2EBOA

Core structure of gp2 from ebola virus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
74
structure length
74
Chain Sequence
GLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCAIEPHDWTKNITDKIDQIIHDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Envelope glycoprotein
molecule keywords EBOLA VIRUS ENVELOPE GLYCOPROTEIN
publication title Core structure of the envelope glycoprotein GP2 from Ebola virus at 1.9-A resolution.
pubmed doi rcsb
source organism Zaire ebolavirus - mayinga (zaire, 1976)
total genus 27
structure length 74
sequence length 74
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eboA00
3B8NA 1K34A 4FIPC 2LP7A 1MG1A 3H01A 5CN0A 5H9CA 3WFVA 5KA6A 1DF5A 2OT5A 2MK3A 1QR8A 3K9AA 2X7RB 3CP1A 1K33A 3M99B 2M7WA 1DF4A 3GWOA 1I5YA 4JF3A 1F23A 1EBOA 3MHSC 1Y66A 1QR9A 1DLBA 4N21A 2EZPA 4JPRA 1JPXA 3MHHC 1MOFA 5KA5A 1ENVA 1I5XA 1JQ0A 2EZOA 1QBZA 3B77A 4FJCC 4JGSA 1Y4MA 3B8MA 4FK5C 2P6JA 4N23A 4E2LA 5HFLA 4G2KA 2EBOA 3P30A 3CYOA 5CMUA 5HFMA 1QCEA 1SZTA
chains in the Genus database with same CATH superfamily
5KHKA 2UXDO 3B40A 1FKAO 3C3TA 3BCCH 2BSKA 1QLNA 3ABLC 4F6EA 1KC8W 3QNEA 2QTSA 3N27A 3RFRA 2EJRA 1N34B 2EIMC 3AEIA 3N2GA 1KP3A 1QVFU 2B9ZA 3ABMC 4JI2O 1Z5WA 3OD4A 1Q7YW 3CCRV 1XQ8A 1H2LA 1JQ0A 1Q6UA 5KAIZ 3ZMUA 2WLHA 1R3JC 4J11A 2C2AA 4Q6GA 5ITZA 5CMUA 4IHJB 2ZIMA 5JH7B 2UXNA 4WBNA 4DV2B 3I5DA 1T5EA 1VQKV 4TV9B 4UCSA 1SETA 1SQGA 3D36C 4YHHB 1US6A 4K8ZA 3TETA 4HAMA 2WLIB 4QNHB 4DR6B 2ATKC 2KB1A 4QGPA 5E1AC 1K7DA 5KA5A 1IX9A 2YEVA 1GH6A 1BT8A 2UXDB 3LDEA 3X2QB 3N2KA 4E4EA 4X1KB 1WJZA 2FB5A 3K79A 3E83A 5TISZ 1H8EG 5KX5A 2WLMA 5IY5B 3K5MA 4I4TA 4LH6A 4IIJB 4NTWA 2Y4TA 3F5TA 1EBOA 1OV9A 4GT1A 4X9QA 4K0KO 3K58A 1PP9H 3ETDA 2HR3A 1WA8B 3CCSV 3QF7A 1TVKA 1WP7A 4TUYA 3SGIA 3IGAC 1XUQA 1EZJA 1BL8A 3ZX6A 4JI2B 5KUKA 3BABA 1VQ9V 4PA4A 4D7TA 4DV1O 1L0LH 3RYIB 2FTKA 4DV3B 1I5YA 4UUJC 4DR2O 1GRJA 4YY3B 2DQ3A 1LNQA 1VF5B 2AGAA 2ZT9B 3FB8C 1YCIA 1DGSA 1G8MA 3ABKC 1P49A 3ZCCA 1NQTA 4NTXA 1GMGA 2A06H 1F4MA 5CN0A 5J2UB 1NR1A 4UCVA 1E1QG 4KL1A 5FPOA 1F51A 1SZXA 1OCOB 4JYCA 4J10A 3KZIZ 3BY6A 1KKCA 3ETQA 2PY5A 3UT5B 1SKVA 4P9OA 5FLXN 5LOVB 5LGTA 2LW7A 1PL0A 5IJ0A 1YTFD 3JAKA 4WFHA 2ITCC 4B3RO 4P30A 4K0KB 4EKWA 2ZE8A 4Z1VA 4PDVA 4MVOA 4U3FH 3CCLV 1Q90D 1Q8IA 1K4CC 3E89A 3MHSC 4N21A 4FM2A 2IW5A 1RFYA 1XL6A 2H3OA 1SA0B 5B1OA 4L8JA 4GLXA 4FPPA 2B5UA 2L35A 2Y48A 3E86A 4G27B 4QJFB 4IYIA 3ZN1A 2QE7G 4DV1B 1QCEA 2Z5UA 3L9DA 4O2BA 5JJEB 4X66O 1K92A 4X89A 2WLLB 4R50A 5JQGB 2ZNJA 1SRYA 3CJHA 4LF6B 2UU9O 2QA4V 3R65A 3DC6A 4DK0A 2P06A 1DF4A 4JF3A 3B4SA 2ZE6A 3VQVA 2BSKB 3SJAC 2F66C 2D3OW 1CP9A 3D3QA 3L75H 1R6TA 4PD4F 2WA4A 1XMQO 2YC0A 2ZR3A 4YJ2A 4BWAA 3AK2A 5CBHA 2YXYA 3A0RA 1M93A 4R7CA 2AHYA 4UB6Z 1S77D 1XREA 5KMGA 3X2QC 4FLYA 1MSDA 2XOKG 4LP8A 4AHCA 1RP3B 4UVAA 1OCRC 4PA7A 5IY5C 3H1LH 1P84F 3OMAB 1IURA 3H1HH 2PTMA 4WBNB 1U97A 4J41A 4OGQB 4JYAB 1WP8A 1S3JA 2MK3A 4ZOLB 4JI1O 3CMAV 3R66A 3K08A 3UO2A 2JJ1G 1HP8A 2DWEC 2P4VA 1VMGA 1MABG 1AI6A 4I5SA 1IVSA 1CEZA 4Q20A 2DOSA 4X66B 1AP6A 3AK1A 4O4HB 2YEVB 1IBKO 1RPOA 4X1YA 4LF7O 5HFLA 4RUFA 2UU9B 3CYOA 1GN2A 1YJNV 3T1CA 2XASA 3AG3B 2CAZC 3OE7G 2UXXA 1PNKA 5KX5B 5KA6A 4I4TB 1XMQB 4I50A 1JA8A 4PJ0Z 5IJ9A 1AROP 3CCMV 1NH2B 1YHQV 4O2AB 5LYJB 1TVKB 4UVBA 3OUSA 3ZMVA 1ZL8B 5K1XA 4UFZA 1YJ9V 2CTWA 1OCOC 4I55A 3HKEA 3JAWB 1PD3A 2B1IA 4TT3G 1WB7A 2JGDA 4DK1A 1PPJH 3JALA 3PN1A 1WB8A 1AI4A 5L3BA 4JYYA 4FVMA 1GAXA 3H1KH 2O57A 4PHZA 2ZDIA 2WSSG 1IDSA 2A3QA 4JI1B 4UV9A 1M1KW 1NKDA 4LWSB 4OPHA 2CK3G 4JYBA 4DR7O 4IGGA 5AG2A 4ZKIA 1HNZO 3BA9A 3SPJA 2N74A 5LGUA 3SPIA 4X65O 3K5NA 4W4KA 2LW1A 3RVYA 3RW0A 3T4DA 1VQLV 2UXCO 5EBMC 3CRQA 2DMXA 3W7UA 4WFAV 1I08A 3G6BA 4HNAB 2Q0AA 1VEWA 2YI8A 4X62O 2PF4E 3GVMA 1Q6IA 1NVPD 3BEHA 4U7OA 1BE3H 4MVUA 3J7AU 4LFCO 3MHHC 1K97A 2UUBO 2Z0AA 2VQFO 3JD4A 2OTJV 1E1RG 4O2BB 1FXVA 3QO8A 1XEQA 3ETEA 1MG1A 3W7WA 1IBLO 2X6BA 4MVQA 4X1IB 1BS3A 4KHPB 3JSLA 2DE0X 4UCUA 3FD9A 4MVMA 4LNUA 1SQQH 1L1FA 4DR7B 2OCHA 4BW5A 1HNZB 5CA0A 2HVKC 5J2TA 5L3DA 3UO3A 4X65B 1WPBA 1EN5A 5B1AB 3K0DA 2WLKA 3E2EA 2UXCB 4UXNA 5KMGB 1NJIW 3CHXA 1S72V 5LP6B 3AG3C 3RYCA 4JTAB 3K06A 1VQOV 1NR7A 1ZTEA 3L74H 1GN6A 3KG2A 3U0ZA 4X62B 1KB9F 1XHZA 4CBCA 4H44B 3OMIB 3CC2V 4LFCB 5FL7G 3VQWA 3VQYA 3DTUB 1YSCA 3E8HA 4PDMA 2UUBB 2VQFB 2X6CA 1NU1H 3EXAA 2RJZA 3OAAG 3UQ8A 3QVNA 5GTHZ 1FXHA 4WCEV 5JVDB 1QU7A 2YXLA 4FIPC 2XAJA 4BAYA 3OFNG 3HB3B 3JD1A 2X7RB 1K73W 4NXNO 5C8YB 3CSXA 3CB2A 1L0NH 2QWOB 4AQYO 2ZD9A 2BTQB 4U3JA 3ZHQA 1ZSPA 1KU9A 1K3EA 1KQSU 2B1GA 5LXTA 1UPGA 4FFBA 4GKJO 2P90A 3RGBA 4CH5A 4E2LA 2W0XA 2XNDG 2QM7A 3CWBH 5A2QN 3FAVB 2DW4A 2XTAA 2PUSA 3SPHA 4I0XA 4DR1O 4B08A 1YXBA 3QG5A 3JALB 2XHBA 3CC7V 2UUCO 1IXMA 3CRAA 2QWPB 5LBQA 4JI3O 1B04A 2NR5A 4LH7A 4MS2A 3W7XA 2OIGA 3RYFB 2AHZA 2BOCC 3E8FA 3EHBB 1YF2A 2P4KA 1Y74B 3KCXA 4GX5A 2UXBB 4MVSA 1KKDA 4NYKA 3SJCC 1VQPV 4NXNB 1S0VA 1H38A 4OX9O 1Y76B 1QHTA 2XT9A 3L71H 4AQYB 3L70H 2FL4A 5JJNB 1AR5A 1N0JA 2JJ2G 1V54B 2AW9A 4JTDB 4LFAO 4GKJB 3AG4B 1H2GA 3K5OA 5EZYA 4NXMB 2KG7B 1BCCH 1GN4A 1JR9A 3QTCA 3ZEDA 5L3GA 2YXHA 4OXSA 1I0HA 3K3WA 2HEPA 5B1AC 1AB3A 1FFXA 4JI8O 1G6UA 4NTYA 3WFVA 4LCUC 4OPAA 4RUEA 4W4LA 2YIDA 5B5EZ 4F6RB 2UUCB 5LP6C 3MDSA 4GUNA 5GONB 1K9MW 2Q68A 3CCJV 4JI3B 1N33O 2A9HA 3B8MA 4LNUB 4FLVA 2Q4PA 1K4DC 2Q69A 2QM8A 2QWRB 1Q3EA 4MSWC 3AK3A 2F4VO 4H0LB 3HPLC 2Q7GA 3ZHSA 2Q9LA 2RCVA 5EK0A 2R70A 1NZ6A 1V55B 1D5NA 2Q7HA 1NI8A 2DYSB 2Q67A 3A0HZ 4ABMA 3HKBA 2HHHO 5L3FA 3IC7A 2EBOA 4L87A 5FNVA 1HNWB 3K57A 5H5NA 1BHAA 4O4LA 1H8HG 2E75B 1S5LZ 3CS5A 1OCZB 3RVZA 4LFAB 1K5SA 2JEUA 1R6KA 2V1DA 3IFXA 4EB6A 3FX7A 2WWWA 4ZI7A 2VQEO 1NTMH 3LNMB 2HLDG 1RSOA 2ITDC 3H9VA 1I5XA 3SPGA 2PGGA 5KLVH 5EC1C 4JI8B 1NTKH 4IYHA 2ZNIA 1NT2B 2K1EA 2NLJC 1JFFA 1WLEA 3G4SV 3QO5A 3JSNA 1OCRB 2OT5A 1QVGU 4F4LA 1YJWV 5B66Z 1N33B 1ZWIC 1HNXO 4U3JB 2DJVA 1QBZA 4TV8A 5BMVB 3G71V 2ADPA 2WLJA 2F4VB 2CTQA 4WFGA 1I7FA 1IBMO 2KQXA 3J80N 4DV7O 3JD0A 3F7YC 5LGNA 5F2VO 2R9AA 2BE3A 3JD2A 4DRXA 2HHHB 2GTAA 5B1NA 3W7SA 3JASA 3TXSA 3SR2C 5EYPA 3EFFK 4FLXA 5IYZB 1V54C 4LBEC 2VQEB 4CS4A 3AG4C 1MA1A 3NR7A 4DYLA 4DR3O 3ZRXA 1Q82W 3JD3A 3E8GA 2EZOA 4X64O 2QSAA 2Y0PA 1Z2GA 1OCCB 3CE2A 3CXHF 4CH4A 1J5EO 1NBMG 4J9ZB 2YS8A 2JEXA 4HZ3A 5A9GA 4FZ0A 1M5IA 1HNXB 1GK9A 1P7GA 3CP1A 2HVJC 3B2EE 1BSMA 4RO2A 1Q86W 2P6JA 4O4JA 4LFBO 2NN4A 1SESA 4QPJA 3O9OA 4H33A 3ZBHA 1NH2D 1YEWA 1M56B 4DR2B 3ZRVA 2CGNA 1XDCA 2M7WA 1V55C 5JCOA 2P22C 2DYSC 4AILC 4PA3A 2V7QG 3G80A 4DV6O 2JVDA 1TUEB 3D3IA 1AI5A 4UV8A 1N36O 4MVZA 4KUMA 3JCUZ 1OCZC 3GWKC 1VQNV 3K59A 3N2GB 1MZEA 2G38A 3ETGA 2CH7A 5EIBC 2ZKOA 4JI6O 4X64B 3E35A 3OR7C 1J5EB 2W0FC 2FMLA 4FLTA 2A79B 3NXSA 3JARA 3OGIB 4ASUG 3HKCA 1TUBA 2Q6AA 2IU3A 4B3RB 3C90A 4B3SO 5ITZB 3ML0A 1S5JA 1G1XB 4X20A 1Q6HA 4O4LB 2XUMA 3TGUH 3ZMTA 3G6EV 3AG1B 3CCVV 1H2SB 4FMTA 3SDLA 4PI0A 3ABUA 4HBNA 1JPXA 2BCCH 2GUZA 1UFIA 4DV0O 3MD0A 3CXCU 2WAMA 3N2KB 2EILB 1UJWB 3RYHA 2HP8A 3FB7C 1VQ6V 2R72A 4AI8A 3CMEV 4J42A 5K1PA 3GWOA 3A8TA 4DV4O 4DV6B 2FKXA 2E76B 1N36B 1URFA 4UVCA 4JI5O 4YIOA 1HDJA 1YTFB 1PV0A 2YI9A 5J9PC 1TGOA 4GX2A 4DV5O 1GN3A 3RWRD 3U10A 1TAEA 4TUYB 3T1YO 3I56V 1X4TA 4TSFG 4JI6B 2LP7A 2ZM6O 1BZKA 1FXKA 4XBFA 2CDYA 1R6NA 1EN6A 2ETNA 3IAYA 1XMOO 1Y6XA 3ZRWA 1OCCC 2KKWA 4UB8Z 1Q5OA 1WNSA 4CS3A 4B3SB 1YITV 3JASB 3EVKA 4D6TH 3FKSG 4IT5A 4WFEA 1BGYH 5EYPB 3F7VC 1S5HC 4CS2A 3STLC 2F43G 4TQFA 5CA1A 1VQMV 4B7EA 3E22A 1IBKB 3ZN0A 4LF7B 4JAUA 3B77A 5KHIA 2Q0OC 3DXRA 4QE9A 4ZHQA 1Z5VA 3CC4V 1M56C 2P67A 3I55V 4IL6Z 3OTFA 4DV4B 5IJ0B 1VF6A 1XILA 3JAKB 5DEDA 1ZAUA 1LUVA 4J7KA 2IM9A 4WF9V 2LO1A 3JATA 3H1IH 4DV5B 2LQTA 2GDSA 1P4RA 3F5WC 4JTCB 3K0GA 1D2DA 3T1YB 1H2KA 4YXWG 4JI7O 2EIKB 2VRZA 2ZM6B 2OYQA 5KHHA 2XAHA 4YJ3A 2PZSA 3OTOO 3P32A 1FYJA 3PJSK 3CJHB 2Q7EA 1EM1A 1ROPA 1VP7A 3OEEG 4J7JA 3FYEB 2ODMA 5EBLC 2PYLA 1QNMA 4YJ2B 2HKOA 3AG1C 2QKAA 2FYUH 3ZHUA 2LGWA 4B3TO 2CUGA 1PNMA 5IE9A 2HG5C 2HFEC 1H2MA 2AZ0A 4ZBMA 4JASA 2CH7B 4X8AA 4XDLA 5KAFZ 4EFBA 4GX1A 2EILC 1PKXA 3IJ4A 4NKGB 1JX9A 2R9IA 3RBZA 1VIBA 3JAMN 3FB6C 2Q73A 1R3KC 4O4IA 2P5OA 4CH6A 2H94A 4UCTA 1JCHA 4DUYO 1AILA 4JI7B 2QWNB 5EBWC 2CTPA 3ZHTA 4FK5C 4U7NA 1AR4A 2E5LO 4IHJA 5JH7A 3OTOB 4X1YB 4P2ZA 1SZTA 3ICXA 3RT3C 4TV9A 3FFQA 1IBLB 3CX5F 2WLIA 2IH3C 2IU0A 1XNRO 1DLBA 4I50B 1N32O 2LFSA 1M90W 1FPOA 2A0LA 5IJ9B 2Q8VA 3SYQA 2ZE5A 4P9PA 3GB7C 1PL4A 1NVPB 5IYBO 1AVMA 1W0KG 2YIAA 1YI2V 4IIJA 1VARA 3E8BA 4JV5O 1FXKB 3BVOA 4I55B 1B06A 3HKEB 3KKYA 1L8DA 2QR4A 1SC5B 3M7MX 4QIWF 3T4ZA 3Q4HA 3ZRWB 5B3SC 1VQ7V 2JGDB 3OR6C 4KFMA 2IJHA 3LUTB 1AI7A 3AG2B 2BOBC 1TA8A 4R6ZA 3DC5A 2XAGA 4MVRA 2LGQA 1HR0O 2YIBD 3J81N 3B8NA 3OMNB 3S3XA 1H2NA 4DUYB 1FFTB 3RYIA 4DW1A 2RNBA 3SYOA 1YVWA 1HW7A 2RDCA 2MW2B 2EIKC 4G28B 2IBZH 2E5LB 3BHPA 4BR6A 4WFBV 4H37A 3LSUA 4JGSA 2HJFC 4GZRB 4R8CA 4XDJA 3C3SA 4DXWA 3BAAA 1KBHA 3ASNB 2ADQB 5J2UA 1COWG 1CPYA 1Q43A 3CCEV 1XNRB 1N32B 4NVPA 5IYCO 4JAAA 5LMNO 2IJKA 3ZMZA 5LOVA 4N23A 2N05A 2Y0IA 1R1BA 3JYCA 1AJNA 4B7KA 2QWQB 5B1BB 4QPKA 2PI4A 1GO3F 1RM1B 1EN4A 3UM7A 1SQBH 2ZCEA 4YJ3B 4UCOA 2GTSA 3IC9A 1JMKC 4DR1B 2GV9A 5BR8O 4WFFA 3UCSC 2IJJA 1SA0A 2OIEA 4CZZA 4YHHO 4DR6O 2A7WA 1SS3A 1S76D 2GSMB 5JQGA 4JI4O 2VWJA 5CA0B 4FLUA 3ZIAG 5CBFA 5J2TB 4ICGA 3WG7B 4MW3A 3APQA 3MAQA 3OUFA 1RPRA 1XNQO 4QE7A 1B3QA 3CRMA 4GX0A 2YUAA 2PYJA 4FJCC 3TJTA 1YZBA 2RN9A 1R73A 3QO7A 4OX9B 2X0LA 3RYCB 4LC1A 3SYCA 1MSWD 4GKKO 3K03A 5LMNB 3ZMSA 2JDIG 5KHGA 4O4IB 2JS5A 1YDXA 1QLEB 1SQPH 4DV3O 4YY3O 2WLNA 4J7ZA 1NTZH 1FXKC 4KP4A 4J9YB 3G67A 5BR8B 1VQ5V 3B09A 2QDOA 4ZOLA 4C7UA 4D7SA 2ZINA 1KD1W 3AG2C 4O4HA 4J80A 2YSUB 1VQ4V 3S3WA 2ZDIC 4JI4B 5DN6G 5LXTB 2GBOA 4LF8O 4FFBB 3TK1A 4TQDA 5LL6Y 2EULA 3CCQV 2D2CB 2JGUA 2JK5C 2EX3A 1KMIZ 4HYOA 1BQ0A 1JOYA 2OWOA 1XNQB 3AG7A 3WB1A 1Q81W 3Q4HB 2EJ7A 4I0XB 4O2AA 3ASNC 5LYJA 4GKKB 4LR3A 1M57B 5GTIZ 1ZL8A 5BZBA 4RQEA 1VF6C 2NNUA 3JAWA 1SF9A 2N04A 1OZ0A 1MNGA 4XDKA 3OM3B 4MTGA 5FPRA 4FM1A 3T1HO 4LF6O 2XAFA 5IT9N 3K9SA 1GKFA 1U96A 1XOUA 5B1BC 5CBGA 1RM1C 2P7TC 4K3AA 2XAQA 1SERA 4ZIBA 5CA3A 4LWSA 2L6LA 2QGNA 3U11A 1OHHG 2ARHA 3LDDA 1GM9A 4LF8B 1MOFA 2Z3YA 1ENVA 1IBMB 5EZYB 3ZHVA 3WG7C 4DV7B 1WN7A 2QTOA 3T2MA 3O65A 4HNAA 1XHXA 3SYPA 1FFXB 4DR5O 1DF5A 4JI0O 1AR1B 4JYAO 5BXZA 1KUQA 1BMFG 1W59A 1WAZA 3D8CA 5JJJB 1LR1A 5LHGA 2CE4A 2Y69B 3OT7A 3T1HB 1QLEC 4DR3B 2PI5A 2DN9A 1Y67A 2VS0A 4X1IA 5GW7A 2JIZG 2UUAO 1NS1A 3FYIB 1Y4MA 5C93A 4PI2A 5EC2C 2EIJB 4G2KA 1AP5A 2QJ1A 3OW2U 2CTRA 4BIUA 3HKBB 1JJOA 5L3CA 1IZ3A 5FNVB 3HKDA 4MTFA 3DGEA 5LMUO 2LFRA 4EB6B 4UCRA 4ZI7B 3SPCA 4LFBB 4PA6A 5LP6A 1A32A 3TCUA 2QEXV 1RSOB 2R9RB 4DR5B 1JJ2U 5BY1A 4GCZA 4JI0B 2LJ2A 1O9GA 2QM4A 3CRCA 1JFFB 1FS0G 2W6JG 4PV1B 4MTOA 3OEHG 5DECA 2ILMA 4RAIA 5CB4A 1M4UA 4DR4O 1R3LC 4DUZO 1M57C 1R3IC 1SQVH 3BRCA 3BPZA 4LF5O 4A5UB 4TWKA 4LF4O 4TV8B 4MTXA 4PDLA 5JVDA 3K04A 4K35A 4CC6A 5C8YA 1GM7A 2YICA 3CCUV 1B6QA 4JZGA 3M99B 2BTQA 2JRIA 4I9WA 2UUAB 4YIPA 3D36A 4NR1A 4DRXB 3LDCA 4DW0A 3KCYA 3ZS8C 1PM9A 3TXQA 5LA6A 1KP2A 3THOA 5IYDO 5LMUB 3SJQC 2AZ2A 2E74B 3H01A 3FAVA 4JZ2A 4LF9O 4K8XA 3HR0A 4DV0B 2EINB 4PDRA 4Z1MG 3VOUA 4KHPO 4FLWA 3W7TA 2QKCA 5B3SB 4H13B 5HFMA 4DR4B 4DUZB 3RYFA 4RQFA 1J95A 4JI5B 3UKMA 4FLZA 2F93B 1BHBA 5IWAO 4EEQA 1THZA 1Y74A 4LF4B 4LF5B 1N8RW 1X59A 2ZXWB 3H1JH 2DYRB 2WA3A 1KECA 1E79G 2Y69C 1BQZA 4O4JB 1Y76A 1ZUQA 3CEIA 1XMOB 2OCCB 5H6QA 3BA8A 3ASOB 1F23A 1MZFA 1DTOA 1Y66A 1GTOA 3WB2A 2EIJC 2KG7A 1K8AW 4MT8A 1XBLA 2OTLV 1PNLA 2AXTZ 2DQ0A 3WB0A 1FAFA 1AJQA 3ZJZA 4DO2A 1G4YB 2VWKA 4FZ1A 1SQFA 4LF9B 1M9NA 4EFEA 1JVMA 4F6RA 2GHYA 2RMKB 5GONA 3L72H 1QR9A 1WPXA 2EZPA 4JAVA 3A0BZ 1N4CA 3JARB 3HKCB 1TUBB 5KHJA 2X6AA 1GM8A 4Z2WA 5IWAB 4FM0A 3HKDB 4X20B 4CH3A 1XI1A 3STZC 2F23A 2YIBA 4RWUA 4NB5A 1SQXH 4BW9A 1P7BA 1ORQC 5E79Z 2GUZB 3ABLB 3DSQA 1VQ8V 1I94O 3P30A 4B3MO 4KXRA 1FD9A 3JCZA 4CC5A 3RYHB 1QR8A 2EIMB 3A2FA 3ZRSA 3K5LA 1D5AA 3P3PA 4MW8A 5CB4B 1EZVH 3ABMB 3CRRA 5KUMA 5DM6V 2ZR2A 2ZE7A 1K5QA 2IJIA 4X1KA 1LUWA 5D5PA 4B3TB 3CD6V 3LSQA 4JPRA 2UXBO 1FJGO 3VQXA 1XL4A 3P3NA 2EINC 1ZLZA 1OJHA 2YDEA 3LSSA 1VF7A 1ZX3A 4GYCB 5BMVA 1WA8A 1IXBA 2K9PA 2V4DA 1V9PA 1W2BU 3VBBA 4NXMO 2IH1C 2RQ6A 5LA6B 2W6IG 4TOIA 2ZQMA 5IDJA 2KSDA 1MMMA 2HJDA 3ABTA 1K33A 3L73H 2ZXWC 2DYRC 5CA1B 1W0JG 2Q5ZA 1I94B 1O9HA 3E22B 3WU2Z 4I7ZB 4B3MB 1F7YA 2JS3A 3DXRB 2OCCC 4ZHQB 5IYZA 2E3CA 3ASOC 5EIBD 4BIZA 5JCOC 1DK1A 3SJBC 1N34O 2H8PC 3LNNA 5H2FZ 1F4NA 5JWPA 1AJPA 3JATB 2CGOA 3OGCC 3UT5A 5L3EA 1EFRG 5H6RA 3SYAA 1FJGB 1CXZB 2ZIOA 2QKSA 5LHIA 4BIOA 3APOA 4JV5B 1K34A 2WPDG 3ZHRA 1HNWO 5H9CA 3ABKB 2F1MA 3FB5C 3K9AA 3CPWU 3M8AA 4PA9A 4DV2O 1QQCA 2M6YA 1YIJV 3RN4A 1HWYA 1N0NA 4FFKA 2BTOA 4PELA 1HR0B 1KYOF 2F95B 4X88A 3BFRA 2DWDC 2Y4UA 5D5QA 2WLLA 5LHHA 4I9QA
chains in the Genus database with same CATH topology
4CBCA 4TSFG 2LP7A 3OMIB 1FXKA 3CC2V 5FL7G 4XBFA 1R6NA 1YSCA 3DTUB 3E8HA 4PDMA 1OHHG 3ZRWA 3LDDA 1QLNA 1GM9A 1OCCC 3ABLC 2X6CA 1MOFA 2Z3YA 1ENVA 1KC8W 3QNEA 1YITV 3FKSG 3OAAG 3WG7C 2EJRA 4WFEA 2EIMC 3F7VC 2QTOA 3T2MA 1FXHA 4WCEV 3AEIA 1KP3A 4FIPC 1S5HC 2XAJA 1QVFU 3SYPA 4BAYA 1DF5A 3OFNG 3ABMC 3HB3B 3JD1A 2X7RB 1AR1B 1K73W 3STLC 2F43G 1Q7YW 1VQMV 3CCRV 2ZD9A 3ZN0A 1K3EA 1KQSU 2B1GA 4JAUA 1BMFG 1JQ0A 3ZMUA 3B77A 2WLHA 1R3JC 4QE9A 2P90A 4E2LA 2C2AA 3CC4V 1M56C 2P67A 3I55V 2XNDG 5CMUA 2QM7A 5LHGA 2UXNA 2Y69B 1QLEC 1VQKV 2PI5A 1SETA 5GW7A 2DW4A 3TETA 4WF9V 4HAMA 2WLIB 3SPHA 4QNHB 2ATKC 1P4RA 2KB1A 3F5WC 4JTCB 3K0GA 5E1AC 2JIZG 1K7DA 5KA5A 3CC7V 2YEVA 1IXMA 4YXWG 3FYIB 1Y4MA 5C93A 3LDEA 3X2QB 2EIKB 5EC2C 2EIJB 4G2KA 5LBQA 3OW2U 4BIUA 5L3CA 3K79A 3E83A 1H8EG 2XAHA 4MTFA 2WLMA 3P32A 5IY5B 3DGEA 3PJSK 3W7XA 4MS2A 1ROPA 2LFRA 2AHZA 2BOCC 3OEEG 1EBOA 3E8FA 3EHBB 3SPCA 4GT1A 4PA6A 3FYEB 3TCUA 2QEXV 3ETDA 2HR3A 4GX5A 5EBLC 3CCSV 2R9RB 4MVSA 1KKDA 2HKOA 3IGAC 3AG1C 1JJ2U 1EZJA 4GCZA 1VQPV 1BL8A 1S0VA 1H38A 5KUKA 1FS0G 1PNMA 1VQ9V 4PA4A 2W6JG 2FTKA 4MTOA 2HG5C 2HFEC 3OEHG 1I5YA 2JJ2G 1V54B 4UUJC 4ZBMA 4JASA 4JTDB 4RAIA 1R3LC 2DQ3A 3AG4B 1H2GA 1M57C 1LNQA 4X8AA 4XDLA 1R3IC 4GX1A 3FB8C 2EILC 1PKXA 5L3GA 4TWKA 4OXSA 1G8MA 4MTXA 3K3WA 1JX9A 2R9IA 3ABKC 4PDLA 1NQTA 3RBZA 3ZCCA 1GMGA 5B1AC 3K04A 3FB6C 1F4MA 5CN0A 3WFVA 1R3KC 4LCUC 1GM7A 1NR1A 4RUEA 1B6QA 3CCUV 3M99B 1E1QG 2H94A 1JCHA 4I9WA 1F51A 1OCOB 4JYCA 1K9MW 3D36A 5EBWC 3BY6A 2Q68A 3CCJV 3LDCA 2A9HA 3B8MA 4FK5C 4U7NA 4P9OA 1K4DC 4P2ZA 1KP2A 5LGTA 5IYDO 1SZTA 2Q69A 1PL0A 2QM8A 3SJQC 4MSWC 1YTFD 3H01A 4WFHA 2ITCC 4P30A 3HPLC 2WLIA 4EKWA 2IH3C 4PDVA 4MVOA 3CCLV 5EK0A 1K4CC 3E89A 3MHSC 2IU0A 1DLBA 4N21A 2EINB 2IW5A 2LFSA 1V55B 4PDRA 1M90W 4Z1MG 1XL6A 2A0LA 2DYSB 2Q67A 5B1OA 3VOUA 4FPPA 2B5UA 3SYQA 3W7TA 3E86A 2Y48A 4G27B 4QJFB 4P9PA 5L3FA 3GB7C 3IC7A 2EBOA 3ZN1A 2QE7G 5B3SB 5IYBO 5HFMA 4L87A 1NVPB 1QCEA 2Z5UA 1W0KG 1K92A 4X89A 2WLLB 4R50A 1BHAA 1H8HG 1SRYA 1YI2V 1OCZB 3RVZA 2QA4V 1K5SA 3R65A 2JEUA 1R6KA 2V1DA 3IFXA 3E8BA 4RQFA 1FXKB 2WWWA 1J95A 1BHBA 1DF4A 4JF3A 3UKMA 4QIWF 1THZA 3T4ZA 3LNMB 3ZRWB 5B3SC 2D3OW 2HLDG 1CP9A 1VQ7V 3OR6C 1N8RW 2ITDC 4KFMA 1I5XA 2IJHA 3SPGA 2ZXWB 2DYRB 2ZR3A 1KECA 1AI7A 3AG2B 1E79G 2BOBC 3LUTB 5EC1C 2Y69C 4R6ZA 2XAGA 4MVRA 5CBHA 2K1EA 2NLJC 3B8NA 3A0RA 3OMNB 1WLEA 3G4SV 3QO5A 1FFTB 1OCRB 2OCCB 5H6QA 2OT5A 1QVGU 4F4LA 3SYOA 3ASOB 1YJWV 4R7CA 2AHYA 1S77D 1F23A 1ZWIC 1DTOA 1Y66A 3X2QC 2EIKC 4G28B 1GTOA 2EIJC 4WFBV 1K8AW 4H37A 4MT8A 2XOKG 4LP8A 1QBZA 2OTLV 4JGSA 4UVAA 1PNLA 3G71V 2HJFC 1OCRC 4R8CA 4XDJA 2WLJA 4PA7A 5IY5C 4DXWA 2DQ0A 4WFGA 3OMAB 3ASNB 1AJQA 3ZJZA 4DO2A 1G4YB 1COWG 1CPYA 3CCEV 3JD0A 2MK3A 1S3JA 1M9NA 3F7YC 5LGNA 3CMAV 1JVMA 2GHYA 3K08A 5IYCO 2JJ1G 2DWEC 1MABG 3JD2A 1AI6A 1QR9A 1WPXA 2EZPA 4I5SA 1CEZA 2IJKA 4Q20A 4JAVA 5B1NA 2YEVB 3W7SA 3ZMZA 1RPOA 4N23A 3JYCA 5HFLA 1AJNA 4RUFA 5B1BB 3CYOA 3EFFK 4QPKA 1YJNV 2PI4A 3T1CA 1GO3F 2X6AA 1GM8A 2XASA 3AG3B 1RM1B 3UM7A 1V54C 3OE7G 4LBEC 2UXXA 1PNKA 5KA6A 3AG4C 3STZC 4WFFA 2IJJA 3ZRXA 1Q82W 3JD3A 4CZZA 1AROP 3CCMV 3E8GA 1NH2B 1P7BA 2EZOA 1YHQV 1ORQC 1OCCB 3ABLB 1VQ8V 1NBMG 4J9ZB 3P30A 1S76D 2GSMB 2JEXA 3OUSA 4HZ3A 4UVBA 3ZMVA 1YJ9V 3JCZA 3ZIAG 5CBFA 3WG7B 1OCOC 1QR8A 1GK9A 2EIMB 3ZRSA 3CP1A 4MW3A 1PD3A 2B1IA 3OUFA 4TT3G 4MW8A 1RPRA 2HVJC 3ABMB 4RO2A 5KUMA 4QE7A 1Q86W 5DM6V 1AI4A 4GX0A 5L3BA 4FJCC 2ZR2A 2P6JA 1K5QA 1R73A 3QO7A 2IJIA 2X0LA 3CD6V 2ZDIA 3LSQA 1SESA 2WSSG 4QPJA 4LC1A 3SYCA 4JPRA 4UV9A 1MSWD 1M1KW 4H33A 1NH2D 1NKDA 2CK3G 3K03A 1M56B 4JYBA 3ZMSA 2JDIG 4ZKIA 1XL4A 3ZRVA 2EINC 2M7WA 3SPJA 1V55C 5LGUA 3SPIA 2DYSC 1QLEB 3LSSA 4PA3A 2V7QG 3RVYA 3RW0A 1TUEB 3D3IA 3T4DA 1AI5A 2WLNA 1VQLV 4UV8A 5EBMC 4MVZA 4KUMA 1W2BU 1OCZC 3VBBA 2IH1C 1FXKC 2W6IG 4WFAV 3W7UA 2ZQMA 4KP4A 5IDJA 1VQNV 4J9YB 1VQ5V 3ETGA 3ABTA 1K33A 1NVPD 3BEHA 2ZXWC 4U7OA 4MVUA 2DYRC 1KD1W 3AG2C 3E35A 3OR7C 1W0JG 3MHHC 2W0FC 1K97A 2YSUB 1VQ4V 2ZDIC 3JD4A 2OTJV 2A79B 3NXSA 5DN6G 1E1RG 4ASUG 2OCCC 2Q6AA 3TK1A 2IU3A 1FXVA 3ML0A 3ASOC 3QO8A 3CCQV 3ETEA 3ZMTA 1MG1A 2JK5C 4BIZA 4HYOA 3G6EV 1JOYA 3AG1B 3CCVV 4FMTA 3W7WA 2H8PC 2X6BA 1Q81W 3ABUA 4MVQA 1F4NA 1AJPA 1JPXA 4MVMA 3OGCC 5L3EA 3ASNC 1EFRG 5H6RA 3SYAA 3MD0A 3CXCU 1M57B 1L1FA 2QKSA 2WAMA 4BW5A 5BZBA 5LHIA 4RQEA 2HVKC 2EILB 1UJWB 1K34A 2NNUA 2WPDG 5L3DA 3FB7C 5H9CA 1VQ6V 3ABKB 3FB5C 1OZ0A 3K9AA 3CMEV 4XDKA 5B1AB 3OM3B 3GWOA 3CPWU 3K0DA 4MTGA 2WLKA 3E2EA 4PA9A 4UXNA 2XAFA 4UVCA 1YIJV 1GKFA 1HWYA 5B1BC 1YTFB 1NJIW 4PELA 1S72V 5CBGA 3AG3C 5J9PC 4JTAB 3K06A 4GX2A 4X88A 1RM1C 1NR7A 2P7TC 1VQOV 2XAQA 1SERA 2DWDC 5CA3A 3KG2A 2WLLA 5LHHA 3I56V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8N A;  1K34 A;  4FIP C;  2LP7 A;  1MG1 A;  3H01 A;  5CN0 A;  5H9C A;  3WFV A;  5KA6 A;  1DF5 A;  2OT5 A;  2MK3 A;  1QR8 A;  3K9A A;  2X7R B;  3CP1 A;  1K33 A;  3M99 B;  2M7W A;  1DF4 A;  3GWO A;  1I5Y A;  4JF3 A;  1F23 A;  1EBO A;  3MHS C;  1Y66 A;  1QR9 A;  1DLB A;  4N21 A;  2EZP A;  4JPR A;  1JPX A;  3MHH C;  1MOF A;  5KA5 A;  1ENV A;  1I5X A;  1JQ0 A;  2EZO A;  1QBZ A;  3B77 A;  4FJC C;  4JGS A;  1Y4M A;  3B8M A;  4FK5 C;  2P6J A;  4N23 A;  4E2L A;  5HFL A;  4G2K A;  2EBO A;  3P30 A;  3CYO A;  5CMU A;  5HFM A;  1QCE A;  1SZT A; 
#chains in the Genus database with same CATH topology
 5KHK A;  2UXD O;  3B40 A;  1FKA O;  3C3T A;  3BCC H;  2BSK A;  1QLN A;  3ABL C;  4F6E A;  1KC8 W;  3QNE A;  2QTS A;  3N27 A;  3RFR A;  2EJR A;  1N34 B;  2EIM C;  3AEI A;  3N2G A;  1KP3 A;  1QVF U;  2B9Z A;  3ABM C;  4JI2 O;  1Z5W A;  3OD4 A;  1Q7Y W;  3CCR V;  1XQ8 A;  1H2L A;  1JQ0 A;  1Q6U A;  5KAI Z;  3ZMU A;  2WLH A;  1R3J C;  4J11 A;  2C2A A;  4Q6G A;  5ITZ A;  5CMU A;  4IHJ B;  2ZIM A;  5JH7 B;  2UXN A;  4WBN A;  4DV2 B;  3I5D A;  1T5E A;  1VQK V;  4TV9 B;  4UCS A;  1SET A;  1SQG A;  3D36 C;  4YHH B;  1US6 A;  4K8Z A;  3TET A;  4HAM A;  2WLI B;  4QNH B;  4DR6 B;  2ATK C;  2KB1 A;  4QGP A;  5E1A C;  1K7D A;  5KA5 A;  1IX9 A;  2YEV A;  1GH6 A;  1BT8 A;  2UXD B;  3LDE A;  3X2Q B;  3N2K A;  4E4E A;  4X1K B;  1WJZ A;  2FB5 A;  3K79 A;  3E83 A;  5TIS Z;  1H8E G;  5KX5 A;  2WLM A;  5IY5 B;  3K5M A;  4I4T A;  4LH6 A;  4IIJ B;  4NTW A;  2Y4T A;  3F5T A;  1EBO A;  1OV9 A;  4GT1 A;  4X9Q A;  4K0K O;  3K58 A;  1PP9 H;  3ETD A;  2HR3 A;  1WA8 B;  3CCS V;  3QF7 A;  1TVK A;  1WP7 A;  4TUY A;  3SGI A;  3IGA C;  1XUQ A;  1EZJ A;  1BL8 A;  3ZX6 A;  4JI2 B;  5KUK A;  3BAB A;  1VQ9 V;  4PA4 A;  4D7T A;  4DV1 O;  1L0L H;  3RYI B;  2FTK A;  4DV3 B;  1I5Y A;  4UUJ C;  4DR2 O;  1GRJ A;  4YY3 B;  2DQ3 A;  1LNQ A;  1VF5 B;  2AGA A;  2ZT9 B;  3FB8 C;  1YCI A;  1DGS A;  1G8M A;  3ABK C;  1P49 A;  3ZCC A;  1NQT A;  4NTX A;  1GMG A;  2A06 H;  1F4M A;  5CN0 A;  5J2U B;  1NR1 A;  4UCV A;  1E1Q G;  4KL1 A;  5FPO A;  1F51 A;  1SZX A;  1OCO B;  4JYC A;  4J10 A;  3KZI Z;  3BY6 A;  1KKC A;  3ETQ A;  2PY5 A;  3UT5 B;  1SKV A;  4P9O A;  5FLX N;  5LOV B;  5LGT A;  2LW7 A;  1PL0 A;  5IJ0 A;  1YTF D;  3JAK A;  4WFH A;  2ITC C;  4B3R O;  4P30 A;  4K0K B;  4EKW A;  2ZE8 A;  4Z1V A;  4PDV A;  4MVO A;  4U3F H;  3CCL V;  1Q90 D;  1Q8I A;  1K4C C;  3E89 A;  3MHS C;  4N21 A;  4FM2 A;  2IW5 A;  1RFY A;  1XL6 A;  2H3O A;  1SA0 B;  5B1O A;  4L8J A;  4GLX A;  4FPP A;  2B5U A;  2L35 A;  2Y48 A;  3E86 A;  4G27 B;  4QJF B;  4IYI A;  3ZN1 A;  2QE7 G;  4DV1 B;  1QCE A;  2Z5U A;  3L9D A;  4O2B A;  5JJE B;  4X66 O;  1K92 A;  4X89 A;  2WLL B;  4R50 A;  5JQG B;  2ZNJ A;  1SRY A;  3CJH A;  4LF6 B;  2UU9 O;  2QA4 V;  3R65 A;  3DC6 A;  4DK0 A;  2P06 A;  1DF4 A;  4JF3 A;  3B4S A;  2ZE6 A;  3VQV A;  2BSK B;  3SJA C;  2F66 C;  2D3O W;  1CP9 A;  3D3Q A;  3L75 H;  1R6T A;  4PD4 F;  2WA4 A;  1XMQ O;  2YC0 A;  2ZR3 A;  4YJ2 A;  4BWA A;  3AK2 A;  5CBH A;  2YXY A;  3A0R A;  1M93 A;  4R7C A;  2AHY A;  4UB6 Z;  1S77 D;  1XRE A;  5KMG A;  3X2Q C;  4FLY A;  1MSD A;  2XOK G;  4LP8 A;  4AHC A;  1RP3 B;  4UVA A;  1OCR C;  4PA7 A;  5IY5 C;  3H1L H;  1P84 F;  3OMA B;  1IUR A;  3H1H H;  2PTM A;  4WBN B;  1U97 A;  4J41 A;  4OGQ B;  4JYA B;  1WP8 A;  1S3J A;  2MK3 A;  4ZOL B;  4JI1 O;  3CMA V;  3R66 A;  3K08 A;  3UO2 A;  2JJ1 G;  1HP8 A;  2DWE C;  2P4V A;  1VMG A;  1MAB G;  1AI6 A;  4I5S A;  1IVS A;  1CEZ A;  4Q20 A;  2DOS A;  4X66 B;  1AP6 A;  3AK1 A;  4O4H B;  2YEV B;  1IBK O;  1RPO A;  4X1Y A;  4LF7 O;  5HFL A;  4RUF A;  2UU9 B;  3CYO A;  1GN2 A;  1YJN V;  3T1C A;  2XAS A;  3AG3 B;  2CAZ C;  3OE7 G;  2UXX A;  1PNK A;  5KX5 B;  5KA6 A;  4I4T B;  1XMQ B;  4I50 A;  1JA8 A;  4PJ0 Z;  5IJ9 A;  1ARO P;  3CCM V;  1NH2 B;  1YHQ V;  4O2A B;  5LYJ B;  1TVK B;  4UVB A;  3OUS A;  3ZMV A;  1ZL8 B;  5K1X A;  4UFZ A;  1YJ9 V;  2CTW A;  1OCO C;  4I55 A;  3HKE A;  3JAW B;  1PD3 A;  2B1I A;  4TT3 G;  1WB7 A;  2JGD A;  4DK1 A;  1PPJ H;  3JAL A;  3PN1 A;  1WB8 A;  1AI4 A;  5L3B A;  4JYY A;  4FVM A;  1GAX A;  3H1K H;  2O57 A;  4PHZ A;  2ZDI A;  2WSS G;  1IDS A;  2A3Q A;  4JI1 B;  4UV9 A;  1M1K W;  1NKD A;  4LWS B;  4OPH A;  2CK3 G;  4JYB A;  4DR7 O;  4IGG A;  5AG2 A;  4ZKI A;  1HNZ O;  3BA9 A;  3SPJ A;  2N74 A;  5LGU A;  3SPI A;  4X65 O;  3K5N A;  4W4K A;  2LW1 A;  3RVY A;  3RW0 A;  3T4D A;  1VQL V;  2UXC O;  5EBM C;  3CRQ A;  2DMX A;  3W7U A;  4WFA V;  1I08 A;  3G6B A;  4HNA B;  2Q0A A;  1VEW A;  2YI8 A;  4X62 O;  2PF4 E;  3GVM A;  1Q6I A;  1NVP D;  3BEH A;  4U7O A;  1BE3 H;  4MVU A;  3J7A U;  4LFC O;  3MHH C;  1K97 A;  2UUB O;  2Z0A A;  2VQF O;  3JD4 A;  2OTJ V;  1E1R G;  4O2B B;  1FXV A;  3QO8 A;  1XEQ A;  3ETE A;  1MG1 A;  3W7W A;  1IBL O;  2X6B A;  4MVQ A;  4X1I B;  1BS3 A;  4KHP B;  3JSL A;  2DE0 X;  4UCU A;  3FD9 A;  4MVM A;  4LNU A;  1SQQ H;  1L1F A;  4DR7 B;  2OCH A;  4BW5 A;  1HNZ B;  5CA0 A;  2HVK C;  5J2T A;  5L3D A;  3UO3 A;  4X65 B;  1WPB A;  1EN5 A;  5B1A B;  3K0D A;  2WLK A;  3E2E A;  2UXC B;  4UXN A;  5KMG B;  1NJI W;  3CHX A;  1S72 V;  5LP6 B;  3AG3 C;  3RYC A;  4JTA B;  3K06 A;  1VQO V;  1NR7 A;  1ZTE A;  3L74 H;  1GN6 A;  3KG2 A;  3U0Z A;  4X62 B;  1KB9 F;  1XHZ A;  4CBC A;  4H44 B;  3OMI B;  3CC2 V;  4LFC B;  5FL7 G;  3VQW A;  3VQY A;  3DTU B;  1YSC A;  3E8H A;  4PDM A;  2UUB B;  2VQF B;  2X6C A;  1NU1 H;  3EXA A;  2RJZ A;  3OAA G;  3UQ8 A;  3QVN A;  5GTH Z;  1FXH A;  4WCE V;  5JVD B;  1QU7 A;  2YXL A;  4FIP C;  2XAJ A;  4BAY A;  3OFN G;  3HB3 B;  3JD1 A;  2X7R B;  1K73 W;  4NXN O;  5C8Y B;  3CSX A;  3CB2 A;  1L0N H;  2QWO B;  4AQY O;  2ZD9 A;  2BTQ B;  4U3J A;  3ZHQ A;  1ZSP A;  1KU9 A;  1K3E A;  1KQS U;  2B1G A;  5LXT A;  1UPG A;  4FFB A;  4GKJ O;  2P90 A;  3RGB A;  4CH5 A;  4E2L A;  2W0X A;  2XND G;  2QM7 A;  3CWB H;  5A2Q N;  3FAV B;  2DW4 A;  2XTA A;  2PUS A;  3SPH A;  4I0X A;  4DR1 O;  4B08 A;  1YXB A;  3QG5 A;  3JAL B;  2XHB A;  3CC7 V;  2UUC O;  1IXM A;  3CRA A;  2QWP B;  5LBQ A;  4JI3 O;  1B04 A;  2NR5 A;  4LH7 A;  4MS2 A;  3W7X A;  2OIG A;  3RYF B;  2AHZ A;  2BOC C;  3E8F A;  3EHB B;  1YF2 A;  2P4K A;  1Y74 B;  3KCX A;  4GX5 A;  2UXB B;  4MVS A;  1KKD A;  4NYK A;  3SJC C;  1VQP V;  4NXN B;  1S0V A;  1H38 A;  4OX9 O;  1Y76 B;  1QHT A;  2XT9 A;  3L71 H;  4AQY B;  3L70 H;  2FL4 A;  5JJN B;  1AR5 A;  1N0J A;  2JJ2 G;  1V54 B;  2AW9 A;  4JTD B;  4LFA O;  4GKJ B;  3AG4 B;  1H2G A;  3K5O A;  5EZY A;  4NXM B;  2KG7 B;  1BCC H;  1GN4 A;  1JR9 A;  3QTC A;  3ZED A;  5L3G A;  2YXH A;  4OXS A;  1I0H A;  3K3W A;  2HEP A;  5B1A C;  1AB3 A;  1FFX A;  4JI8 O;  1G6U A;  4NTY A;  3WFV A;  4LCU C;  4OPA A;  4RUE A;  4W4L A;  2YID A;  5B5E Z;  4F6R B;  2UUC B;  5LP6 C;  3MDS A;  4GUN A;  5GON B;  1K9M W;  2Q68 A;  3CCJ V;  4JI3 B;  1N33 O;  2A9H A;  3B8M A;  4LNU B;  4FLV A;  2Q4P A;  1K4D C;  2Q69 A;  2QM8 A;  2QWR B;  1Q3E A;  4MSW C;  3AK3 A;  2F4V O;  4H0L B;  3HPL C;  2Q7G A;  3ZHS A;  2Q9L A;  2RCV A;  5EK0 A;  2R70 A;  1NZ6 A;  1V55 B;  1D5N A;  2Q7H A;  1NI8 A;  2DYS B;  2Q67 A;  3A0H Z;  4ABM A;  3HKB A;  2HHH O;  5L3F A;  3IC7 A;  2EBO A;  4L87 A;  5FNV A;  1HNW B;  3K57 A;  5H5N A;  1BHA A;  4O4L A;  1H8H G;  2E75 B;  1S5L Z;  3CS5 A;  1OCZ B;  3RVZ A;  4LFA B;  1K5S A;  2JEU A;  1R6K A;  2V1D A;  3IFX A;  4EB6 A;  3FX7 A;  2WWW A;  4ZI7 A;  2VQE O;  1NTM H;  3LNM B;  2HLD G;  1RSO A;  2ITD C;  3H9V A;  1I5X A;  3SPG A;  2PGG A;  5KLV H;  5EC1 C;  4JI8 B;  1NTK H;  4IYH A;  2ZNI A;  1NT2 B;  2K1E A;  2NLJ C;  1JFF A;  1WLE A;  3G4S V;  3QO5 A;  3JSN A;  1OCR B;  2OT5 A;  1QVG U;  4F4L A;  1YJW V;  5B66 Z;  1N33 B;  1ZWI C;  1HNX O;  4U3J B;  2DJV A;  1QBZ A;  4TV8 A;  5BMV B;  3G71 V;  2ADP A;  2WLJ A;  2F4V B;  2CTQ A;  4WFG A;  1I7F A;  1IBM O;  2KQX A;  3J80 N;  4DV7 O;  3JD0 A;  3F7Y C;  5LGN A;  5F2V O;  2R9A A;  2BE3 A;  3JD2 A;  4DRX A;  2HHH B;  2GTA A;  5B1N A;  3W7S A;  3JAS A;  3TXS A;  3SR2 C;  5EYP A;  3EFF K;  4FLX A;  5IYZ B;  1V54 C;  4LBE C;  2VQE B;  4CS4 A;  3AG4 C;  1MA1 A;  3NR7 A;  4DYL A;  4DR3 O;  3ZRX A;  1Q82 W;  3JD3 A;  3E8G A;  2EZO A;  4X64 O;  2QSA A;  2Y0P A;  1Z2G A;  1OCC B;  3CE2 A;  3CXH F;  4CH4 A;  1J5E O;  1NBM G;  4J9Z B;  2YS8 A;  2JEX A;  4HZ3 A;  5A9G A;  4FZ0 A;  1M5I A;  1HNX B;  1GK9 A;  1P7G A;  3CP1 A;  2HVJ C;  3B2E E;  1BSM A;  4RO2 A;  1Q86 W;  2P6J A;  4O4J A;  4LFB O;  2NN4 A;  1SES A;  4QPJ A;  3O9O A;  4H33 A;  3ZBH A;  1NH2 D;  1YEW A;  1M56 B;  4DR2 B;  3ZRV A;  2CGN A;  1XDC A;  2M7W A;  1V55 C;  5JCO A;  2P22 C;  2DYS C;  4AIL C;  4PA3 A;  2V7Q G;  3G80 A;  4DV6 O;  2JVD A;  1TUE B;  3D3I A;  1AI5 A;  4UV8 A;  1N36 O;  4MVZ A;  4KUM A;  3JCU Z;  1OCZ C;  3GWK C;  1VQN V;  3K59 A;  3N2G B;  1MZE A;  2G38 A;  3ETG A;  2CH7 A;  5EIB C;  2ZKO A;  4JI6 O;  4X64 B;  3E35 A;  3OR7 C;  1J5E B;  2W0F C;  2FML A;  4FLT A;  2A79 B;  3NXS A;  3JAR A;  3OGI B;  4ASU G;  3HKC A;  1TUB A;  2Q6A A;  2IU3 A;  4B3R B;  3C90 A;  4B3S O;  5ITZ B;  3ML0 A;  1S5J A;  1G1X B;  4X20 A;  1Q6H A;  4O4L B;  2XUM A;  3TGU H;  3ZMT A;  3G6E V;  3AG1 B;  3CCV V;  1H2S B;  4FMT A;  3SDL A;  4PI0 A;  3ABU A;  4HBN A;  1JPX A;  2BCC H;  2GUZ A;  1UFI A;  4DV0 O;  3MD0 A;  3CXC U;  2WAM A;  3N2K B;  2EIL B;  1UJW B;  3RYH A;  2HP8 A;  3FB7 C;  1VQ6 V;  2R72 A;  4AI8 A;  3CME V;  4J42 A;  5K1P A;  3GWO A;  3A8T A;  4DV4 O;  4DV6 B;  2FKX A;  2E76 B;  1N36 B;  1URF A;  4UVC A;  4JI5 O;  4YIO A;  1HDJ A;  1YTF B;  1PV0 A;  2YI9 A;  5J9P C;  1TGO A;  4GX2 A;  4DV5 O;  1GN3 A;  3RWR D;  3U10 A;  1TAE A;  4TUY B;  3T1Y O;  3I56 V;  1X4T A;  4TSF G;  4JI6 B;  2LP7 A;  2ZM6 O;  1BZK A;  1FXK A;  4XBF A;  2CDY A;  1R6N A;  1EN6 A;  2ETN A;  3IAY A;  1XMO O;  1Y6X A;  3ZRW A;  1OCC C;  2KKW A;  4UB8 Z;  1Q5O A;  1WNS A;  4CS3 A;  4B3S B;  1YIT V;  3JAS B;  3EVK A;  4D6T H;  3FKS G;  4IT5 A;  4WFE A;  1BGY H;  5EYP B;  3F7V C;  1S5H C;  4CS2 A;  3STL C;  2F43 G;  4TQF A;  5CA1 A;  1VQM V;  4B7E A;  3E22 A;  1IBK B;  3ZN0 A;  4LF7 B;  4JAU A;  3B77 A;  5KHI A;  2Q0O C;  3DXR A;  4QE9 A;  4ZHQ A;  1Z5V A;  3CC4 V;  1M56 C;  2P67 A;  3I55 V;  4IL6 Z;  3OTF A;  4DV4 B;  5IJ0 B;  1VF6 A;  1XIL A;  3JAK B;  5DED A;  1ZAU A;  1LUV A;  4J7K A;  2IM9 A;  4WF9 V;  2LO1 A;  3JAT A;  3H1I H;  4DV5 B;  2LQT A;  2GDS A;  1P4R A;  3F5W C;  4JTC B;  3K0G A;  1D2D A;  3T1Y B;  1H2K A;  4YXW G;  4JI7 O;  2EIK B;  2VRZ A;  2ZM6 B;  2OYQ A;  5KHH A;  2XAH A;  4YJ3 A;  2PZS A;  3OTO O;  3P32 A;  1FYJ A;  3PJS K;  3CJH B;  2Q7E A;  1EM1 A;  1ROP A;  1VP7 A;  3OEE G;  4J7J A;  3FYE B;  2ODM A;  5EBL C;  2PYL A;  1QNM A;  4YJ2 B;  2HKO A;  3AG1 C;  2QKA A;  2FYU H;  3ZHU A;  2LGW A;  4B3T O;  2CUG A;  1PNM A;  5IE9 A;  2HG5 C;  2HFE C;  1H2M A;  2AZ0 A;  4ZBM A;  4JAS A;  2CH7 B;  4X8A A;  4XDL A;  5KAF Z;  4EFB A;  4GX1 A;  2EIL C;  1PKX A;  3IJ4 A;  4NKG B;  1JX9 A;  2R9I A;  3RBZ A;  1VIB A;  3JAM N;  3FB6 C;  2Q73 A;  1R3K C;  4O4I A;  2P5O A;  4CH6 A;  2H94 A;  4UCT A;  1JCH A;  4DUY O;  1AIL A;  4JI7 B;  2QWN B;  5EBW C;  2CTP A;  3ZHT A;  4FK5 C;  4U7N A;  1AR4 A;  2E5L O;  4IHJ A;  5JH7 A;  3OTO B;  4X1Y B;  4P2Z A;  1SZT A;  3ICX A;  3RT3 C;  4TV9 A;  3FFQ A;  1IBL B;  3CX5 F;  2WLI A;  2IH3 C;  2IU0 A;  1XNR O;  1DLB A;  4I50 B;  1N32 O;  2LFS A;  1M90 W;  1FPO A;  2A0L A;  5IJ9 B;  2Q8V A;  3SYQ A;  2ZE5 A;  4P9P A;  3GB7 C;  1PL4 A;  1NVP B;  5IYB O;  1AVM A;  1W0K G;  2YIA A;  1YI2 V;  4IIJ A;  1VAR A;  3E8B A;  4JV5 O;  1FXK B;  3BVO A;  4I55 B;  1B06 A;  3HKE B;  3KKY A;  1L8D A;  2QR4 A;  1SC5 B;  3M7M X;  4QIW F;  3T4Z A;  3Q4H A;  3ZRW B;  5B3S C;  1VQ7 V;  2JGD B;  3OR6 C;  4KFM A;  2IJH A;  3LUT B;  1AI7 A;  3AG2 B;  2BOB C;  1TA8 A;  4R6Z A;  3DC5 A;  2XAG A;  4MVR A;  2LGQ A;  1HR0 O;  2YIB D;  3J81 N;  3B8N A;  3OMN B;  3S3X A;  1H2N A;  4DUY B;  1FFT B;  3RYI A;  4DW1 A;  2RNB A;  3SYO A;  1YVW A;  1HW7 A;  2RDC A;  2MW2 B;  2EIK C;  4G28 B;  2IBZ H;  2E5L B;  3BHP A;  4BR6 A;  4WFB V;  4H37 A;  3LSU A;  4JGS A;  2HJF C;  4GZR B;  4R8C A;  4XDJ A;  3C3S A;  4DXW A;  3BAA A;  1KBH A;  3ASN B;  2ADQ B;  5J2U A;  1COW G;  1CPY A;  1Q43 A;  3CCE V;  1XNR B;  1N32 B;  4NVP A;  5IYC O;  4JAA A;  5LMN O;  2IJK A;  3ZMZ A;  5LOV A;  4N23 A;  2N05 A;  2Y0I A;  1R1B A;  3JYC A;  1AJN A;  4B7K A;  2QWQ B;  5B1B B;  4QPK A;  2PI4 A;  1GO3 F;  1RM1 B;  1EN4 A;  3UM7 A;  1SQB H;  2ZCE A;  4YJ3 B;  4UCO A;  2GTS A;  3IC9 A;  1JMK C;  4DR1 B;  2GV9 A;  5BR8 O;  4WFF A;  3UCS C;  2IJJ A;  1SA0 A;  2OIE A;  4CZZ A;  4YHH O;  4DR6 O;  2A7W A;  1SS3 A;  1S76 D;  2GSM B;  5JQG A;  4JI4 O;  2VWJ A;  5CA0 B;  4FLU A;  3ZIA G;  5CBF A;  5J2T B;  4ICG A;  3WG7 B;  4MW3 A;  3APQ A;  3MAQ A;  3OUF A;  1RPR A;  1XNQ O;  4QE7 A;  1B3Q A;  3CRM A;  4GX0 A;  2YUA A;  2PYJ A;  4FJC C;  3TJT A;  1YZB A;  2RN9 A;  1R73 A;  3QO7 A;  4OX9 B;  2X0L A;  3RYC B;  4LC1 A;  3SYC A;  1MSW D;  4GKK O;  3K03 A;  5LMN B;  3ZMS A;  2JDI G;  5KHG A;  4O4I B;  2JS5 A;  1YDX A;  1QLE B;  1SQP H;  4DV3 O;  4YY3 O;  2WLN A;  4J7Z A;  1NTZ H;  1FXK C;  4KP4 A;  4J9Y B;  3G67 A;  5BR8 B;  1VQ5 V;  3B09 A;  2QDO A;  4ZOL A;  4C7U A;  4D7S A;  2ZIN A;  1KD1 W;  3AG2 C;  4O4H A;  4J80 A;  2YSU B;  1VQ4 V;  3S3W A;  2ZDI C;  4JI4 B;  5DN6 G;  5LXT B;  2GBO A;  4LF8 O;  4FFB B;  3TK1 A;  4TQD A;  5LL6 Y;  2EUL A;  3CCQ V;  2D2C B;  2JGU A;  2JK5 C;  2EX3 A;  1KMI Z;  4HYO A;  1BQ0 A;  1JOY A;  2OWO A;  1XNQ B;  3AG7 A;  3WB1 A;  1Q81 W;  3Q4H B;  2EJ7 A;  4I0X B;  4O2A A;  3ASN C;  5LYJ A;  4GKK B;  4LR3 A;  1M57 B;  5GTI Z;  1ZL8 A;  5BZB A;  4RQE A;  1VF6 C;  2NNU A;  3JAW A;  1SF9 A;  2N04 A;  1OZ0 A;  1MNG A;  4XDK A;  3OM3 B;  4MTG A;  5FPR A;  4FM1 A;  3T1H O;  4LF6 O;  2XAF A;  5IT9 N;  3K9S A;  1GKF A;  1U96 A;  1XOU A;  5B1B C;  5CBG A;  1RM1 C;  2P7T C;  4K3A A;  2XAQ A;  1SER A;  4ZIB A;  5CA3 A;  4LWS A;  2L6L A;  2QGN A;  3U11 A;  1OHH G;  2ARH A;  3LDD A;  1GM9 A;  4LF8 B;  1MOF A;  2Z3Y A;  1ENV A;  1IBM B;  5EZY B;  3ZHV A;  3WG7 C;  4DV7 B;  1WN7 A;  2QTO A;  3T2M A;  3O65 A;  4HNA A;  1XHX A;  3SYP A;  1FFX B;  4DR5 O;  1DF5 A;  4JI0 O;  1AR1 B;  4JYA O;  5BXZ A;  1KUQ A;  1BMF G;  1W59 A;  1WAZ A;  3D8C A;  5JJJ B;  1LR1 A;  5LHG A;  2CE4 A;  2Y69 B;  3OT7 A;  3T1H B;  1QLE C;  4DR3 B;  2PI5 A;  2DN9 A;  1Y67 A;  2VS0 A;  4X1I A;  5GW7 A;  2JIZ G;  2UUA O;  1NS1 A;  3FYI B;  1Y4M A;  5C93 A;  4PI2 A;  5EC2 C;  2EIJ B;  4G2K A;  1AP5 A;  2QJ1 A;  3OW2 U;  2CTR A;  4BIU A;  3HKB B;  1JJO A;  5L3C A;  1IZ3 A;  5FNV B;  3HKD A;  4MTF A;  3DGE A;  5LMU O;  2LFR A;  4EB6 B;  4UCR A;  4ZI7 B;  3SPC A;  4LFB B;  4PA6 A;  5LP6 A;  1A32 A;  3TCU A;  2QEX V;  1RSO B;  2R9R B;  4DR5 B;  1JJ2 U;  5BY1 A;  4GCZ A;  4JI0 B;  2LJ2 A;  1O9G A;  2QM4 A;  3CRC A;  1JFF B;  1FS0 G;  2W6J G;  4PV1 B;  4MTO A;  3OEH G;  5DEC A;  2ILM A;  4RAI A;  5CB4 A;  1M4U A;  4DR4 O;  1R3L C;  4DUZ O;  1M57 C;  1R3I C;  1SQV H;  3BRC A;  3BPZ A;  4LF5 O;  4A5U B;  4TWK A;  4LF4 O;  4TV8 B;  4MTX A;  4PDL A;  5JVD A;  3K04 A;  4K35 A;  4CC6 A;  5C8Y A;  1GM7 A;  2YIC A;  3CCU V;  1B6Q A;  4JZG A;  3M99 B;  2BTQ A;  2JRI A;  4I9W A;  2UUA B;  4YIP A;  3D36 A;  4NR1 A;  4DRX B;  3LDC A;  4DW0 A;  3KCY A;  3ZS8 C;  1PM9 A;  3TXQ A;  5LA6 A;  1KP2 A;  3THO A;  5IYD O;  5LMU B;  3SJQ C;  2AZ2 A;  2E74 B;  3H01 A;  3FAV A;  4JZ2 A;  4LF9 O;  4K8X A;  3HR0 A;  4DV0 B;  2EIN B;  4PDR A;  4Z1M G;  3VOU A;  4KHP O;  4FLW A;  3W7T A;  2QKC A;  5B3S B;  4H13 B;  5HFM A;  4DR4 B;  4DUZ B;  3RYF A;  4RQF A;  1J95 A;  4JI5 B;  3UKM A;  4FLZ A;  2F93 B;  1BHB A;  5IWA O;  4EEQ A;  1THZ A;  1Y74 A;  4LF4 B;  4LF5 B;  1N8R W;  1X59 A;  2ZXW B;  3H1J H;  2DYR B;  2WA3 A;  1KEC A;  1E79 G;  2Y69 C;  1BQZ A;  4O4J B;  1Y76 A;  1ZUQ A;  3CEI A;  1XMO B;  2OCC B;  5H6Q A;  3BA8 A;  3ASO B;  1F23 A;  1MZF A;  1DTO A;  1Y66 A;  1GTO A;  3WB2 A;  2EIJ C;  2KG7 A;  1K8A W;  4MT8 A;  1XBL A;  2OTL V;  1PNL A;  2AXT Z;  2DQ0 A;  3WB0 A;  1FAF A;  1AJQ A;  3ZJZ A;  4DO2 A;  1G4Y B;  2VWK A;  4FZ1 A;  1SQF A;  4LF9 B;  1M9N A;  4EFE A;  1JVM A;  4F6R A;  2GHY A;  2RMK B;  5GON A;  3L72 H;  1QR9 A;  1WPX A;  2EZP A;  4JAV A;  3A0B Z;  1N4C A;  3JAR B;  3HKC B;  1TUB B;  5KHJ A;  2X6A A;  1GM8 A;  4Z2W A;  5IWA B;  4FM0 A;  3HKD B;  4X20 B;  4CH3 A;  1XI1 A;  3STZ C;  2F23 A;  2YIB A;  4RWU A;  4NB5 A;  1SQX H;  4BW9 A;  1P7B A;  1ORQ C;  5E79 Z;  2GUZ B;  3ABL B;  3DSQ A;  1VQ8 V;  1I94 O;  3P30 A;  4B3M O;  4KXR A;  1FD9 A;  3JCZ A;  4CC5 A;  3RYH B;  1QR8 A;  2EIM B;  3A2F A;  3ZRS A;  3K5L A;  1D5A A;  3P3P A;  4MW8 A;  5CB4 B;  1EZV H;  3ABM B;  3CRR A;  5KUM A;  5DM6 V;  2ZR2 A;  2ZE7 A;  1K5Q A;  2IJI A;  4X1K A;  1LUW A;  5D5P A;  4B3T B;  3CD6 V;  3LSQ A;  4JPR A;  2UXB O;  1FJG O;  3VQX A;  1XL4 A;  3P3N A;  2EIN C;  1ZLZ A;  1OJH A;  2YDE A;  3LSS A;  1VF7 A;  1ZX3 A;  4GYC B;  5BMV A;  1WA8 A;  1IXB A;  2K9P A;  2V4D A;  1V9P A;  1W2B U;  3VBB A;  4NXM O;  2IH1 C;  2RQ6 A;  5LA6 B;  2W6I G;  4TOI A;  2ZQM A;  5IDJ A;  2KSD A;  1MMM A;  2HJD A;  3ABT A;  1K33 A;  3L73 H;  2ZXW C;  2DYR C;  5CA1 B;  1W0J G;  2Q5Z A;  1I94 B;  1O9H A;  3E22 B;  3WU2 Z;  4I7Z B;  4B3M B;  1F7Y A;  2JS3 A;  3DXR B;  2OCC C;  4ZHQ B;  5IYZ A;  2E3C A;  3ASO C;  5EIB D;  4BIZ A;  5JCO C;  1DK1 A;  3SJB C;  1N34 O;  2H8P C;  3LNN A;  5H2F Z;  1F4N A;  5JWP A;  1AJP A;  3JAT B;  2CGO A;  3OGC C;  3UT5 A;  5L3E A;  1EFR G;  5H6R A;  3SYA A;  1FJG B;  1CXZ B;  2ZIO A;  2QKS A;  5LHI A;  4BIO A;  3APO A;  4JV5 B;  1K34 A;  2WPD G;  3ZHR A;  1HNW O;  5H9C A;  3ABK B;  2F1M A;  3FB5 C;  3K9A A;  3CPW U;  3M8A A;  4PA9 A;  4DV2 O;  1QQC A;  2M6Y A;  1YIJ V;  3RN4 A;  1HWY A;  1N0N A;  4FFK A;  2BTO A;  4PEL A;  1HR0 B;  1KYO F;  2F95 B;  4X88 A;  3BFR A;  2DWD C;  2Y4U A;  5D5Q A;  2WLL A;  5LHH A;  4I9Q A; 
#chains in the Genus database with same CATH homology
 4CBC A;  4TSF G;  2LP7 A;  3OMI B;  1FXK A;  3CC2 V;  5FL7 G;  4XBF A;  1R6N A;  1YSC A;  3DTU B;  3E8H A;  4PDM A;  1OHH G;  3ZRW A;  3LDD A;  1QLN A;  1GM9 A;  1OCC C;  3ABL C;  2X6C A;  1MOF A;  2Z3Y A;  1ENV A;  1KC8 W;  3QNE A;  1YIT V;  3FKS G;  3OAA G;  3WG7 C;  2EJR A;  4WFE A;  2EIM C;  3F7V C;  2QTO A;  3T2M A;  1FXH A;  4WCE V;  3AEI A;  1KP3 A;  4FIP C;  1S5H C;  2XAJ A;  1QVF U;  3SYP A;  4BAY A;  1DF5 A;  3OFN G;  3ABM C;  3HB3 B;  3JD1 A;  2X7R B;  1AR1 B;  1K73 W;  3STL C;  2F43 G;  1Q7Y W;  1VQM V;  3CCR V;  2ZD9 A;  3ZN0 A;  1K3E A;  1KQS U;  2B1G A;  4JAU A;  1BMF G;  1JQ0 A;  3ZMU A;  3B77 A;  2WLH A;  1R3J C;  4QE9 A;  2P90 A;  4E2L A;  2C2A A;  3CC4 V;  1M56 C;  2P67 A;  3I55 V;  2XND G;  5CMU A;  2QM7 A;  5LHG A;  2UXN A;  2Y69 B;  1QLE C;  1VQK V;  2PI5 A;  1SET A;  5GW7 A;  2DW4 A;  3TET A;  4WF9 V;  4HAM A;  2WLI B;  3SPH A;  4QNH B;  2ATK C;  1P4R A;  2KB1 A;  3F5W C;  4JTC B;  3K0G A;  5E1A C;  2JIZ G;  1K7D A;  5KA5 A;  3CC7 V;  2YEV A;  1IXM A;  4YXW G;  3FYI B;  1Y4M A;  5C93 A;  3LDE A;  3X2Q B;  2EIK B;  5EC2 C;  2EIJ B;  4G2K A;  5LBQ A;  3OW2 U;  4BIU A;  5L3C A;  3K79 A;  3E83 A;  1H8E G;  2XAH A;  4MTF A;  2WLM A;  3P32 A;  5IY5 B;  3DGE A;  3PJS K;  3W7X A;  4MS2 A;  1ROP A;  2LFR A;  2AHZ A;  2BOC C;  3OEE G;  1EBO A;  3E8F A;  3EHB B;  3SPC A;  4GT1 A;  4PA6 A;  3FYE B;  3TCU A;  2QEX V;  3ETD A;  2HR3 A;  4GX5 A;  5EBL C;  3CCS V;  2R9R B;  4MVS A;  1KKD A;  2HKO A;  3IGA C;  3AG1 C;  1JJ2 U;  1EZJ A;  4GCZ A;  1VQP V;  1BL8 A;  1S0V A;  1H38 A;  5KUK A;  1FS0 G;  1PNM A;  1VQ9 V;  4PA4 A;  2W6J G;  2FTK A;  4MTO A;  2HG5 C;  2HFE C;  3OEH G;  1I5Y A;  2JJ2 G;  1V54 B;  4UUJ C;  4ZBM A;  4JAS A;  4JTD B;  4RAI A;  1R3L C;  2DQ3 A;  3AG4 B;  1H2G A;  1M57 C;  1LNQ A;  4X8A A;  4XDL A;  1R3I C;  4GX1 A;  3FB8 C;  2EIL C;  1PKX A;  5L3G A;  4TWK A;  4OXS A;  1G8M A;  4MTX A;  3K3W A;  1JX9 A;  2R9I A;  3ABK C;  4PDL A;  1NQT A;  3RBZ A;  3ZCC A;  1GMG A;  5B1A C;  3K04 A;  3FB6 C;  1F4M A;  5CN0 A;  3WFV A;  1R3K C;  4LCU C;  1GM7 A;  1NR1 A;  4RUE A;  1B6Q A;  3CCU V;  3M99 B;  1E1Q G;  2H94 A;  1JCH A;  4I9W A;  1F51 A;  1OCO B;  4JYC A;  1K9M W;  3D36 A;  5EBW C;  3BY6 A;  2Q68 A;  3CCJ V;  3LDC A;  2A9H A;  3B8M A;  4FK5 C;  4U7N A;  4P9O A;  1K4D C;  4P2Z A;  1KP2 A;  5LGT A;  5IYD O;  1SZT A;  2Q69 A;  1PL0 A;  2QM8 A;  3SJQ C;  4MSW C;  1YTF D;  3H01 A;  4WFH A;  2ITC C;  4P30 A;  3HPL C;  2WLI A;  4EKW A;  2IH3 C;  4PDV A;  4MVO A;  3CCL V;  5EK0 A;  1K4C C;  3E89 A;  3MHS C;  2IU0 A;  1DLB A;  4N21 A;  2EIN B;  2IW5 A;  2LFS A;  1V55 B;  4PDR A;  1M90 W;  4Z1M G;  1XL6 A;  2A0L A;  2DYS B;  2Q67 A;  5B1O A;  3VOU A;  4FPP A;  2B5U A;  3SYQ A;  3W7T A;  3E86 A;  2Y48 A;  4G27 B;  4QJF B;  4P9P A;  5L3F A;  3GB7 C;  3IC7 A;  2EBO A;  3ZN1 A;  2QE7 G;  5B3S B;  5IYB O;  5HFM A;  4L87 A;  1NVP B;  1QCE A;  2Z5U A;  1W0K G;  1K92 A;  4X89 A;  2WLL B;  4R50 A;  1BHA A;  1H8H G;  1SRY A;  1YI2 V;  1OCZ B;  3RVZ A;  2QA4 V;  1K5S A;  3R65 A;  2JEU A;  1R6K A;  2V1D A;  3IFX A;  3E8B A;  4RQF A;  1FXK B;  2WWW A;  1J95 A;  1BHB A;  1DF4 A;  4JF3 A;  3UKM A;  4QIW F;  1THZ A;  3T4Z A;  3LNM B;  3ZRW B;  5B3S C;  2D3O W;  2HLD G;  1CP9 A;  1VQ7 V;  3OR6 C;  1N8R W;  2ITD C;  4KFM A;  1I5X A;  2IJH A;  3SPG A;  2ZXW B;  2DYR B;  2ZR3 A;  1KEC A;  1AI7 A;  3AG2 B;  1E79 G;  2BOB C;  3LUT B;  5EC1 C;  2Y69 C;  4R6Z A;  2XAG A;  4MVR A;  5CBH A;  2K1E A;  2NLJ C;  3B8N A;  3A0R A;  3OMN B;  1WLE A;  3G4S V;  3QO5 A;  1FFT B;  1OCR B;  2OCC B;  5H6Q A;  2OT5 A;  1QVG U;  4F4L A;  3SYO A;  3ASO B;  1YJW V;  4R7C A;  2AHY A;  1S77 D;  1F23 A;  1ZWI C;  1DTO A;  1Y66 A;  3X2Q C;  2EIK C;  4G28 B;  1GTO A;  2EIJ C;  4WFB V;  1K8A W;  4H37 A;  4MT8 A;  2XOK G;  4LP8 A;  1QBZ A;  2OTL V;  4JGS A;  4UVA A;  1PNL A;  3G71 V;  2HJF C;  1OCR C;  4R8C A;  4XDJ A;  2WLJ A;  4PA7 A;  5IY5 C;  4DXW A;  2DQ0 A;  4WFG A;  3OMA B;  3ASN B;  1AJQ A;  3ZJZ A;  4DO2 A;  1G4Y B;  1COW G;  1CPY A;  3CCE V;  3JD0 A;  2MK3 A;  1S3J A;  1M9N A;  3F7Y C;  5LGN A;  3CMA V;  1JVM A;  2GHY A;  3K08 A;  5IYC O;  2JJ1 G;  2DWE C;  1MAB G;  3JD2 A;  1AI6 A;  1QR9 A;  1WPX A;  2EZP A;  4I5S A;  1CEZ A;  2IJK A;  4Q20 A;  4JAV A;  5B1N A;  2YEV B;  3W7S A;  3ZMZ A;  1RPO A;  4N23 A;  3JYC A;  5HFL A;  1AJN A;  4RUF A;  5B1B B;  3CYO A;  3EFF K;  4QPK A;  1YJN V;  2PI4 A;  3T1C A;  1GO3 F;  2X6A A;  1GM8 A;  2XAS A;  3AG3 B;  1RM1 B;  3UM7 A;  1V54 C;  3OE7 G;  4LBE C;  2UXX A;  1PNK A;  5KA6 A;  3AG4 C;  3STZ C;  4WFF A;  2IJJ A;  3ZRX A;  1Q82 W;  3JD3 A;  4CZZ A;  1ARO P;  3CCM V;  3E8G A;  1NH2 B;  1P7B A;  2EZO A;  1YHQ V;  1ORQ C;  1OCC B;  3ABL B;  1VQ8 V;  1NBM G;  4J9Z B;  3P30 A;  1S76 D;  2GSM B;  2JEX A;  3OUS A;  4HZ3 A;  4UVB A;  3ZMV A;  1YJ9 V;  3JCZ A;  3ZIA G;  5CBF A;  3WG7 B;  1OCO C;  1QR8 A;  1GK9 A;  2EIM B;  3ZRS A;  3CP1 A;  4MW3 A;  1PD3 A;  2B1I A;  3OUF A;  4TT3 G;  4MW8 A;  1RPR A;  2HVJ C;  3ABM B;  4RO2 A;  5KUM A;  4QE7 A;  1Q86 W;  5DM6 V;  1AI4 A;  4GX0 A;  5L3B A;  4FJC C;  2ZR2 A;  2P6J A;  1K5Q A;  1R73 A;  3QO7 A;  2IJI A;  2X0L A;  3CD6 V;  2ZDI A;  3LSQ A;  1SES A;  2WSS G;  4QPJ A;  4LC1 A;  3SYC A;  4JPR A;  4UV9 A;  1MSW D;  1M1K W;  4H33 A;  1NH2 D;  1NKD A;  2CK3 G;  3K03 A;  1M56 B;  4JYB A;  3ZMS A;  2JDI G;  4ZKI A;  1XL4 A;  3ZRV A;  2EIN C;  2M7W A;  3SPJ A;  1V55 C;  5LGU A;  3SPI A;  2DYS C;  1QLE B;  3LSS A;  4PA3 A;  2V7Q G;  3RVY A;  3RW0 A;  1TUE B;  3D3I A;  3T4D A;  1AI5 A;  2WLN A;  1VQL V;  4UV8 A;  5EBM C;  4MVZ A;  4KUM A;  1W2B U;  1OCZ C;  3VBB A;  2IH1 C;  1FXK C;  2W6I G;  4WFA V;  3W7U A;  2ZQM A;  4KP4 A;  5IDJ A;  1VQN V;  4J9Y B;  1VQ5 V;  3ETG A;  3ABT A;  1K33 A;  1NVP D;  3BEH A;  2ZXW C;  4U7O A;  4MVU A;  2DYR C;  1KD1 W;  3AG2 C;  3E35 A;  3OR7 C;  1W0J G;  3MHH C;  2W0F C;  1K97 A;  2YSU B;  1VQ4 V;  2ZDI C;  3JD4 A;  2OTJ V;  2A79 B;  3NXS A;  5DN6 G;  1E1R G;  4ASU G;  2OCC C;  2Q6A A;  3TK1 A;  2IU3 A;  1FXV A;  3ML0 A;  3ASO C;  3QO8 A;  3CCQ V;  3ETE A;  3ZMT A;  1MG1 A;  2JK5 C;  4BIZ A;  4HYO A;  3G6E V;  1JOY A;  3AG1 B;  3CCV V;  4FMT A;  3W7W A;  2H8P C;  2X6B A;  1Q81 W;  3ABU A;  4MVQ A;  1F4N A;  1AJP A;  1JPX A;  4MVM A;  3OGC C;  5L3E A;  3ASN C;  1EFR G;  5H6R A;  3SYA A;  3MD0 A;  3CXC U;  1M57 B;  1L1F A;  2QKS A;  2WAM A;  4BW5 A;  5BZB A;  5LHI A;  4RQE A;  2HVK C;  2EIL B;  1UJW B;  1K34 A;  2NNU A;  2WPD G;  5L3D A;  3FB7 C;  5H9C A;  1VQ6 V;  3ABK B;  3FB5 C;  1OZ0 A;  3K9A A;  3CME V;  4XDK A;  5B1A B;  3OM3 B;  3GWO A;  3CPW U;  3K0D A;  4MTG A;  2WLK A;  3E2E A;  4PA9 A;  4UXN A;  2XAF A;  4UVC A;  1YIJ V;  1GKF A;  1HWY A;  5B1B C;  1YTF B;  1NJI W;  4PEL A;  1S72 V;  5CBG A;  3AG3 C;  5J9P C;  4JTA B;  3K06 A;  4GX2 A;  4X88 A;  1RM1 C;  1NR7 A;  2P7T C;  1VQO V;  2XAQ A;  1SER A;  2DWD C;  5CA3 A;  3KG2 A;  2WLL A;  5LHH A;  3I56 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...