2DYSB

Bovine heart cytochrome c oxidase modified by dccd
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dysB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dysB02
2DYSB 1PNCA 1DZ0A 5I6NA 4BXVA 4EF3A 1JZIA 1NPNA 1ZDSA 4E9YA 5TK2A 1RZPA 4YSSA 1QHQA 3C75A 1KCBA 3H56A 3FYIB 1L9RA 2UX6A 4UAHA 3EH3B 2HX7A 3V9CA 1GS6X 4CSZA 1NIDA 1SF3A 2PCYA 4A66A 2CBPA 4GY4A 5I6OA 2FQEA 7PAZA 2ZXWB 4GP4B 4YSUA 3FSVA 2AZAA 3G5WA 5I6LA 4FA7B 3FPXA 3ZIYA 1NICA 3BQVA 1AZNA 2FT6A 2J55A 4RH4A 5ANHA 3EF4A 3UACA 2W8CA 4HZ1A 8PAZA 1W8EA 3WNJA 4WTQA 3OQRA 1NWPA 3OD3A 2DWTA 2UXGA 3PXLA 2XXGA 2BP8B 2EIKB 1GS8A 3FPYA 1CYWA 2X87A 2BP8A 3X1EA 2DV6A 3ABLB 3ERXA 5B3SB 2X88A 5B7FA 3FSWA 3X1FA 1CYXA 3WIAA 2BZ7A 2I7OA 3QQXA 1KBWA 1GYCA 4HHWA 2VSMB 4ZK8A 1OCCB 1KDJA 5TK4A 3TU6A 4G70B 2PLTA 5PCYA 2JKWA 1ZV2A 3DKHA 4AZUA 1SFDA 1EHKB 1ET5A 3PAZA 4DP8X 1R1CA 4ENZA 3CG8A 2A3TA 2Q9OA 1OF0A 2P80A 4GP8B 2N0MA 2IWEA 2YARA 3TASA 4DP2X 1GY1A 1HAWA 3BVDB 2OJ1A 2YXWA 2GB2A 1A4AA 1ET7A 2WSDA 2YAOA 4G71B 1AZRA 2VSKB 1QLEB 2GHZA 1NIFA 4X4KA 2E86A 3ASOB 2YAQA 1YLBB 3JT2A 3AG3B 1PF3A 3NJLA 4PCYA 4AX3A 2BP0B 4PAZA 2XYBA 1JVLA 2BP0A 2JXMA 4JHUA 3CZUB 1I53A 4E9SA 2BWIA 3TA4D 4YVUA 5B7MA 5D4HA 1NINA 2CAKA 2ZONA 2XX1A 4A2HA 1OE3A 1WS8A 2IDTA 1KV7A 2QDVA 4F7KA 1W6LA 1A4CA 1E30A 3PLYA 5B1JC 2XV0A 1AIZA 1XMEB 2YAEA 2YAHA 2YAPA 1AZUA 1E5ZA 1BXAA 4E9XA 1OOWA 4KNSA 2Y69B 3T6VA 1XB6A 4W1TA 4BWUA 1TEFA 3SBPA 2YAMA 4N4YB 1AZCA 1ASOA 4BWWA 4DP0X 3IEAA 2ZWNA 3NYKA 1ETJA 2J57A 1BEXA 1PLCA 1JOIA 4DPAX 1SDDB 3NP3A 2DYRB 2IDFA 1RZQA 4TXVB 2BZCA 4KO9A 2VM4A 3FT0A 1N70A 1FA4A 2HX8A 1PLAA 4A2GA 2IDUA 3WNIA 1BXVA 1JZJA 1QNIA 3NP4A 4JKNA 3EHBB 4YSQA 2FTAA 7PCYA 2UXTA 1B3IA 3EH4B 1BYPA 1ZDQA 3DIVA 5F7BA 2NRDA 2MRYA 1BXUA 3X2QB 1OE1A 1A65A 1AACA 2IWFA 4A68A 3TBCA 1F56A 5A7EA 3X1GA 1AG6A 1A4BA 3IN0A 2PPDA 3CVBA 3PAVA 1GSKA 2PPCA 3IE9A 3PCYA 4BDVB 2MTAA 3L45A 1AZBA 2VMJA 3QJQB 2J5WA 4KOCA 3IBOA 2QT6A 6PAZA 5B7EA 3EH5B 5IY5B 1SFHA 1NTDA 4HAKA 4DP9X 1IBYA 2XVBA 1UATA 1IUZA 4KO5A 3S3CB 3NJMA 5I28A 2CALA 2PPFA 3NT0A 1BQRA 1MZYA 3FSZA 5B1AB 1PNDA 2J56A 2VM3A 4YSRA 2Y1AA 2BW4A 5B1BB 2PPEA 1AS7A 4YSDA 2HRHA 3GYRA 3NSDA 4NB7A 3NSCA 2DWSA 4KOBA 1ZPUA 5PAZA 2YXVA 3UADA 1FFTB 1AOZA 2AZUA 4KNUA 1JXDA 2BW5A 1VLXA 4N8UA 4FAAB 2FT8A 3NJIA 2AFNA 3ZDWA 1HAUA 2IWKA 1KGYE 3AG4B 2IH8A 3NSYA 2UX7A 3HB3B 1PMYA 3T9WA 1ASPA 2EIMB 2XXFA 1AANA 3SQRA 4YVNA 5I26A 1J5DA 1AS6A 4M4RB 1IKOP 1ID2A 1V10A 1TU2A 4BXSV 2OV0A 2CCWA 3OMNB 3WKQA 3WG7B 4HCFA 1M57B 1EZLA 2VN3A 2XV3A 3D12B 1ZIBA 5I6MA 1CUOA 2HRGA 4GXFA 4QKTA 2FQGA 3IN2A 2Q5BA 1AAJA 2IDSA 2GC4C 5E9NA 1PZAA 1ASQA 5F7AA 3FQYA 3DTUB 2HXAA 4YL4A 1L9TA 4G7SB 3OMIB 1J9TA 1L9QA 1GR7A 3QJTB 1JZEA 5B1KA 4P5RA 5AFAA 4AKOA 1WA2X 1CC3A 1JZHA 2PCFA 1JXGA 2YAFA 3U25A 1A8ZA 4HALA 1PCSA 2AVFA 4GP5B 1ILSA 5I5JA 1WA0X 2R7EB 1SJMA 4AI7A 3H4FA 2YEVB 1J9SA 2R7EA 4YSOA 3QJSB 3MBWB 1WA1X 1RCYA 1MG3C 1ADWA 2PP8A 3AZUA 1NDTA 3NJNA 1JERA 3H4HA 2UXFA 3QJVB 2B08A 2LLNA 1PAZA 3ABMB 4BWTA 4E9QA 3CDZB 4F2EA 1NIEA 4A2DA 1MG2C 2PP9A 1OCZB 2PP7A 4G7RB 3T6XA 2IAAC 1JXFA 1OE2A 1ET8A 4A67A 1SDDA 3NJFA 6PCYA 1E67A 3UAAA 1NZRA 3JTBA 1NWOA 4KO7A 2EIJB 3QJRB 4HHGA 4A2FA 3FU9A 1MZZA 2TSAA 3S8GB 1BQ5A 4CSPA 2FJSA 1IBZA 4QLWA 1ILUA 3T71A 2GC7C 2GIMA 3KW7A 1A3ZA 2FQDA 2YQBA 3FU7B 4E9RA 1KBVA 3FU7A 1M56B 2WO2B 1WAEA 3FSAA 3NSFA 2H47C 2FT7A 4YSTA 4WKXA 4JHVA 4BDVA 4HIPA 1PZCA 1BQKA 1SNRA 1JZFA 3AG1B 2FQFA 5FC9A 2W88A 3ABKB 3PPSA 4KO6A 4GYBA 4HCGA 4YSPA 4YSCA 3KW8A 3MX0B 2GI0A 3SBQA 2XLLA 2EILB 4YSAA 1OCRB 3FS9A 5AZUA 3GDCA 3UGEA 2XUWA 2I85A 2QDWA 3AG2B 3HEIB 3N55A 1JVOA 1T5KA 1CURA 3PAUA 3V9EA 1J9QA 1FWXA 3UABA 3X1BA 3NJJA 2RACA 3AW5A 5I5IA 3WKPA 4E9VA 3OMAB 1GW0A 2VW4A 2QPEB 4YSEA 3QJUB 3SBRA 3S3BB 4MFHA 4DPBX 3FQ1A 3S3DB 2I7SA 3ZX1A 1PLBA 2HLEB 1ZIAA 1AG0A 1KDIA 2H3XC 3N2JA 4P5SA 3T6WA 2AANA 2PPAA 5EHFA 1X9RA 4DPCX 1KYAA 3NJGA 1TEGA 1J9RA 1NIAA 1E5YA 3NJHA 2B3IA 4UANA 1N68A 4DP7X 2TSBA 5AKRA 2EINB 1OV8A 2H5UA 4L0PB 2ZOOA 1J5CA 2DY2A 3GXUB 1AS8A 1AQ8A 1WS7A 4W9ZA 4DP6X 1IC0A 2CUAA 1E65A 4Q8BA 3WI9A 4BK5C 1HFUA 4KNTA 2FWLB 3T6ZA 3CVCA 3RYMA 3ZBMA 2XU9A 4F2FA 2BO0A 2HZHA 3S8FB 1V55B 1URIA 3X1NA 1NIBA 5I6PA 4DP1X 1L9OA 1L9SA 2BWDA 2JFCA 4E9WA 1DYZA 1PY0A 1JZGA 5LDUA 2UXVA 5I5MA 3FYEB 2QPDB 3AY2A 4DP5X 4DP4X 4K9JA 5B1JA 1NPJA 2BHFA 4E9TA 1RKRA 3QPKA 3CDZA 1XB8A 4HCIA 2IH9A 3CVDA 3FQ2A 1AR1B 1BAWA 1TKWA 1GS7A 1SHWA 2GSMB 3NJKA 4UF7C 5D4JA 1V54B 1SHXA 2CJ3A 1OCOB 3ASNB 4M3HA 9PCYA 4NAJA 1BYOA 3TBBA 4G72B 2OCCB 4G7QB 2FNWA 1W6WA 1X9UA 1XB3A 2P80D 5D4IA 5I6KA 2VW7A 4AKPA 1KCWA 1GY2A 2GBAA 1L9PA 2XWZA 2HX9A 2XV2A 1SF5A 4A2EA 1M9WA 2IDQA 3FU8A 4AKQA 1MDAA 3OM3B 4Q89A 2WO3B 2VW6A 1PZBA 3ABGA 4NERA 2XX0A 3UAEA
chains in the Genus database with same CATH superfamily
1T6VN 2EZ0D 1HKLL 4GG6F 3BWZA 4HZ3A 3MHZA 3ALPA 4W6YB 5KS9F 4DKEH 2BVOB 2J71A 4OPHA 2LU3A 1I7UB 3FTSA 4Q9QL 4G7VL 5AD0A 1FCCA 4XHJD 4FCAA 4LEOA 2X42A 5E5UB 2B59A 1QTPA 1QFWH 3BXNA 5I0WA 1ZJBA 4M6OL 1A7QL 3A0BZ 1J8HB 4UOJA 4HBCH 5I6OA 4B7KA 2FWOA 4M6ML 4RAVB 4TUOA 2VXSH 3FPXA 4PJ8B 3BP4B 4HAGA 2DRUA 3DX3A 4CBCA 3JD1A 1XDTT 1GYAA 1BBDH 2RMKB 4UQ2B 4X50A 5CSZA 4ZMOA 2TAAA 3I84A 1XR8B 5E2VL 5GS1A 1US6A 1OTUC 1HHHA 1EFRG 1ZTMA 3N2KB 3LQZB 4GKZA 4NENB 4HUVB 3OD3A 4D6TH 3QNXA 2IANE 5FYJE 4AT6B 3J80N 4U1SB 2NY1C 4P46A 4PTUA 3ABLB 1WA8A 3HFML 3RX7A 3EOBA 2C1OB 5B7FA 1HNWO 4N26A 4AEFA 1PKQE 3JSSA 1D5XA 3OPZH 1KBWA 1XFPA 4PW4A 5IGXL 2X6UA 3M17B 3AQYA 3MJ6A 3ZHNA 1AYOA 2IPKA 4L0YA 2BVEA 5C07A 1C5BL 4ODVH 1A4KB 2D3OW 2PLTA 1MCWM 5CLWA 5BVPH 4X62O 4G6AD 4Y4KA 4YXKH 3R4RA 4EN2A 2NNRA 2XOKG 3ET9F 1KV3A 2V5TA 1V5JA 3PAZA 1I1FB 2YRZA 4F8OA 1JPXA 1SJHB 4X2UA 4Z3HA 5IB1B 1NCUA 3ZN6A 4O51A 5DTFB 1GMGA 5FW6A 5FYLH 4JFED 3TJEL 3UTSB 3LN5B 4LLUA 4F7EA 1HNZB 3DHUA 2F5BH 2JGDA 2R9AA 5DMYA 4YIOA 4H0LB 3MA7A 1E27A 1WCBA 2HTLC 4N2GA 3V0FA 1NBCA 4NKGB 3AROA 4X4KA 4OGAC 5DQJB 1DDHB 4LF8O 4Y5VB 5CZVH 1RZJL 3SDXB 4MJHA 1TTUA 2A9MH 4U6VL 4OCMC 2N74A 3LDBB 4K0KO 3RWGB 4PRDB 1V55C 4WFFE 4B9GA 3T0AA 2J6EL 3PWPA 3QUGA 3CPLB 4F5CE 4WKZB 3IMVA 1OHHG 2WKOF 4N3UA 4YVUA 1NFIB 1S7TB 3B2EE 1U3NA 1RUMH 2ZONA 3K91A 5HYQA 4E4EA 5EN2A 3B4SA 3SPVA 4C47A 3ZL4H 3B2VH 4K7PX 4HV8B 2BHZA 2DMCA 3VXQB 4WFAV 3BSZH 4J4PA 1KTKE 4BD4A 5CFHA 3GEFA 3MRLB 5AKVA 4NNYB 4HD5A 3VXNA 4OLVH 5LHIA 1TIUA 2CO3A 5DGQA 3VWKD 3L73H 3RFZA 4J10A 4NXSA 1V3KA 4X5XA 2UXBO 2Y0IA 4OD1L 5EU7E 5F0JB 1NBYA 3GLDA 3N6YA 3O45A 5AKTA 2ITCC 1TEFA 1F8TL 1AZCA 1WG3A 4WEBH 1D5RA 1OGTA 4LASH 1CEZA 2HFTA 3NYKA 4NCC2 1JG9A 4PY8I 2DQCH 3OTOO 1OM9A 3I75B 2YUWA 4UZSA 3TCLB 4UTAH 4HT1L 1WZMA 4P2OB 3BFQG 4UCUA 2GABA 3U6RB 5CF3A 1MREH 4J7ZA 1CR9H 4JAUA 4W4OA 3N1QC 1F13A 3FRUA 4K0OA 1X5HA 1IGJB 4HEPA 2WNWA 2VRQA 1A14L 3TYGL 2FR4B 3O0RH 4QPJA 2ARHA 1UYWL 4LEEA 4QRRE 1EEYA 2NCEA 2VTFA 2O61B 4WU7B 2CO1A 2V4LA 4UYPA 3Q8BA 2EVFA 4PA6A 4PEEA 2MRYA 4A68A 3W3BA 1FBIL 2IWFA 3EBIA 4YK4B 4LDLB 3HNVL 4P2RD 1I5YA 3UDWA 1ROWA 4OIAA 1FHNA 3WXWL 5IFAH 1RULH 1HVXA 5EUKA 1U92A 2NTSP 1LO4H 3LDEA 2EP6A 1TQBB 3IAGC 4FQIL 3E38A 4FFYA 1I9IH 3O4OB 5IB2A 3WFDL 4KTGA 3TT3H 3H1HH 2EECA 1NH2D 4WFED 4DP9X 2PWFA 4YUEH 3JQOB 5F3HB 3L72H 5JHMA 3V0EA 3JVGA 1JV2B 1UATA 4KO5A 3BWAB 4G8FA 3NJMA 4QHMA 1TGOA 1NDMB 1M7IA 3D4ZA 3RBSA 1R3LB 5GGRY 5FV1L 3T77B 4FVMA 1DJXA 4RLDA 3ZT7A 4WWKA 2UXNA 1D7DA 2EKSA 2ZZUT 3GB7B 1VKXB 1XILA 1B0IA 3DBXA 3LRLA 1I3VA 1LO3H 5CJ8A 1OP9A 1A6UL 1FVDA 1XH3A 1U3HB 1X5FA 2GQHA 1ZSPA 1CFQA 4KDTA 1A2YA 4GYCB 1HXMB 5A2IH 5KN5A 2JKNA 5BV7L 1YJ9V 1IM3A 1JXDA 4Z77B 1E9PB 3SD5A 1I7TB 1H3TA 4R7CA 4P2QD 5KJRL 3SDDC 3WKNA 5BRQA 1DBMH 1TJIL 1YNLL 3KYNA 2VUYA 4LO9A 5CKAA 1GGBL 3C2SA 1FFOA 4U6HA 5LMNO 2DH2A 1BL8A 1WNSA 2CH8A 2QTVA 4QJ4B 4I1NB 4JLRB 3TA3C 3MRBB 4BZ1L 4ZFOA 1TU2B 1XGQA 1NGYB 3D7PA 1EGJH 1H8SA 4X8JB 3RNQA 3P3NA 4OV5A 2HVKA 4FQ2L 2XN0A 5IR1B 5HPOA 2J8UF 3JD0A 2SEBA 2PWHA 4IIJA 2XV3A 3D12B 5K9OB 1DVZA 1P5UB 2HRGA 2MNJB 1GMIA 1CGUA 1QRNB 2V7QG 1OD9A 1KTDA 1Q9LA 2OMXB 4YBHA 3EO1A 2DWXA 1LEGA 4OGQC 5HI5C 2ADGB 4I18B 3G7TA 3WIIL 3LEXA 5F7AA 3TBTB 3FQYA 1X5KA 1FE8H 3VE0B 5DJ0B 3RIAF 3APOA 4B3SO 1AP5A 1CFMA 1SJEA 2Y0SA 3CZFB 4G7SB 1LXMA 4JO4H 4YHNA 3UYPB 4AITA 2YPLA 3C6LD 1CDBA 3OZ9H 4MXWL 5KYXA 3LKQA 4AIZA 1GH7A 3A6OA 4AQ8C 1KUMA 1JYWA 1QR8A 4Q6YA 1WB7A 1CD8A 4JY5H 4NQED 5BRZA 4AI7A 3CVHH 4OFYA 3S36X 4YSOA 3R7QA 2Q0OC 1BMWA 3KHOA 1ONQA 1KP3A 2HJFB 1HYSC 1MG3C 2CXGA 2XG5B 4PFEA 2WLMA 2BTQA 2G60L 3VACA 2A06H 4WW2F 3MV8E 3T3PE 1N6VA 3GLZA 1SA0A 4M00A 3UC0H 2HR3A 5AVWB 3ARDB 3G6JE 1LR1A 3Q8CA 4D7TA 4Y4FB 5FHBL 2WZ6A 4MNQD 2GSGA 4XBMA 4R8CA 3BABA 5LN8A 4LVEA 3QG5A 2KLTA 2YXFA 1LTXA 2F08A 3P4OA 4H26B 4K07A 2OULB 4H7VA 4NNPL 4A7TA 2X89D 3OJMB 4BQBA 5FKAA 4WTZA 1EPFA 1OE2A 4MAYD 5C71A 3KPSB 1DTUA 2WVVB 4U6XB 5HDRA 4CADA 2JKXA 2X2IA 2DQDL 1E5CA 3E8VA 2MCMA 1OP4A 5KYUB 1T7VA 4K9EC 1FLRL 4A6YL 4DOHB 2EIBA 2OJEB 1OO2A 3QJRB 3BH9B 3HPJA 2YEQA 3BP5B 1KYOF 3KL3A 1MZZA 4NHCL 4ZPTA 1A9EA 3ZZLA 4QE9A 1J8KA 4JO5A 1CFSA 3F01A 1D5MB 1X7QA 4CVXB 1NMAL 1IMHC 1W0KG 2AXJA 4HUUA 1V7MH 1BF5A 2GBOA 4LNUA 4DUXA 1DN2A 3KDMA 3GD1C 4JI6O 5D2NA 2VLKA 3FU7B 5E03A 4RGNB 2QQNL 3SQOH 3MR9B 3TETA 3ATFA 1IEAB 5I71C 1BQHG 2I32A 3DUSA 1M71B 1QR9A 3KPMB 1OT4A 4DTGL 4EOWL 1EANA 4MMXA 1TTRA 2VYRE 4KKCC 3RU8L 4LCYB 4RDQG 4NAMA 4F92B 1LNUA 2IBGA 1IGCL 3HKDA 1IGFL 3DV6A 1BLNB 3O6FD 3ZTEA 5JHLH 4CDGC 1J1OH 1L6XA 1OK0A 3VFVB 5CLTA 4AQ1C 3X14B 4HCGA 1VEMA 3T1HO 1P1VA 4YSCA 2X0VA 4BV1A 3PXJA 3IS0X 2VDRL 4DVBA 4AIOA 3D25A 3RILA 2GT9B 1LE5A 2YJQA 3E89A 1Z5YD 1LP9F 3CFTA 5IYDO 2P7TB 1ZE3C 1YEDA 2ZXQA 1EHNA 7TAAA 2UVFA 3P11H 1BQ0A 1F11B 2EILC 2WSSG 4QGTA 3KBHE 5D2LE 3L71H 3HEIB 3A6CH 3N55A 1BJ1H 2GW5A 3C8DA 4R0LC 5JA8B 4NDMB 3V9EA 1CURA 1MCPL 4JF3A 5GGQH 4UB8Z 1K73W 2E8YA 4PLKD 2RQEA 5BNXD 3VI4F 2OS7A 1VEWA 1MRDH 5LA6A 1URZA 3QGVA 4N5ED 3OMAB 3VUAA 3PJSK 2Y2YA 4KZEH 5AWNL 3MRNB 3NCXA 4NSKB 1PLBA 4U1MB 3ZDZB 1CXFA 1FYTE 3SJAC 4X66O 4HUNB 4DEUA 4GRMA 3JWOL 3NK4A 1MRFL 3FUMA 1MQKH 3VTMA 4HS6A 1XCXA 4YIQA 3GQFA 2QR4A 2EXWD 3ULVL 3DVNA 1BAFH 1JI1A 5DJAA 2B16A 5DEFB 5ITZB 2B3IA 3ZHVA 4YJ2A 4B0MB 2DMKA 2H41A 3V6FB 1XGTB 2EEFA 4XC3L 1XT5A 4YX2L 3QQDB 3NCCB 4FNTA 1NMCC 3GVMA 1PZ5B 1XGYH 3FC8A 1FG2B 3ZMSA 4R5VA 3TBYA 3MJ9A 3K6SB 4GAGH 4MW8A 2F5AL 2GTZB 1HW7A 4N1HB 1N10A 4I3RH 5C0EA 3UCSC 1TFPA 4BK5C 4ZUVB 3C2AL 4WNQB 2XAQA 3GF8A 3GPEA 4PJ8D 4HPHA 5DMIH 5EIIA 1V55B 1NBQA 2O30A 3MV9E 1URIA 4TTDC 5T1DH 4ZRGA 3DUHA 4LSQH 4MVUA 4AV4A 1BSMA 1KN4L 4O2FB 2VXVL 2YKKA 4DP1X 2L7UA 3OGOE 2B4CL 2YEVA 4P06A 5LGJB 3L4YA 3KLSA 5DJXA 4Y16B 2OXGB 3QDJA 3GMRA 3UJIH 3DX7B 4GAAA 2XJKA 5MEPB 4CDHA 3K6FA 2AI0H 1HQ4A 4YOKA 4AGQA 1WWBX 4RO2A 3OAWA 3VD5A 1FZMA 1IXBA 4NBXB 1Y18B 4LMQE 1XNQO 1KKDA 3RYFA 2EDHA 3P0GB 3ZMEA 2H32A 2FH8A 4JGMA 2IH9A 3FOMA 3KLLA 3A2FA 3ZRCC 3CLFL 3SYQA 1SHWA 1P4BL 3NZ8B 4PA7A 1HHJA 4XMLH 1NANI 4DV0O 2ITCB 4MYWB 1UVQB 2NY5L 3QEQE 4Y2OB 4OF8A 3BA9A 3GXMA 2XN9A 1GKFA 5D4IA 3KPRE 4KFZC 4NTWA 1DBBL 1D5AA 3JALB 2HG0A 2CUHA 3L5HA 2XFXA 2ZOKA 4L4VA 4G59C 1LYQA 4X1YA 5C0BB 1KCWA 3MUHL 1YEJL 3UTSD 3O2DA 4QRUB 4JPRA 1E79G 2IQAB 1FJ1B 3HZYB 2PETA 3E1F1 4WCEV 2R1XA 4M1CD 1CFNB 4DKAA 1DLHB 5EIVA 4H25A 3QRFM 3ABGA 2NZ9D 4Y1AA 3QUHA 3F5WA 1EN5A 5I0ZA 4JM2C 2E27H 4H1LA 5ICYB 3NCYP 1F1AA 4XP4H 4AIEA 1IAOB 3ZEDA 5KX5B 1YCSA 4IEFB 4LLDA 3U1SL 2QWPB 5ENWB 4X0KB 1XR9B 1N0XH 1DQJB 4JR9H 3EGSB 1VQNV 2ZWSA 4B9FA 1NLDH 4Y5YA 4GW4A 2OYMA 2CLZB 1XF4B 2J2ZA 2Z4QA 3MX0A 2BERA 2K9FB 2VC2L 3A21A 5DK2A 2IH1C 2ZXWC 2J55A 4RH4A 3MCYA 2HKHH 2W6IG 4DUYB 5FV2A 3EOYG 3KBEA 5A2JH 2EE3A 2ZOWA 1Z3GH 3UJTL 4G5ZH 1UXWA 3H1LH 3G67A 2VS0A 4BAYA 1T83A 3BJLA 3Q3GA 1XZ0B 4L3EA 4A38A 5LWYL 3W57A 1MA1A 1BLIA 3FPYA 4DNLA 1DQQA 3E6FB 1LO5A 1E4HA 1DVFA 2X88A 4ZW5A 4GMSL 1J86A 2IJJA 4MX7B 3LV3A 4JZJA 4JUTA 5CMAB 1KEGL 4PH8A 3GIZL 3UG5A 4XVTL 4AQEA 4NRYB 3DROB 5DHVH 5KW9H 4HZAA 3W7TA 4ZS7L 3EJCA 2LQTA 3I6GB 5I0XA 1JN6B 1H38A 1QBLL 2FEEI 1N3NA 4KROC 5IQ9A 4DR7O 1C12B 2HJKA 5HJBA 1Y6KR 3TA3B 4E41A 5JMRA 4EE2A 2B5IC 4DR3O 2GBVA 3CG8A 4QRRB 3J27A 2WBJB 2QR0A 3GLEA 4W70A 3CC5A 3U2JA 4ANKA 2PUSA 3O6KL 3BVDB 2V7HB 3CE2A 1CN4A 1OAXL 4ZMTA 3Q2WA 1DEEA 3ECQA 4QXTB 1I9JL 1I8KA 5T3XE 2Z92B 4PBWD 5CR1A 4FKKA 4EFEA 1RUPL 4UZGA 4M7LH 3ML0A 1OARL 1JP5A 1A9BB 2XVGA 2BE3A 4YXHH 1YLBB 2R8SL 5F9WC 2A1WH 2QLYA 3K74B 2CLVB 3C08L 3TPUA 1S7WB 4OZFH 4Y4HA 4JVPA 1YEIH 3SY6A 5IM7A 2E5LO 43CAA 3CFQA 1CE1L 3KGTA 5D4HA 1MVUA 1NINA 4Z95L 3U7AA 4RFOL 3QISA 1QSEE 1WJ3A 4BH8A 4EXKA 1TUEB 5ANMB 2VZUA 3SE9H 2YMXL 1CD9B 3L5IA 3HZ3A 3IFOA 2VXUL 3MUZ1 4M7LT 4PY8J 2NUTA 3NAAL 5I30L 4XPAL 1HDMB 1Q8MA 1DVTA 3FB5A 3KVDD 4KAQL 3UGUA 3GMNA 3NZUA 5J6HB 4E9XA 1RIUL 3NESA 4OD2B 3O8XC 3U46B 2IW5A 1TMQA 1R3HA 3WIFA 3D05A 3ALWA 3TO2A 1T0MA 3IJ8A 4KK8D 1FPOA 3D85A 4P57B 3HNSH 1UWEH 4PJAE 3SDLA 1IGMH 1P7HL 2L4OA 3D9AL 4FZ1A 1IL1B 1CZ8H 1I8IB 2HJLB 2ZWNA 4B60A 1ZGLA 2AEPL 3MYJA 5K9QI 4EI5C 4GQRA 3L3DB 1KB9J 3ILQD 3LKNA 3TWCH 4XOCA 4NZ8A 3WB2A 3AC0A 3RYHA 4BUGA 1QFWI 5JUEL 2K6WA 1TVBA 2ZICA 1QRND 2CE6A 4LCVA 4L87A 1OTSC 4PV1C 5A2KH 1SQFA 3KG2A 5DUML 4OKVA 2CHWA 2IFFH 1VF5C 4PR5B 4WQOA 1XL4A 3ETEA 2NCMA 3ZDXE 5DUBA 4HMEA 3G5VA 5DO2D 2J1WA 3FFCA 1MJJA 4YDKL 4OZ4A 3ARGA 3MHHC 5KTEH 4FK5C 5I8KL 1ERNA 5CD5C 4IU2B 5IOPB 3CJJA 3U0PA 3CVBA 3D18B 4M9PA 3LZOA 5CN2A 4MTFA 3KPOB 4V1DA 1U8OA 3TN0A 2A6IB 2RALA 1FVEB 5I1EL 3BCCH 2E3VA 2MTAA 1G43A 4GO6B 3T04D 3W0WB 4HKJB 2DN7A 2EDTA 3QUZC 4H8QA 4LPUA 4HAKA 3GWOA 2EACA 4AQ1B 3I85A 3DDFA 1K5NB 4HSQA 3P3YA 1OTTD 2NQ3A 3F5TA 3ARDD 4DW2H 2FEDC 2N7BA 5LMUB 1UXSB 4Y4FD 4YDJA 4MNGE 1YQ2A 4KHXH 4QHLB 4U49A 4YSRA 1AXSB 2PTVA 4NLAA 4XP6H 5C7ZA 5B8CC 1S9YB 5B1AC 3VRJB 1U8PB 4M5YL 5C0AB 3NSDA 4UOQA 5IW3A 5BY1A 4QMEA 1G6RL 4R0LB 1ZPUA 3KPSD 4F7TA 3MGTB 2FHBA 3B9KA 1CLOH 4ABQA 2C9QA 4D9RD 2VIRB 3REVA 4RISH 1BGXH 2WVSA 4PJHB 4CW1A 1RHFA 1ZHBB 4NM8L 2XICA 2WXGA 5AYQA 5CU9A 2UWEB 3REWA 2GIYA 1UKTA 2NY4C 1W72H 1JFFA 4KK5D 3V6BR 3CFKB 4KTDH 2ICEC 1J5DA 4LVHC 1AS6A 1R24B 1S9WB 1JFHA 2EDLA 4UNUA 2BSKA 4FQHA 2NYYC 2VDQH 3BH8B 2AV7B 2XQ0A 5D70H 3HE7A 4PDMA 5LG1A 4G43B 4GKSB 5KJ7E 3V7AG 4R5XA 1DQMH 3LQAC 3FAVB 1O9GA 1MHHA 3MLVH 3P77A 5HY9A 2WLZA 3RWHA 2WYZA 2XWTB 2FSEB 3AU1A 5J6GA 4GG6A 5H37A 1SZTA 3RPBA 5KS9A 5GIRB 1ASQA 2OX5A 3OAAG 1SXSA 4YL4A 4DQOH 2DLTA 5I17A 2ODIA 1J9TA 2XKNB 3WD5L 2WJ7A 2ZP8A 4F33B 3TK1A 2WN2A 4HGMA 4ONHA 1IKFH 3O2VL 5B1KA 3UZEC 2CGRH 5T5NG 5AFAA 4L37B 4HBNA 5IKCA 2V9UA 3CZKA 4L4TB 3JD2A 2VQEB 1A8ZA 3H85A 4ZYKA 4KK9C 3BQUC 1AGEB 1FDLL 3IXAA 1DJHA 2FK9A 3GRWH 2VDOB 4XPFH 3I02B 5HGBA 4F15C 1S5HC 3QZNA 1WA1X 1RCYA 4U7OA 3FQRA 2H3OA 3KJ6H 1C5DB 5EO0A 3MBWA 4XWGH 4AYFA 2QM8A 3V6ZA 5C1MB 3CWGA 1QA9A 3R06A 3O65A 4K3DH 4JAMA 2UXFA 5E7FA 2WSKA 1TSRA 5H2FZ 5IJ9B 3D0VB 3OL2A 3D52A 2FB4L 4GKNB 2QLVB 2OL3L 1B4JH 4Z9KB 2GBUA 2BJML 2Z34A 4FLQA 4G7RB 4YY3O 4JN2A 2IAAC 5CCKL 2Q69A 3RZCC 2C9UA 2F7IA 2O6PA 5C0IB 1IAKB 4JPWH 4TOYH 4G8GA 4BSVA 4NB5A 2QM4A 5FM4A 2A6KB 4D0CB 3FU0A 1Z2KA 4TLKA 2QKIC 3MLXL 4AM0B 2W95A 5D1QA 3WE1A 4PJXE 1ODUA 2PUQT 1GZPA 3F7LA 5ACZA 3CYOA 2H3KA 2IBBA 1M1XA 3MXWL 2WINB 4OGAD 3Q2NA 1F3DH 1B90A 1FL3A 1UOWA 1R47A 1U0QA 3MODH 2Y7NA 3KWUA 2F6AA 3AY4A 3EFFB 3DX0A 1MDTA 4XP1L 3TEZA 1M56B 4JM2B 3HVNA 1UM5L 4Q9CA 1RIVH 1SLWA 1ZUQA 5DD6A 4NIYE 5BJTA 3SDAC 3QYMA 3W7XA 1FL6A 2A6JB 3BCDA 5EO9B 4XTRD 5GW7A 1E6OH 3K5SA 3CN2A 4JPVH 1H9DA 2X9XA 4LCIH 4F1SA 4NQUA 4WWOA 3CZNA 4P5TA 3V8CA 2JJTA 4Y16D 4J27A 2JKIS 2IAND 3BPLB 5FYJD 5BXZA 4AYMC 4BEIA 2CO6A 2IH1B 1DTOA 5L88L 2CKBB 3G5ZA 1KKCA 2R56L 1UJTA 3EYSL 1Q1PA 4HJJH 4H13B 1T7WA 4J2XA 1IQWH 5AZUA 3L08A 1RZJC 2OTUB 5TDPA 1IM9A 2XTJE 2ZCLH 4G8IA 5DZAA 1Q0EA 3CCUV 2ZXDA 3P4MA 1CT8A 4YMPA 4ZOLB 3QEQB 2ZYRA 1UZGA 4NM4L 2EIZB 3QDGE 2BNQA 2X4RA 3VDBA 2FBJH 3K4DA 4BKLB 3VFSA 4I0KA 1O6SB 1BVOA 4HZLA 1DN0B 5IB3B 3WIHL 2V1DA 1KECA 4JFZL 4HUCA 2NUPB 1GGCL 3VFWB 2UUAB 1T22B 4JQIA 4PB0L 2QTSA 4KROB 2YHGA 1DQKA 1YPZB 3FONB 3QQ4A 3L5XL 3BVNA 3I3DA 4HQQH 4DP7X 3BIKB 4JDEA 1LEIA 4U3FH 3APMA 4HC1A 1I08A 3JD3A 2ZIDA 3BZ4A 2D03H 4LLVA 3TS8A 2OSYA 4JFQB 4MRCA 4PREB 5G55A 3NH7H 2D7QA 4X42A 2JH2A 4QHKI 1M05A 3JBG7 5AEAA 2VDMB 5KVEH 1AJ7L 4J42A 3BLPX 4FTDA 4L1HA 4PW3A 4QD2E 2AK4E 1U8MB 35C8L 3RWEA 1JHLL 3CFMA 3PGDB 1GM8A 1B6QA 4LSSH 2P24A 5F70A 2O72A 5FFLA 3LDCA 4KI1A 2Z3YA 3AJ7A 3MFFA 5D9SA 3UG4A 2HUEA 2BMKB 3VRIB 1NIBA 4PQXA 3OJVC 2DQGH 3T8XB 1ZS8B 4LGRB 1INEL 4MJ5A 3M7OA 1GAFL 1E2ZA 5IQNA 4ZSOE 2D7OA 1Q6UA 3V5KB 3LB6D 3PNRB 5J4MA 1NCDH 5JW5A 2XTJC 5AKSA 1NTMH 1KB3A 1NM4A 1N8RW 4KK6C 4PWKA 4ZNCD 1NU1H 2Z65C 4BKTC 3LPWA 3L1GA 3FW6A 2J8OA 3KNBB 1JV5B 1KXQA 3J07A 5BOZG 1GIGL 1IC7H 4HCIA 3VQMA 1QVFU 4J28A 1FL5A 3FMGH 1SRDA 3O8XB 1EJOH 2OTLV 1MFCH 2A74A 3MROB 3SYCA 4JE0A 4F8PA 4MQSB 12E8H 3D5OF 1GRWA 3CX2A 4O4HA 3TA3D 5T1LA 4MVRA 4LL4A 4ZPVA 2FNWA 1EAQA 4QRRD 1Q4NX 4EI5B 1J5IA 3IJSB 5E94B 2LJ2A 3MBXL 1YTFB 2YD2A 4DAGL 5HVGB 5EEYA 3EDJA 2NLJC 1K8DA 5J3HC 3TX4A 3LPGA 4J3OG 3LN4B 3QB7C 4DGIL 5FB8B 3QHZL 2GITA 4OF5A 5BV7C 4ZUUA 2BDNH 4TUKL 3FQNA 2MOVA 1U8IB 4PV1B 2R72A 4C54A 4DHLA 2YICA 1NVPB 5C7XL 5HI5D 4J8QA 4NERA 2QSQA 1VF5B 1G4MA 2XX0A 4RBPK 3MNVA 5JR1H 5CJOH 2X4QB 4J9ZB 3EDKA 2NXYC 3JUYA 5KLVH 2BCKB 2CHXA 1BZ8A 2YBGA 2ID5A 2KLSA 1FXKC 3JSLA 4Q9BA 1G5AA 5I1IL 3P3RA 2HPOA 2LABA 5IK3B 5IMLA 3QFJB 1JGDA 1F6LL 4GY4A 4LOUC 1FORL 4NZTL 1SN5A 5LBSH 5IFJA 4KZDL 1FVCA 2UY7B 3V8OA 1VADB 1HYSD 4JRXA 1KXVC 1RJYA 2QE7G 1KIUB 2FT6A 2H26B 3OMZA 4TNVF 4Z7WF 1R6NA 1YN6B 4OU3A 4ZQKA 2R2BB 3KCPB 1MAML 4HS8L 1RPRA 1H6EA 3P30H 4LLWB 3MOBL 1P9MC 3OGCA 1KLGB 4HMDA 4CC1A 4NZDA 3GUFA 2C1PB 3INUH 4R83A 2AV1B 1S7XB 4PA4A 4N6RB 1KTBA 1WAPA 3L4CA 2ITFA 1TSHA 2Q4PA 4UT9A 5IVXB 1GGYA 2FYYB 3G04A 1T1ZB 4IOIB 4GINA 3O9WC 1IT9H 1DO5A 1NFAA 3GTNA 3X1FA 4PJ5A 1H3GA 1I5XA 3O11A 4GX1A 4LHUB 5B3SC 3QQXA 5I1DA 4ODSH 5A16B 5AB0A 2CNZA 1H15A 4X8AA 1NJ9A 4LOEA 1CDUA 3KPQB 4K5LA 1HOEA 4AXWB 2GJZA 4NI3A 2JE8A 4IGBC 3FT1A 3UJJH 2J8HA 2E7DA 3QUMA 3VSQA 5F7EL 2N1KA 2ZP0T 4LK4A 2J7LA 3QDMB 4OIIL 1NGWB 2FBOJ 2VQ1A 2VR7A 1WFOA 5EUOE 2ICEB 2C4FT 2YEZB 4LVHB 1IARB 3LCYA 4OVUA 4FQ1H 5EH1A 2Q73A 2N0MA 3W7SA 5D6CB 3RWCB 2DQIL 3TASA 4AJWA 1MMMA 3UKMA 5HGHB 3ARSA 5TE4H 3V4PB 1BMFG 1A1OB 1JZ7A 1T5XA 4IMKA 5BQDA 4OTXH 5LNDA 1AHMA 4AK1A 1E2WA 5DD5L 1JGLL 4G42A 4KKCD 4UCSA 1IGIH 4OZHB 4PGBB 1XO8A 3W0WD 5ACLA 5GSRB 1CB4A 2DDQH 4OCXL 3RL1A 1KN2L 1TZGH 3DURA 3PV6A 4JY4B 4F9PA 1G4YB 3ZKXC 4F58H 1OHQA 4N2LA 1FIEA 4X4XB 3ULVE 2OMBA 3MV8D 1MOEA 4FJCC 2ZPKH 4HH9A 5TGBA 1Y74A 2BSEA 2D7NA 3K6DA 3PYCA 2PO6C 3KEHA 3QPQC 4MAZA 1OM3H 3IPFA 3B2XA 5ACMA 5C0AD 1FIGH 2NY0B 1GHFL 1WBYB 4F15B 1S5HB 1HI6B 5IJVB 2VLLA 1NS1A 3NA9L 2IU0A 2FO8A 2OMWB 3TFKC 3E8HA 4RFNB 3ZOAA 1DVSA 1P6WA 3UERA 2DQUH 3S98A 1IBMO 2YAPA 2DQTL 1WP8A 3JWDL 2J43A 4WV1B 3WNPA 4W1TA 2CGOA 3CIQA 5I8CA 1Y4MA 4BWUA 1YYMH 4LRIC 1YNTA 4OZGE 3WFHB 3LRSB 3PUUA 4BGLA 3FB6B 4N4YB 4WU5A 4HWZA 4WHDA 4OM0H 1KBBA 4RSVA 4J41A 3WY2A 4PN6A 4MQTB 4MMYA 1UHVA 2LE9A 5B3NA 3IS1X 1XMOB 2ATKB 3HTLX 3UTTB 3KPNA 4MZ3A 4ZMYA 2Q0AA 3DX8A 5BZZA 4IM8A 5F1IB 1H2NA 4C55A 3Q2CA 3WHXA 4N8PA 3CMEV 1YSCA 3T09A 3U36A 3AT8A 5L2KA 3NP4A 3TF4A 7PCYA 4U3XA 5FK9B 1E5UI 1B0WA 3GSNA 4JZGA 1BFOA 5DEGB 1ZDQA 4UV4L 5J12B 5ID1A 4KTEH 4L8SA 5AUMA 3A0RA 1A65A 2VDPB 4HPYL 3A3YB 4MJ2A 5CMUA 1SLUA 4ODWB 4XCYA 1UFGA 3JWOC 4HUKB 4OXSA 5FS5A 3WLWC 2X1PA 2XFGB 4TTDD 5IVZA 4J1UA 4LCUA 2YKLL 1HSBB 3ILPB 4L4TD 3ULVC 3EBAA 4NPYA 4Y5XB 3LSOB 1QTYT 2HFGH 1M1SA 3TXSA 1QR1A 3TESA 4QO1B 3L95A 4TVPD 1I1RA 3EH5B 1QNMA 5B7EA 1VENA 1D5IL 3DHMA 1YO4A 4ZO6A 5E8EA 3T0XA 3TURA 4APQC 2R4SL 4S0HA 2AJVL 3GI8H 3N9GH 1NFDE 4DR5O 4MB1A 1CI5A 1LO0H 5TF0A 3RY6C 3J8F7 1MW1A 2EDXA 4HPOL 4OCYH 3MRMA 1K2DA 3VGFA 5IF0A 3K58A 4PRAA 2VAAA 1W0VB 4R9HA 3UADA 1FFTB 3GSOA 3X3GH 2B4CC 3CSYB 4AW7A 3BAEL 4KDWA 2OZ4A 3TC9A 4YGAB 4TV9A 2AJXH 2AFNA 2W60A 1SXAA 4NQCA 1IBKO 2DM7A 4G8EB 2A0LC 1KGYE 2R1YA 3WV0A 5TE6H 4XXCC 3PHQA 1JPEA 4FEIA 3ZRVA 5A43C 4TTGA 5IOKA 3EGXB 4GAJH 3WMSA 3EYOA 2LTQC 1BGYH 4PJXB 5BO1H 3UX9B 1U33A 2VISA 5I16B 5E23A 1TVHB 1A25A 3BMVA 2R29A 4M4RA 4PJ7A 2I69A 2Y7MA 4JM2D 2NY5C 4BJLA 2E7LA 4GS7C 2CWRA 3FN0H 4IU3B 2QWRB 5DK0B 1UM6L 5GGRB 3VXUA 2XWJA 5I6MA 3GZOA 3QH3A 1YEGL 2Y23A 4BW9A 2CHNA 3LNHA 4DVRH 3DUUA 5D7JB 7FABL 3ZUNC 1MJUL 1UFUA 4FJ6A 2BRRL 4LCCB 2LU5A 2ICWA 2VERA 2GC4C 3LVEA 3TP4A 2AQQA 1EO7A 3LSQA 3RWJA 4DO6A 1GC1L 3BAAA 1FAFA 4NYLB 3KGUA 4YZFE 3L3OB 2J12B 4J3OH 2UXDO 1CU4L 1NI8A 3G6DH 1ZWIA 1CL7H 3GJFA 3P2BA 4TVSa 3UTZB 2VLJB 4AILC 2RR3A 1BPLB 4YHLH 2AXHA 3O6ML 4N8CL 4N0YL 2X10A 2ZUQB 1NQTA 5IWAO 1KB5L 1QATA 4E9LA 4WO4C 3SE3A 4NOFA 1W8NA 1I9EA 1ADQL 1ILSA 5I5JA 1JR9A 4GBXC 3I6LD 3KDPB 4RESB 2R7EA 5AB9A 1I82A 1R3IH 3QEQD 5CUSH 3AZUA 1RPOA 4DV6O 1EZVX 2OJZL 4HJSA 3IGAB 3GXPA 1M6UA 4FXKA 1GM7A 4KXZI 3W11D 4JZ2A 4GFTB 2Z1PA 4M7JL 3ZKSD 2AJUH 1ZT4B 2F18A 2ZSVA 3OXRB 3QNZB 2OFQA 3ZDZF 4A2DA 4O02A 3QORB 1A7QH 4YFEA 3OAUH 4BR6A 2BX5A 1F41A 4M6MH 3F7YC 4KROD 4WEMB 5K39B 1GCYA 1F5WA 2DLFL 3PL6B 4UCOA 5ERWA 1FPTH 2FHFA 2BFVL 1KLFA 1NWOA 1QACA 4TNGA 2NLJB 3SGKC 3ETBJ 2FL5B 3QUKB 4G9DA 4OB5L 5IW6A 2F61A 3UPAA 2Y7OA 2E76C 2JJVA 5BV7B 1S78C 3VXSE 3K6OA 4BQ8A 5JJNB 1SVBA 2W0PA 3HRZC 5FA4B 5KSVB 1JWUA 4L1SA 1BG9A 4JFEA 2AZ2A 4IBLT 4N2FA 1N7ML 5TE7L 5FOJA 2YGOA 5JNYB 2HLAA 2FT7A 3IJYA 4F3FA 1Y67A 4BDVA 2A4ZA 2X4OB 4PCTA 2IGFL 4NHUB 1FXKB 1L0NH 1PG7W 1XHHA 2R1WA 3E6HB 4BA8A 1TJGL 3CFCH 3D2UB 4P9MH 3SPCA 2GFBB 2LU7A 2ZKHL 2UY6A 1HTYA 2D3VA 2XXMB 3ETSA 2YUVA 3ZKQD 4KUMA 2EICA 5EOCL 4IRZH 3SKMB 2JJUA 4LU5H 2CUMA 2XLLA 4OAWB 4MCZB 3WEXB 1J05B 2GEQA 3O8XD 2AABL 1GJWA 1KENL 1MFDH 5EBWA 3N42B 2UVEA 5DWUH 4NTXA 2BVQB 5H35A 4K7PY 3S5LA 4QDGA 1BQUA 1FFPB 1DJZA 1L5GB 3ZTNH 4ABWA 1FFXA 3OR6C 4ACTA 1RZFL 1B9ZA 4OQ1A 5D1ZI 3VWKA 3O9WB 4NS0A 3BFOA 4UQ3B 2RACA 5JOPE 3K72B 3O3EB 3CHSA 4EI5D 5KBMA 4Z3IA 1MCFA 1YTFD 3S3BB 2A9DA 4N0UE 3GZKA 3CC4V 1MRCL 4LQ1A 4YC2C 3AM8A 1IVLA 2HLEB 4QHKJ 2F66C 4HDIA 2CIKB 3RURA 4D9QE 5EO1A 2FJUB 2RNBA 2PXYB 3CCHA 4ZFZB 3ROOA 3EOTH 1WBZB 5T3XD 1NVPD 3JTTB 2Y24A 2AJ3B 4K23H 1J9RA 4M7ZB 1NIAA 3IMBA 4OLWL 3ZGIA 3BPZA 1BJ8A 4X99B 3CPWU 1T3FA 3VQLA 2UZYB 5CD5D 4K5NA 3BKCL 1G4RA 1K6QH 2JI2A 1VPOL 3VSTA 4OD1H 2OMUB 3S5YA 2QA4V 1CGYA 3QFJD 1IKNA 5DEDA 3GS7A 1HEHC 1J11A 1F8TH 2MCPH 3FCSB 3QEGL 3WY3A 1UG9A 3UZVB 3CC1A 4A6YB 3OR7C 2E74C 3QUZD 4WJ5B 4D9LH 5C8JB 4J8RB 2F9BT 4LOFA 3JARB 3VG0L 4NO5B 5T1JA 5KVFL 4XZUB 4HT1H 1E6JH 4CAGA 3IDXH 1M4KA 3MKGA 3ZKXB 4P4RA 3AXIA 3DJRA 4LP4A 4YO0B 2ADFH 2FEDD 2L7EA 4P9HL 4F7PA 1A6AA 5EORH 3CPUA 4F20A 2JKRM 2UUCO 2PO6B 4CVZA 3ZPDA 4WFEA 1SDYA 2GSIA 3FXIC 4M56A 25C8L 4M48L 4X6FA 3W56A 4AUYA 1UYWH 1I8MB 4GLRI 3PQYE 5F96L 1R1BA 1RZIA 3Q44A 2K0RA 3L5WA 5AAWA 4LHUD 1Q94B 4LH7A 1G9MH 3NCFB 3QPKA 4JVWA 4E9TA 3ULSB 5LLIC 5KMGB 3WXWH 2WXFA 2BSBA 4YGVB 3FQ2A 5C09B 5DSCB 2GSMB 1Y0LA 2WD0A 3NFSH 1P6FA 4I0XA 1ACCA 1LL1A 3D1MC 5L7XL 4Y9CA 3SE4A 4EKXA 3QDMD 2P8LA 3M8OL 3RDTA 4JG1H 1T1XA 4Y0GA 4ZMLA 2CJSA 4K8RD 3EO0B 1N36B 1AB3A 1U41A 2VW7A 1QWUA 5EUOB 3FQWA 1FO0A 3WS3A 4LPWA 1OPGL 5LOVA 3DBSA 1QLFB 2EIJC 3S36L 3STLB 1OXYA 3B9DA 5DHYA 1QRKA 5JIKA 1SM3H 4XAKE 1P69B 1LQSR 2W0FA 1TR7A 5DHXB 1HT6A 4N2EA 1JX9A 1MDAA 4YHYB 5JXAL 1SXNA 3UTPE 1IAIM 4HIHA 3SGJA 2FWUA 2F7QA 5FYKH 1UA7A 3BW9B 3EJPA 3MRFB 4N9GB 4PRIE 1K85A 1N2RA 1XGPA 4WHCA 1TZOA 1HHIA 2CPCA 4JAVA 3CTTA 1Y6MR 2Q3XA 1CTNA 3HMXH 4ODXB 5KJRH 4QYOA 2NQDA 2F53A 2QEJA 4JPIA 1TJIH 1U58A 1MHCB 4TUYA 2UX6A 3T2QA 5GGVL 3GXNA 3WBDA 4OJFH 1F6FB 4B7LA 1S5IL 3K9SA 3ARBA 4KK9D 4YDIL 1IZJA 1TNMA 2R15A 5F0LB 1I9RH 3FSVA 1SZXA 3GT6A 5MP6L 5EU6E 2AZAA 3C6LA 1O9WA 3G5WA 3GSRB 1JRHH 4ELKB 4H5SB 1P4LB 1W16A 3A4FA 5L6YL 1YECH 3EF4A 3UACA 5B3JF 4MASA 1CDGA 5DRNB 4APQB 1G9NH 4HWUA 3GKZA 2VDLL 4NQEA 4PA9A 4FX5A 4OT1H 3C5XA 3BUYB 2BOBC 4HW6A 4FZEH 4OZGB 3EXLA 4N85A 4HETA 3WIIH 4BYHA 5HHME 2JIXB 2GCYB 3RZCD 4M8QB 1XBRA 4KKAC 2Q86B 2OQJA 1OLZA 3GHEH 3Q6FB 2AXWA 1VZGA 4B9JA 2FJGB 4LDEB 1N34B 1NGXB 2HFEB 3KYAA 4P9PA 4P3DB 4Z0XB 4MXWH 4M62L 3UTTD 2NNAA 3MJ7A 1A6TA 2HG5A 2FEJA 5IHWA 5DUJA 1VACA 2ZE6A 1MCIA 4RA0C 1PG7X 4FXGC 4HJIA 5PCYA 1LVEA 2BSSA 4MAYA 1YMMA 4XBPB 4JREC 3VX1A 1QFHA 5EZLB 1IE4A 5I1JL 5KSUB 3ZE1E 3MBEC 2NY7H 3OKEA 1S3KH 2LTQB 5EBMC 2A7BA 5DVNA 2YMOA 4QXVA 1OF0A 4YNYA 2YUZA 2AXGA 4XBGA 2MW2B 2G4EA 2ZX5A 1XL6A 1TO4A 2YARA 5CWSB 1JPFB 2PWGA 4PS3A 2YXWA 4GS7B 4QI3A 5EULV 1VQOV 4MHHI 3I6SA 3E8UH 4ATWA 4LF4B 3B8NA 4I4WB 1S9VA 5LCVA 4ACPA 1RSOA 1OPOA 2NW2B 1L6ZA 2CLRA 4LKXB 1K5SA 2DQDH 4GNKB 2DQJH 2EYRB 3CCRV 2R2CA 2E4FA 1EBOA 2ZWYA 1RVFH 1J5OL 1J18A 3MJ8A 3O6FA 5EDSA 1HZHL 4U1JB 3G6JF 4OI8A 2Q9LA 3EOAA 5F9OL 1WBXB 1CI3M 1BF8A 3VD7A 1VF6A 1U95B 2YJLA 3A6BL 2ED8A 4GSRA 1GA2A 2QQNH 1DBKH 1NBZA 5HHNA 2YAEA 5FYLD 3K5RA 2O5XH 4DKFH 2EQDA 2EDKA 4AMKL 3TJTA 4ZMXA 5IHUH 3QWQB 3PWLB 4PJHF 2AF2A 1KELL 2DQFA 3QHFH 1SN2A 5EPMA 2F19H 2WWKT 3RU8H 1KG0B 2Y69C 2UWEF 1IGCH 2YD3A 3AG7A 1ETB1 1RURH 5KVMC 3BFWA 4FZ8H 1AGCB 1QQDA 3AS0A 3F12A 1YDXA 3F7YB 2VM9A 1WD8A 1Z5VA 2AAVA 2OKMA 2QL1A 5JIDA 3G9VA 3F6JA 1BM3H 1PLCA 1UGKA 3WNOA 5F3BA 4JFFB 4RAIA 1HOCB 4XPHH 2ADIA 3L3HB 3DO7A 1H3PH 3WMQA 3C8HA 3MRRA 1W59A 3HHMA 2GIXA 3TV3H 2QADC 1XGRB 2E76B 3BDBA 4BFBD 3X3FH 3IWVA 5IEKB 3OZKA 2DWEC 3RVYA 1RJZA 1MCPH 1E4XL 8FABA 5EG6C 1AQMA 3HRZB 4Z7QE 4ZNEA 4JGSA 5AG2A 4GMTH 3EIFA 1CBVH 1NL0L 2XQYA 3FO2A 1JPGB 3UCQA 2VLJD 3BEWB 3DX9B 2NX5E 5AVTB 1MFEL 2PPDA 3NCJH 3PPEA 5AWNH 5IT2L 2PW1B 5AVQB 2YIBD 5SWSE 5JXEA 2WBWB 4X9IA 2OXHA 2P5EA 1MRFH 2N04A 4ETYA 2XTJD 1SESA 5JH7B 5GSVB 2N59A 3ULVH 4UQ2A 1A7NL 5EIQA 1ETZB 3CFNA 2VMFA 4NENA 5ALCH 4I8DA 4HUVA 4JJ5B 2W07B 4P23C 4JM0A 3KLHD 4PJ0Z 5AW2B 5DLML 4MKMA 2OR9L 4O4JA 3EG9A 1CXZB 3U4EA 4LQFL 3WKYA 1U8JB 4P9OA 1GVIA 4B41A 2KHAA 2D73A 4U0QB 3VXRB 3QORD 3WJMA 5KG9A 2HLDG 2WNGA 2EIDA 2MH4A 4I5SA 3OR6B 2EUZA 2FYUH 5D7LB 4JL1A 1VZIA 3DC5A 2BW5A 3NPZB 3W81A 3EADA 2Q10A 4AYEC 1BT8A 2E8ZA 4F27A 5I0DA 4YHZL 2OAAA 4BZ2L 3OSVA 5J3HD 4HF5H 5HHPB 2X4PB 1YMHA 2CKNA 2IXQB 4AC2A 2PYFB 4TUUA 4YC2B 3MSPA 5GXBB 5KA6A 2XZAL 3HBPA 4FQJH 3HZKA 4HP5A 2FX9H 2X28A 3CFBA 3MXVL 4PJDE 3KD4A 2I27N 5ECJE 1AVAA 4P5MB 5B4MC 1I31A 4K3HA 3FTXA 3LPFA 4HEME 1X4XA 3EVKA 2X1OA 1JF1A 2WBXA 4HEPG 4C83A 1DANU 1Y1DA 3MNMA 3H9ZA 5DGRA 2Y5TA 4ONFH 2PKDA 3LN5A 1O0VA 2W9DH 2NXYD 4JM2F 2I9TB 3HR5A 1T5WA 2EAEA 2PYEA 3BVXA 3CLFH 1P4BH 3QK0A 2Y5EA 2PWEA 4OQTL 4CUCA 4XMPL 5HJ3A 3ZE0B 4LHJB 1FP5A 3D2UD 4UT6L 2JRIA 3VGBA 1BQHB 2IBZH 3ARUA 3GM8A 4LR3A 4Q2ZB 1QVOB 2MHAA 3C12A 3LN9A 3V95A 2WV3A 2GK0A 3OR7B 2E74B 1UJ3A 2TRHA 1NEZA 4GQPH 1IXMA 4CH4A 6CGTA 3QJFB 4A55A 5GGUA 2E7MA 1R5IB 5JHBA 3QJTB 4P5RA 4Y1AE 4L8DA 2RH0A 2WN3A 3DIFA 2PCFA 1F4HA 4LWSA 4I5BA 3ZQ9A 4F8TA 4KDVA 4KHTL 4YHOH 3T1YO 2MQCA 3VOUA 1RAMA 3MV11 2KL6A 2Y72A 4ELME 4Z7WA 3VGGA 4ZMVA 3MO1B 4QRQB 4UYQA 4YR6B 4ETQB 1Q43A 3O9WD 2WLLA 1C7TA 3EZ8A 1QSFE 4BSWB 2W38A 2W0LA 1HKFA 3G6AB 4XDJA 1BM7A 3QCUL 3ZHTA 1IEBB 1WRFA 3QAZC 3RWFA 3KL0A 3MJGX 3HG4A 4PJCB 3UPRB 4JI2B 3CXCU 2MKWA 4FL4C 4XVOA 4DV1B 1G6VK 1NIEA 3QT2A 1M7DB 4DCQB 3TOPA 2VQFO 2BOCB 2PXYD 3SB3A 3I75A 4ODTH 4WFGA 1SERA 2B8OT 5EIBC 1HL4A 1ET8A 2CIIB 4G5AA 3NJFA 2P45B 2VC2H 4LPYA 1ZTXH 3U6RA 4POUB 3LS4H 3PJLA 4KUZL 4MRBA 2EIJB 5C0JA 1IGJA 4HHGA 1ZGLM 2ZJSL 3T0DA 2O61A 3SCMC 1G7JA 3BEHA 2I60L 5DF0A 5MHSE 5I1HH 3S4SG 2FJSA 4XMTA 5LWYH 1N18A 3AITA 4MS8D 4YJZL 4X80L 5T5FA 2CO2A 3BN3B 1XH1A 2JLPA 5JHLA 3R0NA 1KEGH 5E2TL 4E41E 1EEQA 3QEUB 3LZQA 1G6UA 3BGFC 1F6AA 3ETTA 4KKPA 1CF8H 4JHVA 4NO0B 3GBML 4DGWC 3SPHA 3OKNB 4NWTL 3R65A 1AC0A 2PO6D 2Q6WB 4R26H 1CFTA 2FQFA 3QPQD 1M3IA 4R2GB 4ZTOH 5L2JA 4NYKA 3UOAB 1YC8A 1QBLH 3IAQA 4YHML 5JW4N 3P69A 1BZQK 3HKEB 1JUFA 3QJHB 2CAZC 3E35A 3T77A 1FQ9C 3PQYB 1G84A 5ES4B 1JCVA 2BH0A 4IYHA 3TO4B 1VKXA 1HNXO 2WM0A 4XO9A 2GTAA 5C09D 3H3PL 3IDNB 5IHBA 1SHSA 1MAJA 4JV5O 4I13B 5DFAA 3L16A 4JRYA 2I85A 1DVYA 4KMTH 5TH2A 4LPVA 1Q6IA 2BOBB 4WGWB 2QWNB 3D69A 5AYTA 1E9PA 4NKQB 1K4DB 2VDQB 2YSTA 3IETA 1PLGL 4JDZB 4PU2A 5HYJE 4MGXA 4QRPB 3ZHFA 4P49A 3PJSA 4H8UA 3RA7H 4TV3A 1TMCB 5L9DL 2XT9A 1QOKA 32C2B 3H55A 3VQVA 1E0OB 2WQSA 3HB3C 4JLRA 4QRTB 4Z95H 4E0RB 1MWOA 2AANA 3EJSA 3MRBA 4FXGB 1BEYH 2AITA 5C08A 1KYAA 4JREB 2ARWA 3UO1L 4LESA 3MAQA 1PYWB 1NTKH 3JWDC 2OYKA 5EYPB 2YMXH 2YIDA 3RWDB 1JGUL 4HWBL 2ZDIC 2F74A 3KCWA 3NFPB 2OL3B 4XPAH 5HFLA 1TQVA 4GXUM 1G7PB 3WNKA 4KAQH 3M7FB 1JTOA 5K9OA 2VDNB 3H6JA 3WLWD 2H5UA 5I1KL 3L4UA 2R23B 4LFCB 4JQVA 4MDJB 5DJ8B 1VARA 3L7EB 3DOSB 3B83A 2XACC 3RGVC 2ADGA 4G1EA 5AW0B 1EO8L 5EEWA 1KTLB 3BCFA 5IMMB 4FTVE 4NBYB 3WS6C 1ZAUA 5KVGH 1BOGA 3VFUB 4MWFB 1UM4H 1CPUA 2RA1A 5FKPA 4CGUB 3T6ZA 1XHXA 2LQRA 4N2NA 4GUOA 5ID0A 3N50A 4HIJA 4CMMB 1ZAGA 5JQIB 3H1IH 3CHXA 2EH8L 4APQD 3OF6D 3QA3A 4Q7DA 3FFCE 3BWSA 3N40P 1OGAE 2GKIA 3T2MA 1I94B 1FNFA 3K0WA 4TUJB 4Y9GA 4F37K 3HN8A 4JB9L 5DUMH 4W4KA 1PZ3A 1ZHKB 2ZX6A 3IXTB 5IVXF 5LDUA 4CC6A 1MCSA 3U1QA 4ZFFB 2JIXD 3HS0B 1DE4B 3TZVA 4S0TD 1X6LA 4PJAF 4UB0L 2BNRE 3S97C 1YUHA 4UIKH 5T1KB 2Z35A 1T2XA 1TVKB 4RNRB 3QXUA 3D4YA 1AI1L 1W9XA 4LSTL 1BAWA 3W5NA 2DYPA 4NT6B 4H26A 2X9YA 1IURA 2A0LD 5EBLC 4TQEL 4HJEA 3QUXB 5D7EA 2CJ3A 3AB0B 1PNLA 4TV8B 3RYIB 5INDA 3QS3A 3K08A 4ISVB 2ZCHL 3B2DC 4G1MA 1AYRA 2Y6TE 3PWNA 4G7QB 4PRHE 4WFHA 3WN5C 4BFNA 1R46A 4P3WA 1ZLWK 1ICTA 3WAJA 3M46A 3D2TA 5K59E 1LEKA 2ZOTA 3S96A 2N05A 1D5MA 4A2EA 3K2UH 4NJAL 4BIKA 5E24E 5F6IB 3FTGB 3NACL 3PHOB 1KFAL 4K2UL 1ZLWH 3UL4A 3WEMA 2O5ZH 1DQIA 3L48A 1MSWD 3B6SB 2VW6A 4UBDD 4QTHB 2DYSB 1EWHA 3MR9A 5G2NA 4XCEA 2VH5L 4J7RA 15C8H 1UENA 4GKJB 2CCVA 3KPMA 3P3SA 3NTCH 2VZTA 3CK0L 2LO1A 4LFBB 1QHQA 3QFDA 3VG9C 3C6SA 4LCYA 4NRZA 1OWWA 2QKAA 5DJCA 4UV9A 2I24N 4RWYH 1BLNA 3DX6B 1SUHA 5GONA 5EIIG 1E4KC 4WO4D 1SF3A 4X64B 3SJQC 2NT0A 2YUXA 3RTQB 3VFVA 1CK0L 3X14A 1NBMG 4HNAB 2XRAH 5DD3L 1NC2B 4QCIB 3WE6A 4XRCA 2A5UA 3GGWB 1FZOB 4DV4O 2VO8A 2QDOA 4GRLC 2GT9A 1ED3A 1N32B 3HE6A 3SYPA 4KY2A 2BNUB 4QUOA 3WTYA 2LLLA 2A2QT 5A40E 3WAKA 4P23B 8PAZA 3U9PL 1TJXA 3P2TA 1F11A 1CD1B 1GC1C 4JI8O 3BP6A 5F7KC 5E4AA 3WNJA 4ADGA 5IMKB 1NZ6A 1RU9L 4KXAA 4NDMA 3IJ7A 1P49A 3QNYB 3EJYC 3SE8L 4FFYH 3P9LB 2ZQMA 1OJHA 4JDTL 2VXQA 5IIEB 3MLZL 4PIRF 2NOYA 2G5UA 4JYAB 2CUGA 5FL7G 1S7QA 2WMPB 1IV8A 1G7LB 5HFMA 4MJIB 5FA3A 4X5WB 3WFBH 1UB6B 3O3UN 4JFFD 3O2VH 4FQPA 5K33A 4APXA 2X38A 3HPLC 4OZIA 3TU6A 1ZSHA 3EYVB 4IJ3C 4DQAA 1IFHL 1J7VR 2AEQH 2VWJA 3DGGB 4XNZC 1FDLH 1OAQH 4QNPE 1S78D 1J5EB 4N2OA 4ABMA 1UH2A 5DEFA 3ULUC 1EMTH 2F1MA 1B2WL 2YWYA 5LBQA 1YA5A 4B9ZA 3T0VA 5F21B 4L5FL 3X12A 2P80A 4GP8B 1ZS2A 5D7SL 1PZ5A 1T6WA 5AW4B 3MRHB 1GH6A 2G2RB 3HC2A 3UZQB 3WJJC 4BFJA 3CSPA 3FQ4A 2GTZA 2GB2A 4YJ3B 4TOIA 2G3ZA 4XCNB 2KH2B 2WXRA 3DVGA 2JJ2G 3NRQA 4R8WH 1O9ZA 4G6ML 2R4RL 4OZFA 2GJ6B 2ESVB 5IVOA 3BHPA 4AQYO 1IGYB 4X9GA 1UT2A 5EDXA 1UWXK 3RB7A 2GHZA 2IWGA 2JK5C 3F7KA 4YBLC 4FFVC 2BIQA 3OLIA 2VZSA 4UDTA 2WZ0A 3VH8A 3NJLA 3ZN1A 3AACA 2C26A 4PCYA 3T1FB 1QTSA 4KQ0A 1XQ8A 3X13B 3MCKB 2QTEA 4DGVL 4UV8A 1M6OB 5F89A 5L8KB 1UWXH 1PZUB 1BREA 2Q8BL 1JMZA 1KTCA 4A04A 4MD0B 1NCTA 4JN1L 1Q72L 2VQ4A 4F6RB 3GXDA 2IANA 3D8MA 1X5XA 1GGUA 4LDOB 5HGAB 1DVQA 4U1LA 4MTGA 5ADPH 5CZKA 3VXRD 1A4CA 5DRWA 5DFWH 3PLYA 2GTWB 5B1JC 5GRVL 5D7LD 5HD8D 4PJFB 1KBHA 3VFTA 3DGEA 2QV2A 4RQQB 3MA9H 4JHAL 1DVUA 5HYSA 1TPXC 3L9RB 3WGUB 4KV5E 1OOWA 2ZKYA 1H2SB 2D7TL 2G2PA 1MHPH 2ITCA 1HXYA 2AZ0A 1N5AA 4U2ZA 5KVFE 1AR5A 1OSZA 2WXQA 3C09B 2VQTA 3N41B 5IBTL 1IZKA 1NLBL 3DXAE 3EYQC 1PPJH 4LKCB 1T66C 3S35L 4PJDB 4TNWK 1MUJB 3JALA 2OCCC 3GRGA 4ZS6C 3W2DL 3VXSD 4PJXF 4FG6C 5EZJB 4LDCA 2BC4A 5I1GL 4U7MA 1FZJA 1PZSA 1SDDB 2JCWA 2R56H 3EYSH 4XXDA 1EAPB 1FA4A 2AEIT 1MWAA 1EFXB 2XPGA 3T8VA 1DLHA 3L3GB 2DYRC 4GLXA 2UXCO 5DD0L 2BNQE 1JZJA 5CJ5A 3SCMB 1UEMA 2APFA 4Q0XH 5ICZA 1JRHI 3HI6L 5ICYA 5JLZA 5KYWB 4XO5A 4NM4H 5DJZB 43C9B 5ENWA 5F7DB 1TZ8A 3NFNA 4F5CA 4FMTA 4PS4L 2MWCA 1EM1A 1IAIH 3CDGA 4W9JC 3PAVA 3SGDH 4CS4A 4PRPE 5A6IA 4KUCD 4MA8L 1JOYA 3TF7C 3Q5YA 4XC1H 4B3EA 4YPGB 1GGCH 4XDLA 1UQSA 2PN5A 4PB0H 1R0AL 3OSKA 2LV4A 3QDHA 4ELMB 1PEWA 3HHSB 2BTOA 1T20A 4XNUH 1AIFA 5MERA 3LS5L 2A3QA 1P5VB 3JAWA 1QSFB 4GOSA 4HXBL 1OZUA 4E2LA 2LFEA 3I9PA 2DPKA 3VFMB 4HCRA 2RCSL 2Y1AA 2CR0A 3QIBC 2PPEA 1AJ7H 3SO3B 3QZBA 5GRWA 5CSGA 4KQ3H 1JHLH 1T1WB 1VEPA 3W5MA 3CXFA 1NCHA 2PR4L 2KSDA 4MX7A 2ENYA 4QT5A 4TRPL 4D9QD 4GRWE 5CMAA 1P84F 1MXGA 3OUSA 3QIUA 2WYHA 3EJTA 4G7YH 4P9HC 2AZUA 2Z0UA 3SDDA 3I2CH 1W72A 2IQ9L 2HAZA 2YIHA 4JFOA 1K3EA 4JFXB 5AYUH 3RI5K 5DRXB 1JCKA 5D1ZA 3I6GA 1C8QA 4AK2A 1GAFH 3BE1L 1JN6A 4QIRA 3UROR 2IH8A 3NSYA 4KNQA 3T2OA 4DW1A 3HB3B 1PMYA 1R5VB 3BRGC 2VJ0A 3U0WL 3VJ6B 1SC5B 4HJGB 4N2MA 4GSDH 4QRRA 3WHE0 1HP8A 1LDSA 3PABA 3JAKB 3MNDA 4FN0A 4URKA 3UIZA 3FDWA 5ISZE 3DHPA 2V7HA 3BD3A 2H8PC 5DU7A 2AVGA 4AH2B 2F4VO 4Y1TA 5DT1L 2VXTH 3E8FA 4ESKA 1TLMA 1YQVH 1ZGLP 2Z92A 4FMFA 1M57B 1EZLA 4FMKA 4JG0L 4ZO8A 4RZCA 4FFZA 2CK0L 4CKVX 4R3SB 3RGVB 4G82A 2ATPB 3CH1A 1KPVB 4R2GD 3ZHQA 1SKVA 1CYGA 4MVZA 2YC1A 2V3FA 1NAML 4ES8A 1H2KA 4OBSA 3GRWA 5EB9A 5CINL 3ZE2B 4I87A 3PQYD 4TSBL 3TO4D 2Z7WA 2J8UE 1N0LB 4NKMA 4D8PA 3BT2H 4IMLB 2IALB 1BQLH 2ZWKA 3CMAV 3TBWA 5KYYA 3N42F 2EKJA 3CMOL 4R97C 3FF7A 5LHGA 5C7XH 4AG4H 5JCOC 1HDMA 3P40A 5J6HA 3GNML 1I1AB 1ADWA 4TS6A 2WPDG 4A2LA 1JGVL 3U46A 4KKAD 5F0MB 4QRPD 3MREA 4IKLA 4JFDE 4LCWE 1JERA 2CD0A 2YD9A 5HYJB 5JORB 5D1XE 4M3JA 1NKDA 4P57A 1EZSA 3C5ZC 2ZKWA 1ZTEA 4OFPA 4CA4A 3U9UA 4HH8A 3K6IA 5MENE 1IL1A 1OCZB 1A7RL 1KC5H 3RBGA 4MD4B 1FORH 4X6DE 1JXFA 2R69L 3L3DA 3WFEL 1R5WA 3ESUF 4GQZA 1LD9A 3KYOB 2B1AH 1SQPH 1AO7E 4NNXB 3D0LB 3WN5B 2D4FA 2Z91A 2PGGA 1DK1A 3QVAA 1NZRA 1Z9MA 4HS8H 3FU9A 4DV5B 2I25N 3JAMN 5IJ0A 3VNYA 4NZRL 1KNOB 3EBHA 3S8GB 3IDIB 4PB9L 1D3CA 1FXHA 5ABZA 1U8HB 1N8OE 3MMEA 3STZA 1D6VL 1ORSB 3DRQB 2ZQKA 2P49B 1TQCC 3FSAA 3RDJA 2A6IA 2AHYA 1P0SE 3OE7G 3QG7L 3VG9B 1NAKL 3QXDB 3O2DH 2HN7B 1F90L 1UZ6F 1BQSA 2HYMA 2DE0X 2DBJA 4IS6A 1G8MA 5L3GA 3EJUA 4XH2B 5FUOH 3F58H 5GISH 4OIIH 4PJEB 2IMMA 3UH8A 4MDIB 4FLVA 3DMMC 3B4NA 3AG1C 2OMNA 5E9DE 2B3RA 3MV8A 2OM5A 4ZD3H 1UXSA 4H1LH 5JIQA 4ANWA 5F7UA 1BD2E 3G6JA 4PV8B 3IU4L 1OAUL 3SODB 1LNQA 4YSAA 1D5BB 3VRJA 1U8PA 4GUCA 5B1BC 3TM6A 5D1XC 4ZT1A 3GMLB 3UGEA 3FX7A 5MEQA 4BIUA 3HG1B 3RIFK 2QDWA 4N90D 4ORZC 5A6MA 1NKOA 3H0TB 2CR3A 3MGTA 5DFVC 4P59L 1AGDA 2ZSWA 1FWXA 1TTAA 4FLYA 3UABA 1XH0A 4PJHA 1ZHBA 2WA4A 3CRRA 1GW0A 2F54E 2VW4A 2WYIA 2K1EA 3CAFA 3MLRH 4PRHB 3BESR 4WW2C 3SBRA 4YSEA 2NPLX 3S3DB 2UWEA 1WFIA 1TJHH 3ZJZA 1DSFH 1KLUA 1LP9E 3AADB 5JW3L 5FO8A 3CFKA 4IJ3B 4KI5C 5D72H 3FQUB 1UWFA 1YEEL 2ZM6O 4WUUE 2AQSA 1GJIA 5CLXA 3NA9H 3IFXA 4O2EA 3VI4E 4G43A 3EO9H 3MRPA 4LVNB 2EH7L 3RW0A 4CVWA 5CM1A 1UKSA 2Y4SA 3HLAB 3WL9B 1C1EH 1TETL 1QSZA 4U1NB 2FSEA 5I1CH 3I55V 1DBJH 1FHGA 1A7OL 4KQ4L 4OCRL 4R90H 5K1JA 4YLCA 5I76A 3OKLA 2IG2L 1AQ8A 5EF2A 3VD0A 2CDGA 3RTQD 4F57L 1E4WH 5D7HA 1TAEA 3POCA 4X7CC 1HNYA 1NC2D 1FFRA 4D0BA 1V7NH 2NY2C 3E2HC 4F33A 2B7DT 4YBLB 5JVDB 4F7MB 5J0BA 2YXLA 3VQXA 3GMOB 4JHWL 2QKCA 1PD6A 2UXXA 1ACXA 2DW4A 3FB7C 3CDCA 1P7QB 3M1OA 4P23D 2HJDA 2DLHA 2H2SC 3HKCA 2FATH 3SGEH 3U7WH 3KWWA 1E7UA 4JVUA 4V33A 4X7FC 2FSDA 1CD0A 2BWDA 5E00B 1ZT7B 3V0GA 2VN7A 1N6QL 5F7YC 1C5DA 1YEFL 4QAWA 4DZ8A 5JJJB 5DJCB 2C4XA 4OZGF 2HT4C 2QPDB 3PNWA 2B2XL 1BIIB 1VGKB 1XZWA 4FE9A 1CXHA 1L0QA 4LPTA 4MJID 4UV4H 1C8PA 4V2BA 3L4VA 2HH0H 4OIFA 4GKNA 5DK3A 4TSAH 2Q76A 3GSVB 1MVYA 3GDBA 3AGWA 3FAXA 5JQ6L 4YXWG 4PG9B 2G9KA 4HUWB 1FYTA 1GN6A 1YN7A 2XG4A 2Q6AA 2JJWA 1OKEA 4UTCA 4GW5B 1J10A 5IUSA 1YCIA 1IAKA 3E22B 1KJ2L 1BYOA 4XE5B 2ITDB 4NTYA 2UU9B 2N4IA 5B4MD 2OCCB 4OSUL 2I07B 3EYUH 5E2WL 3S6CA 1D5IH 1YHPA 2A6KA 4XWOC 3NXSA 5JPMC 4M1GH 4I89A 4F4LA 5D7IB 4AKPA 4WNJA 3VYOA 5L0QC 1OAZH 2AJVH 3C90A 4GSQA 1NSNH 4XNXL 5E4EC 3H9HB 1D7FA 3ZW3A 1M9WA 1HYRC 4M9OA 3UYRH 2XUMA 2X70A 2GJ6D 2ESVD 2DQEL 4WWPA 4BE6A 4XMKL 4N1EA 3NVQA 3N2GB 4LP8A 4JM2A 5JPNC 3UAEA 1A1NA 2H45A 5GZOD 2UYLA 1N12A 3CCVV 1A4JA 1YYLH 3T4YA 3MV9A 5CN3A 2BVPB 3V4UH 2Z8VC 3GK8L 1EDYA 1SQ2N 3A4DA 3OVUB 3C6EA 1GS6X 5CILH 1NIDA 4OGZA 3GSUB 1QUNB 4UOW0 4A66A 1CLYL 1A0QL 2CDFB 1IEHA 3DV4A 2ROXA 3FULA 2CBMA 4M4PA 5CGMA 1XGUA 2XOTA 2V5SA 4XPBL 1KPRA 1F4AA 1KGXA 1R6VA 2XY1A 3HMWH 5EC1C 3EBGA 3CU7A 1YEGH 4JYYA 1A47A 1ROCA 3QIBB 2BP8B 4P05A 7FABH 1X5AA 5ICXB 3AQXA 3DOIA 3QEQA 2X87A 2Y07H 3VFRA 4BRVA 1ES0A 1KCRH 5FNVA 3ZKNC 4BH7A 5EIBD 5D93C 1ZHLB 2HT3C 3SDYL 2XI9A 5GGTL 4L8CA 1EZVY 1R19A 3WIAA 3BO8A 2I7OA 1XEUA 4R4FL 1ANUA 4KKNA 2NQCA 1WIPA 4N8CH 3C60C 1PX3A 3DSFH 4U1KB 5IB3A 3VFGL 4Q6GA 1EFXD 1HHKB 3LTVA 4WY7L 1HINL 3ARFB 3SCMD 1S7SB 2MJWA 3EGDA 4WK2B 4I2XB 1U2CA 3QCVH 3FONA 4Q14A 3DC6A 3CQPA 5DRZA 3OHXB 4FLOA 3CSXA 3L75H 2QJDA 3S8WA 4NPKA 1DO6A 4JFQA 2D8KA 3WENA 2IAMC 4ONGH 5IJDC 4EMZA 2OW6A 5DQDL 2H8PB 1KXTB 1GY1A 4YZFF 3SJVB 2WWNA 3VFOB 3WSQH 2ZD9A 1FNEB 3K5NA 3FJTA 1JPTH 5C3IA 4IIQC 4YHKL 3I6KB 3WNLA 2VSKB 5CEYB 2LGWA 4FLZA 1S72V 2X4UB 1H5BC 5TPWL 4EN3B 4O4IB 2WB1A 5F9JB 3VRIA 5LJYH 1INDH 2EDJA 1AGFB 1T03L 2XIDA 2X4SA 1BS3A 2V2XB 4GKLA 1ZS8A 2NTFB 1E9QB 2DLFH 4LVOB 4GO8A 1DQLL 1JVLA 4QTFA 2BP0A 5IW1A 4JHUA 1QSFD 3V5KA 5BRPA 5CA1B 1S3RA 2G3MA 3V55A 1MVFA 1QLEH 3FBQA 4IOSD 3UMNA 4LF6B 3TTSA 2DQHL 4DV7B 4EJ1C 5BS0E 4X6BB 3ZYJA 2H2PC 5H37H 1SEBB 2WQAA 4RDBA 1JV5A 5H94B 3CP1A 2OYLA 3BKMH 4XN9A 3VW3H 2IPUG 4GRWB 2IOOA 3O8XA 2MPAH 4U33A 1WT5C 6FABL 1T0NB 5GRUL 1BAGA 3SKJL 3C5ZB 5EU3B 2IGFH 2YPVL 4JZOB 1DGSA 1ORQC 3HB3D 5IDJA 1EK3A 4LSPL 3SBPA 3PDOB 2ISDA 4CN6A 4F1ZA 3VD2A 5EZIL 1GZHC 4FQXB 4YEEA 4EI5A 5EOQL 2W65A 1JPSH 1M2VB 3Q9PA 1B0RB 1A3RH 4GKOA 5EOCH 5FB8A 4TXVB 4K15A 3RUGE 4TLUA 3O3AB 4E5XA 3QAQA 3CD4A 4HUXB 5ISZB 3DPBB 1NR1A 1KBGL 1ZV5A 2C9PA 1IBBA 2YS8A 3L3JA 4Z76B 1KENH 1F2XK 3RGVD 3LKOA 4Z7VB 4UQAA 1UUSA 1VIWA 3EH4B 1VQ9V 4GEJA 2ZX8A 3ZE0F 2K7PA 2I9LA 2X4QA 3T08A 1CICB 1K92A 2RBLA 3NZHL 4Z5RB 4GSXA 1KOAA 2BCKA 3HOGA 4PJGE 2NRDA 5KVDH 1NA8A 2K70A 3GRBA 2GUZB 3HR0A 1T89C 3L1OL 4RDQF 2NNFA 2WAMA 4PWIA 1JPST 3BN9C 1TQCB 5LGHL 5BZDA 4PBXA 4NQQA 3X2QC 1JHKL 4F8LA 2WWWA 4I9QA 4JX0A 1T2QL 2EO1A 3P73B 1TTBA 1QSEA 3QUZA 1Q9KA 4H8HA 4I50B 4KUCF 3ULAB 3L9DA 1LUWA 1Q9OA 3IBOA 4R7NB 5TF1L 3U83A 4Q4IA 3K7UA 3QZOA 1I1AD 2WWMD 3DMMB 3FT3A 4BM7A 4LLWA 2Y2WA 4KRPC 4OLWH 5GGSA 5AOKA 2HEPA 1GGIL 1MCWW 4P2RE 4WEEA 5DZJA 3KGSA 3BDYH 1BQZA 3W9EB 5HYJD 1JYXA 5B8CA 3OKOB 3JD4A 2LP7A 1Z9SA 4IHOA 1ZKAA 4PJCF 5B1BB 4W9IC 1T1ZA 3B43A 4IOIA 4WBNB 1F4WH 1W0WA 3DOHA 4OLZL 4PJAA 1V3MA 3G3LA 2AGJH 4S1RH 3VVWA 1U96A 2HRHA 3RX5A 4NB7A 2VWEE 1T0PB 4KOBA 2KPNA 2KQMA 4HK0B 4LHUA 4XVJL 3UTQA 4X6DB 4KNUA 3KPQA 2FZ3B 4HYTB 2WLHA 1QPPA 1F0LA 4N25A 3QJZA 1RK0A 3IWUA 1ZLDA 4XPGL 3U7YL 2KLRA 2F1BA 2HUHA 1NGWA 5C0FB 3SJCC 5DZOA 3MRCB 2XXFA 1PX8A 5TISZ 1KJVB 4M48H 4U0RC 2HVJC 1XMQB 4NQVB 5D6CA 4GW1B 1HH6A 4WGVB 3DYPA 2RFXA 5DMKA 4JPKL 1QWHA 4MLSA 3V4PA 3K2MC 3KBPA 3V0WL 4P2QE 5HHOB 4D3CH 1AHWB 1MJ8H 1Q38A 4PGBA 4DUZO 4OW6A 4MMZC 3BIBX 1HH9B 1YY8B 3JV4A 1AAJA 1EXUB 2IDSA 3A23A 4B3RB 5LXGL 5GJSL 2V2WA 2HHHB 5BZWA 4NUMA 3PJNA 4MCMA 1KJMB 5ITBL 4JQIH 4B53A 1F86A 2VQUA 1JGIA 1KEML 1PG7L 3E2HB 4I0PB 4OGYL 4DR4O 4X4XA 4GRLD 1F02I 3KE0A 3QIWB 1DLFL 4UTBA 4HC1H 1UB5A 4OGXH 1JZEA 1XCTA 1JZ3A 1N8ZA 1L7IL 3RVZA 4NI6A 1QZ1A 2LR4A 3BQUA 4MNGA 1ZHNB 3IKCB 2BS8A 4HCRL 2FIKA 2YAFA 2ZP9A 4L5FE 5HGGS 1FNSL 1S5HA 2JGUA 1HI6A 1T1YB 3EJYD 4I4TB 1JWSA 1X44A 3H4FA 3LKPB 4PRNB 1CLVA 1A6PA 3QNEA 1KJ3H 2VWEC 3U0ZA 5CBAB 4DN3L 1A9VA 1G5GA 2DM4A 3FO9B 3HI1B 4PRHD 1MCEA 1RPQA 2JCCB 3RX9A 2IH3B 5ESVB 2QBWA 4RMBA 2F54B 3LRSA 3OB0K 5GGVH 1OSPH 1IBHA 4YBQC 2PP9A 2WVTA 2X4TA 2IF7A 4CNIA 3B5HA 5D4QA 3RT3C 3RZCA 4U4IA 5CN0A 1AQKL 2CH7A 4K3JH 4JZNA 3ATBA 3HKZA 3ULUD 3OB0H 1KMIZ 4U3JB 2QVMA 4WUUB 5ETUB 4Y2DC 1T21B 1SY6L 5JPMB 4NQDB 1ZLEA 1IAII 2QKIA 2APSA 1BHAA 5L0QB 4QOKB 3SGDI 4FI7A 2FO4A 1OB0A 2OK0H 2DQ6A 4FJYA 3AUVA 4MJ6B 2M1KA 4MNQE 3MTRA 1EHLH 2ZXEB 1ILUA 4UM8B 3AQZA 4ODWA 3ZIAG 3MACL 4TM9A 3X11A 2GIMA 3KW7A 4XNBA 3O41B 4FFVD 4JFYB 2AERT 5TFSL 5JPNB 1UOLA 1MIEH 3SDAA 1XNRB 3UO2A 3B1UA 3G6BA 3BAWA 1RZKL 1K33A 3OAZH 3V4VB 2JDIG 1DBAL 1P7QD 2XA8L 1TLKA 4E36A 3LSOA 5K5YA 1PZCA 1M93A 1JDDA 2QEXV 3F7VC 3II1A 5MEOB 1LMIA 1HE7A 1SNRA 2X1QA 3QQNA 2X53A 1VFOA 2W88A 2Z9TA 4LNVA 3VWJC 2FJHB 4NJ9L 2VLRE 2Q68A 5IY5C 3CC2V 4NN7C 4P3CL 4BFIB 4NR1A 1NH6A 1AMYA 3I56V 1U3ZA 3D39B 1QHPA 3RIAK 2DWDA 5JTWA 1P2CA 3SBQA 1EUUA 3TNNB 3AVEA 4TULH 5KAIZ 2Q3AA 5EZOL 3FS9A 2QWQB 3L1EA 5GRJL 5EC1B 5C6WH 2J73A 1WZ1H 2Z4TA 1YC7A 3E83A 2D7MA 3ECBA 3H42H 5J2TB 4LF5B 1BF2A 2J6EA 1B0GB 4KDTC