4F4LA

Open channel conformation of a voltage gated sodium channel
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
86
Chain Sequence
b'SVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ion transport protein
molecule tags Metal transport
source organism Magnetococcus marinus
publication title Structure of a bacterial voltage-gated sodium channel pore reveals mechanisms of opening and closing.
pubmed doi rcsb
total genus 30
structure length 86
sequence length 86
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4f4lA00
4RO2A 3VOUA 3OR6C 1M57C 4WFHA 3AG3C 2DWDC 2ITCC 4H37A 3E89A 4PDMA 1R3JC 5E1AC 2WLLB 3FB5C 4PA6A 5BZBA 2K1EA 2BOCC 1KKDA 1J95A 1XL4A 2NLJC 2WLKA 2ATKC 5EBLC 1R3LC 5IY5C 4R6ZA 2DWEC 3F7VC 4R8CA 4QNHB 4PDRA 4ZBMA 3BEHA 3K0GA 4JTAB 1QLEC 3AG2C 2W0FC 4QE7A 5EBWC 4XDKA 4GX5A 1ORQC 1V55C 1P7BA 2H8PC 2WLMA 5J9PC 3FB6C 4XDLA 2X6CA 4MVRA 3F5WC 3K03A 2IH3C 3GB7C 1OCRC 4PDVA 4QE9A 3SYQA 2HVKC 4PA9A 3E8GA 4P9OA 3SPHA 5B3SC 4P2ZA 1OCOC 4R50A 3K04A 1R3KC 2A0LA 2Q6AA 3ABLC 2KB1A 4MVZA 4MTFA 2WLIB 3E8HA 4TWKA 2X6BA 2DYSC 3IGAC 1XL6A 2YEVA 5B1BC 4R7CA 2HVJC 2IH1C 3FB8C 3JYCA 4MVMA 4MTGA 4J9ZB 3SYPA 3LNMB 2EIMC 3ABKC 4I9WA 4JTDB 2WLHA 4MSWC 4X89A 5EC2C 5KUKA 2HJFC 4CBCA 4OXSA 5CBHA 3AG4C 1LNQA 2ITDC 5EBMC 3T4ZA 3ZRSA 5KUMA 3SPJA 2OCCC 3AG1C 3EFFK 4MW8A 3K08A 4RUEA 3SPGA 4G27B 3SYOA 3F7YC 3SPCA 4EKWA 3OUFA 3OR7C 4MVQA 4HZ3A 4PA4A 2AHYA 3E8BA 3WG7C 4H33A 2P7TC 4DXWA 3E83A 1S5HC 4MVOA 3LDCA 3E86A 3PJSK 1K4DC 2Q68A 3SYCA 3X2QC 3TCUA 4XDJA 3SPIA 5CBFA 4GX2A 1OCZC 2HFEC 3FB7C 1ZWIC 3K0DA 4X8AA 3T1CA 3IFXA 2X6AA 2WLJA 4LP8A 3STZC 4J9YB 1JVMA 2WLLA 4HYOA 4PDLA 3ABMC 4UUJC 5EC1C 1V54C 4WFGA 2QTOA 2HG5C 3ZJZA 2BOBC 2A9HA 3OGCC 4PA3A 3STLC 3KG2A 2WLIA 4PA7A 4MVSA 4F4LA 2Y69C 4MTOA 3RVYA 4BW5A 3RW0A 3UM7A 1OCCC 1G4YB 2ZXWC 4X88A 5EK0A 3ASNC 4GX1A 4P30A 3RBZA 4JTCB 4WFEA 2A79B 2Q67A 3LDEA 4P9PA 3SYAA 3ASOC 2DYRC 4MS2A 3T2MA 5CBGA 3LDDA 2JK5C 2AHZA 3E8FA 3RVZA 2EINC 4WFFA 4KFMA 1BL8A 4RUFA 2EILC 2QKSA 3OUSA 4MVUA 3LUTB 4LCUC 5B1AC 3HPLC 3SJQC 3K06A 2Q69A 3T4DA 2EIJC 4LBEC 2R9RB 3TETA 4G28B 4GX0A 2WLNA 2ZD9A 4RAIA 4MW3A 1K4CC 2EIKC 3R65A 1R3IC 1M56C 3UKMA
chains in the Genus database with same CATH superfamily
2KG7B 3AG3C 1ZL8B 3JATB 4AQYO 4AI8A 4LF5B 1I94B 2WLKA 4OX9B 2W0XA 4PDRA 1CEZA 4XDKA 1EN5A 1M1KW 5FL7G 5J9PC 2LGWA 5CA0A 1YJNV 5IYDO 4LF4O 3H9VA 3OTFA 1R3KC 2ODMA 4I7ZB 4U3JA 4DV0O 3JAMN 4MSWC 3J80N 1B3QA 3ETQA 4DV4O 2JEUA 3JATA 3RFRA 2OCCC 4RUEA 1XMOB 3SPCA 1NBMG 2GDSA 1TUBB 4UV9A 1YJ9V 5BMVA 4X1KA 2ZINA 3ZN1A 2Q7GA 1WB7A 2Q68A 3X2QC 3BFRA 4K3AA 2XAFA 3K5NA 1ZWIC 3TXSA 2RJZA 1IVSA 1FFXB 1H2LA 1KD1W 3DSQA 1E1RG 1SQXH 3ETGA 3OE7G 3N2KB 3STLC 3RYIB 4ZKIA 3SGIA 1WA8A 4X88A 3F5TA 2GUZB 3VQWA 4Q6GA 5H5NA 5F2VO 5CBGA 5A2QN 2HLDG 1X4TA 2P4VA 3JARB 2EINC 2XNDG 4KFMA 5BY1A 4OPAA 4U7OA 2QE7G 3HPLC 1N8RW 1N32O 3W7SA 1XNQO 1F23A 1QVGU 4F6RB 3UKMA 1YI2V 2CTRA 3JSNA 1Q86W 4IHJB 4JI3O 2QWOB 3H1IH 1FFXA 3RYHB 5EZYA 2VWJA 2P22C 4FLUA 2E5LB 2YXLA 1F7YA 1Q82W 3F7VC 4JI4B 1XNRO 1VF6C 3JSLA 1RM1B 4JI5B 5LHHA 2EIJB 5LYJA 5LXTA 4LF9O 3DGEA 1AR5A 2YXHA 3UQ8A 2PYLA 4PA9A 1OZ0A 4DV3B 1Q90D 1OCZB 4K0KB 4I55B 2K9PA 5DECA 5JCOC 3MDSA 1NZ6A 4JI5O 4MVMA 1XI1A 3DC6A 3LNMB 4W4LA 3HB3B 5IYBO 1VQMV 4OXSA 4DR2B 1LNQA 4IHJA 5K1PA 3K3WA 4G27B 3OUFA 4JI2B 5LGTA 1VQ5V 4PA4A 3WG7C 3HKEB 4GCZA 3ZHQA 3ZHRA 4JI8B 1LUWA 3E86A 4QPJA 3E22A 3BVOA 3RYCB 4JYYA 2CAZC 5KA6A 1ZLZA 4BIUA 3APQA 3SJAC 1JPXA 3CCSV 3OGCC 2DOSA 4JI0B 2HHHO 1A32A 1OCCC 2QJ1A 2BSKA 4X9QA 4LFAB 3ABLB 2GTSA 4O4JA 5BR8O 1O9GA 1JJOA 4DK1A 4DUZB 3JAWA 3I5DA 1QQCA 5LA6B 3OTOO 1B04A 4TV8B 3SJQC 4E2LA 3W7XA 4AHCA 2QWRB 3OMAB 4AILC 2UUAO 3ZMZA 2ITCC 1TA8A 4YJ3B 3ZEDA 4UV8A 2ZDIA 3DC5A 4FLZA 4IL6Z 4WFBV 4OGQB 1KP2A 1WNSA 2ATKC 4X64B 4R8CA 1IBMB 3JCZA 1NVPB 4NR1A 2ZXWB 2H8PC 4MTXA 4LNUA 2X6CA 3K03A 4LWSA 2E3CA 4JF3A 1M90W 1RPOA 4X20A 2LGQA 3K04A 4NVPA 2OWOA 1KU9A 2IJKA 2X6BA 4TV8A 3HKDB 3FB8C 3B77A 2LW1A 3UT5B 1JFFA 2WLHA 5KUKA 1YDXA 2BTQB 4B3SB 4CBCA 2XTAA 1SQBH 2ITDC 1GTOA 3EFFK 3RN4A 4DV2B 1Q6IA 1BHAA 4IIJA 3DXRA 1XBLA 3PJSK 4ZIBA 4NTWA 3SPIA 2Y0PA 5B66Z 3UO3A 2L6LA 3N2GB 3K5LA 5LP6C 2IJIA 2QM8A 4N21A 1B06A 1ZAUA 3M7MX 2QWPB 2F4VB 5BXZA 1FXHA 3J81N 2ZXWC 5B1BB 3BPZA 5L3DA 4X66B 1AB3A 2E5LO 1YIJV 4DV7O 4ABMA 1RSOA 1J5EO 4FLXA 1MOFA 2YIBD 1ZUQA 4HBNA 4WBNB 2JS5A 5J2UA 3R65A 2R9IA 2PI5A 1K9MW 3N2GA 4DR3O 4I50A 4B3TB 1FD9A 1SF9A 3OAAG 3CXHF 4WF9V 1AI7A 1BE3H 4LC1A 1N34B 4X1KB 2XHBA 4CS2A 4ZBMA 3BEHA 2N05A 4JTAB 2F95B 5LMUB 4YY3B 4K35A 1MMMA 5B1AB 4JYCA 1ROPA 3GB7C 3P3PA 3QVNA 2ADQB 1KUQA 3G71V 2ADPA 3CRRA 4JI4O 1XNRB 5LBQA 1DF4A 4PI2A 4WBNA 4L87A 3BAAA 1GKFA 3CJHB 4HNAB 1DK1A 2EX3A 3QO8A 1KMIZ 3CB2A 1VQPV 4JI7O 1X59A 1D5AA 2PY5A 1GM7A 3ETDA 5CMUA 4YJ2B 3FX7A 1JX9A 3S3WA 4LF6O 3P30A 1G8MA 1FKAO 2RNBA 5DM6V 1GN6A 1OCZC 3KKYA 1ZL8A 2UXNA 3A2FA 1IBLB 4JI6B 4LP8A 3RYFA 4LF4B 1YVWA 5FLXN 4WFGA 5EZYB 3ZJZA 3ZMUA 1I0HA 4FLTA 4CC6A 4MTOA 3RVYA 3G4SV 2DYSB 4JTCB 5IYZA 3OW2U 1QHTA 2VQEO 2YDEA 4U3FH 1EM1A 2QKAA 2LW7A 1GN3A 4MVUA 3LUTB 5B1AC 4DO2A 1JJ2U 3K06A 1MG1A 2FYUH 1NR7A 4JI8O 4FLWA 4LF8O 1QCEA 1BZKA 5GTHZ 4JI1B 2YC0A 2P90A 1ENVA 1N32B 4RO2A 5GTIZ 2IJJA 4GUNA 5L3GA 1R3JC 2PTMA 4YY3O 2K1EA 1DLBA 3UO2A 5BMVB 3HKEA 3T1YB 4JAAA 1XQ8A 3LNNA 4I9QA 1EBOA 4DV1B 1P7BA 3L74H 3CD6V 2ZE6A 2IH3C 4B3TO 1PPJH 1MA1A 2ZIOA 1FJGO 4J10A 2E74B 1WPXA 2CTWA 3E8HA 1VF5B 2MK3A 1JOYA 5B1BC 2QM4A 3JD4A 2CDYA 2P06A 4LF7O 1F4NA 3C3TA 1US6A 3JARA 2NR5A 4O2AA 1EZJA 1FPOA 4Z1VA 1URFA 1HNWO 3DTUB 1FAFA 1WAZA 4MVQA 4HZ3A 1M93A 3HKCB 1P4RA 2HEPA 4DXWA 1K5SA 3E83A 4L8JA 1IXBA 4B7KA 3CCVV 2PYJA 3M8AA 4LF5O 1BHBA 2F66C 1O9HA 4J9YB 3RYHA 1W59A 2WLIA 2Y69B 1XREA 5HFLA 4YHHB 5LYJB 3AG2B 1QLEB 4JZ2A 4GX1A 2ARHA 2VQFB 1H2MA 2JK5C 3L75H 2CGOA 4H13B 1XHZA 3G6EV 5KLVH 2H3OA 4FFKA 4YHHO 2R9AA 5A9GA 3K5OA 3UT5A 2XUMA 4MW3A 4LH6A 2BTQA 2FB5A 4GKJO 2XOKG 1K3EA 1COWG 2R72A 2DMXA 3ABTA 4JI6O 1U97A 1QNMA 5IJ9B 1Z5WA 1KKDA 2EJ7A 3CCLV 5IY5C 4R6ZA 5IE9A 1SA0A 4ZHQB 1PL0A 1U96A 3CWBH 1HNZO 2EULA 4JI0O 5EYPA 4KXRA 2HVKC 5ITZB 5H6RA 4UCSA 2F23A 4LF7B 1JMKC 2G38A 2YI9A 1KB9F 1FXKA 4DW0A 2BSKB 1K8AW 2Q7HA 4OX9O 3KCYA 2CTPA 3K08A 3BY6A 4NTXA 3ASNB 5H2FZ 4GZRB 3LDCA 3WFVA 4UCVA 2RQ6A 4UVAA 3BRCA 3H1KH 1MABG 4GX2A 2NN4A 5K1XA 2Z3YA 3FB7C 3W7UA 4X8AA 1AI6A 2X6AA 4ASUG 2WLJA 4HYOA 1HNWB 1P7GA 2QEXV 2JS3A 3LSUA 3CMAV 2ZNIA 3A0RA 4E4EA 2BOBC 3RW0A 4O2BB 1VQ4V 1FXKB 1HW7A 2VS0A 1AP5A 4NXMB 1QR9A 2KSDA 3OMNB 2ZM6O 3T2MA 3H1HH 3SR2C 2R70A 3CCJV 4DV3O 2OTLV 2EILC 1W0KG 1L0NH 3LSQA 3VQYA 2EIJC 2EZOA 1NI8A 4GX0A 4UB8Z 1Y76B 4EB6A 3G67A 3TXQA 2BOCC 4FMTA 5C8YA 1OV9A 1NH2B 1PV0A 3BA8A 5EBWC 4NTYA 1JA8A 1G1XB 1H2KA 3C3SA 3ZN0A 3HKBA 5KX5B 1UJWB 1GMGA 1K7DA 1Q6HA 1FYJA 3RYFB 4FVMA 3E8GA 4P9OA 2IM9A 5B3SC 2FL4A 3IC7A 4R50A 4B3MB 3I55V 5CB4A 3S3XA 1Y74B 4NXNB 4PV1B 4JPRA 1L0LH 5B5EZ 5EC2C 2RDCA 1QBZA 2XAGA 3SPJA 4F6EA 1B6QA 4DR1B 4EKWA 3WU2Z 1RSOB 2OT5A 4DR4O 1S5LZ 2QR4A 2IU0A 2IW5A 5J2UB 3WG7B 1KC8W 3SYCA 1V54B 3ZMTA 1FXVA 4QJFB 4BW9A 3ZIAG 2OCCB 4JI3B 4NB5A 2UXBO 3Q4HA 4K8ZA 4PA7A 2QM7A 4UXNA 1H38A 5IJ0B 4MT8A 1ZX3A 4LF9B 3B40A 4WFEA 4X62O 1GH6A 3LDEA 4X1YA 4K8XA 1GAXA 1L1FA 5L3BA 1WLEA 4X1IB 5E79Z 2WLNA 3T1HO 1R3IC 1XNQB 4HNAA 1XOUA 1Z5VA 3CRAA 1SETA 2CUGA 2DWDC 4O2AB 4FK5C 1AJNA 3LSSA 1HDJA 1J95A 1XL4A 5GW7A 3D36C 1IBKO 5JJJB 3HKCA 1BCCH 5IJ0A 4LF8B 2Q8VA 2ILMA 1VQ9V 3O9OA 1OCRB 1RPRA 4U7NA 1SQQH 1M57B 1R6KA 1BQ0A 2ZCEA 1S5JA 2Y4UA 2DYSC 1N4CA 1Y6XA 1BQZA 3JYCA 4X66O 2IU3A 4K0KO 2HJFC 2OIEA 3RWRD 1PM9A 4JAUA 1VEWA 5KHKA 2UU9B 2AHYA 4DV4B 3ABKB 1XHXA 2X0LA 2AZ0A 4DRXA 2VRZA 4DV5B 5CBFA 4D7TA 2DQ0A 4DV0B 4PD4F 1JVMA 3ABMC 5B1NA 1V54C 3EXAA 1HR0O 1EFRG 1EZVH 1SA0B 3P32A 3CYOA 2JGDA 5KHHA 1NKDA 1N33O 3WB2A 3EVKA 2FTKA 4O4LB 1I7FA 4H0LB 3AG7A 4BIZA 5IWAO 3ASOC 3O65A 3CCEV 4O4IB 5H6QA 5LGUA 1YITV 5ITZA 1I94O 3C90A 4I55A 2LQTA 4LBEC 4JV5O 3CRMA 1XDCA 2R9RB 3ZX6A 4RAIA 5LMUO 1S77D 4DRXB 2ZE7A 2EBOA 2AXTZ 5JWPA 3CC4V 1S76D 3OT7A 3D8CA 1SQVH 1NU1H 4PDMA 1Q6UA 1DGSA 2WLLB 1MZEA 1WN7A 1YJWV 4DR3B 3KZIZ 3ZHSA 2JGDB 4GX5A 2WLMA 2P4KA 3B8MA 1VF7A 3F5WC 3ZHVA 1Y67A 3CP1A 3SYQA 2V4DA 3E2EA 4P2ZA 5L3FA 4DR5B 2KB1A 2W6IG 4GYCB 2XT9A 4A5UB 2A3QA 4TOIA 2EIMC 1VQ8V 2Q7EA 3BABA 4LFCO 4Z1MG 2H94A 3JAWB 5DEDA 5EIBD 5AG2A 2B5UA 3N27A 2W6JG 4C7UA 1KYOF 5FNVA 5KHIA 1SS3A 2D3OW 1M4UA 4LFBO 3ZRWB 4DR7O 1Y76A 3ML0A 2BCCH 2HFEC 3OEEG 2F1MA 3FD9A 3GVMA 4PDLA 2QWQB 4Z2WA 2RMKB 4NXMO 4IGGA 4O4HB 4MVSA 4LH7A 3ASNC 1V9PA 3VQVA 1VMGA 1IBKB 5KX5A 2DYRC 1OCOB 5LMNO 4BIOA 2CK3G 3B4SA 4G2KA 3HKDA 3K59A 4PHZA 3OMIB 2EJRA 1VQNV 1CPYA 4G28B 2EZPA 3ZRWA 2OCHA 3E35A 4W4KA 3FAVB 4I0XA 3K5MA 1IZ3A 3VOUA 1NJIW 1L8DA 4WFHA 5LOVA 5JJEB 4DUYB 2N74A 1AJPA 3JD2A 3FB5C 1HP8A 1P49A 1EN6A 4J11A 1D5NA 2NLJC 1AI5A 1YEWA 2EIKB 3WB1A 1K92A 1K97A 1XMQB 3OM3B 3OEHG 2WAMA 3ZMVA 4EEQA 2YI8A 1N36B 3SDLA 1JR9A 4RWUA 3ABLC 4TWKA 2UUCB 3IGAC 4O2BA 3K9SA 2ZE5A 4I4TB 3SYPA 4I9WA 3ABKC 4X89A 4I0XB 1YSCA 3L71H 1Q7YW 5CBHA 3T4ZA 4GKKO 2JRIA 4NKGB 1Q8IA 5TISZ 3TGUH 1OHHG 3GWOA 4H33A 4NXNO 1NH2D 4MVOA 1DTOA 1PKXA 1SQGA 3TCUA 3JAKB 4B3MO 2YS8A 4I50B 2JEXA 2F93B 1M9NA 4B3RB 4F4LA 1SZTA 2KKWA 2AW9A 1PP9H 4KUMA 2LO1A 5EK0A 4I4TA 2AZ2A 1KQSU 4QIWF 2B1GA 4MS2A 3K79A 1SZXA 2DN9A 1VQKV 3SJBC 5GONA 1GN4A 4J41A 4DUZO 4LF6B 4RUFA 1UFIA 2QGNA 1SKVA 2LFSA 1TUBA 3T4DA 1V55B 2JGUA 2RN9A 4LFBB 2ZD9A 4DV1O 5JQGA 1F4MA 2MW2B 3JAKA 5KMGB 1PNMA 1M57C 5E1AC 1YZBA 1KP3A 4LFCB 3K9AA 5EIBC 4ZI7B 4QNHB 2W0FC 1VP7A 2LP7A 3TJTA 3IJ4A 4JI2O 5D5PA 2GUZA 1K73W 2YICA 4TUYB 4EFBA 4JI7B 3IC9A 3SPHA 3ZCCA 1AJQA 3JALA 2YEVA 2HP8A 4B7EA 1N0JA 2X7RB 3CRCA 4UCOA 5JH7A 1MZFA 4X1YB 3AG4C 3R66A 3CX5F 3HR0A 4MW8A 3SPGA 2OTJV 3CC7V 3QO5A 1FS0G 4FPPA 4X1IA 4ZI7A 3I56V 1S0VA 1QLNA 2QA4V 4FLVA 2WWWA 1MSDA 4J42A 2N04A 4XDJA 1WB8A 3FFQA 4J7KA 2JDIG 2UUCO 3IFXA 3OD4A 5LP6B 1AROP 2DYRB 4CS4A 4UUJC 1XMOO 2QTOA 5L3CA 4CC5A 3KG2A 2UXDO 4ZOLB 4FZ1A 4BW5A 2ZT9B 4UCUA 1G4YB 2Q73A 4P30A 1LUVA 2YIBA 3U11A 2DQ3A 2Q67A 4P9PA 1I08A 3CS5A 1NVPD 2WSSG 3LDDA 4X65O 4GT1A 2QDOA 1I5XA 3OUSA 3EHBB 3KCXA 4QGPA 1BGYH 4FLYA 1VQLV 1IURA 3JD3A 3B09A 1XUQA 1E79G 1PNLA 3TETA 3THOA 1NTZH 2EIKC 3RYCA 3TK1A 5B3SB 3FKSG 2O57A 2CE4A 3L70H 4OPHA 5LMNB 4J7JA 5H9CA 1AI4A 4FJCC 3APOA 2ZNJA 3U10A 2CGNA 3A0BZ 5FPOA 1MSWD 2ETNA 1BSMA 3BHPA 4MVRA 5JJNB 1LR1A 1GK9A 3MHSC 2Q9LA 4UFZA 2QKCA 3ZRVA 1RP3B 5LA6A 4MVZA 1IBMO 2WLIB 4X64O 3CRQA 2A7WA 4MTGA 4J9ZB 4TT3G 2A06H 4JYAB 1YF2A 4KHPO 1HNXB 4O4IA 4CH3A 1K34A 3M99B 4J80A 3B8NA 3F7YC 4D6TH 1IXMA 2JJ2G 2IBZH 1CXZB 3OGIB 1P84F 2P7TC 1R73A 2BTOA 2UUBB 4TQFA 2QWNB 2UUBO 3FAVA 1VQOV 1K33A 1QU7A 2M7WA 4LNUB 1ZTEA 1Q5OA 4LWSB 1XEQA 5LOVB 3W7TA 3AG1B 3STZC 4DV2O 2WLLA 5IJ9A 1XILA 2WPDG 2QTSA 2LJ2A 1AILA 2HR3A 1HWYA 3H1JH 2CH7B 1JFFB 3AK2A 5EYPB 1NQTA 1AP6A 3OTOB 4KL1A 3W7WA 3L72H 1BMFG 3E8FA 3G6BA 3ZBHA 1YXBA 2NNUA 4JAVA 1TAEA 2B1IA 4LCUC 3T1HB 3QNEA 1VQ6V 3OR6C 2EILB 2UXCO 3JASA 4X65B 4H37A 3QTCA 1T5EA 1H8EG 2ZKOA 2UXXA 4FM2A 4DV6O 1QLEC 3AG2C 5JVDB 2BE3A 3MHHC 3FB6C 1JQ0A 2CH7A 4FM1A 2Y4TA 1N36O 1WP8A 2UUAB 5KA5A 2HJDA 5L3EA 1HNZB 3QO7A 1WP7A 2ZR2A 1YHQV 3ASOB 2Q6AA 1E1QG 3T1YO 4FFBB 4FZ0A 4R7CA 1NS1A 3H01A 5IYCO 2UU9O 3PN1A 2KG7A 2UXDB 3ZHUA 3ZRSA 4D7SA 5KUMA 4QPKA 3SYOA 2YIAA 1H2NA 1R6TA 2HKOA 2C2AA 3IAYA 3A8TA 5IDJA 4BR6A 1S5HC 1FFTB 4H44B 5CA1B 4JYAO 2V7QG 4CS3A 4EB6B 4WFAV 3T1CA 3AK1A 3MD0A 1SERA 1JCHA 3NXSA 4PA3A 4JZGA 1THZA 4TQDA 1SQFA 2ZE8A 3BA9A 4FIPC 1Y66A 1HR0B 1AVMA 4IYHA 2PUSA 3CSXA 3ETEA 3HKBB 3CCMV 5IY5B 5B1OA 2OIGA 1KKCA 4WFFA 2FKXA 3A0HZ 3CPWU 2LFRA 4CH5A 2YEVB 4YJ2A 5D5QA 5CA3A 5JH7B 4LR3A 4XBFA 1R1BA 4NYKA 4CH4A 4DR6O 4JV5B 4DV7B 2GV9A 3E89A 3H1LH 3FYIB 1CP9A 1IBLO 2IJHA 5BZBA 2Z5UA 4DYLA 1YTFD 1M56B 3N2KA 1WPBA 3GWKC 2E76B 3RYIA 4PI0A 4UCRA 4QE7A 2Q4PA 1ORQC 1V55C 1WA8B 1VIBA 4B3RO 2AGAA 5IYZB 4XDLA 1S72V 2XAQA 1OCRC 2UXBB 3Q4HB 5KAFZ 5LHIA 4KHPB 1N34O 2WA3A 2HVJC 2XASA 2JIZG 2DW4A 4JTDB 4F6RA 3D36A 3D3IA 5C93A 3FYEB 2YXYA 4JI1O 5GONB 2JVDA 1SC5B 3OR7C 3E8BA 3CMEV 4JGSA 2RCVA 1K4DC 5JQGB 1NTKH 5KMGA 1RFYA 5CA0B 5KHJA 1QR8A 3K0DA 1AR1B 3L9DA 3AG4B 3JD0A 2PGGA 2A9HA 3X2QB 2VQFO 3VQXA 4U3JB 3AEIA 2XAHA 1R6NA 3UM7A 1DF5A 1M5IA 3K57A 1TVKB 1J5EB 3SYAA 4PELA 4TUYA 4DUYO 4I5SA 4TSFG 4IYIA 1BL8A 1QVFU 3AG3B 1ZSPA 2Y0IA 4DV5O 3JALB 2JJ1G 3ZS8C 2YUAA 2GSMB 1F51A 1PL4A 4WCEV 3JCUZ 1Y4MA 1M56C 2DE0X 1NT2B 1NTMH 4YIPA 4PA6A 2L35A 1AR4A 1W2BU 2PF4E 4AQYB 4LFAO 1S3JA 5EBLC 1R3LC 2DWEC 2ZM6B 5KAIZ 2HHHB 1N0NA 2GBOA 1VQ7V 4DR4B 1OJHA 4JYBA 1Q3EA 1TVKA 5J2TA 4IT5A 3U0ZA 4QE9A 5LP6A 3CCRV 3OFNG 2P67A 2D2CB 1I5YA 3RT3C 4MTFA 4ZOLA 3CC2V 1Q43A 3D3QA 2IH1C 3B2EE 4O4LA 1IX9A 4ICGA 1KBHA 1Q81W 3WB0A 4JASA 1PNKA 3ZMSA 1WJZA 1TUEB 4YJ3A 3QF7A 3AK3A 4BAYA 5LHGA 4RQEA 4DR1O 4GKKB 3BCCH 1IDSA 4CH6A 4ZHQA 3ZHTA 3NR7A 1GM9A 4CZZA 5LXTB 3G80A 3RGBA 4UVBA 3UCSC 5J2TB 5BR8B 4BWAA 2FMLA 5KHGA 5EC1C 1MNGA 1YCIA 1BT8A 4X20B 2HG5C 4X62B 1OCCB 1SQPH 4UVCA 2DJVA 4UB6Z 2KQXA 2Y69C 1EN4A 4EFEA 5JVDA 3RBZA 2Y48A 2A79B 2ZDIC 1GRJA 3CHXA 2YSUB 2Q0OC 2P6JA 1HNXO 2P5OA 1TGOA 3RVZA 2OYQA 3J7AU 3VBBA 1SRYA 3ABUA 2QKSA 2Q0AA 4FFBA 1G6UA 1D2DA 4HAMA 3MAQA 3E22B 1PD3A 2M6YA 4GLXA 3P3NA 2VQEB 4TV9B 4RQFA 4J7ZA 3ICXA 1VARA 2Z0AA 4B3SO 2EIMB 5FNVB 3L73H 3SJCC 4DR7B 3K58A 1BS3A 1FXKC 3K0GA 4KP4A 2GHYA 5CA1A 2V1DA 4N23A 5LL6Y 4O4JB 2UXCB 4PDVA 2VWKA 4YXWG 4DW1A 1OCOC 2A0LA 2QSAA 4O4HA 1XL6A 4UCTA 2B9ZA 1NR1A 1H2SB 3CCUV 2ZIMA 4DR5O 2WA4A 1GO3F 5EBMC 1H8HG 3AG1C 3CXCU 4TV9A 3QG5A 1XMQO 4FM0A 5C8YB 3CE2A 5HFMA 5DN6G 4DV6B 5JCOA 3CCQV 2EINB 3JD1A 3JASB 2PZSA 1K5QA 1W0JG 1FJGB 2CTQA 4PJ0Z 4GKJB 4DR6B 2GTAA 2Q5ZA 5CB4B 5FPRA 1Z2GA 1KECA 1VF6A 1Y74A 5CN0A 1RM1C 4Q20A 2PI4A 2F4VO 3CJHA 3ABMB 1H2GA 4DK0A 2AHZA 3ZRXA 1YTFB 1GM8A 2E75B 5IWAB 2F43G 1UPGA 4YIOA 2Q69A 4IIJB 5LGNA 1GN2A 4B08A 3DXRB 1N33B 1SESA 2XAJA 5IT9N 1K4CC 2YIDA 2ZQMA 2ZR3A 3CEIA 4DR2O
chains in the Genus database with same CATH topology
4RO2A 3OR6C 3CC4V 1S76D 3AG3C 2EILB 2IJJA 4H37A 5L3GA 4PDMA 1R3JC 2WLLB 2K1EA 2WLKA 1H8EG 1YJWV 2UXXA 1DLBA 4PDRA 1CEZA 1QLEC 3AG2C 4XDKA 4GX5A 1EBOA 2WLMA 1P7BA 5FL7G 1M1KW 3MHHC 3FB6C 5J9PC 1JQ0A 3B8MA 3CD6V 3F5WC 2IH3C 1YJNV 5IYDO 3CP1A 3SYQA 5KA5A 5L3EA 3E2EA 3QO7A 4P2ZA 2ZR2A 1YHQV 3ASOB 1R3KC 1WPXA 2Q6AA 5L3FA 2KB1A 1E1QG 3E8HA 2MK3A 1JOYA 2W6IG 5B1BC 3JD4A 4R7CA 3H01A 2EIMC 4MSWC 1VQ8V 5IYCO 1F4NA 4Z1MG 2H94A 3ZRSA 2JEUA 5KUMA 1EZJA 2OCCC 4QPKA 4RUEA 3SYOA 2B5UA 2W6JG 3DTUB 1NBMG 2HKOA 3SPCA 2C2AA 4MVQA 4UV9A 4HZ3A 1YJ9V 5IDJA 2D3OW 1P4RA 4DXWA 1K5SA 3E83A 1S5HC 3ZN1A 1FFTB 3ZRWB 2V7QG 2Q68A 3X2QC 3ML0A 3CCVV 1BHBA 2HFEC 3OEEG 2XAFA 1ZWIC 4WFAV 3T1CA 4J9YB 4PDLA 3MD0A 1KD1W 1E1RG 1JCHA 1SERA 3ETGA 3NXSA 3OE7G 4PA3A 1THZA 3STLC 2WLIA 4MVSA 4ZKIA 2Y69B 4FIPC 1Y66A 5HFLA 4X88A 3AG2B 1QLEB 3ASNC 4GX1A 3ETEA 3CCMV 5IY5B 5B1OA 2DYRC 5CBGA 1OCOB 2HLDG 2JK5C 2EINC 4WFFA 2XNDG 4KFMA 2CK3G 3CPWU 4U7OA 2LFRA 4G2KA 2QE7G 3HPLC 2YEVB 3G6EV 3OMIB 1N8RW 5CA3A 3W7SA 2EJRA 1VQNV 1CPYA 4G28B 4XBFA 1F23A 2EZPA 4MW3A 3ZRWA 1QVGU 3E35A 2XOKG 3UKMA 1YI2V 1K3EA 1Q86W 1COWG 3VOUA 1NJIW 4WFHA 3ABTA 3E89A 1AJPA 3FYIB 3JD2A 1CP9A 3FB5C 2IJHA 5BZBA 2Z5UA 1KKDA 2NLJC 1YTFD 1AI5A 1M56B 3CCLV 1ENVA 4R6ZA 2EIKB 5IY5C 3F7VC 1Q82W 1K92A 1PL0A 1RM1B 4QE7A 5LHHA 1ORQC 1V55C 2EIJB 1K97A 3DGEA 4XDLA 1S72V 2XAQA 3OM3B 1OCRC 3OEHG 2WAMA 2HVKC 4PA9A 3ZMVA 1OZ0A 5H6RA 5LHIA 1OCZB 3ABLC 4TWKA 3IGAC 2HVJC 4MVMA 2XASA 2JIZG 1FXKA 2DW4A 3SYPA 3LNMB 4I9WA 3ABKC 4JTDB 4X89A 1K8AW 3HB3B 3D36A 3D3IA 5IYBO 1YSCA 5C93A 1VQMV 3FYEB 1Q7YW 4OXSA 5CBHA 1LNQA 3T4ZA 3K3WA 3K08A 4G27B 3BY6A 3OUFA 3OR7C 5LGTA 1VQ5V 4PA4A 3ASNB 3E8BA 1OHHG 3GWOA 3WG7C 3CMEV 4GCZA 4H33A 4JGSA 1NH2D 4MVOA 3LDCA 1DTOA 3WFVA 3E86A 4QPJA 1K4DC 1PKXA 4UVAA 3TCUA 5KA6A 1MABG 4GX2A 2Z3YA 3FB7C 3W7UA 1QR8A 3K0DA 4X8AA 1AR1B 1AI6A 2JEXA 2X6AA 4ASUG 2WLJA 4BIUA 4HYOA 3AG4B 2QEXV 1JPXA 3JD0A 3CMAV 3A0RA 3CCSV 2BOBC 1M9NA 2A9HA 3OGCC 3X2QB 4F4LA 3AEIA 2XAHA 1SZTA 1R6NA 3RW0A 1VQ4V 3UM7A 1DF5A 1OCCC 4KUMA 5EK0A 1FXKB 1KQSU 3ABLB 1QR9A 2B1GA 4QIWF 3OMNB 3SYAA 4MS2A 3T2MA 3K79A 1VQKV 4PELA 4I5SA 4TSFG 3CCJV 4RUFA 1BL8A 1QVFU 2OTLV 2EILC 3AG3B 2LFSA 1W0KG 3LSQA 3SJQC 3T4DA 2JJ1G 1V55B 2EIJC 2EZOA 4E2LA 2GSMB 1F51A 4GX0A 2ZD9A 3W7XA 4WCEV 1Y4MA 1F4MA 1M56C 1PNMA 3OMAB 1M57C 3ZMZA 2ITCC 5E1AC 4PA6A 4UV8A 2ZDIA 1W2BU 1KP3A 2BOCC 4FMTA 4WFBV 1KP2A 1S3JA 2ATKC 5EBLC 1R3LC 3K9AA 2DWEC 4R8CA 4QNHB 1NH2B 3JCZA 1NVPB 5EBWC 2ZXWB 2W0FC 2H8PC 2LP7A 1VQ7V 4MTXA 4JYBA 3ZN0A 1K73W 2X6CA 3K03A 1UJWB 1GMGA 4JF3A 1K7DA 4QE9A 3E8GA 1M90W 1RPOA 4P9OA 3OFNG 3SPHA 2P67A 5B3SC 3IC7A 4R50A 3CCRV 3K04A 1I5YA 1VQ6V 3I55V 4MTFA 1AJQA 3ZCCA 2IJKA 2X6BA 3CC2V 2YEVA 2IH1C 2X7RB 3FB8C 3B77A 4JPRA 5EC2C 2WLHA 5KUKA 1Q81W 1QBZA 4CBCA 4JASA 1PNKA 2XAGA 3ZMSA 3AG4C 2ITDC 1TUEB 1GTOA 3SPJA 1B6QA 3EFFK 4MW8A 4EKWA 3SPGA 2OTJV 3CC7V 4BAYA 5LHGA 4RQEA 2OT5A 3QO5A 1BHAA 1FS0G 4FPPA 3I56V 1QLNA 1S0VA 2QA4V 2IU0A 2IW5A 1GM9A 3PJSK 3WG7B 4CZZA 1KC8W 2WWWA 3SYCA 4XDJA 3SPIA 4UVBA 1V54B 3ZMTA 1FXVA 2JDIG 4QJFB 3ZIAG 3IFXA 2OCCB 2IJIA 2QM8A 1AROP 2DYRB 4N21A 4UUJC 5EC1C 2QTOA 2HG5C 5L3CA 1OCCB 3KG2A 4UVCA 4PA7A 1FXHA 2QM7A 2Y69C 4BW5A 4UXNA 1H38A 1G4YB 2ZXWC 4MT8A 5B1BB 4P30A 3RBZA 5L3DA 2Y48A 4WFEA 2A79B 2DQ3A 2Q67A 3LDEA 4P9PA 2ZDIC 1YIJV 2YSUB 1NVPD 2WSSG 2P6JA 3LDDA 4GT1A 3RVZA 3VBBA 1L1FA 1SRYA 3ABUA 1I5XA 2QKSA 3OUSA 3EHBB 5L3BA 1WLEA 1VQLV 3JD3A 1MOFA 1E79G 1PNLA 4HAMA 3TETA 2WLNA 2EIKC 3R65A 1PD3A 2R9IA 1R3IC 2PI5A 3TK1A 1K9MW 5B3SB 1SETA 3FKSG 2DWDC 4FK5C 3OAAG 5H9CA 1AI4A 4FJCC 1AJNA 4RQFA 4WF9V 3LSSA 1J95A 1XL4A 5GW7A 1AI7A 2EIMB 4LC1A 1FXKC 4ZBMA 3BEHA 3K0GA 4JTAB 4KP4A 2GHYA 2V1DA 1MSWD 5B1AB 4N23A 4JYCA 4MVRA 1ROPA 1VQ9V 3GB7C 4PDVA 3MHSC 1GK9A 4YXWG 1OCRB 1RPRA 4U7NA 1M57B 3ZRVA 1OCOC 1R6KA 2A0LA 4MVZA 3G71V 2WLIB 2DYSC 1XL6A 5LBQA 3JYCA 4MTGA 1DF4A 1NR1A 4J9ZB 4TT3G 4L87A 2IU3A 3CCUV 1GKFA 2HJFC 3QO8A 1GO3F 1K34A 5EBMC 1VQPV 1H8HG 4JAUA 3M99B 3AG1C 3CXCU 3B8NA 3F7YC 1IXMA 1GM7A 3ETDA 5CMUA 2JJ2G 2AHYA 5HFMA 5DN6G 3ABKB 2P7TC 1JX9A 1R73A 2X0LA 3P30A 1G8MA 3CCQV 1VQOV 5DM6V 1K33A 2M7WA 5CBFA 2EINB 3JD1A 1OCZC 2DQ0A 2UXNA 3W7TA 3AG1B 4LP8A 3STZC 1K5QA 1W0JG 1JVMA 2WLLA 3ABMC 5B1NA 1V54C 4WFGA 1EFRG 2WPDG 3ZJZA 3ZMUA 3P32A 3CYOA 1KECA 1NKDA 4MTOA 3RVYA 2HR3A 5CN0A 1HWYA 1RM1C 2FTKA 3G4SV 2DYSB 4Q20A 2PI4A 4JTCB 1NQTA 4BIZA 3ABMB 3OW2U 1H2GA 3ASOC 3W7WA 3CCEV 1BMFG 2AHZA 3E8FA 5H6QA 3ZRXA 5LGUA 1YITV 1YTFB 1GM8A 2NNUA 2F43G 4JAVA 4MVUA 3LUTB 2B1IA 4LCUC 5B1AC 4DO2A 1JJ2U 3K06A 2Q69A 1MG1A 5LGNA 4LBEC 1NR7A 1SESA 2R9RB 2XAJA 4RAIA 1K4CC 2ZQMA 3QNEA 2ZR3A 1S77D 1QCEA 2EBOA 2P90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RO2 A;  3VOU A;  3OR6 C;  1M57 C;  4WFH A;  3AG3 C;  2DWD C;  2ITC C;  4H37 A;  3E89 A;  4PDM A;  1R3J C;  5E1A C;  2WLL B;  3FB5 C;  4PA6 A;  5BZB A;  2K1E A;  2BOC C;  1KKD A;  1J95 A;  1XL4 A;  2NLJ C;  2WLK A;  2ATK C;  5EBL C;  1R3L C;  5IY5 C;  4R6Z A;  2DWE C;  3F7V C;  4R8C A;  4QNH B;  4PDR A;  4ZBM A;  3BEH A;  3K0G A;  4JTA B;  1QLE C;  3AG2 C;  2W0F C;  4QE7 A;  5EBW C;  4XDK A;  4GX5 A;  1ORQ C;  1V55 C;  1P7B A;  2H8P C;  2WLM A;  5J9P C;  3FB6 C;  4XDL A;  2X6C A;  4MVR A;  3F5W C;  3K03 A;  2IH3 C;  3GB7 C;  1OCR C;  4PDV A;  4QE9 A;  3SYQ A;  2HVK C;  4PA9 A;  3E8G A;  4P9O A;  3SPH A;  5B3S C;  4P2Z A;  1OCO C;  4R50 A;  3K04 A;  1R3K C;  2A0L A;  2Q6A A;  3ABL C;  2KB1 A;  4MVZ A;  4MTF A;  2WLI B;  3E8H A;  4TWK A;  2X6B A;  2DYS C;  3IGA C;  1XL6 A;  2YEV A;  5B1B C;  4R7C A;  2HVJ C;  2IH1 C;  3FB8 C;  3JYC A;  4MVM A;  4MTG A;  4J9Z B;  3SYP A;  3LNM B;  2EIM C;  3ABK C;  4I9W A;  4JTD B;  2WLH A;  4MSW C;  4X89 A;  5EC2 C;  5KUK A;  2HJF C;  4CBC A;  4OXS A;  5CBH A;  3AG4 C;  1LNQ A;  2ITD C;  5EBM C;  3T4Z A;  3ZRS A;  5KUM A;  3SPJ A;  2OCC C;  3AG1 C;  3EFF K;  4MW8 A;  3K08 A;  4RUE A;  3SPG A;  4G27 B;  3SYO A;  3F7Y C;  3SPC A;  4EKW A;  3OUF A;  3OR7 C;  4MVQ A;  4HZ3 A;  4PA4 A;  2AHY A;  3E8B A;  3WG7 C;  4H33 A;  2P7T C;  4DXW A;  3E83 A;  1S5H C;  4MVO A;  3LDC A;  3E86 A;  3PJS K;  1K4D C;  2Q68 A;  3SYC A;  3X2Q C;  3TCU A;  4XDJ A;  3SPI A;  5CBF A;  4GX2 A;  1OCZ C;  2HFE C;  3FB7 C;  1ZWI C;  3K0D A;  4X8A A;  3T1C A;  3IFX A;  2X6A A;  2WLJ A;  4LP8 A;  3STZ C;  4J9Y B;  1JVM A;  2WLL A;  4HYO A;  4PDL A;  3ABM C;  4UUJ C;  5EC1 C;  1V54 C;  4WFG A;  2QTO A;  2HG5 C;  3ZJZ A;  2BOB C;  2A9H A;  3OGC C;  4PA3 A;  3STL C;  3KG2 A;  2WLI A;  4PA7 A;  4MVS A;  4F4L A;  2Y69 C;  4MTO A;  3RVY A;  4BW5 A;  3RW0 A;  3UM7 A;  1OCC C;  1G4Y B;  2ZXW C;  4X88 A;  5EK0 A;  3ASN C;  4GX1 A;  4P30 A;  3RBZ A;  4JTC B;  4WFE A;  2A79 B;  2Q67 A;  3LDE A;  4P9P A;  3SYA A;  3ASO C;  2DYR C;  4MS2 A;  3T2M A;  5CBG A;  3LDD A;  2JK5 C;  2AHZ A;  3E8F A;  3RVZ A;  2EIN C;  4WFF A;  4KFM A;  1BL8 A;  4RUF A;  2EIL C;  2QKS A;  3OUS A;  4MVU A;  3LUT B;  4LCU C;  5B1A C;  3HPL C;  3SJQ C;  3K06 A;  2Q69 A;  3T4D A;  2EIJ C;  4LBE C;  2R9R B;  3TET A;  4G28 B;  4GX0 A;  2WLN A;  2ZD9 A;  4RAI A;  4MW3 A;  1K4C C;  2EIK C;  3R65 A;  1R3I C;  1M56 C;  3UKM A; 
#chains in the Genus database with same CATH topology
 2KG7 B;  3AG3 C;  1ZL8 B;  3JAT B;  4AQY O;  4AI8 A;  4LF5 B;  1I94 B;  2WLK A;  4OX9 B;  2W0X A;  4PDR A;  1CEZ A;  4XDK A;  1EN5 A;  1M1K W;  5FL7 G;  5J9P C;  2LGW A;  5CA0 A;  1YJN V;  5IYD O;  4LF4 O;  3H9V A;  3OTF A;  1R3K C;  2ODM A;  4I7Z B;  4U3J A;  4DV0 O;  3JAM N;  4MSW C;  3J80 N;  1B3Q A;  3ETQ A;  4DV4 O;  2JEU A;  3JAT A;  3RFR A;  2OCC C;  4RUE A;  1XMO B;  3SPC A;  1NBM G;  2GDS A;  1TUB B;  4UV9 A;  1YJ9 V;  5BMV A;  4X1K A;  2ZIN A;  3ZN1 A;  2Q7G A;  1WB7 A;  2Q68 A;  3X2Q C;  3BFR A;  4K3A A;  2XAF A;  3K5N A;  1ZWI C;  3TXS A;  2RJZ A;  1IVS A;  1FFX B;  1H2L A;  1KD1 W;  3DSQ A;  1E1R G;  1SQX H;  3ETG A;  3OE7 G;  3N2K B;  3STL C;  3RYI B;  4ZKI A;  3SGI A;  1WA8 A;  4X88 A;  3F5T A;  2GUZ B;  3VQW A;  4Q6G A;  5H5N A;  5F2V O;  5CBG A;  5A2Q N;  2HLD G;  1X4T A;  2P4V A;  3JAR B;  2EIN C;  2XND G;  4KFM A;  5BY1 A;  4OPA A;  4U7O A;  2QE7 G;  3HPL C;  1N8R W;  1N32 O;  3W7S A;  1XNQ O;  1F23 A;  1QVG U;  4F6R B;  3UKM A;  1YI2 V;  2CTR A;  3JSN A;  1Q86 W;  4IHJ B;  4JI3 O;  2QWO B;  3H1I H;  1FFX A;  3RYH B;  5EZY A;  2VWJ A;  2P22 C;  4FLU A;  2E5L B;  2YXL A;  1F7Y A;  1Q82 W;  3F7V C;  4JI4 B;  1XNR O;  1VF6 C;  3JSL A;  1RM1 B;  4JI5 B;  5LHH A;  2EIJ B;  5LYJ A;  5LXT A;  4LF9 O;  3DGE A;  1AR5 A;  2YXH A;  3UQ8 A;  2PYL A;  4PA9 A;  1OZ0 A;  4DV3 B;  1Q90 D;  1OCZ B;  4K0K B;  4I55 B;  2K9P A;  5DEC A;  5JCO C;  3MDS A;  1NZ6 A;  4JI5 O;  4MVM A;  1XI1 A;  3DC6 A;  3LNM B;  4W4L A;  3HB3 B;  5IYB O;  1VQM V;  4OXS A;  4DR2 B;  1LNQ A;  4IHJ A;  5K1P A;  3K3W A;  4G27 B;  3OUF A;  4JI2 B;  5LGT A;  1VQ5 V;  4PA4 A;  3WG7 C;  3HKE B;  4GCZ A;  3ZHQ A;  3ZHR A;  4JI8 B;  1LUW A;  3E86 A;  4QPJ A;  3E22 A;  3BVO A;  3RYC B;  4JYY A;  2CAZ C;  5KA6 A;  1ZLZ A;  4BIU A;  3APQ A;  3SJA C;  1JPX A;  3CCS V;  3OGC C;  2DOS A;  4JI0 B;  2HHH O;  1A32 A;  1OCC C;  2QJ1 A;  2BSK A;  4X9Q A;  4LFA B;  3ABL B;  2GTS A;  4O4J A;  5BR8 O;  1O9G A;  1JJO A;  4DK1 A;  4DUZ B;  3JAW A;  3I5D A;  1QQC A;  5LA6 B;  3OTO O;  1B04 A;  4TV8 B;  3SJQ C;  4E2L A;  3W7X A;  4AHC A;  2QWR B;  3OMA B;  4AIL C;  2UUA O;  3ZMZ A;  2ITC C;  1TA8 A;  4YJ3 B;  3ZED A;  4UV8 A;  2ZDI A;  3DC5 A;  4FLZ A;  4IL6 Z;  4WFB V;  4OGQ B;  1KP2 A;  1WNS A;  2ATK C;  4X64 B;  4R8C A;  1IBM B;  3JCZ A;  1NVP B;  4NR1 A;  2ZXW B;  2H8P C;  4MTX A;  4LNU A;  2X6C A;  3K03 A;  4LWS A;  2E3C A;  4JF3 A;  1M90 W;  1RPO A;  4X20 A;  2LGQ A;  3K04 A;  4NVP A;  2OWO A;  1KU9 A;  2IJK A;  2X6B A;  4TV8 A;  3HKD B;  3FB8 C;  3B77 A;  2LW1 A;  3UT5 B;  1JFF A;  2WLH A;  5KUK A;  1YDX A;  2BTQ B;  4B3S B;  4CBC A;  2XTA A;  1SQB H;  2ITD C;  1GTO A;  3EFF K;  3RN4 A;  4DV2 B;  1Q6I A;  1BHA A;  4IIJ A;  3DXR A;  1XBL A;  3PJS K;  4ZIB A;  4NTW A;  3SPI A;  2Y0P A;  5B66 Z;  3UO3 A;  2L6L A;  3N2G B;  3K5L A;  5LP6 C;  2IJI A;  2QM8 A;  4N21 A;  1B06 A;  1ZAU A;  3M7M X;  2QWP B;  2F4V B;  5BXZ A;  1FXH A;  3J81 N;  2ZXW C;  5B1B B;  3BPZ A;  5L3D A;  4X66 B;  1AB3 A;  2E5L O;  1YIJ V;  4DV7 O;  4ABM A;  1RSO A;  1J5E O;  4FLX A;  1MOF A;  2YIB D;  1ZUQ A;  4HBN A;  4WBN B;  2JS5 A;  5J2U A;  3R65 A;  2R9I A;  2PI5 A;  1K9M W;  3N2G A;  4DR3 O;  4I50 A;  4B3T B;  1FD9 A;  1SF9 A;  3OAA G;  3CXH F;  4WF9 V;  1AI7 A;  1BE3 H;  4LC1 A;  1N34 B;  4X1K B;  2XHB A;  4CS2 A;  4ZBM A;  3BEH A;  2N05 A;  4JTA B;  2F95 B;  5LMU B;  4YY3 B;  4K35 A;  1MMM A;  5B1A B;  4JYC A;  1ROP A;  3GB7 C;  3P3P A;  3QVN A;  2ADQ B;  1KUQ A;  3G71 V;  2ADP A;  3CRR A;  4JI4 O;  1XNR B;  5LBQ A;  1DF4 A;  4PI2 A;  4WBN A;  4L87 A;  3BAA A;  1GKF A;  3CJH B;  4HNA B;  1DK1 A;  2EX3 A;  3QO8 A;  1KMI Z;  3CB2 A;  1VQP V;  4JI7 O;  1X59 A;  1D5A A;  2PY5 A;  1GM7 A;  3ETD A;  5CMU A;  4YJ2 B;  3FX7 A;  1JX9 A;  3S3W A;  4LF6 O;  3P30 A;  1G8M A;  1FKA O;  2RNB A;  5DM6 V;  1GN6 A;  1OCZ C;  3KKY A;  1ZL8 A;  2UXN A;  3A2F A;  1IBL B;  4JI6 B;  4LP8 A;  3RYF A;  4LF4 B;  1YVW A;  5FLX N;  4WFG A;  5EZY B;  3ZJZ A;  3ZMU A;  1I0H A;  4FLT A;  4CC6 A;  4MTO A;  3RVY A;  3G4S V;  2DYS B;  4JTC B;  5IYZ A;  3OW2 U;  1QHT A;  2VQE O;  2YDE A;  4U3F H;  1EM1 A;  2QKA A;  2LW7 A;  1GN3 A;  4MVU A;  3LUT B;  5B1A C;  4DO2 A;  1JJ2 U;  3K06 A;  1MG1 A;  2FYU H;  1NR7 A;  4JI8 O;  4FLW A;  4LF8 O;  1QCE A;  1BZK A;  5GTH Z;  4JI1 B;  2YC0 A;  2P90 A;  1ENV A;  1N32 B;  4RO2 A;  5GTI Z;  2IJJ A;  4GUN A;  5L3G A;  1R3J C;  2PTM A;  4YY3 O;  2K1E A;  1DLB A;  3UO2 A;  5BMV B;  3HKE A;  3T1Y B;  4JAA A;  1XQ8 A;  3LNN A;  4I9Q A;  1EBO A;  4DV1 B;  1P7B A;  3L74 H;  3CD6 V;  2ZE6 A;  2IH3 C;  4B3T O;  1PPJ H;  1MA1 A;  2ZIO A;  1FJG O;  4J10 A;  2E74 B;  1WPX A;  2CTW A;  3E8H A;  1VF5 B;  2MK3 A;  1JOY A;  5B1B C;  2QM4 A;  3JD4 A;  2CDY A;  2P06 A;  4LF7 O;  1F4N A;  3C3T A;  1US6 A;  3JAR A;  2NR5 A;  4O2A A;  1EZJ A;  1FPO A;  4Z1V A;  1URF A;  1HNW O;  3DTU B;  1FAF A;  1WAZ A;  4MVQ A;  4HZ3 A;  1M93 A;  3HKC B;  1P4R A;  2HEP A;  4DXW A;  1K5S A;  3E83 A;  4L8J A;  1IXB A;  4B7K A;  3CCV V;  2PYJ A;  3M8A A;  4LF5 O;  1BHB A;  2F66 C;  1O9H A;  4J9Y B;  3RYH A;  1W59 A;  2WLI A;  2Y69 B;  1XRE A;  5HFL A;  4YHH B;  5LYJ B;  3AG2 B;  1QLE B;  4JZ2 A;  4GX1 A;  2ARH A;  2VQF B;  1H2M A;  2JK5 C;  3L75 H;  2CGO A;  4H13 B;  1XHZ A;  3G6E V;  5KLV H;  2H3O A;  4FFK A;  4YHH O;  2R9A A;  5A9G A;  3K5O A;  3UT5 A;  2XUM A;  4MW3 A;  4LH6 A;  2BTQ A;  2FB5 A;  4GKJ O;  2XOK G;  1K3E A;  1COW G;  2R72 A;  2DMX A;  3ABT A;  4JI6 O;  1U97 A;  1QNM A;  5IJ9 B;  1Z5W A;  1KKD A;  2EJ7 A;  3CCL V;  5IY5 C;  4R6Z A;  5IE9 A;  1SA0 A;  4ZHQ B;  1PL0 A;  1U96 A;  3CWB H;  1HNZ O;  2EUL A;  4JI0 O;  5EYP A;  4KXR A;  2HVK C;  5ITZ B;  5H6R A;  4UCS A;  2F23 A;  4LF7 B;  1JMK C;  2G38 A;  2YI9 A;  1KB9 F;  1FXK A;  4DW0 A;  2BSK B;  1K8A W;  2Q7H A;  4OX9 O;  3KCY A;  2CTP A;  3K08 A;  3BY6 A;  4NTX A;  3ASN B;  5H2F Z;  4GZR B;  3LDC A;  3WFV A;  4UCV A;  2RQ6 A;  4UVA A;  3BRC A;  3H1K H;  1MAB G;  4GX2 A;  2NN4 A;  5K1X A;  2Z3Y A;  3FB7 C;  3W7U A;  4X8A A;  1AI6 A;  2X6A A;  4ASU G;  2WLJ A;  4HYO A;  1HNW B;  1P7G A;  2QEX V;  2JS3 A;  3LSU A;  3CMA V;  2ZNI A;  3A0R A;  4E4E A;  2BOB C;  3RW0 A;  4O2B B;  1VQ4 V;  1FXK B;  1HW7 A;  2VS0 A;  1AP5 A;  4NXM B;  1QR9 A;  2KSD A;  3OMN B;  2ZM6 O;  3T2M A;  3H1H H;  3SR2 C;  2R70 A;  3CCJ V;  4DV3 O;  2OTL V;  2EIL C;  1W0K G;  1L0N H;  3LSQ A;  3VQY A;  2EIJ C;  2EZO A;  1NI8 A;  4GX0 A;  4UB8 Z;  1Y76 B;  4EB6 A;  3G67 A;  3TXQ A;  2BOC C;  4FMT A;  5C8Y A;  1OV9 A;  1NH2 B;  1PV0 A;  3BA8 A;  5EBW C;  4NTY A;  1JA8 A;  1G1X B;  1H2K A;  3C3S A;  3ZN0 A;  3HKB A;  5KX5 B;  1UJW B;  1GMG A;  1K7D A;  1Q6H A;  1FYJ A;  3RYF B;  4FVM A;  3E8G A;  4P9O A;  2IM9 A;  5B3S C;  2FL4 A;  3IC7 A;  4R50 A;  4B3M B;  3I55 V;  5CB4 A;  3S3X A;  1Y74 B;  4NXN B;  4PV1 B;  4JPR A;  1L0L H;  5B5E Z;  5EC2 C;  2RDC A;  1QBZ A;  2XAG A;  3SPJ A;  4F6E A;  1B6Q A;  4DR1 B;  4EKW A;  3WU2 Z;  1RSO B;  2OT5 A;  4DR4 O;  1S5L Z;  2QR4 A;  2IU0 A;  2IW5 A;  5J2U B;  3WG7 B;  1KC8 W;  3SYC A;  1V54 B;  3ZMT A;  1FXV A;  4QJF B;  4BW9 A;  3ZIA G;  2OCC B;  4JI3 B;  4NB5 A;  2UXB O;  3Q4H A;  4K8Z A;  4PA7 A;  2QM7 A;  4UXN A;  1H38 A;  5IJ0 B;  4MT8 A;  1ZX3 A;  4LF9 B;  3B40 A;  4WFE A;  4X62 O;  1GH6 A;  3LDE A;  4X1Y A;  4K8X A;  1GAX A;  1L1F A;  5L3B A;  1WLE A;  4X1I B;  5E79 Z;  2WLN A;  3T1H O;  1R3I C;  1XNQ B;  4HNA A;  1XOU A;  1Z5V A;  3CRA A;  1SET A;  2CUG A;  2DWD C;  4O2A B;  4FK5 C;  1AJN A;  3LSS A;  1HDJ A;  1J95 A;  1XL4 A;  5GW7 A;  3D36 C;  1IBK O;  5JJJ B;  3HKC A;  1BCC H;  5IJ0 A;  4LF8 B;  2Q8V A;  2ILM A;  1VQ9 V;  3O9O A;  1OCR B;  1RPR A;  4U7N A;  1SQQ H;  1M57 B;  1R6K A;  1BQ0 A;  2ZCE A;  1S5J A;  2Y4U A;  2DYS C;  1N4C A;  1Y6X A;  1BQZ A;  3JYC A;  4X66 O;  2IU3 A;  4K0K O;  2HJF C;  2OIE A;  3RWR D;  1PM9 A;  4JAU A;  1VEW A;  5KHK A;  2UU9 B;  2AHY A;  4DV4 B;  3ABK B;  1XHX A;  2X0L A;  2AZ0 A;  4DRX A;  2VRZ A;  4DV5 B;  5CBF A;  4D7T A;  2DQ0 A;  4DV0 B;  4PD4 F;  1JVM A;  3ABM C;  5B1N A;  1V54 C;  3EXA A;  1HR0 O;  1EFR G;  1EZV H;  1SA0 B;  3P32 A;  3CYO A;  2JGD A;  5KHH A;  1NKD A;  1N33 O;  3WB2 A;  3EVK A;  2FTK A;  4O4L B;  1I7F A;  4H0L B;  3AG7 A;  4BIZ A;  5IWA O;  3ASO C;  3O65 A;  3CCE V;  4O4I B;  5H6Q A;  5LGU A;  1YIT V;  5ITZ A;  1I94 O;  3C90 A;  4I55 A;  2LQT A;  4LBE C;  4JV5 O;  3CRM A;  1XDC A;  2R9R B;  3ZX6 A;  4RAI A;  5LMU O;  1S77 D;  4DRX B;  2ZE7 A;  2EBO A;  2AXT Z;  5JWP A;  3CC4 V;  1S76 D;  3OT7 A;  3D8C A;  1SQV H;  1NU1 H;  4PDM A;  1Q6U A;  1DGS A;  2WLL B;  1MZE A;  1WN7 A;  1YJW V;  4DR3 B;  3KZI Z;  3ZHS A;  2JGD B;  4GX5 A;  2WLM A;  2P4K A;  3B8M A;  1VF7 A;  3F5W C;  3ZHV A;  1Y67 A;  3CP1 A;  3SYQ A;  2V4D A;  3E2E A;  4P2Z A;  5L3F A;  4DR5 B;  2KB1 A;  2W6I G;  4GYC B;  2XT9 A;  4A5U B;  2A3Q A;  4TOI A;  2EIM C;  1VQ8 V;  2Q7E A;  3BAB A;  4LFC O;  4Z1M G;  2H94 A;  3JAW B;  5DED A;  5EIB D;  5AG2 A;  2B5U A;  3N27 A;  2W6J G;  4C7U A;  1KYO F;  5FNV A;  5KHI A;  1SS3 A;  2D3O W;  1M4U A;  4LFB O;  3ZRW B;  4DR7 O;  1Y76 A;  3ML0 A;  2BCC H;  2HFE C;  3OEE G;  2F1M A;  3FD9 A;  3GVM A;  4PDL A;  2QWQ B;  4Z2W A;  2RMK B;  4NXM O;  4IGG A;  4O4H B;  4MVS A;  4LH7 A;  3ASN C;  1V9P A;  3VQV A;  1VMG A;  1IBK B;  5KX5 A;  2DYR C;  1OCO B;  5LMN O;  4BIO A;  2CK3 G;  3B4S A;  4G2K A;  3HKD A;  3K59 A;  4PHZ A;  3OMI B;  2EJR A;  1VQN V;  1CPY A;  4G28 B;  2EZP A;  3ZRW A;  2OCH A;  3E35 A;  4W4K A;  3FAV B;  4I0X A;  3K5M A;  1IZ3 A;  3VOU A;  1NJI W;  1L8D A;  4WFH A;  5LOV A;  5JJE B;  4DUY B;  2N74 A;  1AJP A;  3JD2 A;  3FB5 C;  1HP8 A;  1P49 A;  1EN6 A;  4J11 A;  1D5N A;  2NLJ C;  1AI5 A;  1YEW A;  2EIK B;  3WB1 A;  1K92 A;  1K97 A;  1XMQ B;  3OM3 B;  3OEH G;  2WAM A;  3ZMV A;  4EEQ A;  2YI8 A;  1N36 B;  3SDL A;  1JR9 A;  4RWU A;  3ABL C;  4TWK A;  2UUC B;  3IGA C;  4O2B A;  3K9S A;  2ZE5 A;  4I4T B;  3SYP A;  4I9W A;  3ABK C;  4X89 A;  4I0X B;  1YSC A;  3L71 H;  1Q7Y W;  5CBH A;  3T4Z A;  4GKK O;  2JRI A;  4NKG B;  1Q8I A;  5TIS Z;  3TGU H;  1OHH G;  3GWO A;  4H33 A;  4NXN O;  1NH2 D;  4MVO A;  1DTO A;  1PKX A;  1SQG A;  3TCU A;  3JAK B;  4B3M O;  2YS8 A;  4I50 B;  2JEX A;  2F93 B;  1M9N A;  4B3R B;  4F4L A;  1SZT A;  2KKW A;  2AW9 A;  1PP9 H;  4KUM A;  2LO1 A;  5EK0 A;  4I4T A;  2AZ2 A;  1KQS U;  4QIW F;  2B1G A;  4MS2 A;  3K79 A;  1SZX A;  2DN9 A;  1VQK V;  3SJB C;  5GON A;  1GN4 A;  4J41 A;  4DUZ O;  4LF6 B;  4RUF A;  1UFI A;  2QGN A;  1SKV A;  2LFS A;  1TUB A;  3T4D A;  1V55 B;  2JGU A;  2RN9 A;  4LFB B;  2ZD9 A;  4DV1 O;  5JQG A;  1F4M A;  2MW2 B;  3JAK A;  5KMG B;  1PNM A;  1M57 C;  5E1A C;  1YZB A;  1KP3 A;  4LFC B;  3K9A A;  5EIB C;  4ZI7 B;  4QNH B;  2W0F C;  1VP7 A;  2LP7 A;  3TJT A;  3IJ4 A;  4JI2 O;  5D5P A;  2GUZ A;  1K73 W;  2YIC A;  4TUY B;  4EFB A;  4JI7 B;  3IC9 A;  3SPH A;  3ZCC A;  1AJQ A;  3JAL A;  2YEV A;  2HP8 A;  4B7E A;  1N0J A;  2X7R B;  3CRC A;  4UCO A;  5JH7 A;  1MZF A;  4X1Y B;  3AG4 C;  3R66 A;  3CX5 F;  3HR0 A;  4MW8 A;  3SPG A;  2OTJ V;  3CC7 V;  3QO5 A;  1FS0 G;  4FPP A;  4X1I A;  4ZI7 A;  3I56 V;  1S0V A;  1QLN A;  2QA4 V;  4FLV A;  2WWW A;  1MSD A;  4J42 A;  2N04 A;  4XDJ A;  1WB8 A;  3FFQ A;  4J7K A;  2JDI G;  2UUC O;  3IFX A;  3OD4 A;  5LP6 B;  1ARO P;  2DYR B;  4CS4 A;  4UUJ C;  1XMO O;  2QTO A;  5L3C A;  4CC5 A;  3KG2 A;  2UXD O;  4ZOL B;  4FZ1 A;  4BW5 A;  2ZT9 B;  4UCU A;  1G4Y B;  2Q73 A;  4P30 A;  1LUV A;  2YIB A;  3U11 A;  2DQ3 A;  2Q67 A;  4P9P A;  1I08 A;  3CS5 A;  1NVP D;  2WSS G;  3LDD A;  4X65 O;  4GT1 A;  2QDO A;  1I5X A;  3OUS A;  3EHB B;  3KCX A;  4QGP A;  1BGY H;  4FLY A;  1VQL V;  1IUR A;  3JD3 A;  3B09 A;  1XUQ A;  1E79 G;  1PNL A;  3TET A;  3THO A;  1NTZ H;  2EIK C;  3RYC A;  3TK1 A;  5B3S B;  3FKS G;  2O57 A;  2CE4 A;  3L70 H;  4OPH A;  5LMN B;  4J7J A;  5H9C A;  1AI4 A;  4FJC C;  3APO A;  2ZNJ A;  3U10 A;  2CGN A;  3A0B Z;  5FPO A;  1MSW D;  2ETN A;  1BSM A;  3BHP A;  4MVR A;  5JJN B;  1LR1 A;  1GK9 A;  3MHS C;  2Q9L A;  4UFZ A;  2QKC A;  3ZRV A;  1RP3 B;  5LA6 A;  4MVZ A;  1IBM O;  2WLI B;  4X64 O;  3CRQ A;  2A7W A;  4MTG A;  4J9Z B;  4TT3 G;  2A06 H;  4JYA B;  1YF2 A;  4KHP O;  1HNX B;  4O4I A;  4CH3 A;  1K34 A;  3M99 B;  4J80 A;  3B8N A;  3F7Y C;  4D6T H;  1IXM A;  2JJ2 G;  2IBZ H;  1CXZ B;  3OGI B;  1P84 F;  2P7T C;  1R73 A;  2BTO A;  2UUB B;  4TQF A;  2QWN B;  2UUB O;  3FAV A;  1VQO V;  1K33 A;  1QU7 A;  2M7W A;  4LNU B;  1ZTE A;  1Q5O A;  4LWS B;  1XEQ A;  5LOV B;  3W7T A;  3AG1 B;  3STZ C;  4DV2 O;  2WLL A;  5IJ9 A;  1XIL A;  2WPD G;  2QTS A;  2LJ2 A;  1AIL A;  2HR3 A;  1HWY A;  3H1J H;  2CH7 B;  1JFF B;  3AK2 A;  5EYP B;  1NQT A;  1AP6 A;  3OTO B;  4KL1 A;  3W7W A;  3L72 H;  1BMF G;  3E8F A;  3G6B A;  3ZBH A;  1YXB A;  2NNU A;  4JAV A;  1TAE A;  2B1I A;  4LCU C;  3T1H B;  3QNE A;  1VQ6 V;  3OR6 C;  2EIL B;  2UXC O;  3JAS A;  4X65 B;  4H37 A;  3QTC A;  1T5E A;  1H8E G;  2ZKO A;  2UXX A;  4FM2 A;  4DV6 O;  1QLE C;  3AG2 C;  5JVD B;  2BE3 A;  3MHH C;  3FB6 C;  1JQ0 A;  2CH7 A;  4FM1 A;  2Y4T A;  1N36 O;  1WP8 A;  2UUA B;  5KA5 A;  2HJD A;  5L3E A;  1HNZ B;  3QO7 A;  1WP7 A;  2ZR2 A;  1YHQ V;  3ASO B;  2Q6A A;  1E1Q G;  3T1Y O;  4FFB B;  4FZ0 A;  4R7C A;  1NS1 A;  3H01 A;  5IYC O;  2UU9 O;  3PN1 A;  2KG7 A;  2UXD B;  3ZHU A;  3ZRS A;  4D7S A;  5KUM A;  4QPK A;  3SYO A;  2YIA A;  1H2N A;  1R6T A;  2HKO A;  2C2A A;  3IAY A;  3A8T A;  5IDJ A;  4BR6 A;  1S5H C;  1FFT B;  4H44 B;  5CA1 B;  4JYA O;  2V7Q G;  4CS3 A;  4EB6 B;  4WFA V;  3T1C A;  3AK1 A;  3MD0 A;  1SER A;  1JCH A;  3NXS A;  4PA3 A;  4JZG A;  1THZ A;  4TQD A;  1SQF A;  2ZE8 A;  3BA9 A;  4FIP C;  1Y66 A;  1HR0 B;  1AVM A;  4IYH A;  2PUS A;  3CSX A;  3ETE A;  3HKB B;  3CCM V;  5IY5 B;  5B1O A;  2OIG A;  1KKC A;  4WFF A;  2FKX A;  3A0H Z;  3CPW U;  2LFR A;  4CH5 A;  2YEV B;  4YJ2 A;  5D5Q A;  5CA3 A;  5JH7 B;  4LR3 A;  4XBF A;  1R1B A;  4NYK A;  4CH4 A;  4DR6 O;  4JV5 B;  4DV7 B;  2GV9 A;  3E89 A;  3H1L H;  3FYI B;  1CP9 A;  1IBL O;  2IJH A;  5BZB A;  2Z5U A;  4DYL A;  1YTF D;  1M56 B;  3N2K A;  1WPB A;  3GWK C;  2E76 B;  3RYI A;  4PI0 A;  4UCR A;  4QE7 A;  2Q4P A;  1ORQ C;  1V55 C;  1WA8 B;  1VIB A;  4B3R O;  2AGA A;  5IYZ B;  4XDL A;  1S72 V;  2XAQ A;  1OCR C;  2UXB B;  3Q4H B;  5KAF Z;  5LHI A;  4KHP B;  1N34 O;  2WA3 A;  2HVJ C;  2XAS A;  2JIZ G;  2DW4 A;  4JTD B;  4F6R A;  3D36 A;  3D3I A;  5C93 A;  3FYE B;  2YXY A;  4JI1 O;  5GON B;  2JVD A;  1SC5 B;  3OR7 C;  3E8B A;  3CME V;  4JGS A;  2RCV A;  1K4D C;  5JQG B;  1NTK H;  5KMG A;  1RFY A;  5CA0 B;  5KHJ A;  1QR8 A;  3K0D A;  1AR1 B;  3L9D A;  3AG4 B;  3JD0 A;  2PGG A;  2A9H A;  3X2Q B;  2VQF O;  3VQX A;  4U3J B;  3AEI A;  2XAH A;  1R6N A;  3UM7 A;  1DF5 A;  1M5I A;  3K57 A;  1TVK B;  1J5E B;  3SYA A;  4PEL A;  4TUY A;  4DUY O;  4I5S A;  4TSF G;  4IYI A;  1BL8 A;  1QVF U;  3AG3 B;  1ZSP A;  2Y0I A;  4DV5 O;  3JAL B;  2JJ1 G;  3ZS8 C;  2YUA A;  2GSM B;  1F51 A;  1PL4 A;  4WCE V;  3JCU Z;  1Y4M A;  1M56 C;  2DE0 X;  1NT2 B;  1NTM H;  4YIP A;  4PA6 A;  2L35 A;  1AR4 A;  1W2B U;  2PF4 E;  4AQY B;  4LFA O;  1S3J A;  5EBL C;  1R3L C;  2DWE C;  2ZM6 B;  5KAI Z;  2HHH B;  1N0N A;  2GBO A;  1VQ7 V;  4DR4 B;  1OJH A;  4JYB A;  1Q3E A;  1TVK A;  5J2T A;  4IT5 A;  3U0Z A;  4QE9 A;  5LP6 A;  3CCR V;  3OFN G;  2P67 A;  2D2C B;  1I5Y A;  3RT3 C;  4MTF A;  4ZOL A;  3CC2 V;  1Q43 A;  3D3Q A;  2IH1 C;  3B2E E;  4O4L A;  1IX9 A;  4ICG A;  1KBH A;  1Q81 W;  3WB0 A;  4JAS A;  1PNK A;  3ZMS A;  1WJZ A;  1TUE B;  4YJ3 A;  3QF7 A;  3AK3 A;  4BAY A;  5LHG A;  4RQE A;  4DR1 O;  4GKK B;  3BCC H;  1IDS A;  4CH6 A;  4ZHQ A;  3ZHT A;  3NR7 A;  1GM9 A;  4CZZ A;  5LXT B;  3G80 A;  3RGB A;  4UVB A;  3UCS C;  5J2T B;  5BR8 B;  4BWA A;  2FML A;  5KHG A;  5EC1 C;  1MNG A;  1YCI A;  1BT8 A;  4X20 B;  2HG5 C;  4X62 B;  1OCC B;  1SQP H;  4UVC A;  2DJV A;  4UB6 Z;  2KQX A;  2Y69 C;  1EN4 A;  4EFE A;  5JVD A;  3RBZ A;  2Y48 A;  2A79 B;  2ZDI C;  1GRJ A;  3CHX A;  2YSU B;  2Q0O C;  2P6J A;  1HNX O;  2P5O A;  1TGO A;  3RVZ A;  2OYQ A;  3J7A U;  3VBB A;  1SRY A;  3ABU A;  2QKS A;  2Q0A A;  4FFB A;  1G6U A;  1D2D A;  4HAM A;  3MAQ A;  3E22 B;  1PD3 A;  2M6Y A;  4GLX A;  3P3N A;  2VQE B;  4TV9 B;  4RQF A;  4J7Z A;  3ICX A;  1VAR A;  2Z0A A;  4B3S O;  2EIM B;  5FNV B;  3L73 H;  3SJC C;  4DR7 B;  3K58 A;  1BS3 A;  1FXK C;  3K0G A;  4KP4 A;  2GHY A;  5CA1 A;  2V1D A;  4N23 A;  5LL6 Y;  4O4J B;  2UXC B;  4PDV A;  2VWK A;  4YXW G;  4DW1 A;  1OCO C;  2A0L A;  2QSA A;  4O4H A;  1XL6 A;  4UCT A;  2B9Z A;  1NR1 A;  1H2S B;  3CCU V;  2ZIM A;  4DR5 O;  2WA4 A;  1GO3 F;  5EBM C;  1H8H G;  3AG1 C;  3CXC U;  4TV9 A;  3QG5 A;  1XMQ O;  4FM0 A;  5C8Y B;  3CE2 A;  5HFM A;  5DN6 G;  4DV6 B;  5JCO A;  3CCQ V;  2EIN B;  3JD1 A;  3JAS B;  2PZS A;  1K5Q A;  1W0J G;  1FJG B;  2CTQ A;  4PJ0 Z;  4GKJ B;  4DR6 B;  2GTA A;  2Q5Z A;  5CB4 B;  5FPR A;  1Z2G A;  1KEC A;  1VF6 A;  1Y74 A;  5CN0 A;  1RM1 C;  4Q20 A;  2PI4 A;  2F4V O;  3CJH A;  3ABM B;  1H2G A;  4DK0 A;  2AHZ A;  3ZRX A;  1YTF B;  1GM8 A;  2E75 B;  5IWA B;  2F43 G;  1UPG A;  4YIO A;  2Q69 A;  4IIJ B;  5LGN A;  1GN2 A;  4B08 A;  3DXR B;  1N33 B;  1SES A;  2XAJ A;  5IT9 N;  1K4C C;  2YID A;  2ZQM A;  2ZR3 A;  3CEI A;  4DR2 O; 
#chains in the Genus database with same CATH homology
 4RO2 A;  3OR6 C;  3CC4 V;  1S76 D;  3AG3 C;  2EIL B;  2IJJ A;  4H37 A;  5L3G A;  4PDM A;  1R3J C;  2WLL B;  2K1E A;  2WLK A;  1H8E G;  1YJW V;  2UXX A;  1DLB A;  4PDR A;  1CEZ A;  1QLE C;  3AG2 C;  4XDK A;  4GX5 A;  1EBO A;  2WLM A;  1P7B A;  5FL7 G;  1M1K W;  3MHH C;  3FB6 C;  5J9P C;  1JQ0 A;  3B8M A;  3CD6 V;  3F5W C;  2IH3 C;  1YJN V;  5IYD O;  3CP1 A;  3SYQ A;  5KA5 A;  5L3E A;  3E2E A;  3QO7 A;  4P2Z A;  2ZR2 A;  1YHQ V;  3ASO B;  1R3K C;  1WPX A;  2Q6A A;  5L3F A;  2KB1 A;  1E1Q G;  3E8H A;  2MK3 A;  1JOY A;  2W6I G;  5B1B C;  3JD4 A;  4R7C A;  3H01 A;  2EIM C;  4MSW C;  1VQ8 V;  5IYC O;  1F4N A;  4Z1M G;  2H94 A;  3ZRS A;  2JEU A;  5KUM A;  1EZJ A;  2OCC C;  4QPK A;  4RUE A;  3SYO A;  2B5U A;  2W6J G;  3DTU B;  1NBM G;  2HKO A;  3SPC A;  2C2A A;  4MVQ A;  4UV9 A;  4HZ3 A;  1YJ9 V;  5IDJ A;  2D3O W;  1P4R A;  4DXW A;  1K5S A;  3E83 A;  1S5H C;  3ZN1 A;  1FFT B;  3ZRW B;  2V7Q G;  2Q68 A;  3X2Q C;  3ML0 A;  3CCV V;  1BHB A;  2HFE C;  3OEE G;  2XAF A;  1ZWI C;  4WFA V;  3T1C A;  4J9Y B;  4PDL A;  3MD0 A;  1KD1 W;  1E1R G;  1JCH A;  1SER A;  3ETG A;  3NXS A;  3OE7 G;  4PA3 A;  1THZ A;  3STL C;  2WLI A;  4MVS A;  4ZKI A;  2Y69 B;  4FIP C;  1Y66 A;  5HFL A;  4X88 A;  3AG2 B;  1QLE B;  3ASN C;  4GX1 A;  3ETE A;  3CCM V;  5IY5 B;  5B1O A;  2DYR C;  5CBG A;  1OCO B;  2HLD G;  2JK5 C;  2EIN C;  4WFF A;  2XND G;  4KFM A;  2CK3 G;  3CPW U;  4U7O A;  2LFR A;  4G2K A;  2QE7 G;  3HPL C;  2YEV B;  3G6E V;  3OMI B;  1N8R W;  5CA3 A;  3W7S A;  2EJR A;  1VQN V;  1CPY A;  4G28 B;  4XBF A;  1F23 A;  2EZP A;  4MW3 A;  3ZRW A;  1QVG U;  3E35 A;  2XOK G;  3UKM A;  1YI2 V;  1K3E A;  1Q86 W;  1COW G;  3VOU A;  1NJI W;  4WFH A;  3ABT A;  3E89 A;  1AJP A;  3FYI B;  3JD2 A;  1CP9 A;  3FB5 C;  2IJH A;  5BZB A;  2Z5U A;  1KKD A;  2NLJ C;  1YTF D;  1AI5 A;  1M56 B;  3CCL V;  1ENV A;  4R6Z A;  2EIK B;  5IY5 C;  3F7V C;  1Q82 W;  1K92 A;  1PL0 A;  1RM1 B;  4QE7 A;  5LHH A;  1ORQ C;  1V55 C;  2EIJ B;  1K97 A;  3DGE A;  4XDL A;  1S72 V;  2XAQ A;  3OM3 B;  1OCR C;  3OEH G;  2WAM A;  2HVK C;  4PA9 A;  3ZMV A;  1OZ0 A;  5H6R A;  5LHI A;  1OCZ B;  3ABL C;  4TWK A;  3IGA C;  2HVJ C;  4MVM A;  2XAS A;  2JIZ G;  1FXK A;  2DW4 A;  3SYP A;  3LNM B;  4I9W A;  3ABK C;  4JTD B;  4X89 A;  1K8A W;  3HB3 B;  3D36 A;  3D3I A;  5IYB O;  1YSC A;  5C93 A;  1VQM V;  3FYE B;  1Q7Y W;  4OXS A;  5CBH A;  1LNQ A;  3T4Z A;  3K3W A;  3K08 A;  4G27 B;  3BY6 A;  3OUF A;  3OR7 C;  5LGT A;  1VQ5 V;  4PA4 A;  3ASN B;  3E8B A;  1OHH G;  3GWO A;  3WG7 C;  3CME V;  4GCZ A;  4H33 A;  4JGS A;  1NH2 D;  4MVO A;  3LDC A;  1DTO A;  3WFV A;  3E86 A;  4QPJ A;  1K4D C;  1PKX A;  4UVA A;  3TCU A;  5KA6 A;  1MAB G;  4GX2 A;  2Z3Y A;  3FB7 C;  3W7U A;  1QR8 A;  3K0D A;  4X8A A;  1AR1 B;  1AI6 A;  2JEX A;  2X6A A;  4ASU G;  2WLJ A;  4BIU A;  4HYO A;  3AG4 B;  2QEX V;  1JPX A;  3JD0 A;  3CMA V;  3A0R A;  3CCS V;  2BOB C;  1M9N A;  2A9H A;  3OGC C;  3X2Q B;  4F4L A;  3AEI A;  2XAH A;  1SZT A;  1R6N A;  3RW0 A;  1VQ4 V;  3UM7 A;  1DF5 A;  1OCC C;  4KUM A;  5EK0 A;  1FXK B;  1KQS U;  3ABL B;  1QR9 A;  2B1G A;  4QIW F;  3OMN B;  3SYA A;  4MS2 A;  3T2M A;  3K79 A;  1VQK V;  4PEL A;  4I5S A;  4TSF G;  3CCJ V;  4RUF A;  1BL8 A;  1QVF U;  2OTL V;  2EIL C;  3AG3 B;  2LFS A;  1W0K G;  3LSQ A;  3SJQ C;  3T4D A;  2JJ1 G;  1V55 B;  2EIJ C;  2EZO A;  4E2L A;  2GSM B;  1F51 A;  4GX0 A;  2ZD9 A;  3W7X A;  4WCE V;  1Y4M A;  1F4M A;  1M56 C;  1PNM A;  3OMA B;  1M57 C;  3ZMZ A;  2ITC C;  5E1A C;  4PA6 A;  4UV8 A;  2ZDI A;  1W2B U;  1KP3 A;  2BOC C;  4FMT A;  4WFB V;  1KP2 A;  1S3J A;  2ATK C;  5EBL C;  1R3L C;  3K9A A;  2DWE C;  4R8C A;  4QNH B;  1NH2 B;  3JCZ A;  1NVP B;  5EBW C;  2ZXW B;  2W0F C;  2H8P C;  2LP7 A;  1VQ7 V;  4MTX A;  4JYB A;  3ZN0 A;  1K73 W;  2X6C A;  3K03 A;  1UJW B;  1GMG A;  4JF3 A;  1K7D A;  4QE9 A;  3E8G A;  1M90 W;  1RPO A;  4P9O A;  3OFN G;  3SPH A;  2P67 A;  5B3S C;  3IC7 A;  4R50 A;  3CCR V;  3K04 A;  1I5Y A;  1VQ6 V;  3I55 V;  4MTF A;  1AJQ A;  3ZCC A;  2IJK A;  2X6B A;  3CC2 V;  2YEV A;  2IH1 C;  2X7R B;  3FB8 C;  3B77 A;  4JPR A;  5EC2 C;  2WLH A;  5KUK A;  1Q81 W;  1QBZ A;  4CBC A;  4JAS A;  1PNK A;  2XAG A;  3ZMS A;  3AG4 C;  2ITD C;  1TUE B;  1GTO A;  3SPJ A;  1B6Q A;  3EFF K;  4MW8 A;  4EKW A;  3SPG A;  2OTJ V;  3CC7 V;  4BAY A;  5LHG A;  4RQE A;  2OT5 A;  3QO5 A;  1BHA A;  1FS0 G;  4FPP A;  3I56 V;  1QLN A;  1S0V A;  2QA4 V;  2IU0 A;  2IW5 A;  1GM9 A;  3PJS K;  3WG7 B;  4CZZ A;  1KC8 W;  2WWW A;  3SYC A;  4XDJ A;  3SPI A;  4UVB A;  1V54 B;  3ZMT A;  1FXV A;  2JDI G;  4QJF B;  3ZIA G;  3IFX A;  2OCC B;  2IJI A;  2QM8 A;  1ARO P;  2DYR B;  4N21 A;  4UUJ C;  5EC1 C;  2QTO A;  2HG5 C;  5L3C A;  1OCC B;  3KG2 A;  4UVC A;  4PA7 A;  1FXH A;  2QM7 A;  2Y69 C;  4BW5 A;  4UXN A;  1H38 A;  1G4Y B;  2ZXW C;  4MT8 A;  5B1B B;  4P30 A;  3RBZ A;  5L3D A;  2Y48 A;  4WFE A;  2A79 B;  2DQ3 A;  2Q67 A;  3LDE A;  4P9P A;  2ZDI C;  1YIJ V;  2YSU B;  1NVP D;  2WSS G;  2P6J A;  3LDD A;  4GT1 A;  3RVZ A;  3VBB A;  1L1F A;  1SRY A;  3ABU A;  1I5X A;  2QKS A;  3OUS A;  3EHB B;  5L3B A;  1WLE A;  1VQL V;  3JD3 A;  1MOF A;  1E79 G;  1PNL A;  4HAM A;  3TET A;  2WLN A;  2EIK C;  3R65 A;  1PD3 A;  2R9I A;  1R3I C;  2PI5 A;  3TK1 A;  1K9M W;  5B3S B;  1SET A;  3FKS G;  2DWD C;  4FK5 C;  3OAA G;  5H9C A;  1AI4 A;  4FJC C;  1AJN A;  4RQF A;  4WF9 V;  3LSS A;  1J95 A;  1XL4 A;  5GW7 A;  1AI7 A;  2EIM B;  4LC1 A;  1FXK C;  4ZBM A;  3BEH A;  3K0G A;  4JTA B;  4KP4 A;  2GHY A;  2V1D A;  1MSW D;  5B1A B;  4N23 A;  4JYC A;  4MVR A;  1ROP A;  1VQ9 V;  3GB7 C;  4PDV A;  3MHS C;  1GK9 A;  4YXW G;  1OCR B;  1RPR A;  4U7N A;  1M57 B;  3ZRV A;  1OCO C;  1R6K A;  2A0L A;  4MVZ A;  3G71 V;  2WLI B;  2DYS C;  1XL6 A;  5LBQ A;  3JYC A;  4MTG A;  1DF4 A;  1NR1 A;  4J9Z B;  4TT3 G;  4L87 A;  2IU3 A;  3CCU V;  1GKF A;  2HJF C;  3QO8 A;  1GO3 F;  1K34 A;  5EBM C;  1VQP V;  1H8H G;  4JAU A;  3M99 B;  3AG1 C;  3CXC U;  3B8N A;  3F7Y C;  1IXM A;  1GM7 A;  3ETD A;  5CMU A;  2JJ2 G;  2AHY A;  5HFM A;  5DN6 G;  3ABK B;  2P7T C;  1JX9 A;  1R73 A;  2X0L A;  3P30 A;  1G8M A;  3CCQ V;  1VQO V;  5DM6 V;  1K33 A;  2M7W A;  5CBF A;  2EIN B;  3JD1 A;  1OCZ C;  2DQ0 A;  2UXN A;  3W7T A;  3AG1 B;  4LP8 A;  3STZ C;  1K5Q A;  1W0J G;  1JVM A;  2WLL A;  3ABM C;  5B1N A;  1V54 C;  4WFG A;  1EFR G;  2WPD G;  3ZJZ A;  3ZMU A;  3P32 A;  3CYO A;  1KEC A;  1NKD A;  4MTO A;  3RVY A;  2HR3 A;  5CN0 A;  1HWY A;  1RM1 C;  2FTK A;  3G4S V;  2DYS B;  4Q20 A;  2PI4 A;  4JTC B;  1NQT A;  4BIZ A;  3ABM B;  3OW2 U;  1H2G A;  3ASO C;  3W7W A;  3CCE V;  1BMF G;  2AHZ A;  3E8F A;  5H6Q A;  3ZRX A;  5LGU A;  1YIT V;  1YTF B;  1GM8 A;  2NNU A;  2F43 G;  4JAV A;  4MVU A;  3LUT B;  2B1I A;  4LCU C;  5B1A C;  4DO2 A;  1JJ2 U;  3K06 A;  2Q69 A;  1MG1 A;  5LGN A;  4LBE C;  1NR7 A;  1SES A;  2R9R B;  2XAJ A;  4RAI A;  1K4C C;  2ZQM A;  3QNE A;  2ZR3 A;  1S77 D;  1QCE A;  2EBO A;  2P90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...