2EBOA

Core structure of gp2 from ebola virus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
74
structure length
74
Chain Sequence
GLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCAIEPHDWTKNITDKIDQIIHDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EBOLA VIRUS ENVELOPE GLYCOPROTEIN
publication title Core structure of the envelope glycoprotein GP2 from Ebola virus at 1.9-A resolution.
pubmed doi rcsb
source organism Zaire ebolavirus - mayinga (zaire, 1976)
molecule tags Envelope glycoprotein
total genus 27
structure length 74
sequence length 74
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eboA00
1DF5A 5KA6A 2X7RB 1MG1A 1QR9A 2EBOA 3MHSC 5CN0A 1I5YA 2EZPA 3B8MA 3M99B 1JQ0A 2P6JA 3GWOA 4N23A 2LP7A 2MK3A 1EBOA 4FJCC 4E2LA 1ENVA 1DLBA 5KA5A 4JPRA 1DF4A 4G2KA 1K33A 3B8NA 5HFLA 2OT5A 1K34A 2M7WA 1I5XA 1QCEA 1JPXA 1QBZA 1Y4MA 3CP1A 3CYOA 5H9CA 2EZOA 4N21A 4FIPC 1Y66A 3B77A 3MHHC 4FK5C 1SZTA 1MOFA 3WFVA 1QR8A 3K9AA 3P30A 1F23A 3H01A 4JGSA 4JF3A 5CMUA 5HFMA
chains in the Genus database with same CATH superfamily
1XUQA 4FFKA 4OX9O 2D2CB 4DV6B 1COWG 4AI8A 4TV9B 1FFXA 5E1AC 4BIZA 3ETEA 2DQ0A 1EM1A 3NXSA 4MTOA 3RYIA 4UVAA 3H1KH 3F5WC 3TCUA 3A2FA 1GN4A 1URFA 2HJDA 4LF7B 1AILA 5LXTB 1QQCA 2YI9A 1ZL8B 2WPDG 3CXCU 4I55B 3VQVA 3TGUH 5L3CA 1K4DC 2GUZA 2CTRA 5JWPA 3N27A 1MSWD 4LF7O 4UB6Z 1R1BA 2N74A 3ICXA 2Q8VA 2YUAA 1QHTA 3D8CA 4I50A 1V9PA 3U0ZA 1ZTEA 3GWKC 2CTWA 5LGTA 1IX9A 2RQ6A 1SQFA 1EN6A 3FYEB 4X64O 5BXZA 1BE3H 5KAIZ 2HVKC 3ASNC 2UXXA 1VQ5V 3CRAA 2K9PA 2YXYA 3T4ZA 2WLLA 3FB5C 1FXKC 1WB8A 3RFRA 3OT7A 4DR2B 4XDJA 5JJNB 4EEQA 1N36O 3FAVA 2ZE8A 4C7UA 4Z2WA 1IBMB 2EILB 3PN1A 2LGWA 4O4IA 4JI5O 4O2AA 1S0VA 1Z5VA 4UVBA 4JI1O 3M7MX 1R6NA 2GV9A 4MTGA 4PHZA 5IT9N 3HKBA 3BHPA 3LNNA 3SYOA 4MSWC 2BTQA 3CRQA 1RSOB 3QO8A 1YTFB 5FL7G 1VQ4V 1XNQB 1KKCA 5JH7B 3OTFA 4O4HA 5JQGA 4Z1MG 5LL6Y 1Q82W 3JAWA 3KCYA 3I5DA 4OGQB 2HVJC 1SC5B 4MVSA 2W6JG 1R3LC 1RM1B 4NXNB 2JJ1G 2L6LA 1NT2B 2ZDIA 1AI7A 1R3KC 3R66A 3BABA 2IH1C 1M56C 3AK2A 1JCHA 3QO5A 2PZSA 1WP8A 1V55B 1KC8W 3N2GA 2YIDA 4KHPB 3OMAB 3E89A 1KBHA 3O9OA 4DV0B 4PV1B 2CAZC 3APQA 4UB8Z 3T1HB 2PF4E 2EIJC 2Z5UA 5CBHA 1OCCB 2JEXA 4X1KA 4JI3O 4W4LA 3G80A 4XDLA 4LBEC 4PA7A 2B9ZA 3CSXA 1JR9A 2DW4A 2Q7GA 5J2TA 3K3WA 2X0LA 4GZRB 2Q0OC 3CCVV 1EZVH 1KYOF 1F4MA 1LUVA 3JAKA 2XASA 1WAZA 5EYPA 2OIGA 1O9HA 3SPIA 2LW7A 4RQEA 2RJZA 1MABG 2R9IA 1X4TA 4J42A 2EINB 3H1JH 2PGGA 4NKGB 4DR6O 4DV4B 2ITCC 5CA3A 1SA0A 2ODMA 3I56V 1LUWA 5JJEB 1WA8A 1P7GA 4DV7B 1XNRO 1J5EO 3FFQA 4FJCC 2RNBA 4F6RA 1DF4A 4DV4O 1XL6A 2WA4A 3L73H 2VQEB 3TXQA 2YICA 1Q6HA 3QF7A 3LSUA 2KG7B 1XHZA 4JI6B 4DV7O 5IYBO 4K8XA 2GTSA 1BGYH 4O4JB 3L72H 2JRIA 4PI2A 4UXNA 1AI4A 4NXMB 4DR1O 3OGCC 1BQZA 1YXBA 4DXWA 3OM3B 3MDSA 5BR8O 4JI6O 5BY1A 2CGOA 2XNDG 1AROP 5H9CA 2QSAA 5J9PC 5LGUA 1FAFA 1FFXB 2P22C 4AQYB 5L3GA 2ILMA 2PYLA 4JZGA 2EBOA 3UM7A 3RYIB 5BZBA 3WG7C 5GTIZ 1VEWA 1V54C 3CB2A 4DR4B 1OCZC 1QNMA 1IDSA 3ZMSA 4D6TH 1JVMA 3QG5A 2QKCA 3SPGA 5K1PA 4DR3O 2XAFA 1KUQA 1AJNA 5JCOC 1HR0O 3HKDA 2GUZB 4X89A 5B3SB 2QKAA 2QM8A 4FLZA 4LF8B 4GKJO 1YEWA 2JIZG 3ABMC 4ZHQA 3QO7A 4JI4O 2XAJA 1N32B 4I50B 4NTXA 1FXKA 5LYJA 5EK0A 4LF8O 2UXCO 2PUSA 4KFMA 3DGEA 1AI5A 3E8HA 4FZ0A 4J11A 2EIMC 5LMUO 4PJ0Z 4X62B 4DV5O 3AG1B 2WLLB 5A2QN 4EFEA 1R6KA 1H8EG 2DJVA 4NB5A 5FPRA 2OCCC 2VWJA 3CS5A 2IJHA 2JS3A 3FAVB 4UCVA 4CC5A 4O4IB 4O2AB 4XDKA 3ZRVA 3ETGA 2QWQB 2OTLV 3ZN1A 2LJ2A 3UKMA 3HKBB 3K04A 1OCRB 1QLEB 2IH3C 5HFLA 2CK3G 2B1GA 1NS1A 3U10A 1VQNV 2BTQB 1ZWIC 1BZKA 3B40A 2A7WA 5IJ9A 4GX1A 5TISZ 2YSUB 4Q6GA 4LH7A 1GMGA 3H9VA 3APOA 2YXHA 4LH6A 5C93A 1HWYA 2R72A 4O4HB 5B5EZ 4J41A 5JQGB 4JI7O 4FLXA 3JAWB 4H13B 4X1YA 5B1BB 1I94B 4RUEA 3U11A 3SJQC 1K4CC 4YIPA 1N0NA 2WAMA 1JOYA 3TK1A 2D3OW 3RYHA 4CS4A 2M6YA 3B09A 1GO3F 1AVMA 1MZFA 2E3CA 2WLNA 4U3JA 1R3JC 3K06A 2DWEC 3P3NA 1UPGA 3N2GB 4X65B 3C3TA 4MVZA 4ZOLA 1M57C 4G28B 4UCOA 3OW2U 3ZMVA 5IJ0A 3E8FA 4TV8A 4U7NA 3CJHA 5E79Z 1XREA 4X65O 4D7SA 4X1KB 3OD4A 3ZMUA 5J2UA 2DE0X 4K0KB 3ABUA 1I7FA 1NU1H 1ROPA 4J9ZB 2E5LB 4RO2A 3L9DA 1T5EA 1FXHA 2WA3A 1PM9A 1FXVA 1S5JA 3JAKB 4DV3O 1AR1B 1OCOC 3MHHC 5EYPB 4K0KO 2JJ2G 3UCSC 3CMAV 5L3FA 4JGSA 2E5LO 3C3SA 2OIEA 2XAGA 2ZIOA 1NH2D 4JV5O 2NLJC 4K35A 1BSMA 2BOCC 2P6JA 4LFAB 1SA0B 2V4DA 4DO2A 1WA8B 3ABKB 5LP6C 3M8AA 3B77A 1YCIA 4F6RB 4YHHB 1FJGB 4WFGA 3VQYA 1HNXO 3QNEA 3G6EV 1IXMA 3AG4C 4ZBMA 1VQLV 3STLC 3CMEV 3IFXA 1Y66A 3ETDA 2UUBO 4QPJA 4CH3A 4X66O 4U7OA 1H2SB 3JSLA 4EB6A 3H01A 4DR5B 3GB7C 1LR1A 3BY6A 2XAQA 3K9SA 5FNVA 1QR9A 4AILC 3F5TA 3ZN0A 1Z2GA 2HJFC 2IM9A 3OTOO 1M9NA 5FLXN 1M5IA 1JFFA 4PA4A 2P67A 4DR7B 1F7YA 3HPLC 2LGQA 1S72V 1Q7YW 2AHYA 2F4VO 2Q5ZA 1PNMA 4IHJA 4R7CA 1EBOA 2QE7G 4MW8A 4TWKA 4H0LB 1K7DA 1HW7A 1K5QA 4RQFA 1TUEB 1G8MA 3RT3C 1XMQB 4UVCA 3HKDB 2VWKA 3RGBA 3LDCA 3X2QC 2QWOB 3ASNB 4ZHQB 3D3IA 4JI8O 3ZHTA 1N0JA 4LFCB 2LP7A 1FXKB 5LYJB 4G2KA 2LFRA 4B7KA 1S77D 2ZR3A 4JTDB 1QLNA 2YXLA 3H1HH 4PA6A 1Z5WA 3K79A 1YHQV 4LFCO 4DV6O 2JS5A 4FM2A 2ZKOA 1VQ6V 3H1IH 3C90A 4QGPA 3BVOA 4WFEA 2XTAA 2LQTA 5C8YA 2DYRC 1K5SA 2IJIA 5LBQA 1NTZH 1S5LZ 3HKEA 4TUYA 3JARA 2DYSC 1GM7A 4BIUA 4HZ3A 4I9WA 1QR8A 2Y0IA 5IYZB 1E1RG 2WLHA 1Q3EA 1JA8A 3ETQA 2EULA 4O4LA 2RN9A 5IJ9B 4PELA 4DV2B 4DUYB 3P3PA 5D5PA 3SYPA 4LWSA 1JJ2U 4GKKB 1M56B 2RMKB 2ZXWC 1SKVA 1L1FA 4X1YB 4P2ZA 3ZRXA 3FB8C 2VRZA 2GDSA 4X88A 4W4KA 3RYHB 4JTAB 5EBWC 1CXZB 4J7KA 3CCSV 2CDYA 3RBZA 2EIJB 2Q7HA 4U3JB 1F4NA 4X1IA 1YJNV 3A0BZ 2DOSA 4FMTA 1HP8A 2Q69A 1H2NA 4ZOLB 1NH2B 5EIBC 3ABLC 5IJ0B 2P4VA 3MD0A 4DR2O 1IBMO 4TV8B 3CJHB 1G6UA 2N04A 2ZE7A 4CH4A 5J2UB 5IY5C 2OTJV 3DTUB 3OGIB 3AG7A 3KG2A 1VF6C 5L3DA 1GN2A 3F7YC 1F23A 2AZ2A 2X6BA 3CRRA 2PTMA 2EIKC 1VARA 4JASA 4DK1A 2ARHA 3T1CA 1XNQO 1N8RW 4R6ZA 5LP6A 1MZEA 4PDMA 5L3EA 4WFHA 3E22A 2QEXV 2R9AA 3ZMTA 2ZD9A 4MS2A 2ZE5A 2EJ7A 1TUBA 1G4YB 1RFYA 2AGAA 1PD3A 2HR3A 4ZKIA 1GAXA 5DEDA 4TQDA 2Q67A 4FVMA 3SPCA 2JK5C 3K58A 4NXNO 4UCSA 1YJWV 3AK1A 2YIAA 2IU3A 3CCUV 1WB7A 4I9QA 1THZA 2H3OA 2FKXA 3ZHUA 2DN9A 2QJ1A 4KHPO 3ASOC 4ICGA 3JYCA 3ZX6A 4DV0O 1AB3A 3T1HO 3E2EA 1GTOA 1B3QA 3E35A 2ZIMA 4YY3B 2ITDC 3ZIAG 3K57A 2IU0A 3M99B 4N23A 3B4SA 2W0XA 3WG7B 4EB6B 2NNUA 3RW0A 2UU9B 1GRJA 3S3WA 4IT5A 1V54B 5FNVB 1HNZB 1OCZB 3JATA 3EHBB 2DWDC 1KU9A 2XAHA 3LDDA 3ZRWA 1SQXH 2WSSG 4JI0B 1GH6A 1R3IC 3SJCC 5KUKA 2ZE6A 1JFFB 1XHXA 3BCCH 4TT3G 4ZI7A 1H2GA 3SPHA 2M7WA 3ABMB 4IHJB 4G27B 1J95A 2YIBA 2BSKA 4LFBB 1FS0G 4BAYA 2NN4A 2QWRB 3D36C 4LF9B 1NQTA 1YITV 3LUTB 1NR7A 2VQEO 3OUSA 2FTKA 2WLIA 3O65A 3THOA 1KP3A 2EIMB 4H33A 2ZM6B 4NXMO 4FFBB 2HG5C 3L71H 2OCCB 3W7WA 4Q20A 1Q86W 2YEVA 1XQ8A 1OCCC 1K8AW 2EZPA 1JJOA 3Q4HA 1M90W 1SQGA 3E83A 3CE2A 1KP2A 1SRYA 4I7ZB 1KKDA 1RPRA 5C8YB 4AQYO 4B3TB 1G1XB 1K92A 2YIBD 1SERA 2ZNIA 1NZ6A 1L0LH 2ZNJA 3L75H 1IBLB 4JTCB 3ZJZA 3HKEB 4TUYB 5B1AC 2XUMA 3DC5A 4JYBA 2WLMA 3JARB 4DR4O 1IZ3A 3JALA 1HNWB 4WFBV 2IJJA 3AG2C 5KUMA 4B3TO 4JYAB 1IBLO 5KAFZ 2XT9A 1BMFG 2YS8A 1BS3A 4ASUG 1IBKB 4O4LB 1BL8A 4DK0A 3HKCA 4NYKA 3PJSK 4JI2B 4LWSB 4JYAO 4YJ2A 1P84F 1GK9A 3B2EE 3HR0A 1WNSA 3AK3A 1AR4A 4I0XB 1IBKO 1SQQH 1N32O 2QM4A 1M57B 4JI2O 3WB2A 3SYCA 4B7EA 1AP6A 2CGNA 3DSQA 2UUAB 5JVDA 1SZTA 5LHGA 1CPYA 3UQ8A 5B66Z 4X1IB 4X62O 1K97A 4JYCA 3WB0A 3OUFA 1Q5OA 4DRXA 1K9MW 1YIJV 1VIBA 1DTOA 1IURA 2UUAO 1W59A 1VF6A 5L3BA 5GW7A 5LMNB 5IYZA 3RYCA 1H38A 1FD9A 2N05A 4HNAA 2AZ0A 4PDLA 1W2BU 3WFVA 1US6A 1OCOB 1MMMA 4ABMA 4DUZB 1NTKH 2H94A 1WN7A 5LMNO 1K73W 1HDJA 1I5YA 4PDVA 2CTPA 1PNLA 4B08A 3K0DA 2ETNA 3EFFK 4UV8A 4DUZO 2G38A 2Q9LA 1WPXA 3G67A 3SPJA 5LP6B 2JGUA 1EFRG 2RCVA 5CA1A 3E22B 1PL0A 4KUMA 4BW5A 3JD3A 3H1LH 2HP8A 1TUBB 3IJ4A 1PL4A 1BHAA 4FPPA 1I94O 2BCCH 1WJZA 4X9QA 4RUFA 3A0RA 3BPZA 1XILA 4OPAA 5D5QA 3BEHA 1SF9A 1PNKA 2KKWA 4QE9A 3AG4B 3SR2C 5LOVA 2EZOA 4TSFG 1P49A 1KECA 4J80A 3NR7A 1FFTB 3UO2A 2QTSA 3IGAC 2CE4A 2GBOA 2IBZH 5CBFA 4IYIA 4FLTA 4X8AA 4RWUA 4H44B 3AG1C 4E2LA 4DV1B 5IE9A 2KB1A 5FPOA 2L35A 3ML0A 3G6BA 3JASA 3T2MA 3CYOA 2GHYA 2YDEA 3ABTA 1ZSPA 3W7TA 4B3SB 1CP9A 4WBNA 3DXRA 4B3RB 1MSDA 3LSQA 1XEQA 1RP3B 4WFFA 3JATB 5KA6A 2F93B 2Y69C 5IWAB 3B8MA 2LFSA 4GX2A 1JQ0A 3K5MA 1NVPD 3ZRWB 4X20A 3N2KA 2XOKG 2CTQA 3JCUZ 1M1KW 4ZI7B 1EZJA 3D36A 4GT1A 1I08A 4YJ3A 1Q6UA 4LFAO 3X2QB 3STZC 2X7RB 2ATKC 1B06A 3K5LA 4OXSA 1QVFU 2BSKB 3A0HZ 1DLBA 2WLJA 4I5SA 1DK1A 2QWPB 1K33A 4YHHO 1FJGO 5H5NA 1SZXA 3KZIZ 3HB3B 4OPHA 5CB4A 3FX7A 1Q90D 2WLIB 4EKWA 5LHIA 4IIJA 4FM1A 4L8JA 3KCXA 4J7JA 4E4EA 2UXDB 3IC7A 1BT8A 4LF6B 1E1QG 2DYRB 2YEVB 2HHHB 4UFZA 1VQ9V 2UXBB 3Q4HB 2HFEC 4FIPC 4DR5O 1KMIZ 4DW0A 2DYSB 2F23A 3JD0A 4F6EA 5JCOA 2UXDO 2EX3A 3E8BA 1D5AA 1ZX3A 1XI1A 2X6CA 4LP8A 5CBGA 5DN6G 3T1YB 3TETA 4XBFA 1SQPH 3OMNB 3QTCA 4PD4F 4PA3A 5H6QA 1YSCA 1D5NA 1NR1A 4DR7O 3JALB 2Y0PA 3UO3A 2Z3YA 1KD1W 2ZXWB 2Q6AA 4HAMA 3GVMA 2KQXA 3SYQA 3E8GA 4NR1A 1Y74A 3HKCB 1XMQO 1ZLZA 4FFBA 4TQFA 3RVYA 4JYYA 4YJ2B 4GX0A 1SQVH 2ZT9B 2WLKA 2AXTZ 3JCZA 2F1MA 3FD9A 3CX5F 3CCMV 1OJHA 1VF5B 3ABLB 4BW9A 2K1EA 5JVDB 2BTOA 5KMGA 2WWWA 3J80N 2A06H 1TGOA 4RAIA 4J7ZA 1NBMG 4IL6Z 4I4TA 3BFRA 3K5OA 5GONA 1VQPV 4FLYA 5H2FZ 5LA6A 5IY5B 3CCEV 5CA0A 4DRXB 1H2KA 2NR5A 3P30A 2ZCEA 3RYCB 5A9GA 1MNGA 2B5UA 2QKSA 2H8PC 4B3MB 4HNAB 1RPOA 1MG1A 2Q0AA 3CXHF 4FLUA 2EIKB 5KX5A 3FB7C 2HEPA 2FMLA 2A9HA 1QBZA 3FYIB 2P4KA 3JD1A 4B3MO 4I0XA 4HBNA 3SYAA 1UJWB 5EZYA 4X64B 1TA8A 3SJAC 1M93A 4DV2O 4DUYO 1VMGA 3G71V 3F7VC 5CA1B 3AG3C 2W0FC 4GKKO 5JJJB 1KQSU 5KA5A 1VQOV 2VS0A 3ZCCA 4LR3A 5H6RA 1AJQA 3ASOB 2QGNA 4UCTA 1N36B 3JD4A 3CC2V 1U97A 1NVPB 4JI5B 2O57A 5BMVA 3J81N 4BIOA 4JI1B 3W7XA 2F43G 2EJRA 5LOVB 2P7TC 5EBLC 5CN0A 3K59A 3W7UA 3LDEA 4P9OA 4J10A 3GWOA 3W7SA 5LHHA 3FB6C 4MTFA 4GUNA 1GN3A 4GCZA 3SGIA 4BR6A 5GTHZ 4D7TA 1SETA 1OZ0A 4DW1A 2R70A 4GYCB 1VQ7V 1F51A 4JF3A 5CMUA 5HFMA 3JASB 3SDLA 4WBNB 2PI5A 3DXRB 3CCJV 1S5HC 3L74H 2LW1A 1XOUA 1DGSA 2Q4PA 3CHXA 4X20B 3N2KB 2ADPA 2UXNA 3CEIA 5ITZA 1NTMH 4GX5A 3BA9A 1XL4A 2MW2B 4R50A 4CS2A 1OV9A 2BE3A 3TXSA 4CH6A 2Y4TA 4ZIBA 2V1DA 4YJ3B 5EC2C 1Q8IA 2YI8A 3CWBH 2CH7A 3I55V 4JI3B 3OE7G 1VQKV 2ZR2A 1GKFA 3RYFB 4O2BA 2RDCA 2HLDG 3OR7C 3CC4V 2Y4UA 5CB4B 2EILC 1H2MA 3K08A 4IIJB 1VF7A 5KHHA 2PI4A 2ZQMA 3B8NA 4CBCA 1VQMV 4MT8A 1AJPA 1JMKC 4YY3O 3A8TA 4A5UB 3ZHQA 3K9AA 5B1NA 4CC6A 2VQFB 4QNHB 5B1AB 1YI2V 4UUJC 4EFBA 2UU9O 1Q6IA 1W0KG 4DR6B 3SJBC 3CPWU 1HNZO 4MTXA 3EXAA 3OEEG 3L70H 3OEHG 3AG2B 4JPRA 4UV9A 2JGDB 2JEUA 1Y76A 1XNRB 4JI0O 2VQFO 1J5EB 5B1OA 3JSNA 3E86A 4JAUA 1U96A 3RN4A 1YJ9V 2V7QG 1NKDA 3VBBA 3ZEDA 1RM1C 3VQXA 1YDXA 3ZRSA 2DQ3A 3VOUA 4CS3A 3DC6A 3ZHVA 5LGNA 5IYDO 3OAAG 3ZMZA 1LNQA 3LSSA 1V55C 1TVKA 4DR1B 3P32A 1PPJH 1XDCA 4MW3A 2QR4A 2OCHA 4LFBO 4AHCA 1Y74B 5BR8B 1ZUQA 2PYJA 1MOFA 4LNUA 2ZINA 4H37A 1N33B 5IYCO 3CD6V 1Y6XA 4LF9O 1ZAUA 3S3XA 4JAAA 1W0JG 4MVUA 4FLWA 2ADQB 1M4UA 1BCCH 1SS3A 2ZM6O 3UT5A 1N33O 4FZ1A 3K03A 4FM0A 2C2AA 5KMGB 5DECA 4NTWA 4I4TB 1AI6A 2Q68A 5GONB 3WB1A 2UUCB 4MVRA 1FPOA 5LA6B 4DR3B 5CA0B 1NI8A 2Q73A 1AP5A 1N34B 3EVKA 1FKAO 5KHGA 1HR0B 2EINC 3TJTA 1Y4MA 3CP1A 5KX5B 4CZZA 2UUCO 1Q81W 4QJFB 4GKJB 4HYOA 1HNWO 4F4LA 1BQ0A 4MVQA 2P90A 3OR6C 4JI4B 1N34O 1YZBA 2FYUH 1TAEA 1GM8A 4LCUC 2UXCB 5EZYB 1K34A 4Z1VA 4PA9A 4J9YB 2Z0AA 3AEIA 3D3QA 5LMUB 1GM9A 5KHIA 4QE7A 2GTAA 4DV5B 4YXWG 4TV9A 4TOIA 3WU2Z 3OMIB 2OWOA 4NTYA 5BMVB 1R73A 1JPXA 1EN5A 4FK5C 4IGGA 5LXTA 3IAYA 1VP7A 4BWAA 1ZL8A 1X59A 4I55A 3G4SV 4QIWF 1AR5A 2E74B 2Y69B 4GLXA 4WCEV 3ZHSA 2P5OA 1PV0A 5EIBD 2DMXA 1VQ8V 4JI7B 1PP9H 4PDRA 1NJIW 3ZHRA 2Q7EA 4LF5B 2AW9A 5B3SC 3CCLV 1S76D 3BAAA 1IVSA 2JDIG 2MK3A 2W6IG 5ITZB 4KXRA 4WFAV 1FYJA 1I5XA 1QCEA 3RWRD 3T4DA 4LF5O 2XHBA 1P7BA 4JZ2A 4UCRA 2QWNB 3CCRV 1WLEA 4NVPA 2KSDA 2CUGA 2X6AA 2E76B 1BHBA 2A79B 1P4RA 4K8ZA 3JAMN 2CH7B 1QU7A 3VQWA 3FKSG 4UCUA 4R8CA 5KHJA 2QA4V 3MAQA 4DYLA 4KL1A 1OHHG 4O2BB 2A0LA 2FL4A 1RSOA 2IJKA 1ORQC 1XBLA 3K0GA 4DV3B 3J7AU 1Y67A 4DV1O 1DF5A 5JH7A 3BRCA 3LNMB 5J2TB 1OCRC 1QLEC 1D2DA 1SQBH 2F66C 2A3QA 3BA8A 4PI0A 4B3SO 4JV5B 1JX9A 4B3RO 1PKXA 3OFNG 2YC0A 1WP7A 5IWAO 1SESA 1Y76B 1YF2A 3K5NA 5B1BC 1O9GA 4JAVA 1E79G 4L87A 1HNXB 3IC9A 1IXBA 2ZDIC 3CRCA 2GSMB 5IDJA 3RYFA 2P06A 1YTFD 2F95B 2LO1A 1TVKB 2QM7A 1XMOB 2UUBB 3ZS8C 5DM6V 4X66B 1WPBA 1QVGU 4U3FH 4LNUB 5KHKA 1H8HG 2OYQA 2E75B 5EC1C 3JD2A 3QVNA 5F2VO 1XMOO 1EN4A 2R9RB 1B04A 2Y48A 3OTOB 2B1IA 3CC7V 3UT5B 5KLVH 1A32A 4LF6O 2FB5A 2JGDA 1GN6A 3MHSC 2HHHO 1Q43A 4FLVA 1KB9F 1YVWA 5K1XA 4WF9V 2IW5A 3CRMA 2UXBO 2QDOA 3CCQV 2F4VB 4LF4B 1B6QA 3RVZA 1H2LA 4LC1A 4K3AA 2PY5A 4QPKA 4P30A 2AHZA 1L8DA 1N4CA 2JVDA 3T1YO 4MVMA 3R65A 1R6TA 4LF4O 4KP4A 1CEZA 4IYHA 4MVOA 2KG7A 3ABKC 3KKYA 1ENVA 1UFIA 1K3EA 2HKOA 2OT5A 3AG3B 4O4JA 4P9PA 4JI8B 1MA1A 5EBMC 1I0HA 4OX9B 3ZBHA 4N21A 2QTOA 2BOBC 4CH5A 1L0NH 1S3JA 4YIOA 5AG2A
chains in the Genus database with same CATH topology
1XL4A 4R50A 4WFBV 2IJJA 3AG2C 3ABUA 1COWG 5KUMA 1ROPA 4J9ZB 2V1DA 4RO2A 5E1AC 1FXHA 4BIZA 1BMFG 3ETEA 2DQ0A 1FXVA 5EC2C 4ASUG 1AR1B 3NXSA 1OCOC 3MHHC 1BL8A 4MTOA 4UVAA 2JJ2G 3I55V 3PJSK 3F5WC 3OE7G 3TCUA 3CMAV 1VQKV 2ZR2A 5L3FA 4JGSA 1GK9A 1GKFA 2XAGA 2HLDG 1NH2D 3OR7C 2NLJC 3CC4V 2BOCC 2P6JA 2EILC 2WPDG 3K08A 3CXCU 2PI4A 2ZQMA 3B8NA 4DO2A 3ABKB 1M57B 4CBCA 1VQMV 5L3CA 4MT8A 1AJPA 3SYCA 3B77A 1K4DC 1SZTA 1MSWD 5LHGA 1CPYA 3K9AA 5B1NA 4WFGA 4QNHB 5B1AB 1YI2V 4UUJC 3QNEA 1W0KG 3G6EV 1K97A 4JYCA 1IXMA 3AG4C 3OUFA 4ZBMA 3CPWU 1VQLV 4MTXA 1K9MW 1YIJV 3OEEG 1DTOA 3OEHG 3AG2B 4JPRA 3STLC 5L3BA 4UV9A 5GW7A 3CMEV 2JEUA 5LGTA 1H38A 3IFXA 3FYEB 1Y66A 5B1OA 3ETDA 3E86A 4JAUA 4PDLA 4QPJA 1YJ9V 3ASNC 2HVKC 2V7QG 1NKDA 2UXXA 1W2BU 3VBBA 1VQ5V 4U7OA 3WFVA 1OCOB 3H01A 1RM1C 3GB7C 3T4ZA 2H94A 3BY6A 2WLLA 2XAQA 3ZRSA 2DQ3A 1QR9A 1K73W 3FB5C 3VOUA 1FXKC 1I5YA 3ZN0A 4PDVA 1PNLA 5LGNA 4XDJA 3K0DA 5IYDO 3OAAG 3ZMZA 1LNQA 3LSSA 1V55C 3P32A 3EFFK 2EILB 2HJFC 4MW3A 4UV8A 1WPXA 1S0VA 1M9NA 4UVBA 3SPJA 1EFRG 1R6NA 4MTGA 1MOFA 1PL0A 4PA4A 2P67A 4KUMA 4H37A 4BW5A 5IYCO 3CD6V 3JD3A 3HPLC 1S72V 3SYOA 1Q7YW 1BHAA 4FPPA 2AHYA 4MSWC 1W0JG 4RUFA 3A0RA 3QO8A 4MVUA 1PNMA 4R7CA 1EBOA 2QE7G 3BEHA 4MW8A 4TWKA 1YTFB 5FL7G 1PNKA 4QE9A 3AG4B 1K7DA 1VQ4V 1K5QA 4RQFA 1TUEB 3K03A 1G8MA 2EZOA 4UVCA 4TSFG 2C2AA 4Z1MG 3LDCA 1Q82W 3X2QC 1KECA 2HVJC 1FFTB 3ASNB 1AI6A 2Q68A 3IGAC 4MVSA 5CBFA 3D3IA 2W6JG 1R3LC 4MVRA 1RM1B 2JJ1G 4X8AA 2ZDIA 1AI7A 2LP7A 3AG1C 1R3KC 4E2LA 1FXKB 2IH1C 2KB1A 4G2KA 2LFRA 1M56C 3ML0A 1JCHA 2EINC 3QO5A 1S77D 2ZR3A 1V55B 1Y4MA 3CP1A 3CYOA 3T2MA 4JTDB 1KC8W 2GHYA 1QLNA 4CZZA 3ABTA 1Q81W 4QJFB 3W7TA 4HYOA 4PA6A 3OMAB 1CP9A 3E89A 3K79A 4F4LA 1YHQV 4MVQA 2P90A 3LSQA 3OR6C 1VQ6V 4WFFA 5KA6A 2Y69C 4WFEA 1GM8A 3B8MA 2LFSA 2DYRC 4GX2A 1JQ0A 1K5SA 2EIJC 2IJIA 3ZRWB 1NVPD 2Z5UA 5CBHA 5LBQA 1OCCB 2JEXA 4LCUC 1K34A 2XOKG 4PA9A 4XDLA 4J9YB 4LBEC 2DYSC 1GM7A 4PA7A 4BIUA 3AEIA 1GM9A 1M1KW 4HZ3A 4QE7A 2DW4A 1EZJA 1QR8A 4I9WA 4YXWG 3D36A 1E1RG 2WLHA 3K3WA 4GT1A 2X0LA 3X2QB 3OMIB 3CCVV 3STZC 1F4MA 2ATKC 2X7RB 2XASA 4OXSA 1QVFU 3SPIA 4PELA 4RQEA 1DLBA 2WLJA 4I5SA 1MABG 1K33A 2R9IA 3SYPA 1JJ2U 1R73A 1JPXA 1M56B 2EINB 2ZXWC 3HB3B 1L1FA 4FK5C 4P2ZA 4EKWA 2ITCC 2WLIB 3ZRXA 5CA3A 5LHIA 3I56V 3FB8C 3G4SV 4QIWF 4X88A 3IC7A 4JTAB 5EBWC 2Y69B 4FJCC 4WCEV 3CCSV 1E1QG 1DF4A 2DYRB 2EIJB 2YEVB 3RBZA 1XL6A 1F4NA 1VQ8V 1YJNV 1VQ9V 4FIPC 2HFEC 4FMTA 2Q69A 4PDRA 1NJIW 1NH2B 5IYBO 2DYSB 3JD0A 3ABLC 3E8BA 3MD0A 4UXNA 1AI4A 5B3SC 2X6CA 3OGCC 4LP8A 5CBGA 5DN6G 3CCLV 1S76D 4DXWA 3OM3B 3TETA 4XBFA 3OMNB 2JDIG 2MK3A 2W6IG 4PA3A 5H6QA 1YSCA 1NR1A 4WFAV 1I5XA 1QCEA 5IY5C 2OTJV 2XNDG 3DTUB 1AROP 5H9CA 3T4DA 5J9PC 1P7BA 3KG2A 5LGUA 2Z3YA 1KD1W 5L3DA 3CCRV 1WLEA 2ZXWB 3F7YC 2Q6AA 2X6AA 1F23A 4HAMA 2X6BA 5L3GA 2EIKC 4JASA 1BHBA 2EBOA 3SYQA 2A79B 3UM7A 1P4RA 3E8GA 3T1CA 5BZBA 1N8RW 4R6ZA 3WG7C 4PDMA 5L3EA 3FKSG 4WFHA 2QEXV 4R8CA 1V54C 3ZMTA 2QA4V 2ZD9A 4MS2A 3RVYA 1OCZC 1G4YB 1OHHG 3ZMSA 1PD3A 2HR3A 4GX0A 4ZKIA 2A0LA 1JVMA 2WLKA 2IJKA 3SPGA 2Q67A 3JCZA 3SPCA 2JK5C 1ORQC 3K0GA 3CCMV 1YJWV 2XAFA 1DF5A 3ABLB 2IU3A 3CCUV 1AJNA 2K1EA 3LNMB 4X89A 1OCRC 1QLEC 1THZA 5B3SB 2WWWA 2QM8A 4RAIA 3ASOC 1NBMG 2JIZG 3ABMC 1JX9A 3JYCA 3QO7A 1PKXA 1VQPV 3OFNG 2XAJA 5IY5B 3E2EA 3CCEV 1GTOA 1FXKA 3E35A 3P30A 1SESA 2ITDC 2QKSA 2B5UA 5EK0A 2H8PC 3ZIAG 4KFMA 1RPOA 1MG1A 3DGEA 5B1BC 2IU0A 3M99B 1AI5A 2EIKB 1E79G 4JAVA 3E8HA 4N23A 3FB7C 4L87A 3WG7B 2A9HA 2EIMC 2NNUA 3RW0A 2ZDIC 3AG1B 2WLLB 1V54B 1QBZA 3FYIB 1R6KA 2GSMB 1OCZB 1H8EG 3EHBB 2DWDC 2OCCC 3JD1A 5IDJA 2XAHA 1YTFD 3LDDA 2IJHA 3ZRWA 3SYAA 2WSSG 1UJWB 1R3IC 2QM7A 4XDKA 5KUKA 3G71V 5DM6V 3ZRVA 3F7VC 3ETGA 2OTLV 3ZN1A 4TT3G 3AG3C 2W0FC 1QVGU 1H2GA 1H8HG 3UKMA 1KQSU 5KA5A 1VQOV 3SPHA 3K04A 3ZCCA 1OCRB 1QLEB 2IH3C 5EC1C 2CK3G 5HFLA 2B1GA 2M7WA 1VQNV 5H6RA 3JD2A 1AJQA 3ASOB 1ZWIC 3ABMB 4G27B 3JD4A 1J95A 4GX1A 2R9RB 3CC2V 2YSUB 1NVPB 2Y48A 2B1IA 3CC7V 3W7XA 1FS0G 1GMGA 4BAYA 5C93A 2F43G 2EJRA 1HWYA 2P7TC 5EBLC 5CN0A 3MHSC 3W7UA 3LDEA 4P9OA 1NQTA 1YITV 3GWOA 3W7SA 3LUTB 1NR7A 3FB6C 4MTFA 5LHHA 2IW5A 4WF9V 3OUSA 2FTKA 5B1BB 2WLIA 4GCZA 3CCQV 4RUEA 1B6QA 3RVZA 3SJQC 1K4CC 1KP3A 1SETA 2EIMB 4LC1A 4H33A 2WAMA 1JOYA 1OZ0A 4QPKA 4P30A 3TK1A 2D3OW 2AHZA 1GO3F 2HG5C 1VQ7V 2OCCB 3W7WA 1F51A 4MVMA 2YEVA 4Q20A 3R65A 1Q86W 4JF3A 2WLNA 5CMUA 5HFMA 1OCCC 1R3JC 3K06A 2DWEC 1K8AW 2EZPA 4KP4A 1CEZA 1M90W 4MVOA 4MVZA 3ABKC 2PI5A 1M57C 4G28B 1ENVA 3OW2U 3CCJV 3ZMVA 1K3EA 2HKOA 1S5HC 2OT5A 3AG3B 3E83A 4P9PA 1KP2A 3E8FA 1SRYA 5EBMC 1KKDA 1RPRA 4N21A 2QTOA 4U7NA 1K92A 1SERA 2BOBC 4JTCB 3ZJZA 2UXNA 5B1AC 1S3JA 4JYBA 3ZMUA 2WLMA 4GX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF5 A;  5KA6 A;  2X7R B;  1MG1 A;  1QR9 A;  2EBO A;  3MHS C;  5CN0 A;  1I5Y A;  2EZP A;  3B8M A;  3M99 B;  1JQ0 A;  2P6J A;  3GWO A;  4N23 A;  2LP7 A;  2MK3 A;  1EBO A;  4FJC C;  4E2L A;  1ENV A;  1DLB A;  5KA5 A;  4JPR A;  1DF4 A;  4G2K A;  1K33 A;  3B8N A;  5HFL A;  2OT5 A;  1K34 A;  2M7W A;  1I5X A;  1QCE A;  1JPX A;  1QBZ A;  1Y4M A;  3CP1 A;  3CYO A;  5H9C A;  2EZO A;  4N21 A;  4FIP C;  1Y66 A;  3B77 A;  3MHH C;  4FK5 C;  1SZT A;  1MOF A;  3WFV A;  1QR8 A;  3K9A A;  3P30 A;  1F23 A;  3H01 A;  4JGS A;  4JF3 A;  5CMU A;  5HFM A; 
#chains in the Genus database with same CATH topology
 1XUQ A;  4FFK A;  4OX9 O;  2D2C B;  4DV6 B;  1COW G;  4AI8 A;  4TV9 B;  1FFX A;  5E1A C;  4BIZ A;  3ETE A;  2DQ0 A;  1EM1 A;  3NXS A;  4MTO A;  3RYI A;  4UVA A;  3H1K H;  3F5W C;  3TCU A;  3A2F A;  1GN4 A;  1URF A;  2HJD A;  4LF7 B;  1AIL A;  5LXT B;  1QQC A;  2YI9 A;  1ZL8 B;  2WPD G;  3CXC U;  4I55 B;  3VQV A;  3TGU H;  5L3C A;  1K4D C;  2GUZ A;  2CTR A;  5JWP A;  3N27 A;  1MSW D;  4LF7 O;  4UB6 Z;  1R1B A;  2N74 A;  3ICX A;  2Q8V A;  2YUA A;  1QHT A;  3D8C A;  4I50 A;  1V9P A;  3U0Z A;  1ZTE A;  3GWK C;  2CTW A;  5LGT A;  1IX9 A;  2RQ6 A;  1SQF A;  1EN6 A;  3FYE B;  4X64 O;  5BXZ A;  1BE3 H;  5KAI Z;  2HVK C;  3ASN C;  2UXX A;  1VQ5 V;  3CRA A;  2K9P A;  2YXY A;  3T4Z A;  2WLL A;  3FB5 C;  1FXK C;  1WB8 A;  3RFR A;  3OT7 A;  4DR2 B;  4XDJ A;  5JJN B;  4EEQ A;  1N36 O;  3FAV A;  2ZE8 A;  4C7U A;  4Z2W A;  1IBM B;  2EIL B;  3PN1 A;  2LGW A;  4O4I A;  4JI5 O;  4O2A A;  1S0V A;  1Z5V A;  4UVB A;  4JI1 O;  3M7M X;  1R6N A;  2GV9 A;  4MTG A;  4PHZ A;  5IT9 N;  3HKB A;  3BHP A;  3LNN A;  3SYO A;  4MSW C;  2BTQ A;  3CRQ A;  1RSO B;  3QO8 A;  1YTF B;  5FL7 G;  1VQ4 V;  1XNQ B;  1KKC A;  5JH7 B;  3OTF A;  4O4H A;  5JQG A;  4Z1M G;  5LL6 Y;  1Q82 W;  3JAW A;  3KCY A;  3I5D A;  4OGQ B;  2HVJ C;  1SC5 B;  4MVS A;  2W6J G;  1R3L C;  1RM1 B;  4NXN B;  2JJ1 G;  2L6L A;  1NT2 B;  2ZDI A;  1AI7 A;  1R3K C;  3R66 A;  3BAB A;  2IH1 C;  1M56 C;  3AK2 A;  1JCH A;  3QO5 A;  2PZS A;  1WP8 A;  1V55 B;  1KC8 W;  3N2G A;  2YID A;  4KHP B;  3OMA B;  3E89 A;  1KBH A;  3O9O A;  4DV0 B;  4PV1 B;  2CAZ C;  3APQ A;  4UB8 Z;  3T1H B;  2PF4 E;  2EIJ C;  2Z5U A;  5CBH A;  1OCC B;  2JEX A;  4X1K A;  4JI3 O;  4W4L A;  3G80 A;  4XDL A;  4LBE C;  4PA7 A;  2B9Z A;  3CSX A;  1JR9 A;  2DW4 A;  2Q7G A;  5J2T A;  3K3W A;  2X0L A;  4GZR B;  2Q0O C;  3CCV V;  1EZV H;  1KYO F;  1F4M A;  1LUV A;  3JAK A;  2XAS A;  1WAZ A;  5EYP A;  2OIG A;  1O9H A;  3SPI A;  2LW7 A;  4RQE A;  2RJZ A;  1MAB G;  2R9I A;  1X4T A;  4J42 A;  2EIN B;  3H1J H;  2PGG A;  4NKG B;  4DR6 O;  4DV4 B;  2ITC C;  5CA3 A;  1SA0 A;  2ODM A;  3I56 V;  1LUW A;  5JJE B;  1WA8 A;  1P7G A;  4DV7 B;  1XNR O;  1J5E O;  3FFQ A;  4FJC C;  2RNB A;  4F6R A;  1DF4 A;  4DV4 O;  1XL6 A;  2WA4 A;  3L73 H;  2VQE B;  3TXQ A;  2YIC A;  1Q6H A;  3QF7 A;  3LSU A;  2KG7 B;  1XHZ A;  4JI6 B;  4DV7 O;  5IYB O;  4K8X A;  2GTS A;  1BGY H;  4O4J B;  3L72 H;  2JRI A;  4PI2 A;  4UXN A;  1AI4 A;  4NXM B;  4DR1 O;  3OGC C;  1BQZ A;  1YXB A;  4DXW A;  3OM3 B;  3MDS A;  5BR8 O;  4JI6 O;  5BY1 A;  2CGO A;  2XND G;  1ARO P;  5H9C A;  2QSA A;  5J9P C;  5LGU A;  1FAF A;  1FFX B;  2P22 C;  4AQY B;  5L3G A;  2ILM A;  2PYL A;  4JZG A;  2EBO A;  3UM7 A;  3RYI B;  5BZB A;  3WG7 C;  5GTI Z;  1VEW A;  1V54 C;  3CB2 A;  4DR4 B;  1OCZ C;  1QNM A;  1IDS A;  3ZMS A;  4D6T H;  1JVM A;  3QG5 A;  2QKC A;  3SPG A;  5K1P A;  4DR3 O;  2XAF A;  1KUQ A;  1AJN A;  5JCO C;  1HR0 O;  3HKD A;  2GUZ B;  4X89 A;  5B3S B;  2QKA A;  2QM8 A;  4FLZ A;  4LF8 B;  4GKJ O;  1YEW A;  2JIZ G;  3ABM C;  4ZHQ A;  3QO7 A;  4JI4 O;  2XAJ A;  1N32 B;  4I50 B;  4NTX A;  1FXK A;  5LYJ A;  5EK0 A;  4LF8 O;  2UXC O;  2PUS A;  4KFM A;  3DGE A;  1AI5 A;  3E8H A;  4FZ0 A;  4J11 A;  2EIM C;  5LMU O;  4PJ0 Z;  4X62 B;  4DV5 O;  3AG1 B;  2WLL B;  5A2Q N;  4EFE A;  1R6K A;  1H8E G;  2DJV A;  4NB5 A;  5FPR A;  2OCC C;  2VWJ A;  3CS5 A;  2IJH A;  2JS3 A;  3FAV B;  4UCV A;  4CC5 A;  4O4I B;  4O2A B;  4XDK A;  3ZRV A;  3ETG A;  2QWQ B;  2OTL V;  3ZN1 A;  2LJ2 A;  3UKM A;  3HKB B;  3K04 A;  1OCR B;  1QLE B;  2IH3 C;  5HFL A;  2CK3 G;  2B1G A;  1NS1 A;  3U10 A;  1VQN V;  2BTQ B;  1ZWI C;  1BZK A;  3B40 A;  2A7W A;  5IJ9 A;  4GX1 A;  5TIS Z;  2YSU B;  4Q6G A;  4LH7 A;  1GMG A;  3H9V A;  3APO A;  2YXH A;  4LH6 A;  5C93 A;  1HWY A;  2R72 A;  4O4H B;  5B5E Z;  4J41 A;  5JQG B;  4JI7 O;  4FLX A;  3JAW B;  4H13 B;  4X1Y A;  5B1B B;  1I94 B;  4RUE A;  3U11 A;  3SJQ C;  1K4C C;  4YIP A;  1N0N A;  2WAM A;  1JOY A;  3TK1 A;  2D3O W;  3RYH A;  4CS4 A;  2M6Y A;  3B09 A;  1GO3 F;  1AVM A;  1MZF A;  2E3C A;  2WLN A;  4U3J A;  1R3J C;  3K06 A;  2DWE C;  3P3N A;  1UPG A;  3N2G B;  4X65 B;  3C3T A;  4MVZ A;  4ZOL A;  1M57 C;  4G28 B;  4UCO A;  3OW2 U;  3ZMV A;  5IJ0 A;  3E8F A;  4TV8 A;  4U7N A;  3CJH A;  5E79 Z;  1XRE A;  4X65 O;  4D7S A;  4X1K B;  3OD4 A;  3ZMU A;  5J2U A;  2DE0 X;  4K0K B;  3ABU A;  1I7F A;  1NU1 H;  1ROP A;  4J9Z B;  2E5L B;  4RO2 A;  3L9D A;  1T5E A;  1FXH A;  2WA3 A;  1PM9 A;  1FXV A;  1S5J A;  3JAK B;  4DV3 O;  1AR1 B;  1OCO C;  3MHH C;  5EYP B;  4K0K O;  2JJ2 G;  3UCS C;  3CMA V;  5L3F A;  4JGS A;  2E5L O;  3C3S A;  2OIE A;  2XAG A;  2ZIO A;  1NH2 D;  4JV5 O;  2NLJ C;  4K35 A;  1BSM A;  2BOC C;  2P6J A;  4LFA B;  1SA0 B;  2V4D A;  4DO2 A;  1WA8 B;  3ABK B;  5LP6 C;  3M8A A;  3B77 A;  1YCI A;  4F6R B;  4YHH B;  1FJG B;  4WFG A;  3VQY A;  1HNX O;  3QNE A;  3G6E V;  1IXM A;  3AG4 C;  4ZBM A;  1VQL V;  3STL C;  3CME V;  3IFX A;  1Y66 A;  3ETD A;  2UUB O;  4QPJ A;  4CH3 A;  4X66 O;  4U7O A;  1H2S B;  3JSL A;  4EB6 A;  3H01 A;  4DR5 B;  3GB7 C;  1LR1 A;  3BY6 A;  2XAQ A;  3K9S A;  5FNV A;  1QR9 A;  4AIL C;  3F5T A;  3ZN0 A;  1Z2G A;  2HJF C;  2IM9 A;  3OTO O;  1M9N A;  5FLX N;  1M5I A;  1JFF A;  4PA4 A;  2P67 A;  4DR7 B;  1F7Y A;  3HPL C;  2LGQ A;  1S72 V;  1Q7Y W;  2AHY A;  2F4V O;  2Q5Z A;  1PNM A;  4IHJ A;  4R7C A;  1EBO A;  2QE7 G;  4MW8 A;  4TWK A;  4H0L B;  1K7D A;  1HW7 A;  1K5Q A;  4RQF A;  1TUE B;  1G8M A;  3RT3 C;  1XMQ B;  4UVC A;  3HKD B;  2VWK A;  3RGB A;  3LDC A;  3X2Q C;  2QWO B;  3ASN B;  4ZHQ B;  3D3I A;  4JI8 O;  3ZHT A;  1N0J A;  4LFC B;  2LP7 A;  1FXK B;  5LYJ B;  4G2K A;  2LFR A;  4B7K A;  1S77 D;  2ZR3 A;  4JTD B;  1QLN A;  2YXL A;  3H1H H;  4PA6 A;  1Z5W A;  3K79 A;  1YHQ V;  4LFC O;  4DV6 O;  2JS5 A;  4FM2 A;  2ZKO A;  1VQ6 V;  3H1I H;  3C90 A;  4QGP A;  3BVO A;  4WFE A;  2XTA A;  2LQT A;  5C8Y A;  2DYR C;  1K5S A;  2IJI A;  5LBQ A;  1NTZ H;  1S5L Z;  3HKE A;  4TUY A;  3JAR A;  2DYS C;  1GM7 A;  4BIU A;  4HZ3 A;  4I9W A;  1QR8 A;  2Y0I A;  5IYZ B;  1E1R G;  2WLH A;  1Q3E A;  1JA8 A;  3ETQ A;  2EUL A;  4O4L A;  2RN9 A;  5IJ9 B;  4PEL A;  4DV2 B;  4DUY B;  3P3P A;  5D5P A;  3SYP A;  4LWS A;  1JJ2 U;  4GKK B;  1M56 B;  2RMK B;  2ZXW C;  1SKV A;  1L1F A;  4X1Y B;  4P2Z A;  3ZRX A;  3FB8 C;  2VRZ A;  2GDS A;  4X88 A;  4W4K A;  3RYH B;  4JTA B;  5EBW C;  1CXZ B;  4J7K A;  3CCS V;  2CDY A;  3RBZ A;  2EIJ B;  2Q7H A;  4U3J B;  1F4N A;  4X1I A;  1YJN V;  3A0B Z;  2DOS A;  4FMT A;  1HP8 A;  2Q69 A;  1H2N A;  4ZOL B;  1NH2 B;  5EIB C;  3ABL C;  5IJ0 B;  2P4V A;  3MD0 A;  4DR2 O;  1IBM O;  4TV8 B;  3CJH B;  1G6U A;  2N04 A;  2ZE7 A;  4CH4 A;  5J2U B;  5IY5 C;  2OTJ V;  3DTU B;  3OGI B;  3AG7 A;  3KG2 A;  1VF6 C;  5L3D A;  1GN2 A;  3F7Y C;  1F23 A;  2AZ2 A;  2X6B A;  3CRR A;  2PTM A;  2EIK C;  1VAR A;  4JAS A;  4DK1 A;  2ARH A;  3T1C A;  1XNQ O;  1N8R W;  4R6Z A;  5LP6 A;  1MZE A;  4PDM A;  5L3E A;  4WFH A;  3E22 A;  2QEX V;  2R9A A;  3ZMT A;  2ZD9 A;  4MS2 A;  2ZE5 A;  2EJ7 A;  1TUB A;  1G4Y B;  1RFY A;  2AGA A;  1PD3 A;  2HR3 A;  4ZKI A;  1GAX A;  5DED A;  4TQD A;  2Q67 A;  4FVM A;  3SPC A;  2JK5 C;  3K58 A;  4NXN O;  4UCS A;  1YJW V;  3AK1 A;  2YIA A;  2IU3 A;  3CCU V;  1WB7 A;  4I9Q A;  1THZ A;  2H3O A;  2FKX A;  3ZHU A;  2DN9 A;  2QJ1 A;  4KHP O;  3ASO C;  4ICG A;  3JYC A;  3ZX6 A;  4DV0 O;  1AB3 A;  3T1H O;  3E2E A;  1GTO A;  1B3Q A;  3E35 A;  2ZIM A;  4YY3 B;  2ITD C;  3ZIA G;  3K57 A;  2IU0 A;  3M99 B;  4N23 A;  3B4S A;  2W0X A;  3WG7 B;  4EB6 B;  2NNU A;  3RW0 A;  2UU9 B;  1GRJ A;  3S3W A;  4IT5 A;  1V54 B;  5FNV B;  1HNZ B;  1OCZ B;  3JAT A;  3EHB B;  2DWD C;  1KU9 A;  2XAH A;  3LDD A;  3ZRW A;  1SQX H;  2WSS G;  4JI0 B;  1GH6 A;  1R3I C;  3SJC C;  5KUK A;  2ZE6 A;  1JFF B;  1XHX A;  3BCC H;  4TT3 G;  4ZI7 A;  1H2G A;  3SPH A;  2M7W A;  3ABM B;  4IHJ B;  4G27 B;  1J95 A;  2YIB A;  2BSK A;  4LFB B;  1FS0 G;  4BAY A;  2NN4 A;  2QWR B;  3D36 C;  4LF9 B;  1NQT A;  1YIT V;  3LUT B;  1NR7 A;  2VQE O;  3OUS A;  2FTK A;  2WLI A;  3O65 A;  3THO A;  1KP3 A;  2EIM B;  4H33 A;  2ZM6 B;  4NXM O;  4FFB B;  2HG5 C;  3L71 H;  2OCC B;  3W7W A;  4Q20 A;  1Q86 W;  2YEV A;  1XQ8 A;  1OCC C;  1K8A W;  2EZP A;  1JJO A;  3Q4H A;  1M90 W;  1SQG A;  3E83 A;  3CE2 A;  1KP2 A;  1SRY A;  4I7Z B;  1KKD A;  1RPR A;  5C8Y B;  4AQY O;  4B3T B;  1G1X B;  1K92 A;  2YIB D;  1SER A;  2ZNI A;  1NZ6 A;  1L0L H;  2ZNJ A;  3L75 H;  1IBL B;  4JTC B;  3ZJZ A;  3HKE B;  4TUY B;  5B1A C;  2XUM A;  3DC5 A;  4JYB A;  2WLM A;  3JAR B;  4DR4 O;  1IZ3 A;  3JAL A;  1HNW B;  4WFB V;  2IJJ A;  3AG2 C;  5KUM A;  4B3T O;  4JYA B;  1IBL O;  5KAF Z;  2XT9 A;  1BMF G;  2YS8 A;  1BS3 A;  4ASU G;  1IBK B;  4O4L B;  1BL8 A;  4DK0 A;  3HKC A;  4NYK A;  3PJS K;  4JI2 B;  4LWS B;  4JYA O;  4YJ2 A;  1P84 F;  1GK9 A;  3B2E E;  3HR0 A;  1WNS A;  3AK3 A;  1AR4 A;  4I0X B;  1IBK O;  1SQQ H;  1N32 O;  2QM4 A;  1M57 B;  4JI2 O;  3WB2 A;  3SYC A;  4B7E A;  1AP6 A;  2CGN A;  3DSQ A;  2UUA B;  5JVD A;  1SZT A;  5LHG A;  1CPY A;  3UQ8 A;  5B66 Z;  4X1I B;  4X62 O;  1K97 A;  4JYC A;  3WB0 A;  3OUF A;  1Q5O A;  4DRX A;  1K9M W;  1YIJ V;  1VIB A;  1DTO A;  1IUR A;  2UUA O;  1W59 A;  1VF6 A;  5L3B A;  5GW7 A;  5LMN B;  5IYZ A;  3RYC A;  1H38 A;  1FD9 A;  2N05 A;  4HNA A;  2AZ0 A;  4PDL A;  1W2B U;  3WFV A;  1US6 A;  1OCO B;  1MMM A;  4ABM A;  4DUZ B;  1NTK H;  2H94 A;  1WN7 A;  5LMN O;  1K73 W;  1HDJ A;  1I5Y A;  4PDV A;  2CTP A;  1PNL A;  4B08 A;  3K0D A;  2ETN A;  3EFF K;  4UV8 A;  4DUZ O;  2G38 A;  2Q9L A;  1WPX A;  3G67 A;  3SPJ A;  5LP6 B;  2JGU A;  1EFR G;  2RCV A;  5CA1 A;  3E22 B;  1PL0 A;  4KUM A;  4BW5 A;  3JD3 A;  3H1L H;  2HP8 A;  1TUB B;  3IJ4 A;  1PL4 A;  1BHA A;  4FPP A;  1I94 O;  2BCC H;  1WJZ A;  4X9Q A;  4RUF A;  3A0R A;  3BPZ A;  1XIL A;  4OPA A;  5D5Q A;  3BEH A;  1SF9 A;  1PNK A;  2KKW A;  4QE9 A;  3AG4 B;  3SR2 C;  5LOV A;  2EZO A;  4TSF G;  1P49 A;  1KEC A;  4J80 A;  3NR7 A;  1FFT B;  3UO2 A;  2QTS A;  3IGA C;  2CE4 A;  2GBO A;  2IBZ H;  5CBF A;  4IYI A;  4FLT A;  4X8A A;  4RWU A;  4H44 B;  3AG1 C;  4E2L A;  4DV1 B;  5IE9 A;  2KB1 A;  5FPO A;  2L35 A;  3ML0 A;  3G6B A;  3JAS A;  3T2M A;  3CYO A;  2GHY A;  2YDE A;  3ABT A;  1ZSP A;  3W7T A;  4B3S B;  1CP9 A;  4WBN A;  3DXR A;  4B3R B;  1MSD A;  3LSQ A;  1XEQ A;  1RP3 B;  4WFF A;  3JAT B;  5KA6 A;  2F93 B;  2Y69 C;  5IWA B;  3B8M A;  2LFS A;  4GX2 A;  1JQ0 A;  3K5M A;  1NVP D;  3ZRW B;  4X20 A;  3N2K A;  2XOK G;  2CTQ A;  3JCU Z;  1M1K W;  4ZI7 B;  1EZJ A;  3D36 A;  4GT1 A;  1I08 A;  4YJ3 A;  1Q6U A;  4LFA O;  3X2Q B;  3STZ C;  2X7R B;  2ATK C;  1B06 A;  3K5L A;  4OXS A;  1QVF U;  2BSK B;  3A0H Z;  1DLB A;  2WLJ A;  4I5S A;  1DK1 A;  2QWP B;  1K33 A;  4YHH O;  1FJG O;  5H5N A;  1SZX A;  3KZI Z;  3HB3 B;  4OPH A;  5CB4 A;  3FX7 A;  1Q90 D;  2WLI B;  4EKW A;  5LHI A;  4IIJ A;  4FM1 A;  4L8J A;  3KCX A;  4J7J A;  4E4E A;  2UXD B;  3IC7 A;  1BT8 A;  4LF6 B;  1E1Q G;  2DYR B;  2YEV B;  2HHH B;  4UFZ A;  1VQ9 V;  2UXB B;  3Q4H B;  2HFE C;  4FIP C;  4DR5 O;  1KMI Z;  4DW0 A;  2DYS B;  2F23 A;  3JD0 A;  4F6E A;  5JCO A;  2UXD O;  2EX3 A;  3E8B A;  1D5A A;  1ZX3 A;  1XI1 A;  2X6C A;  4LP8 A;  5CBG A;  5DN6 G;  3T1Y B;  3TET A;  4XBF A;  1SQP H;  3OMN B;  3QTC A;  4PD4 F;  4PA3 A;  5H6Q A;  1YSC A;  1D5N A;  1NR1 A;  4DR7 O;  3JAL B;  2Y0P A;  3UO3 A;  2Z3Y A;  1KD1 W;  2ZXW B;  2Q6A A;  4HAM A;  3GVM A;  2KQX A;  3SYQ A;  3E8G A;  4NR1 A;  1Y74 A;  3HKC B;  1XMQ O;  1ZLZ A;  4FFB A;  4TQF A;  3RVY A;  4JYY A;  4YJ2 B;  4GX0 A;  1SQV H;  2ZT9 B;  2WLK A;  2AXT Z;  3JCZ A;  2F1M A;  3FD9 A;  3CX5 F;  3CCM V;  1OJH A;  1VF5 B;  3ABL B;  4BW9 A;  2K1E A;  5JVD B;  2BTO A;  5KMG A;  2WWW A;  3J80 N;  2A06 H;  1TGO A;  4RAI A;  4J7Z A;  1NBM G;  4IL6 Z;  4I4T A;  3BFR A;  3K5O A;  5GON A;  1VQP V;  4FLY A;  5H2F Z;  5LA6 A;  5IY5 B;  3CCE V;  5CA0 A;  4DRX B;  1H2K A;  2NR5 A;  3P30 A;  2ZCE A;  3RYC B;  5A9G A;  1MNG A;  2B5U A;  2QKS A;  2H8P C;  4B3M B;  4HNA B;  1RPO A;  1MG1 A;  2Q0A A;  3CXH F;  4FLU A;  2EIK B;  5KX5 A;  3FB7 C;  2HEP A;  2FML A;  2A9H A;  1QBZ A;  3FYI B;  2P4K A;  3JD1 A;  4B3M O;  4I0X A;  4HBN A;  3SYA A;  1UJW B;  5EZY A;  4X64 B;  1TA8 A;  3SJA C;  1M93 A;  4DV2 O;  4DUY O;  1VMG A;  3G71 V;  3F7V C;  5CA1 B;  3AG3 C;  2W0F C;  4GKK O;  5JJJ B;  1KQS U;  5KA5 A;  1VQO V;  2VS0 A;  3ZCC A;  4LR3 A;  5H6R A;  1AJQ A;  3ASO B;  2QGN A;  4UCT A;  1N36 B;  3JD4 A;  3CC2 V;  1U97 A;  1NVP B;  4JI5 B;  2O57 A;  5BMV A;  3J81 N;  4BIO A;  4JI1 B;  3W7X A;  2F43 G;  2EJR A;  5LOV B;  2P7T C;  5EBL C;  5CN0 A;  3K59 A;  3W7U A;  3LDE A;  4P9O A;  4J10 A;  3GWO A;  3W7S A;  5LHH A;  3FB6 C;  4MTF A;  4GUN A;  1GN3 A;  4GCZ A;  3SGI A;  4BR6 A;  5GTH Z;  4D7T A;  1SET A;  1OZ0 A;  4DW1 A;  2R70 A;  4GYC B;  1VQ7 V;  1F51 A;  4JF3 A;  5CMU A;  5HFM A;  3JAS B;  3SDL A;  4WBN B;  2PI5 A;  3DXR B;  3CCJ V;  1S5H C;  3L74 H;  2LW1 A;  1XOU A;  1DGS A;  2Q4P A;  3CHX A;  4X20 B;  3N2K B;  2ADP A;  2UXN A;  3CEI A;  5ITZ A;  1NTM H;  4GX5 A;  3BA9 A;  1XL4 A;  2MW2 B;  4R50 A;  4CS2 A;  1OV9 A;  2BE3 A;  3TXS A;  4CH6 A;  2Y4T A;  4ZIB A;  2V1D A;  4YJ3 B;  5EC2 C;  1Q8I A;  2YI8 A;  3CWB H;  2CH7 A;  3I55 V;  4JI3 B;  3OE7 G;  1VQK V;  2ZR2 A;  1GKF A;  3RYF B;  4O2B A;  2RDC A;  2HLD G;  3OR7 C;  3CC4 V;  2Y4U A;  5CB4 B;  2EIL C;  1H2M A;  3K08 A;  4IIJ B;  1VF7 A;  5KHH A;  2PI4 A;  2ZQM A;  3B8N A;  4CBC A;  1VQM V;  4MT8 A;  1AJP A;  1JMK C;  4YY3 O;  3A8T A;  4A5U B;  3ZHQ A;  3K9A A;  5B1N A;  4CC6 A;  2VQF B;  4QNH B;  5B1A B;  1YI2 V;  4UUJ C;  4EFB A;  2UU9 O;  1Q6I A;  1W0K G;  4DR6 B;  3SJB C;  3CPW U;  1HNZ O;  4MTX A;  3EXA A;  3OEE G;  3L70 H;  3OEH G;  3AG2 B;  4JPR A;  4UV9 A;  2JGD B;  2JEU A;  1Y76 A;  1XNR B;  4JI0 O;  2VQF O;  1J5E B;  5B1O A;  3JSN A;  3E86 A;  4JAU A;  1U96 A;  3RN4 A;  1YJ9 V;  2V7Q G;  1NKD A;  3VBB A;  3ZED A;  1RM1 C;  3VQX A;  1YDX A;  3ZRS A;  2DQ3 A;  3VOU A;  4CS3 A;  3DC6 A;  3ZHV A;  5LGN A;  5IYD O;  3OAA G;  3ZMZ A;  1LNQ A;  3LSS A;  1V55 C;  1TVK A;  4DR1 B;  3P32 A;  1PPJ H;  1XDC A;  4MW3 A;  2QR4 A;  2OCH A;  4LFB O;  4AHC A;  1Y74 B;  5BR8 B;  1ZUQ A;  2PYJ A;  1MOF A;  4LNU A;  2ZIN A;  4H37 A;  1N33 B;  5IYC O;  3CD6 V;  1Y6X A;  4LF9 O;  1ZAU A;  3S3X A;  4JAA A;  1W0J G;  4MVU A;  4FLW A;  2ADQ B;  1M4U A;  1BCC H;  1SS3 A;  2ZM6 O;  3UT5 A;  1N33 O;  4FZ1 A;  3K03 A;  4FM0 A;  2C2A A;  5KMG B;  5DEC A;  4NTW A;  4I4T B;  1AI6 A;  2Q68 A;  5GON B;  3WB1 A;  2UUC B;  4MVR A;  1FPO A;  5LA6 B;  4DR3 B;  5CA0 B;  1NI8 A;  2Q73 A;  1AP5 A;  1N34 B;  3EVK A;  1FKA O;  5KHG A;  1HR0 B;  2EIN C;  3TJT A;  1Y4M A;  3CP1 A;  5KX5 B;  4CZZ A;  2UUC O;  1Q81 W;  4QJF B;  4GKJ B;  4HYO A;  1HNW O;  4F4L A;  1BQ0 A;  4MVQ A;  2P90 A;  3OR6 C;  4JI4 B;  1N34 O;  1YZB A;  2FYU H;  1TAE A;  1GM8 A;  4LCU C;  2UXC B;  5EZY B;  1K34 A;  4Z1V A;  4PA9 A;  4J9Y B;  2Z0A A;  3AEI A;  3D3Q A;  5LMU B;  1GM9 A;  5KHI A;  4QE7 A;  2GTA A;  4DV5 B;  4YXW G;  4TV9 A;  4TOI A;  3WU2 Z;  3OMI B;  2OWO A;  4NTY A;  5BMV B;  1R73 A;  1JPX A;  1EN5 A;  4FK5 C;  4IGG A;  5LXT A;  3IAY A;  1VP7 A;  4BWA A;  1ZL8 A;  1X59 A;  4I55 A;  3G4S V;  4QIW F;  1AR5 A;  2E74 B;  2Y69 B;  4GLX A;  4WCE V;  3ZHS A;  2P5O A;  1PV0 A;  5EIB D;  2DMX A;  1VQ8 V;  4JI7 B;  1PP9 H;  4PDR A;  1NJI W;  3ZHR A;  2Q7E A;  4LF5 B;  2AW9 A;  5B3S C;  3CCL V;  1S76 D;  3BAA A;  1IVS A;  2JDI G;  2MK3 A;  2W6I G;  5ITZ B;  4KXR A;  4WFA V;  1FYJ A;  1I5X A;  1QCE A;  3RWR D;  3T4D A;  4LF5 O;  2XHB A;  1P7B A;  4JZ2 A;  4UCR A;  2QWN B;  3CCR V;  1WLE A;  4NVP A;  2KSD A;  2CUG A;  2X6A A;  2E76 B;  1BHB A;  2A79 B;  1P4R A;  4K8Z A;  3JAM N;  2CH7 B;  1QU7 A;  3VQW A;  3FKS G;  4UCU A;  4R8C A;  5KHJ A;  2QA4 V;  3MAQ A;  4DYL A;  4KL1 A;  1OHH G;  4O2B B;  2A0L A;  2FL4 A;  1RSO A;  2IJK A;  1ORQ C;  1XBL A;  3K0G A;  4DV3 B;  3J7A U;  1Y67 A;  4DV1 O;  1DF5 A;  5JH7 A;  3BRC A;  3LNM B;  5J2T B;  1OCR C;  1QLE C;  1D2D A;  1SQB H;  2F66 C;  2A3Q A;  3BA8 A;  4PI0 A;  4B3S O;  4JV5 B;  1JX9 A;  4B3R O;  1PKX A;  3OFN G;  2YC0 A;  1WP7 A;  5IWA O;  1SES A;  1Y76 B;  1YF2 A;  3K5N A;  5B1B C;  1O9G A;  4JAV A;  1E79 G;  4L87 A;  1HNX B;  3IC9 A;  1IXB A;  2ZDI C;  3CRC A;  2GSM B;  5IDJ A;  3RYF A;  2P06 A;  1YTF D;  2F95 B;  2LO1 A;  1TVK B;  2QM7 A;  1XMO B;  2UUB B;  3ZS8 C;  5DM6 V;  4X66 B;  1WPB A;  1QVG U;  4U3F H;  4LNU B;  5KHK A;  1H8H G;  2OYQ A;  2E75 B;  5EC1 C;  3JD2 A;  3QVN A;  5F2V O;  1XMO O;  1EN4 A;  2R9R B;  1B04 A;  2Y48 A;  3OTO B;  2B1I A;  3CC7 V;  3UT5 B;  5KLV H;  1A32 A;  4LF6 O;  2FB5 A;  2JGD A;  1GN6 A;  3MHS C;  2HHH O;  1Q43 A;  4FLV A;  1KB9 F;  1YVW A;  5K1X A;  4WF9 V;  2IW5 A;  3CRM A;  2UXB O;  2QDO A;  3CCQ V;  2F4V B;  4LF4 B;  1B6Q A;  3RVZ A;  1H2L A;  4LC1 A;  4K3A A;  2PY5 A;  4QPK A;  4P30 A;  2AHZ A;  1L8D A;  1N4C A;  2JVD A;  3T1Y O;  4MVM A;  3R65 A;  1R6T A;  4LF4 O;  4KP4 A;  1CEZ A;  4IYH A;  4MVO A;  2KG7 A;  3ABK C;  3KKY A;  1ENV A;  1UFI A;  1K3E A;  2HKO A;  2OT5 A;  3AG3 B;  4O4J A;  4P9P A;  4JI8 B;  1MA1 A;  5EBM C;  1I0H A;  4OX9 B;  3ZBH A;  4N21 A;  2QTO A;  2BOB C;  4CH5 A;  1L0N H;  1S3J A;  4YIO A;  5AG2 A; 
#chains in the Genus database with same CATH homology
 1XL4 A;  4R50 A;  4WFB V;  2IJJ A;  3AG2 C;  3ABU A;  1COW G;  5KUM A;  1ROP A;  4J9Z B;  2V1D A;  4RO2 A;  5E1A C;  1FXH A;  4BIZ A;  1BMF G;  3ETE A;  2DQ0 A;  1FXV A;  5EC2 C;  4ASU G;  1AR1 B;  3NXS A;  1OCO C;  3MHH C;  1BL8 A;  4MTO A;  4UVA A;  2JJ2 G;  3I55 V;  3PJS K;  3F5W C;  3OE7 G;  3TCU A;  3CMA V;  1VQK V;  2ZR2 A;  5L3F A;  4JGS A;  1GK9 A;  1GKF A;  2XAG A;  2HLD G;  1NH2 D;  3OR7 C;  2NLJ C;  3CC4 V;  2BOC C;  2P6J A;  2EIL C;  2WPD G;  3K08 A;  3CXC U;  2PI4 A;  2ZQM A;  3B8N A;  4DO2 A;  3ABK B;  1M57 B;  4CBC A;  1VQM V;  5L3C A;  4MT8 A;  1AJP A;  3SYC A;  3B77 A;  1K4D C;  1SZT A;  1MSW D;  5LHG A;  1CPY A;  3K9A A;  5B1N A;  4WFG A;  4QNH B;  5B1A B;  1YI2 V;  4UUJ C;  3QNE A;  1W0K G;  3G6E V;  1K97 A;  4JYC A;  1IXM A;  3AG4 C;  3OUF A;  4ZBM A;  3CPW U;  1VQL V;  4MTX A;  1K9M W;  1YIJ V;  3OEE G;  1DTO A;  3OEH G;  3AG2 B;  4JPR A;  3STL C;  5L3B A;  4UV9 A;  5GW7 A;  3CME V;  2JEU A;  5LGT A;  1H38 A;  3IFX A;  3FYE B;  1Y66 A;  5B1O A;  3ETD A;  3E86 A;  4JAU A;  4PDL A;  4QPJ A;  1YJ9 V;  3ASN C;  2HVK C;  2V7Q G;  1NKD A;  2UXX A;  1W2B U;  3VBB A;  1VQ5 V;  4U7O A;  3WFV A;  1OCO B;  3H01 A;  1RM1 C;  3GB7 C;  3T4Z A;  2H94 A;  3BY6 A;  2WLL A;  2XAQ A;  3ZRS A;  2DQ3 A;  1QR9 A;  1K73 W;  3FB5 C;  3VOU A;  1FXK C;  1I5Y A;  3ZN0 A;  4PDV A;  1PNL A;  5LGN A;  4XDJ A;  3K0D A;  5IYD O;  3OAA G;  3ZMZ A;  1LNQ A;  3LSS A;  1V55 C;  3P32 A;  3EFF K;  2EIL B;  2HJF C;  4MW3 A;  4UV8 A;  1WPX A;  1S0V A;  1M9N A;  4UVB A;  3SPJ A;  1EFR G;  1R6N A;  4MTG A;  1MOF A;  1PL0 A;  4PA4 A;  2P67 A;  4KUM A;  4H37 A;  4BW5 A;  5IYC O;  3CD6 V;  3JD3 A;  3HPL C;  1S72 V;  3SYO A;  1Q7Y W;  1BHA A;  4FPP A;  2AHY A;  4MSW C;  1W0J G;  4RUF A;  3A0R A;  3QO8 A;  4MVU A;  1PNM A;  4R7C A;  1EBO A;  2QE7 G;  3BEH A;  4MW8 A;  4TWK A;  1YTF B;  5FL7 G;  1PNK A;  4QE9 A;  3AG4 B;  1K7D A;  1VQ4 V;  1K5Q A;  4RQF A;  1TUE B;  3K03 A;  1G8M A;  2EZO A;  4UVC A;  4TSF G;  2C2A A;  4Z1M G;  3LDC A;  1Q82 W;  3X2Q C;  1KEC A;  2HVJ C;  1FFT B;  3ASN B;  1AI6 A;  2Q68 A;  3IGA C;  4MVS A;  5CBF A;  3D3I A;  2W6J G;  1R3L C;  4MVR A;  1RM1 B;  2JJ1 G;  4X8A A;  2ZDI A;  1AI7 A;  2LP7 A;  3AG1 C;  1R3K C;  4E2L A;  1FXK B;  2IH1 C;  2KB1 A;  4G2K A;  2LFR A;  1M56 C;  3ML0 A;  1JCH A;  2EIN C;  3QO5 A;  1S77 D;  2ZR3 A;  1V55 B;  1Y4M A;  3CP1 A;  3CYO A;  3T2M A;  4JTD B;  1KC8 W;  2GHY A;  1QLN A;  4CZZ A;  3ABT A;  1Q81 W;  4QJF B;  3W7T A;  4HYO A;  4PA6 A;  3OMA B;  1CP9 A;  3E89 A;  3K79 A;  4F4L A;  1YHQ V;  4MVQ A;  2P90 A;  3LSQ A;  3OR6 C;  1VQ6 V;  4WFF A;  5KA6 A;  2Y69 C;  4WFE A;  1GM8 A;  3B8M A;  2LFS A;  2DYR C;  4GX2 A;  1JQ0 A;  1K5S A;  2EIJ C;  2IJI A;  3ZRW B;  1NVP D;  2Z5U A;  5CBH A;  5LBQ A;  1OCC B;  2JEX A;  4LCU C;  1K34 A;  2XOK G;  4PA9 A;  4XDL A;  4J9Y B;  4LBE C;  2DYS C;  1GM7 A;  4PA7 A;  4BIU A;  3AEI A;  1GM9 A;  1M1K W;  4HZ3 A;  4QE7 A;  2DW4 A;  1EZJ A;  1QR8 A;  4I9W A;  4YXW G;  3D36 A;  1E1R G;  2WLH A;  3K3W A;  4GT1 A;  2X0L A;  3X2Q B;  3OMI B;  3CCV V;  3STZ C;  1F4M A;  2ATK C;  2X7R B;  2XAS A;  4OXS A;  1QVF U;  3SPI A;  4PEL A;  4RQE A;  1DLB A;  2WLJ A;  4I5S A;  1MAB G;  1K33 A;  2R9I A;  3SYP A;  1JJ2 U;  1R73 A;  1JPX A;  1M56 B;  2EIN B;  2ZXW C;  3HB3 B;  1L1F A;  4FK5 C;  4P2Z A;  4EKW A;  2ITC C;  2WLI B;  3ZRX A;  5CA3 A;  5LHI A;  3I56 V;  3FB8 C;  3G4S V;  4QIW F;  4X88 A;  3IC7 A;  4JTA B;  5EBW C;  2Y69 B;  4FJC C;  4WCE V;  3CCS V;  1E1Q G;  1DF4 A;  2DYR B;  2EIJ B;  2YEV B;  3RBZ A;  1XL6 A;  1F4N A;  1VQ8 V;  1YJN V;  1VQ9 V;  4FIP C;  2HFE C;  4FMT A;  2Q69 A;  4PDR A;  1NJI W;  1NH2 B;  5IYB O;  2DYS B;  3JD0 A;  3ABL C;  3E8B A;  3MD0 A;  4UXN A;  1AI4 A;  5B3S C;  2X6C A;  3OGC C;  4LP8 A;  5CBG A;  5DN6 G;  3CCL V;  1S76 D;  4DXW A;  3OM3 B;  3TET A;  4XBF A;  3OMN B;  2JDI G;  2MK3 A;  2W6I G;  4PA3 A;  5H6Q A;  1YSC A;  1NR1 A;  4WFA V;  1I5X A;  1QCE A;  5IY5 C;  2OTJ V;  2XND G;  3DTU B;  1ARO P;  5H9C A;  3T4D A;  5J9P C;  1P7B A;  3KG2 A;  5LGU A;  2Z3Y A;  1KD1 W;  5L3D A;  3CCR V;  1WLE A;  2ZXW B;  3F7Y C;  2Q6A A;  2X6A A;  1F23 A;  4HAM A;  2X6B A;  5L3G A;  2EIK C;  4JAS A;  1BHB A;  2EBO A;  3SYQ A;  2A79 B;  3UM7 A;  1P4R A;  3E8G A;  3T1C A;  5BZB A;  1N8R W;  4R6Z A;  3WG7 C;  4PDM A;  5L3E A;  3FKS G;  4WFH A;  2QEX V;  4R8C A;  1V54 C;  3ZMT A;  2QA4 V;  2ZD9 A;  4MS2 A;  3RVY A;  1OCZ C;  1G4Y B;  1OHH G;  3ZMS A;  1PD3 A;  2HR3 A;  4GX0 A;  4ZKI A;  2A0L A;  1JVM A;  2WLK A;  2IJK A;  3SPG A;  2Q67 A;  3JCZ A;  3SPC A;  2JK5 C;  1ORQ C;  3K0G A;  3CCM V;  1YJW V;  2XAF A;  1DF5 A;  3ABL B;  2IU3 A;  3CCU V;  1AJN A;  2K1E A;  3LNM B;  4X89 A;  1OCR C;  1QLE C;  1THZ A;  5B3S B;  2WWW A;  2QM8 A;  4RAI A;  3ASO C;  1NBM G;  2JIZ G;  3ABM C;  1JX9 A;  3JYC A;  3QO7 A;  1PKX A;  1VQP V;  3OFN G;  2XAJ A;  5IY5 B;  3E2E A;  3CCE V;  1GTO A;  1FXK A;  3E35 A;  3P30 A;  1SES A;  2ITD C;  2QKS A;  2B5U A;  5EK0 A;  2H8P C;  3ZIA G;  4KFM A;  1RPO A;  1MG1 A;  3DGE A;  5B1B C;  2IU0 A;  3M99 B;  1AI5 A;  2EIK B;  1E79 G;  4JAV A;  3E8H A;  4N23 A;  3FB7 C;  4L87 A;  3WG7 B;  2A9H A;  2EIM C;  2NNU A;  3RW0 A;  2ZDI C;  3AG1 B;  2WLL B;  1V54 B;  1QBZ A;  3FYI B;  1R6K A;  2GSM B;  1OCZ B;  1H8E G;  3EHB B;  2DWD C;  2OCC C;  3JD1 A;  5IDJ A;  2XAH A;  1YTF D;  3LDD A;  2IJH A;  3ZRW A;  3SYA A;  2WSS G;  1UJW B;  1R3I C;  2QM7 A;  4XDK A;  5KUK A;  3G71 V;  5DM6 V;  3ZRV A;  3F7V C;  3ETG A;  2OTL V;  3ZN1 A;  4TT3 G;  3AG3 C;  2W0F C;  1QVG U;  1H2G A;  1H8H G;  3UKM A;  1KQS U;  5KA5 A;  1VQO V;  3SPH A;  3K04 A;  3ZCC A;  1OCR B;  1QLE B;  2IH3 C;  5EC1 C;  2CK3 G;  5HFL A;  2B1G A;  2M7W A;  1VQN V;  5H6R A;  3JD2 A;  1AJQ A;  3ASO B;  1ZWI C;  3ABM B;  4G27 B;  3JD4 A;  1J95 A;  4GX1 A;  2R9R B;  3CC2 V;  2YSU B;  1NVP B;  2Y48 A;  2B1I A;  3CC7 V;  3W7X A;  1FS0 G;  1GMG A;  4BAY A;  5C93 A;  2F43 G;  2EJR A;  1HWY A;  2P7T C;  5EBL C;  5CN0 A;  3MHS C;  3W7U A;  3LDE A;  4P9O A;  1NQT A;  1YIT V;  3GWO A;  3W7S A;  3LUT B;  1NR7 A;  3FB6 C;  4MTF A;  5LHH A;  2IW5 A;  4WF9 V;  3OUS A;  2FTK A;  5B1B B;  2WLI A;  4GCZ A;  3CCQ V;  4RUE A;  1B6Q A;  3RVZ A;  3SJQ C;  1K4C C;  1KP3 A;  1SET A;  2EIM B;  4LC1 A;  4H33 A;  2WAM A;  1JOY A;  1OZ0 A;  4QPK A;  4P30 A;  3TK1 A;  2D3O W;  2AHZ A;  1GO3 F;  2HG5 C;  1VQ7 V;  2OCC B;  3W7W A;  1F51 A;  4MVM A;  2YEV A;  4Q20 A;  3R65 A;  1Q86 W;  4JF3 A;  2WLN A;  5CMU A;  5HFM A;  1OCC C;  1R3J C;  3K06 A;  2DWE C;  1K8A W;  2EZP A;  4KP4 A;  1CEZ A;  1M90 W;  4MVO A;  4MVZ A;  3ABK C;  2PI5 A;  1M57 C;  4G28 B;  1ENV A;  3OW2 U;  3CCJ V;  3ZMV A;  1K3E A;  2HKO A;  1S5H C;  2OT5 A;  3AG3 B;  3E83 A;  4P9P A;  1KP2 A;  3E8F A;  1SRY A;  5EBM C;  1KKD A;  1RPR A;  4N21 A;  2QTO A;  4U7N A;  1K92 A;  1SER A;  2BOB C;  4JTC B;  3ZJZ A;  2UXN A;  5B1A C;  1S3J A;  4JYB A;  3ZMU A;  2WLM A;  4GX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...