3BPZA

Hcn2-i 443-460 e502k in the presence of camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREKIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title C-terminal movement during gating in cyclic nucleotide-modulated channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 66
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3bpzA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3bpzA02
2PAKA 4KWLA 3PVBB 1J3PA 3QOPA 3LA3A 2HJIA 3MYXA 1RUOA 5AVPA 5FLIA 2GC0A 4LTAA 3LAGA 3SCHA 5I8SA 5EFUA 2MHFA 3RNSA 1X7NA 1O3SA 3IDCB 3OTFA 5FLHA 2PYTA 2MNGA 3NW4A 2XHKA 5J7MA 2ATFA 3GYDA 2CAUA 4ZU4A 3NVCA 3FJSA 1EYBA 1PMIA 4HVQA 4I02A 3SHRA 1CAUA 3I59B 4QGLA 2QCSB 2OA2A 3NSTA 4Q0SA 1NYWA 5LEJA 4ZU5A 4XFAA 1VR3A 3WW2A 4L2NA 1QXRA 4L11A 1YLLA 4P9GA 4AVCA 3EJKA 1EP0A 4HN1A 1CGPA 5CVRA 4O9GA 5BY5A 2GH2A 2GC1A 1RUNA 1GQHA 2MPFA 2UYAA 1LKNA 2V09A 1GQGA 4KU7A 1SQ4A 1ZNPA 1QXJA 2K0GA 4LUMA 3DL3A 2PQQA 3UKNA 5JSPA 1ZRCA 4IEQA 5I8TA 1CAXB 2BNOA 1V70A 3LOIA 1LB2A 3KGZA 2UY8A 4WZCA 4MH0E 5JR7B 4J1XA 4JTNA 4MGYE 3E6CC 1WA4A 3H1YA 4UXAA 2I45A 2QNKA 4UBHA 4QM8A 4DINB 5FLJA 3ROUA 2XL9A 1WGPA 4HSLA 4UBGA 1YUDA 1J1LA 4FAHA 4PJYA 1Y9QA 2QDRA 1RL3A 3H8UA 3H9AA 5C8WA 3ES1A 3EQEA 1Y3TA 5BXXA 4IEUA 4FBFA 5KBFA 4KU8A 4PIZA 2D40A 1Q3EA 5I0UA 2OYZA 1UCXA 4BH9A 3IDBB 1J3QA 2D5HA 3EO6A 3ACLA 1OFNA 2B8MA 1TQ5A 1O5LA 3H3ZA 4IEYA 4MX3A 4YARA 5F1RA 3FZ3A 1ZRDA 5C6CA 5J48A 4J1WA 4LEJA 1OD5A 1VJ2A 4IEWA 1YFXA 3ELNA 2Q30A 3WW1A 1ZZCA 3E5QA 1RTVA 2IXJA 2Z2SB 1UPIA 2ET1A 4Z82A 4MGKE 3ZDSA 4EROA 2H6BA 2ET7A 3LA2A 1FT9A 1LR5A 2WC2A 3NKTA 4I09A 1J59A 3SCGA 5CU1A 3BALA 1CAUB 4XFGA 4HSJA 2PA7A 5JCTA 4MV2A 1OMIA 4AVAA 4E2QA 3U11A 2DCTA 4IEOA 1JUHA 4YNIA 1CX4A 2F4PA 4B29A 1ZZ8A 5FDBA 1FXZA 3NL1A 2Q0AA 2O1QA 1ZVFA 1DGRA 4XETA 3HT2A 5KHIA 2IXCA 5EZWA 2PAMA 4D7SA 2EVXA 4XF9A 1X82A 3JZVA 3R6SA 1DZTA 2CGPA 5T3NA 4QGMA 1O4TA 1UIJA 2GC3A 3HIFA 4Z07A 4HVRA 1NE6A 1ZREA 5JSRA 4EWAA 1RGSA 2PHLA 3H1MA 5LRRA 1Q5OA 5FQ0A 2GU9A 5JAXA 2Q1ZB 4XF0A 4N9HA 5BUVA 3E6BA 3U0ZA 1H1IA 3H3UA 4KL1A 3IWZA 4LULA 1UIKA 3BB6A 4Q0PA 3TNQA 4ZU7A 1I5ZA 4XF1A 4OLLA 1HW5A 1UD1A 2UY9A 5D1IA 4JVAA 5FPZA 2BNMA 2PTMA 1O3RA 2KXLA 4OFGA 1X8EA 2ETEA 2B9UA 3CL1A 3D0SA 4E2SA 5FCCA 1YFWA 1NXMA 3C3VA 4RD7A 5JSOA 2IXLA 3E6DA 4KWJA 4MZUA 4O9EA 4XFIA 1VP6A 3USSA 3FHIB 3OCPA 4XF3A 3WW4A 3E5XA 5KHHA 5E1RA 4I01A 4H7LA 1FI2A 3OD0A 5FPXA 2IXIA 3QACA 2H0VA 4XFCA 5I0SA 1XE8A 3ETQA 3M3IA 1J58A 5E16A 4I2OA 4IEVA 4IERA 5BPXA 4NVPA 2PAEA 2CAVA 1ZZ6A 4PIXA 1QWRA 5I0RA 1YFYA 1O7FA 3RYRA 4AQ6A 4KWKA 4FT8A 4Q0QA 5HI0A 1CAWB 1O3QA 3NJZA 4F7ZA 2BEOA 3G7DA 1G6NA 4XFHA 4HZFA 1LRHA 3RZZA 5K8SA 4BHPA 4N9IA 5KHGA 1H1MA 3M70A 1NZCA 3GBFA 2PHDA 4QGNA 1CAVB 4I0BA 1ZZBA 3H50A 4IESA 2IXKA 4ONUA 3RYKA 4EV0A 4GULA 4Q0UA 3L2HA 3TNPB 1CAVA 3MPBA 2QVSB 4ORFA 2VECA 1YHFA 1NE4A 3OF1A 3SXWA 5KHKA 2XKPA 3FFQA 2N7GA 5I91A 3I59A 2XLFA 4X6QB 2XL7A 1ZZ7A 4K8FA 4MGIE 1EPZA 2ZCWA 3RPQA 1PM7A 3U10A 3OGJA 3H7YA 5I0TA 4BIFA 1CAXA 1SFNA 3UKTA 3KCCA 4X6RB 4LLOA 4QXKA 2OZJA 3FWEA 2OPKA 3UKVA 2BYVE 2ZKLA 1QY4A 1I6XA 3I7DA 5LEKA 2FQPA 4XF4A 1DGWA 1ZZ9A 4F8AA 2O8QA 4I3PA 3SMHA 3RDIA 2CV6A 2EA7A 4MUVA 4LA2A 3CLPA 3EBRA 4QMAA 2GC2A 2H6CA 3BCWA 2P17A 3PNAA 3DKWA 5J3UA 3I54A 1O5UA 1OI6A 3KSCA 4I0AA 4FAGA 1L3JA 1J3RA 1YFUA 4LA3A 1RC6A 4AXOA 3FE5A 4Q29A 5I93A 2QJVA 3E5UA 3LA7A 3LWCA 4PIYA 4CYDA 4META 4D7TA 2GAUA 2XGXA 2XLAA 2BNNA 4TLFA 4WVZA 4JV4A 1YWKA 2IXHA 4AQ2A 4XEZA 3ST7A 2C0ZA 1ZRFA 3O14A 3CO2A 3H7JA 2Z69A 3DN7A 2GZWA 3D82A 2OZ6A 1EY2A 3EHKA 5FQ0B 2BGCA 3BU7A 4QX5A 3BPZA 5LRSA 1O3TA 3S7IA 3KGLA 1XRUA 4XFBA 4EWDA 4HVOA 2D5FA 4EWEA 1SEFA 2XLGA 3FX3A 5KHJA 5I8YA 4HBNA 2K9ZA 3CEWA 2EAAA 4E2GA 3B02A 2HKXA 4R8HA 3ES4A 2VPVA 2FMYA 3H1WA 1U12A 3DV8A 3N4MA 4QM9A 4IEZA 2PFWA 4A2UA 3MDPA 1UW8A 2VQAA 3IBMA 3CJXA 2IC1A 2B5HA 3HQXA 5BV6A 2WFPA 4XFFA 2UYBA 4LUKA 3IIAA 1X8MA 1XE7A 4YSFA 4YRDA 1WLTA 4WBBA 3KMHA 3VHRA 1Q43A 1CAWA 1IPJA 3PLQA 1ZRRA 4YYOA 3S0MA 2XKOA 4HMZA 4HN0A 1IPKA 3E97A 4HLTA 3RYPA 3LZZA 4R52A 2D93A 4MGZE 3D0JA 2Q4SA 4BYYA 2Y0OA 3S7EA 4JTOA 3WW3A 2E9QA 1ZX5A 1DZRA 3MZHA 4AVBA 4IEPA 5CADA 3HT1A 3CF6E 4IEXA 4IETA 4Q0VA 3SCFA
chains in the Genus database with same CATH superfamily
3VKLA 2VZPA 4YW7A 3M4FA 3DPRB 1M4WA 2GC0A 4FI9A 2VNVA 4J11A 5B1OA 2JIZG 3TEXA 1CONA 4DV0O 2XUMA 3NRUA 4NTYA 2CAUA 3NVCA 1XBFA 3VZKA 1EUUA 3U78A 3I59B 4Q4Y3 4XJZA 3DYOA 1CPNA 5FLXN 2Y8KA 1EP0A 3RYHA 5CVRA 3PIGA 4O9GA 1HNWO 5FY7A 1JTZX 1XNDA 1RUNA 2RS51 1XHZA 2RMU2 1ZNPA 4O4JA 4FFFA 4GXLA 2P67A 3MFCA 4BE3A 1PO11 1V70A 4DV1B 2VOWA 3WF2A 4EE2A 2ZDIA 1EN5A 2XOKG 1AR83 3DCQA 4DXSA 4MGYE 1AR62 4QX3A 3H1YA 4O2AB 4QHZA 4UXAA 3K0DA 2V72A 3ROUA 5LATA 4LNVA 4UBGA 1TNRA 2FD8A 4FFIA 4QPGA 1BYHA 3ZXAC 5LOVB 3TXQA 1RVF2 3UGFA 3WF3A 3T4HB 1K5QA 5LCWL 1NA1A 2XAHA 3CX5F 3C7FA 3QTCA 1J5EB 4NHXA 3AG1C 1RM1C 4LEJA 2WIIB 4X88A 4MGSA 4XPVA 1QIQA 5FY5A 1UPIA 4YVSB 1BZWA 2HVKC 1S0EA 4GQ7A 1UZZA 4AR2A 4C0BA 5FK8A 4HSJA 2DCTA 2BBAA 4GCZA 1XNRB 2F4PA 4NAOA 3UNPA 3AMNA 3QNEA 4GT1A 1ZVFA 4UW3A 4ES9A 1DU3D 1RUJ1 5KLVH 1QJU1 4GKKO 4GKJB 2EVXA 2DW4A 4IL7A 1O4TA 5FZ1A 3RJ2X 4J7ZA 5B1BB 1RGSA 3WNPA 2QTSA 4DMIA 5LW9A 1GBGA 5IVEA 3U0ZA 3BB6A 4CDUA 3K58A 1HXS3 1ZBE1 1HW5A 1RSOA 4DW0A 2JX9A 1RHI2 4GB32 4XUQA 1TUBB 2AACA 3WU2Z 1PVC3 1AJKA 4BIUA 2IXLA 1LHVA 4K20A 1Q90D 4H7MA 5IYYA 2JIJA 1W6PA 4XF3A 1QJY1 1XYOA 3T09A 4Q5OA 1NU1H 4DYLA 2BUKA 3W7XA 2HEYF 5D8AB 3IDAA 2W6JG 1QQCA 2BV4A 3LSSA 4LR3A 3RYRA 4NJ4A 5DXDA 1VAKA 2BOBC 4O65A 5FP9A 1CXZB 3JBG1 3NAPA 3KLSA 5K8SA 2VY0A 2Y6JA 1AYM2 3ZSMA 3RI8A 1GZWB 4IESA 1E1QG 2G38A 5FY4A 3NNMA 1G6UA 3PTYA 4ORFA 1RUH3 2VOVA 4X9QA 3LEMA 2YV8A 1PM4A 1ZZ7A 2A6WA 2RS52 4ZXEA 1XQ8A 4Q4V2 2ADDA 3S3XA 4BM8A 4LKEA 4X6RB 1WMXA 4CDXC 4LLOA 2OS2A 1PGSA 2OZJA 3JB8A 2OPKA 3LPGA 2QDOA 5FZDA 1QVGU 4MXWB 5K0UB 4LFBB 4AG4A 3ETEA 4IW3A 3CWBH 4MUVA 1YIJV 3TEYA 5ITZA 3D36C 2HHHO 4FTSA 1JU3A 1SQXH 1V55C 3L70H 2QEXV 5ACA1 2QWQB 4LJHA 1XSRA 5HV4A 4WVZA 2WLQA 1BGYH 2QGNA 1ENXA 3AK0A 2VQTA 4JYAB 4B3MO 1BQZA 3O14A 4YJ2B 1KXGA 2ZEZA 3OM3B 1CPMA 3MFAA 3AP5A 3WINE 3A23A 3BU7A 1H2LA 3UT0A 1O3TA 2DBNA 5FUNA 2CTPA 1JXNA 3VQVA 3ME2A 2QDNA 3SPHA 3ZYIB 1VBB1 3H1HH 4KUMA 3KHCA 2GN3A 4MG2A 1WW6A 4V2VA 4C90A 2AZ5A 4GYCB 2UWCA 2ZEWA 3TYJA 3M1HA 4NWVA 4MVSA 4Y33A 1EAH1 2DU1A 1CQ9A 3P3PA 4IL6Z 1H4HA 3ZPOA 3WB2A 1CAWA 4NN0A 2P3IA 3S0MA 3RYIB 3WG7C 5ABJC 3M7AA 2EXIA 4BYYA 4Q8LA 2GNBA 3LIGA 5B4NA 4X64O 4CU8A 1PO21 2Y6KA 4P5HA 2HG5C 1WP7A 1RUOA 5LK5A 3MIDA 4E2LA 1NR7A 4QKFA 3IDCB 4QB6A 5FREA 2PYTA 4EJRA 2P2KA 1VQ5V 3ENRA 2NNUA 1NVPB 1RUH2 5LEJA 1IBMO 2WA4A 3RWRD 4J25A 1OCZC 1WCSA 1QXRA 4MVRA 2VWJA 1AR81 3IJ4A 3J81N 2BRTA 2W39A 5EC1C 2VXRA 1F31A 3VBRA 1C4RA 1SQ4A 5K0UA 4JI0O 1SDDB 2E63A 3W5NA 3R66A 4I55B 4UOJA 5DG2A 4MH0E 1R3IC 5JR7B 4LO8A 1K92A 3CRMA 2ZXWC 4D6TH 3UJQA 3E6CC 5FV3A 4LBKA 3QCWA 1TMF1 5FY8A 1BMV2 3O0VA 4TQDA 4ZS2A 4R9CA 3SPJA 4BW5A 4LBLA 1CIWA 2N05A 3NO8A 4A45A 1ZBA2 5FZ4A 2YPJA 1UNBA 4HT1T 2ZABA 5C6CA 1NH2B 3CC7V 5HXMA 3KB5A 3I2JA 2EF6A 3M8LA 3K2OA 4OPHA 2ZOEB 2CE4A 3DGEA 4XCBA 4L8JA 4EROA 4FM2A 4A6SA 1W06A 3P5BA 4RR3C 5IY5C 3UETA 1DBNA 2WNUC 2O0OA 5JCTA 4CDXB 2YXSA 1VBB3 4DXZA 2KD7A 5IE9A 2QQKA 1HNXO 3FLTA 3ZKUA 3V0AB 2WQ8A 2PF4E 4W6XA 4HAMA 2G4IA 2IZWA 2LW1A 5D8AA 2CGPA 2EALA 2J1AA 3T4DA 1BHGA 5FAXA 1AVMA 1H8TA 1N1TA 4FLXA 1N4CA 3CRRA 4CEYC 3H3UA 4KL1A 4MVQA 4GWJA 1N36O 2WL1A 3BFRA 1PO23 2TEPA 4UFHA 1XBLA 5IJ0A 4K3UA 3PJQA 1JMKC 1N47A 4E2SA 4B8EA 4OZOA 5JDBA 3LEGA 1SRYA 1W6OA 4X8PA 3AL6A 4QGPA 3WW4A 2BVBA 2ZEXA 5E1RA 5C8CB 2WSSG 3QACA 2H0VA 4BPZA 5FXXA 1N34O 2E76B 3G6BA 2VWKA 2R72A 4JI7B 1ZZ6A 2Q0OC 1LU1A 1G6NA 1RUH1 4GKXA 1LRHA 2VCBA 4GAZA 3FN9A 1YNAA 1JZ8A 1Y74A 4P5YA 4TQFA 2RJKA 4UV9A 1PZ8A 2PHDA 5C5TA 2IXKA 4EV0A 3ZFFB 3R65A 3CCUV 1IKQA 1UZWA 4IIJA 5E8AA 2ORZA 3SXWA 1VF7A 2R6QA 2UXDB 5FBJA 5I91A 3UGGA 1YVWA 1AUYA 5ACA3 1PV0A 4MGIE 3I3DA 2BJSA 3IMNA 2PI5A 1HB4A 1LU2A 5LMNO 3MIBA 1QCEA 4AEDA 3CKHA 1L8DA 2RE9A 2WLLB 3HQRA 4M00A 4LF5O 4L99A 3DEMA 2DUPA 3D4KA 1IVSA 2XB6C 5IWFA 2VUDA 3EMRA 1HDKA 4FIPC 2XONA 3KD4A 2VVDA 4BWOA 4ZHNA 4LA3A 4ZI7A 4DV6B 2VMEA 1B6QA 2ZGSA 3E5UA 3VBSA 3CRCA 4NTXA 2VQEB 2WABA 2Q73A 3QBQA 3RYFB 5FQ0B 2BGCA 5IUQA 4GJYA 5LRSA 1YJKA 1GM9A 2Q68A 4YGEA 2HWC2 5C4WC 5C7GA 1LGNA 3B02A 4JKLA 2BP6A 5IJ0B 2W0FC 4NIHA 4CBCA 2K1EA 1X9PA 1YI9A 2C1FA 2OXBA 3CCJV 2JRIA 3WHTA 2ZHKA 3TXSA 1QJX2 2Q9LA 2A7AA 4Z92B 1SA0A 4TTGA 4CEWB 4CH5A 1RUG1 2BBVA 3G71V 3KMHA 4X65O 3URFA 1SBEA 5IY5B 4HMZA 5GZCA 1I94O 4RYDA 3UKMA 2YGLA 3E97A 1PO12 3D0JA 2KR2A 3K59A 5H6QA 3CYOA 4AVBA 3NV1A 4AAPA 1KS4A 3GWOA 3JUUA 4XQDA 3BTZA 1QHTA 5FLIA 4AYUA 2PMWB 4GX0A 1N1YA 1G9DA 1YIPA 2WUHA 1JZ5A 4LWSA 2ETNA 4AWDA 4I50B 3MV01 1F51A 1K5JA 4FLZA 2NLRA 1S0IA 1NLRA 3ZIXA 3EJKA 2YMZA 2HBUA 3N7MA 3BCCH 1JYXA 4LCUC 3HNBM 2ZR3A 3JASB 5T5PA 4DXTA 4LUMA 1IGOA 3WG2A 4IEQA 3D3IA 3NV3A 3PMSA 2UUCB 2UY8A 2QQNA 1BHBA 4H33A 4OI2A 3U4XA 2AUYA 1SLTA 4D69A 1VRH2 4AQSA 3CCSV 4CUCA 1RUD1 5FLJA 4DUYB 1XOYA 5GJ6A 1W04A 3PUSA 1WJZA 4FVVA 4XCAA 2JEUA 1VQOV 4KFMA 4FFHA 4GB31 3EQEA 2W47A 4UCVA 3RYFA 2NYYA 4BLIA 2D5HA 3AFGA 2LUWA 1UL9A 1O5LA 1Q6HA 1N33B 5GTIZ 4YARA 1G9FA 4LR4A 3MI8A 3HN1A 1DLLA 1NLQA 2OVUA 3UQ8A 2WDBA 1K5MC 5EP9A 1ZZCA 1FXKB 4YGBA 5C8CA 2A6ZA 3A0HZ 5A3PA 1W03A 2Y6FA 2H6BA 5DUXA 4YVWA 4B4PA 1WZXA 4ZONA 1QLNA 4COUA 1F4HA 3ILFA 1E57A 3SH3A 3KCXA 3RVHA 2DN9A 4K7JA 3WNLA 4E8CA 1JUHA 2DVBA 3BA9A 4OX9B 2YY1A 3OR7C 2AHYA 3OPTA 2JE7A 2VU9A 1EZVH 3ZM8A 3O1TA 5D5QA 1LODA 3GCXA 1KYOF 4UT5A 2JVDA 1V9PA 3THOA 4NRQA 4JI3B 2YIBD 1VAVA 4PLOA 5F2WA 1H1IA 3J26N 3IWZA 1IHMA 3MIEA 4Q0PA 3QH6A 3C3SA 1W0PA 1GWKA 2VUAA 3E83A 1X8EA 5F6LB 1EUTA 5CFDC 2WLMA 1LESA 5JSOA 5IVJA 2WQZC 1ALYA 5IVBA 1AL21 3H1IH 1COV3 2BTOA 1NCRA 1YRZA 2R042 2FDHA 4DK1A 4B3SO 4GMP0 2GNMA 5H9PA 2XDVA 3D6EA 3LF7A 5L9RA 1XE8A 3LSDA 2FMLA 4BZ4A 4JASA 1SQGA 2RJZA 2XJPA 4OXSA 4JAAA 4AFBA 2F66C 2ZTNA 4IYIA 3OR6C 4UF0B 4IHJA 4LHKA 1LR1A 3ZFGC 2GTAA 1T5EA 2LP7A 2A3QA 4WF9V 4ARYA 4XFHA 1G8MA 1JW6A 5EYPB 1YO8A 4X66B 3IPVB 3C7EA 4I0BA 4B1MA 1VEWA 3X2QB 1VBC2 2HWE2 3TNPB 2GMMA 1AZDA 1NE4A 1GN6A 5KHKA 5L7OB 1SERA 3FFQA 5A6YA 3B7MA 5EC2C 2VTFA 3OMNB 3WDWA 4YM0A 3I3QA 4MXWA 3TBDA 4BIFA 1RP3B 1I3HA 1SFNA 1DLBA 2UUBB 3UKVA 3T4VA 1I6XA 4XZUG 1VLNA 1D0HA 1FFXA 4O2AA 3RDIA 3DXTA 3BCWA 4M4RA 1QKQA 5LA6A 2LFSA 2QTOA 4UFMA 1MS5A 3OYWB 3KSCA 3FL7A 5FZFA 3WNMA 3RS6A 1MOFA 3F95A 1RYYA 1NTZH 4L97A 4Q29A 3OPZA 5FZ3A 4ZS3A 4CYDA 1S0JA 4DV2B 1NA1B 3IM0A 3HBZA 1W9WA 3CO2A 1GANA 3DN7A 4BK5A 5JH7A 2QBXA 3LFMA 3VQYA 4MSWC 5FXWA 1HRI3 1XMQB 1R1BA 2GV9A 3CEWA 5FYYA 3HQUA 1AB3A 4CU9A 4XMAA 2PUSA 2YEVB 4WFHA 1MZ5A 4CPBA 3IC7A 1PO22 1QJEA 2IJJA 1AL0G 3ICXA 2GBOA 2ZM6O 5FKBA 4IEZA 1GWLA 3K5MA 2E7AA 3CJXA 1C57A 2IC1A 1Y67A 4UVCA 4AQYB 3SQOA 1JVMA 4LO7A 2VVFA 4MGZE 1ODMA 2Q4SA 2BDRA 5LMUO 4BWAA 1VRH3 1US6A 4OUEA 5IJ9B 2GUZA 1ULCA 3H8OA 1D5AA 4PA4A 2YICA 1JX9A 2MHFA 3FUOA 2HWE1 3P30A 1DQ4A 4K21A 2EJRA 3WX5A 2A5ZA 4PF1A 4X1IB 2EX3A 3A0RA 1RVF1 2AC1A 4KG8A 1MNGA 3WNNA 1Y7BA 4DNYA 3KV4A 4K0KO 1HXS1 3GNEA 2MW2B 2QWRB 1QJY3 3Q4HB 2CTRA 2JDAA 5T5LA 1G4YB 4XUPA 1VB4A 3BIEA 1KKCA 1LULA 3L74H 4KU7A 1R093 3N2GB 2ZXWB 5EJ1B 1HLCA 1W2OA 5JLVA 5KXEA 2P22C 3AC0A 5FYSA 1GMGA 1VQ6V 3ASNB 3B77A 1ZRIA 4WV8A 4YGDA 1N8RW 2ZKNA 2E26A 1KEXA 3FLPA 1NR1A 1Y9QA 2VNRA 3CRQA 4QKBA 3I97A 2Q5TA 1ULPA 4FBFA 1GRJA 4PIZA 2W1UA 4CCCA 4A3ZA 3EO6A 2PQSA 3ACLA 1V6LA 3G4SV 1TQ5A 2WO1A 5FZAA 1JBCA 3EFFK 3MLLA 2FBEA 4A6OA 1TVKB 5EZYA 5JZGC 1GK9A 5IYZA 4QDRA 1CVNA 4B3TO 4C0HA 1UYYA 4L92A 1FYUA 3MGUA 4QU2A 3FBYA 1DQ1A 1O8SA 1LR5A 1Z0HA 1BMV1 4Q4X1 3B9CA 1SF9A 1GM8A 3JATA 1ZL8A 2D98A 3OY8A 4TSFG 2VBDA 2WKKA 4RR3B 4IEOA 1GOHA 2VQFB 1VIBA 3IFXA 5CAZA 3M2MA 1YQ8A 1YI2V 4YIOA 5KHIA 3WV6A 4D7SA 1DGRN 1BBT3 1W6MA 1DZTA 2WYSA 2W0XA 2AXTZ 4JKKA 3TEWA 3WCSA 3P1IA 1VMHA 4ZOLB 4YZ3A 4WVVA 4BMEA 4PA3A 2C4XA 3IPVA 1VMGA 4YJ2A 4XF1A 3GBWA 4GD4A 4K3AA 3RWKX 5JXIA 3HKDB 5LGNA 3OTOB 5LMUB 4QX1A 3Q4HA 1S2EA 4ZKIA 2RS53 1AP6A 5CB7A 4CP1A 1RUJ2 2RS33 3M8AA 3USSA 5E1AC 1VP6A 4XBNA 4HPKA 2H0BA 1I7FA 3ABTA 2VQFO 2E32A 2IW5A 4EZ4A 1IBKB 2WAOA 3IB3A 1JUIA 2R061 4XACA 2A71A 1R092 1Y9GA 3POGA 2E53A 2EINB 5FPVA 1EV11 4PLMA 2CAVA 3Q8BA 5CB4A 1TME3 2VMHA 1CAWB 4FPHA 3HWJA 4FPYA 2Q1FA 1Y4WA 4YIPA 2ARCA 2W68A 4WCEV 1EAH2 1CJDA 2PY5A 3O1PA 1H1MA 2OIEA 5JMOA 2ZX2A 2YEVA 5IW0A 1KITA 3RYKA 1AR92 5KR7A 3ZPYA 3IIIA 5DPNA 1K3IA 4P2ZA 1S5JA 5CBHA 3POFA 1M93A 2Z0AA 4PDWA 4Q4X2 1PK6B 4DOUA 4RQPA 1IBKO 4D3WA 2D6KA 3AZWA 4ZXKA 1FV3A 4G3YC 1W0OA 3OGJA 4S2FA 3T1MA 4QHBA 2LJ2A 5F39A 3KCCA 3RFRA 4QXKA 4RS5A 3N36A 4X8AA 2Q69A 3D3AA 4MW8A 3LDEA 3RRDA 1BQ0A 1ULOA 2GC2A 3I8TA 4Q4V1 2B45X 5J3UA 1NOVA 4AHXA 2IVIB 3SJCC 3H3LA 3L9JT 4MVUA 2JGDA 5IVVA 4GIQA 4LBJA 4F3JA 5CBFA 4CXWA 1DCSA 5JI9A 4GH4B 2SLIA 1JR9A 5EIBD 3DPRA 3N9MA 3AXDA 1CN1A 2Z69A 3D82A 4EEQA 5FP3A 3TB0A 1E1RG 4XFBA 2PYLA 5CBGA 4HVOA 4O61A 3FX3A 2FDIA 1SZBA 1XXNA 2LRPA 4FLUA 3NJXA 1LHWA 2E51A 4D0QA 1OCCC 4XILA 1U12A 2DOSA 2F43G 3DC5A 3F7VC 2CYFA 3JD2A 2OYQA 1AYM1 1CR7A 4B4QA 3G67A 1E5RA 2WQ4A 4O4JB 3L73H 4D6RA 4B3SB 1WB8A 2RM23 4YRDA 1NCQB 1IPJA 1W2AX 5L36A 4QE7A 2XJQA 1RJ8A 4ZBMA 4DEQA 1X4TA 4MVZA 2LFRA 2JDZA 1QR9A 1KKDA 3S7EA 3PVNA 1S77D 4JGZC 1W8HA 1Z7S1 3JU9A 2W95A 4KWLA 2WO7A 5AVPA 2IH3C 3AK2A 2A75A 4QX2A 2HJFC 5EZYB 2ZGQA 1S55A 3ITQA 1LOFC 5FPOA 3FB6C 3OTFA 3NW4A 1X33A 4LKDA 4UUJC 4HFSA 4R9AA 3ZKYA 2P37A 1DFQA 2I74A 5A1LA 4AI0A 4XQ4A 1RFYA 4CS2A 3ZXFA 1ND3A 4RN5A 3NNGA 1UOJA 4RL7A 2GC1A 2JG9B 1KECA 3WLUA 3KHBA 1POV3 3OTOO 1PM9A 4DR1O 5CA0B 2QKSA 3SEEA 3JD4A 3ZYFA 1ZL8B 1R6KA 1VBB2 3N7JA 3U1XA 4J1XA 4IV3A 1ST8A 3AZXA 1H30A 3FB7C 2QKCA 1FS0G 5FZ6A 3I2KA 5A7QA 3W9AA 2QDRA 3LGRA 4MYEA 1SLAA 1Y3TA 2WZEA 2QQUA 2D44A 2RV9A 2WLHA 3HKDA 3IDEA 1PGL1 1XSQA 2OCHA 4LFBO 5J98B 3PN1A 4HK8A 4YW4A 2B8MA 3TN91 1V6OA 4HNAB 3W20A 1S4CA 2OT5A 2VH9A 1N36B 3AJYA 4TV8B 1M90W 4XHXA 2DTWA 4IEWA 4J42A 5FZ9A 1AR5A 3STLC 3KKYA 3VHPA 2E31A 4ZHQA 4X1YA 3J8F1 1WA8A 3B3QE 2YU2A 3CNAA 3AG2C 2EZOA 2ZQMA 3JBG3 3ZYBA 3AG3B 2PA7A 3G6JB 2XHBA 4HL0A 4DRRA 1FMD1 4W6YA 4NIAA 4GLXA 1B06A 1H38A 4LF5B 1CESA 4NR1A 4ES8A 5FMOS 2KKWA 2EIMB 3I2GA 4Z07A 1HRV3 4Y20B 3A8TA 4F6EA 1W8UA 4UB6Z 1UXZA 3D3QA 1W99A 1W3XA 4GZ9A 2AW9A 1SLLA 5IYBO 2Q1ZB 1UIKA 3ORJA 5LASA 2UY9A 1NTMH 1FJGB 4RS5B 1GOFA 2KB1A 4SLIA 2RVAA 1M1KW 5C9AC 2DFBA 2RR12 4RHV1 3JXSA 4YFWA 1QJY2 4KWJA 4NHKA 4O9EA 4AVVA 4M3CE 1VE0A 4GX1A 2R30A 2RM21 1OJHA 2UWBA 2CGOA 4YGCA 1SZXA 4XZPA 5HFMA 1KGYA 5SV8A 4DV7B 2AGAA 1AR1B 1AXKA 5F2VO 5FPXA 5FZMA 4I2OA 4IERA 1QH7A 2YS8A 2ENRA 1BL8A 3ZN6A 2R7EB 4F7ZA 3B94A 1AI6A 5C4WA 4UFIA 5A7PA 2KQXA 1VF5B 4EZHA 4LWSB 1VF6A 3VBBA 2BTQA 1W8FA 1J95A 4OVEA 3M70A 4I50A 1N33O 4B08A 2UWAA 3GBFA 5JIAA 3VDBA 1MS1A 2VNGA 1OUXA 3ZOIA 4WM7B 4EN0A 3HKCA 1MEC2 2BQPA 3THDA 1AR91 5K1XA 2WPDG 4P9XA 4CDUB 5FJHA 4LXLA 5B2GB 2XL7A 4AI9A 3VQXA 2ZCWA 3ZRWB 4HXCA 4K40A 1AX2A 5HXVA 1N0JA 1DF5A 2HEWF 4OI1A 1QR8A 1HWYA 4X20A 2P5OA 1VQMV 4FLWA 1H8TC 3DKWA 2P90A 5C33A 1IQAA 5JOYA 1BMFG 2RJ2A 3FE5A 3PIJA 2O14A 3S57A 3LA7A 3MAQA 4D7TA 2GAUA 2WNUB 2ZEYA 4Y20A 4AQ2A 4WFGA 1WW4A 5FYBA 1EY2A 4LLFA 2XH6A 3I2DA 1GQPA 5C8YA 2QQWA 5CA1A 2XLGA 1IG3A 4D8MA 4WVMA 5I8YA 5F5AA 2PHWA 3WP3A 4URTA 3WG1A 4JYCA 5LA0A 2VW1A 3VHNA 3H1KH 3B40A 5FMDA 1RHI3 1SKVA 3VD3A 1IS4A 4TUYA 3ZMOA 5FK7A 5BV6A 1F2NA 3SPCA 1OCOC 4LKSA 4IXLA 1ENVA 3TOJA 5T55A 2VULA 1REEA 4FLYA 1QNWA 3C3TA 2IBZH 1PGW2 2BW8A 4H14A 5IWAO 1DZRA 3SYOA 4LQRA 3CF6E 4X66O 2WZ8A 2FDGA 3CCRV 2XTAA 4GKYA 2RR11 4RHV2 4PDRA 4JF3A 4W4LA 1JJOA 1IBMB 4DUYO 2A06H 5APAA 4LNUA 3WG4A 1VBE3 3IGAC 1O6UA 4ZHQB 1RUF2 2P7TC 4EB6B 3VKFC 4HANA 4WM8B 4TV9B 5GW7A 5JWPA 1E5IA 1X9TA 3OUJA 3LPFA 1GFF2 5FYHA 3ABLC 2YB7A 2XJSA 2ODMA 4RQPB 3HJRA 4OCTA 4OQ8A 5JXJA 1W05A 2B1IA 4COWA 1SPPB 1C8M1 3ASOC 1GQHA 5JVDB 1ENRA 4M4PA 3RZGA 4EN7B 2AEZA 2V09A 3JAMN 1AI4A 4X1YB 1W2BU 5HCAA 3UKNA 3K3WA 1CAXB 5EPAA 1K5MA 1O4ZA 2R1DA 5C9AA 4JTNA 4QD2A 1CX1A 2XWBB 4CC5A 3APOA 3BABA 3ZSJA 2MEV2 4DINB 2JS3A 5FMBA 1M57B 4HSLA 3ZMUA 4FAHA 2YC2A 5FBZA 1F4MA 1MVQA 2V5DA 3ES1A 5DN6G 3AP9A 3OEHG 4YW3A 4N53A 2NP0A 4DFSA 3IDBB 1PZ7A 2XPJA 1MVEA 4FM1A 5C3RA 4JHTA 3N2KB 1DZQA 3OBZA 3FZ3A 2ZMNA 5J48A 3RZMA 1OC1A 4ASUG 1N3QA 1VQKV 1H2GA 4KNCA 1YI7A 3WW1A 4JAUA 2AENA 1WB7A 4IV3C 2B4KA 2PHFA 1KDMA 5B1NA 2JB8A 5L7OA 3GGLA 3FKSG 3BOPA 3AMMA 3GJBA 3SH5A 3U75A 4YZ2A 5CU1A 3NV4A 1G9CA 1QJFA 1H8HG 4F6RA 4JZGA 4AVAA 2PHXA 1H8EG 3ZLIA 4IE7A 1GUIA 1DYOA 1FXZA 3VDDB 4CP0A 3OEBA 3LDDA 4EN6B 3QVNA 4FPKA 2ZX4A 1NQTA 3OB8A 2XQXA 3HAGA 4UCUA 4EWAA 4QXHA 1M4UA 2PHLA 1NZIA 2BERA 3HKBB 3C7GA 3I56V 5C70A 4Y22A 1B04A 2BTQB 5J1XA 5IT9N 2Y0PA 3BVOA 4AHZA 4AQYO 4AHYA 4PQ9A 1F7YA 3B5LB 1RUF3 2C26A 4OFGA 2ETEA 1HDJA 3CL1A 4OGQB 1A8MA 1VRH1 5LBEA 3I3BA 3SDLA 5FCCA 1K5SA 2Y6HA 1JZ4A 5IK8A 3LDCA 4JQRA 4ASKA 4W65A 4BQ1A 4XUTA 3AVSA 2RS12 3CE2A 2GDFA 3E5XA 2WS92 1P8JA 2WNUA 1RUG2 5CB4B 3B09A 1UOFA 2C9KA 2F4VO 3LSQA 5JQGA 1OCOB 3JD0A 2EIGA 4NVPA 2RDRA 2V4DA 4LORA 4MS2A 4LF8O 4FPCA 3VBHA 3JALA 4MADA 2B7YA 1Y76B 2OT7A 4P9LA 2KG7B 4DO2A 1HB3A 3AKRA 4GULA 4U7OA 1CAVA 4UVAA 4OHVA 1OVSA 1YHFA 3OF1A 1HRV1 3Q8AA 2VW0A 4R8CA 1EPZA 1OLMA 4DK0A 1TAEA 1UYZA 2HWD3 3B69A 5I0TA 2NR5A 3VBUB 2ZGRA 2YI8A 3A21A 2JGUA 4DY5A 3GCWA 3W7WA 5IYDO 4DRXA 1AVBA 5C3SA 4MVOA 1XILA 4MSVA 5DN2A 3S30A 4Z1MG 2JS5A 2ZIOA 4I0AA 1L7LA 3UT5B 4CDWC 5DQ0A 3ZXKA 4O4LA 5GALA 3LWCA 1XPWA 4META 2ZGUA 2XLAA 1SLCA 5AC93 1V6JA 4JV4A 5CG8A 4XEZA 3H7JA 4CH4A 4DEVA 3ZYRA 4N43B 3KV9A 2F17A 1MA1A 3PUAA 1F15A 5FZ8A 3JD3A 3CQOA 1PMJX 4YZ5A 2XBO2 4HBNA 5B3SB 1AR72 4H55A 3VBOA 4X1KB 1UOGA 1ZBE2 2W2IA 3TJTA 2ADPA 3K57A 1RSOB 4CS4A 3JAKB 5GONA 3HVDA 1N1VA 4LF6O 5F9TA 1OCRB 3VV1A 4ISQA 1Q43A 4QPGC 3OG2A 4HLTA 2WNEA 1JHNA 1Y4MA 3ABLB 4LE3A 5GLWA 2Q7GA 4DV1O 1UYPA 1W3VA 1KQSU 1WLWA 2V73A 2PXJA 2VM9A 3VL8A 4ASMB 1GR3A 3P32A 2F4LA 4ZOLA 5FZOB 3A0NA 2W87A 3LA3A 1QQP2 1VQLV 1K12A 4CUGA 5LBCA 1AYN3 5EFUA 3NJVA 4W4ZA 3RNSA 2W52A 3B4SA 1J84A 5J2UB 5FUPA 5IFPA 3Q8FA 5A7WA 2WLKA 4JYAO 2ATFA 2RNBA 2VD7A 4AQTA 1ND3B 4WFAV 5E79Z 2QCSB 3N3HA 4GKKB 4LE4A 4XFAA 4AVSA 2W1QA 1QHDA 1EPWA 1NKGA 3I2IA 4L11A 3S5QA 1VQNV 2YSUB 3ASNC 2HHHB 1QJX3 4JC1A 2JDYA 1OOPC 4N7UA 2JJ2G 1LAJA 3BEHA 1GZ9A 1R081 2RM22 1QXJA 2D3SA 5JSPA 1M9NA 4JI8B 3ECQA 4CEWA 3PL0A 3K9SA 4PCRA 1SFPA 3OMAB 5LYJB 2QNKA 1C8NA 1LENA 3K77A 4CCEA 3AG7A 4JZRA 5FFOC 2VMCA 1YUDA 1J1LA 1HR0B 1RL3A 5BXXA 4FQ4A 4CVUA 1SCRA 4PDWC 2BOCC 1DQ2A 4BH9A 3E86A 1J3QA 1OFNA 3AZVA 4Z8BA 4YY3O 2BVVA 1XU2A 3CCEV 1LHUA 4E4HA 4MX3A 1GV9A 1EBOA 2R063 4P9YA 4DR7B 1DQ0A 1YFXA 3ELNA 1BCCH 4OPAA 1BQPA 3FC0A 3B00A 2FTKA 1AF9A 4BXSV 3ZDSA 4QB1A 3MF9A 3SCGA 5H5NA 1R082 5DAVA 4XDLA 3QO5A 4CDWA 1AL22 1XNKA 1OOPA 3POSA 1WW7A 2OQ6A 1WPXA 4PI2A 1GWMA 4CDQC 3BPSA 4Q20A 1HNWB 5FDBA 4YJ3B 1ULGA 2HVJC 4UF0A 5LP6C 4XETA 4JI4O 2W5FA 1OURA 2GNDA 4IQPA 3N27A 5ISLA 5FYMA 4MOAA 2OIGA 1C1FA 1R1ZA 3P6BA 2HR3A 1TMF3 2JKBA 3VBHB 3AL5A 5CFDA 4N9HA 1EFRG 3E6BA 5FP8A 3ON7A 1UMZA 4CCDA 2QJ1A 3CHXA 1JA8A 1AXZA 1C5IA 1VQ9V 3BUCA 2BOIA 3ZX7A 2DWEC 5DECA 4BOWA 1RUC3 1V9U3 4ASLA 4Q4X3 2MK3A 3B8NA 4P9IA 4CP9A 3SH4A 3IMMA 1TUBA 1KMIZ 2B5UA 4S2DA 1P49A 2YBPA 1O9HA 2JDUA 4Y4RA 3AP6A 2EIEA 1YCIA 4Z2WA 3OGCC 1BKZA 1K5MB 4OZXA 1W8NA 1N0NA 5CKMA 2XAJA 4J10A 4KWKA 3UYJA 5BNPB 5KXDA 1DP0A 3G7DA 3PURA 2EJ7A 4UCSA 1K34A 3BI3A 4GWIA 3KV6A 3MPBA 4P9PA 2VECA 3MHZA 3PHMA 1RUD2 2YU1A 2J1EA 2DU0A 4YZ4A 5BNNB 1D2QA 2H3OA 4PD4F 3KT7A 1WAZA 3T1LA 3ZSLA 2ZKLA 5LA2A 2YYOA 1DGWA 1ZZ9A 4RUFA 1IZ3A 2F93B 2ARBA 2CNAA 1M5IA 3THPA 5EQUA 2P17A 5LA1A 4AE2A 4EFBA 1ODNA 3MUZ1 1O5UA 1LOFA 1WKYA 4WZFA 4QT6A 1URXA 4AI2A 4FPLA 2KSDA 2Z5WA 1H8TB 1C8M2 2VQ0A 1BEV1 3MW3A 3VZMA 1E5HA 4TLFA 4TYSA 1RMU2 1X59A 1BBT2 3TAYA 1QVFU 4JI2O 2HEVF 3JAWB 5HCHA 1XYPA 2QQIA 1WLCA 2CUGA 3HKBA 3ZJZA 2LO1A 1CIYA 2ZGTA 3OSDA 3ZHQA 1MPXA 1FD9A 4EWEA 1HRI1 1BVVA 1LOBA 1HQLA 2EILC 2PFWA 1W6NA 4YPJA 2ZE6A 4PI0A 2Y64A 2OTLV 3JD1A 2EIKC 5LYJA 4LO4B 4JDMA 2QQPA 4NXMO 2R9AA 3F5TA 4NHYA 1RM1B 2Y34A 4RGKA 3AZYA 2J1RA 3IN9A 1WMDA 1WCUA 5KXBA 4NUBA 5J9PC 1I0HA 5A9GA 3AFKA 5BNPA 2F6BA 4BQ3A 5CADA 4H37A 5JPMB 4XDPA 4Q0VA 3SCFA 1MS8A 3I3MA 1J3PA 3LNNA 4IUGA 2QFEA 1VQ4V 2E5LB 2P3KA 1REFA 2DYSC 1YZBA 2ZDIC 4LF6B 5CIRA 3ACGA 4JGYC 5AG2A 1K4CC 2RQ6A 2ZGLA 3ABMC 4UB8Z 1ZWIC 1ZBA1 1I5XA 2QQMA 2ES3A 2VOTA 3VKMA 2DVDA 4B3RB 1QEXA 2B46X 3VBFA 3POEA 1U0AA 1RPRA 2XUEA 3SHRA 2A1XA 2FCUA 2VGDA 3WW2A 4AVCA 4LH7A 3GHNA 3ZMZA 1JU4A 3ZXDA 4CH3A 5BY1A 4RQPC 3ZN1A 4RO2A 4RQFA 1JZ3A 4JDNA 5I8TA 1HQNA 3W21A 4HYOA 2ZT9B 2N74A 2VUJA 4DV0B 2KA3A 3FUQA 4TWTA 3BA8A 2YC4A 5M0TA 2Y4UA 4Q2FA 4V2WA 2QTWB 4L87A 2W1WA 1ZYBA 1SQFA 1TZOA 4C7UA 3ZIAG 1AYM3 3H8UA 3KT1A 4UYBA 5I0UA 3UESA 3PVOA 5TSWA 4GKJO 4W4KA 5A7SA 2X09A 4ATEA 1PKXA 2R9RB 5KXCA 3A22A 4KQ7A 5L9BA 5IVCA 1Q8SA 2JENA 1KU9A 4DV3O 5AC91 3V0BA 5F3IA 1RTVA 4H13B 1DQ6A 3V56A 4AFMA 4Z82A 3KZ4C 5L73A 1LHOA 4MGKE 1VPHA 3AKTA 2ET7A 4F6RB 3LA2A 5FYVA 3IZOA 4OHXA 4JKMA 3RMXA 3ZRWA 3T2QA 3VDCA 1R73A 1Z2GA 4DR6B 4JI4B 3L2YA 4DZGA 2DCZA 1XNTA 1HJGA 4XURA 1DGRA 1OA4A 1WCDJ 3O9OA 2F95B 3W5MA 2G1MA 1QOSA 1CP9A 4Y1VA 4Q8KA 4GWMA 5EWSA 5LRRA 4WVMB 1YQCA 1ASJ1 4K1ZA 2EBOA 4WFEA 3OOXA 2VJXA 1YTFB 4YVSA 1TUEB 1K97A 3GVMA 5KUMA 3WNXA 5DUUA 1QLEC 3ZCCA 2W08A 4IE5A 5CFCC 3K04A 1FMD2 3T0BA 5L9VA 2P4KA 1R1A3 2D6NA 3AX4A 2DFCA 3QG5A 4XABA 3M3IA 1ND2A 2GMPA 4OI4A 1O7FA 2JG8A 5HI0A 1OLRA 1QXPA 4YVWC 2G9FA 1AR63 2BEOA 1W6QB 1OF4A 1B35A 2HYXA 3UV9A 4I4TB 2K9PA 4RFRB 1TMF2 2C2AA 1WP8A 3OGGA 1CAVB 3IAQA 3H50A 5DUVA 2AHZA 3RN4A 4KHPO 1VB2A 4KP4A 5KMGB 3LD8A 1ZSPA 2R0FA 2JDMA 3I3EA 1DQ5A 2G9ZA 1YQ2A 1RUC2 1RXGA 2OQ7A 4B4RA 3I59A 1GNZA 2ZACA 2WSUA 5H9CA 1DF0A 4WM8A 1KRIA 1VALA 4IV1A 2QE3A 2RMU3 4XYXA 3AZZA 3L72H 3ZN5A 5LGTA 2EINC 1DYPA 4XF4A 1W6NB 2D3PA 1IBLB 2DUOA 2O8QA 1Q6UA 1PVXA 4LA2A 2P3YA 2TUNA 4ABMA 2MEV3 5A3LA 1L3JA 3NWKA 1RC6A 4AXOA 5FNVA 1IKPA 4CDUC 3CS5A 3SISA 4GX5A 3ACHA 3I4IA 3VBOC 3SGIA 4FPFA 2OZ6A 3KVAA 3O1UA 1QQP1 3C8XA 4QX5A 2HWE3 2GSYA 2VZ1A 4M3CA 2D5FA 4DY3A 5L7OC 3VN4A 3VZNA 3RWNA 4PLNA 2HP8A 2HKXA 5LBFA 4EN8B 4DR6O 5FXVA 4FPPA 4OHYA 1NX9A 1UXXX 3N4MA 2EIJB 1QU0A 3VKNA 3SJAC 2HJDA 2ZMLA 4A2UA 2O8OA 5JZGB 1K8AW 2DYCA 5DEDA 2I07B 4E4DX 1M56C 4NE9A 2WNOA 1HN0A 1FAFA 5JCOA 1V54B 1JODA 3RYPA 1HW7A 1QNMA 1OCZB 2RMKB 1RIRA 4ZY9A 1P7BA 4COZA 4AHCA 5EBWC 2JGDB 5BR8B 3GM8A 1O59A 3PTRB 1UF2C 3HKEB 2CDPA 4DR2O 4NPMA 1FFTB 3MICA 3RVYA 3LE0A 3OGVA 3T3YA 1O3SA 3LIHA 5EYPA 4C91A 4P02B 4Q1PA 5E89A 5HBAA 2DCYA 1OA2A 4DUWA 3DPRC 2FB5A 4CCMA 5JI7A 5J7MA 4UW6A 1JOYA 4P9OA 1AR73 1I9RA 3KF3A 2IFWA 2WWJA 4YWAA 4ZU4A 3CPWU 1PMIA 2D6MA 2N04A 4MTFA 1VBD2 1XNQO 3POJA 4NYKA 2DF7A 2ZPXA 1RUJ3 1PNMA 2D6OX 4YW2A 1YLLA 1W6OB 3ZYJB 4JTAB 5T52A 4PDMA 1GQGA 3WZ1A 4LF8B 3OGIB 3AG4B 5EJZB 1HNZO 4AI3A 5GLVA 2JG8C 4LIUA 2XAQA 2L9LA 1ZUQA 2X5IB 5DMYA 1NXD1 3T0AA 4BCUA 2ARHA 3AMQA 4NIIA 3CMGA 1WA4A 1V9U1 4R4XA 3GWKC 1CWPA 4PV1B 5LA6B 1NH2D 3O1VA 2JE8A 3IAYA 1SETA 1M56B 4DUZB 3FFZA 4GA9A 5GLTA 2GP3A 1W2TA 2JICA 5K1PA 5E6HA 4S2GA 2OKXA 4AEMA 2D43A 3WD5A 3KCYA 3SPGA 1KB9F 2BWCA 4AILC 1Z5VA 1K7DA 4J1WA 2KG7A 1OD5A 1IURA 4AAXA 3J4UH 1DTOA 2QA4V 3KS7A 1AX0A 2WN3A 4O2BB 2DVGA 1SMVA 2YZ4A 3E5QA 3VDDC 3CB2A 2OIIA 3EXAA 1CD3G 1S0BA 4BQ2A 2RS11 3NKTA 4I09A 2RDQA 4BQXA 2HH9A 4FLVA 2JG9A 2E7TA 3BALA 1CAUB 3N9PA 1VQPV 1LGBA 4E2QA 3CC4V 3I2FA 3PJYA 4Y1YA 1B35B 1PNKA 2DURA 3IC9A 3SITA 1B09A 2DVFA 2ZGMA 1RMU3 2DTYA 3ZN0A 2ARAA 4U7NA 2WZPP 4HVRA 1UJWB 2P4EA 4AGVA 1D4M1 2VRZA 3X2QC 5FYTA 4QPIB 4X1IA 2Q5ZA 5K7PA 1MMMA 4JQTA 5ERLA 1L0NH 3U07A 4XBQA 4OLLA 1V6MA 4AEKA 3GALA 2VW2A 5FPZA 4YLZA 3UO2A 4RSUA 3D0SA 2WFF2 2VNOA 5DDJ1 3MW2A 3C3VA 3ZFEA 4Q6GA 4Q4V3 1F5FA 5H9QA 4NOTA 2E75B 4Z2AA 5FNVB 4JRLA 4DB5A 1MQTB 1SESA 4H7LA 3MO4A 4IV1C 1YSCA 2VBPA 4QPKA 2F4VB 2VBBA 1K33A 1J58A 2BOJA 1XL6A 3SKVA 4IEVA 5KAFZ 5JOZA 4PIXA 4EYUA 3M7MX 1O3QA 4LPLA 1COV1 1ORQC 2YXYA 5DDJ3 2LQTA 1NQDA 1OUSA 3R0RA 4M3CB 2XJTA 4IHJB 4MXVA 2RDSA 5AVAA 4FOQA 4YFZA 1NZCA 3MHHC 4R9DA 2K2SA 2CTWA 3O5SA 3J9SA 1IBLO 3L9DA 4Q0UA 3UL2A 3PU3A 5IATA 3MW4A 1Q8QA 1VF6C 3POIA 1S0FA 5SV5A 3ZSEA 4FFBA 4N8MA 5B66Z 4P00B 4XJ8A 3U10A 2RN9A 4I0XB 4MTOA 2QQVA 2PLV1 1R1A1 5LEKA 1YDXA 1U96A 4I3PA 4R4ZA 5JZGA 1A6CA 4DW1A 3CLPA 4QMAA 4RS5C 2ZKOA 5FPAA 2DQ0A 1N32B 2B1GA 1SLIA 1JJ2U 1HV1A 2F23A 1V00A 1D2DA 4XIKA 1OQEA 5JOWA 1R3LC 3OY8B 3E2EA 4FZ1A 1FXVA 1XNAA 2QJVA 5ANQA 4B3NA 4JGSA 5L3DA 1MG1A 3ZN6B 1SHWB 5AFEA 1V0AA 2BCCH 1HN1A 2HWC1 1W9YA 5DAQA 4LBEC 3K4ZA 4XJWA 1QDOA 4AGGA 4FZ0A 5A3TA 2DUQA 2V4AA 2WAAA 3S7IA 4N90A 2OUJA 1XRUA 3BKZA 4CPBD 1LOCA 5KHJA 2A3XA 3AMHA 1JOJA 4FQZA 4H3WA 4E2GA 1EV12 5IK5A 3DV8A 1AJQA 4OMDA 4AEDB 4CDWB 1QBZA 4JHZA 4QM9A 2QWNB 1G9BA 1I5PA 4XBFA 4WFFA 4YHHO 1MACA 2VCCA 3AYCA 3WG7B 5ABJB 3RYHB 3ZFGB 4L0PA 4CDXA 4YSFA 1COV2 1WLTA 2YIAA 4FPOB 4BIOA 2NMNA 3WF0A 1H6XA 2XKOA 3FMGA 1LOEA 1IPKA 3NQHA 3LZZA 2XMLA 1APNA 1ZX5A 3K9AA 4CP2A 1RUI3 4QE9A 3ZX6A 3KQRA 4LO5B 5BMVA 4COVA 3CMAV 1W6QA 2GN7A 5ANNA 4JI5B 1JHJA 3FD9A 4NXNO 1BVP1 5A2QN 3LAGA 1X7NA 5FY0A 3PUQA 5FLHA 5F37A 5KMGA 3K79A 1A8DA 2P5BA 2RJLA 3BOWA 2D3RA 3JARA 3MIGA 2Q4PA 2ZMKA 4CC6A 1WCKA 4DV4O 1CAUA 4ZKTB 1NI8A 4LKFA 1FPN2 4FFKA 5BZBA 2W6IG 4DV3B 4PF5A 2LW7A 5BY5A 2WNVA 2NZ9A 2MPFA 2GNTA 3SLIA 2Y38A 3LB9A 1S0VA 1UPGA 3LDBA 5KA6A 5EBMC 2XWJB 2YGMA 3KGZA 2P6JA 3QLQA 4WZCA 3N7KA 3I55V 2CH7B 5CG9A 1QJZA 3SYPA 1U5IA 3PU8A 5EK0A 3ATGA 3FX7A 3GZEA 2ILMA 3TETA 1JN2P 1DYKA 4CCKA 4DQAA 4UAPA 4XTMA 4XJAA 1D7PM 1W2UA 3DXUA 4G2KA 4PJ0Z 2YUAA 4ZZ8A 2QZ2A 1OZ0A 1FJGO 3I2OA 3F7YC 3E22B 2XOMA 2XJRA 4YM2A 4NAMA 4A7KA 1M06G 2IXJA 5GKAC 2ZINA 3OMIB 4B3RO 4TLGA 1OCCB 4M0HA 3VKOA 1PL4A 1IXBA 3D36A 3AG1B 2QKDA 4M3CF 1IOAA 4AHWA 4LIVA 1ROPA 2ZIMA 4ZIBA 2PLV2 4FM0A 1H9PA 3S6PA 2ZE5A 3TCUA 1ACCA 1HB1A 2EXHA 5CYYA 1L7QA 5EZWA 3AKPA 1X82A 5LY1A 4UXNA 3K48A 1UIJA 4XOGA 2RMU1 2R1BA 1ASJ2 1OT5A 2DDUA 4QXBA 2PYJA 3WQ0A 1ZM1A 5FQ0A 1JS9A 5FXZA 4CU6A 5JAXA 1QQP3 1TVGA 1RPOA 5F8PA 2O57A 2QM4A 1WN7A 4D94A 2D3OW 4W50A 5FY1A 3P3NA 1Q81W 3O1MA 3AK3A 1IS5A 2BNMA 3WDXA 1RUE3 4JI8O 3JYCA 1IG0A 4FOVA 4GMP1 1W39A 3JB4C 3WR0A 1PD3A 4UI9L 4XC9A 1NCRC 1NXMA 2ZHLA 3OEEG 5CA0A 1LUWA 4MZUA 1AXYA 3E8FA 4IDZA 1Y66A 1SA0B 5KC6A 5IYCO 4HOOA 4A5UB 2ZE7A 2A3WA 4HPKB 5LZ6A 2DJVA 3W7UA 3OD0A 4TSVA 5AFBA 1K4DC 5IAXA 2PAEA 1EN6A 4AQ6A 4FT8A 1LJ7A 1IPSA 2PELA 1VBA2 1BK0A 1W59A 2X10A 4JPRA 4AOCA 3E8BA 5AC92 3E1F1 4LT5A 4HZ3A 4N9IA 4QGNA 4BMBA 5A6ZA 3OAAG 3STZC 4HETA 1GTOA 1WMFA 3N9QA 2BU9A 2R9IA 3SC7X 3NNLA 2CHHA 2VTXA 4JI1B 5FOJB 2B39A 2W46A 4MHUA 5FTTC 3WP5A 4X6QB 4K8RB 4R50A 1FV2A 3MEPA 3RPQA 2FYUH 1GZTA 4D7YA 1B3QA 3KVBA 5BNPC 4E8DA 3UKTA 2W94A 1R3JC 3WQ7A 1OPMA 5A6XA 1WA8B 1PIV3 4QPYA 1Q6IA 3W58A 1Q8IA 3ZFGA 2Q8CA 3B01A 3CC2V 4J80A 2JG9C 3V0AA 1W28A 2Q7HA 1RUC1 1AJPA 2E7QA 4GALA 1FPOA 1DIWA 5JMCA 1G9AA 1H2NA 2X29A 4ICGA 3WVJA 3CZJA 2D2CB 5K9YA 2LM3A 2CDYA 1O91A 2VO5A 1ZRFA 1K3EA 2HFEC 3RMYA 1HX6A 4YVSC 3BPZA 3WDUA 2AREA 3S5AA 3AYEA 1US3A 3KF5A 4XDJA 1SEFA 4J7KA 5GZGA 2C24A 1L1FA 2HBTA 4YG3A 1UU4A 5ACA2 2OW4A 5A7NA 1YC61 1JOPA 3AK1A 1UW8A 5FZCA 1WNSA 3WXPA 3K3OA 5CEHA 5FO7B 1X8MA 4LF9B 2PLV3 1GMMA 3SNMA 2B42B 2WZR2 1LUVA 2FDJA 4DR5O 4BAYA 5I0DA 1ZRRA 1JZ7A 4I5SA 4RQEA 3M3EA 1YHQV 4OULA 3QO8A 1BCXA 4CZSA 1RXFA 2DE0X 4KG0A 2JK5C 2XAFA 4CSWA 4KH9A 1DLCA 3UGHA 2VZUA 1VRBA 2HLDG 1Y74B 1OA3A 3HOBA 2GHYA 3VQWA 5IJRA 5B3SC 4IGQA 3SCHA 1YJLA 1DDLA 4JTCB 2JDNA 2VZQA 1XJAA 5FJKA 4GB33 3W59A 3CCVV 1OKOA 5J2TB 1PL0A 1U5ZA 3I5DA 1E5SA 2ZM6B 4ET7A 4HVQA 5JR2A 1RMU1 2ZZQA 3BU0A 3ABKC 1LOGA 2WRAA 4P9GA 4HN1A 4JRAA 1R6NA 1SBFA 1XMQO 5B4XA 2Z79A 2X6AA 4X62O 2HKOA 4OQ9A 3BODA 1R6TA 1Q7YW 1R083 4P9JA 4GMP3 3T4ZA 2PQQA 5DZFA 4GJZA 1AL23 3CBNA 4E4SA 3SEPA 3WB0A 5HFLA 3JCZA 3W7SA 3VZJA 3AG4C 1W8ZA 4UVBA 1MZFA 2A6YA 5ITZB 3DECA 2I45A 2ATKC 4QM8A 4ZI7B 3CJIA 1JH5A 4XXPA 5LY2A 2ZHNA 1EAH3 1RITA 1YJNV 1OSGA 4OUSA 1P7GA 1UZ0A 3ZXEA 1ONAA 3UO3A 3H9AA 3EYPA 4OHZA 4U3JB 4LBQA 5DAPA 2UXXA 1WPBA 4K9SA 3K0GA 4KBZA 4PELA 4I4TA 4LHNA 2UU9B 4JGZA 2DQ3A 2VUCA 4JV5O 2LTNA 5F1RA 5DM6V 2HYKA 5A7WB 5EYYA 1H2SB 1NAEA 3BRCA 5LHHA 4TUYB 5A3OA 3V65A 4OMCA 1OBNA 1VBA1 4LF7B 4XXAA 1FT9A 2X8KA 2IH1C 4DV7O 4IV1B 2R072 2R043 1H2MA 1AJNA 1F4AA 1Z7S2 5EV7A 5F6KA 3FAVB 1PK6C 5DZGA 4QKDA 3I49A 3ABKB 4EFEA 2WINB 4LOTA 4LOSA 2UUAO 2QZ3A 2ZGNA 1LEMA 3CU7A 4QGMA 3ZFFA 4FPJA 4QPIA 4BR6A 5EHDA 4XBLA 2A6VA 2J7MA 4IIJB 1NBMG 3EHBB 4JI6O 1NT0A 4B3TB 4V1PA 2XT9A 1KBHA 1NTKH 1UKRA 3NXSA 3VL9A 4RGAA 3ZRVA 2X6CA 5JPNB 1AYN2 1Q8OA 3OD4A 4COYA 1YEWA 3A0KA 3VBHC 1LHNA 2PTMA 1S0GA 3APBA 1ENSA 1ZX3A 1KUQA 1J1TA 3RT3C 2ZS6B 2ZBJA 4IGGA 4Y24A 1PX4A 4K8ZA 4XFIA 1HV0A 3AP4A 3DKQA 3JASA 1NKDA 4BIZA 2QSAA 3RYCA 1LNQA 1SPPA 4JI3O 3A7QA 2R32A 3U14A 2R49A 1SBDA 3T1HO 4Q4W1 1WBLA 3LDRA 1UPSA 3ETQA 1PX3A 3HR9A 2DYRC 3O7OA 5BPXA 1TG7A 4RGGA 2AR6A 2VG9A 3RSJA 2OCCB 4XMIA 3M3QA 2FCTA 1JYIA 4RR3A 3LUTB 1YQ5A 3DTUB 1MS0A 4HZFA 4Y1ZA 1UOBA 1BXHA 2XG3A 4BHPA 2R16A 3K4DA 5FPLA 1VBE2 4G28B 3ZXLA 3BTAA 2WT1A 4PA6A 4GZRB 3ZR5A 1STMA 5G05L 1JCHA 1PZ9A 1K42A 1NY72 1THZA 1GKFA 4LF7O 1JMUB 4DR3B 3I2HA 2A73B 1XYNA 2VMGA 1UMHA 3MF6A 2A9HA 5DG1A 2Z3YA 5G04L 5FP7A 5CKQA 1QU7A 2EXKA 1GO3F 3MIHA 3DSQA 3E8HA 5LHIA 4G27B 4YVWB 4QKNA 1QJU3 4F8AA 4CCJA 1F5JA 3JD73 4FTEA 2D6PA 2P06A 5KUKA 1SFYA 2FDFA 2FKXA 3J8F2 1MZEA 4DV5B 1PO13 3LKJA 4XUOA 2ZE8A 3O65A 2D6LX 5JUVA 2FCVA 4I9QA 1Q8PA 2X5IA 4Y22B 5D21A 5F2SA 1C5HA 3T0DA 4QX7A 3ST7A 2W1SA 2UXBB 2WO2A 2YI9A 4LHSA 3FYEB 4WM8C 4E27A 1EN4A 4HNAA 3E89A 4EWDA 4PDWB 1RB8G 1V6NA 4TXWA 2J42A 4N7IA 2K9ZA 1QF3A 1UQXA 1TVKA 1NCQC 4FK5C 2JKXA 4FO9A 3H1WA 3THCA 3DUIA 4OHWA 3PUHA 4DR4B 5T5JA 2WWSA 1Z7S3 1PK6A 2HWB2 3JATB 1NCRB 3RYIA 2CL2A 4ZPIA 4JAVA 2Y69C 4WBBA 3ZO0B 2GP5A 4XUNA 2RS13 4YW6A 1W2NA 4HN0A 3H8RA 3AKQA 4LBMA 5BNNC 1DF4A 1QOTA 1N1SA 2QUOA 4A41A 1X36A 3K46A 3HN3A 2E9QA 1S3JA 2XHNA 3MZHA 4IEPA 1LCLA 2EULA 4NO4A 5A33B 2PAKA 4MGTA 2L35A 1KJRA 5F5QA 1I94B 4OI0A 1JYCA 3MYXA 3LNMB 1UZYA 2V7QG 3NR7A 5A32B 2H94A 2X5IC 4AFCA 4U3JA 4LBQB 2VOKA 4K0KB 3HNYM 1WMEA 2MNGA 4GH4A 3OBRA 3T08A 5KX5B 2Z5UA 2JDIG 4BQWA 1PVC2 1PMHX 3NSTA 2F1MA 3RJRA 1RUD3 1V54C 1UY4A 4CCNA 4DUXA 1MS4A 1D0GA 1UFIA 3ZMSA 1GNHA 1MQTA 3BIWE 1V55B 2GH2A 3JQWA 2UXNA 4L8QA 2Y4TA 5F3GA 3G80A 2YROA 4M01A 2UYAA 1SQQH 2VZ3A 3AG2B 3GB7C 1LTEA 2RS31 2CH7A 3H0OA 3LOIA 2P34A 3A0BZ 3CD6V 2D97A 4X8NA 2I2SA 5C4WB 4XAEA 4DV6O 3ZHSA 3WEZA 4IE4A 4DR4O 1BT8A 4YW5A 5C8WA 1SCSA 4IEUA 1TNFA 3ZRSA 3O1RA 1UCXA 1QH6A 1B35C 3QO7A 1N3OA 1S1AA 3POYA 3CXCU 4LK6A 3ZR6A 1CJPA 4J9ZB 1MR5A 1HXS2 4DIQA 1OH3A 1H6YA 2Q30A 2VZSA 3JAKA 1C1LA 4YG0A 4INDA 4JZ2A 3TK1A 4AVTA 2NLJC 2Z2SB 2ET1A 3BN6A 3B2EE 3VGIA 1J59A 4X20B 5FMCA 1ZA4A 4ATFA 4MO3M 1BEV2 2VXJA 1XI1A 2QQLA 3U11A 1BLZA 3IKWA 1XL4A 4MVTA 5GONB 2YG0A 5F32A 1ZZ8A 2RDNA 2Q0AA 3BHPA 1KD7A 4FPGA 4QB2A 4Q26A 4X89A 5FZIA 3ZFEC 5FUIA 4XDKA 3MLKA 5IWAB 3H8XA 2Z42A 3HIFA 3FYIB 2A6XA 3ZHVA 2P3JA 1FXKC 4HONA 4IT5A 3A2FA 2VS0A 3GDBA 2GU9A 1H8VA 2P6CA 3ZN4A 3O1OA 1CZTA 5J09A 5B5EZ 2VZOA 1ZAUA 5CN0A 3CCQV 5J2TA 5D1IA 2KXLA 2RG4A 4FSJA 1OCRC 4O4HA 5J2UA 1L7RA 5ABJA 4YM1A 2CTVA 1YFWA 4Q4Y2 3VZLA 1T6GC 1W9TA 2Y26A 2HEPA 3SPIA 3TGUH 1XU1A 4NIGA 4XW3A 2JWPA 1F8VA 1O9GA 4WVWA 4CDQB 4LO6B 2IXIA 5FPUA 4XFCA 5E16A 4CCOA 3ACFA 2UURA 3GJAA 5JH7B 2CWSA 4Q0QA 5F7UA 3NJZA 4O4IA 5L3EA 4LFAB 4N23A 2LGWA 3RZZA 5B1AC 4DXWA 3MPPG 5KHGA 5F5CA 4CXYA 4LFAO 3SYCA 1ULFA 1JFFB 3WDYA 2IJIA 3WCRA 1F23A 1JOBA 3CIHA 2LGQA 1ZA7A 4PBPA 4XIOA 3NNFA 5CA6A 1XNBA 4QPJA 1QDCA 2N7GA 2XLFA 1JYNA 3DGTA 1UY3A 3LSUA 4NPRA 3HPNA 1SACA 2CK3G 1HP8A 2KM2A 2YIDA 5LL6Y 2NN8A 2ZAHA 2BYVE 3I7DA 3PVEA 2FQPA 1V6KA 1R1A2 2HWB3 2R041 2CV6A 1LEDA 2WNVB 3NAPC 3ZHTA 4XAAA 5LBQA 5CFCA 2YBSA 2OX0A 1WWYA 5L3FA 4XJUA 1GLHA 1S2KA 1XMOB 3RQ0A 5CFDB 3LOBA 4DR3O 3ZIWA 3DF0A 1NJIW 2J1UA 2GZWA 5JJNB 3R4DB 1XMOO 4IE6A 1AP5A 4AL9A 5A3NA 2PN5A 5FYCA 3ETDA 4GUNA 1OVPA 1UU5A 4FVMA 3ZFFC 4A3XA 1I5YA 2QE7G 2CAZC 1PGW1 4B7EA 3JQXA 3NJYA 4R7CA 5KX5A 5DAXA 3C7HA 4M0NA 4A4AA 4WM7A 4KBBA 1XB9A 3NV2A 4AW7A 3ZXGA 3T1HB 3CEIA 3WB1A 1HJFA 2B5HA 5JXGA 3ASOB 4LUKA 5H9RA 2EIJC 4LC1A 2VQUA 5EBLC 2LS6A 2RS32 3L71H 1MABG 1DG6A 3VHRA 3PLQA 1TME1 1NZ6A 2PHRA 2NPIA 2YFUA 5FZGA 2QWPB 4G9SB 5F3EA 4CRQA 4QQ2A 3HBKA 2IM9A 4X64B 5IDJA 1Q8VA 2Y0OA 3WW3A 3TN92 1RHI1 3RG0A 1FX5A 2EIDA 4Q4Y1 4DRVA 1W90A 3UCSC 2E74B 5C3QA 1ZTEA 1GICA 1XNCA 2NN4A 3ZMNA 2SBAA 3E35A 2Q6AA 1FPN1 3K51A 5FZOA 1BSMA 2X0LA 4UV8A 1OV9A 1GYKA 1RUE2 2A0LA 1GN2A 2HWC3 4YXWG 1JI6A 2H8PC 4AK3A 3ZEDA 1MEC3 3FJSA 4GX2A 1D5NA 2RR13 3J7AU 3RW0A 5EYXA 5FPBA 4LITA 4MGQA 1K45A 1AILA 1F35A 5IYZB 2EIKB 4DPNA 3BGAA 4OUMA 1ND2C 5LWBA 4ITCA 3GHMA 3C2UA 1ENQA 5LA9A 4JI7O 4IE0A 1GP6A 5LP6B 2UUBO 4Y5TA 5CA3A 4UWDA 1WGPA 1A32A 1PP9H 3OBAA 3LEKA 3SJQC 4N53C 2RCVA 5FZHA 1XHXA 5IVYA 4RWUA 1OPOA 4YG6A 4FOYA 3ABMB 4DR1B 5FYUA 2YC0A 1X50A 3JCUZ 1RUE1 2XBO1 3NKGA 4HK9A 4NHMA 2D7FA 4IEYA 1JZ2A 2A79B 3HR0A 1S0DA 2VZVA 2G9GA 4QDQA 1MSWD 2JD9A 2VMFA 2W9XA 5JVDA 4WBNB 3NMBA 2ZGPA 3VBUA 4C1XA 4O4HB 2YFZA 4JGYA 5KA5A 4JDOA 1KFUL 3ZS8C 4AFAA 5C9AB 3FAVA 2DVAA 4MV2A 3JD71 4O4IB 2XJUA 3TEZA 2DYRB 4Y1XA 3UM7A 1HNXB 1IX9A 5HCBA 4X62B 1CX4A 2K46A 4YNIA 5FRAA 3OE7G 2FZ1A 5IK4A 5EIBC 4MW3A 2LROA 4RA0A 2P6HA 5T3NA 5J37A 2UXBO 4W6WA 5IVFA 1Q86W 3AB0A 3BTXA 1BBT1 2Q67A 4N43A 4EKWA 3LQCA 4XF0A 3VBSB 5BUVA 3VBFB 3BY6A 5FYIA 1HRI2 1XC6A 4Q4W2 2UXDO 3WP6A 3CCMV 2Q8EA 3VD9A 4JVAA 4FFBB 4N53B 4CA9A 1ULDA 4RAIA 3OT7A 4BJ0A 4XDQA 4RD7A 4CEWC 4OX9O 5JIUA 2G19A 1D4M3 3E6DA 4QQPA 3JBG2 2WZR3 2YUEA 2QQOA 3OCPA 4QQOA 1KC8W 1S0CA 2EILB 1FI2A 3AKSA 4BQYA 2WN2A 5I0SA 2A7WA 2ZGKA 2WYFA 3R05A 5A1AA 1GN3A 2CSGA 1PVC1 2ZA9A 4QX0A 3AEIA 1RJ7A 1YITV 5FO9B 2OWOA 4L9BA 5GLZA 1Q82W 3WFVA 1AYN1 4KXRA 1SC5B 2WFF1 4DV4B 2NM1A 1BE3H 4AI1A 4QHOA 1URFA 2WJSA 4TV8A 3WDVA 1WA6X 2R062 2ZR2A 1EV13 1KDKA 2Q1MA 1WLEA 1W9SA 2QM8A 4D6QA 3CDZB 1XREA 1J5EO 2QWOB 3BTYA 3FWEA 2Y69B 4LBNA 5DAWA 2TBVA 4R9BA 2HWB1 2EA7A 3GZUC 4HKLA 5LXTA 4DUZO 1BEV3 3HD8B 2YIBA 5LMNB 2YDEA 4Q1RA 3WUDA 5KWRA 1DK1A 1GN4A 1NT2B 2CTQA 4AEJA 4JI1O 2IXHA 1AR71 3VDAA 4FXGB 2LW8A 3KV5A 1KFXL 3OUIA 2CGNA 4A7ZA 2W92A 5T50A 1F9KA 4UFKA 1L0LH 1REDA 1DGSA 1SQPH 3ES4A 2DWDC 1XNQB 4WFBV 2VOXA 1A78A 3POWA 4TZDA 4F4LA 2IUWA 3MDPA 3IBMA 4UW5A 3LFIA 4IV3B 1PHMA 4DR5B 1UY1A 2WFPA 3CRAA 4XFFA 1OOPB 1LGCA 4LF9O 4YYOA 4BK4A 4YJ3A 1I1EA 1S72V 3SR2C 1OHFA 2P1BA 4W8JA 2WLIB 4DR2B 3J8F3 4NWWA 4BA6A 1N32O 3QF7A 5IJ9A 1UX7A 1WW5A 3SYAA 1ND2B 4K35A 2VE1A 3QOPA 5KC5A 1UZVA 2EZPA 2Q8DA 2HJIA 4WM7C 4LTAA 1VBC1 5I8SA 5LGUA 2DCKA 2XNDG 3F2ZA 4K6BA 3M3CA 5IFTA 2FDKA 1PNFA 5B1AB 1POV0 5EJ3A 1ZBE3 4NMIA 2OA2A 4Q0SA 4CP9B 1K9MW 5FOBB 3JCIA 4D6SA 2ITDC 3KG2A 3ETPA 3BYWA 3LSEA 4QXCA 2ZAAA 3VHOA 2K0GA 2JEXA 4Y26A 5D2AA 1U5YA 2VMIA 1LB2A 1KS5A 1AROP 3J7MA 1AR4A 3AYDA 1QLEB 1H9WA 1YQ6A 4UBHA 2J1TA 3ILNA 1Z5WA 3HEIA 1DGLA 4PJYA 4JI6B 3IAPA 4YHHB 4MTGA 1XUQA 5BMVB 2CY6A 3AM2A 1GOGA 4P30A 3Q9OA 3OPWA 2C5DA 3KT4A 5A70A 2AZ0A 2UUAB 2WT0A 5LB6A 3WNKA 1W8WA 2BFUS 5BNOB 2VVEA 2VL4A 1NVPD 2UU8A 1KJLA 4NKGB 1VQ8V 4A44A 4XVHA 3AVRA 3LCPA 1RUI1 1VJ2A 1VBD3 1CEZA 3JARB 2XBO3 5FL7G 1TGOA 2YPDA 3PJSK 1PGL2 2GSMB 1WCQA 4EN9B 5L3BA 1N34B 1G7YA 3MLJA 2DV9A 2R071 1XEQA 4JI0B 3VBUC 5F5IA 1BS3A 4QIWF 4KHPB 1POQA 5BNQA 3R4UA 2EIBA 3WNOA 2ZD9A 3N35A 1C8M3 4K8XA 2EXJA 5TISZ 4JV5B 3NL1A 4NRPA 4P14A 4LK7A 1O4YA 3CJHA 4ZZ5A 4QWNA 4BDVB 4FXKB 4KWUA 1TA8A 5JSRA 3N7LA 1G86A 3H1MA 4AGRA 1XQNA 2BSKB 4PHZA 4UCTA 2YXLA 4N43C 4EB6A 2XVLA 2P4VA 1D4VB 3KZIZ 4NB5A 5CNAA 2OCCC 1KP2A 3JSLA 1VMJA 3HKCB 4MVMA 3BAAA 3VBOB 3OEAA 2IFRA 1KP3A 2W91A 1UU6A 2BZDA 4X1KA 4CEYA 5GZDA 4Y4YA 1GKBA 3K4AA 4QAWA 1FPN3 2OUHA 2FHRA 4PA9A 3RGBA 5B1BC 4CDQA 1OXCA 2WLLA 2YHJA 4HKOA 5KHHA 4UFLA 3O1SA 3KM5A 4I01A 5A3WA 2WZR1 2WWUA 4BQ4A 4DV2O 2L6LA 4QPGB 1QWRA 5I0RA 4BISA 4PT6A 4NROA 3O0XA 2XXZA 4U2AA 5L3CA 2VTXJ 3J7NA 1HRV2 4DO0A 1VMFA 2Y6LA 1VBD1 5LOVA 2XR4A 4DV5O 3VLBB 1P84F 3VOUA 5A3UA 1VARA 3APQA 2V1DA 5FZLA 2V5YA 2ZJCA 5D8AC 5CMUA 1GM7A 1UY2A 1BHAA 3C90A 3EB7A 1NY71 3L2HA 2R70A 4XE9A 3MD0A 4LF4O 2PGGA 4CH6A 1FNZA 3H42B 2XKPA 1U5XA 2Q7EA 5A32A 2J22A 2QM7A 3Q8CA 5IK7A 1PM7A 3FHAA 3LEIA 4J9YB 2WT2A 5FZBA 4BW9A 5C5UA 3K08A 1NG0A 4JX0A 4CS3A 3DXRA 5FZ0A 5H2FZ 5FR3A 2H6CA 2BE3A 4IGOA 2M7WA 3T2MA 1FOD2 5A3MA 1OI6A 1XOUA 1AHSA 4A7YA 2BPA2 1YFUA 2WNVC 3N2GA 3AP7A 4E4ZA 1SZTA 1H4GA 2JECA 2BNNA 2WS91 4U36A 3ZHUA 3PDQA 1YWKA 3RZLA 2VQEO 1Y9MA 5JXHA 1HKDA 3K5OA 4U3FH 1A3KA 4NXNB 2IWGB 2ZXQA 1OLQA 2EAAA 1VAMA 5LBBA 1PIV1 2BWAA 4R8HA 1IS3A 5BNOC 5L19A 4NIDA 2FMYA 4R6ZA 3WOGA 2DBIA 4FPEA 1PNLA 1LECA 1TE1B 4XDOA 3OJBA 4LMFA 2VQAA 3MIFA 3JSNA 2BGOA 1D4M2 2UYBA 3IIAA 3ACIA 2AGSA 2WO3A 4E9KA 3U37A 1NUKA 2LALA 5IAVA 5BNNA 1S5LZ 5GM0A 3K75B 2VZTA 2GMEA 2IJHA 3ZRXA 1AR82 3CJIB 5HPOA 4JCKA 2QQJA 1MS3A 5FO8B 4FJCC 4IETA 5JVVA 3H1JH 1GZWA 3PVBB 5GTHZ 1GSLA 3WT3A 2HWD1 4YZ1A 3RVZA 1SQBH 3N9OA 3HKEA 3VZOA 3GF6A 3G6EV 1N3PA 1RVF3 1Z78A 2XHKA 1ZBA3 3GBGA 2EIMC 1VBC3 4ARXA 3GYDA 3B9IA 2R0HA 3ASIA 1EYBA 3GZTB 4XHBA 4I02A 1LNSA 4QGLA 3OBTA 1VR3A 4L2NA 3H1LH 3GXUA 1E79G 1POV1 1CGPA 2XASA 1FAYA 1FMD3 3QH7A 2B9VA 1XNRO 2UU9O 1KQRA 5LP6A 2AEYA 3AMPA 3DL3A 2JE9A 1ZRCA 1EZJA 4Z1VA 1NLSA 3WSOA 3FBMA 2XAGA 2Y48A 3WUCA 1DGWX 1VBA3 3ILRA 3TN93 1FOD3 2BSKA 3WF1A 4Q27A 1AI7A 3R4SA 4J6GA 1HIXA 2VAUA 4O4LB 1JFFA 3U4SA 3K03A 4FCAA 1IQDC 1SG3A 3VBFC 2C6SA 3ZMTA 4KU8A 2D40A 1Q3EA 1VBE1 4DUVA 3RZKA 2UUCO 2OYZA 5HV0A 4XJ9A 1Q56A 4CE8A 5JJEB 3OFNG 2A70A 4QPWA 4GWNA 3ZYPA 3O12A 3H3ZA 5C8YB 2ARXA 1WD3A 5F3CA 4WBNA 1FKAO 3HPLC 3N9NA 4FP2A 2WFF3 2NQYA 1GP4A 5A6QA 3OUHA 2Y6GA 1QJX1 1MSDA 4FLTA 2Y33A 2EICA 2VCMA 1JYTA 4XFGA 2Q8OA 1EM1A 1T6BX 1OMIA 2YBKA 2A3YA 2JXAA 4CTEA 3JALB 3H9VA 1UMIA 3HT2A 2PAMA 4K1YA 3WF4A 3JZVA 2DWRA 3OGSA 4I7ZB 2QKAA 2FZ2A 1FYJA 4LFCB 1ZREA 4B3MB 1YYNA 5K4LA 2RDCA 2WR9A 2QR4A 2B9ZA 3CMEV 3JAWA 3ZMVA 2WA3A 4YW1A 1UAIA 3CP1A 5JOXA 3GZAA 5CISA 4X65B 1Q5OA 4UCRA 4BQ5A 1YXBA 4C1WA 4LULA 2ID4A 1ND3C 2VZRA 1I08A 2RHPA 2ZNJA 1I5ZA 3V0BB 4JGZB 3VBSC 4RUEA 1O3RA 5LHGA 4TV9A 4I30A 1T2XA 4NPLA 2B9UA 4H44B 5T54A 2DCJA 4GH4C 1W8TA 1HB2A 1AX1A 1U97A 4LH6A 4QU1A 2J1SA 2HWD2 1OF3A 4PDLA 3F5WC 4J7JA 1JYWA 3K5LA 2JEMA 3J80N 2VMDA 5DABA 1OKQA 5FIXA 1ZLZA 3OYWA 3ZYHA 4AEDC 3AG3C 1MZ6A 1NQJA 5CKNA 5FMOL 2GH8A 3CCLV 2JD4A 5BYNA 3FLRA 1UN1A 1VIWB 4URAA 3LDKA 2FMDA 2CU5A 4I55A 3UT5A 4NHLA 4I9WA 2V4VA 5KAIZ 1YJWV 4A42A 3ETGA 4QJFB 3A4UA 1W9FA 2UXCB 1W0JG 2OTJV 4JI5O 2ITCC 4JTDB 4UW4A 1JPXA 1CZVA 1MEC1 3N9LA 3INAA 3AYAA 1QNYA 4KMQA 4ONUA 3CZUA 2TNFA 1R64A 2QVSB 3ALQA 3K5NA 4XTPA 3N2KA 1H1AA 3VB9A 1CZSA 4UFZA 1Y43B 4CUBA 3E8GA 3WDTA 4LBQD 2WWWA 4TT3G 1OLME 2HLEA 2ORXA 2E6VA 2E5LO 5D5PA 4MHRA 1QY4A 2VCAA 1GP5A 5LXTB 1IDSA 3H01A 3VD7A 1HNZB 3SMHA 4JYBA 5H9SA 3EBRA 1RUG3 3TWIA 3RYCB 3PNAA 3I54A 4SBVA 4UFJA 1HR0O 4PBOA 3T2TA 4CZZA 5FWEA 1NA1C 3HB3B 3EVKA 5C3OA 3PMEA 3TRSB 1D2SA 2BGPA 3ABZA 3MBWA 2ZGOA 4CCLA 3USUA 1R3KC 2VR4A 2WAMA 3EHKA 2HWF2 2ZZJA 2Y0IA 2X6BA 5C93A 3CJIC 4RFT0 4PA7A 3KGLA 3T2OA 4CU7A 1M57C 1ULEA 5H6RA 2DMXA 3UK9A 3FB8C 2PHUA 4FP3A 1FATA 5BR8O 3ML0A 4JGYB 2VPVA 1MQTC 3D5OA 5GLUA 3BVCA 5J96B 3NNJA 4XQWA 1V9U2 1W0KG 5BXZA 1XE0A 4JI2B 3HQXA 4J41A 2ZNIA 5CBLA 3KWVA 4IYHA 4DS0A 4QQHA 1FFXB 3SKJE 2ZX0A 4I0WB 1YXWA 1JQ0A 5JQGB 4Y1UA 3HMYA 4JTOA 3ABUA 2GDSA 4AF9A 3IT8A 1P4RA 1UWWA 2XJVA 3MV11 4DXRA 4ZU7A 1OQ1A 3FB5C 4N21A 2M6YA 5HCFA 2PZSA 3THTA 2YXHA 3WHUA 4LNUB 2Y60A 2EAKA 3T2PA 1YIFA 3T30A 4MT8A 1UY0A 3T1YO 2GTSA 1AR93 2ZX3A 4OYUA 3VD4A 4F83A 1NS1A 1K73W 1KD1W 1NYWA 4ZU5A 4KI5M 5FZEA 4QDSA 2ZX1A 4JYYA 5DUWA 3RBZA 1GZCA 3ZYGA 1LOAA 2ADEA 1W0NA 4BU2A 1W6PB 1LKNA 5JCOC 2X53S 4MLOA 2X7RB 3X29B 3D8CA 1GAXA 1R091 5FZ7A 3RZJA 5A7OA 2NMOA 3S3WA 1OD3A 2R073 2BNOA 3VBRB 1UKGA 4C8DA 3ZXJA 1PIV2 3DYPA 5DDJ2 1JYVA 2AZ2A 2ERFA 2DYSB 3J7HA 5EIYB 2XL9A 1RUI2 2J1VA 3PUIA 4PDVA 2JDPA 4LHLA 3WQBA 1UYXA 5A33A 4CXXA 5KBFA 2GUZB 3OW2U 4RHV3 1YF2A 1AI5A 1HQWA 4QPIC 5IHRA 2JDKA 1G1XB 3CSXA 3ZSKA 5T5OA 3B93A 2IJKA 3MHSC 3VUOA 4Q4W3 2ADQB 5FYZA 3OUSA 1ZRDA 1C28A 1XDCA 1RINA 4PQQA 1WD4A 4CUAA 5C3PA 4TOIA 1OFSA 2WSVA 4KGGA 1FXHA 2XQRA 3POBA 4QNHB 4LF4B 5GZEA 2WC2A 3AXEA 4LFCO 4QQLA 4FTBA 1V6IA 4LBOA 5FKCA 2JJ6A 1O8PA 3CJHB 4O7XA 1FOD1 1J83A 4KGQA 4B29A 2E33A 2O1QA 4AZZA 3CXHF 2IXCA 5FY9A 1TME2 4XF9A 3R6SA 1S76D 2IU0A 2GC3A 4S2HA 1NE6A 1RUF1 4QX8A 4AFDA 2ZHMA 2HWF3 1BK1A 3L75H 1QMJA 1S5HC 2C9AA 5CA1B 5FWJA 2JB4A 2PHTA 3M3OA 2BFUL 3TNQA 4DR7O 2PI4A 1QOOA 3OGRA 1IS6A 4CEYB 1UD1A 1H2KA 3DC6A 3ZVXA 4YY3B 3WY6A 3ZDVA 2E3CA 2WLNA 1F4NA 1AR61 1Y6XA 4IGPA 4H2AA 5FP4A 1OQDA 2HWF1 4UCOA 2WLIA 1BZKA 2W3JA 3FHIB 5LK7B 4O2BA 4NXMB 2CDOA 1SQVH 3JD72 5CFCB 3EXUA 2JIGA 4Y3OA 4Y5Z0 3MUY1 2XVKA