A;  1GN4 A;  3QG5 A;  4UCU A;  2QGN A;  4U3J B;  5H6R A;  1JPX A;  4TUY A;  5JJN B;  2ZDI C;  5KHJ A;  3EVK A;  3CCQ V;  3U0Z A;  3CJH B;  3SJA C;  1XQ8 A;  3KZI Z;  4J10 A;  4RQE A;  2XAF A;  4FLX A;  4GX2 A;  4TOI A;  4E2L A;  5IYD O;  3K5O A;  2X6C A;  4DV2 O;  2WA4 A;  4X1I A;  2W0F C;  4B3M B;  2OTJ V;  2ARH A;  2ZIN A;  1ZLZ A;  1VQO V;  5EIB C;  3SPJ A;  3JAW B;  4GCZ A;  2ZNJ A;  2HG5 C;  3VQX A;  2EIM C;  3SPI A;  4P9O A;  2R9I A;  4O4H A;  4LC1 A;  1HNW B;  2JJ1 G;  1PL0 A;  2MK3 A;  1EBO A;  1G4Y B;  2RCV A;  4U7O A;  5A9G A;  4WFH A;  5FNV B;  5IYZ B;  2OTL V;  3W7U A;  2Q67 A;  5CMU A;  5B1N A;  3RYF B;  4DUY B;  3SDL A;  1NS1 A;  2UUB B;  1M93 A;  1EM1 A;  3BHP A;  3AK1 A;  1F4M A;  4HNA B;  2CTR A;  3CCV V;  4PA7 A;  4DR4 B;  3K0D A;  3FYE B;  2ZR2 A;  5IY5 C;  1SQP H;  1YDX A;  4Q6G A;  1CP9 A;  1VQ5 V;  2PY5 A;  2QWQ B;  1HWY A;  3ETG A;  5H5N A;  1PKX A;  5JH7 B;  2F93 B;  5J9P C;  1Q86 W;  1GN6 A;  2AZ2 A;  2YXY A;  4EFB A;  1L0N H;  4X20 A;  2HR3 A;  1JJ2 U;  2DYS B;  5D5Q A;  5DED A;  3JSL A;  1FPO A;  2YUA A;  4AI8 A;  3P3P A;  3X2Q C;  4ZKI A;  3OTO O;  1FKA O;  3AG1 B;  2EIL C;  2BOC C;  2YI8 A;  4MTO A;  4DW1 A;  2ZR3 A;  3WG7 C;  4B3T O;  3SYQ A;  2Q73 A;  3NXS A;  4MVO A;  2WLJ A;  2LW7 A;  4LF7 O;  3IJ4 A;  2QWP B;  2P4K A;  5E79 Z;  5HFM A;  1NBM G;  4DR6 O;  2AHY A;  4WFE A;  3CHX A;  4R50 A;  3JAL A;  1BE3 H;  2HJF C;  2QR4 A;  5LYJ B;  1TGO A;  4FLV A;  1YTF B;  4B3S O;  3D3Q A;  1BT8 A;  4YJ2 B;  1SA0 B;  1NU1 H;  1AI7 A;  1ORQ C;  2DYR C;  4WCE V;  4D7S A;  5IT9 N;  2ITC C;  1YSC A;  1V54 B;  2RNB A;  4O2B B;  3CB2 A;  4U3F H;  4LF7 B;  2GTS A;  4JI6 O;  2WAM A;  5LP6 C;  2O57 A;  1S76 D;  1I94 O;  2KG7 A;  3QO5 A;  2Q7G A;  4X1Y B;  5CA3 A;  1FJG B;  3L70 H;  4NXM B;  3BEH A;  1SQB H;  2E5L B;  2A9H A;  4JZG A;  5KAF Z;  2CH7 A;  4LFC O;  5A2Q N;  1K97 A;  5KHH A;  5L3B A;  1NQT A;  1IBM O;  1MAB G;  1FXK A;  5DN6 G;  5BXZ A;  4J42 A;  1QCE A;  3CCU V;  3CPW U;  4PA9 A;  2QM8 A;  5L3F A;  4DRX A;  1HDJ A;  2PTM A;  1I94 B;  4IGG A;  2P67 A;  1QR8 A;  3ABL B;  3ZED A;  1KKD A;  2XUM A;  3WB0 A;  2ILM A;  5D5P A;  4PDR A;  2WLN A;  4LFC B;  1ZUQ A;  1BZK A;  1YXB A;  1P7G A;  2BTO A;  1DF5 A;  4UV8 A;  1IBM B;  3BA8 A;  1OV9 A;  3GWK C;  2VRZ A;  2K1E A;  3DGE A;  4ZIB A;  4W4L A;  1F7Y A;  1TVK B;  3N27 A;  3AG3 B;  2IH3 C;  3OTF A;  4JAS A;  2Y48 A;  4UB8 Z;  2KB1 A;  3ABT A;  1K8A W;  4TV8 A;  1N8R W;  2OYQ A;  3OW2 U;  3H01 A;  5KUM A;  4EB6 B;  4WFG A;  3T1H B;  1OJH A;  1ARO P;  3QO8 A;  4DR7 O;  3JAR A;  5LHH A;  5J2T A;  1PPJ H;  4ZOL B;  5IJ0 B;  5FPO A;  4CH4 A;  4DV4 O;  1NVP B;  1ZAU A;  1HP8 A;  4ZHQ B;  2YIC A;  3CC4 V;  4F4L A;  4TUY B;  3BAB A;  4GKJ O;  3E8H A;  3ZRW A;  3JAT A;  3DSQ A;  2Q68 A;  2V4D A;  3M8A A;  2Y69 C;  1Q90 D;  4NXN O;  1JQ0 A;  3OE7 G;  1Y76 B;  4X1I B;  3SPH A;  3QTC A;  2Y0P A;  4N23 A;  2Y0I A;  5KUK A;  1FFX B;  5H6Q A;  2LGW A;  1Y74 A;  4DV4 B;  3DTU B;  2DYS C;  1FAF A;  1XMQ B;  3ETQ A;  2N04 A;  4MT8 A;  3U11 A;  4JPR A;  1B06 A;  1CPY A;  3AG1 C;  3RBZ A;  2FML A;  4QPJ A;  4FFB A;  1KD1 W;  1AP6 A;  4JV5 O;  4UCR A;  1AI4 A;  2LQT A;  3S3X A;  2QTS A;  3H1H H;  4N21 A;  2EJR A;  1IBK O;  2H8P C;  1M4U A;  1NR7 A;  4X9Q A;  3B40 A;  1ROP A;  4TT3 G;  5B3S B;  1XRE A;  5LA6 A;  2YID A;  1OCZ B;  4RUF A;  2KKW A;  1Q6H A;  3CXC U;  3C90 A;  5K1X A;  3AK3 A;  4K8Z A;  3T1C A;  1WA8 A;  3C3T A;  1XL6 A;  4MVM A;  5JJE B;  3N2G B;  2UU9 O;  4J9Y B;  4O4I B;  3H1J H;  2XOK G;  5JCO A;  3G6E V;  4I5S A;  1Y6X A;  3DXR A;  4X20 B;  1V54 C;  5JWP A;  1IZ3 A;  4WFF A;  2WPD G;  3BVO A;  4UVA A;  2PZS A;  5LMU B;  4GKK B;  4DV5 B;  4K3A A;  4JTC B;  4X65 O;  1YF2 A;  2B5U A;  2Z3Y A;  4DUZ B;  1RSO A;  3OMI B;  1EN6 A;  4IYI A;  4DV3 B;  2FTK A;  4LF8 B;  3RYC A;  3B2E E;  5KX5 A;  4JI3 O;  2LO1 A;  2CK3 G;  4CH6 A;  4PV1 B;  4QJF B;  2YC0 A;  1H2N A;  4OPH A;  4LH7 A;  2CGO A;  5LBQ A;  3KCX A;  2DW4 A;  1E79 G;  3WB2 A;  1PNL A;  3JAL B;  3F5T A;  2VWJ A;  4FIP C;  4CBC A;  2AXT Z;  2EIM B;  1KU9 A;  4H33 A;  2HJD A;  4D7T A;  4BIU A;  1GAX A;  2GTA A;  3N2K A;  4ASU G;  1VF6 A;  4G27 B;  4Z2W A;  1WN7 A;  4X65 B;  4OGQ B;  1VQ7 V;  1OHH G;  3L75 H;  4YXW G;  4FLZ A;  2ZE5 A;  1HW7 A;  3LSQ A;  5LGT A;  1K73 W;  3ZCC A;  1GKF A;  4DR3 B;  1RM1 C;  3HKE A;  4P2Z A;  3CC7 V;  2AHZ A;  5IWA B;  3M99 B;  4R6Z A;  4PI0 A;  2OCC C;  2OT5 A;  4IYH A;  5LGU A;  1GMG A;  2A0L A;  2KG7 B;  4JI4 B;  4DR2 O;  2EIN B;  2A3Q A;  1G1X B;  1S72 V;  3AG3 C;  3JCU Z;  2CH7 B;  4UCO A;  3FB8 C;  4NTY A;  4CC5 A;  4CH3 A;  1VAR A;  3JD1 A;  2LW1 A;  4RO2 A;  4LBE C;  3JSN A;  3ZHV A;  4JAA A;  3U10 A;  3H1I H;  1NZ6 A;  3X2Q B;  3R66 A;  3SJQ C;  3B77 A;  2UXB O;  1SZT A;  4DRX B;  1M56 B;  5LOV A;  1ZTE A;  1Q7Y W;  3ZN0 A;  1SZX A;  3WU2 Z;  2DQ0 A;  1SQG A;  4GX1 A;  3ZJZ A;  5H9C A;  1OZ0 A;  3K03 A;  3CX5 F;  4LF4 B;  1AJQ A;  3PN1 A;  4X1K A;  4CZZ A;  4OPA A;  3HKD A;  2QE7 G;  4MVU A;  2AGA A;  2IH1 C;  3M7M X;  2CE4 A;  3E2E A;  3D36 A;  4JI1 O;  4LF5 O;  3ABM C;  4YHH B;  1AIL A;  3HKC A;  5BMV A;  2Q7H A;  3HKB A;  4I55 A;  1M90 W;  4TV8 B;  1K34 A;  5CA1 A;  1VQM V;  5K1P A;  3SYA A;  2X6A A;  1BHA A;  3JAR B;  4PA4 A;  1YIJ V;  1D2D A;  1W2B U;  1YEW A;  2PGG A;  4MW8 A;  2F43 G;  3RFR A;  2CGN A;  3K58 A;  2XAH A;  3P3N A;  4UUJ C;  4MVZ A;  4LF5 B;  1H2M A;  4JGS A;  1QQC A;  2WLI A;  4NB5 A;  3SYO A;  2W6J G;  5LMN B;  1WLE A;  3ZRW B;  3JD4 A;  4AIL C;  4BW5 A;  5JVD B;  1P84 F;  1B6Q A;  2QWO B;  3JAT B;  5B3S C;  2ZM6 B;  5EZY A;  1OCZ C;  1US6 A;  4TWK A;  3IFX A;  3NR7 A;  1QBZ A;  1Y4M A;  4LF9 B;  1Z5V A;  1PP9 H;  3K57 A;  5C8Y A;  4B3M O;  3ABU A;  4FPP A;  3CCL V;  3RN4 A;  5JJJ B;  1IXM A;  4MVS A;  1HNW O;  5AG2 A;  2UXX A;  2WLH A;  3CRM A;  2VS0 A;  4RQF A;  2H94 A;  4I0X A;  1B04 A;  1M57 C;  3K0G A;  4DV6 O;  3LDD A;  4FFB B;  4DV7 B;  4R8C A;  3GVM A;  3VQV A;  4DUY O;  2UUB O;  3RYH A;  2JS5 A;  4IL6 Z;  4DR4 O;  4PA3 A;  4LFB B;  5LA6 B;  4UCS A;  3J81 N;  3K5L A;  3CS5 A;  4KXR A;  1N36 B;  4KUM A;  1XDC A;  4AHC A;  5EBM C;  1YI2 V;  2IJI A;  1PM9 A;  4DV6 B;  1DK1 A;  1ZX3 A;  2R9R B;  3CMA V;  4IIJ A;  3TET A;  4HBN A;  2NNU A;  4LF6 B;  1EN5 A;  1G6U A;  2P22 C;  2X6B A;  4B08 A;  5GON A;  1AR4 A;  3L74 H;  3MDS A;  4MVR A;  1RSO B;  2JIZ G;  2Y69 B;  4LH6 A;  2EIN C;  2WSS G;  3SYP A;  3QO7 A;  1AVM A;  4Z1V A;  3ML0 A;  1OCR B;  5B1O A;  3K59 A;  5KA6 A;  2FKX A;  3WB1 A;  1FXK C;  1KYO F;  2YIB D;  4JI0 B;  2XTA A;  1PD3 A;  2Q6A A;  2ZXW B;  4NR1 A;  3N2K B;  3FAV A;  1YZB A;  3K06 A;  1M56 C;  2N74 A;  1JJO A;  2ADP A;  4PA6 A;  1XBL A;  2DMX A;  2GV9 A;  2XAQ A;  2R9A A;  3UT5 B;  2F1M A;  2QWR B;  2BSK A;  3CRR A;  4UCV A;  5LL6 Y;  3HKE B;  1N34 B;  3PJS K;  5DEC A;  3ASN B;  4HYO A;  1GM8 A;  4JYA B;  4X62 O;  3LDE A;  5EC2 C;  4W4K A;  2CTW A;  3BA9 A;  1TUE B;  2F66 C;  4I7Z B;  3KG2 A;  1H2G A;  1H8H G;  4B7K A;  2DN9 A;  3UM7 A;  1KKC A;  1WAZ A;  4TSF G;  1FJG O;  4NXM O;  1RP3 B;  4JTA B;  2E5L O;  2QKC A;  1QHT A;  3OGI B;  2OWO A;  4YY3 B;  2P90 A;  5CN0 A;  3CME V;  2BE3 A;  4J7K A;  5BR8 B;  3ZN1 A;  4Z1M G;  2RDC A;  2E75 B;  5C93 A;  2JEU A;  4JYY A;  4L87 A;  1FXV A;  1PL4 A;  5IDJ A;  2BOB C;  2RMK B;  1YJ9 V;  2MW2 B;  4ZI7 A;  4X62 B;  5LXT B;  4WBN B;  4JI7 O;  2D3O W;  3AG2 B;  2PI4 A;  5IE9 A;  1B3Q A;  3TXS A;  4LNU B;  4WF9 V;  2QDO A;  3FYI B;  3E22 A;  1LR1 A;  5CB4 B;  4X1K B;  2PUS A;  3HKD B;  2WLL B;  4UVB A;  1XEQ A;  1XNQ B;  1YTF D;  3SJC C;  5KHG A;  3K08 A;  1IVS A;  3L9D A;  1X4T A;  4J80 A;  3E8B A;  1SC5 B;  3HKC B;  1VQ4 V;  5JQG A;  1N33 B;  4JI7 B;  5BMV B;  1Z2G A;  4BW9 A;  4I9W A;  1M5I A;  3HKB B;  3Q4H B;  4I55 B;  5CA1 B;  3KKY A;  1W0K G;  3T1H O;  1S3J A;  2ZE8 A;  4LWS B;  4NYK A;  1RM1 B;  1V55 C;  4MTG A;  1R3K C;  2YIA A;  3ZBH A;  2E76 B;  2QEX V;  2OCC B;  1NH2 D;  5L3E A;  1MA1 A;  3FX7 A;  1TAE A;  3E8F A;  1XOU A;  1SS3 A;  1XHX A;  3LDC A;  4PDM A;  2WLI B;  3CP1 A;  4ZBM A;  3ASO C;  3FD9 A;  4UV9 A;  3ZMV A;  5EZY B;  2QM4 A;  2M6Y A;  2Z0A A;  3HPL C;  2H3O A;  4X66 B;  3ZMZ A;  1XMO B;  5C8Y B;  3OR6 C;  1Q8I A;  4IHJ A;  5JCO C;  2IW5 A;  4XDJ A;  1I5Y A;  1JVM A;  4J41 A;  5CA0 A;  1OCC C;  1FXH A;  1SER A;  5F2V O;  1XMQ O;  3GWO A;  3R65 A;  4GUN A;  1ZL8 A;  5IJ9 A;  3A0R A;  1J5E O;  4F6R A;  2BTQ A;  1VMG A;  4I0X B;  1SKV A;  1S5J A;  5GW7 A;  1K4D C;  5FPR A;  3JAM N;  4PD4 F;  1SES A;  2HHH B;  4DR5 B;  2A7W A;  1OCR C;  4KFM A;  3RYH B;  1SQF A;  3ABM B;  2ZE6 A;  1QR9 A;  3MD0 A;  3CE2 A;  1VF5 B;  3JAS A;  1JX9 A;  3FKS G;  1THZ A;  2WLK A;  2PYJ A;  2OIG A;  4O4H B;  1VQ9 V;  2ZXW C;  5LHI A;  1NT2 B;  1VF6 C;  1XUQ A;  1J5E B;  2HVK C;  1L1F A;  3JD3 A;  5J2U A;  1K9M W;  2LFS A;  1SF9 A;  4E4E A;  1NJI W;  4CS2 A;  4IIJ B;  2QM7 A;  5H2F Z;  4FM1 A;  4JF3 A;  3ZMT A;  3G71 V;  4I50 A;  3ASN C;  4I4T A;  1AJP A;  2Z5U A;  4XDK A;  1W59 A;  5GON B;  5LMU O;  4GKK O;  4DV5 O;  1KMI Z;  1KEC A;  1CEZ A;  3CRA A;  2QWN B;  4HZ3 A;  1H2K A;  3BPZ A;  4DUZ O;  4DV3 O;  4LF8 O;  1EZJ A;  3LSU A;  3APQ A;  3T1Y B;  3L73 H;  5KMG A;  2Q0A A;  2ZIM A;  3JAW A;  1MSD A;  5CBG A;  1XNR B;  4H0L B;  2QTO A;  2EIJ B;  2ZE7 A;  5B5E Z;  2NR5 A;  1FD9 A;  2YIB A;  3AG2 C;  4FLY A;  5FNV A;  1GTO A;  1XI1 A;  1M57 B;  3BFR A;  5IYZ A;  4BIO A;  2GSM B;  4BAY A;  1CXZ B;  4QE7 A;  4RWU A;  2EX3 A;  4DR3 O;  2BSK B;  4CS4 A;  3RWR D;  2ZIO A;  4YIO A;  5IWA O;  3H1K H;  3RT3 C;  4HNA A;  4YIP A;  1JFF A;  2ZNI A;  4FJC C;  3OEH G;  3G4S V;  3UQ8 A;  4B3R B;  2DJV A;  4JI4 O;  4BWA A;  5EYP A;  3D36 C;  1N32 O;  4Q20 A;  3T2M A;  1I0H A;  1NTM H;  3K5M A;  1JMK C;  1HNZ O;  4I9Q A;  1OCO B;  3LSS A;  3ICX A;  1PNM A;  1VEW A;  2G38 A;  4FFK A;  3K79 A;  4G28 B;  4QIW F;  1WJZ A;  3CRC A;  1XHZ A;  1M1K W;  2FB5 A;  1KBH A;  1VQK V;  2P5O A;  3TCU A;  1N32 B;  4UCT A;  2KSD A;  5EIB D;  1KP2 A;  2L6L A;  2RQ6 A;  3HB3 B;  1YJN V;  3AG4 B;  1HNZ B;  4LF4 O;  3VQW A;  2L35 A;  2JGD A;  2QJ1 A;  1FXK B;  4F6E A;  2B9Z A;  1P49 A;  3VOU A;  1WB8 A;  3ZRS A;  2Y4T A;  2JEX A;  2F4V B;  2Q4P A;  4GLX A;  5LYJ A;  4YHH O;  1X59 A;  2FL4 A;  2UXC B;  5JQG B;  1EZV H;  3BRC A;  5LGN A;  2CAZ C;  2CDY A;  1SA0 A;  5L3D A;  4NTX A;  3TJT A;  1Q3E A;  3O9O A;  1VQN V;  1WP8 A;  2A79 B;  4O2B A;  1GK9 A;  2EUL A;  3CYO A;  5B66 Z;  3EFF K;  4QPK A;  4FM0 A;  5KA5 A;  1Z5W A;  3I56 V;  2QA4 V;  2JDI G;  4DR1 B;  4YJ3 A;  4O4L A;  3DC6 A;  2ZD9 A;  2Q5Z A;  4XDL A;  3MHS C;  3ETD A;  1JOY A;  2IJJ A;  2PF4 E;  3MHH C;  4CC6 A;  1GM7 A;  4DV1 B;  5LMN O;  4PDV A;  2ZM6 O;  3RVY A;  3G6B A;  3UO2 A;  2JVD A;  1JR9 A;  2XHB A;  4ICG A;  4LF9 O;  2IU0 A;  1YHQ V;  2DWE C;  3CCE V;  1T5E A;  5J2T B;  3B4S A;  1AJN A;  1ZSP A;  4EEQ A;  4DV0 B;  1WP7 A;  2R70 A;  4JI2 B;  5CA0 B;  3HR0 A;  1BMF G;  2ZQM A;  1YVW A;  2GDS A;  3EHB B;  2VQF B;  2F23 A;  3UO3 A;  3ETE A;  3L71 H;  2EZO A;  3IC7 A;  1IDS A;  2VQE B;  2BTQ B;  1P4R A;  4ABM A;  3J7A U;  1SQQ H;  2HKO A;  4DV7 O;  3ZMS A;  3CCR V;  1NKD A;  1A32 A;  1Q6I A;  2UXN A;  3QVN A;  5KAI Z;  1BS3 A;  1MZE A;  1D5N A;  1QLE B;  1H2S B;  2N05 A;  1IBL B;  1PNK A;  4KHP B;  3OD4 A;  2ITD C;  3F7V C;  3OGC C;  1HR0 B;  3JAS B;  3SJB C;  1Y74 B;  2X7R B;  4LFB O;  4C7U A;  2XAJ A;  3G80 A;  4EB6 A;  2EIJ C;  1N36 O;  5CBF A;  1COW G;  1N0N A;  1V55 B;  3A0B Z;  5J2U B;  5IJ0 A;  5FLX N;  3STL C;  2ADQ B;  4FMT A;  1EN4 A;  3CD6 V;  3A0H Z;  1QNM A;  1GM9 A;  5LHG A;  2UUA B;  4LF6 O;  1K4C C;  2Y4U A;  2IM9 A;  1O9H A;  4I50 B;  4I4T B; 
#chains in the Genus database with same CATH homology
 5EK0 A;  3DTU B;  2DYS C;  3OUS A;  2D3O W;  1KC8 W;  3AG2 B;  2PI4 A;  2HLD G;  2QKS A;  5IY5 B;  2P7T C;  1M9N A;  4WF9 V;  1SRY A;  4R7C A;  3ASO B;  4MT8 A;  1KP3 A;  4JPR A;  3FYI B;  2WWW A;  1DLB A;  2NLJ C;  1CPY A;  3B8N A;  4U7N A;  4UXN A;  3AG1 C;  3RBZ A;  2P6J A;  4JAV A;  3E83 A;  5L3G A;  4QPJ A;  1KD1 W;  2WLL B;  1BHB A;  1Y66 A;  1FS0 G;  1OCO C;  1AI4 A;  4UVB A;  5B1B C;  1DF4 A;  5B1A B;  3ZIA G;  4GX0 A;  3OAA G;  4MSW C;  4N21 A;  1YTF D;  2EJR A;  3K08 A;  2H8P C;  1OCC B;  1NR7 A;  4PDL A;  3VBB A;  4FK5 C;  3E8B A;  2EIL B;  4P9P A;  4BIZ A;  1ROP A;  5L3C A;  1VQ4 V;  4TT3 G;  1ENV A;  5B3S B;  4I9W A;  1OCZ B;  4RUF A;  3WG7 B;  1G8M A;  3GB7 C;  1E1Q G;  3E8G A;  3CXC U;  3E86 A;  1W0K G;  2V7Q G;  3T1C A;  1S3J A;  1E1R G;  1VQL V;  1XL6 A;  4MVM A;  3WFV A;  2WLL A;  1RM1 B;  4J9Y B;  1V55 C;  4HAM A;  4RAI A;  2XOK G;  1K92 A;  4EKW A;  4MTG A;  1JCH A;  1R3K C;  3K9A A;  3G6E V;  1VQ6 V;  2QEX V;  4I5S A;  3AG4 C;  2OCC B;  1NH2 D;  1V54 C;  1MG1 A;  5L3E A;  1J95 A;  3E8F A;  5BZB A;  1MSW D;  4MTX A;  4WFF A;  2EBO A;  2WPD G;  3P32 A;  5EC1 C;  4UVA A;  2PI5 A;  3SPC A;  3RVZ A;  3JCZ A;  3D3I A;  3LDC A;  4PDM A;  1R6K A;  4JTC B;  2WLI B;  2B5U A;  2WLM A;  3CP1 A;  4P30 A;  2DYR B;  2Z3Y A;  4X89 A;  3CCS V;  3B8M A;  3JD2 A;  3BY6 A;  3OMI B;  2FTK A;  1Q82 W;  4ZBM A;  3ASO C;  4UV9 A;  3ZMV A;  1SET A;  2CK3 G;  3HPL C;  1I5X A;  3ABK C;  4MVQ A;  2W6I G;  3ZMZ A;  3JYC A;  2EIK B;  4DXW A;  3CC2 V;  3T4D A;  4QJF B;  3E89 A;  5LBQ A;  3OR6 C;  1AI5 A;  2DW4 A;  2HVJ C;  5CBH A;  1F51 A;  1E79 G;  1PNL A;  1LNQ A;  3ZMU A;  2IW5 A;  4XDJ A;  3W7W A;  1I5Y A;  4FIP C;  4CBC A;  2EIM B;  2ZDI A;  1JVM A;  5E1A C;  1R73 A;  1YJW V;  4H33 A;  1OCC C;  1FXH A;  4BIU A;  1SER A;  4MW3 A;  3GWO A;  4ASU G;  3FB7 C;  3R65 A;  4G27 B;  3A0R A;  1S0V A;  3OFN G;  2C2A A;  2M7W A;  3ZRX A;  1VQ7 V;  1OHH G;  3F5W C;  4JYB A;  4YXW G;  5GW7 A;  1K4D C;  3OM3 B;  3LSQ A;  3TK1 A;  4JYC A;  5LGT A;  1K73 W;  3ZCC A;  1GKF A;  1SES A;  1RM1 C;  2Q69 A;  1K33 A;  1QLN A;  1R6N A;  4P2Z A;  3CC7 V;  2AHZ A;  2B1G A;  3M99 B;  3CCJ V;  4R6Z A;  3W7T A;  1OCR C;  4KFM A;  2OCC C;  2OT5 A;  5LGU A;  2JJ2 G;  3ABM B;  1QR9 A;  3MD0 A;  1GMG A;  2A0L A;  4J9Z B;  1JX9 A;  3W7X A;  3FKS G;  5H6R A;  1JPX A;  1THZ A;  2YSU B;  2ZDI C;  2EIN B;  2JK5 C;  2WLK A;  1S72 V;  3AG3 C;  3CCQ V;  3K3W A;  2XND G;  1VQ9 V;  3W7S A;  2ZXW C;  5LHI A;  2YEV A;  3FB8 C;  4RQE A;  2XAF A;  4GX2 A;  4E2L A;  4PEL A;  2HVK C;  1L1F A;  5IYD O;  2X6C A;  3JD3 A;  1K9M W;  3JD1 A;  4GT1 A;  1KQS U;  2LFS A;  2W0F C;  1NJI W;  4RO2 A;  4LBE C;  2QM7 A;  2OTJ V;  4JF3 A;  3ZMT A;  3X2Q B;  1VQO V;  1RPO A;  3SPJ A;  3SJQ C;  3B77 A;  5HFL A;  4DO2 A;  3ASN C;  3G71 V;  4GCZ A;  1AJP A;  1SZT A;  1QLE C;  2HG5 C;  1M56 B;  2Z5U A;  3IGA C;  4XDK A;  2EIM C;  1K7D A;  3OEE G;  1Q7Y W;  3SPI A;  1NH2 B;  3ZN0 A;  1KEC A;  4G2K A;  2R9I A;  4P9O A;  4LC1 A;  1CEZ A;  2JJ1 G;  1W0J G;  2DQ0 A;  1PL0 A;  2MK3 A;  4HZ3 A;  4GX1 A;  1EBO A;  1R3L C;  1G4Y B;  4U7O A;  4X88 A;  4WFH A;  3ZJZ A;  5H9C A;  1OZ0 A;  1EZJ A;  2GHY A;  2OTL V;  3K03 A;  4OXS A;  1AJQ A;  2Q67 A;  4JTD B;  3W7U A;  4CZZ A;  4KP4 A;  5CMU A;  5B1N A;  2QE7 G;  4MVU A;  1DTO A;  2IH1 C;  3E2E A;  1WPX A;  5CBG A;  3D36 A;  2QTO A;  1F4M A;  3ABM C;  2EIJ B;  3I55 V;  3CCV V;  2V1D A;  4PA7 A;  5FL7 G;  2B1I A;  3K0D A;  3FYE B;  1M90 W;  1VQM V;  3AG2 C;  1K34 A;  1EFR G;  1GTO A;  2ZR2 A;  1M57 B;  5IY5 C;  3SYA A;  1FFT B;  1R3J C;  1CP9 A;  2GSM B;  4BAY A;  1VQ5 V;  2X6A A;  1GO3 F;  3ETG A;  1HWY A;  4QE7 A;  5IYB O;  1PKX A;  1BHA A;  4UVC A;  1UJW B;  4PA4 A;  5J9P C;  1Q86 W;  1YIJ V;  3SPG A;  2HR3 A;  1W2B U;  1JJ2 U;  2DYS B;  3ZRV A;  4WFA V;  4MW8 A;  2F43 G;  4XBF A;  1P7B A;  3X2Q C;  4ZKI A;  5B1A C;  4FJC C;  3OEH G;  2XAH A;  3G4S V;  3T4Z A;  4UUJ C;  4MTF A;  4MVZ A;  4JGS A;  2WLI A;  3SYO A;  3AG1 B;  4Q20 A;  3T2M A;  3CCM V;  2EIL C;  2W6J G;  1WLE A;  1VQP V;  2BOC C;  3JD4 A;  3ZRW B;  4BW5 A;  1B6Q A;  4MTO A;  5B3S C;  3F7Y C;  2ZR3 A;  2IJK A;  1OCZ C;  3WG7 C;  2HFE C;  1OCO B;  3SYQ A;  3OMN B;  4TWK A;  3LSS A;  1H8E G;  3IFX A;  3NXS A;  2WLJ A;  4MVO A;  1QBZ A;  1Y4M A;  1PNM A;  2XAG A;  3OMA B;  5HFM A;  2LFR A;  1NBM G;  2AHY A;  3ABU A;  4QE9 A;  4WFE A;  4FPP A;  4RUE A;  5EBW C;  3CCL V;  3K79 A;  4R50 A;  3E35 A;  4G28 B;  4QIW F;  1IXM A;  2HJF C;  1M1K W;  4MVS A;  3AEI A;  4MS2 A;  1VQK V;  1RPR A;  3TCU A;  2UXX A;  4LCU C;  2WLH A;  1YTF B;  1KP2 A;  4RQF A;  3P30 A;  2H94 A;  3STZ C;  1M57 C;  3K0G A;  1ZWI C;  3HB3 B;  1AI7 A;  1ORQ C;  2DYR C;  4WCE V;  1YJN V;  4JAU A;  2ITC C;  3AG4 B;  3LDD A;  1YSC A;  3FB6 C;  1NVP D;  1V54 B;  4R8C A;  2DWD C;  3K04 A;  1FXK B;  1S5H C;  3VOU A;  1Q81 W;  2WAM A;  2EIK C;  3ZRS A;  2JEX A;  4H37 A;  1S76 D;  1QVG U;  3QO5 A;  5CA3 A;  4QNH B;  4PA3 A;  1XL4 A;  3BEH A;  2A9H A;  3OR7 C;  5LGN A;  5L3D A;  3ABK B;  3RW0 A;  1K97 A;  1VQN V;  1YIT V;  4KUM A;  4X8A A;  5L3B A;  5EBM C;  1K3E A;  2A79 B;  1YI2 V;  2IJI A;  2EZP A;  2X0L A;  1GK9 A;  1NQT A;  3CYO A;  4GX5 A;  3EFF K;  4QPK A;  1MAB G;  1FXK A;  5DN6 G;  2R9R B;  3CMA V;  1R3I C;  1QCE A;  5KA5 A;  3CCU V;  3TET A;  2NNU A;  3CPW U;  4PA9 A;  3I56 V;  2QA4 V;  2JDI G;  1H38 A;  2QM8 A;  2ZD9 A;  5L3F A;  2X6B A;  4XDL A;  3MHS C;  3ETD A;  1JOY A;  2IJJ A;  1AR1 B;  3QNE A;  3MHH C;  2P67 A;  1QR8 A;  3ABL B;  3JD0 A;  1GM7 A;  1KKD A;  1F4N A;  3LNM B;  4MVR A;  4PDV A;  5DM6 V;  4LP8 A;  2JIZ G;  4WFB V;  4PDR A;  2Y69 B;  3OUF A;  2WLN A;  2EIN C;  2WSS G;  3SYP A;  3QO7 A;  3RVY A;  5EBL C;  3SYC A;  3ML0 A;  1OCR B;  2IU0 A;  1YHQ V;  2DWE C;  3CCE V;  5B1O A;  1DF5 A;  4UV8 A;  5KA6 A;  1AJN A;  1FXK C;  1QVF U;  2K1E A;  3DGE A;  1S77 D;  1K5S A;  2DQ3 A;  1PD3 A;  2Q6A A;  3AG3 B;  2IH3 C;  4JAS A;  1BMF G;  2ZXW B;  1BL8 A;  2ZQM A;  2Y48 A;  2LP7 A;  2KB1 A;  3ABT A;  3EHB B;  1NR1 A;  1K8A W;  5IYC O;  3K06 A;  3ETE A;  1M56 C;  2EZO A;  1N8R W;  3IC7 A;  3OW2 U;  4PA6 A;  3FB5 C;  3H01 A;  5KUM A;  1AI6 A;  4WFG A;  2XAQ A;  1P4R A;  2HKO A;  1ARO P;  3QO8 A;  3ZMS A;  3CCR V;  1NKD A;  2XAS A;  5B1B B;  5LHH A;  3UKM A;  2UXN A;  3PJS K;  3ASN B;  4HYO A;  1GM8 A;  1QLE B;  3LDE A;  1PNK A;  5EC2 C;  1F23 A;  1NVP B;  2ITD C;  3F7V C;  3OGC C;  1TUE B;  3KG2 A;  1H2G A;  1H8H G;  3UM7 A;  1MOF A;  4TSF G;  3CC4 V;  2X7R B;  4F4L A;  4JTA B;  2XAJ A;  2EIJ C;  2IJH A;  3ABL C;  3E8H A;  3ZRW A;  2P90 A;  2YEV B;  5CN0 A;  3CME V;  2Q68 A;  5CBF A;  1COW G;  1V55 B;  1K5Q A;  2Y69 C;  3LUT B;  3ZN1 A;  1JQ0 A;  2ATK C;  3STL C;  4Z1M G;  4FMT A;  3OE7 G;  3CD6 V;  3SPH A;  2JEU A;  4L87 A;  5C93 A;  1FXV A;  5IDJ A;  1GM9 A;  2IU3 A;  5LHG A;  2BOB C;  1YJ9 V;  4N23 A;  1K4C C;  5KUK A;  1VQ8 V;  5H6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...