3BPZA

Hcn2-i 443-460 e502k in the presence of camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREKIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title C-terminal movement during gating in cyclic nucleotide-modulated channels.
pubmed doi rcsb
source organism Mus musculus
total genus 66
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3bpzA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3bpzA02
2CAUA 3WW3A 3D0JA 4AVCA 5JSPA 2IXIA 3HQXA 4R8HA 5I0TA 1ZNPA 4Q29A 3LOIA 4Q0UA 1L3JA 1YHFA 4WZCA 1ZX5A 2XL7A 3OCPA 1RC6A 3FX3A 4EV0A 4CYDA 4META 5JSOA 2PFWA 2Z2SB 4AXOA 4YSFA 1PMIA 4HSJA 3RZZA 3CO2A 4L11A 3TNPB 1XRUA 4KWLA 3SMHA 4O9GA 4XFAA 2H0VA 2D93A 4HLTA 4YNIA 5LEJA 5CVRA 4AVAA 5FPXA 1CAXA 2P17A 4E2QA 4IEXA 3KSCA 2V09A 4QM9A 3CLPA 1YWKA 3RPQA 1SFNA 3BPZA 3IDCB 4Q0VA 1CAVB 5I8YA 1UIKA 1X82A 5KHKA 4E2SA 4TLFA 4IEOA 4DINB 3IWZA 4AQ6A 2WC2A 2Q0AA 1H1MA 4BH9A 4I3PA 4LTAA 1XE7A 1QXRA 2F4PA 3IDBB 3LA3A 5FLHA 2XLAA 2HKXA 3M70A 4QM8A 3O14A 5LEKA 2PHDA 3E5QA 4Q0SA 3KGLA 1JUHA 3MZHA 4WBBA 2UY8A 5I0UA 1CAWB 4MGKE 4QGMA 3NVCA 4O9EA 4JVAA 1EP0A 3SXWA 3BU7A 3U0ZA 1DZRA 4XFIA 3EQEA 5FQ0A 4EWDA 5KHHA 1NZCA 3U10A 5FLIA 3ES4A 2QDRA 1RTVA 2B9UA 2OPKA 4HSLA 2QCSB 1Y9QA 4QXKA 4PIYA 3MYXA 3FWEA 2XL9A 4YARA 4X6QB 4HN0A 3E6BA 3UKTA 4I2OA 3ROUA 2PHLA 4Q0QA 5CADA 2OA2A 3RYRA 1ZVFA 4HVOA 4MX3A 5KHGA 2Z69A 4P9GA 4MUVA 4ZU7A 3NSTA 1ZRRA 4A2UA 4XF9A 5T3NA 4IEYA 3E5XA 2UYAA 1OD5A 5AVPA 4N9HA 2ATFA 2PAKA 2MNGA 3LWCA 2IXKA 2GU9A 4XF1A 4QGNA 3DKWA 5JSRA 5LRRA 3H50A 5LRSA 4ZU5A 2I45A 1NE6A 4H7LA 3RYKA 3NJZA 4ORFA 2DCTA 4JV4A 1YFXA 3DV8A 4KWKA 3E6DA 4HMZA 4LLOA 3CL1A 3PLQA 1UCXA 3CJXA 4HZFA 4XFFA 1ZZBA 2GH2A 3C3VA 5JR7B 4UBGA 4N9IA 3DN7A 3KMHA 2GC3A 3JZVA 3H1MA 5I93A 3MDPA 1ZREA 2OYZA 1YLLA 2BEOA 2PTMA 5E1RA 1LRHA 4MH0E 3H7JA 3GBFA 4KU8A 4B29A 3BCWA 4YYOA 3RNSA 1ZRDA 3QOPA 1ZZ6A 2C0ZA 3H3UA 2K9ZA 1QWRA 2K0GA 3LAGA 1IPJA 2GC2A 3UKVA 4EWEA 2PAEA 4XFHA 1I6XA 1ZZCA 2EAAA 5J3UA 3I59A 3SCGA 4JTOA 4KWJA 5JAXA 5KHIA 4I09A 3E6CC 5BV6A 4Z07A 5D1IA 1YFUA 2CV6A 2XLFA 3MPBA 5EZWA 1EPZA 5J7MA 1CAUA 2CAVA 5F1RA 3QACA 1X7NA 4HVRA 3FHIB 4QMAA 4FBFA 4MGIE 3S7EA 4BYYA 4HBNA 2PAMA 4F8AA 4LA2A 1ZZ8A 2IXCA 2D40A 2GC0A 4XFBA 1WLTA 3OD0A 5EFUA 2Y0OA 3H8UA 1J3PA 3N4MA 2PYTA 2QNKA 1CX4A 5I8TA 2IXHA 4NVPA 5I0RA 4XFCA 4PIXA 1LR5A 3ST7A 2B8MA 5I8SA 4R52A 2PA7A 3EJKA 1O5LA 3LZZA 2H6CA 3ETQA 3H3ZA 4HN1A 4QGLA 4AQ2A 4IEVA 4KU7A 1Q3EA 4UBHA 5FCCA 1J3RA 1I5ZA 1QY4A 1ZRFA 3UKNA 5I0SA 1OFNA 4XEZA 2BNNA 4PIZA 1X8MA 3ACLA 3WW4A 2UY9A 2MHFA 4D7TA 3M3IA 1EYBA 1IPKA 4LUKA 4D7SA 2D5FA 3NKTA 2GZWA 4K8FA 4FAGA 3BB6A 5C8WA 2Q30A 2N7GA 1H1IA 5JCTA 1O4TA 3USSA 3FFQA 2BGCA 3H1WA 1LKNA 3S0MA 4OFGA 2B5HA 2ET7A 1CAVA 3LA2A 2EA7A 4HVQA 1WA4A 1NE4A 5FPZA 2OZJA 3SHRA 2CGPA 3H9AA 1Q5OA 1UD1A 5J48A 2QVSB 5BXXA 3EBRA 4LUMA 3SCHA 4OLLA 3OTFA 2XKPA 4YRDA 3H7YA 3PVBB 2UYBA 1V70A 2FQPA 1NYWA 3TNQA 3E5UA 1CAWA 1WGPA 4JTNA 1O3SA 3KCCA 4FT8A 3RDIA 3NL1A 1O5UA 5C6CA 4XF0A 1UIJA 3KGZA 1J58A 3PNAA 2VQAA 4X6RB 1G6NA 1GQHA 1J1LA 1U12A 1TQ5A 2ET1A 4ZU4A 4J1WA 2Q1ZB 5BPXA 3FE5A 1PM7A 3ELNA 1DGWA 5FDBA 1VR3A 4XETA 3CEWA 3IIAA 4IEZA 5CU1A 1YFYA 3I54A 4WVZA 4FAHA 3D82A 4IESA 3HT2A 1ZZ7A 4EWAA 1UPIA 2GC1A 4L2NA 1RUOA 1X8EA 1OMIA 4XF4A 1XE8A 2EVXA 4IEPA 1Q43A 2XKOA 2BNOA 3DL3A 1SEFA 4IERA 2GAUA 3RYPA 4Z82A 5I91A 4KL1A 4QX5A 1UW8A 5FLJA 1YUDA 4ONUA 2ZCWA 1GQGA 3EO6A 4LA3A 3OGJA 3VHRA 4IEQA 2QJVA 4RD7A 3GYDA 4AVBA 4E2GA 1ZRCA 4LEJA 2IC1A 4I01A 3HIFA 4MZUA 1J59A 4XFGA 4I0BA 1EY2A 2IXLA 3WW2A 3OF1A 1RL3A 2MPFA 4LULA 2H6BA 2FMYA 2KXLA 1QXJA 5E16A 5KBFA 2D5HA 3LA7A 4EROA 1CGPA 2Q4SA 2ZKLA 1LB2A 4IEUA 4MV2A 2VPVA 1Y3TA 3R6SA 4MGZE 1HW5A 3ZDSA 2OZ6A 1OI6A 3I59B 5BY5A 3E97A 1FT9A 4I0AA 2ETEA 2XGXA 1CAXB 3D0SA 4J1XA 2XHKA 1YFWA 3B02A 3FZ3A 4BHPA 3HT1A 2O1QA 4IEWA 1SQ4A 1ZZ9A 4XF3A 1DGRA 2HJIA 3G7DA 3IBMA 3WW1A 3EHKA 1FI2A 2VECA 1VP6A 3U11A 1FXZA 2BYVE 3SCFA 5BUVA 4MGYE 5HI0A 1RUNA 1RGSA 1CAUB 2IXJA 3ES1A 4GULA 2XLGA 3S7IA 2WFPA 2BNMA 5K8SA 1O3QA 3I7DA 1O7FA 4BIFA 4UXAA 3H1YA 1NXMA 1J3QA 1DZTA 4PJYA 1VJ2A 3CF6E 4IETA 2O8QA 1O3TA 3FJSA 4I02A 5FQ0B 4F7ZA 4Q0PA 1O3RA 2PQQA 3L2HA 5KHJA 3NW4A 3BALA 2E9QA
chains in the Genus database with same CATH superfamily
4I55B 1XMOO 3GZEA 4L92A 2F4VO 2Q8EA 5FPRA 2A06H 2DTWA 2F4LA 4Q2FA 1NCQA 4Q29A 3ZYRA 1YHFA 1FPN3 4LO6B 3VGIA 3E8HA 5LY1A 2Z79A 4DV3B 4XHBA 3LPFA 5LCWL 2WQZC 3PU3A 1Q8QA 5LEJA 3RZJA 4X1KB 5LWBA 3BPZA 3STLC 2ADEA 2A70A 3DF0A 5FNVA 2GN7A 1SQFA 5E88A 5BNNC 4D6QA 1EN5A 1POV1 2XLAA 1HNWB 1XC6A 5J9PC 2HYKA 2HBUA 3H01A 4JI0O 1LGNA 3ZYGA 5LK5A 3AFGA 4NHKA 1POQA 3SXWA 1MA1A 2RS32 4UW3A 5KHHA 4DV5O 2WLPA 2XOKG 1RVF1 5A32B 3POEA 2VULA 3WDVA 4HN0A 2VZRA 5K0UA 2PHLA 4Q0QA 2RR13 3AX4A 2KA3A 5IVVA 1PX4A 1FPN1 4MUVA 1RSOB 4A2UA 3LEKA 4YM0A 1W6MA 3ZYFA 1RUE2 4BQWA 2OIEA 4U7NA 3T4ZA 4QGNA 3FLTA 2Q8DA 4UAPA 4Y1VA 5LRSA 4LT5A 3WF4A 2ZGRA 2XVKA 2BCCH 1GM9A 3THOA 4WF9V 3VBFA 3P32A 3TEXA 2ZA9A 2VNOA 2VJXA 4XFFA 5H9QA 2Y48A 2Y4TA 3JYCA 2VMEA 3E8GA 4W4LA 2ZKOA 3FHAA 3M1HA 2ZJCA 3ILRA 1YJWV 3KKYA 4LO5B 2ZE8A 5A32A 3H1LH 1I6XA 3WINE 4XJ9A 2G9ZA 3ZX6A 2RR11 5DM6V 1YF2A 4YZ4A 1YFUA 5A3WA 4LBMA 4XTMA 3NNFA 4I9QA 1QDCA 4CU6A 1OXCA 4NIAA 2VOXA 1I94O 1OD3A 2IVIB 2QTSA 2Y0OA 5I8TA 4FPFA 4NVPA 4JGZA 4S2GA 3WDYA 3G80A 3NWKA 3AZVA 4DV0B 2PA7A 2ZHLA 3AEIA 3TB0A 2OW4A 4N53B 3CYOA 3CJIC 3ETQA 1LCLA 1NA1C 1AZDA 1FXKA 5A7NA 1LECA 4UT5A 4OI1A 2GHYA 5LBEA 5LA6B 3MHSC 2W9XA 1QLEB 2JDMA 3POFA 3BIEA 4UF0B 1C3HA 3PU8A 2RDSA 4YM1A 2ADPA 2N7GA 3POJA 2WNVC 5LMUB 4LFCO 3SYCA 2B5HA 2ET7A 4ZBMA 2JDZA 3T1HO 1VQLV 4FQZA 4MVRA 4WM7C 1UD1A 4Z1VA 1E5HA 4DR6B 1W2NA 3EBRA 2JKXA 2JG9C 2HWE3 4XCBA 4YG6A 2ZGSA 2ARCA 1VBC3 3TNQA 4LNUB 1QR8A 1OUSA 1REEA 2NN8A 1OFSA 3WNMA 1PO13 2A3XA 4QT6A 4EE2A 1NT2B 2ET1A 3ZYHA 3ZYBA 2YHJA 3CCEV 3U14A 4O2BB 4YHHB 4XETA 4YY3O 3O1OA 4EWAA 3CRAA 1XE8A 2AZ0A 1VQ9V 4TLGA 3WDTA 1J84A 4OHXA 1XHZA 2A71A 3CCVV 2QTWB 5I91A 1IGOA 1MEC3 4ZS3A 5DMYA 2Y64A 3J7MA 1R093 2TUNA 2QJVA 2VCAA 4I9WA 1VF6C 3V0BA 1SCRA 4CS4A 1OKOA 2UUCB 2JDUA 1W8HA 4GH4C 2ZE5A 1TE1B 5ACA3 2HWE1 3T1CA 2OTLV 4LNUA 1VBC1 2FMYA 1WLCA 5LA1A 2ATKC 3WP3A 4Z2AA 1UY4A 2VUCA 3VQXA 1B35C 3GVMA 2NM1A 2X6CA 1PO11 1YQ6A 4NAMA 3NRUA 1XHXA 2ETEA 3PDQA 5D5QA 2BPA2 1C8M2 3IDEA 3W21A 2ZM6B 2HJIA 4Q26A 4OHYA 3B00A 3AZWA 2IXJA 4FPJA 3AZYA 3ALQA 1D4M3 1FNZA 4XW3A 2VTXJ 4LR3A 1O7FA 3CB2A 3ZM8A 1OF4A 3G67A 1XU2A 1SLBA 5FUNA 4YVWA 1MEC1 2VMIA 4ICGA 1R091 3DYMA 5AC92 5GZEA 4I02A 5DAVA 1GUIA 4F7ZA 5LOVB 4LF7B 3RYIA 4AZZA 1OCOC 4KHPO 1W39A 5JSPA 2NZ9A 2FCTA 2J22A 1XNTA 1JZ4A 3ABLC 3I2FA 3KHCA 2X10A 2UXDB 4MADA 5ACA1 3LOIA 1JPXA 2G38A 4TWTA 2MEV2 4EN0A 3W5NA 3LE0A 5H9CA 1JMKC 3FUOA 1QOSA 4QKFA 4FFBB 3LSSA 4FOVA 3DGTA 1CJDA 1SLTA 2VZSA 3TEWA 1O9GA 3P1IA 3WP4A 1D4M1 5FMOL 2WJSA 1SZTA 1Z7S3 2W68A 2QQUA 4OHZA 2ARHA 2V4VA 3CJHB 4Q8KA 3ZXFA 3CKHA 3BODA 2XL9A 2N74A 1OKQA 1AR92 2EXKA 5CFCB 5F5CA 2WABA 4DY5A 1LEDA 1ZVFA 4Y5TA 1XEQA 4WBNA 1N0NA 1WMXA 2CGNA 4XF9A 1F15A 1OD5A 1R64A 1M4WA 4XF1A 4DOUA 5LGNA 2I2SA 2HWC3 2YGLA 4AFMA 1UY2A 4H7LA 3W58A 1HQNA 2ZTNA 1CZTA 4PI0A 1DFQA 4PA6A 5I0DA 1GANA 1Y9GA 1AR63 3CL1A 3WR0A 1RM1C 4YW1A 2AEYA 3CJXA 2UUBO 4CC5A 3MDPA 4RN5A 1Z7S1 4W6YA 5HCFA 4YW2A 2YEVB 5T55A 1D2DA 4MGQA 3CJHA 4ZKIA 3EFFK 2VOVA 2JDKA 2YDEA 1VMFA 3LAGA 2PHUA 4CRQA 1VAMA 1ZZCA 1WMDA 5CFCA 5ITZB 5H2FZ 5HBAA 5F39A 5BMVA 4MVZA 1Q8SA 2VUDA 2K9PA 5L9BA 1W2AX 5F1RA 5FZ9A 3WLUA 1OUXA 2AZ5A 4YJ2A 1H4HA 4P02B 2GC0A 2HWC1 1XMQB 1GH6A 1GP5A 1GM7A 3VBOB 1WW5A 3O7OA 3A22A 1G1XB 1AR61 5FPBA 2IBZH 4TQFA 5C8YB 3OPTA 1ND2C 2AEZA 2WT1A 1WNSA 2DCYA 2R16A 2LS6A 1NVPB 3PHMA 3JSNA 2YEVA 3CNAA 1I5ZA 1KXGA 1HXS2 3QBQA 1IPSA 2QKSA 3OYWB 5FWJA 3N2GB 5JVDA 4WVMA 4RQPC 4D7TA 1N3PA 5JPMB 2XDVA 1KU9A 1NX9A 4AL9A 3C7HA 3DYPA 2IJIA 1WLEA 5JJJB 3AYDA 5FY1A 3MO4A 1JZ3A 1NE4A 1D7PM 1JFFA 2P37A 1ROPA 1PM4A 4CCKA 1F7YA 1EZJA 2F1MA 4CPBA 1MS0A 2ZDIA 4IIJB 2P3IA 4FLXA 4GKXA 1E5IA 3POYA 1JZ5A 1GZ9A 4QPGC 2ZIMA 3QNEA 2HBTA 1VBB3 3LCPA 4YFWA 4OHVA 4YVSC 1FFXA 1HLCA 1BZKA 3L72H 4P14A 5JH7A 2B45X 3RGBA 1YVWA 3ZYPA 1UX6A 2VMDA 4RFT0 3ZFEC 5FZ3A 5CA1A 3B09A 4QPYA 4JTCB 2GAUA 3LSUA 2VQ0A 1PVC3 2Q69A 1CONA 1EBOA 1OSGA 4PA9A 4BOWA 4O4LB 4LKEA 4X1YB 5T5JA 4IL7A 3QCWA 1W0PA 5FYHA 2IXLA 4O4JA 3OE7G 1ZLZA 1NY71 5KX5B 5ABJB 1KMIZ 3M2MA 4EN9B 4BXFA 2GBOA 2HHHB 4GB32 3OBZA 1VBB1 4B3RO 4IE7A 5BY5A 4FOQA 1QBZA 4ZI7B 5JZGC 3HT1A 3CRMA 2WNUA 1ZZ9A 1BT8A 1FI2A 2BYVE 1YCIA 4WM8C 3C3SA 2DU1A 2GDFA 4LBQA 1HV0A 4ZXEA 3H1YA 2O8OA 4CDUB 1K8AW 1PVC1 4AFAA 4Z2WA 4NXMB 4U3FH 5FQ0B 3AB0A 4KH9A 2WQ4A 2XR4A 3VBRA 3C8XA 2DBIA 2CAUA 4BLJA 2D6MA 4ES8A 5KX5A 3WD5A 4DUVA 1S72V 2XL7A 4EV0A 2W6IG 1JH5A 1PMIA 5ERLA 4AI3A 2CDOA 4O9GA 4UFZA 2XJSA 4LO7A 1O59A 4WFGA 5CVRA 2BFUL 5EBLC 4Y1UA 1JR9A 1RUD3 5LB6A 1NI8A 2YS8A 4EFBA 4DUYB 5M0TA 2W3JA 2LJ2A 1BQ0A 1U5ZA 3IWZA 4JI3B 2KKWA 1H1MA 1XE7A 2ZMKA 2GTAA 1LNSA 5LEKA 5E89A 1C1FA 5K0UC 1MS9A 1WB8A 3RSJA 4LOTA 1S0JA 4MHUA 1CAWB 4O9EA 1TZOA 2EIGA 2P34A 5FQ0A 1FYJA 5FYZA 3I2OA 4FOYA 2QM7A 1RTVA 2B9UA 1Y9QA 5DDJ2 1KP2A 1ZAUA 1RHI3 2JX9A 2PN5A 1DG6A 2PF4E 4CDWB 2OX0A 2HEVF 4JKKA 3TEYA 1X9TA 5B1NA 3VBFC 2ZXWB 5A33B 1NH2B 3E5XA 5DG2A 5HV4A 2JICA 1AHSA 3ZHVA 3I49A 1WN7A 1RUD1 3NJZA 4R9DA 2IFWA 5L9VA 2EALA 5FTTC 1G8WA 1REDA 4IYHA 4PELA 1VQ8V 2R7EB 3BEHA 3AVRA 4K40A 1NKGA 3SPJA 2K46A 2FDKA 3ON7A 3PJQA 5EK0A 1JODA 4OX9B 1COV3 2ZHMA 3WZ1A 2RJLA 4O4IA 3Q8BA 4ET7A 1OA3A 3QG5A 3WY6A 1VQKV 4QKNA 3QTCA 2A73B 2C24A 1GZWB 5ISLA 1AR1B 5D2AA 3TCUA 1S5LZ 3UCSC 1YEWA 4FQ4A 2GC2A 2WUHA 3NO8A 3NV2A 2EAAA 5IATA 1R1A3 2AR6A 3I59A 5CBFA 3QVNA 3PUAA 1TMF3 4JTOA 1RHI1 1NTMH 2QWNB 3ZOIA 5KC5A 3APQA 1H0BA 3JATB 1YDXA 5A33A 1CAUA 3ZHTA 3ZMNA 2LGWA 2XAJA 4QX8A 2FTKA 4QMAA 3DYOA 4UFKA 1Q81W 1OA2A 1ZZ8A 1W90A 4DR7O 1HRI3 3HKCB 2ERFA 3JUUA 4CDQA 1FXKC 5F37A 3WVJA 4CPBD 1K3IA 4LF6B 5L7OA 1QQCA 2FCUA 1LUVA 4XZPA 1M06G 2B8MA 2QDNA 3MIEA 4CH3A 4GX1A 1Q6UA 2P06A 4JDOA 1QQP2 4NB5A 2ZEYA 1AYM3 3CZJA 1SBDA 4HN1A 1COV1 1AYN3 1IKQA 4KWUA 1URXA 1W9YA 4LBNA 3SEEA 4BIUA 3FYIB 2YUEA 3CQOA 2VQTA 4FZ0A 5KA6A 3C7EA 1UPGA 2BGOA 3VZOA 1R1A1 5C8WA 2Q30A 1TMF1 3C3TA 3MAQA 2PLV2 5DQ0A 4ASUG 2AREA 1FFTB 3TXQA 4CUAA 4A41A 5JQGA 4N53C 4IE5A 4P5YA 1V70A 2SBAA 1HRI1 4DR2B 1LGBA 3N27A 2E33A 4RS5B 3KCCA 1J83A 5GJ6A 5C4WA 5LA9A 2JWPA 2RS13 2QQKA 4XQWA 3K9AA 5BPXA 4CCNA 1DHKB 1AYM1 5IW0A 2A5ZA 3WG3A 1AYN1 1FOD3 2BW8A 3RJRA 3IC9A 1LOGA 4CCDA 1UPIA 5JXJA 5T52A 3BVOA 1AX1A 2B1GA 5FK8A 1QH7A 1DBNA 2ILMA 1CVNA 4LBQD 3L71H 2R70A 5C70A 5FYSA 2QEXV 4TSVA 5LY2A 5IY5B 2ZHNA 3I3MA 4UW5A 1DF5A 2WLQA 2G9GA 3HNMA 3T0AA 1Q8PA 4I3GA 2JDHA 2YIDA 3JALB 1N1VA 3O1PA 5FZHA 1UKRA 3OBRA 3OF1A 3J80N 4NJ4A 3WSOA 1HWYA 4RS5A 5D21A 4TV8B 2YBSA 3FLRA 1CGPA 1YQ5A 2Q4SA 4IEUA 2G4IA 2HYXA 2ZR2A 2RS11 3NKGA 3T0BA 2X09A 2XB6C 3K3OA 3DEMA 4ARXA 1Z0HA 1VARA 3MF6A 1FT9A 5FZKA 1JBCA 4YVWC 2JDNA 4XF3A 3IBMA 2A9HA 3SCFA 1FOD1 4HKLA 4IV1A 4KUMA 3VQWA 1RGSA 3R4UA 2RQ6A 1NJIW 4D3WA 3ZFGA 1WA8B 4H3WA 4XZUG 2JIZG 2VUAA 4D8MA 2D3PA 4Y20A 4IETA 3UYJA 4DO2A 4DXZA 3K4ZA 5CZKA 3UO2A 2AENA 2NMNA 3K58A 2W91A 1CN1A 1VAVA 2IXIA 4JI5B 5I0TA 2RDNA 2XWJB 3WQBA 4TV8A 4Q0UA 1FPN2 3O65A 1A8DA 2RJ2A 3G6JB 4AHZA 1OZ0A 1M56B 4GYCB 1PO23 3VUOA 1Q82W 1DGLA 3B77A 3O0WA 2LQTA 2XJPA 3CIHA 1IBMO 1SFNA 5A80A 2TBVA 2Q68A 3ZN5A 3LSDA 4AQ6A 4I50B 4ZXKA 2GP3A 4LF9B 4XIKA 1QXRA 2F4PA 4AAXA 3OUHA 1UAIA 4IYIA 3AJZA 1SETA 3E1F1 3MZHA 4UB8Z 4UCOA 3CRQA 3ZHQA 3HQUA 5I0UA 4QGMA 4JI8B 2W08A 4E4SA 1ND3A 4DQAA 2CHHA 1S0DA 1G6UA 4FLUA 4CP1A 3ZN4A 5LP6A 2YFZA 1KITA 3WX5A 1FPOA 1K5JA 2Y6KA 2RR12 5E6HA 5HFMA 4G27B 1KFUL 1Y66A 2IJJA 3HN1A 3T1MA 4AG4A 3WV6A 3UGFA 1JUIA 3DPRA 5KR7A 1NH2D 4P9IA 3LWCA 1BK0A 2W1SA 1PO21 1CWPA 3KWVA 1NE6A 3T1YB 3ZLIA 3JAWA 3GZUC 3AL5A 4R9AA 3KHBA 4BB3A 3PJYA 3FBYA 5CFCC 1OQ1A 4IT5A 1LOFC 3SPGA 2UXCO 1SERA 1HRV3 1MQTA 1WB7A 3H7JA 3R4SA 3AK1A 4PDWA 3RNSA 1ZZ6A 4MSWC 1TNRA 3CS5A 5TISZ 4XFHA 1XNRO 1W6OA 4HYOA 3OMAB 2ZZJA 5K4LA 4CH4A 4Y5SA 4C8DA 4COYA 4MXWB 1POV0 4S2DA 5FY7A 3M8AA 3IMNA 2ZX1A 3WDUA 3ZXDA 2WNEA 3DXUA 4E27A 3I2DA 2X7RB 1KP3A 2VMGA 3ECQA 2DQ0A 1XU1A 2D40A 2HJFC 5L3CA 4B3SO 4CEYB 3MIHA 2WSVA 4S2HA 2JK5C 3AP6A 4QX7A 4PIXA 4X62O 4NHMA 1SKVA 4CUBA 2Q7EA 3SYPA 4J7JA 1NLSA 3W7XA 3V64A 1LNQA 2VNGA 5IYZA 1XNBA 3E2EA 3RVYA 5FPAA 4UOJA 3VBHB 1HRV1 5FKBA 2EILB 1OFNA 4EZHA 3ETEA 3OEEG 4L9BA 2WAOA 1CESA 4Q20A 2XH6A 1TVKA 4RR3B 4SBVA 1EYBA 3S6PA 2ZS6B 2R6QA 3ZRWB 2ZDIC 3V56A 5F2SA 2YUAA 3USSA 3VBOC 3O1SA 2BGCA 5C3QA 1K9MW 1E57A 2NYYA 1MNGA 3FB5C 3LDBA 1UOJA 2GP5A 3JD2A 3RYHB 5BXXA 4MT8A 4LUMA 4AHCA 3ZYJB 3OTFA 2VW0A 1QKQA 2HWE2 4V2WA 1VBC2 4CEWB 1PO12 5BR8B 1JJ2U 1HQLA 2WYSA 2E7TA 2GSMB 5CKQA 1N4CA 4LFAO 3WG2A 4YW4A 2DW4A 2JGDB 1VR3A 4IGPA 1FV2A 2FDFA 5JIUA 2WPDG 1N1SA 4L2NA 1FS0G 1VPHA 3ZSMA 5FZ7A 4LHSA 4D6RA 3JD0A 4YPJA 3WF2A 4QX2A 4AI2A 4HT1T 2IJKA 4MVSA 3POIA 4PBOA 4JYBA 1MEC2 2F66C 4NRQA 1TVGA 4TXWA 1R092 3SEPA 5JOXA 1UWWA 4NAOA 2UXBO 4IW3A 4AFBA 2ARBA 2IC1A 4ATEA 1M90W 1L1FA 1Q8IA 4LF8B 5ACA2 2WNUC 2OT7A 1CXZB 1D5AA 2QZ2A 4EROA 4BW9A 4QQ2A 2DUPA 3UT5B 2WA4A 2M7WA 4MGZE 3CRRA 5CB4B 2XGXA 2JGDA 4BHPA 1FMD3 5A7QA 4NO4A 4KNCA 1ZBE3 2QTOA 1FXZA 1ENQA 3PUHA 3N9QA 5EIBD 4C91A 4NIHA 5B1BC 1D4M2 5FJKA 5B2GB 3IAYA 2DU0A 1SPPA 3VBRC 2BOBC 2V4DA 4HAMA 1DU3D 4XBQA 5ABJC 1D4VB 3Q8AA 2DCZA 1DGSA 1NUKA 2Y6HA 3L2HA 4Q5OA 2BP6A 3UGGA 2VCMA 3WG4A 3AMPA 4A3ZA 3K04A 4JKMA 5FMBA 3CO2A 2XUMA 1YYNA 3B4SA 2D6KA 1XJAA 4NUBA 3F5WC 4K0KB 4GKJO 4FPKA 3S3WA 5CFDA 4CDUC 1WZXA 1FMD1 2E7AA 4A6OA 3EHBB 4GZ9A 5JCOA 1ZBE1 1GN3A 4OXSA 4LMFA 2Q0AA 5B1AC 1MZ6A 1KD1W 4LTAA 3CPWU 1Y9MA 1NQJA 5J1XA 3G4SV 2XT9A 2WO7A 4C0HA 1XBFA 4M3CA 4F6RA 1W2OA 3E5QA 1G86A 3WNKA 4QPWA 2YC2A 1GRJA 3K59A 4R7CA 4CP9A 1JZ7A 3AMHA 2AW9A 4QIWF 3ABKB 3OW2U 4XFIA 2YXYA 2WWWA 3O12A 4N90A 5FZ8A 2V72A 2Q5ZA 2CNAA 3RW0A 4I0WB 4J7ZA 2QM8A 3UKTA 1HN0A 5GONB 4H37A 2XVLA 4BK4A 3G71V 3K08A 3J4UH 4KQ7A 3IPVA 2P2KA 3TJTA 3ZSKA 1S0IA 4LHLA 4EKWA 2UYAA 2N05A 3SJAC 3MV01 4B1LA 2ITCC 2BWCA 3OGRA 2HWC2 3H9VA 4PBPA 5JWPA 2GMPA 2JG8A 2XTAA 4KWKA 1I5XA 2BQPA 4Y26A 1HNZB 1AR62 4MTXA 1N33O 2YFUA 5IFPA 3HB3B 1W99A 1BBT3 4N9IA 4OGQB 4KP4A 4DV6B 1YLLA 4CDWC 4COZA 4KU8A 1DTOA 1HNXO 3E83A 3ILNA 2ZXWC 5ANQA 4YYOA 4JI6O 4Q4V3 1AR73 4LR4A 1C57A 4DR3O 3RFRA 1KJLA 4MO3M 1HR0B 1WCUA 1OHFA 2ZD9A 3BYWA 1MACA 2EULA 1LEMA 3GWOA 1PNFA 2W6JG 3WB2A 1UKGA 3E6CC 4WFHA 4B3TO 2WNOA 5D1IA 1UYXA 1OCCB 3TXSA 1MS8A 2VBPA 2VBBA 2ZKNA 5F3IA 1WLTA 3B9IA 1BS3A 1SHWB 4X89A 4QQHA 2ZGOA 5KC6A 1F4HA 3CCQV 3ST7A 1MMMA 4NE9A 1GNYA 3NNJA 2H8PC 5T54A 2F4VB 3AKPA 2RDCA 3V0AB 1I5PA 5J09A 4QGLA 4IEVA 5FCCA 3ME2A 3VV1A 2DOSA 3CZUA 1PZ9A 4Q4V1 1AR71 1Q8OA 2MHFA 1OV9A 2A75A 1SMVA 3H8RA 2Y0PA 2D5FA 4FAGA 1SA0A 1RUF3 5GTHZ 4JQTA 4OZXA 2WSUA 1H1IA 4OVEA 3JCUZ 1O4TA 1N47A 4NTXA 1CAVA 1W04A 4BIZA 4CDXB 4XACA 3QO7A 2Z4FA 1ODNA 1RUC3 5CMUA 5IYBO 4JI0B 1OVPA 2WSSG 1NY72 3FX7A 1BLZA 4JI2O 4Y4YA 1WCQA 3K3WA 3FB7C 5A6XA 4Y1YA 4GX2A 4DV5B 5BNNB 1BEV3 1VBB2 2VQAA 3JU9A 2JDPA 4JAVA 1T6GC 2RMU3 4DUWA 3BUCA 3INAA 2D3RA 3MUZ1 4IEZA 2O57A 2OUJA 4AAPA 1V6OA 2C2AA 5C8CA 5ANNA 4MVUA 4YGEA 4X65O 1RFYA 2A6ZA 4BK5A 4P08A 4LH7A 4CXXA 1Y67A 1RUF1 4RS5C 4WZFA 1PVC2 1ZA7A 4XE9A 4PA3A 3EO6A 3HPNA 3KF5A 1B04A 1X4TA 1TGOA 3ZMOA 4E2GA 4M3CE 3W20A 1BQZA 1KDKA 2WLLA 2UUAO 1AI5A 5KWRA 1ZA4A 4BQYA 1RUC1 1EM1A 4ITCA 3ABUA 2L35A 1VBD3 4XAEA 4ZZ5A 3CXHF 2QQIA 4ZZ8A 3WQ7A 5FXWA 1S77D 4IV1C 4Z8BA 3M99B 3LOBA 4QE9A 4QPIA 3P30A 3BCCH 1BEV1 2V73A 4PLNA 2IW5A 2PMWB 2RMU1 2EZOA 5IY5C 2X6BA 3AG4C 4JTDB 3G7DA 2RE9A 3VD5A 1LHUA 1I94B 1IOAA 3WP6A 4TN7A 2BTQB 5IK5A 4EN8B 2JEXA 3PL0A 1VQ5V 1US6A 2OQ6A 1N3QA 4FFFA 3LIGA 5F2VO 1GFF2 4H55A 1I7FA 4Y22B 3BI3A 1DQ5A 1OPOA 4W4KA 4AK3A 1S1AA 1P7BA 1MS1A 4BISA 3VDBA 4UFIA 2R073 1I08A 3N9LA 3MPPG 4BXSV 1VBD1 1EAH3 5LZ6A 5EIBC 2FMLA 4U3JB 1ZX5A 1RC6A 3L75H 1ULEA 4LH6A 1XRUA 2C5DA 4R6ZA 2FL4A 4KWLA 4HLTA 3CJIB 3D4KA 3ASNB 4CZSA 3OTOB 5KMGB 3HKEA 3S30A 1RUD2 4LFCB 4JAUA 4LKSA 1RXGA 4DNYA 1YWKA 1B09A 1ND3C 2X8KA 3T1HB 2ZGPA 4QQLA 4GWNA 4I3PA 3PUIA 4RQEA 3KGLA 4RSUA 1V9PA 3HR0A 1SZBA 2YYOA 1LU1A 3VBSA 1M56C 1CZVA 2UWBA 4CP0A 3RQ0A 3ES4A 4Q4Y3 3O1TA 1RB8G 2QCSB 2X6AA 2DDUA 4X6QB 1RHI2 4L8JA 1I1EA 1VBE3 3HKBB 1PX3A 4YY3B 2R071 3Q4HB 4U3JA 5IVEA 5H6RA 1EAH1 1V0AA 1HV1A 4CCOA 4FM1A 4LKDA 5FYVA 2ENRA 4H14A 2MNGA 2GU9A 5KMGA 5JSRA 1GQPA 1A34A 4J6GA 2I07B 5BNQA 4RGAA 4GWMA 4QDRA 1KDMA 4AVTA 5H9SA 3JARA 1UCXA 1JU4A 3JD3A 4YZ3A 4FM2A 2LGQA 1JZ6A 4MGTA 1COV2 2BWAA 3WDWA 1E1QG 2EIKB 1UY3A 1W6NB 3DXRA 4P9YA 2VQUA 2FDJA 1WMFA 1Q8VA 4JI4O 1C8NA 4Q4Y1 2PAEA 3GCWA 1R1A2 2ZT9B 1TMF2 4GH4B 2V1DA 1VBE1 2WO1A 3ZRVA 1KKCA 2ETNA 4Z1MG 3SJBC 3VQYA 4XAAA 4RFRB 2FHRA 5A7WB 3QACA 3F2ZA 4OHWA 1TUBB 2LUWA 4OI2A 1WW7A 2P4VA 4DEVA 3A23A 4JGYA 1HRI2 3H8UA 2QNKA 1U97A 1EZVH 3AM2A 4A6SA 3K51A 2YZ4A 3U4SA 4KHPB 2AUYA 3A8TA 5JI7A 1NCRB 3VDDA 1O5LA 3JAKB 4AHWA 1AYM2 4GMP0 4JASA 1AYN2 2XBO3 2H94A 4J80A 1V54C 4QHZA 2BNNA 2BZDA 1PGL1 1IQAA 4YZ1A 2HP8A 4DRXA 1DQ0A 4Q4X3 1OCOB 4LUKA 3K79A 5CYYA 3ABLB 3BB6A 4QWNA 2VQFO 2HWF3 4PT6A 3A0KA 5FK7A 4X1IB 2NLJC 5FZ4A 2ZX3A 2BBVA 2A6VA 2D44A 4DXSA 5A2QN 5J48A 2FDGA 4W8JA 3AG2C 4QXBA 2RG4A 1WUVA 2D43A 2ZEWA 4B3NA 1S76D 1NYWA 4JTNA 1O3SA 1UIJA 4RR3C 2RS12 3OUJA 1GQHA 1R083 4ZU4A 2VQEO 1FKAO 4H44B 4DXWA 2X0LA 4D94A 3FE5A 1Q6HA 2YBPA 3B7MA 3VBUA 3J7LA 2C6SA 1FOD2 2XBO1 1YFYA 5L73A 2E53A 2ZMNA 1YITV 4NWWA 1X8EA 4LE3A 4UVCA 5IJ9A 2EVXA 4YW6A 4A3XA 4Q4X1 2LROA 3UO3A 1QHDA 4J10A 4CH5A 4CEWC 2HWF1 1L7RA 2UU9O 4DO0A 1MPXA 2PI4A 1TEIA 3BIWE 1K5MB 4LEJA 2UUBB 2IU3A 2VCBA 1MS3A 1JHNA 2AHZA 1SG3A 3NAPB 1G9DA 3ZIWA 2IM9A 1ZM1A 5BNOA 2A79B 1Y7BA 5KAIZ 5CA6A 3WXPA 1VF7A 1N1YA 2ZNJA 4AE2A 4OUSA 1GSLA 1PMJX 1R081 4BJ0A 5FO7B 3GDBA 3VZLA 1NU1H 2DVGA 1DCSA 1DQ1A 4LF5O 2ZHKA 4GULA 3MGUA 2DFCA 2BNMA 4IGQA 5GZFA 1W6QB 2JECA 3DC5A 2GN3A 3I3DA 3THDA 1VB2A 3E22A 2AYHA 1VEWA 3M3CA 1XYPA 5EJZB 3VD9A 4ZOLB 2WZEA 4GLXA 4XC9A 4KI5M 2F95B 3FJSA 1SQXH 4AILC 4JI7O 1QJEA 5IWFA 1O3RA 2E9QA 2B7YA 3D0JA 3I8TA 4AGRA 3AFKA 5A6QA 4R8HA 5FYTA 1L3JA 5JCOC 1UY0A 2Z2SB 3RYCB 3QH7A 5KAFZ 2QBXA 1XNQO 3ZXAC 4WFBV 2D93A 4Q6GA 1PO22 2B5UA 4XDLA 1XDCA 1F35A 3IB3A 4IHJA 2QM4A 4C1XA 1H2KA 5EYPB 2ARAA 2VO5A 3H0OA 4J42A 4XIOA 2C9KA 2W95A 5FZLA 3O5SA 3ZRSA 2WZR3 2WLKA 1OOPA 5C93A 4AR2A 1HP8A 1L0LH 2XAQA 4NPMA 2P3YA 5LHHA 4TTGA 2CU5A 2QDRA 2HWD3 1NZ6A 1N1TA 1MZEA 3POWA 4I2OA 2CH7A 1VALA 3WB1A 4O2AA 4O4HA 4HVOA 2VZOA 3T2PA 5K7PA 2XAHA 4QPGB 3USUB 5L3EA 5CN0A 2F17A 3LPGA 5BXZA 2HEPA 4BDVB 2I45A 1RMU3 5C3OA 2WO2A 3ABKC 2H3OA 2QUOA 3RWRD 3PLQA 2FZ2A 1VMJA 3ZFEB 2OS2A 5FKCA 1PIV3 1K12A 5JMCA 2QDOA 3KV4A 3VHPA 4JCKA 2WZR1 2X5IB 4CCMA 1HRV2 2DVFA 1Y74B 1RUG1 3SPHA 3N7KA 5L3BA 3J8F3 1ZRDA 3T2QA 3UGHA 4COWA 3DECA 1OPMA 5DEDA 1QWRA 4B3RB 4LFBO 1ZL8B 4O7XA 3B8NA 2HWD1 3SCGA 1ASJ3 2P22C 5JAXA 3CMAV 5D8AB 5BV6A 2JIJA 1UZ0A 1QJFA 3OEAA 2QWRB 2VM9A 1EPZA 3BAAA 5KUMA 5LA2A 1X7NA 2W2IA 3KV6A 5EP9A 5JIAA 1W28A 5JMOA 1J3PA 3VKNA 4YJ3B 3O1VA 4N7IA 4R52A 4FSJA 4I7ZB 4H33A 5LASA 1US2A 1VQPV 5CKNA 5B66Z 1PIV1 1JXNA 1WW6A 4BW5A 2X5IA 4OPAA 2Q8CA 4BAYA 1NCQB 4UBHA 1OCCC 1IS5A 1ZRFA 3I2KA 4L87A 1JOYA 5I0SA 4GKKO 3J8F1 3FL7A 2O14A 2XG3A 4UCTA 1NZIA 5FO8B 2BDRA 4D7SA 1S5JA 1ASJ1 2J1TA 1IX9A 3GM8A 4DR5O 3U1XA 4CSWA 1CIYA 1QXPA 5FNVB 3CD6V 3KLSA 2OZJA 2W47A 5IYDO 1JYCA 1WCSA 2CY6A 4YG0A 1F4AA 3ZR6A 4YRDA 1Q86W 4HNAB 2LW8A 1GP6A 3SC7X 4CXYA 2J7MA 4E4ZA 3CP1A 5C8CC 1O5UA 2DCJA 2W46A 3KGZA 1WWYA 2ZEXA 3ZN6A 5FP8A 4P00B 4PDVA 5A7PA 4GJZA 3ZPYA 5K0UB 5FDBA 4BQ1A 4FLVA 3OGVA 4BZ4A 4CDXC 4D6TH 2E74B 3D82A 1W6MB 3HAGA 1AUYA 2IVJA 1Q43A 4YXWG 1SEFA 2Q8VA 1H8VA 2WKKA 1UO9A 4P9OA 5A7OA 4ES9A 5FLJA 2R063 2ZCWA 3ZFFA 4GX0A 3GYDA 3W9AA 2XJUA 4TYSA 3VBFB 3MHZA 4I01A 3SKJE 2XHBA 2FKXA 2JGUA 1MSWD 4XFGA 4HNAA 1APNA 3NQHA 4JRLA 3ASIA 1QXJA 1JN2P 2AC1A 4K6BA 1UF2C 4YWAA 3OGSA 1LB2A 5BNPA 2LFRA 1F2NA 3KD4A 3A0RA 2PYJA 1CJPA 3KT7A 2ADDA 4ARYA 2XNDG 4I0AA 4G9SB 4TT3G 2XHKA 1FMD2 5AVAA 1KRIA 3B40A 1ZBE2 1GOHA 2RN9A 3TYJA 3T30A 3AG1B 4WVWA 3BTXA 2XLGA 1VMHA 2CTPA 3WF1A 4EB6A 4RWUA 4DR7B 3OGCC 3PURA 3MLLA 1DZTA 4OULA 4BU2A 2B46X 1ZBA3 3M3QA 2Z3YA 3LGRA 2C4XA 4K3UA 2R061 4JGZB 2VS0A 1O3TA 3SH5A 1S0GA 2H0BA 2PELA 4UI9L 2GUZA 4K8XA 3NJXA 1GNZA 1S55A 5J2TA 4XYXA 2ZGUA 1UYPA 4LHNA 2RS53 5IJ0B 2R9IA 2PY5A 1FXKB 2KR2A 4AWDA 4QPKA 4CYDA 4JYAO 2WWJA 1K3EA 4META 1BMV1 2FDIA 1DGWX 2OCCB 1SRYA 4TWKA 2VW2A 3HBKA 3ABZA 5JPNB 2D6NA 1YI7A 3LDKA 3ZBHA 1HB1A 3BTYA 5SV8A 4N7UA 4DINB 4OCTA 3VBSC 2EX3A 1DLLA 2EIJB 5FLHA 4DUZO 3R4DB 1PGW1 3O14A 2R30A 1N36O 1RYYA 1XREA 4Y24A 1GP4A 1ZBA1 4U2AA 1A78A 3V65A 3Q8FA 4K1YA 2G9FA 1H30A 1GU3A 1UYZA 1F23A 1NZCA 4LK7A 5LK7B 1YQCA 1BE3H 3ASNC 3GB7C 4GX5A 2R043 3MYXA 3NJVA 4RUEA 2EIDA 3ZMUA 3ROUA 2MK3A 4HK9A 5IJ0A 3RMYA 4TSFG 2OA2A 3D5OA 4FTSA 2RS51 1IS3A 2X29A 3LDEA 4MX3A 2J1VA 4Z92B 4TV9A 2E75B 4IEYA 4X66O 1MSDA 2ATFA 2Q7GA 2EAKA 1X50A 2BE3A 4RHV3 2BERA 2D98A 1W2UA 5LRRA 3CRCA 4NKGB 4QB1A 3CC4V 5FZ1A 4DEQA 1YFXA 1IG0A 2ZE6A 1RPOA 5IVBA 3ZXGA 3N3HA 2HVKC 4LLOA 3V0BB 1STMA 1IBLO 2W94A 1GKFA 4Y33A 1LAJA 3OD4A 1BBT2 1KC8W 1B06A 4UBGA 3OGGA 3H1MA 2ZGLA 4YW3A 1IG3A 1XNAA 4D69A 2BEOA 1W0NA 1LRHA 4NWVA 2VL4A 4Q4V2 4P9PA 1AR72 4HOOA 2D6OX 3I5DA 2VVDA 4JZRA 1FAYA 1IPJA 4EWEA 2R041 1FNYA 2A6XA 1AR83 4TQDA 5FMCA 3FB6C 2Q6AA 4IV3A 3VD4A 4Z07A 3W7SA 4TUYA 3CX5F 3DTUB 4JHTA 3AG7A 1HN1A 2ITDC 4HG6B 3B69A 3OBAA 5FR3A 1O8PA 1WA6X 2YROA 3OEBA 4RHV1 4LA2A 4XOGA 4IDZA 2QQNA 3JCZA 3OD0A 1PP9H 3ZJZA 2EIKC 4YVWB 1M93A 2QSAA 2W0XA 5IJRA 2OUHA 3LFIA 3RYIB 4QDQA 2YV8A 3EJKA 2DYRB 3GZTB 5FY8A 4X20B 2EIMB 2C26A 5EZYA 3K0GA 3HEIA 2LP7A 3I55V 2LM3A 1ZSPA 3RG0A 1OLMA 4K8RB 2QKCA 4FK5C 1W9FA 3CCLV 1AR81 1RUF2 1IBMB 1W8WA 3PUSA 3TN93 1OURA 3TBDA 3LA2A 1CPNA 4P30A 4AEJA 2FCVA 3L74H 1QVFU 1NCRC 1WPXA 3H9AA 3ZEDA 1RUC2 4CXWA 4Q8LA 3IDAA 4AQYO 5FP7A 4OUMA 3E5UA 3UM7A 3UNPA 4KBZA 3RDIA 3A0NA 4XBLA 5KXEA 5C6CA 1I3HA 1BEV2 4UB6Z 1QH6A 1QF3A 2RMU2 1K97A 5IFTA 1AL23 4X20A 1H2MA 2Y0IA 1Y4MA 2RVAA 1GTOA 4WBNB 4IESA 1WAZA 3CCSV 3N2KA 1OMIA 5EPAA 4H13B 1W2BU 3SYAA 2D6PA 4PLOA 4LF4B 3H8XA 2Y38A 4Z82A 4QX5A 3S3XA 5BNOC 4LA3A 4FO9A 3TN91 5APAA 1ZRCA 2W87A 2E6VA 3HIFA 4MZUA 1NXD1 4EZ4A 3A21A 2B1IA 2UXCB 4DV2O 2Q4PA 1VBD2 2MPFA 4FP2A 3O1UA 1D2SA 2H6BA 1FYUA 1V6IA 4WFEA 1ULGA 1JX9A 2ZKLA 3RZMA 3SYOA 4NIIA 1M1KW 1Y3TA 4MXVA 3UL2A 2FD8A 1W8UA 1R3JC 2LW1A 1QLNA 4XMAA 1IBKO 1LULA 1OI6A 1K42A 1AL21 1UJWB 1CAXB 5BMVB 3B5LB 2DVDA 2HG5C 1U5YA 4NHXA 2VNVA 5CA3A 3HR9A 3U11A 2E31A 5JJNB 1K5MC 4B4QA 1I5YA 5FZDA 3VD3A 3S7IA 3GGLA 1RUH3 2OCHA 3TWIA 4YJ2B 3HMYA 3NAPC 3K9SA 2G19A 3G6EV 1N34O 2Z0AA 3SPIA 4GCZA 2YB7A 2WNVA 1V6LA 3SPCA 2BTVC 5DUUA 4X62B 3O9OA 4KMQA 5FY9A 4UV8A 4PF5A 4Q0PA 5JLVA 1OH4A 2JG9A 4AVCA 1ODMA 4YIPA 2R072 2F23A 1XE0A 4SLIA 1EAH2 4K3AA 3K5MA 5JSOA 1NQDA 3B93A 4L11A 1SLIA 5JVDB 4WVMB 1YNAA 1VBA3 1CAXA 4COUA 3AJYA 4QHOA 1M4UA 4M4PA 1UIKA 2UXXA 4E2SA 1JFFB 4BH9A 1K73W 1SDWA 1YO8A 5GLVA 1AR4A 1RUH1 3AVSA 2Z5WA 1KD7A 1JUHA 4UUJC 2VZUA 2ZE7A 1F5JA 4RO2A 3LEMA 4AHYA 2ZQMA 5A1LA 4L0PA 4EWDA 2E5LB 5GLZA 3T4VA 3U10A 4DR1O 3ACFA 4Q4Y2 2B4KA 4CS2A 1QU0A 5F5AA 3Q9OA 1XQ8A 4LFAB 1FFXB 4I0XA 3Q8CA 1VBE2 1YRZA 2BOCC 1WW4A 1W3VA 3SNMA 5JH7B 4BQ5A 5HPOA 3N9PA 1QR9A 2O0OA 1ZTEA 2GALA 1OLME 5KXDA 4JX0A 1BVVA 1B35A 5DABA 1BHGA 5CA1B 3PUQA 5CG9A 3DKWA 4QKDA 1V9U2 1VBA1 2XUEA 3H50A 3T1LA 2WWSA 4F83A 5AFBA 4JDMA 3UJQA 1KS4A 1Y43B 1WP8A 2UXBB 4LXLA 1JS9A 4JYCA 3D8CA 1AJNA 2P67A 1WMEA 2D3OW 5JR7B 3SH4A 4O61A 4O4JB 1NTKH 1XXNA 4HXCA 5LHGA 4UWDA 1PGL2 2EINC 2RDQA 2K9ZA 4G2KA 3KZIZ 3P3NA 5LYJA 4KWJA 2DVBA 2HKOA 1H6XA 2GV9A 4AI1A 3KV9A 4PQ9A 1B3QA 4DYLA 1HX6A 2WNUB 3ICXA 1S5HC 3ZPOA 4R4XA 3AP7A 1SQVH 1R3KC 4LBQB 5JDBA 4FBFA 3SKVA 5FY5A 2IFRA 3GWKC 1F8VA 3OJBA 4B3MO 2X5IC 5EFUA 3VN4A 1VQ4V 3K5OA 4JV5O 3MIGA 5T5LA 1LR5A 5LXTA 1J1TA 4I4TA 4IE6A 5B1BB 4V1PA 3ZO0B 2BSKA 3VBRB 1ULPA 5FO9B 1GMGA 5D8AC 4K20A 3M7AA 4UCSA 4FLWA 3ACHA 1Q3EA 4YGDA 2XBO2 1N32O 5FZ0A 1G9CA 3B8MA 5B3SB 3ZSLA 5C71A 2DUOA 4HKWA 3J9SA 4XILA 2OWOA 5DXDA 4Q4X2 3VZKA 5FLXN 1BCXA 4FPGA 1KFXL 5H9RA 3LDCA 4GT1A 4AHXA 4GKJB 5J2UA 3NKTA 1V6KA 2HWF2 4AQSA 3W7UA 3SGIA 3RYFA 1N0JA 2OT5A 3KM5A 2VMHA 2ID4A 3S0MA 2VOTA 4HANA 3DKQA 3OM3B 3MW4A 2P6HA 4DV1O 3SCHA 4LORA 3ZKYA 5J37A 3FC0A 1NCQC 1MZ5A 1QHTA 1AVMA 2D7FA 5GLWA 2XJRA 2OIGA 4FT8A 1ZUQA 1RP3B 2RCVA 1XPWA 3AKSA 3LEGA 1VAKA 5B1AB 1IXBA 4BQ3A 1R082 1R6TA 1QNWA 1WLDA 1VLNA 1NKDA 3MUY1 2IH3C 3PVNA 3AG3C 2BUKA 5LBCA 5FYBA 3FUQA 4KGGA 3ZFFC 5CU1A 2A3QA 4DK1A 2DTYA 1LOBA 3WNPA 1AXYA 3JD1A 3LD8A 3MLKA 1PNMA 4GIQA 4YW7A 4XJ8A 4E4EA 4AQTA 4MVOA 1ZRIA 2LW7A 1N33B 5BNPC 4XHXA 5CAZA 4AVBA 4L97A 1QJZA 1ST8A 1QGLA 1KQRA 4G3YC 3M7MX 1YIFA 5IHRA 3P5BA 4YFZA 4LWSA 4O4IB 4PV1B 1YZBA 1HNXB 2WAMA 2EIBA 5GZCA 4JI6B 1G4YB 4LBEC 3WOGA 4M3CF 2HLEA 4MV2A 4DR3B 4C7UA 1SACA 4ASKA 1SC5B 3BRCA 4OPHA 3I59B 1ND2A 2J1SA 2HWB3 3HKDA 3HN3A 3KCXA 4B3TB 1OLQA 4KG8A 2CK3G 1SFPA 1R73A 3B9CA 5K1PA 1UZZA 1CAUB 1R3IC 1HDKA 4M0NA 5A3LA 4N21A 2X05A 4RQPA 1NXMA 2JE7A 4Q1PA 3R0RA 3M3OA 4CDQB 2J42A 4LE4A 3T0DA 5GLTA 5L7OB 1QMJA 4HONA 3MLJA 1GWLA 1VF5B 2W92A 4XMIA 2WLIA 3MD0A 3SQOA 2ZPXA 4WZCA 5T5OA 3AG1C 1I9RA 5FAXA 1KB9F 5C3SA 5LBQA 1JW6A 4HSJA 1ENVA 1PZ8A 1US3A 5F3EA 5C3PA 1RJ8A 2EICA 4DR4O 1VIWB 4YVSA 2VTFA 2HWB1 2RHPA 3ZMVA 5E8AA 1K4CC 2VXJA 4JGZC 2ZAAA 2HEYF 5JQGB 4FPEA 1YJKA 4Q4W3 4QM8A 2AHYA 1LHOA 3QD6A 3PN1A 2WZR2 1PKXA 4JI2B 4CS3A 3KS7A 4LQRA 4NN0A 4EN7B 1TA8A 1SQBH 1BXHA 5C4WB 2OCCC 5H5NA 4B8EA 5FLIA 2ZGNA 2HWD2 1H2SB 4FPPA 1A32A 4YARA 3BVCA 1H9PA 2UWAA 4GQ7A 3E6BA 3OY8B 5JXGA 1AJKA 4LPLA 3OPWA 1AP5A 3JQWA 5EJ1B 5KHGA 3H8OA 4ZU7A 2BV4A 2PZSA 4X65B 2EIJC 1S0CA 1D0GA 2KG7A 5LATA 3ORJA 1X33A 1UL9A 3OUFA 1RMU2 1U0AA 1GLHA 3OPZA 1U96A 2YI9A 2W1WA 1BYHA 2I74A 4EQVA 2UUAB 1WD4A 2VGDA 4WM8A 1BK1A 2YC0A 1X36A 3I2HA 1K34A 2VOKA 3NMBA 2GH2A 1PIV2 3C3VA 4Q4W1 4XUTA 5C9AB 3K5LA 4NYKA 2AACA 4IV3C 1Z5WA 1WBFA 3NNLA 3J8F2 1GM8A 1ULFA 1UZVA 3H3UA 3OT7A 2RM23 5LL6Y 5FZCA 1GOFA 3OY8A 1ASJ2 3MW3A 2RJKA 1LTEA 2JJ2G 4IV1B 5EZWA 5IDJA 1XILA 1VE0A 1TAEA 4MGIE 3ZFGB 1PL4A 2WLJA 5FPUA 4XFBA 4HETA 2XXZA 4URAA 3F5TA 1A6CA 3N4MA 4XUPA 4Y20B 3AG4B 2IXHA 3NV1A 3WG1A 1MOFA 3BGAA 4FXGB 3LZZA 4MVTA 4I55A 5C9AA 1Q90D 2JENA 1K5SA 2AGSA 1C1LA 1XUQA 1AXKA 1UY1A 4FFGA 2DWDC 3AKTA 2V4AA 2F6BA 4JYYA 5FPOA 2Y34A 3B94A 4GD4A 2RM21 1TG7A 1IPKA 1G9FA 3HVDA 2DMXA 3ZHRA 4X1KA 1W2TA 2ZX4A 3FFQA 1VIBA 2PYLA 3EB7A 5FPZA 4YIOA 2WFF3 2CGPA 5SV5A 3AXEA 2ZNIA 2DYRC 5IK8A 5K1XA 2EIMC 2ZCEA 3C2UA 1H38A 4XUOA 2DURA 1DK1A 1XOYA 5FZ6A 4ABMA 5B4XA 2UU8A 1ND3B 1AP6A 3ZHSA 3JD73 4J7KA 3ZDVA 4S2FA 1BJQA 3U37A 3CE2A 4OI0A 1J58A 1RVF2 1UOBA 5LP6B 2R1BA 4RGKA 4YGCA 3ZMTA 3AXDA 1KS5A 3CDZB 3EYPA 5BZBA 3SISA 2QQWA 1RSOA 4FZ1A 1WP7A 3R05A 1RUOA 4QB6A 3DPRB 2HR3A 4QQOA 1SQPH 4LC1A 3DL3A 4N23A 3VL8A 1AROP 3GJAA 4MHRA 1SFYA 2R062 3RI9A 4ONUA 3JAWB 4B08A 2XAGA 3OGJA 1R1ZA 1VQMV 1YQ8A 3H3LA 2CWMA 4JGSA 2WFF1 1J59A 4FLTA 2HVJC 1L8DA 2Q73A 1V6JA 3RS6A 4XUNA 2EF6A 1MQTB 1C5HA 1BMV2 4PDWB 2VG9A 3JD71 2VBDA 2YY1A 1LOAA 4L99A 4JI4B 5FOBB 2P90A 3J7AU 1HW5A 2ODMA 3VDCA 2L6LA 2GNDA 1MVQA 1W6OB 4N8MA 3URFA 3OTOO 3FZ3A 3L2YA 1JJOA 1DGRA 3BOPA 2ZAHA 3EHKA 4MGYE 4GZRB 1GO3F 4DK0A 1WD3A 3AYCA 3N9OA 2HLDG 5CBGA 1PGW2 3VKFC 1Y76B 3RBZA 4FXKB 2OYQA 3CMGA 5FBJA 2CE4A 1SDDB 2E26A 1ZBA2 2ADQB 2NNUA 1Y6XA 3AMMA 3B01A 1E79G 3MFAA 1GWKA 4AOCA 1DGRN 2B9VA 5A3OA 1EN6A 4PF1A 4N53A 1TME3 3DGEA 2YPJA 2BOIA 4HK8A 5IYZB 2RS52 2WN2A 4AI9A 3L70H 3B2EE 1AI6A 3JBG3 4EYUA 2EJ7A 1QCEA 1LOEA 1QNYA 5LA6A 2XQXA 1DLCA 2CTVA 1TVKB 1DP0A 5A3PA 4YNIA 4UF0A 1UU5A 4AVAA 1JTZX 2VQFB 3LSEA 4P9WA 4QGPA 3KSCA 1A3KA 1OQDA 5JOYA 1V54B 5IE9A 5KHKA 2WC2A 5FV3A 1Y76A 3K75B 4JHZA 3M70A 1MABG 1YXBA 1PM9A 4NOTA 2P6JA 2GMMA 1BMFG 4MGKE 1ACCA 3NVCA 2ZZQA 5EC1C 1W0KG 1ULDA 2PHWA 2W1UA 3KVBA 1CPYA 2DYSB 2VQEB 4WVZA 2R042 4HSLA 1W0JG 1TME1 3RVHA 3AG2B 3ZKUA 3ILFA 4DIQA 5JOZA 4LO4B 2QQMA 5CADA 4O2BA 4NXNO 4DMIA 3ZCCA 1H8EG 1S2KA 3JBG1 1JVMA 3NSTA 2WS93 1HB4A 4B4RA 5AVPA 4RHV2 1UYYA 1MZFA 2XOMA 4DV7O 3VOUA 4A44A 1OLRA 1QOOA 2WWUA 3W7WA 1XSQA 2UU9B 4CBCA 1AI4A 2CDYA 3ETPA 4KXRA 4X8PA 3Q8EA 4UVAA 5HFLA 3N7MA 1QJU3 3N36A 2DBNA 4HZFA 1SLCA 3RZGA 2WBKA 1ZREA 3R65A 5E1RA 2OTJV 1PK6B 2GMEA 4QX0A 1DQ6A 3BN6A 3FLPA 4CVUA 1P84F 1X59A 5IK7A 1AR82 3JCIA 1L7LA 3FKSG 5J96B 2YU2A 4CUCA 2JS5A 4LF5B 2CV6A 3MPBA 3ASOB 4J9YB 4ZKTB 2XJVA 5HXVA 2WS91 1SPPB 3BA8A 3C90A 4PDLA 3S7EA 1W8NA 4CCCA 4LIUA 4PHZA 3WQ0A 4M01A 1SS3A 2ZOEB 5CA0B 2VC9A 3KT4A 1L7QA 5GZDA 4IQPA 3O1RA 4QXHA 4JI7B 4UVBA 5LOVA 2WL1A 2W0FC 5FUIA 4LNVA 3STZC 4XJWA 1QJU1 4BM8A 4EJRA 5C5UA 4D0QA 5H6QA 2Z5UA 3ZXJA 4GA9A 1XSRA 1PK6A 1JOJA 4X64O 4GUNA 4PA7A 4QQPA 1QDOA 4LBJA 4LKFA 5EYYA 1XNQB 4F4LA 1R6NA 2UY9A 4NROA 2R0FA 1SQGA 5DN6G 1S3JA 1YXWA 4K8FA 1IDSA 4GAZA 5CFDB 5JCTA 1BCCH 4FFBA 3BA9A 3TN92 5FY0A 1PNLA 4E4DX 4BMBA 3ZVXA 2P3KA 4CE8A 2CL2A 3MW2A 3P6BA 1E5SA 4PA4A 3ML0A 3C7OA 3PTRB 2P3JA 4M3CB 4F6RB 5CA0A 2WA3A 2FQPA 3VKLA 4CP9B 5B3SC 3WP5A 2KQXA 5B4NA 1J5EO 1VRH3 3DUIA 5FP4A 3VZMA 4XF0A 2YBKA 3OMIB 3EMRA 4XBNA 3UESA 3NV3A 3GCXA 1J1LA 1TQ5A 1C4RA 3OOXA 1UZWA 5EBMC 1AL22 1S2BA 2Q1ZB 1PM7A 4JI1O 3CC2V 1LOFA 3AYEA 1S0BA 1H8TB 2E76B 3I54A 2VVEA 3IPVB 3HT2A 2GC1A 1DQ4A 4UFHA 5HCAA 3N9MA 2WZPP 2Y60A 4CU7A 2XKOA 2IZWA 1WLWA 1UNBA 4KL1A 5J36A 2JG8B 5FYYA 5FZOB 1KGYA 4DV4B 5LMNO 4INDA 2VWJA 5AG2A 3ATGA 4Y4RA 5IT9N 4UCRA 5GZGA 3ZS8C 2DYCA 1Z7S2 4I0BA 2VTXA 5FRAA 2W1QA 3ZN1A 3GHMA 4FMTA 3WNLA 1F4NA 4KBBA 4DPNA 1VRH1 4LFBB 5FBZA 3GZAA 4B4PA 3WCRA 4MTFA 2VZVA 5ITZA 3E35A 3FYEB 4NMIA 4E8CA 4K7JA 1JYTA 5DUWA 4CU9A 3I2IA 1H8TA 4NTWA 3WDXA 3WW1A 1RUNA 3WG7B 5A6YA 5DAWA 1H9WA 1RUH2 3I7DA 3QO8A 1AL0G 1RXFA 4PCRA 2OIIA 3WEZA 3QLQA 4PJYA 1QVGU 5FZOA 1G7YA 3VBOA 3CC7V 2KSDA 1AJQA 3R66A 4MOAA 3FAVB 5KA5A 5C8YA 4CP2A 2A1XA 2FZ1A 3S5QA 4H2AA 1QIQA 1R1BA 4U7OA 1W05A 4CCJA 3NJYA 3VZJA 4GKKB 4UCUA 2KM2A 3OYWA 3N2GA 3SMHA 2V5DA 4JC1A 4XVHA 3OUSA 3I4IA 1VBA2 4XJZA 2CSGA 1SA0B 1GYKA 4F6EA 4IEXA 4CDQC 1F9KA 4DR5B 3MV11 5L7OC 4NTYA 2PHTA 4Q0VA 1CAVB 3PIGA 5L36A 1Q56A 1GK9A 4DXTA 2LO1A 1ALYA 2P7TC 3HQRA 2DWRA 4YM2A 3IN9A 4XBFA 4R9CA 5G04L 3AK0A 5EQUA 2ZBJA 2CTQA 4G4FA 5FZAA 3IC7A 2QQPA 4IIJA 1BKZA 1EP0A 3U78A 4CH6A 1DZRA 3FD9A 2GTSA 3M4FA 5B1OA 3FAVA 2QWOB 4QDSA 3VDAA 1XMOB 4PIYA 4CCEA 1NQTA 2JKBA 4BA6A 3L9JT 1C5IA 2VXRA 4LBLA 2AH2A 4P9GA 5CG8A 1SBEA 5DAPA 5C8CB 2XMLA 1JOPA 1D0HA 3W7TA 1AX2A 3IZOA 2RDRA 1N8RW 3OFNG 1HQWA 1KEXA 1UZYA 3WF0A 1V6MA 5L3FA 3S5AA 1JOBA 3E6DA 4N43B 5C4WC 4CA9A 2C1FA 4NIGA 4O4LA 4XXPA 3U75A 2WLLB 4X1YA 3PMSA 3JQXA 4DB5A 3T3YA 5L9RA 3JZVA 3M3EA 1CR7A 3CCUV 1FJGO 5ABJA 1WJZA 3GBFA 2E3CA 2AZ2A 2A3WA 1Q7YW 4GMP3 5LA0A 3U4XA 3AP9A 4QPIB 1CX1A 3IFXA 4OMCA 1EV13 4AW7A 3MDSA 2J1UA 3RZKA 5KHIA 4ZI7A 3I2JA 1W06A 1DF4A 3MF9A 3ZXEA 3WFVA 1X9PA 1H1AA 2ZGKA 2ZEZA 3LIHA 1ZYBA 3JASB 3NR7A 2X53S 4BYYA 5C9AC 2FB5A 5FREA 2IXCA 1UXXX 5DUVA 1HB2A 4CDUA 4N43A 1RPRA 5LGTA 5IWAO 4P9JA 2EIEA 4JAAA 4FFHA 5DZEA 5CIRA 3AKRA 1QEXA 5FXVA 3H3ZA 3IIIA 1GN4A 1F4MA 4JYAB 3WNOA 1UPSA 4PIZA 4MS2A 4GMP1 4DV3O 3ZFGC 2A6YA 1V55B 1EV11 3LQCA 3HKEB 1KBHA 2V7QG 2YIBA 2HH9A 3JASA 3SHRA 2YMZA 4QB2A 4W50A 4DUZB 1HKDA 1XB9A 3DSQA 4LP8A 1N36B 4GKYA 2WIIB 3IMMA 3OEHG 3H7YA 2F43G 1HNWO 3IAQA 5EIYB 2A0LA 1E1RG 1CAWA 4M00A 1WGPA 4LCUC 2QWPB 3NL1A 3VBSB 2VAUA 4X6RB 1S2EA 4NRMA 3K03A 3U07A 5A7SA 4M4RA 4FPYA 1HJFA 3OB8A 2XHNA 4BE3A 4GWIA 4CDWA 1FAFA 3X2QB 1IZ3A 4DUXA 4X66B 5CBHA 3MIDA 4IEPA 3D6EA 1LUWA 1YQ2A 2QE3A 5DAQA 4IE0A 4A45A 5C5TA 3KQRA 2QKDA 5GALA 1IQDC 1UW8A 5IK4A 5FPVA 1QNMA 3E89A 4NHYA 3UV9A 1IBLB 3JARB 5LP6C 2UWCA 5IUQA 3NXSA 1PZ7A 1UOFA 1EY2A 3K57A 2PGGA 4XQDA 4QU1A 1BVP1 5GW7A 3VKOA 2CTWA 3OR6C 3DXRB 1NVPD 1W03A 4B7KA 3DPRC 1RIRA 1GZWA 1EPWA 1L0NH 3RWKX 2VNRA 3N35A 3F7YC 4WFAV 1RINA 2HWB2 4NHLA 1OA4A 3AK3A 1NAEA 4IEWA 5A9GA 3GF6A 3JATA 4XABA 4FFKA 1YC61 1AI7A 3L73H 1G8MA 4BQ2A 3IT8A 4I30A 4OI4A 4JGYB 5DUXA 3ZN0A 4HPKB 3HKCA 2OQ7A 3ZMZA 1MQTC 2ZXQA 4PDWC 1THZA 4NRPA 5LBFA 2DJVA 1WCDJ 3N7LA 3VDDB 1QLEC 4DV0O 4FCAA 1DIWA 4BMEA 2CTRA 2D3SA 4HZ3A 1ZNPA 2XJTA 2NR5A 2JJ1G 2Y6GA 2YXHA 3IJ4A 2Q1MA 3P3PA 3TK1A 4AXOA 4YSFA 4W4ZA 4DRXB 4P9LA 5FPXA 3THCA 4E2QA 1RUI3 4C0BA 3CLPA 2JD9A 5LMUO 4QPJA 5A6ZA 3AKQA 4QU2A 5A1FA 4IGOA 4E8DA 1U5XA 4UW4A 3E8FA 3IDBB 4Q4W2 5LHIA 4DR6O 2XPJA 4HPKA 4LOSA 4AQYB 4Q0SA 4BCUA 3MIBA 3ZYIB 4WBBA 2UY8A 4JVAA 1T5EA 3FN9A 2YSUB 2WDBA 5DZGA 1BZWA 3KG2A 3RI8A 2Q67A 3MIFA 4QXKA 3K5NA 2EXHA 4WCEV 4ATFA 2RMKB 2DUQA 2DCKA 3K48A 3VBUB 4B1MA 4Y5Z0 3SDLA 4YHHO 3K3NA 3AK2A 5IJ9B 2WRAA 1M57B 4J9ZB 2YG0A 4MW8A 1D5NA 5FZGA 3UKMA 4DW0A 4RA0A 5TSWA 4YZ5A 3RYKA 1RUI1 4AFCA 1JYVA 3M8LA 4BWOA 1UMIA 1MG1A 3DV8A 4XJAA 4HMZA 1OQEA 3CEIA 2DYSC 3T2TA 4X8AA 5FXXA 3WUDA 2ZACA 3JALA 3TRSB 3SH3A 1OBNA 3BTZA 2UUCO 4DV2B 2GC3A 5BYNA 4ZIBA 2XJQA 3VB9A 5CISA 5BNOB 3E8BA 3BCWA 4KG0A 1IS4A 3PVOA 2C0ZA 3ENRA 1IBKB 2K2SA 2RM22 2K0GA 3K77A 3KZ4C 1FD9A 2WINB 5A70A 1QJX3 3J81N 2ZM6O 2YIBD 3QH6A 3ABTA 5FY4A 4QJFB 2Q8OA 2CAVA 1IXMA 1H2LA 1CZSA 1WA8A 2PAMA 4F8AA 2XVGA 3E22B 1N34B 1PK6C 2VUJA 2P4EA 1CX4A 4LIVA 2QGNA 4OQ8A 4XFCA 3E86A 3O1MA 4J11A 5E79Z 1BHBA 4LF7O 1U5IA 4PI2A 2GH8A 1V6NA 1NBMG 2Y8KA 5GTIZ 2EZPA 4AQ2A 4KU7A 2UXDO 1OJHA 3KV5A 3ASOC 3OG2A 3ACLA 2DWEC 3APOA 1CP9A 4DW1A 3WW4A 5C7GA 1YI2V 4KGQA 4MVMA 5H9PA 4LF4O 3OR7C 4MTOA 3LNNA 4IHJB 3H1WA 4GWJA 2Y69B 2VOWA 1QJX1 1JCHA 1WA4A 3T2MA 5F2WA 2JD4A 2WFF2 4BQXA 1Z2GA 4I50A 3CCJV 4XXAA 3OBTA 1PNGA 1FXHA 2QVSB 5EWSA 1JI6A 5T5PA 4HL0A 3PVBB 1REFA 1UX7A 2PXJA 1OOPB 3BKZA 2GNBA 3JD72 2VW1A 3NNGA 2DE0X 5DN2A 4DR1B 1UMHA 1CD3G 2ZINA 2P5OA 2YU1A 2YI8A 2RV9A 5EYXA 4JQRA 5F6KA 3VHNA 2CAZC 3DC6A 5CFDC 4A7ZA 2CH7B 4O2AB 4O4HB 1R3LC 1NLRA 5JR2A 5K9YA 2DVAA 4FM0A 4XF4A 1MR5A 2M6YA 5FZBA 4QAWA 4B7EA 4MG2A 2JIGA 1HW7A 1SLAA 3APBA 1DZQA 3ZSJA 5AFEA 2W39A 1AX0A 2AGAA 2P5BA 5C3RA 1QJY3 3ZIXA 2VCCA 2J1RA 4O65A 3JAMN 3I56V 1XQNA 5EBWC 2YGMA 1BHAA 1H8TC 1QOTA 1RUG3 5E16A 2KXLA 5JXHA 4Q27A 2D2CB 1H6YA 4AI8A 2R1DA 1XNDA 2VPVA 4A4AA 4C1WA 3UJOA 2V5YA 4EEQA 3NV4A 2D6LX 1HB3A 2YC4A 4W6XA 3D0SA 2JG8C 4CC6A 3LDRA 4UW6A 1AVBA 4FLYA 4IUGA 4MXWA 2VECA 4RYDA 1N3OA 3ES1A 2EINB 1LODA 1PHMA 1RUJ3 1W3XA 2WFPA 3THTA 4HFSA 1H4GA 1O3QA 1URFA 2WN3A 4PLMA 4B3MB 3HNBM 3JSLA 2Y33A 4FPHA 3IM0A 1J3QA 3AYAA 1VJ2A 1K4DC 4CEYA 4JV5B 5FYCA 1XMQO 2O8QA 2TNFA 1OCRB 2B39A 4XDQA 1YIPA 5DAXA 1GNHA 2WT2A 2PQQA 2E5LO 1XNCA 2BGPA 1QJY1 1TME2 3BALA 2E63A 2W52A 2QFEA 1D2QA 2JRIA 1DYKA 2W5FA 2VZQA 1N32B 2ZGTA 3BOWA 2R0HA 3JBG2 3VBHA 1LENA 3POGA 3WG7C 1G9AA 1Z5VA 4LHKA 2R49A 4XFAA 4RR3A 2J1EA 1EUTA 5FOJB 2C9AA 3AMNA 4J25A 3ZRWA 3SLIA 3IDCB 4AVVA 3RT3C 2YICA 4XJUA 3AZZA 5F5IA 1S0VA 2Q0OC 3RYHA 4DV1B 4BIOA 1RUJ1 3HPLC 2E32A 3BABA 2NN4A 1K5QA 1ENXA 4OMDA 4CEWA 2Q9LA 3BU7A 3WHTA 2RS33 2OPKA 3ZN6B 1A8MA 2BBAA 1TNFA 3ABMB 5F32A 4AEDB 3ETDA 3AMQA 2HFEC 4K8ZA 1CPMA 1ZRRA 3VLBB 4DY3A 4M0HA 1VMGA 2WS92 1XL6A 2LRPA 4N9HA 5A3NA 1W59A 1EUUA 1RUE3 1WPBA 4JKLA 2QQJA 1NR1A 1JA8A 2SLIA 4ZU5A 5DECA 3AG3B 3MFCA 4A42A 1VB4A 2OXBA 1O91A 4CUGA 2DCTA 3ZFFB 1NOVA 4XDKA 3IKWA 1OT5A 2A7AA 3MEPA 2CWSA 1QJU2 3BHPA 1W0OA 5F8PA 4LJHA 1GKBA 3HWJA 3K2OA 4X8NA 2WZ8A 5I93A 2NMOA 2OYZA 3WCSA 2PTMA 1KJRA 4R50A 1GZTA 2QQLA 2YXLA 3CSXA 5BNPB 4XCAA 3TGUH 2RS31 3UT5A 3LSQA 3RRDA 1ZX3A 2HHHO 4RAIA 1KQSU 5FJHA 2FBEA 1WBLA 4GALA 4AEDA 3O0XA 5CB4A 4I09A 4N43C 1PMHX 2XLFA 2G1MA 1ULOA 2QWQB 1FX5A 3FHIB 5FMOS 3LEIA 5GKAC 1VRBA 1RUE1 1XNKA 4HBNA 5J98B 4EB6B 4FLZA 2PHRA 2VZPA 2TEPA 1LR1A 5G05L 3N9NA 2PYTA 1UXZA 4JRAA 1GN2A 4NXMO 3LDDA 4QPIC 2GUZB 4P2ZA 1W9TA 5F6LB 4AFDA 5A1AA 2HEWF 5J2TB 2R9RB 4R4ZA 4AVSA 4YM3A 3GBWA 3ACIA 4MVQA 5E1AC 5B5EZ 2VD7A 1DYOA 2JDYA 4GJYA 3D36A 1VP7A 3GBGA 4K35A 3WNNA 3QO5A 1AF9A 1YI9A 4DR4B 5IVJA 2QQOA 4UV9A 1CQ9A 1LU2A 2PUSA 1LOCA 5JVVA 1LKNA 1UU6A 4OFGA 3J7NA 3CMEV 2IJHA 4E4HA 3TAYA 4L8QA 4DUYO 4QX1A 4YLZA 2WO3A 5A3UA 3A0BZ 4JI3O 4FPCA 3KQ4B 2VE1A 2WQ8A 2B9ZA 5KLVH 1Q5OA 3I3EA 1IVSA 3OSDA 4OLLA 5IAVA 2NPIA 2VZ3A 1MS5A 1OVSA 1JHJA 1K45A 1GAXA 2QE7G 2VH9A 4OQ9A 5EV7A 2P6CA 1EFRG 1MVEA 1NLQA 5DZFA 1CEZA 3CBNA 5JXIA 4HKOA 1VRH2 4KFMA 4AEMA 1DLBA 1G6NA 3PIJA 4FPLA 1V55C 4FI9A 4ZHQB 4MSVA 4DRVA 5GONA 3HD8B 1DGWA 3VHOA 3FFZA 1YIJV 3CEWA 4TV9B 4FAHA 2HJDA 3LF7A 4YG3A 1R6KA 2IWGB 5EJ3A 4E9KA 3A2FA 1SCSA 5IVCA 1OCZB 4ZONA 1W9WA 2QJ1A 1YUDA 1ONAA 1TUEB 4QD2A 4IEQA 4MW3A 5JUVA 4CTEA 1JMUB 5KUKA 3T2OA 2JJ6A 1W9SA 2IUWA 3H1HH 3ZHUA 1BBT1 2IH1C 1AJOA 4AYUA 4X88A 3N7JA 4OX9O 5LGUA 4ZHNA 4C90A 3X2QC 2D5HA 1FATA 3ZXLA 3DCQA 4D6SA 5GM0A 3THPA 3GALA 2JE8A 4AI0A 1O8SA 3R6SA 4IL6Z 1I0HA 3CXCU 1IKPA 4FTEA 4ZHQA 1BGYH 3E97A 4RUFA 3SR2C 2YXSA 4J1XA 2BTOA 1GWMA 5DPNA 4XDOA 4IV3B 1C8M3 2O1QA 1SQ4A 3POSA 1NT0A 4MGSA 4TUYB 1T2XA 1XYOA 3QF7A 4ISRA 1PD3A 4BIFA 2UXNA 5JOWA 5F3CA 2GNTA 2ZR3A 3EVKA 3CF6E 1IURA 1W6PB 4LF6O 5AC93 3T4DA 5KXCA 4G28B 3KT1A 1W8OA 4LK6A 1S4CA 3NW4A 4HVRA 3SYQA 3V0AA 4PJ0Z 4K21A 5CBLA 5EZYB 2YPDA 2KB1A 2Y26A 4H0LB 2BOJA 3RZZA 3TNPB 1ZWIC 5IYYA 2MEV3 2B42B 2Q7HA 2CUGA 1NG0A 1WKYA 4JGYC 2NP0A 2P17A 5GLUA 4JZGA 2ORZA 4QM9A 1LJ7A 4W65A 4A7YA 1C8M1 1AXZA 3H1KH 4CDXA 3D3IA 2WYFA 4IEOA 3VDDC 4UFMA 1GICA 1ORQC 3LA3A 2HKXA 2LFSA 2PHDA 4CU8A 1AB3A 1W6PA 4UXNA 4DR2O 5JI9A 1S0FA 3K4AA 1HJGA 4FVVA 5AC91 3CU7A 5BNNA 3WU2Z 4LO8A 3RMXA 1DF0A 1XYNA 2QA4V 3D3AA 4MLOA 1W8TA 4ASLA 1AR93 3A7QA 2CGOA 3LKJA 4OZOA 3LFMA 3RYRA 3W5MA 3VL9A 5A3MA 2JS3A 4XDJA 3N2KB 2ARXA 5T3NA 5FUPA 2PAKA 2MEV1 2IXKA 1LGCA 1GV9A 1MS4A 5FXZA 1PPJH 3FHQA 1SBFA 2N04A 5FFOC 3X29B 2GSYA 3CHXA 1KUQA 4XDPA 4UCVA 1VQNV 4NPRA 2XONA 4E2LA 1ZZBA 3H42B 3WB0A 1BSMA 5L19A 3KMHA 3VBUC 2DN9A 1K92A 3LB9A 4B29A 2VU9A 4BR6A 4QHBA 3QOPA 3AP4A 2VZ1A 3ACGA 3ZXKA 1M57C 3EXUA 2Y6LA 4YGBA 4PQQA 3LNMB 3H1JH 3T09A 1EV12 1JYNA 5HCHA 2BFUS 1AR91 1LHNA 1YJNV 3OMNB 5F9TA 1NA1B 1VQ6V 5J7MA 5IVYA 5IT6A 5FIXA 1NTZH 4XURA 2VMCA 2LTNA 3UQ8A 3HNYM 1W8FA 5FPLA 2BTQA 2ZX0A 2QR4A 5FWEA 2FMDA 4AEKA 4IE4A 2R32A 1G9BA 4NPLA 2WNVB 3TEZA 2Y4UA 3ETGA 4UFLA 4Y22A 5FZMA 2ZMLA 5I8SA 4EFEA 5FL7G 2H6CA 4WM7B 4IGGA 2JG9B 2K1EA 5FZIA 4JI5O 1QY4A 1HXS3 1UOGA 1XL4A 3VKMA 2XQRA 1SF9A 3OAAG 2BJSA 4RL7A 1X8MA 3PVEA 4FJCC 4OYUA 1YJLA 1XNRB 2QQVA 5EC2C 3C7FA 1F5FA 5HCBA 3CJIA 5FYMA 2Y6FA 1V9U3 5FYIA 1NA1A 3CCRV 2EA7A 1BQPA 2A7WA 2Q5TA 3MHHC 3AL6A 3JD4A 2D97A 2JDAA 2PHXA 4LF9O 2Y6JA 3ZR5A 4Y1ZA 4B3SB 2XKPA 4F3JA 3VZNA 1YSCA 2PQSA 4URTA 4JI8O 5CKMA 5JJEB 3LUTB 3PNAA 1O6UA 4WM7A 3UETA 4I0XB 4NXNB 3HKBA 3Q4HA 3I3QA 2Y69C 2RNBA 1LHVA 2J1AA 3IIAA 3FB8C 2DF7A 3FBMA 1O4ZA 1HXS1 4RGGA 4EN6B 1B35B 1AILA 1JZ8A 1Z78A 5FP9A 2BNOA 5EXOA 4IERA 1UQXA 3GXUA 5DG1A 4MYEA 4DV7B 1OOPC 1V9U1 2ZIOA 4LBKA 3T1YO 1GQGA 4JDNA 2JDIG 1B6QA 3PTYA 1F31A 4AF9A 1GOGA 3VBBA 4V2VA 3K06A 1QU7A 1SQQH 1JYWA 1OHHG 4PD4F 4LULA 2EJRA 3F95A 1IS6A 3GHNA 3HOBA 3LA7A 1W6NA 5IVFA 1P4RA 1SESA 1VF6A 1RITA 3HJRA 1O9HA 4GB33 1C28A 1DQ2A 3ZDSA 4ASMB 1LHWA 4GXLA 1OH3A 3OGIB 1RJ7A 2OZ6A 5LYJB 4GH4A 3SJCC 1YTFB 4CEYC 1YFWA 5FP3A 1UN1A 4ZY9A 4R8CA 3NNMA 5EHDA 3RWNA 5A7WA 4PDRA 1PNKA 2CYFA 3UK9A 2RJZA 2JEMA 1TUBA 4CCLA 1XBLA 4UXAA 5CEHA 4NIDA 4UFJA 2CDPA 3VBHC 2EILC 4I5SA 5LXTB 1HDJA 4I4TB 3BU0A 4A5UB 4FFIA 1NCRA 5FZFA 1W8ZA 2BSKB 3JAKA 1KECA 2ZGMA 3ITQA 3WW3A 3ZMSA 3HQXA 3K4DA 4X64B 3BFRA 4BWAA 3T08A 4BPZA 3OCPA 1EN4A 2ORXA 3FX3A 5CNAA 2PFWA 2XWBB 1NR7A 2FYUH 4NR1A 4OUEA 4Q1RA 4GB31 2H0VA 2MW2B 5A3TA 2P4KA 4JF3A 1Q6IA 5J2UB 5HV0A 1ULCA 4XTPA 1RUI2 1JYIA 4K9SA 1FXVA 3RYFB 2V09A 1VQ7V 4RQFA 2ES3A 1OCRC 3RPQA 3BPSA 4X1IA 3PMEA 4W6WA 5I8YA 2KD7A 1LESA 1X82A 4TLFA 3A0HZ 4QXCA 1K33A 1AR5A 3VQVA 3OUIA 1GZCA 3UT0A 3BTAA 1OF3A 3WNXA 2VMFA 3D3QA 2WLMA 1J5EB 3U0ZA 4ZPIA 5IAXA 1COWG 3EQEA 4QKBA 1M5IA 3POBA 5BY1A 3RZHA 5BR8O 1RM1B 5C33A 3IAPA 3FWEA 5DDJ3 1UFIA 4JI1B 3SITA 2Z69A 2VWKA 3VD7A 2VY0A 3TOJA 3K0DA 2E7QA 4X9QA 1JYXA 2JVDA 2PI5A 1PGSA 3W59A 4BQ4A 2AXTZ 3RN4A 4FP3A 4ORFA 1FV3A 4JV4A 1BL8A 5LW9A 5LMNB 4JTAB 2A6WA 4YZ2A 1K5MA 2LALA 1KKDA 2BVBA 3WQ1A 2WT0A 3ABMC 3IGAC 4FVMA 2EXJA 1AJPA 3TETA 4AEDC 1UU4A 4DFSA 3DN7A 5F7UA 2VZTA 3ZX7A 2VR4A 5F3GA 3A4UA 3NAPA 4LF8O 5T50A 4LWSB 2FDHA 4MH0E 2OVUA 3GJBA 1PL0A 1XI1A 2XAFA 2WLNA 3SJQC 1V00A 4U36A 3B3QE 2JXAA 1XOUA 3UKVA 4ISQA 5DDJ1 5J3UA 1ND2B 4JPRA 2JE9A 3HKDB 2IU0A 1P8JA 1QJX2 4D7YA 3JB4C 1J95A 3FMGA 5D5PA 1PV0A 2YIAA 3BY6A 4K1ZA 1JU3A 3J7HA 1ENRA 3ZSEA 1W6QA 2R9AA 1SZXA 4RQPB 4P5HA 3G6BA 2PHFA 1H2NA 3MI8A 1Y4WA 4COVA 5L3GA 4Y1XA 4ZOLA 3J26N 1GMMA 5F5QA 4CZZA 1O4YA 3D36C 1GR3A 5I0RA 3CWBH 2JB4A 2A3YA 3JXSA 1YHQV 2P1BA 4AGVA 3CCMV 1M9NA 1QQP3 2WLIB 3O0VA 2Z42A 5CB7A 1J3RA 2ZABA 3UKNA 3T4HB 2WAAA 4XEZA 1IHMA 1H2GA 3RYCA 2E51A 4PDMA 3KVAA 4Y3OA 5IYCO 1ENSA 5HXMA 4WVVA 3M3IA 3EXAA 4JZ2A 2GZWA 4YVSB 4K0KO 3AZXA 3RZLA 1SLLA 2PLV3 <