4F4LA

Open channel conformation of a voltage gated sodium channel
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
86
Chain Sequence
SVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bacterial voltage-gated sodium channel pore reveals mechanisms of opening and closing.
pubmed doi rcsb
source organism Magnetococcus marinus
molecule tags Metal transport
molecule keywords Ion transport protein
total genus 30
structure length 86
sequence length 86
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4f4lA00
2QKSA 1JVMA 1XL4A 2R9RB 3KG2A 4CBCA 5B3SC 4JTCB 4MTGA 5IY5C 4GX2A 4HYOA 2ITDC 3K0DA 3SPHA 3SYQA 2WLIB 2AHYA 4LCUC 4PDMA 2WLMA 3F7YC 3OUFA 2QTOA 2IH1C 2ZXWC 5CBFA 4GX5A 3RBZA 3IGAC 4GX1A 3E8GA 3FB8C 5EC2C 1K4CC 4RAIA 5E1AC 5CBHA 3FB6C 3ASNC 4J9YB 4RUFA 4GX0A 5B1BC 4MTFA 4MS2A 2EIMC 4ZBMA 3RVZA 2BOBC 4QE9A 3SPCA 4X88A 2NLJC 3OGCC 4R8CA 4RO2A 2DYRC 3R65A 3K08A 4RUEA 2EIJC 4MW3A 4PA4A 2EIKC 2K1EA 3UM7A 3F7VC 3E86A 3OR7C 4MVMA 3RW0A 3STLC 4XDJA 4QE7A 3RVYA 1XL6A 3E83A 4QNHB 1R3KC 4WFHA 2A79B 2BOCC 3AG3C 3E8BA 4PDLA 4I9WA 4X89A 4DXWA 2A9HA 3K0GA 4TWKA 3SJQC 4G28B 2W0FC 3K04A 1QLEC 4MVRA 4LP8A 4WFEA 2WLKA 3ZJZA 4WFFA 3ABKC 2EINC 3T4DA 2WLNA 4MW8A 1G4YB 5B1AC 1R3LC 2HJFC 3E8FA 3PJSK 4P2ZA 3BEHA 3OUSA 3X2QC 2HFEC 4MSWC 4MVOA 2Q68A 5EBMC 3JYCA 5EBLC 3SYCA 4WFGA 2Q67A 4XDLA 4JTAB 2WLLB 2DWDC 4MVUA 3E8HA 2OCCC 3OR6C 3IFXA 2ITCC 3ABLC 1R3JC 3EFFK 2WLJA 3LNMB 3AG1C 1KKDA 3E89A 4PA3A 3ZRSA 1LNQA 2Q6AA 2EILC 4P9OA 4UUJC 1V54C 2JK5C 3AG2C 1OCOC 2P7TC 1S5HC 4P30A 3T2MA 3WG7C 5EC1C 4R50A 4H37A 4P9PA 3AG4C 2Q69A 3GB7C 5KUMA 3STZC 1R3IC 3K03A 4KFMA 2X6BA 1BL8A 4XDKA 2WLIA 5CBGA 1ZWIC 2X6CA 4R6ZA 3SYAA 3FB5C 4J9ZB 2HVKC 2KB1A 4MTOA 1M57C 4MVQA 3SPJA 3SYOA 4LBEC 1ORQC 4EKWA 3UKMA 3SYPA 1OCZC 2ATKC 3LDDA 2ZD9A 3VOUA 2Y69C 2A0LA 4PDVA 3FB7C 2IH3C 1OCCC 3ABMC 4F4LA 2DWEC 4MVSA 4JTDB 5EK0A 3TETA 4BW5A 2DYSC 5J9PC 2HG5C 2WLHA 5KUKA 2HVJC 2WLLA 3T1CA 1K4DC 3LUTB 1V55C 3F5WC 4PA9A 4X8AA 3TCUA 2YEVA 1M56C 4MVZA 3ASOC 4PA6A 4PDRA 3LDEA 2AHZA 5EBWC 3SPGA 4PA7A 3LDCA 1P7BA 4OXSA 3SPIA 5BZBA 3K06A 4HZ3A 4R7CA 2X6AA 1J95A 1OCRC 3HPLC 3T4ZA 2H8PC 4G27B 4H33A
chains in the Genus database with same CATH superfamily
1VF6C 5LMNO 1ZL8B 3G6BA 3DTUB 4UV9A 2IJJA 4PELA 4B7KA 4LFBO 4J80A 5J2TA 5EIBC 4WF9V 2IJKA 2PY5A 1M4UA 2P67A 5BR8B 4DV7B 3CC4V 1K5QA 4NXMO 4DR7O 4B3MO 4JI7B 3JATA 3F7VC 3WB2A 1Q7YW 1QVFU 1HW7A 4OPHA 3ZN0A 4X1YA 5KA5A 5IWAO 4TV9B 4FM0A 5HFMA 5JCOA 1VIBA 2A06H 3AG3B 3ZN1A 4DR1B 4PI0A 4K8XA 2DE0X 2GTSA 4L87A 4YHHB 2WA4A 1XI1A 1WJZA 1X59A 4KUMA 1EZVH 3AG4C 4RQFA 3O65A 4UCUA 2QJ1A 3WG7B 2PGGA 3CP1A 1V54B 2DOSA 3UT5B 1BCCH 2MW2B 4JI5B 4JPRA 4MTOA 4O4JA 3AK2A 4HBNA 4LBEC 2RJZA 3JCZA 1QBZA 5LHGA 2WWWA 2ATKC 2QKCA 1NH2B 4XBFA 4FLWA 2Y69C 1NR1A 4MVSA 1AI5A 2OTJV 3H01A 3AG2B 3VQWA 4IL6Z 5LP6C 4BIUA 3K59A 1HNXO 2IW5A 4PA7A 4YIOA 1EM1A 4ZHQB 2ZNIA 2QR4A 4DR6B 4I4TA 1JVMA 2OIEA 4FPPA 3JARA 4JTCB 2F4VB 4EFBA 2UUAO 2ZXWC 4GX5A 5LA6B 5E1AC 4GX0A 4ZBMA 4K0KB 2B1GA 1XOUA 4UCOA 1QR9A 1IBKB 4DYLA 2BTQB 5KHHA 1GN3A 3CJHA 4DRXB 4TV8A 5JVDA 5IYZB 4KHPB 3E8BA 4TQFA 3WB1A 5JQGA 2XAQA 3CCRV 3ABKC 5L3DA 3IAYA 4O4LB 1N0NA 3E8FA 3ABUA 3PJSK 5B1OA 3AK1A 3RYHB 5BY1A 4BWAA 1WPBA 1L0LH 5EZYB 2EIKB 3ETGA 5EBMC 3TGUH 4XDLA 4X1IB 4LFAO 2YEVB 1QLEB 2KSDA 1YJWV 1O9GA 1OCOC 4DV0O 4NXNO 1EN5A 3L74H 3GWKC 2XAJA 3B4SA 3ZRWB 5IYBO 1NH2D 4LFCO 2DMXA 3WB0A 5EYPA 4DR2O 2YXYA 5EZYA 5IY5B 2X0LA 2ZE8A 4F6EA 1R73A 4EKWA 1JMKC 2E74B 3CCSV 1R6NA 1S3JA 3L75H 1K73W 1M9NA 4X66B 1ENVA 2ZD9A 3JAMN 2PUSA 1FJGO 2HKOA 1KYOF 1VF7A 1PL0A 2A0LA 3EVKA 1OCCC 5BXZA 4LF9O 2Q7EA 4DV5O 2JEUA 1BMFG 5J9PC 4ZKIA 3CRAA 2FB5A 3CD6V 5LMUO 4RWUA 3AEIA 1G6UA 3SPIA 2P4KA 4YY3B 1SQBH 3ASNB 3ZHUA 1TA8A 1D5AA 3D3IA 4CH3A 2W6JG 1Q3EA 5BMVB 4BW9A 1H38A 1K33A 5LHIA 2ZR3A 2Q9LA 2LP7A 3CJHB 3UT5A 2P06A 2N05A 1ZL8A 1WA8A 1Y67A 4X20B 5DM6V 4B3SO 5LGUA 4DV6O 3K79A 4YJ2B 4LF4B 1GM8A 4TUYB 1BGYH 5A9GA 4FLTA 3LSUA 4N23A 3LNNA 1ZLZA 2DQ3A 4G28B 3BRCA 1WP7A 1VQLV 5KAFZ 4WFEA 4YJ3A 1H8HG 2ZT9B 3ZX6A 2JVDA 5IDJA 1G4YB 3P32A 2HJFC 4GKJB 2HEPA 3B8NA 1RFYA 3B09A 4I4TB 5B1NA 1I08A 1QNMA 3CX5F 4CH4A 4RQEA 4GKJO 3H1HH 4Q20A 1Q90D 2DJVA 1ZSPA 2UXNA 4FMTA 5D5PA 1Y4MA 4GKKO 4O4IB 1D2DA 1Y66A 2YICA 3G71V 2P4VA 1LR1A 4DV1B 3ML0A 4IT5A 4LF4O 2EJRA 1TUBB 4TV8B 5JVDB 4UCVA 3A0HZ 2OCHA 5L3CA 1VQ9V 4FZ1A 3RYCB 1I5YA 1JJOA 1K4DC 2YXLA 4J7ZA 4PDRA 3KZIZ 4X64B 1XREA 2AZ0A 4MT8A 4E2LA 4DUYB 4JYAO 2UUBO 1OCRC 2LW7A 3T4ZA 1KU9A 2H8PC 2PZSA 4PI2A 1FXHA 4YY3O 4DV3O 4GLXA 3SYQA 4I0XB 2EBOA 3F7YC 3JCUZ 4JI6O 1VF6A 1N33B 4L8JA 5KHJA 1HR0B 1FXKA 3FB6C 2EIMC 2BCCH 2RCVA 4BIOA 1KP2A 3N2GA 4K0KO 2JDIG 4DO2A 3CCMV 5CA1A 3APQA 3UM7A 4LH7A 2IM9A 2DW4A 4FM2A 3IC7A 5KHIA 3CB2A 4X89A 3GWOA 2CTWA 4TWKA 3SJQC 1XHXA 4U3FH 3WFVA 4ICGA 3G67A 1W2BU 4DV0B 3DGEA 4YIPA 2ADQB 4MVOA 3E2EA 5LXTA 2QM7A 3CYOA 2JGUA 4J11A 3IFXA 2IJIA 1WB8A 2O57A 1EZJA 3ABLC 4JV5O 2EULA 2ZCEA 3KKYA 3LSSA 3SJAC 4JYYA 1WLEA 2Y0IA 2M7WA 3RYHA 1BHBA 4AQYB 3U11A 4R50A 1TAEA 3STZC 4H37A 4PV1B 1JPXA 3JAWA 1RM1C 4DR3O 1RPRA 1XQ8A 3K5OA 3A8TA 2X6BA 4XDKA 1OCCB 1DF5A 2AW9A 3RGBA 4YJ2A 4JI5O 1VQ7V 4IGGA 3CRMA 1AP6A 3UO3A 3E22B 1QVGU 1GH6A 1SQQH 4LFAB 2CTPA 3VOUA 4UVAA 1CEZA 1SA0B 3QO7A 2DYSC 3W7UA 2WLHA 1JX9A 2PYLA 5L3EA 4BIZA 2Y4TA 3BVOA 4PHZA 1GKFA 4R7CA 2X6AA 4J42A 1K97A 2EINB 2QKSA 5LHHA 5IT9N 4IYHA 1TGOA 1M93A 1IBKO 1KBHA 1NS1A 3FB8C 1UPGA 5CBHA 2F23A 5F2VO 3Q4HB 4RUFA 4O4IA 4HAMA 3ZS8C 1KMIZ 3CC2V 3VQYA 1Z2GA 1F51A 2UUCB 1S0VA 4DUZO 4ZOLA 1U97A 1IXBA 3C3SA 4UCTA 3RVYA 2A9HA 3N2KA 4X20A 3RYCA 3BCCH 2VQEO 3LSQA 1QLEC 2WLKA 1ZAUA 4K35A 1VP7A 2Q73A 4O2BB 1GN6A 2ODMA 4I9QA 1HNZO 1QU7A 3DC6A 1SQXH 3JAWB 5DN6G 1V55B 2PI5A 2N74A 3AG1C 2Q6AA 1CXZB 2EILC 5IE9A 4X1KB 3AG2C 4U7OA 5CMUA 3QF7A 4EB6A 1YJ9V 3JAKA 3CCLV 1HWYA 4X62O 1FXKC 4X62B 1VQ5V 1I5XA 1VARA 4ASUG 4D6TH 3SYPA 3JD4A 3RWRD 2V4DA 1IBMO 1OCZC 2UXDB 2YXHA 2CTRA 1I7FA 4B3RB 3ZIAG 3ZRXA 3ABMC 3IC9A 3OMIB 1XEQA 5LYJB 4LFBB 1QR8A 1B3QA 1B6QA 1K3EA 1XILA 1L8DA 2QEXV 1EN4A 3F5WC 4I7ZB 1YSCA 3G80A 1WP8A 3ASOC 5IYZA 3M99B 1GMGA 1N36B 1XBLA 2GV9A 1P84F 1X4TA 4OXSA 5BZBA 1XDCA 3JALB 5CB4A 3KG2A 4B3MB 1L0NH 4FLYA 4X65O 4FJCC 2VWKA 5BR8O 1K7DA 5LL6Y 1URFA 3ZBHA 4BR6A 1WAZA 4CS2A 3ASNC 3FFQA 1ZX3A 5JJEB 4MTFA 1NU1H 2QKAA 4HNAA 4X88A 3JALA 3SJCC 4OX9B 2K9PA 3K08A 4DV2O 2EIJC 3RN4A 3E86A 1GM7A 4J7JA 4GCZA 3K0GA 1SRYA 1BE3H 3K04A 3C90A 3K5LA 4DUZB 4QGPA 1G8MA 3OEHG 2ZIOA 2IU3A 2HR3A 1DLBA 4GUNA 3W7TA 3VQVA 5LGTA 2D2CB 2LJ2A 2R9AA 4DV6B 2F95B 4P9OA 2P7TC 4J10A 1YI2V 1ROPA 1VQPV 1Q5OA 3W7WA 3T1YO 3K9AA 1KUQA 3CPWU 1BL8A 3PN1A 3L71H 5CBGA 4DR3B 4J9ZB 5BMVA 2KB1A 1YXBA 2P5OA 2E75B 1AB3A 4ZOLB 3F5TA 1EBOA 2B9ZA 3UKMA 2XASA 1YIJV 4KL1A 5H5NA 1NKDA 1N0JA 5LOVA 1K9MW 3OFNG 1LUWA 1S72V 3CC7V 1BT8A 4OPAA 1RP3B 3O9OA 2QWPB 4DV5B 5GONA 2VRZA 2QWQB 1WB7A 3T1HO 3BA9A 3K5NA 3BFRA 4CBCA 2H3OA 1PNLA 2CK3G 3CHXA 1E1QG 3HB3B 2IH1C 2ETNA 1RM1B 3CRRA 2JEXA 3CEIA 1NT2B 4JI1B 3FYEB 2ZDIA 4AI8A 3J7AU 2UU9B 3GVMA 1GN2A 1N33O 3BABA 3CWBH 2DYRC 5LP6B 4B08A 2EJ7A 2Z5UA 2BSKB 3HR0A 2A79B 1OHHG 2BOCC 4QJFB 1PPJH 1QLNA 4JI4O 4JAAA 4LP8A 4B3TB 2WLNA 4CC5A 5B1AC 4P2ZA 5A2QN 1S5JA 4O4JB 2LO1A 1H2LA 4UB6Z 5CB4B 2RNBA 4MTXA 2CUGA 2QDOA 5JH7A 4DV2B 4OX9O 3EFFK 1B04A 2Y48A 4E4EA 2RMKB 2LGQA 4DR4O 4UUJC 4LF7B 3CXHF 4I55B 1S76D 2GTAA 1JR9A 2XHBA 2A3QA 4KFMA 2B5UA 1JJ2U 4FFBA 3H1IH 2C2AA 1GTOA 3W7SA 1ORQC 5KMGA 5B1AB 3SJBC 4WBNA 1RPOA 3K58A 2W6IG 5GONB 3UQ8A 2YIBA 4LWSA 2JGDA 1VQKV 2UXBB 1J5EO 2ZINA 3FD9A 1NTMH 2PTMA 4JI8B 3TCUA 1OCZB 4TSFG 2AHZA 1YJNV 4ZI7B 4D7TA 2KG7B 1FFXB 3NR7A 1XL4A 1I94B 4MTGA 4LR3A 5FNVB 1F23A 4AILC 3OE7G 1HDJA 1D5NA 2GHYA 1IBLB 4UVBA 4JI0O 2XT9A 4U3JB 3D3QA 2AGAA 2P22C 4UCRA 1YTFB 2NLJC 3TK1A 3K3WA 4RUEA 5E79Z 4MVMA 4QE7A 2Z3YA 3H1LH 3ZMVA 3G6EV 1HNZB 1IBMB 1NJIW 1H2NA 4LF8O 2VQEB 1M5IA 1IZ3A 2YSUB 2YIAA 1BSMA 4WCEV 1MOFA 4B3SB 2WSSG 3P3NA 4Z2WA 1SZXA 4LF5B 1MABG 5EBLC 2LQTA 3SYCA 5TISZ 3ZHTA 5B5EZ 3LNMB 4IIJB 1PV0A 3CCEV 1AI7A 3CRQA 4P9PA 1SESA 1R3IC 3OMNB 2Y0PA 2X6CA 5DECA 2UXBO 3SPJA 5LMUB 4DR5B 3N2KB 4GZRB 1AR4A 1NZ6A 3ZMTA 2GSMB 1GRJA 2DYSB 1OV9A 2CGOA 2ZDIC 1COWG 2XTAA 1JA8A 2HVJC 3U0ZA 3H9VA 5IJ9A 1M56C 3SPGA 2QM8A 4LFCB 4NTXA 5LXTB 3L73H 3EHBB 5JQGB 1B06A 1SS3A 1XMOO 5JH7B 4G27B 4H33A 4DW0A 3HKDB 2N04A 3SPHA 2HLDG 2OT5A 4QPJA 3UCSC 4D7SA 1N8RW 5AG2A 4GX1A 2NN4A 3ABLB 2FYUH 4NYKA 1HNWO 1PP9H 3CS5A 2IBZH 1AVMA 1MZFA 2ZE6A 2ZQMA 2LW1A 3X2QB 1FD9A 4JV5B 1THZA 3ZRWA 1HNWB 2EIKC 2K1EA 2UXCO 3L9DA 2F4VO 3L70H 5KHKA 4XDJA 1AJNA 3CE2A 2CE4A 3NXSA 4DXWA 3OEEG 1EN6A 3D8CA 4CS3A 1G1XB 1SQFA 3T4DA 2QTSA 1F4MA 4YXWG 1VQ6V 4X1KA 1Z5WA 3CCJV 1QCEA 4JAUA 5H6QA 4B7EA 4WFGA 2XAFA 2DWDC 1YHQV 3BPZA 1XUQA 1AI4A 4PA3A 4J41A 1S5HC 2P90A 5DEDA 4FM1A 2HHHO 3OGIB 2DN9A 2WLIA 2ZE7A 4O2AB 3OM3B 4JZGA 1GM9A 3FB5C 1O9HA 1H2SB 3OTOO 4FLVA 4DV3B 1GAXA 3JATB 3LDDA 4YJ3B 2FL4A 3B2EE 1FPOA 2LFSA 2DQ0A 3KCXA 4JTDB 3ZMUA 3TJTA 3E22A 1AILA 4MVZA 2WPDG 4LWSB 1P7BA 3FYIB 4HZ3A 4CH6A 4F6RB 1JCHA 3K0DA 2AHYA 1I94O 1H2MA 3OUFA 5IYCO 3ZMZA 4ZI7A 2BE3A 4GKKB 4CH5A 2CTQA 4J9YB 3BA8A 4JI8O 2BOBC 3ZCCA 5CN0A 3OGCC 4UVCA 3THOA 2XUMA 3OD4A 3STLC 1Y74B 1XL6A 3E83A 1R3KC 4U7NA 4ZIBA 3D36C 4I50A 4PDLA 3AG3C 1KC8W 1WN7A 5JWPA 2QWNB 4DV1O 1PM9A 3ZJZA 4DR7B 4DK0A 4DV7O 2E3CA 3HKBA 1NTKH 3BEHA 4LNUB 2QWOB 2Q67A 4JTAB 4MVUA 1IURA 2YIDA 1R3JC 3QVNA 3E89A 1H2GA 2ZM6O 4H44B 2E76B 1N36O 1DK1A 1MSDA 2BTOA 4JAVA 5LBQA 1K8AW 3FAVB 2F1MA 3M8AA 3SR2C 4QIWF 1IVSA 2NR5A 3QG5A 4CC6A 4WFBV 4NR1A 1FFTB 3DSQA 1FFXA 4FVMA 4AHCA 3IJ4A 1R6KA 4FZ0A 1Y6XA 2IH3C 1N32B 2EILB 1JQ0A 3JSLA 1KD1W 4LC1A 5KX5A 1VF5B 1JOYA 2OYQA 4X66O 1K34A 2FTKA 4NB5A 2LFRA 3ZRVA 4HYOA 2ITDC 5CA0B 1MMMA 4FFBB 5GTHZ 3ZHRA 1YZBA 3RBZA 2D3OW 2V1DA 4Q6GA 1KB9F 5EC2C 3ZMSA 4Z1MG 1J5EB 1MZEA 2NNUA 3B40A 4MS2A 4QE9A 4K3AA 1XNQO 5C93A 2OCCB 2HHHB 1OJHA 3K9SA 2WA3A 2G38A 1VQOV 4FK5C 2RQ6A 5LOVB 3OR7C 1BS3A 1QQCA 2UXCB 3ICXA 4QNHB 2UUCO 1AJQA 3JASB 3K5MA 2JJ1G 3HKEB 2KG7A 4X9QA 5IYDO 1U96A 4WFFA 2EINC 5B66Z 4LF7O 1S77D 5EIBD 3VBBA 1NVPD 2VWJA 2EIJB 2RN9A 3E8HA 4OGQB 4F6RA 4UFZA 2CH7B 1Q6UA 2YS8A 3OMAB 1VQ8V 3K57A 3P3PA 2Q69A 1Q81W 4FFKA 1L1FA 2Q8VA 1IX9A 2YI8A 3SYAA 2HVKC 4EFEA 5KHGA 1Q82W 1AR1B 1AR5A 3WU2Z 1VMGA 3QO8A 3CCQV 4G2KA 3CMEV 1TUEB 4U3JA 4UCSA 3U10A 3RYFB 1XMQB 4FLZA 4DK1A 4FLUA 2ZM6B 4UB8Z 4H13B 3LUTB 3ABMB 3EXAA 2JIZG 5KLVH 3AG1B 1VQNV 4IIJA 3LDCA 1NBMG 2F93B 1E1RG 3ASOB 2UUAB 1Z5VA 5JJJB 4O2BA 4GX2A 2VS0A 3TXQA 4PDMA 2WLMA 3J81N 4LF5O 1BQ0A 2YIBD 1PNMA 4Z1VA 1TVKA 2F66C 3E8GA 2ZR2A 4JZ2A 3G4SV 1K92A 2ZIMA 1QHTA 3CRCA 2E5LB 3MHHC 2EIMB 3R65A 2JS3A 3OT7A 4JI2B 3AK3A 3HKCA 5J2UB 3CCUV 1HP8A 5LP6A 5KX5B 1FS0G 2ILMA 3ETEA 3HKDA 1SZTA 3OUSA 2EZOA 1M57B 3RT3C 4FLXA 5FPRA 1NR7A 5IJ9B 4JI7O 4JGSA 1KQSU 2JJ2G 2JK5C 3HKBB 5IJ0B 3T2MA 4YHHO 3DXRA 5KA6A 4JI2O 2RDCA 2ZE5A 5KUMA 1V9PA 2XOKG 4B3RO 3K03A 1VQMV 1ZWIC 4R6ZA 2R9IA 1P4RA 1M57C 3N27A 4MVQA 4DW1A 1Q43A 4JI0B 3ABTA 1IBLO 1VEWA 5IWAB 3OTFA 5LMNB 1NI8A 1T5EA 1WA8B 4HNAB 2Y4UA 4PDVA 5KAIZ 1FJGB 4F4LA 1R1BA 3C3TA 4JF3A 5KMGB 3TXSA 2PF4E 2HG5C 3JSNA 3T1CA 4JI3O 1JFFA 3FX7A 3K06A 3AG7A 1MA1A 3FKSG 2WAMA 4TQDA 1XMQO 2WLIB 4C7UA 2Q7HA 4O2AA 3MDSA 3I5DA 5CBFA 2Z0AA 2BTQA 2JS5A 4IHJA 1US6A 4B3TO 4RAIA 4H0LB 5B1BC 3RVZA 1KKCA 3JD2A 4JI4B 1Q6IA 2V7QG 1KP3A 1Y76A 4RO2A 2UXDO 2IJHA 3ZHQA 4DR4B 2VQFO 2Q5ZA 2H94A 1SERA 4X1IA 1TUBA 1MNGA 1BZKA 1UFIA 4WFAV 4UV8A 1N34B 2Q68A 2QSAA 1W0KG 2IU0A 3MD0A 2WLLB 1SETA 5EYPB 2LGWA 5D5QA 1YF2A 3SDLA 1AROP 1F7YA 3GB7C 1FYJA 4IYIA 2KKWA 4JYBA 1OCOB 1Y74A 5L3GA 4DR5O 2JRIA 5L3BA 1AI6A 1F4NA 5H6RA 1AJPA 4JI1O 2QA4V 1SC5B 1GO3F 3QNEA 1JFFB 5CA0A 4AQYO 2Q0OC 2YDEA 1ZUQA 3SGIA 1N34O 5HFLA 1SQVH 4ABMA 4EEQA 2KQXA 5K1PA 4X1YB 5EBWC 1RSOA 3RYFA 3KCYA 2VQFB 3P30A 1WNSA 3HPLC 3ETDA 1YCIA 1I0HA 5B3SC 3R66A 3MAQA 2P6JA 3H1KH 5IJ0A 3JASA 3IGAC 3DXRB 2L35A 3HKEA 2GDSA 1K4CC 3DC5A 3ETQA 1YTFD 5ITZB 3JARB 2M6YA 3A0RA 5L3FA 3ZHSA 2JGDB 3T1YB 4KHPO 4W4LA 3B8MA 1XNRB 5C8YA 5CA3A 1ZTEA 4KP4A 3RFRA 3RYIA 2EZPA 2ZKOA 1UJWB 5LYJA 4WBNB 4MVRA 1CPYA 4TOIA 5ITZA 1MSWD 2QM4A 2Y69B 2Q0AA 4MW8A 4K8ZA 4I5SA 4DUYO 4JYAB 3HKCB 4X65B 1SA0A 3X2QC 1DGSA 5JJNB 2HFEC 5FL7G 4X64O 1R6TA 2XNDG 2YC0A 3QTCA 4FIPC 1LNQA 4DR6O 1V54C 1GK9A 3WG7C 5EC1C 2XAHA 1SQGA 1W0JG 3APOA 5FPOA 1N4CA 2QGNA 4DV4O 3SYOA 3H1JH 1Y76B 2R70A 1IDSA 2L6LA 4W4KA 3OW2U 1M56B 2Q4PA 2BSKA 3VQXA 4LF6O 4TUYA 4LH6A 2GBOA 1NQTA 2AZ2A 4PJ0Z 5H9CA 4DRXA 2YEVA 3LDEA 3W7XA 2R72A 2OTLV 4LF6B 5LGNA 1OCRB 2PI4A 5IY5C 3N2GB 4O4HB 2QTOA 3D36A 4DR1O 5CA1B 2E5LO 2Q7GA 2CH7A 3OTOB 4JASA 2DYRB 3RYIB 3UO2A 4ZHQA 3S3WA 3QO5A 4LF9B 2OIGA 4PA4A 1Q86W 1WPXA 1SKVA 3RW0A 2MK3A 5FNVA 4NXMB 2PYJA 4I9WA 1FXVA 3ABKB 3J80N 2AXTZ 3CXCU 2GUZB 2ZXWB 1OZ0A 3M7MX 4DV4B 3I55V 1H8EG 1E79G 1Q6HA 4I50B 1W59A 2F43G 4NKGB 1XNRO 4NXNB 1TVKB 2EX3A 3OR6C 4TT3G 2WLJA 1KKDA 3ZRSA 2YUAA 2HP8A 3B77A 2CDYA 5B3SB 3E35A 3BY6A 1Q8IA 3L72H 4DR2B 2UXXA 5FLXN 3FAVA 5K1XA 4GYCB 5C8YB 2QE7G 1YITV 1NVPB 1DTOA 2YI9A 4N21A 4TV9A 3JD3A 2ARHA 3TETA 4J7KA 3A2FA 4NTYA 4GT1A 4BW5A 4X8AA 5J2UA 4KXRA 4UXNA 4O4HA 3OAAG 1M1KW 3T1HB 2XAGA 5H2FZ 1H2KA 2A7WA 2CGNA 1FKAO 1K5SA 2R9RB 3Q4HA 1PNKA 1P7GA 4LCUC 3BAAA 1LUVA 1IXMA 2X7RB 4CZZA 1SF9A 2CAZC 1YDXA 1BHAA 5GW7A 2UU9O 1PL4A 1GN4A 3S3XA 1PKXA 2FKXA 4I0XA 1FAFA 3SPCA 4R8CA 1BQZA 5GTIZ 4MW3A 4PD4F 4O4LA 1NTZH 3AG4B 4WFHA 2ZNJA 1M90W 3I56V 5JCOC 1S5LZ 4NVPA 2W0FC 3BHPA 1SQPH 1A32A 1R3LC 1XNQB 4EB6B 4MSWC 1HNXB 3JAKB 3JYCA 4LF8B 1N32O 1YVWA 5B1BB 2OCCC 2ITCC 2HJDA 4BAYA 1YEWA 1DF4A 4NTWA 4P30A 3MHSC 5LA6A 3A0BZ 3CCVV 1KECA 1P49A 1EFRG 3ZHVA 2OWOA 4JYCA 1RSOB 1HR0O 2B1IA 3JD0A 1FXKB 4JI6B 1PD3A 1XHZA 1XMOB 4CS4A 3FB7C 1VQ4V 1AP5A 4JI3B 2ADPA 2DWEC 4LNUA 2GUZA 5EK0A 2W0XA 5KUKA 4A5UB 2UUBB 2WLLA 2FMLA 1V55C 4PA9A 3CMAV 5J2TB 4PA6A 1CP9A 4QPKA 3JD1A 4IHJB 4I55A 1J95A 1MG1A 3ZEDA 3CSXA 2QWRB
chains in the Genus database with same CATH topology
1K97A 2EINB 2QKSA 5LHHA 2WAMA 3SPHA 2HLDG 2WLIB 3DTUB 4UV9A 2OT5A 2IJJA 4QPJA 4PELA 5CBFA 1N8RW 4GX1A 3FB8C 4RAIA 3ABLB 5CBHA 4WF9V 2IJKA 4RUFA 5B1BC 3RVZA 4HAMA 3JD2A 2P67A 3CC2V 2ZQMA 3CC4V 2V7QG 1K5QA 1F51A 1KP3A 3X2QB 4RO2A 1S0VA 1THZA 3ZRWA 2EIKC 2K1EA 2IJHA 3F7VC 1Q7YW 4XDJA 3RVYA 1QVFU 3ZN0A 1AJNA 3NXSA 4DXWA 3OEEG 2A9HA 5KA5A 2H94A 1SERA 3LSQA 1QLEC 5HFMA 2WLKA 3T4DA 3AG3B 1F4MA 4YXWG 3ZN1A 4WFAV 1VQ6V 4UV8A 3CCJV 1QCEA 4JAUA 2Q68A 1W0KG 5H6QA 2IU0A 3MD0A 4L87A 4WFGA 2XAFA 2WLLB 2DWDC 1YHQV 1SETA 5DN6G 1V55B 2PI5A 3AG1C 1AI4A 4PA3A 2Q6AA 2EILC 3AG2C 4U7OA 1S5HC 5CMUA 1AROP 2P90A 1YJ9V 4KUMA 3AG4C 3GB7C 1HWYA 3CCLV 4RQFA 4JYBA 3WG7B 1OCOB 3CP1A 1V54B 2WLIA 1FXKC 3OM3B 5L3GA 1VQ5V 1GM9A 3FB5C 4JPRA 4MTOA 5L3BA 1AI6A 1F4NA 5H6RA 4LBEC 3JCZA 1I5XA 1QBZA 1AJPA 4ASUG 3SYPA 3JD4A 1OCZC 2QA4V 5LHGA 2WWWA 2ATKC 1NH2B 4XBFA 3LDDA 1GO3F 3QNEA 3ZIAG 2Y69C 3ZRXA 1NR1A 3ABMC 2LFSA 3OMIB 2DQ0A 4MVSA 1QR8A 1AI5A 4JTDB 3ZMUA 5HFLA 2OTJV 1B6QA 1K3EA 2QEXV 3H01A 3AG2B 3F5WC 1YSCA 4MVZA 3ASOC 3M99B 1GMGA 4BIUA 2IW5A 5EBWC 4PA7A 4OXSA 1P7BA 3FYIB 5BZBA 4HZ3A 3P30A 3HPLC 3ETDA 1JCHA 1JVMA 3KG2A 5B3SC 4FPPA 4JTCB 2P6JA 3K0DA 2AHYA 3OUFA 5IYCO 3ZMZA 2ZXWC 4GX5A 3IGAC 4FJCC 1K7DA 1K4CC 5E1AC 1YTFD 3ASNC 4J9YB 4GX0A 4MTFA 4ZBMA 3A0RA 2B1GA 5L3FA 2BOBC 4X88A 3ZCCA 5CN0A 3OGCC 1QR9A 3B8MA 4UVCA 3K08A 2EIJC 3E86A 1GM7A 3STLC 1XL6A 3E83A 1R3KC 4U7NA 5CA3A 3E8BA 3AG3C 4GCZA 4PDLA 4KP4A 1KC8W 2EZPA 3K0GA 1UJWB 1SRYA 2XAQA 3K04A 3CCRV 4MVRA 1CPYA 3ZJZA 1MSWD 3ABKC 5L3DA 1G8MA 3OEHG 2Y69B 4MW8A 4I5SA 3E8FA 3ABUA 3PJSK 5B1OA 3BEHA 3X2QC 2HFEC 5FL7G 2EIKB 3ETGA 5EBMC 2IU3A 2Q67A 4XDLA 2HR3A 1DLBA 2XNDG 4JTAB 4MVUA 3W7TA 2YEVB 1R3JC 5LGTA 1QLEB 1YJWV 4FIPC 3E89A 1LNQA 4P9OA 1H2GA 1V54C 1OCOC 2P7TC 1GK9A 3WG7C 1YI2V 1ROPA 5EC1C 2XAHA 1VQPV 3W7WA 2XAJA 4JAVA 5LBQA 1K8AW 1W0JG 3K9AA 3ZRWB 5IYBO 3CPWU 1BL8A 4QIWF 1NH2D 5CBGA 4J9ZB 2KB1A 5IY5B 3SYOA 2X0LA 4WFBV 1R73A 4EKWA 1EBOA 3UKMA 1FFTB 3CCSV 2XASA 3OW2U 1R6NA 1S3JA 1M56B 1YIJV 1K73W 1NKDA 1M9NA 1R6KA 1ENVA 1K9MW 2ZD9A 3OFNG 2HKOA 1NQTA 1PL0A 2A0LA 2IH3C 1OCCC 3CC7V 1S72V 2EILB 2JEUA 1BMFG 1JQ0A 5J9PC 1KD1W 4ZKIA 5H9CA 4LC1A 2YEVA 3CD6V 3LDEA 3W7XA 3AEIA 2OTLV 3SPIA 1JOYA 5LGNA 1OCRB 2PI4A 2FTKA 3ASNB 1K34A 2LFRA 4CBCA 5IY5C 3ZRVA 4HYOA 3D3IA 1PNLA 2CK3G 2ITDC 2W6JG 1E1QG 2QTOA 3D36A 3HB3B 2IH1C 1H38A 1RM1B 1K33A 5LHIA 3RBZA 2D3OW 2JEXA 2V1DA 2ZR3A 5EC2C 3ZMSA 4Z1MG 2LP7A 3FYEB 4JASA 2ZDIA 2NNUA 4MS2A 2DYRB 4QE9A 5DM6V 5C93A 5LGUA 2OCCB 3K79A 3QO5A 2DYRC 1VQOV 4PA4A 4FK5C 1Q86W 1GM8A 1WPXA 3OR7C 3RW0A 2MK3A 2Z5UA 4QNHB 2A79B 1AJQA 1OHHG 2BOCC 4QJFB 4I9WA 1FXVA 3ABKB 4N23A 1QLNA 2JJ1G 3CXCU 2DQ3A 4G28B 5IYDO 1VQLV 4LP8A 4WFEA 2ZXWB 1H8HG 1OZ0A 4WFFA 2EINC 2WLNA 5IDJA 3I55V 1S77D 1G4YB 3P32A 1H8EG 2HJFC 5B1AC 3VBBA 4P2ZA 1E79G 3B8NA 1NVPD 2F43G 2EIJB 4MTXA 3E8HA 3OR6C 5B1NA 3EFFK 4TT3G 2WLJA 4RQEA 2Y48A 1KKDA 3ZRSA 3OMAB 4Q20A 4UUJC 3B77A 1VQ8V 2UXNA 4FMTA 1S76D 2Q69A 1Y4MA 1Q81W 4KFMA 5B3SB 1L1FA 2B5UA 3E35A 1JJ2U 1Y66A 3BY6A 3SYAA 3G71V 2C2AA 2HVKC 1GTOA 3W7SA 1ORQC 1Q82W 2UXXA 1AR1B 3ML0A 5B1AB 3QO8A 3CCQV 1RPOA 2EJRA 4G2KA 3CMEV 1TUEB 2QE7G 1YITV 5L3CA 2W6IG 1NVPB 1VQ9V 1DTOA 4N21A 1VQKV 1I5YA 3JD3A 3TETA 4BW5A 4GT1A 1K4DC 3LUTB 3ABMB 4X8AA 3TCUA 1OCZB 2JIZG 4PDRA 4TSFG 4UXNA 3AG1B 2AHZA 3OAAG 1VQNV 1YJNV 1M1KW 3LDCA 4MT8A 4E2LA 1NBMG 1E1RG 2XAGA 1OCRC 3ASOB 3T4ZA 2H8PC 1FXHA 1XL4A 1K5SA 2R9RB 4MTGA 1PNKA 4GX2A 3SYQA 4PDMA 4LCUC 1F23A 2EBOA 2WLMA 3F7YC 1IXMA 3OE7G 2X7RB 4CZZA 1PNMA 2GHYA 3E8GA 2ZR2A 1BHAA 4UVBA 5GW7A 3G4SV 1FXKA 1K92A 3FB6C 2EIMC 1PKXA 3SPCA 1KP2A 1YTFB 2JDIG 2NLJC 4R8CA 3TK1A 4DO2A 3CCMV 3MHHC 2EIMB 3R65A 3K3WA 4RUEA 4MW3A 3UM7A 4MVMA 2DW4A 4QE7A 3CCUV 3AG4B 2Z3YA 3ZMVA 4WFHA 3IC7A 3G6EV 1M90W 3I56V 4X89A 3GWOA 4TWKA 3SJQC 1NJIW 2W0FC 3WFVA 2YSUB 1W2BU 4WCEV 1MOFA 1FS0G 3DGEA 3ETEA 1R3LC 1SZTA 2WSSG 3OUSA 4MSWC 2EZOA 4MVOA 1M57B 3E2EA 2QM7A 3JYCA 1MABG 3CYOA 5EBLC 3SYCA 5B1BB 1NR7A 2OCCC 3IFXA 2IJIA 2ITCC 1EZJA 3ABLC 4BAYA 4JGSA 3LNMB 1KQSU 2JJ2G 1DF4A 3LSSA 2JK5C 1WLEA 2M7WA 3T2MA 4P30A 3MHSC 1BHBA 3CCEV 5KA6A 3CCVV 1AI7A 4R50A 4H37A 4P9PA 5KUMA 3STZC 2XOKG 1JPXA 1SESA 1KECA 1R3IC 3K03A 3OMNB 1RPRA 1EFRG 1RM1C 2X6BA 4XDKA 1OCCB 1VQMV 1DF5A 1ZWIC 2X6CA 4R6ZA 2R9IA 1P4RA 1M57C 4JYCA 4MVQA 3SPJA 1VQ7V 2B1IA 3ABTA 3JD0A 1FXKB 1PD3A 3ZMTA 1QVGU 2GSMB 2DYSB 3VOUA 4PDVA 3FB7C 4UVAA 1VQ4V 1CEZA 2ZDIC 3QO7A 4F4LA 4JF3A 2DWEC 5EK0A 1COWG 5KUKA 2DYSC 2HG5C 2WLHA 3W7UA 2HVJC 2WLLA 1JX9A 3T1CA 1V55C 4PA9A 3CMAV 1M56C 5L3EA 4PA6A 1CP9A 4QPKA 3SPGA 4BIZA 3JD1A 2QM8A 1GKFA 3EHBB 3K06A 4R7CA 2X6AA 1J95A 1MG1A 3FKSG 2WPDG 4G27B 4H33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKS A;  1JVM A;  1XL4 A;  2R9R B;  3KG2 A;  4CBC A;  5B3S C;  4JTC B;  4MTG A;  5IY5 C;  4GX2 A;  4HYO A;  2ITD C;  3K0D A;  3SPH A;  3SYQ A;  2WLI B;  2AHY A;  4LCU C;  4PDM A;  2WLM A;  3F7Y C;  3OUF A;  2QTO A;  2IH1 C;  2ZXW C;  5CBF A;  4GX5 A;  3RBZ A;  3IGA C;  4GX1 A;  3E8G A;  3FB8 C;  5EC2 C;  1K4C C;  4RAI A;  5E1A C;  5CBH A;  3FB6 C;  3ASN C;  4J9Y B;  4RUF A;  4GX0 A;  5B1B C;  4MTF A;  4MS2 A;  2EIM C;  4ZBM A;  3RVZ A;  2BOB C;  4QE9 A;  3SPC A;  4X88 A;  2NLJ C;  3OGC C;  4R8C A;  4RO2 A;  2DYR C;  3R65 A;  3K08 A;  4RUE A;  2EIJ C;  4MW3 A;  4PA4 A;  2EIK C;  2K1E A;  3UM7 A;  3F7V C;  3E86 A;  3OR7 C;  4MVM A;  3RW0 A;  3STL C;  4XDJ A;  4QE7 A;  3RVY A;  1XL6 A;  3E83 A;  4QNH B;  1R3K C;  4WFH A;  2A79 B;  2BOC C;  3AG3 C;  3E8B A;  4PDL A;  4I9W A;  4X89 A;  4DXW A;  2A9H A;  3K0G A;  4TWK A;  3SJQ C;  4G28 B;  2W0F C;  3K04 A;  1QLE C;  4MVR A;  4LP8 A;  4WFE A;  2WLK A;  3ZJZ A;  4WFF A;  3ABK C;  2EIN C;  3T4D A;  2WLN A;  4MW8 A;  1G4Y B;  5B1A C;  1R3L C;  2HJF C;  3E8F A;  3PJS K;  4P2Z A;  3BEH A;  3OUS A;  3X2Q C;  2HFE C;  4MSW C;  4MVO A;  2Q68 A;  5EBM C;  3JYC A;  5EBL C;  3SYC A;  4WFG A;  2Q67 A;  4XDL A;  4JTA B;  2WLL B;  2DWD C;  4MVU A;  3E8H A;  2OCC C;  3OR6 C;  3IFX A;  2ITC C;  3ABL C;  1R3J C;  3EFF K;  2WLJ A;  3LNM B;  3AG1 C;  1KKD A;  3E89 A;  4PA3 A;  3ZRS A;  1LNQ A;  2Q6A A;  2EIL C;  4P9O A;  4UUJ C;  1V54 C;  2JK5 C;  3AG2 C;  1OCO C;  2P7T C;  1S5H C;  4P30 A;  3T2M A;  3WG7 C;  5EC1 C;  4R50 A;  4H37 A;  4P9P A;  3AG4 C;  2Q69 A;  3GB7 C;  5KUM A;  3STZ C;  1R3I C;  3K03 A;  4KFM A;  2X6B A;  1BL8 A;  4XDK A;  2WLI A;  5CBG A;  1ZWI C;  2X6C A;  4R6Z A;  3SYA A;  3FB5 C;  4J9Z B;  2HVK C;  2KB1 A;  4MTO A;  1M57 C;  4MVQ A;  3SPJ A;  3SYO A;  4LBE C;  1ORQ C;  4EKW A;  3UKM A;  3SYP A;  1OCZ C;  2ATK C;  3LDD A;  2ZD9 A;  3VOU A;  2Y69 C;  2A0L A;  4PDV A;  3FB7 C;  2IH3 C;  1OCC C;  3ABM C;  4F4L A;  2DWE C;  4MVS A;  4JTD B;  5EK0 A;  3TET A;  4BW5 A;  2DYS C;  5J9P C;  2HG5 C;  2WLH A;  5KUK A;  2HVJ C;  2WLL A;  3T1C A;  1K4D C;  3LUT B;  1V55 C;  3F5W C;  4PA9 A;  4X8A A;  3TCU A;  2YEV A;  1M56 C;  4MVZ A;  3ASO C;  4PA6 A;  4PDR A;  3LDE A;  2AHZ A;  5EBW C;  3SPG A;  4PA7 A;  3LDC A;  1P7B A;  4OXS A;  3SPI A;  5BZB A;  3K06 A;  4HZ3 A;  4R7C A;  2X6A A;  1J95 A;  1OCR C;  3HPL C;  3T4Z A;  2H8P C;  4G27 B;  4H33 A; 
#chains in the Genus database with same CATH topology
 1VF6 C;  5LMN O;  1ZL8 B;  3G6B A;  3DTU B;  4UV9 A;  2IJJ A;  4PEL A;  4B7K A;  4LFB O;  4J80 A;  5J2T A;  5EIB C;  4WF9 V;  2IJK A;  2PY5 A;  1M4U A;  2P67 A;  5BR8 B;  4DV7 B;  3CC4 V;  1K5Q A;  4NXM O;  4DR7 O;  4B3M O;  4JI7 B;  3JAT A;  3F7V C;  3WB2 A;  1Q7Y W;  1QVF U;  1HW7 A;  4OPH A;  3ZN0 A;  4X1Y A;  5KA5 A;  5IWA O;  4TV9 B;  4FM0 A;  5HFM A;  5JCO A;  1VIB A;  2A06 H;  3AG3 B;  3ZN1 A;  4DR1 B;  4PI0 A;  4K8X A;  2DE0 X;  2GTS A;  4L87 A;  4YHH B;  2WA4 A;  1XI1 A;  1WJZ A;  1X59 A;  4KUM A;  1EZV H;  3AG4 C;  4RQF A;  3O65 A;  4UCU A;  2QJ1 A;  3WG7 B;  2PGG A;  3CP1 A;  1V54 B;  2DOS A;  3UT5 B;  1BCC H;  2MW2 B;  4JI5 B;  4JPR A;  4MTO A;  4O4J A;  3AK2 A;  4HBN A;  4LBE C;  2RJZ A;  3JCZ A;  1QBZ A;  5LHG A;  2WWW A;  2ATK C;  2QKC A;  1NH2 B;  4XBF A;  4FLW A;  2Y69 C;  1NR1 A;  4MVS A;  1AI5 A;  2OTJ V;  3H01 A;  3AG2 B;  3VQW A;  4IL6 Z;  5LP6 C;  4BIU A;  3K59 A;  1HNX O;  2IW5 A;  4PA7 A;  4YIO A;  1EM1 A;  4ZHQ B;  2ZNI A;  2QR4 A;  4DR6 B;  4I4T A;  1JVM A;  2OIE A;  4FPP A;  3JAR A;  4JTC B;  2F4V B;  4EFB A;  2UUA O;  2ZXW C;  4GX5 A;  5LA6 B;  5E1A C;  4GX0 A;  4ZBM A;  4K0K B;  2B1G A;  1XOU A;  4UCO A;  1QR9 A;  1IBK B;  4DYL A;  2BTQ B;  5KHH A;  1GN3 A;  3CJH A;  4DRX B;  4TV8 A;  5JVD A;  5IYZ B;  4KHP B;  3E8B A;  4TQF A;  3WB1 A;  5JQG A;  2XAQ A;  3CCR V;  3ABK C;  5L3D A;  3IAY A;  4O4L B;  1N0N A;  3E8F A;  3ABU A;  3PJS K;  5B1O A;  3AK1 A;  3RYH B;  5BY1 A;  4BWA A;  1WPB A;  1L0L H;  5EZY B;  2EIK B;  3ETG A;  5EBM C;  3TGU H;  4XDL A;  4X1I B;  4LFA O;  2YEV B;  1QLE B;  2KSD A;  1YJW V;  1O9G A;  1OCO C;  4DV0 O;  4NXN O;  1EN5 A;  3L74 H;  3GWK C;  2XAJ A;  3B4S A;  3ZRW B;  5IYB O;  1NH2 D;  4LFC O;  2DMX A;  3WB0 A;  5EYP A;  4DR2 O;  2YXY A;  5EZY A;  5IY5 B;  2X0L A;  2ZE8 A;  4F6E A;  1R73 A;  4EKW A;  1JMK C;  2E74 B;  3CCS V;  1R6N A;  1S3J A;  3L75 H;  1K73 W;  1M9N A;  4X66 B;  1ENV A;  2ZD9 A;  3JAM N;  2PUS A;  1FJG O;  2HKO A;  1KYO F;  1VF7 A;  1PL0 A;  2A0L A;  3EVK A;  1OCC C;  5BXZ A;  4LF9 O;  2Q7E A;  4DV5 O;  2JEU A;  1BMF G;  5J9P C;  4ZKI A;  3CRA A;  2FB5 A;  3CD6 V;  5LMU O;  4RWU A;  3AEI A;  1G6U A;  3SPI A;  2P4K A;  4YY3 B;  1SQB H;  3ASN B;  3ZHU A;  1TA8 A;  1D5A A;  3D3I A;  4CH3 A;  2W6J G;  1Q3E A;  5BMV B;  4BW9 A;  1H38 A;  1K33 A;  5LHI A;  2ZR3 A;  2Q9L A;  2LP7 A;  3CJH B;  3UT5 A;  2P06 A;  2N05 A;  1ZL8 A;  1WA8 A;  1Y67 A;  4X20 B;  5DM6 V;  4B3S O;  5LGU A;  4DV6 O;  3K79 A;  4YJ2 B;  4LF4 B;  1GM8 A;  4TUY B;  1BGY H;  5A9G A;  4FLT A;  3LSU A;  4N23 A;  3LNN A;  1ZLZ A;  2DQ3 A;  4G28 B;  3BRC A;  1WP7 A;  1VQL V;  5KAF Z;  4WFE A;  4YJ3 A;  1H8H G;  2ZT9 B;  3ZX6 A;  2JVD A;  5IDJ A;  1G4Y B;  3P32 A;  2HJF C;  4GKJ B;  2HEP A;  3B8N A;  1RFY A;  3B09 A;  4I4T B;  5B1N A;  1I08 A;  1QNM A;  3CX5 F;  4CH4 A;  4RQE A;  4GKJ O;  3H1H H;  4Q20 A;  1Q90 D;  2DJV A;  1ZSP A;  2UXN A;  4FMT A;  5D5P A;  1Y4M A;  4GKK O;  4O4I B;  1D2D A;  1Y66 A;  2YIC A;  3G71 V;  2P4V A;  1LR1 A;  4DV1 B;  3ML0 A;  4IT5 A;  4LF4 O;  2EJR A;  1TUB B;  4TV8 B;  5JVD B;  4UCV A;  3A0H Z;  2OCH A;  5L3C A;  1VQ9 V;  4FZ1 A;  3RYC B;  1I5Y A;  1JJO A;  1K4D C;  2YXL A;  4J7Z A;  4PDR A;  3KZI Z;  4X64 B;  1XRE A;  2AZ0 A;  4MT8 A;  4E2L A;  4DUY B;  4JYA O;  2UUB O;  1OCR C;  2LW7 A;  3T4Z A;  1KU9 A;  2H8P C;  2PZS A;  4PI2 A;  1FXH A;  4YY3 O;  4DV3 O;  4GLX A;  3SYQ A;  4I0X B;  2EBO A;  3F7Y C;  3JCU Z;  4JI6 O;  1VF6 A;  1N33 B;  4L8J A;  5KHJ A;  1HR0 B;  1FXK A;  3FB6 C;  2EIM C;  2BCC H;  2RCV A;  4BIO A;  1KP2 A;  3N2G A;  4K0K O;  2JDI G;  4DO2 A;  3CCM V;  5CA1 A;  3APQ A;  3UM7 A;  4LH7 A;  2IM9 A;  2DW4 A;  4FM2 A;  3IC7 A;  5KHI A;  3CB2 A;  4X89 A;  3GWO A;  2CTW A;  4TWK A;  3SJQ C;  1XHX A;  4U3F H;  3WFV A;  4ICG A;  3G67 A;  1W2B U;  4DV0 B;  3DGE A;  4YIP A;  2ADQ B;  4MVO A;  3E2E A;  5LXT A;  2QM7 A;  3CYO A;  2JGU A;  4J11 A;  3IFX A;  2IJI A;  1WB8 A;  2O57 A;  1EZJ A;  3ABL C;  4JV5 O;  2EUL A;  2ZCE A;  3KKY A;  3LSS A;  3SJA C;  4JYY A;  1WLE A;  2Y0I A;  2M7W A;  3RYH A;  1BHB A;  4AQY B;  3U11 A;  4R50 A;  1TAE A;  3STZ C;  4H37 A;  4PV1 B;  1JPX A;  3JAW A;  1RM1 C;  4DR3 O;  1RPR A;  1XQ8 A;  3K5O A;  3A8T A;  2X6B A;  4XDK A;  1OCC B;  1DF5 A;  2AW9 A;  3RGB A;  4YJ2 A;  4JI5 O;  1VQ7 V;  4IGG A;  3CRM A;  1AP6 A;  3UO3 A;  3E22 B;  1QVG U;  1GH6 A;  1SQQ H;  4LFA B;  2CTP A;  3VOU A;  4UVA A;  1CEZ A;  1SA0 B;  3QO7 A;  2DYS C;  3W7U A;  2WLH A;  1JX9 A;  2PYL A;  5L3E A;  4BIZ A;  2Y4T A;  3BVO A;  4PHZ A;  1GKF A;  4R7C A;  2X6A A;  4J42 A;  1K97 A;  2EIN B;  2QKS A;  5LHH A;  5IT9 N;  4IYH A;  1TGO A;  1M93 A;  1IBK O;  1KBH A;  1NS1 A;  3FB8 C;  1UPG A;  5CBH A;  2F23 A;  5F2V O;  3Q4H B;  4RUF A;  4O4I A;  4HAM A;  3ZS8 C;  1KMI Z;  3CC2 V;  3VQY A;  1Z2G A;  1F51 A;  2UUC B;  1S0V A;  4DUZ O;  4ZOL A;  1U97 A;  1IXB A;  3C3S A;  4UCT A;  3RVY A;  2A9H A;  3N2K A;  4X20 A;  3RYC A;  3BCC H;  2VQE O;  3LSQ A;  1QLE C;  2WLK A;  1ZAU A;  4K35 A;  1VP7 A;  2Q73 A;  4O2B B;  1GN6 A;  2ODM A;  4I9Q A;  1HNZ O;  1QU7 A;  3DC6 A;  1SQX H;  3JAW B;  5DN6 G;  1V55 B;  2PI5 A;  2N74 A;  3AG1 C;  2Q6A A;  1CXZ B;  2EIL C;  5IE9 A;  4X1K B;  3AG2 C;  4U7O A;  5CMU A;  3QF7 A;  4EB6 A;  1YJ9 V;  3JAK A;  3CCL V;  1HWY A;  4X62 O;  1FXK C;  4X62 B;  1VQ5 V;  1I5X A;  1VAR A;  4ASU G;  4D6T H;  3SYP A;  3JD4 A;  3RWR D;  2V4D A;  1IBM O;  1OCZ C;  2UXD B;  2YXH A;  2CTR A;  1I7F A;  4B3R B;  3ZIA G;  3ZRX A;  3ABM C;  3IC9 A;  3OMI B;  1XEQ A;  5LYJ B;  4LFB B;  1QR8 A;  1B3Q A;  1B6Q A;  1K3E A;  1XIL A;  1L8D A;  2QEX V;  1EN4 A;  3F5W C;  4I7Z B;  1YSC A;  3G80 A;  1WP8 A;  3ASO C;  5IYZ A;  3M99 B;  1GMG A;  1N36 B;  1XBL A;  2GV9 A;  1P84 F;  1X4T A;  4OXS A;  5BZB A;  1XDC A;  3JAL B;  5CB4 A;  3KG2 A;  4B3M B;  1L0N H;  4FLY A;  4X65 O;  4FJC C;  2VWK A;  5BR8 O;  1K7D A;  5LL6 Y;  1URF A;  3ZBH A;  4BR6 A;  1WAZ A;  4CS2 A;  3ASN C;  3FFQ A;  1ZX3 A;  5JJE B;  4MTF A;  1NU1 H;  2QKA A;  4HNA A;  4X88 A;  3JAL A;  3SJC C;  4OX9 B;  2K9P A;  3K08 A;  4DV2 O;  2EIJ C;  3RN4 A;  3E86 A;  1GM7 A;  4J7J A;  4GCZ A;  3K0G A;  1SRY A;  1BE3 H;  3K04 A;  3C90 A;  3K5L A;  4DUZ B;  4QGP A;  1G8M A;  3OEH G;  2ZIO A;  2IU3 A;  2HR3 A;  1DLB A;  4GUN A;  3W7T A;  3VQV A;  5LGT A;  2D2C B;  2LJ2 A;  2R9A A;  4DV6 B;  2F95 B;  4P9O A;  2P7T C;  4J10 A;  1YI2 V;  1ROP A;  1VQP V;  1Q5O A;  3W7W A;  3T1Y O;  3K9A A;  1KUQ A;  3CPW U;  1BL8 A;  3PN1 A;  3L71 H;  5CBG A;  4DR3 B;  4J9Z B;  5BMV A;  2KB1 A;  1YXB A;  2P5O A;  2E75 B;  1AB3 A;  4ZOL B;  3F5T A;  1EBO A;  2B9Z A;  3UKM A;  2XAS A;  1YIJ V;  4KL1 A;  5H5N A;  1NKD A;  1N0J A;  5LOV A;  1K9M W;  3OFN G;  1LUW A;  1S72 V;  3CC7 V;  1BT8 A;  4OPA A;  1RP3 B;  3O9O A;  2QWP B;  4DV5 B;  5GON A;  2VRZ A;  2QWQ B;  1WB7 A;  3T1H O;  3BA9 A;  3K5N A;  3BFR A;  4CBC A;  2H3O A;  1PNL A;  2CK3 G;  3CHX A;  1E1Q G;  3HB3 B;  2IH1 C;  2ETN A;  1RM1 B;  3CRR A;  2JEX A;  3CEI A;  1NT2 B;  4JI1 B;  3FYE B;  2ZDI A;  4AI8 A;  3J7A U;  2UU9 B;  3GVM A;  1GN2 A;  1N33 O;  3BAB A;  3CWB H;  2DYR C;  5LP6 B;  4B08 A;  2EJ7 A;  2Z5U A;  2BSK B;  3HR0 A;  2A79 B;  1OHH G;  2BOC C;  4QJF B;  1PPJ H;  1QLN A;  4JI4 O;  4JAA A;  4LP8 A;  4B3T B;  2WLN A;  4CC5 A;  5B1A C;  4P2Z A;  5A2Q N;  1S5J A;  4O4J B;  2LO1 A;  1H2L A;  4UB6 Z;  5CB4 B;  2RNB A;  4MTX A;  2CUG A;  2QDO A;  5JH7 A;  4DV2 B;  4OX9 O;  3EFF K;  1B04 A;  2Y48 A;  4E4E A;  2RMK B;  2LGQ A;  4DR4 O;  4UUJ C;  4LF7 B;  3CXH F;  4I55 B;  1S76 D;  2GTA A;  1JR9 A;  2XHB A;  2A3Q A;  4KFM A;  2B5U A;  1JJ2 U;  4FFB A;  3H1I H;  2C2A A;  1GTO A;  3W7S A;  1ORQ C;  5KMG A;  5B1A B;  3SJB C;  4WBN A;  1RPO A;  3K58 A;  2W6I G;  5GON B;  3UQ8 A;  2YIB A;  4LWS A;  2JGD A;  1VQK V;  2UXB B;  1J5E O;  2ZIN A;  3FD9 A;  1NTM H;  2PTM A;  4JI8 B;  3TCU A;  1OCZ B;  4TSF G;  2AHZ A;  1YJN V;  4ZI7 B;  4D7T A;  2KG7 B;  1FFX B;  3NR7 A;  1XL4 A;  1I94 B;  4MTG A;  4LR3 A;  5FNV B;  1F23 A;  4AIL C;  3OE7 G;  1HDJ A;  1D5N A;  2GHY A;  1IBL B;  4UVB A;  4JI0 O;  2XT9 A;  4U3J B;  3D3Q A;  2AGA A;  2P22 C;  4UCR A;  1YTF B;  2NLJ C;  3TK1 A;  3K3W A;  4RUE A;  5E79 Z;  4MVM A;  4QE7 A;  2Z3Y A;  3H1L H;  3ZMV A;  3G6E V;  1HNZ B;  1IBM B;  1NJI W;  1H2N A;  4LF8 O;  2VQE B;  1M5I A;  1IZ3 A;  2YSU B;  2YIA A;  1BSM A;  4WCE V;  1MOF A;  4B3S B;  2WSS G;  3P3N A;  4Z2W A;  1SZX A;  4LF5 B;  1MAB G;  5EBL C;  2LQT A;  3SYC A;  5TIS Z;  3ZHT A;  5B5E Z;  3LNM B;  4IIJ B;  1PV0 A;  3CCE V;  1AI7 A;  3CRQ A;  4P9P A;  1SES A;  1R3I C;  3OMN B;  2Y0P A;  2X6C A;  5DEC A;  2UXB O;  3SPJ A;  5LMU B;  4DR5 B;  3N2K B;  4GZR B;  1AR4 A;  1NZ6 A;  3ZMT A;  2GSM B;  1GRJ A;  2DYS B;  1OV9 A;  2CGO A;  2ZDI C;  1COW G;  2XTA A;  1JA8 A;  2HVJ C;  3U0Z A;  3H9V A;  5IJ9 A;  1M56 C;  3SPG A;  2QM8 A;  4LFC B;  4NTX A;  5LXT B;  3L73 H;  3EHB B;  5JQG B;  1B06 A;  1SS3 A;  1XMO O;  5JH7 B;  4G27 B;  4H33 A;  4DW0 A;  3HKD B;  2N04 A;  3SPH A;  2HLD G;  2OT5 A;  4QPJ A;  3UCS C;  4D7S A;  1N8R W;  5AG2 A;  4GX1 A;  2NN4 A;  3ABL B;  2FYU H;  4NYK A;  1HNW O;  1PP9 H;  3CS5 A;  2IBZ H;  1AVM A;  1MZF A;  2ZE6 A;  2ZQM A;  2LW1 A;  3X2Q B;  1FD9 A;  4JV5 B;  1THZ A;  3ZRW A;  1HNW B;  2EIK C;  2K1E A;  2UXC O;  3L9D A;  2F4V O;  3L70 H;  5KHK A;  4XDJ A;  1AJN A;  3CE2 A;  2CE4 A;  3NXS A;  4DXW A;  3OEE G;  1EN6 A;  3D8C A;  4CS3 A;  1G1X B;  1SQF A;  3T4D A;  2QTS A;  1F4M A;  4YXW G;  1VQ6 V;  4X1K A;  1Z5W A;  3CCJ V;  1QCE A;  4JAU A;  5H6Q A;  4B7E A;  4WFG A;  2XAF A;  2DWD C;  1YHQ V;  3BPZ A;  1XUQ A;  1AI4 A;  4PA3 A;  4J41 A;  1S5H C;  2P90 A;  5DED A;  4FM1 A;  2HHH O;  3OGI B;  2DN9 A;  2WLI A;  2ZE7 A;  4O2A B;  3OM3 B;  4JZG A;  1GM9 A;  3FB5 C;  1O9H A;  1H2S B;  3OTO O;  4FLV A;  4DV3 B;  1GAX A;  3JAT B;  3LDD A;  4YJ3 B;  2FL4 A;  3B2E E;  1FPO A;  2LFS A;  2DQ0 A;  3KCX A;  4JTD B;  3ZMU A;  3TJT A;  3E22 A;  1AIL A;  4MVZ A;  2WPD G;  4LWS B;  1P7B A;  3FYI B;  4HZ3 A;  4CH6 A;  4F6R B;  1JCH A;  3K0D A;  2AHY A;  1I94 O;  1H2M A;  3OUF A;  5IYC O;  3ZMZ A;  4ZI7 A;  2BE3 A;  4GKK B;  4CH5 A;  2CTQ A;  4J9Y B;  3BA8 A;  4JI8 O;  2BOB C;  3ZCC A;  5CN0 A;  3OGC C;  4UVC A;  3THO A;  2XUM A;  3OD4 A;  3STL C;  1Y74 B;  1XL6 A;  3E83 A;  1R3K C;  4U7N A;  4ZIB A;  3D36 C;  4I50 A;  4PDL A;  3AG3 C;  1KC8 W;  1WN7 A;  5JWP A;  2QWN B;  4DV1 O;  1PM9 A;  3ZJZ A;  4DR7 B;  4DK0 A;  4DV7 O;  2E3C A;  3HKB A;  1NTK H;  3BEH A;  4LNU B;  2QWO B;  2Q67 A;  4JTA B;  4MVU A;  1IUR A;  2YID A;  1R3J C;  3QVN A;  3E89 A;  1H2G A;  2ZM6 O;  4H44 B;  2E76 B;  1N36 O;  1DK1 A;  1MSD A;  2BTO A;  4JAV A;  5LBQ A;  1K8A W;  3FAV B;  2F1M A;  3M8A A;  3SR2 C;  4QIW F;  1IVS A;  2NR5 A;  3QG5 A;  4CC6 A;  4WFB V;  4NR1 A;  1FFT B;  3DSQ A;  1FFX A;  4FVM A;  4AHC A;  3IJ4 A;  1R6K A;  4FZ0 A;  1Y6X A;  2IH3 C;  1N32 B;  2EIL B;  1JQ0 A;  3JSL A;  1KD1 W;  4LC1 A;  5KX5 A;  1VF5 B;  1JOY A;  2OYQ A;  4X66 O;  1K34 A;  2FTK A;  4NB5 A;  2LFR A;  3ZRV A;  4HYO A;  2ITD C;  5CA0 B;  1MMM A;  4FFB B;  5GTH Z;  3ZHR A;  1YZB A;  3RBZ A;  2D3O W;  2V1D A;  4Q6G A;  1KB9 F;  5EC2 C;  3ZMS A;  4Z1M G;  1J5E B;  1MZE A;  2NNU A;  3B40 A;  4MS2 A;  4QE9 A;  4K3A A;  1XNQ O;  5C93 A;  2OCC B;  2HHH B;  1OJH A;  3K9S A;  2WA3 A;  2G38 A;  1VQO V;  4FK5 C;  2RQ6 A;  5LOV B;  3OR7 C;  1BS3 A;  1QQC A;  2UXC B;  3ICX A;  4QNH B;  2UUC O;  1AJQ A;  3JAS B;  3K5M A;  2JJ1 G;  3HKE B;  2KG7 A;  4X9Q A;  5IYD O;  1U96 A;  4WFF A;  2EIN C;  5B66 Z;  4LF7 O;  1S77 D;  5EIB D;  3VBB A;  1NVP D;  2VWJ A;  2EIJ B;  2RN9 A;  3E8H A;  4OGQ B;  4F6R A;  4UFZ A;  2CH7 B;  1Q6U A;  2YS8 A;  3OMA B;  1VQ8 V;  3K57 A;  3P3P A;  2Q69 A;  1Q81 W;  4FFK A;  1L1F A;  2Q8V A;  1IX9 A;  2YI8 A;  3SYA A;  2HVK C;  4EFE A;  5KHG A;  1Q82 W;  1AR1 B;  1AR5 A;  3WU2 Z;  1VMG A;  3QO8 A;  3CCQ V;  4G2K A;  3CME V;  1TUE B;  4U3J A;  4UCS A;  3U10 A;  3RYF B;  1XMQ B;  4FLZ A;  4DK1 A;  4FLU A;  2ZM6 B;  4UB8 Z;  4H13 B;  3LUT B;  3ABM B;  3EXA A;  2JIZ G;  5KLV H;  3AG1 B;  1VQN V;  4IIJ A;  3LDC A;  1NBM G;  2F93 B;  1E1R G;  3ASO B;  2UUA B;  1Z5V A;  5JJJ B;  4O2B A;  4GX2 A;  2VS0 A;  3TXQ A;  4PDM A;  2WLM A;  3J81 N;  4LF5 O;  1BQ0 A;  2YIB D;  1PNM A;  4Z1V A;  1TVK A;  2F66 C;  3E8G A;  2ZR2 A;  4JZ2 A;  3G4S V;  1K92 A;  2ZIM A;  1QHT A;  3CRC A;  2E5L B;  3MHH C;  2EIM B;  3R65 A;  2JS3 A;  3OT7 A;  4JI2 B;  3AK3 A;  3HKC A;  5J2U B;  3CCU V;  1HP8 A;  5LP6 A;  5KX5 B;  1FS0 G;  2ILM A;  3ETE A;  3HKD A;  1SZT A;  3OUS A;  2EZO A;  1M57 B;  3RT3 C;  4FLX A;  5FPR A;  1NR7 A;  5IJ9 B;  4JI7 O;  4JGS A;  1KQS U;  2JJ2 G;  2JK5 C;  3HKB B;  5IJ0 B;  3T2M A;  4YHH O;  3DXR A;  5KA6 A;  4JI2 O;  2RDC A;  2ZE5 A;  5KUM A;  1V9P A;  2XOK G;  4B3R O;  3K03 A;  1VQM V;  1ZWI C;  4R6Z A;  2R9I A;  1P4R A;  1M57 C;  3N27 A;  4MVQ A;  4DW1 A;  1Q43 A;  4JI0 B;  3ABT A;  1IBL O;  1VEW A;  5IWA B;  3OTF A;  5LMN B;  1NI8 A;  1T5E A;  1WA8 B;  4HNA B;  2Y4U A;  4PDV A;  5KAI Z;  1FJG B;  4F4L A;  1R1B A;  3C3T A;  4JF3 A;  5KMG B;  3TXS A;  2PF4 E;  2HG5 C;  3JSN A;  3T1C A;  4JI3 O;  1JFF A;  3FX7 A;  3K06 A;  3AG7 A;  1MA1 A;  3FKS G;  2WAM A;  4TQD A;  1XMQ O;  2WLI B;  4C7U A;  2Q7H A;  4O2A A;  3MDS A;  3I5D A;  5CBF A;  2Z0A A;  2BTQ A;  2JS5 A;  4IHJ A;  1US6 A;  4B3T O;  4RAI A;  4H0L B;  5B1B C;  3RVZ A;  1KKC A;  3JD2 A;  4JI4 B;  1Q6I A;  2V7Q G;  1KP3 A;  1Y76 A;  4RO2 A;  2UXD O;  2IJH A;  3ZHQ A;  4DR4 B;  2VQF O;  2Q5Z A;  2H94 A;  1SER A;  4X1I A;  1TUB A;  1MNG A;  1BZK A;  1UFI A;  4WFA V;  4UV8 A;  1N34 B;  2Q68 A;  2QSA A;  1W0K G;  2IU0 A;  3MD0 A;  2WLL B;  1SET A;  5EYP B;  2LGW A;  5D5Q A;  1YF2 A;  3SDL A;  1ARO P;  1F7Y A;  3GB7 C;  1FYJ A;  4IYI A;  2KKW A;  4JYB A;  1OCO B;  1Y74 A;  5L3G A;  4DR5 O;  2JRI A;  5L3B A;  1AI6 A;  1F4N A;  5H6R A;  1AJP A;  4JI1 O;  2QA4 V;  1SC5 B;  1GO3 F;  3QNE A;  1JFF B;  5CA0 A;  4AQY O;  2Q0O C;  2YDE A;  1ZUQ A;  3SGI A;  1N34 O;  5HFL A;  1SQV H;  4ABM A;  4EEQ A;  2KQX A;  5K1P A;  4X1Y B;  5EBW C;  1RSO A;  3RYF A;  3KCY A;  2VQF B;  3P30 A;  1WNS A;  3HPL C;  3ETD A;  1YCI A;  1I0H A;  5B3S C;  3R66 A;  3MAQ A;  2P6J A;  3H1K H;  5IJ0 A;  3JAS A;  3IGA C;  3DXR B;  2L35 A;  3HKE A;  2GDS A;  1K4C C;  3DC5 A;  3ETQ A;  1YTF D;  5ITZ B;  3JAR B;  2M6Y A;  3A0R A;  5L3F A;  3ZHS A;  2JGD B;  3T1Y B;  4KHP O;  4W4L A;  3B8M A;  1XNR B;  5C8Y A;  5CA3 A;  1ZTE A;  4KP4 A;  3RFR A;  3RYI A;  2EZP A;  2ZKO A;  1UJW B;  5LYJ A;  4WBN B;  4MVR A;  1CPY A;  4TOI A;  5ITZ A;  1MSW D;  2QM4 A;  2Y69 B;  2Q0A A;  4MW8 A;  4K8Z A;  4I5S A;  4DUY O;  4JYA B;  3HKC B;  4X65 B;  1SA0 A;  3X2Q C;  1DGS A;  5JJN B;  2HFE C;  5FL7 G;  4X64 O;  1R6T A;  2XND G;  2YC0 A;  3QTC A;  4FIP C;  1LNQ A;  4DR6 O;  1V54 C;  1GK9 A;  3WG7 C;  5EC1 C;  2XAH A;  1SQG A;  1W0J G;  3APO A;  5FPO A;  1N4C A;  2QGN A;  4DV4 O;  3SYO A;  3H1J H;  1Y76 B;  2R70 A;  1IDS A;  2L6L A;  4W4K A;  3OW2 U;  1M56 B;  2Q4P A;  2BSK A;  3VQX A;  4LF6 O;  4TUY A;  4LH6 A;  2GBO A;  1NQT A;  2AZ2 A;  4PJ0 Z;  5H9C A;  4DRX A;  2YEV A;  3LDE A;  3W7X A;  2R72 A;  2OTL V;  4LF6 B;  5LGN A;  1OCR B;  2PI4 A;  5IY5 C;  3N2G B;  4O4H B;  2QTO A;  3D36 A;  4DR1 O;  5CA1 B;  2E5L O;  2Q7G A;  2CH7 A;  3OTO B;  4JAS A;  2DYR B;  3RYI B;  3UO2 A;  4ZHQ A;  3S3W A;  3QO5 A;  4LF9 B;  2OIG A;  4PA4 A;  1Q86 W;  1WPX A;  1SKV A;  3RW0 A;  2MK3 A;  5FNV A;  4NXM B;  2PYJ A;  4I9W A;  1FXV A;  3ABK B;  3J80 N;  2AXT Z;  3CXC U;  2GUZ B;  2ZXW B;  1OZ0 A;  3M7M X;  4DV4 B;  3I55 V;  1H8E G;  1E79 G;  1Q6H A;  4I50 B;  1W59 A;  2F43 G;  4NKG B;  1XNR O;  4NXN B;  1TVK B;  2EX3 A;  3OR6 C;  4TT3 G;  2WLJ A;  1KKD A;  3ZRS A;  2YUA A;  2HP8 A;  3B77 A;  2CDY A;  5B3S B;  3E35 A;  3BY6 A;  1Q8I A;  3L72 H;  4DR2 B;  2UXX A;  5FLX N;  3FAV A;  5K1X A;  4GYC B;  5C8Y B;  2QE7 G;  1YIT V;  1NVP B;  1DTO A;  2YI9 A;  4N21 A;  4TV9 A;  3JD3 A;  2ARH A;  3TET A;  4J7K A;  3A2F A;  4NTY A;  4GT1 A;  4BW5 A;  4X8A A;  5J2U A;  4KXR A;  4UXN A;  4O4H A;  3OAA G;  1M1K W;  3T1H B;  2XAG A;  5H2F Z;  1H2K A;  2A7W A;  2CGN A;  1FKA O;  1K5S A;  2R9R B;  3Q4H A;  1PNK A;  1P7G A;  4LCU C;  3BAA A;  1LUV A;  1IXM A;  2X7R B;  4CZZ A;  1SF9 A;  2CAZ C;  1YDX A;  1BHA A;  5GW7 A;  2UU9 O;  1PL4 A;  1GN4 A;  3S3X A;  1PKX A;  2FKX A;  4I0X A;  1FAF A;  3SPC A;  4R8C A;  1BQZ A;  5GTI Z;  4MW3 A;  4PD4 F;  4O4L A;  1NTZ H;  3AG4 B;  4WFH A;  2ZNJ A;  1M90 W;  3I56 V;  5JCO C;  1S5L Z;  4NVP A;  2W0F C;  3BHP A;  1SQP H;  1A32 A;  1R3L C;  1XNQ B;  4EB6 B;  4MSW C;  1HNX B;  3JAK B;  3JYC A;  4LF8 B;  1N32 O;  1YVW A;  5B1B B;  2OCC C;  2ITC C;  2HJD A;  4BAY A;  1YEW A;  1DF4 A;  4NTW A;  4P30 A;  3MHS C;  5LA6 A;  3A0B Z;  3CCV V;  1KEC A;  1P49 A;  1EFR G;  3ZHV A;  2OWO A;  4JYC A;  1RSO B;  1HR0 O;  2B1I A;  3JD0 A;  1FXK B;  4JI6 B;  1PD3 A;  1XHZ A;  1XMO B;  4CS4 A;  3FB7 C;  1VQ4 V;  1AP5 A;  4JI3 B;  2ADP A;  2DWE C;  4LNU A;  2GUZ A;  5EK0 A;  2W0X A;  5KUK A;  4A5U B;  2UUB B;  2WLL A;  2FML A;  1V55 C;  4PA9 A;  3CMA V;  5J2T B;  4PA6 A;  1CP9 A;  4QPK A;  3JD1 A;  4IHJ B;  4I55 A;  1J95 A;  1MG1 A;  3ZED A;  3CSX A;  2QWR B; 
#chains in the Genus database with same CATH homology
 1K97 A;  2EIN B;  2QKS A;  5LHH A;  2WAM A;  3SPH A;  2HLD G;  2WLI B;  3DTU B;  4UV9 A;  2OT5 A;  2IJJ A;  4QPJ A;  4PEL A;  5CBF A;  1N8R W;  4GX1 A;  3FB8 C;  4RAI A;  3ABL B;  5CBH A;  4WF9 V;  2IJK A;  4RUF A;  5B1B C;  3RVZ A;  4HAM A;  3JD2 A;  2P67 A;  3CC2 V;  2ZQM A;  3CC4 V;  2V7Q G;  1K5Q A;  1F51 A;  1KP3 A;  3X2Q B;  4RO2 A;  1S0V A;  1THZ A;  3ZRW A;  2EIK C;  2K1E A;  2IJH A;  3F7V C;  1Q7Y W;  4XDJ A;  3RVY A;  1QVF U;  3ZN0 A;  1AJN A;  3NXS A;  4DXW A;  3OEE G;  2A9H A;  5KA5 A;  2H94 A;  1SER A;  3LSQ A;  1QLE C;  5HFM A;  2WLK A;  3T4D A;  3AG3 B;  1F4M A;  4YXW G;  3ZN1 A;  4WFA V;  1VQ6 V;  4UV8 A;  3CCJ V;  1QCE A;  4JAU A;  2Q68 A;  1W0K G;  5H6Q A;  2IU0 A;  3MD0 A;  4L87 A;  4WFG A;  2XAF A;  2WLL B;  2DWD C;  1YHQ V;  1SET A;  5DN6 G;  1V55 B;  2PI5 A;  3AG1 C;  1AI4 A;  4PA3 A;  2Q6A A;  2EIL C;  3AG2 C;  4U7O A;  1S5H C;  5CMU A;  1ARO P;  2P90 A;  1YJ9 V;  4KUM A;  3AG4 C;  3GB7 C;  1HWY A;  3CCL V;  4RQF A;  4JYB A;  3WG7 B;  1OCO B;  3CP1 A;  1V54 B;  2WLI A;  1FXK C;  3OM3 B;  5L3G A;  1VQ5 V;  1GM9 A;  3FB5 C;  4JPR A;  4MTO A;  5L3B A;  1AI6 A;  1F4N A;  5H6R A;  4LBE C;  3JCZ A;  1I5X A;  1QBZ A;  1AJP A;  4ASU G;  3SYP A;  3JD4 A;  1OCZ C;  2QA4 V;  5LHG A;  2WWW A;  2ATK C;  1NH2 B;  4XBF A;  3LDD A;  1GO3 F;  3QNE A;  3ZIA G;  2Y69 C;  3ZRX A;  1NR1 A;  3ABM C;  2LFS A;  3OMI B;  2DQ0 A;  4MVS A;  1QR8 A;  1AI5 A;  4JTD B;  3ZMU A;  5HFL A;  2OTJ V;  1B6Q A;  1K3E A;  2QEX V;  3H01 A;  3AG2 B;  3F5W C;  1YSC A;  4MVZ A;  3ASO C;  3M99 B;  1GMG A;  4BIU A;  2IW5 A;  5EBW C;  4PA7 A;  4OXS A;  1P7B A;  3FYI B;  5BZB A;  4HZ3 A;  3P30 A;  3HPL C;  3ETD A;  1JCH A;  1JVM A;  3KG2 A;  5B3S C;  4FPP A;  4JTC B;  2P6J A;  3K0D A;  2AHY A;  3OUF A;  5IYC O;  3ZMZ A;  2ZXW C;  4GX5 A;  3IGA C;  4FJC C;  1K7D A;  1K4C C;  5E1A C;  1YTF D;  3ASN C;  4J9Y B;  4GX0 A;  4MTF A;  4ZBM A;  3A0R A;  2B1G A;  5L3F A;  2BOB C;  4X88 A;  3ZCC A;  5CN0 A;  3OGC C;  1QR9 A;  3B8M A;  4UVC A;  3K08 A;  2EIJ C;  3E86 A;  1GM7 A;  3STL C;  1XL6 A;  3E83 A;  1R3K C;  4U7N A;  5CA3 A;  3E8B A;  3AG3 C;  4GCZ A;  4PDL A;  4KP4 A;  1KC8 W;  2EZP A;  3K0G A;  1UJW B;  1SRY A;  2XAQ A;  3K04 A;  3CCR V;  4MVR A;  1CPY A;  3ZJZ A;  1MSW D;  3ABK C;  5L3D A;  1G8M A;  3OEH G;  2Y69 B;  4MW8 A;  4I5S A;  3E8F A;  3ABU A;  3PJS K;  5B1O A;  3BEH A;  3X2Q C;  2HFE C;  5FL7 G;  2EIK B;  3ETG A;  5EBM C;  2IU3 A;  2Q67 A;  4XDL A;  2HR3 A;  1DLB A;  2XND G;  4JTA B;  4MVU A;  3W7T A;  2YEV B;  1R3J C;  5LGT A;  1QLE B;  1YJW V;  4FIP C;  3E89 A;  1LNQ A;  4P9O A;  1H2G A;  1V54 C;  1OCO C;  2P7T C;  1GK9 A;  3WG7 C;  1YI2 V;  1ROP A;  5EC1 C;  2XAH A;  1VQP V;  3W7W A;  2XAJ A;  4JAV A;  5LBQ A;  1K8A W;  1W0J G;  3K9A A;  3ZRW B;  5IYB O;  3CPW U;  1BL8 A;  4QIW F;  1NH2 D;  5CBG A;  4J9Z B;  2KB1 A;  5IY5 B;  3SYO A;  2X0L A;  4WFB V;  1R73 A;  4EKW A;  1EBO A;  3UKM A;  1FFT B;  3CCS V;  2XAS A;  3OW2 U;  1R6N A;  1S3J A;  1M56 B;  1YIJ V;  1K73 W;  1NKD A;  1M9N A;  1R6K A;  1ENV A;  1K9M W;  2ZD9 A;  3OFN G;  2HKO A;  1NQT A;  1PL0 A;  2A0L A;  2IH3 C;  1OCC C;  3CC7 V;  1S72 V;  2EIL B;  2JEU A;  1BMF G;  1JQ0 A;  5J9P C;  1KD1 W;  4ZKI A;  5H9C A;  4LC1 A;  2YEV A;  3CD6 V;  3LDE A;  3W7X A;  3AEI A;  2OTL V;  3SPI A;  1JOY A;  5LGN A;  1OCR B;  2PI4 A;  2FTK A;  3ASN B;  1K34 A;  2LFR A;  4CBC A;  5IY5 C;  3ZRV A;  4HYO A;  3D3I A;  1PNL A;  2CK3 G;  2ITD C;  2W6J G;  1E1Q G;  2QTO A;  3D36 A;  3HB3 B;  2IH1 C;  1H38 A;  1RM1 B;  1K33 A;  5LHI A;  3RBZ A;  2D3O W;  2JEX A;  2V1D A;  2ZR3 A;  5EC2 C;  3ZMS A;  4Z1M G;  2LP7 A;  3FYE B;  4JAS A;  2ZDI A;  2NNU A;  4MS2 A;  2DYR B;  4QE9 A;  5DM6 V;  5C93 A;  5LGU A;  2OCC B;  3K79 A;  3QO5 A;  2DYR C;  1VQO V;  4PA4 A;  4FK5 C;  1Q86 W;  1GM8 A;  1WPX A;  3OR7 C;  3RW0 A;  2MK3 A;  2Z5U A;  4QNH B;  2A79 B;  1AJQ A;  1OHH G;  2BOC C;  4QJF B;  4I9W A;  1FXV A;  3ABK B;  4N23 A;  1QLN A;  2JJ1 G;  3CXC U;  2DQ3 A;  4G28 B;  5IYD O;  1VQL V;  4LP8 A;  4WFE A;  2ZXW B;  1H8H G;  1OZ0 A;  4WFF A;  2EIN C;  2WLN A;  5IDJ A;  3I55 V;  1S77 D;  1G4Y B;  3P32 A;  1H8E G;  2HJF C;  5B1A C;  3VBB A;  4P2Z A;  1E79 G;  3B8N A;  1NVP D;  2F43 G;  2EIJ B;  4MTX A;  3E8H A;  3OR6 C;  5B1N A;  3EFF K;  4TT3 G;  2WLJ A;  4RQE A;  2Y48 A;  1KKD A;  3ZRS A;  3OMA B;  4Q20 A;  4UUJ C;  3B77 A;  1VQ8 V;  2UXN A;  4FMT A;  1S76 D;  2Q69 A;  1Y4M A;  1Q81 W;  4KFM A;  5B3S B;  1L1F A;  2B5U A;  3E35 A;  1JJ2 U;  1Y66 A;  3BY6 A;  3SYA A;  3G71 V;  2C2A A;  2HVK C;  1GTO A;  3W7S A;  1ORQ C;  1Q82 W;  2UXX A;  1AR1 B;  3ML0 A;  5B1A B;  3QO8 A;  3CCQ V;  1RPO A;  2EJR A;  4G2K A;  3CME V;  1TUE B;  2QE7 G;  1YIT V;  5L3C A;  2W6I G;  1NVP B;  1VQ9 V;  1DTO A;  4N21 A;  1VQK V;  1I5Y A;  3JD3 A;  3TET A;  4BW5 A;  4GT1 A;  1K4D C;  3LUT B;  3ABM B;  4X8A A;  3TCU A;  1OCZ B;  2JIZ G;  4PDR A;  4TSF G;  4UXN A;  3AG1 B;  2AHZ A;  3OAA G;  1VQN V;  1YJN V;  1M1K W;  3LDC A;  4MT8 A;  4E2L A;  1NBM G;  1E1R G;  2XAG A;  1OCR C;  3ASO B;  3T4Z A;  2H8P C;  1FXH A;  1XL4 A;  1K5S A;  2R9R B;  4MTG A;  1PNK A;  4GX2 A;  3SYQ A;  4PDM A;  4LCU C;  1F23 A;  2EBO A;  2WLM A;  3F7Y C;  1IXM A;  3OE7 G;  2X7R B;  4CZZ A;  1PNM A;  2GHY A;  3E8G A;  2ZR2 A;  1BHA A;  4UVB A;  5GW7 A;  3G4S V;  1FXK A;  1K92 A;  3FB6 C;  2EIM C;  1PKX A;  3SPC A;  1KP2 A;  1YTF B;  2JDI G;  2NLJ C;  4R8C A;  3TK1 A;  4DO2 A;  3CCM V;  3MHH C;  2EIM B;  3R65 A;  3K3W A;  4RUE A;  4MW3 A;  3UM7 A;  4MVM A;  2DW4 A;  4QE7 A;  3CCU V;  3AG4 B;  2Z3Y A;  3ZMV A;  4WFH A;  3IC7 A;  3G6E V;  1M90 W;  3I56 V;  4X89 A;  3GWO A;  4TWK A;  3SJQ C;  1NJI W;  2W0F C;  3WFV A;  2YSU B;  1W2B U;  4WCE V;  1MOF A;  1FS0 G;  3DGE A;  3ETE A;  1R3L C;  1SZT A;  2WSS G;  3OUS A;  4MSW C;  2EZO A;  4MVO A;  1M57 B;  3E2E A;  2QM7 A;  3JYC A;  1MAB G;  3CYO A;  5EBL C;  3SYC A;  5B1B B;  1NR7 A;  2OCC C;  3IFX A;  2IJI A;  2ITC C;  1EZJ A;  3ABL C;  4BAY A;  4JGS A;  3LNM B;  1KQS U;  2JJ2 G;  1DF4 A;  3LSS A;  2JK5 C;  1WLE A;  2M7W A;  3T2M A;  4P30 A;  3MHS C;  1BHB A;  3CCE V;  5KA6 A;  3CCV V;  1AI7 A;  4R50 A;  4H37 A;  4P9P A;  5KUM A;  3STZ C;  2XOK G;  1JPX A;  1SES A;  1KEC A;  1R3I C;  3K03 A;  3OMN B;  1RPR A;  1EFR G;  1RM1 C;  2X6B A;  4XDK A;  1OCC B;  1VQM V;  1DF5 A;  1ZWI C;  2X6C A;  4R6Z A;  2R9I A;  1P4R A;  1M57 C;  4JYC A;  4MVQ A;  3SPJ A;  1VQ7 V;  2B1I A;  3ABT A;  3JD0 A;  1FXK B;  1PD3 A;  3ZMT A;  1QVG U;  2GSM B;  2DYS B;  3VOU A;  4PDV A;  3FB7 C;  4UVA A;  1VQ4 V;  1CEZ A;  2ZDI C;  3QO7 A;  4F4L A;  4JF3 A;  2DWE C;  5EK0 A;  1COW G;  5KUK A;  2DYS C;  2HG5 C;  2WLH A;  3W7U A;  2HVJ C;  2WLL A;  1JX9 A;  3T1C A;  1V55 C;  4PA9 A;  3CMA V;  1M56 C;  5L3E A;  4PA6 A;  1CP9 A;  4QPK A;  3SPG A;  4BIZ A;  3JD1 A;  2QM8 A;  1GKF A;  3EHB B;  3K06 A;  4R7C A;  2X6A A;  1J95 A;  1MG1 A;  3FKS G;  2WPD G;  4G27 B;  4H33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...