2DYSB

Bovine heart cytochrome c oxidase modified by dccd
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dysB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dysB02
2PP8A 2XYBA 5B7MA 2AVFA 2DYSB 4G71B 1KCWA 1PLBA 1WS7A 2HX8A 1ZIAA 5AZUA 3WNJA 2IDUA 2BHFA 1L9OA 5E9NA 1KYAA 2FNWA 1GS7A 1NPJA 2PCFA 1A4CA 3ASOB 3PPSA 2PPAA 4KNUA 3U25A 2NRDA 4E9XA 2IH8A 3BVDB 3EHBB 4GP4B 2IDSA 3UAAA 3FU8A 3S3BB 3DTUB 1L9PA 1N68A 2YAOA 2BP8B 2QDWA 4BDVA 3OQRA 4JKNA 3N55A 5I6LA 2HRGA 2UX6A 2HX9A 1IUZA 3FSWA 5I6PA 2BP8A 1W6LA 4BWWA 2XV0A 5FC9A 2UXFA 2X87A 4DPCX 1OE1A 4FAAB 3OMAB 4NAJA 4UANA 1AG0A 3SBPA 4DP9X 1BQKA 2BW4A 3IN2A 2YXVA 3NP4A 1AS8A 1ILSA 3AG1B 1ETJA 1IBYA 4HCIA 3ZBMA 5B1JA 1BYPA 2PPCA 1OE2A 5I5IA 2YEVB 5TK4A 2R7EB 2GBAA 1M56B 3CVCA 4YSQA 3IN0A 1KCBA 1XB8A 5PCYA 3X1NA 3FU9A 2PLTA 4DP0X 1OV8A 2JKWA 1KBVA 1NIEA 4DP8X 1IKOP 2ZOOA 3IBOA 5B3SB 2XWZA 3GDCA 4KO5A 4HIPA 1SFDA 2VM3A 4YSPA 4A2HA 2HXAA 2B08A 1RCYA 2EIMB 3JT2A 1AR1B 1AZRA 5LDUA 1J9QA 2WSDA 3GXUB 3T9WA 2DYRB 2I7OA 4E9VA 1BXAA 3G5WA 4YSTA 3OD3A 2XXGA 5I6OA 2PPEA 1HAUA 3NSYA 2BW5A 2YAEA 4A68A 1E67A 3UAEA 3FS9A 2MRYA 4W1TA 2P80A 1ZIBA 1ASQA 1J9RA 1PZBA 1BYOA 3EF4A 2PPDA 1HFUA 2JXMA 2I7SA 1E5ZA 3FYIB 1GW0A 2XX1A 2AZAA 1XMEB 2IDTA 1A65A 1PF3A 3PAUA 3X1EA 1URIA 3ZDWA 2IWFA 2XU9A 4P5SA 2PP7A 1PZCA 1TEGA 3H4HA 3MX0B 4FA7B 1KGYE 1KBWA 3ERXA 5B1BB 2FTAA 4BXSV 3FT0A 3SBRA 3ABKB 2UXGA 2QPDB 3JTBA 3NJIA 5AFAA 1NIFA 1JZJA 1W8EA 5AKRA 3DKHA 3TBCA 3FSZA 1J5DA 1IC0A 1W6WA 4BWTA 1AZCA 2ZWNA 3QJRB 2VMJA 4BXVA 1E30A 1OCOB 2VSKB 1AAJA 1JZEA 3TU6A 1JERA 4TXVB 1FWXA 1NICA 1PAZA 1SF5A 3ASNB 2FT7A 1JVOA 4DP2X 2VSMB 7PAZA 3CG8A 1KDJA 2YXWA 1OE3A 3AW5A 3EH5B 3NJGA 4QKTA 3WI9A 6PAZA 2IDQA 1HAWA 4A66A 1SHXA 1XB3A 1JXGA 2W88A 1GS6X 3H56A 4G7QB 4WTQA 1OCZB 1V54B 3NJJA 4KO9A 4DP7X 4AKPA 3SQRA 1AIZA 4CSPA 1L9SA 1ILUA 2XV3A 4G72B 4YSRA 4PCYA 1ADWA 4G70B 3CZUB 1WAEA 4E9QA 3CVBA 1TKWA 2Y1AA 2YAMA 2CBPA 1CUOA 3ABMB 2DY2A 1GS8A 3N2JA 1XB6A 1L9RA 2HLEB 1NPNA 2EINB 1AS7A 4F7KA 5I6MA 1PMYA 3V9CA 4RH4A 2H5UA 3AG3B 2IWEA 3UADA 2UX7A 1X9UA 2DV6A 1SF3A 3OMNB 5D4HA 1ET7A 4JHVA 2Y69B 3H4FA 3EH4B 3PXLA 3X1BA 2OV0A 4A67A 2E86A 2FQGA 2CALA 2TSAA 2FT8A 1L9TA 1QNIA 1NWPA 3NSDA 5EHFA 3WKPA 3CVDA 4DP1X 2XVBA 1WA2X 3S3DB 2J57A 2EIKB 1ET8A 2GHZA 3TASA 4HHGA 4Q8BA 4WKXA 3CDZB 5A7EA 1NIBA 1NIAA 3QJVB 1NINA 3WIAA 1JZIA 1WA0X 1I53A 4YSUA 7PCYA 4UF7C 1ZDQA 1ET5A 1NZRA 1NIDA 4A2DA 2XLLA 4A2FA 2ZXWB 2EIJB 3SBQA 3X2QB 1GSKA 3AG2B 1AS6A 1R1CA 1SNRA 1MZYA 2PP9A 4M4RB 2IAAC 2WO3B 3ABGA 1OCRB 1AOZA 2OJ1A 2WO2B 2FWLB 3T6ZA 1NTDA 2W8CA 1PY0A 1WS8A 3QJTB 1AG6A 4F2FA 1L9QA 1PCSA 3NJKA 2CCWA 4GYBA 2PCYA 2UXVA 4UAHA 3NJLA 1JZGA 5I28A 3C75A 3TBBA 3QJUB 1JOIA 1ZDSA 4AX3A 5I6NA 3NP3A 2QT6A 4MFHA 4YL4A 1JZHA 1MDAA 3BQVA 2YAQA 4HALA 1V10A 1M57B 4A2GA 1PLCA 2YAFA 2ZONA 4E9YA 1M9WA 5I6KA 1B3IA 4YSAA 2J5WA 3PCYA 1E5YA 1SHWA 1SFHA 5B1JC 2Q9OA 3AG4B 1A3ZA 4L0PB 4AKOA 4N4YB 6PCYA 1SJMA 1SDDA 2XV2A 3FPXA 2OCCB 1FA4A 4P5RA 1A8ZA 1TU2A 2BWDA 2BZ7A 3NSFA 1PNCA 3NT0A 2YAHA 3WKQA 4NERA 4G7RB 1NDTA 2I85A 5PAZA 1TEFA 1GR7A 4GP8B 3X1FA 1BAWA 3RYMA 2EILB 2FJSA 2VW4A 4HHWA 2LLNA 3FPYA 1ZPUA 4Q89A 4W9ZA 3T6VA 4YSCA 1AZBA 3FQYA 2YAPA 1AZNA 1YLBB 4ENZA 2GSMB 3NJFA 4DPBX 1PZAA 1AZUA 3S8FB 2QDVA 3ZIYA 3QJQB 3QJSB 2GB2A 2IH9A 4KO6A 4KO7A 4AZUA 4KOBA 2R7EA 4DP6X 2XX0A 2YQBA 3AZUA 3FU7A 3UGEA 4DP5X 1J9TA 5I5JA 4K9JA 4A2EA 1ZV2A 2VW7A 3PLYA 3KW8A 4DPAX 2DWSA 3KW7A 2BO0A 2YARA 2GC4C 4M3HA 1BXUA 2J55A 4N8UA 3TA4D 5B1AB 2MTAA 3AY2A 2N0MA 1QLEB 5F7BA 3T6WA 4CSZA 4PAZA 1IBZA 2VM4A 1JXDA 1RZPA 3PAZA 4HCGA 3T71A 4ZK8A 4YSOA 2AZUA 1JVLA 2CUAA 1N70A 4E9RA 3NJMA 3GYRA 2QPEB 4KOCA 4GXFA 3S8GB 4GY4A 4G7SB 2H47C 2RACA 1OF0A 4YSEA 1X9RA 1JXFA 4E9TA 5D4IA 2A3TA 3NSCA 1BQRA 9PCYA 1J9SA 4HAKA 4NB7A 3UACA 2JFCA 4KNSA 4BDVB 1BXVA 1KDIA 4EF3A 3ZX1A 1MZZA 4YSSA 2XXFA 4KNTA 8PAZA 5B7EA 1ASOA 1F56A 2BZCA 2FQDA 1CURA 3IE9A 1BQ5A 1GY2A 1PNDA 3NJHA 2BP0A 1RZQA 3FSAA 1NWOA 1AANA 3T6XA 2J56A 5I5MA 1AACA 2VN3A 1CC3A 2GIMA 1A4BA 2XUWA 3EH3B 4BK5C 2X88A 1CYXA 5I26A 4YSDA 2AFNA 2CJ3A 2GC7C 2IWKA 2IDFA 4GP5B 4DP4X 1OOWA 2HRHA 4YVUA 3MBWB 2H3XC 1PLAA 1UATA 1VLXA 1QHQA 3L45A 3DIVA 5ANHA 4HCFA 3WG7B 1A4AA 3CDZA 5D4JA 1WA1X 2Q5BA 1CYWA 4JHUA 3V9EA 2BWIA 1DZ0A 4QLWA 1J5CA 5TK2A 3FYEB 2HX7A 5B7FA 1GYCA 1MG2C 2DWTA 2BP0B 3ABLB 3HB3B 4AI7A 1DYZA 5F7AA 1SDDB 2P80D 3D12B 3WNIA 3QPKA 3QQXA 3FSVA 3NJNA 4X4KA 2HZHA 2B3IA 3S3CB 3FU7B 4HZ1A 2FQEA 1JZFA 1BEXA 5IY5B 1GY1A 1EZLA 1ASPA 2VW6A 2TSBA 4AKQA 3NYKA 2PPFA 3PAVA 5B1KA 3IEAA 4E9WA 3OM3B 4F2EA 3UABA 4YVNA 1RKRA 2FT6A 1EHKB 1V55B 2UXTA 3FQ1A 3HEIB 3FQ2A 4E9SA 3OMIB 4BWUA 3X1GA 1OCCB 2FQFA 1KV7A 1AQ8A 1ID2A 1FFTB 1T5KA 2AANA 2GI0A 1MG3C 1E65A 2CAKA
chains in the Genus database with same CATH superfamily
1CFQA 5B7MA 3MCG1 3F58H 2RGSA 4G71B 3D3VB 1T20B 3W7TA 4Q97A 3DX6B 4TSBH 1R73A 4JAAA 1OPGL 4LLMA 4N90D 2OSLB 4HF5L 4GO8A 1I5XA 2AERT 3CNKA 3HMWH 3KCPB 4OM0H 4QGYA 2Q73A 2XKUA 1UM6L 4BKLA 4MA1C 1JYWA 2NRDA 1UOLA 1SBBA 2ZICA 2ZR2A 2EKSA 3TV3H 2WLKA 5EK0A 4TKWA 2IDSA 2XOKG 2P7TB 3LKQB 1QRNE 1JFQL 3IFLL 1WAAA 3CUPB 3W3BA 3NESA 4RBPH 3FU8A 1N67A 3NFSL 2XWCA 1L9PA 3QEHA 3SKNB 4OFIA 4ZZFA 4JI7O 4DV6O 3DX2A 4X99B 2HRGA 5LNGA 1IUZA 4PJIB 4GKZA 4LL1A 1W6LA 1TA8A 1OSZA 2DWEC 2X87A 3DBSA 5L2KD 1OE1A 4Y16B 2NUPA 3MRKA 3PJLA 1OV9A 4J42A 3G3LA 1I3RB 4WI3A 1PSKL 4MJ6A 4FYTA 5ILTH 3NP4A 1A32A 2PR9A 3WE6A 5JO5A 3LZFH 5DXWA 4B3EA 4UCUA 3EDEA 1DDTA 2KLRA 3HNTL 3OLEA 3NCMA 5E8PB 5FKPB 1S9WA 2KL6A 2AJ3B 3QJZA 2WXMA 3AACA 1AGDB 3IGAB 4P5TC 3E2HC 3MUZ1 4GI8A 2MOQA 3DVGA 5PCYA 4ELMF 4ZFOA 3TIEB 3L17A 2EEAA 3L2NA 3IFOB 2HMID 1KBVA 5C0ND 2X4TA 3QC5X 3HW7A 5HYEA 1EMTL 4JN2A 1L6PA 3ARGB 3TBVB 1OVZA 1G0XA 3IDMB 3NN8B 3MV7E 4U4BA 3VWJC 1SFDA 1Z9NA 3TPUB 4YSPA 3U2SA 5L3GA 5ICYB 4UT7L 5C0RL 5D1XC 3C60A 2NY7L 3HFML 1D6VH 4HKZB 5AW4B 2WYZA 3AS2A 4JJ5A 2J21A 2K1MA 3ZKXC 4JREC 4GI9A 3LXBA 1C1EH 4B08A 1H2SB 3HBPA 3ZMVA 4R6UA 3G5WA 3LZPA 4P48A 2E27L 1X5HA 2BFVL 3EYUL 3FFOA 4YSTA 5D70L 3RWDA 4U33A 3RY6A 2EXYD 3QYNA 2VUKA 4XP5H 1KB9K 4JVUA 3RL1B 3MLTA 4UUJA 1S7RB 2VDQL 2LOEA 5ADPL 1AMXA 4XXDB 1J9CT 1KXVA 4W1TA 3VI3A 3UTTE 1ZIBA 2ATPB 4ZOBA 5I30H 2CJUH 3CPLA 2A77H 1HFUA 3T3PF 1G0DA 3DX7A 4KFZC 4NR1A 2EIDA 2JQZA 2J6EA 2R39A 1A7RL 3L4VA 3VQ2C 1JV5B 2F58H 3CPLB 3ET9F 4NXKA 4P5SA 1T03H 5EIQA 4TSAH 1OQXA 2YGOA 5CLWA 4NHUA 1WTLA 1B2WL 1CVSC 2ZKWA 2E8YA 4KMQA 3OLIA 3JTBA 4H0GA 3HKCA 1VERA 1NIFA 2JJUA 1V27A 2NW2B 2CQVA 4Y2OA 1KU9A 2WXOA 1J1XL 1JTPA 1OP4A 1S5HA 1WAAE 3BHBA 3M6DA 3O3UN 3QJRB 4NZRL 3SCMC 2OK0H 32C2A 1ZHNA 1JPGB 4K8ZA 3HBGA 2F9BT 2YIDA 1RERA 4TXVB 1S3JA 5C07D 4KJWC 4AEIH 3BA9A 4IS6A 4ODHH 4ZUVB 5KANG 1H0DB 1IDSA 2G75B 3FB7B 3G5ZB 4Z95H 5FA4A 3VSVA 1MFBH 5DSCA 2EUVA 1B4JL 3GSWA 4QKTA 2XKNA 3W9EA 1D5BA 2HJLA 1A6WL 3E3QC 3MRDB 3FMGL 4XCNB 4YIQB 3QXWA 1PU0A 3FB6A 3HC2A 2DJMA 2ADYA 3FN0L 2WPGA 1QNZH 4WTQA 3TZVB 2WGNB 3R18A 3IJHB 3D0VA 3C60D 1N18A 3QXVA 4WNJA 4AQ8C 4I85A 4LPYA 4MS6A 4M6NL 5TQ0H 3B2UC 1GSMA 2A79B 1PJWA 4Q74A 4I5BB 5HVWA 3HUJA 3MXVL 5DRWB 3TCLB 3LPPA 1CFBA 3D09A 2OMYB 3DUUB 4PJBF 3QIWB 1FC2D 3X3GH 1SVBA 4B6ZA 4LCWB 2VIRB 2EDHA 3S88H 4H1LG 4ZFFA 1M1XB 4JRYE 2JVUA 3K71A 1A9BA 1VFMA 2AEQL 1TG8A 1TZ8A 2F1EA 2ICWB 2WN2A 3MCYA 5DS1A 4AIZB 5L9DH 1UD2A 1ZCRA 4PS7A 4DZBB 1B4LA 1R3JC 5D8JL 5J1TC 2YSTA 3VWJB 5MEND 1I7FA 2J43A 4YDJA 2WHVA 3IKCA 2FLBT 4A5UB 2V8LA 2R1XB 5D4QA 2HJFC 3MJGX 4J3SA 5IF0B 2VB5A 3WJJA 3UADA 5I73B 2EEBA 4O2EB 4PRID 1ET7A 3NCWA 4HSAC 3U9UB 2ITDA 5A43C 4JM0A 4Z7QB 3TIDB 2EDNA 2G2RB 3PP4H 1XNQO 3A4FA 2J6EH 4X4XA 1OY3B 2CBOA 5KG9B 3K6SB 4IOFC 4WFEA 4PLKD 4U1JB 5E5MB 3FAVB 4MNQD 3D05A 4AL8L 1QNIA 2ZXQA 1OAZL 5F7FA 1BD2D 1DJWA 3HC3L 5K1PA 3O6FD 3DUSA 4F5CE 4X64O 2KDYA 1UASA 2MOVA 3FKUS 2GHZA 3LHPH 2A9AA 3RU8L 3L4CA 5LBQA 1HQ4B 3CN1A 2YKLL 1WA0X 1CZ8H 3TFKC 4G28B 4X20A 3I6KA 4FQJH 3X3FL 4YWGL 1M4KA 2XAJA 5H37G 1E8XA 1OSYA 2ZX5A 3MLXL 4NN7C 5AW6B 3GFUA 2UUCB 4NO5B 2YPKA 4PI0A 4XOCA 3E8GA 4WI4A 5I19L 3T6ZA 4I7ZB 1X9QA 1H3XA 3U4EA 4NHCH 4G11A 4Z78A 2NNRA 3PHQA 3CAFA 1RZGA 4RMBA 2PO6B 4OZGF 4X6CB 2MCG1 2MQ0A 3ZE2E 2H3NA 2J12B 4K71B 4YBHA 4H0LC 1R0AH 3L4UA 3BC9A 4JFYA 2VTFA 3P0YL 1L7IH 4MD4A 2H3KA 3JUYA 5E56A 5C0BB 3QJUB 3GXNA 5LHHA 3V0DA 1EHXA 3OSVA 3MNDA 1NCDL 4J3UA 2QT6A 3VI4A 1BM3H 4HK0A 4UIKL 1HXKA 2X40A 5FF6A 4DV3O 2QV4A 4X5WB 5DA4A 1Y0LB 2W65A 3BQUB 4OW6A 1XF4B 1TPXB 4MGXA 4NC0B 5IROC 4E9YA 1MW2A 5I6KA 2AHZA 2HFEB 4I1RA 5CJXA 4YR6A 1SHWA 2DS4A 4YOKA 1K5SA 4KPHH 3L4TA 2FECI 3JTTA 5IMMA 3SE4A 1LXMA 5L9DL 2RR3A 1DJIA 4Z7OF 5LOVA 2PYJA 3SKMB 3CXHF 5D1XB 2OCCB 2YI8A 1TQWA 4IKIA 3NT0A 5EF1A 2YAHA 5DWUH 1GZHA 4JHWH 3QDMA 5C0EA 5CBAB 2ZF8A 3IDYB 4G7RB 4IEFA 5J9PC 4W4OA 3OKOA 5PAZA 3ZR6A 4Y19E 5TE4H 5HVHB 3JV4A 4GP8B 3WUWB 1NGXB 4XOAA 2B8OT 3AWEA 1F97A 3E6FB 1NTKH 4XP5L 4HBNA 2FJGA 1HL8A 1KFGA 4HIEB 1NQTA 4KTDL 4UB6Z 4XX1E 5C9JA 3CV5A 2F4VB 2B39A 3ELAT 4Y1AA 4BFRA 4GQZA 3THOA 2Q8AH 4EOWH 2JJ2G 3V0JA 4KPHL 2GB2A 1UTDA 1E2ZA 4AGMA 3BIBX 7TAAA 4NPKA 5CZVL 2XFGB 2ZWSA 3CCHA 3D3IA 3DX0A 2FX7L 1XNRO 4QWWC 1ZV2A 2P45B 1SDAB 5C0AD 2Y4UA 4DPAX 2DF3A 2EYRA 5TDOB 3QR0A 4I2XA 1YAZA 1WZAA 4Y16D 5JIKA 2YIBA 43C9A 1B0WA 4J39A 4YBLC 4XOBA 3A6BL 1PX3A 3B9KD 1GC1H 2AK4B 3ZE0E 2CG9X 2VCOA 5TQ2L 3JASA 4BQ6A 5TE7H 4PAZA 5E4AA 3L4YA 12E8L 4KXRA 3GS7A 2EYTA 3QG7L 3KLDA 3NQIA 4RRPG 5K9KB 3TA3A 1F13A 1P7QB 2E3VA 3HJ0A 2BSBA 2EYTB 5J2UB 1UJ3B 5BS0D 4PBDA 1QLEL 2F8VA 4GXFA 1QRKA 3MRNA 3ZGHA 4H2AA 1Q9OA 5T1MB 1V9PA 2DM7A 5B4MC 3FN9A 2W9DH 4I3SL 4UT7H 1DGSA 3NSCA 4N2GA 2IAMA 1IAII 3MNWB 1OCWL 3UACA 1HCVA 3Q0HA 4A7SA 2GFBB 1GH6A 5IKCB 4PJFB 3P9LB 5DURB 1X5MA 4J9ZB 2OIGA 2QM8A 1KDIA 1PYWA 3QHZL 4MCZA 2YPLB 4MNGE 3ESOA 3V6FA 1GIGH 2F2HA 4XODA 1ASOA 1CGSH 3QH3A 4G2KA 4J6IA 4UB0H 4RRPM 2ZYRA 2QGDA 4KY2A 3ZE0F 1RZQA 1TO4A 1FFPA 4W81A 1EEYB 2AEPL 2W38A 5F3BA 1GTOA 1U6AH 5C2BL 3TCTA 4G8GE 5A2IH 2W91A 2RD0A 3EFDL 2H0FA 1OJHA 2LR4A 3SQOH 4MA3B 3E83A 1UOWA 1PCXA 3B4SA 3QNXA 1QEXA 4TTGA 1PZ5A 5GIRB 3LB6C 3BIKA 2Q2EB 2H3XC 4PM1A 3JV6A 3L45A 4ONGL 2NYZA 2VDLL 3BO8B 3ESUF 4LKXB 3SDCA 2IMMA 2CTQA 1IGTB 2VLJA 3HLAB 2BVOA 4TUOB 4K7FB 4OZ4B 5EUKB 4YQXL 1P53A 4DCQA 3V9EA 2GSIB 3DIDA 5ID1A 3DO7B 1RK0A 1BFVH 3MSPA 4LF6O 3V4LA 3LVEA 3PDOA 1NOAA 2YLKA 2HX7A 4NOFA 4HKJA 2DWTA 5FM8A 4JO8A 1FSKC 4JI3O 4FXKC 5I75C 1QG3A 3FO0H 3IJYB 3V4VB 1JCVA 1Q6IA 2AJVL 3MNVA 4Y88A 1AI1L 3VX0A 4QJ4B 1WFTA 4NP4L 3VRIB 5CR1A 1EDQA 3D8CA 3B9AA 3F85A 4PYHA 3SE8H 2DYPA 1I9IH 1C9SA 1Q1JH 4D9LL 3F83A 3EADA 1CTNA 1UD5A 2WXHA 1G7QA 2FQEA 1NEZA 4PJHB 3ZSSA 3ETBJ 3DV4B 4TM9A 1QRNB 1HWYA 2OTWA 4OQTH 5DCCA 2BOCB 5GRUH 5C0BA 2OAAA 3KNBA 4ZMPA 5MEPA 1U8HA 5LGJB 2G9HA 4CC4A 1R5WA 1RY7B 2DQHL 3IEAA 1GA2A 3D7PA 4ONOA 4IRZH 3VYPA 5D2NB 4WKZA 2VDPH 1E4XL 5ALBL 1RD6A 2LP7A 4JFPA 4CW1B 4DFHA 1GN6A 4K71C 4TVPD 1EM1A 1CMOA 4DV0B 4L1BA 4AQEB 3OZLA 4Z76B 3Q05A 1CFMA 3PJSB 2NZ1A 5LMUB 1T0PB 3OLDA 4GKKO 2V7NB 3FH5A 1H6UA 4MMYA 3QIWD 4JY6B 4HW6A 43CAB 4GS7C 1BQ0A 1DBJL 4CC1A 2WWKO 3AMLA 1N2RA 4BD4A 3NBNA 1FAIL 2X6UA 1AFVL 1EZVX 1OW0A 2E9GA 2XT1B 4KHXL 4PRDB 4YWGH 1NANI 2YN3A 3U36B 4HMCA 5EZOH 2H26B 3VSQA 3DTXB 1AYRA 3CRRA 1E3XA 1S8DA 1CZ8L 1TZGH 2JCCA 2O93L 3LRMA 2ZP8A 3JYBA 2GK0B 4UI2A 3BUTA 4HX1A 2DBLL 4PP2A 4Z7VA 4B3MB 4MQXC 4J28A 5INCB 4YMPA 4LLUA 1F51A 4L37B 3O6FA 3U0PA 2L3BA 1JPEA 3HG1E 1NUGA 1A7BA 4V11A 1JFFB 5FYLL 5CP7B 2GITA 4ERSL 1AGCB 1U8NA 2GJ6D 3EFOB 2VLLA 3CXDL 3ARFC 5JVDA 5IW6A 3R4RA 1IARB 4F15B 2IH8A 3PP4L 4IQHA 3LH8A 4M5TA 3B6SA 3PREA 4WI8A 4CC5A 2LE9A 3BKYH 1VQOV 2KZ1B 4HXBL 4YFLI 4Z3FA 5JXED 1NH2D 2P5WB 2ZXAA 5I8OH 1NDMA 4B96A 4C4BA 4MX7B 5DJZB 5KOVC 3S3BB 3UTSB 4PSPA 3AXIA 2DBJA 1JCHA 2RQ6A 1N68A 5HHPA 1VQ8V 2P5WA 2QDWA 4TQHA 2EVGA 3QYCA 1TQUA 5C09A 3C8HA 1CF8H 1HE8A 2R2BB 1KIQA 3BPOB 3G5YA 4QIWF 4NKDB 4XBGA 4R7DB 5H4YA 5JIHA 3SDDA 1E1QG 4V2CB 4FFBA 5EIVA 3VFOA 4I5SA 1KIPB 2W92A 2Z92B 3EG9A 4TUJA 5F96H 2VXVH 4XPAL 3DARA 4OCRL 5JUEL 3SZKC 4WWKB 5DT1L 3ROLB 2WZPD 5GXBB 2R1WB 2XZZA 1J7VR 3I02B 4OFYD 5CLTA 4AJVA 3LKSB 5H2BB 2R0ZL 5L2JA 1QLFA 1Q4NX 4UT6A 4UZSA 1XR8B 1Y1UA 4Z9KB 1SS3A 1XOUA 2EIJC 5DEDA 4UWQB 3LIUA 2VR8A 3QFJE 4APQC 3PRZA 2PLTA 4LOEA 5HJBA 2GABA 1MCFA 4RZCB 1LK3L 5C8YA 4NO3B 1XXFC 1BZ8A 3X13A 2PTVA 4W9CC 1J88A 2TRYA 5AWNH 4DUYO 1LUWA 3GMOB 1ZHBA 4HIPA 3U6XA 3BESR 4OR1A 3BWUF 3N41B 4Y9FA 2UZPA 1P7GA 2NW3A 1JWSB 2R23B 4I0KA 1TQSA 1PL0A 1YYML 3LEYH 2L7QA 2J73A 5LDUA 3JD4A 1X4YA 1XH2A 1AD9B 3NZ8B 4P2QA 5D5ME 1N64H 2QTOA 3RKPA 3O8XC 4F7TB 5C0IA 2C1OB 3K2UL 3FHEA 5HGHA 1LHZA 3DX9B 5IHLB 3PV7A 5KSAA 5DR5L 3D69A 1YZBA 3PWVB 2BW5A 3N1QC 2VYRE 3QDME 3VRJB 2JQMA 3OHXA 4UYPA 4CH4A 3MKGA 3WEMA 2AJSL 3DHPA 3H3PL 3IB4A 4LQFL 5ESAB 2BJMH 5JIDA 3MLRL 3OAZK 4NQTA 1IC5H 3NUKA 3P3NA 4TQDA 3X1EA 4UNIA 1J5EB 3VGAB 4LVNB 1JPSL 2XQBH 3BJ91 4NKMA 3SQOL 2ZUWA 3PGDB 3BE1H 2WVVA 5L4JA 2RN9A 1Z9OA 1A6UL 1PKQA 1YMHA 4WIQA 1R33A 1JMXA 5FWRA 2CLZB 5C08E 3RWGA 3IYLW 2VZOA 5IQ7L 1RULH 3HMXA 3P73A 3Q1SL 4X4YB 4LEOB 1RI8A 1J5DA 3RIFF 4P46C 4XO5A 3T3PE 2XN9E 3HIZA 3K74B 1IZ3A 3CJJA 1CXZB 4JLRB 3VI4E 1CFVH 1GIGL 2QV2A 4L4TD 2N3JA 3FH8A 3TO4D 1EA9C 4JZJB 2VSKB 4EPSA 4PDLA 1H6FA 3IGAA 1DSFH 1YY8A 4NXNO 4MJ2A 4G80A 3O6LH 5GSRA 2FEDC 2DICA 3KDMB 3ZHDA 5KYNA 4J41A 3RL2A 1YYLH 4M8RA 3MV7B 4N9OB 3TN0C 2ZG1A 2D03L 3KYOA 3NFSH 4L4JA 5DZPA 3UDWC 4KK8C 4KUCD 1HP8A 3MV7A 1J0KA 1SY6H 4YDKL 2F66C 1FLRL 2VRAA 4PVBA 4XN5A 1ZJBA 2ZIMA 1P7QD 2HLAB 3N44F 4P46A 3V0VA 4G7QB 4FCAA 4PJ7B 1NFIB 2R15A 2WLZA 5IP4A 2Q7GA 1KLGB 1VQPV 2XC8A 3POHA 5F7EL 2ICES 3OKDB 3B9DA 1HT6A 3VTAA 4JM4L 3ZIMA 1S7XB 4HJUA 1BVKB 1IV8A 5TGBA 3DX7B 1E6JL 3MJ9L 3HG3A 4GW4B 2ZWLT 5DVKA 2GSGA 4XBPB 5DURD 3KJ4B 3SPGA 1H3WM 2WQWA 2BVUA 1EANA 2CBPA 3JCUZ 4HVBA 2F18A 4HH9A 1IM3A 5FECA 3KBHE 4U1MB 2YD9A 3IT8D 1US6A 4BQCA 4FZ0A 4B0MM 1NGWA 4CH5A 1R9FA 1PMYA 4I4WB 2DAVA 5JMRA 4KUZL 1ZRUA 4FM1A 1XSOA 1X9UA 5D7LD 1A4JA 2ICCA 1KCUH 4LEXH 3OR6A 1DZBA 3TWYA 5FDWA 3NCXA 3KYMA 3D8MA 4CS2A 1DQQB 1I7ZA 3PHOB 4E9LA 2H32H 3ZZLA 1KXQA 3NIGE 2VXUH 5IR1B 1IBLO 2X9ZA 3SQBB 5F6HI 1ZSHA 1BW8A 2EIKB 3ARQA 2VQFB 5KS9F 2YWYA 5LUMA 1ROCA 3HMXH 3O45A 3TBYB 3H53A 3UROR 5IR1A 3CDZB 2E7MA 3W9DB 3HZVA 1JMKC 3IRPX 5C70A 2QZ5A 2GUZA 4JPIB 3JAMN 1MRCL 2MQ3A 5CN2A 5E5LA 5H9CA 2I60H 3NCJH 2LQTA 4PJ9A 3BSHA 3AUVA 5IJ0A 1SNRA 1URFA 1ZJAA 3C8KB 3IXAB 4TUYB 4DV4O 3WU1A 4B9GA 5D7KD 1JPTL 1UGNA 1XCTB 1F00I 5FHAH 2CZNA 2XZQH 3L5XL 2H1PL 4PJIE 4ZFFB 3F5TA 4UIKH 3UOAB 4D0BB 5GGRA 3FQWA 4HWNA 4XCFH 2OMYA 4ZOEA 1OTTD 1UVQA 2ZSWA 1JZGA 3O0RH 5EU6A 2ZUQB 1AGEB 4AYDC 4BYHA 4RMTA 4O02H 2D8KA 1DQLH 2QPSA 1WE5A 3SKOB 1E9QA 1XCQA 2ZKYA 3DTDA 4HEPG 1MDTA 1NCBL 1NC2B 5CCHE 3KXFD 1A1NB 3F05A 2YAQA 4G7YH 5DFWH 2P5OA 1EFQA 1XMWA 3LV3A 2CXGA 3V0IA 5BV7L 3ETGA 1O6SB 4J3XA 3ARFA 3WBDA 4YSAA 2J5WA 1E5YA 2Z35B 1H19A 5AG9A 5LXGL 1GRWA 3RYCB 5K9JH 4F7TA 5LHGA 3FT4B 5HYJA 4U1GC 3O6FC 2QGCA 4NZJA 2ED9A 1EAQA 2GJ6E 3FZUD 1CBVL 2UZXB 1XQ4A 1QFWL 4ZIBA 1BFOA 4AZ8A 3FPXA 5DJXB 3D52A 2CRMA 1XHXA 1A8ZA 1YMMB 1F5WA 2W07A 4X98A 2V7HA 3TGUH 4F8LA 2F5AL 2WZAA 1OZ0A 1DEEA 2IVFC 4WF7A 2VJ0A 1HHHB 2ADJB 5IFJA 4ZMLA 5IJDC 4HUCA 3QUYD 3O2VL 2ZUXA 2Y48A 3ZMRA 2OMUA 3LKOB 4YY3B 2VC2H 2IGLA 4YSCA 2CA3A 2KZBA 3FQYA 1HOEA 4NXMO 2ETWA 4W9EC 2VDOL 4U3CA 5CKAA 2K7PA 1LK2A 3CZFA 4NKIL 4QRSA 1NH2B 4JAVA 3R1GH 3TO4C 4NB5A 2CLZA 3S8FB 1S7SA 2J1WA 5CEZL 3IMRA 1JGEA 3QQ3A 1NM9A 2PWGA 3BHPA 4YHNA 1MSPA 4G1EB 3WS6C 1VHPA 4LCUB 1S7SB 3LQMA 3AZUA 1TT6A 5AVZB 2A4EA 1ZOXA 3MTXA 3X11A 4I89A 1JFHA 4LGSB 5K1JA 4ATTA 4F24A 1KGWA 2BO0A 3OUSA 3M1BA 1SJHA 3QHZH 2A6KB 3MJ7B 1NGPH 4NFDA 3RWRD 1K73W 2APXA 2J1YA 3BSGA 3WIFB 2ZT9B 3SO5A 4F92B 2ILLA 3U2IA 3MJ9A 4K9EC 1IBZA 1HESA 4XR8C 3NAAL 1B3JA 3V7MA 1JRHL 4HCGA 4JI0B 4FXKA 1QUPA 1RZKH 4MTFA 4C83B 3AS3A 4XGZB 3H01A 1ANUA 4YJ2B 1XF5B 1L7TH 2LFEA 4EJ1C 1R5IA 2AABH 5ABZA 4Z0BH 4ALAH 3U11A 2JF1A 3HB3C 3EYQC 3HNSH 2X9WA 3L3OA 3M8OH 1KPVA 1Y74A 1I7RA 1GGIL 5GZND 1S7RA 1IC7H 1CF1A 2GIYA 1YCIA 3FNKA 4GFTB 3SDCC 2AJXL 5EA0L 4WWID 1OIOA 1WJZA 2EZ0C 4RGND 5GGUB 1TJHL 3BMVA 1IGFH 4CH6A 4EIGB 4KZCA 2MTPA 1YNLH 3OKLA 2VO5A 5GGRY 4AUJA 2R29A 2JH2A 2NTFA 4YSSA 2NLJB 5FO9B 4ZAKD 1GXEA 2A9BA 4RGNE 1VFBB 4TV9B 3S98A 4J6RH 3J80N 5B8CA 5FXCH 4EDXB 3VWKC 1OCOC 3NGBC 1GKEA 4PJ8A 1FZMB 1ZA3A 1A3QA 3RI5K 4LF7O 4Y2OB 5C0AE 1TQBC 3QEUA 5F3FA 4PWIA 5DJCA 3KM1A 4OUOA 3T4YA 4HG4J 2SEBB 3FDWA 4U1GB 5JOFB 3AT8A 1QFUL 1WAZA 3CSYB 4NQUA 4NGHL 1BZ7A 4NDMB 1Z66A 3QUKA 3DI3B 5CCKH 3NXSA 3ZYZA 3CZNA 3MGAA 3VGGA 1BECA 3VM5A 2R2BA 1YEIL 1Z5HA 2K1EA 2F7IA 2IAMC 3GB7B 1EHLH 5CO1A 3WG7B 4DVRL 3CDZA 2BSKA 3BWUC 5TE6H 3ZUCA 3HAEH 3PWPB 1S3RA 4U1NA 1SEQL 3D9AL 4JUSA 3WEOA 1QVOB 1NAKL 1NPUA 3HZYA 2R0LL 4UNTA 4YIPA 3P30L 5JZ7D 1U8MB 4MZ2A 4YZFF 4A7TA 4N8CH 5JHBA 1A66A 1G5GA 4JM4H 2B5IB 2R1YB 4OJFL 3QPKA 3L1OL 1T4WA 1V7NL 5DZLA 4GAFB 1MN4A 3MPCA 3O4LE 1BVLA 2R1YA 1C8QA 1M42A 4LHUB 4XMLL 2Z6FA 4XNDA 4TSAL 3BN3B 3GJEB 2YIBD 4J3OG 4H37A 3X12B 1MXGA 4R7XA 1A25A 4JZ2A 2QEJA 2RJZA 4AKQA 5D96C 1ZLSL 4PJHE 2WVUA 3CCSV 3MUUA 2VLJD 4Z1MG 2EIZA 3D0LA 4RDQF 4CRPA 5KW9L 4LPCA 2CRIA 5AVVB 4CNIB 2NZIA 2YZ1A 4OZFA 1I7TB 3HEIB 3GEFA 1OTUD 3FQ2A 1BMZA 2BIQA 1L0LH 5IEKA 3KPLB 5E4EB 2APTA 4WHTB 5INDB 3NZSA 5EIIA 5B39G 2OA9A 3PWUB 5F2FA 3UAJC 3Q1SH 4JI6B 5FW6A 1IKNA 4M61A 5HHXH 5F70A 4X4XB 3BP6B 3MLXH 2HEPA 3IKKA 4G9DB 3OKMB 1U58B 1T7WA 2PW2A 4GRWB 2EYSB 2LV4A 2B1GA 3UTQB 3ZYJA 5F89A 3SDCB 3QUXD 1HYSD 4UOW1 1DCEA 4MVUA 1QPXA 8FABA 5KANI 3BEVA 1JUFB 5IFHL 2VLRB 5I2IA 2NY2C 1G9NC 1WS7A 1ZLSH 1UJTA 4ZKIA 1EUUA 1D9KC 1DJGA 1U3HB 2QSCH 4M7KL 4Z7UB 3WNJA 5D7LB 1XGPB 3TP4A 2Q67A 3TO2B 2XTAA 4HH8A 3KYKH 3HPJB 4JFVA 1PIGA 3CN0A 4KGJA 3OV6A 4TVSa 1SEBA 5EU3B 4KNUA 1AXTL 4IRJC 1WUZA 2A6JA 2FLRT 4E9XA 2XASA 1YECL 2A9CA 3K80A 3PDOB 4UVBA 4QRBA 1K8IA 3G6AA 4UB0L 3U4EB 3T0EC 4Z78B 5E9AA 4R0LC 3G5VA 4HIIB 5DHYA 3GI9L 4Z7OE 5CA1A 1N0LA 4KU1A 3G5VB 4HIIA 4U7SA 5E9DB 1H6TA 1WEJH 3M17B 2DQ3A 2UX6A 3FOLB 3FSWA 5EYPB 1X7TA 2HP8A 4D8PB 3EFFK 3M17A 1KIRA 1TGOA 4KRPD 3BGAA 2BIMA 3UYOD 4DP9X 4IRSC 2OSLA 1BLNA 3OR7B 1PX8A 1YPZF 1Y0LA 3BQUA 1XZWA 2E56A 1ADQL 5TH2A 1TCRB 4F57H 3OE7G 3KKYA 2MCMA 3PNWA 5GQBA 2Q6WB 4OGYH 1BA9A 1Q38A 4V33A 4AQEA 1JVKA 4Z76A 3BX7C 3WIHL 1MJ7L 3MGOB 1S5LZ 4X42A 3N2KB 3MJ6A 4UQAA 2NDGA 4DV2B 3V95A 5LWYL 3X2QC 3TEYA 1MNGA 1L3NA 1NC4D 1AQHA 3BDYH 4WDIA 1I9RL 3ARDA 3U6RA 3ARED 3HKDA 4OZGE 4MQXD 5JW4Q 3BRDA 2EVHA 4DUZB 1QKZL 4YE0A 1ND0B 1NC2D 3OTOO 4QEGA 1IKOP 1MKFA 5GGVY 3I55V 3H42L 4I77L 4C58B 5LP6A 1FZOA 1CGUA 1L0NH 2ZF9A 4ODHL 2JJTC 2XAHA 2I07B 5L8LB 5DVPA 4M1CC 1X7SA 1CDUA 5LA6A 2HXAA 3G04B 2J88L 3ULAB 3T5WA 4L8CA 5A2KH 2X2IA 3D4GA 3JD3A 1U93A 1ITBB 3WJJC 4LF4O 4XE0A 2UY6B 2HJFA 1DFBL 4GSXA 3VXMA 3ULVD 2P06A 1CFNA 1UWEH 1ROWA 2NX5A 3UO8B 4Z0BL 3ZQ9A 4ALAL 3UERA 3EYSH 1HAUA 2VNCA 1CR9H 5KAQF 4GG6E 1TO5A 1CS6A 2YSUB 1DJSA 2XWDA 4AILC 2NX5B 3FS9A 4H8WH 4OIBA 4RETB 3FRPA 3QCUL 4S10A 5TE4L 4A6YB 1X5KA 1MCEA 5CD3A 2FWSA 1BYOA 4UOQA 2PPDA 1LWHA 2I7SA 2WZ6A 1M3JA 1I9JL 3S97C 5CD5C 1LNUB 5T1KB 1LR1A 5B1BB 1J1PH 3FT3B 1BBDL 3HE7D 5C09E 2ZM6O 1QVOA 4OJDH 2VDPB 4QHUA 2D4DA 4PJGB 5AFAA 5CGYC 1JBJA 1SLVA 2FGWH 4AGLA 3L3KA 4ZMWA 4KHTH 4JHAL 3B2PA 2GHWB 4ZW5A 2Q7NA 4KJYB 2OMXB 3K4AA 2QGNA 1FNSL 3FOMA 3KCWA 1IBHA 3MRBA 5A2QN 1CEZA 2MFNA 2BIIA 3W7WA 1A7NH 2ZE7A 2FH8A 3VFMA 2FWOA 3V5KA 3OB8A 4DP2X 1JVOA 3CCLV 4MQSB 4MTXA 7PAZA 3H9ZA 2JK5C 3CG8A 1KDJA 2B16A 3B8SA 6PAZA 3DX1A 4LOVA 1HAWA 3EOAA 4YDNA 4A66A 3AK1A 1KJ2H 1AR5A 3PQYE 4XO8A 3ZLQC 5KBNC 5CCGE 3II2A 1NGXA 1UZ8A 1MFAL 4EKJA 3HOGA 1PVHA 3ARFB 2AABL 1N9PA 1T1YA 3CXHK 1CDGA 5DJ0B 1JD9A 4PRHD 2CUIA 1ACXA 1N8OE 5AVWB 4GKJB 4PV1B 4D0DA 3RPBA 1D5MA 3P0VL 1CLYH 5I1IL 3S96B 3GSXB 5BNXD 4P2RE 3BP6A 4BQBA 1VIWA 3ZL1A 5KSAB 4M43H 5E8OA 2YAMA 3MNMA 2OJZL 4I1PA 4NQCD 3F62A 1FQ9C 3IJEB 2WWMC 2NSXA 1SJVA 3RX8A 1RP8A 3JWOC 4AM0A 1BOGA 5DTFB 3VVVA 2LTQB 3O3BA 3W7UA 5IQ9B 3V9CA 1G7PB 2QQQA 2FYYA 4NSKA 1SQBH 4AQYB 1ZLUH 3UTPD 1E8YA 4PVLA 2XACC 2LGWA 2W94A 1F1GA 1FV1B 3FO9A 3GNMH 3L5XH 1KD1W 3R06B 4NFBA 4WO4D 1BV8A 4FZEH 3C60C 4I0XA 3QORB 1U6AL 3IJYA 2GTAA 4HGMA 1KG0A 2FQGA 1H5BB 2VRQA 2DZEA 3BGMB 5F8QC 5AAWC 4QNPF 5GGVH 5HD8D 3M1CA 1HEZA 3M7FB 3AB0C 4GKSB 2IH3A 2R29L 4HK3J 4BFIB 4DGIL 4AW4A 1XZ0A 2H1XA 4WRLA 3WKPA 4L9DA 1SYSA 4XCCH 5E9DA 3ZTCC 3ALXA 1G9HA 4Z1PA 5KYYA 3TA3D 3J81N 4GT1A 2B1HH 2F8IA 2VC2B 4DETA 2EDLA 4P5TA 1TMQA 3T0EE 2XLLA 2OYMA 4X80L 2DQIL 4UCOA 5EU5B 3AVEA 1TLMA 3BZFA 2VERN 4BH7A 4N1EA 4PJ7E 5F1IA 1NAKH 1UB6A 1M1KW 3I6LE 3O6MH 4OPAA 4LHUD 3HI6L 4WU7B 4F2FA 3TJHD 4FA6A 4XCYB 2VLKE 3MTRA 2DWEA 4FG6D 5IZ7A 4CZZA 2FB5A 1X5AA 4FQHA 4OH2A 4DIXA 1N59B 1PL4A 1WIOA 1OT1A 3GXFA 4AX3A 3LPOA 1FFXA 1JV2A 2D7QA 3PL6A 1TUBB 2RCVA 4NPYA 4XP4H 2DQUH 5B66Z 1GJWA 1T6BX 4LH6A 1X5ZA 4ODUA 3UO1L 4DOHB 3OKKB 4FMFA 1VFBA 4O2CB 1CCZA 2ITEA 2CMRL 5DS2A 3SDXA 1M57B 3MODL 2DQDL 3T3PB 1AGBA 3S3XA 3EO1B 4CVXB 3DRTA 1K5QA 4I4TA 1B04A 1K5NA 3V10A 4KNQA 1T2QH 2GUYA 5JIMA 1HHGA 3J2PA 4L3AA 5JW5B 3PGFH 3QUXB 2Z7UA 4QNPE 2IG2H 4FMKA 2F54B 5KSUA 1BM3L 1E1RG 3I6SA 2VLRD 1QR8A 3UZVB 1TU2A 3CVIH 1RMFL 2BWDA 3NSFA 4ABWA 4BQ8A 1VRSA 4LIQL 1U3HD 1N5YH 4U6XB 2PTUA 3Q2WA 4H13C 4NZTH 1CLZL 3NN8A 1VMGA 2WQRA 4O2BA 3ULVE 2AK4A 4MS2A 4QAMB 1EGJH 3FQUB 2BSCA 4E42A 1P6AB 5BOZG 1FL5B 3IXAA 5TF0A 4I9XA 4JFQB 5KAIZ 4X83A 2DMHA 5A2JH 1INQA 3SOTA 4HOMA 2KQXA 4WNSA 3FT3A 4N2CA 1SQ2N 2YFNA 1H6EA 3IWUA 1PD6A 2AHYA 1P5UC 3RYFB 3CMAV 1NI8A 1JWMA 1KB5B 1G9MC 2WTRA 4TLUA 1DCLA 1N4XL 2AEIT 5L88H 1BQLL 3B7YA 3POCA 1YA5A 1P4LA 2Y7QA 1J9TA 3RAJL 5J2TA 1A14H 3US9A 2Y07L 2F5BH 4GW5B 5E0QA 3U9PH 3D48R 1LLAA 1R3LC 1SBSH 1T5XA 4JRXE 4QXUL 1EAPB 1XEUA 4MVBD 2ZTBA 1G6RB 2VDNL 1UT9A 3GHEL 2ZWYA 4LAQL 4MJ5B 4NHUB 4HJGB 4LFBB 3QH3B 3KMDA 3QG6B 3QHFL 3FB8C 1PKOA 1ZEAH 4FTDA 1MCJA 1GGIH 5DUPH 4A2MA 2EP6A 5BQDA 4LCYB 4ZMVA 3FU3A 2QTSA 3P3PA 4QE7A 4NKIH 4GUPA 3QT2A 1YIJV 1SJEA 3PWPE 5MERB 1F1AA 1CT8A 5D9SB 3OKEB 4MCNA 4M61B 1NC4B 4IYHA 3BN9D 1J0HA 2EDRA 3AXHA 2IANE 1X5IA 4IKLA 2Y5EA 3CZJA 5D9SA 2OZNA 4KKQA 4KV5F 2X0UA 4HZ3A 5DJ8B 3K0GA 3B77A 3V5HA 3VM7A 3TL5A 2IADB 3MBEA 5IBLC 1L5GB 2G75A 5DJDA 3RUGA 1FH5L 5AB9A 4WI9A 2P9RA 3BT2L 3WY2A 1LMIA 1TJGL 2UXDB 2RTTA 4DTGL 3PGCB 3U79A 2VRZA 1VKXB 2MW2B 2HHHO 3RE0A 3SJAC 3ETDA 3ZX1A 1T3FB 4WO4C 5I1IH 2XXFA 4TOYH 5JW4M 4Q6YA 4Z3EA 5G4OA 3IU4H 4R97B 1YCSA 5IM7B 3QUMH 5I0VA 5I1LA 1AR4A 2FGWL 4AE0A 1CXIA 5J12C 3HS0B 4RZKA 3FO9B 3R06A 4KI5F 5E08H 5E1GA 1IE5A 2EQDA 2VN3A 1BVNT 3O9WC 3EGDB 3HS0A 5DHVH 3K6DA 5FYJH 2VKXA 2V4DA 3E8VA 4EMZA 2X70A 3P54A 1UWXH 4JG1H 3MA7A 4JZOA 3LDEA 5CKGA 2AXTZ 2OTWB 4YLQT 2YWZA 3CCUV 2XG5A 1AIFB 1XZ0B 4OIFA 5AALA 1QHQA 1J5OL 4H13B 4L4VE 1T1XB 1T5WB 2H8PC 4GRWE 1I8IA 5D4JA 4WKZB 3O3DA 4AMWA 1IAKB 2ZOLA 1URZA 1WA1X 3R8BB 3BVOA 2X7LA 2BWIA 4FG2A 1CD1B 3FONA 3R4DA 2MCPH 4XN2A 2AEWA 4MNQE 3MI6A 1FNSH 1IAKA 1AJPA 1N64L 4JGUA 1GYCA 4HYTB 2W60A 4KTEL 3K79A 3VFUB 3QZLA 5HGGS 3HB3B 2VL5B 4PREA 4BFFA 2B2XL 1MAKA 1EIBA 1T21B 3VFUA 3CE1A 1TYEB 3ML9A 2XAQA 3WY3A 3FTSA 4AENA 4P3DA 1WJ3A 2JIZG 1ZT4B 2GDSA 2EO7A 2X4NB 2NT0A 5D1ZD 3H1HH 4C47A 4DR2B 2J1ZA 1P1ZB 2JCCB 3F01A 1BEXA 2JKRM 3PJNA 4Y5YA 5IB1B 2ED8A 4OQTL 5GRUL 4NUMA 2OTUA 4L3CB 5EU4A 4ZAKC 4B9IA 4WBNA 3LZRA 1Q9KB 4Y4HA 4P4KA 2HT3D 4NO0B 3GSVB 4K5PA 1NGWB 2FT6A 3P4MB 4NP4H 1JG9A 2UZIL 1EHKB 1PBYA 3B83A 4AQ1A 1TLKA 2AEOA 4MXQC 5CU5A 3CFKA 1AFVH 2CRZA 3PS6A 3FBKA 1FORH 4X6CE 1EERB 4F15C 1DHKA 1TQBB 1KCRL 4AXWA 2OXGA 4R96B 5F1OB 3TONA 1T89A 2EE6A 5I9QB 4HKBB 3LSUA 5AAMA 5IIEA 4FYSA 3CFJB 5F71A 3SE9H 2BSSB 5IMLA 4HA1A 5BXFB 1YNKH 3KL3A 4PS4L 5E2UL 5HFLA 4ACPA 5GGTH 4L4VB 3A3YB 4RGMC 4B9PA 1ODAA 3N44B 3CFCL 5L7XH 1FYTD 4GMSL 5J89A 3HPLA 4PGEB 4UTBH 5ABDE 5GRWA 4O4LA 2HH0L 5IJBC 1KFAH 2UXXA 1EJ8A 4IIZA 4LASL 2N4IA 3RWEA 4AHCA 5FYKU 1MCOH 1E40A 1I9RH 1U8MA 3QUZD 4HWBL 4WWKA 3HG4A 1KYAA 2ZG2A 3L6FB 3NPSC 2FNWA 1NFAA 3QORD 4NRZB 4IGBA 2ZUTA 4TUYA 1RUKH 4PGJA 1V3LA 4KK6C 2FATL 3IGFA 2K3TA 4Y7OC 4FQ2H 2V0AA 1IGJA 1U8KB 4TLSA 4ZS7L 4M48H 4TQPA 2B4CL 4U05A 3K72B 4BFGA 1JR9A 2CXKA 2DIEA 4PR5B 3ILPA 2XQYA 5IOPA 1S7XA 4X2UA 4D9RE 2LLLA 4N21A 2BSTA 5F7WC 3RY5A 2FWOB 2BSEA 3QNYA 1B06A 1AHMA 2GQHA 4IEFB 3F04A 4MHHG 3TURA 1GHFH 5I6PA 4P3CL 1TEYA 5BR8O 1I1FA 4M3KB 5IWLC 3EOAB 5E03A 1JN6B 3IN2A 1ZTMA 2VH5L 4PJXE 1HX0A 1UFIA 25C8L 5AW1B 1YY9C 3T4ZA 1M1SA 3PE9A 1I3GH 3RVUD 1ETJA 4K0KO 2DJ4A 3EO9L 4LCCB 2IOOA 4KDVA 1OT2A 5DO2C 5IDJA 3T0WA 2YGQA 5KAFZ 32C2B 2OS7A 2AZ0A 2VMFA 3P4NB 3FT4A 3CCHB 3EOTH 4PJAA 2Y5TA 2GBAA 2W0FB 5DRXB 2JKTM 4YSQA 3K08A 5IMOA 1S7QA 3P77B 1FXKC 2KZKA 3JV6B 4Z3IA 1A3RL 2YIHA 1K3EA 4DR4B 3FUIA 5TD4A 1OEZW 4FL4C 5HHVL 5BZWB 4X4ME 3WJLC 2DN9A 1LDSA 2I5YL 2B20A 4XP9H 3TFBA 4L8SA 1KIQB 3G5YB 4R7CA 4IS6B 4Q9RL 3FL7A 4B3SO 3HAEA 3VFPA 1KJ2B 3PGDA 1OSPL 5EC1B 5FYKE 3TZVA 5L4IA 4HPOH 4HIXL 4IRJD 4NWUH 5I17A 1UD3A 1XDCA 4NIYE 4N2LA 1S4IA 3LRKA 4Z7UA 2X10A 3MACH 4DGVH 4XCNA 5K9KA 1QBLH 3GXUB 4B3RB 2UWEF 1OKEA 4OIAA 4WW1B 4KKAC 2DWDC 1WFUA 3BWZA 4GAAA 5F7YC 1Y7VA 1DL7L 2HTLD 2ZX9A 1NVPB 4JYAO 3RJOA 1HEHC 3MXWH 3SKJL 3W38A 2DKMA 2IH3B 3I50L 3Q43A 4CJ0A 5EYPA 4MVZA 2GY7B 1HKLL 1UZ6E 3EUDA 4B9FA 4NZTL 2G2NA 4OI7A 2BS9A 4RGMB 5D2NA 5I1JL 5I1CL 4QCIA 5D96B 2EXTA 5IQMA 1FIEA 2CLVB 2ZE0A 1F11B 3L9YA 3TJEH 3S3SA 1P6FA 2ENPA 4U2ZA 4HC1H 1CE1H 3RWFA 1ZT7B 1SBSL 3WXVH 3ERXA 5JJNB 2ZCHH 4OLZH 5DQDH 2Q1EA 3AGWA 1JTTA 3QO0B 4BXSV 4Z7NE 4PD4F 3MBED 2VWEC 2G2RA 3WNOA 1A1NA 3TBCA 1AD9A 4O4IB 4P2QB 5L3EA 1Q86W 1AYOA 1N4XH 1O75A 3BEWA 1RHHB 3L3GB 4MDIA 1AZCA 5ITZA 3ZHUA 3O8XD 3ARVA 2EH7H 3JV5A 4JI5O 4RNRB 1YYMH 2VMJA 4OCSL 1L6XA 3TU6A 4KH2A 1JERA 3HVDA 4Q7DA 3VFNA 1NICA 2EXWD 4H8PA 5C7ZA 1SF5A 4KX7A 5KSVB 4UT9A 4J2XA 5ELIA 2KC0A 4U1MA 1OANA 4EI6A 3BAKA 5CGMA 1CLZH 5CP7A 4KDTC 1SXAA 3KS0J 3MO1B 1R3KA 1PY4A 1GMEA 4LLQA 3A0HZ 2WNKA 3HE6B 5HBBA 3ULVC 3H2PA 5IJ9B 4KO9A 5HYSG 1R46A 3QQ4B 4UV8A 2FL5B 5CS7A 5TFSH 3UZQB 4HAFA 2WXLA 1L9SA 3IDXH 5B39A 1SA0A 1T0NB 4N20A 1YXBA 3OTFA 2HWZL 5FK9A 5KSUB 3ULUF 1BJ8A 4YSRA 1ZY9A 3FCBA 1WAEA 2CKBL 5BS0A 4H44B 1HJCA 3MRIB 4K9EH 4MD5B 2CGZA 1TKWA 4M8QB 5DYOB 2MMXA 5F1NA 1PJ9A 3IDNB 4JPKH 4UM8B 5G55A 2HLEB 1H2GA 1U9KA 1EFXB 3WKMH 5CM1A 3MN8A 2BY2A 3T1HB 1P7KB 3DRQB 4YIOA 1NCWL 3H9SD 4H88L 1IC7L 2GG1A 5ICYA 1VQLV 3L6FA 3SD5A 4DOHE 1SMOA 5K1VA 2Y69B 4G5AA 1S9KC 3HNSL 1HEJC 3FFDA 5CMAA 4NHCL 4O00A 1QX1A 3BUDA 4X6DA 3TF4A 3IVKA 1U33A 5IT2H 5IHWA 5CMAB 2VUYA 1ZXQA 3Q3GA 5FV1L 4IOSA 1NWPA 4L48A 3ILPB 5EV7A 1NEZG 1A5FL 3FOMB 3GBDA 4G8FA 4OUUB 2X4RB 3HG1A 1Z2GA 1VCBC 3MLYH 4Z7WA 4NKOB 1IAOA 1GTFA 3AQXA 1T5EA 1F86A 5AZEH 2HFGH 3BT2H 1NINA 4HCRA 4RA3A 4HSQA 1W0KG 1U2HA 1ZDQA 5CMUA 1RZJL 4F9PA 4X66O 3MYJB 4L29A 1I1YB 3AG2B 2C7UA 1Q72L 1MREH 1L3WA 1MZYA 3IAPA 4HUNB 1HSAA 2UUBB 5C0CE 1QABA 1MVYA 3HKCB 4I1NB 3NACH 5EOCJ 2NY0B 5DECA 3F6LA 4FX5A 4NXNB 1EJ6A 2GBOA 5DJ0A 5CFAA 5IREA 1OGAE 5DJZA 3FN3A 4FTVE 2RMNA 5HHOD 5EC1C 4Y5VA 4HIQA 3UO2A 1UH3A 1FPTH 2E0PA 4PJBB 3FQTA 4PELA 4JVWA 2X28A 4W6WB 3KL0A 5KUMA 4WFGE 5JW3L 3QTCA 1N32O 5DUBB 1K33A 3C6LA 4TPRL 4MVRA 1GH7A 3IE4A 2ROXA 4UAOB 2Q8BH 5HDBF 1XMQO 2YD4A 2WZ5A 4PG2C 4WSKA 2ED6A 3CB2A 2IH1A 3ZRVA 5HGAB 1ZXKA 5I1EL 1A64A 5I17B 1J18A 3MROA 3N85H 4K3GA 3QZWA 2Q3ZA 1QFWH 3VD2A 3H9SA 2XWXA 1O9HA 5H2FZ 1EEQA 4Y2DB 1WCBB 2XG4A 3QDHA 2R8SH 3KGUA 4NNYB 3V0FA 3CEIA 3R19A 4G7YL 4RFNC 4L4VD 4N4YB 5ITFA 5A2AA 3WTTA 1CLCA 3B9KA 4OV5B 1VFUA 4PRNB 4D0BA 3I75A 1G8MA 2F58L 4W9DC 1FA4A 4B60A 3L81A 1SJHB 5C1MB 5H4ZA 3D50A 3M7OA 2BOCC 2HTLC 2HLDG 1VQ4V 3BUBA 5DJ2A 2I85A 1OAZH 2Q8BL 4ZD3L 1NLDL 3FQXB 3N40F 2C3HA 2DM2A 1O0VA 1CWVA 3BAIA 5B1NA 1TJXA 2FJSA 2VXQA 5IT2L 4UQ3B 4XHJC 1CD1A 3JAKA 3JALA 1WGVA 2WWNA 2HRLA 4LF5O 1EAJA 2C5DC 2OR8A 1E2WA 4MCZB 5D70H 1XF5A 3JATB 4JTAB 4RFEB 4JM2A 5A40E 3UTTD 4QXVA 5DHVB 2X6CA 4Z77B 2ZXEB 4HKXA 5JTWA 1P2CB 5IEKB 4N2BA 2XX0A 1ZT4A 2DLIA 2YQBA 4R4FL 5C0GA 1KIUB 2NNXA 5AYUH 1EAOA 3ZDZF 3QULA 3BO8A 5JOPE 2ZUSA 1EMTH 1SQMA 1TIUA 2YUVA 4G9DA 3W0WA 2GTQA 3A24A 4X5XB 5EZIL 1JNJA 1M53A 1AD0A 2I9LA 1KCKA 4KITB 3U7AA 2N0MA 4G8IB 3DO7A 4P57A 4PMFA 1QLEC 4GPVA 5T1DH 5IQNA 4YDLC 1GGBH 1IGTA 1NCAH 4F6EA 4JGMA 4OD2A 1I1AD 2F53D 3T71A 3WIHH 2VR7A 4QHKI 2WIIA 1FP5A 3F65A 4NBZB 4XHQA 4O4JA 5F93C 3SKJH 3D39B 2ITFA 4L0ZA 1CP9A 5BUGA 5EZYB 4RQFA 3WIIH 1S7VA 5DC0A 1SXZA 3L2LA 4ODXA 3VRLE 3CFUA 4RVBA 2COVD 2C8NA 4WSGA 1D5AA 5K59F 1UEMA 3HZMB 2V3FA 3VI4F 12E8H 4LVNC 4UTAA 4W9LC 1KXTB 1MH5B 4FLSA 4R3SB 3UJTL 4BAYA 5DRNB 1NZ6A 3W9DA 3PQYB 3L48A 3FO1B 2JFCA 4JKMA 4Q9RH 1BPLB 3ZS8C 3A67H 3IFNH 5D5MB 2A73A 3IBEA 3FF8A 1EFRG 4QNHB 3BUQA 1TQCB 3WCYA 5JZ7C 2ZOKA 3GI8L 5LLIC 1FL6B 1ZK9A 4YE4L 1FFNB 3BAJA 3RLSA 4I2XE 4DW1A 1G1OA 3F5WC 4WTZA 5CSZA 1LEGB 2FGZA 5L3CA 3FB5A 4N2KA 4AEHL 5BZDB 3BXNB 3AT9A 3SYOA 2YPLE 4TMPA 2EZPA 4N0RA 5I5MA 3IGKA 3BCCH 1G1CA 2X3AA 1HQRB 3HNTH 2X1QA 5CR8A 5JJEB 1U8JB 2XVLA 3CSTA 2VITB 5EZLA 4LHUA 3ZHNA 3TJEL 1KWGA 3VI3B 3ZIAG 3SE3C 2CJ3A 2VOTA 4FLQA 1MOFA 3OR7C 3WD5L 3MBWB 4PRDA 3VFMB 3DJZA 4F2MA 2AMGA 5JHLH 3E8FA 2CJSA 3OW2U 3CCJV 3I50H 1FBIH 2Z93B 2MNJB 4G1MB 2ZDIC 1YSOA 4FXGB 4DR1B 3QJHA 2C9QA 3SJQC 3MJ8A 5HGBB 4EKWA 1FZOB 2ESVD 1AQKL 4TV9A 3DJRA 1MOEA 1UZ8B 2Z7ZA 1NC4A 4NKQB 1FYTE 3HRZA 3RFZA 1SLWA 3ZN0A 3L7FA 4I3RH 4Y1AB 5E4EC 3WENA 1DQVA 3QDJE 4LFCB 4YEFA 1DQML 3NIGB 5KVGL 2WQUA 3BVWA 2VJXA 4HT1H 4OGQC 3OZKA 2QM4A 1BSMA 4L1HA 4LVHB 3VD9A 3FT2B 4ZYKA 2X4PB 1V5JA 3G80A 2ZE8A 1LTXA 4IHJA 4GQPH 2LFGA 1F58L 3RX9A 3I9IA 1VF7A 1JUFA 4UT6L 1N8ZA 4WUKL 3ATBA 4LASH 1MCPH 5KA5A 3JVFC 4R5TA 4Z3TA 4OD1H 2VKWA 4IIQA 3WTUA 3CX2A 2HUEA 4Y4KB 4JB9L 4ZFOL 3GIVB 1MEXH 2DTSA 3FQNA 1XV8A 4JFDA 4O2FA 5TTRA 3P3RA 3NSXA 3RW0A 1R6NA 4U0RC 4BK8A 3U2JA 3TS8A 5DRZB 4FS0A 4ZNCD 3JVGC 1R3IL 2V2XB 3DURB 3LKSA 4JFDB 4PB9L 5LHIA 3STLA 3ARTA 3SE9L 4E9SA 2N0KA 1YDPA 2N7AA 2DQCL 4V1DE 1DVUA 1NCWH 4H88H 2X09A 5A2BA 3MRFB 2ZOUA 4M00A 2QEXV 5K9QI 4PHXA 3DJSA 4NQED 4X1IB 4OLXL 3GSNL 4YX2H 1P7BA 1BJ1J 4K94H 1AQ8A 1JK8A 4H1LA 2AANA 1XR8A 3GMRA 5DZOA 3FRUB 2NY6C 3GJEA 3FZUC 1P0SE 5EUOF 1FIGH 4IBQA 1C8PA 4UVAA 1BBJB 2VQTA 1GGUA 5CEYB 5AD0A 1XQ8A 4XH2B 3UJIL 4HIJB 1CLYL 3FCGA 4YDJB 1A5FH 1SRYA 1QO3A 4XI5C 3PY9A 3M7MX 3D0LB 1M7IB 4IDJL 2LU3A 1WFOA 4PREB 5E2WL 1Q9WB 2X7RB 1SN5A 4QRRA 4HV8A 4FADA 5F7HA 4UBDD 2ITDB 3BLKA 1TNMA 4CU8A 1H8OA 3NR7A 3W7SA 1OTUC 3K7UA 4ERSH 5I74B 4UINH 2V2TB 2VQ4A 4L0YA 4DK1A 4KTGA 2NY3B 4LFAB 3BVNB 3VXNB 3MCKA 5DK0B 1UPGA 1OPGH 2ENJA 5B3JE 3OC8A 4FM2A 4YDLB 4IOIB 3HKDB 4Z7WF 2FNBA 1IEAB 1PZ5B 4H8HA 5GIRA 1LP9B 15C8H 3OC5A 5L7XL 1MJJB 3GSXA 3KWTA 1GL4B 3KCYA 1F4YH 5CIPH 1OAQH 4LKXA 4EBQL 4DPCX 2A99A 2HTKC 2H4EA 2W5PA 4LP5A 1C7TA 4PU2A 4KJQC 1XGRA 2VISA 2FKXA 1ORQA 2NY0D 3VSUA 2Q4PA 3QEUB 3RHWK 1AS8A 4OD2B 4C8XA 5LWYH 1P4BL 3DETC 1AGDA 5EU3A 1XBDA 3T0AA 1SN2A 1JGEB 3QQ3B 1SQVH 1BBDH 1TNNA 3KHQA 1S46A 3NRFA 4B97A 3WXVL 2QQLL 1LO0L 4QTFA 4N2MA 1OARL 3O3EB 5AENA 4NTWA 3A0OA 1FKAO 1UM4H 3K8KA 3X1NA 3EOYG 4PJCE 1KG0B 2D3NA 1YEKL 4Y1SA 2J5LC 3TX4A 3N91A 1HILA 3Q7JA 4LLWA 3TWCL 4DP8X 2BRRH 3UC2A 2Q0AA 1P9MA 4XMPH 3KBEA 4NNXB 5J3HD 3WYRA 3NA4A 1DBAL 1BHBA 1BIIB 3LD8C 3QXTA 2WBXA 1MFNA 1AZRA 4KK6D 1AXSA 4JPQA 4Z0XB 5GPRA 4IRSD 2X3BA 3EJUA 3QDGA 1I85C 2PTMA 2MCAA 2VXTH 4NZ8A 2P5EB 5CN3A 3DHMA 1UJ3C 5F1KC 4XXDA 1DVFC 3H7LA 2C3GA 4QRTB 1FORL 1GO3F 1QP1A 1I7RB 4Y9BA 3QNYB 2GJRA 1LJMA 1YG9A 2DN7A 3RWDB 2ZCHL 1OF2B 2ZE5A 4QYOB 4ENED 2P80A 4TRPH 2XZCH 1BAFL 2X4RA 3CBRA 3GZKA 2JV6A 5DMKA 4X9HA 1CL7L 4FLXA 2LU4A 2MPAL 1CXEA 1K8DB 5C71A 2J8UA 2Y6TE 3RP1A 4WFFA 2ATPA 5FOBA 3KPQB 4XVTL 4NN6B 1LQSR 1NGPL 2NLJA 5CLXA 5FO9A 2CO1A 1TEGA 3CRCA 4J27A 5SWZA 1M7XA 1R5VB 5HI4C 2AJVH 2P8PB 3FT0A 4J7JA 2Y07H 4P2YA 4Y4FB 4LDCA 4IGBD 5ADPH 5HXMA 4LCCC 5FX3A 3VI3E 5F72S 3P4NA 3O0LA 2NY1B 1SYVA 5DF0A 3PUCA 2OULB 4WZ9A 5GS0L 4Y16C 5DDHA 4ESKA 3IETA 4JNXA 1L0XA 1JZ4A 3JT0A 3Q4HB 1GZPA 4JTDB 1ETZB 1IEBB 4M93B 5EULV 1EZJA 1T0MB 3BHBB 1NJIW 4LEBA 4IGGA 4L8SB 4WI0A 3PHOA 3V7AE 3GB7A 1PAZA 4XN8A 2DEYX 4YJZL 1T0MA 4I3SH 4BGDA 1N8ZB 3WD5H 4WUUB 2VE6B 1V8HA 4F3FA 2DH3A 4JQIL 1VKXA 2X6VA 5IQ9A 2OBGA 3C2AL 3TXAA 4FP8L 2PY5A 4QHNB 1RSOB 1ERNA 2QR0B 3WB2A 1QHOA 4WO0A 4JCWA 1Q0XH 3NJJA 2K4AA 4LCIH 4AEHH 4DP7X 4X8CA 4HULB 1CBVH 3EFDH 4JFFA 5ANME 4OM0L 3L3KB 3A6OA 3GBMH 4I9WD 5J06A 4UFZA 5CGYD 3ZZ1A 5C2BH 4I3RL 3AABA 4PLJD 1E27A 5H2BA 2ZD9A 3OPZH 1HZHH 3S34H 4XT1C 2CCVA 4ZX4A 2DQ0A 1NCBH 2NOYA 3VMOA 3EFFA 1B4RA 2P8LB 4ZSOA 4JI1B 3A67L 3IFNL 5C6WH 5HYJD 3GIZH 3ABMB 3IAYA 1X4ZA 3IRZA 4EIZC 3N2JA 4GRLC 3QO0A 4MMXC 4NQEE 1FH5H 4P3WA 4NC2B 5JDSB 3EFFB 1U2CA 1KPRB 4DK5A 3B2VL 1XGYL 2AW9A 1EAPA 3O4OB 3QDMD 4XPGL 1F11A 2I27N 2IPKB 3BEWB 3EJPA 1YEGH 2NY6B 4RFOH 3IKCB 5T5FL 4W93A 2VWKA 1OM9A 3FTVA 5GZOA 4JV5O 3CJHA 2QTEA 1HNWB 4PJDB 2J2ZB 4AMXA 3WJMA 1NDGA 3ETQA 2D31A 1Z5LB 4UIMA 4D0DB 4LC1A 4N1HB 3GVMA 3A47A 1AR1C 2X0VA 3JUZA 2DQIH 4P4RB 2X05A 3LEVH 3UTQA 2CO6B 1U8QB 4FL4B 3A4DA 3D2UA 3DX8A 4UIMB 1RPRA 3CVDA 4OCWL 3FAVA 3Q6GL 4G6AD 5E1AC 4KJQD 4XMLH 3A0RA 4FQLL 3MLUL 4KRNA 3MU3A 1MELA 5J1AA 2ITCC 4LL9A 4F7EA 5F8RC 5D7IA 1W2KT 4BH8A 2ZXWB 4AGPA 5DEJA 5J1AB 4LF3A 1YMME 1R1CA 4F7EB 1JE6A 4Y4FC 3VXMB 1PG7W 3MLVL 4XP1L 4JQXC 1OL0A 4H7VA 4K5MA 3EJSA 5IB5A 2DQDH 1TSHA 4LSVL 2AGAA 3WGUB 4NO5A 1EVUA 4A6YA 1WS8A 4J7RA 5FYKH 3L70H 2WCSA 1MRDH 2WUCL 1B88A 2HT2C 3M1BB 3F7YA 5DQ9A 3RGVC 3VFSB 4FC3E 4NUGH 1J5OH 1CDIA 1TFHA 3LH9A 2NUTA 1MI5B 1WBZB 3NDZE 1AJNA 4QHLA 2FSDA 5FGCB 5FB8B 5EOCH 5I6NA 1IFHH 3ABUA 4N2IA 1MLCB 1XH1A 4MD4B 1Y76B 4LPXA 4MFHA 2H7WA 2XUMA 4LWSA 3ILEA 1JZHA 4RMUA 5C0DA 3B4NA 2O72A 1MJ8H 5D1ZA 3VD3A 4DO5A 1AJ7L 3ZKXB 3BABA 4OJEH 3FB5B 5DUJA 5LGTA 5CA0A 3WGVB 3EIFA 2D7MA 1Y74B 5BV7H 2Y3NA 3H0TA 4YHMH 3ZHFA 3ZMEA 1A3ZA 2NCEA 4GAGH 4U2YA 1A0QL 2NTSP 3IF1B 2CTWA 3F6JA 3H0TB 1H8SA 3UPAA 3D3VD 2NMSA 1IM9A 1L9MA 3ZKQD 5I0ZA 1MY7A 1A7PH 1W0WA 3OGCB 4LGPB 3ZXAC 1ZHKB 1USZA 1T83C 2G0LA 4HOZA 1E4XI 3U46B 1K4DC 4HX1B 4IBYA 2KDGA 2EDKA 1OCCC 3CN3A 4G8FB 2WJ5A 4QRPE 1BAWA 1WPXA 2XY1A 4NN5C 3KWVA 2V9RA 5HHMB 3DYMA 1N10A 1B9KA 2AQSA 2XZQL 3GXIA 3WN5A 5CJ5A 4WBNB 1USQA 2YAPA 2AW2A 1DR9A 2XPGA 3LRHA 3WFBH 4PHZA 1ZWIB 1L0YA 3UPRA 2VXTL 5C0FA 3GHBH 3HI6H 3KL5A 3R65A 2NY3D 1QASA 4P5KB 1TJIL 5F7KC 4JYBA 1IL1B 1INEH 1YAIA 3ZIYA 5I19H 2A9DA 2IH9A 5IT9N 3STZB 2QLYA 2E59A 3NRQA 3FQTB 1HHJB 2BC4B 4MJIE 3P30A 2XBDA 3BH8B 3PHAA 4JR9L 3RDTC 2XN0A 3L4XA 2J8HA 3PDDA 5HHPB 4ETQA 1ETZA 2WN3A 3I9GL 3L9EA 2DYRC 1IAIH 3LHPL 3KPOA 2EDEA 2SEBA 1XMOO 5D93B 3RU8H 2BRRL 2YKLH 3ZDXF 3RX5A 4JI2O 2FEJA 4JFWA 5E1AB 2WKOF 3LMJL 1U3HC 5GSVB 4PJGE 3E22A 5HI3D 3FUFA 1LO0H 3V4PH 4H0HB 4JFQA 1WWCA 3WO3B 2BSKB 5IESL 1VF5B 3ZKSD 3BPNC 2E74B 4PJEE 3LQZB 4APQD 1BVNP 4DKFL 3BKCL 3N9GH 4N5ED 3ABLC 5HDBE 1NBMG 3QCVH 2DM3A 3CS5A 1ACYL 2YSSA 2HG5B 4KOCA 5GGSB 1RSYA 3FMGH 5CUSL 3S35X 1TZOA 2YD5A 4G7SB 1Y67A 2FBRA 4N23A 4KV5E 4KROD 3UC0H 3NJXA 3QNZA 1IKFL 3CFNA 4MAYB 1DANT 3US1A 1B9ZA 3D30A 1Z0MA 2VDNH 5ICXB 3QXDB 4MHHI 2V5MA 5GRXG 2P5EE 1HWHB 4PRHE 4K3DL 1FVCA 4WI5A 4URTB 3V4UH 1PEWA 4Q9QH 2AQ2A 1BZKA 1I8LA 4DV7B 1KPRA 2XIDA 1MRFL 3HFFA 1JGIA 1J1XH 4F80A 3DK2A 3H54A 3I2CH 4OZHA 1LWJA 4ZMTA 4ZS6C 4LAJH 3GLZA 2NT1A 2V17L 4P99A 2NNCA 4ZUWA 1UA6H 4MNGB 4GRMA 2PW2B 2HVBA 2M1KA 4IDJH 4U49A 3ZDYB 3WJMB 2DJVA 2CK0H 2CHNA 4B41A 5T3XH 2QADC 3BN9C 2ZXWC 2GC7C 3NZHH 4JGJA 1RLBA 4WJG3 1JXJA 5GS0D 1RZ8B 1GGTA 2HRHA 4FEMA 4ODUB 4JTCB 1VAHA 2PYLA 3IJEA 4OCXL 1VEWA 4Y4FD 2OR9H 2AK1H 1I4FB 4MXQD 4IHBA 4AEIL 2EH7L 3VD1A 2XNAB 4K9EL 1X44A 3MO1A 1G7PA 4X62O 1ZAGA 3D39A 1S9YA 5EFIA 4JFED 3P11H 3MRMB 2K45A 1ZWIC 3C12A 3IM1A 5FYKD 3ZE0B 2BNRA 1CLVA 2UWEA 4PGCB 5AKVA 2I69A 4ELME 4FJYA 3QI9A 4HD5A 2PO6A 4XPHL 5BUAA 1MVFA 1HEZB 1SVZA 3QZWG 1HNFA 4O2BB 1RLWA 3VFSA 5KSBE 1QUNB 2QQNH 3HC4L 3THML 5B1OA 3ULUE 4CUCA 4UNUA 5H94B 5T1JA 1NCNA 1R3IC 2A6KA 3MJ7A 3TJHC 3ZHKA 1X59A 2Q8VA 1INQB 1WBYA 2BVEA 3ALWA 5D7KE 3EDKA 3OT7A 1UXSA 4OI8A 1K6QH 5CSZB 3C60B 3QORC 4JFHE 4M6ML 3QPQD 1ZTXH 5HHQB 2WUCH 2EJ7A 1FNEA 4OLEA 4OD3H 1B3QA 4RA0C 1S5IL 1EZSA 5T5FH 5MHSE 2PXYD 2XFXA 3EYSL 4BH7B 3DMMC 1CTMA 1OB0A 1WT5C 2CNZA 2J20A 2VQEB 5J2TB 1JNNH 2NXZC 4LCWE 2GTZB 5IBUG 1HNXB 2AQQA 1LD9A 2JWYA 2FQFA 5LCVL 5T8IA 3MZGB 4KKLC 5KVFL 4FMTA 5JORA 4HUWA 2GK2A 5DLLA 1UKSA 2XYBA 3MBXL 1MCBA 3FFCE 5B21A 2K0RA 2FL4A 3MLUH 4XO9A 5F2VO 1SQQH 4FKKA 3VFNB 4NYLA 1QTYT 4U6VL 4CBCA 4GUCA 1I0HA 3UPCA 4I18C 4ZFQA 4OLYH 4ZXBD 2NTFB 4TRPL 4WHDA 4DUVA 5I1DA 2W95A 1BOYA 2P8MA 4WHCA 4PS3A 4YHYB 3ASOB 1Q1JL 2HT3C 4D9LH 4R26H 4GQQA 3A4AA 4U4IA 1YZZA 4HDIB 2MHAA 3AM8C 3N43F 1JHTB 5C0JA 2YK1H 1MVUA 4I55B 1O7SA 2ZNXA 3QRGH 2OXGB 4R96A 1BD2B 4ODTH 5DMJB 3T65B 4ZMYA 5C8JB 4H40A 4PY8J 5J8OA 3RURA 5DJDB 1HHIB 3HUJF 5ISZA 2DLFL 4TNFA 4IHOB 1E6OH 2D7TH 4XBGB 4BDVA 1GN3A 4JKNA 3HE6C 4UM9D 1OO2A 1DLHB 3D18B 4OFYA 4YHPA 4F8QA 1OQOA 4O2AB 1KEML 4F3FB 5KVFH 1OWWA 3GD1C 1Y6KR 2AQ3A 2UWEE 4P9ML 3SGJC 3O4LD 3OD4A 4QHUB 5T3ZL 3FTZA 3RVWD 3VXMD 4ZXBA 4HWEL 3T4DA 2VMEA 4M48L 2CO3A 4Y19B 1KF9B 3FQRA 4Y4KA 4XZ4A 3SBPA 4HU8A 1JTOA 3ZL4H 1UH2A 1XF1A 4B0MB 2VR3A 2ROYA 1IGMH 3QG5A 1GJIA 3EBHA 2P24A 1NLBH 3E9TA 3OFNG 1LYQA 3NJVA 2OMXA 1KTKE 2A4CA 5AVRB 5FYLH 5J5EA 3ZOAA 4KI5C 4N3UA 2C9SA 3IMVA 3Q5YA 1WF5A 4HWBH 4R26L 3NK3A 4N26A 1M56B 1CGXA 4QD2E 5TE7L 3T2LA 3IAQA 1XB8A 3HMWL 4GAYA 1GN2A 4PUBH 3SY0B 4N5EC 2A9NL 2O5XH 2RFXB 2X4SA 2EC8A 1CLOL 2IAMB 1QSED 5J0BA 3GMRB 3SSGA 4PY7B 4KXZH 4LMQI 5I1KL 5B3SB 2XRAL 4JI4O 3V0HA 2A38A 4KZEH 1IBLB 4LB8A 1SZTA 2D3JA 3V4VL 5DD6A 5IBLD 3ZY7A 1JWUB 5D2LB 3QYMA 5AD0B 3JT2A 2N05A 1GJUA 3FUDA 4LPUA 1AKJB 4P5MB 1J5IA 4EFBA 1T80A 4PD4J 4XB8A 4XMWA 1P1VA 3SPHA 1E42A 3GO1L 4HGKC 3OG4B 5IHZA 3BZDA 3NEXA 4JG5A 4G9FE 3GXPA 4KH9A 5I76A 4BKLB 4N85A 4YPGA 3SO3B 2UZXA 1FFOB 1BFOB 2VZUA 2G60H 3WEXA 1V55C 4ELKB 1N3NB 1E67A 4D0CB 1KIUA 1NLDH 3V7AG 4YLCA 5EO0A 1CDHA 2Y7SA 2WVSA 5HHMD 4NI3A 3REWB 2XX1A 3SKNA 4ZTPL 4K3JH 2VLRA 2HAZA 1OB1B 2KQMA 2PP7A 4GSRA 3TCUA 1BQSA 2Q10A 1GYVA 1RJZB 2MPVA 1E28A 3LH2L 1G4RA 3ZE1E 3KCXA 2XWJA 2R0ZH 3MUGB 2UZYB 4DFIA 3W2DL 2FTAA 4P30A 5E8PA 5K39B 3ZDYF 5JLZB 3ABKB 5IJ9A 2XKSA 5HP5A 4HKBA 1IBKO 1MCNA 3L1GA 3CU1A 3DIFA 3DKHA 2XTJC 1HTYA 2EECA 4DV3B 1KQSU 2FYYB 1RSFA 4NSKB 3TT3H 1KC8W 3B7UX 2JJSA 3S37L 3BD5A 4DWHA 4YHKH 5ESVA 5C0AB 3VGEA 3N42F 4LP8A 5GJTL 1J8HD 1QTPA 4J3OC 4QIRA 1G9EA 4P59H 1AAJA 5BO1H 5L2KE 1JZEA 1WLEA 4JLRA 2IALB 1M6UA 4PV8B 2CK2A 3B9KB 4IOFD 5L2KB 2HSIA 1YTFB 1U4FA 1I7UA 1JHLH 4XBEL 3WSQL 2DYSC 4YO0B 4JFXB 5TDNB 1IEHA 2MKLC 3ZJAA 4W9HC 4PA4A 4MXWL 2A9HA 4ELMB 1O6VA 3AB0B 3QIWC 1YEJL 1AILA 4APQB 3W0WD 4BCYA 5HHQA 3U0WH 4GIAA 5FUZH 5KVDH 3BYTA 5EN3A 3RWCA 3OLGA 5DD1H 1BGXL 1N0XH 4GMTL 1ICTA 1AIZA 3DOSB 4ZOLB 4DV5B 2C9XA 1KT2A 1HKFA 2FHBA 1Q72H 3FUHA 4PV9A 2YICA 3L3OB 3ZRWB 4NQSB 5DFTA 1Q8IA 4G72B 4Q6KA 4WNQA 5LOVB 3S36L 4C55A 1X5FA 1MA1A 2VDKB 3NCFB 2MWCA 5B3JF 1H2LA 5LMNO 1TZAA 1ZHKA 5HVGB 4CH3A 3O2DL 5LG6A 3F7RA 1TJMA 4ZJ9A 4XCYA 2WBJC 1MG1A 2YPLD 3CU7A 5JPMA 4GG6B 4EIBA 4HJ0D 1JN6A 3QULB 1LO3L 1EUTA 3SD2A 2EINB 1LGVA 3SPJA 3ZDYE 4FXGA 5DUMH 1JNHA 1U8OA 3FHAA 4HH9B 4Z7NF 5DQJA 3ZE1F 7FABL 4RH4A 3T0BA 3AG2C 2BVPB 2CCLA 4ZT1A 2QKIB 4X65B 1SF3A 2NY1C 1SLXA 4JHVA 4PWKA 3EH4B 5JQ6H 3PXLA 1ZLDA 3QB7C 5FYJE 2FL5A 4YNYB 3WL9A 4PDMA 1V05A 2E86A 4OCMC 4PW9A 1GOFA 3KYMB 1B0GB 2PMZA 5DMIH 1ZK5A 3QEGL 2F08A 3WDIA 1TVKB 1YF2A 4TVPH 4HXAH 4A55A 2H6OA 1S0VA 1DVZA 3DVNA 3IMSA 1IC4L 4JFEA 4KC3B 4MSWA 1ET8A 5LYJB 2CIKB 1NIBA 3MBXH 3Q8AA 3QJVB 4IIQB 1XGQB 1DEDA 1I53A 4JFEB 1KBHA 4UF7C 4DKEH 1NZRA 1ECYA 2KH2B 4I3GA 3BAXA 1SZNA 3CFTA 3QXAA 1RZFL 1FZKB 3QJOA 1P7KA 2APFA 3DRQA 4ZQTA 3UP1A 1NCGA 1XGUA 5ANMB 1G1KA 3NIDF 5SWZD 3E8UH 3HUJB 4ONFH 3KPSE 3T8XB 2Y25A 5EF2A 2FWLB 1A21A 4J4PA 1ZHLA 4Z23A 4LU5L 3GSRA 4BZ1H 2X44D 2WA3A 5C07B 2XJLA 2OX5B 4GW5A 4DHLA 3QJTB 2QSAA 1FCGA 1NFDF 4LF7B 4YFDB 5T33L 2WAQA 2O5ZH 5DLML 1ZVYA 1K6QL 1KKDA 1OAUH 2WB1A 3ABTA 3VXSB 3C75A 5I8EA 4LLVB 1SHMA 2Y36L 1EEUA 1NC2A 2JRIA 1LO2H 3T2OA 4WUKH 1K4CC 2XVKA 1IO4C 5KUKA 4MVSA 4JZJC 3T4AA 3I6GB 4JRXD 5FHAL 4KK5D 3VDBA 1W72H 2M83A 2FYUH 3LVTA 3OKEA 4MQ7A 1E4WH 4HFUL 5G2NA 4YFEA 1E5AA 4PJHF 1H3UA 3C90A 3PCYA 4PJCB 4ZUWB 3MXVH 3U4KA 1AR1D 4GG8B 4XCEA 4NZDA 2CUMA 4UTBA 4TTDC 3WS3B 2PKDA 3T1FB 4NCC2 1FPOA 1RURL 4ZBJA 5DM6V 1SDDA 3PWVA 1KBKA 3T1FA 5LBSH 5MENE 3OAYH 5LXVA 1PNCA 2KYIA 3C5ZC 5FCUL 3M99B 4X8GA 2DOSA 5MENB 4CC6A 3LPWA 3CHRA 2PGGA 1T04B 1DQLL 5EEXA 2WXGA 2VZTA 2DD8L 4YGAB 4GQ9L 4TVUA 3X1FA 2GJ6B 1XGPA 1GOHA 3HE6A