2EBOA

Core structure of gp2 from ebola virus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
74
structure length
74
Chain Sequence
b'GLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCAIEPHDWTKNITDKIDQIIHDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EBOLA VIRUS ENVELOPE GLYCOPROTEIN
publication title Core structure of the envelope glycoprotein GP2 from Ebola virus at 1.9-A resolution.
pubmed doi rcsb
source organism Zaire ebolavirus - mayinga (zaire, 1976)
molecule tags Envelope glycoprotein
total genus 27
structure length 74
sequence length 74
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eboA00
1F23A 1MG1A 5CN0A 2MK3A 3B8NA 3M99B 3P30A 4FJCC 1DLBA 4JGSA 5HFLA 2M7WA 3GWOA 1K33A 1I5YA 1DF5A 2EZOA 3CYOA 1DF4A 3B8MA 1QCEA 4N23A 4G2KA 4N21A 2OT5A 2EBOA 1QR9A 1SZTA 4JF3A 3MHSC 5HFMA 3B77A 3CP1A 4FIPC 1ENVA 3H01A 1JPXA 1JQ0A 1QBZA 3K9AA 1K34A 1MOFA 1Y4MA 4FK5C 1Y66A 1EBOA 5CMUA 5KA5A 5KA6A 2EZPA 4E2LA 4JPRA 1I5XA 5H9CA 3WFVA 2LP7A 1QR8A 2X7RB 3MHHC 2P6JA
chains in the Genus database with same CATH superfamily
2PTMA 3ZMSA 3ABMB 2UUAB 4Z2WA 4GKJB 2R9AA 2GTAA 3SGIA 4D6TH 5F2VO 1KU9A 3TXSA 4OX9B 1OHHG 1BGYH 3OEEG 2YEVA 4PI0A 4OPAA 2D3OW 2EX3A 1VQMV 3BFRA 1Z5VA 4PDLA 4PA7A 1ZX3A 5LGTA 5IWAO 3OGCC 3CYOA 1FFXA 4I4TA 3SJQC 3ABMC 4DV7B 3CCLV 1JOYA 4DR2O 3APQA 4ICGA 1S76D 4ZKIA 1AROP 2OYQA 3CC7V 1VARA 2ZR3A 3E22B 3I55V 1VQ6V 5GONB 2WLJA 3G71V 2JVDA 4UFZA 1M56B 3TETA 3B4SA 1K4DC 3CCQV 1G8MA 4X8AA 4DYLA 4N23A 2BTQA 4JV5B 2HFEC 2B5UA 2G38A 4C7UA 1EBOA 2KG7B 1IBMB 3T2MA 5KA6A 4XDLA 1V55B 4BIZA 4E2LA 3CC2V 3K3WA 2IJKA 3BY6A 4B3MB 4O2BB 2P6JA 3Q4HB 3OM3B 2E3CA 1QU7A 1XUQA 5B1NA 4JGSA 5HFLA 1R1BA 3T4ZA 5H5NA 1KKCA 1AILA 2CTPA 1M56C 2Q5ZA 5L3DA 3CP1A 4QGPA 5LMNO 4IHJA 5DM6V 4O4HA 4PA3A 5IYZA 3OT7A 5KMGB 2ZDIA 3F5WC 3HKDB 3KCXA 1V55C 2BE3A 3B8NA 5L3EA 3UT5A 2P90A 4UCRA 4RO2A 3K79A 1H8HG 1QVFU 2ZM6B 4FLXA 1B6QA 4EEQA 2UU9O 1AP6A 1MMMA 1XMQB 1K7DA 2Q69A 4B7KA 2XNDG 2MK3A 2Z0AA 1NTZH 4XBFA 4PI2A 4L87A 1GTOA 4LP8A 1ZLZA 1ZWIC 3CXCU 2XT9A 4JZGA 3THOA 3CCJV 2W0FC 1Q7YW 4U3JA 5EBMC 1Y76B 1YTFB 1OCZB 4DR7B 3LSSA 1U97A 1P49A 1W0JG 3BAAA 3ZMUA 3C90A 1YXBA 4DR5O 2ODMA 1DK1A 4DK1A 1WJZA 4LF5O 4BIOA 3ABUA 2DYSB 2UUCO 4LWSB 5LHGA 3RT3C 4DV3O 4R7CA 5BR8B 1YITV 1OCZC 4TQFA 5AG2A 1VQ9V 1FXKA 2LFSA 4K8ZA 5IJ9A 2IU3A 2Q4PA 3LDEA 2BCCH 3M7MX 4MS2A 4JF3A 2RJZA 2AXTZ 1WP8A 3SR2C 3SYPA 4DO2A 4AQYO 1XMOO 4PDMA 4NVPA 5KA5A 4DUYB 2UXBO 2YI9A 1H2SB 4O4LB 5CA1A 2DYSC 1LUWA 4JI3O 4LNUB 3UO2A 3G4SV 3EFFK 3WG7B 1R6KA 4LF7O 3E8BA 4WCEV 3STLC 1ENVA 5L3FA 1WNSA 1MA1A 4JAVA 2EZPA 1LR1A 3ZRWB 2DW4A 4LH7A 4W4LA 2CGOA 3T4DA 2YICA 3L73H 2HLDG 1WPXA 4P2ZA 2HKOA 4KXRA 5JH7A 3SPIA 2DWEC 3F7YC 1E79G 1H2LA 3SPHA 2HVKC 2ZIMA 3WG7C 1R6TA 2JK5C 4LF4O 2WPDG 4JI5B 2E5LB 4LFAB 4LF6O 2X0LA 4X88A 1GN2A 1N36B 3BABA 3SJBC 1AI4A 1VF7A 1YJ9V 1K92A 3ABKB 3DSQA 4UUJC 4X64O 2Y48A 3H1IH 5FNVB 3SPGA 4DUZO 4X62O 3DGEA 3AG3B 1SZXA 3HKCB 4LFCB 4NYKA 1AI6A 1L8DA 5EYPA 1H2KA 3ABLB 4YJ2B 4FFBA 4P9OA 1TUBB 2A0LA 3D36C 4JI7B 2DN9A 1MZFA 4U3FH 1EZJA 1E1RG 4J7KA 1JVMA 5LXTB 3ABKC 2YSUB 1FJGB 4LC1A 4L8JA 2R9RB 3AG3C 4FIPC 4UB6Z 4PA4A 1OCRB 3ABLC 5BY1A 4YIOA 3CRQA 1FXHA 1YZBA 2F43G 1X59A 2PZSA 2LO1A 1HNZB 4ZOLA 3DXRA 4R8CA 1P7BA 4JI1O 2HHHO 2OCHA 4J10A 1OZ0A 3FFQA 1R3KC 1XQ8A 3SPCA 4TV9A 4YJ3A 4NXNB 1RFYA 3E35A 3JD2A 4MTOA 3ZMTA 2JGDA 3RN4A 1OCRC 2EINB 1NVPD 2HJFC 2HVJC 1XNQB 4O2AB 1VMGA 4JI4O 2YIBA 4X1YB 3IGAC 4JI8B 2QKSA 2ZNIA 1H2MA 1SETA 5LA6B 1FS0G 2QE7G 1H2NA 2F95B 2JJ2G 5LBQA 3J81N 1KQSU 4W4KA 1VF6C 1VQ4V 5LMUB 5GTHZ 5C93A 2EINC 2ETNA 3CCEV 2H94A 2LW1A 4FJCC 1DLBA 5LL6Y 3FD9A 4MVUA 4DR1B 4WFGA 3HKEA 4ASUG 3ZRVA 5IJ0A 1R3JC 3OE7G 1QQCA 4FFKA 1N33O 1XBLA 4GKKO 3K0DA 1SKVA 2WLNA 1IX9A 4IIJA 3SYQA 4DR4B 1B3QA 4TT3G 1UFIA 4I5SA 1SQVH 3VQXA 3ZN0A 4DV2B 1VQOV 1UPGA 1COWG 3T1YO 4TQDA 5C8YA 2VWJA 3RYCB 3CMEV 2B9ZA 1ZTEA 5J2UB 4RQFA 2DWDC 2BSKB 3J7AU 1PNKA 5L3CA 4U7OA 2AZ0A 3SJAC 3ZHUA 1VQNV 2XAGA 3BHPA 1PNLA 2JIZG 1NKDA 1N32B 1S5JA 3E2EA 1Q81W 3H1LH 3R66A 2OTLV 5DECA 1VQKV 1H38A 3G6BA 2L35A 1TUEB 2JS5A 1NQTA 1RSOA 5KLVH 3B77A 3VQYA 1FXVA 3QTCA 4XDJA 1YI2V 2YEVB 4CS2A 3OMNB 2FMLA 4X9QA 1Q6HA 1JJOA 5BMVB 4O4JA 1T5EA 4H44B 4FM0A 2A06H 2Y4UA 5JCOA 5LGNA 5D5PA 4UCSA 2WWWA 3G67A 4CH6A 1FFXB 4I4TB 3CX5F 3L70H 3MHSC 2Y69B 3U0ZA 2RDCA 1KYOF 4UCTA 2Q67A 4DR3O 1N34O 1BSMA 5EC1C 1KECA 2Y4TA 4B3MO 5IDJA 1AJPA 4R6ZA 4WFHA 1M93A 1DF5A 2FL4A 1SC5B 4X1IA 5GTIZ 1QCEA 3ZMVA 3OR7C 2P06A 2ZCEA 3G80A 5B1OA 4BW9A 4DV4O 4JI6B 3GVMA 3WB2A 2BTQB 1MOFA 1Y66A 1FFTB 2WA4A 2GV9A 4GLXA 3CHXA 3LNNA 2Y69C 1M9NA 1SQBH 2HG5C 1GO3F 1SESA 4GUNA 4O4IA 1XHZA 3OR6C 4RWUA 1FAFA 4JASA 3A0BZ 4B3TO 1NTMH 2Q6AA 2ZM6O 1N8RW 1Y4MA 4DV5B 1ORQC 1VIBA 2X6BA 4IHJB 4O4HB 2IM9A 2PI4A 3K08A 3JSNA 3BRCA 4BWAA 2E76B 1Y67A 5IYZB 2W0XA 2Q7HA 1XI1A 4JYAB 1R6NA 1S5HC 3UT5B 4AILC 4JI0O 3NXSA 2JRIA 2A7WA 4DR6B 1YEWA 3TJTA 3JATA 2CTWA 1AJQA 2ZKOA 2K9PA 1F4NA 1R73A 4K0KB 1NTKH 3ML0A 2DQ3A 1MSWD 3JCZA 3QNEA 4D7TA 1SS3A 3CCVV 3K5MA 3OMIB 4MVOA 2F4VB 1LUVA 4FVMA 1NH2B 2CGNA 2ADQB 2ZDIC 2Y0PA 3F7VC 5IYBO 2YDEA 1PM9A 3RFRA 4K35A 2X6CA 2BOBC 4JI2B 1FYJA 4CS4A 4MVMA 1MNGA 2Y0IA 4J42A 1XREA 2BOCC 1HR0O 2P22C 4JPRA 3K5LA 1US6A 4U3JB 3DTUB 4OPHA 3ZEDA 2F23A 5BR8O 1NR7A 3LNMB 1O9HA 1DTOA 2QR4A 2UUBB 4ZBMA 2PGGA 4LFBB 3H01A 2VQFO 4J80A 4ZHQA 4A5UB 4MVZA 4DRXA 1QVGU 1GKFA 5DN6G 2OIGA 5FPOA 3STZC 4QPJA 2UXDB 1FXKB 4FLUA 2NLJC 2UXCB 3ETQA 5IJ9B 1WP7A 2WLHA 3SJCC 3H1KH 5H6RA 4E4EA 3K5NA 4PA9A 3RBZA 1HNXO 2LQTA 2LGQA 4MVRA 3CRRA 1JR9A 5CA1B 1GRJA 2QSAA 1OJHA 4GCZA 1G6UA 2RQ6A 2OIEA 3W7TA 3ZX6A 1FXKC 4RQEA 2E5LO 5B1BB 1IBLB 2QM7A 4KHPO 3P3NA 3T1HB 2YS8A 4I9WA 2GBOA 4LF8B 4B3RO 4TSFG 1S5LZ 4TWKA 2CDYA 2QWNB 1IDSA 1EN5A 4NR1A 2CH7A 1F23A 3IJ4A 2M7WA 4GYCB 5JH7B 1K33A 3K58A 2YXYA 2WLLA 4B3SO 3ZCCA 2IJHA 3OFNG 4Q6GA 4LF9B 4YY3O 3WB0A 3ZIAG 4MW3A 4JTDB 3LSQA 2F93B 3H1HH 3RW0A 5B1BC 1YIJV 5K1PA 2GUZA 4CH5A 2A79B 1FPOA 4DV1O 4ZI7A 3APOA 5FL7G 5EYPB 5EZYA 1JPXA 1Y6XA 2QWQB 4OGQB 2XHBA 4Z1MG 4FFBB 4D7SA 4JZ2A 1PD3A 2X6AA 4JYBA 1HNZO 3OTOB 1IBKB 3SYAA 1U96A 3CCUV 4NXMO 1MABG 2Q0OC 1XL4A 2QWPB 3I5DA 1DGSA 4NXNO 3N2GA 3U11A 2ZINA 5B5EZ 1SQFA 5K1XA 1AJNA 4UV8A 4ZOLB 3DXRB 3JD4A 2XTAA 1HDJA 4WBNA 2ZT9B 4QE9A 3CJHA 3TGUH 1AI5A 2QGNA 1AVMA 1BS3A 4GX5A 3S3WA 4TV9B 3UKMA 1KB9F 3RVZA 1PV0A 1ZL8B 3ETDA 1BQ0A 4CH4A 2P5OA 4MW8A 3BCCH 2HR3A 5KHHA 5IWAB 1WLEA 2QKCA 4DR1O 4PHZA 3CC4V 5DEDA 2V7QG 5CBFA 1SZTA 3JAWA 5J2TA 1AP5A 1YF2A 4FK5C 4X20A 5IYDO 4DR2B 1BZKA 1CPYA 1IXMA 4JTCB 2CUGA 2H3OA 2QM4A 2L6LA 1I94B 5A2QN 5CBGA 3GWOA 1R3IC 2FKXA 4FM1A 1VP7A 2ITCC 4X65O 5ITZA 2EJ7A 3VQWA 4EFEA 1GMGA 3HKEB 4NTYA 2K1EA 5IJ0B 5LP6A 2GDSA 4GZRB 5EBWC 2FYUH 3D3IA 2ILMA 2E74B 2WLIA 4IIJB 5KX5A 3JARA 3J80N 3R65A 4JTAB 1J5EO 1K73W 2OWOA 3E83A 3K9AA 1NVPB 5LMNB 5C8YB 2XOKG 4GT1A 2LFRA 3E8FA 1P4RA 2F1MA 3JD1A 5D5QA 3K04A 4DV6O 2H8PC 3N27A 2NNUA 4UB8Z 1KBHA 2VQEO 4KUMA 2ZE5A 1TVKA 1Q6UA 4LCUC 5CBHA 4DXWA 1RSOB 3MD0A 2UU9B 3OUSA 4F4LA 1PL4A 4UVAA 5L3BA 3WB1A 4B7EA 2VWKA 2XAJA 3TXQA 2ARHA 2ZR2A 5EC2C 3BEHA 1JJ2U 2NR5A 2Q8VA 4CH3A 1FKAO 3JALA 4I0XA 4O4JB 3ASOB 3AEIA 4G2KA 3RWRD 5B3SB 3E8GA 5H2FZ 4WFAV 3ASNB 3JCUZ 4QPKA 1M4UA 4BR6A 3RYIB 5LOVA 4CS3A 3L71H 4KFMA 4RUEA 3VQVA 1PP9H 4QNHB 1K5SA 4HYOA 4CZZA 4YHHB 3N2KA 1HNWO 1OCCB 1YSCA 5KHGA 3ZHRA 4DR5B 3ZS8C 3ASOC 3QO5A 1QBZA 4DV5O 5B3SC 5JCOC 1EN4A 1SA0A 3HKBA 3AG1B 3ASNC 4LF5B 4H0LB 2PUSA 2UUCB 2C2AA 1WA8A 2E75B 3FYIB 4DV3B 2QM8A 2YIAA 1GN6A 4O4IB 3UQ8A 4QIWF 1OCCC 4DR6O 4X66O 1XMOB 1PNMA 5KUKA 2UXBB 2VRZA 3AG1C 1NS1A 2WLMA 4LR3A 1KP2A 3CWBH 3D8CA 4JI3B 3ETEA 1K4CC 4JAAA 5BZBA 2UUAO 2P7TC 4HNAA 3LDDA 4GKJO 1I5YA 1HP8A 1A32A 5LYJB 3FAVA 3ZJZA 4OX9O 2N04A 1S77D 2XAFA 3JATB 2QA4V 1KUQA 3IFXA 3PN1A 4UCVA 1EM1A 5JQGA 2UUBO 3CSXA 2W6JG 2AZ2A 4DV7O 1MSDA 3SPJA 5IE9A 4LF4B 4PD4F 5A9GA 5H6QA 3CCRV 4LF6B 4G27B 2YUAA 3OTFA 1XNRB 3BVOA 3QF7A 1WB8A 1KC8W 3OMAB 3KCYA 2ZE7A 4DUZB 1OV9A 4X62B 3ZN1A 3E8HA 2Z3YA 4JV5O 3JSLA 5JJEB 1JQ0A 4H37A 3OGIB 1IBMO 3W7XA 1LNQA 4YIPA 1KMIZ 4WF9V 4WFBV 1S3JA 4UV9A 4ZHQB 4MTGA 2ZIOA 4DRXB 3CS5A 3C3SA 3H1JH 4H33A 3CRMA 4BAYA 4I9QA 3AG4B 3RYHA 4EB6A 1EZVH 1K97A 3CB2A 5EIBD 5HFMA 3GWKC 5JWPA 2Q7GA 1WN7A 2ZE8A 2CAZC 3WFVA 4FLWA 3K06A 1QLEB 3ZBHA 3T1CA 1NZ6A 1VQ8V 1GM8A 4JI1B 2RMKB 5LA6A 1BMFG 1JA8A 4I55A 4K3AA 4J41A 4DV0B 2YIDA 1B04A 3AG4C 1BE3H 1URFA 4PDRA 1S72V 3ZRXA 4QJFB 1WB7A 3L72H 5CA0A 1XMQO 2QJ1A 5IYCO 5CB4A 2FTKA 1W0KG 1THZA 4JI4B 1IURA 3L9DA 3FB7C 1B06A 2CH7B 1QLEC 4UCUA 3EVKA 1M57B 4TOIA 4MSWC 4FLYA 1OCOB 3DC6A 4FLVA 2WLLB 1VQ5V 1I08A 4PA6A 1F4MA 1M90W 4DR7O 3A8TA 2KQXA 4MTFA 1TGOA 3U10A 1I7FA 1O9GA 2GUZB 1D2DA 3SDLA 2DOSA 1VQPV 3CPWU 5KHKA 1Z5WA 4ZI7B 2ZD9A 3HB3B 2EIKB 2A3QA 1M57C 3AK2A 1XHXA 3RYFA 4IL6Z 4FLTA 2BSKA 5EZYB 1OCOC 4DW1A 3VOUA 1N33B 4GKKB 4P30A 3CEIA 2CTRA 3S3XA 3T1YB 4I50A 2KSDA 4TUYA 4Z1VA 1AR1B 2DQ0A 4KL1A 1N0JA 1H8EG 5CA3A 3N2GB 2EIKC 2EULA 4DUYO 4TV8A 1VEWA 1Q86W 5BMVA 1YJNV 4MVQA 3ZMZA 2R70A 2RN9A 1TA8A 2ZE6A 4WBNB 2LW7A 3CJHB 5IT9N 3K57A 4FZ1A 5JVDA 1GK9A 1JFFA 3RVYA 3FX7A 1IZ3A 1I94O 4UVBA 1MG1A 4F6EA 1BL8A 4X1KA 1NH2D 2PYLA 1JCHA 4HZ3A 2V4DA 2OCCB 2LGWA 4JI5O 2BTOA 1AI7A 2WA3A 1W59A 3JAWB 5JJNB 4LFAO 5J2TB 1Y74A 1N36O 4R50A 5KAIZ 4DR3B 1N34B 4X20B 1NJIW 3D3QA 3JASA 2QDOA 3SYCA 1GN3A 3JYCA 3K9SA 2GSMB 3M99B 3X2QB 1D5AA 2PF4E 4LFCO 2M6YA 1VQ7V 1X4TA 2EZOA 3EXAA 2R72A 3ZHSA 4DV4B 4JYYA 3HPLC 4WFFA 4JI7O 5ITZB 2OCCC 2CK3G 3QG5A 1WPBA 3CCSV 3JAKA 5EBLC 5LP6B 3HR0A 1HWYA 2MW2B 1NR1A 3K5OA 1V9PA 2DYRB 2ADPA 3JD0A 2WLIB 1FJGO 1L0NH 1K8AW 5KX5B 3JARB 1KKDA 4B3TB 3X2QC 2AHYA 2ZQMA 4HBNA 2PI5A 4F6RA 2JS3A 4OXSA 2NN4A 5E1AC 5J9PC 2QWRB 2QKAA 2Q73A 1J95A 1CXZB 4FM2A 3K03A 3O9OA 5LP6C 2LJ2A 3GB7C 4JI0B 2P4KA 2DYRC 1TVKB 1XDCA 1PL0A 2B1GA 4LH6A 3C3TA 2IH3C 3QO8A 3BPZA 1XNQO 4NTXA 3MHHC 4YHHO 5KHIA 5GW7A 1VF5B 1XEQA 4JI8O 4FPPA 4QE7A 1L1FA 1QLNA 3JALB 4I0XB 4N21A 1NT2B 1BHBA 3L75H 4YJ3B 3IAYA 3K59A 5LOVB 2ZNJA 3JD3A 3MDSA 5KAFZ 1HR0B 3LDCA 1EFRG 2JGDB 1Q8IA 1GM9A 3E22A 5LMUO 5GONA 2N05A 2CE4A 4HAMA 3FB8C 3W7WA 3N2KB 1S0VA 2YXLA 2JEUA 3L74H 3OD4A 4XDKA 1KD1W 4DK0A 1V54B 4JAUA 4UVCA 4B08A 2KG7A 1N0NA 3UO3A 2VQFB 4J7ZA 1SA0B 2IW5A 3HKBB 3W7SA 5BXZA 4O2BA 3RGBA 3ABTA 3TCUA 3Q4HA 3CRCA 4MVSA 1BQZA 1WA8B 1RP3B 4DR4O 3F5TA 1YTFD 4MT8A 4DV2O 4PJ0Z 4J9ZB 1GH6A 1F51A 1PPJH 2XASA 3KKYA 3B2EE 1K5QA 1V54C 4WFEA 5FPRA 3LUTB 4BIUA 2RNBA 5KMGA 4PDVA 4I7ZB 4NKGB 3HKDA 1HNXB 1FD9A 4EFBA 3CD6V 1N32O 1SERA 1SQXH 4FLZA 4HNAB 4H13B 3QO7A 2IJIA 3FAVB 4PELA 3A2FA 4KHPB 1XNRO 5LHIA 3G6EV 3NR7A 4RUFA 4YXWG 4B3RB 2R9IA 2X7RB 3O65A 5FLXN 1Q82W 1QNMA 2GTSA 3A0RA 3VBBA 3UCSC 4J7JA 5JQGB 1PKXA 5LHHA 3P32A 2QTOA 5KHJA 2YIBD 4B3SB 2Q68A 2EBOA 3ETGA 3SYOA 2FB5A 1K34A 2QTSA 4YY3B 1P84F 3B40A 2IBZH 1Y76A 4MTXA 3OUFA 5IY5B 4P9PA 1QR8A 1KP3A 4ZIBA 1Z2GA 1XILA 2WAMA 1BCCH 2YXHA 4G28B 2DJVA 4DV1B 1JX9A 3AG7A 3AK3A 3UM7A 1HW7A 4FZ0A 2OTJV 1I0HA 1GN4A 1YCIA 4JI6O 3K0GA 1YJWV 4LWSA 3KG2A 3M8AA 5L3GA 2XAQA 2EIMB 1SQGA 1ZUQA 2HJDA 1XL6A 4NB5A 5IY5C 5CN0A 3OEHG 2Q7EA 2YC0A 3P3PA 4CC5A 3EHBB 4DV0O 2W6IG 4NXMB 3KZIZ 3RYHB 2OT5A 4EB6B 3IC9A 4X1IB 1UJWB 1BHAA 5KUMA 3B09A 3TK1A 4EKWA 5LGUA 4O4LA 1ZL8A 5E79Z 5H9CA 1MZEA 4IYHA 4LNUA 2EIMC 4FMTA 4BW5A 2V1DA 1SQQH 3CRAA 4JYAO 3CCMV 2GHYA 1H2GA 2DMXA 4I55B 3ZRSA 2O57A 5B66Z 3CMAV 4AQYB 3ZRWA 3I56V 4JYCA 1F7YA 4K0KO 1IXBA 3OAAG 1CEZA 2N74A 1M5IA 5CA0B 1I5XA 3FKSG 1Q5OA 1BT8A 1N4CA 3DC5A 5CB4B 1M1KW 2F4VO 3P30A 5B1AB 5TISZ 3LSUA 1DF4A 3B8MA 3D36A 3H9VA 4X89A 1RM1B 3FYEB 4LF7B 1ZSPA 4NTWA 4JI2O 2Q9LA 2YI8A 2DE0X 2KB1A 3FB5C 2PYJA 1Q90D 1SRYA 4CBCA 2P4VA 1RPOA 4GX2A 5FNVA 2QEXV 3CXHF 3HKCA 3AG2B 4LBEC 1TAEA 4YJ2A 2XUMA 5B1AC 4GX0A 1R3LC 1K9MW 3AK1A 1TUBA 2EIJB 1QR9A 4UXNA 4X65B 4LFBO 3ZHQA 1RM1C 1NU1H 4AHCA 1WAZA 2B1IA 3RYFB 4IGGA 4CC6A 2AHZA 4IYIA 1YDXA 2EJRA 1NBMG 5LXTA 1L0LH 4X64B 1AR5A 4PV1B 2JGUA 2UXNA 3W7UA 1CP9A 4K8XA 2UXDO 1YHQV 1P7GA 2Q0AA 1J5EB 2UXCO 5JJJB 3AG2C 5EIBC 1YVWA 2F66C 4I50B 4TUYB 1AB3A 2EIJC 1IVSA 1E1QG 4DV6B 4ABMA 4U7NA 4TV8B 2IU0A 3JAMN 1JMKC 1Q43A 2VQEB 3E89A 3QVNA 2JJ1G 2UXXA 2RCVA 3RYIA 1SQPH 1VF6A 3CE2A 2Z5UA 1IBLO 2WSSG 3T1HO 1GM7A 3ZHTA 1SF9A 5JVDB 4O2AA 4LF8O 1XOUA 1GAXA 2CTQA 1JFFB 2LP7A 4X1YA 4AI8A 1ZAUA 3FB6C 2XAHA 2HHHB 1VQLV 2PY5A 4UCOA 1RPRA 3OW2U 3IC7A 4X1KB 1G1XB 3ZHVA 1K3EA 4LF9O 2IH1C 3WU2Z 2AW9A 2ZXWB 4Q20A 2HEPA 1Y74B 5EK0A 2JDIG 4RAIA 3JASB 2ITDC 2VS0A 1W2BU 2EILB 1HNWB 2KKWA 3ICXA 4J11A 4DW0A 2QWOB 2WLKA 4GX1A 5CMUA 1EN6A 1NI8A 1AR4A 3BA8A 2ZXWC 3PJSK 3OTOO 4KP4A 4IT5A 3JAKB 2D2CB 3MAQA 1D5NA 1G4YB 1ROPA 2IJJA 1IBKO 1Q6IA 5LYJA 2P67A 2EILC 3RYCA 5J2UA 4X66B 2HP8A 1QHTA 2AGAA 2A9HA 3A0HZ 4F6RB 3BA9A 1Q3EA 3E86A 2ATKC 4J9YB 2JEXA
chains in the Genus database with same CATH topology
2JIZG 3ZMSA 1NKDA 3ABMB 4KUMA 3E2EA 1Q81W 2OTLV 1VQKV 1H38A 3GB7C 2DYRC 4LCUC 1TUEB 1PL0A 1NQTA 2B1GA 1OHHG 3B77A 5CBHA 3OEEG 4DXWA 1FXVA 2YEVA 4XDJA 3MD0A 1YI2V 2D3OW 2YEVB 3OUSA 4F4LA 2IH3C 3QO8A 4UVAA 3OMNB 5L3BA 1VQMV 3MHHC 2XAJA 4PDLA 5GW7A 2ZR2A 5EC2C 3BEHA 1JJ2U 4PA7A 5LGTA 3OGCC 3ASOB 3CYOA 3AEIA 4FPPA 4QE7A 1L1FA 3SJQC 3ABMC 5LGNA 1QLNA 4G2KA 5B3SB 2WWWA 3E8GA 4N21A 4WFAV 3ASNB 3MHSC 4QPKA 2Y69B 3CCLV 1JOYA 1BHBA 2Q67A 4KFMA 4RUEA 5EC1C 3JD3A 1KECA 3LDCA 1S76D 4QNHB 1EFRG 1K5SA 1GM9A 4HYOA 4CZZA 1AROP 4ZKIA 5IDJA 1AJPA 4R6ZA 3CC7V 2ZR3A 4WFHA 3I55V 1VQ6V 4HAMA 2WLJA 3FB8C 3W7WA 3G71V 1OCCB 1YSCA 1S0VA 1M56B 1DF5A 3TETA 1K4DC 2JEUA 3CCQV 1QCEA 1G8MA 4X8AA 4XDKA 3OR7C 4N23A 3ZMVA 1KD1W 5B1OA 1V54B 4JAUA 2HFEC 3ASOC 4UVCA 3QO5A 2B5UA 1QBZA 5B3SC 1MOFA 1Y66A 1EBOA 1FFTB 3AG1B 3ASNC 3T2MA 5KA6A 2Y69C 4XDLA 2IW5A 1M9NA 1V55B 2HG5C 4BIZA 4E2LA 3W7SA 3TCUA 3CC2V 2C2AA 3ABTA 1GO3F 3K3WA 2IJKA 3FYIB 1SESA 4MVSA 3BY6A 2QM8A 2P6JA 3OM3B 1YTFD 4QIWF 5B1NA 4MT8A 4JGSA 5HFLA 3OR6C 3T4ZA 4JASA 2Q6AA 1OCCC 4J9ZB 1M56C 5L3DA 3CP1A 1F51A 2XASA 1N8RW 1K5QA 1Y4MA 1ORQC 5DM6V 1V54C 4WFEA 3LUTB 4BIUA 2X6BA 4PA3A 1PNMA 5KUKA 4PDVA 2ZDIA 3AG1C 2PI4A 3F5WC 2WLMA 3K08A 1KP2A 1V55C 3CD6V 3ETEA 3B8NA 1K4CC 5L3EA 5BZBA 2P7TC 1SERA 3LDDA 2P90A 1I5YA 1R6NA 4RO2A 1S5HC 3K79A 1H8HG 3NXSA 1QVFU 3ZJZA 3QO7A 2IJIA 1S77D 4PELA 1AJQA 1B6QA 2XAFA 5LHIA 3G6EV 1F4NA 1R73A 4RUFA 3ML0A 4YXWG 2QA4V 2DQ3A 1MSWD 2R9IA 1K7DA 2Q69A 2X7RB 3JCZA 3IFXA 3QNEA 3CCVV 3OMIB 4MVOA 2XNDG 2MK3A 1NH2B 1Q82W 3VBBA 3A0RA 4XBFA 2W6JG 2ZDIC 4L87A 1GTOA 3F7VC 1PKXA 4LP8A 5IYBO 5LHHA 3P32A 2QTOA 2Q68A 2EBOA 1ZWIC 3ETGA 3SPJA 3CXCU 3SYOA 2X6CA 2BOBC 1K34A 5H6QA 3CCJV 3CCRV 2W0FC 4MVMA 4G27B 1Q7YW 4MTXA 3OUFA 5EBMC 2BOCC 1YTFB 1OCZB 4JPRA 5IY5B 3DTUB 3LSSA 4P9PA 1QR8A 1W0JG 1KC8W 1KP3A 1NR7A 3OMAB 3LNMB 2WAMA 3ZN1A 3ZMUA 1DTOA 3E8HA 4G28B 2Z3YA 1JX9A 4ZBMA 1PNLA 3UM7A 2OTJV 3H01A 1JQ0A 3K0GA 4H37A 1YJWV 3KG2A 3W7XA 3ABUA 2DYSB 1LNQA 4MVZA 5L3GA 2XAQA 4WF9V 4WFBV 1S3JA 4UV9A 2EIMB 1QVGU 5LHGA 4MTGA 1GKFA 4R7CA 1XL6A 5DN6G 1YITV 1OCZC 5IY5C 5CN0A 3OEHG 4H33A 1VQ9V 1FXKA 3STZC 4BAYA 4QPJA 3AG4B 2LFSA 3EHBB 2W6IG 1FXKB 2IU3A 2NLJC 3LDEA 2OT5A 4MS2A 1K97A 4JF3A 1UJWB 1BHAA 5HFMA 4DO2A 5KUMA 2WLHA 3SYPA 4PDMA 3TK1A 5H6RA 4EKWA 5LGUA 5KA5A 4PA9A 3RBZA 5H9CA 3WFVA 2DYSC 3K06A 4MVRA 1QLEB 3T1CA 2EIMC 4FMTA 1GM8A 4BW5A 2V1DA 1VQ8V 3CCMV 3G4SV 3EFFK 3WG7B 1BMFG 2GHYA 1H2GA 4GCZA 1R6KA 3AG4C 3ZRSA 3W7TA 3E8BA 1FXKC 3STLC 4RQEA 1ENVA 5B1BB 4WCEV 3CMAV 5L3FA 2QM7A 4PDRA 3ZRWA 1S72V 4JAVA 4JYCA 3ZRXA 4QJFB 3I56V 4I9WA 2EZPA 3OAAG 1CEZA 3ZRWB 2DW4A 5IYCO 3T4DA 4TSFG 1I5XA 2FTKA 3FKSG 2HLDG 1WPXA 1W0KG 4P2ZA 1THZA 2HKOA 4TWKA 1M1KW 1F23A 3FB7C 3P30A 3SPIA 5B1AB 2M7WA 2DWEC 1QLEC 3F7YC 1E79G 1K33A 1M57B 1DF4A 3B8MA 3D36A 4MSWC 4X89A 3SPHA 1RM1B 2HVKC 3FYEB 2WLLA 3ZCCA 3WG7C 2IJHA 3OFNG 2JK5C 1OCOB 2WLLB 2WPDG 1VQ5V 3ZIAG 2KB1A 4MW3A 4JTDB 3FB5C 3LSQA 2X0LA 4X88A 3RW0A 5B1BC 1SRYA 4CBCA 1AI4A 4PA6A 1F4MA 1YIJV 1M90W 1RPOA 4GX2A 1K92A 1YJ9V 3ABKB 4MTFA 4UUJC 2QEXV 2Y48A 3SPGA 3DGEA 2A79B 3AG3B 1VQPV 3AG2B 4LBEC 3CPWU 1AI6A 5FL7G 5B1AC 4GX0A 1R3LC 2ZD9A 1K9MW 3ABLB 3HB3B 2EIJB 1QR9A 2EIKB 4UXNA 1M57C 1RM1C 1JPXA 4P9OA 2A0LA 2B1IA 4Z1MG 1OCOC 3VOUA 2AHZA 2EJRA 1PD3A 1EZJA 2X6AA 1NBMG 4JYBA 1E1RG 4P30A 1JVMA 3W7UA 2UXNA 3ABKC 1CP9A 2YSUB 1YHQV 3SYAA 4LC1A 3CCUV 2R9RB 1MABG 3AG3C 1XL4A 3AG2C 1AR1B 2DQ0A 4FIPC 4PA4A 1OCRB 1H8EG 5CA3A 3ABLC 2EIJC 2EIKC 1FXHA 1E1QG 1Q86W 2F43G 1YJNV 4MVQA 4U7NA 3ZMZA 2IU0A 1AJNA 4R8CA 4UV8A 1P7BA 3JD4A 3E89A 4QE9A 1AI5A 2JJ1G 2UXXA 1OZ0A 1R3KC 3SPCA 2Z5UA 3E35A 2WSSG 4GX5A 1GK9A 3JD2A 3UKMA 1GM7A 4MTOA 3ZMTA 3RVZA 3RVYA 1OCRC 2EINB 1NVPD 2HJFC 2HVJC 3ETDA 2LP7A 4MW8A 4UVBA 1MG1A 3FB6C 2HR3A 2XAHA 3IGAC 1BL8A 1WLEA 1VQLV 2QKSA 1NH2D 3OW2U 1RPRA 1SETA 3IC7A 3CC4V 1JCHA 2V7QG 4HZ3A 1FS0G 5CBFA 1SZTA 1K3EA 2OCCB 2QE7G 2JJ2G 2IH1C 1AI7A 4FK5C 2ZXWB 4Q20A 5LBQA 4R50A 5IYDO 1KQSU 1NJIW 1CPYA 1IXMA 5EK0A 4JTCB 2JDIG 4RAIA 1VQ4V 3SYCA 5C93A 2EINC 3JYCA 3CCEV 2H94A 2ITDC 2GSMB 1W2BU 3M99B 2EILB 4FJCC 1DLBA 3X2QB 5CBGA 3GWOA 1R3IC 1VQ7V 2EZOA 4MVUA 4WFGA 2ITCC 3HPLC 4ASUG 3ZRVA 2WLKA 4WFFA 4GX1A 5CMUA 1R3JC 1GMGA 3OE7G 2K1EA 2OCCC 2CK3G 3K0DA 2WLNA 3CCSV 2ZXWC 5EBWC 5EBLC 3D3IA 3PJSK 3SYQA 1HWYA 4KP4A 1NR1A 2WLIA 4TT3G 1G4YB 1ROPA 2IJJA 4I5SA 2DYRB 3JD0A 2WLIB 3R65A 3ZN0A 1VQOV 4JTAB 1COWG 1K8AW 1KKDA 2P67A 1K73W 2EILC 3X2QC 2AHYA 3E83A 3CMEV 3K9AA 1NVPB 4RQFA 2DWDC 2ZQMA 2PI5A 2XOKG 4GT1A 2LFRA 3E8FA 4OXSA 1P4RA 3JD1A 5E1AC 2A9HA 3K04A 5J9PC 1PNKA 2H8PC 1J95A 5L3CA 4U7OA 3E86A 2ATKC 1VQNV 2NNUA 2XAGA 4J9YB 2JEXA 3K03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F23 A;  1MG1 A;  5CN0 A;  2MK3 A;  3B8N A;  3M99 B;  3P30 A;  4FJC C;  1DLB A;  4JGS A;  5HFL A;  2M7W A;  3GWO A;  1K33 A;  1I5Y A;  1DF5 A;  2EZO A;  3CYO A;  1DF4 A;  3B8M A;  1QCE A;  4N23 A;  4G2K A;  4N21 A;  2OT5 A;  2EBO A;  1QR9 A;  1SZT A;  4JF3 A;  3MHS C;  5HFM A;  3B77 A;  3CP1 A;  4FIP C;  1ENV A;  3H01 A;  1JPX A;  1JQ0 A;  1QBZ A;  3K9A A;  1K34 A;  1MOF A;  1Y4M A;  4FK5 C;  1Y66 A;  1EBO A;  5CMU A;  5KA5 A;  5KA6 A;  2EZP A;  4E2L A;  4JPR A;  1I5X A;  5H9C A;  3WFV A;  2LP7 A;  1QR8 A;  2X7R B;  3MHH C;  2P6J A; 
#chains in the Genus database with same CATH topology
 2PTM A;  3ZMS A;  3ABM B;  2UUA B;  4Z2W A;  4GKJ B;  2R9A A;  2GTA A;  3SGI A;  4D6T H;  5F2V O;  1KU9 A;  3TXS A;  4OX9 B;  1OHH G;  1BGY H;  3OEE G;  2YEV A;  4PI0 A;  4OPA A;  2D3O W;  2EX3 A;  1VQM V;  3BFR A;  1Z5V A;  4PDL A;  4PA7 A;  1ZX3 A;  5LGT A;  5IWA O;  3OGC C;  3CYO A;  1FFX A;  4I4T A;  3SJQ C;  3ABM C;  4DV7 B;  3CCL V;  1JOY A;  4DR2 O;  3APQ A;  4ICG A;  1S76 D;  4ZKI A;  1ARO P;  2OYQ A;  3CC7 V;  1VAR A;  2ZR3 A;  3E22 B;  3I55 V;  1VQ6 V;  5GON B;  2WLJ A;  3G71 V;  2JVD A;  4UFZ A;  1M56 B;  3TET A;  3B4S A;  1K4D C;  3CCQ V;  1G8M A;  4X8A A;  4DYL A;  4N23 A;  2BTQ A;  4JV5 B;  2HFE C;  2B5U A;  2G38 A;  4C7U A;  1EBO A;  2KG7 B;  1IBM B;  3T2M A;  5KA6 A;  4XDL A;  1V55 B;  4BIZ A;  4E2L A;  3CC2 V;  3K3W A;  2IJK A;  3BY6 A;  4B3M B;  4O2B B;  2P6J A;  3Q4H B;  3OM3 B;  2E3C A;  1QU7 A;  1XUQ A;  5B1N A;  4JGS A;  5HFL A;  1R1B A;  3T4Z A;  5H5N A;  1KKC A;  1AIL A;  2CTP A;  1M56 C;  2Q5Z A;  5L3D A;  3CP1 A;  4QGP A;  5LMN O;  4IHJ A;  5DM6 V;  4O4H A;  4PA3 A;  5IYZ A;  3OT7 A;  5KMG B;  2ZDI A;  3F5W C;  3HKD B;  3KCX A;  1V55 C;  2BE3 A;  3B8N A;  5L3E A;  3UT5 A;  2P90 A;  4UCR A;  4RO2 A;  3K79 A;  1H8H G;  1QVF U;  2ZM6 B;  4FLX A;  1B6Q A;  4EEQ A;  2UU9 O;  1AP6 A;  1MMM A;  1XMQ B;  1K7D A;  2Q69 A;  4B7K A;  2XND G;  2MK3 A;  2Z0A A;  1NTZ H;  4XBF A;  4PI2 A;  4L87 A;  1GTO A;  4LP8 A;  1ZLZ A;  1ZWI C;  3CXC U;  2XT9 A;  4JZG A;  3THO A;  3CCJ V;  2W0F C;  1Q7Y W;  4U3J A;  5EBM C;  1Y76 B;  1YTF B;  1OCZ B;  4DR7 B;  3LSS A;  1U97 A;  1P49 A;  1W0J G;  3BAA A;  3ZMU A;  3C90 A;  1YXB A;  4DR5 O;  2ODM A;  1DK1 A;  4DK1 A;  1WJZ A;  4LF5 O;  4BIO A;  3ABU A;  2DYS B;  2UUC O;  4LWS B;  5LHG A;  3RT3 C;  4DV3 O;  4R7C A;  5BR8 B;  1YIT V;  1OCZ C;  4TQF A;  5AG2 A;  1VQ9 V;  1FXK A;  2LFS A;  4K8Z A;  5IJ9 A;  2IU3 A;  2Q4P A;  3LDE A;  2BCC H;  3M7M X;  4MS2 A;  4JF3 A;  2RJZ A;  2AXT Z;  1WP8 A;  3SR2 C;  3SYP A;  4DO2 A;  4AQY O;  1XMO O;  4PDM A;  4NVP A;  5KA5 A;  4DUY B;  2UXB O;  2YI9 A;  1H2S B;  4O4L B;  5CA1 A;  2DYS C;  1LUW A;  4JI3 O;  4LNU B;  3UO2 A;  3G4S V;  3EFF K;  3WG7 B;  1R6K A;  4LF7 O;  3E8B A;  4WCE V;  3STL C;  1ENV A;  5L3F A;  1WNS A;  1MA1 A;  4JAV A;  2EZP A;  1LR1 A;  3ZRW B;  2DW4 A;  4LH7 A;  4W4L A;  2CGO A;  3T4D A;  2YIC A;  3L73 H;  2HLD G;  1WPX A;  4P2Z A;  2HKO A;  4KXR A;  5JH7 A;  3SPI A;  2DWE C;  3F7Y C;  1E79 G;  1H2L A;  3SPH A;  2HVK C;  2ZIM A;  3WG7 C;  1R6T A;  2JK5 C;  4LF4 O;  2WPD G;  4JI5 B;  2E5L B;  4LFA B;  4LF6 O;  2X0L A;  4X88 A;  1GN2 A;  1N36 B;  3BAB A;  3SJB C;  1AI4 A;  1VF7 A;  1YJ9 V;  1K92 A;  3ABK B;  3DSQ A;  4UUJ C;  4X64 O;  2Y48 A;  3H1I H;  5FNV B;  3SPG A;  4DUZ O;  4X62 O;  3DGE A;  3AG3 B;  1SZX A;  3HKC B;  4LFC B;  4NYK A;  1AI6 A;  1L8D A;  5EYP A;  1H2K A;  3ABL B;  4YJ2 B;  4FFB A;  4P9O A;  1TUB B;  2A0L A;  3D36 C;  4JI7 B;  2DN9 A;  1MZF A;  4U3F H;  1EZJ A;  1E1R G;  4J7K A;  1JVM A;  5LXT B;  3ABK C;  2YSU B;  1FJG B;  4LC1 A;  4L8J A;  2R9R B;  3AG3 C;  4FIP C;  4UB6 Z;  4PA4 A;  1OCR B;  3ABL C;  5BY1 A;  4YIO A;  3CRQ A;  1FXH A;  1YZB A;  2F43 G;  1X59 A;  2PZS A;  2LO1 A;  1HNZ B;  4ZOL A;  3DXR A;  4R8C A;  1P7B A;  4JI1 O;  2HHH O;  2OCH A;  4J10 A;  1OZ0 A;  3FFQ A;  1R3K C;  1XQ8 A;  3SPC A;  4TV9 A;  4YJ3 A;  4NXN B;  1RFY A;  3E35 A;  3JD2 A;  4MTO A;  3ZMT A;  2JGD A;  3RN4 A;  1OCR C;  2EIN B;  1NVP D;  2HJF C;  2HVJ C;  1XNQ B;  4O2A B;  1VMG A;  4JI4 O;  2YIB A;  4X1Y B;  3IGA C;  4JI8 B;  2QKS A;  2ZNI A;  1H2M A;  1SET A;  5LA6 B;  1FS0 G;  2QE7 G;  1H2N A;  2F95 B;  2JJ2 G;  5LBQ A;  3J81 N;  1KQS U;  4W4K A;  1VF6 C;  1VQ4 V;  5LMU B;  5GTH Z;  5C93 A;  2EIN C;  2ETN A;  3CCE V;  2H94 A;  2LW1 A;  4FJC C;  1DLB A;  5LL6 Y;  3FD9 A;  4MVU A;  4DR1 B;  4WFG A;  3HKE A;  4ASU G;  3ZRV A;  5IJ0 A;  1R3J C;  3OE7 G;  1QQC A;  4FFK A;  1N33 O;  1XBL A;  4GKK O;  3K0D A;  1SKV A;  2WLN A;  1IX9 A;  4IIJ A;  3SYQ A;  4DR4 B;  1B3Q A;  4TT3 G;  1UFI A;  4I5S A;  1SQV H;  3VQX A;  3ZN0 A;  4DV2 B;  1VQO V;  1UPG A;  1COW G;  3T1Y O;  4TQD A;  5C8Y A;  2VWJ A;  3RYC B;  3CME V;  2B9Z A;  1ZTE A;  5J2U B;  4RQF A;  2DWD C;  2BSK B;  3J7A U;  1PNK A;  5L3C A;  4U7O A;  2AZ0 A;  3SJA C;  3ZHU A;  1VQN V;  2XAG A;  3BHP A;  1PNL A;  2JIZ G;  1NKD A;  1N32 B;  1S5J A;  3E2E A;  1Q81 W;  3H1L H;  3R66 A;  2OTL V;  5DEC A;  1VQK V;  1H38 A;  3G6B A;  2L35 A;  1TUE B;  2JS5 A;  1NQT A;  1RSO A;  5KLV H;  3B77 A;  3VQY A;  1FXV A;  3QTC A;  4XDJ A;  1YI2 V;  2YEV B;  4CS2 A;  3OMN B;  2FML A;  4X9Q A;  1Q6H A;  1JJO A;  5BMV B;  4O4J A;  1T5E A;  4H44 B;  4FM0 A;  2A06 H;  2Y4U A;  5JCO A;  5LGN A;  5D5P A;  4UCS A;  2WWW A;  3G67 A;  4CH6 A;  1FFX B;  4I4T B;  3CX5 F;  3L70 H;  3MHS C;  2Y69 B;  3U0Z A;  2RDC A;  1KYO F;  4UCT A;  2Q67 A;  4DR3 O;  1N34 O;  1BSM A;  5EC1 C;  1KEC A;  2Y4T A;  4B3M O;  5IDJ A;  1AJP A;  4R6Z A;  4WFH A;  1M93 A;  1DF5 A;  2FL4 A;  1SC5 B;  4X1I A;  5GTI Z;  1QCE A;  3ZMV A;  3OR7 C;  2P06 A;  2ZCE A;  3G80 A;  5B1O A;  4BW9 A;  4DV4 O;  4JI6 B;  3GVM A;  3WB2 A;  2BTQ B;  1MOF A;  1Y66 A;  1FFT B;  2WA4 A;  2GV9 A;  4GLX A;  3CHX A;  3LNN A;  2Y69 C;  1M9N A;  1SQB H;  2HG5 C;  1GO3 F;  1SES A;  4GUN A;  4O4I A;  1XHZ A;  3OR6 C;  4RWU A;  1FAF A;  4JAS A;  3A0B Z;  4B3T O;  1NTM H;  2Q6A A;  2ZM6 O;  1N8R W;  1Y4M A;  4DV5 B;  1ORQ C;  1VIB A;  2X6B A;  4IHJ B;  4O4H B;  2IM9 A;  2PI4 A;  3K08 A;  3JSN A;  3BRC A;  4BWA A;  2E76 B;  1Y67 A;  5IYZ B;  2W0X A;  2Q7H A;  1XI1 A;  4JYA B;  1R6N A;  1S5H C;  3UT5 B;  4AIL C;  4JI0 O;  3NXS A;  2JRI A;  2A7W A;  4DR6 B;  1YEW A;  3TJT A;  3JAT A;  2CTW A;  1AJQ A;  2ZKO A;  2K9P A;  1F4N A;  1R73 A;  4K0K B;  1NTK H;  3ML0 A;  2DQ3 A;  1MSW D;  3JCZ A;  3QNE A;  4D7T A;  1SS3 A;  3CCV V;  3K5M A;  3OMI B;  4MVO A;  2F4V B;  1LUV A;  4FVM A;  1NH2 B;  2CGN A;  2ADQ B;  2ZDI C;  2Y0P A;  3F7V C;  5IYB O;  2YDE A;  1PM9 A;  3RFR A;  4K35 A;  2X6C A;  2BOB C;  4JI2 B;  1FYJ A;  4CS4 A;  4MVM A;  1MNG A;  2Y0I A;  4J42 A;  1XRE A;  2BOC C;  1HR0 O;  2P22 C;  4JPR A;  3K5L A;  1US6 A;  4U3J B;  3DTU B;  4OPH A;  3ZED A;  2F23 A;  5BR8 O;  1NR7 A;  3LNM B;  1O9H A;  1DTO A;  2QR4 A;  2UUB B;  4ZBM A;  2PGG A;  4LFB B;  3H01 A;  2VQF O;  4J80 A;  4ZHQ A;  4A5U B;  4MVZ A;  4DRX A;  1QVG U;  1GKF A;  5DN6 G;  2OIG A;  5FPO A;  3STZ C;  4QPJ A;  2UXD B;  1FXK B;  4FLU A;  2NLJ C;  2UXC B;  3ETQ A;  5IJ9 B;  1WP7 A;  2WLH A;  3SJC C;  3H1K H;  5H6R A;  4E4E A;  3K5N A;  4PA9 A;  3RBZ A;  1HNX O;  2LQT A;  2LGQ A;  4MVR A;  3CRR A;  1JR9 A;  5CA1 B;  1GRJ A;  2QSA A;  1OJH A;  4GCZ A;  1G6U A;  2RQ6 A;  2OIE A;  3W7T A;  3ZX6 A;  1FXK C;  4RQE A;  2E5L O;  5B1B B;  1IBL B;  2QM7 A;  4KHP O;  3P3N A;  3T1H B;  2YS8 A;  4I9W A;  2GBO A;  4LF8 B;  4B3R O;  4TSF G;  1S5L Z;  4TWK A;  2CDY A;  2QWN B;  1IDS A;  1EN5 A;  4NR1 A;  2CH7 A;  1F23 A;  3IJ4 A;  2M7W A;  4GYC B;  5JH7 B;  1K33 A;  3K58 A;  2YXY A;  2WLL A;  4B3S O;  3ZCC A;  2IJH A;  3OFN G;  4Q6G A;  4LF9 B;  4YY3 O;  3WB0 A;  3ZIA G;  4MW3 A;  4JTD B;  3LSQ A;  2F93 B;  3H1H H;  3RW0 A;  5B1B C;  1YIJ V;  5K1P A;  2GUZ A;  4CH5 A;  2A79 B;  1FPO A;  4DV1 O;  4ZI7 A;  3APO A;  5FL7 G;  5EYP B;  5EZY A;  1JPX A;  1Y6X A;  2QWQ B;  4OGQ B;  2XHB A;  4Z1M G;  4FFB B;  4D7S A;  4JZ2 A;  1PD3 A;  2X6A A;  4JYB A;  1HNZ O;  3OTO B;  1IBK B;  3SYA A;  1U96 A;  3CCU V;  4NXM O;  1MAB G;  2Q0O C;  1XL4 A;  2QWP B;  3I5D A;  1DGS A;  4NXN O;  3N2G A;  3U11 A;  2ZIN A;  5B5E Z;  1SQF A;  5K1X A;  1AJN A;  4UV8 A;  4ZOL B;  3DXR B;  3JD4 A;  2XTA A;  1HDJ A;  4WBN A;  2ZT9 B;  4QE9 A;  3CJH A;  3TGU H;  1AI5 A;  2QGN A;  1AVM A;  1BS3 A;  4GX5 A;  3S3W A;  4TV9 B;  3UKM A;  1KB9 F;  3RVZ A;  1PV0 A;  1ZL8 B;  3ETD A;  1BQ0 A;  4CH4 A;  2P5O A;  4MW8 A;  3BCC H;  2HR3 A;  5KHH A;  5IWA B;  1WLE A;  2QKC A;  4DR1 O;  4PHZ A;  3CC4 V;  5DED A;  2V7Q G;  5CBF A;  1SZT A;  3JAW A;  5J2T A;  1AP5 A;  1YF2 A;  4FK5 C;  4X20 A;  5IYD O;  4DR2 B;  1BZK A;  1CPY A;  1IXM A;  4JTC B;  2CUG A;  2H3O A;  2QM4 A;  2L6L A;  1I94 B;  5A2Q N;  5CBG A;  3GWO A;  1R3I C;  2FKX A;  4FM1 A;  1VP7 A;  2ITC C;  4X65 O;  5ITZ A;  2EJ7 A;  3VQW A;  4EFE A;  1GMG A;  3HKE B;  4NTY A;  2K1E A;  5IJ0 B;  5LP6 A;  2GDS A;  4GZR B;  5EBW C;  2FYU H;  3D3I A;  2ILM A;  2E74 B;  2WLI A;  4IIJ B;  5KX5 A;  3JAR A;  3J80 N;  3R65 A;  4JTA B;  1J5E O;  1K73 W;  2OWO A;  3E83 A;  3K9A A;  1NVP B;  5LMN B;  5C8Y B;  2XOK G;  4GT1 A;  2LFR A;  3E8F A;  1P4R A;  2F1M A;  3JD1 A;  5D5Q A;  3K04 A;  4DV6 O;  2H8P C;  3N27 A;  2NNU A;  4UB8 Z;  1KBH A;  2VQE O;  4KUM A;  2ZE5 A;  1TVK A;  1Q6U A;  4LCU C;  5CBH A;  4DXW A;  1RSO B;  3MD0 A;  2UU9 B;  3OUS A;  4F4L A;  1PL4 A;  4UVA A;  5L3B A;  3WB1 A;  4B7E A;  2VWK A;  2XAJ A;  3TXQ A;  2ARH A;  2ZR2 A;  5EC2 C;  3BEH A;  1JJ2 U;  2NR5 A;  2Q8V A;  4CH3 A;  1FKA O;  3JAL A;  4I0X A;  4O4J B;  3ASO B;  3AEI A;  4G2K A;  3RWR D;  5B3S B;  3E8G A;  5H2F Z;  4WFA V;  3ASN B;  3JCU Z;  4QPK A;  1M4U A;  4BR6 A;  3RYI B;  5LOV A;  4CS3 A;  3L71 H;  4KFM A;  4RUE A;  3VQV A;  1PP9 H;  4QNH B;  1K5S A;  4HYO A;  4CZZ A;  4YHH B;  3N2K A;  1HNW O;  1OCC B;  1YSC A;  5KHG A;  3ZHR A;  4DR5 B;  3ZS8 C;  3ASO C;  3QO5 A;  1QBZ A;  4DV5 O;  5B3S C;  5JCO C;  1EN4 A;  1SA0 A;  3HKB A;  3AG1 B;  3ASN C;  4LF5 B;  4H0L B;  2PUS A;  2UUC B;  2C2A A;  1WA8 A;  2E75 B;  3FYI B;  4DV3 B;  2QM8 A;  2YIA A;  1GN6 A;  4O4I B;  3UQ8 A;  4QIW F;  1OCC C;  4DR6 O;  4X66 O;  1XMO B;  1PNM A;  5KUK A;  2UXB B;  2VRZ A;  3AG1 C;  1NS1 A;  2WLM A;  4LR3 A;  1KP2 A;  3CWB H;  3D8C A;  4JI3 B;  3ETE A;  1K4C C;  4JAA A;  5BZB A;  2UUA O;  2P7T C;  4HNA A;  3LDD A;  4GKJ O;  1I5Y A;  1HP8 A;  1A32 A;  5LYJ B;  3FAV A;  3ZJZ A;  4OX9 O;  2N04 A;  1S77 D;  2XAF A;  3JAT B;  2QA4 V;  1KUQ A;  3IFX A;  3PN1 A;  4UCV A;  1EM1 A;  5JQG A;  2UUB O;  3CSX A;  2W6J G;  2AZ2 A;  4DV7 O;  1MSD A;  3SPJ A;  5IE9 A;  4LF4 B;  4PD4 F;  5A9G A;  5H6Q A;  3CCR V;  4LF6 B;  4G27 B;  2YUA A;  3OTF A;  1XNR B;  3BVO A;  3QF7 A;  1WB8 A;  1KC8 W;  3OMA B;  3KCY A;  2ZE7 A;  4DUZ B;  1OV9 A;  4X62 B;  3ZN1 A;  3E8H A;  2Z3Y A;  4JV5 O;  3JSL A;  5JJE B;  1JQ0 A;  4H37 A;  3OGI B;  1IBM O;  3W7X A;  1LNQ A;  4YIP A;  1KMI Z;  4WF9 V;  4WFB V;  1S3J A;  4UV9 A;  4ZHQ B;  4MTG A;  2ZIO A;  4DRX B;  3CS5 A;  3C3S A;  3H1J H;  4H33 A;  3CRM A;  4BAY A;  4I9Q A;  3AG4 B;  3RYH A;  4EB6 A;  1EZV H;  1K97 A;  3CB2 A;  5EIB D;  5HFM A;  3GWK C;  5JWP A;  2Q7G A;  1WN7 A;  2ZE8 A;  2CAZ C;  3WFV A;  4FLW A;  3K06 A;  1QLE B;  3ZBH A;  3T1C A;  1NZ6 A;  1VQ8 V;  1GM8 A;  4JI1 B;  2RMK B;  5LA6 A;  1BMF G;  1JA8 A;  4I55 A;  4K3A A;  4J41 A;  4DV0 B;  2YID A;  1B04 A;  3AG4 C;  1BE3 H;  1URF A;  4PDR A;  1S72 V;  3ZRX A;  4QJF B;  1WB7 A;  3L72 H;  5CA0 A;  1XMQ O;  2QJ1 A;  5IYC O;  5CB4 A;  2FTK A;  1W0K G;  1THZ A;  4JI4 B;  1IUR A;  3L9D A;  3FB7 C;  1B06 A;  2CH7 B;  1QLE C;  4UCU A;  3EVK A;  1M57 B;  4TOI A;  4MSW C;  4FLY A;  1OCO B;  3DC6 A;  4FLV A;  2WLL B;  1VQ5 V;  1I08 A;  4PA6 A;  1F4M A;  1M90 W;  4DR7 O;  3A8T A;  2KQX A;  4MTF A;  1TGO A;  3U10 A;  1I7F A;  1O9G A;  2GUZ B;  1D2D A;  3SDL A;  2DOS A;  1VQP V;  3CPW U;  5KHK A;  1Z5W A;  4ZI7 B;  2ZD9 A;  3HB3 B;  2EIK B;  2A3Q A;  1M57 C;  3AK2 A;  1XHX A;  3RYF A;  4IL6 Z;  4FLT A;  2BSK A;  5EZY B;  1OCO C;  4DW1 A;  3VOU A;  1N33 B;  4GKK B;  4P30 A;  3CEI A;  2CTR A;  3S3X A;  3T1Y B;  4I50 A;  2KSD A;  4TUY A;  4Z1V A;  1AR1 B;  2DQ0 A;  4KL1 A;  1N0J A;  1H8E G;  5CA3 A;  3N2G B;  2EIK C;  2EUL A;  4DUY O;  4TV8 A;  1VEW A;  1Q86 W;  5BMV A;  1YJN V;  4MVQ A;  3ZMZ A;  2R70 A;  2RN9 A;  1TA8 A;  2ZE6 A;  4WBN B;  2LW7 A;  3CJH B;  5IT9 N;  3K57 A;  4FZ1 A;  5JVD A;  1GK9 A;  1JFF A;  3RVY A;  3FX7 A;  1IZ3 A;  1I94 O;  4UVB A;  1MG1 A;  4F6E A;  1BL8 A;  4X1K A;  1NH2 D;  2PYL A;  1JCH A;  4HZ3 A;  2V4D A;  2OCC B;  2LGW A;  4JI5 O;  2BTO A;  1AI7 A;  2WA3 A;  1W59 A;  3JAW B;  5JJN B;  4LFA O;  5J2T B;  1Y74 A;  1N36 O;  4R50 A;  5KAI Z;  4DR3 B;  1N34 B;  4X20 B;  1NJI W;  3D3Q A;  3JAS A;  2QDO A;  3SYC A;  1GN3 A;  3JYC A;  3K9S A;  2GSM B;  3M99 B;  3X2Q B;  1D5A A;  2PF4 E;  4LFC O;  2M6Y A;  1VQ7 V;  1X4T A;  2EZO A;  3EXA A;  2R72 A;  3ZHS A;  4DV4 B;  4JYY A;  3HPL C;  4WFF A;  4JI7 O;  5ITZ B;  2OCC C;  2CK3 G;  3QG5 A;  1WPB A;  3CCS V;  3JAK A;  5EBL C;  5LP6 B;  3HR0 A;  1HWY A;  2MW2 B;  1NR1 A;  3K5O A;  1V9P A;  2DYR B;  2ADP A;  3JD0 A;  2WLI B;  1FJG O;  1L0N H;  1K8A W;  5KX5 B;  3JAR B;  1KKD A;  4B3T B;  3X2Q C;  2AHY A;  2ZQM A;  4HBN A;  2PI5 A;  4F6R A;  2JS3 A;  4OXS A;  2NN4 A;  5E1A C;  5J9P C;  2QWR B;  2QKA A;  2Q73 A;  1J95 A;  1CXZ B;  4FM2 A;  3K03 A;  3O9O A;  5LP6 C;  2LJ2 A;  3GB7 C;  4JI0 B;  2P4K A;  2DYR C;  1TVK B;  1XDC A;  1PL0 A;  2B1G A;  4LH6 A;  3C3T A;  2IH3 C;  3QO8 A;  3BPZ A;  1XNQ O;  4NTX A;  3MHH C;  4YHH O;  5KHI A;  5GW7 A;  1VF5 B;  1XEQ A;  4JI8 O;  4FPP A;  4QE7 A;  1L1F A;  1QLN A;  3JAL B;  4I0X B;  4N21 A;  1NT2 B;  1BHB A;  3L75 H;  4YJ3 B;  3IAY A;  3K59 A;  5LOV B;  2ZNJ A;  3JD3 A;  3MDS A;  5KAF Z;  1HR0 B;  3LDC A;  1EFR G;  2JGD B;  1Q8I A;  1GM9 A;  3E22 A;  5LMU O;  5GON A;  2N05 A;  2CE4 A;  4HAM A;  3FB8 C;  3W7W A;  3N2K B;  1S0V A;  2YXL A;  2JEU A;  3L74 H;  3OD4 A;  4XDK A;  1KD1 W;  4DK0 A;  1V54 B;  4JAU A;  4UVC A;  4B08 A;  2KG7 A;  1N0N A;  3UO3 A;  2VQF B;  4J7Z A;  1SA0 B;  2IW5 A;  3HKB B;  3W7S A;  5BXZ A;  4O2B A;  3RGB A;  3ABT A;  3TCU A;  3Q4H A;  3CRC A;  4MVS A;  1BQZ A;  1WA8 B;  1RP3 B;  4DR4 O;  3F5T A;  1YTF D;  4MT8 A;  4DV2 O;  4PJ0 Z;  4J9Z B;  1GH6 A;  1F51 A;  1PPJ H;  2XAS A;  3KKY A;  3B2E E;  1K5Q A;  1V54 C;  4WFE A;  5FPR A;  3LUT B;  4BIU A;  2RNB A;  5KMG A;  4PDV A;  4I7Z B;  4NKG B;  3HKD A;  1HNX B;  1FD9 A;  4EFB A;  3CD6 V;  1N32 O;  1SER A;  1SQX H;  4FLZ A;  4HNA B;  4H13 B;  3QO7 A;  2IJI A;  3FAV B;  4PEL A;  3A2F A;  4KHP B;  1XNR O;  5LHI A;  3G6E V;  3NR7 A;  4RUF A;  4YXW G;  4B3R B;  2R9I A;  2X7R B;  3O65 A;  5FLX N;  1Q82 W;  1QNM A;  2GTS A;  3A0R A;  3VBB A;  3UCS C;  4J7J A;  5JQG B;  1PKX A;  5LHH A;  3P32 A;  2QTO A;  5KHJ A;  2YIB D;  4B3S B;  2Q68 A;  2EBO A;  3ETG A;  3SYO A;  2FB5 A;  1K34 A;  2QTS A;  4YY3 B;  1P84 F;  3B40 A;  2IBZ H;  1Y76 A;  4MTX A;  3OUF A;  5IY5 B;  4P9P A;  1QR8 A;  1KP3 A;  4ZIB A;  1Z2G A;  1XIL A;  2WAM A;  1BCC H;  2YXH A;  4G28 B;  2DJV A;  4DV1 B;  1JX9 A;  3AG7 A;  3AK3 A;  3UM7 A;  1HW7 A;  4FZ0 A;  2OTJ V;  1I0H A;  1GN4 A;  1YCI A;  4JI6 O;  3K0G A;  1YJW V;  4LWS A;  3KG2 A;  3M8A A;  5L3G A;  2XAQ A;  2EIM B;  1SQG A;  1ZUQ A;  2HJD A;  1XL6 A;  4NB5 A;  5IY5 C;  5CN0 A;  3OEH G;  2Q7E A;  2YC0 A;  3P3P A;  4CC5 A;  3EHB B;  4DV0 O;  2W6I G;  4NXM B;  3KZI Z;  3RYH B;  2OT5 A;  4EB6 B;  3IC9 A;  4X1I B;  1UJW B;  1BHA A;  5KUM A;  3B09 A;  3TK1 A;  4EKW A;  5LGU A;  4O4L A;  1ZL8 A;  5E79 Z;  5H9C A;  1MZE A;  4IYH A;  4LNU A;  2EIM C;  4FMT A;  4BW5 A;  2V1D A;  1SQQ H;  3CRA A;  4JYA O;  3CCM V;  2GHY A;  1H2G A;  2DMX A;  4I55 B;  3ZRS A;  2O57 A;  5B66 Z;  3CMA V;  4AQY B;  3ZRW A;  3I56 V;  4JYC A;  1F7Y A;  4K0K O;  1IXB A;  3OAA G;  1CEZ A;  2N74 A;  1M5I A;  5CA0 B;  1I5X A;  3FKS G;  1Q5O A;  1BT8 A;  1N4C A;  3DC5 A;  5CB4 B;  1M1K W;  2F4V O;  3P30 A;  5B1A B;  5TIS Z;  3LSU A;  1DF4 A;  3B8M A;  3D36 A;  3H9V A;  4X89 A;  1RM1 B;  3FYE B;  4LF7 B;  1ZSP A;  4NTW A;  4JI2 O;  2Q9L A;  2YI8 A;  2DE0 X;  2KB1 A;  3FB5 C;  2PYJ A;  1Q90 D;  1SRY A;  4CBC A;  2P4V A;  1RPO A;  4GX2 A;  5FNV A;  2QEX V;  3CXH F;  3HKC A;  3AG2 B;  4LBE C;  1TAE A;  4YJ2 A;  2XUM A;  5B1A C;  4GX0 A;  1R3L C;  1K9M W;  3AK1 A;  1TUB A;  2EIJ B;  1QR9 A;  4UXN A;  4X65 B;  4LFB O;  3ZHQ A;  1RM1 C;  1NU1 H;  4AHC A;  1WAZ A;  2B1I A;  3RYF B;  4IGG A;  4CC6 A;  2AHZ A;  4IYI A;  1YDX A;  2EJR A;  1NBM G;  5LXT A;  1L0L H;  4X64 B;  1AR5 A;  4PV1 B;  2JGU A;  2UXN A;  3W7U A;  1CP9 A;  4K8X A;  2UXD O;  1YHQ V;  1P7G A;  2Q0A A;  1J5E B;  2UXC O;  5JJJ B;  3AG2 C;  5EIB C;  1YVW A;  2F66 C;  4I50 B;  4TUY B;  1AB3 A;  2EIJ C;  1IVS A;  1E1Q G;  4DV6 B;  4ABM A;  4U7N A;  4TV8 B;  2IU0 A;  3JAM N;  1JMK C;  1Q43 A;  2VQE B;  3E89 A;  3QVN A;  2JJ1 G;  2UXX A;  2RCV A;  3RYI A;  1SQP H;  1VF6 A;  3CE2 A;  2Z5U A;  1IBL O;  2WSS G;  3T1H O;  1GM7 A;  3ZHT A;  1SF9 A;  5JVD B;  4O2A A;  4LF8 O;  1XOU A;  1GAX A;  2CTQ A;  1JFF B;  2LP7 A;  4X1Y A;  4AI8 A;  1ZAU A;  3FB6 C;  2XAH A;  2HHH B;  1VQL V;  2PY5 A;  4UCO A;  1RPR A;  3OW2 U;  3IC7 A;  4X1K B;  1G1X B;  3ZHV A;  1K3E A;  4LF9 O;  2IH1 C;  3WU2 Z;  2AW9 A;  2ZXW B;  4Q20 A;  2HEP A;  1Y74 B;  5EK0 A;  2JDI G;  4RAI A;  3JAS B;  2ITD C;  2VS0 A;  1W2B U;  2EIL B;  1HNW B;  2KKW A;  3ICX A;  4J11 A;  4DW0 A;  2QWO B;  2WLK A;  4GX1 A;  5CMU A;  1EN6 A;  1NI8 A;  1AR4 A;  3BA8 A;  2ZXW C;  3PJS K;  3OTO O;  4KP4 A;  4IT5 A;  3JAK B;  2D2C B;  3MAQ A;  1D5N A;  1G4Y B;  1ROP A;  2IJJ A;  1IBK O;  1Q6I A;  5LYJ A;  2P67 A;  2EIL C;  3RYC A;  5J2U A;  4X66 B;  2HP8 A;  1QHT A;  2AGA A;  2A9H A;  3A0H Z;  4F6R B;  3BA9 A;  1Q3E A;  3E86 A;  2ATK C;  4J9Y B;  2JEX A; 
#chains in the Genus database with same CATH homology
 2JIZ G;  3ZMS A;  1NKD A;  3ABM B;  4KUM A;  3E2E A;  1Q81 W;  2OTL V;  1VQK V;  1H38 A;  3GB7 C;  2DYR C;  4LCU C;  1TUE B;  1PL0 A;  1NQT A;  2B1G A;  1OHH G;  3B77 A;  5CBH A;  3OEE G;  4DXW A;  1FXV A;  2YEV A;  4XDJ A;  3MD0 A;  1YI2 V;  2D3O W;  2YEV B;  3OUS A;  4F4L A;  2IH3 C;  3QO8 A;  4UVA A;  3OMN B;  5L3B A;  1VQM V;  3MHH C;  2XAJ A;  4PDL A;  5GW7 A;  2ZR2 A;  5EC2 C;  3BEH A;  1JJ2 U;  4PA7 A;  5LGT A;  3OGC C;  3ASO B;  3CYO A;  3AEI A;  4FPP A;  4QE7 A;  1L1F A;  3SJQ C;  3ABM C;  5LGN A;  1QLN A;  4G2K A;  5B3S B;  2WWW A;  3E8G A;  4N21 A;  4WFA V;  3ASN B;  3MHS C;  4QPK A;  2Y69 B;  3CCL V;  1JOY A;  1BHB A;  2Q67 A;  4KFM A;  4RUE A;  5EC1 C;  3JD3 A;  1KEC A;  3LDC A;  1S76 D;  4QNH B;  1EFR G;  1K5S A;  1GM9 A;  4HYO A;  4CZZ A;  1ARO P;  4ZKI A;  5IDJ A;  1AJP A;  4R6Z A;  3CC7 V;  2ZR3 A;  4WFH A;  3I55 V;  1VQ6 V;  4HAM A;  2WLJ A;  3FB8 C;  3W7W A;  3G71 V;  1OCC B;  1YSC A;  1S0V A;  1M56 B;  1DF5 A;  3TET A;  1K4D C;  2JEU A;  3CCQ V;  1QCE A;  1G8M A;  4X8A A;  4XDK A;  3OR7 C;  4N23 A;  3ZMV A;  1KD1 W;  5B1O A;  1V54 B;  4JAU A;  2HFE C;  3ASO C;  4UVC A;  3QO5 A;  2B5U A;  1QBZ A;  5B3S C;  1MOF A;  1Y66 A;  1EBO A;  1FFT B;  3AG1 B;  3ASN C;  3T2M A;  5KA6 A;  2Y69 C;  4XDL A;  2IW5 A;  1M9N A;  1V55 B;  2HG5 C;  4BIZ A;  4E2L A;  3W7S A;  3TCU A;  3CC2 V;  2C2A A;  3ABT A;  1GO3 F;  3K3W A;  2IJK A;  3FYI B;  1SES A;  4MVS A;  3BY6 A;  2QM8 A;  2P6J A;  3OM3 B;  1YTF D;  4QIW F;  5B1N A;  4MT8 A;  4JGS A;  5HFL A;  3OR6 C;  3T4Z A;  4JAS A;  2Q6A A;  1OCC C;  4J9Z B;  1M56 C;  5L3D A;  3CP1 A;  1F51 A;  2XAS A;  1N8R W;  1K5Q A;  1Y4M A;  1ORQ C;  5DM6 V;  1V54 C;  4WFE A;  3LUT B;  4BIU A;  2X6B A;  4PA3 A;  1PNM A;  5KUK A;  4PDV A;  2ZDI A;  3AG1 C;  2PI4 A;  3F5W C;  2WLM A;  3K08 A;  1KP2 A;  1V55 C;  3CD6 V;  3ETE A;  3B8N A;  1K4C C;  5L3E A;  5BZB A;  2P7T C;  1SER A;  3LDD A;  2P90 A;  1I5Y A;  1R6N A;  4RO2 A;  1S5H C;  3K79 A;  1H8H G;  3NXS A;  1QVF U;  3ZJZ A;  3QO7 A;  2IJI A;  1S77 D;  4PEL A;  1AJQ A;  1B6Q A;  2XAF A;  5LHI A;  3G6E V;  1F4N A;  1R73 A;  4RUF A;  3ML0 A;  4YXW G;  2QA4 V;  2DQ3 A;  1MSW D;  2R9I A;  1K7D A;  2Q69 A;  2X7R B;  3JCZ A;  3IFX A;  3QNE A;  3CCV V;  3OMI B;  4MVO A;  2XND G;  2MK3 A;  1NH2 B;  1Q82 W;  3VBB A;  3A0R A;  4XBF A;  2W6J G;  2ZDI C;  4L87 A;  1GTO A;  3F7V C;  1PKX A;  4LP8 A;  5IYB O;  5LHH A;  3P32 A;  2QTO A;  2Q68 A;  2EBO A;  1ZWI C;  3ETG A;  3SPJ A;  3CXC U;  3SYO A;  2X6C A;  2BOB C;  1K34 A;  5H6Q A;  3CCJ V;  3CCR V;  2W0F C;  4MVM A;  4G27 B;  1Q7Y W;  4MTX A;  3OUF A;  5EBM C;  2BOC C;  1YTF B;  1OCZ B;  4JPR A;  5IY5 B;  3DTU B;  3LSS A;  4P9P A;  1QR8 A;  1W0J G;  1KC8 W;  1KP3 A;  1NR7 A;  3OMA B;  3LNM B;  2WAM A;  3ZN1 A;  3ZMU A;  1DTO A;  3E8H A;  4G28 B;  2Z3Y A;  1JX9 A;  4ZBM A;  1PNL A;  3UM7 A;  2OTJ V;  3H01 A;  1JQ0 A;  3K0G A;  4H37 A;  1YJW V;  3KG2 A;  3W7X A;  3ABU A;  2DYS B;  1LNQ A;  4MVZ A;  5L3G A;  2XAQ A;  4WF9 V;  4WFB V;  1S3J A;  4UV9 A;  2EIM B;  1QVG U;  5LHG A;  4MTG A;  1GKF A;  4R7C A;  1XL6 A;  5DN6 G;  1YIT V;  1OCZ C;  5IY5 C;  5CN0 A;  3OEH G;  4H33 A;  1VQ9 V;  1FXK A;  3STZ C;  4BAY A;  4QPJ A;  3AG4 B;  2LFS A;  3EHB B;  2W6I G;  1FXK B;  2IU3 A;  2NLJ C;  3LDE A;  2OT5 A;  4MS2 A;  1K97 A;  4JF3 A;  1UJW B;  1BHA A;  5HFM A;  4DO2 A;  5KUM A;  2WLH A;  3SYP A;  4PDM A;  3TK1 A;  5H6R A;  4EKW A;  5LGU A;  5KA5 A;  4PA9 A;  3RBZ A;  5H9C A;  3WFV A;  2DYS C;  3K06 A;  4MVR A;  1QLE B;  3T1C A;  2EIM C;  4FMT A;  1GM8 A;  4BW5 A;  2V1D A;  1VQ8 V;  3CCM V;  3G4S V;  3EFF K;  3WG7 B;  1BMF G;  2GHY A;  1H2G A;  4GCZ A;  1R6K A;  3AG4 C;  3ZRS A;  3W7T A;  3E8B A;  1FXK C;  3STL C;  4RQE A;  1ENV A;  5B1B B;  4WCE V;  3CMA V;  5L3F A;  2QM7 A;  4PDR A;  3ZRW A;  1S72 V;  4JAV A;  4JYC A;  3ZRX A;  4QJF B;  3I56 V;  4I9W A;  2EZP A;  3OAA G;  1CEZ A;  3ZRW B;  2DW4 A;  5IYC O;  3T4D A;  4TSF G;  1I5X A;  2FTK A;  3FKS G;  2HLD G;  1WPX A;  1W0K G;  4P2Z A;  1THZ A;  2HKO A;  4TWK A;  1M1K W;  1F23 A;  3FB7 C;  3P30 A;  3SPI A;  5B1A B;  2M7W A;  2DWE C;  1QLE C;  3F7Y C;  1E79 G;  1K33 A;  1M57 B;  1DF4 A;  3B8M A;  3D36 A;  4MSW C;  4X89 A;  3SPH A;  1RM1 B;  2HVK C;  3FYE B;  2WLL A;  3ZCC A;  3WG7 C;  2IJH A;  3OFN G;  2JK5 C;  1OCO B;  2WLL B;  2WPD G;  1VQ5 V;  3ZIA G;  2KB1 A;  4MW3 A;  4JTD B;  3FB5 C;  3LSQ A;  2X0L A;  4X88 A;  3RW0 A;  5B1B C;  1SRY A;  4CBC A;  1AI4 A;  4PA6 A;  1F4M A;  1YIJ V;  1M90 W;  1RPO A;  4GX2 A;  1K92 A;  1YJ9 V;  3ABK B;  4MTF A;  4UUJ C;  2QEX V;  2Y48 A;  3SPG A;  3DGE A;  2A79 B;  3AG3 B;  1VQP V;  3AG2 B;  4LBE C;  3CPW U;  1AI6 A;  5FL7 G;  5B1A C;  4GX0 A;  1R3L C;  2ZD9 A;  1K9M W;  3ABL B;  3HB3 B;  2EIJ B;  1QR9 A;  2EIK B;  4UXN A;  1M57 C;  1RM1 C;  1JPX A;  4P9O A;  2A0L A;  2B1I A;  4Z1M G;  1OCO C;  3VOU A;  2AHZ A;  2EJR A;  1PD3 A;  1EZJ A;  2X6A A;  1NBM G;  4JYB A;  1E1R G;  4P30 A;  1JVM A;  3W7U A;  2UXN A;  3ABK C;  1CP9 A;  2YSU B;  1YHQ V;  3SYA A;  4LC1 A;  3CCU V;  2R9R B;  1MAB G;  3AG3 C;  1XL4 A;  3AG2 C;  1AR1 B;  2DQ0 A;  4FIP C;  4PA4 A;  1OCR B;  1H8E G;  5CA3 A;  3ABL C;  2EIJ C;  2EIK C;  1FXH A;  1E1Q G;  1Q86 W;  2F43 G;  1YJN V;  4MVQ A;  4U7N A;  3ZMZ A;  2IU0 A;  1AJN A;  4R8C A;  4UV8 A;  1P7B A;  3JD4 A;  3E89 A;  4QE9 A;  1AI5 A;  2JJ1 G;  2UXX A;  1OZ0 A;  1R3K C;  3SPC A;  2Z5U A;  3E35 A;  2WSS G;  4GX5 A;  1GK9 A;  3JD2 A;  3UKM A;  1GM7 A;  4MTO A;  3ZMT A;  3RVZ A;  3RVY A;  1OCR C;  2EIN B;  1NVP D;  2HJF C;  2HVJ C;  3ETD A;  2LP7 A;  4MW8 A;  4UVB A;  1MG1 A;  3FB6 C;  2HR3 A;  2XAH A;  3IGA C;  1BL8 A;  1WLE A;  1VQL V;  2QKS A;  1NH2 D;  3OW2 U;  1RPR A;  1SET A;  3IC7 A;  3CC4 V;  1JCH A;  2V7Q G;  4HZ3 A;  1FS0 G;  5CBF A;  1SZT A;  1K3E A;  2OCC B;  2QE7 G;  2JJ2 G;  2IH1 C;  1AI7 A;  4FK5 C;  2ZXW B;  4Q20 A;  5LBQ A;  4R50 A;  5IYD O;  1KQS U;  1NJI W;  1CPY A;  1IXM A;  5EK0 A;  4JTC B;  2JDI G;  4RAI A;  1VQ4 V;  3SYC A;  5C93 A;  2EIN C;  3JYC A;  3CCE V;  2H94 A;  2ITD C;  2GSM B;  1W2B U;  3M99 B;  2EIL B;  4FJC C;  1DLB A;  3X2Q B;  5CBG A;  3GWO A;  1R3I C;  1VQ7 V;  2EZO A;  4MVU A;  4WFG A;  2ITC C;  3HPL C;  4ASU G;  3ZRV A;  2WLK A;  4WFF A;  4GX1 A;  5CMU A;  1R3J C;  1GMG A;  3OE7 G;  2K1E A;  2OCC C;  2CK3 G;  3K0D A;  2WLN A;  3CCS V;  2ZXW C;  5EBW C;  5EBL C;  3D3I A;  3PJS K;  3SYQ A;  1HWY A;  4KP4 A;  1NR1 A;  2WLI A;  4TT3 G;  1G4Y B;  1ROP A;  2IJJ A;  4I5S A;  2DYR B;  3JD0 A;  2WLI B;  3R65 A;  3ZN0 A;  1VQO V;  4JTA B;  1COW G;  1K8A W;  1KKD A;  2P67 A;  1K73 W;  2EIL C;  3X2Q C;  2AHY A;  3E83 A;  3CME V;  3K9A A;  1NVP B;  4RQF A;  2DWD C;  2ZQM A;  2PI5 A;  2XOK G;  4GT1 A;  2LFR A;  3E8F A;  4OXS A;  1P4R A;  3JD1 A;  5E1A C;  2A9H A;  3K04 A;  5J9P C;  1PNK A;  2H8P C;  1J95 A;  5L3C A;  4U7O A;  3E86 A;  2ATK C;  1VQN V;  2NNU A;  2XAG A;  4J9Y B;  2JEX A;  3K03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...