4PA3A

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa3A00
1J95A 1V54C 4RUFA 4X88A 3E8BA 3K0DA 3LDDA 1V55C 2EIKC 1OCRC 3K0GA 4OXSA 4P30A 4R50A 4X8AA 4J9ZB 4DXWA 4MVUA 4RAIA 2R9RB 1OCZC 2EIJC 4PA7A 4RO2A 3STLC 4PDVA 3T2MA 3TCUA 2ATKC 4MTFA 2BOCC 5B1BC 2BOBC 3E8HA 3JYCA 4MW3A 4EKWA 2DWDC 4P2ZA 3ASNC 4PA6A 2OCCC 3ABKC 1S5HC 4LBEC 3T4ZA 3SYPA 4LP8A 3UM7A 3OR6C 3AG1C 2DYSC 4WFEA 4H37A 4HYOA 2Q68A 3K04A 3T1CA 4XDJA 4P9OA 3STZC 2Q6AA 3IGAC 4GX2A 5EBLC 1P7BA 3OUSA 3ABMC 3ZRSA 1K4CC 1ORQC 2YEVA 3F7VC 1M57C 4MVOA 4GX5A 4WFGA 4BW5A 4CBCA 4GX0A 4JTAB 3EFFK 4WFHA 2A79B 3SYCA 4MTGA 1G4YB 2WLIB 4ZBMA 2WLMA 3FB7C 3LDEA 4JTDB 4PA3A 4R6ZA 4F4LA 4MS2A 5B3SC 2P7TC 4PDLA 4LCUC 4PDRA 3AG4C 4MVZA 2HVKC 2IH1C 2AHZA 3SJQC 3IFXA 3FB8C 4I9WA 3E8GA 4JTCB 1JVMA 1R3IC 3KG2A 2WLIA 4MTOA 1XL4A 2IH3C 4G27B 2DYRC 2WLNA 2ITDC 2Y69C 3LNMB 4P9PA 3LDCA 3K03A 4GX1A 3BEHA 1M56C 4HZ3A 4MVQA 3E86A 1R3JC 3SPCA 1ZWIC 4MSWC 2K1EA 3SYAA 3WG7C 5CBGA 2DWEC 2NLJC 1OCCC 3ZJZA 4J9YB 3GB7C 5J9PC 3SPIA 2ZD9A 2ITCC 4QE7A 3SPJA 2EILC 3E83A 3X2QC 3F7YC 3PJSK 4X89A 2HG5C 1R3KC 2X6CA 1XL6A 3E8FA 2EIMC 3AG2C 2WLKA 2EINC 4H33A 2H8PC 4MVSA 2HVJC 5BZBA 2HFEC 5EBMC 3RVZA 2WLLB 4TWKA 5EBWC 3ABLC 5CBHA 3SPHA 4MVMA 3RBZA 3SPGA 5EC1C 2W0FC 2X6AA 3LUTB 4RUEA 4MW8A 5E1AC 4KFMA 1LNQA 1KKDA 3RW0A 2JK5C 2QKSA 3VOUA 3AG3C 3T4DA 4PDMA 3K06A 2A0LA 2AHYA 4QE9A 3R65A 1QLEC 3ASOC 4R7CA 3K08A 1OCOC 2WLLA 4PA9A 3OR7C 3FB6C 4PA4A 5EK0A 3F5WC 2HJFC 3UKMA 3RVYA 3TETA 3OUFA 2Q69A 4XDKA 1BL8A 3E89A 4WFFA 4MVRA 3SYQA 2A9HA 2ZXWC 5KUKA 4G28B 3HPLC 5IY5C 3OGCC 1K4DC 4QNHB 2QTOA 4R8CA 4UUJC 3SYOA 2WLJA 2WLHA 5B1AC 5KUMA 5CBFA 1R3LC 2X6BA 5EC2C 2Q67A 2KB1A 3FB5C 4XDLA
chains in the Genus database with same CATH superfamily
4O4IB 5JH7B 1V54C 4JI7B 2CTPA 3E8BA 2EIKC 3FD9A 1F4NA 1H2GA 2XAFA 4DXWA 1VQPV 5FLXN 1CEZA 4B3TO 4DK0A 2VQEB 3E22A 4LNUB 4JI5B 4RQFA 1E79G 3JATA 4IYIA 4LP8A 1JOYA 2W6JG 4WBNA 4ZOLA 1TGOA 3JALB 1Q81W 2X7RB 2DE0X 4GX2A 4HNAB 3BFRA 3BAAA 3OUSA 2NN4A 5KA6A 5C8YB 3F7VC 5J2TB 4UVAA 1WPBA 3F5TA 4MTGA 4YHHB 3CCSV 2EIJB 4JGSA 1SA0B 4MVZA 2AHZA 1US6A 3CRMA 4I9WA 1FXHA 2P5OA 4FPPA 3AG1B 4JI8O 1G1XB 1UFIA 4PHZA 5EZYA 2JVDA 1LUVA 1YTFB 3GWKC 5BY1A 1TUEB 5CBGA 2Q0AA 1S0VA 3DXRA 1YIJV 1Z2GA 3L70H 4DR3O 3H9VA 3P3NA 2EIMC 1SS3A 1PKXA 1AI6A 1MABG 3N2GA 2Y0IA 1XHXA 1M5IA 4TWKA 2BSKB 4MVMA 4O4HB 2ZR3A 1AR4A 4YJ3B 2JK5C 1MZEA 3K06A 2FYUH 2AXTZ 4DV0O 1B06A 1KMIZ 3OR7C 5J2UB 2XNDG 1Q6UA 4JI4O 1QHTA 4LR3A 2ZXWC 2UXCO 3CRRA 2EINB 2Y48A 3CMEV 2VRZA 4UB8Z 4XDLA 5CA1B 2WSSG 1FFXA 4X88A 1AJQA 4LH7A 4FLXA 3OMNB 2MK3A 2LO1A 3UT5B 2YXLA 5LYJA 3VQYA 4LF9O 1F23A 4O4IA 5JH7A 1SQQH 1Q6IA 3G6BA 3W7XA 4DR7O 2F93B 2F43G 4NTXA 4ZKIA 2DYSC 1X59A 1Q7YW 3L72H 4HYOA 5A2QN 5GTHZ 4PD4F 4LNUA 4Z1VA 2ZIMA 3L9DA 5L3BA 1M57C 4MVOA 1BQZA 4TUYB 2Q7EA 3JALA 1IBLO 1SQXH 1XNQO 5KMGA 4R6ZA 4HNAA 1PPJH 3ZRXA 2HVKC 5C8YA 1NQTA 1FD9A 3K9AA 3ZHVA 5J2TA 4LFBB 2B1GA 4JTCB 1R3IC 4LH6A 3TXQA 3K5NA 1K8AW 1SA0A 1WNSA 5H6RA 3BEHA 5L3DA 2VQFB 3ABMB 3RYIB 4FIPC 5LGUA 1XQ8A 3CPWU 1KKCA 3CHXA 3VBBA 2P6JA 2UXNA 4H33A 1GN6A 1WP8A 3Q4HB 5BXZA 2LFSA 1ZAUA 4JI2B 1JJ2U 4CC6A 1KKDA 1KYOF 2QKSA 4DV1O 2UUCO 4LF6O 4I55B 4PA9A 1EZJA 4X20B 1XBLA 2BSKA 3UKMA 1XDCA 4O4HA 2ZINA 4YJ3A 3E2EA 2Y4UA 4RWUA 2QTOA 2WLJA 3MAQA 3M8AA 4X65B 5J2UA 2DYRC 4GYCB 2JEUA 3SPCA 2F4VB 1J95A 4R50A 2HHHB 4FJCC 1QR9A 4D6TH 4J7KA 2ZE8A 1SC5B 4RAIA 2LJ2A 2R9RB 4RO2A 2XTAA 3OAAG 5CA1A 3CE2A 1VF6A 5LA6B 2ETNA 3S3XA 1ZSPA 3UT5A 5IJ9B 3A0HZ 2KG7B 3CCRV 5B1OA 3ZBHA 2DMXA 3QO7A 3T1HO 1EFRG 4GKJO 2CDYA 1OV9A 1QCEA 1NKDA 1BGYH 1JCHA 2A79B 4E2LA 3LDEA 3C3SA 4HBNA 1I94B 1NJIW 5IYZB 4DR1O 2OYQA 1S76D 1K92A 4TUYA 3CCMV 1ZLZA 5CMUA 1DK1A 4B3RB 1GO3F 2K9PA 4WFAV 3OW2U 1VQ7V 1K9MW 4GX1A 3APOA 1N33B 5J9PC 3SJAC 1D2DA 4PELA 1PNKA 2ZR2A 5B3SB 1S5LZ 2QGNA 4N23A 3AG4B 4D7TA 2H8PC 2EZOA 4CZZA 1J5EO 3CD6V 3RW0A 3A2FA 2CGNA 4O4LB 2ZKOA 2UUAO 1X4TA 3HKEA 3Q4HA 2Q4PA 5GTIZ 3B77A 5KAIZ 2ZT9B 2EILB 4Q6GA 4KHPB 4YXWG 1QVFU 1JPXA 4I55A 3U11A 4R8CA 2WA3A 5CBFA 4X20A 1RP3B 2X6BA 5LGNA 5KAFZ 3CS5A 1M93A 4X8AA 2XT9A 4LFCO 5LOVB 1HNWB 1OCOB 2C2AA 2XUMA 4F6RB 5JWPA 3I5DA 1HNXB 1FXVA 2YIAA 2QWNB 1YJNV 1XHZA 3VQVA 3K04A 1LR1A 4FM1A 3IGAC 2A3QA 4IT5A 1ORQC 1HP8A 5FPOA 5IJ9A 2KG7A 4O2BB 4UCRA 1W59A 3B8NA 4J7JA 1FAFA 1CXZB 4QIWF 4CS3A 2IH1C 4UV8A 2OCCB 3CWBH 4JI0B 4J42A 3O9OA 4DV6B 4MTOA 2RN9A 4DR4B 2CUGA 4I7ZB 1M56C 1CP9A 1VQ8V 5IYZA 4DV2B 5LBQA 2HP8A 1R3KC 1K5SA 1K5QA 1OHHG 3K79A 4DV3O 3SJBC 1GK9A 4FLYA 2YICA 1XMOB 4N21A 2UXBB 2Y69B 1DF4A 3WG7B 1HNZB 1OCCB 4FLUA 1I08A 2P4VA 5GW7A 2DN9A 4CS4A 2HJFC 3JASB 1IBKB 1BL8A 3RYCB 4O4LA 4K0KB 1IDSA 2WPDG 2PTMA 5KUMA 1UPGA 5EC2C 4HAMA 5JCOA 4JYAO 1Y74B 2CGOA 4LF8B 3APQA 4JZGA 1EZVH 1VQKV 4OXSA 1UJWB 2YXHA 2ZE6A 3U10A 1KP2A 2EIJC 1YCIA 3ZHTA 4MW3A 3FYIB 1Y76A 3ZHUA 4LF7O 1NU1H 3A0BZ 4PJ0Z 3C3TA 3AG1C 4WFEA 5JVDB 1DGSA 1TUBB 3ABUA 5LOVA 1NTZH 1K7DA 4XDJA 4O4JB 4LF5B 5HFMA 2Q6AA 3CRAA 5LMNB 1H2MA 4AHCA 1VP7A 4F6RA 2PZSA 4MTXA 3JD4A 4LFAO 1BHAA 3CCEV 3CB2A 1N32B 2P7TC 4PDLA 2Q0OC 1QU7A 2ZIOA 1BQ0A 4O2BA 4X64O 1QR8A 1N34B 5IYCO 3CCJV 5F2VO 2F66C 1KP3A 5BR8O 4GKKO 1R3JC 4U3JA 3CXHF 1VIBA 4WCEV 3JAKB 4GUNA 5KHHA 4I0XB 3PJSK 2QEXV 1W0JG 2QM7A 2YIBD 2EINC 2UUBB 1RM1B 3P3PA 2NNUA 1MG1A 2QR4A 3W7TA 1TAEA 2UXDB 3VQWA 2CK3G 3ICXA 2E76B 1AP5A 3LSQA 3JSLA 4QE9A 1CPYA 4L8JA 4J10A 1WB8A 5ITZA 3SYQA 4MVRA 4AQYO 1YHQV 2V4DA 4U7OA 3JASA 3EXAA 5FPRA 1XNRO 1KU9A 3RYCA 5CA3A 2LGQA 4A5UB 4X62O 3KCYA 2QWPB 2B1IA 4OX9O 3T2MA 3BCCH 3ZN0A 4DV5B 5L3EA 1Y74A 5EIBD 2JGDB 3T4ZA 1ZL8B 3CCQV 4K8ZA 3QO5A 1ZUQA 3OFNG 3IAYA 5EBLC 3KCXA 4EEQA 3ABMC 5FNVB 1OCRB 1NVPD 5JVDA 2CAZC 1TUBA 1RFYA 2GV9A 4O4JA 3CSXA 4JPRA 4NYKA 3QF7A 2GUZB 3FFQA 4NXMB 1Q90D 4K8XA 3ABKB 1NVPB 3BRCA 3TK1A 4AILC 4G27B 3ZRVA 4P9PA 1YSCA 3E86A 1VEWA 3N2KA 2K1EA 3D8CA 2NLJC 4DUZB 1XUQA 1EBOA 4TV9B 2ZM6O 3G4SV 1FJGO 1GH6A 2R72A 3J81N 3DC5A 2HFEC 3JAKA 2P06A 4FLWA 1SQBH 1THZA 3A8TA 1BZKA 4I0XA 2IW5A 2W6IG 3L75H 1WLEA 4ZHQB 2PYJA 4JI3O 1H8EG 4UCTA 1COWG 1L8DA 1NR7A 1WN7A 3W7SA 1K33A 4W4KA 3RGBA 5KUKA 4G28B 1N36B 5IT9N 5IYDO 1Q43A 3D36C 4DRXB 5B5EZ 1BS3A 1L0NH 5IE9A 4D7SA 2UU9B 3ETQA 4QPKA 4ICGA 2CTWA 3G71V 3AG3B 4LWSB 4PI2A 1M4UA 2RDCA 4C7UA 3JYCA 4KP4A 1I5XA 4H44B 5KLVH 4NXNB 2V7QG 3CC7V 1B04A 5B1AB 3T1CA 1FXKB 5LGTA 1PV0A 1XILA 3ZRSA 2JGDA 1ZL8A 1V55B 3M7MX 4UVBA 1AR5A 3CXCU 1YXBA 1FFTB 1SETA 1V9PA 2ZE5A 4WFHA 4JI1O 3ZIAG 4K35A 4DR5B 2WLIB 1WA8A 4F4LA 3CYOA 4LC1A 5B3SC 3JCZA 1XI1A 5C93A 4NB5A 2PYLA 4LCUC 3AG4C 4H0LB 2X0LA 1JQ0A 3EVKA 1F4MA 1WJZA 3WB2A 4B08A 5CA0B 1JMKC 4DR2O 3MHSC 2AGAA 4O2AB 3GB7C 2EILC 1SZXA 5DN6G 5JCOC 2CTQA 1I5YA 4KUMA 3W7UA 3RVZA 2KSDA 4X1KB 2D3OW 4X1IB 4DR6O 2CH7B 4TV9A 3OTOO 3VOUA 3AK3A 3CRCA 2E3CA 2E75B 4R7CA 1OCOC 5LP6B 4B3SB 2IJHA 1MZFA 3X2QB 5JJJB 4JYAB 5JJNB 1SQFA 1YJ9V 3WFVA 2VWKA 4JV5B 3T1YO 4ZHQA 1VQOV 3WB1A 4OPAA 3G6EV 2QE7G 2Q5ZA 1NS1A 1E1QG 3TJTA 2E5LO 2XAHA 3STLC 1JX9A 1NR1A 1YITV 1GM7A 4U3FH 1W0KG 5BMVB 4EKWA 2OCCC 1H2NA 3RN4A 3DGEA 1VQ5V 4FFBB 1H2SB 3CC4V 4EFEA 3HR0A 3IC9A 4TSFG 1A32A 3LNNA 1N4CA 4X66B 4TOIA 5D5QA 1XMQO 1OJHA 2JEXA 2YI8A 3LSSA 1VQNV 4WFGA 1GN3A 5KHIA 1ROPA 1SF9A 4NR1A 2R70A 3DC6A 1YF2A 2WLMA 1FXKA 1OCZB 4DV4O 1IBMB 1S3JA 3ZN1A 3KG2A 2WLIA 3ETGA 2IH3C 2Y69C 1K34A 1YEWA 3WG7C 1OCCC 1K73W 5KHKA 2EZPA 5IWAB 4WF9V 1MNGA 5CA0A 3SR2C 2X6CA 4CC5A 2WLKA 1AI4A 3ZMSA 4O2AA 4DW1A 4FLTA 2CTRA 2HEPA 3OD4A 4RUEA 3LUTB 1MA1A 5FL7G 1HW7A 4YY3B 2HJDA 2ZQMA 3BA8A 3K08A 1PP9H 5LMUB 3FB6C 4I5SA 4X1KA 2YC0A 4X1IA 3MHHC 2AW9A 4JI7O 2YEVB 3AG2B 3RYIA 4L87A 5LP6A 2VQEO 1P84F 1R3LC 3H1KH 2O57A 1YVWA 3SJCC 4JI5O 5JQGB 1IXMA 2F23A 4YIPA 2QWRB 3ETEA 2GTAA 3K3WA 4U7NA 2JJ2G 5L3GA 1SKVA 3ASOB 3OMAB 2PI5A 4LF4B 2BOCC 3OT7A 2HR3A 4EB6B 4I50B 1SQGA 3RYFB 2RCVA 2YDEA 5IJ0B 3KKYA 3WB0A 4ASUG 1D5AA 3NR7A 5IY5B 2P90A 4YHHO 3K58A 2P67A 2QSAA 4B3TB 2FMLA 2QM4A 1R73A 5BMVA 1WB7A 4ZIBA 3L73H 4FFBA 4X1YB 5EYPB 3MD0A 3B4SA 4DYLA 2ZDIA 2ADPA 4JTDB 2GHYA 3B8MA 3D3QA 4YIOA 3J80N 1B3QA 5HFLA 1RM1C 2VWJA 3H1LH 2EJ7A 3ZHSA 1GM8A 2JS5A 4X9QA 2YUAA 1N0JA 5LA6A 3SYAA 1VQMV 1BSMA 4JI8B 3D36A 4GCZA 3ZMUA 3CMAV 3E8FA 5KX5B 2F95B 3ZRWB 2HLDG 3BHPA 1GRJA 4DV7O 1SERA 3M99B 5DECA 3AG7A 2IU3A 3JCUZ 1MOFA 2IM9A 1TA8A 5EC1C 3HKDB 4MW8A 4DR3B 3H1IH 1WPXA 3GWOA 4XBFA 2FB5A 1YI2V 4DUYO 1Q8IA 5CN0A 3E35A 4DV0B 1DF5A 2ARHA 2B9ZA 4P30A 4JI4B 1OCRC 2UXCB 3J7AU 2BTOA 1D5NA 5JQGA 2M6YA 1QNMA 1MSDA 4PA6A 3ABKC 4KXRA 2EX3A 4PV1B 3OR6C 4H37A 4I4TB 2OIGA 4LF9B 2AZ2A 4I50A 3RYFA 2XAQA 3GVMA 5IJ0A 4DR7B 4LFBO 3R66A 2EULA 3H1JH 4JTAB 3EFFK 4GX0A 1YZBA 2L35A 3QG5A 4JYYA 3SYCA 1G4YB 3K5LA 4ZBMA 1KECA 3B2EE 4FZ0A 2VQFO 3B09A 2A7WA 3IFXA 4X1YA 2FKXA 1IBLB 1Z5VA 1XNQB 3AEIA 1DLBA 3FX7A 3L74H 2OWOA 5H6QA 4BR6A 2ITCC 3SPJA 4JI2O 4X89A 3CP1A 1ZTEA 3FAVB 4QJFB 2P4KA 5TISZ 1K3EA 4MVSA 4B3MO 4IHJB 3TXSA 2ZE7A 5EBWC 5L3FA 2X6AA 5LHHA 3JATB 5KX5A 1JR9A 3ZRWA 1YJWV 3AG3C 2LW7A 2KKWA 1GN2A 4X65O 3HB3B 2QM8A 2F1MA 3RVYA 2F4VO 3HKDA 4MT8A 2HHHO 2ADQB 2CE4A 2JIZG 4DV1B 5JJEB 2ZNJA 2UUCB 4QNHB 4LF6B 2Q7HA 5B1AC 3ZCCA 1F51A 1FXKC 5KHGA 2DW4A 4F6EA 3WU2Z 1V55C 1RPOA 1AJPA 1LUWA 3ZMZA 3RT3C 1SQVH 1QLEB 3JAMN 3TCUA 1VF7A 4TT3G 1AI7A 3CRQA 5LHGA 3OE7G 4JASA 1I0HA 2Z0AA 3S3WA 1I94O 1U96A 4J80A 1Q5OA 1FKAO 1AI5A 4CBCA 4B3RO 4I4TA 1KBHA 4GZRB 2GTSA 3JAWB 3K59A 4NVPA 5B1BB 4CH4A 3T1HB 2VS0A 4GKJB 3ASNB 3SJQC 1N33O 4NTWA 3ZMVA 2QA4V 4J7ZA 4FLVA 2BCCH 3I55V 1HR0O 2LFRA 5A9GA 3K03A 5KA5A 2ILMA 1GM9A 4UFZA 4DR1B 2RJZA 4J9YB 3SPIA 5LP6C 2ZD9A 5B66Z 3X2QC 1FYJA 1RPRA 2N74A 1MSWD 4FMTA 2XAJA 1B6QA 5KHJA 1H2KA 1SQPH 3FYEB 4CH6A 4KHPO 3OEEG 2EJRA 3FAVA 2DOSA 4JAVA 1VQLV 3DSQA 4IHJA 2YS8A 2XASA 1S5JA 1TVKB 4Z2WA 1M9NA 1J5EB 3F5WC 3HKCB 2AZ0A 1AJNA 4WFFA 1QBZA 4W4LA 1K4DC 3CCLV 2ZDIC 2UUAB 1AR1B 5KMGB 1HNWO 2Q7GA 3JD3A 1BCCH 4NTYA 1G8MA 3RWRD 3ABLB 3ZX6A 1HNXO 1L1FA 2XOKG 1EN6A 1IVSA 2KQXA 1Y67A 1E1RG 1Q6HA 2GDSA 2IJKA 3BY6A 2XAGA 4IYHA 1EM1A 1OCZC 1H2LA 1YTFD 1HWYA 1O9GA 4OGQB 3P32A 2YIBA 3BA9A 1URFA 3K5OA 1NH2D 4LFCB 2Q68A 4JYCA 3QTCA 2HKOA 3STZC 3ABTA 1P7BA 1GTOA 3UQ8A 4B7EA 4UCUA 3JD1A 4JI0O 1GAXA 4DV6O 1NH2B 3O65A 4JI6O 4PA3A 4DR4O 1P7GA 1KC8W 4PDRA 4GT1A 4H13B 1XREA 1WP7A 1RSOB 3THOA 2NR5A 4DV2O 3JAWA 1XL4A 5B1NA 2WA4A 4DV7B 3CEIA 1KUQA 2EBOA 4BW9A 2DJVA 3P30A 1XMOO 2UXBO 3AG2C 4G2KA 5FNVA 1HNZO 3CJHB 4DUYB 2WLLB 3SPHA 3RBZA 3SPGA 2W0FC 1IBKO 1EN4A 4UCSA 2GUZA 4K0KO 2YSUB 4FVMA 1VQ4V 3ETDA 3ASOC 2OTLV 2QTSA 4DV3B 4UV9A 3OUFA 4LF8O 2Q69A 2YXYA 3K9SA 1KD1W 3E89A 5IY5C 3OGCC 3ZMTA 1TVKA 1VQ9V 2PY5A 3SYOA 1XOUA 2Q73A 3HKCA 2Q67A 2IBZH 1PD3A 5K1XA 1GN4A 4OPHA 3CCUV 3D3IA 5AG2A 2XHBA 3OGIB 2WWWA 4LF5O 4KL1A 5GONB 5LMNO 4J11A 1Q82W 2JGUA 1BHBA 2OTJV 1KQSU 1GMGA 3DTUB 1N32O 3LSUA 3ZHRA 1U97A 4GLXA 4JAUA 1V54B 4IGGA 2N04A 3SGIA 4LF7B 2EIKB 4GX5A 4DO2A 1N34O 3H01A 1PL0A 2QDOA 3FB7C 4FZ1A 4DRXA 4JF3A 3CC2V 3HKEB 3E8GA 4UVCA 4LFAB 3OM3B 2LP7A 4LWSA 1PNMA 2ITDC 3LNMB 5K1PA 2IU0A 2A06H 1K97A 4MVQA 2UUBO 4B3MB 1RSOA 2OCHA 4X64B 2M7WA 3JD2A 3ZHQA 4UB6Z 2UXDO 1VMGA 2HG5C 5BR8B 4GKKB 4NKGB 1XEQA 1IZ3A 2GSMB 3JSNA 5EBMC 1NZ6A 1HDJA 2MW2B 2LGWA 4BAYA 2H94A 3BPZA 4IL6Z 1NI8A 3QNEA 3T4DA 2GBOA 1MMMA 2Z3YA 1R6NA 2QWOB 2A0LA 4PDMA 4QGPA 3CJHA 1AROP 1BT8A 2WLLA 2QWQB 4E4EA 2EIMB 5E79Z 3MDSA 4B7KA 4TV8B 5DEDA 2JRIA 2WLHA 4DV5O 1IURA 3C90A 2QJ1A 4RUFA 2IJIA 3LDDA 4AQYB 1EN5A 4PA7A 3ML0A 2CH7A 5DM6V 3BVOA 3K57A 4YJ2B 1NTMH 1S5HC 4LBEC 1QLNA 3SYPA 1XNRB 3K5MA 2ZXWB 2OT5A 2QKCA 4DW0A 4X62B 5GONA 3PN1A 4ABMA 4OX9B 4P9OA 4JAAA 1AILA 2JJ1G 3AK2A 4NXMO 4TQFA 3FKSG 1DTOA 4TQDA 1Y6XA 1HR0B 4MS2A 1QVGU 2PGGA 2DQ3A 3UCSC 4BIOA 3H1HH 4DUZO 2D2CB 1JFFB 5CB4B 2DYSB 1L0LH 2WLNA 3RYHB 1R1BA 2R9AA 1Q86W 1ZWIC 1GKFA 4UCOA 2OIEA 2DWEC 3ZJZA 1M57B 1Y4MA 3ZEDA 3QVNA 1M90W 2PUSA 1H38A 1N0NA 4WFBV 2B5UA 2Y4TA 1Y76B 2R9IA 2ZM6B 2PI4A 2IJJA 1FJGB 1AVMA 2RMKB 3IC7A 1N36O 3EHBB 3BABA 3R65A 1QLEC 1R6KA 2DQ0A 2LW1A 4FLZA 4FK5C 1ENVA 5EK0A 3TETA 4J41A 2UU9O 3VQXA 3OTFA 2YIDA 4ZI7B 3HKBB 3HPLC 3JARB 2RNBA 4UUJC 4JI3B 1AB3A 2L6LA 1AP6A 3K0GA 1VARA 1PNLA 4NXNO 1IX9A 4Q20A 4TV8A 3W7WA 4IIJB 4PDVA 3IJ4A 2ZNIA 5B1BC 2BOBC 1NBMG 3E8HA 1SESA 2DWDC 3ASNC 4U3JB 3TGUH 4AI8A 4DR5O 5LXTB 4JI6B 2P22C 4UCVA 4FM2A 2FTKA 1VF5B 4BWAA 2DYRB 5EIBC 3UO3A 4YJ2A 1K4CC 5IYBO 2YEVA 2BTQB 4K3AA 3OMIB 3KZIZ 1FS0G 3U0ZA 2ODMA 4JI1B 3OEHG 1Z5WA 4CH5A 2Q8VA 3JD0A 3N27A 5H2FZ 4EB6A 5ITZB 4Z1MG 1VQ6V 3AK1A 3L71H 1JFFA 5CB4A 2LQTA 2PF4E 2H3OA 4QE7A 3E83A 4RQEA 4PI0A 3RYHA 1G6UA 4DR2B 1S72V 2E74B 5EYPA 4B3SO 3ABLC 1H8HG 4BIUA 4JYBA 1FPOA 2ZCEA 5E1AC 4JV5O 4KFMA 1LNQA 2Q9LA 2AHYA 5LHIA 4CS2A 4DR6B 2Z5UA 3OTOB 4BIZA 3G67A 3UO2A 3CCVV 1ZX3A 2A9HA 2FL4A 5LL6Y 2UXXA 3NXSA 3E22B 2KB1A 1SZTA 3K0DA 5H5NA 4ZI7A 3HKBA 3JARA 1T5EA 3T1YB 4J9ZB 4WBNB 4ZOLB 1W2BU 4MVUA 3G80A 4FM0A 1KB9F 4FFKA 2ATKC 4MTFA 4X66O 1F7YA 3N2KB 4P2ZA 3QO8A 1OZ0A 1YDXA 3UM7A 4UXNA 2E5LB 4IIJA 3SDLA 2Y0PA 1IBMO 3A0RA 3CX5F 4BW5A 1SRYA 5LXTA 1O9HA 4QPJA 1Q3EA 2YI9A 1BE3H 5EZYB 1N8RW 1R6TA 1XMQB 2BTQA 3FB8C 4I9QA 5L3CA 1WAZA 4JZ2A 5IWAO 3ZS8C 1JVMA 1NT2B 1QQCA 2WAMA 2W0XA 3DXRB 1S77D 1VF6C 3B40A 4DV4B 3LDCA 4HZ3A 4MSWC 5D5PA 1I7FA 5H9CA 3N2GB 2QKAA 3F7YC 1XL6A 1JJOA 2HVJC 4YY3O 5BZBA 3I56V 5LMUO 5CBHA 2N05A 2V1DA 5IDJA 4DK1A 1JA8A 2RQ6A 2G38A 1M56B 1Y66A 1BMFG 1NTKH 2JS3A 1P49A 4PA4A 4CH3A 1IXBA 4XDKA 2BE3A 1FFXB 1PM9A 1PL4A 1M1KW 1P4RA 2JDIG 4EFBA 5LYJB 1WA8B 3RFRA 4LF4O 3FB5C
chains in the Genus database with same CATH topology
1IXMA 1V54C 3CCUV 3E8BA 3D3IA 2EIKC 4OXSA 1VQKV 1F4NA 1H2GA 3ETEA 1UJWB 4U7NA 3K3WA 2JJ2G 2XAFA 4DXWA 5L3GA 2WWWA 1VQPV 1CEZA 3ASOB 1KP2A 3OMAB 2EIJC 2PI5A 2BOCC 2HR3A 4MW3A 1Q82W 4RQFA 3FYIB 1E79G 1BHBA 4LP8A 4ASUG 2OTJV 1JOYA 2W6JG 3AG1C 5IY5B 1KQSU 4WFEA 1GMGA 3ABUA 3DTUB 2P90A 1Q81W 1K7DA 2P67A 2X7RB 4XDJA 5HFMA 2Q6AA 1R73A 4GX2A 3OUSA 4JAUA 4MTXA 5KA6A 3JD4A 1V54B 3F7VC 2EIKB 4GX5A 4UVAA 3MD0A 4DO2A 1BHAA 3CCEV 2ZDIA 3H01A 4MTGA 1PL0A 3FB7C 4JTDB 2GHYA 3B8MA 3CCSV 2EIJB 4JGSA 2P7TC 4PDLA 4MVZA 2AHZA 4JF3A 5HFLA 1RM1C 3CC2V 4I9WA 1FXHA 3E8GA 4UVCA 3OM3B 2LP7A 4FPPA 1QR8A 3AG1B 5IYCO 1GM8A 3CCJV 1PNMA 1KP3A 2ITDC 3LNMB 1YTFB 2IU0A 1K97A 4MVQA 1R3JC 1TUEB 3SYAA 1VQMV 5CBGA 4WCEV 1S0VA 1YIJV 2M7WA 3JD2A 3D36A 4GCZA 3PJSK 2HG5C 2QEXV 3ZMUA 3CMAV 1W0JG 3E8FA 2EIMC 2QM7A 1PKXA 2GSMB 3ZRWB 2EINC 2HLDG 1RM1B 1SERA 3M99B 1AI6A 2NNUA 1MG1A 5EBMC 3W7TA 1MABG 2IU3A 4BAYA 2H94A 4TWKA 1MOFA 4MVMA 5EC1C 2ZR3A 3QNEA 4MW8A 2CK3G 2JK5C 3T4DA 1WPXA 2Z3YA 3LSQA 1R6NA 3GWOA 2A0LA 3K06A 4PDMA 4QE9A 4XBFA 1AROP 1CPYA 2WLLA 1YI2V 3OR7C 2XNDG 2EIMB 3SYQA 4MVRA 2ZXWC 5CN0A 2EINB 2WLHA 3E35A 1YHQV 2Y48A 3CMEV 1DF5A 4U7OA 4XDLA 2WSSG 4RUFA 4X88A 1AJQA 2IJIA 3LDDA 4P30A 1OCRC 3OMNB 5CA3A 2MK3A 2B1IA 3T2MA 4PA7A 3ZN0A 5L3EA 1F23A 3ML0A 5DM6V 4PA6A 3ABKC 3W7XA 1S5HC 4LBEC 3T4ZA 1QLNA 3SYPA 3CCQV 2ZXWB 2F43G 3OR6C 4ZKIA 2DYSC 2OT5A 3QO5A 4H37A 1Q7YW 3OFNG 4HYOA 4P9OA 5EBLC 2JJ1G 3ABMC 2XAQA 5L3BA 1M57C 1OCRB 4MVOA 3FKSG 1DTOA 4GX0A 4JTAB 3EFFK 1NVPD 3SYCA 1G4YB 4ZBMA 1KECA 4R6ZA 4JPRA 4MS2A 1QVGU 2DQ3A 3ZRXA 2HVKC 1NQTA 3K9AA 3ABKB 3IFXA 2B1GA 1NVPB 4JTCB 1R3IC 2DYSB 3TK1A 4G27B 2WLNA 3ZRVA 4P9PA 3AEIA 1K8AW 5H6RA 1Q86W 3BEHA 1DLBA 5L3DA 1YSCA 3E86A 1ZWIC 1GKFA 2K1EA 3ABMB 5H6QA 2DWEC 4FIPC 2NLJC 5LGUA 3ZJZA 1M57B 1Y4MA 3CPWU 2ITCC 1EBOA 3SPJA 4X89A 3CP1A 3VBBA 3G4SV 4QJFB 1M90W 1K3EA 4MVSA 2P6JA 2UXNA 4H33A 1H38A 2HFEC 4WFBV 2B5UA 1THZA 2LFSA 5EBWC 2IW5A 5L3FA 2R9IA 2X6AA 5LHHA 1JJ2U 2PI4A 2IJJA 2W6IG 1KKDA 3IC7A 1WLEA 2QKSA 3ZRWA 1YJWV 3AG3C 3EHBB 3R65A 1QLEC 1R6KA 2DQ0A 1H8EG 4PA9A 1EZJA 3HB3B 4FK5C 1ENVA 5EK0A 3UKMA 3TETA 2QM8A 3RVYA 1COWG 1NR7A 3W7SA 4MT8A 1K33A 5KUKA 4G28B 2JIZG 3HPLC 3E2EA 5IYDO 4QNHB 2QTOA 4UUJC 2WLJA 5B1AC 3ZCCA 1F51A 1FXKC 2DYRC 2JEUA 3SPCA 1J95A 2DW4A 4QPKA 1V55C 3K0GA 4R50A 1RPOA 1QR9A 4FJCC 3G71V 1AJPA 1PNLA 3AG3B 4Q20A 3W7WA 3ZMZA 4RAIA 1QLEB 2R9RB 4RO2A 3TCUA 4PDVA 5B1BC 2BOBC 3OAAG 1NBMG 3E8HA 3JYCA 1SESA 2DWDC 4TT3G 3ASNC 4KP4A 1AI7A 1I5XA 5LHGA 3OE7G 4JASA 3CCRV 2V7QG 3CC7V 5B1AB 3T1CA 1FXKB 5LGTA 5B1OA 3QO7A 2FTKA 2DYRB 1EFRG 3ZRSA 1K4CC 5IYBO 2YEVA 1QCEA 1V55B 4UVBA 3CXCU 1AI5A 1FFTB 1NKDA 1SETA 4WFHA 3ZIAG 1JCHA 2A79B 4CBCA 4E2LA 2WLIB 4F4LA 3CYOA 3LDEA 4LC1A 5B3SC 3JCZA 5C93A 1NJIW 3OMIB 4LCUC 5B1BB 1FS0G 3AG4C 3ASNB 3SJQC 2X0LA 3ZMVA 1JQ0A 1S76D 1K92A 3CCMV 2QA4V 5CMUA 1F4MA 3OEHG 1GO3F 3I55V 4WFAV 3JD0A 3OW2U 1VQ7V 1K9MW 2LFRA 3K03A 5KA5A 4GX1A 4Z1MG 1GM9A 3MHSC 1VQ6V 4J9YB 3GB7C 5J9PC 3SPIA 2ZD9A 4PELA 4QE7A 3X2QC 2EILC 3E83A 1PNKA 4RQEA 5DN6G 2ZR2A 5B3SB 1RPRA 1MSWD 4FMTA 1I5YA 4N23A 3AG4B 1S72V 4KUMA 2H8PC 2XAJA 2EZOA 4CZZA 3W7UA 3RVZA 1B6QA 3CD6V 3ABLC 1H8HG 3FYEB 4BIUA 2D3OW 3OEEG 2EJRA 4JYBA 4JAVA 5E1AC 1VQLV 4KFMA 1LNQA 3RW0A 3VOUA 2XASA 2AHYA 1M9NA 4R7CA 5LHIA 1OCOC 3B77A 2IJHA 3F5WC 3X2QB 2EILB 2Z5UA 1YJ9V 4BIZA 3WFVA 1AJNA 3CCVV 4WFFA 4YXWG 2A9HA 1QBZA 1VQOV 1QVFU 1JPXA 1K4DC 3CCLV 2ZDIC 4R8CA 1AR1B 2UXXA 3NXSA 5CBFA 3G6EV 3JD3A 2X6BA 1G8MA 5LGNA 3ABLB 2KB1A 2QE7G 1SZTA 3K0DA 1L1FA 2XOKG 4X8AA 1E1QG 4J9ZB 1E1RG 2IJKA 3BY6A 1W2BU 4MVUA 2XAGA 2XAHA 1OCZC 3STLC 1JX9A 1NR1A 1OCOB 1GM7A 2ATKC 1W0KG 4MTFA 1YITV 1YTFD 1HWYA 2C2AA 4EKWA 4P2ZA 2OCCC 3QO8A 3DGEA 1VQ5V 3P32A 1FXVA 1OZ0A 3UM7A 3CC4V 4UXNA 1YJNV 1NH2D 4TSFG 2Q68A 3K04A 4JYCA 3STZC 2HKOA 3IGAC 3ABTA 1P7BA 1GTOA 1ORQC 2JEXA 3A0RA 3LSSA 1VQNV 4WFGA 4BW5A 3JD1A 1SRYA 1ROPA 3B8NA 4QPJA 1NH2B 2WLMA 4PA3A 1FXKA 1OCZB 1KC8W 1N8RW 4PDRA 4GT1A 1S3JA 4QIWF 2IH1C 4UV8A 3ZN1A 2OCCB 3FB8C 5L3CA 1JVMA 3KG2A 2WAMA 2WLIA 3ETGA 4MTOA 1XL4A 5B1NA 1S77D 2IH3C 2Y69C 3LDCA 1K34A 1M56C 1CP9A 4HZ3A 1VQ8V 4MSWC 3WG7C 5H9CA 1OCCC 1K73W 4WF9V 2EBOA 2EZPA 5LBQA 3P30A 3F7YC 1R3KC 2X6CA 1XL6A 1K5SA 3AG2C 1K5QA 2WLKA 1AI4A 1OHHG 3ZMSA 2HVJC 4G2KA 5BZBA 3I56V 3K79A 1GK9A 2WLLB 5CBHA 3SPHA 2V1DA 3RBZA 3SPGA 4N21A 2W0FC 4RUEA 3LUTB 5IDJA 2Y69B 1M56B 1Y66A 1DF4A 2YSUB 1BMFG 1VQ4V 5FL7G 3WG7B 3ETDA 3ASOC 1OCCB 2OTLV 2ZQMA 3K08A 5GW7A 3FB6C 4I5SA 4PA4A 2HJFC 4UV9A 3MHHC 3OUFA 2Q69A 4XDKA 1KD1W 1BL8A 2YEVB 3E89A 3AG2B 5IY5C 1M1KW 3OGCC 3ZMTA 1P4RA 2JDIG 4L87A 1VQ9V 2WPDG 3SYOA 5KUMA 1R3LC 5EC2C 4HAMA 2Q67A 1PD3A 3FB5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J95 A;  1V54 C;  4RUF A;  4X88 A;  3E8B A;  3K0D A;  3LDD A;  1V55 C;  2EIK C;  1OCR C;  3K0G A;  4OXS A;  4P30 A;  4R50 A;  4X8A A;  4J9Z B;  4DXW A;  4MVU A;  4RAI A;  2R9R B;  1OCZ C;  2EIJ C;  4PA7 A;  4RO2 A;  3STL C;  4PDV A;  3T2M A;  3TCU A;  2ATK C;  4MTF A;  2BOC C;  5B1B C;  2BOB C;  3E8H A;  3JYC A;  4MW3 A;  4EKW A;  2DWD C;  4P2Z A;  3ASN C;  4PA6 A;  2OCC C;  3ABK C;  1S5H C;  4LBE C;  3T4Z A;  3SYP A;  4LP8 A;  3UM7 A;  3OR6 C;  3AG1 C;  2DYS C;  4WFE A;  4H37 A;  4HYO A;  2Q68 A;  3K04 A;  3T1C A;  4XDJ A;  4P9O A;  3STZ C;  2Q6A A;  3IGA C;  4GX2 A;  5EBL C;  1P7B A;  3OUS A;  3ABM C;  3ZRS A;  1K4C C;  1ORQ C;  2YEV A;  3F7V C;  1M57 C;  4MVO A;  4GX5 A;  4WFG A;  4BW5 A;  4CBC A;  4GX0 A;  4JTA B;  3EFF K;  4WFH A;  2A79 B;  3SYC A;  4MTG A;  1G4Y B;  2WLI B;  4ZBM A;  2WLM A;  3FB7 C;  3LDE A;  4JTD B;  4PA3 A;  4R6Z A;  4F4L A;  4MS2 A;  5B3S C;  2P7T C;  4PDL A;  4LCU C;  4PDR A;  3AG4 C;  4MVZ A;  2HVK C;  2IH1 C;  2AHZ A;  3SJQ C;  3IFX A;  3FB8 C;  4I9W A;  3E8G A;  4JTC B;  1JVM A;  1R3I C;  3KG2 A;  2WLI A;  4MTO A;  1XL4 A;  2IH3 C;  4G27 B;  2DYR C;  2WLN A;  2ITD C;  2Y69 C;  3LNM B;  4P9P A;  3LDC A;  3K03 A;  4GX1 A;  3BEH A;  1M56 C;  4HZ3 A;  4MVQ A;  3E86 A;  1R3J C;  3SPC A;  1ZWI C;  4MSW C;  2K1E A;  3SYA A;  3WG7 C;  5CBG A;  2DWE C;  2NLJ C;  1OCC C;  3ZJZ A;  4J9Y B;  3GB7 C;  5J9P C;  3SPI A;  2ZD9 A;  2ITC C;  4QE7 A;  3SPJ A;  2EIL C;  3E83 A;  3X2Q C;  3F7Y C;  3PJS K;  4X89 A;  2HG5 C;  1R3K C;  2X6C A;  1XL6 A;  3E8F A;  2EIM C;  3AG2 C;  2WLK A;  2EIN C;  4H33 A;  2H8P C;  4MVS A;  2HVJ C;  5BZB A;  2HFE C;  5EBM C;  3RVZ A;  2WLL B;  4TWK A;  5EBW C;  3ABL C;  5CBH A;  3SPH A;  4MVM A;  3RBZ A;  3SPG A;  5EC1 C;  2W0F C;  2X6A A;  3LUT B;  4RUE A;  4MW8 A;  5E1A C;  4KFM A;  1LNQ A;  1KKD A;  3RW0 A;  2JK5 C;  2QKS A;  3VOU A;  3AG3 C;  3T4D A;  4PDM A;  3K06 A;  2A0L A;  2AHY A;  4QE9 A;  3R65 A;  1QLE C;  3ASO C;  4R7C A;  3K08 A;  1OCO C;  2WLL A;  4PA9 A;  3OR7 C;  3FB6 C;  4PA4 A;  5EK0 A;  3F5W C;  2HJF C;  3UKM A;  3RVY A;  3TET A;  3OUF A;  2Q69 A;  4XDK A;  1BL8 A;  3E89 A;  4WFF A;  4MVR A;  3SYQ A;  2A9H A;  2ZXW C;  5KUK A;  4G28 B;  3HPL C;  5IY5 C;  3OGC C;  1K4D C;  4QNH B;  2QTO A;  4R8C A;  4UUJ C;  3SYO A;  2WLJ A;  2WLH A;  5B1A C;  5KUM A;  5CBF A;  1R3L C;  2X6B A;  5EC2 C;  2Q67 A;  2KB1 A;  3FB5 C;  4XDL A; 
#chains in the Genus database with same CATH topology
 4O4I B;  5JH7 B;  1V54 C;  4JI7 B;  2CTP A;  3E8B A;  2EIK C;  3FD9 A;  1F4N A;  1H2G A;  2XAF A;  4DXW A;  1VQP V;  5FLX N;  1CEZ A;  4B3T O;  4DK0 A;  2VQE B;  3E22 A;  4LNU B;  4JI5 B;  4RQF A;  1E79 G;  3JAT A;  4IYI A;  4LP8 A;  1JOY A;  2W6J G;  4WBN A;  4ZOL A;  1TGO A;  3JAL B;  1Q81 W;  2X7R B;  2DE0 X;  4GX2 A;  4HNA B;  3BFR A;  3BAA A;  3OUS A;  2NN4 A;  5KA6 A;  5C8Y B;  3F7V C;  5J2T B;  4UVA A;  1WPB A;  3F5T A;  4MTG A;  4YHH B;  3CCS V;  2EIJ B;  4JGS A;  1SA0 B;  4MVZ A;  2AHZ A;  1US6 A;  3CRM A;  4I9W A;  1FXH A;  2P5O A;  4FPP A;  3AG1 B;  4JI8 O;  1G1X B;  1UFI A;  4PHZ A;  5EZY A;  2JVD A;  1LUV A;  1YTF B;  3GWK C;  5BY1 A;  1TUE B;  5CBG A;  2Q0A A;  1S0V A;  3DXR A;  1YIJ V;  1Z2G A;  3L70 H;  4DR3 O;  3H9V A;  3P3N A;  2EIM C;  1SS3 A;  1PKX A;  1AI6 A;  1MAB G;  3N2G A;  2Y0I A;  1XHX A;  1M5I A;  4TWK A;  2BSK B;  4MVM A;  4O4H B;  2ZR3 A;  1AR4 A;  4YJ3 B;  2JK5 C;  1MZE A;  3K06 A;  2FYU H;  2AXT Z;  4DV0 O;  1B06 A;  1KMI Z;  3OR7 C;  5J2U B;  2XND G;  1Q6U A;  4JI4 O;  1QHT A;  4LR3 A;  2ZXW C;  2UXC O;  3CRR A;  2EIN B;  2Y48 A;  3CME V;  2VRZ A;  4UB8 Z;  4XDL A;  5CA1 B;  2WSS G;  1FFX A;  4X88 A;  1AJQ A;  4LH7 A;  4FLX A;  3OMN B;  2MK3 A;  2LO1 A;  3UT5 B;  2YXL A;  5LYJ A;  3VQY A;  4LF9 O;  1F23 A;  4O4I A;  5JH7 A;  1SQQ H;  1Q6I A;  3G6B A;  3W7X A;  4DR7 O;  2F93 B;  2F43 G;  4NTX A;  4ZKI A;  2DYS C;  1X59 A;  1Q7Y W;  3L72 H;  4HYO A;  5A2Q N;  5GTH Z;  4PD4 F;  4LNU A;  4Z1V A;  2ZIM A;  3L9D A;  5L3B A;  1M57 C;  4MVO A;  1BQZ A;  4TUY B;  2Q7E A;  3JAL A;  1IBL O;  1SQX H;  1XNQ O;  5KMG A;  4R6Z A;  4HNA A;  1PPJ H;  3ZRX A;  2HVK C;  5C8Y A;  1NQT A;  1FD9 A;  3K9A A;  3ZHV A;  5J2T A;  4LFB B;  2B1G A;  4JTC B;  1R3I C;  4LH6 A;  3TXQ A;  3K5N A;  1K8A W;  1SA0 A;  1WNS A;  5H6R A;  3BEH A;  5L3D A;  2VQF B;  3ABM B;  3RYI B;  4FIP C;  5LGU A;  1XQ8 A;  3CPW U;  1KKC A;  3CHX A;  3VBB A;  2P6J A;  2UXN A;  4H33 A;  1GN6 A;  1WP8 A;  3Q4H B;  5BXZ A;  2LFS A;  1ZAU A;  4JI2 B;  1JJ2 U;  4CC6 A;  1KKD A;  1KYO F;  2QKS A;  4DV1 O;  2UUC O;  4LF6 O;  4I55 B;  4PA9 A;  1EZJ A;  4X20 B;  1XBL A;  2BSK A;  3UKM A;  1XDC A;  4O4H A;  2ZIN A;  4YJ3 A;  3E2E A;  2Y4U A;  4RWU A;  2QTO A;  2WLJ A;  3MAQ A;  3M8A A;  4X65 B;  5J2U A;  2DYR C;  4GYC B;  2JEU A;  3SPC A;  2F4V B;  1J95 A;  4R50 A;  2HHH B;  4FJC C;  1QR9 A;  4D6T H;  4J7K A;  2ZE8 A;  1SC5 B;  4RAI A;  2LJ2 A;  2R9R B;  4RO2 A;  2XTA A;  3OAA G;  5CA1 A;  3CE2 A;  1VF6 A;  5LA6 B;  2ETN A;  3S3X A;  1ZSP A;  3UT5 A;  5IJ9 B;  3A0H Z;  2KG7 B;  3CCR V;  5B1O A;  3ZBH A;  2DMX A;  3QO7 A;  3T1H O;  1EFR G;  4GKJ O;  2CDY A;  1OV9 A;  1QCE A;  1NKD A;  1BGY H;  1JCH A;  2A79 B;  4E2L A;  3LDE A;  3C3S A;  4HBN A;  1I94 B;  1NJI W;  5IYZ B;  4DR1 O;  2OYQ A;  1S76 D;  1K92 A;  4TUY A;  3CCM V;  1ZLZ A;  5CMU A;  1DK1 A;  4B3R B;  1GO3 F;  2K9P A;  4WFA V;  3OW2 U;  1VQ7 V;  1K9M W;  4GX1 A;  3APO A;  1N33 B;  5J9P C;  3SJA C;  1D2D A;  4PEL A;  1PNK A;  2ZR2 A;  5B3S B;  1S5L Z;  2QGN A;  4N23 A;  3AG4 B;  4D7T A;  2H8P C;  2EZO A;  4CZZ A;  1J5E O;  3CD6 V;  3RW0 A;  3A2F A;  2CGN A;  4O4L B;  2ZKO A;  2UUA O;  1X4T A;  3HKE A;  3Q4H A;  2Q4P A;  5GTI Z;  3B77 A;  5KAI Z;  2ZT9 B;  2EIL B;  4Q6G A;  4KHP B;  4YXW G;  1QVF U;  1JPX A;  4I55 A;  3U11 A;  4R8C A;  2WA3 A;  5CBF A;  4X20 A;  1RP3 B;  2X6B A;  5LGN A;  5KAF Z;  3CS5 A;  1M93 A;  4X8A A;  2XT9 A;  4LFC O;  5LOV B;  1HNW B;  1OCO B;  2C2A A;  2XUM A;  4F6R B;  5JWP A;  3I5D A;  1HNX B;  1FXV A;  2YIA A;  2QWN B;  1YJN V;  1XHZ A;  3VQV A;  3K04 A;  1LR1 A;  4FM1 A;  3IGA C;  2A3Q A;  4IT5 A;  1ORQ C;  1HP8 A;  5FPO A;  5IJ9 A;  2KG7 A;  4O2B B;  4UCR A;  1W59 A;  3B8N A;  4J7J A;  1FAF A;  1CXZ B;  4QIW F;  4CS3 A;  2IH1 C;  4UV8 A;  2OCC B;  3CWB H;  4JI0 B;  4J42 A;  3O9O A;  4DV6 B;  4MTO A;  2RN9 A;  4DR4 B;  2CUG A;  4I7Z B;  1M56 C;  1CP9 A;  1VQ8 V;  5IYZ A;  4DV2 B;  5LBQ A;  2HP8 A;  1R3K C;  1K5S A;  1K5Q A;  1OHH G;  3K79 A;  4DV3 O;  3SJB C;  1GK9 A;  4FLY A;  2YIC A;  1XMO B;  4N21 A;  2UXB B;  2Y69 B;  1DF4 A;  3WG7 B;  1HNZ B;  1OCC B;  4FLU A;  1I08 A;  2P4V A;  5GW7 A;  2DN9 A;  4CS4 A;  2HJF C;  3JAS B;  1IBK B;  1BL8 A;  3RYC B;  4O4L A;  4K0K B;  1IDS A;  2WPD G;  2PTM A;  5KUM A;  1UPG A;  5EC2 C;  4HAM A;  5JCO A;  4JYA O;  1Y74 B;  2CGO A;  4LF8 B;  3APQ A;  4JZG A;  1EZV H;  1VQK V;  4OXS A;  1UJW B;  2YXH A;  2ZE6 A;  3U10 A;  1KP2 A;  2EIJ C;  1YCI A;  3ZHT A;  4MW3 A;  3FYI B;  1Y76 A;  3ZHU A;  4LF7 O;  1NU1 H;  3A0B Z;  4PJ0 Z;  3C3T A;  3AG1 C;  4WFE A;  5JVD B;  1DGS A;  1TUB B;  3ABU A;  5LOV A;  1NTZ H;  1K7D A;  4XDJ A;  4O4J B;  4LF5 B;  5HFM A;  2Q6A A;  3CRA A;  5LMN B;  1H2M A;  4AHC A;  1VP7 A;  4F6R A;  2PZS A;  4MTX A;  3JD4 A;  4LFA O;  1BHA A;  3CCE V;  3CB2 A;  1N32 B;  2P7T C;  4PDL A;  2Q0O C;  1QU7 A;  2ZIO A;  1BQ0 A;  4O2B A;  4X64 O;  1QR8 A;  1N34 B;  5IYC O;  3CCJ V;  5F2V O;  2F66 C;  1KP3 A;  5BR8 O;  4GKK O;  1R3J C;  4U3J A;  3CXH F;  1VIB A;  4WCE V;  3JAK B;  4GUN A;  5KHH A;  4I0X B;  3PJS K;  2QEX V;  1W0J G;  2QM7 A;  2YIB D;  2EIN C;  2UUB B;  1RM1 B;  3P3P A;  2NNU A;  1MG1 A;  2QR4 A;  3W7T A;  1TAE A;  2UXD B;  3VQW A;  2CK3 G;  3ICX A;  2E76 B;  1AP5 A;  3LSQ A;  3JSL A;  4QE9 A;  1CPY A;  4L8J A;  4J10 A;  1WB8 A;  5ITZ A;  3SYQ A;  4MVR A;  4AQY O;  1YHQ V;  2V4D A;  4U7O A;  3JAS A;  3EXA A;  5FPR A;  1XNR O;  1KU9 A;  3RYC A;  5CA3 A;  2LGQ A;  4A5U B;  4X62 O;  3KCY A;  2QWP B;  2B1I A;  4OX9 O;  3T2M A;  3BCC H;  3ZN0 A;  4DV5 B;  5L3E A;  1Y74 A;  5EIB D;  2JGD B;  3T4Z A;  1ZL8 B;  3CCQ V;  4K8Z A;  3QO5 A;  1ZUQ A;  3OFN G;  3IAY A;  5EBL C;  3KCX A;  4EEQ A;  3ABM C;  5FNV B;  1OCR B;  1NVP D;  5JVD A;  2CAZ C;  1TUB A;  1RFY A;  2GV9 A;  4O4J A;  3CSX A;  4JPR A;  4NYK A;  3QF7 A;  2GUZ B;  3FFQ A;  4NXM B;  1Q90 D;  4K8X A;  3ABK B;  1NVP B;  3BRC A;  3TK1 A;  4AIL C;  4G27 B;  3ZRV A;  4P9P A;  1YSC A;  3E86 A;  1VEW A;  3N2K A;  2K1E A;  3D8C A;  2NLJ C;  4DUZ B;  1XUQ A;  1EBO A;  4TV9 B;  2ZM6 O;  3G4S V;  1FJG O;  1GH6 A;  2R72 A;  3J81 N;  3DC5 A;  2HFE C;  3JAK A;  2P06 A;  4FLW A;  1SQB H;  1THZ A;  3A8T A;  1BZK A;  4I0X A;  2IW5 A;  2W6I G;  3L75 H;  1WLE A;  4ZHQ B;  2PYJ A;  4JI3 O;  1H8E G;  4UCT A;  1COW G;  1L8D A;  1NR7 A;  1WN7 A;  3W7S A;  1K33 A;  4W4K A;  3RGB A;  5KUK A;  4G28 B;  1N36 B;  5IT9 N;  5IYD O;  1Q43 A;  3D36 C;  4DRX B;  5B5E Z;  1BS3 A;  1L0N H;  5IE9 A;  4D7S A;  2UU9 B;  3ETQ A;  4QPK A;  4ICG A;  2CTW A;  3G71 V;  3AG3 B;  4LWS B;  4PI2 A;  1M4U A;  2RDC A;  4C7U A;  3JYC A;  4KP4 A;  1I5X A;  4H44 B;  5KLV H;  4NXN B;  2V7Q G;  3CC7 V;  1B04 A;  5B1A B;  3T1C A;  1FXK B;  5LGT A;  1PV0 A;  1XIL A;  3ZRS A;  2JGD A;  1ZL8 A;  1V55 B;  3M7M X;  4UVB A;  1AR5 A;  3CXC U;  1YXB A;  1FFT B;  1SET A;  1V9P A;  2ZE5 A;  4WFH A;  4JI1 O;  3ZIA G;  4K35 A;  4DR5 B;  2WLI B;  1WA8 A;  4F4L A;  3CYO A;  4LC1 A;  5B3S C;  3JCZ A;  1XI1 A;  5C93 A;  4NB5 A;  2PYL A;  4LCU C;  3AG4 C;  4H0L B;  2X0L A;  1JQ0 A;  3EVK A;  1F4M A;  1WJZ A;  3WB2 A;  4B08 A;  5CA0 B;  1JMK C;  4DR2 O;  3MHS C;  2AGA A;  4O2A B;  3GB7 C;  2EIL C;  1SZX A;  5DN6 G;  5JCO C;  2CTQ A;  1I5Y A;  4KUM A;  3W7U A;  3RVZ A;  2KSD A;  4X1K B;  2D3O W;  4X1I B;  4DR6 O;  2CH7 B;  4TV9 A;  3OTO O;  3VOU A;  3AK3 A;  3CRC A;  2E3C A;  2E75 B;  4R7C A;  1OCO C;  5LP6 B;  4B3S B;  2IJH A;  1MZF A;  3X2Q B;  5JJJ B;  4JYA B;  5JJN B;  1SQF A;  1YJ9 V;  3WFV A;  2VWK A;  4JV5 B;  3T1Y O;  4ZHQ A;  1VQO V;  3WB1 A;  4OPA A;  3G6E V;  2QE7 G;  2Q5Z A;  1NS1 A;  1E1Q G;  3TJT A;  2E5L O;  2XAH A;  3STL C;  1JX9 A;  1NR1 A;  1YIT V;  1GM7 A;  4U3F H;  1W0K G;  5BMV B;  4EKW A;  2OCC C;  1H2N A;  3RN4 A;  3DGE A;  1VQ5 V;  4FFB B;  1H2S B;  3CC4 V;  4EFE A;  3HR0 A;  3IC9 A;  4TSF G;  1A32 A;  3LNN A;  1N4C A;  4X66 B;  4TOI A;  5D5Q A;  1XMQ O;  1OJH A;  2JEX A;  2YI8 A;  3LSS A;  1VQN V;  4WFG A;  1GN3 A;  5KHI A;  1ROP A;  1SF9 A;  4NR1 A;  2R70 A;  3DC6 A;  1YF2 A;  2WLM A;  1FXK A;  1OCZ B;  4DV4 O;  1IBM B;  1S3J A;  3ZN1 A;  3KG2 A;  2WLI A;  3ETG A;  2IH3 C;  2Y69 C;  1K34 A;  1YEW A;  3WG7 C;  1OCC C;  1K73 W;  5KHK A;  2EZP A;  5IWA B;  4WF9 V;  1MNG A;  5CA0 A;  3SR2 C;  2X6C A;  4CC5 A;  2WLK A;  1AI4 A;  3ZMS A;  4O2A A;  4DW1 A;  4FLT A;  2CTR A;  2HEP A;  3OD4 A;  4RUE A;  3LUT B;  1MA1 A;  5FL7 G;  1HW7 A;  4YY3 B;  2HJD A;  2ZQM A;  3BA8 A;  3K08 A;  1PP9 H;  5LMU B;  3FB6 C;  4I5S A;  4X1K A;  2YC0 A;  4X1I A;  3MHH C;  2AW9 A;  4JI7 O;  2YEV B;  3AG2 B;  3RYI A;  4L87 A;  5LP6 A;  2VQE O;  1P84 F;  1R3L C;  3H1K H;  2O57 A;  1YVW A;  3SJC C;  4JI5 O;  5JQG B;  1IXM A;  2F23 A;  4YIP A;  2QWR B;  3ETE A;  2GTA A;  3K3W A;  4U7N A;  2JJ2 G;  5L3G A;  1SKV A;  3ASO B;  3OMA B;  2PI5 A;  4LF4 B;  2BOC C;  3OT7 A;  2HR3 A;  4EB6 B;  4I50 B;  1SQG A;  3RYF B;  2RCV A;  2YDE A;  5IJ0 B;  3KKY A;  3WB0 A;  4ASU G;  1D5A A;  3NR7 A;  5IY5 B;  2P90 A;  4YHH O;  3K58 A;  2P67 A;  2QSA A;  4B3T B;  2FML A;  2QM4 A;  1R73 A;  5BMV A;  1WB7 A;  4ZIB A;  3L73 H;  4FFB A;  4X1Y B;  5EYP B;  3MD0 A;  3B4S A;  4DYL A;  2ZDI A;  2ADP A;  4JTD B;  2GHY A;  3B8M A;  3D3Q A;  4YIO A;  3J80 N;  1B3Q A;  5HFL A;  1RM1 C;  2VWJ A;  3H1L H;  2EJ7 A;  3ZHS A;  1GM8 A;  2JS5 A;  4X9Q A;  2YUA A;  1N0J A;  5LA6 A;  3SYA A;  1VQM V;  1BSM A;  4JI8 B;  3D36 A;  4GCZ A;  3ZMU A;  3CMA V;  3E8F A;  5KX5 B;  2F95 B;  3ZRW B;  2HLD G;  3BHP A;  1GRJ A;  4DV7 O;  1SER A;  3M99 B;  5DEC A;  3AG7 A;  2IU3 A;  3JCU Z;  1MOF A;  2IM9 A;  1TA8 A;  5EC1 C;  3HKD B;  4MW8 A;  4DR3 B;  3H1I H;  1WPX A;  3GWO A;  4XBF A;  2FB5 A;  1YI2 V;  4DUY O;  1Q8I A;  5CN0 A;  3E35 A;  4DV0 B;  1DF5 A;  2ARH A;  2B9Z A;  4P30 A;  4JI4 B;  1OCR C;  2UXC B;  3J7A U;  2BTO A;  1D5N A;  5JQG A;  2M6Y A;  1QNM A;  1MSD A;  4PA6 A;  3ABK C;  4KXR A;  2EX3 A;  4PV1 B;  3OR6 C;  4H37 A;  4I4T B;  2OIG A;  4LF9 B;  2AZ2 A;  4I50 A;  3RYF A;  2XAQ A;  3GVM A;  5IJ0 A;  4DR7 B;  4LFB O;  3R66 A;  2EUL A;  3H1J H;  4JTA B;  3EFF K;  4GX0 A;  1YZB A;  2L35 A;  3QG5 A;  4JYY A;  3SYC A;  1G4Y B;  3K5L A;  4ZBM A;  1KEC A;  3B2E E;  4FZ0 A;  2VQF O;  3B09 A;  2A7W A;  3IFX A;  4X1Y A;  2FKX A;  1IBL B;  1Z5V A;  1XNQ B;  3AEI A;  1DLB A;  3FX7 A;  3L74 H;  2OWO A;  5H6Q A;  4BR6 A;  2ITC C;  3SPJ A;  4JI2 O;  4X89 A;  3CP1 A;  1ZTE A;  3FAV B;  4QJF B;  2P4K A;  5TIS Z;  1K3E A;  4MVS A;  4B3M O;  4IHJ B;  3TXS A;  2ZE7 A;  5EBW C;  5L3F A;  2X6A A;  5LHH A;  3JAT B;  5KX5 A;  1JR9 A;  3ZRW A;  1YJW V;  3AG3 C;  2LW7 A;  2KKW A;  1GN2 A;  4X65 O;  3HB3 B;  2QM8 A;  2F1M A;  3RVY A;  2F4V O;  3HKD A;  4MT8 A;  2HHH O;  2ADQ B;  2CE4 A;  2JIZ G;  4DV1 B;  5JJE B;  2ZNJ A;  2UUC B;  4QNH B;  4LF6 B;  2Q7H A;  5B1A C;  3ZCC A;  1F51 A;  1FXK C;  5KHG A;  2DW4 A;  4F6E A;  3WU2 Z;  1V55 C;  1RPO A;  1AJP A;  1LUW A;  3ZMZ A;  3RT3 C;  1SQV H;  1QLE B;  3JAM N;  3TCU A;  1VF7 A;  4TT3 G;  1AI7 A;  3CRQ A;  5LHG A;  3OE7 G;  4JAS A;  1I0H A;  2Z0A A;  3S3W A;  1I94 O;  1U96 A;  4J80 A;  1Q5O A;  1FKA O;  1AI5 A;  4CBC A;  4B3R O;  4I4T A;  1KBH A;  4GZR B;  2GTS A;  3JAW B;  3K59 A;  4NVP A;  5B1B B;  4CH4 A;  3T1H B;  2VS0 A;  4GKJ B;  3ASN B;  3SJQ C;  1N33 O;  4NTW A;  3ZMV A;  2QA4 V;  4J7Z A;  4FLV A;  2BCC H;  3I55 V;  1HR0 O;  2LFR A;  5A9G A;  3K03 A;  5KA5 A;  2ILM A;  1GM9 A;  4UFZ A;  4DR1 B;  2RJZ A;  4J9Y B;  3SPI A;  5LP6 C;  2ZD9 A;  5B66 Z;  3X2Q C;  1FYJ A;  1RPR A;  2N74 A;  1MSW D;  4FMT A;  2XAJ A;  1B6Q A;  5KHJ A;  1H2K A;  1SQP H;  3FYE B;  4CH6 A;  4KHP O;  3OEE G;  2EJR A;  3FAV A;  2DOS A;  4JAV A;  1VQL V;  3DSQ A;  4IHJ A;  2YS8 A;  2XAS A;  1S5J A;  1TVK B;  4Z2W A;  1M9N A;  1J5E B;  3F5W C;  3HKC B;  2AZ0 A;  1AJN A;  4WFF A;  1QBZ A;  4W4L A;  1K4D C;  3CCL V;  2ZDI C;  2UUA B;  1AR1 B;  5KMG B;  1HNW O;  2Q7G A;  3JD3 A;  1BCC H;  4NTY A;  1G8M A;  3RWR D;  3ABL B;  3ZX6 A;  1HNX O;  1L1F A;  2XOK G;  1EN6 A;  1IVS A;  2KQX A;  1Y67 A;  1E1R G;  1Q6H A;  2GDS A;  2IJK A;  3BY6 A;  2XAG A;  4IYH A;  1EM1 A;  1OCZ C;  1H2L A;  1YTF D;  1HWY A;  1O9G A;  4OGQ B;  3P32 A;  2YIB A;  3BA9 A;  1URF A;  3K5O A;  1NH2 D;  4LFC B;  2Q68 A;  4JYC A;  3QTC A;  2HKO A;  3STZ C;  3ABT A;  1P7B A;  1GTO A;  3UQ8 A;  4B7E A;  4UCU A;  3JD1 A;  4JI0 O;  1GAX A;  4DV6 O;  1NH2 B;  3O65 A;  4JI6 O;  4PA3 A;  4DR4 O;  1P7G A;  1KC8 W;  4PDR A;  4GT1 A;  4H13 B;  1XRE A;  1WP7 A;  1RSO B;  3THO A;  2NR5 A;  4DV2 O;  3JAW A;  1XL4 A;  5B1N A;  2WA4 A;  4DV7 B;  3CEI A;  1KUQ A;  2EBO A;  4BW9 A;  2DJV A;  3P30 A;  1XMO O;  2UXB O;  3AG2 C;  4G2K A;  5FNV A;  1HNZ O;  3CJH B;  4DUY B;  2WLL B;  3SPH A;  3RBZ A;  3SPG A;  2W0F C;  1IBK O;  1EN4 A;  4UCS A;  2GUZ A;  4K0K O;  2YSU B;  4FVM A;  1VQ4 V;  3ETD A;  3ASO C;  2OTL V;  2QTS A;  4DV3 B;  4UV9 A;  3OUF A;  4LF8 O;  2Q69 A;  2YXY A;  3K9S A;  1KD1 W;  3E89 A;  5IY5 C;  3OGC C;  3ZMT A;  1TVK A;  1VQ9 V;  2PY5 A;  3SYO A;  1XOU A;  2Q73 A;  3HKC A;  2Q67 A;  2IBZ H;  1PD3 A;  5K1X A;  1GN4 A;  4OPH A;  3CCU V;  3D3I A;  5AG2 A;  2XHB A;  3OGI B;  2WWW A;  4LF5 O;  4KL1 A;  5GON B;  5LMN O;  4J11 A;  1Q82 W;  2JGU A;  1BHB A;  2OTJ V;  1KQS U;  1GMG A;  3DTU B;  1N32 O;  3LSU A;  3ZHR A;  1U97 A;  4GLX A;  4JAU A;  1V54 B;  4IGG A;  2N04 A;  3SGI A;  4LF7 B;  2EIK B;  4GX5 A;  4DO2 A;  1N34 O;  3H01 A;  1PL0 A;  2QDO A;  3FB7 C;  4FZ1 A;  4DRX A;  4JF3 A;  3CC2 V;  3HKE B;  3E8G A;  4UVC A;  4LFA B;  3OM3 B;  2LP7 A;  4LWS A;  1PNM A;  2ITD C;  3LNM B;  5K1P A;  2IU0 A;  2A06 H;  1K97 A;  4MVQ A;  2UUB O;  4B3M B;  1RSO A;  2OCH A;  4X64 B;  2M7W A;  3JD2 A;  3ZHQ A;  4UB6 Z;  2UXD O;  1VMG A;  2HG5 C;  5BR8 B;  4GKK B;  4NKG B;  1XEQ A;  1IZ3 A;  2GSM B;  3JSN A;  5EBM C;  1NZ6 A;  1HDJ A;  2MW2 B;  2LGW A;  4BAY A;  2H94 A;  3BPZ A;  4IL6 Z;  1NI8 A;  3QNE A;  3T4D A;  2GBO A;  1MMM A;  2Z3Y A;  1R6N A;  2QWO B;  2A0L A;  4PDM A;  4QGP A;  3CJH A;  1ARO P;  1BT8 A;  2WLL A;  2QWQ B;  4E4E A;  2EIM B;  5E79 Z;  3MDS A;  4B7K A;  4TV8 B;  5DED A;  2JRI A;  2WLH A;  4DV5 O;  1IUR A;  3C90 A;  2QJ1 A;  4RUF A;  2IJI A;  3LDD A;  4AQY B;  1EN5 A;  4PA7 A;  3ML0 A;  2CH7 A;  5DM6 V;  3BVO A;  3K57 A;  4YJ2 B;  1NTM H;  1S5H C;  4LBE C;  1QLN A;  3SYP A;  1XNR B;  3K5M A;  2ZXW B;  2OT5 A;  2QKC A;  4DW0 A;  4X62 B;  5GON A;  3PN1 A;  4ABM A;  4OX9 B;  4P9O A;  4JAA A;  1AIL A;  2JJ1 G;  3AK2 A;  4NXM O;  4TQF A;  3FKS G;  1DTO A;  4TQD A;  1Y6X A;  1HR0 B;  4MS2 A;  1QVG U;  2PGG A;  2DQ3 A;  3UCS C;  4BIO A;  3H1H H;  4DUZ O;  2D2C B;  1JFF B;  5CB4 B;  2DYS B;  1L0L H;  2WLN A;  3RYH B;  1R1B A;  2R9A A;  1Q86 W;  1ZWI C;  1GKF A;  4UCO A;  2OIE A;  2DWE C;  3ZJZ A;  1M57 B;  1Y4M A;  3ZED A;  3QVN A;  1M90 W;  2PUS A;  1H38 A;  1N0N A;  4WFB V;  2B5U A;  2Y4T A;  1Y76 B;  2R9I A;  2ZM6 B;  2PI4 A;  2IJJ A;  1FJG B;  1AVM A;  2RMK B;  3IC7 A;  1N36 O;  3EHB B;  3BAB A;  3R65 A;  1QLE C;  1R6K A;  2DQ0 A;  2LW1 A;  4FLZ A;  4FK5 C;  1ENV A;  5EK0 A;  3TET A;  4J41 A;  2UU9 O;  3VQX A;  3OTF A;  2YID A;  4ZI7 B;  3HKB B;  3HPL C;  3JAR B;  2RNB A;  4UUJ C;  4JI3 B;  1AB3 A;  2L6L A;  1AP6 A;  3K0G A;  1VAR A;  1PNL A;  4NXN O;  1IX9 A;  4Q20 A;  4TV8 A;  3W7W A;  4IIJ B;  4PDV A;  3IJ4 A;  2ZNI A;  5B1B C;  2BOB C;  1NBM G;  3E8H A;  1SES A;  2DWD C;  3ASN C;  4U3J B;  3TGU H;  4AI8 A;  4DR5 O;  5LXT B;  4JI6 B;  2P22 C;  4UCV A;  4FM2 A;  2FTK A;  1VF5 B;  4BWA A;  2DYR B;  5EIB C;  3UO3 A;  4YJ2 A;  1K4C C;  5IYB O;  2YEV A;  2BTQ B;  4K3A A;  3OMI B;  3KZI Z;  1FS0 G;  3U0Z A;  2ODM A;  4JI1 B;  3OEH G;  1Z5W A;  4CH5 A;  2Q8V A;  3JD0 A;  3N27 A;  5H2F Z;  4EB6 A;  5ITZ B;  4Z1M G;  1VQ6 V;  3AK1 A;  3L71 H;  1JFF A;  5CB4 A;  2LQT A;  2PF4 E;  2H3O A;  4QE7 A;  3E83 A;  4RQE A;  4PI0 A;  3RYH A;  1G6U A;  4DR2 B;  1S72 V;  2E74 B;  5EYP A;  4B3S O;  3ABL C;  1H8H G;  4BIU A;  4JYB A;  1FPO A;  2ZCE A;  5E1A C;  4JV5 O;  4KFM A;  1LNQ A;  2Q9L A;  2AHY A;  5LHI A;  4CS2 A;  4DR6 B;  2Z5U A;  3OTO B;  4BIZ A;  3G67 A;  3UO2 A;  3CCV V;  1ZX3 A;  2A9H A;  2FL4 A;  5LL6 Y;  2UXX A;  3NXS A;  3E22 B;  2KB1 A;  1SZT A;  3K0D A;  5H5N A;  4ZI7 A;  3HKB A;  3JAR A;  1T5E A;  3T1Y B;  4J9Z B;  4WBN B;  4ZOL B;  1W2B U;  4MVU A;  3G80 A;  4FM0 A;  1KB9 F;  4FFK A;  2ATK C;  4MTF A;  4X66 O;  1F7Y A;  3N2K B;  4P2Z A;  3QO8 A;  1OZ0 A;  1YDX A;  3UM7 A;  4UXN A;  2E5L B;  4IIJ A;  3SDL A;  2Y0P A;  1IBM O;  3A0R A;  3CX5 F;  4BW5 A;  1SRY A;  5LXT A;  1O9H A;  4QPJ A;  1Q3E A;  2YI9 A;  1BE3 H;  5EZY B;  1N8R W;  1R6T A;  1XMQ B;  2BTQ A;  3FB8 C;  4I9Q A;  5L3C A;  1WAZ A;  4JZ2 A;  5IWA O;  3ZS8 C;  1JVM A;  1NT2 B;  1QQC A;  2WAM A;  2W0X A;  3DXR B;  1S77 D;  1VF6 C;  3B40 A;  4DV4 B;  3LDC A;  4HZ3 A;  4MSW C;  5D5P A;  1I7F A;  5H9C A;  3N2G B;  2QKA A;  3F7Y C;  1XL6 A;  1JJO A;  2HVJ C;  4YY3 O;  5BZB A;  3I56 V;  5LMU O;  5CBH A;  2N05 A;  2V1D A;  5IDJ A;  4DK1 A;  1JA8 A;  2RQ6 A;  2G38 A;  1M56 B;  1Y66 A;  1BMF G;  1NTK H;  2JS3 A;  1P49 A;  4PA4 A;  4CH3 A;  1IXB A;  4XDK A;  2BE3 A;  1FFX B;  1PM9 A;  1PL4 A;  1M1K W;  1P4R A;  2JDI G;  4EFB A;  5LYJ B;  1WA8 B;  3RFR A;  4LF4 O;  3FB5 C; 
#chains in the Genus database with same CATH homology
 1IXM A;  1V54 C;  3CCU V;  3E8B A;  3D3I A;  2EIK C;  4OXS A;  1VQK V;  1F4N A;  1H2G A;  3ETE A;  1UJW B;  4U7N A;  3K3W A;  2JJ2 G;  2XAF A;  4DXW A;  5L3G A;  2WWW A;  1VQP V;  1CEZ A;  3ASO B;  1KP2 A;  3OMA B;  2EIJ C;  2PI5 A;  2BOC C;  2HR3 A;  4MW3 A;  1Q82 W;  4RQF A;  3FYI B;  1E79 G;  1BHB A;  4LP8 A;  4ASU G;  2OTJ V;  1JOY A;  2W6J G;  3AG1 C;  5IY5 B;  1KQS U;  4WFE A;  1GMG A;  3ABU A;  3DTU B;  2P90 A;  1Q81 W;  1K7D A;  2P67 A;  2X7R B;  4XDJ A;  5HFM A;  2Q6A A;  1R73 A;  4GX2 A;  3OUS A;  4JAU A;  4MTX A;  5KA6 A;  3JD4 A;  1V54 B;  3F7V C;  2EIK B;  4GX5 A;  4UVA A;  3MD0 A;  4DO2 A;  1BHA A;  3CCE V;  2ZDI A;  3H01 A;  4MTG A;  1PL0 A;  3FB7 C;  4JTD B;  2GHY A;  3B8M A;  3CCS V;  2EIJ B;  4JGS A;  2P7T C;  4PDL A;  4MVZ A;  2AHZ A;  4JF3 A;  5HFL A;  1RM1 C;  3CC2 V;  4I9W A;  1FXH A;  3E8G A;  4UVC A;  3OM3 B;  2LP7 A;  4FPP A;  1QR8 A;  3AG1 B;  5IYC O;  1GM8 A;  3CCJ V;  1PNM A;  1KP3 A;  2ITD C;  3LNM B;  1YTF B;  2IU0 A;  1K97 A;  4MVQ A;  1R3J C;  1TUE B;  3SYA A;  1VQM V;  5CBG A;  4WCE V;  1S0V A;  1YIJ V;  2M7W A;  3JD2 A;  3D36 A;  4GCZ A;  3PJS K;  2HG5 C;  2QEX V;  3ZMU A;  3CMA V;  1W0J G;  3E8F A;  2EIM C;  2QM7 A;  1PKX A;  2GSM B;  3ZRW B;  2EIN C;  2HLD G;  1RM1 B;  1SER A;  3M99 B;  1AI6 A;  2NNU A;  1MG1 A;  5EBM C;  3W7T A;  1MAB G;  2IU3 A;  4BAY A;  2H94 A;  4TWK A;  1MOF A;  4MVM A;  5EC1 C;  2ZR3 A;  3QNE A;  4MW8 A;  2CK3 G;  2JK5 C;  3T4D A;  1WPX A;  2Z3Y A;  3LSQ A;  1R6N A;  3GWO A;  2A0L A;  3K06 A;  4PDM A;  4QE9 A;  4XBF A;  1ARO P;  1CPY A;  2WLL A;  1YI2 V;  3OR7 C;  2XND G;  2EIM B;  3SYQ A;  4MVR A;  2ZXW C;  5CN0 A;  2EIN B;  2WLH A;  3E35 A;  1YHQ V;  2Y48 A;  3CME V;  1DF5 A;  4U7O A;  4XDL A;  2WSS G;  4RUF A;  4X88 A;  1AJQ A;  2IJI A;  3LDD A;  4P30 A;  1OCR C;  3OMN B;  5CA3 A;  2MK3 A;  2B1I A;  3T2M A;  4PA7 A;  3ZN0 A;  5L3E A;  1F23 A;  3ML0 A;  5DM6 V;  4PA6 A;  3ABK C;  3W7X A;  1S5H C;  4LBE C;  3T4Z A;  1QLN A;  3SYP A;  3CCQ V;  2ZXW B;  2F43 G;  3OR6 C;  4ZKI A;  2DYS C;  2OT5 A;  3QO5 A;  4H37 A;  1Q7Y W;  3OFN G;  4HYO A;  4P9O A;  5EBL C;  2JJ1 G;  3ABM C;  2XAQ A;  5L3B A;  1M57 C;  1OCR B;  4MVO A;  3FKS G;  1DTO A;  4GX0 A;  4JTA B;  3EFF K;  1NVP D;  3SYC A;  1G4Y B;  4ZBM A;  1KEC A;  4R6Z A;  4JPR A;  4MS2 A;  1QVG U;  2DQ3 A;  3ZRX A;  2HVK C;  1NQT A;  3K9A A;  3ABK B;  3IFX A;  2B1G A;  1NVP B;  4JTC B;  1R3I C;  2DYS B;  3TK1 A;  4G27 B;  2WLN A;  3ZRV A;  4P9P A;  3AEI A;  1K8A W;  5H6R A;  1Q86 W;  3BEH A;  1DLB A;  5L3D A;  1YSC A;  3E86 A;  1ZWI C;  1GKF A;  2K1E A;  3ABM B;  5H6Q A;  2DWE C;  4FIP C;  2NLJ C;  5LGU A;  3ZJZ A;  1M57 B;  1Y4M A;  3CPW U;  2ITC C;  1EBO A;  3SPJ A;  4X89 A;  3CP1 A;  3VBB A;  3G4S V;  4QJF B;  1M90 W;  1K3E A;  4MVS A;  2P6J A;  2UXN A;  4H33 A;  1H38 A;  2HFE C;  4WFB V;  2B5U A;  1THZ A;  2LFS A;  5EBW C;  2IW5 A;  5L3F A;  2R9I A;  2X6A A;  5LHH A;  1JJ2 U;  2PI4 A;  2IJJ A;  2W6I G;  1KKD A;  3IC7 A;  1WLE A;  2QKS A;  3ZRW A;  1YJW V;  3AG3 C;  3EHB B;  3R65 A;  1QLE C;  1R6K A;  2DQ0 A;  1H8E G;  4PA9 A;  1EZJ A;  3HB3 B;  4FK5 C;  1ENV A;  5EK0 A;  3UKM A;  3TET A;  2QM8 A;  3RVY A;  1COW G;  1NR7 A;  3W7S A;  4MT8 A;  1K33 A;  5KUK A;  4G28 B;  2JIZ G;  3HPL C;  3E2E A;  5IYD O;  4QNH B;  2QTO A;  4UUJ C;  2WLJ A;  5B1A C;  3ZCC A;  1F51 A;  1FXK C;  2DYR C;  2JEU A;  3SPC A;  1J95 A;  2DW4 A;  4QPK A;  1V55 C;  3K0G A;  4R50 A;  1RPO A;  1QR9 A;  4FJC C;  3G71 V;  1AJP A;  1PNL A;  3AG3 B;  4Q20 A;  3W7W A;  3ZMZ A;  4RAI A;  1QLE B;  2R9R B;  4RO2 A;  3TCU A;  4PDV A;  5B1B C;  2BOB C;  3OAA G;  1NBM G;  3E8H A;  3JYC A;  1SES A;  2DWD C;  4TT3 G;  3ASN C;  4KP4 A;  1AI7 A;  1I5X A;  5LHG A;  3OE7 G;  4JAS A;  3CCR V;  2V7Q G;  3CC7 V;  5B1A B;  3T1C A;  1FXK B;  5LGT A;  5B1O A;  3QO7 A;  2FTK A;  2DYR B;  1EFR G;  3ZRS A;  1K4C C;  5IYB O;  2YEV A;  1QCE A;  1V55 B;  4UVB A;  3CXC U;  1AI5 A;  1FFT B;  1NKD A;  1SET A;  4WFH A;  3ZIA G;  1JCH A;  2A79 B;  4CBC A;  4E2L A;  2WLI B;  4F4L A;  3CYO A;  3LDE A;  4LC1 A;  5B3S C;  3JCZ A;  5C93 A;  1NJI W;  3OMI B;  4LCU C;  5B1B B;  1FS0 G;  3AG4 C;  3ASN B;  3SJQ C;  2X0L A;  3ZMV A;  1JQ0 A;  1S76 D;  1K92 A;  3CCM V;  2QA4 V;  5CMU A;  1F4M A;  3OEH G;  1GO3 F;  3I55 V;  4WFA V;  3JD0 A;  3OW2 U;  1VQ7 V;  1K9M W;  2LFR A;  3K03 A;  5KA5 A;  4GX1 A;  4Z1M G;  1GM9 A;  3MHS C;  1VQ6 V;  4J9Y B;  3GB7 C;  5J9P C;  3SPI A;  2ZD9 A;  4PEL A;  4QE7 A;  3X2Q C;  2EIL C;  3E83 A;  1PNK A;  4RQE A;  5DN6 G;  2ZR2 A;  5B3S B;  1RPR A;  1MSW D;  4FMT A;  1I5Y A;  4N23 A;  3AG4 B;  1S72 V;  4KUM A;  2H8P C;  2XAJ A;  2EZO A;  4CZZ A;  3W7U A;  3RVZ A;  1B6Q A;  3CD6 V;  3ABL C;  1H8H G;  3FYE B;  4BIU A;  2D3O W;  3OEE G;  2EJR A;  4JYB A;  4JAV A;  5E1A C;  1VQL V;  4KFM A;  1LNQ A;  3RW0 A;  3VOU A;  2XAS A;  2AHY A;  1M9N A;  4R7C A;  5LHI A;  1OCO C;  3B77 A;  2IJH A;  3F5W C;  3X2Q B;  2EIL B;  2Z5U A;  1YJ9 V;  4BIZ A;  3WFV A;  1AJN A;  3CCV V;  4WFF A;  4YXW G;  2A9H A;  1QBZ A;  1VQO V;  1QVF U;  1JPX A;  1K4D C;  3CCL V;  2ZDI C;  4R8C A;  1AR1 B;  2UXX A;  3NXS A;  5CBF A;  3G6E V;  3JD3 A;  2X6B A;  1G8M A;  5LGN A;  3ABL B;  2KB1 A;  2QE7 G;  1SZT A;  3K0D A;  1L1F A;  2XOK G;  4X8A A;  1E1Q G;  4J9Z B;  1E1R G;  2IJK A;  3BY6 A;  1W2B U;  4MVU A;  2XAG A;  2XAH A;  1OCZ C;  3STL C;  1JX9 A;  1NR1 A;  1OCO B;  1GM7 A;  2ATK C;  1W0K G;  4MTF A;  1YIT V;  1YTF D;  1HWY A;  2C2A A;  4EKW A;  4P2Z A;  2OCC C;  3QO8 A;  3DGE A;  1VQ5 V;  3P32 A;  1FXV A;  1OZ0 A;  3UM7 A;  3CC4 V;  4UXN A;  1YJN V;  1NH2 D;  4TSF G;  2Q68 A;  3K04 A;  4JYC A;  3STZ C;  2HKO A;  3IGA C;  3ABT A;  1P7B A;  1GTO A;  1ORQ C;  2JEX A;  3A0R A;  3LSS A;  1VQN V;  4WFG A;  4BW5 A;  3JD1 A;  1SRY A;  1ROP A;  3B8N A;  4QPJ A;  1NH2 B;  2WLM A;  4PA3 A;  1FXK A;  1OCZ B;  1KC8 W;  1N8R W;  4PDR A;  4GT1 A;  1S3J A;  4QIW F;  2IH1 C;  4UV8 A;  3ZN1 A;  2OCC B;  3FB8 C;  5L3C A;  1JVM A;  3KG2 A;  2WAM A;  2WLI A;  3ETG A;  4MTO A;  1XL4 A;  5B1N A;  1S77 D;  2IH3 C;  2Y69 C;  3LDC A;  1K34 A;  1M56 C;  1CP9 A;  4HZ3 A;  1VQ8 V;  4MSW C;  3WG7 C;  5H9C A;  1OCC C;  1K73 W;  4WF9 V;  2EBO A;  2EZP A;  5LBQ A;  3P30 A;  3F7Y C;  1R3K C;  2X6C A;  1XL6 A;  1K5S A;  3AG2 C;  1K5Q A;  2WLK A;  1AI4 A;  1OHH G;  3ZMS A;  2HVJ C;  4G2K A;  5BZB A;  3I56 V;  3K79 A;  1GK9 A;  2WLL B;  5CBH A;  3SPH A;  2V1D A;  3RBZ A;  3SPG A;  4N21 A;  2W0F C;  4RUE A;  3LUT B;  5IDJ A;  2Y69 B;  1M56 B;  1Y66 A;  1DF4 A;  2YSU B;  1BMF G;  1VQ4 V;  5FL7 G;  3WG7 B;  3ETD A;  3ASO C;  1OCC B;  2OTL V;  2ZQM A;  3K08 A;  5GW7 A;  3FB6 C;  4I5S A;  4PA4 A;  2HJF C;  4UV9 A;  3MHH C;  3OUF A;  2Q69 A;  4XDK A;  1KD1 W;  1BL8 A;  2YEV B;  3E89 A;  3AG2 B;  5IY5 C;  1M1K W;  3OGC C;  3ZMT A;  1P4R A;  2JDI G;  4L87 A;  1VQ9 V;  2WPD G;  3SYO A;  5KUM A;  1R3L C;  5EC2 C;  4HAM A;  2Q67 A;  1PD3 A;  3FB5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...