2DYSB

Bovine heart cytochrome c oxidase modified by dccd
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dysB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dysB02
1WA0X 3T6WA 2I7SA 3X1GA 1AS7A 5I6LA 4YSUA 1AOZA 1J9SA 5E9NA 2JFCA 3TU6A 1BEXA 2BWIA 2ZONA 3NYKA 2GC7C 1JZEA 3MX0B 1JZIA 2B3IA 2Q9OA 3IE9A 2GBAA 2BW5A 2YXVA 1OOWA 1NTDA 1ETJA 3SBPA 2CBPA 2BP8B 3EH5B 5B1KA 4HCFA 2QPEB 4DPAX 1WA2X 2QDWA 3PCYA 5ANHA 1NINA 2HX7A 1J9TA 1WAEA 1YLBB 2VMJA 4A66A 2VW6A 2XLLA 1SNRA 7PAZA 1PF3A 3L45A 5D4JA 4G70B 3ZBMA 2PPCA 1CC3A 3S8GB 3NJNA 1BXAA 3CZUB 2J57A 2VM4A 2XV2A 2HX8A 3TBBA 2EIMB 4YSCA 3AG2B 1OCRB 2IH8A 1MG3C 2IDTA 2J55A 2BZ7A 3NP3A 4DPBX 1QHQA 3IN0A 4E9WA 2IWEA 2UXFA 1ET8A 3BQVA 4K9JA 2BP8A 4M3HA 1BQKA 5B1JC 3FQ2A 4GP5B 5B3SB 3CVBA 3RYMA 2XYBA 3FU8A 2AANA 2PP7A 2FQEA 4BWWA 5I28A 1A3ZA 2IH9A 1JZJA 4KOBA 4DP8X 5TK2A 1TEFA 1JXGA 2CAKA 2FT8A 1AZRA 2OJ1A 4DP5X 1MZYA 1SFHA 3FYIB 3AZUA 4HALA 1OE2A 3EF4A 2IWKA 4G71B 4YSPA 1N68A 1PZBA 1E67A 4YSAA 2W88A 4E9VA 2EIJB 3HEIB 1AACA 1SDDB 1KCWA 2HLEB 2BHFA 4KNSA 3PXLA 1UATA 5A7EA 5I6OA 4A2HA 2DYRB 3AG1B 3T6ZA 4X4KA 2W8CA 4CSZA 5PCYA 1NWOA 3S3DB 4E9RA 1PY0A 4F2FA 2CALA 1KGYE 4P5RA 4UF7C 1NDTA 4AKOA 2FT6A 4DP6X 2UXVA 3H56A 4A2EA 3X2QB 1T5KA 4ENZA 3TBCA 1BYOA 1V54B 2A3TA 2P80D 2UX7A 1AR1B 3FPXA 1CYXA 2IDSA 4F7KA 1NPNA 3PLYA 1SDDA 1GYCA 5AFAA 1F56A 1L9OA 2CJ3A 1AZNA 3OMIB 5EHFA 4N8UA 2BW4A 2YARA 1MDAA 3FSAA 1IUZA 3UADA 1VLXA 1XB8A 1TEGA 1GSKA 1SJMA 1SHWA 1W6WA 4YL4A 3TA4D 3D12B 3FU7B 3G5WA 5B7MA 3AW5A 1FFTB 4A2FA 1W6LA 4BWTA 1J5CA 2X87A 2IDUA 1PAZA 3WNJA 2OCCB 1AZBA 2XV3A 2MRYA 1TU2A 1M56B 1KBVA 4QKTA 1AS6A 4GP4B 3FQ1A 4WKXA 1SFDA 3DKHA 3WI9A 3QJQB 2H5UA 2N0MA 5I5JA 1PNDA 4A2DA 2XX1A 3UAAA 1V10A 2CCWA 1DYZA 2BO0A 2IAAC 4DP2X 2EILB 3S3BB 2PP9A 4DP9X 3FU7A 3N55A 3X1FA 3S3CB 4KO7A 2YAFA 2PPDA 1E65A 2RACA 1E5ZA 2PLTA 1NIBA 1ILUA 5I5IA 2BWDA 2XUWA 3FYEB 1L9SA 2ZXWB 3NJIA 5AKRA 4KO6A 1QNIA 2FQGA 2TSAA 4A68A 1GW0A 4JHUA 4KOCA 5B1JA 1V55B 2YEVB 1FA4A 1A65A 1QLEB 1I53A 1BXUA 3MBWB 1AQ8A 1B3IA 1DZ0A 2HZHA 2DV6A 1ASOA 1KDIA 5I6NA 1CYWA 3JTBA 4N4YB 1KYAA 2ZWNA 3IEAA 2HRGA 5D4IA 3X1BA 1BAWA 2QT6A 4BXVA 2VSMB 3QJUB 1XMEB 3DIVA 3FT0A 3NSCA 3PAZA 3PPSA 5D4HA 4A67A 3OD3A 3FSVA 4AKPA 2FJSA 4Q8BA 2I7OA 2VN3A 4UANA 2GHZA 3QJVB 4W1TA 4Q89A 4JHVA 2AZUA 4YSTA 3S8FB 1L9TA 2PPEA 1XB3A 2VW7A 3FSZA 3ERXA 1CUOA 4AKQA 3CG8A 1SF3A 4BDVB 1JVOA 3NJFA 3ABMB 2NRDA 1ZDQA 1GS8A 4DPCX 3NJJA 4HHWA 2GI0A 1A4BA 1PLBA 4HAKA 4F2EA 1GS6X 1MG2C 5AZUA 1E30A 1RZPA 2HX9A 3SBRA 5I6KA 4W9ZA 1JOIA 2ZOOA 1ET5A 2FQDA 2DWSA 3QPKA 3EH3B 5TK4A 4E9TA 2I85A 4AZUA 2FQFA 3ABGA 4NB7A 1L9PA 2X88A 2DY2A 3FS9A 4G7SB 1AAJA 4YSRA 1NIAA 1AZCA 1JXDA 2PPAA 4M4RB 3SBQA 1R1CA 3T6XA 2UX6A 2Y69B 1HFUA 2QDVA 3NSFA 4L0PB 3QJRB 1EHKB 4NERA 2IWFA 1BYPA 3KW7A 3DTUB 1PNCA 3T9WA 4BWUA 2YAPA 7PCYA 2VSKB 1E5YA 1ILSA 4G7RB 3PAUA 2B08A 1ASPA 3WKQA 1HAWA 4E9SA 1IC0A 3ASNB 1ID2A 2DYSB 1NIEA 2HRHA 2PPFA 3UABA 1NICA 2Y1AA 1JERA 3WIAA 2PCYA 3WKPA 4AI7A 4HCGA 3NT0A 4KNUA 1JXFA 1RKRA 4JKNA 4GYBA 4YVUA 1ET7A 1XB6A 1AANA 1OE3A 1JZGA 2YAOA 3OQRA 3U25A 4QLWA 4G7QB 2XX0A 6PAZA 2GIMA 3GYRA 1IBZA 5B7EA 1GY2A 1ADWA 3NJLA 4PCYA 1BQ5A 1NWPA 1OCZB 4KO9A 4DP7X 4GY4A 1A8ZA 3X1EA 1OF0A 1NZRA 1PLCA 4E9XA 1AIZA 1J9QA 2PP8A 3OM3B 1WS7A 3T6VA 1AG6A 1AG0A 1KV7A 1JZHA 1OCCB 4AX3A 5F7BA 1WS8A 2CUAA 1L9RA 3FPYA 1TKWA 2PCFA 1W8EA 2XVBA 4WTQA 1JZFA 4E9YA 2YAHA 2H3XC 2YQBA 1SF5A 2AZAA 2E86A 4KNTA 2UXGA 4DP1X 1GR7A 1IKOP 3X1NA 3GDCA 4BK5C 1WA1X 1SHXA 3QJSB 2QPDB 1OCOB 4GP8B 4FAAB 3KW8A 2MTAA 2Q5BA 2J5WA 1ZPUA 3EHBB 1X9UA 4DP0X 2AFNA 6PCYA 4TXVB 4GXFA 3CVCA 2UXTA 2EIKB 2XV0A 4YSDA 1EZLA 1JVLA 3NP4A 4HZ1A 5B7FA 4NAJA 2FNWA 1ZDSA 1PZAA 1ZIAA 3OMAB 3IN2A 2R7EB 2WO2B 1ASQA 3V9EA 2J56A 1FWXA 1M57B 3UGEA 5F7AA 3ASOB 5I26A 4BXSV 1KBWA 4ZK8A 1GS7A 1X9RA 1CURA 3BVDB 1RCYA 1PMYA 2YAMA 3OMNB 3TASA 1RZQA 1MZZA 2IDQA 4CSPA 3CVDA 5FC9A 2JKWA 3N2JA 4PAZA 9PCYA 3C75A 4YVNA 3FSWA 5IY5B 1OE1A 3FQYA 1KDJA 2FWLB 2YAQA 3NJHA 2BP0B 2AVFA 2BZCA 2XU9A 3FU9A 4HHGA 3NSYA 2FTAA 2R7EA 5I6MA 5B1AB 1NPJA 1NIFA 2WSDA 3H4FA 1HAUA 2FT7A 2LLNA 1J5DA 1J9RA 1KCBA 2JXMA 3T71A 3UAEA 2YAEA 4FA7B 3QJTB 1AZUA 3CDZB 3UACA 3ZX1A 3V9CA 3AG3B 2DWTA 2WO3B 1BQRA 2P80A 4G72B 3AG4B 4DP4X 1A4CA 1NIDA 2HXAA 5PAZA 3ZIYA 3NSDA 4YSEA 1URIA 1M9WA 2YXWA 4YSOA 2GC4C 2XWZA 3NJMA 2IDFA 5I6PA 4HCIA 4BDVA 1L9QA 3QQXA 2GB2A 3AY2A 3ABKB 5B1BB 1A4AA 3JT2A 3NJGA 3SQRA 1AS8A 2VW4A 2BP0A 1IBYA 2EINB 2XXGA 1PZCA 3EH4B 3WNIA 4YSQA 4E9QA 1GY1A 1BXVA 2VM3A 3GXUB 3HB3B 1N70A 3PAVA 3ZDWA 3WG7B 2OV0A 5I5MA 1ZV2A 8PAZA 3IBOA 4MFHA 1PCSA 2TSBA 3CDZA 4HIPA 2H47C 1ZIBA 4A2GA 4KO5A 4EF3A 3H4HA 3NJKA 4YSSA 4RH4A 2XXFA 3ABLB 1PLAA 4UAHA 1OV8A 2GSMB 4P5SA 5LDUA
chains in the Genus database with same CATH superfamily
2G60L 3QAQA 4GMTL 2OL3B 3CN4A 1I1RA 3QUYD 5HVGB 4YSUA 4JI7B 1T4WA 4U6TA 4LQ1A 5E9NA 1NUGA 3O9OA 4PJIF 4JY5H 1AXTH 2VDLB 4G7YH 1KB9K 3F2LA 4RAIA 2Y06L 3FQXA 3NIGF 3BWZA 1U8JB 4NC1E 2COQA 2J1KA 4Q56A 3V52H 4NQSA 4HJJH 4U7SA 1WZAA 3CU7A 3V4PH 1OTTC 1S9KC 2VERA 3U6RA 2NXZB 2MNWA 3UC2A 4WWID 3DURB 4MNGE 5DRZB 2VDRL 5JOPE 1YDPA 3PCYA 4XCFH 4AI8A 4ZI8A 1KYOJ 5AEAA 3TETA 5BXFA 1G7MB 1Q94A 1ZPLA 1KFAL 2VW6A 4NQCA 4V2BA 5B38B 4HHAB 3VDAA 4NPJA 3DXAA 4ZFFB 2IQ9L 1BZEA 2YPVL 1FAKT 4PA9A 3ETTA 3VFTA 3JASB 3FQTA 1MWAH 4KRPB 3LD8C 1FFQA 3DPDA 4XAWH 4QRPA 2WZ5A 5FW7A 1XMOO 5FGBA 4QTIL 2A2QT 3PYCA 2ITDA 1Q6UA 3LPPA 3CXHJ 1T22A 1V9PA 4WK4B 2BIQA 5EZJA 5E2WL 1EZSA 4MGXA 2BZ7A 4PB9L 2ADJB 1Q3EA 4RMWA 5EUOB 1UT9A 4DV1O 2NT1A 2EXWC 2Y22A 3GSXA 3NZ8B 3IPEA 4FQJL 4ZTPL 3I5DA 1DN2A 3ZKQD 5IESH 3Q01A 4KKAC 5DDHA 4Q6YA 3T1HB 1WD8A 1JZ4A 4YX2L 1VENA 3VGAB 2AQTA 32C2B 5IHWA 4FQ2L 2ZCZA 1XV8A 4H2AA 2QKSA 1T7ZA 1ZHBB 3MJ8A 3RX7A 3CC4V 3BA9A 5JPNB 2AK4E 4F33B 4FK5C 3GHBL 4X62B 3DTXB 3CH1B 1DQIA 4YAQA 2EVFA 3F7RA 4X50A 1C08A 4HFWB 3T8XB 5C07E 1O7DC 3WSQL 2E56A 4G7VL 4NO2A 5IK3B 3GXMA 2MNJB 2JB6B 3AT8A 1JTPA 3H2PA 1QEXA 3EDDA 3TFKD 2Z4QA 2IWKA 1O5DT 1KYFA 3MRFA 4MNQA 1CI5A 4HSCX 4FQHB 2E27L 1JPSH 1OZTG 3ZRSA 4YC2C 2XUMA 2W88A 4LKCB 2HTLC 1L1FA 4JK0D 2VQFB 2MQ3A 1N6QH 1AACA 1SDDB 3HI1B 3N1MC 2BOCC 5CZXC 2FGWL 3TH4T 1W0KG 2RD0A 3D18B 3EJJX 1SJXA 3K8MA 2ZIDA 3OHXA 3Q1SL 2VIRB 4JQIA 4XP4H 5AALA 5A2KH 1TZAA 2VQEB 3OJMB 3O11B 2IPUK 1DDTA 2KZKA 5PCYA 2ZUWA 4F15C 5I8EA 3VCLB 2Q7YB 3B2UD 4Z3TA 1TQBC 1RHHB 2H9GA 4ETQB 1RH8A 2QWRB 4L87A 1NCIA 2BC4B 4PJGB 2BNQE 1ZKAA 4AXWA 3CBKB 4W9GC 4Y5XB 4Z8FL 5KTEL 3KJ4C 1FO0L 4F8PA 3ZRFC 3VRJA 1UJ3A 1XBDA 2O6FA 1U93B 5EN2A 5EU5A 4F7CB 4NNXB 4DAGL 3TBCA 1OM3H 3FH7A 2GYSA 2WUBL 1JAEA 2G75B 1IAIH 2V1DA 4WQOA 5I8OL 3FPXA 1FNGA 3GT6A 3KPQB 4PD4K 3MGOB 4NUGL 3PLYA 1D5ZB 4OF0A 1SXCA 4OKDA 5DHVH 3SD5A 1DJYA 4JN1L 3IAQA 1RFDH 2FZ3A 4NLAA 4LFCO 1R5WB 4U1GB 1XZ0A 3GSNH 2CIKB 3RVYA 2GK0A 2XTSA 1MQKL 4QXWA 3C6LD 4OZGE 2BIHA 4CU6A 3FB5A 1WAAE 3GMQB 3MDSA 2IGTA 3AT0A 4QRAA 1RIHH 3COOA 5FM5O 3RIKA 2VYRE 4AITA 3ZHQA 3BAKA 2Z31C 3BY6A 2V5TA 3U46B 2V6HA 3RWIB 3BLKA 4DV3B 1Z9PA 2DQFB 1W6LA 1JWMA 4Z78B 2ILMA 4NZTH 1VA9A 1K5QA 4G1EB 2W0FA 5E94B 3RDTA 4FYTA 3UTZA 4NTXA 3AAZB 1SOQA 3K46A 5JR1L 3QFDA 4APQC 5BCAA 1VESA 1QLFB 5BO1L 4X6EA 1COBA 3WEOA 4XHQA 4QKTA 4XI5D 2DM2A 5C0DA 1BM7A 1KB5L 1SFDA 2ARJA 1AQKL 1JCVA 3FN3A 1UA3A 4KMTL 2J6WA 5SWQB 5J2TB 2QQNL 3V6ZA 5TH2B 2E9BA 2OI9C 4LHUD 4PGDB 3H42L 4DT2A 4KITB 1UD5A 4JPRA 1IGTB 2BO0A 2EILB 2Q4PA 4ES8A 3E6FA 5E2UL 1TNMA 1MAMH 1EFXB 3W0WB 2CO1A 3IETA 3B83A 3ZHFA 3GHEL 1ETB1 4DO5A 5FHAL 2IADA 1FYTD 4DV4B 3B8MA 1K8IA 2B8OT 2ZUQC 3EYQC 3PDDA 1WK0A 1RZJH 4G8EB 1M2OA 4CU8A 5D71L 4LQFH 5FYJH 2OMXB 5KZCB 3G9VA 3TN0B 1MCJA 3TJTA 2VDML 3OB8A 4A6YB 2RMKB 1JGEA 2VDQB 3C5SB 2CJUH 4KWUA 3V5HB 1O9ZA 1U21A 4AY0A 5DRWB 3LRGA 3GO1H 4FMFA 3G5YB 3QCTL 1MFCL 4HS6A 4JHUA 2LU7A 4WF7A 1V55B 6CGTA 1WPBA 1K3IA 2XKSA 1I1FB 2ZKMX 3GPSA 3BW9A 1SLVA 5MERB 12E8H 1N19A 3BUYA 1B3IA 1U9KA 4XRCA 4N85A 1JYVA 1SGKA 3VGDA 1DN0A 5DFVD 3C90A 4FCAA 3L5XH 3L95A 4IIQC 1GGTA 1HKFA 1CXHA 3FOMA 2IBZH 1YQ2A 4I2XA 1MNNA 3EFFK 1E8YA 1AE6L 2OP4L 3SE4C 3K1KC 4JQXA 3OD3A 4OPAA 1MCWW 4HUNB 4PJBA 3VYPA 5IOPB 3SPGA 2ZKHH 4Q8BA 2PYFA 2LO1A 3SDXA 4JI3O 4LLUB 2H3NA 3RIAK 4UYPA 4Z77B 4WEBL 4P2OA 4E0RB 5CSZB 2M26A 1DCLA 4IIZA 2YPKA 4UM9D 3E2HC 3TT3L 2ZXWC 3B5GA 2EIEA 4HGMA 2QVTA 1ACZA 4GZRB 1IKFH 5HHQB 1XGQB 3NVQA 5CJBA 1CUOA 5JW4Q 4CS4A 2HP4A 1X5HA 2I25N 3U0WH 5E99L 3EO0A 1MCRA 4LCIL 3RB7A 3UL4A 1LK3L 2BSKA 4KVNL 4K9EL 4KZDL 4NQUA 1ZL8B 4HWZA 5C0CE 4PCSA 4DPCX 4JY4A 1PLBA 3UZQA 3ZYIA 3DLQR 1GHFH 3TBSA 3SSGA 2CK3G 2V7NB 4HAFA 4ZXBC 1Q4NX 4F1SA 3IJEA 3IFNH 3W57A 2K8QA 3MHZA 5C0JA 5DO2D 5EB9A 2DWSA 1GGIH 1F90H 1KXQE 1FNSH 5DD5L 3UYOD 1HOCA 4O51A 3V9FA 4TSAL 2I85A 4AZUA 4O2EA 5I73C 3T1HO 1EO5A 3P9WB 4NB7A 1JK8A 2CGRH 4QUOA 4GS7B 2ATAA 4RWHA 2ATKC 4YSRA 4ZSOA 1YTFB 5FX3A 2J5LB 1KTBA 1BWMA 3SBQA 3T0VA 1A6UH 2EICA 5FO8B 1RZKC 2ZOKB 3X14A 5CWSB 2FTKA 7PCYA 2CA4A 1KXVA 1N67A 1XF4B 4MAYC 4R26H 2DYSB 3QDHA 4L8BA 3ILPA 5JXAL 2N01B 5DVNA 2H1PH 5D6CB 4Z5RA 2WIIB 4CDHA 3HBPA 2JKLA 4UQ3A 4N2EA 4KNUA 4A7SA 1RMFH 3HJ0A 5FDWB 1ZEAH 3QUYA 4LCUC 5ESQA 3ZKNC 1DJIA 1MEXL 4Y2OA 2JGDA 3IGLA 1AGDB 4OPHA 4R0LA 2QR0A 1ORQC 2XVKA 4HUMB 1THCA 2EDOA 4DUZB 1YY9D 3LIZH 1IBZA 1UGKA 4AMWA 3KLDA 4X6CB 5DCCA 1M3IA 2E4FA 3N1FC 1N34O 2YEZB 3KBEA 1M05A 3DO3A 5IP4A 2JJTC 3D36C 1WGOA 3LKRB 4KKCC 3RBSA 2CRYA 4I3RL 4IRZH 4QT5B 3IMUA 1RK1A 3EDFA 1YAIA 5EORH 2PUQT 1KV7A 2JH2A 4JB9L 1G84A 1P84K 1FI8C 2K6ZA 4U4IA 5AUMA 5IFJA 1QTYT 1O9GA 2IEPA 2XVBA 3O2DL 1KP2A 4I9XA 3OSVA 5DYOA 4MZIA 1QZ1A 3T3PB 4D9QD 4W9DC 4G8GA 2RJZA 1T89C 4LB8A 4N2GA 3HKCA 5EC1B 3M46A 4TVPE 4KGJA 3IKKA 1MDTA 4M6OH 4PVMA 3IDIA 3S96B 2UUAB 2CHZA 2WBJB 2ZSVA 5C08E 3TO2A 3T4AA 3BPCA 4FNSA 2X4NB 5EO1A 3FQ4A 2FCBA 5E9DA 4AYMC 4FAAB 2MTAA 4DXWA 2VXSH 3LX9A 1FFXA 5E5MB 1UWEL 4YIQB 4HULB 4GXFA 3DMMC 3U1SH 1EHLL 3NP4A 3D34A 1MUJA 5BMFH 2R4RH 3F05A 4QF1A 3J81N 2FO8A 4XDLA 5DMJB 4B0MB 3BMWA 1IGFL 1M6OA 1WTLA 5C86A 1BHBA 4JDTL 4HAGA 1NJIW 3ZMEA 4XMZA 3HHSB 1AP6A 4LBAA 1MJJA 1RULL 2ED9A 4TOYL 5FS5A 5MEPA 5F7AA 2MPVA 3K72B 4P06A 1D9KC 1P7QD 1XR8A 2R9HD 2VR5A 3BT2H 3JWDH 2HLDG 5EBLA 4BXSV 4U1NA 4KTDH 4NGHH 1S7UB 2ZDIC 2LQTA 3KPSD 1INDH 3G6AB 2KQNA 4P5KB 4RBPH 3SGEH 2A6KB 3U79A 1PY9A 4FFWD 1MW1A 1VGKB 3MLUL 3MRQA 4FG0A 4IMLB 3DX7B 5EU6E 1QO3A 4UB6Z 4XDKA 1RZQA 4W4LA 2IDQA 4HF5L 4HP5A 4TT3G 2NQDA 4WIQA 5BV7H 1WBZB 2JKWA 1BPVA 5ERWB 3MOBH 3VXUB 2ZX8A 3QZPA 4RA0C 2C1PA 2V7QG 1A4JA 1FNEA 4TNFA 5DQ9B 1AO7D 4ODXB 5AZ2H 4E2LA 4PS3A 2EIKC 5HYJD 3HG1B 1NLDL 3I84A 3G5ZA 3MGAA 4KKLC 1VFAA 4I77H 5KSAC 1A7OL 2E9JA 4LXFA 3DXRB 2DW5A 4ODHH 2X10A 3US1A 4DK0A 3WY1A 5FYKE 2UWEF 1NIFA 1G4RA 1A21A 2FT7A 5BOPA 3D3QA 35C8L 3A47A 3APMA 3O45A 2J1YA 2YAEA 5ETUB 4HYTB 3ULVH 1KG0B 5G4NA 4XXCC 3MV8A 4LIQE 1MCCA 4HEME 2X9ZA 3Q06A 4PJHE 2XC8A 3PWJB 4NCDA 1SXSA 3NSDA 2A9HA 3CC5B 1KKDA 4BCZA 1XGRA 3O6FC 1YEWA 1F58L 1NVPD 4KPHH 4HCIA 4B7EA 2I9TB 2LW3A 1KXTB 1U36A 5A3IC 4PY7B 4TUKH 3G5VA 3CFJA 5I16B 1AS8A 3QDGB 3E22B 4X9GA 4A2LA 3BUPA 4A38A 5LBSL 4GO8A 5HYQB 1OTSC 3FFCD 1ZVYA 2IG2H 5DJCB 1UZ8A 3FHAA 5IVXA 1TU2B 2AEWA 2RFXA 3PHQA 5F7LB 4M8QA 4Z7WB 2JJWA 1F1DA 5BMVA 3ZE2B 4C57C 1QEWA 1LM8V 2JELL 2NNCA 3WXWH 2VXUH 2H47C 4HUXB 4EZJA 1ZIBA 1BZKA 1E9OA 1GGCL 2QSAA 1RJLB 3ARWA 3KEDA 5SWSD 4L4VD 3SOBH 2X89D 1S0VA 3FHEA 4LARH 4DR3O 3D09A 4JKPL 4OJDH 2P8MA 5IYBO 3HUJA 4TQIA 3VFMB 4B9PA 4BQ9A 3AG1C 3MLYL 5EC2C 3FB8C 5F7HA 3HC3L 3CEIA 1DBML 3QI9D 3FTGA 2GY7B 3O3AA 4OGXH 4R8WL 4D8PB 2P6JA 4X5QA 4XWOD 4AMKH 4WJ5B 5D1ZA 1M4KA 3EGXB 1M4UA 2GUOB 4UT6H 4LHUA 1IAOB 1R17A 4ONGH 2NTFB 4OZHE 5E1AC 5DFTA 5F88A 1AOZA 1GCFA 1I82A 1M7IB 1KIUB 4HGWA 4N0UE 3RVTC 3MX0B 5HHVH 2NUTB 2VITA 4FXKA 2Q9OA 3MUHL 1DHKA 1S3JA 4XP9H 2BW5A 3OGIB 2IOOA 5AAPA 1LWRA 1W9XA 4QHLA 3SODB 1FFNA 1XGTA 3D1MC 4BYHA 4B3MO 1IIIA 2XASA 3LIUA 1INQA 3EH5B 1QACA 3QAZC 3WKYA 4O9HL 5JXED 4OGQB 3LZQA 3ZGIA 1PPIA 3T2LA 3SDDA 1WAEA 3HFFA 4GKNB 4K55A 5D7IE 1D5IL 4S0HA 2RAMA 4PP1D 4MS8D 1PGRB 3RL2A 2EDHA 5LCVL 1XF1A 5J1SC 4G70B 1G6RA 2RQ6A 1TYJA 1GAFL 4KI5F 1EJOL 2GAZA 3BAIA 3I02A 4WAFA 3QIUC 3PG2A 2P8LB 3S35X 5JHDD 2GEQA 4JASA 1X7QB 4F58L 2YLKA 4PJ8D 4LLDA 4QRTB 5F97E 5LYJB 4J28A 1MG1A 4AENB 5IB2A 1MCSA 3OZ9L 1D5RA 2W5PA 3TCLB 4Y5VA 1XGZA 2X6MA 3BQVA 1M2VB 3QUKB 5LGNA 5CEZH 1WSST 3FH8A 4NTWA 4AOFA 5I0ZA 3RWGA 3HNTH 4WFAV 4JRYD 3H2QA 2F1EA 2XYBA 2AJSL 5AOMA 4TNWK 4X0KA 3B9AA 3W5MA 1RAMA 3L3DB 1AKPA 5DD0H 3PQYE 4KOBA 4ZMTA 3MBEB 1EJFA 4IM8A 4PJAF 4XMVA 5HHOB 2XJLA 1Q9WB 2H32H 2EDRA 2OJ1A 2NY5H 3MLWL 3ESMA 4XCYB 5B4MD 3SQBB 5BVJB 2DIBA 2FIKB 3LDCA 1OSZB 3BH4A 4J4PC 1OANA 4MQXC 2XZQL 3LYRA 1DTOA 1U3HC 3JWNH 3O0RL 4HK3J 5AAMA 2Z1KA 1WEJL 3CHPA 4RSVA 4W9EC 5D55A 4BRVA 2AEQH 3OBAA 4X66O 3RWHB 3TX4A 4NP4H 3MXVL 4F5CA 2MCMA 3GMPB 1CXFA 4OLZH 3W9EB 3IDUA 5F9WB 1YEIL 1BD2B 3PXLA 3UBXB 1EK3A 4LASL 4QJ5B 3KL0A 3HPLB 4ZO8A 3N04A 1XQ8A 4ZAKC 1YYLH 2DI7A 2W8CA 3KKYA 2OXGB 2QGDA 3RFZB 3FULA 4LCCB 3DUSA 4YXLL 1MFAL 5MEQA 3FQRA 1J5OL 1LK2B 2NUPA 2NR6D 1I5XA 1C5CL 2ZOLA 1J1OH 1NDTA 4I0PB 3FQUA 4O2FB 1A9VA 2ZX7A 3QJXA 4PV1B 5JUEL 3IB4A 4HIXH 4Z7VE 3IJ8A 4GKJO 1IDSA 1G7HB 2DLIA 4MTMA 4L9DA 2YZ1A 1HHKA 1MCOL 2CWRA 2XT1B 2O5XH 3KCPA 3VFSA 4TQPA 1FJ1B 4B3RO 1A4KA 2EEFA 3OJ2C 1H3VA 4KUZH 3CSTA 4TRPL 4Y8DC 2AMUA 3N2GA 3X13B 4LK4A 4BEIA 4OI9A 4BSJA 1MCEA 2Q3ZA 2VDRB 3BCFA 4N8UA 3U9PH 4ZO6A 2RCSH 4PJEA 1U3NA 3TV3H 4LLYA 5TQ0L 3BIKB 1RPRA 1AVAA 2ZE8A 1IUZA 4YHPB 3STZB 1I3RA 4HJ1A 1BLIA 3ABMC 4NI6A 3H6AA 3WHXA 1W6WA 3KJ6H 1GPOL 4W9JC 2JJ1G 1PG7L 3FU7B 5AENA 3FOLA 3BAYA 2WSPA 4IU2A 1GZHC 3WFCH 3LN4A 2ID5A 5AW4B 4TQHA 4H20L 2N7BA 4ODBD 3ARBA 2HT3C 3U7AA 3TONA 3NAAL 5CJQL 2QTSA 4XDJA 4ADGA 4FZ8H 3P0VH 1NMAH 1AZBA 4ZD3L 5JORA 2ROYA 3WV0A 2ZPKH 2B0SH 4LCVA 3G6BA 4LO9A 4QXGH 4HIEB 2VXQL 1QLNA 4L29A 4YBQC 4Z7UF 4MVRA 5D1QB 5AYQA 3V6OA 5LBGA 4NRYA 2JIZG 1KENH 1QFWI 1HK6A 4LLMA 2ADIB 1DBBH 4XP5L 4ZNEA 4FZEH 3ULSB 2XWCA 4WJG3 5D2LA 2DQUH 4L4TB 5EEVA 3FTZA 2R56H 1FYTE 2QHRH 1YEFL 1FL3B 3D9AL 2WZPD 3FNKA 2YDEA 2CGZA 4GX0A 4WBNA 5AW9B 4NB5A 2VR9A 5AKRA 4KO6A 1LE5A 1WC7B 4YDLC 4E9LA 4LL9A 3A6CL 1IGJB 3RQ3A 2ZUXA 4LP5A 2YEVB 3F8UB 4IJTA 1M9NA 1OAJA 2AXWA 2BIOA 4R4ND 2WCPA 1G5AA 3SJAC 3FCGA 3QC6X 2ZKXA 3QPXL 1ASOA 3HNSL 4O4YL 4PV9B 5BS0A 3UMNA 4TUOB 4EDXB 3BVTA 3NQIA 4P3CH 4YFDB 1UCBL 4X20B 5EF3A 3PAZA 2GT9B 2NQ3A 4NHCH 1KGCD 4CJ0A 3Q5TA 1FO0B 2ATPA 1AO7A 2C1OA 5HYJA 2BP3A 3JARA 4L3EA 4OV5A 1A1OB 5JHAA 1JG9A 1EQWA 1PD0A 2ZQKA 1H3PH 1IFHH 2ZSWA 3MLSH 4IHOA 3HNVL 2QFPA 1GW6A 3CPUA 5HVWA 3GIVA 3MKGA 2IGFH 3BQUA 3FT2B 4I1RA 4JI5O 5C09E 4ZW3A 5JIMA 3PV6B 5EOQH 4OQTH 3WJLC 1BLNA 3HLAA 3LRKA 2X53A 1Z7JA 3ERXA 3Q6GH 2DQ0A 4CGUB 2FVNA 4ZUSA 1Z0NA 5C0GA 3RUGF 1TVHA 3D6GA 3B5TA 2D3NA 3R4RA 5ICYA 3UTTD 4LCYA 5IG7A 1SJHA 4LL1A 1NBZA 1D3CA 5IHUL 3WJJA 4F2EA 4ZX5A 2GG1A 4JF3A 4LU5L 5GRZA 3E8GA 1W16A 4F20A 5CCGE 5GSVB 4LGPB 1CLOL 1NBVH 3I9IA 4NN6C 1E9PB 4X7SL 1IVLA 2TAAA 2O4EA 2D7OA 2X12A 3QDAA 4E41D 5ABDE 2MWCA 4YHKH 1AGFB 1AI5A 1T2QH 2AC0A 3DBXA 3I75A 1TR7A 4HJGB 4W6WB 3IGAA 4JX0A 5D1ZI 3PHAA 3GMOA 3OF6D 2E75C 1H2LA 4B9YA 1KB5B 4HV8B 4PJCA 4YXHH 1A7RH 1FG2B 2V3DA 5TDPA 2AEPH 2IWFA 1BYPA 3THML 3PHOB 3WFEH 5G5DA 3LEYH 5SWSA 1S7RB 4G7RB 1JGVL 3RPBA 2DTSA 3GGWA 3E83A 4OD1H 1IC0A 1J8HD 5FA3B 1QLRA 4KKQA 1SQQH 5T33L 1CXLA 4JDEB 1HWGB 4JG9A 3I56V 2UXNA 3LZLA 1XH0A 2PCYA 1XH1A 2J72A 4GRLB 4MYPA 2GPZA 2EE6A 1B4RA 2IBZX 2P67A 4AV4A 1ZJAA 4LOVA 4GYBA 2VDMB 1JHKH 1XVSA 2VQ1B 5LGTA 4U6XB 1H2MA 2PZSA 3PIQA 4FQXB 3POCA 4RZCB 4IRJB 4M4PA 3Q3GA 2VLRE 3V5KB 4O4HB 1ZT7A 5IJ0A 1E5BA 2HT4C 3WTUA 3TO4A 2O61A 3ARVA 4Y1SA 3NIFB 1N5YH 4ICWA 5C97A 4WFED 3W38A 2L04A 2YK1L 3GB7B 3MRLA 3PGCB 3ABKC 5DJYA 1P6FA 3S8WA 3QZWG 4OJFL 1I7TA 4XN1A 1EAJA 5EF2A 2A6JB 4YOKA 4Q14A 1W8EA 1RU9L 5F1SA 2HVJB 4XBGA 5DA0B 4BFOA 1JDAA 4OZFA 1LWHA 2HN7B 3P3SA 3IMSA 3QISA 5MEND 5E5UB 3WENA 4X7FC 4WWKC 1D5XA 1MJUL 1KEGH 1KN4L 2UXGA 5JHDA 1DJZA 1KELL 4K2UH 5EBWA 1KACB 4ABVA 4OZIE 4YQXL 1J7VR 1VERA 2DICA 2MEJB 3BISA 4TLUA 3V0VB 4B95C 4PJ8A 4TSCH 3S5LB 4ZMOA 5B1NA 4PJFB 1XSOA 3Q6FB 4U31A 1F3JB 3GIZL 4RAHA 3U9UA 1UXSA 2CLVA 1MFDH 2HWZL 1LL1A 3OAUH 4UZUA 4GSDH 4AH2A 3IS0X 1RD6A 1I3VA 2V9UA 5KVGH 2BY1A 3TZVC 4YLQT 4YSDA 2ETNA 2GBVA 4ZOLA 2I07B 5EU3B 4J39A 3VQYA 3MOAH 1UURA 2VLJD 4I0XB 3KYOA 4JGNA 3K9SA 4W9CC 4K23H 1P5VB 3VXQB 3GNMH 1EEYB 4WW2A 4RIRB 4ZDHA 4MVBC 1FWXA 5E6RB 4KKAD 2P24B 1IXBA 1OP9A 1SZXA 1V3KA 1ZOXA 2MIZA 5H4ZA 3IRPX 3MCG1 1D5NA 4F80A 3DVNA 3L3GA 4LEOB 4PJDB 2WWKO 4JKMA 2FJGB 3W7WA 1MRFH 2DOCA 2EO9A 5DWPA 4WI6A 2OBGA 1ZA3A 2H1XA 1H2SB 2H41A 4XNXL 4BQBA 5IYZB 3KPSE 4HKXA 5DEGA 2WNWA 2C2AA 1VQLV 1YMMD 1Z5HA 3SO5A 3R06A 4IGBB 3ZDXF 1J0IA 1M1XB 1OE1A 3BUBA 4B9ZA 4IS6A 2JCCE 3T04D 3L3KB 2BZCA 3JUYA 2VE6A 3KWVA 4PA6A 1HHGA 3SJCC 3U0PA 3JV4A 2LFSA 2HTLD 4D0BB 1A6AA 1J10A 4JDVA 2NR6A 4LMQE 2K9FB 3O6LH 4LRIC 3RWEB 4AZ8A 1KBGH 5K1PA 4DJMA 4A39A 1KJVB 4YHYB 3O9WC 1RVFH 1UGNA 1WB7A 1PS3A 1E9QB 1U6AL 2IH1B 4J3BA 1NIDA 2G0LA 4LCWD 1I94B 5I1KL 4HAMA 4EZKA 4QWWC 3FT4B 5DVKA 2QV2A 1MW2A 2JTDA 3PN1A 2ZT9C 4DR6B 4FG2A 2PF6A 2R1YA 4EIGB 1NAKH 2L3BA 1IFGA 2VZ1A 3N44F 3CJHB 2R59A 3EG9A 1VFMA 1KB9J 3IYLW 1QTPA 3K4DA 3WKML 4XVJH 5JW3H 2EINB 1SYVB 3QG5A 3TJHD 4EXKA 4PLKD 1WWBX 4DETA 1ZSPA 4FE9A 3F5WA 3AEIA 3L6FB 3L3OA 1INEH 3ZDWA 3MMEA 1MI5B 1ZV2A 4LVOC 5ALCH 3T1FB 1IJ9A 4WI7A 3FFCE 3LDBB 3L3IA 4R50A 4KROC 3AU1A 4P2RB 1IZ3A 2ICWB 4YBLB 2DQCH 3CNKA 1CDYA 4AQ1A 1GGBL 4P23B 5HDBE 1YPZE 2B59A 3MRDA 3V55A 5DS8A 4NZRL 2YXLA 2B4CH 5EO9A 4NQEE 2GTZB 4RLDA 1ZLVK 4G5ZL 4L4VE 2B39A 3ZRVA 4MSWB 3E7JA 4F7MB 1DP0A 4DW1A 1WBXA 1A7PH 3FH5A 1QSEB 5IMKA 1FL5A 5AZEL 4HC1H 1AHWB 4X6DA 4P4RB 1H3TA 1WP7A 1WHPA 3NA9H 2FX7H 4APQD 1QVOA 5HYSB 3L5HA 3VH8G 5L8LB 1B4LA 5DJAA 3DV4A 1AIFA 1BQUA 1BVOA 4PJXE 4ZJ9A 4PVNA 3TT1H 2R1WA 2DLEA 4CH4A 3N42F 4OFIA 4TVPL 1M93A 1T80A 3JWNG 4ODTL 5EFIA 1WHOA 2BP8B 2CBPA 1Z3GL 3MRGB 2AQSA 3ULVE 2ENSA 3MBXL 3OLIA 4NQQA 2CGYA 1KU9A 4BZ1H 2JQZA 1KJMB 1A32A 4JZJA 5KSVA 5LG6A 4G8FA 2H0FA 1DJXA 3LZOA 2AV7A 1E6OH 3MN8A 3VXME 4OGYL 5JPMB 1P4LB 3AREC 4KI5C 1WLHA 2JK5C 1N36B 1SEBA 1TQSA 2X9WA 3B37A 3HZYB 1JPGA 2XV2A 1BWWA 3BXNB 5M94B 2R69A 3ECBB 1EHAA 2QADC 1WN7A 3TNNB 1QRNA 3MZGB 2EYTB 3M7FB 4QXUH 3OKMB 3I55V 1B90A 1IKNA 1KIRB 1A14H 1JMZA 3DNKA 4Y4FC 2V3EA 3CPWU 1BW8A 5EEYA 4AM0B 1BHGA 1OGAD 3VFNA 1HEZA 5IFHL 1BFSA 1PSKL 2IANA 3V8OA 4GAJL 2HFEC 3N41B 4G11A 4JRYE 4K5LA 2IFFH 4PJ7F 3T3ME 3ZTJH 4ZHQB 1HHHB 2VR7A 3MSPA 4OIIH 4EN2A 1J0ZA 1NCAL 5DFWH 3SGKA 4M7KL 2DTML 1UD3A 3B6SB 3VTMA 2A1WH 5FECA 3CSBA 4MAUL 2J88L 1XEUA 3UTTA 5HGHB 3ULUL 1CD1B 5KG9B 1XIWC 3R66A 2HG0A 5T3XL 1H0DB 1T03H 1NMCC 2AJVL 2EIJB 1TITA 5BZBA 2DKMA 4D7BA 3KDMA 3VD0A 2CJTA 2HLEB 3GS4A 2FX9H 5IVZB 4OLWH 4C55A 4E41A 2BM3A 1F86A 3KNBA 1U95A 1L5GB 4H5SB 3R19A 3O3DA 4GQ9H 4LVHB 1UJTA 4BH8B 5KVFH 4UCRA 2DD8L 2L6LA 1T0NB 2Q7HA 4RFOH 2P5WD 1BT8A 1YEJL 4H0HB 4I0CC 4ZXBD 3MI6A 5I76B 2AHZA 2A6IA 4F2FA 2NY1C 3BD3A 1EPFA 4RRPA 2C7UB 4XN8A 3NCJH 3BDXA 4CUCA 5C0FB 4OCYH 1AH1A 5AW7B 3QFJD 1Y76B 1R3JB 4GNKB 1FIGH 1NKOA 1AHKA 1GC1C 5DJ2B 3WD5L 3ZY7A 4XWGL 3X2QB 4JI4O 1NI8A 2AJXH 3D39B 5IGXL 3U4BH 1PX8A 2JNZA 2CHNA 3VI4F 3KYAA 4AYID 1BYOA 2UX7A 4PS4L 3VXOB 2NY5C 2QDOA 2EDQA 3HI5H 4G1MB 4O02B 3P77B 4HMEA 3CRQA 3GKZA 2V2XA 3QH3B 5LWYL 5CEZE 1YCIA 3ARGB 1A6WL 3JWNC 1AXSB 1RURL 5IV2A 2FAUA 4RQFA 5SX5H 3VXRE 1DFBL 3QDMD 5AOJA 4LH6A 3T2OA 3UADA 1R6NA 2X4OB 1S7WB 2J1XA 1SHWA 3IWVA 3K7UA 4RAUB 1M7DB 1K7DA 2R15A 3PS6A 4X83A 1X3DA 5E7FA 2WVVA 1P7KA 2YD8A 5AOLA 1KY7A 3E35A 2UXDB 5BZZA 1S7XA 1ZS8A 3KGRA 3NXSA 4OJAA 4D2NA 1ZHKB 2XZAL 2X87A 1D2OA 4DQOL 3JWNE 3JALB 2CRIA 3C5JA 3QHFL 5IBLC 2GEEA 4J2QA 5MENA 5F7KC 4Y2DB 2DMBA 4XNQA 5TF1L 1EZUA 1FCCA 2K78A 3SDYH 2FWSA 3QA3A 1MHPL 1S7TB 2JB5L 5IEHB 1MSWD 4A2DA 5E6YA 2ITCB 3EKCA 4X7DC 3GI9L 4POUB 2QA4V 3QWOB 4UQIM 3UJTL 4QGPA 1JGLL 1HDMA 3LAFA 1MZFA 1HXYA 1PDKA 5D93C 5GZNC 1EZJA 1W80A 4MA3B 5EZOH 4WV1C 3KVQA 3LQMA 5KS9F 3V4UL 3RWDB 3HG2A 1IX9A 5KEZA 1ILUA 1PD6A 4NKDA 4NRXB 2VLJA 4OIBA 4Y9EA 4QRRD 5DHYB 3DJSA 2J6EA 3D7PA 3A4EA 4YDIL 5FO2A 3HG3A 4OF6A 2ZZUT 1HU8A 1OV9A 1QWUA 3TIEA 1WA8B 1F4AA 2IFGA 4HH9B 2IPUG 1RZFH 5DMGC 1K73W 5DR5L 4NKIL 3K2MC 4QRQB 3RWCB 3SDAB 1OCZC 3STBA 3RY4A 4QYOA 3WEXA 1IGML 4QR7A 4E5XG 3K6FA 1X5XA 1G1CA 5JW4R 4HS8L 4JM2F 3RG1C 4ZMVA 1B3JA 3RPIB 4PRID 4U2YA 2VMFA 3AK3A 1IURA 3TV8A 2PWEA 4OSUL 3ZKMD 5CM1A 3AITA 1ZMYA 5FM8A 5BRZA 1OZ0A 3NFPA 2Y72A 1OAYL 3D05A 4JPVL 1CYGA 1OEZW 5IWAB 3UTQB 3BUTA 3DX8A 5IIEB 4CVZB 4BKLA 4ZZFA 1KGCE 1HS6A 4N5ED 1GTOA 3CK0H 4JHVA 4KZEH 3ROLA 2GDSA 3H9SE 2VRAA 2AZUA 1KGXA 1IGYB 2BOCA 4FQLH 1JWUB 1UHVA 2NOYA 2CZNA 2J2ZA 5ADPL 5GS1C 2W07B 2O6CA 4LESA 2RJMA 2WJ7A 2X3CA 5KSAD 1FE8L 3I6GA 3PWNA 3APNA 1NAMH 3HC4L 2WO4A 1U33A 4H8UA 3NJJA 4PREB 3GLAA 2X2YA 4U1SB 3ISRA 2Q10A 2VLKB 1QR1B 1E4XL 3ZE0E 1H5BB 1BVNT 2AXFB 2OPCA 3CSYA 3OKEA 4W9ZA 1Q90D 4YHML 4HQQL 4WI3A 3PHSA 3RYHB 4NKOA 1KJ2H 2EACA 3QPKA 1XEQA 2DMKA 1UT2A 2YICA 3T0EC 3VX1A 3N40P 2FSEA 4DKAA 3JTTB 2X41A 5HI3D 1H9DA 5IKCB 3D4GA 3LRHA 4MD4B 4OTXH 5MEOB 3L1OH 1PW3A 2M1KA 4MNGB 5T5NF 1FIEA 3O6FD 1NBQA 1EAPA 2OQJA 3JVGC 2NX5A 1A0QL 1FUNA 4NSKB 2EDBA 5F1IB 1OM9A 2D9QB 4M7ZC 1RPQA 4NJ9L 3K58A 4GBXB 3WXVH 1RP9A 3FO1A 1ILSA 1VEOA 3DGGB 4DGUA 5I30L 1OTSD 5K39B 1PTZA 4OD2A 2Z31A 5GGVL 2ZUUA 5A2LH 3ESPA 1UPGA 4JAUA 5I5RA 4AQAA 5LGKA 2Q7GA 2EEBA 3AS1A 2HJFB 3AWGA 3HFMH 2B9BA 5KSBB 1XQ4A 5C2BH 4W81A 4HGKC 4NQDE 4PDMA 3ZDYE 4APQA 1ZTMA 4BUHA 1HTYA 5CB4B 3CJJA 1FZMA 3MRMB 4RSYA 4LF8O 2Q67A 4GAGH 2Q8BL 4DV7B 1UB6B 3PDOA 2BNUA 2MOVA 4FXGB 5D2NE 3CP1A 2V7HA 3O4LE 3RN4A 1T0MA 4NUMA 1SVCP 3D69B 1IGIH 3N2KA 1HNXB 4ALAH 4QHUB 1CCZA 1ITCA 1WV7T 2G9HA 2OMWA 2F93B 2N05A 4PU2A 5LVEA 3CXDH 4H88L 4DV5O 2CBTA 2GV9A 4EKWA 4YJ3A 2MH4A 3RKDC 4GAYA 4LDCA 4JZGA 3MRBB 4HOWA 1OCCB 1BIHA 5FR3A 2KHAA 3QORC 3UO3A 4G2KA 3DA0A 4D0CA 1EX0A 4W9HC 2KPNA 1TZ8A 4M43H 2DPKA 1HINL 3FZUC 5E2VL 1SY6A 1IKOP 4D9RE 2O57A 3IJ7A 1FH5H 2EH8H 5T1LD 2EZPA 4AL8H 5LQBL 3RGVB 3PWVB 1I8MA 4WFFD 3TBWB 1JNNL 1YNTA 4OAWB 2A9DA 4GP8B 3V95A 3QXAA 3QXUA 2BY2A 5C92A 1PFOA 1XSJA 2PUSA 3L4UA 2CAZC 1X5JA 2FYVA 4JFED 4WTZG 3IJHA 1G6RL 3RBZA 3E8UL 1OGAA 3QIUD 2Y6SD 3KAAA 2R0WL 2G2RB 3N85L 4IIQA 4ZOAA 4G6KH 5C6TL 2VR3A 4GW5A 4ELMA 1MHHB 4LKXB 4FM0A 2BNQB 1BS3A 1B4JL 3SE4A 4JI6O 4JY6B 3D85A 2NY0D 5ADOL 1F11B 1HCFX 4JPKH 3CFQA 4MDIA 2VDNL 4DUWA 4Z7NF 2EDDA 2YD5A 5CR1A 3GSOB 5DLMH 5CMAA 3LH8A 4LF6B 2O5ZH 2B1OA 3W39B 1RZ7H 1XH2A 3BSZA 1Y18B 4OUUA 2N7AA 1DLBA 1JFFB 4J2XA 2V4LA 1VGEL 4UV7H 5I66A 1IBMO 1T1YB 4LFAO 2XAQA 4UB0L 3MV01 1J5EO 2I32A 3H1JH 1I0HA 5J2UA 2IV8A 5GTIZ 2R51A 3B2MA 1VQOV 2WA3A 3CC7V 3OR7B 1QP1A 1KBPA 4NC2B 1YMME 1CU4H 4B5ZA 1K3ZA 4MQXD 4X5PA 5GS0C 4YDNA 5ESVB 1OAKH 1U3HD 1WRFA 2A77H 2CDFB 5AW3B 2DDQL 2BP0B 3VSVA 2AVFA 1X9LA 4ZXBA 4UUJC 1SJEA 1QAWA 3WIIL 2BSRA 1RUKL 1ZVSB 1BQZA 4J5VA 4HKZB 3ZQXA 3VWKD 4FKKA 3H4FA 3WGVB 3QFJA 2M83A 4FQQA 5JA8B 4BD4A 2PWGA 4CBCA 1Q1JH 5FHBH 5K9JH 1NDGA 5L2KB 4ZAKD 4UQAA 4JAMA 2ATKA 1BQRA 2A73A 1BM3H 5BZDA 1IAIM 4CRPA 3ZN6A 4X9YA 3UTSE 5MHSD 5HDLA 4YSOA 4A7GF 5D5MA 2OYQA 4J7JA 1BECA 1DQQB 2IDFA 4LCWE 5CZVL 4MLSA 3G3LA 4LAQL 5KVGE 3VTAA 4MAYA 1SBBA 4CBPA 4XPHL 2A9AA 4YR6A 5KYNA 1J95A 1NFDE 1R24A 3FU3A 5C0AD 4E9QA 1E2VA 3VQMA 3MRKA 4APXA 3FQXB 4EEQA 1H15A 2NY6B 4NQSB 4DGWC 4LCUA 5F7DA 1MCPL 3TGUH 5TDNA 2NY7H 2PTUA 25C8H 1DQLL 3HS0C 3R8BB 3U6RB 2AJUL 3P3TA 1ORQA 5L8JB 3N1QC 4GCZA 2FJHA 2XETA 1UENA 5FPOA 4LRNH 4ODVL 1PYWA 2IJIA 4EF3A 3QXDB 3H4HA 2YQGA 2W9DL 4ADIA 5HGAA 5BW7C 4F57H 3RW0A 3ESUF 3H9HA 1Q94B 3T1YO 1GL4B 5BXFB 2OL3H 2JJTA 3D36A 1ZGLM 1OIOA 1PLAA 1S9YB 1G6UA 1I8KA 1LO4H 3L17A 5AW0B 5BZXA 3OEEG 1O9WA 3N40F 3B4SA 3VFTB 3FQTB 1CICC 4ODSH 3ZTJG 1HNWB 1CGYA 4PWJA 2WM0A 4WTXA 3WNPA 1QW9A 1FGNH 2ITDB 4LSTH 5AWNH 3L9DA 3L3HA 2KLRA 4G42A 4EUPA 1T22B 2ZONA 2A3QA 4O2BA 3B7SA 3B8NA 3NFNA 4J12A 3KVDD 3RJOA 4YPGA 5IYDO 1YG9A 1YY8A 3BRGC 1CL7I 1T89A 3GSXB 1CDBA 2J12B 4FLUA 3EOTH 1ETJA 1S5LZ 3C5ZC 4YBQD 4RMQA 1NR1A 5DDHB 5KOVC 4PDRA 4DR2B 2YBGA 1Y1UA 1YECH 3BAJA 3G6JF 3K3WA 4PLJD 4QRRA 1YYMH 5B1OA 4S1SL 4BWAA 1EBOA 3NK4A 2MCPH 1Q0XH 4UFZA 4YFLF 7PAZA 3L45A 4YAQB 1KGUA 5LDSA 3DMMA 3HR0A 1C08B 2VOTA 3LEXA 1E42A 1Z5VA 2VAJA 1U58A 3CHQA 4OFKA 2BVTA 5J9PC 3ZSSA 4NO2B 2VM4A 1U8MA 2E76B 3L4XA 3MRFB 5TE7H 1XZWA 4MNQB 4YUEL 2ZD0A 4P49A 4Z6AT 1NL0H 4JO2H 4AQYO 2O5YH 1D9KA 3DRQA 3HS8A 3PWUA 2AJYL 4EN3D 2ZDIA 4W9LC 1MVYA 3QXVA 1ZT4A 2H2PC 5B8CC 2ZM6B 4YLBA 4XMLH 2N74A 2N1TE 2ZXGA 4K7PY 3WAJA 3LPOA 1YEEL 4QE7A 4UVAA 1YJDL 1TQCB 3G6EV 5I8EB 2WPGA 1YAZA 5ITBH 5KAIZ 1V3MA 3W2DH 4H8WH 2H9GB 1TEFA 4GG8A 1EZVY 4HBQA 3QO0A 5DEJA 4Z7QE 4L1HA 2ZYRA 5LMNB 2PXYC 3OXRA 4YY3O 2OW6A 4P9HH 2OJZL 1NCDH 3VRJB 5KSAA 1UJ3B 3ZS8C 4H44C 2Z7ZA 2IC2A 1CZ8H 3PFQA 4KFZC 4MXVE 4LSQL 4LH7A 4YDJA 4TSBH 4GSXA 1D6EA 1S3RA 3C5XA 2QZQA 2WLIA 2PR9A 5CLZA 1FZJA 1FNGB 5GJTL 2I5YH 2W9EL 1Q90A 3H7LA 4XXCA 5IT2H 2XTJE 1SMDA 4RCAA 3AG7A 4N0YH 4CILA 2UU9O 4KXRA 4KRPD 3UEZA 3GK8H 2EDKA 1XZ0B 2E74C 1SZNA 3NFSL 4OGZA 5FA4A 4ACTA 3TPKA 3IGFA 1FNFA 1FBIH 1PKOA 2WK2A 3TA3C 4WDIB 3FB5B 2NY3C 1I1YA 3O6FA 4AGOA 1R46A 5D1XD 3IPBA 3ZMUA 5J6SA 4ES9A 4WI0B 3RB5A 2P5WE 3VQLA 1A6VL 2ZAGA 1YDXA 1K8AW 4JYAB 4JFFD 4RGNB 1HILA 2W0FB 2CG9X 1TVKA 4V33A 4QIRA 5TDOA 2AQ1A 4YHOH 3UTZB 1KCVH 5CCJA 1N8ZA 1OAXL 3L4YA 4HEPG 4X6EB 1QD0A 3WNOA 5C0DB 4JKLA 3FTYA 3UKMA 1L9OA 2ARJB 5KHHA 5B66Z 2UUCB 1CGSH 4I18C 5HY9A 2Z65C 3VXSE 3SIKA 4H1LG 3D8MA 3VB8A 3V6ZB 2XQBL 1M9SA 3C2SA 3N6YA 3P4NB 4NWUL 1UD4A 3AQDA 4MJ2A 3SDCD 3FSAA 1VLXA 1XB8A 3FB8A 4L1BA 5EC2A 3EJZC 4WHYG 1SJMA 3QDME 2VISA 5FUOH 4FQ1L 4ZUUA 3IETB 3K2IA 5J12C 3HE7C 3IDMA 2IADB 1FVDA 1K8IB 5E1AA 4WUKH 4J80A 5I9QB 5F44A 4JHWH 1KTLB 1XGPB 5EIBD 5IW1A 2FH6A 3WUWG 4HPYL 1JGEB 2OX5A 3BHPA 5B3NA 1ZLVH 4LF3A 6FABH 1M56B 2HT4D 4KV5F 5D7KE 3O8XD 4BQCA 4J3SA 4HS6B 4LF5O 3I85A 5KYYA 1Y7VA 4NFDA 5LO7A 3IC7A 1O5PA 2YI9A 3PL6C 4PA3A 1WJZA 2WUCH 1MJ7L 1W2KT 1BAFH 3F58L 5GRUH 3BUYB 2Q0ZX 4U2ZA 4WEEA 3RGBA 2CE6A 2J1ZA 4XRCB 5KVFE 2X6AA 3FT3A 5I1HH 1W72A 1DYZA 2OK0L 4WFFA 1FKAO 1Y0LA 3POHA 4U6HA 4XO9A 1JGDA 3WIHL 1URZA 3L95B 2Z35A 3PP3H 3ZKXC 4RO2A 2JJVA 4J3VA 4DTGH 2QHLA 2RDCA 4JM4L 4I2XB 4JFEA 3QDJA 1LVEA 3LV3A 4KI1A 4A6YH 2VDQH 3HC0B 1JV5A 3QIUA 1SRYA 3VXTA 3FBQA 4PJBB 4Y16D 4PR5A 3X11A 5GGSA 5DQJA 2Q7AA 4GAFB 2KSDA 2A0LC 4Y5YC 2F19L 3SDXB 5DGQA 2LAGB 2H3NB 1IM3A 1GO3F 3GI8L 1R3IH 2PYED 5SWZD 1H8HG 5IDJA 4KNQA 4P2OB 2D7TL 4YBHA 2WLZA 4QIWF 2ROXA 5EIIB 2YPKB 2VXUL 3RVXC 3UIZA 4MA7L 3T0AA 2EEDA 1HHIA 1HHJA 1RJZA 5CILL 1KCLA 1FZOB 5EOTA 1AQ8A 4KZCA 1DZ0A 1JPTL 4FQCH 3EO0B 1SETA 3TCUA 1PIFA 1TJGL 4ATTA 2BSKB 4JM2C 2YJQA 1MN4A 3ZEDA 1AGCA 4HWZB 4B27A 2VABB 1FGVL 2HRGA 1CXZB 2QTOA 2W38A 4M8UA 4KX7A 2X0WA 3UZQB 3FCUB 4PRIE 3NGBC 4ZMQA 3R18A 1UH4A 1N6VA 4FI8A 3VFPA 5BZWA 1MQ8A 4GLRI 2FJSA 3L5JA 4OX9B 4J4PA 4QO1B 1IC4L 1U3HA 2QQKH 5HI5D 1HOCB 4JVUA 1KF9B 1M7UA 4O51B 3L5WA 1YIJV 4O2EB 4Q89A 4P2AA 2NNAA 3BCDA 1R3KC 1QSFA 1FC2D 3GC3A 3H1IH 3GMNA 4ZSOB 1IT9H 1DL7L 4MD0A 2CLZA 3DV6A 5ICUA 5I8KH 5LHDA 1AB3A 1EFXD 4PGZA 3SE8L 1QPKA 2GIXA 4PBVC 1A1MA 5E5LA 2FL5B 4ZAKA 1OOAA 3X14B 4ZTEA 4P9ML 1C8QA 1JVOA 2NZ1A 3FTVA 5LUMA 1NGYA 4LVNC 5KZCD 4LNVA 1F97A 3GS7A 4HHWA 4L8BB 1HEHC 3D06A 4S1DC 1UC6A 4Z5RB 1RZPA 4LZKA 3P02A 2XIBA 1B9KA 5GJSL 3KPRA 1JOIA 4Q7DA 3QQDA 4UQ3B 3SCMC 1CO1A 1U42A 4I13B 1C5DA 4GUNA 3GRGA 4K5MA 5TK4A 3N9GH 2P5EA 3QUYB 5J7CC 2YSTA 5C0AA 5ESQB 4Y2OB 4ZYKB 2JGDB 4BR6A 3P54A 2CJSA 4XNUL 4R0LB 3FONA 3FS9A 4ZMYA 2QR0B 5KJRL 4JFSA 1EH9A 5CFHA 5JJJB 2OCFD 2RH0A 5I1JL 4K3DL 4ERSL 3AK1A 3OPZH 4RMSA 1HKLH 1V8HA 4BGDA 3BN9D 1RUPL 1Q9OA 2DEXX 1M05B 4P46C 2EC9U 1V27A 4YDKH 1JHTA 2WXFA 3BJ91 1RK1B 2V5SA 4PTTB 4BKSC 1S76D 4GXVL 2X7LB 3E3QC 3S97C 2NY2C 3H1KH 4NOBA 2JEUA 3T0WA 3VD9A 1CTOA 3LDDA 2JVDA 2YKLH 4JO4L 4KXDA 3UABA 4JYCA 1OLLA 4PI2A 1GZHA 2Z7WA 2PR4H 2P1YA 2WLYA 4YNYA 3HKBA 4LGRB 4KROD 5DYOB 3UG3A 2JKXA 5F6HJ 4UT9A 4YVUA 4K94H 1NMBL 4OF5A 4PGBA 3REWB 3HKCB 1JZGA 2HH0H 1BBDH 4OCNC 3PWPA 3U30B 4CMHB 5T1MA 3IDIB 4I3SL 4WENB 2ZSVB 4FIPC 3TO2B 2NZ9C 3BPCB 3T4AB 3NCWA 3AG4C 4I5SA 3KBPA 5EO1B 5E9DB 3CZGA 2W94A 3WL9A 5JOEA 1GYVA 2XN9D 5B22A 1ZLSH 1OSPL 4GY4A 1FFXB 1A8ZA 2GJ6A 3HI6H 2YA0A 3QWRD 5HJBA 5ITFB 2WN3A 3GSWB 2JKRM 5FUZH 3DGCR 1MUJB 1J88A 4NZ8A 1K2DA 3L1GA 4QF1B 4KJWC 4AQ8C 5CBFA 2YGVA 3RU8H 2CUAA 4M7LT 4GAAA 4PJIE 1M6OB 3QEUA 2FEEI 2LV4A 4CC6A 4WTQA 5E56A 4YHLL 5FB8A 5MEPB 3ZDZE 2YAHA 1MJJB 2ED6A 4R6ZA 1TETH 1XR8B 4DO2A 3F85A 3Q48A 4QCIA 4RGMC 4YE4L 5EBLB 1JNJA 1G4YB 2EIDA 3V4PB 5DEZA 2FB4L 4OR1A 1LUWA 4FLZA 3ZRWA 1G5GA 3MRQB 1KCSL 1NLBL 5IUSA 1QO3B 3OKYA 2MPAH 3NEOA 3VSUA 2F54A 4DN3H 1WF5A 2AGJL 1Q8IA 1X9UA 2CBOA 3AB0B 3ARED 4KI5D 4PWKA 1HN1A 3S3WA 3DPBB 5HHMD 5C09A 3Q4HB 2IWGA 1FNEB 1S5IL 1VF5C 2CMRH 1IEBA 4B9KC 2QADD 4QD2E 1UVQA 2W0LA 2KG7B 1ZDSA 1VFAB 2DJVA 2ZWKA 1MNUH 2R69L 5DWUH 5ESAB 3OMAB 4ODUA 4JHAL 4N2DA 1G43A 2ZOWA 2FJFA 2LLGA 3OGCC 4G9FD 3V0GA 4N20A 5JO5A 3UGEA 5C0RH 3ZT7A 3O45B 4EOWH 1UA7A 4FMTA 1ZK9A 1KBWA 3JD3A 3GSUA 1HXMA 2D4DA 2BVPB 4WNSA 1OK8A 3LZPA 2VRZA 1CBJA 4RNRA 3RFRA 4UOJA 2AITA 5LXVA 5CA1A 3WJLA 5EU7E 2HKHH 3K5NA 1P4IL 3WLBA 2ZWLT 4I85A 3RDJA 4H0LB 1XGRB 2OMZB 5C1MB 4IMKC 2XQ0A 3FQWB 4LEEA 4IU3A 2DBLL 4ZUVB 4OGAC 2W6JG 1JK9A 5IB1A 3CFJB 3UAJC 3C6LB 3ZX6A 4X8AA 1CFBA 2XU9A 4FGMA 1PZDA 4PFEA 1QNZH 3CLFL 2DLFH 2O6PA 5EUKA 5MP6L 5IVXB 4JZOA 2ZAHA 1MVFA 4JFDD 3T2NH 1MFNA 4GLXA 2RFXB 3PHQB 5FGCE 3UAEA 1PLGH 1Z66A 1DE4A 4M8QB 2W6IG 5BMVB 1TT6A 2D7PA 3BAEL 3TYGH 1GCYA 1QEWB 3A24A 4JCWA 4OCXH 1AZUA 3UACA 3I9GL 1NPUA 3V0FA 3AG3B 3QYMA 1E9OB 3OPUA 1F3RB 4ONHA 4JAVA 5I8CA 4XR8C 1K4CC 2NY1D 2X2JA 3HUJB 1K72A 2XWZA 1D5MA 1GMEA 1UXWB 4LSPL 5AB1A 1GMGA 3J7AU 3KLQA 1JJ2U 4UNUA 2NNUA 3JAKA 2A74C 3O3AB 5I6PA 4NO0D 5IR1A 2EUXA 2VLRA 2HHHB 5TQ2H 3LB6D 5B1BB 3A21A 3KPNB 4LHUB 3SYOA 4MB1A 5BUGA 4U3JB 3QO8A 5F21B 2E7BA 1AJ7L 1YF2A 1Z9MA 2GJJA 4HGWB 4G6MH 4UM8B 3GXPA 3QEQD 3HZVA 4F8LA 5ECGA 2Q6WA 4OF7A 2IAMC 3LRSA 1XWVA 3L70H 4QHLB 3TH2T 1FFNB 1XGTB 3O6KL 1ADQH 3X12B 1INQB 4NNPH 1J87A 4QTHA 1FSKB 3F7QA 2JJUA 1TJIH 4JO3H 4RFNB 3P4MA 3J2PA 4KO5A 4XVTL 1C1EH 1ZANH 4RA3A 4A2GA 2SODB 4BQ6A 5DHVB 4RH4A 2XWBA 2DQGL 3CMOH 4OZIA 4PRHD 3MV7A 3RL2B 4AIEA 3JZ7A 4X5LA 3K0WA 1OCWH 3UO8B 4IK6A 1G6RB 3SKUD 1KKCA 3BZEB 3DVGB 2ESVE 5E9AA 2GAZB 5FCSH 4OIFA 2QTVA 5IQNA 3TGXA 1IC7H 2JFCA 1BVLA 1X4XA 2DJ4A 2A9NL 3NYKA 3ABTA 5CUSH 3T09A 4LLDB 1S7QA 1WAZA 2VDNB 2VM9A 3WG7C 5IB2B 4WWKA 2EAEA 3ZHSA 4KJQC 4KK8C 4L8DB 4Y4HC 4XPFH 4BELD 2E6QA 3BPNC 3Q2WA 1I31A 3KH4A 3BYYA 2AXGB 1N2RA 1AR5A 1B0RA 4DESA 5SWZA 5C70A 2PYEA 2E9WA 5HHXL 1ZGLB 2G3ZA 1WWAX 4UM9B 1OAZL 2VR6A 4L23A 2WKOF 5GZND 1U2CA 4Q9RL 1MCLA 5DRNA 4Z7OB 3TZVA 4P07A 3ABLC 4O4IB 3LIZA 4ANXA 4Q20A 3BP4A 5ISZD 4M5ZL 1PFCA 1U3YA 1TSRA 4HLZH 5GIRA 1EZVH 3IF1A 1AVMA 3HS9A 3WO3B 3QUXC 2UY6B 4UWQB 3DJRA 3B77A 2FEDD 2HKOA 1VQMV 1N0XH 3OTOB 3OB0K 4DUXA 4MJ6A 2BH0A 1LO0L 4YMPA 2BLFA 5D6DC 2J6EL 1EGJH 5AVXB 1KEML 1GJWA 3HRZC 1UOLA 3QQ4B 1NANH 4PP2A 5DMGD 3M6DA 5HJDA 4E9WA 4WI8A 2UXFA 5HTSA 2OULB 1Z0MA 3NJXA 1FC1A 2R29A 4OU3A 2JI1A 3OT7A 1DBJH 4UDTA 1CL7L 4AYGA 2DL9A 1DEDA 3JTSA 1WP8A 4FNRA 4JFPA 1KC5L 3ALPA 3GZKA 1KCUL 4E2OA 1HZHH 3DUSB 3RYIA 1F4WL 1JZJA 1MJ8H 5MEQB 1FCGA 1M6UA 1MFVA 3FQRB 3VRLF 5CP3H 4JPWL 1DEEA 1KNOB 2F5BH 2NUPB 5KMGA 2ZOLB 4AYSA 1HSBA 3FQUB 1HEJC 3O2WH 5DLLA 1OE2A 4ASUG 3VFRA 1RUMH 4UOW1 5EH1A 1R3LC 4S2SA 1UEMA 4P30A 4I4TA 4LRIA 2UWEA 4MJJA 1HHKB 1QWHA 3P30H 4TNGA 4MJIA 5AVYB 3KCPB 1HWYA 3VFSB 1CN4A 5IFAL 1HNZO 2YWZA 3O9WA 2ZUTA 5D9SA 2YSUB 4BGLA 1Q9LB 3N2GB 3MXWH 1JHLH 3R4DA 5E6SB 4DGYL 1JF6A 4MMYB 1G6VK 3E8FA 2P4VA 1MY7A 1U8CA 2XQYG 1FDLH 4PJEB 2YIBD 4PWFA 5HGGS 4LLYB 1G9MC 2WNGA 3BPLB 4BK8A 3QHTC 2G60H 3L9RA 1I3RB 4HOZA 4GMTH 4HD5A 2CO7A 4KKNA 3WHXB 2ZTBA 5L88L 4XNMA 5D1XE 3T0ED 4LFHD 2Y06H 3LN4B 4WWNA 2I69A 3LNHA 1BF5A 4PB0L 1TQUA 3C6SB 3NRPA 1QYGL 3DBSA 3UO1L 5FPRA 1NTZH 4MVQA 1V54B 1IAII 1S4IA 1O6SA 4IEFA 4L2LA 5E8EA 4N5UA 4HJ0C 4PMFA 4R83A 4B9GA 5JORB 2VDRH 4P9HC 3LKNA 3VFVA 4F7KA 5H94A 5AFAA 1MWOA 3GBNL 1D6VL 4L29B 1KFAH 4HIJA 4U0RC 2CKBA 2XACC 3OJDA 2YFNA 2BS9A 2IQ9H 2E6PA 2L7EA 3RA7L 1ROCA 2YPVH 1E7VA 3DK2A 2XVLA 4NUJA 5GGRA 3ZTNL 1GSKA 3NIDF 1MCNA 1WZ1L 3CIAA 4LLMB 2PTVA 4W9KC 4QTIH 3H85A 4K07A 5EMYA 3A0OA 1A6PA 1TKWB 3GD1C 1KIQA 2VMDA 5B7MA 2VR4A 5D2LB 1QSVA 3RTLA 4EBQL 1CLCA 5E2WH 1GXEA 2P4KA 1VQPV 4PB9H 3IS1X 5I74B 1EV2E 4GKKB 5CNHA 2AF2A 4FQJH 2C7FA 4ZTPH 4WBNB 3DHPA 2OCCB 3IDJB 1LE5B 4YX2H 1PVHA 1AS6A 3IFOA 1ZHLA 4FQ2H 5EZYA 3CZJA 2E7LA 4AE1A 1O9VA 1L4IA 3LN9A 2CD0A 3GHBH 3V4VA 3KPSB 3RKDD 4L18A 4YJ2A 1CD8A 1TTAA 4PJGE 1F4YL 3QORD 4NI3A 3WSQH 2PP9A 3DHMA 4JMXA 4FJZA 5DJXA 1CFQB 1GKOA 3HB3D 4G7VH 4DNLA 1URFA 3AREA 5K1NA 2JK5A 2FHCA 3RI5F 5E00A 3WIFA 2ATPB 3WE6B 1AO7B 1OTUC 2C1OB 2E27H 5F1NA 5HYJB 3JARB 4TQDA 5TFSL 2EXYC 2XUWA 2H45A 5EBMC 4UT6A 1VCBC 3W7UA 1A47A 5GISL 1HIMH 1L9SA 2FGWH 2ZSWB 4IHOB 3CZFA 4C8XA 4Y4FA 1RHFA 1ZLWK 1VIBA 1CE6A 1JPXA 3GIVB 3Q1SH 3Q2VA 1DJGA 4QJ3B 2IF7A 1ZLUK 2NXYC 3T0BA 1SZTA 1A65A 1CR9L 1BLNB 3HLAB 5FO7A 3QUZC 3ROOA 5DJ0A 4ZUSB 2HFEA 4ZOEA 1WWCA 1DANU 2BSED 1ZT1A 2WVUA 5DRXA 5C0GB 1OP4A 3KWTA 4JVWA 4N4YB 3GJFK 1V05A 3NABL 5CJ8A 4Z8FH 4P2QD 5KTEH 4PJAA 1FO0H 4P3WA 2WV3A 1QHTA 2FWOA 4C54A 4NQXA 5IW3A 3AUWB 3ZO0A 1UM4L 4I4WA 3ZZ1A 3FTXA 4DAGH 3NA9L 1NVPB 4KXAA 4Y4KC 2WUBH 1VQ7V 3CCHA 3SB3A 4H8PA 4AKPA 5I8OH 4DK1A 3EJPA 1XIWA 3N43F 2ZCHL 4HZLA 1T3FA 5F89A 5LBQA 3PNWB 3QJVB 4NUGH 4N87A 1NOAA 1OF2B 3BSZL 2KKQA 3O41A 1NCCL 4JI2B 2ZKOA 3FFCB 2RHEA 1TZOA 4YHIA 1T7WA 2WW8A 4JN1H 1XD1A 4A2MA 1I9JL 3K9AA 3S8FB 2QSVA 1ZHNA 3GMOB 3LZFL 4ABQA 5J8OA 4PJCB 1MQKH 5F72S 3RL1B 1YPZB 1R3IC 1V55C 5CINL 5FFGA 5GS0D 3EBIA 3W0WE 4L4TD 5SWSB 4XGZA 4FN0A 4L4VB 3C08L 4IOSD 1P1VA 1UCTA 1JGUL 3IDGA 3EVKA 2Z0UA 4P57A 1QLRB 4NO0A 2Z8RA 2QJ1A 5AL8A 5JR1H 3MV9D 1U8NB 4LOFA 5L8KB 1KWGA 2ZX6A 3QIWC 1B6QA 3P0GB 3VA2C 5BO1H 5ANMA 5FM4A 4WWOA 4JRLA 2F9BT 3M7MX 1KB5H 4TV8A 1AQKH 4KMTH 1A1NA 5E4EB 2FBRA 4G8IA 3PIQB 2QQNH 3TK1A 4JG0L 4N2LA 3U83A 5IMLA 3P4LA 3Q3GB 3U1QA 4WFHE 1GOHA 3VMNA 4XMUA 5I0YA 1DQJA 2Y69B 1RZKL 3EYUL 3H42H 2QDVA 5IJ0B 1T1WA 3M86A 4JRXD 8CGTA 2KKWA 5E2UH 1JZ3A 4JI1O 1Z32X 4BWUA 1P7GA 1BOYA 1NGWA 1QPXA 3GHEH 5FHAH 1RIUL 5FO9A 4BKTC 3SPVB 5LGYA 1LO5A 5DJYB 3DECA 1PNLA 2BSSA 2PPFA 1TQWA 4N8VG 4PRHA 1JMXA 1I7TB 1X5FA 2BNRD 2DH3A 4XPTL 3UP1A 4FXLA 4B6ZA 2VS0A 5C0IA 3WIAA 1HJCA 3EIFA 2VDMH 4XBGB 1JX9A 2XAGA 5B1AC 3LPFA 3P9LA 3PWLA 2NYZA 4AUJA 3BFRA 1L9MA 4W6XB 2NYYD 2JS3A 1D5XB 4LT7A 5JHDB 2ZOUA 3QCTH 5EBWB 1MFCH 1XHHA 2CKNA 2K9PA 3H1LH 4PJ8B 4G6JL 4L8CB 2FD6L 1YQVL 4UBDC 2H26A 3U9UB 1UXSB 3JATB 5ECJE 5CLXA 4PI0A 4AH2B 4Z7UA 1NH2D 2D3OW 1KUMA 2P45B 2OFQA 2Q2EB 4PW9A 4YFEA 1WFUA 4WUUD 4IYIA 5A2AA 2OTWA 1FJGO 2XN9E 4XMPL 4DVBB 2OP4H 4W93A 1AE6H 1S8DA 1WS7A 3IDXL 4PWEA 3OKOB 4RETB 1C16A 5GZNA 2UXBO 3ZE1F 1LP9E 3FPYA 1L9RA 4WV1A 5HPOA 2B14A 3KYOB 4LMQI 2E46A 3QRFM 4S11A 2Z8SA 3N1GC 1QX1A 2C9XA 4DVRL 2Y48A 4WW2B 4E9YA 3EYOA 3C5ZD 4WEBH 3B34A 1I1AD 1EVUA 4JFWA 4B3EA 4Q9QL 1SF5A 2AZAA 3TT3H 2P90A 1UOWA 1AD0B 3DVNB 1FN4A 3L3GB 4NXMB 3LJ3A 2KLTA 1SHXA 4BZ2A 1ZA3B 4AVKA 3R1GL 1BAGA 2MSPA 4HKXB 1GGYA 1OCOB 5E99H 2GFBA 4LCIH 4R96A 5DEGB 1LK3H 1GZPA 4KVNH 4K9EH 5J6GA 2KC0A 4KZDH 3R06B 3HKFA 4AEFA 3L3JA 3NRQA 1DSYA 1WZKA 2C9PA 4FHJA 4LNRA 4MD5A 5DUBA 3CRMA 4FJ6A 2L7UA 3K6DA 4HIHA 2GTSA 5KW9L 5TE4L 3QB7C 1NCBL 1HHGB 3FTSA 3U0PB 3JV4B 5DD5H 3FU6A 5E1QA 3BP6B 3FB7B 4HUVB 4TSAH 1GN6A 1DBKL 1A6AB 2OM5A 2YIDA 4FERA 4JDVB 5DS2A 3ZR5A 4AZ8B 4DKEL 1TIUA 1IVSA 2G3NA 1LJMA 2H2PD 1GIGL 1OPGL 1IX2A 2WZAA 3L2LA 2VWEC 3ASOB 4YDVA 4G9FE 1WE5A 4X6CE 2HVBA 2LTQC 2Y1YA 4K73A 2APWA 2IOMA 1N32B 5BQ7A 2XOKG 3DSQA 2E59A 2WBJC 5GS1A 4WNQA 2H6OA 3N2JA 4J42A 1A25A 3RUGA 3SEPA 2R1YB 3C75A 1T2JA 5T1JA 5JXAH 1B0GA 4A04A 2YIBA 3HZMA 1NT2B 1CWVA 2LLLA 1IBLO 3T3PE 2FTAA 2R7EA 1NKDA 3F5TA 3L3OB 3RHWF 3MMEB 4ZO7A 1MEXH 3HN5A 2EDXA 3GWOA 2UUBO 1AI7A 5IE9A 3T0EA 2AAAA 3FO0L 4MKMA 3AU1B 4JFDE 5F7YC 5JWPA 2WQRA 2AJZB 2O5NA 1SUJA 1URLA 3TA3D 4R4BA 4AQ1B 2NY3D 5CSBA 2C3HA 2VUOA 1JVMA 3MRDB 1KV3A 3QT2A 3JVGA 4I3RH 5DS8B 4LWSA 3D4YA 3NJMA 1BFOA 2AI0L 2J8UB 4PWGA 4FM1A 3VAEA 3UPCA 4OFVA 1WBXB 1XTLA 3JWOC 4JB9H 3DYPA 2L7JA 5IMKB 1AXIB 1FL5B 4XBMA 4JREC 3O2DH 4X6DB 3IDYC 3NZSA 1P1ZA 5DU7A 4K15A 3FUIA 1FD9A 2EYRA 2JE8A 1QVOB 1MREL 3F7LA 4HPOL 3GXDA 4HLZG 1LD9A 3BZ5A 3ML9A 5DJAB 5CAYB 3CVIL 3DIFA 1AIFB 1I9RL 3DV4B 1COWG 1QBLL 1SOXA 1OPOA 3CHSA 1BG9A 2R1WB 1CF1A 5E0QA 3QEQE 5EFIB 2BOBC 3E86A 2HAZA 4IGBD 4JHZA 4GKSA 4UCUA 1EDYA 4MCZA 3D3VA 3FN0L 3ZYJA 5HVHC 5C93A 3APFA 3VXUE 3NJKA 4R3SA 1H2GA 1UWEH 4XN4A 1IBKB 3MRHA 4V2CB 3PXHA 1EHLH 1L7IL 4CL7A 4G8FB 4HFUL 4J6RL 4OF3A 5KSVB 4OLVL 3HG1E 2GSMB 5DZJA 1FYJA 5BVPL 4MT8A 1IGFH 1WT5C 1SQ2N 4DR1B 2CDGB 3C8DA 4JDTH 1SEBB 4HZ3A 1JPGB 3QORA 1D2DA 1J9SA 1RULH 2HVKC 2WSSG 5C0ND 1Z9SA 3RX9A 1F4HA 4TOYH 3CWGA 1QRNB 3P73A 2Z0AA 2F4VO 4GFTB 3T8MA 2JV6A 3K8LA 2OSWA 2W9LA 4P9PA 3MLUH 4LC1A 1LEGA 1OOWA 5C6WH 3I6LD 5B1KA 4HF5H 4NJAL 3UIYA 1ED3A 3VFNB 1HEZB 2K1MA 3RWJA 1EN6A 2A7BA 2IANB 4U1IA 2PTMA 1AP2A 3CC1A 3TEWA 1EERB 4XPGL 2EVJA 2I60L 4OZ4A 4X6BA 5A3ID 3LDEA 1NLDH 4ONFL 3CRRA 4CNIA 1MI5D 1UFIA 4AQOA 3NPSC 1A7OH 2BSEA 2X4UB 3CZUB 1KPVA 2COVD 2A0LD 4WSJA 3RP1A 3R7RA 5FECB 5ISZE 3BGAA 4P2QA 5GGUA 3UTTB 2MOQA 2EIMB 2GTAA 1JNHB 35C8H 4Z7WE 1OZUA 2PWHA 2IALA 5D7SL 3VGHA 4DUYO 2ZE6A 5DGRA 2Q8VA 3ZE0B 3K71A 4KK9C 2WC7A 1D7FA 1B06A 2ZCLL 4K8RD 3KDMB 1J05A 2DF3A 3WE1A 4E41B 3BKCL 1KCKA 1TTRA 2WLMA 3BGFC 5JA9A 3T0DA 5KBLA 4N2HA 1U95B 3CZSA 1U4EA 4JM2D 5B3SB 3O3DB 4Z23A 3ME0A 5DUPL 1T7YA 1F58H 1HH9A 4RWYL 1X59A 2BFGA 2QE7G 2FR4B 4YZWA 4X4XA 4J11A 4MW8A 3EAKA 3AMLA 3DI2B 4NCC1 5LBSH 1M5IA 1RSOB 1SFHA 3FFDA 4CS3A 3H53A 1CG9B 3Q5OA 4DOHB 1W0VA 4IOSA 4UUJA 2WINA 1BFVL 2EVHA 3FCBA 3OL2A 3GWJA 4KXZH 5DS1A 3EXLA 2ISDA 1JWSA 5E6ZA 1J8HB 3DUUA 2Z4TA 2UZPA 1GVIA 2JELH 3EYVB 3HR5A 4YSAA 4HCRL 4NEHB 3FD9A 2FATL 3QNXA 1GGCH 4JV5O 1J0YA 3CHOA 2EABA 4XNZB 2V2XB 2CO6A 2BHFA 5AW6B 4JKPH 5HJ3A 3EHBD 1YEGL 4B3VA 5JLZA 4I5BA 5A7EA 3MLYH 3HC3H 1DBMH 3VD7A 3MLVL 1EFQA 3OAZK 4PV8A 4RX4D 1TPXB 4R8WH 4X4KA 4AGNA 3IGKA 1Y67A 4ZW7A 1IILE 4IBQA 2W0XA 2Y5TA 4Y19D 2G3MA 3ZMZA 3U0TB 1I3GL 4R7NA 2XWXA 3W5NA 5BY1A 3CX5K 3K5SA 4XXWC 1SXZA 2CA3A 4K7PX 3VQ2C 5L4FA 2WVVB 2IH3C 5DD3L 4UF7C 3FAVA 1XO8A 4UYQA 5C71A 3MA7A 3M1BA 1S7XB 5LXTA 1UZ6F 3JQOB 4I89A 2QSCL 5LGHL 4JPKL 4UTAL 1YITV 1EZVX 2MCAA 1G7QB 2BNRA 3ZL2A 1I8IA 1NGPL 5JH7A 1NCNA 3VSQA 5I15L 3LNNA 3ML0A 4O9HH 3HS0A 2FE0A 2IDSA 4X9IA 5KA6A 2K45A 3QCUL 5DJ8A 3SD2A 3BZ4B 3ETBJ 2NTSP 4HU2A 5TPWL 43CAA 2BERA 1D5IH 3JUZA 3BEWA 3QA3B 4BRJA 4DW0A 3AADB 5BW7A 5LCVH 3HPLC 1IARB 4R5XA 4S10A 2OMVA 2ZYIA 3WNKA 3RFZC 1GAFH 1EJOH 1CICA 1UEYA 1HDMB 2WJ5A 4LCCC 4P04A 1BYNA 1HXYB 1RV6X 1NM4A 4Q97A 2DZEA 5JIQA 3FF7A 1FFTB 3HMWL 4WUUA 4F58H 4R6UA 2B1AL 4IDLA 4UT9L 2HT2C 1NUDA 3S98A 4PV1C 4KU1A 3OZ9H 4NKDB 1RL1A 2VLJB 4NKMA 5HYIA 4UQEA 2NZ9D 1BD2E 2WHVA 2RGSA 3C5ZA 3TIEB 3GM8A 1JYXA 2AJSH 4I3GA 3WTVA 3ENEA 2KBGA 5FUCC 4GIPD 1IC5L 1HCZA 4HJEA 3LNIA 5DA4A 4D94A 4Y88A 4QYOB 1XXFC 1AZZC 3U36A 4U1MA 1K8DA 3MLWH 4DP2X 3D39D 3STZC 1IC1A 2OR9L 2YD0A 2EKJA 1YMMB 3LKQA 5HD8D 5J9PA 1E6JL 3RZCD 5DSCA 2XZQH 2VRKA 5BRZB 3O0RH 3NFPB 3WAKA 1WEJH 4ZUWA 1T66C 3SDLA 2ZG2A 2FEJA 3QEHA 3S4SG 3MXVH 3ARGD 4BKLB 3EZJB 1LNUA 4YC2B 2Y7SA 2GI7A 4NT6A 1YEIH 3H7BA 4KJPC 1Q0YL 3FBKA 4LASH 3QULA 4AG4L 1IM9D 2X4TA 4A68A 5KX5A 3GUTA 2BOCB 4I8DA 5B8CA 2FUTA 5DI8A 1FA4A 2J2ZB 2AQNA 1I53A 2XKNB 5EPMA 1G1OA 1UACL 4UQ2A 4HBCL 1MFAH 4YXLH 3VI3F 3WLWD 3LSOA 2XAHA 3OB0H 1BCCH 4PJ7A 4XOEA 1J5OH 1NH6A 3I6GB 3B8YA 1C5CH 1TQBB 1KYAA 3SHSA 4PGEB 4KHPO 1IU1A 4BZ1A 5JUEH 2C9SA 1OAUL 2PXYA 3KJ4B 4UQDA 4WHCA 3V7MA 2WANA 3UO2A 1MCOH 2WIMA 2P7TB 4QOKA 4NKOB 4DV6B 4UV9A 5DT1L 4AYFA 4NN5C 1CDHA 2NCMA 3CAFA 1N8RW 4NENA 4TRPH 1WUZA 2BVYA 3DC6A 1QQDA 1DO5A 3IC9A 2ICWJ 2QKIB 4NUQA 2EYSA 4YSTA 5I1EH 1KBKA 5D1QE 5EZPA 5C0BD 4UVBA 2AVGA 4OCSL 4KK6C 5TQ0H 3FSZA 1EAPB 2NX5B 3E8HA 1DVFC 4DGVL 5KYUB 1GPOH 1PG7H 1Q0XL 3EFFB 3MZTA 3QZLA 3TA3A 3UAJD 4M7LL 3DX6B 5K59F 4L4TE 4OD2B 2XFXA 2BK8A 2Y4UA 1K4DC 4H20H 2Z31B 1A4BA 1DVTA 5H5NA 2DQ3A 1GS6X 4K3EL 3TCXA 4HISA 4AQAB 3NAAH 1AOHA 5CJQH 2ZOOA 1UB5A 4B7KA 1XMWA 4C59B 2YOCA 3HMXA 3FAXA 3TXSA 3VI4A 4ZD3H 1MVUB 3HKEA 2D7NA 4APQB 4M1CD 3MV9E 1MCIA 4JMNA