3BPZA

Hcn2-i 443-460 e502k in the presence of camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREKIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title C-terminal movement during gating in cyclic nucleotide-modulated channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 66
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3bpzA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3bpzA02
3N4MA 1VJ2A 2GU9A 3O14A 4I3PA 2Q0AA 3MYXA 4LUKA 2V09A 1EPZA 3KSCA 1XRUA 1UPIA 2GH2A 3E6BA 3U11A 1O3TA 3SCGA 4QMAA 3U10A 1YUDA 3I54A 1ZRCA 5CU1A 4DINB 2N7GA 3HT1A 3NKTA 3RYRA 3D82A 1X82A 1YFYA 3PNAA 3ETQA 1IPJA 5I0TA 1SFNA 1Y9QA 4FAGA 3WW3A 3I59B 3H9AA 1O5LA 3TNPB 3IBMA 3R6SA 5J3UA 4IEXA 4ZU4A 3H1MA 5BXXA 4XFFA 4N9HA 2ZCWA 4XF3A 1FXZA 4IESA 4O9GA 3H8UA 5KHJA 1FI2A 2XLGA 2B9UA 3KCCA 1QXRA 5I91A 5JCTA 1RGSA 2P17A 1LRHA 3LWCA 1JUHA 3FJSA 4FAHA 2FMYA 2GC2A 2UYBA 2VECA 4Z82A 3MZHA 4QM9A 2IXKA 1O5UA 3UKNA 3OD0A 4WVZA 3HIFA 2XL7A 3DL3A 3LA2A 2WFPA 1OFNA 5FLJA 5KHIA 1J3PA 5HI0A 2E9QA 4YNIA 4TLFA 5I8SA 1RTVA 1WGPA 2OA2A 3LOIA 4MV2A 3IIAA 1FT9A 4QX5A 5BUVA 3H7JA 5LRSA 1CAXB 2XKPA 2WC2A 2D5FA 4PIYA 1UIKA 3GBFA 1CX4A 2EA7A 1O3QA 4ZU5A 1H1MA 3DKWA 5F1RA 3M70A 4ONUA 2KXLA 1H1IA 1LKNA 4I0AA 4YSFA 3IDBB 1ZRFA 4HSLA 1NZCA 1GQGA 4PIZA 4XFBA 4ZU7A 4HSJA 1ZNPA 2D40A 2MHFA 3PLQA 4IEZA 5LEJA 4IEQA 3NVCA 4LA2A 4XF4A 1J58A 2BNMA 3KGLA 4XETA 1ZVFA 2IXJA 4X6RB 4XFGA 4OLLA 3E6CC 2QCSB 1NE4A 3H50A 4WBBA 2OYZA 2O1QA 4LTAA 1L3JA 3CLPA 1ZZCA 4KWKA 4N9IA 3CJXA 1WA4A 4BHPA 5BPXA 4CYDA 3LAGA 1CAVA 3BALA 3BU7A 2IXCA 3IWZA 2H6BA 3NW4A 3RYKA 4AVAA 3G7DA 4B29A 1J3QA 1CAXA 4LA3A 1YFUA 4UBGA 2I45A 3E5QA 4YYOA 4KU8A 1J59A 5EFUA 1XE8A 4J1XA 4D7TA 2XGXA 2XL9A 4XFHA 2IXIA 5LRRA 2OZJA 3H1WA 2CAUA 4E2GA 3FWEA 5I0RA 4XFCA 1IPKA 2MPFA 3CF6E 3OF1A 1DGWA 4HLTA 4Q0UA 2BEOA 3UKTA 3EJKA 4EWAA 4XF0A 5I0SA 3S7EA 1UCXA 5EZWA 4HBNA 2XLFA 4I0BA 4UXAA 3RNSA 2XKOA 2Q1ZB 4KU7A 3FE5A 2FQPA 1DZRA 3DV8A 5J7MA 4X6QB 4QM8A 4Q29A 3LA3A 1Q43A 3OCPA 4AVBA 3WW1A 3IDCB 2B8MA 1RUNA 1DGRA 4I01A 1G6NA 2UY9A 3SMHA 5CADA 2PTMA 4R8HA 3LZZA 4JTNA 2PA7A 2ZKLA 4FBFA 3S7IA 1LR5A 4HVQA 3BCWA 1WLTA 5E1RA 1I6XA 4HZFA 5FLIA 5I8YA 2GC1A 3FZ3A 3RPQA 3OGJA 1CAWA 1UIJA 1RUOA 3NJZA 2Z2SB 1CAUA 1XE7A 5KHKA 1OI6A 3WW2A 1O7FA 3FX3A 4Q0QA 5JSOA 4JVAA 4O9EA 1YLLA 1TQ5A 3S0MA 2Q30A 4KL1A 4Q0PA 1CAVB 1ZZ8A 1YFWA 3NSTA 1Q3EA 3SCHA 3U0ZA 1RL3A 4R52A 4QGMA 1ZREA 1YHFA 5FCCA 4I09A 1J3RA 3MDPA 3TNQA 1GQHA 1CAUB 3L2HA 4A2UA 1VR3A 1X7NA 2PHDA 5FPZA 5BY5A 2IC1A 3EO6A 3CO2A 4IEVA 4WZCA 4QGNA 4HN1A 4IEUA 2QNKA 3QACA 3EHKA 1ZZ9A 1X8EA 5CVRA 4KWJA 3I59A 2BGCA 2C0ZA 3E5UA 2CAVA 2BNNA 3FHIB 4IERA 4IEYA 2VQAA 1YWKA 2XLAA 3SHRA 1SEFA 1V70A 3EBRA 4XEZA 5I8TA 5E16A 3D0SA 3BPZA 4LEJA 4NVPA 2PFWA 5KHHA 4MGYE 2F4PA 4MH0E 2CV6A 4MGIE 1HW5A 3VHRA 4I2OA 4Q0SA 3H3UA 1ZRDA 1EYBA 3QOPA 3OTFA 2EAAA 3NL1A 5BV6A 3E6DA 4HMZA 1UD1A 3ST7A 1Y3TA 2UYAA 3BB6A 4L11A 2Q4SA 1NXMA 2ET7A 4XF9A 3PVBB 1QWRA 4EROA 3SCFA 2BYVE 3H7YA 2IXLA 4AXOA 4LLOA 2K9ZA 1ZX5A 2ETEA 1DZTA 2GAUA 3ES4A 4IETA 3RZZA 4XFAA 2QVSB 2HJIA 4LULA 3KMHA 2EVXA 4KWLA 4PJYA 4IEWA 4AQ6A 4H7LA 4QGLA 1CAWB 1NE6A 3SXWA 3UKVA 2PHLA 4P9GA 3E97A 4QXKA 2MNGA 2CGPA 3RDIA 4OFGA 3USSA 2PAKA 4L2NA 5J48A 5D1IA 4D7SA 3ZDSA 1OMIA 2H6CA 1ZZ6A 3JZVA 4EWEA 4YARA 3H3ZA 4EWDA 2OZ6A 2PQQA 4META 2D93A 2UY8A 4FT8A 4AVCA 4J1WA 4E2SA 2BNOA 4F7ZA 4Z07A 4PIXA 4YRDA 2QDRA 5FLHA 4XFIA 2ET1A 5C6CA 3D0JA 5T3NA 1X8MA 3GYDA 5LEKA 3CL1A 3I7DA 2O8QA 3ELNA 2PAEA 4RD7A 2DCTA 3CEWA 3LA7A 3C3VA 5FPXA 2PYTA 5FDBA 1SQ4A 2H0VA 2K0GA 1QY4A 1ZZBA 2GC3A 3EQEA 3M3IA 1RC6A 5K8SA 4XF1A 4Q0VA 2GC0A 3H1YA 5JSRA 1LB2A 2QJVA 3E5XA 3ROUA 2HKXA 5I0UA 4E2QA 2Y0OA 4HVOA 2PAMA 3MPBA 4HN0A 1ZZ7A 1O4TA 1OD5A 5JR7B 4HVRA 1EP0A 4F8AA 5FQ0A 3B02A 4BH9A 3ES1A 1UW8A 4LUMA 4UBHA 3DN7A 1QXJA 3WW4A 1VP6A 5FQ0B 1NYWA 3HT2A 4BYYA 4JV4A 4GULA 5AVPA 3HQXA 2ATFA 1I5ZA 4I02A 1PM7A 4K8FA 2OPKA 1O3RA 2XHKA 5JAXA 5JSPA 1ZRRA 4IEPA 1Q5OA 1PMIA 2VPVA 4JTOA 1YFXA 2Z69A 5I93A 3ACLA 5KBFA 3RYPA 2IXHA 4EV0A 1O3SA 4MGZE 4BIFA 4IEOA 4MGKE 1U12A 1CGPA 2D5HA 5KHGA 4MZUA 4MX3A 5C8WA 2B5HA 1J1LA 3FFQA 4MUVA 3KGZA 1EY2A 2GZWA 4AQ2A 4ORFA
chains in the Genus database with same CATH superfamily
1DBNA 1VJ2A 4JI2O 1XNDA 5JPNB 4PLNA 2YSUB 2IVJA 4Q27A 2ZAAA 4B3RO 3CRMA 3X2QC 3N3HA 3TEYA 4UW3A 2CK3G 4GWNA 3PNAA 5FP4A 2CHHA 2XASA 3TN93 2Q69A 1MEC3 1WUVA 1OCRC 3T1LA 3NNGA 4WM8C 2WO7A 5LMNO 3H1MA 1HRI3 4DV4B 2W1QA 2WNOA 2ZCWA 2Y69B 1FI2A 4FLTA 3BKZA 1N0NA 1QXRA 5A32A 1BLZA 2WWJA 4AFAA 3LWCA 1K3EA 3DKQA 4ABMA 2XAHA 1BQZA 2Y6FA 3JD73 1U96A 4MVQA 1XQ8A 5C5TA 3HIFA 4NPLA 4FLWA 4FLYA 4B3SB 5HI0A 4IV1B 5LOVA 1V0AA 2D3PA 5CB4A 1RTVA 1XMQB 3OT7A 2ZEWA 1SPPA 3N27A 1FMD3 4PIYA 2QZ2A 1CPMA 1CX4A 5LY2A 3DKWA 3RYFB 2WLIB 4M4PA 1LHOA 1FFTB 1YZBA 4I7ZB 5JCOC 3HMYA 1K5QA 4FSJA 4CPBD 1UMIA 1IS4A 3FUQA 2BNMA 2PHUA 5FPUA 2VZVA 1U5ZA 4OI2A 1LODA 2O1QA 2XNDG 5DZGA 1OLRA 4FPHA 4OPHA 4RHV1 3IWZA 3WQ1A 4CUBA 1JZ6A 1JZ8A 3WUCA 5ITZB 4AHCA 1XNAA 4DRRA 1D5AA 4X8NA 3ZN6A 1J59A 1QH6A 1V00A 4UCVA 1OUXA 2ZD9A 4LQRA 2W87A 5CN0A 4PA9A 1DGWA 1VPHA 5FPOA 2HKOA 2JEXA 2KA3A 5LMUO 2WNVC 5CBGA 4XVHA 2TEPA 4UXAA 1QMJA 3ZSKA 3AP7A 3RWNA 4LOSA 2DW4A 2FDHA 4L97A 2GSMB 3H01A 4B3TB 1CONA 4UFJA 5D8AA 1VBE1 1MS1A 4Q4Y2 4CP9B 1W3VA 5G05L 5LWBA 3OUJA 2ZACA 4P9WA 2JKBA 2H8PC 3H9VA 3AP5A 1PGSA 3M4FA 2Z2SB 1B35C 2Q67A 3TRSB 5FZBA 4NAMA 3CCRV 1VE0A 3K46A 5B4NA 1ZZ8A 3ALQA 4HPKA 1JCHA 2VBBA 4X88A 4YFWA 3BVOA 3BUCA 1KJLA 2GDSA 5A7WA 4E4DX 5FZMA 3EO6A 5JOZA 4HN1A 3NV4A 2K1EA 5EYPB 1PNFA 5C8CA 1SBFA 1K45A 1QHDA 2XOKG 1XYPA 1FKAO 1AJNA 1NVPD 3TB0A 5JOXA 4XEZA 5I8TA 1TA8A 4I9QA 2P67A 4TV8B 4FFKA 2PFWA 5F5IA 5IY5C 1K8AW 1OA3A 4MH0E 5F3CA 3LEMA 1SBEA 2VZUA 1YI7A 5FPRA 4UVBA 2CGOA 2ZGQA 4Q0SA 1COV3 1EYBA 4DR1B 4Z92B 3NL1A 3N36A 3E6DA 1UD1A 1YJNV 2JS3A 2ZR3A 1S5JA 3AG2C 2R9AA 2RMU2 4LITA 4LIUA 1W0OA 2DFBA 5FK8A 3MIBA 1BVP1 2A6XA 4UFLA 2XJSA 4AVTA 1IGOA 1SETA 4H7LA 3RYCA 3SXWA 4YZ4A 1UJWB 4WM7B 4R9AA 5A3PA 4D7SA 1IHMA 2OZ6A 1GTOA 3O1MA 1GZWB 3WDVA 1RUH1 4J1WA 2XR4A 4MGQA 2DYRB 5BNOB 2E51A 2ITCC 4R7CA 3FKSG 1TNFA 1GQPA 3CMAV 1MPXA 3Q8BA 2PAEA 2XONA 3VBRB 4OUSA 5C8CB 1WCDJ 3DPRB 2ENRA 5A6YA 3HVDA 2D43A 5FDBA 2PHWA 1AXYA 1QY4A 4GT1A 4TV8A 1HQLA 2G19A 4N53B 5DAWA 4DR4O 2BQPA 4HK8A 5A3UA 2BSKB 1BHGA 4HVRA 3GJBA 1S72V 4W50A 4E4HA 4GD4A 5FQ0B 5ERLA 2DBNA 4LR4A 1UYXA 3C2UA 4XABA 4BOWA 4O61A 1GYKA 1WPBA 1IBLB 3OBAA 5JAXA 1UL9A 1YJWV 4JTOA 5KUKA 2WSSG 2BOIA 4UFIA 2A7AA 1O3SA 3HAGA 3V0BB 1HR0O 5FBJA 4JI0O 1VF6A 1JVMA 4J9ZB 4AYUA 1QQP3 3CDZB 1EY2A 3BI3A 3O14A 3MYXA 2V09A 3JCIA 1DLBA 1UPIA 4J42A 3U11A 5LMUB 2E6VA 4ZS3A 5L7OC 1ENRA 1WP7A 3NKTA 5CYYA 3CNAA 4XBQA 4X89A 3M8AA 3P3NA 5FZ3A 3JARA 3TNPB 1K5MC 1S0EA 3CC2V 1W6QB 2D6MA 2JB4A 4XHBA 4UF0B 1UWWA 5KHJA 1XJAA 3FFZA 3H8OA 1MMMA 3CD6V 1KDKA 5JXGA 2RS12 1IZ3A 2Y6JA 3OEHG 3UCSC 1S0DA 1OV9A 2VU9A 5FTTC 3ZSMA 3IAPA 5T5OA 2P6HA 1S0CA 2DQ3A 2WS93 2WO1A 2PELA 4FCAA 4NAOA 3POSA 3URFA 5IYCO 1AP6A 1KUQA 3S57A 3R4DB 2OQ6A 1QQP1 4JI5O 3BN6A 1KKDA 1RVF2 2GDFA 1PPJH 4RR3C 5FR3A 5B1BB 3VBHA 1NCRB 3WU2Z 1PO21 3JUUA 1VBA3 1HRV1 2QE7G 4QGPA 2AHZA 1ZZCA 2OVUA 2ZX4A 4D69A 5E88A 4BISA 3BALA 1LOBA 3K57A 2YC4A 2BP6A 2JGDB 1XBFA 4QX0A 5FMDA 2JVDA 4JF3A 5KX5A 4ET7A 1LCLA 2A3YA 5ABJC 3GDBA 3T4HB 4E2GA 5LBBA 1JZ4A 4EN7B 4PLOA 3OPZA 4CH5A 2PMWB 4XFCA 2ZX0A 1KU9A 1AP5A 4DW1A 3ZCCA 1WA6X 2B7YA 3H1HH 2UWAA 1FXKC 2FBEA 1IVSA 1HR0B 5HCFA 4L92A 4ZBMA 2J1RA 3ABUA 3T1MA 5D21A 4ARYA 4UW6A 5J2UB 4COWA 3RYCB 2LO1A 3RN4A 4YVSB 1SS3A 5A7NA 2QKSA 3D36C 5L19A 1RUNA 3ABMC 1P7GA 2UUBB 1C5HA 4AZZA 4TUYB 5DUXA 4JAUA 5HV0A 5LHIA 1XPWA 5FRAA 2PXJA 3AZXA 3BCWA 3ZKYA 1N33O 2UUCO 4JV5B 3PUAA 3SLIA 1RUF3 3N9OA 5IYZA 5JSOA 1XOUA 4YHHO 3ENRA 4Q0PA 4ASMB 3I2KA 5D8AB 4L0PA 1RL3A 2P2KA 4XPVA 3T2MA 4BWOA 2R49A 4J7JA 2YICA 1NTZH 4XIOA 1X7NA 2W92A 1QJX3 1ZYBA 1XNRO 4Q4W2 3HKEB 5IAXA 1ZZ9A 4U3JB 1PMHX 4AWDA 3FHIB 4IEYA 5CB7A 3PIGA 3VKNA 5IK7A 4ZZ8A 1O9HA 2A6ZA 3E89A 5KHHA 2WA4A 3VGIA 4OGQB 3QO5A 2DV9A 1U5YA 1XOYA 2P3JA 5FYVA 4JX0A 1D0HA 3UJQA 5FXWA 4HKLA 2FB5A 2P22C 4EB6B 1MEC2 1V9U2 3MPPG 4LLOA 4MW8A 4ZS2A 3PUSA 1HN0A 1N34B 3RZZA 1KGYA 3U78A 4MVSA 2GNMA 2R043 1C1LA 3IFXA 1CAWB 1SRYA 2QQPA 5EBWC 1LGCA 1JODA 1GBGA 1WZXA 1K5MA 4OFGA 2VXRA 3ZIWA 1WWYA 5FY9A 3JAWA 2WKKA 2HWE1 5A1FA 1IQAA 3LFIA 3ACHA 4F7ZA 1Z5WA 1ALYA 3G67A 4URAA 2V7QG 2FDFA 1R1A1 2JK5C 5FNVA 1H8VA 3TK1A 3B93A 1QQCA 5K1PA 4DEQA 2WABA 3VL8A 3A0BZ 1NH2B 2VQFO 1ENSA 5AC91 5M0TA 3M3IA 2JDAA 1BCCH 5DUUA 1BK0A 4LC1A 2Q5ZA 2ZM6O 3CE2A 4X8AA 4LF7B 1PK6A 2KKWA 2WZR1 1H9WA 4BQ5A 1MS8A 2EF6A 3B01A 2W08A 4HT1T 4J41A 2D2CB 4QQPA 3RFRA 2W0XA 1IKQA 3SKJE 5EK0A 2LFRA 3I2HA 1IXMA 4PV1B 4LMFA 3ZSEA 2BFUS 1LOFC 2BVBA 2SBAA 4QDRA 1HP8A 2M7WA 4Y24A 4IV1A 4K7JA 4CDWC 3CRAA 1NA1C 3M8LA 2E76B 1EPZA 4HNAA 3J7AU 5T55A 3T1YB 4QT6A 3ZLIA 2VRZA 4HONA 5FYSA 3WR0A 4P02B 2AREA 3N7LA 2IH3C 3ZHSA 1ND2C 2QTSA 3P3PA 4S2FA 1YQCA 5FYUA 5F9TA 2YIDA 5FXVA 5B4XA 1LRHA 3IC9A 4IHJB 1OCOB 2OUJA 2UYBA 3ZXAC 1GZTA 4ZY9A 2F17A 1Z0HA 1SKVA 1JZ3A 5GJ6A 3LA2A 2RDRA 3TBDA 4XCBA 4I55B 4NXMO 2ARCA 4AHXA 3SYPA 2WO2A 4DUZO 5GZDA 1J83A 3T09A 1K73W 4X1KB 4PI0A 1TMF3 2YGLA 4Q4Y3 2JEUA 3ZBHA 5JIUA 1W2NA 2D5FA 3TJTA 5AVAA 4BK5A 5C9AC 2CUGA 3RZGA 1SLAA 3LD8A 4RUFA 4HSLA 1Y66A 1A32A 4F6RA 4FFHA 1JU3A 1DQ0A 5LEJA 2G1MA 3WB2A 3KGLA 2J22A 1TVKA 4OLLA 3DC5A 1Q56A 1XXNA 4D6SA 1W04A 1FXKA 3BHPA 4QQLA 4CUGA 3PVEA 1RIRA 4CEWA 4RAIA 5C33A 5FZ0A 3ZOIA 4TT3G 4FFFA 1UKGA 3CP1A 4K35A 3S3XA 3R05A 4ZHNA 2R1DA 2WNUB 4COZA 5CA1A 1QJU3 3FB5C 4MGTA 2WT2A 5CB4B 1XE8A 2WQZC 3A0KA 4D7TA 1MR5A 2G4IA 1V9U1 3NJYA 4Q1RA 3GCWA 3WP5A 4KHPO 5EZYA 1SERA 5CMUA 3FBYA 1QOTA 3J80N 2QQLA 1KD7A 2WLQA 4ZIBA 3O0VA 2DTYA 4KU7A 3LCPA 2YDEA 2UXCB 1EM1A 2VUJA 3K4DA 3VBOA 3JQXA 4DUYB 1RUJ2 2EICA 1IDSA 1N8RW 1G6NA 1GN2A 1UOGA 5H6RA 2PZSA 1QDOA 2HYXA 4HVQA 5CIRA 1J5EO 3RPQA 1E57A 3OBTA 4LFAO 4YXWG 5L73A 4J11A 1NTKH 1O7FA 3ILRA 5T54A 1SA0B 4M3CE 4K3UA 4ASKA 1JXNA 3C90A 3FLRA 4CH6A 4OCTA 1RUC2 3WG2A 2HBTA 3BIEA 1N3QA 4RHV2 5FP7A 5TSWA 5EPAA 1IS6A 1X9PA 1OH4A 1VRBA 4IEUA 4L8QA 3UT0A 5CVRA 3SJCC 4KWJA 3SYCA 1W3XA 4IE7A 4HKOA 1REDA 2GP5A 2YXHA 3D0SA 4NHKA 2YBKA 4NVPA 1OLMA 1POQA 2CTQA 2VZTA 3O12A 3CZUA 3OR7C 2X5IB 4MOAA 4I2OA 3V65A 3LNNA 1HNZB 2IJIA 3BGAA 4CEWC 1HNWO 4L11A 5C7GA 3JARB 4ASUG 4IV3A 4ITCA 1ULFA 1QWRA 4PDVA 5FKBA 2CDYA 2F95B 4N43B 5FZOA 1DFQA 2K9ZA 1OXCA 1ZX5A 2Y6KA 4Q20A 1VMHA 4MS2A 4IETA 1XNQB 1TNRA 1Y7BA 1QLNA 2YV8A 4IEWA 4DK1A 2VQEO 3VDBA 1OOPA 4XJ9A 1G9CA 2PF4E 3W7WA 2CGPA 3USSA 1RUD3 4X64O 2H6CA 2PQQA 3JCZA 3D6EA 4N53C 3SPIA 1K34A 5FIXA 3RQ0A 2VOWA 2BNOA 5FZ6A 2X6CA 4GB33 5CZKA 3Q8FA 2YBPA 4UCTA 4YGCA 3OGSA 2WSUA 3LKJA 4OUMA 2WZR3 1RMU3 4XMIA 1ULEA 4Y20B 1DQ4A 3OEEG 1FYUA 4NIAA 1LAJA 2BOJA 4RQEA 1NJIW 3O1UA 1SQ4A 1SLLA 3EQEA 2JDHA 4N7UA 4C0BA 5IJ0B 3LFMA 1JJOA 4CUCA 1ND2A 3CCSV 4TTGA 1EV13 5H9QA 2QJ1A 4K6BA 5FZEA 2PAMA 1RUD2 4M0NA 3AVRA 4D8MA 2XMLA 2VCAA 4Z1VA 3ES1A 1JZ7A 4LF8O 5CA0B 3IGAC 1NI8A 5C9AB 2VZSA 2P34A 3AG1C 5I93A 2R0FA 1CPYA 4EV0A 2IXHA 2AH2A 4JI5B 3R4UA 4O65A 2ZX1A 2IUWA 1UQXA 1H4GA 1SG3A 1Q86W 5B66Z 4OHVA 3IC7A 3M99B 1BMV2 5C4WA 1TVGA 3VKFC 3OBRA 5A33B 2BV4A 3SCGA 3U10A 3GBWA 3K08A 2YU1A 2DCZA 1Z7S3 2VUAA 2Q7EA 4PBPA 5DN2A 1UFIA 5LA6B 4FVVA 5LP6B 4E27A 1YJ9V 5I0TA 2VZQA 4MVUA 3WW3A 2FDGA 3WCSA 4QPKA 2RDCA 4FPGA 1R1A3 4N9HA 3KT4A 2FDKA 1FXZA 1PIV1 3L2YA 1WBLA 1AL0G 3HD8B 3AZWA 3ZSJA 3ASNC 2XJQA 2ZXWC 3WQ7A 1VB2A 2Q1FA 4DXWA 1X36A 3LF7A 1K97A 4AVVA 1PO13 3M3OA 1TE1B 2OA2A 4B1LA 3RWKX 1DGWX 2XJRA 3H7JA 3JAMN 3THDA 2WLLA 2EA7A 1EZVH 1YITV 3O7OA 3T0BA 1N0JA 5JH7B 1AR92 2Y60A 4UVAA 1PNLA 3NAPA 2WZ8A 2G9FA 3DF0A 2FZ1A 4R6ZA 5H9PA 5L3EA 1N3PA 3BABA 5LBFA 4IEZA 1RP3B 5DQ0A 3PL0A 3W59A 4X6RB 4XFGA 5LGTA 2RS33 4BAYA 3RVHA 4YW1A 2V73A 1EFRG 1GICA 1SMVA 2RM23 5JOYA 5L3DA 4A45A 1QF3A 3TCUA 2QKAA 3DXUA 1W0JG 3NRUA 4JYCA 5LL6Y 2YXSA 4H13B 4LA3A 4UBGA 4Y4RA 2I45A 3RVYA 2R061 4KU8A 4QPJA 2J1VA 3WP4A 4QDSA 3I4IA 5FPVA 3ZS8C 4BU2A 3K79A 4FVMA 4CXWA 2ZEZA 4EWAA 1UPSA 4X1IB 1MZ5A 5HCHA 4I4TB 5LCWL 5BNPB 4R50A 1AYM2 3SR2C 4OHWA 1IXBA 5BR8O 1F15A 3VQVA 3PTYA 4QPGC 4W8JA 3OW2U 4M01A 4OX9B 1CJPA 1VQ4V 3I2GA 4I01A 1GM8A 1NAEA 2DVDA 2PTMA 3UO2A 1GZ9A 4XJWA 2WZPP 5K0UA 5JXJA 3CCVV 1H8TA 1FJGO 1M90W 1JA8A 4MTGA 1HWYA 4JDMA 3WNOA 1JYNA 3MIDA 1YLLA 1AL21 1CAVB 4XQDA 4F6EA 3JB4C 4I9WA 2YIBD 4V2WA 5GTIZ 2OWOA 3AYEA 1DLLA 2YIAA 2EBOA 5BNNA 4LKSA 3JAKA 2JKXA 3ETDA 4IEVA 1MZFA 1F31A 4YJ3A 4JKMA 1KQSU 2PLV3 2JG9C 4HG6B 3WB0A 5F5CA 1UY2A 4QWNA 4COVA 3AEIA 3N7JA 3ICXA 1UN1A 4ZONA 1D4M3 3SJBC 4EQVA 4QHBA 1VBD1 2F4PA 5BMVA 3ZHRA 1KITA 5IVBA 2WYFA 4QHOA 2JECA 4WVVA 4GMP3 1DQ5A 4CCMA 1HIXA 5FO7B 4DOUA 1X4TA 1LESA 4N90A 1WW5A 5CFDC 1O4ZA 1FPN3 1H0BA 1OOPC 4IT5A 4NRMA 3EHBB 4AQ6A 3TEXA 4JZGA 1H2KA 4JCKA 4AHWA 4QDQA 4LXLA 4FOWA 3FHQA 4QXKA 5FZLA 2BTQB 5J48A 1RINA 1W9YA 1SZBA 4NYKA 1VBB3 1OKQA 2ZGSA 2BGOA 4PIXA 1QU7A 5FLHA 5HFLA 4HXCA 3MUZ1 2C4XA 3I7DA 4GH4C 1Y76B 2HWD3 1NQTA 3WSOA 4DR1O 1HRI1 1JYTA 3E35A 2JG9A 1NX9A 4Q4Y1 3B8NA 4DUZB 4QX3A 1DIWA 2E7TA 4GKKB 1ZZ7A 3RSJA 2VZ3A 4UFZA 5IVEA 4WVMB 2AZ0A 1CIWA 1W8TA 3DN7A 3L9DA 3HR9A 2YU2A 1AB3A 2VQEB 3OMIB 2OUHA 1UX6A 1NU1H 3K48A 4H7MA 3AMMA 1XNTA 1WCKA 4K8FA 3J7LA 1YRZA 3TOJA 3ASOC 3M1HA 1MS5A 1NCRA 2X8KA 4NIIA 4Q8LA 1PVXA 2C9KA 3T1HB 1BQPA 1E5IA 2R041 4IEOA 1H2GA 4MGKE 2VOVA 2DJVA 1CGPA 3B9IA 2D3SA 3W7SA 3WF1A 1W9FA 2AENA 4DUWA 2GZWA 4LBNA 4PQQA 4YW7A 4DRVA 5CEHA 4WFGA 1W8WA 4I3PA 3KSCA 3PMEA 3CRQA 3LEIA 3THOA 1YUDA 2YEVB 3PVOA 2DYCA 2X5IC 5LB6A 2QQUA 1HV0A 4ISRA 1WMFA 1XSRA 3VBSB 1LHUA 4BQ4A 3VN4A 1V6NA 3EXAA 4IEXA 4F6RB 4U3FH 2V4VA 4NPMA 4RWUA 5IWFA 4O2AB 3H8UA 4GX5A 5ISLA 4NXNB 3L75H 2OT7A 2L6LA 1YHQV 2P6JA 4DR5B 1O5UA 1FATA 2XPJA 3INAA 4CC6A 4JGZA 3OSDA 4Q1PA 3CB2A 2AR6A 2XBO1 5B1AB 2LRPA 4N23A 2XJTA 4ZU5A 1YXWA 4GUNA 5JCOA 4NPRA 2Z79A 4QPGB 4IGOA 3AZYA 1GK9A 3JBG3 4LF7O 1NLRA 4JI6B 4PIZA 3NQHA 4I0XA 1W2UA 3T4DA 2Q8VA 2GMPA 5AFBA 4UFHA 2EJRA 1DF5A 4QKNA 3E6CC 5JH7A 5JZGB 2Y33A 1W6MB 4JI8O 1BBT3 2VVEA 2QKCA 3ASOB 4JPRA 2YG0A 3DPRC 3G7DA 2NQYA 4HYOA 2XDVA 5FZOB 4RFRB 3OMNB 1I0HA 2VS0A 3NAPC 1LOAA 5EFUA 3I5DA 4DXTA 3H1WA 4JGYA 1YVWA 4A7ZA 5IW0A 5A3NA 5LA0A 1IPKA 1ULDA 2BJSA 5EC1C 2VZPA 5EHDA 5K4LA 5I0SA 3LSEA 4UFMA 1TEIA 2A5ZA 4HBNA 4I0BA 1VQ9V 4DY5A 2RS11 5J7MA 3FMGA 1HQNA 2HH9A 2NLJC 1C28A 2DWRA 4D3WA 5LGUA 1GZCA 2QWOB 4CTEA 1XNBA 5LA1A 2ID4A 3ZHUA 1MABG 4O2AA 4AE2A 1N36B 3APBA 3BA9A 4IQPA 1OOPB 5FLIA 1F4NA 4UW4A 1AYN3 5BNNC 4IYHA 3ZHVA 4LF6B 1DGLA 1WA8B 3MD0A 3K51A 3JU9A 2OXBA 1GSLA 4NRPA 2CDPA 4H33A 1K7DA 2CH7B 5LXTB 1FOD3 3KQRA 5LY1A 4DR6B 3TETA 4ZHQB 3TNQA 2RR11 4YVWA 5CFCA 3OD4A 1XI1A 2XLAA 1W6OA 1M9NA 4TQDA 1AL23 1PVC2 4UAPA 4LEJA 4QPYA 4EN6B 4OQ8A 1PZ8A 4Q6GA 1VRH3 1AL22 1PVC3 1QEXA 4LWSA 2J1EA 2W1WA 1ZRDA 4AGVA 4E8CA 1V6KA 2JE8A 4CCOA 5ACA1 3SCFA 4NROA 3VHNA 2VMCA 1QJEA 1V54B 2D3OW 4EB6A 4LKEA 2BWAA 4FO9A 5FMBA 3CWBH 2RHPA 3KT1A 4B4RA 4L9BA 3UKVA 1FXVA 3HKEA 5DAVA 2A6WA 3ABLB 4UCOA 3JZVA 2Q1MA 2Y6GA 5IVFA 2ZINA 3R66A 1YI2V 1V55C 3FD9A 3CJHB 4YRDA 2F4VB 2DURA 3BTZA 2CTWA 3QO8A 4JI1O 2LGQA 2Q8EA 3ZEDA 1XU1A 2MEV2 2HVJC 3HNBM 5AG2A 1AROP 4WFAV 2JGDA 2ZHMA 3K5MA 1R1ZA 4JZ2A 2ZE7A 1JOYA 4LBQA 3A21A 5JSRA 2WDBA 4LO8A 1LENA 4YGBA 4J10A 4IV3C 5JOWA 3BCCH 4AGGA 4CXYA 4IHJA 1NTMH 3KHBA 1UKRA 3BPSA 1D4M1 2VUDA 1QVFU 5IHRA 3LE0A 5JUVA 3WLUA 4AFBA 3WW4A 2OT5A 4JQRA 1YQ6A 2VG9A 1YTFD 1CPNA 3C7FA 1PM7A 1LGBA 2XHKA 1WW4A 2ZT9B 3K5LA 1UAIA 4QIWF 1YFXA 4EJRA 1HJGA 2ZGRA 1VF6C 2AGSA 3ZPOA 4QPWA 3VQYA 3HBZA 1FYJA 3KVBA 4ZKTB 1VBA2 4NB5A 2D5HA 5FWEA 2VO5A 1VB4A 5BYNA 3J81N 1VQLV 1RVF3 1HJFA 1OC1A 2Q4PA 5CBFA 2RNBA 3FAVA 4QMAA 4XILA 1NR1A 5E89A 4YY3O 4WFFA 4LK6A 1ZA4A 3TWIA 3QNEA 5FZ1A 3R6SA 3VBRC 1UOFA 4BDVB 5K0UB 1FFXB 3CRCA 1ZBE2 1HNWB 1BZKA 4LBEC 2D97A 1GNYA 4TWTA 3VBUC 3TXSA 5APAA 4TLGA 4UT5A 1NH2D 2VECA 4QM9A 3AKQA 3SKVA 2W91A 1RPRA 3J9SA 3MI8A 3ATGA 2WQ8A 2WNUA 1B04A 1T6BX 5BNPA 3CZJA 4ZHQA 2A6YA 3W7XA 3D3IA 4XBLA 3AZVA 1ZX3A 2E7QA 3PJSK 1R6NA 3B40A 3LDDA 3P5BA 5JVVA 2A3QA 1OHFA 2AGAA 1FXHA 1N1YA 2VBDA 4GAZA 1HKDA 1LOCA 5ABJA 2WAOA 1V9PA 1QR9A 5JI7A 2FYUH 1ACCA 2DQ0A 4ICGA 4JYYA 2LALA 5FPAA 1ZNPA 2MHFA 4FPCA 2DN9A 4XF4A 1FX5A 5DABA 4MYEA 1WW7A 3ZFEC 1APNA 1VBC2 3OE7G 2OYZA 1UU4A 1FV3A 1GLHA 2VZRA 5J37A 1CZTA 4N9IA 2WFF3 3HKDA 4JGYB 3ZMVA 4AR2A 4CBCA 1I94B 3OJBA 3ZHQA 1AXZA 3W20A 4XUTA 5DAQA 5T52A 4Q4X3 3S3WA 1TZOA 4XFHA 3GBGA 4IGQA 1MEC1 3RJ2X 5I0RA 3DYPA 2VD7A 4I50A 5CKMA 3K59A 1AR61 1UOJA 1ULCA 4O4IB 1UCXA 1XYNA 3AG7A 1VIWB 3ZYHA 1S0IA 4NHLA 4GKJO 5C70A 3FE5A 2J1SA 3I3DA 2D98A 4DV1O 4BLJA 4DRXA 3CPWU 1B35B 2QUOA 3K58A 2HHHO 1FMD2 3WV6A 1B35A 4FP2A 3RRDA 2LM3A 4OMCA 3T08A 1JZ5A 1BGYH 1T2XA 4Y26A 3X29B 4D0QA 1QBZA 4Q5OA 3DEMA 3CSXA 5FMOL 2VQTA 2GC1A 1SLBA 2P90A 1VRH2 5A3LA 3ZMSA 4RL7A 4YJ2B 4I50B 1S4CA 2PYJA 2VOTA 4N43C 4QPGA 5LMNB 1PKXA 2GMEA 4CP9A 1RHI2 1A3KA 4EYUA 3S6PA 3WNLA 1COV1 2UUAO 1XE0A 4Q4W3 4QX7A 5FZ4A 3MDPA 3CC4V 5GZGA 3KB5A 2QQVA 2R0HA 5B1AC 5AFEA 2QNKA 2UURA 2W52A 1RUI3 1H30A 3SHRA 1SEFA 1COV2 3B09A 1I5YA 3E8BA 1RUG2 3HJRA 2RR12 1EUTA 1FOD1 3RBZA 1H8EG 4MVRA 4Z2AA 3QOPA 1F51A 3LDBA 3CCMV 2UYAA 2ES3A 3DGEA 3DXRB 2QWNB 4MHUA 1BHAA 3H7YA 2P4KA 4XUQA 4AXOA 3AG3C 4N43A 1KJRA 4YG3A 4LO6B 2B1IA 2QVSB 4QU2A 3LDCA 3GCXA 3MHSC 1AR1B 4P30A 4E8DA 1BS3A 4JZRA 4LNUA 2W39A 3NV3A 4LBLA 3HKCB 4PF5A 4L2NA 4LF4O 2R072 5D1IA 1ZZ6A 3E8HA 5HFMA 2XTAA 4FMTA 3J8F3 1ZBA3 2JDIG 4RN5A 1EV11 1WW6A 2Q8CA 2A6VA 5KXDA 4GMP1 5FY4A 3D0JA 3C7EA 2J1AA 1IBMO 1N4CA 3IPVA 1X8MA 1F5JA 2IW5A 3PIJA 4Y1VA 4RD7A 5JLVA 1W90A 2EXHA 4LBOA 3LA7A 5KXBA 3QBQA 3JD4A 4MVMA 1OT5A 2HVKC 4P5YA 4OZOA 2AACA 1R093 4Y4YA 5JIAA 3MPBA 4URTA 4JI4B 2K2SA 4I3GA 1OD5A 4H37A 1JYWA 1PIV2 1QKQA 2P3YA 4TV9A 2BVVA 2VCBA 4TSVA 3OB8A 4RGGA 1FPN2 1PV0A 3DECA 5F5QA 2ITDC 2UU9B 5KLVH 1TME1 1JOBA 3KT7A 3Q8AA 3G6JB 3H42B 4QNHB 2WNEA 4E4SA 1ND3B 5IVCA 2ERFA 1RITA 1S0BA 4JYAO 1OUSA 5A7QA 2R70A 3GNEA 2NYYA 1VIBA 1FPOA 2NP0A 4RGAA 1IOAA 1ZL8A 2FDIA 2R062 4IXLA 3J7NA 5L9BA 1UNBA 4JI7O 3FFQA 1SQQH 4WZFA 5JWPA 4OXSA 2WWWA 3E6BA 3EXUA 4OI1A 5IYDO 4K1YA 3MHZA 1M56B 1MS4A 4CUAA 2OW4A 4BWAA 4G3YC 4NR1A 1HXS2 3JD71 4J25A 1UXZA 2JG8B 4ZU4A 3N9MA 3BA8A 4FPEA 5BR8B 1F35A 1OCZC 4XF3A 3CKHA 2BOCC 3SISA 2XLGA 3ZXFA 3AYDA 4AFCA 5JCTA 4FJCC 4XJAA 2E74B 1IS3A 4XBFA 1JUHA 1YCIA 1WBFA 5EC2C 5FO8B 2ZX3A 4YPJA 3T2TA 2IJJA 3S5QA 1RM1B 4M3CB 3VOUA 1QXPA 2DOSA 5FY1A 2JXAA 4DIQA 2YXLA 4UOJA 4BK4A 2EXKA 1FT9A 4QX5A 5H9CA 5KC5A 2WC2A 4YLZA 1AR81 4PHZA 1RUJ3 4OHXA 1DTOA 3VBHB 2E63A 4LO4B 2ZDIA 1H1IA 1W6OB 4LFAB 1MS3A 1K9MW 3AYCA 2QZ3A 2X53S 1GQGA 1SLIA 1NKGA 4A41A 2VMFA 3HOBA 3MAQA 4KG0A 1WCSA 4B7KA 2CWMA 5A32B 5A6XA 5SV5A 3O1PA 1Q7YW 1BEV1 3KZIZ 1JFFB 4N7IA 3CCJV 3MICA 3KF5A 5J1XA 2JJ6A 5FBZA 3AK3A 4JV5O 2JG8A 2WJSA 3RYKA 2Q7GA 4B29A 4OHYA 5JDBA 4I4TA 1LEMA 1YFUA 2D6LX 1YIPA 1X33A 2YBSA 4UUJC 1QLEB 3ZXEA 2HWB2 3UT5A 2RV9A 1KXGA 5A1AA 1VBC3 4AVSA 4FOQA 4RQPC 2N05A 3OF1A 4X65B 2LW8A 4BE3A 4XE9A 2M6YA 2DCKA 2XLFA 1OA2A 2X0LA 2RJKA 4NOTA 2GTSA 1XMOO 2VMDA 4QM8A 3ECQA 3NV2A 3J7HA 1C8M1 2C24A 3D8CA 4IW3A 1WN7A 4B3SO 2WLKA 3SMHA 1SF9A 4CS2A 4P9OA 2CH7A 5LXTA 2ZNJA 5CA3A 2ARXA 5A80A 4FM2A 1PK6B 4DRXB 3U37A 3JALA 1DCSA 4X20A 2VJXA 1XE7A 1S77D 1LUVA 3AG4B 2WLJA 4PA3A 3U14A 4UCSA 3PJQA 3RS6A 4V1PA 5FMCA 5KAFZ 1P8JA 4LBQB 5FZDA 3N35A 5JI9A 1GQHA 1BZWA 2HBUA 5BY5A 2UU8A 2C26A 4ATFA 4U3JA 1M5IA 3O65A 3STLC 3AP4A 4E9KA 1RUE2 3HKBA 5DG1A 5DPNA 1YWKA 1RSOA 3W58A 3F5TA 3OPTA 1JYVA 5K7PA 1MVQA 4XMAA 1T5EA 2HHHB 5FP8A 5C71A 5JQGA 3AB0A 5BV6A 3FC0A 2R7EB 1V55B 1NXMA 1QOOA 2ET7A 3N9LA 4QPIA 4JQTA 5B1OA 1K5SA 2BWCA 4GCZA 3D4KA 1UYZA 4AHYA 3ZR6A 1N32O 2A0LA 4MXWA 4MTOA 5FY5A 2HJIA 3ZXGA 1L1FA 3ZMNA 2IWGB 2VWKA 3UT5B 3VZJA 4KHPB 1RUC3 1NE6A 5H2FZ 2OIEA 4P9GA 3UGGA 1ODMA 3RZHA 1C3HA 4GH4A 1Q8VA 2KG7A 2W6IG 4DV5O 1P4RA 2DVBA 3RYIA 3AMPA 2EJ7A 1PZ9A 1ASJ3 3T1CA 3VZNA 3E22B 2QDRA 4KUMA 1TUEB 3ABMB 1ONAA 2QQOA 2Q8DA 5FOBB 4YJ2A 2O8QA 3UGHA 5GKAC 3BYWA 3AG2B 2LS6A 2PGGA 2PHXA 1D0GA 1HB4A 1XNKA 3IAYA 4DUXA 1AX0A 1QVGU 3AKRA 5DUWA 2W95A 3PVNA 1QIQA 2JE7A 4W4ZA 1Y6XA 4TUYA 1DU3D 3HWJA 1JUIA 4W4LA 2PY5A 4MVTA 4O4IA 3AKPA 1GM7A 3NO8A 3MF9A 3AK2A 1Q5OA 2FZ2A 1V54C 1CR7A 3AK0A 5FYTA 2NNUA 3JSLA 1UY1A 4YM0A 4SBVA 1YQ5A 4WVMA 3N2KB 2VVFA 1E5SA 1YJLA 1H2MA 1ZWIC 2BBVA 3VZKA 3MV11 4Q4X1 4UI9L 3WP3A 4UCRA 2P4VA 2EILC 2VBPA 5FYYA 1RUG1 1E5HA 3JATB 4K20A 2N7GA 3WHTA 4CC5A 1NQJA 3KM5A 1TGOA 5HCBA 3RVZA 1Y9QA 1ULGA 3VV1A 4IE4A 2QBXA 3QG5A 5A1LA 2ZMKA 3CQOA 3EVKA 2R30A 4OX9O 2GHYA 2JJ1G 2QQNA 1QOSA 3WNXA 5EBLC 3FJSA 2GC2A 2CYFA 1JHJA 4CCCA 2P4EA 3I2JA 2XL7A 3DL3A 4GLXA 2X09A 1J3PA 4TV9B 1SBDA 2R72A 2E9QA 2VTFA 3ZKUA 1HW7A 1FV2A 4BQ2A 1ZBE3 3E8FA 3ZX7A 3DTUB 1RUE3 2JIJA 5T5JA 2JDZA 2L35A 1VBD2 4NRQA 1EN4A 1RB8G 1W2AX 2IFRA 4BIUA 1CEZA 3NJVA 2BCCH 1VAVA 1GWLA 1HRV3 2KR2A 4BLIA 1OPOA 3H8RA 2QQJA 2ZMNA 4RQFA 1S1AA 4QB1A 1W9WA 3PJYA 5AC92 3ZYIB 2VMHA 2JWPA 3FB7C 2XG3A 2ZHNA 3H0OA 3ZJZA 4KI5M 3ZRWB 1VALA 4R9CA 5KWRA 4W65A 3OFNG 1PD3A 1LU2A 2J1TA 3UQ8A 3LAGA 4BB3A 2VW1A 3HN3A 3VDDC 2IJKA 4DPNA 4LNVA 4AQTA 1KRIA 2IZWA 1W2BU 2A79B 2AW9A 3O1RA 5IJ9A 4LE4A 3ZRXA 4GB32 4JKLA 2IXIA 3EYPA 1RYYA 1ZBA2 1I3HA 2ZZQA 1JYCA 1FS0G 4AEJA 4FI9A 3OY8A 2BEOA 1GP4A 2ZA9A 1SZXA 5EZWA 1W05A 2QM4A 2Y69C 4NIHA 2FCVA 4MTXA 3VQXA 4K0KB 1VBA1 4D6QA 4DQAA 1OLQA 4JTDB 1NT2B 4HZ3A 3FHAA 4X6QB 1JU4A 4WM7A 1H2LA 4PA6A 4DV0B 4ZOLA 2XOMA 1Q43A 2W0FC 3JD0A 4AAPA 5E6HA 4CDQA 4LBJA 4IE5A 3OM3B 1ST8A 2Y4UA 1TMF1 1GH6A 1W6PB 3NV1A 4CDUC 1TUBA 1B3QA 1VLNA 3B69A 1W39A 5LA9A 3UETA 1MOFA 4HZFA 4LO7A 2KB1A 1YI9A 2JD9A 4NXMB 5EYXA 3JXSA 4NE9A 5KHKA 5BNQA 5H6QA 2R16A 3O1OA 4WCEV 5AC93 1KB9F 3M7MX 1POV1 1UMHA 4WVWA 2XXZA 1DDLA 2A9HA 3M3EA 4QE7A 1W2TA 2PYLA 2DTWA 4J7ZA 5FK7A 1XHXA 3WZ1A 2MK3A 2UXBO 3B77A 1S3JA 4X1KA 4RO2A 4MG2A 3OPWA 4WBNA 1MS0A 2DE0X 1OSGA 3U75A 1VBD3 3CIHA 3OEBA 5FREA 5FPZA 2IC1A 3CC7V 3APOA 5EYPA 2SLIA 4RHV3 1Y76A 2C0ZA 1YF2A 4IGPA 3AMNA 2K9PA 4QQHA 1F9KA 1TAEA 1G9DA 3KV4A 3SGIA 1F5FA 3B7MA 4AI1A 1QR8A 3RG0A 3N9QA 1JN2P 4F3JA 2NM1A 3DC6A 1JJ2U 1REFA 3H3UA 4HMZA 3WY6A 5DAXA 3FB6C 4AI9A 3PVBB 2XVLA 2PHRA 1UZZA 1ZL8B 3I3BA 4ZZ5A 2BE3A 1GOFA 2RCVA 1VARA 4JGYC 1PNKA 4XFAA 3W9AA 1X59A 2PLV1 4A44A 1M4UA 1W9TA 4P9PA 1C57A 4CDQC 4YM2A 1QJFA 4LLFA 4QKFA 1PHMA 5CKQA 4DV7O 3DPRA 4EKWA 1RM1C 3AM2A 2ZX2A 5EQUA 1RXGA 3K2OA 3TAYA 3AMQA 2BDRA 2A71A 1NXD1 4AVCA 3ZYFA 4E2SA 5TISZ 1XU2A 4PA4A 3QH7A 1JX9A 3AKTA 4RR3A 3WF3A 4LOTA 3SYQA 4D94A 5LEKA 2WNVB 4HETA 3SEEA 4JRLA 3TEZA 3D3QA 1AI4A 5LHGA 2GH8A 5C8YB 2H0VA 1NZ6A 1ZZBA 5ABJB 2XVKA 3BRCA 2AZ2A 4FM0A 1THZA 1MS9A 2QJVA 3JB8A 2HKXA 2F43G 4QJFB 1HNXB 3KCXA 3ZYJB 1MSDA 4P08A 5CA0A 3OOXA 3CCQV 1V6JA 3HKCA 5EIBC 4JV4A 5B1BC 4QKDA 1AI7A 2QEXV 4CS3A 3H1IH 5JSPA 1UPGA 1AJKA 2EIJC 3WQBA 3ACLA 4DV3O 3LDRA 4DMIA 1I94O 3UV9A 3AXDA 3AJZA 1WLWA 4CCLA 4CP2A 2PHFA 4A42A 4MX3A 1W8UA 5HCAA 2JE9A 2EZPA 1PL4A 4MUVA 3CCEV 2YXYA 1EAH1 1UZYA 4LHNA 3WHUA 5C3RA 4F83A 3VD4A 1GR3A 3FAVB 5JZGA 1I1EA 5JMOA 2FMLA 5A2QN 4B7EA 3STZC 1SCRA 2VMEA 4G28B 4FAGA 2PI4A 3N2GA 4FQ4A 3I59B 4NTXA 3ACGA 5J3UA 2XT9A 4GKKO 1M93A 2XVGA 2J1UA 4Q4W1 4ZXKA 1NZIA 1FNZA 4RUEA 5KMGB 4LBMA 4AQSA 3MLKA 1RGSA 1FNYA 4BMEA 3VBFC 2JD4A 5B3SC 4KFMA 2IXKA 4UWDA 2EIDA 2RJ2A 3OAAG 4TYSA 2WFPA 5IYZB 4AEKA 5KHIA 1Y74B 2N74A 1V6IA 4WBNB 4BXSV 5FWJA 3EB7A 1QJY2 4DV2B 2RDQA 2WZEA 4YW6A 2GSYA 2WFF1 1HB3A 2B9ZA 4DR7B 3M70A 2E75B 2KXLA 2Q5TA 1R3IC 1SQBH 1LKNA 4I0AA 2LFSA 3T1YO 3RZMA 5FUNA 2B1GA 1ZRFA 4XW3A 2JB8A 5KXEA 3ABLC 3FX7A 4LJHA 2GNDA 5GLZA 1JI6A 4CXXA 4CCEA 1ZVFA 1OURA 5DZFA 1NG0A 1NE4A 2WS91 4M3CF 2A73B 4KWKA 5GW7A 3BU7A 4O2BB 2IXCA 3N7KA 2Y0PA 4HL0A 5FY7A 1F4MA 2R9IA 3LQCA 3HN1A 4QB6A 1YC61 2L9LA 2WZR2 4YIPA 4Z2WA 1BBT2 5LRRA 4AG4A 5HXVA 5LA6A 1XEQA 3JD2A 4CU8A 1HB2A 4Y5Z0 3WNKA 3WDXA 2YGMA 4DV3B 5K1XA 5LP6C 3RJRA 4CZZA 2FQPA 4HK9A 2NN4A 1POV3 4GZ9A 1FPN1 2EIKC 2EZOA 3MBWA 3WNNA 3BY6A 4YVSC 3N9PA 1TME3 4JTNA 3B4SA 3N7MA 1PO12 1QJX1 4IL7A 1CN1A 1LR5A 4CEYB 5LYJB 2QM7A 1WLEA 3KS7A 3I3MA 2YPDA 2EAKA 3OGJA 1RUOA 1XSQA 3BU0A 4YFZA 3UKMA 1TQ5A 4NIDA 4CDQB 1OKOA 4FLXA 3SCHA 2GBOA 3JBG1 1RUI2 3KF3A 4B1MA 2IH1C 1HRI2 2QWRB 4UXNA 4B8EA 1H8TC 4OI0A 4KG8A 3WCRA 3ORJA 4FFGA 2A06H 3CCLV 3HEIA 4PBOA 3HB3B 4XAAA 3VBUA 5FFOC 2A70A 5IAVA 2ZE6A 1RHI3 4XDLA 5E16A 4CDXB 1V6MA 5E8AA 3K75B 3OYWB 2MW2B 4UF0A 5IFTA 4K21A 1GUIA 4KH9A 1D4M2 3K3OA 5IATA 1Y3TA 1MACA 2CSGA 2UXDB 3A7QA 4O4JA 4FPFA 1NY72 3W7TA 1U97A 3WOGA 2HJDA 4L99A 4KQ7A 5L3BA 1GP5A 2ZGPA 4MW3A 1U5XA 2A3XA 1XL6A 4R4ZA 1W9SA 3A22A 3AYAA 1VQ7V 1AHSA 5A3WA 1NCQC 2DUOA 4FT8A 4PDWC 3B9CA 2ZGKA 1R1BA 3W5NA 1VQKV 2UUBO 4XFIA 2ET1A 2HP8A 2XAGA 3K04A 4YJ3B 4LF9B 4RYDA 2VL4A 2P5BA 3CL1A 3WF0A 3ZN1A 4LBKA 1GP6A 2X29A 3MIFA 2QQKA 5LATA 4Y33A 2ORXA 2F6BA 1AUYA 1OPMA 1ASJ2 1AR82 4QX1A 5J2TA 1PIV3 1Y74A 1S5LZ 2WINB 2K46A 3LUTB 3L9JT 5L9RA 4QE9A 4BQ1A 1VBB1 5FZ7A 4GA9A 5I0UA 2DWEC 4HVOA 1KS4A 1R083 3AZZA 4BQWA 2ZHLA 1O4TA 1PZ7A 3WF4A 1EP0A 1BL8A 1AR83 4JGZB 3VD5A 1LR1A 1EPWA 4I55A 4U36A 3HR0A 1I5ZA 4WV8A 4I02A 3UK9A 3VDDB 1YDXA 4DB5A 2WWUA 4IEPA 2VPVA 4AI8A 2XUEA 2ZGLA 1N3OA 1VQ6V 2ZMLA 4JC1A 1U12A 2YC0A 1N34O 1W6NA 5KHGA 4XXAA 2C6SA 1R6KA 3POEA 2UXXA 1J1LA 4DY3A 4K40A 1BBT1 5DUVA 2VC9A 1ULPA 2WIIB 1H38A 3RW0A 3E86A 5GZCA 5HBAA 2Q8OA 4Z8BA 3POJA 1XQNA 2XAJA 1FJGB 5EBMC 5KUMA 1AR63 1SFNA 1BXHA 3UO3A 3G71V 5CAZA 4RQPB 1H1AA 3ZMOA 5BXXA 3K9SA 4Y5TA 3A23A 5T5PA 2ZIOA 3S5AA 2JDYA 3APQA 5FZIA 2AYHA 1VMGA 3WNPA 4YW4A 5I91A 1OCRB 4FIPC 1PX4A 4YVWC 5CFCC 4JASA 4Z82A 3THPA 1UXXX 1W6MA 2VOXA 2QQIA 2BBAA 5GZFA 1Y4MA 4LPLA 2OCCB 4DUYO 4QPIC 4DR2B 5I8SA 2CWSA 2R6QA 3LOIA 1DGSA 1LECA 4YW5A 4U2AA 5LRSA 2W47A 4YZ2A 1UIKA 2Z0AA 3TN92 5FP3A 2CL2A 2ETNA 3CXCU 5DN6G 1UY4A 4MXWB 3ZXKA 2WLHA 2ZE5A 2VMGA 2Q73A 3JAWB 2ADDA 4IUGA 2BU9A 4G2KA 1J58A 1SDWA 4XETA 4ARXA 2VCMA 3AX4A 2F1MA 1D7PM 2GUZA 4PDRA 1L3JA 4AI0A 2RJZA 1YQ8A 1XREA 2OX0A 1MQTC 4K3AA 2EIBA 2DYSB 2JX9A 1OLME 4KWUA 3A8TA 4J1XA 3AMHA 3GZUC 1AJPA 3VD9A 2VNRA 4I30A 1AR4A 5F37A 1WJZA 2QDOA 4CP1A 3GVMA 3CF6E 3K3WA 1R082 1OCOC 4KXRA 3EJKA 2BOBC 5F3GA 3S7EA 3ME2A 3VKLA 3AXEA 4JYBA 3Q8CA 4Z1MG 5ITZA 3DV8A 4JI0B 5EIBD 4AI3A 3ZFEB 2HWD2 4RR3B 3PN1A 4AVBA 4FZ0A 1D2QA 4PELA 3T0DA 2E31A 1V9U3 3C3TA 3V64A 1UU6A 1JZ2A 4IYIA 2WFF2 3KZ4C 2W3JA 2PA7A 2ZKLA 3IIIA 4I0WB 4MXVA 4FP3A 4JI3B 5A33A 2E53A 4JDOA 3VBOB 2UXNA 1CAWA 4IE6A 1HDKA 3NJZA 1CAUA 4LF5O 2IM9A 3CCUV 3RYHA 2Q9LA 2WUHA 5C3OA 2RVAA 5GZEA 1XYOA 4XUNA 3HKDB 1YFWA 5F3EA 3R65A 5EJZB 3OGIB 1YYNA 1VRH1 2VVDA 3RYIB 1O8SA 1VQOV 1W8NA 2BERA 4B08A 2JG9B 4OHZA 4XTMA 1W2OA 2PHDA 1URFA 4MHRA 4LHKA 5GALA 1KFXL 4AK3A 1DF0A 1Y43B 1Z7S2 3IB3A 4TOIA 5J36A 3Q9OA 1XUQA 2XWJB 2VE1A 3EBRA 3UESA 3BFRA 3KWVA 2ZEXA 3I3EA 2QDNA 3BODA 2DCYA 4QQ2A 4XZPA 3WVJA 4KP4A 3K5NA 2A75A 3ZVXA 1CZVA 2A3WA 1DYOA 4Q2FA 4QAWA 4KMQA 1M4WA 4FOYA 2Y6HA 1LU1A 5F8PA 4N8MA 2GN7A 3WF2A 1H6YA 3OY8B 3OYWA 4DXRA 5HXMA 1QJZA 1IKPA 3QD6A 3C8XA 1XHZA 2TBVA 4PA7A 1RUH2 2YHJA 2RG4A 4FTEA 4PI2A 2ZGUA 1US6A 4LIVA 2UUAB 4M4RA 4PDMA 3SH3A 3RMXA 2P3IA 2EULA 3I2DA 3IJ4A 2G38A 4K0KO 1DP0A 4ASLA 3LPGA 3H3ZA 4M3CA 3JYCA 4JYAB 3LDEA 1NKDA 5BMVB 2YPJA 2NMOA 5IK8A 1LNSA 4JHZA 2VGDA 5FV3A 1GN6A 3JCUZ 3RWRD 3ZSLA 1ZM1A 2B45X 3AVSA 5FPXA 5HV4A 2PYTA 4DUVA 5K8SA 5C93A 1O9GA 4CRQA 3LSSA 4WM8A 1NT0A 4LF6O 1P49A 3WB1A 3MLJA 1WMXA 5IT9N 4WM8B 2XHBA 3ROUA 4CVUA 2R073 4BA6A 5KMGA 1BEV2 3BAAA 4JI6O 2J42A 4I5SA 3N2KA 2D6KA 1UX7A 5A7PA 4BIZA 4UBHA 2PUSA 3ABKB 2UUCB 3FL7A 1OH3A 3K06A 1LTEA 4P9IA 3ZN5A 3ZXLA 5FUIA 2OPKA 2X05A 1LHNA 2ODMA 4N53A 5F2SA 1ZRRA 3AG3B 3NXSA 2WS92 1K5JA 5KBFA 2YI8A 3H8XA 2VUCA 4X62O 1JS9A 3M7AA 1D2DA 4W6YA 5C8WA 3ZN0A 3DYMA 1TUBB 2FDJA 4QU1A 2WL1A 3PURA 3J8F1 1WMDA 4GX1A 2GTAA 3S30A 4CEYA 3I54A 1SC5B 3E2EA 3V0BA 4S2GA 2QWQB 4BJ0A 1ENXA 2ZXQA 1WMEA 1NR7A 1GMGA 2VY0A 1LJ7A 2EINB 1G8WA 1H2SB 4D6RA 1QJY3 3GF6A 1G9FA 1Q8PA 5A6ZA 2LJ2A 3E22A 5BNOA 4IESA 3GXUA 1LULA 5K9YA 1LNQA 5D8AC 1AR73 3P30A 2ZE8A 1SFYA 2RS53 2WR9A 2ZDIC 1XMOB 2QGNA 1YSCA 1Y67A 1JHNA 1AYN2 4JI3O 4MO3M 1W6QA 3T1HO 3POGA 1SLTA 4DK0A 1ZTEA 3IIAA 4ZI7A 3NNJA 1HXS3 3ABZA 4FPOB 3GBFA 1AR62 1Q82W 1UYYA 4FPJA 3WDUA 3RYHB 5DDJ1 4HANA 2O57A 3SQOA 4AW7A 3UM7A 1UY3A 2NN8A 4CZSA 1PNMA 5DMYA 1VBC1 5DAPA 3FLPA 1XNRB 2FL4A 2XJUA 1HLCA 1HDJA 5CFDB 4IEQA 3NVCA 1D4VB 1S2KA 4Y20A 3ZX6A 2HFEC 4Q4V1 4CPBA 4IIJB 4G4FA 5J98B 2V1DA 4YG6A 2Y0IA 1WA4A 4CU7A 3OGGA 2KSDA 1ZBA1 1PMJX 4LO5B 4PLMA 3RZKA 3V56A 4A4AA 4ES8A 2QFEA 1ZRIA 2F66C 1SHWB 2B9VA 2EALA 5IE9A 4DR3B 4B4PA 4XJ8A 4HLTA 1PGW1 2VNOA 2JGUA 4YW2A 4CDWB 2O0OA 1BQ0A 2V5YA 3K5OA 2OIGA 3HPNA 4W4KA 4DV5B 2ADPA 5KXCA 3TXQA 1FD9A 2HWC1 2PN5A 3JATA 3KVAA 2VM9A 2KQXA 1BVVA 4P9JA 3I2FA 3ON7A 3IKWA 5C9AA 3S7IA 2B42B 1GNHA 4X9QA 1WLTA 4HNAB 2FMDA 3FZ3A 2UWBA 4H14A 4GX0A 2D44A 4NO4A 3S0MA 3T2QA 3NSTA 2ZZJA 4LH6A 5IVYA 1N1SA 4I09A 2Q6AA 1GAXA 4NMIA 4CS4A 1VR3A 4WZCA 2ZTNA 2F4LA 2B46X 2DUPA 1NLSA 3UL2A 2DVAA 3BOWA 3E5UA 4GJZA 5D2AA 2WLIA 4W6XA 1V70A 1AR91 2RJLA 2DF7A 4EE2A 2ORZA 1VP7A 4AL9A 3LB9A 2RS52 2CV6A 3VHRA 4JRAA 5KX5B 4DR7O 3R0RA 2VQUA 4E4EA 2ILMA 1DQ6A 1IBLO 3ACIA 3BOPA 1ZAUA 1N36O 3B8MA 1RPOA 5T50A 1AVMA 2IXLA 2ZQMA 3F2ZA 2GAUA 2OTJV 4QHZA 3KMHA 1NUKA 1AYM3 4NKGB 3OBZA 3D3AA 5FPBA 2YROA 4IIJA 4LFBB 4DR6O 4CDUA 1QU0A 2MNGA 3ZXDA 3VBSA 4NIGA 4P9XA 2P6CA 1V6LA 5C3QA 2AEYA 1BSMA 3GGLA 2VMIA 4J9YB 1AX2A 3VBHC 3WEZA 5FZKA 4FPYA 1UZWA 1LEDA 4UW5A 3OR6C 3GYDA 2JDNA 3H1KH 1O4YA 3HKBB 3C3VA 4LFCB 4BZ4A 3NNFA 1IBKB 5LASA 3B3QE 5E1AC 4MTFA 4AEMA 2V72A 1LB2A 4E2QA 4KGQA 4OUEA 3MEPA 4H44B 1K92A 1IG0A 5C3SA 4PDWA 2D6OX 3B02A 4TZDA 2JDPA 3VBOC 3MUY1 1G7YA 3DXTA 1QXJA 1VP6A 3VD3A 5IT6A 4FFBA 4GULA 3O9OA 5FKCA 5T5LA 1AR93 3POIA 3B5LB 2I2SA 4FPKA 1PMIA 5L3GA 3JD3A 2V4AA 5FZ9A 3ZHTA 4PCRA 5JXHA 5LK5A 1SCSA 1W8HA 3SH4A 1GRJA 3OTOB 1VMJA 1R081 4LUKA 2Q0AA 2X5IA 4R8CA 2C1FA 4JAAA 4C1XA 2MEV1 4WFHA 1HRV2 4CCDA 3ABTA 5KAIZ 1SPPB 2RDNA 2WN2A 1X82A 4DW0A 2LUWA 4FFBB 1F2NA 5JMCA 3H9AA 2JJ2G 3FYEB 3KCYA 4BR6A 3UJOA 3HQUA 1A34A 5EP9A 2YUEA 4O9GA 5A7SA 4RA0A 1RUJ1 2HWF1 3Q4HB 1JTZX 4K9SA 5L36A 2VOKA 2VNGA 4M0HA 3MZHA 4GQ7A 2YS8A 2EINC 2UWCA 2Y8KA 3VBUB 4JTCB 4OVEA 2RS31 1RFYA 1I9RA 4EN9B 5FJKA 5JJJB 4LF9O 3A4UA 1BKZA 1WD3A 2EIGA 2RM21 4XURA 4M00A 4XBNA 4X62B 1GWMA 4QB2A 4MV2A 1CAXB 4AFMA 3OUFA 3ZMZA 5C4WC 2TNFA 3VDAA 1O3QA 4C90A 4IL6Z 5F1RA 4O4LB 3A2FA 2CY6A 4GYCB 5FO9B 1K12A 3J7MA 3G6EV 3IDBB 4RS5A 1PO23 4NHXA 4AEDB 3THCA 2QTWB 3KD4A 3Q8EA 3ZIAG 1IQDC 3JAKB 1XC6A 4YIOA 1E1QG 1R092 2YYOA 4MSVA 5FZGA 1QNWA 2IBZH 2D3RA 3SYAA 3H50A 4LTAA 3CLPA 4KGGA 3G80A 5L9VA 4K1ZA 3NMBA 5BPXA 1CAVA 4LFBO 4S2DA 1ZA7A 2H6BA 3R4SA 4DV6B 2P1BA 4GIQA 1Q8SA 3KG2A 1CAXA 1EBOA 3POBA 4CDWA 3E8GA 4IV1C 1G6UA 4FXKB 3BTYA 2OZJA 3VQWA 2NLRA 1IG3A 2PQSA 4X1YB 5D5QA 3AJYA 3ZN4A 3SPCA 2MPFA 2RMU1 2C9AA 5KA5A 5F3IA 4Q0UA 5F2WA 2GNTA 1L7LA 5A70A 1AR71 4X66O 1CIYA 4MGSA 1AYN1 2O14A 4NJ4A 1IBKO 4PDWB 5IWAB 2QR4A 5FAXA 2JENA 1KQRA 2D6NA 2JS5A 2B8MA 1NS1A 4XAEA 4H55A 5CADA 4DS0A 4PJ0Z 5E79Z 1CVNA 1MSWD 1GN4A 1ROPA 5E1RA 1I6XA 5GONB 3VL9A 2UU9O 2RR13 2EIJB 2RS13 2EX3A 3NWKA 1W8FA 1B06A 4WM7C 1L7QA 4XTPA 1W99A 2Q30A 3P6BA 3JASA 2DU1A 2R042 4R52A 4ZI7B 4A7KA 2GP3A 3VHPA 2DDUA 1DLCA 1OA4A 3VZLA 2FD8A 2ATKC 4BM8A 4A2UA 3WG3A 1K42A 3ASNB 5IY5B 1S55A 4XYXA 2WO3A 1G9AA 4N21A 4XOGA 3I59A 1AJQA 2YIBA 4COUA 1BYHA 3B2EE 5FMOS 4LHLA 3HBKA 1P84F 2P7TC 5I0DA 1COWG 4EZHA 5EV7A 3VUOA 4NN0A 5GM0A 2R071 2YUAA 4CDXC 2WT1A 5FYMA 3ZN6B 2XJVA 1D5NA 3KHCA 3ST7A 3ASIA 3BB6A 1Z78A 2Q4SA 2WNVA 3VZMA 4J6GA 3JALB 2BSKA 5EJ1B 1WPXA 1SQVH 4EROA 4DZGA 2E3CA 3NKGA 3WP6A 2ZS6B 1EAH3 1SLCA 3I8TA 3GZAA 3GM8A 3MGUA 3I56V 3U4XA 3WG4A 2Y34A 1LGNA 4DV0O 4PJYA 5EYYA 2QWPB 2WT0A 3H3LA 5JQGB 4NUBA 1NA1B 3DXRA 2I74A 2DMXA 4CSWA 4GWMA 4V2VA 2PAKA 3IDEA 3G4SV 1XNCA 3CJIB 5BXZA 3D5OA 3E1F1 4EWDA 2QQWA 4YG0A 4FXGB 1I08A 2DVFA 3ETPA 5L3FA 3VD7A 3USUA 1RUF1 4TXWA 1WLDA 3RT3C 3QH6A 3IMMA 2DCTA 4COYA 2ZKNA 3M2MA 4QPIB 4MT8A 3NR7A 3SJQC 2CAZC 2GC3A 1I7FA 2GNBA 2CGNA 3VBBA 3TGUH 2ZPXA 1L8DA 2GC0A 5IVVA 2VW0A 2IJHA 1F23A 1JW6A 2Y0OA 3O5SA 4FK5C 1QDCA 4EN0A 5BZBA 3L74H 1G4YB 4QQOA 4DV2O 1M56C 1MZEA 3BIWE 4EFEA 5FUPA 2HWC2 5FXZA 1M57B 3H1JH 1Z5VA 3THTA 1REEA 2WLMA 3J4UH 5A7WB 1F8VA 1FMD1 3GWOA 1Z7S1 4X64B 1EN6A 5J09A 2FCTA 4MGZE 5IK4A 1ORQC 1QNMA 1DYPA 5CBLA 4HOOA 2OCCC 2QTOA 3IDAA 1IBMB 3ZYBA 2R1BA 5CKNA 3AP9A 4W6WA 4AQ2A 4ORFA 2X6BA 3N4MA 2FTKA 4LFCO 1AILA 3ZRSA 1ND3A 1XRUA 1N32B 3I97A 4MADA 5CU1A 2YY1A 4LF4B 3MFCA 2QM8A 2ZEYA 4GJYA 3K4ZA 1DYKA 2VXJA 4XIKA 3RYRA 4XC9A 4FZ1A 2W1SA 1EAH2 4LP8A 1O5LA 4FFIA 3IBMA 1OF3A 4XZUG 3T4VA 4D6TH 4XFFA 4P5HA 5IYBO 5FYIA 3SITA 3V0AA 3GHNA 1PVC1 2Y48A 3LPFA 3JQWA 1CD3G 3ITQA 1QJY1 4GXLA 3WDTA 4Y1UA 4JTAB 1KECA 4FLUA 5FLJA 5ANQA 4GKYA 5LOVB 2Z4FA 3ZXJA 4P2ZA 1LHVA 2CTVA 2VH9A 3VBSC 1IS5A 2VQ0A 2XKPA 1QJX2 4OQ9A 2R9RB 4YM1A 4PD4F 4ONUA 3SPJA 3H1LH 4QKBA 3VHOA 5FZAA 5A7OA 2NPIA 1S76D 2LROA 2XQRA 2V5DA 4DV1B 1NZCA 1YQ2A 4GMP0 1YXBA 2YFZA 4FOVA 4LA2A 4KBZA 4GWIA 4WBBA 2HEYF 1M57C 4ATEA 1RVF1 1OF4A 1TME2 2BFUL 2E5LO 4CYDA 1GZWA 4MLOA 3RYFA 4P9LA 2ZXWB 4X1YA 1BJQA 1YEWA 5B5EZ 1XL4A 2MEV3 4AVAA 3LIHA 1J3QA 3SPHA 2W94A 3E5QA 1FFXA 2F93B 4O4HA 5JVDA 2EXJA 4DO2A 4X1IA 1VAKA 1ENQA 1OD3A 2RM22 3ZR5A 3KQ4B 4JI2B 1VBB2 2ZGMA 4C1WA 3LOBA 2G9GA 5F32A 4QX2A 3RI9A 3MFAA 5J2TB 3T2PA 1YJKA 4FPPA 3UKTA 4ZPIA 3CMGA 1XILA 5A6QA 4R9DA 2HWF2 2WAMA 3ZFGC 4QXHA 1SQFA 3V0AB 1OQDA 2DBIA 4CH4A 4U7NA 4ZXEA 1Q8IA 1CJDA 3MIHA 3CJIC 1GFF2 3WW1A 3UYJA 5FZ8A 5CG9A 1RMU2 3IT8A 2A7WA 2D6PA 2EILB 2DU0A 1WKYA 4X8PA 3K9AA 5I8YA 5IYYA 2EIMC 5CA1B 3AG1B 3JD72 1RJ7A 2VR4A 2JDMA 1POV0 3K3NA 4HKWA 1RUH3 1W8OA 4FTSA 4HPKB 1PO22 3MLLA 2RN9A 4DR4B 2W68A 1ZREA 4DV7B 1OCCB 2ZOEB 3WQ0A 3ZYGA 1NCQA 3Q4HA 2RDSA 4DR5O 3QVNA 1OVPA 3ZYRA 2HR3A 5LBEA 4DYLA 5FOJB 3ZRVA 1TMF2 5CISA 2X7RB 3QACA 3LNMB 3GHMA 1BHBA 2BNNA 2VULA 2ARBA 2WLNA 4TQFA 2ZBJA 3CJIA 1GN3A 1UY0A 4YZ3A 2AZ5A 5F6KA 1MG1A 1OQEA 3ILFA 3KV5A 4H2AA 4LKFA 1CP9A 4P00B 1BE3H 3DUIA 5CFDA 1JBCA 1R73A 3CEIA 1FAYA 5EXOA 4ES9A 4UB8Z 2HWE3 1OJHA 4L87A 4AQYB 1HN1A 2PLV2 1KD1W 3O1TA 1JYXA 5EIYB 5F6LB 3SEPA 5J96B 2ZGTA 2FKXA 4LULA 1E1RG 1GKFA 3C7OA 1HB1A 4CDUB 1B09A 1PL0A 5KR7A 1W6NB 3QCWA 2LGWA 1GM9A 3I49A 3ZDSA 4FLVA 4META 2D93A 1K33A 3KKYA 1VF7A 1L0LH 3WFVA 2LTNA 1L7RA 1PNGA 4QXBA 4J80A 5GTHZ 1K5MB 4QX8A 1XB9A 3AFKA 3CEWA 1NA1A 1IX9A 3SJAC 1GV9A 1H8HG 3J26N 4SLIA 3K03A 2HWF3 1AZDA 3H1YA 2EIEA 2B5UA 4Y22A 2DFCA 4DEVA 1NLQA 1AI5A 2UXBB 4Y1YA 1F7YA 1WA8A 2IU0A 1WLCA 2Z5WA 4DV4O 2WAAA 1UW8A 2HWD1 5B1NA 4DR3O 3NNMA 2ATFA 2XH6A 2BGPA 2XUMA 4IGGA 1LHWA 1PK6C 5LBCA 3ZFEA 3A0RA 3U1XA 2NMNA 4U7OA 1J84A 2CTRA 3K77A 4PQ9A 5ACA2 2P5OA 3C7HA 2B5HA 3DCQA 2ZIMA 1ENVA 2GU9A 4R4XA 3ZFFB 2VQFB 1S0VA 3VDDA 1ZRCA 4DINB 4YGEA 1SQPH 2VNVA 3IM0A 2JEMA 3QF7A 1YNAA 3HT1A 4LCUC 3F5WC 3ETQA 3OMAB 1VMFA 4IV3B 1RSOB 3P32A 3B00A 2OCHA 5B3SB 2BTQA 1JOJA 1X50A 1OZ0A 2UXCO 3FLTA 4UYBA 2QSAA 1RJ8A 4XQ4A 4AGRA 3FYIB 2PI5A 2GN3A 5BY1A 1CQ9A 1WB8A 4FQZA 3MW2A 2XQXA 1H4HA 4GX2A 2W6JG 2P17A 4C0HA 5DDJ3 3LSUA 2WLLB 3I2IA 3ZO0B 3OD0A 4WF9V 4WVZA 4A3XA 1OBNA 3WDYA 3HPLC 3PMSA 3RZJA 1L0NH 3AP6A 4YNIA 4CCNA 2I07B 4E2LA 1NCQB 1WB7A 2EXIA 1AXKA 2Y64A 5FL7G 3AC0A 2HEWF 2WLPA 1KS5A 1PGW2 4G27B 3VBFA 4EEQA 1H1MA 5EWSA 1FOD2 3POYA 4PF1A 2RS51 2LQTA 1KP3A 5IVJA 4LKDA 3M3QA 4A6SA 1J1TA 4XFBA 4HSJA 2ZJCA 4JI1B 2XB6C 1UZ0A 4GALA 1F4HA 3L70H 2W1UA 2WPDG 4AOCA 5CBHA 1IURA 5FZCA 3VKOA 4GKXA 2R063 2AUYA 1KMIZ 3JD1A 4BQ3A 1KEXA 3MW4A 1QLEC 5IDJA 3NW4A 2TUNA 4RQPA 1HNZO 4JGSA 2JRIA 1S2EA 4Q26A 4UVCA 1QCEA 3ZFGB 1RUI1 1OCZB 1BK1A 1Q6IA 5IFPA 1Q8QA 4F4LA 3P1IA 4LR3A 2JG8C 5ANNA 5JR2A 1MQTB 2E33A 4DXSA 2HWB1 4O4HB 5JVDB 1QNYA 1GNZA 2Q1ZB 4CEYC 1DZRA 3ETGA 5FYZA 2KD7A 4LT5A 5LK7B 4A6OA 3GZTB 4CU6A 4TN7A 2W9XA 4R8HA 3LZZA 1U5IA 1A8DA 1T6GC 1CZSA 4XDPA 2Q7HA 1N47A 2E5LB 4DFSA 4CA9A 3CYOA 4AF9A 2UXDO 1UIJA 3MV01 1OI6A 2KM2A 4Q0QA 2DVGA 1DZQA 3ML0A 2ZAHA 1HX6A 4CH3A 5FCCA 2ZGNA 2N04A 1G9BA 2OTLV 4BW9A 1CAUB 2QA4V 3MIGA 1J95A 3ZMUA 4A3ZA 4XDQA 2NR5A 1EN5A 3T0AA 5FY0A 2LP7A 1S5HC 1U0AA 2BTOA 3ETEA 1MA1A 3O1SA 2WRAA 2BGCA 1D2SA 2XHNA 2ZM6B 3K0GA 3NAPB 4KBBA 3NJXA 3SPGA 4GZRB 1QJU1 5LZ6A 2AHYA 3BPZA 2H0BA 4OZXA 1R64A 3QLQA 1BT8A 2PHTA 3CRRA 3EFFK 4BQYA 4DV6O 3ACFA 1NY71 2F23A 3WG7C 3OTOO 4O7XA 3OUSA 4XF9A 5LBQA 1SFPA 4BCUA 4LORA 1UYPA 1OFSA 1KDMA 1UF2C 1ND3C 3GALA 1VF5B 4LF5B 1DZTA 2JICA 2ZGOA 1DK1A 2HWC3 4X65O 4QGLA 3CJHA 2YI9A 3ZRWA 1VQMV 4Q4V3 3E97A 1XMQO 5FYHA 4IDZA 5A3OA 1JH5A 4FPLA 3VBRA 4Y3OA 1PP9H 2A1XA 1H6XA 2ADEA 2Y4TA 5ACA3 2C2AA 2YMZA 4Z07A 3TEWA 4NWVA 1BCXA 4JGZC 1NQDA 1BMFG 1DGRN 5T3NA 2HYKA 4RSUA 1ZUQA 3VBFB 2CDOA 4JAVA 4QXCA 4WFBV 4RFT0 1QHTA 3BTAA 5A3TA 4JKKA 1Q90D 2YC2A 4BXFA 1YIFA 4MSWC 1RUD1 1C4RA 3PUIA 3VKMA 2Y26A 2ZR2A 2YZ4A 4RGKA 1C1FA 2RS32 3OGCC 2IVIB 3DYOA 1PO11 2E7AA 3A0NA 4IE0A 1SDDB 4Q4V2 4BQXA 3B94A 5FQ0A 2HLEA 4BH9A 3WDWA 3HNYM 3X2QB 2GALA 1NYWA 3HT2A 4BYYA 4XUOA 3BVCA 5AVPA 4AHZA 3JSNA 3AK1A 3CU7A 3A0HZ 4BPZA 3KLSA 2Z69A 3RYPA 4X66B 2Q68A 3IMNA 3LEGA 3WG7B 1VQNV 1JR9A 2LW7A 2XAFA 4MZUA 3LDKA 2RMKB 4LBQD 3RZLA 3MIEA 1VQPV 4LK7A 2GH2A 2VTXJ 1A8MA 3CX5F 4A5UB 3AL5A 1RXFA 4XDOA 2ZKOA 1FXKB 1R1A2 3IAQA 5H5NA 1R3JC 1N1VA 1IPJA 5GLTA 4GKJB 1V6OA 3RGBA 3OUIA 3OGVA 1RUE1 4YGDA 5IWAO 5EJ3A 2RMU3 1RMU1 2E32A 3ILNA 2AXTZ 2JIZG 2E26A 1O91A 3USUB 2B9UA 1S0GA 2BW8A 4FTBA 2XWBB 1GMMA 1NBMG 2O8OA 3PTRB 1R3KC 3KV6A 2Z3YA 5FP9A 5DM6V 4GH4B 3UNPA 1UO9A 5GLWA 1Y4WA 3O0WA 1WD4A 4INDA 1ZLZA 5JJEB 1OCCC 4HAMA 3PUHA 4TLFA 3WINE 3IN9A 5L7OA 5GONA 4MVOA 5SV8A 5L3CA 4ZKIA 5BUVA 2BUKA 4QD2A 5FPLA 5A3MA 2DCJA 1HQWA 3PUQA 4GWJA 4YSFA 3ZYPA 2QE3A 5KC6A 1W06A 4TSFG 1S2BA 4ZU7A 4YY3B 3IZOA 3PLQA 4PT6A 1DG6A 3F7YC 2EIKB 2QCSB 1P7BA 2NZ9A 2OQ7A 3T4ZA 2P37A 1PGL1 2C5DA 2D7FA 1Q6HA 3N9NA 1H2NA 3CJXA 4JDNA 2WYSA 2VZOA 5DXDA 4CCKA 1HXS1 4I0XB 2HG5C 1WCUA 5FLXN 4RS5C 1F4AA 2CAUA 5K0UC 3POWA 2GMMA 4H3WA 4DXZA 2OKXA 1A78A 1WCQA 2BTVC 4XDKA 2XBO2 5FYBA 3TN91 1E5RA 1I5PA 3G6BA 5LW9A 2CU5A 1Z2GA 1Y9GA 5L7OB 2WSVA 2XKOA 5JZGC 3LIGA 4XDJA 1W0KG 2X10A 3ZM8A 2BRTA 2OIIA 4P9YA 2RQ6A 5LP6A 4EFBA 1QJU2 3TYJA 2GV9A 4Q29A 4JI7B 3OCPA 3GWKC 3IDCB 3OGRA 2J7MA 3I2OA 4O4LA 4JHTA 4GB31 3T30A 2YEVA 4FBFA 3AKSA 1DHKB 2Y6LA 2QQMA 2ARHA 3WXPA 2LW1A 1H9PA 2F4VO 1RUG3 2FHRA 4X20B 1NVPB 4YW3A 4KL1A 4XJZA 4B3MO 2JDKA 4CEWB 1VEWA 3W7UA 3U0ZA 1YHFA 4P14A 4UV8A 5C5UA 3L2HA 3DGTA 1GOGA 1Q8OA 1B6QA 5IJ9B 2ARAA 4DR2O 1O6UA 1JFFA 2Z5UA 2VQAA 3VB9A 1OHHG 3PU8A 5IK5A 5IJ0A 5C8CC 1AR5A 5EZYB 4K8ZA 3CHXA 1HW5A 2B39A 3NNLA 1WNSA 5D5PA 1STMA 2EAAA 1AJOA 5H9SA 1CXZB 1MVEA 2IFWA 1K3IA 5IJRA 2CNAA 5FY8A 1C8M3 1K4DC 2WNUC 3WNMA 1AX1A 2BYVE 2VTXA 3WD5A 3ZPYA 3L71H 1E79G 2YB7A 5JJNB 2ETEA 4Y1ZA 4O2BA 2FCUA 5JPMB 4YZ1A 2EVXA 2H94A 4AEDC 4B3TO 1EZJA 3DSQA 1ASJ1 3VDCA 4EN8B 4HFSA 2CTPA 4ZOLB 1ULOA 2PHLA 1M06G 4J7KA 1R6TA 4C8DA 2R32A 4NHYA 5DZEA 2IU3A 4EWEA 4L8JA 1RUF2 5FZHA 4BMBA 2UY8A 5DEDA 1JPXA 2HEPA 1RUC1 1Q6UA 1WP8A 5FJHA 5C6CA 4Q4X2 1SESA 1KC8W 4CU9A 1O8PA 2WA3A 1J5EB 1A6CA 2RE9A 2K0GA 4DNYA 3T2OA 1XDCA 2HEVF 1W6PA 2DYRC 3CXHF 5BNOC 1AI6A 3GZEA 4OMDA 3OEAA 2VCCA 4K8XA 2XBO3 5C3PA 1H8TB 4OULA 2DUQA 1XNQO 1UU5A 4CP0A 1IPSA 5JR7B 1SA0A 4F8AA 2ZNIA 4LUMA 4Q8KA 1EUUA 4YZ5A 3CMEV 4YM3A 1O3RA 5BNNB 4DO0A 1ZSPA 4XHXA 2QKDA 1OQ1A 3ZFFA 3WG1A 2HWE2 1TVKB 3T3YA 1GANA 3MO4A 4BIFA 1AVBA 1MZ6A 1R091 2VW2A 4B4QA 3J8F2 1OVSA 2VWJA 3N2GB 3K0DA 2EIMB 3BEHA 3IPVB 1W0NA 5GLUA 1JYIA 1O3TA 3LSDA 1W0PA 3C3SA 4G9SB 3PDQA 3ZFGA 3JBG2 3FBMA 4Y22B 4OPAA 3FB8C 3D82A 1YFYA 3POFA 1PM9A 3SYOA 3L73H 5LA2A 3GB7C 2DYSC 4OI4A 1S0FA 2AC1A 3WX5A 2OPWA 1QH7A 4JI4O 2WBKA 4LWSB 4KNCA 4XQWA 5KA6A 2OYQA 3U4SA 2GUZB 1GO3F 2V4DA 1ND2B 3KCCA 1DF4A 1WAZA 4AQYO 3WT3A 4UV9A 4FAHA 1DQ2A 3SC7X 2FMYA 3QTCA 1MQTA 5F5AA 4YVWB 5CFCB 1RHI1 3UKNA 2WQ4A 1YIJV 1CX1A 1K4CC 1G8MA 1AR72 1KFUL 1OFNA 1US3A 3MW3A 4TWKA 1WGPA 3CBNA 5G04L 1GWKA 3U07A 2JDUA 5HPOA 5LYJA 1NOVA 1TG7A 4B3NA 2OS2A 4LF8B 3C7GA 1JMKC 1PM4A 4AILC 1BMV1 3FN9A 2KG7B 1ZBE1 3AG4C 5C8YA 4OYUA 3D36A 3SDLA 2D40A 3K4AA 2VAUA 4B3MB 2DWDC 4XXPA 1UZVA 3F7VC 1GKBA 1KBHA 2IXJA 3SNMA 2AEZA 3ABKC 3E83A 5DG2A 3LGRA 4BIOA 4LNUB 5BNPC 1G1XB 4BHPA 3RI8A 3W21A 2B4KA 2Q0OC 4B3RB 4Y5SA 1LUWA 3F95A 4YYOA 1PX3A 3FUOA 5B2GB 1X9TA 4NWWA 2XGXA 2XL9A 4EZ4A 1VBE3 4YWAA 3FWEA 3ZFFC 1BEV3 2WWSA 3WUDA 2P3KA 4XF0A 2XJPA 2BPA2 1SZTA 3I55V 3RNSA 2H3OA 1VBE2 3SH5A 4E4ZA 4LE3A 5J9PC 1KKCA 1R3LC 3M3CA 5FNVB 4XCAA 1CWPA 3LEKA 3LA3A 1AYM1 3HNMA 2ZABA 2XAQA 5CA6A 1HNXO 1O59A 1DGRA 1FAFA 2UY9A 2P06A 1JMUB 5FZFA 1C8M2 4NHMA 3UGFA 1LOEA 3ZDVA 1MNGA 2Z42A 2W46A 3PU3A 5F2VO 1CESA 5C4WB 4A7YA 5JXIA 3EMRA 4LHSA 3WW2A