3BPZA

Hcn2-i 443-460 e502k in the presence of camp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREKIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title C-terminal movement during gating in cyclic nucleotide-modulated channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 66
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3bpzA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3bpzA02
3PVBB 4CYDA 1U12A 1VR3A 4D7TA 2PQQA 1UIJA 2CV6A 3H7YA 4P9GA 5I8YA 1ZVFA 4X6RB 4QGNA 2OPKA 5E16A 4JTOA 4XEZA 4IEOA 1QY4A 5BY5A 2D5FA 2XGXA 1CAXA 2XKPA 4YARA 2GAUA 4LEJA 5K8SA 2IXCA 4PIZA 2C0ZA 4Q29A 2XLAA 4QGMA 1UW8A 3FE5A 4XFBA 5FQ0B 4J1XA 4ORFA 1ZZ7A 2MNGA 1FI2A 5KHHA 4IESA 2PA7A 4YSFA 4YRDA 5F1RA 2GC0A 2MHFA 2O1QA 2ET7A 3H1WA 2OZ6A 1YLLA 4NVPA 4JVAA 3LZZA 3H8UA 1H1IA 4AVBA 3BB6A 4LUMA 4MUVA 3RNSA 1ZREA 4R52A 2GC1A 1ZZ9A 3N4MA 3R6SA 5FLHA 1J59A 1DZTA 1H1MA 3CL1A 5JSOA 2XHKA 4QGLA 5J48A 1CAVA 3WW2A 2ET1A 2OA2A 3QACA 1NZCA 4UBGA 2IXIA 2ZKLA 3MYXA 5EFUA 1I5ZA 2QDRA 3FWEA 3L2HA 4XF3A 3KGLA 4LA3A 2IXKA 3CJXA 4HZFA 4XF4A 4WBBA 1LKNA 2PTMA 3OF1A 2Y0OA 2GU9A 3LAGA 3SXWA 4IEQA 3GBFA 4HSLA 1NE4A 4XF1A 2P17A 2Q0AA 1Y9QA 3D82A 2OZJA 5J7MA 3H9AA 5I0RA 2CAUA 5KBFA 3OGJA 5CVRA 2UY9A 1IPJA 3DL3A 1XE8A 3FFQA 4I3PA 3GYDA 1ZZCA 2Q1ZB 4PIXA 4BYYA 1YUDA 5I0UA 1GQGA 1QWRA 4I0AA 1VP6A 4IERA 4HVQA 2D93A 1ZZBA 3LOIA 3ACLA 5KHIA 3U11A 3HT2A 4ZU5A 4OFGA 3LA7A 4MGYE 3LA3A 2MPFA 2V09A 5BV6A 4Z07A 3KSCA 5I91A 1G6NA 4LLOA 3I7DA 3E6DA 1DZRA 2QNKA 4EV0A 5T3NA 3RYKA 4BIFA 2BNNA 3WW1A 3USSA 4D7SA 3M70A 1RTVA 4K8FA 2PAKA 5I0SA 1J1LA 2XKOA 4IEUA 5FLJA 1YHFA 3CEWA 5FPZA 1O4TA 4EWDA 5JSPA 1FXZA 5C8WA 1OMIA 2UYBA 2EAAA 2H6BA 3U0ZA 3NL1A 4FT8A 4H7LA 4Q0PA 3IBMA 4KWJA 2WC2A 2KXLA 3EJKA 3FZ3A 3ROUA 3S7IA 4R8HA 2QCSB 4IEWA 2E9QA 4A2UA 4WZCA 1X7NA 3I59B 5FPXA 5JCTA 5BPXA 2Z2SB 3ELNA 3H3UA 5CADA 1J3PA 2QJVA 2ATFA 4MGKE 4LULA 2PHLA 3MDPA 5HI0A 4XFCA 4GULA 2O8QA 4E2SA 1ZNPA 1QXRA 2IXLA 3JZVA 2ZCWA 3O14A 1SQ4A 4XETA 4XFAA 2IC1A 1J3RA 1L3JA 3B02A 4YNIA 4E2GA 3SCFA 2VQAA 4QX5A 4PJYA 4UBHA 1JUHA 3OCPA 4YYOA 4BHPA 1FT9A 1YFUA 5C6CA 3OTFA 3H7JA 4XFFA 4QM8A 2BYVE 1OI6A 4F7ZA 4XFHA 3UKVA 4XF0A 1Q5OA 3ZDSA 1QXJA 4FAHA 3E97A 2BNOA 5J3UA 4Q0UA 3G7DA 3RDIA 4X6QB 3KGZA 2BEOA 3H1YA 2B9UA 2ETEA 1CAXB 4EWEA 5AVPA 2CAVA 2PAEA 4AQ6A 3H1MA 2XL9A 3IDBB 3RYRA 1Q3EA 1ZZ6A 1YFWA 2BGCA 1CAUA 3E6BA 3HQXA 3IWZA 4QMAA 2EA7A 1ZZ8A 3TNPB 4HVRA 5I8SA 1Q43A 5JAXA 3D0SA 1ZRDA 3IDCB 5I93A 1CAWA 2HKXA 2XLFA 3KMHA 5LEJA 4DINB 4MV2A 4MGZE 3BPZA 3FX3A 1UPIA 1XRUA 3EBRA 1XE7A 3TNQA 2EVXA 1UCXA 3E5XA 1RGSA 2N7GA 3DV8A 1X8MA 3BALA 3BCWA 3I54A 1LB2A 2QVSB 3ST7A 1VJ2A 1O3QA 4L11A 1V70A 1I6XA 5EZWA 2UY8A 1CX4A 2FQPA 4PIYA 4QXKA 4WVZA 5FQ0A 4LTAA 1EY2A 3RYPA 4EWAA 1CAVB 4FAGA 5FDBA 4MZUA 3ES1A 1RL3A 4XF9A 1WGPA 3KCCA 4IETA 3WW4A 1OD5A 1YFYA 4MX3A 2PFWA 2FMYA 1O3TA 5BXXA 1EP0A 2IXHA 1O5LA 2CGPA 3UKNA 3ES4A 3EHKA 4XFGA 4HBNA 5FLIA 3FHIB 1NE6A 4I2OA 4IEPA 5BUVA 2K9ZA 2GC3A 5CU1A 4KWLA 3S7EA 5LRSA 4KWKA 2OYZA 3CF6E 1O3SA 3IIAA 3PNAA 2GZWA 4HN1A 3SCHA 3EQEA 3WW3A 4Z82A 2VPVA 4I0BA 1WA4A 3H50A 5KHKA 2Q30A 4AVAA 1NXMA 4RD7A 4Q0VA 4E2QA 4HVOA 4O9GA 1ZRFA 3S0MA 4KU7A 3PLQA 1OFNA 4I02A 4I09A 4O9EA 1O7FA 1EPZA 5KHJA 1LRHA 1UIKA 4ZU4A 2XLGA 2HJIA 3VHRA 2B5HA 4I01A 4LA2A 1O3RA 1PMIA 4AQ2A 1HW5A 4HMZA 3E5QA 1YFXA 4QM9A 3DKWA 3SHRA 2K0GA 3OD0A 1SEFA 3NVCA 3NW4A 5D1IA 5LRRA 5JSRA 2BNMA 4EROA 3D0JA 3QOPA 4AXOA 4TLFA 1YWKA 1X82A 4N9IA 3UKTA 4BH9A 4META 2UYAA 2DCTA 3MZHA 4JTNA 4HLTA 2PAMA 2H6CA 1PM7A 4IEVA 1WLTA 2I45A 3DN7A 4FBFA 3ETQA 2XL7A 3MPBA 4JV4A 2Q4SA 4MGIE 1ZRRA 3C3VA 1DGRA 5KHGA 1J58A 1X8EA 4J1WA 3LWCA 4KL1A 3HT1A 3CLPA 4ONUA 4L2NA 2VECA 4OLLA 2GC2A 3EO6A 3HIFA 4XFIA 1LR5A 2PYTA 1RC6A 1RUOA 4Q0SA 1CGPA 5I8TA 4HSJA 5E1RA 1IPKA 1O5UA 1TQ5A 2IXJA 2D5HA 4LUKA 2WFPA 4HN0A 4KU8A 3E5UA 3I59A 1J3QA 3SCGA 1ZX5A 1NYWA 1RUNA 3H3ZA 2GH2A 3U10A 4IEYA 5JR7B 2B8MA 1EYBA 4AVCA 3RPQA 1DGWA 3RZZA 3NKTA 4UXAA 4MH0E 2F4PA 4B29A 3SMHA 2PHDA 3CO2A 3NSTA 1ZRCA 1SFNA 1UD1A 4ZU7A 2H0VA 3FJSA 5FCCA 4IEZA 4F8AA 1GQHA 3BU7A 3E6CC 1CAUB 5LEKA 4N9HA 2Z69A 1Y3TA 4IEXA 3LA2A 4Q0QA 3NJZA 5I0TA 1CAWB 3M3IA 2D40A
chains in the Genus database with same CATH superfamily
1VR3A 1K42A 2P4EA 3B4SA 5ISLA 2QE3A 1AX2A 4QGNA 1EFRG 3E35A 2Y8KA 5FYIA 4GKKO 4UCRA 4PQQA 5KMGB 4RGGA 5ACA3 2B1IA 4AI0A 1F9KA 4W50A 2WT0A 2OIEA 2EINB 4LE4A 2ZX1A 4F3JA 1WPXA 3WF3A 4AHZA 1N3OA 2PA7A 1UZZA 2VZ1A 5KA6A 5F1RA 3D8CA 1C3HA 4O4HA 2JDYA 3VZNA 1MMMA 3JALB 1W0PA 2WJSA 4JVAA 4FLZA 2AGAA 3BB6A 4TN7A 4CEYA 2VMGA 3OBTA 5CBLA 2ZEXA 5JWPA 3GNEA 4CU6A 2FDGA 3I2GA 3JBG3 4PDVA 3MUZ1 5FMDA 4J9ZB 4ZZ5A 3F7VC 3T2TA 1PNKA 4LE3A 1NI8A 4J25A 3LPGA 4KUMA 1AILA 3F5TA 1Z7S2 3ASNC 1XDCA 2CE4A 1PO13 1QLEC 3CMAV 3JCZA 3C8XA 5FY9A 1YNAA 2EZOA 2NLJC 5E89A 3K5OA 2XG3A 3EXAA 5A3PA 1VQ4V 1JYTA 2XHNA 4FK5C 3B01A 3MLKA 5LBQA 1SACA 3DEMA 5FYHA 4ZHQB 1WD3A 3I3MA 4BYYA 4YPJA 3CWBH 3RYIB 1X9PA 2IU3A 1RUF1 1YIPA 5GLZA 1PIV2 4LFAO 1XC6A 2JRIA 2MPFA 4COWA 4Z07A 4C1XA 3MDSA 4GXLA 3ZO0B 5H6RA 1Y43B 1SC5B 3JB4C 2E7AA 4BIFA 1O91A 2CDPA 2Y26A 1MG1A 2EIEA 4PDMA 4EN6B 3NAPA 2XKOA 3UYJA 1V00A 3RYCA 3H8OA 1CZVA 4RWUA 2KA3A 1PK6A 2QQPA 3U0ZA 4XCBA 2QZ2A 5FUNA 1PMHX 2ZGOA 1DP0A 3N2KB 2WLIB 3RYHA 1RXGA 3J7NA 3A7QA 4R8HA 2YXHA 3A21A 4MXWA 5FPXA 4L99A 1P49A 4FJCC 1JHJA 2QJVA 2XJPA 1AR91 3JD2A 3E22B 4LULA 4FLWA 1PHMA 1WKYA 1UJWB 5FJKA 4YY3B 3JD4A 3VD9A 1OKOA 2IXLA 5C9AB 2QQMA 3C7GA 4DV1B 4LC1A 2Y34A 3AG4B 1FFXB 4N7UA 1JUHA 4PI0A 4YZ1A 1FT9A 1W8HA 5JLVA 1YJNV 1RUE2 4FPOB 3W7WA 1J95A 4UCOA 4FZ1A 4DR5B 4NYKA 3ZHSA 4IE0A 2VWJA 4EN7B 5C3QA 2XBO3 4PA6A 1SG3A 1VAVA 3H1MA 2W6IG 4IE6A 1F31A 1TG7A 4HVRA 2ZMKA 2JDUA 3RI8A 5LA2A 4EKWA 1N34B 2QM8A 4QPGA 3BCWA 3TGUH 1VJ2A 3VDDC 2F23A 1GWLA 3KQRA 2HHHO 2PLV2 5F32A 2FHRA 1S0BA 2FQPA 5EIBD 4Q1RA 5FZDA 1YYNA 3P6BA 3RT3C 3FAVB 1JHNA 1JJ2U 3ES1A 1REDA 4TV9A 3C3TA 3DGEA 4OQ8A 2DYSB 4BK5A 4HBNA 5BUVA 4LMFA 3JD0A 2AR6A 1IZ3A 4XDPA 5FFOC 2WLPA 4Y4RA 4JKLA 4FM2A 2HWF3 3ZRVA 5CB4B 3WW3A 2EILB 3ZMTA 3K4AA 3I55V 4JI7B 2VZVA 1KEXA 1H2SB 4I02A 4RGAA 4CUBA 3G80A 3M8AA 3KV4A 3ZIAG 3A4UA 2B5HA 3J7LA 3PJYA 1AF9A 4I01A 4TUYA 1HDKA 3VZMA 4QXCA 3CIHA 3ML0A 1HP8A 1N1TA 5FMCA 3B5LB 3CSXA 5JSRA 5F2VO 4NHXA 1I08A 4RS5B 4MO3M 4OI0A 2YPDA 2G19A 4BH9A 4WFGA 3ME2A 1O4YA 1BKZA 2ZEWA 3ZYFA 1OQ1A 4JDOA 5B4NA 3HBKA 4JDMA 3HNMA 3RJ2X 2Y60A 5FV3A 4CU8A 3CMGA 3H8XA 4JGZA 4CA9A 4A41A 1W6NB 3BHPA 1BSMA 3F5WC 3POSA 5T5PA 5F3GA 5IW0A 3T09A 2YXLA 1F4MA 4UV9A 4DV5B 5A3MA 4NXMB 4IE5A 2UXDB 3OMAB 4Q27A 3OUSA 1VBC2 3WVJA 2XJQA 3LEGA 4FOWA 4K1YA 5G04L 4MGTA 3BU0A 3ZEDA 2GN7A 1AR83 1AJNA 3IMMA 5BNPA 4AI1A 1GZWA 4RHV2 1EPWA 2Y6KA 2K9PA 1B09A 3JASB 2VOKA 4NRQA 5L9VA 1Y74B 3NO8A 3B77A 2DU0A 1GMGA 3AM2A 1PL0A 3B8NA 2ZGTA 2Y38A 1H2GA 5FP4A 1T6BX 1BL8A 2GAUA 5JH7B 3H8RA 1F15A 4EE2A 1JX9A 4ZS2A 3WUDA 4D94A 1GKBA 4KP4A 2UUCB 3CRCA 1M90W 4AQYO 3IGAC 2OXBA 2DVBA 5DMYA 2GC0A 1XU2A 2MHFA 1H2NA 4MVUA 5T5JA 2IH3C 1GU3A 2W2IA 5FKCA 4LF6B 4MUVA 4U7OA 3KG2A 2HH9A 4HNAB 4UB8Z 4MVTA 2A6XA 1FD9A 1QGLA 3CL1A 1OHFA 5C3OA 1AB3A 1WLDA 2VM9A 1GP5A 4WBNA 2HWB1 5FWEA 5FUIA 3VUOA 5E1AC 1RMU2 4LF4B 3T2PA 3T1HB 3GJAA 3CJHA 2WNUC 3CJXA 4YZ3A 3L71H 3LFMA 5BMVB 1NX9A 4HSLA 5C3PA 2ZMLA 4H7MA 1SA0B 3D3AA 1BMFG 3WF4A 3T1LA 5FREA 1OCCC 4XZPA 2BTQA 3OUFA 4J80A 1PD3A 1R6KA 5LK7B 1XREA 4JAVA 4LK7A 1XMQO 1K9MW 4GZRB 3T0BA 1FPOA 2V09A 3T1CA 1QDCA 3N9PA 1OQDA 4P02B 1G6NA 5A6YA 3L9DA 2ZHLA 1IKQA 2DV9A 4IGPA 4P5HA 5IJ9A 1UU6A 5DQ0A 1IS6A 2ZHMA 3IDAA 3O7OA 1R091 4D6TH 2QA4V 5L36A 2CNAA 4EFBA 3RZGA 3OG2A 4W4ZA 1H2KA 4B08A 1XQ8A 4JHTA 5EIBC 2WSSG 1REFA 3RWRD 4PA3A 4GT1A 1UZVA 2F4VO 3QBQA 1I5YA 4MGKE 3IM0A 4W4KA 1JZ7A 4PA9A 2JDAA 2O8QA 4JYAB 1QJU1 5GZCA 2DFCA 4NJ4A 5FMBA 2XDVA 2CK3G 3GZAA 5A32B 4MADA 1K3EA 3DF0A 3AMPA 4X1IA 2P5OA 3L9JT 4BHPA 1NVPD 2I07B 3SNMA 1K12A 4LBQA 2W1UA 2YROA 5FXVA 1DIWA 4F7ZA 2BTOA 3BTZA 3H1JH 2G4IA 3AK2A 3UNPA 1MOFA 3AVRA 3M2MA 1VRH3 4O4IA 3J7MA 3A0KA 4XJUA 1HNZB 4RUFA 2BGCA 4PI2A 3ZX7A 5FO7B 5I8SA 4CZSA 4DK0A 1SRYA 1P8JA 5FZ0A 4FOVA 3D5OA 1SPPB 2EVXA 3RMXA 1X8MA 3WG3A 1AXZA 2ZIMA 2E51A 1V70A 1DGWX 1VBB2 5CFDB 3AKSA 4WVZA 4XOGA 1CAVB 4XDLA 4MZUA 1QQP1 4QWNA 4IETA 3OBRA 1B35A 2YC4A 5IVEA 1S2BA 1EP0A 2CTRA 4AOCA 4FTBA 5FLIA 1W0KG 4RQPB 3ON7A 2BWCA 2OYZA 5LOVA 2YU1A 3DSQA 3ABKC 1YI7A 2BOIA 3MGUA 1V6NA 3WCSA 2ORZA 3SJAC 1LAJA 1PGW2 5KHKA 2UWAA 3PN1A 4K20A 3VBSA 5A3TA 3IN9A 3ZDVA 2LGWA 4X66B 1BVVA 3MEPA 4F4LA 3M3EA 4IYHA 2F66C 1PMIA 4O2AA 1UY3A 4OUMA 4QM9A 1T6GC 1LHNA 1F8VA 1QJY2 1Z5VA 2JS3A 3HMYA 2C9KA 2X53S 1LNSA 3VD4A 2NPIA 5DABA 1QLEB 2KG7A 5FPVA 4IV3B 4E4ZA 1RP3B 2G9GA 3ZLIA 2VO5A 4HLTA 2JG8A 4YW3A 1MA1A 4TOIA 5CA1B 1US6A 3EYPA 3AG2C 3VBRB 1HRV2 2WNOA 5DN2A 3RYFB 1N3QA 2DBNA 3WB0A 1JCHA 1CIWA 4J41A 4UI9L 2P3YA 2CDYA 5DZFA 1UOJA 3I2FA 1NCQC 3P3NA 3QO7A 1OBNA 4W6WA 3LSSA 3VBUC 4KU8A 1BEV2 1KUQA 5IY5B 1NYWA 3VBHA 4ZOLA 1IBMB 1RUG3 1YITV 2JG9C 5JR7B 2OTLV 2JDPA 1FMD1 4Q4V2 5F2WA 5D8AB 4URAA 1UD1A 1Q8QA 3AYDA 2X05A 2HBUA 3GWOA 2RG4A 4CEWC 3WV6A 1KB9F 1N47A 4P30A 2FDIA 5JOXA 4GLXA 4G9SB 3H0OA 2GV9A 3UQ8A 3POBA 2VTXA 3CCMV 2B45X 2W68A 5K8SA 2LTNA 1FYUA 4DEQA 4NIDA 2HWE2 1FPN2 1UW8A 3FE5A 1W8FA 4CPBD 1L0LH 4GJYA 2Y0PA 4XMIA 5C8YB 2MNGA 1FI2A 2AZ2A 5LYJA 1EV12 4D6SA 4EZ4A 2ET7A 1MVEA 3OAAG 4LNVA 1OXCA 1ZYBA 3POWA 3UGHA 3RNSA 2YI9A 3D36C 2OYQA 1X59A 1J59A 1ENSA 3IPVB 1DGSA 1GM7A 1W2OA 2P7TC 2JIZG 2J1SA 1UYYA 3WY6A 1C8M2 3QACA 3HNYM 4X88A 2YBKA 4KXRA 2QDRA 1OUSA 5LBFA 1V9U1 2PHXA 3P32A 4WBBA 1DF5A 1DGRN 5A2QN 5KX5A 3OTOO 1K5MC 4QPYA 3SXWA 5ANNA 2R6QA 4JGSA 1OT5A 5FUPA 2AH2A 3VD3A 5B1AB 3UJOA 5C3SA 3QO5A 4MTXA 3H1LH 1POV3 1RYYA 1SFPA 3LNMB 4D8MA 3JATA 5L7OB 1YQ2A 2WDBA 3GZUC 3RN4A 4D6QA 1SQVH 4LLFA 1DG6A 3MICA 2QFEA 1QMJA 4YGBA 3MFAA 5FZ8A 1YTFB 5FPUA 5CEHA 4B4RA 5LATA 4D7SA 1AX1A 5A1FA 5J09A 1SCRA 2QKDA 1AI6A 4K0KB 3N9QA 3HR0A 4A7YA 4J7JA 3ACGA 1IBKB 2N04A 1JN2P 5IFTA 1FV3A 3EJKA 1Q81W 4OX9O 3AX4A 3H1IH 3K48A 2RM21 1OPOA 2VQUA 2GHYA 2AZ0A 1HR0B 2YS8A 4LBKA 3ZXKA 3ZFFC 3K04A 2B42B 2WAMA 1QXRA 5LGTA 3CCVV 4Q4Y1 2IC1A 1VBD1 4AG4A 4I55B 1XYOA 3VB9A 2BZDA 1K5QA 4PDWB 3BPSA 2AZ5A 3ABLC 4OPHA 2ADPA 1Q8IA 5FK8A 2PLV3 4NR1A 1ND3A 1JYIA 2IUWA 2JJ2G 4E4HA 4TQDA 5E6HA 3G6JB 5FZFA 1VQLV 1ZBE3 5LB6A 1AUYA 1GAXA 2RCVA 5BNOB 4CC5A 4LT5A 1GKFA 2ZOEB 3RG0A 2X5IB 1NKDA 1QJX3 2VWKA 2C5DA 2BP6A 5L3CA 3I54A 4U3JA 2A6WA 4CDWB 4HKLA 4AF9A 3P30A 2TUNA 1FJGB 1WAZA 4E4DX 3J4UH 4YM2A 3V0AA 4IHJA 1CX4A 3SISA 3TXSA 4PCRA 4FAGA 2G9FA 2PGGA 4M3CF 1GR3A 3C3SA 2FBEA 1VB2A 4DR2B 1RM1B 5BXXA 1O5LA 4RSUA 1XMOO 1F7YA 4XFGA 2VQEB 1JZ6A 2K9ZA 1GQPA 2LW1A 2EXHA 3OE7G 1Y7BA 2HJFC 3JUUA 4I0XB 4INDA 4HN1A 3SDLA 3GM8A 1FOD3 3AXEA 4NTWA 1NTMH 4LO8A 1ENQA 2JB8A 4QT6A 1HLCA 3CCQV 1MACA 2A75A 3VQYA 4FFHA 3VHRA 3ZFGB 4QB6A 5ABJA 2E31A 1D4M1 2AXTZ 5EQUA 4DUVA 4DW1A 1YFXA 5HXVA 1PZ8A 5GZEA 2CWSA 5L3DA 1W6OA 2LRPA 4K3AA 5ITZA 1ULEA 4UCSA 1MEC2 1TMF3 3JU9A 4QPKA 4MYEA 3BTYA 2WS91 1Q56A 2ZE6A 2HYKA 3NNJA 1HV0A 1UKRA 1I0HA 5LZ6A 4D7YA 5D5QA 1P7BA 3DUIA 2WLMA 3WB2A 3NNGA 1VQ7V 2ZZJA 2CWMA 4Q0SA 5I8TA 3I3QA 1PO23 2UXNA 1D0HA 3I59A 1D5AA 4DV6O 1JOJA 2QKCA 2YHJA 1RUC1 3OBZA 3IMNA 3WDVA 1YXWA 4JI8B 2B8MA 4AVCA 5J37A 3I3DA 1DGWA 2YC0A 2F1MA 1XNQB 2KKWA 2BOCC 2A3YA 4IT5A 4DNYA 3R66A 2XQRA 2OCCC 3LIHA 3E6CC 1CAUB 1BHGA 1DCSA 4XJ8A 1R081 5GZGA 1V6IA 1V54B 4XPVA 2A7AA 2CY6A 4NTXA 1WCDJ 2WA4A 3V56A 1HXS1 3S57A 3OR7C 5DUVA 5FZOB 1GANA 4AEKA 4M00A 3DPRC 3OGCC 1KKDA 1RMU3 1KKCA 4H0LB 2ZKOA 4IESA 1NUKA 4LBNA 3TEXA 4YVWC 1V6LA 2BUKA 3LZZA 2UU8A 3TWIA 5EHDA 1LOBA 5EYXA 3LGRA 1GP6A 5JSOA 4XBQA 4GKKB 3MIGA 4JI3O 4IGGA 3WW2A 1W6MA 2BPA2 3CRQA 4LR3A 4QXBA 1HNXO 2BW8A 3MYXA 1AJOA 3N2GA 4H44B 3WP4A 2P4VA 4QX0A 2FCTA 4GH4A 5EBMC 1XSQA 4LH6A 4QX2A 2K46A 3M3QA 3OEHG 2D3OW 1AL22 2OZJA 2P5BA 4XBLA 1G1XB 3I2HA 1TUBB 5A1LA 5SV5A 1BQPA 1EN6A 3FFQA 5FTTC 1SZXA 1A6CA 3FHAA 2E76B 5BNNC 4WVWA 1RINA 3QD6A 4ZU5A 2P6HA 5GLVA 2ZAHA 4QE9A 3I2KA 3ZXGA 2CTWA 4PA4A 4MVOA 1OOPA 2ADEA 1NXD1 4AAPA 2C26A 1I94B 2L9LA 1HNWO 2VCAA 4FQ4A 2JEUA 5LL6Y 1RVF1 5JSPA 4QDQA 1EUUA 1S5HC 4BIUA 2IM9A 4ZY9A 1W8UA 3HEIA 2GNDA 2QQLA 3MIBA 5IYCO 4XZUG 2P22C 3DKQA 2E3CA 4C1WA 1NCRB 3OD4A 4Q4X1 4X89A 3VBOA 3AZXA 2VMCA 3POGA 4YNIA 2MW2B 2P06A 2PHUA 5IT6A 4E2GA 1AYN2 1AJPA 4XUNA 4TV8A 2JKBA 3H7JA 1WBFA 2VUJA 2GDSA 3UKVA 4Y22B 2D44A 4JGYC 3DYOA 3VD5A 2V4AA 5FBJA 3G7DA 3HQUA 4CP9B 2EIKC 1U96A 1W8ZA 1WP7A 1Q3EA 5CFCB 4AI9A 1IPSA 5F7UA 3WNNA 5JAXA 1TEIA 2PYJA 3DXTA 3QLQA 5F3CA 1K4DC 4GAZA 3M99B 1OSGA 4XABA 3EBRA 1ONAA 3FB6C 5CNAA 5KXDA 3NV3A 4BAYA 2QBXA 5IAXA 2WLJA 2ZCEA 3ZYRA 5K0UC 1POV0 4A7KA 2A3WA 4DR6O 2GN3A 3ZFEA 2VAUA 1I5PA 2ZX4A 3HNBM 4XF9A 1OUXA 1VALA 1V6OA 5J2UA 2DBIA 2R042 4X1KA 2GALA 3UKNA 2BVBA 5FK7A 4C90A 3OUIA 1J83A 3AK0A 4GB31 3S7EA 3FUQA 1IS4A 4QPIB 2RS31 2E7TA 1UU5A 1OCZC 3SPIA 5LXTB 4FXKB 2GZWA 4Y20B 3SCHA 4A44A 2O14A 3FLTA 1JOPA 1CZTA 1WA8A 1MS8A 4RD7A 1SFYA 2PHFA 2ITCC 3PLQA 1W6QB 2VCCA 5FZKA 2BU9A 2A70A 2VJXA 1RUJ3 1BE3H 4WVMB 4YVSA 2NR5A 1RUF2 3W58A 4ZBMA 1HRV3 1HW5A 2YEVB 5IFPA 5A3OA 4ABMA 4G27B 3Q4HA 2ADQB 4CH6A 3WQ7A 3WFVA 1PV0A 4GKJO 4DV2B 4FZ0A 5E79Z 1H38A 5DXDA 3AG1C 3TN91 3ZHTA 4META 3VL8A 1LEMA 3H1HH 2YU2A 4UW3A 1COV2 3DGTA 4Z8BA 2ZT9B 2I45A 1YCIA 3KVBA 2NZ9A 1W28A 1ZWIC 2VBDA 4BMEA 4CC6A 2VZRA 1VF5B 3AXDA 3MLJA 3LWCA 5JXGA 3ZRXA 3CLPA 3CP1A 4AEDA 1JFFB 1HB3A 3OPTA 1AR92 3NV2A 1RSOA 2D6LX 4JASA 1CGPA 2W87A 3VBFC 1IPKA 3E89A 2VGDA 4CDQB 4L87A 4XYXA 4GALA 4LBOA 1GOFA 4PV1B 2BGPA 1J3QA 2I2SA 2D3SA 3RZKA 3ETEA 4NHYA 2HWE3 5BNQA 1URXA 4MH0E 4X8AA 3Q8EA 2UUBB 2NP0A 3BAAA 1AR62 1S76D 3S3WA 1SFNA 3PUHA 1DLCA 3LA2A 4XXAA 3A8TA 3CRMA 5AC91 3ZFFB 4IV1B 1UIJA 1SDWA 4CCEA 1W6PB 3WUCA 4NKGB 2NNUA 1VF6C 2RDSA 1UN1A 4LEJA 4PIZA 5HBAA 3W21A 3JBG1 4LO5B 3KKYA 2ADDA 3SJQC 4HZ3A 5FQ0B 2DTWA 3TK1A 3GDBA 2VOXA 1DQ1A 3RI9A 1RUH2 4HONA 1QNYA 3AC0A 4U36A 4LNUA 3AMMA 1ORQC 2GC1A 3K3NA 2QZ3A 4Q4W1 1WD4A 2JENA 2XAFA 1DZTA 3JARA 2XASA 2XWBB 3Q8BA 1ZA7A 3SITA 4P9WA 1LUWA 4FP2A 1NZCA 1ZTEA 3VHPA 4LA3A 1ODNA 1POQA 2B1GA 5LA1A 5IJ0A 5CA3A 3AP4A 1H8TB 1NE4A 5FZEA 4DRVA 2IBZH 4ZIBA 2DCYA 1YO8A 3T4DA 4P08A 2XWJB 1GQGA 5LP6A 1ND2C 3LOIA 2Z4FA 5FNVB 2VVFA 2Q73A 1W2AX 4BU2A 4DYLA 5GALA 3MF6A 1ZL8B 3E1F1 1UL9A 1J1TA 2VOWA 5BZBA 2G1MA 4LPLA 4LFBO 4X65B 1TVKA 3ZPOA 1OA2A 1XNTA 4W4LA 2WLKA 5FYVA 3RJRA 3K9AA 2Y4TA 1L7LA 5FR3A 4B3TB 1KJLA 4JI2B 1W8WA 3S3XA 2VXJA 3IBMA 4ICGA 2Y69B 5FP3A 1N4CA 2BSKB 4A2UA 2E9QA 4XW3A 1JZ4A 1S4CA 2EICA 3INAA 1N3PA 3OW2U 1NR7A 4FPPA 5J96B 4FFBA 4RYDA 2P37A 1DK1A 4YIOA 3HKDA 1SQFA 2WAAA 3O1UA 1P7GA 4M3CA 4BA6A 2XOMA 4RR3C 2FKXA 5CN0A 4LO6B 2ZXWB 1G9AA 4D69A 4FPYA 4CU7A 2WT1A 3OGVA 4KH9A 2RMU2 3B9IA 1Q6HA 5IK7A 2YDEA 5C8CA 2LP7A 2GTAA 2RJZA 1JU3A 3HQRA 1YZBA 4LJHA 3SJCC 1OURA 3THTA 3KT1A 3IB3A 4COZA 1G8WA 4CH5A 4PBOA 4YW5A 3T0AA 4EZHA 1XRUA 5GJ6A 1X50A 4IIJA 4DUZO 3LE0A 1RGSA 1LB2A 5FKBA 2WN2A 3RVYA 4CDUC 3VQXA 4AGGA 1NKGA 2HJDA 1WCQA 2VL4A 4K8RB 3OJBA 3T08A 3JSLA 2EAKA 4CDXB 4NWWA 4MX3A 4K9SA 5CYYA 2V7QG 3K08A 3ZVXA 2WRAA 4LWSA 3AKRA 4P9XA 1UQXA 3VGIA 4JI0O 3SYCA 2QTWB 4RQEA 1RUD1 4A3XA 2YB7A 4YVWB 3EQEA 2QQWA 1GMMA 1NT2B 2JDIG 2F17A 1GNYA 4AVAA 1T5EA 2E6VA 4YFWA 4UCVA 1SQPH 5IE9A 1H8HG 1SZTA 1W03A 2JDHA 3NV1A 1Z5WA 1ASJ2 3ZYGA 4DMIA 2Y33A 5FZ6A 3F7YC 2ARBA 2ETNA 3E5QA 4AILC 1CN1A 5EYYA 3LOBA 3N27A 4H33A 2SLIA 3OD0A 5FYSA 2GMMA 4QX3A 4QDSA 3J8F2 1BMV2 3Q8CA 4LKFA 2HYXA 3UKTA 5FXWA 3A0HZ 1TNRA 2UWBA 5GLWA 3KZ4C 4JTNA 1Q7YW 5DPNA 3VN4A 1SQGA 1WLTA 5ACA2 4DR4O 1BS3A 5DEDA 1JZ3A 1RHI3 3VHNA 1XYPA 2WWWA 3FB5C 3FN9A 2ERFA 5JI9A 4GIQA 5KXBA 4HAMA 3LSEA 5IK5A 4BR6A 3BKZA 1WP8A 3CC4V 4HFSA 4KGGA 5E1RA 4Y1ZA 4FLVA 1ZX5A 4BK4A 4LH7A 3WP6A 4IEYA 2IJKA 1PNMA 5K1PA 2FCVA 2HWD2 5FP8A 4FPCA 4CEYC 1PO12 3WZ1A 3CO2A 3NSTA 1ALYA 2X0LA 4ZU7A 4I9QA 1XB9A 3VD7A 4UFMA 4O4LA 5FBZA 5EZYA 2YFZA 4O4JB 4ASLA 1U12A 4QD2A 3LNNA 5B1BC 4LHNA 3ICXA 4OPAA 4JTOA 1YJKA 2MEV1 3M7AA 1N1SA 3VDDA 2IXCA 5DUXA 3ZN0A 2QDNA 2J1AA 1R1A3 1ENXA 1HRI2 4J1XA 2ZEYA 3OPWA 4WM7A 3AFKA 3SH3A 4DXZA 5LA0A 5CKQA 1UY2A 3C7EA 4UF0B 1UYXA 5GTIZ 2O1QA 3AZZA 2OZ6A 4LF5B 5IHRA 1PGL1 1AL23 1K97A 3DTUB 4FFKA 3BFRA 1O8SA 2XJVA 1TVGA 4OZXA 2JX9A 3B69A 3N4MA 1KD7A 4OQ9A 1HX6A 5F6KA 3AZWA 2EINC 4DO2A 2ZHNA 2OQ7A 4LBMA 4OI2A 3CQOA 1W9WA 5FZHA 4OHWA 4LKSA 4HT1T 4GKYA 4XACA 1VBA1 5LBCA 3PJSK 4LFCO 3DXRB 2ZTNA 5FXZA 3QVNA 2RS13 4XHBA 2DUQA 5IWAB 1H6YA 2VR4A 1YHQV 1Y9QA 4PA7A 4WM8B 3MFCA 1FXKB 3SKJE 3U1XA 1ACCA 4WFAV 5IVJA 2ZHKA 2UY9A 5F39A 3WXPA 3NNFA 4NOTA 1OCOB 3ZRWB 2HWC2 2WSVA 4FOYA 1QWRA 3ZYIB 2VTXJ 4IL6Z 1AP5A 4CCOA 3PUQA 3K0DA 5E88A 1SS3A 3RGBA 4WFFA 5GONB 5JZGB 3B00A 3GWKC 4YXWG 4Q26A 3KSCA 1NAEA 2RR12 3STZC 3E6DA 1DZRA 1XHZA 1JJOA 4G2KA 2XBO2 2UU9O 3CZUA 4HPKB 4I5SA 1OCZB 3T1YO 2AC1A 4CH3A 3OTOB 2OKXA 2XMLA 1COWG 2J1UA 1JYCA 4Y1VA 2RS53 3HWJA 1YHFA 5FPZA 1W06A 4A42A 5C8WA 4OGQB 1Z2GA 1W2UA 4R7CA 2IJHA 4SBVA 4BQWA 4FT8A 2IZWA 5FZ4A 2JB4A 4XQ4A 5FZBA 5F6LB 2RDNA 2QTOA 2IJJA 1WLWA 3O1MA 3AMQA 1W0OA 2EF6A 1F4HA 5LMNB 3V0BA 3H1KH 2R9AA 3ZN6A 4Q2FA 4UBHA 4FM0A 3OCPA 1OF4A 1YJLA 1XBLA 2MK3A 4MTFA 1IDSA 3H3LA 1YI9A 4X62B 3PMSA 1L1FA 4AHCA 4FAHA 2C9AA 3E97A 2HWF2 2OUJA 3G4SV 3KGZA 5C4WB 5C9AC 4MGSA 4OMCA 1ST8A 4EWEA 3VBFB 3AG4C 2QWPB 3HQXA 1UKGA 3G67A 2CDOA 4L97A 1HN0A 4TTGA 2R0FA 3M4FA 4MV2A 4MGZE 3U78A 4MTGA 2R071 3EXUA 5JUVA 4X20B 3KCXA 1JMKC 5EIYB 1JYWA 2RDCA 3H9VA 1M56B 1I6XA 2DDUA 3K4DA 3NWKA 2EBOA 3ACFA 4LTAA 4BW9A 3RYPA 2YUAA 3I5DA 1UOFA 4XQWA 3HKBA 2BWAA 4N43B 1MQTA 1ROPA 4OHVA 3AP5A 5TSWA 1RUF3 2WNUA 4CRQA 2LQTA 4EB6A 4JV5O 4DFSA 2GC3A 4XAEA 2ODMA 4MVQA 5IYBO 4DW0A 2JD9A 4I4TA 1PM9A 1H0BA 4Q6GA 4CZZA 1OH3A 2Q30A 3CXCU 4M4RA 4CVUA 5T50A 4JI6O 1ZRFA 1FXVA 2B9ZA 3JAWA 2ZGPA 2DYSC 3V64A 2WKKA 1WCUA 3K0GA 2WPDG 3I2DA 1UIKA 2A1XA 4P2ZA 1CEZA 3AMNA 1OA3A 1QCEA 4Y1XA 4P14A 4XUOA 1N33O 1IVSA 3FLRA 3SHRA 4J11A 1AR93 1AR82 1PVC1 2K0GA 4AHXA 2EILC 3ABZA 4S2HA 2WZR1 2XOKG 2YG0A 4NROA 2NMOA 4N9IA 4YGCA 2JGDA 2DWRA 3MI8A 3N9OA 4TWTA 1DQ0A 5JOWA 2DTYA 5DUWA 1TZOA 2ZM6O 4LHSA 3WF2A 1SBEA 3ZOIA 1QOTA 3GHNA 4Z2WA 1JYVA 3SPCA 5JQGA 4JYYA 1X8EA 4J1WA 3GZTB 4YHHO 1HN1A 2ZNJA 1XBFA 4G4FA 4OLLA 2GUZA 2GC2A 2E53A 1CJDA 1QJFA 4RS5C 4UFHA 2WR9A 4AWDA 1SETA 3UT5B 3NR7A 3UM7A 3WNMA 3JCUZ 1N32O 5LK5A 2LROA 1VARA 1PKXA 3NKTA 5K9YA 3HN3A 5F37A 4MXVA 2V1DA 1H9WA 1M1KW 4P9LA 1J5EO 3POYA 4UW4A 1Z7S1 3ETGA 1E1QG 3ETPA 1KECA 2Q4PA 3RBZA 3J7HA 4NN0A 1PX4A 4N21A 4CYDA 4D7TA 3PVNA 2EXIA 3ZKUA 4ES8A 3H01A 4TWKA 2AREA 2ZGRA 4DR3B 1VAMA 2DE0X 5IYZA 3CC7V 2IW5A 3AVSA 5FWJA 3OYWA 4IE7A 3ZMNA 3QH6A 2VZOA 3MLLA 5LY1A 4LF7B 4XUTA 4RR3B 1IXBA 1NA1B 3F2ZA 1ZZ7A 4QXHA 5KHHA 1HWYA 4GA9A 4XC9A 1PIV1 2XJTA 4MW8A 1KITA 2A7WA 1H6XA 3CHXA 2W94A 1H1MA 2OUHA 2PZSA 2XHKA 1S5JA 3IZOA 4XJAA 3HAGA 3OR6C 1YJWV 1ULOA 3J80N 2JXAA 3THPA 1NBMG 3D3QA 4ES9A 2HEPA 4GX1A 2IXKA 1XNDA 4UT5A 3APBA 5J2TB 2VNVA 1F4AA 2GU9A 5T5LA 1DYKA 4QU1A 2VZSA 2R1BA 3I8TA 4PHZA 3T2QA 2F93B 5IT9N 5LWBA 3W20A 4NB5A 3OGJA 1N36B 3BGAA 3IC7A 3UKMA 2UXXA 2Q1ZB 4CE8A 1CESA 2FB5A 1WW6A 1BGYH 1SHWB 4HVQA 1D4M2 3ZCCA 5KHIA 3USUB 4OFGA 4W8JA 2PHRA 4OHYA 1HNXB 2Q0OC 2DVFA 1ZRIA 1RUE1 2QWRB 3ZSMA 4PBPA 3POFA 1XNRO 3CJIB 1EUTA 1B6QA 3MIFA 1LTEA 3BI3A 2HR3A 3CE2A 5FLJA 4DV3O 2VZPA 2VXRA 5BYNA 4B4QA 1Y76B 3NJYA 1QR8A 1NCQA 1WCSA 3ZHUA 3VBUA 5JCTA 5B66Z 2RMU3 4WF9V 1IHMA 4OMDA 4K3UA 4XJZA 1XILA 2LS6A 2JG9A 5FMOL 3BOWA 1URFA 2PLV1 1E5RA 2D43A 5HCFA 4QB1A 4X1YA 5L3EA 4BOWA 1HNWB 3MPPG 4FTEA 4CEWA 3OTFA 4F6RB 2BYVE 5B1NA 5A70A 1A32A 5LA6B 3BIEA 3HJRA 5IVVA 1R082 2OW4A 1B35C 5CA6A 5CA0A 3ZBHA 1GN6A 1OJHA 5F5QA 5AVPA 2YBPA 4AQ6A 3HKCA 3IDBB 5DG1A 1Q43A 1G86A 5GZFA 2WFF1 4MSVA 2HWB3 5L9RA 4PDLA 4O4HB 4QKNA 3VDAA 4P9OA 5JPMB 4CEYB 3VBSC 3D36A 1W3XA 1SDDB 1ZM1A 2WNVA 1BCCH 3ETDA 3PU8A 1YTFD 4QX1A 4E27A 3VKFC 5D5PA 1YXBA 5B1BB 1GZCA 3BTAA 2VW0A 5LASA 1YFYA 1VQMV 1JMUB 2PHWA 1R3LC 1HB4A 1OA4A 4ZS3A 1K5MA 1JZ2A 1BK0A 5CFDC 5CU1A 1SLLA 3E8GA 3MUY1 1HIXA 4Z82A 1C28A 2AEYA 3OGIB 1R093 5JI7A 1V0AA 5DECA 1RUG2 4ZHNA 1OFNA 1O6UA 4RQPC 1FFTB 3ACHA 1HJFA 4EFEA 4A4AA 3WDTA 1XQNA 2P3KA 1N34O 1CIYA 3K2OA 4HMZA 3M3OA 3I56V 3NAPB 1VBC1 1TGOA 3RYCB 4EROA 1DQ2A 4IQPA 2W39A 1QJU3 4FVVA 3NJVA 4X64O 1ULFA 1PK6B 4RHV1 4B3NA 1G6UA 3RYHB 1BJQA 3TJTA 4QX8A 4MXWB 2HWD3 2UURA 4NHLA 4MW3A 3PIJA 1VQ8V 5FZGA 5K7PA 4L2NA 3VHOA 4IV3C 4WFEA 1W8NA 2D7FA 3T4VA 1AXKA 5G05L 4GKJB 3Q9OA 3WG7B 3ILNA 4HKOA 3OY8A 5HCBA 4JI7O 5FY4A 1DLBA 1HV1A 4AZZA 5LA9A 4GMP0 3SPJA 3VBRC 5DN6G 1Q8OA 3RPQA 1HRI3 1ENVA 2CYFA 4GKXA 1VQOV 2XH6A 2ZINA 5CKMA 1YSCA 1B3QA 2H0VA 4A3ZA 1UZ0A 3BU7A 5A7QA 5LEKA 1RMU1 1GOGA 4LR4A 3QF7A 4XTPA 5IY5C 4I50A 2R062 3WU2Z 4DV7B 3M3IA 2XONA 1QQP3 2PQQA 1OVSA 4FFFA 4CS2A 1W2NA 5D8AC 4QPGB 3S5QA 4CCDA 1CAXA 1GYKA 4UV8A 3TOJA 1SERA 4BWOA 5EXOA 3ZYHA 3ZM8A 3FX7A 2W08A 4CH4A 2JICA 4TV9B 2IFRA 3ALQA 3WDWA 1B06A 1S2KA 3ABTA 1A78A 2HVJC 3L70H 1DQ4A 3BEHA 2VS0A 2E5LB 2HWC3 4A7ZA 3AMHA 3LEMA 3RRDA 1IBLB 4CXXA 4QQ2A 3CRAA 4NXMO 1BQ0A 4DV4O 1N1VA 2UXDO 3O1OA 2RR13 2Y4UA 5CMUA 2BOJA 4DK1A 3ZN1A 3C90A 4PLNA 2VMDA 1S0VA 3W7UA 2PF4E 4GX0A 2YZ4A 2YICA 2GH8A 4AYUA 3IT8A 4TUYB 3AKTA 4YW2A 4NE9A 2P3JA 2DWEC 2WL1A 3FB8C 2FMDA 5F5IA 4DXSA 2VY0A 2UUCO 1WA6X 1EBOA 3ZSLA 4CPBA 1YIJV 1TME2 4B3MO 2C1FA 5B1AC 2QNKA 5T3NA 3RYKA 2BNNA 3VV1A 2GNBA 3USSA 1ZBE2 4LF6O 3LDEA 1QBZA 4DRXA 5L7OC 2HLDG 3A23A 4BISA 3M3CA 4EWDA 1OMIA 2UXBB 4Y33A 5DM6V 1QJX2 4JGZB 1ENRA 3E2EA 2J1TA 3S7IA 3UESA 5KAIZ 4E8DA 4HG6B 5BPXA 5A6ZA 2W1WA 3CX5F 4XJWA 4MGQA 1QOOA 1UZWA 4JTCB 2WLLA 2H0BA 1VBB1 1VPHA 5DAXA 4LFBB 2JEXA 2YIBD 2J1VA 4ATEA 4QKDA 5JXHA 5BNPB 1CONA 5HFLA 1GZWB 1ZX3A 5CG8A 3BODA 4ZXEA 1U5YA 3BTXA 2QM7A 1FOD2 2V5YA 2NN4A 2AACA 1W39A 3RVHA 5FY5A 3LCPA 2CAVA 1VMGA 3DPRA 5KUKA 2KSDA 1I9RA 1ZZ6A 2EXJA 3E6BA 3CDZB 3TNPB 1PGW1 3JD71 4PDWC 1LU2A 4WV8A 4V2WA 3KMHA 4EN0A 1WLEA 3OB8A 3JQXA 4AW7A 3O0WA 1XE7A 5HCAA 4XUQA 3ST7A 4JQTA 2HFEC 5L3GA 2GMEA 3NXSA 1HB2A 1TMF2 1QJY1 2UY8A 4FPFA 2OCHA 3THDA 5BNOC 1EY2A 1LODA 4UUJC 2ZAAA 1G9DA 2QQVA 3OBAA 2EALA 5FYZA 1AVBA 4DZGA 1PPJH 4WBNB 4ARYA 5L3BA 2X5IC 3WW4A 2UXCB 3CJHB 1EAH2 4CDWC 2R9RB 3EHKA 3O1TA 2XHBA 3E8HA 1E1RG 1AR1B 3X29B 4DUZB 4ATFA 3TYJA 3CF6E 2BTQB 3UO3A 1PO22 5A3NA 2WO1A 4HKWA 4UVCA 5BNNA 1RM1C 1E79G 1BEV1 2EULA 5EC2C 3FYEB 1KBHA 2XLGA 1DYOA 1NJIW 3MO4A 1WW5A 3BVOA 2V4VA 5IWFA 4AQ2A 4HOOA 2OIIA 4Q4V1 5IJ9B 2RM23 5A7OA 4LHKA 4L92A 2DURA 3R4SA 4JI0B 3PTYA 4BQ5A 3QOPA 3IAPA 2E75B 4Q4Y3 1BCXA 3FBMA 1VBD3 4XUPA 4OYUA 3ZFGC 2H6CA 3CCLV 3UO2A 2Q4SA 1AYM1 5EYPA 4BW5A 3C3VA 1LR1A 5KHGA 3N9MA 1IG0A 2ARHA 3UJQA 4B3SB 3WP3A 3WHUA 4UOJA 4ONUA 3OGSA 1P4RA 1FPN1 5FZ9A 1FKAO 2PYTA 1RUOA 4NRPA 2Y64A 1EV11 4X1IB 4BQYA 2R16A 4S2FA 4LBQB 2WQ8A 1RUI2 3N9NA 3GZEA 3K51A 4W6XA 3IAYA 3L75H 4DIQA 1LHWA 4JGYA 4XCAA 5DAVA 2FZ2A 1Q6UA 4X66O 4DEVA 2Q8DA 4XBFA 4R4ZA 5DUUA 1BVP1 1NQJA 1JR9A 1WMDA 3W5MA 4C8DA 2CTQA 3K3WA 4O4IB 3KHCA 1ZRCA 1C8M1 1OF3A 2J1RA 1A34A 1OV9A 5FLXN 1HQLA 4JX0A 3WR0A 5I0DA 3WINE 1S5LZ 4IEXA 2VZTA 3FB7C 3Q8AA 3WHTA 1QLNA 2D40A 3PVBB 5FO9B 5A9GA 5I8YA 1GICA 1KQSU 4M01A 5DG2A 1NS1A 5CBGA 1SESA 2B9VA 1NT0A 1IOAA 3TRSB 2C0ZA 4K6BA 5FOJB 5K0UA 1YDXA 4XFBA 3MW2A 1E5IA 1V54C 2DUOA 1NY72 3T4HB 4ITCA 3DYMA 1S0JA 4AVTA 1V6MA 1MS1A 1B35B 3ACIA 4LUMA 2A6ZA 5F5CA 3W7TA 4CBCA 2RJLA 2NQYA 2R49A 1X9TA 3ZR6A 1IBMO 2DYRB 5LOVB 4QGLA 3N35A 5LHGA 1RXFA 1D4M3 2Z0AA 3AJYA 1OOPC 3E8FA 1KXGA 4D6RA 5LW9A 1LOFA 5H9RA 3VBSB 2DVDA 3LAGA 2W0FC 4IEQA 4XILA 2RN9A 3AEIA 2CAUA 2PI5A 1ODMA 4NTYA 5FY0A 4O2AB 1HB1A 1IPJA 1XNKA 4YW1A 1ZZCA 3M1HA 1V55B 1YUDA 2J42A 3ZRSA 4IERA 1ZZBA 2KG7B 3LA3A 2FDKA 1GM9A 4LFCB 3HPLC 2VMFA 1C1FA 4EV0A 1QQCA 1MSDA 2JG8B 4RQFA 2JWPA 5AG2A 2R30A 2GDFA 2XAHA 4JC1A 1GN2A 1AR5A 2EAAA 1SZBA 1GWKA 2O57A 3J7AU 1FATA 3ENRA 3ROUA 3SLIA 4DPNA 1ZAUA 1QF3A 1R083 3GB7C 4BQ2A 5JXJA 1GWMA 1UZYA 2QDOA 2ATFA 3VBHB 4ZOLB 3ZSJA 1W3VA 3MDPA 3AG7A 4QHOA 5EBLC 5D2AA 4XFCA 5KXCA 4AVSA 3JZVA 1PX3A 1SQ4A 1J3RA 4YG3A 2PQSA 1ZBA1 5F3EA 1M4UA 3ZXAC 3W7SA 3JAKA 3VQVA 1OI6A 2W3JA 4XQDA 1LNQA 3UL2A 3Q8FA 1NCRC 2EXKA 3FHQA 4Q0UA 1K33A 2WO3A 3H1YA 1JBCA 1VF6A 4ZI7A 4L0PA 2UWCA 5CKNA 5C5TA 2E63A 2PELA 4FLTA 4QQOA 1RUJ2 2Z42A 3IDCB 1CAWA 5LYJB 4JQRA 3ZXJA 1AVMA 1W2TA 5A7WA 1IBKO 1UCXA 1R6TA 3BALA 4O2BA 4UXNA 1LOAA 1W0JG 4N8MA 5BY1A 4TQFA 1HR0O 5CFCC 3KF3A 3TXQA 4NIIA 1S0DA 3IJ4A 4QXKA 1MPXA 1X36A 5F9TA 3W7XA 1MEC1 1D7PM 3O0VA 3VZLA 1WGPA 3WOGA 2Q8EA 5T52A 1QU7A 3JCIA 3ZSKA 1C1LA 3KV5A 3KQ4B 5A1AA 3DECA 4UVBA 5KX5B 3CZJA 4IEPA 5DZEA 1UY1A 4FOQA 3OFNG 2GMPA 3T0DA 4YJ3A 5JMCA 1O3SA 1YQCA 3POJA 2JIJA 1G4YB 4GWNA 5TISZ 2VPVA 2VTFA 4UFKA 1WA4A 1N8RW 2ARAA 5JCOA 3JATB 1ND2A 1CQ9A 3ZKYA 2QUOA 3ZPYA 4MLOA 4QPIC 4OHXA 2IWGB 5H5NA 1S0CA 4LA2A 2VNOA 2GSYA 1CXZB 4YZ5A 4CU9A 5FP9A 3FC0A 5FPAA 1V6KA 4WFHA 3NW4A 3KV9A 1FJGO 2BNMA 3VKNA 2XVKA 3D0JA 1AP6A 4CCLA 4C91A 4J7KA 4AXOA 3HKEA 4Q4X3 4Y3OA 4IUGA 2PYLA 2Y6LA 1LU1A 5GTHZ 1DQ5A 2NYYA 4H2AA 4Z92B 5FZ1A 5JVVA 4JI6B 1F23A 1UU4A 4DR2O 4JV4A 3RMYA 2A71A 3SYOA 1DGLA 2P4KA 2VQEO 2XR4A 3HT1A 4UW6A 1N33B 5AFEA 3OMNB 2R063 3ZYJB 1AR72 2D5HA 4LUKA 4KHPB 3LB9A 4HYOA 2Q69A 4BE3A 4CS3A 2ZM6B 5FP7A 1ND3B 2SBAA 1P84F 4OZOA 2M6YA 4CDQC 2XPJA 2WN3A 3I4IA 1KFUL 4AL9A 4YLZA 3BIWE 5I0TA 4LHLA 2VUCA 2YFUA 2Q7EA 2BDRA 1LENA 4AI8A 4N53A 1AX0A 5E16A 1VAKA 3A0RA 4U3JB 4IEOA 4LF8O 1YQ6A 1K5SA 4GB33 1VBE2 2XLAA 3V0AB 2F43G 4IHJB 4QNHB 4PF1A 2RS33 4CDUA 4DR1O 4FLYA 4ORFA 2PN5A 3AP7A 3ATGA 2DCJA 4IV1C 4E2LA 1Y6XA 4MTOA 2KQXA 3H1WA 5A3UA 1H1IA 3B09A 5A7PA 1BZKA 4ISRA 1BBT2 2W95A 1R3IC 5CBHA 3AJZA 2JEMA 3O9OA 4MVZA 4URTA 4JI8O 4Y24A 2I74A 4B4PA 3TB0A 4QE7A 2ET1A 4E4SA 1UY4A 3DCQA 2OA2A 2VMHA 3HR9A 4UFLA 2FZ1A 2WQ4A 2CH7A 4RFRB 3VQWA 5JVDA 5A33A 5B4XA 1M4WA 1I5ZA 3URFA 1TME3 4LF9B 1UFIA 3V65A 4J10A 1LGBA 4GWMA 3JYCA 3SJBC 3TN93 4XF1A 2Q0AA 3HVDA 2ZPXA 5J7MA 1GRJA 5ABJB 3N7MA 1TNFA 1LHOA 4QQLA 5LY2A 1W6OB 5I0UA 4I0AA 3GCWA 4U2AA 3I3BA 3H42B 5ITZB 3LKJA 1AYN1 3WCRA 2P34A 4DUXA 4CCKA 3S6PA 4CUGA 4BWAA 4YGDA 1H8TC 4CUAA 2RMKB 2R0HA 3P1IA 2QWOB 4LBEC 4XDJA 1NU1H 4FPJA 4RL7A 4V1PA 1DBNA 3IC9A 4Y5Z0 3GVMA 5HCHA 3K5LA 2ZA9A 1O4TA 2E7QA 4JI1B 1FXZA 1UPSA 5C8CC 1JS9A 3NQHA 4LO7A 3NL1A 1ULDA 3FZ3A 1I1EA 5F8PA 5LMUO 3I59B 1O9HA 2Z2SB 3ELNA 1J3PA 5FYYA 5DDJ2 5AC93 5DAWA 3PURA 4UAPA 1UMIA 1XNRB 2ZQMA 4E2SA 2BV4A 4IYIA 4TYSA 4BQXA 2DOSA 1XEQA 2Y69C 5GKAC 4DV3B 4QX5A 3L2YA 1KS4A 4R9AA 4LP8A 3R05A 4BZ4A 1Q5OA 2DVAA 2R041 1MZFA 2YC2A 2RHPA 4Y1YA 3RDIA 1BYHA 3ZSEA 4QX7A 2AUYA 2J22A 4GMP1 4Q4W3 2PAEA 1Y9GA 3NRUA 1I94O 2CTPA 2F95B 4JI4O 1ZRDA 1ZLZA 3THOA 3X2QB 2BOBC 3IDEA 1EAH3 1W9SA 1I3HA 5I93A 2ZXWC 4FFGA 2IJIA 1UPIA 4KFMA 3SYAA 1OPMA 1VMFA 5IK4A 5H2FZ 4ZPIA 2XVLA 5KR7A 2QVSB 3KLSA 5KMGA 2VNGA 4QGPA 1REEA 1UWWA 1W9FA 2TBVA 4M0HA 2VZUA 4EWAA 1W6MB 5A6QA 2BTVC 3N2GB 5IUQA 2ATKC 3JALA 1WBLA 2A6YA 2PFWA 1X33A 4GH4B 4KBBA 4OXSA 1S0FA 1NLRA 1RHI2 3VKLA 1JZ5A 1COV1 4XMAA 1W99A 3LD8A 4I2OA 2ZGQA 3AG3B 2OTJV 2L35A 4K1ZA 2D2CB 2YSUB 3VBBA 3I49A 3GXUA 4JRLA 5L3FA 5D21A 3VKMA 2GTSA 4UWDA 4CDXC 1VMHA 1GN3A 2ZD9A 1EPZA 1YC61 2YBSA 5B1OA 2HJIA 3ASOB 1AI5A 2H3OA 1DHKB 1OOPB 4A6SA 2QQNA 1CPNA 4ZHQA 2WABA 4ARXA 2ZGMA 2W92A 3LDBA 2X8KA 3NVCA 3RYIA 1AR61 2A9HA 1W8TA 1YIFA 1CP9A 1X82A 1RUI3 3PUAA 5JJJB 4GWIA 5FPOA 2DCTA 1JODA 4DXRA 3UK9A 2QM4A 1YJ9V 1MR5A 4SLIA 4FBFA 3ETQA 3MPBA 4MGIE 1ZRRA 4H14A 1R1A2 2XUMA 2EIMB 4LKEA 5H9PA 2VECA 2RJKA 3C2UA 1NTKH 1U5ZA 2QE7G 3EO6A 1Z0HA 3HIFA 3OSDA 4B8EA 3VBOB 1OLRA 5H9CA 2IFWA 3N2KA 2WLIA 3LFIA 3BA8A 2IXJA 4TV8B 2ZGSA 1ZSPA 4I7ZB 1QJZA 1RUH1 5KA5A 1K4CC 4X64B 4L9BA 2E32A 4WM7C 1CWPA 3TBDA 3E22A 4NRMA 1Q8PA 2WNEA 4O65A 3K75B 4P00B 2F4PA 5C9AA 2RS12 2FL4A 1FFXA 1QXPA 2YPJA 1FNYA 5EBWC 3CYOA 2CU5A 4DV2O 2KR2A 3UV9A 2A73B 4YM3A 4P9GA 2BJSA 2ENRA 2OPKA 1MABG 2WFF2 5BR8O 2XKPA 3WD5A 1R1BA 1K7DA 2XJUA 3R4UA 4FVMA 4Q29A 3EB7A 2QQKA 4LFAB 4DR7O 3ZFEB 2ARXA 1XUQA 2X6AA 1RUD3 1M9NA 4XBNA 2RE9A 1U97A 4R9BA 4WFBV 5J36A 4RUEA 5J2UB 5HV4A 4FFIA 4AVBA 3SYQA 3CS5A 5EV7A 5A3LA 4X1KB 1S0GA 2RS52 1APNA 1C8NA 3OMIB 3VLBB 1EZVH 2Q1FA 5J48A 2BFUL 2V5DA 3FAVA 4GYCB 4EYUA 2CAZC 2UUBO 5EFUA 1WA8B 4XF4A 3RVZA 2R32A 4BLJA 2VW2A 4HXCA 2P17A 5KUMA 3U75A 3E8BA 4YVSB 2XJRA 3H9AA 1M06G 3UGGA 5I0RA 4GWJA 5CB4A 3Q4HB 4QJFB 1GM8A 4OHZA 3GGLA 2DCKA 2Q67A 3AFGA 3RZJA 5J9PC 2D93A 1RJ8A 5FMOS 1DFQA 1O8PA 4DV4B 4DUYO 4WM8C 5L73A 1FXKC 1KQRA 5K4LA 1ULGA 3WW1A 1C4RA 5EK0A 4AEJA 4UFZA 1OCOC 1PNFA 2RMU1 3CBNA 3ZHRA 1GNHA 4XDKA 4LXLA 5EP9A 3DXUA 1MS9A 5LBBA 4AEDB 5JZGC 4RS5A 3CEIA 3I3EA 2ZR3A 1PZ7A 1RSOB 2EIJB 2ZABA 3SC7X 3JAMN 1ZUQA 4R50A 4LITA 2QWNB 4O7XA 5C7GA 2KXLA 1K34A 2HHHB 2BGOA 3T2OA 3BA9A 4B3MB 1JZ8A 3KM5A 4B7KA 2GP3A 1AJKA 1CD3G 1VE0A 1H1AA 2MEV3 3O14A 3M8LA 1WW7A 3A22A 2IU0A 4X8NA 4K35A 1H8VA 1W6NA 2ORXA 4JAAA 4XFFA 2P6JA 1Y4WA 2LW8A 4DV0O 2WWSA 4JI5O 1YVWA 1MQTC 4YM0A 4X6QB 1M57B 2B9UA 2VZ3A 2F4LA 4P9IA 1JTZX 2EZPA 3RYRA 1AJQA 2ZGKA 4QMAA 4X65O 2AYHA 1BHAA 5C33A 2GSMB 3JASA 4DINB 5LEJA 1Y74A 2Q5TA 3BPZA 4B3TO 1VBA3 3B94A 4JI2O 1ASJ1 5JIUA 4NWVA 1D4VB 3CCUV 4LNUB 5C4WC 2YGLA 3WNKA 5JH7A 1XI1A 3PVOA 2YIAA 1VLNA 3JARB 4PIYA 1E5SA 4Y26A 3FMGA 3J8F1 1BMV1 4IW3A 4FPGA 3KCCA 1GUIA 4MVMA 2FMYA 3MV11 2X6BA 1XNBA 4HNAA 1M56C 5IJ0B 3CXHF 3FHIB 5ACA1 3A0NA 5M0TA 4KWKA 1SLTA 4AK3A 2YMZA 1OZ0A 3P5BA 1FAYA 2NM1A 3LDCA 1QU0A 4N43C 2R72A 3K4ZA 3H50A 1OFSA 1DTOA 5LP6B 4O9GA 1Z78A 4JZ2A 4KU7A 4QIWF 1JOBA 2C4XA 5BMVA 1GN4A 4QPWA 1SA0A 5FY8A 1OCRB 4MOAA 4AEMA 1MS3A 1Y9MA 2HWD1 3DKWA 1DLLA 3BOPA 4M0NA 1PO11 1BK1A 1TVKB 5F2SA 5B3SB 2ZJCA 1AR73 1JH5A 3PL0A 1O59A 4R6ZA 2QEXV 3MAQA 3ABMB 2UYAA 5FZMA 4LO4B 5B5EZ 1YQ8A 2JDZA 2A3XA 4DUWA 4IEVA 1RJ7A 1GK9A 3AKPA 3DN7A 3RWNA 1WMEA 2ZDIC 3KS7A 2Q5ZA 1Q6IA 3O1SA 1WN7A 3AKQA 5FYBA 3FKSG 1WB7A 2C6SA 4FFBB 4P9PA 1OLMA 4AQYB 5IATA 1HRI1 2ZS6B 1MSWD 3HKDB 5GW7A 1VQPV 1JPXA 4M3CB 1GV9A 3AZVA 4P5YA 4AI2A 3SH5A 2EJ7A 2YXYA 2A0LA 4CS4A 5KWRA 3I2OA 3P3PA 2R073 3RSJA 1VBE3 1LECA 3CU7A 2M7WA 3TEYA 4IE4A 4KG0A 1KYOF 2WA3A 5C8CB 1XHXA 4OVEA 2XQXA 5A32A 2B46X 1RPRA 1STMA 4DQAA 3N9LA 4IEZA 4Y4YA 2VRZA 3OT7A 2Y6GA 4CP1A 1JI6A 3APOA 4I3GA 1JXNA 3VZOA 1BBT3 1EN5A 5FY7A 1ZVFA 4IIJB 4YIPA 3JD72 4BIZA 1CR7A 1LJ7A 3LDKA 3MW4A 4YARA 5FYTA 5AFBA 2VMIA 1XMQB 2HWC1 3R4DB 3K9SA 4FQZA 3EMRA 4IXLA 2IVJA 2WZ8A 4Z1VA 1S1AA 1SPPA 3ASNB 3ITQA 2RR11 4FIPC 1OVPA 2XBO1 3K77A 4UFJA 2JECA 2W47A 2RV9A 4LWSB 5CFDA 3UETA 1NA1C 4RGKA 1FAFA 2LUWA 1UXXX 1CAVA 4ZXKA 3VDBA 4QPJA 1ULPA 1RFYA 2ZKLA 2ITDC 1PVC3 4YM1A 1PL4A 1SKVA 4AVVA 2WZR3 3T30A 1HJGA 2F4VB 2WAOA 1FXHA 3OEAA 2XJSA 1NQTA 4RQPA 3MIEA 2VG9A 1D2SA 2EIGA 1V9PA 2R7EB 4QU2A 2NLRA 5KBFA 2ZGNA 1AZDA 1JYNA 1Q8VA 3PTRB 1MNGA 1PM4A 3U11A 3ZHVA 5DDJ3 4LLOA 1DF0A 4PQ9A 4NIHA 4BJ0A 4LF5O 2HWF1 2QR4A 1LEDA 4UCUA 4BXFA 3M70A 1F51A 5HV0A 4XIKA 1U0AA 3KVAA 2A3QA 4WVVA 3ZXEA 3AB0A 3CC2V 3WDUA 2HWB2 1AYM2 4DY5A 4IV3A 2FDJA 4NMIA 1KP3A 3NJXA 5DZGA 1D2DA 5EWSA 1VQKV 4IDZA 1Z7S3 3R0RA 1NH2B 1W05A 5CA1A 4PELA 3CJIC 3PJQA 2JE9A 5IWAO 3PU3A 3VBRA 2JDKA 4XVHA 3RYFA 4N23A 4EEQA 4KQ7A 4TLGA 4XETA 2VQFO 1L3JA 3B02A 1A8DA 2WNVC 2ZNIA 1N1YA 4O4LB 4XFHA 5EZYB 4FPEA 2EIBA 1PIV3 2KM2A 3ZDSA 1FNZA 5CZKA 2V72A 4MHUA 2BNOA 3AL5A 3WX5A 5D8AA 3MHZA 3WSOA 1MZ6A 4BCUA 2BEOA 1R3JC 2ZE7A 3VDDB 1GSLA 4Q8KA 4B3RO 1R092 2HLEA 2JE8A 2XL9A 1GTOA 4YWAA 1XYNA 2X6CA 2Q7HA 3KV6A 2YY1A 3OOXA 4WM7B 3RZHA 3AYEA 2HG5C 2GNTA 2W1SA 3FX3A 2FMLA 1WJZA 1QHDA 5IDJA 3TNQA 4CXYA 3E5XA 2WQZC 3NNMA 2DCZA 3WF0A 4LBJA 2O0OA 3CKHA 2OS2A 1RPOA 2XTAA 3VL9A 3TCUA 3U4SA 2RQ6A 1QJU2 1UX7A 1AR81 3U14A 4FM1A 5C8YA 5BXZA 5LMNO 1AI4A 3DC6A 4G28B 2AGSA 2H8PC 3HOBA 2IXHA 3QO8A 4LQRA 5FZ7A 2LO1A 4YFZA 1NE6A 2VW1A 4X62O 3IPVA 1RUE3 1S77D 1J84A 4MHRA 3ZIXA 2B7YA 4MVRA 2Y6FA 3ABUA 1QJEA 4AFAA 1IXMA 4GX5A 5CG9A 5JJNB 3ZMOA 1NXMA 2LGQA 1WW4A 4W6YA 3MIDA 4O9EA 1BHBA 3CD6V 1YRZA 1FS0G 3ZHQA 4ZKIA 2DYCA 4P9JA 1O3RA 4NIAA 2WSUA 1QIQA 1SCSA 4UYBA 2P3IA 5L7OA 5LRRA 1NOVA 1K73W 1H4HA 3VOUA 1QQP2 1RIRA 3WDYA 2CTVA 2ZX2A 3ZN4A 5HXMA 4KBZA 3U07A 2ZACA 3K03A 1XE0A 1US3A 1SLIA 1N0JA 3K79A 4GUNA 1BZWA 2NN8A 3OGRA 3WNPA 3NAPC 2HEYF 2WZPP 1JQ0A 2B4KA 2ILMA 4AFBA 4PDRA 4NHKA 1W2BU 4FPKA 3V0BB 1PK6C 1RC6A 5J98B 5CISA 3ZN6B 3IFXA 5JMOA 4NPLA 3CCJV 2W6JG 1NQDA 4JRAA 3PIGA 4AFMA 2BQPA 2WFF3 1ZBA2 2AENA 1HQWA 3O1PA 3O1RA 2P6CA 4B29A 3SGIA 3G6BA 2D98A 5FXXA 4CCJA 4ASMB 4I55A 1VIBA 3FUOA 2E74B 1JYXA 1G9CA 5HFMA 3WG7C 4NAOA 5JDBA 1MZ5A 4PDWA 4KG8A 2CV6A 4XDQA 4YZ2A 3H7YA 4AHYA 4RA0A 3S30A 3U4XA 1DU3D 2JDNA 5JIAA 4AHWA 1XXNA 1MVQA 4CCMA 2WZEA 3K5MA 5BNOA 1UYPA 3W59A 4BM8A 3FL7A 1QOSA 3HKBB 2X5IA 1MQTB 4YW6A 4NVPA 4QPGC 1VRH1 1LGCA 2WNUB 4K40A 1AXYA 4CDWA 1THZA 2B5UA 3AP6A 1KMIZ 1IQDC 1AHSA 4EB6B 1FMD2 4CP0A 2VMEA 3B9CA 5B2GB 2XAJA 4LF8B 4I4TB 1OCCB 3CMEV 4UBGA 2IXIA 4OX9B 2CGNA 2DFBA 3FWEA 1VBC3 4DR1B 2R9IA 3JAWB 1I7FA 2Z3YA 2AW9A 2VD7A 4RHV3 4LBLA 3LDDA 4E4EA 3AYAA 4I0XA 4LBQD 4DR3O 2W91A 3DL3A 4OULA 1F2NA 3I2JA 3KHBA 3A2FA 1HDJA 4LF7O 4FLUA 3OPZA 3B2EE 5FYCA 2JGDB 2X7RB 5L19A 4XE9A 5I91A 5EJ1B 3I7DA 3LPFA 3ZFGA 4ASUG 1DF4A 1UO9A 4LCUC 3ZIWA 2N05A 3K59A 2Q8CA 4NPRA 5JQGB 2XXZA 4HANA 4QKFA 1EN4A 1GOHA 2GUZB 3CEWA 2ARCA 1JU4A 5FPLA 1GZTA 4FPLA 4H7LA 4Q0PA 1V9U2 2WC2A 2QCSB 1KC8W 3ECQA 4IEWA 3ZS8C 3WNXA 1X7NA 3B3QE 4BDVB 4Q20A 2D3PA 4RO2A 5CIRA 1OC1A 1PGSA 2BCCH 4ASKA 5DAPA 5JJEB 4O61A 3M7MX 3U37A 4N90A 4XFAA 1XNCA 3C7OA 4JDNA 1N36O 3GHMA 4JGZC 4F6EA 4QKBA 3KCYA 4PJYA 3LQCA 4YYOA 1EM1A 2FYUH 1XMOB 4BQ3A 5FYMA 1DZQA 2VBBA 3EFFK 3SPHA 5C3RA 1K92A 2QKAA 2XAGA 2Q68A 1QXJA 4JKMA 4KMQA 1QDOA 1HQNA 5LMUB 3AP9A 5IYZB 2LFSA 2QQIA 5GZDA 2OX0A 3I2IA 4DOUA 3OYWB 3OUJA 1KU9A 1CAUA 1YQ5A 3CRRA 5BNPC 5ERLA 3SH4A 4GQ7A 1RUG1 2JKXA 2WWUA 1BXHA 5FZOA 2RM22 1UYZA 4J42A 4FI9A 1W90A 5CBFA 5LBEA 4J9YB 1K3IA 3AK3A 1R73A 2PUSA 2QQJA 4Q4Y2 3R65A 2VQ0A 1VMJA 1VBD2 1F4NA 3ABKB 5FDBA 1VF7A 1R64A 4XURA 1AR4A 4M4PA 1AL0G 1HW7A 4QDRA 4GJZA 4JI4B 2WBKA 3WP5A 2CGPA 3ES4A 2YIBA 4COUA 1A3KA 5LRSA 2WO7A 4I9WA 1GP4A 3PNAA 3K06A 2HEWF 3VDCA 3NKGA 4EQVA 2VNRA 4DV6B 1LHVA 4AI3A 1CJPA 5K1XA 3S0MA 2VUDA 2OWOA 5A3WA 3E86A 4XJ9A 1TUBA 3WB1A 5KAFZ 4CSWA 1Y66A 5T54A 3RS6A 2VCMA 5D1IA 2CUGA 1UOGA 3AG2B 1VBB3 4TLFA 2GNMA 1Q86W 5IVYA 1C57A 2WLNA 2X29A 2R061 3N3HA 1NCQB 3K57A 3L72H 2PAMA 3ZXFA 3PHMA 1PM7A 3VBUB 3KB5A 1KP2A 3BUCA 1POV1 1XL4A 2OIGA 4NXNO 3ZMZA 2JG9B 2UUAO 4R4XA 3LF7A 4BIOA 4U3FH 4DS0A 4X1YB 3AL6A 3J81N 1SMVA 2OPWA 1SLCA 5KXEA 4HN0A 3CCEV 3E5UA 2CHHA 4CEWB 4YJ2B 3JD73 3SCGA 3DYPA 2K1EA 2OT5A 1CPMA 2GH2A 1PP9H 3U10A 1S0EA 1MZEA 1NCRA 1EYBA 1LOEA 4EN9B 4JI3B 1JVMA 2FTKA 4DY3A 5CA0B 4MT8A 4NPMA 2V73A 3W9AA 4JKKA 3FJSA 5FCCA 3HKCB 1QKQA 1GQHA 2VBPA 1QJY3 2Z69A 1QR9A 1Y3TA 2DU1A 2WS92 2KD7A 1JUIA 3NJZA 2JIGA 4Y22A 2OT7A 4Q0QA 4Q1PA 2TEPA 1XOYA 4XTMA 4H55A 4X6RB 1FX5A 4FP3A 4PLMA 1WUVA 2YI8A 4XEZA 4KNCA 1L7RA 4CP9A 2Y6HA 1LUVA 5BY5A 1LOFC 2D5FA 3T2MA 2ZBJA 2WYFA 2VVEA 5CFCA 2FD8A 2Y48A 2WNVB 1XL6A 4C7UA 3TAYA 3O5SA 2G9ZA 5ANQA 3KWVA 4GX2A 1NZIA 3BY6A 3C7FA 1PVXA 2VOTA 2W5FA 3BCCH 2D6NA 3H8UA 1RUC2 2DUPA 1QVFU 1TME1 1OH4A 1ZREA 2QSAA 2QTSA 1BEV3 3WQBA 1K5MB 1ZZ9A 1ZBE1 2W1QA 4FXGB 1NVPB 1UMHA 1G7YA 3BABA 4Q4V3 5BR8B 1VQ9V 1H2LA 1C5IA 1N0NA 2VOVA 3RZLA 4R9CA 3WQ0A 4PJ0Z 4DR7B 4XF3A 3KGLA 1QJX1 5LGUA 4HZFA 1HXS2 3A0BZ 4JCKA 2Y0OA 3J26N 4U7NA 4DV7O 4QPIA 2DYRC 1S2EA 5LXTA 4AFDA 4Y20A 2TNFA 1AYM3 4I3PA 3GYDA 4DO0A 3ZMSA 2VCBA 4H3WA 2VQTA 1R1ZA 4UB6Z 4K21A 1VQNV 2QKSA 1FPN3 3LA7A 1W6QA 1H2MA 2YXSA 4WVMA 1EV13 3B93A 3ZMVA 4PLOA 2YEVA 4YY3O 1FOD1 1MS0A 2ZE5A 4DV1O 1V55C 3LIGA 3LEKA 2E5LO 1KS5A 1OLME 1IBLO 2C24A 2H6BA 1F5FA 2JE7A 1C8M3 1EZJA 3ZX6A 4DR5O 1IG3A 4F83A 2JG8C 2D3RA 3OY8B 1OQEA 3EHBB 4PF5A 4NO4A 4DUYB 2DJVA 3ABLB 4DR6B 4B1MA 4Z1MG 3AK1A 1TMF1 4LORA 1JFFA 3TETA 1XSRA 1BT8A 1ZNPA 5LHIA 3ZR5A 5CAZA 2L6LA 3LSUA 1Q90D 4XXPA 3SCFA 4CDQA 1F35A 1R3KC 5LGNA 2BVVA 2YYOA 5A80A 4QM8A 4I50B 5IAVA 1EAH1 3VBHC 1UAIA 3WG1A 4CUCA 4E8CA 3WG2A 1UY0A 3GCXA 5SV8A 1T2XA 3MV01 3HB3B 5H9SA 5FY1A 3KT7A 1SBDA 1CAXB 2ETEA 4R9DA 2VC9A 4DXWA 1RVF2 1YFWA 3IWZA 1PO21 4E9KA 3JD3A 1L8DA 4AGRA 2QGNA 3QG5A 3ZFFA 2ES3A 2UXBO 4IV1A 3FD9A 2N74A 1IS5A 4DB5A 2ZGUA 1W6PA 5JCOC 2R1DA 4D3WA 4DV0B 2CL2A 2WLHA 4JI5B 4M3CE 5EZWA 4Q4X2 2ZE8A 4KWUA 5FQ0A 1GZ9A 3RZMA 2Z5WA 4RAIA 3K58A 4HETA 4JYCA 3LSDA 1OD5A 1AROP 2HVKC 1IURA 3PUIA 5IJRA 1O3TA 1GBGA 2W0XA 2ZZQA 3JB8A 3RWKX 5T55A 5DAQA 1XOUA 1K5JA 5A7NA 3ILRA 1CX1A 1Y4MA 4NHMA 1KRIA 3OM3B 4Q0VA 4HVOA 2W52A 1OD3A 2LM3A 4HL0A 1O7FA 4LOTA 3ZMUA 4BB3A 1H8TA 1RUI1 4ZU4A 1TA8A 4AQTA 1IGOA 5FZAA 3G71V 1KFXL 1WB8A 5GLUA 1S55A 2A79B 3KF5A 4DRXB 1OLQA 2V4DA 3ZXLA 4JTDB 1YF2A 1KJRA 5FNVA 1CVNA 2QJ1A 3QCWA 3D3IA 4QAWA 3SR2C 3CNAA 1ZL8A 2F6BA 2VZQA 2DN9A 4JZRA 1ZBA3 3MW3A 4Q5OA 5KC6A 1PZ9A 3HPNA 4TZDA 2EIDA 3ZN5A 4DV5O 2XL7A 4GB32 2HKOA 4NUBA 2UXCO 2QWQB 2D6PA 2RS32 4Y5SA 2WLLB 1O4ZA 3LEIA 1DDLA 1Q82W 4N53C 4TXWA 1NTZH 2HBTA 1B04A 1LCLA 3GALA 2RJ2A 4K8XA 1NY71 3CCRV 4HSJA 2OCCB 1TQ5A 2JDMA 4KGQA 2BSKA 5CB7A 2WFPA 2Q6AA 4Y5TA 1U5XA 2BBVA 1NG0A 1VIWB 1SF9A 1XPWA 1RITA 4UXAA 3K46A 2H94A 4MS2A 2PHDA 3WT3A 3DPRB 4F8AA 4QHZA 5FRAA 4BLIA 3TN92 3F95A 4TSVA 5A7SA 5C71A 4W65A 1MEC3 2DQ0A 2BFUS 5A6XA 1YEWA 3GJBA 1UX6A 2IVIB 1FMD3 1X4TA 1ND3C 4BPZA 3NMBA 1I5XA 4XDOA 4DRRA 2XGXA 1GLHA 3OUHA 1AI7A 2J7MA 4QGMA 4LF4O 4B3SO 3T1HO 3JSNA 5JXIA 3IIIA 3GF6A 2P2KA 1YI2V 2LALA 3CCSV 4IGQA 2YUEA 3J9SA 4N7IA 2XT9A 1BLZA 1YLLA 3WF1A 4R52A 2A5ZA 5GM0A 3R6SA 4EJRA 3W5NA 1S3JA 4Z2AA 5FJHA 4YW4A 3MF9A 3O12A 4QHBA 1KD1W 3PVEA 3WNLA 2W46A 4CDXA 5BNNB 4COYA 3PUSA 5AC92 4UVAA 2WLQA 2YV8A 1LKNA 4RFT0 5IVCA 1NZ6A 3GBFA 4V2VA 4JYBA 3UCSC 2JD4A 2VULA 3CB2A 1WWYA 4YVWA 3B7MA 3JBG2 2ZKNA 2OQ6A 3ILFA 1WMXA 1CZSA 4CCNA 3FYIB 1VP6A 1V9U3 1UNBA 1UPGA 1H8EG 4K7JA 2XVGA 1WMFA 2KB1A 4MGYE 3SYPA 5BV6A 1VRBA 4B7EA 5F3IA 1M5IA 5EC1C 4FCAA 5ABJC 1VB4A 3BVCA 4JYAO 3FBYA 4Q4W2 5EYPB 3L74H 2D6KA 1QHTA 4Y1UA 1F5JA 1G8MA 3ORJA 3JD1A 2XNDG 2ZX3A 3SQOA 3G6EV 3VZKA 3WEZA 4BXSV 4JAUA 1IX9A 2QQOA 4YG0A 5H9QA 2WUHA 1GNZA 1NLSA 1UMZA 1RUJ1 1WZXA 1HRV1 2O8OA 2JVDA 1WCKA 5CADA 4ZONA 3L73H 3D6EA 1HNZO 4EN8B 2PHLA 4JGYB 4GULA 1DYPA 2VH9A 2J1EA 1LOCA 3JQWA 2CGOA 2EIKB 4J7ZA 4JF3A 1VEWA 2BRTA 4I30A 1LHUA 2VQAA 5FOBB 5C6CA 2ZGLA 2AEZA 1L0NH 2Q7GA 4BMBA 2ZEZA 3HD8B 1PNGA 4I0WB 2Q1MA 2XB6C 4XIOA 5K0UB 3N7LA 1E5HA 2C2AA 3QH7A 1ZZ8A 1U5IA 1OHHG 3D0SA 4O4JA 1WNSA 2WWJA 2VQFB 2E26A 4UFIA 3UT0A 5FIXA 1FYJA 2HWE1 1ZA4A 3MHSC 3QNEA 5LCWL 3VZJA 3IAQA 5IK8A 1QNWA 2JJ1G 2GP5A 3ZYBA 1D5NA 4CTEA 1O3QA 4CCCA 4BQ1A 3PDQA 4XHXA 1Y67A 3NNLA 3X2QC 1LOGA 1XU1A 1XNAA 4UF0A 4B3RB 1RL3A 3EVKA 1JA8A 5C70A 1SQQH 1QEXA 4DR4B 3O1VA 4H13B 1AYN3 2WO2A 3AYCA 4KI5M 5EJ3A 4LK6A 1O9GA 1HKDA 5L9BA 4PD4F 3GBWA 1FV2A 3IIAA 1W0NA 3SEPA 3DXRA 4GH4C 1SQXH 4LOSA 4JTAB 1AR71 4I09A 5FL7G 3AG1B 5KHJA 4H37A 4OCTA 4FTSA 3AG3C 4WM8A 1FXKA 3JXSA 5F5AA 4MG2A 1PMJX 2WYSA 2Q8OA 3ZRWA 2E33A 4ZZ8A 2Q9LA 4GZ9A 5JR2A 1H30A 1SLAA 5JZGA 5GONA 3C7HA 3UGFA 1UF2C 1QH6A 4D0QA 3LSQA 2BBAA 3ASOC 4OI1A 2LW7A 4MSWC 4HPKA 3SEEA 4FPHA 5T5OA 1SBFA 3DC5A 1J58A 5LHHA 2R043 4KL1A 5IYYA 5KLVH 1RUD2 1GH6A 1VBE1 2LJ2A 4C0HA 1WPBA 4OUSA 4BQ4A 3WDXA 2WS93 2GBOA 4GMP3 3T1MA 4YZ4A 1O5UA 3BN6A 2DWDC 1W9YA 3JAKB 2DMXA 4AFCA 1RUNA 5FZLA 4NAMA 3H3ZA 3OEEG 2EIMC 3LUTB 3APQA 3MD0A 1BBT1 2EX3A 2FDFA 1ULCA 1VQ5V 1KDKA 1SLBA 3RZZA 1V6JA 2RVAA 4AR2A 2OVUA 3SMHA 2K2SA 3VBOC 1NR1A 4ZI7B 3QTCA 3GBGA 5IYDO 2CSGA 2BE3A 5H6QA 3E83A 1KDMA 3HN1A 5FYUA 1RUC3 4AE2A 2DQ3A 1CAWB 2YIDA 2PMWB 2A06H 1RB8G 5FAXA 4AQSA 3KT4A 2WIIB 5A7WB 2X09A 5C4WA 4O2BB 1QY4A 1COV3 5EPAA 1S72V 3S5AA 3VBFA 3O65A 1E57A 4JPRA 4S2GA 1JOYA 5FZIA 4LIVA 4YSFA 4YRDA 2G38A 3AZYA 1W59A 1IKPA 1HXS3 2UU9B 1VP7A 3T1YB 4X20A 2IH1C 4TT3G 2XUEA 4IL7A 4COVA 2Q8VA 5KC5A 4KHPO 5FLHA 4FLXA 4HK9A 5J1XA 3ZFEC 3POIA 2NMNA 4YJ3B 2P67A 1XJAA 2ZX0A 4QQPA 4N43A 1CPYA 5GLTA 1AR63 3L2HA 5JOZA 4JHZA 1D2QA 1ND2B 1IS3A 2PTMA 3OF1A 2JJ6A 2ZR2A 3D82A 3O0XA 5DDJ1 1Q8SA 2MEV2 1QH7A 2PY5A 3B8MA 5E8AA 2P90A 4K0KO 4LIUA 5CVRA 2VU9A 1XE8A 3SKVA 3WQ1A 5IVFA 4K8ZA 4PIXA 2X10A 4YGEA 2A6VA 3K3OA 1R6NA 3RW0A 1M93A 1W9TA 3ACLA 2WT2A 2ZMNA 3HKEB 3HT2A 1LULA 3SPGA 5FO8B 2PI4A 1PGL2 4LKDA 4YVSC 3N7JA 5IVBA 2LFRA 1MS5A 4X9QA 1K45A 2P1BA 1RUH3 1LGNA 5AVAA 2ZDIA 2HP8A 3LDRA 1GFF2 1RTVA 4K8FA 2PAKA 2WINB 5I0SA 1J1LA 3RQ0A 4IEUA 4UCTA 2YGMA 4AAXA 3WNOA 1WLCA 1L7QA 3HBZA 2UYBA 2QQUA 1VBA2 2EJRA 4S2DA 4KWJA 1VQ6V 4XAAA 1K8AW 2D6OX 4B1LA 4WZCA 4GCZA 4PT6A 4A45A 4GD4A 4LF9O 3H3UA 5EJZB 1LESA 5APAA 4AGVA 1US2A 5HI0A 5C93A 1RVF3 4AEDC 4OI4A 2ZCWA 4FO9A 2EIJC 1TAEA 2FDHA 2D97A 5FPRA 2Z79A 1YFUA 3UT5A 4JV5B 2RNBA 1RHI1 4XF0A 4UW5A 4OUEA 4G3YC 1TUEB 4ET7A 1H4GA 4N53B 5J3UA 2FCUA 4DXTA 2VVDA 3T4ZA 4QB2A 2ZXQA 4ZKTB 5JOYA 5JPNB 2EA7A 4CDUB 2HKXA