2DYSB

Bovine heart cytochrome c oxidase modified by dccd
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dysB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dysB02
2EIMB 3JT2A 2IDQA 3NJNA 3QJUB 1CURA 5I6MA 2BP8A 2UXTA 2HXAA 1OCRB 2W8CA 1PMYA 1XB6A 3QPKA 2Q5BA 2VW6A 1R1CA 3QJVB 2EILB 2BP8B 3IBOA 3TU6A 1TKWA 2PPCA 3RYMA 1V55B 1WA2X 3FT0A 5AZUA 1WA1X 4BWWA 4DP4X 3HEIB 2H5UA 2IH9A 4YSOA 1MZZA 3NT0A 4GYBA 4HHGA 1FFTB 4A66A 2YXVA 1KBVA 1L9TA 2FNWA 1ET7A 2OJ1A 2ZXWB 2PPAA 3NYKA 4AKQA 4E9RA 3FSAA 2UXGA 3OMNB 1ILUA 2Y69B 1A4CA 1KYAA 1ASPA 1AS6A 4PCYA 4YSEA 2IDSA 4K9JA 1NWOA 2QPEB 3S8FB 1GS7A 1A3ZA 4KO5A 4HCFA 3NSCA 4G7QB 1M56B 3CDZA 1KDJA 4EF3A 2P80D 3GYRA 4DP2X 3X2QB 3V9CA 3AG1B 3SBQA 5B7FA 4NAJA 1OE3A 3V9EA 4UAHA 4G7SB 4HAKA 4DP8X 1KDIA 2Q9OA 4KNUA 3CZUB 3QJRB 2YAQA 4P5SA 2IAAC 3X1NA 1A8ZA 1ADWA 1L9QA 4YSPA 3TASA 4MFHA 5EHFA 4F2EA 1ETJA 1YLBB 1RZPA 1AZCA 2DV6A 1ZDQA 3QJSB 1HAWA 1ASOA 1GY1A 2E86A 6PCYA 2FTAA 1PNCA 3AY2A 3MBWB 1PLAA 3NP4A 3WNIA 1AOZA 4P5RA 1KGYE 2R7EB 3SBPA 1AZRA 3EHBB 2PLTA 1NDTA 1NIFA 1PZCA 1WA0X 3QQXA 3TA4D 2VM4A 1PY0A 4PAZA 5I5MA 2GB2A 4DP0X 4DP1X 3UGEA 1J5DA 4GP4B 2DY2A 5ANHA 4FAAB 2YAMA 3KW7A 1A65A 4G71B 3X1BA 1E5ZA 4GY4A 3D12B 1MZYA 3NSDA 3NJFA 1ASQA 2HX9A 4HALA 1PZBA 1OE2A 1PNDA 1AZNA 2FQGA 2AZAA 4YSRA 1NIEA 3H56A 2BW5A 3FU7A 4AKOA 4E9XA 3BQVA 4DP6X 2BHFA 4WKXA 3NJMA 4M4RB 1EHKB 1L9OA 1L9RA 2QDWA 3OQRA 2UX6A 5I6KA 4L0PB 2HZHA 2VN3A 4A67A 4N8UA 2GBAA 1JZFA 5PAZA 1WS8A 2PP7A 4KO6A 1E65A 3NSFA 1J9QA 2VMJA 2AZUA 3NSYA 4BWUA 5F7AA 1MDAA 1PZAA 2YXWA 1JOIA 3NJHA 4AKPA 1OOWA 1SHXA 2ZONA 2MTAA 4HIPA 3UAEA 1J5CA 5B3SB 4YVNA 2XX1A 3WG7B 1BXVA 5I5IA 3T71A 2PCFA 2J56A 3UAAA 1OF0A 2J57A 2XVBA 1OCOB 1BEXA 2YAHA 2EINB 5B7EA 2J5WA 1B3IA 5B1AB 5LDUA 1JZEA 1IBYA 3OMAB 2DYSB 4W1TA 3CVBA 2DYRB 3S3DB 3NP3A 1XB3A 3ZX1A 2UXFA 3T6WA 1IKOP 1NPNA 3CVDA 1NTDA 2MRYA 3T6ZA 4KNSA 2I7SA 2JXMA 1BQ5A 4Q89A 1OCCB 3IN2A 1FWXA 1JZHA 2N0MA 1RCYA 1AS7A 1NPJA 1N68A 1W8EA 2FQDA 2BP0A 1ZV2A 2UX7A 2CAKA 5I5JA 3EH5B 2FQEA 2BP0B 2JFCA 4W9ZA 1SF3A 2IDFA 1JVLA 2IDTA 1E5YA 4AI7A 5B7MA 5FC9A 2OCCB 6PAZA 2XUWA 3G5WA 1TEGA 1SHWA 4YSDA 3H4FA 1F56A 1NIBA 3SBRA 3ZDWA 3S3CB 4KOCA 4A2FA 1DZ0A 1FA4A 2WO3B 3U25A 1GW0A 1GS8A 2FWLB 3TBBA 4DP7X 5TK2A 3GXUB 4E9YA 3IE9A 2B3IA 4YSQA 5I26A 5PCYA 1OCZB 2BZCA 1TEFA 2OV0A 4YL4A 5TK4A 5I6LA 3X1GA 1J9SA 1PLCA 2YARA 2CJ3A 2YAOA 2IH8A 4GP5B 5I28A 2XLLA 2A3TA 2P80A 4BXVA 3QJTB 4HCGA 4YSAA 3UACA 3NJIA 2CBPA 1BQRA 2I7OA 3WKQA 2YEVB 2XX0A 1ZIAA 1AZBA 2HLEB 2PPDA 3KW8A 3FQ1A 1A4AA 3QJQB 4HCIA 3WNJA 1PF3A 3FQ2A 4RH4A 3PAVA 1W6LA 3FS9A 1RKRA 4ENZA 3FSWA 4DP9X 1MG3C 4A68A 1NICA 1XB8A 1V10A 3IEAA 2QPDB 3AG3B 2VW7A 1BXUA 2FQFA 1J9RA 1TU2A 2XV3A 4QKTA 2FT8A 3H4HA 2IWEA 3ZBMA 3PXLA 4G70B 3ABLB 3CDZB 4AZUA 1KBWA 4M3HA 4BDVB 2HRHA 1GSKA 1W6WA 2DWTA 1EZLA 3CG8A 2Y1AA 4JHVA 4E9VA 4E9SA 4AX3A 4BWTA 2QT6A 3AG2B 1AS8A 1JERA 1GR7A 4UANA 3EH3B 3C75A 7PCYA 4YSSA 1BYOA 3X1FA 1OV8A 3ASOB 2PPEA 2PP9A 1A4BA 1GYCA 1UATA 1N70A 2IWKA 1IUZA 1QLEB 3WIAA 4G72B 5AKRA 4KO7A 1RZQA 3ZIYA 3CVCA 5IY5B 2J55A 2BWDA 1QHQA 1AZUA 3NJKA 4NB7A 2AVFA 5B1JC 3FU7B 2ZWNA 3S8GB 3FU9A 2FT6A 2YAFA 3ABMB 3X1EA 1AANA 1GY2A 4Q8BA 2R7EA 3WKPA 3OD3A 3ABKB 1ZIBA 2DWSA 3HB3B 1ET8A 5I6PA 1NINA 3NJJA 1GS6X 1AACA 1CC3A 4KNTA 2I85A 1XMEB 2VW4A 5E9NA 1HFUA 3NJGA 3PCYA 5F7BA 2FJSA 5D4HA 1JXFA 4DPCX 1E67A 2GC4C 2IWFA 3FQYA 4ZK8A 2ZOOA 3ASNB 1NIAA 2YAEA 1SJMA 2TSAA 3T6VA 5B1BB 4E9QA 2WO2B 1BAWA 3T9WA 3EH4B 2PPFA 3N2JA 4F2FA 2XWZA 3AW5A 2XU9A 4DPAX 1AG6A 3PAUA 4BXSV 2AFNA 8PAZA 3S3BB 1CYWA 4WTQA 4YVUA 3SQRA 4A2DA 2BW4A 2VM3A 5A7EA 1PCSA 4YSTA 3FSVA 3BVDB 4HHWA 2HX7A 4QLWA 4CSPA 1M57B 1OE1A 1VLXA 1SFDA 3FYEB 4X4KA 5D4JA 2CALA 2HRGA 4YSUA 1BXAA 1NWPA 2EIJB 1ID2A 2XXGA 1X9UA 3TBCA 2YQBA 3L45A 4KOBA 3T6XA 1ET5A 1KV7A 3OM3B 5B1JA 2PP8A 1L9SA 1X9RA 3MX0B 3EF4A 1MG2C 1AQ8A 4E9TA 1SDDA 4G7RB 3NJLA 4HZ1A 3GDCA 9PCYA 1BQKA 2XV0A 1SDDB 1HAUA 1SFHA 2TSBA 4A2EA 4TXVB 2WSDA 1AG0A 2GIMA 4N4YB 2CCWA 2EIKB 2FT7A 2LLNA 3WI9A 2XV2A 1E30A 2IDUA 1SF5A 2H47C 7PAZA 4JHUA 3UABA 3JTBA 1IBZA 1AAJA 1NIDA 3PAZA 3FYIB 1CUOA 2H3XC 4GXFA 3AG4B 2QDVA 2CUAA 3DIVA 2RACA 3IN0A 2XXFA 2GC7C 3UADA 3PPSA 3ABGA 1DYZA 1JXDA 2GHZA 4YSCA 1PLBA 4FA7B 2XYBA 4DPBX 4CSZA 5I6OA 3DTUB 1L9PA 1WAEA 3ERXA 1URIA 1JZIA 1JVOA 1PAZA 1AIZA 1CYXA 2X88A 3FSZA 1NZRA 3OMIB 4E9WA 5I6NA 2YAPA 2B08A 5D4IA 2NRDA 1KCWA 2BO0A 2BWIA 3PLYA 3N55A 4A2GA 4A2HA 4DP5X 3FPYA 2PCYA 1I53A 2VSMB 2HX8A 1WS7A 1JXGA 2X87A 4UF7C 1J9TA 2VSKB 1V54B 1JZGA 4GP8B 1QNIA 2UXVA 4BK5C 2JKWA 1M9WA 2W88A 1AR1B 1ILSA 2GI0A 1T5KA 5AFAA 2BZ7A 3AZUA 4BDVA 1IC0A 3DKHA 1ZDSA 4F7KA 2GSMB 1SNRA 3FU8A 5B1KA 1BYPA 2AANA 1ZPUA 3FPXA 4NERA 4KO9A 4JKNA 1KCBA 1JZJA
chains in the Genus database with same CATH superfamily
1HDMB 3CRRA 1KZQA 2NY6C 5JTWA 1ZWIC 2DLHA 3BAXA 2J1ZA 4ANVA 4PJ9B 4PJAB 4NRXA 5IF0B 1L6ZA 1M71A 2DTSA 3U2IA 2EBOA 1P84J 5CU9A 2J1XA 5L88H 2YSSA 5DC0A 1MSWD 3N1QC 3ZTNL 4ZMYA 5A43C 3KGTA 5LCVH 2V5SA 1B2YA 2QSVA 2R9HC 2ZJSH 3QIWC 1IM3A 2ZINA 3MA9H 1ET7A 3NYKA 3NZ8A 3EHBD 4FRWA 4X1KB 4ZMQA 4XN9A 5JUEL 3VGAB 1F8TL 2Y69B 4P2AA 3E9UA 4U7OA 3DO4A 3ZTCC 3PPEA 4X7FC 3KAAA 3WUZA 4GMTL 5F89A 4NUQA 4KV5E 4K9JA 1YTFB 1N2RB 4LSRH 4NM8H 1EXUA 3VXME 3O6FB 3S2AA 2R1WB 3UGUA 1C5CL 4BCYA 2FBRA 2F5BH 2FJUB 1MY7A 5IW6A 5HHVL 3ARGC 2D9QB 1F58L 5CINH 3WD5L 1ZPLA 1YPZE 5EG6C 5ETUB 3ATBA 5FWQA 4CVZB 4YXLH 2ESVA 1NJIW 3FT1A 3QEQA 2AGJL 2DL9A 3M1OA 4LMQE 1J10A 1IAIH 2IFFH 2OMTB 2VR9A 3ZL4H 1U8HA 3QORC 2NCMA 3X1NA 1ZKAA 3P0YL 3QDGB 2A0LC 5IUCA 1J1PH 3QTCA 2V9UA 1BREA 3EJJX 3UDWA 1EEYB 3QCUL 3KNBB 3FOMA 3SE3C 4W4NA 4O2EA 4O02B 4XC1L 3W0WD 4BFIA 1FV1B 3ML9A 4JQXC 4YDJA 3PGCB 3DC0A 4JGMA 2YPVH 5FUCC 4PBWD 5I6XB 2FL4A 3VYOA 3RIAF 1RIVH 4H26A 1N33B 3KGUA 4JPVL 2H45A 1JGVL 1H3VA 1NDTA 3FFCB 4BQ8A 3WUWG 1J0ZA 1K5NB 3D0LA 2YD7A 4O02L 5K39A 4XPGH 4AYEC 3N2GB 1DQIA 1FXKC 1S9VA 3F00A 4M5ZH 4JREC 5AB1A 1B6UA 2OX5A 4B9PA 4RDQG 2DDQH 3AG3C 4AILC 1SN0A 4JI0B 2J73A 2ZCHH 3ESUF 4X4YB 1W72A 1S5IH 3VVWA 2P28B 3GEFA 1AZNA 3MGOB 3SZKC 1HKLH 1NCDL 3VXNA 1FZOB 4MJIB 5H94A 3FU7A 5D5ME 4DP6X 2YXHA 3HRPA 2IMNA 2UX6A 3HJ0A 4LQFL 4RSVA 1KBGH 1ZVHA 1UXLA 2WTRB 3ZX6A 3GM8A 3LQZB 3MACH 3NFSH 4RGMC 1JGEA 3HNTH 3NEEA 2J4WH 2ZE7A 1JTTA 4NUGH 5A2LH 3TV3H 1FJGO 1K4DB 4AK2A 2JNZA 3D85D 1O7VA 1R34A 2FIKA 4HS6B 2VMJA 4LVEA 3EUUA 4O2CB 2R1YB 3AWEA 1MDAA 3HUJA 4TOIA 4XRCB 3K71A 3V4LA 4JFFA 2TRYA 4WTZG 3S5LG 3RWIA 4EI6B 1ZX3A 2DMGA 2EO9A 3JZYA 3NVQA 4PWKA 4TUOB 1RK7A 4FE9A 3V6FB 2HMID 1TUBA 3KJ6H 4HIQA 2DTML 4MQ7A 5FYJL 1BYNA 4LKXB 5K59E 5LA6B 1JPXA 1ED3B 3LH2L 5KBPA 4OGZA 4Y19E 1KPVA 1UWEL 4FZ0A 2J6EL 2EVGA 1CJYA 3JSNA 3BCFA 4GKZA 1XZ0A 1DBAH 5I1KH 5IQ7L 1QBML 2YGNA 4Q9QH 2XV6B 4YXWG 4UIKH 1RI8A 3LYRA 1XB3A 4LOEA 1KB3A 3JWNE 3GXPA 1WBYB 1YUKB 1LP9B 1X5LA 4U3SB 5C6WH 5DGRA 5IMLB 1KPUA 5CEXB 3IDNA 2JQMA 4XN4A 1QYGH 1ZTMA 2DI9A 1IGJB 4WZ9A 4PA6A 3QUHA 3N40F 1BQ5A 4P4KA 4QJFB 1MJUH 1ONQB 5C08D 1NPJA 3BAYA 5E95B 4C59B 4L8BA 2JKNA 1EH9A 3F84A 1IBLO 4R9HA 1Y76B 1S5JA 3ABZA 1SRYA 4DZBB 5D5PA 1F3DH 2A9CA 5EEUA 5HDOA 3IU4L 1VB9A 5ALBL 3KM2A 4I3GA 3EJYD 5D96C 4N2MA 4CA4A 2C9AA 1JVLA 2FBJH 2B16A 5E7FA 1R6VA 2V4DA 5ICXB 2CCVA 5ADPL 4NKOA 5ADOH 3G5WA 3A24A 4FMVA 4WEBH 3TOPA 5T1LB 1TEGA 1Z5LB 4GYCB 1AQKL 2J8UE 4XGZA 1CLYH 5E9DE 1JVKA 1HOCA 4KOCA 5EA0H 3GSVB 1X6LA 5TPWH 3MLRH 4OZGE 4PWHA 4HISA 3OJDA 1VQMV 4MKTA 3KWTA 1BFOA 1GW0A 1ND0B 3O4OC 1KACB 4K5NA 3TEUA 1PBYA 4OV5A 2W0PA 2B8OT 1GSMA 2CK0L 3BC9A 4OFKA 1IGML 3IDYC 1T22B 2QA4V 3T1HO 3EO1B 4LFCO 2HHHB 1BVLB 5A2JH 3E8FA 5AZ2H 3I6LD 1GM7A 4R0LC 2YIBD 3IETB 3CP1A 4OGAC 4IRSB 4OPHA 3KS0J 4BFNA 4JX0A 1FKAO 4YR6B 3EGDB 4ODVL 4UQ3A 5TGBA 4PV8A 2K78A 4TVSa 5D1ZC 1SERA 2X9ZA 2PTTB 2A79B 1HCYA 1TCMA 1C12A 3TO4C 3WN6A 3EFFA 1W91A 2I7OA 2MOQA 2MCG1 5F7FA 1FZMB 4AQ1B 2FYVA 4CN6A 1AKJD 1IQDB 1ZIAA 3KW8A 4IBVA 4UUJA 4DPRA 3NFNA 4P4KC 2WGXA 4CVZA 2H32B 3TYFB 3L1EA 3QI9A 1RHHB 3RUGA 1HKFA 3FFDA 3P9WB 1FNLA 1K8IA 4JHWH 1F7YA 4JVWA 1RPKA 1RUAL 3HZKB 1LE9A 1KTRL 1U36A 1KB9J 3IFOA 3QO1A 4LU5H 1QWNA 1VEWA 1DJYA 3DHMA 1ZLEA 4K8RC 3SPCA 5C0GB 3GMLA 3QQNA 4MW3A 3HKCA 4EDWL 3K81A 4RFOH 4LIQE 4S1DC 1FAIL 4FXGC 3Q3GB 4UB0L 3X3GH 2Q5ZA 2PR9A 3MLWH 1Z9OA 2XTJC 4E2OA 4C4KT 1AP5A 4ZNCD 4K8XA 2Q76B 3VGAC 4KXZH 4HIXL 2WKOA 1CWVA 2Y3AA 3T1FB 2D4FA 1JFQH 2GABA 5H9CA 1P84F 2R0ZL 5IJVA 1GR7A 3QVAA 1K5NA 3D0LB 3JD3A 1YY8A 4G43B 3SDXA 5DM6V 3TA3C 4XMZA 1WC7B 5G2NA 2C3WA 2EECA 3MLUH 2XZQL 2OBGA 4U3XA 1PYWA 2WWKO 3SE8L 4I4TB 4M1GH 2FH8A 3DSFH 4DKTA 3U2SB 5DZLA 1XR9B 3HKZA 5C93A 1BSMA 2E76C 5DJDB 2NUTA 3II2A 4JDVA 2DH2A 1V7NL 4H0LB 5TDOA 1RIHH 3UG3A 4DGYL 1A3LH 5B1JC 2MNUA 3FU7B 3SHSA 3EYVA 3GS4A 4ZOBA 3W39B 1O9WA 1BZEA 1GY2A 5DFVD 5DRNB 5EOQL 5CO1A 3R18A 4KX9A 3MGAA 3ML0A 2MKLC 1IFGA 2QR4A 4WVRA 4ZX6A 1D3CA 3BN9D 4WWOA 5DJYA 4N6RA 4UUJC 2FD6L 5INCB 2ORBL 4XCFH 2H3NA 2I85A 1G1CA 4K3DH 5T3ZH 1MCOH 1Q43A 1ZAGA 4JFQB 3MAWA 4UCOA 1PSKL 2VERA 1QRND 3QYCA 4TNGA 5CBEA 5J9PC 5DUML 1WFMA 2DYPA 2J1WA 3OC8A 4NDMB 3U7WH 5JHAA 1DLHB 4OJDH 4XHJC 1A7PH 3KVDD 1JJ2U 3HG1E 2MCAA 3OR6C 3ALWA 2GSIA 1AY1H 2QZ5A 4JFZL 1N8ZA 2IQ9H 4P23B 4RIRA 1JG9A 2WP3O 1XCQB 3T9WA 2VDRH 2C5DC 2ZWZA 4IU3A 1JYXA 3VWKC 2NYZA 2XFXA 4JI3B 3PAUA 1TJIL 2ATPA 5HI3D 4RNRB 3ULVL 4PJCF 5F7UA 3LQAH 3ZL2A 1I9RH 3K1KC 2YR3A 3SQRA 1ETZA 2BNQA 4DQAA 1DQKA 2XQBH 5MP6L 2XVLA 4OF0A 2FRGP 1DO6A 1TUEB 1IC5H 5J4MA 3D7PA 1QWUA 2ENSA 2EXYC 3AGVA 3TA3A 1IFHH 1UD8A 4KVNL 3KYKH 2AK4E 2CDEA 3LN5A 4M8QB 4GKKO 1BXAA 3R8BB 1FFNA 4DK6A 4L8DB 3D6GA 1GMGA 2Q3XA 3UL4A 1UUSA 5CMAB 3TWCL 2WB1A 2IU0A 4M7JL 1GN6A 1VGKB 1F0LA 1JCKA 2NNUA 1F45A 1X6NA 1LMKA 1KB5H 5IBLD 3NK3A 4AV5A 5H4ZA 1UCBL 1Y0LB 2VXQA 4P5MA 3BVVA 2H2PD 4M7ZC 4L29B 2GIYA 3CH1B 3VFOA 3BQUD 4YBLB 3QO0B 3DOSA 3IWUA 3LZFH 2ITDA 2GTZB 4MD0B 5LMNB 5C0AE 4MASA 2C9RA 4FQHB 3C2AL 2QWQB 2CR6A 2VYRE 2F19H 3WUWA 4GKLA 2YFOA 1YHPA 3FB7C 1A4KB 3TZVA 1IXBA 5AVZB 1FZKB 2BVYA 2QSTA 1INDL 1RHFA 2OMUA 1CPUA 3O4LD 4A7GF 1TR7A 2XNAB 2EIKC 4XXCC 2A74A 4X5QA 1RIVL 4X20A 3MJ9H 3TIDA 4F9PC 4Y5XB 1CXLA 5D5QA 5DS8B 3KBEA 4L1LA 3W0WE 3IU3A 5BQ7B 4OZIE 3ESNA 3OF6D 1UPGA 4FVMA 4GIAA 3A2FA 3M7OA 1W72H 3PV6B 4GOSA 4JO1L 3GLEA 1X7SA 5KOVC 3C08H 5J8OA 1A7QL 5DJ0B 2GC7C 1W8OA 4MMYA 2LFSA 5IHBA 2JE8A 3QCUH 2Z7YA 1ZOXA 4K0OA 5DEJA 1HI6A 5SWSD 3MLXH 3WEBA 5BZDA 4WQOA 2J6WA 3MJ7A 5LHHA 4DN3H 1GZHC 4JDZA 1BAFL 2QADB 3NIGB 4QRFA 3G9AB 2X4RA 1HS6A 3HE7A 2PXYB 3P3YA 2X2UA 2VDNL 1P2CA 4XHJD 3SPHA 3FSZA 3VFPB 4H7VA 3W56A 4Y9GA 4GW1A 2J2ZA 2DRUA 3KPOB 3ZN1A 3L17A 4M3KB 4UOW1 3AAZA 3VXSA 3CMOL 3Q4HB 1K5QA 3DV6A 4WBNA 1ZV5A 4PV9B 4XC3L 5F0PB 3MHHC 2GAZB 4HIHA 1JDCA 4WFHD 4FFWD 5F1IB 4ALAL 4Z3JA 1JZGA 4UZUA 1K2DB 4NZUL 4P2QB 4OF6A 4RGMB 3VRIA 2BIIA 2APFA 2BZ7A 3II1A 3ZTDC 2QHLA 3JVGC 1U8CA 4LSVL 3ARRA 2FATH 1MVFA 5F3BB 1T1ZB 4D8PB 5D71L 3FU8A 2ZNWA 1ZT7A 1CFNA 2FX7L 2HT3C 1BGYH 1UZ6F 1ZPUA 2RMNA 3FRUB 4M6OL 1CXIA 4O9HL 4WTXA 1YY8B 3MDSA 4YGAB 5DXWA 3QG5A 4KQ3L 3PXHA 1YJWV 1JF5A 2BP8A 2YMTA 4LLVB 4NHUB 3PYCA 4P5KB 5KVEE 2YZ8A 2DEWX 1DBML 1XB6A 2K6YA 4LZKA 2AQQA 3BH8A 4FCHA 4MDRA 1VSCA 4P2CG 3O6ML 3TU6A 1S0VA 3QH3B 5DJDA 1T04A 2WZ6A 4ZOLA 4ZI7B 2LGNA 5EBLB 5I5RA 4TNVK 1AY1L 1I75A 5AZUA 1SLWA 4Q58C 4D9LL 3E38A 4OLUH 3I6KB 4Q2ZB 3NT0A 1BBDH 3RDTD 4UILL 2PYLA 3DX6A 2VITA 3EXJA 4HWEL 4N2CA 5KBNC 4U0QB 1X4TA 2YBRA 3FSAA 3I9GH 3C09B 2JJVA 4NJ9H 2NY1B 4I87A 4AQAA 4UT6L 4K3DL 2E76B 4FYTA 1BLNB 2AKRA 3KPQA 4M5TA 5MEOB 1JPEA 5BXFB 3MNWA 3K46A 2P90A 1WWCA 2ROXA 3JWDH 3KLSA 2XPGA 5JA9A 3TNNA 4P23A 1NQTA 3JTTB 3UERA 5DD5L 2E5EA 3MI6A 2DLFH 4K9EH 5D7LD 2AJSL 4BK5A 3BFQG 5F9DC 3AG1B 3HG2A 4NJAH 4PY8I 2DLEA 5DK3A 2YRLA 3SE8H 1TMCB 3FTVA 3VWJA 1NCOA 1KDIA 1N18A 4ODBD 2DIJA 1T2QL 2GTSA 2XT9A 2GUOB 2H26B 4LCWA 4S11A 4X64B 2H2PC 1JBJA 4M43H 5CZVH 3H9ZA 2XG4B 4G80A 5D55A 2AMGA 5IMOB 1FBIH 1I1YA 3AQZA 4OZGF 4WW1B 4EMZA 3FMGL 3D0VB 5ADOL 3CDGB 2W80C 3TA3B 1F18A 3NGBC 3S97C 3V9FA 5C0RH 5D7JD 4YIOA 4R0LB 4WO4A 3S0PA 2YWYA 4KRLB 3US9A 3V0VA 2FMLA 5LP6A 1AGEB 1QABA 1K73W 3TYGL 5IOKA 1DJWA 1G4RA 1R5IA 2EDHA 4XNYL 1NEPA 3RFZB 2EXWD 3RWDA 5CMAA 3QUMH 3X13B 1PY0A 1IKNC 2IANE 1UJWB 1MHHB 3GMMA 2QBWA 2Z4QA 4X1YB 3OJ2C 5C8JB 2O61B 1VQ8V 1V5JA 2NNFA 3TO4B 4QOKE 1A65A 2WUCH 3GLZA 2CCLA 4G71B 4XX5A 4OCSH 3GBNL 4Y1AD 1Z9SB 4YHOL 1SYSB 1UZ6E 1WLHA 2YSTA 4M56A 1U8QA 2NY6B 2BSSB 3VYPA 2W59A 3N1PC 4JMXA 5A2AA 4BH7B 5ITBL 4GG6F 2OL3L 2R51A 3TN0C 4FHBD 4Q6IB 4ODVH 2GUZB 1INQA 4J28A 3CCHB 1OGPA 4RSYA 4LSQH 4V11A 3QISA 2BOBB 4N9OB 4ODUB 3H0TA 3WB1A 4X4ME 3BGMA 3PUCA 1OAKH 3NJMA 2ZD0A 3P3PA 3E9TA 4LASH 2HFEA 1XIWA 2P22C 3VA6A 5B3JE 4XCYB 3LSOA 1JWSA 1RZJL 3QZLA 3NG5A 3LS5H 1QSEE 5FPOA 5CEZH 1O6SA 1DQVA 1NFIA 3O4LB 4MJ5A 1G7IA 1EFXB 1U3HB 1L0NH 1EEQA 1NBYA 3HC3L 3IJSA 2Y7LA 3RHWK 4AENB 4G28B 1RULL 4OLZH 1IT9H 5ANME 1ADQL 3E6HB 3BPLB 3NCBB 5JIHA 3HN3A 1RUKL 1E9PB 3K72B 5HHPA 4YIPA 4Z18A 2LVEA 3CCVV 5E4OA 4Q0XH 1TGOA 3OZKA 4ES8A 3K79A 1I1AA 4UQCA 5H37A 5CSZA 4HGMA 5TQ0H 2RTTA 1E2WA 1OCOB 1FH2A 2DEXX 1AGFA 2H4EA 3O4OB 3QNZB 3QP3A 4HSQA 5DUBB 5F70A 5KVDH 4GX1A 3VE0B 4UNVA 3HMXA 3WU1A 5JW4N 4ZJ9A 4EFBA 1NSNL 4DAGH 3O6FD 2E4TA 1DVFD 4OGXH 2BSBA 1ORSB 4G6JL 3H1HH 3B2VL 3WMPA 3SKMA 3B9KB 1U92A 1H3XA 4OCRL 2X3AA 1V3LA 4K8RH 3O3BA 1A22B 5I0WA 4KQ4L 2RCSH 2ZYSA 1CFSB 3HG1A 4XDJA 1JZHA 2FL5A 3NIDB 3PWNA 3RILA 4BCZA 2EE6A 3VGHA 5EORH 4G8FB 4NNYA 1ZV2A 1AZZC 5GGRY 4UV8A 1IBFA 2D31A 4PB0H 3V0JA 3S3SA 1WA8A 1UXMA 5F6HI 3QUXA 3ECWA 2G4GA 4PJBF 2EZ0D 4X0NA 5G5DB 3IVKB 2ZE0A 1S7UB 2X1QA 3UBXA 1KBBA 3UT5B 2KPWA 2HFEC 4E4EA 1P53A 4F92B 4JFDB 5BV7B 1J5OL 2YD1A 4JZJC 4GQPH 3OPZL 2YPVL 4GW4B 2YPLE 2BOLA 1CZ8H 1XF3B 3S3CB 5JDSA 5E1HB 1JOYA 4JFXB 4OFYA 4OM0H 2ADIB 1DTUA 2WVUA 1D5MA 3RYIA 3BKML 2UZXB 3MRJA 5EZLA 2Y1ZA 3GT6A 1FNHA 4BKLB 4Z3IA 1QWHA 3ZZQA 2D3LA 2VR8A 3DX6B 3OD4A 1ZVNA 2HHHO 2A9DA 1CICC 1OGTB 1HQRB 3O3DB 2Q69A 5I82A 3BX7C 2XBDA 5D5MA 1FHNA 2AP2A 3CNKA 3TESA 2EADA 3ECQA 1PLCA 2V3FA 3GZKA 1LEGA 4M6AA 4JANB 4HUMB 5I28A 2XLLA 3DVNA 3EOTH 3LDDA 2D3JA 3S35L 2JKLA 4ZS7H 2P8LA 5DCCA 4ZNEA 1FH5L 4X8GA 2BNRB 4HCGA 3V5KB 3P0GB 1ZTXL 2HUEA 3KG5A 4RA0C 4Y4HB 4PMEA 2ZUTA 2EDFA 1FL5A 3CJHA 4JW3A 4QPKA 5IFAH 1XXDC 3D87B 4QXTA 5F0MB 3C5ZC 3FQ2A 3D25B 3JWNC 2NY0D 4RH4A 1MCEA 3T2LA 1EDHA 1CXFA 5IB2A 1DBMH 2K3TA 3WTSA 1RK1B 5DURD 1XB8A 5I1AA 2CUIA 3VNYA 5EIBD 3BRGC 3JD1A 3LV3A 4UTBH 1X5FA 2O6PA 5T1MB 1MVYA 4U4IA 1BXUA 2FQFA 3NOIA 3EG9B 4QKTA 5DFAA 3WO4C 1HQ4A 1TQUA 1Z2GA 3O45B 3OMZA 3KPSE 3ETSA 2NXYD 4BSWA 2EINC 2E56A 1PZ5A 1FSKC 4L3EE 2ZIMA 3HS8A 4XPAH 5ESQB 1FP5A 4JPKH 4X83A 2JGUA 1CDCA 4WV1B 1AGEA 3AXHA 3TEYA 1HSAB 3BZDA 2RR3A 4I4WA 4MMXB 4W9CC 3WJLA 2ILMA 2V7NA 4UAOC 1E4XL 2CNZA 4WI8A 4JJHA 4Z7UE 2X7RB 5IEHB 4HFWA 2F8OA 1T5XB 4QHPA 2DQGH 4WFED 5CINL 1U6AH 1N0JA 4MVZA 4L0YA 2ZOKA 1EGJL 3D18A 4Y19D 2DOCA 2QGEA 3BLKA 4K4KA 1KB9K 5TE6H 1OPGH 3PJSB 2DQHH 3LNHA 4J4PD 1E27A 5TDNB 4ZQKA 5E2VL 1KBKA 3DK0A 3QIUC 3ZIYA 2K1MA 4IJ3B 1KOAA 2VDOH 3VJ6B 1U33A 3LEYL 2WMPB 3IAGC 1G7LA 2AVFA 4FS0A 4R4BB 2YAFA 1KG0A 4HOWA 5KSAC 2WA3A 1NOAA 5FKPA 3BVOA 2BNRE 4JDTH 4PMFA 1CU4L 2E27H 2CQVA 5KBKA 4F5CA 4MMZC 1OOAA 1M2VB 1RPRA 3C6EA 4HSAC 2DQIL 5E8EB 4G11A 3VFNB 2BVQB 1G6UA 2O4EA 4FQIH 4KPHH 3VH8A 3FB5B 4PJIB 2KPNA 5J13C 3HI1B 5I18H 2YJQA 4JB9H 1MCQA 5FUZL 1D5BA 4XBGA 3L5HA 5HHXL 1JXFA 5LOVA 3TBTA 3KPSD 4QOKA 43CAA 1BMWA 4LCIH 1HHHB 2XAGA 4AGLA 2FJFB 5F9OL 5HGBB 4WK4B 3T4YA 3DUHA 1TCRA 3DGEA 4F33B 4FLTA 3ZHSA 1JWUB 2WCGA 3KJ4C 4M5YL 4OFDA 1IL1A 2XWZA 4KJYA 3SQBB 3IWVA 2XWDA 4IBQA 3S3BB 3QRFM 2AAVA 4J3XA 3EBIA 4L05A 1X9LA 2KZKA 3F7LA 3L7EB 3WFVA 3B7SA 4OVVA 4PELA 4PS4L 3QCVH 4EUPG 5KA6A 4FNSA 2DPKA 3BA9A 2E7MA 4O4JA 2ICWA 4X65B 2IWGA 3KBHE 2ITCB 5EC2A 5J5EA 5CZKA 5JW4Q 5C08B 3FQUB 4I50A 2XWTB 4X6EA 2Q0AA 4ABUA 4KFZC 5HYJB 3D39A 3GHPA 2EC9T 4GW5A 3ZMEA 2WNKA 2XNDG 1VFAB 5AOJA 1IB5A 1JRHH 2C7UA 5I1EL 5AEAA 4HXAH 4NQCE 5CXPA 2AXHA 1F3DJ 3V4PL 2NXZD 2UY7A 5KX5B 4J2QA 3OM3B 4NKDA 4PSRA 3WMQA 4N2KA 3TXAA 1KJ2A 1FG2B 2DH3A 2ZCEA 5DK2B 1E28B 3PIQA 3LHPL 4X88A 4U6VH 2PP8A 1EBOA 5FB8B 5KSAA 4HWZA 4DTGH 2JVDA 3AQXA 4CL7A 3BP7B 1A1OB 2G30A 1RERA 3RWFA 4FXGB 4MMZA 4NSKB 12E8H 2AI0H 5JXAL 1TZGH 3MLYL 4CW1A 4QJ3B 2AEIT 2PR4L 3PWVB 4WWKC 4JFXA 1JHKH 4H20H 1EAJA 3TONA 3Q2WA 4LKCA 4PB9L 1K8DA 1I7FA 3MGTA 2C9PA 3U9WA 1IGTA 2OTLV 1HH9B 2ZYRA 2D7TH 4QTHA 3SGJC 3DETD 1H8SA 4FFZH 4XCNA 4M3JA 1R19A 2EILC 1JHLH 1MWAL 2Y06L 4CVXB 2H47C 7PAZA 3IC9A 4HUXB 5IYBO 3ULUD 4OSUL 4QGYA 4XNZB 3FYIB 2VC2L 2W81C 3GMPA 3EYUH 2BXYA 3SJBC 5I16B 3RFRA 4JHAL 4DF9A 2XTJB 1MUJB 2WWMC 3CDYA 4P2RA 4ZUSA 3U7YL 1VF6C 5JIPA 2COVD 3FKUS 4B9CA 1MCHA 5EOQH 4Q0XL 1X4YA 4FZEL 32C2B 4KZDL 5AD0B 2BRRH 2UUCB 1P7QB 2DICA 1T3FA 2VN5A 2JJ2G 4WHTB 2E8YA 4AEHH 5HYSA 3WXVL 4TUKL 1WG3A 3OMIB 2ZX9A 3SDLA 2OS7A 2APTA 4JRXB 1KIQA 1SGKA 3Q1EA 2BWIA 2WOYA 5CN2A 3RB5A 4NS0A 3ZHRA 3L3DB 2AJZB 4C56E 1YEDA 3NACH 2Q68A 5DRZB 1QTYT 3ZKXB 4AEFA 3ABMC 3HHSA 3HC3H 4ZHQB 1I8IB 1CT8A 3LX9A 4LLYA 4HZ3A 5A6LA 2VR4A 1VAHA 2EEXA 4MX7A 4JTAB 4DKFH 5D2LB 1YUHA 4WUUA 1D9KB 3WHE1 3VTMA 4APQA 4PLOB 3G71V 4OX9B 5CSGA 1TJMA 4BD4A 1OANA 1GGTA 2EZOA 1NCWL 3GSRA 1QOKA 3HR0A 4DGUA 2QMKA 1Y67A 4B3SO 1RJCA 3GI8L 3IYLW 1CLYL 3THMH 1FYTE 1UFGA 2UXCO 4MLSA 1R6KA 2G75B 1IXMA 4RGND 3RE0A 2HLFD 4U1KB 2HJLB 4DV5B 4EZLA 3QJVB 2WYHA 4R7DB 4JNXA 3QULA 2F0CA 4ZTOH 1WPXA 4XVJH 3WIFB 3DMMB 3R19A 3D3QA 3UBXG 4DP4X 5ALBH 2IH9A 1IX2A 4NBYB 4JFTA 5B22A 4A66A 4YDZA 4JG1H 3SY6A 2ZKWA 1YEFH 4J3WA 4G6KH 4BFIB 2WOBA 2VQUA 2IALA 1KYAA 1IU1A 3P3TA 3V55A 3QUMA 3JTSB 2FECL 3UFIA 1TNNA 2IJIA 4Z7VF 2Q3ZA 2E5LO 5IYZB 3DUSB 4JI3O 3CZJA 4LHUD 5GGVH 2B0SL 2BM3A 1RZGB 3F64A 4L4VD 4PJDE 3TBTB 3CDZA 5F7EH 1WB7A 2YEVA 5IROA 4KDWA 2P80D 2DB8A 2BLFA 3GYRA 1XGZA 4HAGA 3BIKA 1XF2B 3OEEG 3SBQA 1O9ZA 2VWEC 5GGRA 3P0VL 1A3QA 3H9VA 1T5WB 3D3VE 5EZIH 4LPXA 4BZ1A 2V7HB 4JZ2A 4HUKB 1M57C 1UOVA 2IBZH 2LOEA 3C12A 1A5FL 1OCWL 2AXGA 1HC1A 3T0BA 3O2DA 3ABKC 3NABL 3VBBA 5HGAA 4UXNA 2DYSC 2Z92A 4LCUB 4AH2B 3ZHTA 3QXDB 3QJSB 4N1EA 4LCCA 3ZOAA 5AUMB 3C90A 2OWOA 3DSQA 1IEBA 5C2UB 2B4CH 1V3KA 4PJIE 4WDIA 3I3DA 4MSWB 1AIFB 1ZWIA 2MHAB 3K5SA 2F08A 1ZLVH 1YCIA 3N85H 4YH6A 4NQEE 4XVSH 2VRKA 1UYWL 3BAJA 4QUOA 5AOKA 3DROB 4FFBA 5C0BB 1B0GB 1KCRH 2R27A 1DK1A 4L23A 4QGPA 4ICWA 3K5LA 3VB9A 2XWEA 4NKDB 2AQSA 2Z34A 5MHSE 1U8KA 3HI5L 2D7TL 1QA9B 5K9KA 4CMMB 1F1GA 1AI7A 1ECZA 3QIWA 3RI5F 3OHXB 1VZHA 2ZZUT 4HH8A 4YNYA 4WI4A 2GT9A 5A16B 3D12B 4XWGL 5GGSA 1CBVL 4TVPL 3UX9B 3DXAD 3NJFA 3VD5A 2D3OW 5HDWA 3OHMB 1JZ7A 1WUZA 3MLYH 3QUZD 2VABA 2K6WA 5MEPA 2YGQA 1VQPV 1OJHA 2J5LB 1LTXA 3PDGA 3Q6GH 2GITB 3NIGE 4Y5YB 5JQ6H 3LNGA 3VI3B 1U4FA 1X5YA 1OAZH 3AUWB 2C4XA 3ARUA 1SQPH 3D39E 1FYJA 1CGTA 4LEOB 3WIIL 1I1FB 3X11B 4DGWC 3IDNB 3VXUB 5JW4M 1U8PB 2XPZA 3VGFA 4R97C 4CS3A 1KJ2L 1SXNA 1X5HA 3IDIA 4WI9A 3VXRA 3BKJH 5KYUB 1TYJA 3RVYA 4FP8H 3KPPB 3RIFF 4U1IB 5CD3B 1JRHL 2PP7A 4PJEB 4BZYA 1J9QA 5DI8B 4AYBA 2QHRH 1TJGH 2V2XB 4LVOC 3UM7A 1TENA 2VZ1A 3QORA 4PJCE 2A1WL 3CVIH 4G7VH 2ICEA 3UO3A 1U8NA 4NZDA 2Y48A 1OOWA 1SHXA 3U6XA 1QHOA 1YECH 3CZFB 4Z78A 1J5CA 1SJXA 1TZIA 3UGXA 2FR4B 3JATA 1KJ3H 5DJZA 3ZHVA 1WITA 4GG6B 4WGVB 1C16B 4XGZB 2ZG1A 1QMUA 3AK1A 2XAHA 3F5WC 5I15L 1JZEA 2XQYA 3RURA 1EFRG 2OI9B 4QRRD 3LRMA 2FZ3B 3ARBB 3STZA 3MLXL 3RWRD 5BZXA 3TJEL 1XSIA 5AL0A 5FO8B 1MHCA 2BVTA 4UB8Z 1FVDB 2R0LH 3TBWA 4HHAA 4PJ5D 3F5TA 1A2YB 3LVEA 2A3QA 1SJEA 3CX5K 2N0MA 1PPJH 1OT1A 5I18L 4JFOB 4ANUA 2BSDA 5H6RA 1QHTA 5CJBA 5JHLH 5FYKU 3CD6V 1E8XA 4RETB 2CXGA 4N0CC 1QUNA 3KPLB 1S7VA 2GUYA 1RFDH 1IQWH 3AT0A 4DOHE 4NENB 4X6DB 1UCBH 4RRPM 4F3FA 4L2YA 4Q14A 3PDOA 3D3IA 1MCLA 3C3TA 1SN2A 1T0PB 1C9SA 4LF6O 3VXTA 2AV7A 3QE5A 3VFRB 3ZE1F 5JHDD 1XGPA 3NPSC 3TJHD 3BSGA 3WFEL 5H35B 2J4WL 2YEQA 5D1ZB 5GZND 2P4AB 3AWFA 3MRPA 1MW2A 3JV4B 4TULL 5F72S 2WO3B 5BV7H 1I3UA 5C2BL 4OV6F 3TVMB 3GRWA 1AQDB 1GS8A 3VSTA 2X6VA 1K9TA 4MDIB 3VD7A 5D70H 3DGGA 3MNMA 3PABA 3T65B 2HT3D 1G7MB 4OF5A 1VPOL 2XQYG 3JSLA 5C0GA 2WLLB 4NO2B 5DTFA 4N68A 4NCC1 4MVMA 3LY6A 2OMVA 3WTVA 3F7VC 1F4XL 2BSTA 1YMMD 3FBKA 1S9XA 4YDIL 4EBQL 1KGWA 4Z7VA 1J9SA 5C0AB 2L3BA 1DTOA 4AG4H 5D1QD 5AG2A 2IH8A 4GP5B 3R06A 5GRXG 3VFSA 5AZEL 1UWYA 4LSRL 3OAWA 4NM8L 4HFUL 5AAMC 4EIGB 4FLVA 1MQ8A 1MHPL 2CR3A 4W9FC 1W2KT 5BMFL 1JS4A 3L95A 3LKRB 4D3CH 1Q9OA 3ES6B 4P9MH 4Y4FB 4K8ZA 2LW3A 4HZLB 1A25A 4PR5A 5EOCH 3HZVA 4FQXB 2HVKC 4FYRA 1KXVC 3MO1B 1OAXH 5HD8D 1RKRA 4B5EA 3VTTA 4NXMB 4N3UA 3ZKQD 3PL6A 4Y88A 5J1AB 1Q0YL 4NOFA 1OD7A 1HNYA 4NC1C 1NICA 2AQ3A 3N40P 1Q4NX 4OAWB 5CB4B 1DQML 2VMEA 5EEXA 3ZTNH 2KERA 3MV9E 1YEHH 2MOGA 3VXSD 5EIQA 5HJ3B 2IJJA 5DRNA 3L3OB 3QFJB 4U3JA 3WG7C 3H9SA 2JGDB 4Q9CA 3PWUA 4JFPB 4H1LH 5HVHB 5FW6A 4I7ZC 4YY3B 1F3JB 2K9PA 2WB7A 1UENA 4WUUE 1FJ1B 2DKMA 3OJVC 2EE9A 1QPXA 3S34H 3LKSA 4EI5C 5DYOB 3WOVA 2ZNIA 2BVOA 4L8SC 1OF2B 1QSEA 2BY0A 1FUNA 3NDZE 5AKVA 4GAFB 3ULSA 3AG2B 5D96B 4I1NB 1Q9LB 1XGTA 1K3EA 3C75A 5C07D 1W16A 4OGAD 2DQUL 2MFNA 2VAJA 4YBQC 5DSCA 4Z8FL 4TV8A 3WIHH 5ANMA 3CHOA 1YDPB 4FP8L 2IWKA 5A16A 2W9EL 3DX9B 4WF9V 4YBQD 4JJ5A 4OBRA 2ARJB 5AKRA 1H5BA 1L4IA 4XWOD 5E94B 1M9NA 3RYHB 2PW2A 2F5AH 4E42A 2LE9A 1PIFA 4Y4HC 1GHFH 1IMHC 2AJVH 2FT6A 1AKJA 3V0IA 1KECA 3X1EA 4JI5O 5AAMA 2B0SH 1QP1A 4JASA 5GTIZ 4FIPC 1V9PA 2H8PA 3B4NA 2CR0A 4LLQA 3NAAH 5C7ZA 1IM3D 4IDLA 4YDKH 3JV0A 1SLVA 4X62O 4OGQC 4BUGA 4KRPD 5FX3A 4EKJA 4I9WD 2V2TB 2VQ4A 4XH2A 3QWNA 5FYKL 3ARFD 2YN3A 3TVMD 3LKPA 5ESVB 4DV4O 2GVYA 4FJZA 3A4DA 5D1ZD 2MMXA 3QDJE 1UVQA 3FTUA 4WHDA 4Y5XC 4D0BB 1N3NA 4OLUL 1BAWA 2EDRA 4LLWA 4RAVA 1H8HG 2Z35B 1E8ZA 4YE4H 1LO5B 3B09A 3DV4A 5T3ZD 3K59A 3AW5A 5CWSA 5AVRB 4P9OA 1ZT1B 2VS0A 4DIXA 3WELA 3CSTA 5T5FH 2WBJA 4YVUA 4HGWB 5AQ0A 3CFBB 1VQKV 4M9OA 5C9KA 2J8UB 3VWKD 1PNMA 1IFRA 2VM3A 1GAXA 3LKOB 2ZOLA 2DIEA 5EO0A 2AEOA 2G2RB 3C3SA 1FG9C 2PXYC 2HR3A 3P9MB 4WEMB 3TIEB 1R6NA 3D30A 1M57B 1BBJB 2BJML 1Z9PA 2YMXL 4ODXA 2CTRA 3VWJD 1FE8H 2SEBB 3KZIZ 4UCRA 3MKKA 5E1QA 2HRGA 1QPKA 1YVLA 3RG1C 4X20B 3FQNB 3D08A 3TIDB 1R75A 2Y36L 2ODHA 4HP5A 3T6XA 5JJEB 5KAFZ 4MNQA 1JI1A 1VKXA 2Q7AA 3ZGHA 1A3RH 1WCQA 4KTDL 4PJGB 4QRRB 3KYNB 1H38A 1Q94A 3OJMB 4OIBA 4XNQA 1VGEH 1DVFA 3M7FB 4TLSA 4U7NA 4I3SH 1OGAD 4Z1VA 1NUDA 4FQCL 4PLKC 4GQ9H 3QI9D 4O58H 1UM4L 3U0TB 3IMWA 5GW7A 1TTGA 2BY2A 4LCYA 4E41A 1DBKH 1BZQK 1NCDH 3MRGB 9PCYA 3CFDA 3KYMA 4DZ8A 4UQEA 3M8AA 3L6FA 3MTRA 4H8WC 4HIEB 3TN0D 4UDTB 2GIMA 3CK0L 5T3ZE 5E6YA 2VLKD 3Q13A 4DR2B 1II4E 1U8LB 2IPKA 2KT6A 2VLJD 3SCMA 5LWYH 2C1OA 1OTTD 3EJPA 2HUHA 4GI6A 4TNWF 3ARXA 4MQSB 4X80H 4PJDF 2WBJC 4YLCA 1TTBA 4XI5C 4Z2WA 3RPKA 4J3OF 4NRYB 1YIJV 4PGJA 1N6QL 4AG4L 2Z1KA 5TF1L 4MXVF 4RMWA 4XBEH 3K6SB 2CIIA 2YGVA 4CSTA 3U83A 1ZT7B 1N4XL 3ABGA 2UUAB 3K2UH 3FUKA 4EI5B 3MRCA 3Q2VA 3ES6A 4AE0A 5EF1A 1I0HA 1JV2A 2C9UA 5DHMC 2C3VB 4FG0A 1E50A 1JPFB 1Q38A 1JMKC 4KV5F 4XNZC 5D2NA 1IZJA 4LBEA 5D4IA 4RWUA 4AM0Q 1RPQA 1AILA 1F4YL 1PX4A 3UTTD 5JPMC 2QR0B 1EZVH 4DV5O 1QR9A 3CTTA 3QO5A 1A1MA 3ASNC 5HP5A 2R1WA 1AFVL 1ZD6A 2ADJB 4WFAV 3BMWA 4FLOA 4L9LB 1LP9E 4P46B 2BOCC 1X3DA 3QWOA 2OYPA 3QFJA 4D7PA 1FC1A 1C08B 1XIWD 3U11A 1M9WA 4C58B 1B2WH 1SLXA 1AJPA 1F4HA 3MCKA 3QEHA 4OI9A 1DN0B 3U4BH 4BKSC 2EUXA 3LZPA 2ITDC 3JARA 4YJ3A 4AQAB 5J0BA 3LKSB 4HOMA 2UV3A 1CIDA 2HRLA 3ARDB 3BO8B 4APXB 1H3GA 2CRZA 4HWBH 1SNRA 1SOXA 5C0DB 3ZZ1A 4Y16A 4TQIA 3QUYB 2EIZB 1JNLL 1EEZB 1TQTA 2AW9A 3FPXA 3RYCB 2QQKH 5KN5A 3TNNB 4X4MA 2VUOA 2GJ6A 2A6IA 3FT3B 2QVIA 1PY9A 2V9QA 4XPBH 1CO1A 3E6FB 5ANMB 3MNZA 4XXCA 4FXLA 4JFDD 2X2IA 5CILL 4NVPA 2JB5L 3U7AA 1TVKA 3DHPA 3RGVB 1TTUA 2Q5BA 4LH7A 3CC1A 1HHKA 3IBOA 4JCMA 4MJJA 4JO5A 4EI5D 2PPCA 2GCYA 2H9GA 2ZF9A 5L8KB 4P49A 3T2OA 1J5IA 4YSOA 1B4JL 2UUAO 5E00A 2AEQL 4LNRB 5DHYA 1IGYB 4G9FA 2VSCA 4YFLF 1A7NH 1KIUA 1KYDA 4BSVA 1L9TA 4EIZC 3N2GA 4KRNA 3SDAB 3SN6N 1L5GB 5KUKA 12E8L 3L7FB 1AS6A 1VERA 1NDGA 2OJEA 3SYPA 5IBUB 3SO3B 3IGUA 2B39A 3MV11 1JFFB 3WEMA 5FO9B 5CJXA 4ELME 4ALAC 1WAPA 3KWUA 1P7HL 1V7MH 3LDEA 2X4SB 1MHHA 3TN0B 4OLEA 1W0JG 4XC3H 4X1YA 4NN7B 4KVNH 1LM8V 4NQCA 2BOCA 1UXWB 2EE3A 2PN5A 4RAVB 3X2QB 1OCCC 2WXQA 1P1ZA 4A7GA 4UAHA 3EOYG 2MQ3A 3WV0A 3IKCA 1JTOA 2YOAA 2QPSA 3GNMH 3QJRB 5CGYC 5JA8B 4UOW0 4PJ7B 1N36B 4I13B 1YNTF 4S0SD 3NSXA 3L5WB 3EGSA 4IRSC 1DEEA 1N59A 4GINA 4Y16C 4YGVA 4F2EA 5K9QI 2X12A 5LBSA 3MLVH 3IC7A 1MNGA 2CJTA 3D5OF 4UM8B 4ANXA 1WLEA 3H1JH 4TUOA 3VGEA 4LF3A 1MAML 3NCWA 3IM1A 3LSOB 1EJOH 3JWNH 5D7LE 3BKYL 3FU3A 1PLAA 2EC9U 1NZ6A 4LF9B 2FO4A 3D2UA 4NC1E 3QQDA 5E2UL 3GWJA 3IXTA 2Z91B 4KUCD 5FO7B 3SBPA 1SQ2N 4KROD 4PGDA 1MEXL 3NA9L 5F96L 1KCSH 3TA4D 1GXEA 1OTUC 5ILTH 4JFYB 4AXWA 4DP1X 4JF3A 3B40A 2KQNA 4LEXL 1GJWA 3NH7L 5BZBA 4F58L 3N2KA 5CA1B 2IG2H 2VKXA 3X12A 5L7XH 4OI7A 2E9IA 1VESA 1PNDA 4OGYL 2AZAA 2XICA 1MCOL 3LB6C 4X9GA 4JCLA 3IJHB 2B3RA 2VAAA 3JD4A 3ARTA 3UYPA 3GQFA 5JQHC 2X3CA 4LDLB 2OMYB 3Q5YA 3G6JA 3QK0A 1SHMA 5CN1A 1CN4A 5CEZE 4DUZO 4O2BB 1XBLA 2DQGL 2F58H 4H40A 3OR7A 2ZCZA 3BKCH 2VCOA 3SJVE 4Y1AE 3MJWA 1DEDA 2DQHL 4AK1A 1CEZA 1XF5B 3L4YA 3QZPA 4OM0L 4DHLA 5HXMA 4J80A 4CBZA 3VD4A 1HE8A 3D51A 4LSSH 3FZUC 2KG7B 3OUFA 1Q0EA 3C5SB 4HMDA 4NRYA 1A6TB 4N2DA 3NJHA 1PG7L 3ALXA 1OV9A 1FIEA 2N7BA 3UAEA 5E6ID 5B3SB 2VDRL 2ED6A 2YD5A 3K2UL 3IF1A 4AJYV 1P4UA 4QHLB 2VWJA 2NY2D 4QJ4B 4DV3B 4MDJA 3LQAL 2UUBB 1OTTC 1B3IA 4L4VA 5J12B 4P3WA 4AZ8A 4UTBA 3L3GA 4XCCL 5BO0D 3UMNA 1NFAA 5TGBB 5H2FZ 4BFBD 3RU8H 4AYMC 3T0EE 3IXAB 2VR6A 5C0CB 3VX0A 2UXNA 1IKNA 3T6WA 1A1MB 1NTDA 3A6BL 5CLTA 1QFUH 2MW2B 4I2XA 3X14A 2I60H 4FEIA 5JYMA 4DP9X 2P5WB 3AABA 4WI6A 1UM5L 2NY1D 3KCPA 4NLAA 3UP1A 1SXSA 1C08A 1G0XA 4ZMVA 2BY1A 3SDDA 3ULUH 5ITZA 3NFNB 1QUPA 1DQQB 1NAMB 2ZP9A 4DR4B 1F4AA 2MOVA 4HKJA 5CEZD 5EU6E 1E79G 2XKNB 4P2OA 1GAFH 4HBQA 4Z7WF 3CPUA 1S72V 1CCZA 2VSDA 2O6DA 3HNSH 2UWEA 2G9HA 3AGWA 1CL7H 4I3SL 1MWAB 2IGLA 4J8RB 1QR4A 4TSBH 5BPPA 4DR6B 3N42B 1T1WA 4NWUH 1BMZA 43C9A 4HDIB 2GJJA 4DUVA 5IMKA 1U4EA 3H4FA 2B1AL 4G8GB 1RP3B 1FQ9C 1E9QB 3FAWA 3FO0L 3H42L 4JG5A 1UOLA 2O5ZL 4Y9BA 5IB2B 1JYNA 3P0VH 4IEFA 3ZE2B 1DZ0A 3KPSB 5GZOC 1EHLH 1JK8A 2GBOA 3DVIA 2D03L 4IIJA 5DC9B 1G7QB 4HLZG 4KKAD 3U0PB 3NN8B 3TBBA 4FQPA 1NDMA 3GXUB 3RPBA 3ZZLA 2WYIA 5I19H 5ELIA 1D5ZB 3CDCA 4MVBC 1YNLH 4MD5B 1RZ7H 1E8WA 5EU3A 4TSAL 2MCPL 2HTKD 4MZRA 1KEGH 4POZC 3QDMB 5GISH 4BSWB 3P02A 3VQWA 1E7UA 1LK3L 3S6CA 4G82A 3ZTEA 4KFMA 2HH0H 4I4WB 4L1BA 4MMXA 3TEXA 2VRZA 2P80A 1EXUB 4DK3A 4PUBL 2QTSA 3V6ZB 1LK2B 2ZDIA 1BFTA 3GJFA 1XGQB 4H1LG 5JYLA 4YFEA 2YPVA 1PDKA 4QRPA 4H0IA 1OZTG 1RZJC 2BMKA 1MF2L 3AU0A 4FULA 1YEGH 25C8L 2QADD 4XP1L 4XPTL 1CFVL 3DO7B 5JR1H 2ZWSA 1WCBA 1FXKB 3WS3A 3FTWA 5FW8A 1F6AB 4YHIA 4ODWB 2IH3B 1QRNA 4AQEA 2GHYA 2H0FA 3CX5J 1CDUA 1G0YR 3ZZSA 1YY9C 3U10A 1GYVA 4M1CC 5FKPB 2WA4A 2NNRA 1ZE3H 3X2QC 2VMDA 3K2IA 4KKLD 1NCUA 5JQIB 5DD3L 1JD7A 3ABLB 2A9ML 4GRWE 3P77B 3US0A 4UV7H 1NGQL 4P2ZA 3L13A 2OYQA 1FAFA 1FO0B 3BSZA 5FHBH 1J05B 1TTRA 3IMTA 1YAIA 1L3NA 5L3GA 1W6WA 2HRHA 3MRRB 3QGVA 4KWUA 3CFCH 4H26B 3HI1A 4QXGL 2FDBP 3JT0A 2O5ZH 1RLBA 4WU7A 5CBHA 2GJZB 1WIOA 3KLAA 3T8MA 1N19A 1ETZB 2RB8A 4N1HB 2IJKA 4G42B 1VJSA 3O3UN 1ZANL 1WE5A 2QVKA 1GGBL 2ZCLL 3EH3B 4H25A 3CD4A 2NT0A 2BSEA 5TJWK 4YSSA 2ZX6A 2NQDA 5E4AA 4ZTEA 3ISWA 4APQD 1A32A 1A4BA 1JWUA 3U1SL 1N70A 3DIDA 3SDCB 5J11C 1S46A 2O5XL 1QLEB 1RJYA 4J23A 3ULVC 2R2BA 3W9EA 1B0RA 3R0MA 1KLGA 2UXBB 1TPXB 2CBOA 3PP4H 2AW2A 2LO1A 4HNAB 2D2OA 3QXAA 3VFGL 2YLHA 4PVNA 4ACPA 2H7WA 4ZW3A 1LEIB 3CZSA 2OMYA 4Q8BA 2VQTA 4HWEH 2H2SC 2KLRA 1NCBH 3FFCE 1K4CB 4PJHE 2FHFA 1AP2B 4ZD3H 2WQRA 4NM4H 5KSBF 2MWCA 3OGIB 2Q3AA 1Q9KA 4KNTA 4FLUA 1MRCL 3P30L 4BR6A 5JWPA 1TOXA 5C92A 5JJNB 1MH5B 1QR1A 2CIKB 3NJGA 4JLRB 1BE3H 5J3HD 3K74B 4JPVH 5IQMA 1CMOA 3WLBB 4JDEA 4KTEL 3VG0H 1KJ2B 5F88B 1T1XA 4O4IB 3AU1A 4KQ3H 1TETH 5JO5B 2LTQB 5KJRH 1RUPH 5IJBC 3FQ4A 3QQ9C 5JNYA 1M6OB 2Q67A 4OFIA 2EX3A 2CM5A 2PPFA 3KLLA 3OGCA 5GGSY 3TPKA 4B7LA 1DJSA 1HN1A 1TQBB 1BECA 2G3ZA 5FA4B 2B7DT 3VFVA 2CTPA 1AG6A 2J43A 1KIRB 5IVXF 3A8TA 1IM9D 2DQCL 2DQFB 4GT7A 4LDOB 2EYTA 4PJXE 3RKPA 5AENA 3GEWB 3LH2H 3ZE2F 4CW1B 4X98A 1BZ8A 3L3JB 5FKAB 3WJLC 3SPVB 3OC5A 3NA4A 1AI1L 2F43G 2GI7A 4AUUA 1MZEA 2HX7A 2JEUA 2IH1B 4ENED 3EZJB 4GG6E 3OQ3B 2DLIA 5CEXA 4AYDC 1DDHB 2WYZA 4DV6B 1CICD 4M6MH 4PRDA 4DUWA 3HFMH 1E2VA 1TJGL 4X6CB 1BM3L 4LVHC 5C0NC 2JQAA 1JFHA 4DCQB 4BEIA 3BPCB 1HEZA 2L35A 1JJOA 3DBXA 5DMYA 1EQWA 1EZVY 1OM9A 2VR3A 3NZHL 3V0WL 2XKUA 3HNSL 4MCNA 4Y2DD 4F58H 3JALB 3LRSA 1JCHA 4YHPA 5LBSH 5J2TB 3I02A 4GKJB 3HVNA 4X99A 5GRVL 4J27A 5FM8A 1NGZA 4JQIA 2CO6B 2NY1C 3QS2A 5GRJL 2BS71 2ICCA 2XOKG 3H2PA 5D6CB 2A9HA 3RLSA 2LGWA 4IGBC 5AW3B 2ADFH 2PWHA 1OAXL 4R4FL 2EEAA 4QMEA 4TL5A 3II3A 2EDYA 1C8QA 1BZ9A 2ZWYA 1N5AB 3L1GA 5F3BA 4OZFG 5F7DB 4OV5B 2VL5B 4UYQA 5CA3A 1IBGH 1IGFH 2R0LL 3IFNL 4GRLD 2ZXWC 5TDPB 5D1XE 3GI9L 1NCGA 1VPOH 3UABA 1KP2A 2OMWB 4KK5C 1SZNA 5I1GL 2ZYHA 3PAZA 4PJ6A 2HT2C 4ZMXA 2B1OA 2BSKA 3APOA 3CXHF 1NMBL 4KKQA 4B7EA 4GLRH 4LWSB 3QPXH 1NGPH 2DLTA 4YDIH 4FMKA 1SEBB 2EIMC 4MAYA 2VISA 2VM9A 4U1MA 3DURA 3G7TA 3PQYE 3RJDA 3HLAB 5H37G 5FO2A 5I1CH 4NZFA 2GG1A 5L0QB 2D7OA 3O3EB 4U1HB 2J8HA 3BGFC 4JI1O 4TSBL 2F4VB 1UJTA 3VQMA 2L6LA 1JPGB 1PDKB 1XH3B 4QRPB 1JL8A 4X4ZA 3GSOA 1ZMYA 3UO1L 5BVPH 4NUGL 1JDAA 2R0KL 2B20A 2BFVH 3CZNA 1HCZA 4KI5D 5HFLA 3UTPD 3VXRE 2P5WE 3K2KA 4ODWA 4E5XG 2EKJA 2Y2WA 1I53A 3C8HA 5I1IH 3ARGA 2QVFB 3M86A 2DWEA 2GFBB 2HX8A 1FNGA 2X2JA 3FAXA 3NH7H 1QKZL 3PHAA 5C0CE 4FZ8H 3GLDA 1PZSA 3VCLA 1AJQA 3CZEA 3FN0L 4I9WE 1GMEA 3GMRA 3ECUA 4ODSH 2NY4D 2BNQE 3MR9A 1WSST 4AV0A 1IC0A 1M1XB 1ZDSA 3FF8A 4KTYA 4PBXA 2ZPKL 1P5VB 2P9RA 5DJ8B 4K3JL 3KLAB 3QG6A 5K33A 3UDWC 3F62A 3KWXA 1I8MB 3VRJA 1NBMG 2ZNXA 3D0AA 4QE7A 4IHBA 3OKKB 3ZJZA 2P7TC 1AJNA 1TYEB 4GQQA 4LLDA 3LH9A 1OB1A 3T2MA 4LOUC 5AVVB 3OAYH 4JFZH 4Z6AT 1NI8A 3NJNA 4JQXA 2GBUA 1CURA 3SE4C 4AV4A 3TCLB 1X5ZA 4XE5B 4KAQH 3RVZA 1PMYA 4U3CA 4UQ9A 4ZT1A 1I94B 4I4TA 1X5JA 3N9GL 2F66C 4JHWL 4L3AA 5MI0B 4MAUL 1L0QA 1M05B 4OJFL 4PWFA 1WDAA 4FNTA 3V5HB 1R6TA 1Z32X 3HEIB 1KEML 1RZIB 4Y7MA 2XTJD 1FFTB 4JZJB 3B5HA 3SOTA 3RZCA 1P4BL 1XUQA 2P5WD 1Q9KB 4NQDB 3FB6C 1BLIA 3CN2A 3LIUA 1PD0A 2Z31B 3FT2B 4JPRA 1AMYA 4B50A 1FFOA 2LV4A 4JLRA 4B60A 4WSGA 2QPEB 2K0RA 5DZJA 1V05A 4HCFA 3NSCA 4OD3H 2BC4A 2NUPA 3RPIA 2NPLX 2RQ8A 2ZKYA 4OZGA 4NBZB 4MNGE 4MCZB 2H2SD 4Z7NE 2VZTA 3V9CA 1EHAA 3MNDA 4LEBA 2VUKA 1KENL 2A2QT 4K7FA 2VDQL 3LPOA 3QDJA 5AW1B 3JV6A 4ZPVA 3VD9A 3FCSB 4UV4H 3L1FA 1T21A 3MCYA 4HAKA 1JX9A 1ZY9A 4JAUA 5IW6B 5E0QA 5DWPA 5E6IB 4X7CC 4NXNB 1WV7T 4KRPC 4JI2O 3VRLF 1QSVA 4IRJB 5CBFA 1ZSHA 1U95A 1LO4L 2AABH 4HC1H 4A2MA 1YLBB 3P30A 1RZPA 1TVHB 2EKSA 2A6DB 2VDLL 3D34A 4FTVA 3ZHKA 5DS2A 3D85B 5B1AC 5CLWA 3CCEV 1YQ2A 3CRQA 4YHNB 15C8H 6PCYA 1T0NA 1UQSA 1UA7A 1ZHNA 1CDIA 2HLFC 4G5ZH 2LJ2A 2ZSVA 4DW2L 1Q9WB 3O6KL 4J1UB 4I3RH 2Z93A 1I7UA 3UTTA 3WAKA 2QSAA 4BK4A 1AOZA 1EEYA 1MI5A 2XTJE 1D2OA 1S7RA 2W6JG 4ELMF 2W0LA 5C09B 4DCQA 1PZCA 2DAVA 3T4ZA 1PX3A 3N41B 3W37A 5L2KB 4UVCA 5D6DA 1RUML 5ICZB 2HKAA 3NZHH 3PF2A 2PYJA 3V0WH 4JAMB 3SKNA 4X1IB 1UEYA 2FX8L 1UCTA 2BVEA 1RZ7L 3EFFK 2Y07L 5C9JA 5DD1H 1OZ0A 4LFBB 4I1PA 4MVBD 3POCA 4KTDH 4FNPA 1T03H 2EVHA 3VMPA 2CBMA 2E9WA 2D31B 5IW3A 4NHCL 5IGXL 4XX1G 5AW0B 5I5MA 3JXAA 5K9OB 2J6EA 2N59A 3GPSA 1DQJB 1S8DB 2G38A 1BQLH 5HY9A 1FVDA 2I26N 1BW8A 1TPXC 4B3TO 3BGAA 1X44A 4Z7NB 5IT2H 1JZFA 2IV8A 4HH9A 5PAZA 3FUIA 3KLQA 2XUMA 1G9NH 1WS8A 2F7RA 1F5WA 4JFOA 4HKXA 3ASOC 3VQ1C 5BUPA 3LQZA 2W0KA 4IYHA 1H8OA 4GFXA 5KSBB 4WGKA 4PD4K 2BS9A 1MRDH 3E35A 3C60B 2WWKT 3U0ZA 2NZ1A 4JZOB 1R47A 2DBLH 3DX4A 4NOBA 4WJKB 1JPGA 1XH3A 4U1SB 4KXZI 3LN4B 3VI4E 3LIZL 1OGTA 3O3DA 3HC4H 2VJ8A 1YSCA 1S5HB 4X42A 5E99H 1XR8B 2HTKC 4RZCB 3E1F1 5D1ZA 2A7WA 3VTAA 2G0LA 4IBYA 1WHOA 1RSOB 4H20L 4ZPTA 4YHLL 2MK3A 1LEKB 2A73B 2NX5E 3B3IA 2WBWB 3BEWA 4PJFB 5K59F 5LA6A 1ECYA 2IXQA 1QLEH 2K9FB 3LRLA 3QEQD 4MDIA 3QF7A 4PRPE 4TVPE 1H3WM 5D6DC 5DS1A 1DCEA 2I7SA 5T1LD 3UTSE 4Q89A 5AAWC 4L5FE 5IYCO 3QI9C 1PQZA 1E40A 5ACMA 2YA2A 1LP9A 4UT7H 5ISZA 5HPMB 5LL6Y 3LAFA 3LEXB 2JKIS 3S2CA 4DW1A 2FQEA 3FU6A 5K1PA 1NCNA 1TTCA 2WQWA 5LG1A 4FM1A 3ZMZA 3Q2CA 3VFSB 3S88H 3US1A 4D8PA 1SF3A 1VGEL 2IDFA 2DIAA 4N21A 1NAMH 4RMBA 3FB6B 5DURB 1TFHA 2XUWA 2P5OA 4J3OG 4TQ8A 2QZQA 4KVCL 5EU4A 4IMKA 4A63A 3NQIA 5F93C 5F2VO 3VXSE 5KYXB 3U9PH 4DN4H 1KULA 1VQ5V 4DEUA 1DF5A 1S6NA 4Y2LA 4A2FA 2WXOA 3OTTA 1UFUA 3MRQA 3RVXC 3QCVL 5ICXA 1EHXA 3M46A 4X5XB 5LWYL 3DOIA 1BZDA 3ESMA 3KDMB 5CP7A 2OSYA 4Y2DB 3FRPA 4ZUVB 4CU6A 2WNGA 1IZ3A 4LPTA 5TK2A 1G7HB 1IBBA 1E1RG 4U3JB 5EIIB 3E22B 1BBDL 4D7BA 2XXMB 2O30A 2P24B 3IPFA 3F7YC 1BSIA 3PQYA 4HUWB 1DVZA 5TK4A 1ZRUA 3TXSA 3X1GA 3T8XA 2BCKA 1YITV 1M4KA 1UT1A 2HJFB 4JM2B 4TS6A 2OMTA 4N8CL 4ZQKB 3ZHQA 5BXFA 5FM5M 4PJ0Z 3STZC 2B9BA 3P1VA 3Q6FB 4U1JA 1MMMA 1AXSB 5DRWA 3UTSD 3R66A 7FABL 2NNAB 3H7BA 4GAAA 1XMOO 2HJKA 1LDPH 4D0DB 3MNVA 1NM9A 2XOTA 5I2IA 3FOMB 2V8LA 2YEZB 3QZWG 2A38A 2WLYA 4QHMB 1F4MA 3ZDZE 1MOEA 3MCLH 5AAWA 3K5RA 2CDYA 2WQUA 4U1GC 3JV6B 2Y1YA 4P2OD 4ZPVB 3WFBH 4IS6B 4PG9B 4CSSA 5E6IA 2R72A 3I84A 2GUOA 2H26A 3VI4F 2PUQT 3BAAA 4LPWA 2QPDB 5T1KD 2W91A 4OLXH 3EGXA 3DECA 2H32A 1UD2A 4WW1A 1WB8A 3ETDA 3UO2A 5IJ0A 3MV7A 4EVNA 2JS3A 4N5ED 5K39B 2E4FA 2W60A 3P3UA 1EX0A 1QO3A 4YHNA 4F8NA 5IMMB 1HSBB 3EJZC 1ROCA 4GNKB 4KROC 1HZKA 4GUPA 1DANU 3QR2A 2UZPA 2X6AA 2Y5TA 4RX4A 1UZ8B 4XH2B 4JHVA 5HI3C 2PYFA 4E9SA 3H3BC 3RNKA 4NP4L 1TF4A 2ED9A 4LVNC 1X5AA 3B2XA 2K7QA 1SA0A 2Z4QB 2IW5A 3TGUH 3LPWA 1BYOA 3KYKL 4OD2B 5F6IC 7PCYA 2J88L 4NQSB 3RYFB 4PM1A 4YBHA 3F58H 3TXQA 2OSLB 4FI6A 1L7IL 1N64H 2EIEA 1IUZA 4XMTA 2YUAA 4J41A 3BUIA 1XGUA 2RQEA 5B39A 1I7ZA 4MAUH 3SDCD 5FDWA 3CVCA 3NA9H 5F96H 5IY5B 4Q6IA 3GHEL 3WLWC 4YMPA 1AZUA 1EAQA 1T2XA 3E2HB 5SWQA 3CWGA 2P48B 3S8GB 4G27B 4PS7A 1UM6L 2EH7L 2FEJA 3CSFA 2XIBA 5T8IA 1IBMB 4NNXA 4Q4EA 5HJBA 4NN5C 3HZMA 2BNUA 5C07E 5BMFH 5I6PA 2HVJB 4HWNA 1NINA 3GGWB 4F7MA 1EFXD 1GS6X 1U3HD 2C9SA 3BP7A 1MQKH 1XREA 7TAAA 1KXVA 4TNVF 5B8CC 3W39A 2KS0A 2RAMA 1PKOA 4QXVA 4YDNA 4N0CD 3D9AL 4KJPD 1M1SA 3HE7D 4PB0L 4DPCX 5H2BA 1FO0L 1HEHC 1CTMA 2H6OA 3FH5A 4IHOB 3HNVH 3P73A 1W0WA 1A6PA 5D2NE 2YLKA 3J81N 4UTAA 3EOAA 3F12B 4HJJL 4E9QA 2FH6A 1ETB1 1OXYA 3FO9A 4YHML 2D7PA 1B4RA 1OKEA 5FYKD 4JZNA 3WDHA 1AQMA 4MZ2A 2O6CA 1CI3M 2GSIB 1D7CA 3GNML 4GG8B 2WTPA 3VQYA 1NC2D 3TO4D 3A0HZ 5LQBH 3EDEA 1BIIA 1GGIL 2VO8A 1G6RB 5IR1A 4OUUA 4HKZB 4WW2B 4KKZA 2YOCA 5E9DA 1R3HA 4AGMA 1GZHA 4O4LB 1MFEL 4ZQTA 4MTGA 3J27A 2Y4TA 1OE1A 5D1XD 3V8CA 3F7YB 4LP8A 3HS0C 4ZFZB 1M5IA 4FLXA 3JWOL 4HMEA 3S36H 1NGXB 4LPVA 4OCWL 2EEDA 1SQVH 1TVBA 4IYIA 2UXXA 1T7XA 3GDBA 2NW2B 3DTXA 3Q1SL 4HYTB 4NN7C 4X9HA 1DJGA 3KZ8A 3NESA 3UQ8A 4OCYL 4KY1L 4DYLA 2DQ6A 2CUMA 3V95A 2CG9X 3WY3A 4L8DA 1WJZA 4UMSA 3BCDA 2H8PC 4HF5L 4YZWA 1C8PA 2PI5A 4QHNA 3CC2V 2YHGA 4ABQA 1D5RA 5ENWB 1JV2B 4DETA 3PREA 4NEHB 3JVGA 2NX5A 4V1DB 5B8CA 1SDDB 3TBYA 2GY5A 3Q2NA 3D52A 3NCMA 4M93B 5D2NB 1W15A 1XMWA 1Y0LA 3F2LA 3PAYA 4P5MB 4XMXA 1C1EL 1TTAA 1S7SB 4YJZL 5HHQA 1MOFA 1BGXL 4G2AA 4HJEA 3DOSB 3F7KA 4XOCA 1UASA 2B4CL 2L7EA 4BKLA 1N8OE 2OYLA 2JCCA 5I75B 5JPNA 1P4IL 3MV8D 5IZ7A 5E08L 1EJ6A 5KOMC 4AGOA 1MRDL 1NPUA 3WKYA 4K23L 4JPWL 4M03A 2H3XC 5E2VH 3U9UB 1FZKA 4PA7A 3KPRB 2C1PA 4GXFA 1DZBA 5DJAA 5JPMB 1U2CA 2Z1PA 1YN7A 2JKTM 2XNAA 3O11A 1YYML 3MRIB 4KQ0A 3VXOB 2AJ3B 2A74B 1BHGA 4ZDHA 2EIZA 3ZKMD 1EN5A 1AXSA 3CC5A 1DYZA 4PIBA 5F71A 5ERWB 1D6EA 2CE4A 4IRZH 4DGIL 5MENA 3SE9L 2YD3A 4EUPA 3RHWF 5JOPE 2Q2EB 2WXIA 1JPTL 1JNJA 2ADGA 4I0PA 2VZVA 5AOIA 4HBNA 1WPBA 4PRBA 5FNVA 1FVEB 1MFCH 1PAZA 1OARL 3AREB 1T5EA 4EO5A 5IQLA 4LOVA 2B08A 3PN1A 1Q90A 4JRLA 1SQXH 3B7TA 4YHZL 1KTLA 1QSFE 1AJ7L 4Y8DC 3VG0L 1CD0A 5CS7A 2PCYA 4DO5A 3BY6A 3SR2C 4BIUA 2VSMB 4BQ9A 1LVEA 4H33A 4PH8A 4L2LA 5EBMA 5C0AD 3RGBA 2VH5L 3KVPA 5JHBA 3CE2A 25C8H 4GW1B 1S7XB 4GBXB 2A9NL 3GZQA 3MV9A 5JXEC 1DQTA 1JD9A 1ILSA 2ZWLT 3BWSA 4P2QD 3Q4HA 4PY7B 2WXMA 35C8L 4QRQB 3AZUA 3VWJC 3IGKA 5T1JA 1FZJB 5ESQA 4J12A 1N0LA 4N2AA 1OK0A 1FCGA 3VX1A 1YEIH 4N8CH 5DO2D 5HHME 1UZ8A 1V3JA 2WYTA 4UTAL 2ZXGA 2P5PA 5TDOB 3LRGA 3HOGA 3Q8FA 1L7TL 1KN4L 2KC0A 3OZ9L 1M4UA 1SA0B 4EZJA 3MFGB 2UU9B 4BIOA 2I60L 4XCEA 5DZAA 4UV9A 1DN2A 2DQ3A 3RWJB 3GXMA 4EEEA 1QBLL 2VUYA 2EVJA 1B3QA 1A1NB 1MCWM 3MLTB 3ZDYB 2A6KB 2QHRL 3DK2A 4D7SA 3S4SG 4L37B 3UAFA 3UTQA 3BHBA 5SWSB 1M71B 4S1DD 2H5UA 2KYIA 3CHPA 1YNTB 2XWRA 2GW5A 3RL2B 4ZO6A 5AZ2L 2EUZA 1KBVA 3I6GB 2FNWA 4U1LB 1CGXA 2NX5D 3GJEB 5SWZB 5DD3H 2VN6A 1J12A 1EDYA 4KK9C 4N22A 1QBAA 2UWEE 5CD5D 4GQRA 1ASPA 1CL7I 4IU3B 4IJ3C 3WHE0 4S0HA 3A6OA 1H3PL 3VYNA 4X1KA 3CFCL 1J88A 1DSFL 4GRLB 2ROYA 4KHXL 1INEL 3WFBL 1G1YA 4TWKA 1GS7A 2VB5A 3NFPA 1G7JB 2QSQA 4IHOA 3BVWA 2Z65C 1OGAA 1XIWC 4LSUL 3PNWB 4YWGL 4JFYA 3U46B 4JPSA 4OT1L 1F41A 5CR1A 5D7EA 2D0HA 4TV9B 4XMWA 1G1XB 1D6VL 3J80N 2OX5B 3UPCA 3LEVL 4F57H 4N86A 1CLCA 1IL1B 5C0BE 2VDMB 1OE3A 3V9EA 3CLFH 4N90E 3UCRA 3LN5B 4IHJA 1LO2L 1OZUA 3EH2A 4NQEB 1QSFB 3PRZA 4KKPA 1FSKB 1XWVA 1TQWA 1HNWB 2X6BA 2L04A 4U6HA 2ZR3A 5GJSH 3TASA 1G87A 4YSPA 5E9DD 5LUMA 3B2EE 4ZUTB 3L7EA 5GRWA 5GIRA 2OP4H 5JCOC 2DV6A 4OUUB 4WW2A 1HWGB 1SJHA 4H0HB 3LOWA 4POUB 3TO2A 3IBEA 1GY1A 3OZ9H 1Y7VA 5KSAD 2OCHA 3CDFA 3BLPX 3L5IA 3P4OB 3CRCA 2I27N 3KNBA 4TQEL 1R5VA 1U8IA 2NSQA 4P5RA 3KM1A 4AEIH 4ETYA 2BCCH 2C9XA 4TV3A 2WBJD 2CK2A 3MYJB 3BZFA 2R0WL 3F05A 3DTXB 1EAPA 3HUJB 4ZG1A 3WY2A 2GB2A 1BQHG 2PWGA 3TZVB 3RZCD 2DW4A 3JUZA 2SODB 3CN1A 3TPUB 2WNWA 4NC2B 4GO9A 2F7IA 3VOUA 1BV8A 4KKBD 1SJEB 3FL7A 5CA0A 4HALA 2WXRA 4NQQA 4XP9L 3K04A 2OK0L 4EB6B 3LRHA 4I5BA 4JYCA 2CGOA 4XO9A 5D2LE 4FC3E 1DJHA 4CKQA 4N0RA 4HUCA 5CJXC 2X4UA 1S7WB 2UZIH 3PHQB 1L9RA 2A9BA 2QFPA 2W94A 3PGDB 1S7VB 3SE9H 1XF4A 1A9VA 5MERB 1UOWA 4HOXA 2VN3A 4ZSOB 3CHXA 3QEUB 1G6VK 4WK2B 4F3FB 3BDYL 2WZAA 3GKWH 3QC6X 5IVXB 4NQVB 4TUYB 2QQNH 1WZLA 4ZO9A 5AOZA 1IILE 4JL2A 1CLZH 3IT8D 1KNOA 1XIWB 4ELMB 1NAMA 1YJDL 3BUYA 1V55C 4E2LA 4PTTA 5D72H 1W72L 2NZ9D 1GZPB 3MRPB 4B3RB 3TVMA 4X7DC 3W0WA 1JHLL 4O2CA 6FABL 5I6XC 4I0PD 1MWAA 4G1EA 4RAIA 4XMKH 3JYCA 1CICA 3ULUC 3OSKA 4TPRL 3EYUL 4O4HB 4FQ1L 5LDUA 1SHSA 3FC8A 3GSVA 4C57C 3MODL 4ZFOA 1R3KA 1COBA 5FHAL 4LHUB 4QY8A 1K5WA 5BRZD 3ZX1A 2YD6A 3DYOA 3MMEA 4WWKD 1X4XA 3NCEB 4AYID 3D3VA 1NTKH 2G5BA 1IM9A 1XCXA 4D0CB 4YQXL 2Z3YA 3BH9A 1D5ZA 1HIML 4PGBB 4Q9BA 1YDXA 4FHKA 4FZ8L 2FHCA 2IPTL 2I9LA 5D7IA 5FS5A 3ZXAC 3HZVB 1CF1A 4NTXA 3HA0A 4L18A 1IURA 1U92B 4M7JH 3ISYA 1GC1L 4Z7OE 2XZZA 2WINB 3BUQA 4LLUA 2FWOB 4Z0BH 3S37H 1YUHB 2Z8WC 4NXSA 4IL6Z 4L8CA 2IDTA 2Z8RA 1XMOB 1M90W 2F74A 3REWA 4BCXA 4DGIH 5CIPA 1IGIL 3L16A 4MXQC 3GSRB 1JF1B 1M56C 2UY6B 3OR7C 1E5BA 1FNSH 1R3IC 2N1KA 3VB8A 2IGFL 4DEPB 1KIPB 4MT8A 5LQBL 1RHHA 5GGTL 2AGJH 1UOKA 3P4MA 4QHKI 4MTOA 4FL4C 1FA4A 1KYOK 3V52L 5E2TL 3FUNA 4F8TA 3HC0A 3WIFA 5AVSB 4QXUL 1NC4A 5C3IA 3BQUA 4UT9A 3FB8B 4PRHE 3TVMC 1XF3A 3CN0A 1Z5YD 3HZYA 1A7NL 3AADB 2DYRC 2A5UA 1I7RA 5LVEA 4H8WL 1O7DC 1KT2A 3T4AA 1SBBA 3AJ7A 4AUYA 1CDBA 2FGWH 3OTOO 4PVMA 2F54D 4R5XA 4HEPG 2AXTZ 3N06B 4PD4F 4W70A 3VWJB 1R3LA 4GRLA 4R4FH 3ZMSA 2GJRA 1G7PB 4JFHE 4BXVA 4DKEH 4YR6A 4XVOA 3QIBB 3UACA 2R23B 1PZUB 2XG4A 1O6VA 5F2FA 1VACA 3SDXB 2YEVB 3SD5A 1NKOA 4GT1A 1AZBA 4CC0A 3BXNB 1T6BX 4JFEB 3KCWA 3JYBA 1C5BH 3BIKB 1HZLA 1X59A 3LZNA 2M83A 2F19L 1NA8A 4A6YA 3WNKA 2LTQC 5EK0A 4MNGA 3HAEG 4X6BA 2R2HA 3QS3A 2IGTA 5DZNA 1E5AA 5DZ9A 2NUTB 2NY5C 4MYWB 1MJ7H 1E8YA 3GXIA 1VARA 1R5IB 3VMOA 1XNQB 3LKPB 3NCFB 5ESVA 3SPJA 1GC1H 2QSCL 1NKDA 1IX9A 1K92A 1QLFA 3IAQA 4QJ5B 5LNGA 1BF5A 3ULUF 3UZVA 3UJTL 1R24A 4JM0A 2I9TB 2XCMC 2L0DA 3GTNA 1NOFA 1JVMA 5DJYB 3ZL4L 2W65A 5JIMA 4B9GA 3A6CL 2MHAA 3WIHA 4HX1B 1JGDA 3VXMA 3LVTA 5DN6G 3WFCH 1JK9A 4XTRC 1XF1A 1DVSA 1SOQA 3N04A 3DROA 4JGJA 2R2EB 5GGVL 1BF2A 3G08B 3HPLB 4LR3A 3RVUC 1Z3RA 3JVFC 3HG1D 2F5BL 1KXTA 4ODUA 5GS1B 1SXAA 1QA9A 2ZG3A 1RLWA 1N8ZB 3MBXH 4ZTPL 1L0PA 3N1FC 1P5UB 4K3GA 1MFNA 2AEQH 5L3BA 4MW8A 2DJMA 3WLWD 5HHOE 1ZUQA 1FIGH 4QHKJ 3THOA 1RU9L 5J89A 5JOPD 1E4XI 4GX0A 2BVPA 4ORGA 3ABTA 5BUAA 2QGNA 1HHGA 3WNMA 1FL6A 1QHQA 3G6JF 3AFLA 2OMBA 4MTMA 2ZJSL 5D7JC 2H41A 4QWWD 5TFSL 2X4UB 2XVGA 2YMOA 3MLZL 3PHQA 1UUNA 2ZWKA 2M7WA 4FQQB 2ZDIC 3K72A 2VT0A 5I8EB 4OFPA 3AEIA 1KY6A 3CU1A 3W11C 2F53B 1OAYL 2GK0A 1E9OB 2ADFL 1MW1A 1QBBA 3U0TA 4TTDC 3GF8A 4HWBL 3AC0A 5E5LA 3VU1A 1TUPA 2X1PA 2ZM6B 2PTMA 3G6BA 3JSSA 3O6LL 5DLML 3VE0A 5ICYB 1OP9A 1Z2KA 4MA7L 3B56A 2OIGA 4UDUB 1T20B 2MPVA 4HS3A 1FV1A 3ASNB 1IJNA 1VGKA 3F7PC 4LIQL 2XFGB 1N32O 3BVUA