2IJKA

Structure of a rom protein dimer at 1.55 angstrom resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
57
structure length
57
Chain Sequence
TKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 27
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijkA00
1RPOA 1RPRA 2GHYA 2IJHA 2IJKA 1F4NA 2IJIA 4DO2A 1B6QA 1GMGA 2IJJA 1GTOA 1F4MA 1ROPA 3K79A 1NKDA 1PD3A
chains in the Genus database with same CATH superfamily
4W4LA 2YEVB 2KKWA 2WLJA 4R8CA 1YJ9V 2CH7B 1KYOF 1H2GA 4X1YA 2ZIMA 3SPGA 1EFRG 1N33O 1F4NA 4GKKB 1XUQA 4BW9A 2H8PC 5LOVA 3CC2V 4K35A 1WN7A 2XT9A 3SPIA 2KG7A 2EINB 4R6ZA 1EZJA 1TA8A 1Y74A 1YTFD 1VQNV 1BQ0A 3FX7A 2DQ0A 3ZMTA 5EZYB 3CXHF 1FJGB 5LOVB 3N27A 2IJJA 4PI0A 3E8FA 1JPXA 3CCEV 2VQFB 2ZIOA 2EILB 3FB8C 4PV1B 1IZ3A 2M6YA 2ZNIA 1GN4A 3JSLA 4ZBMA 3IGAC 3FYEB 2XUMA 1JA8A 3UO3A 2YICA 3TCUA 3T1CA 1XL6A 4DV5B 3CSXA 3OTFA 3T2MA 2QEXV 2AW9A 4J11A 4DUZO 1W0KG 1NTZH 4EFBA 5EIBD 2WLLA 1KKDA 5JH7B 2FL4A 1OV9A 2BSKA 2V7QG 4TUYA 1US6A 3ZMZA 2D3OW 1GKFA 4DV2B 2A9HA 2IJIA 2P7TC 1HNZO 3OEEG 3M7MX 4J10A 4TQDA 2XASA 4I50A 3MDSA 4GKJB 2UXBO 3I55V 4MVSA 4UCVA 4H33A 2Q0OC 1VQPV 4F6EA 4RQEA 5KLVH 4HAMA 3ML0A 3ZMUA 5KHGA 5KX5B 2ITCC 4MTOA 1GRJA 3FB5C 4JAAA 3CMAV 4JI5O 1U97A 4JTAB 3RYFB 1JQ0A 1RP3B 1ZUQA 3CJHB 3L73H 3SYPA 1I94O 1KP2A 4JASA 5JJJB 4FLUA 3ZMSA 4GX1A 1FFXB 5GTHZ 3T1HO 1I0HA 1RFYA 1HR0O 3LSSA 3CRMA 4ICGA 4HBNA 1VF7A 3K0GA 2OCHA 2Q6AA 4FLTA 2XHBA 1S5JA 1XNRB 3TJTA 5KUKA 4DV7O 4GX5A 1B04A 3W7WA 2YXYA 4W4KA 1NZ6A 1QVFU 4MTFA 2YIAA 4LFCO 2OTJV 4DR5B 2X0LA 4LBEC 5D5QA 3BRCA 1SQQH 2HFEC 5B1NA 1OCCC 1SZTA 2XAQA 3E22B 2JS5A 3JAKB 4O4HA 1DTOA 1VF5B 2IH1C 4DRXA 5JQGA 3JCZA 4K3AA 4I4TB 4LH6A 1KP3A 4FM2A 4MVOA 2HJFC 3STZC 4FM1A 3CC4V 1PNMA 3QO8A 3JCUZ 5FNVB 5LBQA 2YS8A 1MNGA 5L3DA 4MVUA 4FK5C 4CH3A 4IIJA 2V1DA 1BGYH 4DXWA 1IBKB 4WBNA 2FB5A 2HEPA 3K5MA 4B3MB 4D7TA 1Q3EA 2XNDG 1JVMA 1DF5A 2JJ2G 1PNKA 2HVKC 2Y4TA 1M56B 4DV4B 4H44B 4JZGA 3RN4A 3DXRA 1FAFA 2ZDIC 4H13B 4U3FH 3CPWU 3SYQA 1GMGA 2MK3A 4TV9A 3CYOA 2PUSA 1NT2B 3STLC 5ITZB 3R66A 3GWOA 3B09A 4DR1B 4Q20A 2AHZA 2YIBA 3RW0A 2VQFO 4QE9A 3LSUA 5AG2A 4YY3B 1BQZA 1G1XB 1AP5A 4CBCA 3K57A 3K5OA 1M4UA 3EHBB 1H2NA 1Q90D 2QA4V 2X6CA 4DV5O 4DV1B 4Z2WA 1NH2D 2EBOA 2EIKC 2Y69C 4UB6Z 1G8MA 2UUBO 5EK0A 4HNAA 1B6QA 3ETGA 5HFMA 1XILA 4O2BA 5IJ0B 2ZM6O 4I0XB 2OCCB 3A2FA 4CS2A 2N05A 3P30A 4PDVA 2OIEA 4X66O 2X6BA 2Q9LA 4X20B 2JS3A 4CZZA 3L9DA 5LHGA 3CXCU 2IJKA 4UXNA 2JK5C 1YIJV 3L72H 3GVMA 4DR3O 3CC7V 2DYRC 3RYIB 4LF5O 3OUSA 3AG3B 4UUJC 2ZKOA 4YIOA 1MABG 2GSMB 3HKDA 1VF6C 2UUAB 2OTLV 1MZFA 1ZTEA 3UT5A 1QLEB 5LHIA 4FLZA 2RN9A 2F23A 2YIBD 1K8AW 3K59A 4DK1A 1SZXA 4J42A 4F6RA 1NU1H 4UCSA 2P5OA 1N32B 2QM7A 1V55C 1VARA 3P3NA 2ZXWB 2ZT9B 4G28B 1YEWA 5A2QN 4PA6A 3JD0A 1XMOO 4CC6A 1TUBA 5IYCO 2QM8A 2WA4A 4F6RB 2Y0PA 2LGQA 3HB3B 1KBHA 1WA8A 3JYCA 3TETA 4X64O 1BHBA 1FPOA 5B3SB 1VF6A 2PTMA 3M99B 2ATKC 4NTXA 1GN6A 3ZMVA 2AXTZ 3CP1A 3SJCC 3ZRXA 2LW1A 3ZX6A 1R3IC 4X65B 1YCIA 4JTDB 3OMNB 5IJ9A 2IH3C 3CCQV 5LGTA 1QNMA 2ITDC 4J41A 3CX5F 5CN0A 3PJSK 3G6BA 3HKBA 4JI8B 4DV3O 1I08A 4K8XA 2P90A 3AG4B 3I56V 2Q0AA 1N36O 4I55B 1I5YA 1JCHA 4DV4O 4UV8A 5LMNB 5LA6A 1P49A 4BR6A 1XDCA 5LP6A 5L3FA 1YJNV 4RO2A 2AZ0A 3QG5A 4UFZA 4UV9A 1QCEA 3ABUA 1QHTA 3LDDA 1THZA 1OZ0A 2DWEC 3O65A 1AJNA 4UCOA 4YY3O 3K5LA 5LA6B 5IT9N 1R3LC 2E5LB 3FKSG 3ASOC 1JR9A 1ORQC 3QF7A 4IYIA 2WAMA 2P4KA 3CCMV 1E1RG 2NLJC 3ZN1A 5GW7A 2A06H 3AEIA 5J2UB 1V54B 2PYJA 2VWKA 3D3QA 4X88A 3BA8A 5HFLA 1X59A 3SR2C 2HR3A 1MZEA 4G27B 5CA1B 3AG2C 2ZE8A 4RUEA 2N74A 1R6NA 3H1HH 5IYBO 1JX9A 2X7RB 1BMFG 1JMKC 1XQ8A 1SS3A 2BCCH 5B1BB 2ZINA 2W6JG 4IHJB 4LF7B 3SGIA 1R3JC 4YJ3B 3D8CA 5H9CA 1WB7A 1N0JA 3ABTA 3SJQC 1XMQO 2DYSC 2BOCC 3S3WA 4N21A 4FPPA 4LF4B 2KB1A 1K34A 1WB8A 1L0NH 3CRQA 2ARHA 1RPOA 5H2FZ 3D36C 4UCRA 2UUAO 4TWKA 4O4IB 5FPRA 4OPAA 2R72A 5F2VO 2JDIG 2GUZA 1AVMA 5DEDA 1OCZC 5IYZA 4J7ZA 5EBMC 4L87A 5CBFA 3K04A 4ZOLB 5C8YA 1E1QG 2R9IA 1FD9A 4IGGA 3VQYA 1K3EA 1A32A 2IW5A 3ICXA 1B3QA 1TVKB 1V9PA 1W2BU 1HWYA 1PV0A 4RAIA 5FPOA 1K4CC 1X4TA 2B9ZA 1K5QA 1BS3A 2BTQA 5EIBC 3B4SA 2BOBC 4O2AB 1VQLV 3D36A 1VIBA 1M93A 1AJPA 3CWBH 1H8EG 3N2KA 4CH5A 2CDYA 3B2EE 1MA1A 5B5EZ 1URFA 3CD6V 4WFGA 5L3CA 3OTOB 2WSSG 2IM9A 2M7WA 4JI8O 3FAVB 2EINC 1E79G 4PA7A 1XEQA 1NQTA 1NVPD 3JALB 2XAJA 4FFBA 1S72V 1SETA 1HNXO 2YEVA 4DV6B 1DF4A 4X89A 5LXTB 1XHZA 2CH7A 4WFFA 1S76D 3D3IA 3B8MA 4JV5B 3T1YB 3X2QB 1K5SA 1AR1B 2HKOA 3UKMA 1RSOB 1Y6XA 1MSWD 3BEHA 3CRCA 4K0KB 2DMXA 2VWJA 2HHHB 1PL4A 4KFMA 4XDJA 5B1AB 4DR2O 1I5XA 2ZE5A 5EZYA 5DN6G 2HG5C 4DUYO 2WWWA 1Y67A 5KUMA 2UXCB 2CTRA 3AG7A 2A7WA 5BY1A 3N2GB 4LF8B 2Y4UA 4MTXA 4JGSA 2ODMA 1QLNA 3B40A 5H6QA 3QO5A 3JARB 5EYPB 4Z1MG 4FMTA 5JH7A 3Q4HA 3JAMN 2YDEA 3MAQA 3J7AU 2GTAA 3QVNA 1FXKB 1OCRC 3U11A 3G6EV 4NXNO 5LMUO 3IAYA 2D2CB 4LF4O 3RYCB 1CEZA 4EKWA 5FLXN 2UU9B 3Q4HB 1L0LH 4LP8A 3JD4A 1LUWA 4MVRA 4PD4F 3TXSA 5KX5A 1T5EA 4KXRA 1NKDA 2EZPA 3BHPA 3KG2A 3RYFA 5KHJA 3OGIB 1Q6UA 2F43G 3CJHA 5GONA 2ETNA 1QR8A 1N34O 1KECA 3SPCA 1IBLB 3HKCB 4G2KA 3TGUH 1FFXA 2Q73A 3H1LH 1P7BA 3K79A 5GONB 5IY5C 4NXMB 2QWQB 3G4SV 4JI6B 4YIPA 3JASB 2HP8A 4IYHA 1Y76B 5JWPA 2K9PA 1AILA 3K3WA 4JPRA 1KC8W 3ABKC 1IBMB 3OT7A 2CGNA 1TGOA 2PI4A 1AJQA 3EXAA 3E22A 3JAKA 1M56C 2UXDB 2ZCEA 4ZHQB 4YJ2B 4JI7B 4DW0A 4U3JA 4I4TA 4B3RO 1COWG 2JGDB 3K58A 2K1EA 3RT3C 1XREA 1WP8A 4EFEA 2WA3A 4DW1A 5FNVA 3RVYA 1L1FA 1F7YA 1Q7YW 3ASNB 2ZR2A 4DR7O 1Q6IA 4FVMA 1VQMV 1NI8A 4U3JB 4TQFA 2F1MA 2EZOA 2R9RB 2HLDG 5KHIA 1SQPH 3IFXA 4LFBB 1PKXA 1JJOA 1ZAUA 4BWAA 4J9ZB 1DK1A 1LR1A 1W0JG 5CMUA 4FZ0A 1H8HG 4XDLA 1SC5B 4WFHA 3K9SA 5BMVA 1VQ8V 2UUCB 2F93B 4K0KO 2HHHO 2CTPA 1AROP 3CCJV 5CA0B 1QQCA 1NH2B 4GKKO 2NNUA 5ITZA 2Y0IA 4LH7A 3E8GA 4X62B 1AI4A 4H37A 1ZX3A 4QPKA 3W7XA 3T4DA 3MD0A 4FLWA 2UXCO 5BMVB 2PGGA 2OCCC 2RNBA 1PM9A 5E1AC 4DR4B 4JZ2A 4LF8O 4FFKA 4X1KB 2QJ1A 1M57B 1FJGO 4JAVA 5IYDO 2QWRB 4ZIBA 2ADQB 4PDRA 3GB7C 3LNMB 3AG3C 3M8AA 1M9NA 2QWOB 4MW8A 1VQ4V 4XBFA 1GM8A 1K7DA 5TISZ 1EBOA 3BCCH 2YI9A 1QLEC 1LNQA 5IJ0A 4TV8A 2UU9O 4QE7A 4Z1VA 1K9MW 5KHKA 1S77D 4I0XA 3ETDA 1XBLA 4LWSA 3KKYA 4JI1B 1J5EB 4DV2O 1N4CA 2E76B 1K92A 2HJDA 4X20A 2ZXWC 2EIJB 4GKJO 3J80N 4TV8B 2ZE6A 3DSQA 3G67A 1NBMG 1FS0G 3OMAB 3RYIA 4B3SB 2O57A 1HNWB 3BA9A 4LWSB 1NTKH 2DWDC 3A0HZ 5CB4A 1VEWA 1Q43A 5B3SC 2Z0AA 1GN2A 2Q7GA 4LFAB 5LHHA 4LR3A 4BIOA 4NXMO 4N23A 3CHXA 1S5LZ 4KHPB 4ZI7B 3H1JH 2N04A 5CB4B 4B7EA 4YXWG 1AI7A 1XNQB 1AI5A 2XOKG 1F23A 1H38A 2WLKA 3SYAA 2Q7EA 1XNRO 1ENVA 1XI1A 1SQVH 2YUAA 4D7SA 2B1IA 3UM7A 1K33A 2UXDO 1FXHA 2CTWA 3SPHA 4JI7O 5KA5A 2P4VA 4MTGA 2P67A 4LC1A 4DR5O 2QSAA 2EIKB 2Y69B 4JI0B 4L8JA 3GWKC 3HKEA 3WG7B 3K06A 1IXBA 1L8DA 2DOSA 5J2TB 1BCCH 3MHHC 1FXVA 4MW3A 2F4VB 3BFRA 2JIZG 1O9GA 1Q82W 5JCOA 2OWOA 1AR5A 3ZIAG 3OEHG 5LP6C 1KD1W 4P9OA 5L3GA 3HKEB 1KKCA 5H6RA 1WJZA 2QE7G 5LGUA 1UPGA 1G4YB 4I55A 3ZHVA 2XAHA 4C7UA 4OGQB 4AQYB 1PPJH 2NR5A 4YHHB 5H5NA 4P9PA 1IBKO 3F5WC 1VQKV 2DYRB 4B3MO 4JYAB 3ZRWB 1F51A 1RM1B 5BR8B 5EC2C 1R6TA 3OFNG 2EIMB 1G6UA 5B1BC 3KZIZ 2ZD9A 2CAZC 3BPZA 3UO2A 2V4DA 2PI5A 3ZHQA 4DR1O 2LJ2A 4WFBV 4CH4A 3RBZA 5J2UA 1R3KC 4GZRB 1F4MA 4AHCA 1W59A 1KUQA 2E3CA 3JATB 1CP9A 3ZHTA 5CA1A 4MS2A 4DV1O 3B8NA 1P84F 1HP8A 3WFVA 3ABMC 4B3TB 1NR1A 2RDCA 4I7ZB 2RCVA 3E35A 2Z5UA 4X8AA 3DC6A 3SJBC 3I5DA 4JI1O 2GHYA 1GN3A 4IHJA 2PYLA 2C2AA 4YJ3A 3ETQA 1N33B 2JEUA 1KU9A 2W0FC 3CE2A 2CTQA 3G80A 2FMLA 3WB2A 1OCOB 1NTMH 3NXSA 4UVCA 5KMGA 1N0NA 3IJ4A 1K4DC 3E89A 4O4IA 3RYHB 4NTWA 1QVGU 3AG1C 1SA0A 4EB6B 1EM1A 2EJ7A 4JF3A 1D5AA 1ROPA 3IC9A 1LUVA 3FB6C 1H2SB 2B1GA 1YITV 3E83A 4ZOLA 5KMGB 5DECA 2ZQMA 4GYCB 1VMGA 5JJNB 4ASUG 1WPXA 1SA0B 1TVKA 1D2DA 2P22C 2CUGA 1JOYA 4DUZB 2EX3A 2CE4A 3SDLA 2UXNA 3ASOB 5JJEB 5FL7G 1N32O 1KQSU 5C93A 4O2AA 3W7TA 5EC1C 2QWNB 4FZ1A 1VQ5V 3ZHSA 4ZKIA 5KA6A 3X2QC 4KL1A 2OYQA 1U96A 4QPJA 5D5PA 2FKXA 2L35A 2WLIA 3AG2B 1AI6A 4LCUC 3C90A 1MMMA 3C3SA 3FAVA 3TK1A 4JI5B 5LGNA 3CRRA 1KB9F 1SQFA 5B1AC 4FM0A 3ABLB 2QWPB 3OE7G 1GO3F 1GH6A 2EJRA 2JVDA 3JALA 4A5UB 2IJHA 2RQ6A 4X65O 4E2LA 2LFSA 2WLIB 2NN4A 2QKCA 1VP7A 2F66C 2FYUH 5LXTA 5IWAB 4NKGB 1HR0B 2ZE7A 4UVAA 4O4JA 1I7FA 2DW4A 2YSUB 1ZSPA 4R50A 5JVDA 2LFRA 3OW2U 2H3OA 2G38A 5BR8O 1RSOA 2EILC 3KCXA 5LMNO 1AR4A 1YTFB 4O4LB 2LQTA 4J7KA 3E8BA 4O4JB 4UVBA 4LFCB 1D5NA 2JRIA 4DV0B 2RMKB 5JVDB 4QJFB 1H2MA 4TOIA 3CB2A 1Z5WA 2E5LO 1K73W 1Q8IA 4JI2B 4X9QA 1BHAA 1EN5A 2QKSA 3N2GA 4UCTA 2WLHA 3R65A 2ADPA 4JYYA 1ZL8A 4B3TO 5IDJA 3AK3A 1SF9A 3JARA 4CC5A 4FIPC 5EYPA 2IU0A 2AHYA 3BVOA 1SRYA 1EZVH 4LNUB 2GDSA 3P3PA 1FXKA 1ZL8B 1VQOV 3OMIB 2Q4PA 3DC5A 1IX9A 3RYCA 2YI8A 2ZR3A 4LF7O 4X1YB 2OIGA 3QO7A 4OPHA 4MSWC 1VQ6V 3ZN0A 1J95A 3VQWA 1XHXA 1Q5OA 2EULA 1Q86W 2KG7B 3HKCA 3DTUB 2GV9A 1Y74B 4XDKA 1M1KW 1O9HA 2L6LA 5B66Z 4DYLA 3L75H 3ZJZA 4KP4A 4X1IA 4CS4A 4E4EA 2YIDA 5L3EA 2QTOA 1IVSA 4GUNA 2W6IG 5IE9A 2UUBB 3ZBHA 3RVZA 1WLEA 4D6TH 5EBLC 4FLXA 4JTCB 3ASNC 3RGBA 3JASA 4DR6B 4NVPA 4X1IB 4NYKA 3VOUA 1VQ9V 1Y76A 2LW7A 2FTKA 1ZLZA 5K1PA 4WFEA 2WLLB 2ZM6B 4TSFG 2BSKB 4TUYB 3ETEA 3LSQA 1BSMA 2GTSA 1M90W 1PNLA 4X66B 3CCUV 3VQVA 3ZEDA 4ZHQA 4YJ2A 4I50B 5BXZA 2JGDA 1K97A 1MOFA 3AK2A 2JJ1G 4DR3B 4LF5B 3OUFA 3CCSV 4LF6B 3VQXA 2QKAA 5DM6V 1NS1A 3OTOO 4R7CA 5IWAO 1GM9A 2JGUA 1OCRB 1R6KA 1SQGA 1DGSA 2X6AA 4JYBA 1M57C 3E2EA 2R9AA 3OR6C 1YHQV 4GLXA 4MVMA 4DV6O 4J9YB 3IC7A 3WB1A 4PDMA 1Q81W 1S0VA 4JV5O 5CA0A 3T1YO 3CCRV 3MHSC 3UQ8A 2XAGA 4DV0O 3CEIA 3P32A 2BE3A 4PDLA 1XMOB 3CMEV 4MT8A 2DE0X 4KUMA 1CXZB 3LNNA 3A0RA 4WFAV 4CS3A 4JI2O 4WCEV 3ZHUA 4X64B 4U7OA 4X1KA 3WB0A 5IY5B 5CBGA 1HW7A 1NR7A 2EIJC 4GX2A 1Q6HA 2DQ3A 2HVJC 2ZNJA 4O4HB 3FB7C 3TXQA 4DRXB 5JQGB 4I5SA 4HZ3A 3FD9A 3W7UA 1Y66A 3C3TA 4DV3B 1M5IA 3ABKB 4ABMA 1SERA 1OHHG 3F5TA 3OGCC 4JAUA 5LYJA 2PZSA 1XL4A 1WP7A 1YF2A 1N36B 1SQXH 3QNEA 4MVQA 4IIJB 3JD2A 1OJHA 4WBNB 2B5UA 3CRAA 5LYJB 3WU2Z 1SESA 3W7SA 1OCCB 4PJ0Z 4PA9A 2RJZA 3DXRB 2IBZH 4RUFA 3E86A 3ZS8C 2UXXA 2A79B 4JI4B 4TV9B 4BIZA 4AI8A 2P06A 4K8ZA 4JI3B 2LO1A 3U0ZA 3SYCA 5L3BA 4P2ZA 4F4LA 1H2KA 1KMIZ 1VQ7V 4NR1A 4DK0A 5E79Z 1AB3A 3LUTB 4UB8Z 1JJ2U 2Q8VA 3WG7C 1IBLO 4P30A 1YDXA 2ZDIA 4ZI7A 4U7NA 2AGAA 4DR6O 1GK9A 2DN9A 3JD3A 3KCYA 2VS0A 4LF9B 4RQFA 3QTCA 4FLVA 2W0XA 2Y48A 3L74H 2Q68A 4HNAB 4JI6O 3SJAC 3FFQA 2CGOA 4O2BB 5JCOC 4FJCC 4H0LB 1R73A 3A8TA 3ZCCA 5LL6Y 1HDJA 1XMQB 1B06A 3H9VA 1IBMO 3DGEA 2GBOA 2JEXA 3APQA 4LF6O 3AG4C 2E74B 5KHHA 5J2TA 1RM1C 4AILC 1UJWB 2QGNA 2Q67A 1YVWA 2EIMC 3AK1A 2YC0A 2XTAA 1YZBA 3FYIB 4J7JA 4DO2A 4WF9V 1Y4MA 1BT8A 1FYJA 2LP7A 2VQEB 1EN6A 1NJIW 3HKDB 2AZ2A 5BZBA 5K1XA 3UT5B 4LFBO 2Z3YA 1V54C 3BAAA 2PF4E 4OX9B 3ZRWA 2Q69A 2UUCO 2E75B 3UCSC 4PELA 1BL8A 4B7KA 1WAZA 1YSCA 2Q5ZA 1TUBB 3S3XA 4X62O 3T4ZA 3OM3B 3ZRSA 4FLYA 4PA4A 4BW5A 2F95B 1TUEB 1WA8B 1TAEA 4RWUA 1OCOC 3APOA 1FFTB 1N8RW 4DR4O 1AP6A 2QDOA 3JATA 4IT5A 3F7VC 1MG1A 1QR9A 5KAIZ 5IJ9B 2A0LA 4NB5A 1V55B 2DJVA 1HNXB 3HKBB 1XOUA 1QBZA 4B08A 2A3QA 1WPBA 1YI2V 5CA3A 3ZHRA 1IDSA 3K9AA 3K08A 4IL6Z 3K0DA 3HPLC 3BABA 1J5EO 4JI4O 3B77A 1YJWV 3VBBA 5LP6B 2YXLA 4JI3O 4TT3G 4DR2B 1R1BA 3EFFK 3RYHA 4DUYB 4NTYA 4PA3A 3L70H 3RFRA 4EB6A 2CK3G 5GTIZ 4B3SO 1HNWO 2R70A 2KSDA 5EBWC 1FKAO 3ZRVA 5KAFZ 4EEQA 3L71H 3H01A 4LF9O 3NR7A 4LFAO 3SYOA 1PD3A 1ZWIC 3ABLC 4PHZA 3JAWA 1PP9H 2QR4A 1PL0A 4KHPO 4QIWF 1S5HC 2YXHA 4GX0A 1XNQO 2WPDG 4GT1A 3CCLV 3OAAG 2QTSA 4BIUA 3H1IH 4NXNB 5LMUB 3K5NA 3JAWB 3K03A 4BAYA 1UFIA 1EN4A 1GM7A 1RPRA 1MSDA 3H1KH 2WLNA 2VRZA 3J81N 3A0BZ 1NVPB 1HNZB 4QNHB 3ABMB 1GAXA 4JI0O 3CCVV 2UXBB 3OD4A 3SPJA 1WNSA 4MVZA 4Q6GA 2PY5A 4CH6A 3F7YC 1N34B 1QU7A 5A9GA 2VQEO 1SQBH 1Z2GA 1DLBA 3BY6A 3EVKA 1P4RA 2F4VO 4I9QA 2WLMA 2ILMA 4QGPA 2OT5A 1S3JA 1JFFA 4UCUA 4I9WA 2GUZB 2LGWA 4GCZA 5IYZB 2Q7HA 1I94B 3JSNA 1BZKA 1CPYA 2IU3A 5C8YB 4OX9O 1P7GA 1IXMA 3T1HB 4O4LA 4AQYO 1JFFB 4YHHO 2DYSB 3G71V 3AG1B 4OXSA 2BTQB 4JYAO 1GTOA 2QM4A 4DV7B 3U10A 3O9OA 4PI2A 1H2LA 2XAFA 4B3RB 3N2KB 1OCZB 3OR7C 1FXKC 2H94A 3LDCA 4J80A 3JD1A 5B1OA 2KQXA 1YXBA 2BTOA 3RWRD 3CS5A 5CBHA 4HYOA 4JYCA 4DR7B 3THOA 3LDEA 1IURA 3PN1A 2P6JA 3E8HA 1SKVA 1Z5VA 5J9PC 4LNUA 2MW2B 1BE3H 4FFBB 3HR0A
chains in the Genus database with same CATH topology
1AI5A 4PDMA 2YEVB 4R8CA 2WLJA 1JX9A 2X7RB 5IYBO 1BMFG 1YJ9V 2XOKG 1Q81W 1F23A 1H38A 1S0VA 2WLKA 5B1BB 3SYAA 1H2GA 1ENVA 3CCRV 2W6JG 3MHSC 2XAGA 3SPGA 3P32A 1EFRG 1R3JC 1F4NA 2B1IA 4PDLA 5H9CA 3UM7A 3CMEV 4MT8A 2H8PC 1K33A 3ABTA 4KUMA 3SJQC 1FXHA 2DYSC 3SPHA 3A0RA 3CC2V 2BOCC 4WFAV 5KA5A 4N21A 4FPPA 4MTGA 4WCEV 2P67A 4LC1A 2EIKB 3SPIA 2Y69B 2KB1A 1K34A 2EINB 4R6ZA 4U7OA 1EZJA 3WG7B 1YTFD 1VQNV 5IY5B 3K06A 1RPOA 5CBGA 2DQ0A 1NR7A 2EIJC 4GX2A 3ZMTA 2DQ3A 3MHHC 2HVJC 2IJJA 1FXVA 4MW3A 4TWKA 3E8FA 1JPXA 2JIZG 3CCEV 1Q82W 3FB7C 2EILB 3ZIAG 2JDIG 4I5SA 1OCZC 3OEHG 1KD1W 4P9OA 4HZ3A 3FB8C 3W7UA 1Y66A 5L3GA 5EBMC 5H6RA 4ZBMA 3IGAC 4L87A 3FYEB 5CBFA 3K04A 3ABKB 1SERA 1OHHG 2QE7G 3TCUA 1E1QG 5LGUA 2R9IA 3OGCC 4JAUA 1K3EA 1XL6A 3T1CA 2IW5A 1G4YB 3T2MA 2QEXV 1XL4A 2XAHA 1W0KG 1W2BU 1HWYA 3QNEA 4RAIA 2WLLA 4MVQA 1KKDA 4P9PA 1K4CC 1K5QA 2V7QG 3F5WC 3ZMZA 1VQKV 2D3OW 2DYRB 3JD2A 1GKFA 2B5UA 2BOBC 2A9HA 2IJIA 2P7TC 1F51A 3ZRWB 1SESA 3D36A 3OEEG 3W7SA 1VQLV 1RM1B 2XASA 5EC2C 3OFNG 1OCCB 2EIMB 5B1BC 3I55V 4PA9A 1AJPA 2ZD9A 1H8EG 4MVSA 2PI5A 4H33A 4RUFA 1VQPV 3E86A 4RQEA 2UXXA 2A79B 4HAMA 3ML0A 3ZMUA 4BIZA 3CD6V 4WFBV 3RBZA 2ITCC 4MTOA 1R3KC 4WFGA 3SYCA 5L3BA 4P2ZA 4F4LA 3FB5C 5L3CA 3CMAV 1VQ7V 1F4MA 2WSSG 3LUTB 2M7WA 4JTAB 2EINC 1JQ0A 1JJ2U 1E79G 3WG7C 4PA7A 4P30A 1NQTA 3SYPA 1NVPD 1CP9A 1KP2A 4JASA 2ZDIA 4U7NA 4MS2A 3ZMSA 2XAJA 4GX1A 1GK9A 3B8NA 1S72V 1SETA 3JD3A 3WFVA 3ABMC 1NR1A 2YEVA 3LSSA 1DF4A 4RQFA 4X89A 4WFFA 1S76D 2Y48A 3E35A 3D3IA 3B8MA 2Z5UA 3K0GA 4X8AA 2Q68A 2Q6AA 2GHYA 3X2QB 2C2AA 5KUKA 1K5SA 1AR1B 4GX5A 4FJCC 2JEUA 2HKOA 1R73A 3UKMA 2W0FC 3W7WA 3ZCCA 1MSWD 3BEHA 1QVFU 4MTFA 2OTJV 1OCOB 3DGEA 4KFMA 2JEXA 4XDJA 5B1AB 2X0LA 4LBEC 3NXSA 1I5XA 4UVCA 3AG4C 2HFEC 5B1NA 1K4DC 5DN6G 2HG5C 1RM1C 1UJWB 3E89A 2XAQA 1OCCC 1SZTA 2Q67A 2EIMC 2WWWA 1QVGU 1DTOA 2IH1C 3AG1C 5KUMA 3JCZA 3FYIB 4DO2A 4JF3A 1Y4MA 4WF9V 1ROPA 3FB6C 1KP3A 2B1GA 4MVOA 3E83A 1YITV 2HJFC 2LP7A 3STZC 3CC4V 2ZQMA 1PNMA 4MTXA 3QO8A 4JGSA 1QLNA 5LBQA 1NJIW 5H6QA 3QO5A 4ASUG 5BZBA 1WPXA 4Z1MG 1JOYA 5L3DA 4MVUA 4FMTA 4FK5C 2Z3YA 2V1DA 2UXNA 4DXWA 1V54C 3ASOB 5FL7G 1KQSU 5C93A 1FXKB 3ZRWA 1OCRC 2XNDG 1JVMA 1DF5A 3G6EV 2JJ2G 2Q69A 5EC1C 3W7TA 1PNKA 1VQ5V 2HVKC 1M56B 4PELA 4ZKIA 1CEZA 1BL8A 2ZDIC 4EKWA 5KA6A 3X2QC 3CPWU 3SYQA 4LP8A 1GMGA 2MK3A 3JD4A 1YSCA 4QPJA 4MVRA 3CYOA 3STLC 3T4ZA 3GWOA 3OM3B 3ZRSA 2WLIA 4PA4A 4Q20A 3AG2B 4BW5A 1NKDA 1AI6A 2EZPA 2AHZA 4LCUC 1TUEB 3RW0A 4QE9A 3KG2A 1OCOC 3TK1A 1FFTB 5LGNA 1N8RW 5B1AC 2F43G 3ABLB 1QR8A 3OE7G 1GO3F 1KECA 2EJRA 3SPCA 4CBCA 4G2KA 3EHBB 3F7VC 2IJHA 2QA4V 1MG1A 2X6CA 4E2LA 2LFSA 2WLIB 1QR9A 1NH2D 2EBOA 2EIKC 2A0LA 2Y69C 1V55B 1P7BA 1G8MA 3K79A 4UVAA 5IY5C 5EK0A 1QBZA 1B6QA 2DW4A 3G4SV 2YSUB 3ETGA 4R50A 5HFMA 2LFRA 1YI2V 3OW2U 5CA3A 2EILC 3K9AA 3K08A 1YTFB 3K0DA 3E8BA 3K3WA 3HPLC 4JPRA 1KC8W 4UVBA 3ABKC 2OCCB 3B77A 1YJWV 3VBBA 3P30A 4PDVA 2PI4A 4TT3G 2X6BA 1AJQA 3EFFK 4QJFB 4CZZA 1M56C 5LHGA 3CXCU 2IJKA 4PA3A 1K73W 4UXNA 2CK3G 1COWG 2JK5C 1YIJV 1BHAA 2QKSA 3CC7V 2DYRC 2K1EA 5EBWC 3OUSA 3ZRVA 2WLHA 3AG3B 4UUJC 3R65A 3RVYA 4YXWG 1MABG 1L1FA 5IDJA 1Q7YW 3ASNB 2ZR2A 3H01A 2GSMB 3SYOA 1VQMV 1PD3A 4FIPC 2OTLV 1ZWIC 2IU0A 1QLEB 3ABLC 5LHIA 2EZOA 2R9RB 2AHYA 2HLDG 3IFXA 1PKXA 1PL0A 1SRYA 4QIWF 1K8AW 4J9ZB 1S5HC 1W0JG 5CMUA 4GX0A 1FXKA 2WPDG 1H8HG 4XDLA 2QM7A 1V55C 4GT1A 3CCLV 1VQOV 3OMIB 3OAAG 4BIUA 2ZXWB 4WFHA 4G28B 1VQ8V 3K03A 1AROP 4BAYA 4PA6A 3CCJV 3JD0A 2ZR3A 1GM7A 1NH2B 5IYCO 2NNUA 2QM8A 3QO7A 1RPRA 3E8GA 4MSWC 1AI4A 2WLNA 4H37A 1VQ6V 4QPKA 3ZN0A 1NVPB 3HB3B 3W7XA 1J95A 3T4DA 3MD0A 3JYCA 3TETA 1BHBA 4QNHB 5B3SB 3ABMB 1Q86W 3M99B 2OCCC 3CCVV 2ATKC 3SPJA 4MVZA 3ZMVA 5E1AC 3F7YC 3DTUB 3CP1A 4XDKA 1M57B 1M1KW 3ZJZA 3ZRXA 1DLBA 1R3IC 3BY6A 1P4RA 4JAVA 3CCQV 4JTDB 3OMNB 4KP4A 2IH3C 5LGTA 5IYDO 2WLMA 2ITDC 2OT5A 5CN0A 5L3EA 1S3JA 2QTOA 3PJSK 4I9WA 4PDRA 3GB7C 4GCZA 3LNMB 2W6IG 3AG3C 1M9NA 4MW8A 3RVZA 1VQ4V 1CPYA 1WLEA 4XBFA 2P90A 1GM8A 2IU3A 5EBLC 4JTCB 3ASNC 1K7DA 1EBOA 1IXMA 3AG4B 3I56V 1QLEC 3VOUA 1LNQA 1VQ9V 1I5YA 1JCHA 4UV8A 2DYSB 3G71V 2FTKA 4QE7A 1K9MW 1S77D 3AG1B 4WFEA 2WLLB 3ETDA 4OXSA 4TSFG 5L3FA 1YJNV 3ETEA 3LSQA 4RO2A 4UV9A 1K92A 1M90W 1GTOA 1QCEA 1PNLA 3ABUA 3CCUV 2ZXWC 3LDDA 1THZA 1OZ0A 2EIJB 2DWEC 1AJNA 1R3LC 2XAFA 3FKSG 1NBMG 1FS0G 1K97A 3ASOC 1ORQC 3OMAB 1MOFA 1OCZB 2JJ1G 2WAMA 3OR7C 3CCMV 1FXKC 1E1RG 2H94A 2DWDC 2NLJC 3LDCA 3ZN1A 3OUFA 5GW7A 3JD1A 3CCSV 5B1OA 5DM6V 3AEIA 1V54B 4R7CA 5B3SC 5CBHA 4HYOA 4JYCA 4X88A 1GM9A 1OCRB 5HFLA 1R6KA 5LHHA 3LDEA 2X6AA 4JYBA 1M57C 2HR3A 3E2EA 2P6JA 4N23A 3E8HA 4G27B 5J9PC 3OR6C 3AG2C 1YHQV 4RUEA 4MVMA 4J9YB 1AI7A 3IC7A 1R6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPO A;  1RPR A;  2GHY A;  2IJH A;  2IJK A;  1F4N A;  2IJI A;  4DO2 A;  1B6Q A;  1GMG A;  2IJJ A;  1GTO A;  1F4M A;  1ROP A;  3K79 A;  1NKD A;  1PD3 A; 
#chains in the Genus database with same CATH topology
 4W4L A;  2YEV B;  2KKW A;  2WLJ A;  4R8C A;  1YJ9 V;  2CH7 B;  1KYO F;  1H2G A;  4X1Y A;  2ZIM A;  3SPG A;  1EFR G;  1N33 O;  1F4N A;  4GKK B;  1XUQ A;  4BW9 A;  2H8P C;  5LOV A;  3CC2 V;  4K35 A;  1WN7 A;  2XT9 A;  3SPI A;  2KG7 A;  2EIN B;  4R6Z A;  1EZJ A;  1TA8 A;  1Y74 A;  1YTF D;  1VQN V;  1BQ0 A;  3FX7 A;  2DQ0 A;  3ZMT A;  5EZY B;  3CXH F;  1FJG B;  5LOV B;  3N27 A;  2IJJ A;  4PI0 A;  3E8F A;  1JPX A;  3CCE V;  2VQF B;  2ZIO A;  2EIL B;  3FB8 C;  4PV1 B;  1IZ3 A;  2M6Y A;  2ZNI A;  1GN4 A;  3JSL A;  4ZBM A;  3IGA C;  3FYE B;  2XUM A;  1JA8 A;  3UO3 A;  2YIC A;  3TCU A;  3T1C A;  1XL6 A;  4DV5 B;  3CSX A;  3OTF A;  3T2M A;  2QEX V;  2AW9 A;  4J11 A;  4DUZ O;  1W0K G;  1NTZ H;  4EFB A;  5EIB D;  2WLL A;  1KKD A;  5JH7 B;  2FL4 A;  1OV9 A;  2BSK A;  2V7Q G;  4TUY A;  1US6 A;  3ZMZ A;  2D3O W;  1GKF A;  4DV2 B;  2A9H A;  2IJI A;  2P7T C;  1HNZ O;  3OEE G;  3M7M X;  4J10 A;  4TQD A;  2XAS A;  4I50 A;  3MDS A;  4GKJ B;  2UXB O;  3I55 V;  4MVS A;  4UCV A;  4H33 A;  2Q0O C;  1VQP V;  4F6E A;  4RQE A;  5KLV H;  4HAM A;  3ML0 A;  3ZMU A;  5KHG A;  5KX5 B;  2ITC C;  4MTO A;  1GRJ A;  3FB5 C;  4JAA A;  3CMA V;  4JI5 O;  1U97 A;  4JTA B;  3RYF B;  1JQ0 A;  1RP3 B;  1ZUQ A;  3CJH B;  3L73 H;  3SYP A;  1I94 O;  1KP2 A;  4JAS A;  5JJJ B;  4FLU A;  3ZMS A;  4GX1 A;  1FFX B;  5GTH Z;  3T1H O;  1I0H A;  1RFY A;  1HR0 O;  3LSS A;  3CRM A;  4ICG A;  4HBN A;  1VF7 A;  3K0G A;  2OCH A;  2Q6A A;  4FLT A;  2XHB A;  1S5J A;  1XNR B;  3TJT A;  5KUK A;  4DV7 O;  4GX5 A;  1B04 A;  3W7W A;  2YXY A;  4W4K A;  1NZ6 A;  1QVF U;  4MTF A;  2YIA A;  4LFC O;  2OTJ V;  4DR5 B;  2X0L A;  4LBE C;  5D5Q A;  3BRC A;  1SQQ H;  2HFE C;  5B1N A;  1OCC C;  1SZT A;  2XAQ A;  3E22 B;  2JS5 A;  3JAK B;  4O4H A;  1DTO A;  1VF5 B;  2IH1 C;  4DRX A;  5JQG A;  3JCZ A;  4K3A A;  4I4T B;  4LH6 A;  1KP3 A;  4FM2 A;  4MVO A;  2HJF C;  3STZ C;  4FM1 A;  3CC4 V;  1PNM A;  3QO8 A;  3JCU Z;  5FNV B;  5LBQ A;  2YS8 A;  1MNG A;  5L3D A;  4MVU A;  4FK5 C;  4CH3 A;  4IIJ A;  2V1D A;  1BGY H;  4DXW A;  1IBK B;  4WBN A;  2FB5 A;  2HEP A;  3K5M A;  4B3M B;  4D7T A;  1Q3E A;  2XND G;  1JVM A;  1DF5 A;  2JJ2 G;  1PNK A;  2HVK C;  2Y4T A;  1M56 B;  4DV4 B;  4H44 B;  4JZG A;  3RN4 A;  3DXR A;  1FAF A;  2ZDI C;  4H13 B;  4U3F H;  3CPW U;  3SYQ A;  1GMG A;  2MK3 A;  4TV9 A;  3CYO A;  2PUS A;  1NT2 B;  3STL C;  5ITZ B;  3R66 A;  3GWO A;  3B09 A;  4DR1 B;  4Q20 A;  2AHZ A;  2YIB A;  3RW0 A;  2VQF O;  4QE9 A;  3LSU A;  5AG2 A;  4YY3 B;  1BQZ A;  1G1X B;  1AP5 A;  4CBC A;  3K57 A;  3K5O A;  1M4U A;  3EHB B;  1H2N A;  1Q90 D;  2QA4 V;  2X6C A;  4DV5 O;  4DV1 B;  4Z2W A;  1NH2 D;  2EBO A;  2EIK C;  2Y69 C;  4UB6 Z;  1G8M A;  2UUB O;  5EK0 A;  4HNA A;  1B6Q A;  3ETG A;  5HFM A;  1XIL A;  4O2B A;  5IJ0 B;  2ZM6 O;  4I0X B;  2OCC B;  3A2F A;  4CS2 A;  2N05 A;  3P30 A;  4PDV A;  2OIE A;  4X66 O;  2X6B A;  2Q9L A;  4X20 B;  2JS3 A;  4CZZ A;  3L9D A;  5LHG A;  3CXC U;  2IJK A;  4UXN A;  2JK5 C;  1YIJ V;  3L72 H;  3GVM A;  4DR3 O;  3CC7 V;  2DYR C;  3RYI B;  4LF5 O;  3OUS A;  3AG3 B;  4UUJ C;  2ZKO A;  4YIO A;  1MAB G;  2GSM B;  3HKD A;  1VF6 C;  2UUA B;  2OTL V;  1MZF A;  1ZTE A;  3UT5 A;  1QLE B;  5LHI A;  4FLZ A;  2RN9 A;  2F23 A;  2YIB D;  1K8A W;  3K59 A;  4DK1 A;  1SZX A;  4J42 A;  4F6R A;  1NU1 H;  4UCS A;  2P5O A;  1N32 B;  2QM7 A;  1V55 C;  1VAR A;  3P3N A;  2ZXW B;  2ZT9 B;  4G28 B;  1YEW A;  5A2Q N;  4PA6 A;  3JD0 A;  1XMO O;  4CC6 A;  1TUB A;  5IYC O;  2QM8 A;  2WA4 A;  4F6R B;  2Y0P A;  2LGQ A;  3HB3 B;  1KBH A;  1WA8 A;  3JYC A;  3TET A;  4X64 O;  1BHB A;  1FPO A;  5B3S B;  1VF6 A;  2PTM A;  3M99 B;  2ATK C;  4NTX A;  1GN6 A;  3ZMV A;  2AXT Z;  3CP1 A;  3SJC C;  3ZRX A;  2LW1 A;  3ZX6 A;  1R3I C;  4X65 B;  1YCI A;  4JTD B;  3OMN B;  5IJ9 A;  2IH3 C;  3CCQ V;  5LGT A;  1QNM A;  2ITD C;  4J41 A;  3CX5 F;  5CN0 A;  3PJS K;  3G6B A;  3HKB A;  4JI8 B;  4DV3 O;  1I08 A;  4K8X A;  2P90 A;  3AG4 B;  3I56 V;  2Q0A A;  1N36 O;  4I55 B;  1I5Y A;  1JCH A;  4DV4 O;  4UV8 A;  5LMN B;  5LA6 A;  1P49 A;  4BR6 A;  1XDC A;  5LP6 A;  5L3F A;  1YJN V;  4RO2 A;  2AZ0 A;  3QG5 A;  4UFZ A;  4UV9 A;  1QCE A;  3ABU A;  1QHT A;  3LDD A;  1THZ A;  1OZ0 A;  2DWE C;  3O65 A;  1AJN A;  4UCO A;  4YY3 O;  3K5L A;  5LA6 B;  5IT9 N;  1R3L C;  2E5L B;  3FKS G;  3ASO C;  1JR9 A;  1ORQ C;  3QF7 A;  4IYI A;  2WAM A;  2P4K A;  3CCM V;  1E1R G;  2NLJ C;  3ZN1 A;  5GW7 A;  2A06 H;  3AEI A;  5J2U B;  1V54 B;  2PYJ A;  2VWK A;  3D3Q A;  4X88 A;  3BA8 A;  5HFL A;  1X59 A;  3SR2 C;  2HR3 A;  1MZE A;  4G27 B;  5CA1 B;  3AG2 C;  2ZE8 A;  4RUE A;  2N74 A;  1R6N A;  3H1H H;  5IYB O;  1JX9 A;  2X7R B;  1BMF G;  1JMK C;  1XQ8 A;  1SS3 A;  2BCC H;  5B1B B;  2ZIN A;  2W6J G;  4IHJ B;  4LF7 B;  3SGI A;  1R3J C;  4YJ3 B;  3D8C A;  5H9C A;  1WB7 A;  1N0J A;  3ABT A;  3SJQ C;  1XMQ O;  2DYS C;  2BOC C;  3S3W A;  4N21 A;  4FPP A;  4LF4 B;  2KB1 A;  1K34 A;  1WB8 A;  1L0N H;  3CRQ A;  2ARH A;  1RPO A;  5H2F Z;  3D36 C;  4UCR A;  2UUA O;  4TWK A;  4O4I B;  5FPR A;  4OPA A;  2R72 A;  5F2V O;  2JDI G;  2GUZ A;  1AVM A;  5DED A;  1OCZ C;  5IYZ A;  4J7Z A;  5EBM C;  4L87 A;  5CBF A;  3K04 A;  4ZOL B;  5C8Y A;  1E1Q G;  2R9I A;  1FD9 A;  4IGG A;  3VQY A;  1K3E A;  1A32 A;  2IW5 A;  3ICX A;  1B3Q A;  1TVK B;  1V9P A;  1W2B U;  1HWY A;  1PV0 A;  4RAI A;  5FPO A;  1K4C C;  1X4T A;  2B9Z A;  1K5Q A;  1BS3 A;  2BTQ A;  5EIB C;  3B4S A;  2BOB C;  4O2A B;  1VQL V;  3D36 A;  1VIB A;  1M93 A;  1AJP A;  3CWB H;  1H8E G;  3N2K A;  4CH5 A;  2CDY A;  3B2E E;  1MA1 A;  5B5E Z;  1URF A;  3CD6 V;  4WFG A;  5L3C A;  3OTO B;  2WSS G;  2IM9 A;  2M7W A;  4JI8 O;  3FAV B;  2EIN C;  1E79 G;  4PA7 A;  1XEQ A;  1NQT A;  1NVP D;  3JAL B;  2XAJ A;  4FFB A;  1S72 V;  1SET A;  1HNX O;  2YEV A;  4DV6 B;  1DF4 A;  4X89 A;  5LXT B;  1XHZ A;  2CH7 A;  4WFF A;  1S76 D;  3D3I A;  3B8M A;  4JV5 B;  3T1Y B;  3X2Q B;  1K5S A;  1AR1 B;  2HKO A;  3UKM A;  1RSO B;  1Y6X A;  1MSW D;  3BEH A;  3CRC A;  4K0K B;  2DMX A;  2VWJ A;  2HHH B;  1PL4 A;  4KFM A;  4XDJ A;  5B1A B;  4DR2 O;  1I5X A;  2ZE5 A;  5EZY A;  5DN6 G;  2HG5 C;  4DUY O;  2WWW A;  1Y67 A;  5KUM A;  2UXC B;  2CTR A;  3AG7 A;  2A7W A;  5BY1 A;  3N2G B;  4LF8 B;  2Y4U A;  4MTX A;  4JGS A;  2ODM A;  1QLN A;  3B40 A;  5H6Q A;  3QO5 A;  3JAR B;  5EYP B;  4Z1M G;  4FMT A;  5JH7 A;  3Q4H A;  3JAM N;  2YDE A;  3MAQ A;  3J7A U;  2GTA A;  3QVN A;  1FXK B;  1OCR C;  3U11 A;  3G6E V;  4NXN O;  5LMU O;  3IAY A;  2D2C B;  4LF4 O;  3RYC B;  1CEZ A;  4EKW A;  5FLX N;  2UU9 B;  3Q4H B;  1L0L H;  4LP8 A;  3JD4 A;  1LUW A;  4MVR A;  4PD4 F;  3TXS A;  5KX5 A;  1T5E A;  4KXR A;  1NKD A;  2EZP A;  3BHP A;  3KG2 A;  3RYF A;  5KHJ A;  3OGI B;  1Q6U A;  2F43 G;  3CJH A;  5GON A;  2ETN A;  1QR8 A;  1N34 O;  1KEC A;  3SPC A;  1IBL B;  3HKC B;  4G2K A;  3TGU H;  1FFX A;  2Q73 A;  3H1L H;  1P7B A;  3K79 A;  5GON B;  5IY5 C;  4NXM B;  2QWQ B;  3G4S V;  4JI6 B;  4YIP A;  3JAS B;  2HP8 A;  4IYH A;  1Y76 B;  5JWP A;  2K9P A;  1AIL A;  3K3W A;  4JPR A;  1KC8 W;  3ABK C;  1IBM B;  3OT7 A;  2CGN A;  1TGO A;  2PI4 A;  1AJQ A;  3EXA A;  3E22 A;  3JAK A;  1M56 C;  2UXD B;  2ZCE A;  4ZHQ B;  4YJ2 B;  4JI7 B;  4DW0 A;  4U3J A;  4I4T A;  4B3R O;  1COW G;  2JGD B;  3K58 A;  2K1E A;  3RT3 C;  1XRE A;  1WP8 A;  4EFE A;  2WA3 A;  4DW1 A;  5FNV A;  3RVY A;  1L1F A;  1F7Y A;  1Q7Y W;  3ASN B;  2ZR2 A;  4DR7 O;  1Q6I A;  4FVM A;  1VQM V;  1NI8 A;  4U3J B;  4TQF A;  2F1M A;  2EZO A;  2R9R B;  2HLD G;  5KHI A;  1SQP H;  3IFX A;  4LFB B;  1PKX A;  1JJO A;  1ZAU A;  4BWA A;  4J9Z B;  1DK1 A;  1LR1 A;  1W0J G;  5CMU A;  4FZ0 A;  1H8H G;  4XDL A;  1SC5 B;  4WFH A;  3K9S A;  5BMV A;  1VQ8 V;  2UUC B;  2F93 B;  4K0K O;  2HHH O;  2CTP A;  1ARO P;  3CCJ V;  5CA0 B;  1QQC A;  1NH2 B;  4GKK O;  2NNU A;  5ITZ A;  2Y0I A;  4LH7 A;  3E8G A;  4X62 B;  1AI4 A;  4H37 A;  1ZX3 A;  4QPK A;  3W7X A;  3T4D A;  3MD0 A;  4FLW A;  2UXC O;  5BMV B;  2PGG A;  2OCC C;  2RNB A;  1PM9 A;  5E1A C;  4DR4 B;  4JZ2 A;  4LF8 O;  4FFK A;  4X1K B;  2QJ1 A;  1M57 B;  1FJG O;  4JAV A;  5IYD O;  2QWR B;  4ZIB A;  2ADQ B;  4PDR A;  3GB7 C;  3LNM B;  3AG3 C;  3M8A A;  1M9N A;  2QWO B;  4MW8 A;  1VQ4 V;  4XBF A;  1GM8 A;  1K7D A;  5TIS Z;  1EBO A;  3BCC H;  2YI9 A;  1QLE C;  1LNQ A;  5IJ0 A;  4TV8 A;  2UU9 O;  4QE7 A;  4Z1V A;  1K9M W;  5KHK A;  1S77 D;  4I0X A;  3ETD A;  1XBL A;  4LWS A;  3KKY A;  4JI1 B;  1J5E B;  4DV2 O;  1N4C A;  2E76 B;  1K92 A;  2HJD A;  4X20 A;  2ZXW C;  2EIJ B;  4GKJ O;  3J80 N;  4TV8 B;  2ZE6 A;  3DSQ A;  3G67 A;  1NBM G;  1FS0 G;  3OMA B;  3RYI A;  4B3S B;  2O57 A;  1HNW B;  3BA9 A;  4LWS B;  1NTK H;  2DWD C;  3A0H Z;  5CB4 A;  1VEW A;  1Q43 A;  5B3S C;  2Z0A A;  1GN2 A;  2Q7G A;  4LFA B;  5LHH A;  4LR3 A;  4BIO A;  4NXM O;  4N23 A;  3CHX A;  1S5L Z;  4KHP B;  4ZI7 B;  3H1J H;  2N04 A;  5CB4 B;  4B7E A;  4YXW G;  1AI7 A;  1XNQ B;  1AI5 A;  2XOK G;  1F23 A;  1H38 A;  2WLK A;  3SYA A;  2Q7E A;  1XNR O;  1ENV A;  1XI1 A;  1SQV H;  2YUA A;  4D7S A;  2B1I A;  3UM7 A;  1K33 A;  2UXD O;  1FXH A;  2CTW A;  3SPH A;  4JI7 O;  5KA5 A;  2P4V A;  4MTG A;  2P67 A;  4LC1 A;  4DR5 O;  2QSA A;  2EIK B;  2Y69 B;  4JI0 B;  4L8J A;  3GWK C;  3HKE A;  3WG7 B;  3K06 A;  1IXB A;  1L8D A;  2DOS A;  5J2T B;  1BCC H;  3MHH C;  1FXV A;  4MW3 A;  2F4V B;  3BFR A;  2JIZ G;  1O9G A;  1Q82 W;  5JCO A;  2OWO A;  1AR5 A;  3ZIA G;  3OEH G;  5LP6 C;  1KD1 W;  4P9O A;  5L3G A;  3HKE B;  1KKC A;  5H6R A;  1WJZ A;  2QE7 G;  5LGU A;  1UPG A;  1G4Y B;  4I55 A;  3ZHV A;  2XAH A;  4C7U A;  4OGQ B;  4AQY B;  1PPJ H;  2NR5 A;  4YHH B;  5H5N A;  4P9P A;  1IBK O;  3F5W C;  1VQK V;  2DYR B;  4B3M O;  4JYA B;  3ZRW B;  1F51 A;  1RM1 B;  5BR8 B;  5EC2 C;  1R6T A;  3OFN G;  2EIM B;  1G6U A;  5B1B C;  3KZI Z;  2ZD9 A;  2CAZ C;  3BPZ A;  3UO2 A;  2V4D A;  2PI5 A;  3ZHQ A;  4DR1 O;  2LJ2 A;  4WFB V;  4CH4 A;  3RBZ A;  5J2U A;  1R3K C;  4GZR B;  1F4M A;  4AHC A;  1W59 A;  1KUQ A;  2E3C A;  3JAT B;  1CP9 A;  3ZHT A;  5CA1 A;  4MS2 A;  4DV1 O;  3B8N A;  1P84 F;  1HP8 A;  3WFV A;  3ABM C;  4B3T B;  1NR1 A;  2RDC A;  4I7Z B;  2RCV A;  3E35 A;  2Z5U A;  4X8A A;  3DC6 A;  3SJB C;  3I5D A;  4JI1 O;  2GHY A;  1GN3 A;  4IHJ A;  2PYL A;  2C2A A;  4YJ3 A;  3ETQ A;  1N33 B;  2JEU A;  1KU9 A;  2W0F C;  3CE2 A;  2CTQ A;  3G80 A;  2FML A;  3WB2 A;  1OCO B;  1NTM H;  3NXS A;  4UVC A;  5KMG A;  1N0N A;  3IJ4 A;  1K4D C;  3E89 A;  4O4I A;  3RYH B;  4NTW A;  1QVG U;  3AG1 C;  1SA0 A;  4EB6 B;  1EM1 A;  2EJ7 A;  4JF3 A;  1D5A A;  1ROP A;  3IC9 A;  1LUV A;  3FB6 C;  1H2S B;  2B1G A;  1YIT V;  3E83 A;  4ZOL A;  5KMG B;  5DEC A;  2ZQM A;  4GYC B;  1VMG A;  5JJN B;  4ASU G;  1WPX A;  1SA0 B;  1TVK A;  1D2D A;  2P22 C;  2CUG A;  1JOY A;  4DUZ B;  2EX3 A;  2CE4 A;  3SDL A;  2UXN A;  3ASO B;  5JJE B;  5FL7 G;  1N32 O;  1KQS U;  5C93 A;  4O2A A;  3W7T A;  5EC1 C;  2QWN B;  4FZ1 A;  1VQ5 V;  3ZHS A;  4ZKI A;  5KA6 A;  3X2Q C;  4KL1 A;  2OYQ A;  1U96 A;  4QPJ A;  5D5P A;  2FKX A;  2L35 A;  2WLI A;  3AG2 B;  1AI6 A;  4LCU C;  3C90 A;  1MMM A;  3C3S A;  3FAV A;  3TK1 A;  4JI5 B;  5LGN A;  3CRR A;  1KB9 F;  1SQF A;  5B1A C;  4FM0 A;  3ABL B;  2QWP B;  3OE7 G;  1GO3 F;  1GH6 A;  2EJR A;  2JVD A;  3JAL A;  4A5U B;  2IJH A;  2RQ6 A;  4X65 O;  4E2L A;  2LFS A;  2WLI B;  2NN4 A;  2QKC A;  1VP7 A;  2F66 C;  2FYU H;  5LXT A;  5IWA B;  4NKG B;  1HR0 B;  2ZE7 A;  4UVA A;  4O4J A;  1I7F A;  2DW4 A;  2YSU B;  1ZSP A;  4R50 A;  5JVD A;  2LFR A;  3OW2 U;  2H3O A;  2G38 A;  5BR8 O;  1RSO A;  2EIL C;  3KCX A;  5LMN O;  1AR4 A;  1YTF B;  4O4L B;  2LQT A;  4J7K A;  3E8B A;  4O4J B;  4UVB A;  4LFC B;  1D5N A;  2JRI A;  4DV0 B;  2RMK B;  5JVD B;  4QJF B;  1H2M A;  4TOI A;  3CB2 A;  1Z5W A;  2E5L O;  1K73 W;  1Q8I A;  4JI2 B;  4X9Q A;  1BHA A;  1EN5 A;  2QKS A;  3N2G A;  4UCT A;  2WLH A;  3R65 A;  2ADP A;  4JYY A;  1ZL8 A;  4B3T O;  5IDJ A;  3AK3 A;  1SF9 A;  3JAR A;  4CC5 A;  4FIP C;  5EYP A;  2IU0 A;  2AHY A;  3BVO A;  1SRY A;  1EZV H;  4LNU B;  2GDS A;  3P3P A;  1FXK A;  1ZL8 B;  1VQO V;  3OMI B;  2Q4P A;  3DC5 A;  1IX9 A;  3RYC A;  2YI8 A;  2ZR3 A;  4LF7 O;  4X1Y B;  2OIG A;  3QO7 A;  4OPH A;  4MSW C;  1VQ6 V;  3ZN0 A;  1J95 A;  3VQW A;  1XHX A;  1Q5O A;  2EUL A;  1Q86 W;  2KG7 B;  3HKC A;  3DTU B;  2GV9 A;  1Y74 B;  4XDK A;  1M1K W;  1O9H A;  2L6L A;  5B66 Z;  4DYL A;  3L75 H;  3ZJZ A;  4KP4 A;  4X1I A;  4CS4 A;  4E4E A;  2YID A;  5L3E A;  2QTO A;  1IVS A;  4GUN A;  2W6I G;  5IE9 A;  2UUB B;  3ZBH A;  3RVZ A;  1WLE A;  4D6T H;  5EBL C;  4FLX A;  4JTC B;  3ASN C;  3RGB A;  3JAS A;  4DR6 B;  4NVP A;  4X1I B;  4NYK A;  3VOU A;  1VQ9 V;  1Y76 A;  2LW7 A;  2FTK A;  1ZLZ A;  5K1P A;  4WFE A;  2WLL B;  2ZM6 B;  4TSF G;  2BSK B;  4TUY B;  3ETE A;  3LSQ A;  1BSM A;  2GTS A;  1M90 W;  1PNL A;  4X66 B;  3CCU V;  3VQV A;  3ZED A;  4ZHQ A;  4YJ2 A;  4I50 B;  5BXZ A;  2JGD A;  1K97 A;  1MOF A;  3AK2 A;  2JJ1 G;  4DR3 B;  4LF5 B;  3OUF A;  3CCS V;  4LF6 B;  3VQX A;  2QKA A;  5DM6 V;  1NS1 A;  3OTO O;  4R7C A;  5IWA O;  1GM9 A;  2JGU A;  1OCR B;  1R6K A;  1SQG A;  1DGS A;  2X6A A;  4JYB A;  1M57 C;  3E2E A;  2R9A A;  3OR6 C;  1YHQ V;  4GLX A;  4MVM A;  4DV6 O;  4J9Y B;  3IC7 A;  3WB1 A;  4PDM A;  1Q81 W;  1S0V A;  4JV5 O;  5CA0 A;  3T1Y O;  3CCR V;  3MHS C;  3UQ8 A;  2XAG A;  4DV0 O;  3CEI A;  3P32 A;  2BE3 A;  4PDL A;  1XMO B;  3CME V;  4MT8 A;  2DE0 X;  4KUM A;  1CXZ B;  3LNN A;  3A0R A;  4WFA V;  4CS3 A;  4JI2 O;  4WCE V;  3ZHU A;  4X64 B;  4U7O A;  4X1K A;  3WB0 A;  5IY5 B;  5CBG A;  1HW7 A;  1NR7 A;  2EIJ C;  4GX2 A;  1Q6H A;  2DQ3 A;  2HVJ C;  2ZNJ A;  4O4H B;  3FB7 C;  3TXQ A;  4DRX B;  5JQG B;  4I5S A;  4HZ3 A;  3FD9 A;  3W7U A;  1Y66 A;  3C3T A;  4DV3 B;  1M5I A;  3ABK B;  4ABM A;  1SER A;  1OHH G;  3F5T A;  3OGC C;  4JAU A;  5LYJ A;  2PZS A;  1XL4 A;  1WP7 A;  1YF2 A;  1N36 B;  1SQX H;  3QNE A;  4MVQ A;  4IIJ B;  3JD2 A;  1OJH A;  4WBN B;  2B5U A;  3CRA A;  5LYJ B;  3WU2 Z;  1SES A;  3W7S A;  1OCC B;  4PJ0 Z;  4PA9 A;  2RJZ A;  3DXR B;  2IBZ H;  4RUF A;  3E86 A;  3ZS8 C;  2UXX A;  2A79 B;  4JI4 B;  4TV9 B;  4BIZ A;  4AI8 A;  2P06 A;  4K8Z A;  4JI3 B;  2LO1 A;  3U0Z A;  3SYC A;  5L3B A;  4P2Z A;  4F4L A;  1H2K A;  1KMI Z;  1VQ7 V;  4NR1 A;  4DK0 A;  5E79 Z;  1AB3 A;  3LUT B;  4UB8 Z;  1JJ2 U;  2Q8V A;  3WG7 C;  1IBL O;  4P30 A;  1YDX A;  2ZDI A;  4ZI7 A;  4U7N A;  2AGA A;  4DR6 O;  1GK9 A;  2DN9 A;  3JD3 A;  3KCY A;  2VS0 A;  4LF9 B;  4RQF A;  3QTC A;  4FLV A;  2W0X A;  2Y48 A;  3L74 H;  2Q68 A;  4HNA B;  4JI6 O;  3SJA C;  3FFQ A;  2CGO A;  4O2B B;  5JCO C;  4FJC C;  4H0L B;  1R73 A;  3A8T A;  3ZCC A;  5LL6 Y;  1HDJ A;  1XMQ B;  1B06 A;  3H9V A;  1IBM O;  3DGE A;  2GBO A;  2JEX A;  3APQ A;  4LF6 O;  3AG4 C;  2E74 B;  5KHH A;  5J2T A;  1RM1 C;  4AIL C;  1UJW B;  2QGN A;  2Q67 A;  1YVW A;  2EIM C;  3AK1 A;  2YC0 A;  2XTA A;  1YZB A;  3FYI B;  4J7J A;  4DO2 A;  4WF9 V;  1Y4M A;  1BT8 A;  1FYJ A;  2LP7 A;  2VQE B;  1EN6 A;  1NJI W;  3HKD B;  2AZ2 A;  5BZB A;  5K1X A;  3UT5 B;  4LFB O;  2Z3Y A;  1V54 C;  3BAA A;  2PF4 E;  4OX9 B;  3ZRW A;  2Q69 A;  2UUC O;  2E75 B;  3UCS C;  4PEL A;  1BL8 A;  4B7K A;  1WAZ A;  1YSC A;  2Q5Z A;  1TUB B;  3S3X A;  4X62 O;  3T4Z A;  3OM3 B;  3ZRS A;  4FLY A;  4PA4 A;  4BW5 A;  2F95 B;  1TUE B;  1WA8 B;  1TAE A;  4RWU A;  1OCO C;  3APO A;  1FFT B;  1N8R W;  4DR4 O;  1AP6 A;  2QDO A;  3JAT A;  4IT5 A;  3F7V C;  1MG1 A;  1QR9 A;  5KAI Z;  5IJ9 B;  2A0L A;  4NB5 A;  1V55 B;  2DJV A;  1HNX B;  3HKB B;  1XOU A;  1QBZ A;  4B08 A;  2A3Q A;  1WPB A;  1YI2 V;  5CA3 A;  3ZHR A;  1IDS A;  3K9A A;  3K08 A;  4IL6 Z;  3K0D A;  3HPL C;  3BAB A;  1J5E O;  4JI4 O;  3B77 A;  1YJW V;  3VBB A;  5LP6 B;  2YXL A;  4JI3 O;  4TT3 G;  4DR2 B;  1R1B A;  3EFF K;  3RYH A;  4DUY B;  4NTY A;  4PA3 A;  3L70 H;  3RFR A;  4EB6 A;  2CK3 G;  5GTI Z;  4B3S O;  1HNW O;  2R70 A;  2KSD A;  5EBW C;  1FKA O;  3ZRV A;  5KAF Z;  4EEQ A;  3L71 H;  3H01 A;  4LF9 O;  3NR7 A;  4LFA O;  3SYO A;  1PD3 A;  1ZWI C;  3ABL C;  4PHZ A;  3JAW A;  1PP9 H;  2QR4 A;  1PL0 A;  4KHP O;  4QIW F;  1S5H C;  2YXH A;  4GX0 A;  1XNQ O;  2WPD G;  4GT1 A;  3CCL V;  3OAA G;  2QTS A;  4BIU A;  3H1I H;  4NXN B;  5LMU B;  3K5N A;  3JAW B;  3K03 A;  4BAY A;  1UFI A;  1EN4 A;  1GM7 A;  1RPR A;  1MSD A;  3H1K H;  2WLN A;  2VRZ A;  3J81 N;  3A0B Z;  1NVP B;  1HNZ B;  4QNH B;  3ABM B;  1GAX A;  4JI0 O;  3CCV V;  2UXB B;  3OD4 A;  3SPJ A;  1WNS A;  4MVZ A;  4Q6G A;  2PY5 A;  4CH6 A;  3F7Y C;  1N34 B;  1QU7 A;  5A9G A;  2VQE O;  1SQB H;  1Z2G A;  1DLB A;  3BY6 A;  3EVK A;  1P4R A;  2F4V O;  4I9Q A;  2WLM A;  2ILM A;  4QGP A;  2OT5 A;  1S3J A;  1JFF A;  4UCU A;  4I9W A;  2GUZ B;  2LGW A;  4GCZ A;  5IYZ B;  2Q7H A;  1I94 B;  3JSN A;  1BZK A;  1CPY A;  2IU3 A;  5C8Y B;  4OX9 O;  1P7G A;  1IXM A;  3T1H B;  4O4L A;  4AQY O;  1JFF B;  4YHH O;  2DYS B;  3G71 V;  3AG1 B;  4OXS A;  2BTQ B;  4JYA O;  1GTO A;  2QM4 A;  4DV7 B;  3U10 A;  3O9O A;  4PI2 A;  1H2L A;  2XAF A;  4B3R B;  3N2K B;  1OCZ B;  3OR7 C;  1FXK C;  2H94 A;  3LDC A;  4J80 A;  3JD1 A;  5B1O A;  2KQX A;  1YXB A;  2BTO A;  3RWR D;  3CS5 A;  5CBH A;  4HYO A;  4JYC A;  4DR7 B;  3THO A;  3LDE A;  1IUR A;  3PN1 A;  2P6J A;  3E8H A;  1SKV A;  1Z5V A;  5J9P C;  4LNU A;  2MW2 B;  1BE3 H;  4FFB B;  3HR0 A; 
#chains in the Genus database with same CATH homology
 1AI5 A;  4PDM A;  2YEV B;  4R8C A;  2WLJ A;  1JX9 A;  2X7R B;  5IYB O;  1BMF G;  1YJ9 V;  2XOK G;  1Q81 W;  1F23 A;  1H38 A;  1S0V A;  2WLK A;  5B1B B;  3SYA A;  1H2G A;  1ENV A;  3CCR V;  2W6J G;  3MHS C;  2XAG A;  3SPG A;  3P32 A;  1EFR G;  1R3J C;  1F4N A;  2B1I A;  4PDL A;  5H9C A;  3UM7 A;  3CME V;  4MT8 A;  2H8P C;  1K33 A;  3ABT A;  4KUM A;  3SJQ C;  1FXH A;  2DYS C;  3SPH A;  3A0R A;  3CC2 V;  2BOC C;  4WFA V;  5KA5 A;  4N21 A;  4FPP A;  4MTG A;  4WCE V;  2P67 A;  4LC1 A;  2EIK B;  3SPI A;  2Y69 B;  2KB1 A;  1K34 A;  2EIN B;  4R6Z A;  4U7O A;  1EZJ A;  3WG7 B;  1YTF D;  1VQN V;  5IY5 B;  3K06 A;  1RPO A;  5CBG A;  2DQ0 A;  1NR7 A;  2EIJ C;  4GX2 A;  3ZMT A;  2DQ3 A;  3MHH C;  2HVJ C;  2IJJ A;  1FXV A;  4MW3 A;  4TWK A;  3E8F A;  1JPX A;  2JIZ G;  3CCE V;  1Q82 W;  3FB7 C;  2EIL B;  3ZIA G;  2JDI G;  4I5S A;  1OCZ C;  3OEH G;  1KD1 W;  4P9O A;  4HZ3 A;  3FB8 C;  3W7U A;  1Y66 A;  5L3G A;  5EBM C;  5H6R A;  4ZBM A;  3IGA C;  4L87 A;  3FYE B;  5CBF A;  3K04 A;  3ABK B;  1SER A;  1OHH G;  2QE7 G;  3TCU A;  1E1Q G;  5LGU A;  2R9I A;  3OGC C;  4JAU A;  1K3E A;  1XL6 A;  3T1C A;  2IW5 A;  1G4Y B;  3T2M A;  2QEX V;  1XL4 A;  2XAH A;  1W0K G;  1W2B U;  1HWY A;  3QNE A;  4RAI A;  2WLL A;  4MVQ A;  1KKD A;  4P9P A;  1K4C C;  1K5Q A;  2V7Q G;  3F5W C;  3ZMZ A;  1VQK V;  2D3O W;  2DYR B;  3JD2 A;  1GKF A;  2B5U A;  2BOB C;  2A9H A;  2IJI A;  2P7T C;  1F51 A;  3ZRW B;  1SES A;  3D36 A;  3OEE G;  3W7S A;  1VQL V;  1RM1 B;  2XAS A;  5EC2 C;  3OFN G;  1OCC B;  2EIM B;  5B1B C;  3I55 V;  4PA9 A;  1AJP A;  2ZD9 A;  1H8E G;  4MVS A;  2PI5 A;  4H33 A;  4RUF A;  1VQP V;  3E86 A;  4RQE A;  2UXX A;  2A79 B;  4HAM A;  3ML0 A;  3ZMU A;  4BIZ A;  3CD6 V;  4WFB V;  3RBZ A;  2ITC C;  4MTO A;  1R3K C;  4WFG A;  3SYC A;  5L3B A;  4P2Z A;  4F4L A;  3FB5 C;  5L3C A;  3CMA V;  1VQ7 V;  1F4M A;  2WSS G;  3LUT B;  2M7W A;  4JTA B;  2EIN C;  1JQ0 A;  1JJ2 U;  1E79 G;  3WG7 C;  4PA7 A;  4P30 A;  1NQT A;  3SYP A;  1NVP D;  1CP9 A;  1KP2 A;  4JAS A;  2ZDI A;  4U7N A;  4MS2 A;  3ZMS A;  2XAJ A;  4GX1 A;  1GK9 A;  3B8N A;  1S72 V;  1SET A;  3JD3 A;  3WFV A;  3ABM C;  1NR1 A;  2YEV A;  3LSS A;  1DF4 A;  4RQF A;  4X89 A;  4WFF A;  1S76 D;  2Y48 A;  3E35 A;  3D3I A;  3B8M A;  2Z5U A;  3K0G A;  4X8A A;  2Q68 A;  2Q6A A;  2GHY A;  3X2Q B;  2C2A A;  5KUK A;  1K5S A;  1AR1 B;  4GX5 A;  4FJC C;  2JEU A;  2HKO A;  1R73 A;  3UKM A;  2W0F C;  3W7W A;  3ZCC A;  1MSW D;  3BEH A;  1QVF U;  4MTF A;  2OTJ V;  1OCO B;  3DGE A;  4KFM A;  2JEX A;  4XDJ A;  5B1A B;  2X0L A;  4LBE C;  3NXS A;  1I5X A;  4UVC A;  3AG4 C;  2HFE C;  5B1N A;  1K4D C;  5DN6 G;  2HG5 C;  1RM1 C;  1UJW B;  3E89 A;  2XAQ A;  1OCC C;  1SZT A;  2Q67 A;  2EIM C;  2WWW A;  1QVG U;  1DTO A;  2IH1 C;  3AG1 C;  5KUM A;  3JCZ A;  3FYI B;  4DO2 A;  4JF3 A;  1Y4M A;  4WF9 V;  1ROP A;  3FB6 C;  1KP3 A;  2B1G A;  4MVO A;  3E83 A;  1YIT V;  2HJF C;  2LP7 A;  3STZ C;  3CC4 V;  2ZQM A;  1PNM A;  4MTX A;  3QO8 A;  4JGS A;  1QLN A;  5LBQ A;  1NJI W;  5H6Q A;  3QO5 A;  4ASU G;  5BZB A;  1WPX A;  4Z1M G;  1JOY A;  5L3D A;  4MVU A;  4FMT A;  4FK5 C;  2Z3Y A;  2V1D A;  2UXN A;  4DXW A;  1V54 C;  3ASO B;  5FL7 G;  1KQS U;  5C93 A;  1FXK B;  3ZRW A;  1OCR C;  2XND G;  1JVM A;  1DF5 A;  3G6E V;  2JJ2 G;  2Q69 A;  5EC1 C;  3W7T A;  1PNK A;  1VQ5 V;  2HVK C;  1M56 B;  4PEL A;  4ZKI A;  1CEZ A;  1BL8 A;  2ZDI C;  4EKW A;  5KA6 A;  3X2Q C;  3CPW U;  3SYQ A;  4LP8 A;  1GMG A;  2MK3 A;  3JD4 A;  1YSC A;  4QPJ A;  4MVR A;  3CYO A;  3STL C;  3T4Z A;  3GWO A;  3OM3 B;  3ZRS A;  2WLI A;  4PA4 A;  4Q20 A;  3AG2 B;  4BW5 A;  1NKD A;  1AI6 A;  2EZP A;  2AHZ A;  4LCU C;  1TUE B;  3RW0 A;  4QE9 A;  3KG2 A;  1OCO C;  3TK1 A;  1FFT B;  5LGN A;  1N8R W;  5B1A C;  2F43 G;  3ABL B;  1QR8 A;  3OE7 G;  1GO3 F;  1KEC A;  2EJR A;  3SPC A;  4CBC A;  4G2K A;  3EHB B;  3F7V C;  2IJH A;  2QA4 V;  1MG1 A;  2X6C A;  4E2L A;  2LFS A;  2WLI B;  1QR9 A;  1NH2 D;  2EBO A;  2EIK C;  2A0L A;  2Y69 C;  1V55 B;  1P7B A;  1G8M A;  3K79 A;  4UVA A;  5IY5 C;  5EK0 A;  1QBZ A;  1B6Q A;  2DW4 A;  3G4S V;  2YSU B;  3ETG A;  4R50 A;  5HFM A;  2LFR A;  1YI2 V;  3OW2 U;  5CA3 A;  2EIL C;  3K9A A;  3K08 A;  1YTF B;  3K0D A;  3E8B A;  3K3W A;  3HPL C;  4JPR A;  1KC8 W;  4UVB A;  3ABK C;  2OCC B;  3B77 A;  1YJW V;  3VBB A;  3P30 A;  4PDV A;  2PI4 A;  4TT3 G;  2X6B A;  1AJQ A;  3EFF K;  4QJF B;  4CZZ A;  1M56 C;  5LHG A;  3CXC U;  2IJK A;  4PA3 A;  1K73 W;  4UXN A;  2CK3 G;  1COW G;  2JK5 C;  1YIJ V;  1BHA A;  2QKS A;  3CC7 V;  2DYR C;  2K1E A;  5EBW C;  3OUS A;  3ZRV A;  2WLH A;  3AG3 B;  4UUJ C;  3R65 A;  3RVY A;  4YXW G;  1MAB G;  1L1F A;  5IDJ A;  1Q7Y W;  3ASN B;  2ZR2 A;  3H01 A;  2GSM B;  3SYO A;  1VQM V;  1PD3 A;  4FIP C;  2OTL V;  1ZWI C;  2IU0 A;  1QLE B;  3ABL C;  5LHI A;  2EZO A;  2R9R B;  2AHY A;  2HLD G;  3IFX A;  1PKX A;  1PL0 A;  1SRY A;  4QIW F;  1K8A W;  4J9Z B;  1S5H C;  1W0J G;  5CMU A;  4GX0 A;  1FXK A;  2WPD G;  1H8H G;  4XDL A;  2QM7 A;  1V55 C;  4GT1 A;  3CCL V;  1VQO V;  3OMI B;  3OAA G;  4BIU A;  2ZXW B;  4WFH A;  4G28 B;  1VQ8 V;  3K03 A;  1ARO P;  4BAY A;  4PA6 A;  3CCJ V;  3JD0 A;  2ZR3 A;  1GM7 A;  1NH2 B;  5IYC O;  2NNU A;  2QM8 A;  3QO7 A;  1RPR A;  3E8G A;  4MSW C;  1AI4 A;  2WLN A;  4H37 A;  1VQ6 V;  4QPK A;  3ZN0 A;  1NVP B;  3HB3 B;  3W7X A;  1J95 A;  3T4D A;  3MD0 A;  3JYC A;  3TET A;  1BHB A;  4QNH B;  5B3S B;  3ABM B;  1Q86 W;  3M99 B;  2OCC C;  3CCV V;  2ATK C;  3SPJ A;  4MVZ A;  3ZMV A;  5E1A C;  3F7Y C;  3DTU B;  3CP1 A;  4XDK A;  1M57 B;  1M1K W;  3ZJZ A;  3ZRX A;  1DLB A;  1R3I C;  3BY6 A;  1P4R A;  4JAV A;  3CCQ V;  4JTD B;  3OMN B;  4KP4 A;  2IH3 C;  5LGT A;  5IYD O;  2WLM A;  2ITD C;  2OT5 A;  5CN0 A;  5L3E A;  1S3J A;  2QTO A;  3PJS K;  4I9W A;  4PDR A;  3GB7 C;  4GCZ A;  3LNM B;  2W6I G;  3AG3 C;  1M9N A;  4MW8 A;  3RVZ A;  1VQ4 V;  1CPY A;  1WLE A;  4XBF A;  2P90 A;  1GM8 A;  2IU3 A;  5EBL C;  4JTC B;  3ASN C;  1K7D A;  1EBO A;  1IXM A;  3AG4 B;  3I56 V;  1QLE C;  3VOU A;  1LNQ A;  1VQ9 V;  1I5Y A;  1JCH A;  4UV8 A;  2DYS B;  3G71 V;  2FTK A;  4QE7 A;  1K9M W;  1S77 D;  3AG1 B;  4WFE A;  2WLL B;  3ETD A;  4OXS A;  4TSF G;  5L3F A;  1YJN V;  3ETE A;  3LSQ A;  4RO2 A;  4UV9 A;  1K92 A;  1M90 W;  1GTO A;  1QCE A;  1PNL A;  3ABU A;  3CCU V;  2ZXW C;  3LDD A;  1THZ A;  1OZ0 A;  2EIJ B;  2DWE C;  1AJN A;  1R3L C;  2XAF A;  3FKS G;  1NBM G;  1FS0 G;  1K97 A;  3ASO C;  1ORQ C;  3OMA B;  1MOF A;  1OCZ B;  2JJ1 G;  2WAM A;  3OR7 C;  3CCM V;  1FXK C;  1E1R G;  2H94 A;  2DWD C;  2NLJ C;  3LDC A;  3ZN1 A;  3OUF A;  5GW7 A;  3JD1 A;  3CCS V;  5B1O A;  5DM6 V;  3AEI A;  1V54 B;  4R7C A;  5B3S C;  5CBH A;  4HYO A;  4JYC A;  4X88 A;  1GM9 A;  1OCR B;  5HFL A;  1R6K A;  5LHH A;  3LDE A;  2X6A A;  4JYB A;  1M57 C;  2HR3 A;  3E2E A;  2P6J A;  4N23 A;  3E8H A;  4G27 B;  5J9P C;  3OR6 C;  3AG2 C;  1YHQ V;  4RUE A;  4MVM A;  4J9Y B;  1AI7 A;  3IC7 A;  1R6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...