4PA3A

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa3A00
4KFMA 4JTDB 4R50A 2K1EA 4MVSA 4MVUA 3SYAA 3ZJZA 4H33A 1V55C 3ASOC 2EILC 4MS2A 2AHZA 4MTOA 3SYPA 5J9PC 4PDRA 3K0GA 3FB6C 2BOCC 3OUSA 4X88A 4I9WA 3K03A 2W0FC 1P7BA 4DXWA 5E1AC 2WLLA 5EBLC 2A9HA 3LDCA 1J95A 3LUTB 3E89A 1OCOC 1ORQC 2ZD9A 3E8FA 4MW8A 4XDLA 5CBGA 3LNMB 1S5HC 2ITDC 4WFHA 1BL8A 4G28B 2ZXWC 4P9OA 3STZC 3AG3C 2X6BA 1XL4A 2ATKC 2HVKC 2DYRC 2QTOA 2BOBC 5EC2C 2IH1C 4CBCA 3E86A 3LDDA 2IH3C 1KKDA 4UUJC 2A0LA 2WLHA 3T4ZA 3X2QC 1V54C 1ZWIC 3FB7C 3ZRSA 5KUKA 3T2MA 1OCCC 4LBEC 4PDMA 4J9YB 4PDVA 4P30A 3AG2C 4GX1A 4PA4A 3UKMA 3K06A 1K4CC 5CBFA 1K4DC 3K08A 5EBMC 3VOUA 4JTCB 2WLIB 3K04A 4X89A 2DWDC 4ZBMA 3K0DA 5KUMA 3GB7C 3SJQC 4JTAB 2WLJA 1M56C 2NLJC 2HJFC 3ABLC 3OR7C 4PA3A 2AHYA 4HZ3A 5B1AC 1R3JC 2A79B 1M57C 3IGAC 2X6AA 3KG2A 2EIKC 3FB5C 3TETA 4MVRA 3ABMC 4MVQA 4QE9A 2Q69A 3EFFK 4R8CA 3ABKC 3PJSK 4MW3A 4P2ZA 2ITCC 4WFEA 4LP8A 3F7VC 4HYOA 3T4DA 4PDLA 3RVZA 4GX5A 1XL6A 4RUFA 2X6CA 3WG7C 3T1CA 4RUEA 2YEVA 4TWKA 3SYOA 3ASNC 4GX2A 2HVJC 3JYCA 3RW0A 1OCRC 2EIJC 4XDKA 4RAIA 5EK0A 5B3SC 2OCCC 4MTGA 3R65A 1OCZC 4MVOA 4R6ZA 3SPHA 3SYQA 5CBHA 3HPLC 3SPIA 3E8GA 3E8BA 3RVYA 3SPCA 4EKWA 2QKSA 2HFEC 2WLMA 3F7YC 5EC1C 2Q68A 3BEHA 2WLIA 2WLKA 5IY5C 1R3LC 5B1BC 2EINC 3SPGA 1R3IC 4G27B 4P9PA 1R3KC 2WLLB 3IFXA 2Q67A 3OR6C 2Q6AA 4GX0A 3AG1C 4MVZA 2DYSC 2H8PC 5EBWC 4PA7A 2DWEC 4MVMA 4X8AA 5BZBA 4QE7A 1JVMA 3FB8C 3TCUA 2EIMC 2JK5C 3RBZA 4WFGA 3SPJA 3STLC 2HG5C 3OUFA 4OXSA 4PA9A 3AG4C 2R9RB 4MTFA 4BW5A 3E83A 4WFFA 4QNHB 4J9ZB 3SYCA 2KB1A 1QLEC 3OGCC 4XDJA 3UM7A 2P7TC 3E8HA 3LDEA 4H37A 1G4YB 4MSWC 4PA6A 2WLNA 3F5WC 4RO2A 2Y69C 4R7CA 4F4LA 4LCUC 1LNQA
chains in the Genus database with same CATH superfamily
1THZA 3CX5F 4MVUA 1N8RW 3QG5A 1XHXA 3VBBA 3MDSA 3WU2Z 2W0FC 1S0VA 3KCYA 1URFA 3E22A 1OCOC 5CA3A 1XMOO 5CA0B 4G2KA 1P84F 1YTFB 4D7TA 1Y76A 1WP8A 3ETQA 5KHKA 1KP3A 1QVGU 3ZRVA 4X1YA 4LNUB 5FLXN 4UUJC 5KA6A 3FB7C 5CA1A 4JGSA 1MSWD 4GX1A 5GTIZ 3AG7A 2WA4A 2ZE6A 2DWDC 4KP4A 3K0DA 4NXNO 3ABMB 2HEPA 2WLJA 2NLJC 2P5OA 2AHYA 1HNWB 4HZ3A 1AI6A 5B1AC 3ZS8C 3W7WA 1NS1A 1SA0A 4JI5B 1EN4A 4CS2A 2YIDA 3ABKC 4RWUA 4JYBA 4DV1B 4RUEA 1NU1H 3RW0A 2HVJC 1Z2GA 3CS5A 3TXSA 2OCCC 4UCRA 1RM1B 5KAIZ 5IYDO 5IT9N 3E8BA 5KMGB 1R6KA 2IW5A 5B1BC 3RGBA 3AG1C 3AEIA 1D5NA 3MAQA 1AI7A 4DR4B 1YDXA 5C8YB 5EZYB 1M93A 4TOIA 4NTWA 3L73H 4CS3A 3ASOB 5LGNA 2QM4A 2Y48A 1TVKA 3DGEA 5IDJA 3IAYA 1N4CA 1XNQB 1FPOA 3H1JH 3J80N 5BMVB 5KHJA 4IGGA 2VS0A 2Q7GA 4DXWA 5LHIA 1HNWO 1DF5A 2E5LB 4L87A 1CEZA 4JI5O 2B1GA 2ZE5A 3ZMZA 1I94B 4O4IB 5K1PA 3UCSC 3DSQA 1V54B 3HKBB 3CCMV 2XAFA 1H2SB 1S5JA 2IH1C 2YEVB 4DV1O 5FPRA 2IH3C 1JX9A 2YI8A 4CH5A 5JQGA 4YJ2A 2UXXA 1QVFU 5CBFA 2GSMB 2P6JA 2ZNJA 3SJQC 1M56C 1DF4A 1ROPA 3ZMUA 4ZHQB 4LF4B 5L3CA 4DR4O 4GT1A 1EN6A 5B3SB 3ETEA 2CGOA 1WAZA 4UB6Z 4FM1A 4F6RA 1GN2A 1VQLV 4TWKA 1MOFA 4ABMA 1H8EG 4BAYA 5H6RA 3R65A 2NNUA 4O4JB 1XNQO 4O4LB 1FXHA 3CMEV 3F7YC 2JDIG 1ENVA 2QTSA 4MTXA 2E5LO 2Q6AA 3D3QA 2MK3A 3DTUB 2DWEC 1FXVA 1I94O 1B04A 3J81N 1SQPH 5J2UA 4K35A 1J5EB 1GKFA 2R9RB 3H1IH 5JCOA 3ZMTA 1V55B 1KU9A 1PP9H 1G4YB 3ZHVA 4ZOLA 3PN1A 2K1EA 4MVSA 3APOA 3N2GA 3J7AU 5B5EZ 2HKOA 3K5MA 4EFBA 1SZTA 4LFBB 2FTKA 1K5QA 4LF4O 3JALB 1WLEA 4LF7B 3LDCA 1YEWA 4HNAA 1UPGA 4I4TB 1B06A 2Z0AA 3ZRWA 1WJZA 2ZXWC 1QNMA 3H1LH 3RYFB 3STZC 2DYRC 4BIOA 3CXHF 3LDDA 4X1IB 1Q90D 2WLHA 3RYHB 3ZEDA 2ZCEA 3SDLA 2XTAA 2WLIB 1R6NA 4LWSA 1VF6C 3RYIA 2HP8A 1Q7YW 2CE4A 2CH7A 4MVQA 3KKYA 5LYJA 4J7JA 3FKSG 2ITCC 3FAVA 2GBOA 3T4DA 4JYAB 3ASNC 1K33A 1JCHA 4LH7A 3HKEB 3QO5A 4A5UB 3MHHC 4NXMB 1PNMA 1Q6HA 4DR7B 1IVSA 4WCEV 4YHHB 2UXDB 3DXRA 3L75H 4LFBO 1R3IC 4P9PA 3BVOA 4GKKB 1R3KC 1FJGB 3OAAG 3HKDA 4FJCC 4LF7O 5JJNB 1KD1W 4JYCA 4PA7A 4MVMA 1XBLA 5BZBA 2V4DA 2IJJA 4JI2B 4DRXA 3SPJA 4OXSA 1XUQA 3N2KA 1H2LA 2KSDA 3E35A 4RQEA 4AHCA 4DV4B 4IHJB 4X62B 4JTDB 3CP1A 1SQGA 3SYAA 2WA3A 3OMAB 5IYZB 1TUEB 3DC6A 1GN4A 1FXKC 4OGQB 1HNZB 2YIAA 1VQ4V 3ZIAG 2EULA 1D5AA 3M7MX 3X2QB 2XUMA 2WWWA 2BTOA 2ATKC 2K9PA 4JYAO 3E86A 2JVDA 3OMNB 1JOYA 1FS0G 3K5OA 3T2MA 1K7DA 4NXMO 1ZUQA 4JI3B 1Q3EA 5L3GA 4DR7O 5EBMC 1BHBA 2XASA 5LHHA 4YHHO 2UXDO 2ILMA 3GB7C 4GKKO 4YXWG 1SERA 1FJGO 1MG1A 3D8CA 3OR7C 3HKCA 3JAKB 2LW7A 5KX5A 3WG7B 4MVRA 3CMAV 4JI2O 2UUAB 4PHZA 1OCZB 2EX3A 4ICGA 2B9ZA 4RUFA 1QR8A 1YITV 4DV4O 5EK0A 2LQTA 1LR1A 5LOVA 2RMKB 4X62O 3UT5A 3A8TA 1NTMH 1BZKA 1T5EA 3G67A 4I5SA 3ML0A 2QWOB 3JARB 5JH7B 2Y0PA 3OR6C 1IZ3A 2F23A 2H8PC 1HNZO 4B7EA 1NR1A 4O2BB 3AG4B 3JASA 4XBFA 1K34A 3RBZA 2BE3A 1WPXA 2E76B 3B8NA 5IJ0A 2OYQA 1KP2A 5DEDA 5HFLA 2JRIA 4MTOA 2O57A 4O2AB 4JI3O 4W4LA 3ZMVA 3CRQA 1G1XB 2EILC 1Q43A 5KHIA 1OCOB 1K8AW 3C3TA 3H1KH 1P7BA 2F1MA 1YHQV 4X64B 1IX9A 3I56V 1CPYA 2FYUH 3O9OA 2CAZC 4B3MO 2GUZB 2UUAO 4P9OA 3BABA 1VQ5V 3CPWU 3FX7A 3LNNA 4DV7B 4X9QA 4ZIBA 2QDOA 5B1AB 4H0LB 4JTCB 1BE3H 2HJFC 4FPPA 2P67A 3ABKB 4U7OA 5LGTA 3FFQA 2GV9A 2YC0A 2UUCO 5DN6G 2QA4V 4H13B 5CA0A 4UXNA 4DV6B 2OCCB 4LC1A 3RVZA 5FNVB 4E4EA 2H3OA 5IYCO 4J10A 1NVPD 4TUYB 1WP7A 4R6ZA 3TXQA 4U7NA 4UCVA 5B1BB 4FFBB 4FLWA 5C93A 3B09A 5CB4B 1V9PA 2XAQA 3AG1B 5LGUA 1SQVH 2WLMA 3OFNG 4JZ2A 4NTYA 3ZHUA 3K5NA 2AZ2A 4X64O 1KECA 4QE7A 1JVMA 1KKCA 3H01A 2JK5C 4K8XA 3JATB 1U97A 3T1HB 1S77D 2ZR2A 4DV7O 2ZE7A 3CD6V 3D3IA 3QF7A 1BSMA 2A06H 1JA8A 1AR1B 1L1FA 1LNQA 3QO8A 2AHZA 1M5IA 4ZI7A 2FL4A 4FK5C 1BHAA 5KMGA 1VQKV 3K03A 2VWKA 2A9HA 4MT8A 3L70H 3OD4A 2CTQA 3QVNA 1MABG 4BW9A 1FFXB 5KLVH 4DYLA 1HWYA 5IWAB 4QJFB 1E79G 5IE9A 5B1OA 1M56B 4BWAA 1XNRB 1XREA 2P90A 3K57A 3VQWA 3T1YB 5BMVA 3B4SA 3U10A 1R3JC 5JWPA 2PUSA 1W0JG 1H8HG 2M6YA 2EIKC 3FB5C 3TETA 3JD2A 3G6BA 3FYEB 2Q7HA 3S3XA 5IJ9B 3T1HO 3QNEA 2YEVA 4GX2A 5K1XA 1HNXB 2W6JG 1VP7A 3CC7V 3SPIA 1S76D 1I5XA 3W7TA 2DE0X 2IU0A 4FLYA 2W0XA 4ZHQA 4LF5B 1QLNA 4FVMA 1EZJA 3SR2C 2XOKG 3OUFA 1JJ2U 1WB8A 5IWAO 3K59A 1X4TA 2P7TC 1JFFB 1NR7A 1XNRO 4I50B 1XMQB 4R50A 2ZIOA 4BIZA 2RDCA 4JF3A 4H33A 3QTCA 3T1YO 1DGSA 3OMIB 1FD9A 2ZXWB 1GO3F 4CC6A 4KL1A 2DYRB 3EVKA 2F43G 3A0RA 2RN9A 1L8DA 1WA8B 2QTOA 4I55A 3OEHG 1HNXO 1KC8W 3ZRSA 3CHXA 4DUYB 2ZQMA 3GWOA 1SS3A 3ABTA 2UXNA 2PF4E 2OWOA 2YUAA 1Y67A 3B8MA 4Q20A 4CS4A 5D5QA 4PA3A 3UO2A 3ZRXA 4LF5O 4JASA 4DR6B 3P32A 2YDEA 4I4TA 2IBZH 2Q69A 1P49A 2R72A 1PNLA 3E22B 4P2ZA 3RYFA 1XL6A 4NYKA 3JYCA 1OCRC 1H38A 3ZN1A 3RYHA 4LF9B 1YF2A 3FD9A 4X1YB 5B1NA 1XMQO 3ZHRA 3JD3A 2QKSA 3W7UA 4K3AA 4YJ3B 3BEHA 2WLIA 1NT2B 4J7KA 4LF8B 2YS8A 4TV8B 1VQNV 3C3SA 2IJIA 3S3WA 3CC4V 4DV3B 2L6LA 3FB8C 1SA0B 4JI6B 2XAGA 4D6TH 1F23A 4DUYO 1PM9A 4F4LA 4PJ0Z 4PI2A 1TA8A 3HKEA 1IBLB 4LH6A 1FXKB 2R9AA 1E1QG 1XDCA 2KG7A 4MS2A 2VWJA 2BOCC 4UVAA 3OT7A 3K9AA 4DR6O 1K5SA 1Y66A 2CDYA 3QO7A 4Z1MG 3CB2A 3N27A 5EIBD 2OTLV 1BL8A 3AG3C 4X20B 1YCIA 3VQVA 3L72H 1KKDA 1P7GA 4LF9O 2QGNA 3CCEV 5LP6C 3R66A 1K4CC 2WSSG 3K08A 4IHJA 3VOUA 1OJHA 4F6EA 4LF8O 3ABLC 1NTKH 2G38A 2F66C 2EBOA 4DV3O 1I0HA 1NKDA 1F4NA 1KUQA 4AQYO 3K5LA 5FL7G 1R6TA 5KAFZ 4JI6O 4GX5A 4UB8Z 1U96A 2EIJC 2IU3A 3ZCCA 2UXBB 3NR7A 1TAEA 3AK1A 2R70A 1IBLO 3SPCA 1VQ8V 1RPOA 3CCUV 5JQGB 2EINC 2WLLB 1EN5A 4GX0A 1K73W 2DYSC 2UUBB 5JVDB 4IT5A 3JAKA 1OZ0A 2EIMC 1HR0B 1PD3A 5IYBO 4B3SB 4PA9A 2B1IA 4FIPC 3O65A 1GH6A 4QNHB 2QSAA 3SYCA 2KB1A 1QLEC 2EILB 4NR1A 4L8JA 2Y69C 4R7CA 4N21A 4JI8B 3GWKC 3JD1A 2JGDA 3FB6C 5GW7A 3ABUA 1ZAUA 3JARA 1SESA 5JH7A 1J95A 2LGQA 4JPRA 1BQZA 5CBGA 1KBHA 1GM9A 4WBNA 5GTHZ 3CEIA 5J2UB 3C90A 1LUWA 4QIWF 4NTXA 5HFMA 1PNKA 2UXBO 1M9NA 1OCCC 1PKXA 3UKMA 3JAWB 4O2AA 1K4DC 2AXTZ 4ZOLB 4PELA 2LP7A 3WB0A 1WB7A 4FLTA 3JD0A 5KUMA 2ZNIA 2ETNA 4JTAB 1GTOA 3N2GB 3ZMSA 4B7KA 2LFRA 1M57C 2UUBO 3RYCA 4IIJB 1HR0O 4JZGA 4DV0B 4B3SO 1YZBA 3CE2A 4JYYA 3ZN0A 1MNGA 3ZRWB 4UCSA 3ETGA 2F93B 4JAUA 4FLZA 5LHGA 3CCRV 3P3PA 4TQFA 3RVYA 4JI8O 3IC7A 1Q8IA 1JMKC 2JS3A 5CMUA 2A7WA 1AJNA 1Q86W 2VQEB 4LWSB 4B3MB 1CP9A 4FM0A 2OIEA 1O9GA 2UU9B 1SZXA 2Q7EA 1DK1A 1SRYA 1Y74B 2CH7B 1L0NH 4TV9B 3BRCA 1BMFG 3D36A 3FAVB 5FNVA 4BW5A 1NQTA 5LXTB 2QWNB 2F95B 4OPHA 1SQBH 1YJ9V 3H9VA 3K79A 4O4HA 4FFBA 5CB4A 3ZJZA 1HW7A 4B3TB 4WFBV 3IJ4A 1JJOA 2Q0AA 3I5DA 2UUCB 3DXRB 4JI4B 1F7YA 1RPRA 1XQ8A 5BXZA 5LA6B 5L3DA 4DV0O 3CCQV 1YVWA 3JATA 5J2TA 3U0ZA 1YI2V 2GTSA 1VQ7V 3N2KB 3WFVA 1SF9A 1GM7A 3VQXA 4EEQA 3JSLA 2P4VA 5GONB 2FB5A 3AG2C 2ZE8A 3F5TA 1MSDA 4LF6B 3K04A 4X89A 2EIKB 4LFCB 3A2FA 4LR3A 2VQEO 1MA1A 2ZINA 4I0XA 1R73A 3KG2A 4DV5B 2UU9O 5EYPB 1N0JA 4UVBA 4R8CA 2CUGA 1GMGA 4WFEA 5JJJB 1ZL8A 4PDLA 1FFXA 1GK9A 1YJWV 3B77A 1WNSA 4K8ZA 2RJZA 3UO3A 4U3FH 1F4MA 4MVOA 1NBMG 1BT8A 5CBHA 4X66B 1EFRG 5L3BA 2OTJV 5JCOC 2HFEC 3WB1A 1ZX3A 4B3TO 2EJRA 1YTFD 2OIGA 5EC1C 2Q68A 5IY5C 2KQXA 4CZZA 1VIBA 5EIBC 4JI4O 4J80A 4MVZA 3BPZA 3I55V 2LJ2A 2E75B 4X8AA 3TCUA 1XOUA 2CTRA 1GRJA 5H2FZ 3LSUA 1QU7A 4LNUA 2HG5C 5IJ9A 1UFIA 2PYLA 1LUVA 2YXHA 4J9ZB 2R9IA 2QWPB 3LSQA 1VQ6V 4TT3G 4CH4A 2ZM6B 2V1DA 4DW1A 4UCOA 4LF6O 5J9PC 3M8AA 4LFCO 4PDRA 1I7FA 3OUSA 2GDSA 5ITZB 1RSOB 2N74A 4DV5O 1Q81W 1NZ6A 1EZVH 1A32A 1S5HC 3IC9A 2ZT9B 2AW9A 2BTQB 4DK1A 3L74H 4CBCA 2PI5A 2RQ6A 1ZWIC 4FZ0A 4LBEC 4X66O 1JFFA 1QHTA 4I50A 2QM8A 4D7SA 1I5YA 4ZBMA 1H2GA 5TISZ 1VQOV 1K3EA 1K97A 1TGOA 5KHGA 2Q0OC 4J41A 5C8YA 1G8MA 1XI1A 4QE9A 3G4SV 3UQ8A 1OCRB 1BCCH 4FMTA 4MW3A 5EZYA 2QJ1A 1WA8A 2CGNA 3CJHB 3T1CA 3P3NA 4J11A 2P06A 1M4UA 1DLBA 3BFRA 4QPKA 2ZM6O 4UV9A 2Q8VA 3E8GA 4C7UA 1JR9A 4IL6Z 1VF6A 4ZKIA 1HP8A 1NH2B 3Q4HB 1I08A 4KXRA 1SKVA 3SPGA 2LW1A 1AVMA 4O4IA 1W0KG 3HKBA 2HR3A 2YI9A 4K0KB 1SQFA 3STLC 2BSKB 3W7XA 3CCJV 2P4KA 4X1KB 4GYCB 3L71H 4IYHA 2V7QG 1QR9A 2JJ1G 3BA8A 1TUBB 2WLNA 2QM7A 3F5WC 3THOA 5L3EA 1OHHG 2N04A 2PI4A 1S5LZ 5LMNB 4GCZA 3E2EA 3GVMA 5H6QA 4YJ3A 1NVPB 3CC2V 4I9WA 5LL6Y 1KB9F 3CCVV 1NTZH 4TV8A 1FAFA 3K9SA 3AG3B 3P30A 4BIUA 3EXAA 1B3QA 2PYJA 4MW8A 3A0HZ 4WFHA 1IBKB 1GAXA 4G28B 4U3JB 4YIPA 3ZHSA 4WF9V 5LP6B 2PGGA 4PV1B 4FLXA 1PL0A 4WFAV 4DR1B 2D3OW 1N0NA 3OM3B 3T4ZA 4O4JA 5KA5A 4O4LA 1US6A 3ABLB 3SGIA 4DR3B 1FXKA 3DC5A 4FLVA 3U11A 2RCVA 1F51A 1BS3A 3D36C 2QKCA 3RFRA 1GM8A 3CYOA 4ZI7B 5AG2A 3JCUZ 1S3JA 3EFFK 4K0KO 2EIJB 2D2CB 1RP3B 3F7VC 2ADQB 4HYOA 2P22C 4EB6B 1R1BA 4X20A 4UCTA 3AK2A 4DUZB 1W2BU 4XDKA 2Y4UA 4B3RB 4JI0B 1VQ9V 2OCHA 4Z2WA 2EINB 4HAMA 1WN7A 4EKWA 5LMNO 3OGIB 2AGAA 2DYSB 3MHSC 5DECA 4TSFG 2JIZG 1Q6UA 3JALA 1R3LC 2H94A 2EIMB 4NKGB 2DW4A 3IFXA 1X59A 4GLXA 1KMIZ 1L0LH 3ASNB 1VF7A 3BCCH 1YXBA 3JD4A 1IBMB 1CXZB 2Q4PA 3SJBC 5A2QN 1QLEB 1Y76B 2LGWA 2WAMA 4HBNA 1IBKO 1AJQA 4X1IA 4LFAB 2Y69B 2MW2B 2ZDIA 2CTPA 1UJWB 4DR1O 4XDJA 5CA1B 1W59A 1BQ0A 4DR3O 3RT3C 2DQ0A 5E79Z 1AB3A 3K0GA 1YSCA 2DOSA 5DM6V 2C2AA 2QEXV 5E1AC 2WLLA 1NI8A 4W4KA 4AQYB 1M1KW 3OEEG 5JVDA 3LNMB 3OTOB 3A0BZ 1OCCB 2HVKC 5EC2C 4BR6A 2ZIMA 4DUZO 3B2EE 2A0LA 4B3RO 4JI0O 1N33B 4H44B 1JPXA 3HB3B 3H1HH 1ZTEA 4IYIA 1AR5A 2YIBD 2HLDG 4EFEA 3ZX6A 4FLUA 2AZ0A 3JCZA 1M57B 2OT5A 3LSSA 2QE7G 4UVCA 2ARHA 2YIBA 2GTAA 1B6QA 2NN4A 3ABMC 2VQFB 1IBMO 3ICXA 3RWRD 4I9QA 4B08A 1VARA 4LP8A 4LFAO 4Q6GA 3TK1A 1YIJV 2ZKOA 4JV5B 1TVKB 1E1RG 4I55B 1BGYH 1Q82W 4ASUG 3CCLV 5F2VO 5IYZA 3JAWA 5A9GA 4CC5A 1RM1C 1O9HA 4JI1B 3SJCC 4RQFA 1Y6XA 3WB2A 2JS5A 2N05A 1XHZA 1MMMA 4IIJA 3OTOO 2Q9LA 1PPJH 3CRAA 4MTFA 1JQ0A 3UM7A 1N33O 3E8HA 3LDEA 4PA6A 1IXBA 4DV2B 4RO2A 4YJ2B 4PD4F 2LO1A 1N34B 4KUMA 5BR8B 2EZOA 3ASOC 4AILC 4YIOA 3BHPA 2CK3G 2DMXA 4JAVA 1PV0A 3LUTB 3E89A 1ORQC 2ZD9A 2VQFO 1VEWA 1N32B 5H5NA 1Y74A 4F6RB 2LFSA 4TV9A 3AG2B 4JV5O 1V54C 2QWRB 1J5EO 1ZSPA 1P4RA 5LXTA 2YSUB 3TJTA 1GN6A 4PDMA 1MZFA 4P30A 4PDVA 1H2NA 3JAMN 4TQDA 1SC5B 4JI1O 2KG7B 4O2BA 4UFZA 1SETA 4JAAA 4NVPA 3BY6A 5CN0A 3MD0A 3B40A 3CRRA 2NR5A 3PJSK 4X65B 5LA6A 2B5UA 4QPJA 1MZEA 1N36B 2X6CA 1KQSU 2Z3YA 3SYOA 1H2MA 4NB5A 5B3SC 4DV2O 3BAAA 4MTGA 2DQ3A 5IY5B 3SPHA 5GONA 1N34O 5BR8O 4KHPB 2VRZA 4HNAB 3G6EV 2UXCB 3CSXA 2GUZA 2Q73A 3CCSV 1N32O 5EYPA 5JJEB 4WFGA 2HHHB 2CTWA 4FFKA 2YXLA 3RN4A 3G71V 3OW2U 3E83A 4WFFA 1AJPA 1K9MW 2JGUA 5B66Z 4H37A 1Q5OA 2A3QA 2XAHA 1AI4A 2E74B 1V55C 3SYPA 1AP5A 3RYIB 4X88A 3KCXA 3L9DA 1AI5A 5EBLC 5LYJB 4XDLA 3BA9A 2FMLA 2X0LA 3FYIB 4X65O 2X7RB 4JI7B 1N36O 1GN3A 4TUYA 3HR0A 4CH3A 5L3FA 1RFYA 4J7ZA 1WPBA 1YJNV 4J9YB 2JEUA 3EHBB 2RNBA 2ZDIC 4I7ZB 4KHPO 1Z5VA 2JEXA 2JJ2G 3HKDB 1G6UA 4GZRB 3M99B 3ZBHA 1IDSA 4J42A 1AR4A 1XILA 2A79B 2L35A 2JGDB 4UCUA 3IGAC 2IJKA 2IM9A 5ITZA 1RSOA 5LMUB 2UXCO 4DR2B 2YICA 4UV8A 2HHHO 4DRXB 1SQQH 2BTQA 2QWQB 4WBNB 1QBZA 1KYOF 3NXSA 2ODMA 4RAIA 4DR5B 1S72V 1D2DA 1Q6IA 3OTFA 2F4VB 3SYQA 4FM2A 1QCEA 1OV9A 2PY5A 1NJIW 3SJAC 5H9CA 1AP6A 1SQXH 2EZPA 2WLKA 1XEQA 1HDJA 2Q67A 3VQYA 4N23A 2Q5ZA 1ZLZA 2XAJA 3JSNA 4QGPA 3CXCU 3OE7G 3RYCB 2KKWA 4OX9B 4JI7O 4E2LA 1EBOA 4GKJB 3ZHQA 2M7WA 1QQCA 3CJHA 1DTOA 3OGCC 1NH2D 1PL4A 4MSWC 2EJ7A 1FYJA 2DN9A 2Y4TA 4LCUC 2ADPA 1H2KA 4KFMA 3APQA 4GUNA 3ETDA 2W6IG 1COWG 5LBQA 3Q4HA 1K92A 3CRMA 1M90W 4DO2A 3HKCB 2HJDA 5KX5B 2IJHA 5LMUO 4DR2O 3E8FA 2ITDC 2X6BA 1XL4A 2BOBC 1FKAO 1FFTB 1Z5WA 2BSKA 1AILA 1VQPV 4YY3B 2DJVA 4X1KA 3KZIZ 2Y0IA 4DR5O 3X2QC 5KUKA 5FPOA 2XHBA 2F4VO 5LOVB 1TUBA 3CWBH 3UT5B 2BCCH 4PA4A 1AROP 3K06A 4FZ1A 1Y4MA 4O4HB 4DW0A 4AI8A 3K58A 5KHHA 2X6AA 2XNDG 3JASB 1XMOB 4PI0A 1IURA 1VF5B 2WPDG 2ZR3A 5IJ0B 4OX9O 1VQMV 4U3JA 2GHYA 4GKJO 3WG7C 5LP6A 2QR4A 5J2TB 2XT9A 2E3CA 2Z5UA 3TGUH 1OCZC 1EM1A 3HPLC 3ZHTA 4CH6A 3CRCA 4DK0A 3W7SA 4NXNB 4G27B 2QKAA 5D5PA 1VMGA 2PTMA 5EBWC 1IXMA 4OPAA 3AK3A 4Z1VA 4I0XB 5BY1A 3K3WA 4EB6A 3AG4C 4YY3O 2YXYA 4DV6O 1ZL8B 2PZSA 2FKXA 3G80A
chains in the Genus database with same CATH topology
4N21A 1THZA 4MVUA 3ZMVA 3JD1A 1N8RW 2DQ0A 2EILC 1OCOB 1YSCA 3K0GA 3FB6C 5GW7A 3VBBA 1K8AW 3ABUA 5DM6V 2C2AA 2W0FC 1P7BA 2QEXV 1S0VA 5E1AC 1SESA 2WLLA 1YHQV 1J95A 3I56V 1CPYA 1M1KW 1OCOC 3OEEG 4JPRA 5CA3A 4G2KA 5CBGA 3LNMB 1GM9A 1YTFB 4P9OA 1OCCB 1VQ5V 3CPWU 2HVKC 5EC2C 1KP3A 1QVGU 3ZRVA 4QIWF 4UUJC 2A0LA 5HFMA 5KA6A 1PNKA 3FB7C 1JPXA 3HB3B 1M9NA 1OCCC 4JGSA 1MSWD 1PKXA 4GX1A 2HLDG 3UKMA 1K4DC 5B1AB 3JCZA 4JTCB 1M57B 2OT5A 4PELA 2LP7A 3LSSA 2QE7G 2DWDC 4UVCA 3JD0A 4KP4A 3K0DA 5KUMA 3ABMB 4JTAB 2WLJA 2NLJC 2HJFC 4FPPA 1GTOA 2AHYA 2P67A 3ABKB 4U7OA 3ZMSA 4HZ3A 1AI6A 2LFRA 5B1AC 1B6QA 5LGTA 1M57C 3W7WA 3ABMC 5DN6G 2QA4V 4UXNA 3ABKC 4LP8A 2OCCB 3ZN0A 4LC1A 3RVZA 3ZRWB 3ETGA 4JYBA 3TK1A 4JAUA 4RUEA 5IYCO 1YIJV 1NVPD 3RW0A 2HVJC 5LHGA 3CCRV 1E1RG 2OCCC 4R6ZA 1RM1B 4U7NA 1Q82W 5B1BB 4ASUG 3CCLV 5IYDO 3E8BA 3RVYA 5C93A 2XAQA 3AG1B 5LGUA 2WLMA 3IC7A 3OFNG 1RM1C 1R6KA 2IW5A 5B1BC 5CMUA 1Q86W 1AJNA 3AG1C 3AEIA 1KECA 4RQFA 1CP9A 4QE7A 1AI7A 1JVMA 3H01A 2JK5C 1SRYA 1S77D 4MTFA 1BMFG 1JQ0A 2ZR2A 3D36A 4BW5A 3CD6V 1NQTA 3UM7A 3D3IA 3ASOB 3E8HA 3LDEA 5LGNA 2Y48A 4PA6A 3DGEA 4RO2A 1L1FA 5IDJA 1AR1B 1YJ9V 1LNQA 3QO8A 3K79A 4KUMA 3ZJZA 2EZOA 3ASOC 2AHZA 4WFBV 4FK5C 1BHAA 1VQKV 3K03A 4DXWA 2CK3G 5LHIA 1DF5A 4JAVA 4L87A 2A9HA 1CEZA 3LUTB 3E89A 1ORQC 2B1GA 2ZD9A 4MT8A 1RPRA 3ZMZA 5L3DA 1MABG 1V54B 3CCQV 3CCMV 2XAFA 2LFSA 1YI2V 1HWYA 2IH1C 2YEVB 3AG2B 2IH3C 1VQ7V 3WFVA 4QJFB 1V54C 1E79G 5B1OA 1JX9A 1P4RA 1GM7A 2YSUB 4PDMA 4PDVA 4P30A 1M56B 3AG2C 2UXXA 2P90A 1QVFU 5CBFA 2GSMB 2P6JA 3K04A 4X89A 2EIKB 3SJQC 1M56C 1DF4A 1ROPA 1R3JC 1SETA 3ZMUA 1W0JG 1H8HG 1R73A 3BY6A 3KG2A 5L3CA 2EIKC 3FB5C 5CN0A 3TETA 3JD2A 4GT1A 4UVBA 3FYEB 3MD0A 4R8CA 3PJSK 5B3SB 1GMGA 4WFEA 3ETEA 2B5UA 4QPJA 4PDLA 3QNEA 2X6CA 1GK9A 1VQLV 3B77A 1YJWV 1KQSU 2Z3YA 2YEVA 1MOFA 4TWKA 4GX2A 3SYOA 1H8EG 4BAYA 5B3SC 2W6JG 4MTGA 1F4MA 3R65A 4MVOA 1NBMG 2DQ3A 5H6RA 3SPHA 5IY5B 3CC7V 2NNUA 3SPIA 5CBHA 1EFRG 5L3BA 2OTJV 1FXHA 2HFEC 3CMEV 3F7YC 2EJRA 1YTFD 5EC1C 2Q68A 2JDIG 1I5XA 5IY5C 1S76D 4CZZA 1ENVA 3W7TA 4MTXA 2Q6AA 3G6EV 2MK3A 2IU0A 4MVZA 3DTUB 2DWEC 3I55V 4X8AA 1FXVA 3CCSV 3TCUA 1QLNA 4WFGA 1EZJA 2XOKG 2HG5C 3OUFA 1GKFA 1JJ2U 2R9RB 3G71V 3OW2U 3E83A 4WFFA 1AJPA 4J9ZB 1K9MW 2R9IA 3ZMTA 1V55B 2P7TC 4H37A 1G4YB 3LSQA 1VQ6V 4TT3G 1NR7A 2V1DA 2XAHA 4R50A 2K1EA 4MVSA 1AI4A 4BIZA 4JF3A 4H33A 1V55C 4MTOA 3SYPA 5J9PC 4PDRA 2HKOA 1SZTA 3OUSA 4X88A 2FTKA 1K5QA 3OMIB 1AI5A 5EBLC 1WLEA 2ZXWB 3LDCA 1GO3F 1Q81W 2DYRB 2F43G 4XDLA 3A0RA 1S5HC 3ZRWA 2X0LA 3FYIB 2ZXWC 2X7RB 3STZC 2DYRC 2QTOA 4CBCA 3LDDA 2PI5A 3OEHG 5L3FA 1KC8W 2WLHA 3ZRSA 1ZWIC 2ZQMA 4LBEC 1YJNV 3GWOA 4J9YB 3ABTA 2JEUA 2UXNA 3B8MA 2QM8A 4Q20A 3EHBB 2ZDIC 2WLIB 1R6NA 1I5YA 4ZBMA 1H2GA 2JEXA 2JJ2G 1VQOV 4PA3A 1Q7YW 3M99B 1K3EA 2A79B 1K97A 3IGAC 2IJKA 3ZRXA 4JASA 3P32A 4MVQA 1G8MA 4QE9A 3G4SV 2Q69A 1PNLA 1OCRB 4UV8A 4P2ZA 3FKSG 4FMTA 2ITCC 4MW3A 3T4DA 1XL6A 3T1CA 3ASNC 3JYCA 1OCRC 1QBZA 1H38A 3ZN1A 3NXSA 1DLBA 1K33A 4RAIA 1JCHA 1S72V 3SYQA 4QPKA 4UV9A 1QCEA 3E8GA 3QO5A 5B1NA 3MHHC 1PNMA 3JD3A 2QKSA 1NJIW 4ZKIA 1NH2B 5H9CA 3W7UA 2EZPA 4WCEV 3BEHA 2WLIA 2WLKA 3SPGA 1R3IC 4P9PA 1R3KC 3OAAG 2Q67A 4FJCC 1VQNV 1KD1W 1W0KG 2IJIA 4N23A 3CC4V 4JYCA 4PA7A 4MVMA 5BZBA 3FB8C 2XAJA 2HR3A 3CXCU 3OE7G 2IJJA 3SPJA 3STLC 4E2LA 4OXSA 3W7XA 2XAGA 3CCJV 1EBOA 3E35A 2M7WA 4RQEA 1DTOA 1F23A 3OGCC 2V7QG 1QR9A 1NH2D 2JJ1G 4MSWC 2WLNA 2QM7A 3F5WC 5L3EA 1OHHG 4F4LA 4LCUC 2PI4A 4KFMA 4JTDB 3CP1A 1FXKB 3SYAA 4GCZA 1E1QG 4MS2A 3OMAB 3E2EA 3ETDA 2W6IG 1COWG 5LBQA 5H6QA 1TUEB 1K92A 2BOCC 4UVAA 1NVPB 3CC2V 4I9WA 1M90W 3CCVV 4DO2A 1FXKC 3K9AA 3AG3B 2IJHA 1K5SA 3P30A 4BIUA 1VQ4V 3E8FA 4MW8A 3ZIAG 1Y66A 3QO7A 4Z1MG 2ITDC 3X2QB 2OTLV 4WFHA 1BL8A 4G28B 2WWWA 3AG3C 2X6BA 4WF9V 1XL4A 2ATKC 2BOBC 1FFTB 1VQPV 3E86A 3OMNB 1KKDA 1PL0A 4WFAV 2D3OW 3OM3B 3X2QC 3T4ZA 1JOYA 1FS0G 5KUKA 5KA5A 3T2MA 3CCEV 1K7DA 4PA4A 3ABLB 1AROP 3K06A 1K4CC 2WSSG 3K08A 5EBMC 5L3GA 1BHBA 3VOUA 2XASA 1FXKA 5LHHA 1F51A 1Y4MA 3GB7C 4YXWG 1SERA 3ABLC 1MG1A 3OR7C 1GM8A 3CYOA 2X6AA 2EBOA 1NKDA 2XNDG 1F4NA 3WG7B 4MVRA 3CMAV 1S3JA 2WPDG 2ZR3A 3EFFK 2EIJB 5FL7G 1VQMV 3F7VC 4HYOA 1OCZB 2GHYA 4GX5A 4RUFA 3WG7C 1W2BU 1QR8A 1YITV 2EIJC 2IU3A 4XDKA 3ZCCA 5EK0A 2Z5UA 1OCZC 1VQ9V 2EINB 3HPLC 4HAMA 4EKWA 3SPCA 1VQ8V 1RPOA 2DYSB 3CCUV 3MHSC 4I5SA 3ML0A 2JIZG 4TSFG 3W7SA 1R3LC 2EINC 2H94A 4G27B 2EIMB 2DW4A 2WLLB 3IFXA 3OR6C 4GX0A 3ASNB 1K73W 2DYSC 2H8PC 5EBWC 1NR1A 1IXMA 3AG4B 3JD4A 4XBFA 1OZ0A 2EIMC 1K34A 3RBZA 1PD3A 1QLEB 2WAMA 1WPXA 1AJQA 5IYBO 3B8NA 2Y69B 2ZDIA 3K3WA 2B1IA 4FIPC 3AG4C 4PA9A 1KP2A 1UJWB 4QNHB 3SYCA 2KB1A 5HFLA 1QLEC 4XDJA 2EILB 2Y69C 4R7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KFM A;  4JTD B;  4R50 A;  2K1E A;  4MVS A;  4MVU A;  3SYA A;  3ZJZ A;  4H33 A;  1V55 C;  3ASO C;  2EIL C;  4MS2 A;  2AHZ A;  4MTO A;  3SYP A;  5J9P C;  4PDR A;  3K0G A;  3FB6 C;  2BOC C;  3OUS A;  4X88 A;  4I9W A;  3K03 A;  2W0F C;  1P7B A;  4DXW A;  5E1A C;  2WLL A;  5EBL C;  2A9H A;  3LDC A;  1J95 A;  3LUT B;  3E89 A;  1OCO C;  1ORQ C;  2ZD9 A;  3E8F A;  4MW8 A;  4XDL A;  5CBG A;  3LNM B;  1S5H C;  2ITD C;  4WFH A;  1BL8 A;  4G28 B;  2ZXW C;  4P9O A;  3STZ C;  3AG3 C;  2X6B A;  1XL4 A;  2ATK C;  2HVK C;  2DYR C;  2QTO A;  2BOB C;  5EC2 C;  2IH1 C;  4CBC A;  3E86 A;  3LDD A;  2IH3 C;  1KKD A;  4UUJ C;  2A0L A;  2WLH A;  3T4Z A;  3X2Q C;  1V54 C;  1ZWI C;  3FB7 C;  3ZRS A;  5KUK A;  3T2M A;  1OCC C;  4LBE C;  4PDM A;  4J9Y B;  4PDV A;  4P30 A;  3AG2 C;  4GX1 A;  4PA4 A;  3UKM A;  3K06 A;  1K4C C;  5CBF A;  1K4D C;  3K08 A;  5EBM C;  3VOU A;  4JTC B;  2WLI B;  3K04 A;  4X89 A;  2DWD C;  4ZBM A;  3K0D A;  5KUM A;  3GB7 C;  3SJQ C;  4JTA B;  2WLJ A;  1M56 C;  2NLJ C;  2HJF C;  3ABL C;  3OR7 C;  4PA3 A;  2AHY A;  4HZ3 A;  5B1A C;  1R3J C;  2A79 B;  1M57 C;  3IGA C;  2X6A A;  3KG2 A;  2EIK C;  3FB5 C;  3TET A;  4MVR A;  3ABM C;  4MVQ A;  4QE9 A;  2Q69 A;  3EFF K;  4R8C A;  3ABK C;  3PJS K;  4MW3 A;  4P2Z A;  2ITC C;  4WFE A;  4LP8 A;  3F7V C;  4HYO A;  3T4D A;  4PDL A;  3RVZ A;  4GX5 A;  1XL6 A;  4RUF A;  2X6C A;  3WG7 C;  3T1C A;  4RUE A;  2YEV A;  4TWK A;  3SYO A;  3ASN C;  4GX2 A;  2HVJ C;  3JYC A;  3RW0 A;  1OCR C;  2EIJ C;  4XDK A;  4RAI A;  5EK0 A;  5B3S C;  2OCC C;  4MTG A;  3R65 A;  1OCZ C;  4MVO A;  4R6Z A;  3SPH A;  3SYQ A;  5CBH A;  3HPL C;  3SPI A;  3E8G A;  3E8B A;  3RVY A;  3SPC A;  4EKW A;  2QKS A;  2HFE C;  2WLM A;  3F7Y C;  5EC1 C;  2Q68 A;  3BEH A;  2WLI A;  2WLK A;  5IY5 C;  1R3L C;  5B1B C;  2EIN C;  3SPG A;  1R3I C;  4G27 B;  4P9P A;  1R3K C;  2WLL B;  3IFX A;  2Q67 A;  3OR6 C;  2Q6A A;  4GX0 A;  3AG1 C;  4MVZ A;  2DYS C;  2H8P C;  5EBW C;  4PA7 A;  2DWE C;  4MVM A;  4X8A A;  5BZB A;  4QE7 A;  1JVM A;  3FB8 C;  3TCU A;  2EIM C;  2JK5 C;  3RBZ A;  4WFG A;  3SPJ A;  3STL C;  2HG5 C;  3OUF A;  4OXS A;  4PA9 A;  3AG4 C;  2R9R B;  4MTF A;  4BW5 A;  3E83 A;  4WFF A;  4QNH B;  4J9Z B;  3SYC A;  2KB1 A;  1QLE C;  3OGC C;  4XDJ A;  3UM7 A;  2P7T C;  3E8H A;  3LDE A;  4H37 A;  1G4Y B;  4MSW C;  4PA6 A;  2WLN A;  3F5W C;  4RO2 A;  2Y69 C;  4R7C A;  4F4L A;  4LCU C;  1LNQ A; 
#chains in the Genus database with same CATH topology
 1THZ A;  3CX5 F;  4MVU A;  1N8R W;  3QG5 A;  1XHX A;  3VBB A;  3MDS A;  3WU2 Z;  2W0F C;  1S0V A;  3KCY A;  1URF A;  3E22 A;  1OCO C;  5CA3 A;  1XMO O;  5CA0 B;  4G2K A;  1P84 F;  1YTF B;  4D7T A;  1Y76 A;  1WP8 A;  3ETQ A;  5KHK A;  1KP3 A;  1QVG U;  3ZRV A;  4X1Y A;  4LNU B;  5FLX N;  4UUJ C;  5KA6 A;  3FB7 C;  5CA1 A;  4JGS A;  1MSW D;  4GX1 A;  5GTI Z;  3AG7 A;  2WA4 A;  2ZE6 A;  2DWD C;  4KP4 A;  3K0D A;  4NXN O;  3ABM B;  2HEP A;  2WLJ A;  2NLJ C;  2P5O A;  2AHY A;  1HNW B;  4HZ3 A;  1AI6 A;  5B1A C;  3ZS8 C;  3W7W A;  1NS1 A;  1SA0 A;  4JI5 B;  1EN4 A;  4CS2 A;  2YID A;  3ABK C;  4RWU A;  4JYB A;  4DV1 B;  4RUE A;  1NU1 H;  3RW0 A;  2HVJ C;  1Z2G A;  3CS5 A;  3TXS A;  2OCC C;  4UCR A;  1RM1 B;  5KAI Z;  5IYD O;  5IT9 N;  3E8B A;  5KMG B;  1R6K A;  2IW5 A;  5B1B C;  3RGB A;  3AG1 C;  3AEI A;  1D5N A;  3MAQ A;  1AI7 A;  4DR4 B;  1YDX A;  5C8Y B;  5EZY B;  1M93 A;  4TOI A;  4NTW A;  3L73 H;  4CS3 A;  3ASO B;  5LGN A;  2QM4 A;  2Y48 A;  1TVK A;  3DGE A;  5IDJ A;  3IAY A;  1N4C A;  1XNQ B;  1FPO A;  3H1J H;  3J80 N;  5BMV B;  5KHJ A;  4IGG A;  2VS0 A;  2Q7G A;  4DXW A;  5LHI A;  1HNW O;  1DF5 A;  2E5L B;  4L87 A;  1CEZ A;  4JI5 O;  2B1G A;  2ZE5 A;  3ZMZ A;  1I94 B;  4O4I B;  5K1P A;  3UCS C;  3DSQ A;  1V54 B;  3HKB B;  3CCM V;  2XAF A;  1H2S B;  1S5J A;  2IH1 C;  2YEV B;  4DV1 O;  5FPR A;  2IH3 C;  1JX9 A;  2YI8 A;  4CH5 A;  5JQG A;  4YJ2 A;  2UXX A;  1QVF U;  5CBF A;  2GSM B;  2P6J A;  2ZNJ A;  3SJQ C;  1M56 C;  1DF4 A;  1ROP A;  3ZMU A;  4ZHQ B;  4LF4 B;  5L3C A;  4DR4 O;  4GT1 A;  1EN6 A;  5B3S B;  3ETE A;  2CGO A;  1WAZ A;  4UB6 Z;  4FM1 A;  4F6R A;  1GN2 A;  1VQL V;  4TWK A;  1MOF A;  4ABM A;  1H8E G;  4BAY A;  5H6R A;  3R65 A;  2NNU A;  4O4J B;  1XNQ O;  4O4L B;  1FXH A;  3CME V;  3F7Y C;  2JDI G;  1ENV A;  2QTS A;  4MTX A;  2E5L O;  2Q6A A;  3D3Q A;  2MK3 A;  3DTU B;  2DWE C;  1FXV A;  1I94 O;  1B04 A;  3J81 N;  1SQP H;  5J2U A;  4K35 A;  1J5E B;  1GKF A;  2R9R B;  3H1I H;  5JCO A;  3ZMT A;  1V55 B;  1KU9 A;  1PP9 H;  1G4Y B;  3ZHV A;  4ZOL A;  3PN1 A;  2K1E A;  4MVS A;  3APO A;  3N2G A;  3J7A U;  5B5E Z;  2HKO A;  3K5M A;  4EFB A;  1SZT A;  4LFB B;  2FTK A;  1K5Q A;  4LF4 O;  3JAL B;  1WLE A;  4LF7 B;  3LDC A;  1YEW A;  4HNA A;  1UPG A;  4I4T B;  1B06 A;  2Z0A A;  3ZRW A;  1WJZ A;  2ZXW C;  1QNM A;  3H1L H;  3RYF B;  3STZ C;  2DYR C;  4BIO A;  3CXH F;  3LDD A;  4X1I B;  1Q90 D;  2WLH A;  3RYH B;  3ZED A;  2ZCE A;  3SDL A;  2XTA A;  2WLI B;  1R6N A;  4LWS A;  1VF6 C;  3RYI A;  2HP8 A;  1Q7Y W;  2CE4 A;  2CH7 A;  4MVQ A;  3KKY A;  5LYJ A;  4J7J A;  3FKS G;  2ITC C;  3FAV A;  2GBO A;  3T4D A;  4JYA B;  3ASN C;  1K33 A;  1JCH A;  4LH7 A;  3HKE B;  3QO5 A;  4A5U B;  3MHH C;  4NXM B;  1PNM A;  1Q6H A;  4DR7 B;  1IVS A;  4WCE V;  4YHH B;  2UXD B;  3DXR A;  3L75 H;  4LFB O;  1R3I C;  4P9P A;  3BVO A;  4GKK B;  1R3K C;  1FJG B;  3OAA G;  3HKD A;  4FJC C;  4LF7 O;  5JJN B;  1KD1 W;  4JYC A;  4PA7 A;  4MVM A;  1XBL A;  5BZB A;  2V4D A;  2IJJ A;  4JI2 B;  4DRX A;  3SPJ A;  4OXS A;  1XUQ A;  3N2K A;  1H2L A;  2KSD A;  3E35 A;  4RQE A;  4AHC A;  4DV4 B;  4IHJ B;  4X62 B;  4JTD B;  3CP1 A;  1SQG A;  3SYA A;  2WA3 A;  3OMA B;  5IYZ B;  1TUE B;  3DC6 A;  1GN4 A;  1FXK C;  4OGQ B;  1HNZ B;  2YIA A;  1VQ4 V;  3ZIA G;  2EUL A;  1D5A A;  3M7M X;  3X2Q B;  2XUM A;  2WWW A;  2BTO A;  2ATK C;  2K9P A;  4JYA O;  3E86 A;  2JVD A;  3OMN B;  1JOY A;  1FS0 G;  3K5O A;  3T2M A;  1K7D A;  4NXM O;  1ZUQ A;  4JI3 B;  1Q3E A;  5L3G A;  4DR7 O;  5EBM C;  1BHB A;  2XAS A;  5LHH A;  4YHH O;  2UXD O;  2ILM A;  3GB7 C;  4GKK O;  4YXW G;  1SER A;  1FJG O;  1MG1 A;  3D8C A;  3OR7 C;  3HKC A;  3JAK B;  2LW7 A;  5KX5 A;  3WG7 B;  4MVR A;  3CMA V;  4JI2 O;  2UUA B;  4PHZ A;  1OCZ B;  2EX3 A;  4ICG A;  2B9Z A;  4RUF A;  1QR8 A;  1YIT V;  4DV4 O;  5EK0 A;  2LQT A;  1LR1 A;  5LOV A;  2RMK B;  4X62 O;  3UT5 A;  3A8T A;  1NTM H;  1BZK A;  1T5E A;  3G67 A;  4I5S A;  3ML0 A;  2QWO B;  3JAR B;  5JH7 B;  2Y0P A;  3OR6 C;  1IZ3 A;  2F23 A;  2H8P C;  1HNZ O;  4B7E A;  1NR1 A;  4O2B B;  3AG4 B;  3JAS A;  4XBF A;  1K34 A;  3RBZ A;  2BE3 A;  1WPX A;  2E76 B;  3B8N A;  5IJ0 A;  2OYQ A;  1KP2 A;  5DED A;  5HFL A;  2JRI A;  4MTO A;  2O57 A;  4O2A B;  4JI3 O;  4W4L A;  3ZMV A;  3CRQ A;  1G1X B;  2EIL C;  1Q43 A;  5KHI A;  1OCO B;  1K8A W;  3C3T A;  3H1K H;  1P7B A;  2F1M A;  1YHQ V;  4X64 B;  1IX9 A;  3I56 V;  1CPY A;  2FYU H;  3O9O A;  2CAZ C;  4B3M O;  2GUZ B;  2UUA O;  4P9O A;  3BAB A;  1VQ5 V;  3CPW U;  3FX7 A;  3LNN A;  4DV7 B;  4X9Q A;  4ZIB A;  2QDO A;  5B1A B;  4H0L B;  4JTC B;  1BE3 H;  2HJF C;  4FPP A;  2P67 A;  3ABK B;  4U7O A;  5LGT A;  3FFQ A;  2GV9 A;  2YC0 A;  2UUC O;  5DN6 G;  2QA4 V;  4H13 B;  5CA0 A;  4UXN A;  4DV6 B;  2OCC B;  4LC1 A;  3RVZ A;  5FNV B;  4E4E A;  2H3O A;  5IYC O;  4J10 A;  1NVP D;  4TUY B;  1WP7 A;  4R6Z A;  3TXQ A;  4U7N A;  4UCV A;  5B1B B;  4FFB B;  4FLW A;  5C93 A;  3B09 A;  5CB4 B;  1V9P A;  2XAQ A;  3AG1 B;  5LGU A;  1SQV H;  2WLM A;  3OFN G;  4JZ2 A;  4NTY A;  3ZHU A;  3K5N A;  2AZ2 A;  4X64 O;  1KEC A;  4QE7 A;  1JVM A;  1KKC A;  3H01 A;  2JK5 C;  4K8X A;  3JAT B;  1U97 A;  3T1H B;  1S77 D;  2ZR2 A;  4DV7 O;  2ZE7 A;  3CD6 V;  3D3I A;  3QF7 A;  1BSM A;  2A06 H;  1JA8 A;  1AR1 B;  1L1F A;  1LNQ A;  3QO8 A;  2AHZ A;  1M5I A;  4ZI7 A;  2FL4 A;  4FK5 C;  1BHA A;  5KMG A;  1VQK V;  3K03 A;  2VWK A;  2A9H A;  4MT8 A;  3L70 H;  3OD4 A;  2CTQ A;  3QVN A;  1MAB G;  4BW9 A;  1FFX B;  5KLV H;  4DYL A;  1HWY A;  5IWA B;  4QJF B;  1E79 G;  5IE9 A;  5B1O A;  1M56 B;  4BWA A;  1XNR B;  1XRE A;  2P90 A;  3K57 A;  3VQW A;  3T1Y B;  5BMV A;  3B4S A;  3U10 A;  1R3J C;  5JWP A;  2PUS A;  1W0J G;  1H8H G;  2M6Y A;  2EIK C;  3FB5 C;  3TET A;  3JD2 A;  3G6B A;  3FYE B;  2Q7H A;  3S3X A;  5IJ9 B;  3T1H O;  3QNE A;  2YEV A;  4GX2 A;  5K1X A;  1HNX B;  2W6J G;  1VP7 A;  3CC7 V;  3SPI A;  1S76 D;  1I5X A;  3W7T A;  2DE0 X;  2IU0 A;  4FLY A;  2W0X A;  4ZHQ A;  4LF5 B;  1QLN A;  4FVM A;  1EZJ A;  3SR2 C;  2XOK G;  3OUF A;  1JJ2 U;  1WB8 A;  5IWA O;  3K59 A;  1X4T A;  2P7T C;  1JFF B;  1NR7 A;  1XNR O;  4I50 B;  1XMQ B;  4R50 A;  2ZIO A;  4BIZ A;  2RDC A;  4JF3 A;  4H33 A;  3QTC A;  3T1Y O;  1DGS A;  3OMI B;  1FD9 A;  2ZXW B;  1GO3 F;  4CC6 A;  4KL1 A;  2DYR B;  3EVK A;  2F43 G;  3A0R A;  2RN9 A;  1L8D A;  1WA8 B;  2QTO A;  4I55 A;  3OEH G;  1HNX O;  1KC8 W;  3ZRS A;  3CHX A;  4DUY B;  2ZQM A;  3GWO A;  1SS3 A;  3ABT A;  2UXN A;  2PF4 E;  2OWO A;  2YUA A;  1Y67 A;  3B8M A;  4Q20 A;  4CS4 A;  5D5Q A;  4PA3 A;  3UO2 A;  3ZRX A;  4LF5 O;  4JAS A;  4DR6 B;  3P32 A;  2YDE A;  4I4T A;  2IBZ H;  2Q69 A;  1P49 A;  2R72 A;  1PNL A;  3E22 B;  4P2Z A;  3RYF A;  1XL6 A;  4NYK A;  3JYC A;  1OCR C;  1H38 A;  3ZN1 A;  3RYH A;  4LF9 B;  1YF2 A;  3FD9 A;  4X1Y B;  5B1N A;  1XMQ O;  3ZHR A;  3JD3 A;  2QKS A;  3W7U A;  4K3A A;  4YJ3 B;  3BEH A;  2WLI A;  1NT2 B;  4J7K A;  4LF8 B;  2YS8 A;  4TV8 B;  1VQN V;  3C3S A;  2IJI A;  3S3W A;  3CC4 V;  4DV3 B;  2L6L A;  3FB8 C;  1SA0 B;  4JI6 B;  2XAG A;  4D6T H;  1F23 A;  4DUY O;  1PM9 A;  4F4L A;  4PJ0 Z;  4PI2 A;  1TA8 A;  3HKE A;  1IBL B;  4LH6 A;  1FXK B;  2R9A A;  1E1Q G;  1XDC A;  2KG7 A;  4MS2 A;  2VWJ A;  2BOC C;  4UVA A;  3OT7 A;  3K9A A;  4DR6 O;  1K5S A;  1Y66 A;  2CDY A;  3QO7 A;  4Z1M G;  3CB2 A;  3N27 A;  5EIB D;  2OTL V;  1BL8 A;  3AG3 C;  4X20 B;  1YCI A;  3VQV A;  3L72 H;  1KKD A;  1P7G A;  4LF9 O;  2QGN A;  3CCE V;  5LP6 C;  3R66 A;  1K4C C;  2WSS G;  3K08 A;  4IHJ A;  3VOU A;  1OJH A;  4F6E A;  4LF8 O;  3ABL C;  1NTK H;  2G38 A;  2F66 C;  2EBO A;  4DV3 O;  1I0H A;  1NKD A;  1F4N A;  1KUQ A;  4AQY O;  3K5L A;  5FL7 G;  1R6T A;  5KAF Z;  4JI6 O;  4GX5 A;  4UB8 Z;  1U96 A;  2EIJ C;  2IU3 A;  3ZCC A;  2UXB B;  3NR7 A;  1TAE A;  3AK1 A;  2R70 A;  1IBL O;  3SPC A;  1VQ8 V;  1RPO A;  3CCU V;  5JQG B;  2EIN C;  2WLL B;  1EN5 A;  4GX0 A;  1K73 W;  2DYS C;  2UUB B;  5JVD B;  4IT5 A;  3JAK A;  1OZ0 A;  2EIM C;  1HR0 B;  1PD3 A;  5IYB O;  4B3S B;  4PA9 A;  2B1I A;  4FIP C;  3O65 A;  1GH6 A;  4QNH B;  2QSA A;  3SYC A;  2KB1 A;  1QLE C;  2EIL B;  4NR1 A;  4L8J A;  2Y69 C;  4R7C A;  4N21 A;  4JI8 B;  3GWK C;  3JD1 A;  2JGD A;  3FB6 C;  5GW7 A;  3ABU A;  1ZAU A;  3JAR A;  1SES A;  5JH7 A;  1J95 A;  2LGQ A;  4JPR A;  1BQZ A;  5CBG A;  1KBH A;  1GM9 A;  4WBN A;  5GTH Z;  3CEI A;  5J2U B;  3C90 A;  1LUW A;  4QIW F;  4NTX A;  5HFM A;  1PNK A;  2UXB O;  1M9N A;  1OCC C;  1PKX A;  3UKM A;  3JAW B;  4O2A A;  1K4D C;  2AXT Z;  4ZOL B;  4PEL A;  2LP7 A;  3WB0 A;  1WB7 A;  4FLT A;  3JD0 A;  5KUM A;  2ZNI A;  2ETN A;  4JTA B;  1GTO A;  3N2G B;  3ZMS A;  4B7K A;  2LFR A;  1M57 C;  2UUB O;  3RYC A;  4IIJ B;  1HR0 O;  4JZG A;  4DV0 B;  4B3S O;  1YZB A;  3CE2 A;  4JYY A;  3ZN0 A;  1MNG A;  3ZRW B;  4UCS A;  3ETG A;  2F93 B;  4JAU A;  4FLZ A;  5LHG A;  3CCR V;  3P3P A;  4TQF A;  3RVY A;  4JI8 O;  3IC7 A;  1Q8I A;  1JMK C;  2JS3 A;  5CMU A;  2A7W A;  1AJN A;  1Q86 W;  2VQE B;  4LWS B;  4B3M B;  1CP9 A;  4FM0 A;  2OIE A;  1O9G A;  2UU9 B;  1SZX A;  2Q7E A;  1DK1 A;  1SRY A;  1Y74 B;  2CH7 B;  1L0N H;  4TV9 B;  3BRC A;  1BMF G;  3D36 A;  3FAV B;  5FNV A;  4BW5 A;  1NQT A;  5LXT B;  2QWN B;  2F95 B;  4OPH A;  1SQB H;  1YJ9 V;  3H9V A;  3K79 A;  4O4H A;  4FFB A;  5CB4 A;  3ZJZ A;  1HW7 A;  4B3T B;  4WFB V;  3IJ4 A;  1JJO A;  2Q0A A;  3I5D A;  2UUC B;  3DXR B;  4JI4 B;  1F7Y A;  1RPR A;  1XQ8 A;  5BXZ A;  5LA6 B;  5L3D A;  4DV0 O;  3CCQ V;  1YVW A;  3JAT A;  5J2T A;  3U0Z A;  1YI2 V;  2GTS A;  1VQ7 V;  3N2K B;  3WFV A;  1SF9 A;  1GM7 A;  3VQX A;  4EEQ A;  3JSL A;  2P4V A;  5GON B;  2FB5 A;  3AG2 C;  2ZE8 A;  3F5T A;  1MSD A;  4LF6 B;  3K04 A;  4X89 A;  2EIK B;  4LFC B;  3A2F A;  4LR3 A;  2VQE O;  1MA1 A;  2ZIN A;  4I0X A;  1R73 A;  3KG2 A;  4DV5 B;  2UU9 O;  5EYP B;  1N0J A;  4UVB A;  4R8C A;  2CUG A;  1GMG A;  4WFE A;  5JJJ B;  1ZL8 A;  4PDL A;  1FFX A;  1GK9 A;  1YJW V;  3B77 A;  1WNS A;  4K8Z A;  2RJZ A;  3UO3 A;  4U3F H;  1F4M A;  4MVO A;  1NBM G;  1BT8 A;  5CBH A;  4X66 B;  1EFR G;  5L3B A;  2OTJ V;  5JCO C;  2HFE C;  3WB1 A;  1ZX3 A;  4B3T O;  2EJR A;  1YTF D;  2OIG A;  5EC1 C;  2Q68 A;  5IY5 C;  2KQX A;  4CZZ A;  1VIB A;  5EIB C;  4JI4 O;  4J80 A;  4MVZ A;  3BPZ A;  3I55 V;  2LJ2 A;  2E75 B;  4X8A A;  3TCU A;  1XOU A;  2CTR A;  1GRJ A;  5H2F Z;  3LSU A;  1QU7 A;  4LNU A;  2HG5 C;  5IJ9 A;  1UFI A;  2PYL A;  1LUV A;  2YXH A;  4J9Z B;  2R9I A;  2QWP B;  3LSQ A;  1VQ6 V;  4TT3 G;  4CH4 A;  2ZM6 B;  2V1D A;  4DW1 A;  4UCO A;  4LF6 O;  5J9P C;  3M8A A;  4LFC O;  4PDR A;  1I7F A;  3OUS A;  2GDS A;  5ITZ B;  1RSO B;  2N74 A;  4DV5 O;  1Q81 W;  1NZ6 A;  1EZV H;  1A32 A;  1S5H C;  3IC9 A;  2ZT9 B;  2AW9 A;  2BTQ B;  4DK1 A;  3L74 H;  4CBC A;  2PI5 A;  2RQ6 A;  1ZWI C;  4FZ0 A;  4LBE C;  4X66 O;  1JFF A;  1QHT A;  4I50 A;  2QM8 A;  4D7S A;  1I5Y A;  4ZBM A;  1H2G A;  5TIS Z;  1VQO V;  1K3E A;  1K97 A;  1TGO A;  5KHG A;  2Q0O C;  4J41 A;  5C8Y A;  1G8M A;  1XI1 A;  4QE9 A;  3G4S V;  3UQ8 A;  1OCR B;  1BCC H;  4FMT A;  4MW3 A;  5EZY A;  2QJ1 A;  1WA8 A;  2CGN A;  3CJH B;  3T1C A;  3P3N A;  4J11 A;  2P06 A;  1M4U A;  1DLB A;  3BFR A;  4QPK A;  2ZM6 O;  4UV9 A;  2Q8V A;  3E8G A;  4C7U A;  1JR9 A;  4IL6 Z;  1VF6 A;  4ZKI A;  1HP8 A;  1NH2 B;  3Q4H B;  1I08 A;  4KXR A;  1SKV A;  3SPG A;  2LW1 A;  1AVM A;  4O4I A;  1W0K G;  3HKB A;  2HR3 A;  2YI9 A;  4K0K B;  1SQF A;  3STL C;  2BSK B;  3W7X A;  3CCJ V;  2P4K A;  4X1K B;  4GYC B;  3L71 H;  4IYH A;  2V7Q G;  1QR9 A;  2JJ1 G;  3BA8 A;  1TUB B;  2WLN A;  2QM7 A;  3F5W C;  3THO A;  5L3E A;  1OHH G;  2N04 A;  2PI4 A;  1S5L Z;  5LMN B;  4GCZ A;  3E2E A;  3GVM A;  5H6Q A;  4YJ3 A;  1NVP B;  3CC2 V;  4I9W A;  5LL6 Y;  1KB9 F;  3CCV V;  1NTZ H;  4TV8 A;  1FAF A;  3K9S A;  3AG3 B;  3P30 A;  4BIU A;  3EXA A;  1B3Q A;  2PYJ A;  4MW8 A;  3A0H Z;  4WFH A;  1IBK B;  1GAX A;  4G28 B;  4U3J B;  4YIP A;  3ZHS A;  4WF9 V;  5LP6 B;  2PGG A;  4PV1 B;  4FLX A;  1PL0 A;  4WFA V;  4DR1 B;  2D3O W;  1N0N A;  3OM3 B;  3T4Z A;  4O4J A;  5KA5 A;  4O4L A;  1US6 A;  3ABL B;  3SGI A;  4DR3 B;  1FXK A;  3DC5 A;  4FLV A;  3U11 A;  2RCV A;  1F51 A;  1BS3 A;  3D36 C;  2QKC A;  3RFR A;  1GM8 A;  3CYO A;  4ZI7 B;  5AG2 A;  3JCU Z;  1S3J A;  3EFF K;  4K0K O;  2EIJ B;  2D2C B;  1RP3 B;  3F7V C;  2ADQ B;  4HYO A;  2P22 C;  4EB6 B;  1R1B A;  4X20 A;  4UCT A;  3AK2 A;  4DUZ B;  1W2B U;  4XDK A;  2Y4U A;  4B3R B;  4JI0 B;  1VQ9 V;  2OCH A;  4Z2W A;  2EIN B;  4HAM A;  1WN7 A;  4EKW A;  5LMN O;  3OGI B;  2AGA A;  2DYS B;  3MHS C;  5DEC A;  4TSF G;  2JIZ G;  1Q6U A;  3JAL A;  1R3L C;  2H94 A;  2EIM B;  4NKG B;  2DW4 A;  3IFX A;  1X59 A;  4GLX A;  1KMI Z;  1L0L H;  3ASN B;  1VF7 A;  3BCC H;  1YXB A;  3JD4 A;  1IBM B;  1CXZ B;  2Q4P A;  3SJB C;  5A2Q N;  1QLE B;  1Y76 B;  2LGW A;  2WAM A;  4HBN A;  1IBK O;  1AJQ A;  4X1I A;  4LFA B;  2Y69 B;  2MW2 B;  2ZDI A;  2CTP A;  1UJW B;  4DR1 O;  4XDJ A;  5CA1 B;  1W59 A;  1BQ0 A;  4DR3 O;  3RT3 C;  2DQ0 A;  5E79 Z;  1AB3 A;  3K0G A;  1YSC A;  2DOS A;  5DM6 V;  2C2A A;  2QEX V;  5E1A C;  2WLL A;  1NI8 A;  4W4K A;  4AQY B;  1M1K W;  3OEE G;  5JVD A;  3LNM B;  3OTO B;  3A0B Z;  1OCC B;  2HVK C;  5EC2 C;  4BR6 A;  2ZIM A;  4DUZ O;  3B2E E;  2A0L A;  4B3R O;  4JI0 O;  1N33 B;  4H44 B;  1JPX A;  3HB3 B;  3H1H H;  1ZTE A;  4IYI A;  1AR5 A;  2YIB D;  2HLD G;  4EFE A;  3ZX6 A;  4FLU A;  2AZ0 A;  3JCZ A;  1M57 B;  2OT5 A;  3LSS A;  2QE7 G;  4UVC A;  2ARH A;  2YIB A;  2GTA A;  1B6Q A;  2NN4 A;  3ABM C;  2VQF B;  1IBM O;  3ICX A;  3RWR D;  4I9Q A;  4B08 A;  1VAR A;  4LP8 A;  4LFA O;  4Q6G A;  3TK1 A;  1YIJ V;  2ZKO A;  4JV5 B;  1TVK B;  1E1R G;  4I55 B;  1BGY H;  1Q82 W;  4ASU G;  3CCL V;  5F2V O;  5IYZ A;  3JAW A;  5A9G A;  4CC5 A;  1RM1 C;  1O9H A;  4JI1 B;  3SJC C;  4RQF A;  1Y6X A;  3WB2 A;  2JS5 A;  2N05 A;  1XHZ A;  1MMM A;  4IIJ A;  3OTO O;  2Q9L A;  1PPJ H;  3CRA A;  4MTF A;  1JQ0 A;  3UM7 A;  1N33 O;  3E8H A;  3LDE A;  4PA6 A;  1IXB A;  4DV2 B;  4RO2 A;  4YJ2 B;  4PD4 F;  2LO1 A;  1N34 B;  4KUM A;  5BR8 B;  2EZO A;  3ASO C;  4AIL C;  4YIO A;  3BHP A;  2CK3 G;  2DMX A;  4JAV A;  1PV0 A;  3LUT B;  3E89 A;  1ORQ C;  2ZD9 A;  2VQF O;  1VEW A;  1N32 B;  5H5N A;  1Y74 A;  4F6R B;  2LFS A;  4TV9 A;  3AG2 B;  4JV5 O;  1V54 C;  2QWR B;  1J5E O;  1ZSP A;  1P4R A;  5LXT A;  2YSU B;  3TJT A;  1GN6 A;  4PDM A;  1MZF A;  4P30 A;  4PDV A;  1H2N A;  3JAM N;  4TQD A;  1SC5 B;  4JI1 O;  2KG7 B;  4O2B A;  4UFZ A;  1SET A;  4JAA A;  4NVP A;  3BY6 A;  5CN0 A;  3MD0 A;  3B40 A;  3CRR A;  2NR5 A;  3PJS K;  4X65 B;  5LA6 A;  2B5U A;  4QPJ A;  1MZE A;  1N36 B;  2X6C A;  1KQS U;  2Z3Y A;  3SYO A;  1H2M A;  4NB5 A;  5B3S C;  4DV2 O;  3BAA A;  4MTG A;  2DQ3 A;  5IY5 B;  3SPH A;  5GON A;  1N34 O;  5BR8 O;  4KHP B;  2VRZ A;  4HNA B;  3G6E V;  2UXC B;  3CSX A;  2GUZ A;  2Q73 A;  3CCS V;  1N32 O;  5EYP A;  5JJE B;  4WFG A;  2HHH B;  2CTW A;  4FFK A;  2YXL A;  3RN4 A;  3G71 V;  3OW2 U;  3E83 A;  4WFF A;  1AJP A;  1K9M W;  2JGU A;  5B66 Z;  4H37 A;  1Q5O A;  2A3Q A;  2XAH A;  1AI4 A;  2E74 B;  1V55 C;  3SYP A;  1AP5 A;  3RYI B;  4X88 A;  3KCX A;  3L9D A;  1AI5 A;  5EBL C;  5LYJ B;  4XDL A;  3BA9 A;  2FML A;  2X0L A;  3FYI B;  4X65 O;  2X7R B;  4JI7 B;  1N36 O;  1GN3 A;  4TUY A;  3HR0 A;  4CH3 A;  5L3F A;  1RFY A;  4J7Z A;  1WPB A;  1YJN V;  4J9Y B;  2JEU A;  3EHB B;  2RNB A;  2ZDI C;  4I7Z B;  4KHP O;  1Z5V A;  2JEX A;  2JJ2 G;  3HKD B;  1G6U A;  4GZR B;  3M99 B;  3ZBH A;  1IDS A;  4J42 A;  1AR4 A;  1XIL A;  2A79 B;  2L35 A;  2JGD B;  4UCU A;  3IGA C;  2IJK A;  2IM9 A;  5ITZ A;  1RSO A;  5LMU B;  2UXC O;  4DR2 B;  2YIC A;  4UV8 A;  2HHH O;  4DRX B;  1SQQ H;  2BTQ A;  2QWQ B;  4WBN B;  1QBZ A;  1KYO F;  3NXS A;  2ODM A;  4RAI A;  4DR5 B;  1S72 V;  1D2D A;  1Q6I A;  3OTF A;  2F4V B;  3SYQ A;  4FM2 A;  1QCE A;  1OV9 A;  2PY5 A;  1NJI W;  3SJA C;  5H9C A;  1AP6 A;  1SQX H;  2EZP A;  2WLK A;  1XEQ A;  1HDJ A;  2Q67 A;  3VQY A;  4N23 A;  2Q5Z A;  1ZLZ A;  2XAJ A;  3JSN A;  4QGP A;  3CXC U;  3OE7 G;  3RYC B;  2KKW A;  4OX9 B;  4JI7 O;  4E2L A;  1EBO A;  4GKJ B;  3ZHQ A;  2M7W A;  1QQC A;  3CJH A;  1DTO A;  3OGC C;  1NH2 D;  1PL4 A;  4MSW C;  2EJ7 A;  1FYJ A;  2DN9 A;  2Y4T A;  4LCU C;  2ADP A;  1H2K A;  4KFM A;  3APQ A;  4GUN A;  3ETD A;  2W6I G;  1COW G;  5LBQ A;  3Q4H A;  1K92 A;  3CRM A;  1M90 W;  4DO2 A;  3HKC B;  2HJD A;  5KX5 B;  2IJH A;  5LMU O;  4DR2 O;  3E8F A;  2ITD C;  2X6B A;  1XL4 A;  2BOB C;  1FKA O;  1FFT B;  1Z5W A;  2BSK A;  1AIL A;  1VQP V;  4YY3 B;  2DJV A;  4X1K A;  3KZI Z;  2Y0I A;  4DR5 O;  3X2Q C;  5KUK A;  5FPO A;  2XHB A;  2F4V O;  5LOV B;  1TUB A;  3CWB H;  3UT5 B;  2BCC H;  4PA4 A;  1ARO P;  3K06 A;  4FZ1 A;  1Y4M A;  4O4H B;  4DW0 A;  4AI8 A;  3K58 A;  5KHH A;  2X6A A;  2XND G;  3JAS B;  1XMO B;  4PI0 A;  1IUR A;  1VF5 B;  2WPD G;  2ZR3 A;  5IJ0 B;  4OX9 O;  1VQM V;  4U3J A;  2GHY A;  4GKJ O;  3WG7 C;  5LP6 A;  2QR4 A;  5J2T B;  2XT9 A;  2E3C A;  2Z5U A;  3TGU H;  1OCZ C;  1EM1 A;  3HPL C;  3ZHT A;  4CH6 A;  3CRC A;  4DK0 A;  3W7S A;  4NXN B;  4G27 B;  2QKA A;  5D5P A;  1VMG A;  2PTM A;  5EBW C;  1IXM A;  4OPA A;  3AK3 A;  4Z1V A;  4I0X B;  5BY1 A;  3K3W A;  4EB6 A;  3AG4 C;  4YY3 O;  2YXY A;  4DV6 O;  1ZL8 B;  2PZS A;  2FKX A;  3G80 A; 
#chains in the Genus database with same CATH homology
 4N21 A;  1THZ A;  4MVU A;  3ZMV A;  3JD1 A;  1N8R W;  2DQ0 A;  2EIL C;  1OCO B;  1YSC A;  3K0G A;  3FB6 C;  5GW7 A;  3VBB A;  1K8A W;  3ABU A;  5DM6 V;  2C2A A;  2W0F C;  1P7B A;  2QEX V;  1S0V A;  5E1A C;  1SES A;  2WLL A;  1YHQ V;  1J95 A;  3I56 V;  1CPY A;  1M1K W;  1OCO C;  3OEE G;  4JPR A;  5CA3 A;  4G2K A;  5CBG A;  3LNM B;  1GM9 A;  1YTF B;  4P9O A;  1OCC B;  1VQ5 V;  3CPW U;  2HVK C;  5EC2 C;  1KP3 A;  1QVG U;  3ZRV A;  4QIW F;  4UUJ C;  2A0L A;  5HFM A;  5KA6 A;  1PNK A;  3FB7 C;  1JPX A;  3HB3 B;  1M9N A;  1OCC C;  4JGS A;  1MSW D;  1PKX A;  4GX1 A;  2HLD G;  3UKM A;  1K4D C;  5B1A B;  3JCZ A;  4JTC B;  1M57 B;  2OT5 A;  4PEL A;  2LP7 A;  3LSS A;  2QE7 G;  2DWD C;  4UVC A;  3JD0 A;  4KP4 A;  3K0D A;  5KUM A;  3ABM B;  4JTA B;  2WLJ A;  2NLJ C;  2HJF C;  4FPP A;  1GTO A;  2AHY A;  2P67 A;  3ABK B;  4U7O A;  3ZMS A;  4HZ3 A;  1AI6 A;  2LFR A;  5B1A C;  1B6Q A;  5LGT A;  1M57 C;  3W7W A;  3ABM C;  5DN6 G;  2QA4 V;  4UXN A;  3ABK C;  4LP8 A;  2OCC B;  3ZN0 A;  4LC1 A;  3RVZ A;  3ZRW B;  3ETG A;  4JYB A;  3TK1 A;  4JAU A;  4RUE A;  5IYC O;  1YIJ V;  1NVP D;  3RW0 A;  2HVJ C;  5LHG A;  3CCR V;  1E1R G;  2OCC C;  4R6Z A;  1RM1 B;  4U7N A;  1Q82 W;  5B1B B;  4ASU G;  3CCL V;  5IYD O;  3E8B A;  3RVY A;  5C93 A;  2XAQ A;  3AG1 B;  5LGU A;  2WLM A;  3IC7 A;  3OFN G;  1RM1 C;  1R6K A;  2IW5 A;  5B1B C;  5CMU A;  1Q86 W;  1AJN A;  3AG1 C;  3AEI A;  1KEC A;  4RQF A;  1CP9 A;  4QE7 A;  1AI7 A;  1JVM A;  3H01 A;  2JK5 C;  1SRY A;  1S77 D;  4MTF A;  1BMF G;  1JQ0 A;  2ZR2 A;  3D36 A;  4BW5 A;  3CD6 V;  1NQT A;  3UM7 A;  3D3I A;  3ASO B;  3E8H A;  3LDE A;  5LGN A;  2Y48 A;  4PA6 A;  3DGE A;  4RO2 A;  1L1F A;  5IDJ A;  1AR1 B;  1YJ9 V;  1LNQ A;  3QO8 A;  3K79 A;  4KUM A;  3ZJZ A;  2EZO A;  3ASO C;  2AHZ A;  4WFB V;  4FK5 C;  1BHA A;  1VQK V;  3K03 A;  4DXW A;  2CK3 G;  5LHI A;  1DF5 A;  4JAV A;  4L87 A;  2A9H A;  1CEZ A;  3LUT B;  3E89 A;  1ORQ C;  2B1G A;  2ZD9 A;  4MT8 A;  1RPR A;  3ZMZ A;  5L3D A;  1MAB G;  1V54 B;  3CCQ V;  3CCM V;  2XAF A;  2LFS A;  1YI2 V;  1HWY A;  2IH1 C;  2YEV B;  3AG2 B;  2IH3 C;  1VQ7 V;  3WFV A;  4QJF B;  1V54 C;  1E79 G;  5B1O A;  1JX9 A;  1P4R A;  1GM7 A;  2YSU B;  4PDM A;  4PDV A;  4P30 A;  1M56 B;  3AG2 C;  2UXX A;  2P90 A;  1QVF U;  5CBF A;  2GSM B;  2P6J A;  3K04 A;  4X89 A;  2EIK B;  3SJQ C;  1M56 C;  1DF4 A;  1ROP A;  1R3J C;  1SET A;  3ZMU A;  1W0J G;  1H8H G;  1R73 A;  3BY6 A;  3KG2 A;  5L3C A;  2EIK C;  3FB5 C;  5CN0 A;  3TET A;  3JD2 A;  4GT1 A;  4UVB A;  3FYE B;  3MD0 A;  4R8C A;  3PJS K;  5B3S B;  1GMG A;  4WFE A;  3ETE A;  2B5U A;  4QPJ A;  4PDL A;  3QNE A;  2X6C A;  1GK9 A;  1VQL V;  3B77 A;  1YJW V;  1KQS U;  2Z3Y A;  2YEV A;  1MOF A;  4TWK A;  4GX2 A;  3SYO A;  1H8E G;  4BAY A;  5B3S C;  2W6J G;  4MTG A;  1F4M A;  3R65 A;  4MVO A;  1NBM G;  2DQ3 A;  5H6R A;  3SPH A;  5IY5 B;  3CC7 V;  2NNU A;  3SPI A;  5CBH A;  1EFR G;  5L3B A;  2OTJ V;  1FXH A;  2HFE C;  3CME V;  3F7Y C;  2EJR A;  1YTF D;  5EC1 C;  2Q68 A;  2JDI G;  1I5X A;  5IY5 C;  1S76 D;  4CZZ A;  1ENV A;  3W7T A;  4MTX A;  2Q6A A;  3G6E V;  2MK3 A;  2IU0 A;  4MVZ A;  3DTU B;  2DWE C;  3I55 V;  4X8A A;  1FXV A;  3CCS V;  3TCU A;  1QLN A;  4WFG A;  1EZJ A;  2XOK G;  2HG5 C;  3OUF A;  1GKF A;  1JJ2 U;  2R9R B;  3G71 V;  3OW2 U;  3E83 A;  4WFF A;  1AJP A;  4J9Z B;  1K9M W;  2R9I A;  3ZMT A;  1V55 B;  2P7T C;  4H37 A;  1G4Y B;  3LSQ A;  1VQ6 V;  4TT3 G;  1NR7 A;  2V1D A;  2XAH A;  4R50 A;  2K1E A;  4MVS A;  1AI4 A;  4BIZ A;  4JF3 A;  4H33 A;  1V55 C;  4MTO A;  3SYP A;  5J9P C;  4PDR A;  2HKO A;  1SZT A;  3OUS A;  4X88 A;  2FTK A;  1K5Q A;  3OMI B;  1AI5 A;  5EBL C;  1WLE A;  2ZXW B;  3LDC A;  1GO3 F;  1Q81 W;  2DYR B;  2F43 G;  4XDL A;  3A0R A;  1S5H C;  3ZRW A;  2X0L A;  3FYI B;  2ZXW C;  2X7R B;  3STZ C;  2DYR C;  2QTO A;  4CBC A;  3LDD A;  2PI5 A;  3OEH G;  5L3F A;  1KC8 W;  2WLH A;  3ZRS A;  1ZWI C;  2ZQM A;  4LBE C;  1YJN V;  3GWO A;  4J9Y B;  3ABT A;  2JEU A;  2UXN A;  3B8M A;  2QM8 A;  4Q20 A;  3EHB B;  2ZDI C;  2WLI B;  1R6N A;  1I5Y A;  4ZBM A;  1H2G A;  2JEX A;  2JJ2 G;  1VQO V;  4PA3 A;  1Q7Y W;  3M99 B;  1K3E A;  2A79 B;  1K97 A;  3IGA C;  2IJK A;  3ZRX A;  4JAS A;  3P32 A;  4MVQ A;  1G8M A;  4QE9 A;  3G4S V;  2Q69 A;  1PNL A;  1OCR B;  4UV8 A;  4P2Z A;  3FKS G;  4FMT A;  2ITC C;  4MW3 A;  3T4D A;  1XL6 A;  3T1C A;  3ASN C;  3JYC A;  1OCR C;  1QBZ A;  1H38 A;  3ZN1 A;  3NXS A;  1DLB A;  1K33 A;  4RAI A;  1JCH A;  1S72 V;  3SYQ A;  4QPK A;  4UV9 A;  1QCE A;  3E8G A;  3QO5 A;  5B1N A;  3MHH C;  1PNM A;  3JD3 A;  2QKS A;  1NJI W;  4ZKI A;  1NH2 B;  5H9C A;  3W7U A;  2EZP A;  4WCE V;  3BEH A;  2WLI A;  2WLK A;  3SPG A;  1R3I C;  4P9P A;  1R3K C;  3OAA G;  2Q67 A;  4FJC C;  1VQN V;  1KD1 W;  1W0K G;  2IJI A;  4N23 A;  3CC4 V;  4JYC A;  4PA7 A;  4MVM A;  5BZB A;  3FB8 C;  2XAJ A;  2HR3 A;  3CXC U;  3OE7 G;  2IJJ A;  3SPJ A;  3STL C;  4E2L A;  4OXS A;  3W7X A;  2XAG A;  3CCJ V;  1EBO A;  3E35 A;  2M7W A;  4RQE A;  1DTO A;  1F23 A;  3OGC C;  2V7Q G;  1QR9 A;  1NH2 D;  2JJ1 G;  4MSW C;  2WLN A;  2QM7 A;  3F5W C;  5L3E A;  1OHH G;  4F4L A;  4LCU C;  2PI4 A;  4KFM A;  4JTD B;  3CP1 A;  1FXK B;  3SYA A;  4GCZ A;  1E1Q G;  4MS2 A;  3OMA B;  3E2E A;  3ETD A;  2W6I G;  1COW G;  5LBQ A;  5H6Q A;  1TUE B;  1K92 A;  2BOC C;  4UVA A;  1NVP B;  3CC2 V;  4I9W A;  1M90 W;  3CCV V;  4DO2 A;  1FXK C;  3K9A A;  3AG3 B;  2IJH A;  1K5S A;  3P30 A;  4BIU A;  1VQ4 V;  3E8F A;  4MW8 A;  3ZIA G;  1Y66 A;  3QO7 A;  4Z1M G;  2ITD C;  3X2Q B;  2OTL V;  4WFH A;  1BL8 A;  4G28 B;  2WWW A;  3AG3 C;  2X6B A;  4WF9 V;  1XL4 A;  2ATK C;  2BOB C;  1FFT B;  1VQP V;  3E86 A;  3OMN B;  1KKD A;  1PL0 A;  4WFA V;  2D3O W;  3OM3 B;  3X2Q C;  3T4Z A;  1JOY A;  1FS0 G;  5KUK A;  5KA5 A;  3T2M A;  3CCE V;  1K7D A;  4PA4 A;  3ABL B;  1ARO P;  3K06 A;  1K4C C;  2WSS G;  3K08 A;  5EBM C;  5L3G A;  1BHB A;  3VOU A;  2XAS A;  1FXK A;  5LHH A;  1F51 A;  1Y4M A;  3GB7 C;  4YXW G;  1SER A;  3ABL C;  1MG1 A;  3OR7 C;  1GM8 A;  3CYO A;  2X6A A;  2EBO A;  1NKD A;  2XND G;  1F4N A;  3WG7 B;  4MVR A;  3CMA V;  1S3J A;  2WPD G;  2ZR3 A;  3EFF K;  2EIJ B;  5FL7 G;  1VQM V;  3F7V C;  4HYO A;  1OCZ B;  2GHY A;  4GX5 A;  4RUF A;  3WG7 C;  1W2B U;  1QR8 A;  1YIT V;  2EIJ C;  2IU3 A;  4XDK A;  3ZCC A;  5EK0 A;  2Z5U A;  1OCZ C;  1VQ9 V;  2EIN B;  3HPL C;  4HAM A;  4EKW A;  3SPC A;  1VQ8 V;  1RPO A;  2DYS B;  3CCU V;  3MHS C;  4I5S A;  3ML0 A;  2JIZ G;  4TSF G;  3W7S A;  1R3L C;  2EIN C;  2H94 A;  4G27 B;  2EIM B;  2DW4 A;  2WLL B;  3IFX A;  3OR6 C;  4GX0 A;  3ASN B;  1K73 W;  2DYS C;  2H8P C;  5EBW C;  1NR1 A;  1IXM A;  3AG4 B;  3JD4 A;  4XBF A;  1OZ0 A;  2EIM C;  1K34 A;  3RBZ A;  1PD3 A;  1QLE B;  2WAM A;  1WPX A;  1AJQ A;  5IYB O;  3B8N A;  2Y69 B;  2ZDI A;  3K3W A;  2B1I A;  4FIP C;  3AG4 C;  4PA9 A;  1KP2 A;  1UJW B;  4QNH B;  3SYC A;  2KB1 A;  5HFL A;  1QLE C;  4XDJ A;  2EIL B;  2Y69 C;  4R7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...