3BPZA

Hcn2-i 443-460 e502k in the presence of camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREKIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title C-terminal movement during gating in cyclic nucleotide-modulated channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 66
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3bpzA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3bpzA02
3LZZA 5LRRA 1ZRFA 4IEWA 5I8TA 3DL3A 1ZZ9A 3ELNA 3LAGA 4JV4A 4EWDA 2Z69A 3E6CC 3RNSA 1IPJA 4A2UA 4HN0A 3FX3A 5I0RA 3OTFA 4JTOA 3CEWA 4L2NA 1QY4A 3NJZA 4Q0QA 1ZZ7A 4WZCA 1EP0A 1Q3EA 4IEXA 1NE6A 4XEZA 3D0SA 3BPZA 1CAUB 1VJ2A 1DZRA 4JTNA 1YFWA 1GQGA 1PMIA 4QM9A 4XFAA 2GC3A 1I6XA 3NSTA 3S7IA 1QWRA 3HQXA 5CADA 4UXAA 1DZTA 1XE7A 2OA2A 5BV6A 1CAUA 1LKNA 4XFIA 2EA7A 5I0TA 2B9UA 1CGPA 3LA7A 2UY8A 4P9GA 1WA4A 3CO2A 2IXLA 4MV2A 3H1YA 3NKTA 2XKOA 4JVAA 4DINB 2PHDA 3EJKA 5E16A 4IEUA 1FI2A 4PIZA 2XGXA 5HI0A 1O7FA 2D93A 4K8FA 3OCPA 1GQHA 5C8WA 2Q1ZB 4I02A 5FCCA 4HMZA 1UIKA 2OPKA 3ES1A 4GULA 1ZZ8A 2BYVE 3MPBA 3PVBB 5EZWA 1I5ZA 1ZREA 4IEVA 2ET1A 4ZU7A 5FLHA 2O1QA 3ETQA 5J3UA 1RGSA 3IBMA 3JZVA 4LTAA 5C6CA 2ATFA 3MZHA 1H1IA 1WGPA 4XF3A 1YWKA 4KU7A 4PJYA 1DGWA 2GH2A 1J1LA 4I3PA 1EY2A 3H3UA 1ZZBA 4EWEA 1CAXB 4ONUA 4LUKA 3BCWA 1UIJA 3IDCB 4IEYA 2BEOA 5FLIA 1J59A 2Y0OA 3ACLA 2PFWA 3PNAA 2UY9A 4FAGA 4META 1SFNA 4XFHA 3B02A 1OD5A 2KXLA 1X82A 5D1IA 4BHPA 3IWZA 1Q43A 4BYYA 4XF4A 1ZNPA 2Z2SB 1CAXA 4L11A 2HKXA 4OLLA 3DV8A 2QVSB 3RZZA 3UKNA 4UBHA 1Q5OA 4YARA 2D5FA 3VHRA 3SCHA 3WW2A 4D7SA 4QX5A 4F8AA 2GU9A 1DGRA 2PQQA 3QOPA 2K9ZA 2PAMA 1X7NA 5BY5A 3LOIA 3MYXA 2MPFA 3M70A 4FBFA 4R52A 4AQ6A 2QCSB 4BIFA 5JCTA 4XFBA 4QGNA 4AVBA 5LRSA 2V09A 3GBFA 2QJVA 1NE4A 3H3ZA 5JSOA 2BNMA 4AXOA 3ROUA 3QACA 4XFCA 4YNIA 3E97A 3DKWA 4WBBA 2PHLA 4AVAA 4Q0PA 4NVPA 4UBGA 4QM8A 3H9AA 4E2SA 1RUNA 1ZX5A 1UPIA 1ZRRA 2B8MA 4MGZE 2IXKA 5I91A 1QXJA 5K8SA 1UCXA 4MGIE 3KMHA 3WW1A 5FLJA 2K0GA 4IEQA 3O14A 3E5UA 3I59B 4D7TA 2QDRA 2IXHA 4X6RB 3FFQA 2H6BA 2IC1A 1YUDA 1H1MA 2PAKA 3MDPA 4HSLA 1O3QA 2WC2A 4MUVA 3OF1A 3SCFA 1OMIA 1SQ4A 4FAHA 1O3RA 1YLLA 2IXIA 5J7MA 4PIXA 1RL3A 1J3QA 3RYRA 3RPQA 5KHGA 2BGCA 2O8QA 3NVCA 3I59A 1NZCA 4LLOA 1NXMA 2F4PA 3D0JA 2Q30A 4HZFA 2XHKA 4ORFA 4Q0UA 5FPXA 3R6SA 4I09A 3PLQA 4ZU4A 1XRUA 2GZWA 4HSJA 4LA2A 4E2QA 3N4MA 5FPZA 3LA2A 1LB2A 1YFUA 4BH9A 1CAVB 2PAEA 5I8YA 1SEFA 2B5HA 4QXKA 4J1WA 1O5LA 4IERA 4MZUA 2DCTA 3UKTA 2EAAA 2ET7A 3KCCA 3EHKA 5BXXA 2BNNA 1ZZ6A 2ETEA 3U11A 4I0AA 4Q0SA 5LEJA 3S7EA 5BPXA 1CAVA 1YFXA 1LR5A 3GYDA 3IIAA 4KWLA 1CAWB 4MGKE 2CAVA 4IESA 4OFGA 3U10A 4MX3A 4HVRA 5I8SA 3IDBB 1LRHA 3HIFA 4N9HA 2ZCWA 3RYKA 1O4TA 4J1XA 2VQAA 1QXRA 4XF0A 2OYZA 3FWEA 4HVQA 5J48A 4LULA 3S0MA 4AVCA 4LUMA 5KHHA 2XLGA 4LEJA 2WFPA 1JUHA 1RUOA 4PIYA 4KWJA 5JSRA 2FMYA 2OZJA 2XKPA 4X6QB 1OI6A 4Z07A 4HLTA 3BU7A 3FJSA 5LEKA 4RD7A 2UYBA 4EV0A 1UW8A 4QGLA 3H1WA 2OZ6A 1ZRDA 5I93A 3KGZA 1ZVFA 4HBNA 3CLPA 4IETA 5T3NA 1XE8A 1ZZCA 2EVXA 3TNQA 5CVRA 3NL1A 1FT9A 2N7GA 4FT8A 3G7DA 2CAUA 2FQPA 2MHFA 4I01A 4ZU5A 5FDBA 5I0SA 4YSFA 1O3SA 2Q0AA 1ZRCA 4I2OA 2XL9A 2H0VA 5KHJA 2IXCA 2GC1A 4N9IA 3E6BA 1YFYA 4YRDA 2PYTA 4MH0E 4WVZA 5KBFA 2IXJA 2XLFA 2CGPA 5JAXA 1Y9QA 5KHKA 2P17A 3FHIB 4IEZA 3CF6E 3E6DA 5I0UA 3HT2A 1UD1A 4H7LA 1O5UA 1U12A 4YYOA 4XFFA 4HVOA 1J3RA 3EBRA 4XETA 4IEPA 3HT1A 4KWKA 3E5XA 3WW4A 3LA3A 3LWCA 3E5QA 3SMHA 1FXZA 2BNOA 1CX4A 3FE5A 5BUVA 2MNGA 3RDIA 3UKVA 1J3PA 4B29A 5FQ0B 4Q29A 4E2GA 2PA7A 4XF1A 4O9EA 2HJIA 2XL7A 4Z82A 2UYAA 1VP6A 5AVPA 2GAUA 4R8HA 2C0ZA 4HN1A 3RYPA 4MGYE 3DN7A 4I0BA 3CJXA 3KGLA 3EO6A 3OGJA 3EQEA 3ST7A 2I45A 2QNKA 4LA3A 3SHRA 3KSCA 5FQ0A 2PTMA 3FZ3A 1VR3A 4EROA 3NW4A 4Q0VA 3I54A 5EFUA 1X8MA 4QMAA 1RC6A 2VECA 2GC0A 3CL1A 3L2HA 3H7YA 3H7JA 1EPZA 3H1MA 1WLTA 3C3VA 3USSA 4AQ2A 4EWAA 1PM7A 1O3TA 5JSPA 3WW3A 1IPKA 1TQ5A 3BB6A 3SCGA 2VPVA 3ZDSA 1L3JA 4O9GA 1J58A 1EYBA 2ZKLA 1RTVA 3SXWA 2Q4SA 1OFNA 2E9QA 1V70A 2D40A 2H6CA 5JR7B 4F7ZA 3M3IA 3BALA 3H8UA 1CAWA 1X8EA 3I7DA 3OD0A 1HW5A 5KHIA 4QGMA 4IEOA 3U0ZA 2CV6A 4XFGA 4KU8A 3ES4A 1G6NA 5E1RA 4CYDA 1YHFA 4TLFA 1NYWA 1Y3TA 5F1RA 3TNPB 3D82A 4XF9A 4KL1A 2XLAA 5CU1A 2GC2A 2D5HA 3H50A
chains in the Genus database with same CATH superfamily
4LR3A 2W9XA 1BJQA 3P1IA 5G04L 4IEWA 2W1WA 3WNLA 4EWDA 4X1YB 2BJSA 2OT5A 5FY7A 3E2EA 5C9AB 3ZIWA 4Q0QA 1HDKA 4EN9B 5FKBA 5BR8B 4YM3A 2QJ1A 3VD7A 1YFWA 2A3QA 5CIRA 4B7EA 1I6XA 4NMIA 4OI1A 3ZFGA 3ZN6A 3WCSA 4LJHA 1N1YA 2TEPA 1CAUA 2JG9B 2B9UA 3H01A 2ZGPA 2NYYA 4P9GA 5T50A 1XI1A 4IV3A 4MV2A 3H1YA 2HWC3 1IG3A 1O9HA 3D8CA 1F7YA 1W9FA 2BFUL 4Y1UA 4PDVA 4ZY9A 1O7FA 2RJZA 3CCMV 4Q4W2 4A3ZA 3UCSC 4M01A 2C24A 1GQHA 4LBJA 4UI9L 4H2AA 3VBOC 2CU5A 1JZ7A 1OV9A 1MG1A 2V72A 1ZREA 4W4ZA 2TNFA 2DUOA 4BISA 4IEVA 4CDUA 2O1QA 5GZDA 3JZVA 4QDRA 2W5FA 2JK5C 1IS3A 2LTNA 4EWEA 4KBBA 3LEIA 4CU8A 4AAPA 3PUAA 2GDFA 1HN0A 5KXCA 3IDCB 2W0FC 2Z5WA 1N33B 3GDBA 5FLIA 1IBLB 4I0WB 2YIAA 2RJKA 4FFIA 3RJ2X 4LO5B 1H9WA 1E79G 3UKNA 3LDKA 1D4M1 1K45A 4RO2A 1HRV3 4NOTA 5IWAO 4YM2A 5C5UA 3AP7A 3LOIA 5BNNA 2UWAA 2OUHA 3T2PA 1Q8OA 2YICA 4FBFA 3CXHF 4XJ8A 1UOGA 1JMKC 2ZHLA 2JEMA 1EUUA 4P9LA 3E35A 4X64O 4RGAA 4MVMA 1MOFA 1K5MB 4IYIA 1WCDJ 1QF3A 5IVEA 1DLCA 4BQ4A 2G1MA 1IBMB 3ZR6A 1W6PB 4UFZA 1OBNA 5C4WB 3BVCA 1HX6A 4W6XA 4OHVA 1KFUL 3R4DB 3CS5A 4J7JA 3IM0A 2ORZA 3T30A 4COZA 1N34O 1Y76B 1K4DC 3J7LA 2WL1A 2A71A 3I59A 1NZCA 4LITA 3CB2A 1MS3A 2F4VB 5IW0A 1H8TB 3W58A 1R3LC 3AP5A 5EYPA 3HBKA 1U5XA 2BSKB 3P6BA 2G9GA 4GYCB 3AJZA 3CC2V 4Q4V2 3AP9A 3LSEA 3ZXDA 4CRQA 3FN9A 3ZYRA 4NPRA 3TN93 5LEJA 5BPXA 5CMUA 4CEYB 3A23A 3V56A 4LMFA 4RFRB 3HQUA 1G9DA 3AG4B 3ZKYA 3J26N 4LULA 3F5WC 5EWSA 1R081 2WWUA 2D6PA 2YHJA 1VQ6V 1VALA 3BU7A 4TLGA 3EFFK 4RQPA 4YVWA 1XHXA 1F5FA 1ZA7A 1XE8A 1AJNA 2ETNA 4QPKA 5EHDA 2Q67A 3BABA 3K46A 1GM7A 4GAZA 4LH6A 3E89A 3MAQA 2HWD3 4HG6B 4CU7A 5LMUB 3RYFB 3ZYBA 2DWDC 1RUG1 2LM3A 5DDJ1 1PZ8A 2OYQA 3SH5A 2FDGA 1PGW2 1JZ5A 4PDWA 1ND2C 1P7GA 2VU9A 5H9QA 3I3QA 4CPBA 3LA3A 5F6KA 3BOPA 2PY5A 1HB3A 4UFMA 3SEPA 1UOJA 2QDNA 1DQ2A 5BNPA 4B29A 4XTPA 4Q29A 4BU2A 2ZKOA 2HJIA 5DAVA 3K59A 4GX0A 2UYAA 1V6LA 4MGYE 3T1MA 5FJKA 5L19A 1SG3A 3D4KA 1TME2 5LP6C 4YVSB 2EAKA 3RYCB 4PI0A 3DCQA 3V0BB 4X1KA 1EN4A 2PXJA 3CL1A 1ZBE1 1YTFD 2W39A 5FYCA 1D2QA 2NN4A 2DN9A 1S55A 3POGA 2VY0A 4AHWA 1VIBA 4H44B 2IUWA 4K9SA 4PA6A 1SLTA 3ACGA 1L3JA 3FUQA 2XUMA 4FLXA 2J1EA 3D36A 1X33A 2BFUS 1S0CA 5CEHA 1YDXA 4QB2A 1J1TA 3U0ZA 2WZR1 2QBXA 1FFXA 1GKBA 1I7FA 3OY8B 3X2QC 3ZSJA 4ARXA 4I0XB 1CWPA 1RJ7A 3WQ7A 3D82A 3MGUA 1F31A 3ZJZA 4F4LA 3O1MA 3HPNA 1VBC3 4Q4X1 2WT0A 4K0KO 1J5EB 2Q73A 5L73A 3O0WA 4B8EA 3ZM8A 1GMGA 5A1FA 5C8CA 5IYYA 3GBGA 1XE0A 1W04A 5CFDB 4TYSA 1NE6A 4XEZA 3D0SA 3B9IA 4NHYA 4PBOA 4K35A 4LNUB 4D6TH 1I5YA 3QVNA 4DR6B 3NRUA 2Y6FA 2WSVA 4YPJA 3RG0A 5KUKA 3ZPYA 2Y8KA 3ETEA 1OOPA 3ZN5A 4BCUA 3VBOB 3LA7A 5C3PA 3HNYM 5A2QN 2BTQA 5EC1C 1K42A 2WFF2 1XMOB 3CP1A 1ZTEA 2YB7A 2Q7EA 2Q68A 3P30A 2XGXA 3B9CA 4A6OA 4JASA 4YY3B 1F4MA 4P5HA 1XQ8A 3ABUA 2FTKA 5IFPA 5A3TA 4CVUA 3MPBA 1I5ZA 2X7RB 1S0GA 5FY9A 4XUPA 3B8MA 3WU2Z 4Y5TA 3CRQA 3ETQA 1ASJ2 2X6BA 1SDWA 1AR92 1T2XA 5GLWA 4QDQA 5DN2A 1M4WA 4XF3A 4Q1RA 3GZTB 1WBLA 5F32A 1EY2A 4HT1T 4ARYA 2H8PC 1Q6IA 1R73A 1PO11 3T2OA 1M93A 1W8HA 2X5IC 3MLKA 2W68A 1FV2A 2VZPA 3K3OA 2ORXA 1HB1A 1PVC3 5KA6A 3MHZA 1YRZA 3UKMA 4TOIA 3LKJA 4QPWA 2OCHA 1VBA3 2GU9A 3WG1A 1KD7A 5B4XA 2PQQA 4TXWA 2BW8A 4WM7C 3M70A 5FBZA 1LU1A 2RN9A 1R6TA 2WWSA 1AR83 3SITA 1NKDA 4XJUA 2VUJA 4QPIC 2HVKC 3BA8A 4FLZA 2QZ3A 2Y6KA 2YU1A 4GQ7A 1AILA 4Q0PA 3THTA 2EILC 1ZWIC 4P14A 3ITQA 5C9AA 4CCOA 4WF9V 4YIOA 1QJU3 2QSAA 4QWNA 1NR1A 2VO5A 1RHI2 4IV1A 4RL7A 3AX4A 3OUIA 1QOSA 1YLLA 3POEA 4COWA 3RPQA 2JG9A 2VOWA 2Q1MA 1H0BA 1TMF2 3NKGA 3VQVA 1WA8A 4LPLA 2ITDC 5FPXA 3I55V 2WAAA 4G4FA 4CZZA 4R9BA 3ZFFA 3WLUA 1DG6A 1YFUA 1B09A 2W0XA 1GZ9A 1WLWA 4Y5Z0 4NTWA 1F15A 5KX5A 4O7XA 4UUJC 2ZBJA 4XUQA 1V55B 2BP6A 5FOBB 2QE7G 3J8F1 3S7EA 4DR2O 1JU3A 3QTCA 4QHBA 1RVF2 1JQ0A 2FCTA 3ZIXA 4N9HA 5JVDB 3RYKA 4GKYA 1DGRN 4H0LB 3VKOA 4COUA 1VLNA 1SS3A 4P9PA 1MQTC 3HOBA 1B35B 3NNLA 4RA0A 4ZXEA 1WNSA 3PU3A 1G9AA 5GM0A 1K5JA 5FZKA 1SDDB 2FDIA 4X6QB 1RMU3 3N7LA 2ZABA 1CD3G 4HLTA 5IAVA 1AYN3 3LSDA 1F4HA 1AP5A 4X66O 5CVRA 1ENRA 3WXPA 3M8AA 1WUVA 2YBKA 4LHSA 3JATB 1QJEA 2GC1A 4HETA 5FXXA 4P2ZA 3VBUC 1BEV3 1Y9QA 1OCZC 2VUAA 1R64A 1QNMA 1VPHA 1UKGA 1J3RA 4JAAA 4C7UA 2BTOA 4O4LB 2GMMA 1BS3A 3VOUA 4LFAB 3WW4A 1NQDA 1W6PA 3OR6C 2BNOA 2CL2A 3RDIA 4UVAA 1YI9A 4XW3A 1F4AA 1CVNA 4R6ZA 2VUDA 2BUKA 3HD8B 1I08A 4QX3A 3BYWA 5GONB 1S2EA 4DRXA 4FPCA 3AZZA 3LIGA 3NV3A 3KGLA 1MZ6A 1GN6A 4N53B 2VTXA 1QJX1 2PTMA 2KSDA 1RUJ3 2A73B 4EROA 2X8KA 1Z5VA 2GP5A 4XJWA 2VZSA 2QQOA 4LE4A 1ZBA1 1RUH2 3ZMTA 1JYCA 4WFHA 3F7YC 2VM9A 1WLTA 4FOVA 4QE9A 3N2KA 4F6RA 3B2EE 4DR3O 2BGOA 1ULGA 1MS8A 2BWAA 5K1PA 3SCGA 3N9OA 5LHIA 2VTFA 1POV1 1V9U3 2QWQB 3E8GA 1S0EA 4E4ZA 4Y1YA 5ABJC 3MFAA 4LE3A 5JI9A 2AGSA 3NWKA 2A79B 5E1RA 2Y4TA 1IBLO 5A7PA 1VRBA 4AI0A 1OCRC 3QD6A 1BHBA 2Q6AA 1W0NA 3DXRB 3ELNA 5L7OC 2JENA 4BWAA 2D7FA 4WVVA 1K73W 4CE8A 1NJIW 5LXTB 2ZDIC 3OTFA 5CFCA 1LCLA 3PMEA 2F66C 5FYTA 1WMFA 3C2UA 4FFGA 4CZSA 1QLNA 3SGIA 4OYUA 5IK5A 1W6NA 2RS52 4X88A 4JDOA 4N23A 1M9NA 3RYFA 2EIMC 1IBMO 5DM6V 4LWSA 2Q0OC 4OQ9A 3Q8BA 3ECQA 4YZ2A 4UXNA 2WNVA 1SMVA 4XABA 5LK7B 5SV8A 3WQ1A 3NKTA 1S4CA 3ZSMA 1GV9A 1NU1H 1VB4A 2KR2A 3QH6A 1FI2A 2KM2A 3SNMA 1U97A 5FY1A 2ITCC 2DQ3A 5KXEA 2UUCO 1K3IA 1URXA 1COV3 4XURA 2X5IB 2M7WA 2ET1A 3SYOA 3JBG3 3BU0A 3BVOA 1K34A 2EZPA 1FMD3 3HN3A 2VULA 1YIPA 5TISZ 1COWG 1TVKA 3RYCA 1YO8A 4GB31 3H1KH 1LHVA 1XU1A 4BW5A 2YBSA 3R65A 2R041 4DUZB 4FAGA 4Q4Y2 3K3NA 3K08A 1TNFA 4GCZA 1V9PA 4XYXA 4JAVA 5FYUA 4AFAA 3N2GA 3CHXA 2CYFA 1Q5OA 3VHRA 2PMWB 2YUEA 1BQ0A 3POIA 3CWBH 5L3EA 2B46X 3OMIB 4E2LA 1X7NA 2ZGTA 3TXSA 1NQJA 4I0XA 2ADDA 1RUD2 3RI9A 4IGPA 3PUSA 5JIUA 4GZ9A 4AVBA 1YITV 5IDJA 4TV8B 1S0IA 4YZ3A 4PJ0Z 4WM8A 1A8DA 3DKWA 3WDTA 3U1XA 4DO2A 1JYNA 2YZ4A 5CA1B 2C6SA 3MO4A 1XNRB 1VB2A 5LMUO 3N9QA 2E7TA 1SA0B 2X10A 4LNUA 1AL22 1CPMA 2HWC1 3BODA 2FZ1A 2M6YA 4LF5B 1T6BX 4DV6B 2F93B 5L3CA 2YV8A 5IT6A 4J80A 2EXIA 4AQYO 1OLME 4FO9A 3JALB 3VBOA 3JAMN 1WP7A 2FZ2A 5DAWA 4Z1VA 2HFEC 3CX5F 3CMGA 3RJRA 5APAA 3THOA 1BK0A 4GALA 3RYIA 4CCCA 4LR4A 2NM1A 1F5JA 3TYJA 4AI3A 1NH2B 1SCSA 1MQTB 2G9ZA 3CRCA 3ZR5A 4X62O 4UW5A 2VAUA 4ABMA 1CAVA 1POQA 3IIAA 1W9TA 1QMJA 3LE0A 3SEEA 3FHQA 3OGGA 2ZCWA 2B5UA 1HB2A 3WFVA 4J11A 3JSNA 5EP9A 5H2FZ 1FPN2 5BYNA 2JX9A 3K48A 4DXRA 1FYJA 1BQZA 1WCKA 2LALA 4JRLA 2W47A 1HRV1 2X6AA 1XB9A 5KUMA 5GKAC 2D3PA 2XKPA 2JB4A 4RS5C 1UAIA 2BU9A 5LEKA 3VBUB 2ZGQA 3HR0A 2XAHA 2PHUA 2VQEB 1H9PA 3AK0A 2QQNA 5EXOA 5SV5A 3G7DA 2XL9A 2SBAA 4KG0A 4YRDA 3AC0A 2IXJA 4DO0A 3K79A 3VBSC 5JMOA 4BXFA 3DYOA 4QJFB 1LGCA 2HWE3 2ZZQA 3NNFA 3UO2A 4J41A 1AZDA 1DZQA 2P3JA 4P30A 2VNGA 5JWPA 2ZGRA 1WD3A 1SZTA 1FOD2 2PLV3 5DUWA 2ZEXA 1YSCA 3DGEA 1DHKB 1XMOO 4ZBMA 3PHMA 5DPNA 3F5TA 2PELA 1YZBA 1IQAA 4Q0VA 4RHV2 2ZGLA 2XJTA 2I2SA 3CRAA 3W7XA 2GC0A 1NG0A 4FJCC 5IY5B 3QBQA 2R072 3TN91 4LKFA 2QKAA 4AQ2A 2QQJA 5JUVA 1EZJA 1ND3C 4AAXA 1MR5A 4MTXA 2N05A 4X1IA 4NPMA 1UU6A 1OCRB 4Y22A 4QT6A 2HJDA 3NR7A 3LGRA 4OQ8A 3BTAA 3H8UA 4LF7B 5FNVB 1YYNA 4LT5A 3TCUA 2IH1C 3W7UA 3OMNB 2WLIB 2IVIB 1W2TA 4CU6A 2A6WA 1DGWX 2VMCA 3EXAA 2D5HA 2LFSA 4AVVA 1FXVA 1Z7S3 5A3UA 4LCUC 5FO7B 3WG4A 3O1OA 1RIRA 3JD73 4JRAA 1PV0A 1WN7A 5LW9A 3N3HA 1EP0A 1VRH3 1GZCA 1ST8A 2PHFA 3A0RA 3K57A 4N7UA 2BERA 3WHUA 2NZ9A 1VJ2A 1YQCA 1EV13 1CQ9A 1ND2A 3VZOA 5L9VA 1PMIA 2GC3A 1VQKV 4LH7A 4GD4A 1N32O 2E5LO 4JI0B 2HG5C 1Z5WA 1XNKA 3TRSB 4DY5A 3MI8A 5FMOL 1KS5A 4NIGA 1BYHA 1UN1A 1LKNA 3LEMA 3ZHSA 1CGPA 4IQPA 3JAWB 4O4LA 3MBWA 2YUAA 2XONA 3OUSA 2BQPA 1IS4A 2YEVA 4YG0A 2CY6A 5LP6A 3L74H 1GYKA 3AYCA 4PIZA 2CDPA 1YQ2A 3IN9A 2VBPA 4LKSA 1VBD2 4AEJA 3CQOA 1UZYA 2Q1ZB 4QIWF 5EZWA 3OM3B 1IOAA 2DBIA 5FZGA 1V54B 3JQWA 3B8NA 4EZHA 2EJ7A 3KT1A 2ZGMA 5FYMA 1VAKA 3FHAA 4UWDA 4AOCA 3ZHTA 3WF2A 2GHYA 1BSMA 4HKLA 1UIJA 1QU7A 2Y6LA 4RN5A 4XFHA 3WVJA 2NR5A 1FATA 2DOSA 5D1IA 2FD8A 1L8DA 4FZ1A 3AM2A 4U36A 4YARA 1WBFA 4X8NA 3CZUA 2YROA 1US2A 1VBC1 3VD5A 4JI3B 1ENQA 2XASA 5J2UB 4R52A 3ZCCA 3K4AA 5T5PA 3G4SV 2Q8OA 1OCCB 3C7OA 1UY0A 4C1WA 2EICA 2DDUA 3ROUA 3DXRA 3VZNA 4DEQA 5FPVA 3M7AA 4NVPA 5LXTA 5FUNA 3CRMA 1W2OA 2LGWA 4XDPA 2B8MA 1JFFB 1PD3A 3SPIA 1RM1C 4U3JA 4UCVA 1PIV2 1NH2D 2A3YA 5LGNA 1J83A 4Y20B 2JIZG 1YUDA 3AG2B 1KP3A 1H1MA 5HBAA 4K8ZA 1O3QA 4PHZA 4QB6A 1M1KW 1A8MA 4PIXA 4CCDA 1E5RA 2W87A 3AP6A 1U5IA 4LLOA 3R6SA 4QHOA 5BY1A 4OCTA 2P90A 3DYMA 4Q4V1 3FB7C 2PAEA 3PVOA 2B5HA 3D3IA 3E86A 4N43C 4B3SO 4OUMA 1T6GC 4AW7A 5B5EZ 4YW3A 2P4EA 1KITA 3TJTA 1K9MW 4DOUA 4R8CA 4GKKO 2ETEA 4EYUA 4Q0SA 1AX2A 1LR5A 4KWLA 2B45X 2CTPA 4IGQA 1QQCA 2CAVA 2R16A 5FY4A 4RS5B 2IBZH 4FPEA 1WB8A 3WDXA 3E1F1 3NMBA 1QQP3 3PL0A 2AGAA 1NLRA 2OYZA 1PVC1 2YXSA 2RR13 2PZSA 1MEC2 3RYHA 2A6XA 1VBA1 3RFRA 5LA6A 4WM7A 2IW5A 4JDNA 1H4GA 5GLZA 1QR8A 1XSQA 4LO7A 1AR81 4JCKA 4KMQA 4QGLA 4S2DA 4JI1O 3Q4HB 3TNQA 4QPIA 1EN5A 4DV2O 4DV4B 5HPOA 2N7GA 4FT8A 2NMNA 4MHRA 3RN4A 4DUYB 4ZS3A 3FKSG 2H3OA 1IQDC 4A42A 3T1YO 4BQYA 4MH0E 4UAPA 4K20A 3LPGA 1QJU1 4IEZA 3HT2A 4TV8A 4X20B 3M8LA 2XWJB 4WFBV 3APBA 5CA1A 5JMCA 3O9OA 4OULA 5FYZA 1DQ4A 5J2TB 5L3GA 4Q27A 4EN7B 3RMXA 1ZYBA 3SMHA 1FXZA 3ZXGA 3AKRA 1GNYA 3FE5A 4IE6A 5DMYA 1XEQA 2PA7A 3KLSA 4O9EA 3OG2A 2FDJA 3MW2A 5DABA 4R8HA 4YW4A 2C0ZA 3RYPA 4FK5C 2VZOA 4JI7B 1XNTA 3PJQA 2OKXA 3OGJA 2BRTA 3ST7A 1LOCA 2KKWA 3R66A 2WLKA 4ZKIA 4B3MO 2GTAA 1S5HC 2ARHA 4JI8O 3NW4A 3ZXAC 1NOVA 2C1FA 3LEGA 2RS13 4DYLA 3B69A 3L2HA 1ZL8B 3H7YA 3GJBA 1GZTA 4Z1MG 5B66Z 3C3VA 5F2SA 4PF5A 4EWAA 4DV1O 1FKAO 3I8TA 4MLOA 4R9CA 3AZWA 4SLIA 2ZKLA 5CN0A 4CCMA 1WWYA 4DV3O 1D2DA 4L92A 5FYVA 3I49A 3K77A 1W9WA 4IGGA 1RMU1 4JPRA 5CISA 1HNXB 1OPMA 2V5DA 1Y3TA 1GWKA 3HEIA 1H2NA 3TNPB 1AYN1 4Y1VA 2XLAA 2BBAA 2B42B 3LZZA 4S2HA 1JZ2A 5GTHZ 4GWNA 1ZZ9A 1DQ5A 5BMVB 1L7QA 2D3OW 3VBUA 4ZI7B 1BEV1 4M3CE 3T0DA 1S2KA 4BMEA 1GZWA 5FMCA 4NIIA 3GJAA 4PD4F 3K0DA 4A4AA 3APOA 4XFAA 4QM9A 1TNRA 3ZYPA 4UFLA 1ENVA 1QWRA 3HQXA 5EZYA 4L0PA 2RE9A 2EA7A 1PGL1 2ARBA 2WFF1 5JDBA 1UQXA 1ULFA 2R30A 1AR1B 3VD4A 3ML0A 4OPHA 4YJ3A 2H0BA 3CJHB 3EJKA 5E16A 4P9OA 2VZVA 1RUJ1 4Y24A 4AI1A 4CP2A 3ZMZA 2HVJC 1LOFC 2RCVA 2VD7A 1F35A 5J3UA 3HQRA 2YC2A 2CWSA 1WGPA 3K04A 4JX0A 1DGWA 1XILA 1J1LA 1JOYA 2WNUC 1Z78A 4URTA 1V9U1 1APNA 2VR4A 5ABJA 2BEOA 2EIJB 3ACLA 3PTYA 4HZ3A 2GNDA 1Y74A 2PFWA 3I2KA 1Q8QA 4MVOA 5J98B 4FTBA 2OXBA 5T52A 1IZ3A 5A3OA 2ZTNA 2W3JA 4XBQA 1CAXA 3CCRV 5GTIZ 2J1VA 3IDAA 3X29B 5IATA 3V0AA 1WA6X 3WW2A 5FZIA 4F8AA 1KS4A 2UXCB 3JB4C 4OUSA 5L7OA 2YI9A 4M00A 3KV6A 2ZDIA 1KMIZ 3A2FA 1UX6A 1NA1C 3HMYA 5LRSA 2V09A 1QHTA 1R6NA 4LF9O 4ZXKA 1UOFA 3IKWA 4GMP0 2Q69A 2RDRA 2AR6A 4TQFA 2AENA 5FOJB 1QXJA 2DFBA 3D3QA 2O14A 1OLMA 4PA7A 2X53S 4MGIE 1EZVH 2QUOA 2XT9A 3UYJA 4D7TA 5DDJ2 5DG2A 5HCBA 2PAKA 1NQTA 3CCQV 3LDEA 3AKSA 1OMIA 1OQ1A 4WFFA 1SQ4A 3T4DA 2Y34A 2R1DA 4WVMA 4JV5O 4QQOA 4IIJA 1COV1 1EM1A 2VZ1A 4FVMA 1NKGA 3IZOA 4JYAO 4LFBB 3AMPA 5FR3A 3OTOB 2BCCH 3QG5A 1NXD1 2Y38A 4DZGA 3M2MA 4Q8KA 5EC2C 5CB4A 3O1VA 1W6MA 1ZBE2 3RMYA 2F4LA 2KG7B 1BMV1 5KA5A 1GU3A 1GP5A 4DPNA 1R093 2HH9A 3G6EV 4LUMA 5KHHA 1OVPA 1BKZA 2ZHNA 3CNAA 2YG0A 3JD3A 2KQXA 1US6A 5JSRA 4NJ4A 5JZGB 1RUC3 4O4JB 4LF7O 3FB8C 3W7SA 2LGQA 2XBO3 4W65A 2WZR2 2XVGA 3WSOA 3P3NA 1XBFA 5FBJA 5T3NA 4E4DX 4OX9B 2DUQA 4CCKA 4JYBA 3RWRD 5A9GA 3ZBHA 4ZU5A 2JECA 1WCSA 1R1A3 4UT5A 2VVEA 4JGZB 2QQMA 4Q4X2 4W6WA 1W8FA 1SBFA 1DLLA 2D98A 3FHIB 1RHI3 1O5UA 2XPJA 2ADPA 4AGGA 4AGVA 3CMAV 2OX0A 3PMSA 3LFMA 3U37A 3OUHA 3LWCA 4AZZA 2WT1A 4V1PA 1GNHA 1VQ9V 4XF1A 5DZEA 2E63A 4OI2A 4GKJO 1L1FA 1DIWA 1TUBA 1QJZA 3CU7A 4I0BA 1JODA 3CJXA 2D3SA 3MHHC 1JOPA 1CPYA 3SHRA 3STLC 4DEVA 4EKWA 1NTKH 5EFUA 4AFBA 1QJY3 4RQEA 2E33A 3ZSEA 5JLVA 4CDXC 4CC5A 1BHAA 1PX3A 3ACHA 1EPZA 4ICGA 3VBFC 3H1JH 3CMEV 1QDOA 4NRQA 4CCLA 3ZRXA 1RUI3 5CBGA 2EXKA 4XIKA 4UFKA 4QPGA 1OFNA 3KQRA 4XILA 3BALA 4LBEC 5JXJA 1PO12 4QGMA 2QDOA 4IEOA 2P3KA 3FUOA 1PM4A 1GN2A 4NIDA 3LFIA 1MMMA 2WSUA 2XQRA 1GH6A 1OC1A 3ABTA 1K92A 5J96B 4DS0A 1KGYA 1TUEB 2W1UA 1YXBA 2Z69A 3TETA 3ALQA 1IXBA 2OCCB 5I0RA 1DQ6A 4L2NA 4RYDA 3OBAA 5AC93 3VBSA 4JTNA 4TQDA 5FPLA 1AB3A 5KXDA 3KQ4B 2GTSA 2HWE1 2MEV2 3LD8A 3N27A 2UU9O 3OUJA 4QKFA 4UXAA 4GX5A 5T5JA 2A6ZA 4AI2A 1SCRA 1UU5A 5FZ4A 2GMPA 3HPLC 1W2NA 1W6OB 3AMHA 3BCCH 2PLV1 3MLJA 5A1LA 3CO2A 5EBLC 5J2TA 3IFXA 5T54A 3HKBB 3AXDA 1JTZX 3SPJA 5D5QA 1PNKA 5HI0A 1AR63 4XDLA 4K8FA 2JDNA 2WNUB 2BOJA 1HB4A 3WQBA 5K0UC 2P06A 2ZE6A 1OQEA 3A7QA 2JJ2G 2VQUA 5C8YB 4QXHA 1E5HA 1KRIA 1CIWA 3IBMA 3FLTA 1ND3A 4I4TA 2LP7A 5B3SB 5ITZA 4MGTA 4LHKA 4MS2A 2ZX1A 4P02B 1W9SA 2VMDA 1E5IA 1I3HA 3H3UA 4K1ZA 2CTRA 1QLEC 5FUIA 3APQA 3MUY1 1SFNA 3FFZA 3AKTA 3J8F2 5E88A 5HFLA 1JUIA 1XBLA 4YW1A 1O59A 1Q6UA 2Y4UA 4NPLA 5A7OA 1REDA 5IWAB 1CONA 3E22B 4O4IA 4TWKA 1XMQO 1Z7S1 3NAPC 1RUD1 3KT4A 4EFBA 3JD71 3IC7A 2JS5A 2BBVA 1S0BA 2ARXA 3GF6A 2UWBA 2QQWA 3R0RA 4X64B 1V6JA 3FLPA 1HR0O 5M0TA 1LESA 3T0AA 1TEIA 1NE4A 2DJVA 1EV11 4ES8A 5BMVA 1SKVA 4DV4O 1CP9A 5K1XA 4DK0A 2LO1A 1YI2V 3HBZA 4BIOA 1PPJH 2Q7HA 3CKHA 4Q26A 2RJLA 1IHMA 1FX5A 1X36A 3L72H 3AYDA 1MSDA 1Z2GA 2O8OA 1N34B 1ULDA 1LUVA 5EYXA 2BGCA 4RAIA 3QCWA 5JR2A 5DG1A 1Y9GA 2ZGUA 3OEBA 3JASA 1JXNA 1JYVA 4JGSA 2SLIA 2D44A 4LFCO 4UW3A 3DC5A 3CJHA 1HNZB 5EYYA 3WNKA 3ZN0A 4AQSA 3UT5B 3FB5C 1YJWV 3K9SA 3WF1A 1XL4A 4DQAA 1QJX2 1V6IA 4UF0A 1LULA 1AJPA 3GXUA 3QLQA 1ZBA2 5KMGB 5FKCA 4HVRA 3ZMOA 2LW1A 4NAMA 1O4TA 2RV9A 1RB8G 2Z0AA 1VP7A 4I9WA 1SQXH 1Q6HA 3S0MA 3DTUB 4K40A 1D5NA 1XNQB 3VQYA 2JJ1G 2VQTA 4WBNB 5D2AA 1X9TA 2GN3A 1SBDA 3PUIA 3CZJA 1HNXO 1AVBA 1UW8A 5E1AC 5F6LB 3RW0A 5FZAA 3WDYA 1OKOA 3THCA 1T5EA 1REEA 1NCRC 1FT9A 2WO1A 1ZRCA 4DXSA 4NIHA 5J36A 2JG8C 4N9IA 4ES9A 1QNWA 5IYCO 1QJFA 4QQHA 4PBPA 5KHKA 5EIYB 4MVSA 1KDMA 4DUVA 5FMBA 4E8CA 3TOJA 4XETA 3WDWA 4MOAA 5EBMC 5FZOA 4LKEA 4GJZA 2E53A 1JHNA 1XNDA 3AZYA 5D21A 5A3MA 1CIYA 1RUF2 3WHTA 2ZGKA 2H94A 3GHNA 4TSFG 2ZCEA 5FYYA 3ABZA 4XVHA 5JOWA 1VBE3 4I9QA 4K6BA 3JCUZ 2JE8A 2ZGSA 2UXXA 4UCTA 1UOBA 5H9CA 4GH4C 3VKNA 3VBFB 2HLDG 4N43A 5FQ0A 1NX9A 3FZ3A 1HXS3 2ZEZA 1ZM1A 5C7GA 5GZEA 3M3QA 4ZOLB 3SH3A 3K3WA 4Y3OA 1UMZA 5H9PA 5C3SA 4ZHQB 2RDQA 2Q5TA 4M3CF 3H1MA 2VVDA 3K5LA 2VXRA 4YGEA 3ZXKA 1VQ4V 1TQ5A 1W8TA 1QQP1 1MVQA 3ZFEC 3VBRC 5CAZA 4XDKA 3MICA 3MUZ1 4PLOA 4TTGA 4KHPO 2RR11 3ZRSA 4GB32 5J9PC 5J09A 4XFGA 3ES4A 2R042 5A6QA 5K4LA 2D2CB 3AZXA 5FWEA 4NYKA 1D5AA 1O6UA 2G4IA 1OKQA 2CWMA 4H3WA 1ZVFA 4K0KB 2JWPA 5LRRA 2ZZJA 4ATEA 3LAGA 1KYOF 4O4JA 1KEXA 4OVEA 5HV4A 1C1FA 4XDJA 3FX3A 1W8ZA 2WQZC 3ZOIA 2WNEA 1OCOC 4FPLA 1DK1A 3KT7A 1VEWA 3V64A 1HJGA 2HR3A 1MS4A 4YGDA 3C7FA 2JDUA 4H33A 1VBB3 2VNOA 1GQGA 3J4UH 2ZOEB 1SETA 2A1XA 3S7IA 1UPSA 4AHXA 3B09A 3PIJA 2AW9A 1DYPA 2OA2A 4DW0A 4MW8A 4A41A 4CXYA 4HFSA 3BRCA 1K5MC 4DR7O 2F1MA 1DYKA 3J7HA 2PF4E 3MFCA 4J10A 1W06A 3CCSV 3K58A 2QWNB 1BHGA 2DYSC 1CZTA 5C4WC 2HWC2 2WLMA 5F9TA 3VQXA 3LB9A 5C8WA 2RS11 1HDJA 1UIKA 1AF9A 2WQ4A 4LXLA 1QGLA 1VE0A 1QVFU 3MZHA 5EJ1B 2DURA 1W99A 4ZONA 4WFGA 4R4XA 1H8TC 3FAVA 4M0NA 4AYUA 1VQOV 1BT8A 2WLJA 1LEDA 3PNAA 3VQWA 2ZA9A 3B40A 5J1XA 4INDA 2CK3G 4FTEA 1TGOA 3M3CA 1Q8IA 4XF4A 4PQQA 1M4UA 5DQ0A 2QKCA 4Z92B 4OUEA 1AUYA 2D5FA 5ANQA 1R6KA 1NAEA 4NXNO 4CEYC 4MGQA 4ISQA 5LGTA 2VBDA 1UJWB 2Y60A 2E6VA 1HRV2 3W21A 2Q4PA 1DFQA 4BIFA 3AG4C 1C5HA 4XCAA 3WG2A 3H3ZA 1N1TA 3QACA 2J1SA 4ASKA 1E57A 1JCHA 3CC7V 4BQ1A 3D5OA 1UCXA 1SZXA 4Q1PA 3PDQA 3EXUA 1H4HA 2AUYA 4CP9B 1SQVH 2HEVF 3ABKC 1QBZA 4I50A 2Q5ZA 1DGLA 3WINE 1ENSA 3WNPA 3I2HA 1L7RA 1W8WA 2N74A 4Q5OA 4WZFA 1XNBA 1W6OA 4AHYA 4FFKA 2GZWA 1FS0G 2XHBA 4MXWA 1DU3D 1LOFA 5D8AC 4ZPIA 4C1XA 4YG6A 2B1GA 3H1HH 2RJ2A 1UPGA 2A9HA 2ET7A 1ACCA 4OHWA 4F3JA 4DR2B 2B4KA 3UGHA 1UU4A 2PHXA 1WMDA 4OFGA 2EJRA 4YVSC 5ERLA 3IDBB 4MHUA 3TN92 2EBOA 4AFDA 1NLSA 4GT1A 3FWEA 1PX4A 1XOYA 3LOBA 4FIPC 4FM1A 1DQ0A 4AR2A 4HPKB 1WCQA 4D0QA 3OPTA 4B3RB 5A1AA 4W6YA 2JG8B 1NA1A 1XC6A 4GLXA 5TSWA 1CZVA 4QX0A 1O91A 2W08A 3JARB 4X66B 4XQDA 3VBHC 1OHFA 3IMNA 1QDCA 2VE1A 4B3NA 3E22A 3O0XA 3NL1A 4OI0A 3ENRA 2HEWF 2XWBB 4XACA 4WVZA 2PYJA 3M99B 4XIOA 2CH7A 4BQXA 3C90A 1BBT3 1UD1A 1H8HG 2E7QA 4AEDB 3JCZA 3E5QA 1H1AA 2ADEA 3AJYA 4CEWA 4GH4B 2P5BA 2WR9A 2E3CA 4NIAA 5CFDC 4JZGA 5CB7A 2XQXA 1Q82W 4EN0A 5GLVA 4DW1A 3K4ZA 1KJLA 3UM7A 3BTZA 2AC1A 4A6SA 4BQ5A 2K2SA 1A3KA 2XG3A 2W91A 3EO6A 5JJEB 1O8PA 3VHPA 5IVFA 3T3YA 1UO9A 1FYUA 2UXDO 4G28B 2WS91 3HKCA 3ZFEB 3VBRB 2DUPA 4PLMA 2GUZA 4HONA 5FZ1A 4OXSA 2RHPA 3Q8CA 4DR3B 3UNPA 3F2ZA 2ZR3A 1B04A 1PM7A 3UT5A 3S6PA 4U7NA 5E8AA 1UF2C 3BB6A 4IGOA 3VBBA 2LS6A 3ILNA 1J58A 1G86A 1OXCA 4LO8A 1R091 4MT8A 1O4YA 3KM5A 4YGCA 5GALA 3CYOA 2ZACA 2WLHA 4TSVA 3MF6A 1RUC1 3LNNA 4DR4O 3MDSA 2XBO1 1GN4A 1YHFA 5K9YA 4NXMO 1OCOB 2HWF3 3MIGA 4KL1A 3UL2A 3H50A 3PUHA 3I3DA 1W0OA 2ZXWB 4V2VA 1QNYA 3MEPA 3E6CC 1R1A1 3H1LH 5FTTC 4HN0A 1VBC2 1QH7A 4EN8B 1M90W 3CEWA 4WZCA 3KKYA 4LF6O 3KVBA 3OB8A 1NZIA 1IBKO 3POSA 4RSUA 3I2JA 1KD1W 4IE0A 2DYSB 1XE7A 1HQLA 4K8RB 3KD4A 2E74B 4CC6A 2QTSA 5BZBA 4B7KA 4K3AA 3BI3A 1W03A 1N0NA 2VQ0A 1JH5A 4GUNA 1PZ7A 5JJJB 3A0KA 2UUCB 2WUHA 3OCPA 3KZ4C 2P1BA 1QJY1 3T0BA 4CDXA 4IE7A 5IVYA 1TAEA 2WWJA 4LTAA 1HNZO 1B6QA 2ATFA 3AYEA 2BGPA 2RDCA 3E8HA 2HJFC 1FXKC 4WFAV 4ZOLA 2W94A 1RUI1 1PNMA 4ZHQA 3IC9A 3ZRWB 5JH7B 2Z3YA 1QR9A 4JTDB 2P6CA 4UCOA 2JDMA 2OQ6A 2UUBB 3CE2A 4JI2O 4C0HA 4G27B 4D94A 1W6QB 1V55C 2YGLA 4AWDA 1Y9MA 4UBHA 2XH6A 1D4M3 2XR4A 4R7CA 4U2AA 1XNQO 1PVC2 3LIHA 1L7LA 4UFJA 4XCBA 2GNTA 1VBA2 4D6QA 5FWJA 2GN7A 4J7ZA 2QE3A 1B35C 5FZBA 2JGDB 2Z42A 2YXYA 3VKMA 1OA3A 4F83A 5AC91 3GBFA 2Y26A 2AXTZ 1AR82 1RP3B 3TBDA 5A32A 1HQWA 4BQ3A 3ABKB 4QGPA 1S77D 1GICA 2AHZA 2IXKA 4IHJB 3CIHA 4LORA 4O2AA 5KLVH 1SQBH 4XMAA 2W6IG 3PVEA 3E5UA 4EB6B 5IT9N 1QJU2 4Y1XA 2C5DA 3SPHA 3KV9A 1KU9A 2ZINA 4EN6B 5D8AB 1PNLA 2ZAHA 3MDPA 1RUE3 4AQYB 3KHBA 4LBMA 2XMLA 4MVTA 5T5OA 3SJBC 4PDMA 1AR61 2Q8EA 5K0UA 3THPA 3URFA 1ALYA 4LO6B 1H30A 4JKLA 2OIGA 1CZSA 3RZKA 4J1WA 4IERA 4RWUA 5F3GA 5C3QA 1JU4A 2A70A 4X62B 2OPWA 3HJRA 2WSSG 4MTOA 2CE4A 2XB6C 3C7GA 1C1LA 4YJ2A 3DC6A 4ATFA 5FZCA 1VQNV 4N53C 4IESA 2F23A 1K4CC 2JS3A 3VZLA 3HIFA 2VQAA 4XF0A 2ERFA 4IDZA 4NRMA 3VBHB 5J48A 3G6JB 3ZRVA 2CGNA 1R083 3DGTA 4NO4A 3NAPA 1K33A 4DXTA 4XBFA 1U5YA 5FP3A 1VMGA 1VMJA 1TVGA 2DTWA 2UYBA 1N3PA 5A33B 1RMU2 4RQPC 4NN0A 4OI4A 2VMGA 1PK6C 2HWB3 3RBZA 1VAMA 1RYYA 1AYN2 4FPKA 4J6GA 1W2AX 2VMEA 3KG2A 1W3XA 2EIKB 2QGNA 3Q8AA 3I4IA 3ZXLA 1ONAA 1RUG3 5CA0A 5F39A 4BQ2A 3IIIA 3WUDA 3VZJA 2UU8A 4XFFA 4J7KA 1BEV2 1MSWD 4IEPA 1KP2A 5FXWA 4Z8BA 2J1TA 2A7AA 4XJZA 4DR1O 4DRVA 1LECA 2J1AA 4O2BB 3HKDB 5AVPA 2DCKA 4K7JA 1NTMH 1PGL2 2YFUA 2DVDA 4LK7A 1OFSA 3EQEA 1OVSA 3RQ0A 3KSCA 4NR1A 1H6YA 1BVP1 4RFT0 2J7MA 2F43G 3T09A 4LP8A 4ASUG 1RUJ2 4NKGB 4NHLA 1UZVA 2BWCA 3MPPG 3H7JA 4CA9A 4JI6O 1U5ZA 2RQ6A 5LOVB 3H8XA 3AKQA 3RZHA 3P32A 2RM23 2GDSA 2Q7GA 4QQLA 2ZNIA 4YFZA 4DV0B 4GIQA 4JI4O 4DV7O 5IWFA 2Y0IA 4JHTA 2JEXA 1F2NA 4NTYA 2Q4SA 2E9QA 3ZXEA 2OUJA 1FD9A 1CJPA 2LQTA 3JAKB 1V9U2 1AJOA 1HW5A 2VZRA 2WO2A 4DK1A 4DUWA 2K1EA 2ZX3A 3R4SA 5BNQA 4TLFA 1A34A 1PO23 2RMU3 1NCRA 3ZKUA 3T2MA 4QU2A 2R9RB 2AZ5A 3J7MA 4FP2A 1H8EG 2JG8A 2PUSA 3RNSA 3I5DA 4Y4RA 4CXWA 4GX2A 1L0LH 3EYPA 2E32A 3ZHUA 3JARA 3W7TA 3ZN4A 5IJ0B 3ZN6B 2G9FA 2MEV1 1CAUB 3WDVA 4X1YA 5JPNB 1KBHA 1N32B 2E5LB 1UY3A 4JDMA 1WP8A 5LBFA 2QKDA 4PF1A 3HR9A 3L73H 3J7NA 4A7KA 2OIIA 4FPHA 5GZCA 3A21A 1VBE1 4IW3A 3A4UA 1WA4A 1EAH3 3SDLA 2XKOA 4JVAA 4GH4A 5B2GB 1G8MA 3NV1A 4F6EA 3NNMA 4CCNA 1KJRA 5CA6A 5A6XA 1HXS1 1K97A 3ZMUA 1FXKB 3KWVA 5CBLA 3I3MA 4I02A 5FCCA 2OPKA 3SYQA 4BMBA 2JVDA 3ASOC 2HEPA 1SERA 2IU3A 4LIVA 1COV2 1H1IA 4GWJA 4FPPA 1FMD2 1POV0 3MHSC 1XJAA 2ZMKA 4Y1ZA 2GSMB 2VXJA 3SR2C 2KA3A 4DR5O 1D0GA 4D69A 3RI8A 4BPZA 4P9JA 2KXLA 5BNNB 4BA6A 1ZNPA 1EFRG 4OMDA 4LF8O 3KZIZ 2HLEA 2JD4A 1LEMA 2XXZA 3TGUH 3V65A 2L6LA 1IVSA 1BMV2 2DF7A 4P5YA 1RSOB 1BMFG 1F8VA 3AFGA 4B3RO 3KHCA 1GMMA 1OT5A 4FQ4A 3MW3A 4PA4A 3U75A 4FFHA 5F3CA 2FMDA 2ZPXA 5C5TA 3E97A 3K75B 5JVVA 2PHLA 1K5QA 1G9CA 4A7YA 4E2SA 1ZX5A 3FX7A 3JXSA 2NMOA 4XUNA 1P4RA 3O12A 2WBKA 4BR6A 3A0NA 2DYCA 2VCCA 3KMHA 1K5MA 3NV4A 5B4NA 3I59B 3AK3A 1V00A 2HBUA 1WW4A 2IXHA 3FFQA 4LQRA 5JI7A 2H6BA 2VCBA 5DUXA 5EJZB 4IV1C 1QXPA 3N7JA 2WC2A 3N9PA 1C8NA 3LUTB 5EYPB 2IXIA 3MIEA 5C4WA 3MF9A 1ZRIA 1N36O 2F4PA 4ORFA 1KFXL 4I09A 1SLBA 1AI5A 3GBWA 4CS2A 3WP5A 4B3SB 1Y76A 1L0NH 2PI5A 2ZNJA 3VZMA 4GKKB 4E9KA 3K51A 1KUQA 1H8TA 2XAJA 3QF7A 2YIBD 3GYDA 4WFEA 1NI8A 3Q8FA 3DEMA 2BSKA 4XBNA 2OIEA 1EUTA 1YVWA 3U10A 4A3XA 3KS7A 2ZX0A 2IWGB 1JJOA 2BPA2 1HNWO 2QWPB 3MV01 1AR71 1H8VA 4RQPB 5ACA3 3JD1A 4YVWB 3S5QA 4HKWA 1JR9A 5IY5C 5F37A 5EK0A 1PK6B 4CEYA 4D6SA 4PIYA 2ZHMA 5H9RA 3BEHA 1CESA 4CH5A 4RD7A 4JI1B 4EE2A 1W6QA 4NRPA 2ODMA 1ZRDA 5I93A 4J9YB 4DV2B 4TV9B 1DQ1A 3T2QA 3JQXA 4DY3A 2V73A 1SFYA 4PDWB 3T1YB 1AYM3 4CDQC 3UK9A 4XXAA 2WT2A 3OW2U 1X50A 2OQ7A 2PYTA 2WJSA 4QPYA 2ZQMA 4BK5A 5AFEA 2IZWA 2P3YA 5BNPB 4X65O 4K21A 1AI6A 3NNJA 3WNNA 1JW6A 1RUF1 3SYCA 1SHWB 4MO3M 4JGYC 2HWE2 2AEZA 2PGGA 4E8DA 2MNGA 2Q8CA 1XYOA 2WLPA 1PGSA 4X89A 4ZHNA 1VP6A 1JZ8A 1PNGA 3IGAC 3L9DA 4X1KB 4K3UA 4B3MB 1MNGA 2PLV2 4JI8B 5H6RA 1G4YB 5LBQA 2J1UA 1HV0A 4AGRA 4P00B 3I54A 1X8MA 1ZX3A 1AROP 5DAPA 2W46A 4OZXA 5T5LA 5IK7A 2XDVA 5EJ3A 1UYYA 1QVGU 2JIJA 4DV1B 3USSA 1SPPB 1YCIA 2Q1FA 3NNGA 4NUBA 5EQUA 4UV9A 2R6QA 4YVSA 4IE4A 1FFXB 1W0KG 1AXYA 3M3EA 3V0BA 5A7SA 2VMHA 1WMXA 1MZ5A 2IFWA 4DV3B 3LDRA 2AYHA 1H2MA 5CBFA 2K46A 3M3IA 4COVA 1V54C 1PL0A 2WAOA 3AG3C 2JGUA 3HWJA 5FYBA 4HXCA 2UUBO 1OPOA 1NYWA 5IYZB 3SPGA 3KCXA 3VBHA 5CKNA 5CG8A 4I55B 3QO5A 2GC2A 3OE7G 3POWA 1UX7A 2E26A 1B3QA 4JV4A 3H0OA 4UOJA 3OY8A 2R063 4RUEA 3S57A 4A2UA 3ZIAG 3UETA 2E76B 3VL8A 4FMTA 1Z7S2 4E4HA 5A33A 4E27A 4TT3G 1ROPA 1OJHA 3JD72 1ZZ7A 3WD5A 2YIBA 1YF2A 5LY2A 1BBT1 2V7QG 2DFCA 3KV4A 3I56V 1W2BU 1OOPB 2VTXJ 1OLRA 5DZFA 2BTQB 1EV12 4FQZA 2NP0A 2W95A 4UCUA 1ODMA 4P9IA 2P6HA 3LNMB 1OCCC 5CFDA 3LDBA 3WF3A 2YMZA 2LRPA 1IS6A 3J81N 1D7PM 1G6UA 3I2IA 1S0FA 3ASOB 1F23A 1M06G 1Y6XA 3AXEA 3E83A 4XBLA 2EX3A 2DTYA 4LBQB 2CTVA 5FIXA 3HKDA 4W4KA 3BA9A 2UUAO 1ZZ8A 1Q56A 2BYVE 3AG2C 1LENA 3EHBB 1QOOA 1C8M3 3NJYA 2ZHKA 1QU0A 3CCEV 2MW2B 4BWOA 5A80A 1GWLA 2XJSA 4JZ2A 2QTOA 2LUWA 2RMKB 4MVQA 2PI4A 3BCWA 3LDDA 1PVXA 5FPAA 1CPNA 2ZKNA 1J59A 1HRI3 2W1SA 3ZXJA 2UY9A 3B02A 2C4XA 1V0AA 3GB7C 1RXGA 2CNAA 2TBVA 3AG1C 4QKNA 4L11A 3DV8A 2D6NA 4L87A 3EMRA 4LF4O 1SFPA 4D7SA 1QIQA 3JAKA 3QOPA 2OS2A 2XNDG 5LBBA 1RPRA 4NE9A 2EZOA 1DGSA 4A45A 2QCSB 2B39A 5JCTA 4YGBA 1C5IA 5B1OA 4LF9B 3T4HB 5FPRA 5CG9A 4ITCA 4M0HA 2X29A 5CKMA 5JJNB 4XQWA 2DU1A 4XFCA 4WM8C 1XYNA 4IV1B 3H9AA 1KQRA 3PJYA 3IDEA 2QEXV 4MGZE 4EFEA 2QWRB 5IJ0A 1RXFA 5B1BC 5FRAA 3WOGA 3POFA 2ID4A 2K0GA 3OBRA 3RZGA 1SQQH 1HWYA 1WA8B 2PYLA 1PHMA 4X6RB 3ZO0B 4ZIBA 3N7KA 3ZFFB 3SCFA 2QR4A 3BFRA 4KQ7A 1W90A 4JV5B 2HEYF 2XJUA 5CA3A 5KX5B 2LJ2A 2Y6HA 3WP4A 1NXMA 3D0JA 4S2GA 2Q30A 4HZFA 4Q0UA 1LHUA 2FL4A 4FSJA 3BKZA 1GR3A 4JYAB 4I5SA 1MZEA 2R0FA 1LODA 1O5LA 1UZZA 2JDKA 2IJJA 1FXKA 2YY1A 4TN7A 3UKTA 3WCRA 1LOBA 2B9VA 3KCCA 1VF6C 3NO8A 1GSLA 4UV8A 4PA3A 2ZGOA 3OD4A 4MGKE 5GLTA 5E6HA 5JXIA 4BDVB 4MX3A 1XYPA 2C9KA 4UVBA 5G05L 2AZ0A 1QXRA 5A3WA 4CPBD 3L75H 4DV0O 4XHBA 1HP8A 2XLGA 1QQP2 2A6VA 1JUHA 2PHWA 5KR7A 4CDQB 1YIFA 2RR12 5JVDA 2VMIA 1WLEA 2RS33 1YJKA 1B35A 3F95A 2R0HA 1QCEA 4XJAA 1RSOA 1B06A 4AI9A 3ZHVA 5KHJA 3E6BA 2HWD1 4JGYB 4W50A 3OPWA 2CGPA 5JAXA 4U7OA 2FB5A 3LEKA 2EULA 1U12A 1XOUA 4R9DA 1HN1A 3JATA 5DEDA 3E5XA 4NHXA 3KCYA 4DRXB 1RUE1 1ULCA 1XL6A 2WLQA 3UKVA 5C70A 4GKJB 4XHXA 1S0VA 5CNAA 2A0LA 3FD9A 4FCAA 4DB5A 1OH3A 2GNMA 3RS6A 1GNZA 2WPDG 2Q9LA 2XVKA 1X4TA 3UV9A 4JZRA 1UFIA 1ULEA 1STMA 3RZLA 3N2KB 4F6RB 2UWCA 1G8WA 2FKXA 4QMAA 4Y26A 5GONA 5FPOA 4FM2A 2W92A 2CAZC 4YLZA 2CSGA 4UCRA 2RS12 4N53A 4R9AA 3AG3B 4LKDA 3H8OA 4J42A 5JSPA 1R3IC 4JQTA 1LGBA 3UJOA 4A7ZA 1RTVA 1UY4A 4YZ4A 1RINA 2WO7A 2D40A 4F7ZA 3IJ4A 2WWWA 1VMHA 5FMDA 2Y6GA 2ARCA 5LL6Y 4O61A 1LU2A 4LOTA 5CFCB 3AK1A 5F1RA 2N04A 3CCVV 3ZYFA 4QXBA 1PK6A 2EIJC 2HWB1 1ZRFA 2YC0A 2YXHA 4PV1B 1W6NB 2R9AA 4M4RA 4DV5O 2WZ8A 1Y67A 4YZ1A 4TV9A 4LBQD 4LWSB 4JTAB 3VD9A 2WNVB 2UU9B 3PN1A 5IVVA 2VOKA 5LCWL 1EN6A 1DZTA 2ILMA 1XREA 3WDUA 1ORQC 1M5IA 3M3OA 5IVJA 3VHOA 3WEZA 2E75B 3GNEA 3OMAB 3QO7A 2I74A 2IXLA 5LBEA 4Q4W3 2HHHB 1VQ8V 1XQNA 3OGVA 2JDAA 3BGAA 2ZMNA 3TEYA 3NJVA 1TVKB 3N9LA 4H7MA 2NQYA 3B3QE 5KC6A 5FLHA 3WB0A 1DBNA 4MXVA 1Y43B 1D4VB 1NUKA 2W1QA 2RM21 5FXVA 3AG1B 5F5CA 4QX8A 4B3TB 2YYOA 3AK2A 3ABLC 3N2GB 2IFRA 1OUXA 2X5IA 5IFTA 1N1SA 2V5YA 1NR7A 2Y0OA 5FP7A 1S0DA 1SPPA 1PMJX 4AL9A 1LNQA 5FY0A 3WY6A 1FJGO 4BHPA 3IWZA 1Q43A 1NY71 1A78A 1AX1A 2NN8A 2HKXA 1R1BA 2VZ3A 4HNAB 3CRRA 1I94O 1XMQB 1PO21 2RMU1 1PM9A 2FHRA 4CS3A 2PAMA 1AI4A 4WM8B 2MPFA 4CH6A 1K5SA 1YQ5A 5L3BA 3GGLA 2DVAA 1HR0B 5EIBC 5IYZA 4QU1A 5B1BB 4I55A 2WZPP 2AREA 4GX1A 4RQFA 3ETGA 2RNBA 2DYRC 2L35A 4ZZ8A 5JZGC 4MYEA 4QM8A 1UPIA 1Q90D 5IVCA 2Y69C 3BTYA 5FZ3A 3H9VA 5FLJA 3RVHA 4CH4A 3K0GA 5AG2A 4BE3A 4AFCA 1EAH1 4JGZC 3CXCU 1OF4A 4H37A 1IPSA 4FFFA 5FZ9A 1O3RA 3VKFC 2RDSA 3RYRA 1SA0A 3RYIB 2ZR2A 3IMMA 3KF5A 5JCOC 1REFA 4LFCB 3OEEG 2QWOB 3N4MA 5FPZA 3LA2A 1LB2A 1WW6A 3WUCA 4BH9A 4Q4V3 1CAVB 1Q7YW 3DUIA 3NXSA 2ZIMA 3IAPA 4PDRA 4LBQA 2WAMA 4JTCB 3PVNA 3JALA 3S30A 3U14A 1WW7A 1GQPA 4OHXA 1VAVA 1UYZA 1ZZ6A 2QA4V 2WS92 5FMOS 4CP1A 5A3LA 2FMLA 2BV4A 3WNXA 2ZJCA 2R70A 3TK1A 3GM8A 4XC9A 1MQTA 3LCPA 3OGIB 1BLZA 3N9NA 2UXBO 2Z5UA 3P3PA 3WB2A 5J37A 4QHZA 2WFPA 1RUOA 1N47A 1MVEA 1R092 2OZJA 4ZS2A 3FJSA 2EXJA 1IGOA 3O5SA 4COYA 1N4CA 1RUC2 2DVBA 4CS4A 2J42A 2OW4A 2XBO2 5FLXN 2DV9A 1ZZCA 1MS5A 2D43A 4HK8A 4YSFA 2Q0AA 4AEMA 4I7ZB 3DXUA 3GWKC 3ZVXA 1G9BA 1AI7A 3DKQA 2G19A 1R1A2 2K9PA 3SH4A 2VW1A 2P6JA 3FC0A 2Z79A 1YC61 3W5MA 3E8FA 5C33A 3SC7X 2OCCC 3DECA 1ULOA 5FUPA 3FYEB 5L9BA 5F5IA 5JQGB 4Y33A 3BHPA 2O0OA 3B5LB 4V2WA 1KKCA 2WN2A 4Z82A 1W0JG 1TME3 4HN1A 4XTMA 3WB1A 1XPWA 2I45A 5IYDO 1VR3A 4TWTA 1SF9A 3AFKA 3JCIA 4QE7A 2VOXA 4X1IB 1O9GA 1W8OA 4Y22B 1THZA 5HCFA 4DFSA 1QJY2 4FOQA 3C7EA 3BUCA 3UGFA 3CJIC 4KHPB 3ZDSA 2GH8A 5ACA1 3AZVA 2YSUB 1UNBA 4IL7A 1RUI2 2VCAA 5GW7A 4KU8A 5B3SC 3VLBB 1IX9A 2PHTA 4MGSA 5B1AC 3VZKA 3JSLA 1I9RA 4L9BA 5FK7A 5I8TA 5FNVA 2UURA 1ND2B 4HOOA 4CDQA 1S0JA 4XZUG 3SQOA 1AYM1 2WLIA 3M1HA 3RZMA 3ORJA 1GP6A 3LDCA 5FZLA 4IE5A 4PQ9A 3B93A 2VZUA 3CC4V 3AP4A 4XAEA 1VMFA 1G7YA 5BR8O 5AC92 2P4KA 1KC8W 5FPBA 4JGYA 5JOYA 2YEVB 3N7MA 4O65A 5LP6B 4NHMA 4DR7B 1I5PA 3FL7A 2EF6A 4DNYA 2WFF3 2UY8A 3JUUA 5HFMA 3HNMA 5H5NA 4CUAA 1VQ5V 5A3NA 2EIEA 4IYHA 4YM1A 3JAWA 1ASJ3 3DPRC 4HMZA 3ABLB 3ES1A 1AR93 1LOGA 1AR62 4QX2A 3R4UA 1H2LA 4ZU7A 3ZHQA 1DF5A 1YHQV 3JBG1 1FMD1 2VNRA 2JDYA 5C6CA 2C26A 2ZD9A 3X2QB 1NS1A 4XE9A 4PJYA 3HVDA 4MSWC 4IEYA 4KNCA 4B4QA 4CTEA 3TAYA 1N33O 5FAXA 2ZX2A 1OD5A 1AJKA 1WJZA 2QM4A 1J95A 4BYYA 5JXHA 3SJCC 3O1UA 2VBBA 1C57A 5C3OA 1JOJA 4W8JA 4NXNB 4XMIA 1WMEA 1XDCA 4KI5M 3AYAA 2DYRB 1UL9A 1W28A 4GWMA 5IE9A 4LLFA 4YG3A 2VS0A 2R061 3GHMA 4PT6A 5FY5A 2WYSA 2IJIA 3K5NA 3IAYA 2Y69B 1LOAA 1W8NA 1S2BA 4U3JB 1GK9A 5JSOA 2CHHA 4AXOA 4O4HB 4LNVA 4MTGA 5J2UA 3K03A 4QKDA 4UBGA 4XAAA 3A8TA 1S76D 1US3A 3PUQA 4LOSA 3T08A 4Q2FA 2WLLB 2A3WA 1S5JA 1SC5B 2IC1A 4LIUA 1VIWB 1JFFA 1TMF3 3PURA 2Q8DA 1RL3A 1IKQA 2ZAAA 3R05A 5KHGA 3KB5A 3WF4A 2XHKA 3MD0A 4ISRA 4Y20A 1XRUA 4HSJA 1YJNV 2F4VO 3MLLA 2JDZA 1C8M1 1TZOA 3VDDC 3WR0A 3SYPA 2JIGA 1VQ7V 4I30A 3LF7A 1JHJA 4MZUA 1LR1A 2NLJC 4G9SB 3K5OA 1O4ZA 2QQPA 3G6BA 1RVF3 2F6BA 1Z0HA 2DW4A 3UQ8A 4MADA 2DQ0A 3RYHB 1DP0A 1HRI1 1MA1A 1CAWB 5GJ6A 3ZMSA 4HK9A 5LA6B 2P5OA 1NLQA 2A7WA 4WM7B 5I8SA 1LRHA 4J1XA 4FLVA 5FO9B 5A3PA 2WO3A 5EPAA 1GM9A 2IVJA 2ATKC 4QPIB 4DIQA 1S3JA 1JYIA 1WAZA 2FMYA 4RS5A 1OI6A 2F95B 3L9JT 2EILB 3MIFA 3OT7A 1JYXA 3H1WA 4HNAA 2OZ6A 3KGZA 1W0PA 4HBNA 3CLPA 4JC1A 4H55A 1X9PA 1MPXA 2FQPA 3T4VA 3J9SA 2DBNA 1HW7A 4BLJA 3FLRA 2HBTA 2RVAA 3Q4HA 2X05A 3WNOA 3E6DA 2P22C 2DCYA 3P5BA 5LGUA 2A75A 3GALA 4XDOA 3ME2A 2JXAA 3U07A 4GMP3 3SJAC 3USUB 5DECA 2VGDA 2F17A 4BIUA 4X20A 1I1EA 3I97A 3O1PA 1F9KA 2EIBA 2ENRA 2VQFB 3DN7A 5DAQA 1VBE2 4L97A 1I5XA 4QX1A 2UXDB 3W5NA 2HHHO 1M57C 3WF0A 1RUH3 1O8SA 1DF4A 3CJIB 1VF6A 1BVVA 1OA2A 3POJA 3ATGA 1HXS2 4OGQB 4CBCA 2D3RA 3I3BA 5IYBO 5F3EA 1FPOA 3LQCA 1NTZH 3GVMA 3UJQA 4YHHB 2EALA 3WW3A 3OYWB 1Q81W 2VPVA 3F7VC 2W2IA 1ZL8A 5B1AB 1EBOA 4B3TO 3SXWA 2H6CA 4QPGC 4FLUA 2BVBA 4DR4B 3OD0A 5IJ9B 3Q9OA 1W59A 4P9WA 4FZ0A 1CEZA 1HJFA 4NXMB 1AHSA 2RS31 1VARA 1EPWA 3WP6A 5IAXA 3JU9A 1LTEA 1OCZB 3I2GA 2CUGA 4QD2A 4FM0A 1GZWB 2YS8A 4YW5A 4J25A 4E4EA 4BM8A 4RGKA 1J5EO 4IUGA 1GRJA 4LF6B 2ZX4A 5EZYB 2WIIB 3OOXA 1VRH1 5LWBA 1IBKB 3B00A 3VUOA 4LHLA 3BPZA 2RS53 1A6CA 5HXVA 2PHRA 3ZYIB 2VUCA 4GJYA 1AR5A 3NSTA 1BZWA 5CADA 4YJ3B 4ZI7A 5FO8B 1VBB2 4FLTA 1KXGA 3CCLV 4DR6O 5LZ6A 1FV3A 1WPBA 1NT2B 4CH3A 5K7PA 5A7WB 3DPRB 2GALA 4AF9A 1VF5B 3BIWE 5HCHA 5JQGA 2ZXQA 2VMFA 1H6XA 2NPIA 5EIBD 1S1AA 4YY3O 4CDWC 1SLCA 5ABJB 5DUUA 5FXZA 4D6RA 4XUOA 3U4SA 5FK8A 1Y74B 5FZDA 3CDZB 1SQFA 3VHNA 1GWMA 2R9IA 3JB8A 1AVMA 4KU7A 1YXWA 2XHNA 2Y33A 5A70A 3OJBA 3D6EA 2JKBA 1CAXB 3G67A 4Q4Y3 1GP4A 2JD9A 4FXKB 3V0AB 1GM8A 1BZKA 5LMNB 3POBA 5L7OB 4JI2B 1JMUB 2BOIA 1AP6A 2WDBA 4QKBA 2YU2A 3T1CA 1WCUA 3RZZA 1IS5A 4YW2A 2YPDA 3ON7A 1AR72 5FP4A 1RUD3 5LA1A 5L3DA 5BY5A 1LAJA 5JOZA 3AVRA 1UKRA 2TUNA 3BAAA 3QH7A 3RT3C 3ZSKA 2EIMB 4JHZA 3MV11 1NCQC 4KWUA 1AR4A 2QJVA 2GV9A 2FDFA 2GBOA 3PJSK 1CR7A 3IB3A 3HNBM 3LSSA 4WBBA 4NTXA 4NHKA 4AVTA 3ZMVA 1ZRRA 1ZLZA 3HB3B 5F8PA 5I91A 3BTXA 5LASA 1AL23 2PQSA 3O1TA 2DWEC 3WW1A 3D3AA 4IEQA 2YI8A 3O14A 4WVMB 2QDRA 4JKKA 3DXTA 5CZKA 2W52A 4IIJB 3ZS8C 2OT7A 3B4SA 2ARAA 4HSLA 4AK3A 1WLDA 1XNAA 4Q4W1 3VDDB 1SZBA 5FP9A 3HAGA 3ACIA 1J3QA 3JD0A 2IJKA 3AG7A 2BDRA 2V4VA 4ZU4A 4AEDC 2FYUH 2J1RA 5LA2A 1PZ9A 2CTWA 4CSWA 4WVWA 5I8YA 1SEFA 3MIHA 3VDBA 1R3KC 5CB4B 1W6MB 1BCCH 1GO3F 5DXDA 5FZ0A 3SPCA 1XUQA 3K5MA 4R4ZA 4Q20A 3TEZA 1YFXA 3I2DA 4RUFA 3ZSLA 1UXXX 1FPN3 5GZGA 2YXLA 4UB8Z 2V4DA 4JYCA 1G9FA 5F3IA 5IHRA 4FXGB 4AVCA 1K7DA 2JE7A 2QQVA 1D0HA 4LEJA 3U78A 1ZA4A 2KG7A 1YQ8A 4EV0A 4OMCA 4P08A 1E1RG 2WKKA 5FV3A 1GBGA 4D8MA 2EVXA 4NWWA 3W59A 4QQ2A 2CAUA 4W4LA 2MHFA 5JZGA 5FDBA 1O3SA 2V4AA 1W05A 4K1YA 3HKEB 2ZE8A 3FYIB 1JA8A 2VCMA 2XLFA 5JOXA 4XPVA 2BVVA 4H7LA 4X8PA 4O4HA 1LJ7A 2ZXWC 1Q86W 1BBT2 4JGZA 2CDOA 1TUBB 2QM7A 3H1IH 2LW8A 4DR1B 4LFAO 1SESA 1CX4A 1FOD3 3HN1A 1M57B 4CUGA 2WLLA 1IG0A 5IJRA 2VZQA 5JCOA 3UO3A 4UYBA 4YWAA 2BE3A 1DLBA 3MIDA 3CSXA 4BJ0A 4RHV3 4CUBA 4GZRB 1Y4WA 4KBZA 5LHGA 1SLLA 2R073 1X59A 1SBEA 4JI6B 3IPVB 3VDAA 4QPGB 2NNUA 4ZZ5A 4LC1A 1PL4A 3OGRA 2ZS6B 3H3LA 1WZXA 1O3TA 1GOHA 1P84F 1BE3H 4JI4B 4S2FA 4DV7B 3M4FA 1IPKA 1BGYH 2Y48A 3WQ0A 1SLAA 2WYFA 1GOFA 2A6YA 1CAWA 1X8EA 3C3SA 4C0BA 1JJ2U 5JPMB 1JS9A 5KC5A 1JX9A 4PLNA 4GKXA 4GWIA 1MACA 2VW0A 3STZC 1U96A 1YIJV 1N3OA 2GSYA 3VBSB 3DL3A 3OUFA 2D6KA 4Q8LA 2HWF2 4AEKA 1S72V 1IKPA 2Y64A 2ES3A 3GWOA 4Q6GA 3N9MA 1JI6A 1QY4A 3NJZA 1PGW1 3JD2A 5FY8A 2QQIA 3I2FA 1SQGA 1DZRA 2C9AA 4URAA 2DE0X 2A06H 1DTOA 3ASNC 4DXWA 5F2VO 2AEYA 1AX0A 3KV5A 4KGGA 1ZUQA 5I0TA 3A22A 3VD3A 3ETDA 4CDWB 1TME1 2HP8A 3U4XA 3GZEA 3USUA 5A6ZA 4DINB 1VBD3 5FL7G 1H2GA 1SQPH 1ND3B 2DCZA 1OH4A 4I4TB 5LK5A 1OHHG 5ITZB 4C90A 1JZ4A 1ZAUA 4FOWA 2XJQA 3HKBA 3A0HZ 1VQMV 2Q8VA 1OD3A 1JOBA 3AMNA 3CJIA 2WNUA 4I3PA 1ZZBA 5B1NA 3EVKA 1CX1A 3I2OA 5C8YA 4DR5B 4RR3C 1N8RW 2VNVA 4O4IB 3FMGA 3THDA 4YFWA 3B77A 4KH9A 4DUZO 3N36A 1E5SA 2BOCC 5HV0A 4LF8B 3OYWA 1LHNA 2Z2SB 2X0LA 4N21A 1NCQB 4OLLA 3B7MA 3OAAG 3WZ1A 3CCJV 1NVPB 3SCHA 3BIEA 1GOGA 1NBMG 5IJ9A 4UW6A 3MYXA 1A32A 1D4M2 3S3XA 1W8UA 3LSQA 5KAFZ 5EBWC 4QGNA 4JI5B 2YPJA 1C4RA 2BNMA 3OBTA 2VVFA 1LHOA 4PI2A 4IT5A 4AVSA 4AVAA 1UY1A 4UFHA 4BW9A 4B4RA 1PIV3 2FCVA 2JRIA 1XNRO 3INAA 3VB9A 5FZ6A 2HWD2 4AFMA 1BL8A 5BNOC 4OPAA 1H2SB 2IJHA 5A6YA 3JASB 3OPZA 1AXZA 4JQRA 2EINC 1Y4MA 4IL6Z 2EIKC 4MUVA 3OF1A 4LF5O 5GZFA 4DV6O 1GKFA 1N36B 3FBYA 4YXWG 1RUE2 4N7IA 5A7WA 3DPRA 3IAQA 4MSVA 1QOTA 4ASLA 1ASJ1 4LA2A 4Z2WA 1AR91 3POYA 2VQFO 1Q8PA 1HIXA 1K3EA 4UF0B 4YW7A 1MS9A 1WD4A 2VW2A 4JYYA 5JXGA 1QH6A 1YQ6A 2ZE5A 3NQHA 2Y6JA 4YW6A 4R50A 2XJVA 5HXMA 5BXZA 3U11A 4I0AA 2VOTA 4XZPA 3DSQA 1OZ0A 1HNWB 4ET7A 3O7OA 2QFEA 5LYJB 1MEC3 3WNMA 4YHHO 5GLUA 2D97A 4KP4A 3OEHG 4KFMA 2BTVC 5KMGA 2DU0A 3BPSA 3GCWA 3M7MX 1HKDA 1M56C 1R082 1V6KA 5KXBA 3VDCA 3RSJA 4H13B 3CD6V 2OWOA 1RM1B 1GAXA 4IETA 2W6JG 2EIDA 4ZKTB 2ADQB 4MG2A 5H9SA 2VQEO 5I0SA 3L70H 4WBNA 3ETPA 1N3QA 5FPUA 2E51A 2HWB2 5FZOB 2AH2A 5KBFA 3C8XA 3S5AA 5FREA 4X65B 3AL5A 1RHI1 5I0UA 4LBNA 4MTFA 4YYOA 5IK8A 1RUG2 5DZGA 4A5UB 3L2YA 3LPFA 2EXHA 2A5ZA 4MVUA 4FP3A 4K8XA 1TMF1 4CEWC 4N43B 1J3PA 3ZFGC 5FQ0B 2D6MA 4P9YA 4E2GA 3CBNA 1LNSA 3BOWA 1F51A 4L8QA 3CPWU 3J80N 4IXLA 4IV3C 5FYIA 3WG7C 3VDDA 1UWWA 2VWKA 2QNKA 4TZDA 3T1HB 3DF0A 4H14A 3A0BZ 2WS93 4U3FH 5KWRA 1RC6A 4NAOA 2ZIOA 5FZHA 1RVF1 4CCJA 3VBFA 2YIDA 4AI8A 4LBKA 4CDUC 1SLIA 5FP8A 2QQKA 2OTJV 3AVSA 3C7HA 2X6CA 1EYBA 1JYTA 3SISA 2RM22 2ZT9B 4M3CB 2L9LA 5JR7B 5LA0A 1C28A 2CTQA 2ZM6B 4B4PA 5DUVA 2CV6A 2YFZA 2LW7A 5LMNO 3J7AU 4KUMA 5L3FA 2HYXA 5EV7A 4NB5A 2XVLA 3ABMC 1IDSA 1NY72 1WKYA 4P9XA 1XSRA 2P4VA 1TE1B 3S3WA 5F7UA 3ASNB 2GNBA 1PO22 2RMU2 5BNNC 1IPJA 5C71A 1OF3A 1UY2A 4XDQA 2EIGA 3RGBA 1Q3EA 4A44A 4LK6A 2D6LX 4TUYB 1IURA 2R32A 4N90A 3WP3A 3HKEA 3ZDVA 3NV2A 4GMP1 4OHZA 1GUIA 1K12A 3TWIA 4JI0O 3UESA 1MS1A 3OR7C 1XXNA 3MIBA 3UGGA 1KKDA 1UMIA 1DCSA 2YDEA 1DDLA 2VOVA 3T1LA 4J9ZB 3TB0A 2PHDA 1EAH2 2KD7A 4IEUA 1AXKA 2UUAB 2D93A 1P49A 1RUH1 1DYOA 1SRYA 2XJPA 3PVBB 4RR3B 1NVPD 4FOYA 1JVMA 1WW5A 2J22A 2JDPA 4UB6Z 2C2AA 3FAVB 3FB6C 3L71H 1RGSA 2HYKA 1JZ3A 1RFYA 4QXCA 3ZYGA 1YWKA 2GH2A 4G3YC 3TXQA 1HQNA 4C91A 3W20A 2YC4A 1W3VA 4ONUA 2XUEA 3IPVA 4LUKA 5C3RA 4FFBB 1GN3A 2VJXA 3VV1A 2ZE7A 4AG4A 4BB3A 3CEIA 3WX5A 4LF4B 2B1IA 4QX5A 1WPXA 2BOBC 1U0AA 2ZMLA 3EB7A 3PU8A 5FZ8A 1WB7A 5F2WA 1YI7A 3SJQC 4JI3O 3VL9A 3OFNG 1DF0A 1VQPV 4XFBA 1VQLV 4YVWC 2VRZA 1E1QG 5IK4A 2IH3C 2P7TC 1MABG 5LATA 2RS51 5BNOB 2JICA 4YNIA 4HANA 2O57A 1FNYA 4DUXA 4RGGA 3VN4A 2EINB 1XNCA 4QB1A 5F5AA 1HV1A 4I50B 5K8SA 4UFIA 5DDJ3 4HL0A 4D3WA 1Q8VA 2AHYA 3JYCA 3TEWA 1GANA 3NJXA 1MS0A 4PDWC 2AACA 4BQWA 3K9AA 3ILFA 3G80A 2B9ZA 2QTWB 4MXWB 3W9AA 1YEWA 4AILC 1FNZA 2Z4FA 5J7MA 2JE9A 5BNPC 3RVYA 1FFTB 4UVCA 1LHWA 5DAXA 1BQPA 4CDWA 1JZ6A 4CP9A 2KB1A 2P67A 3BN6A 4KG8A 2I07B 2VL4A 2CDYA 1MZFA 1HLCA 3ZMNA 3ZHRA 2QQUA 4OHYA 3O65A 1V6MA 2Y0PA 2FDKA 3WV6A 5BXXA 4FPFA 2BNNA 2A3XA 1SACA 3AKPA 1ULPA 2JJ6A 4Q4Y1 1ZBE3 5IVBA 1OSGA 3RWKX 4ASMB 2HKOA 3I3EA 2XTAA 1M56B 5JIAA 5LHHA 1W39A 1NA1B 1LGNA 2P3IA 2DVFA 1I0HA 1UYXA 2RDNA 5LA9A 3D36C 5ACA2 5FFOC 1PKXA 3ZPOA 4G2KA 2WZR3 3ZX7A 3H42B 4MW3A 3OGSA 5FYHA 2PN5A 5F5QA 3K06A 1NCQA 2CH7B 1VF7A 4Q4X3 4HPKA 5HCAA 1FXHA 4I2OA 2H0VA 2IXCA 1YFYA 4HYOA 1F4NA 4FPYA 5C8CC 4DXZA 4DUYO 4CEWB 5T55A 1AYM2 3ZFGB 3T4ZA 1AL21 4WV8A 3PTRB 4JKMA 2QM8A 2R72A 3O0VA 1W9YA 1IXMA 4DRRA 4KWKA 3GZAA 4DMIA 4IV3B 3WG7B 3ASIA 1KDKA 3ZN1A 1NT0A 4FI9A 4MVZA 1PMHX 4YM0A 1XHZA 2FDHA 3RRDA 4HKOA 5A7NA 3HKCB 3ZYJB 1OOPC 5KAIZ 4AEDA 2GUZB 2DCJA 4XUTA 3UT0A 3RZJA 2FBEA 2WZEA 4CDUB 1JBCA 4LA3A 2XOKG 4JI7O 5LY1A 2IM9A 3CCUV 3H8RA 3Q8EA 1KECA 1AJQA 1Y66A 1CN1A 3QO8A 2QZ2A 4JAUA 4QDSA 4AE2A 4KXRA 2X09A 1QKQA 4XXPA 2JEUA 3DYPA 1D2SA 2D6OX 1N1VA 1FPN1 1BXHA 3JBG2 3ZFEA 3VBRA 3SYAA 4O9GA 1PO13 4OZOA 1UZWA 3ABMB 2WA3A 1V70A 5I0DA 4UW4A 2FCUA 3ZX6A 4EJRA 3I7DA 2XAGA 2GP3A 5LYJA 4CYDA 1URFA 2WINB 1H2KA 3O1RA 5KHIA 3N35A 2P2KA 1LOEA 2V1DA 2OVUA 3AL6A 3MW4A 4DV5B 1GFF2 1YJ9V 4LBOA 4E4SA 4BXSV 4QPJA 4JTOA 2XAQA 4BZ4A 1KB9F 1RITA 4M4PA 2R062 3AMMA 4IEXA 2MEV3 2VG9A 4JI5O 1VBB1 3PIGA 4JF3A 4XJ9A 5ISLA 5C9AC 5BV6A 1FOD1 1PNFA 3ILRA 4XFIA 4QX7A 3VKLA 4BOWA 4CDXB 2DMXA 4FLWA 2WA4A 4RHV1 1OUSA 2JDIG 1JPXA 3C3TA 2R071 2JG9C 1OLQA 3ZXFA 5CKQA 4GULA 2P34A 4XOGA 5LBCA 3K2OA 5FZEA 3B94A 3ZFFC 4UCSA 1Q8SA 5L9RA 2ZGNA 4BLIA 4X8AA 3KF3A 3SKJE 1C8M2 4CU9A 1JYWA 2RG4A 2JB8A 4CXXA 3QNEA 2IU0A 3J8F3 1FJGB 4META 2QQLA 2OTLV 1X82A 1HRI2 2G38A 1I94B 5H6QA 2QVSB 2GMEA 4FLYA 5FZ7A 4BIZA 1GTOA 3ZRWA 4M3CA 2WQ8A 3B01A 5JH7A 4B1LA 3OEAA 1DGRA 2K9ZA 3TEXA 1OURA 2UXCO 5IUQA 4NWVA 2VWJA 4PA9A 1G1XB 1JN2P 2ZEWA 4GXLA 5A32B 4AQ6A 2XJRA 1BCXA 4L99A 1R3JC 4O2AB 2MK3A 5FZMA 4CP0A 4Y5SA 1TA8A 1RUNA 3ZYHA 5AVAA 2JGDA 2QKSA 4QAWA 4EQVA 2JKXA 2VC9A 3OGCC 4TUYA 4AHCA 2DWRA 5CYYA 3G71V 5K0UB 3JD4A 1RJ8A 1N0JA 1GLHA 3ZEDA 1VBD1 4IHJA 4FAHA 2O8QA 2YBPA 2AZ2A 3KVAA 3NVCA 4D7YA 4LBLA 4EB6A 4WCEV 2XOMA 3PLQA 1QLEB 4E2QA 5D8AA 3IT8A 4MVRA 3OBZA 4YJ2B 3BY6A 2R7EB 4QXKA 1QJX3 1FAYA 3WG3A 3T2TA 2DCTA 3T1HO 2EAAA 4LFBO 2CGOA 3EHKA 4LO4B 3OTOO 1ZBA3 4RR3A 4LHNA 5FYSA 2WLNA 5C93A