2IJKA

Structure of a rom protein dimer at 1.55 angstrom resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
57
structure length
57
Chain Sequence
TKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Regulatory protein rop
total genus 27
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijkA00
1GTOA 2IJIA 1F4MA 2IJJA 4DO2A 2IJHA 1PD3A 2GHYA 1GMGA 2IJKA 1B6QA 3K79A 1ROPA 1RPOA 1NKDA 1RPRA 1F4NA
chains in the Genus database with same CATH superfamily
5CA0B 1L0LH 3QO5A 5EYPA 2BSKA 1D5AA 3FYEB 2XT9A 2IJIA 3VOUA 3WB1A 5KA6A 1K34A 3JATA 4YY3O 4DW1A 5H2FZ 4EKWA 2P22C 1H2NA 2Q8VA 4X1YA 3HKBB 3B77A 1MZEA 4FZ1A 5LGTA 5FNVA 2WLMA 3PN1A 3ZMZA 5KHKA 4J7ZA 4DRXB 5J2TB 1M57C 2LGQA 4JASA 2JGUA 3SPCA 3JATB 3JASA 4FLUA 5BXZA 3KG2A 2A0LA 1XDCA 2YEVA 4UB6Z 5IE9A 4DUZB 2MW2B 1R3KC 2EBOA 1GMGA 5EC2C 4CS4A 2Q7GA 4NXMB 2WPDG 3ASOC 2B1IA 3WG7C 3D36C 3T2MA 4I0XB 1QVFU 4Q6GA 1YXBA 3W7XA 2Y48A 2Z5UA 2OIEA 1KMIZ 4DR3O 1HR0O 2IU0A 2PYLA 4QE9A 3RYIB 2RMKB 5JCOC 2LFSA 3SPJA 5EZYB 2LP7A 4O4HB 2UUAO 1SF9A 1SZXA 3AG1B 2Q6AA 4DV2O 4FMTA 2JJ1G 1OCZC 4B7KA 2PI4A 2X6AA 1NKDA 1GN3A 2Z3YA 3WB0A 2CUGA 4JYAB 1PNMA 3K9SA 3JALB 4LWSA 1AI5A 5JJJB 1YTFD 5IT9N 3RYCB 3HPLC 5CB4B 1V54B 3P30A 4JF3A 4JI5O 4MVUA 4TUYB 1MSDA 2IW5A 1NI8A 5EK0A 3ETDA 1A32A 4K0KO 1KYOF 1WB7A 2Q0OC 5LYJB 3T1HO 1MG1A 2ZXWC 5CA0A 4JZ2A 4CH5A 2LW7A 4TUYA 2YI9A 2IJHA 4OX9O 5CBHA 3B09A 2CTQA 1VMGA 1S5HC 1FYJA 4EB6B 1N0NA 4GKJB 2EIMB 2Q4PA 3RGBA 4AHCA 2GUZA 4JI0O 1BZKA 4FVMA 3IJ4A 5B1BB 4X66B 4GKJO 4RUEA 5HFMA 1JJ2U 3ZRWA 3F7YC 5B3SC 5HFLA 4I50B 1JOYA 5EC1C 1H2LA 3CMAV 2QKAA 2Y69C 2Z0AA 1VIBA 3ZBHA 2JRIA 1K7DA 5IYBO 2IJJA 2JGDB 2VWJA 3F5WC 1Y4MA 2WAMA 5LOVB 4KL1A 3QG5A 1IDSA 2Q0AA 4U3JB 1N34B 4DR4B 2O57A 4NR1A 4R8CA 4DUZO 1I94B 5CMUA 5KUMA 3AG3B 4DV6B 4X62B 4JI4O 1Z2GA 3JALA 1LUWA 2LW1A 1SERA 1Q43A 4X65B 2P06A 3ABKB 1U97A 3L73H 3L9DA 2IU3A 2BOCC 2EIJC 2IBZH 2DYSB 4FFBB 4JI3B 1Q6UA 3RT3C 4DYLA 3E89A 3STLC 1SRYA 1VQOV 2JGDA 5EIBD 3HKDA 4CC6A 5LYJA 4PA7A 4FM0A 1BMFG 4UUJC 3BY6A 1UPGA 2HJFC 4MS2A 4Z1MG 1S5LZ 1PV0A 2PTMA 4K35A 2Q69A 1NH2D 4MTXA 1Q90D 4NTWA 2IH3C 3ZS8C 1EM1A 2KSDA 4BAYA 3ZN0A 3UQ8A 1OCCB 2E74B 3E8FA 1D5NA 1F23A 2JVDA 1M5IA 2EX3A 3CRAA 3J7AU 3TK1A 4DV2B 2EIKB 2F95B 4XBFA 3K57A 1XNRO 3K9AA 1J95A 4I4TA 4ZBMA 4DK0A 3JSLA 3ZHVA 3E2EA 3ABMC 3C3SA 5EBMC 3AG3C 1S3JA 2BOBC 3SPHA 1ZTEA 4YXWG 2QWPB 2ZE5A 3JASB 4JI7O 1RSOB 4XDJA 5FLXN 4FLZA 1CP9A 3QO8A 2Q7EA 4B3SO 2CGNA 3GWKC 3ZEDA 2N04A 1HW7A 2QGNA 5JVDA 3LUTB 4L87A 4CC5A 4IGGA 2PYJA 3OT7A 3BFRA 4JTCB 1RPRA 4DV3B 3MAQA 3VQYA 3JD0A 4J7JA 2EINB 1V54C 2CDYA 4NTXA 2E5LB 1VARA 2E75B 5IYDO 3CHXA 3EVKA 1PL0A 1TVKA 2LJ2A 4PI0A 3FB7C 3CRMA 3CCUV 3FB6C 2MK3A 3I5DA 3JD2A 1AJPA 2YDEA 4MW3A 1GH6A 4WFEA 1AP5A 2AZ2A 1BQ0A 2YICA 4B08A 1W2BU 4BIOA 4P30A 4K8XA 1N33O 3N2KA 4WFGA 4DV1O 1ZL8B 1IBKB 4UCSA 4PELA 4JGSA 5JWPA 1HNZB 4LCUC 5IYZA 2AXTZ 3ZMVA 1YTFB 2Q73A 4JYYA 5GTIZ 1KECA 1OJHA 4E2LA 2UUCB 5B3SB 1K4DC 3CWBH 1O9HA 3WB2A 5LGNA 1MSWD 3OMIB 1EN5A 1IBLB 1M4UA 3OR7C 4FIPC 2JEUA 3ZRXA 4CS2A 1IBLO 3W7UA 2Y0PA 2OWOA 2P5OA 4DR1B 4QGPA 4O4IA 4FZ0A 2OT5A 4JI4B 1R6KA 2HHHB 1I94O 4JAVA 1R3JC 2EILC 3K59A 1FJGB 3PJSK 4MVRA 2M7WA 1DF4A 2Q5ZA 3JCZA 4MTOA 2GBOA 1FFTB 1NJIW 3AK2A 3BABA 5BR8B 2ADPA 1EBOA 4PA9A 3T1CA 2OCCC 4GKKO 5LP6A 1FXHA 1KP2A 3G80A 3ZJZA 4MSWC 1J5EB 4ZOLA 3H1JH 4DR1O 2R70A 4O4JA 2C2AA 5DECA 1QQCA 3WFVA 1ZSPA 5KA5A 1KKCA 3OGIB 4ZHQA 4O2AA 4QIWF 2DYSC 1ZUQA 2JEXA 1SQXH 4Q20A 4J11A 3OEHG 4LF5O 2VQFB 4JI8B 4NKGB 2QEXV 3D8CA 4YJ2A 2KB1A 2BTOA 3OFNG 3JD1A 4I9QA 2A06H 3CJHA 2ZM6B 4K3AA 1IZ3A 5BMVB 1ZX3A 1XQ8A 3U10A 5F2VO 3ABTA 4QPJA 1NVPB 1K5QA 1ORQC 5LMNO 3L75H 1X59A 3CRCA 3MHSC 3T4DA 3T1YB 3SGIA 3CJHB 4FLTA 4JI7B 1OCRB 3OW2U 4F6RA 5A2QN 5DM6V 1V9PA 2H8PC 1CXZB 5BY1A 3RYIA 3MD0A 4XDKA 1QR9A 3N27A 4JZGA 4LH7A 1JPXA 4BW5A 3ML0A 1TVKB 1R1BA 3SYOA 3UKMA 3ETGA 3K06A 1HNWB 3SJAC 3K5NA 4PV1B 4IIJA 5E1AC 1AVMA 3HKCB 4DV0B 4B3SB 4I55B 1HNWO 1XILA 5TISZ 4LF9B 4KP4A 3BA9A 2RCVA 1Q7YW 4FFBA 1BSMA 5L3FA 3CCRV 3RN4A 4LF4O 2HR3A 3IC9A 1VQPV 4N21A 5AG2A 4ZIBA 2JK5C 1YCIA 4RUFA 1JCHA 4DRXA 4Z2WA 5L3GA 1SETA 3ZRVA 2CTRA 3H1HH 3OGCC 2R9AA 3BVOA 2K9PA 3JAKA 3KZIZ 5ITZB 3IFXA 4LP8A 3P32A 3ZHQA 1XBLA 5CA3A 3W7SA 5LBQA 1QLNA 3ZMSA 1CPYA 5EBLC 2AGAA 4FLXA 2QE7G 3APQA 3BHPA 1Z5VA 5LHHA 4LFAO 1COWG 5KUKA 2KKWA 5D5QA 1NTZH 1H2SB 4LF6O 1AR5A 3TETA 2VQFO 2OCHA 4GUNA 5KHGA 1VF5B 4R7CA 4DR2B 3CC2V 1T5EA 2HP8A 1F7YA 4X62O 2Y0IA 3A0BZ 3AG7A 3OUSA 4EB6A 3MHHC 1PD3A 5J2UA 1PL4A 4CH4A 5JQGB 3BCCH 5IYZB 1UFIA 1BQZA 4JI3O 5JJNB 1RSOA 3RWRD 3I55V 4U3JA 1XOUA 1I5XA 4LF9O 5LXTB 4DW0A 2BTQB 3CC7V 2P90A 3TJTA 4W4LA 1QU7A 3OUFA 1N36B 1GO3F 3LDDA 3K5OA 4B3RB 1AJNA 3K0DA 4GX2A 5JH7A 1Q5OA 3CCLV 3QF7A 1B06A 5IJ9A 4GT1A 2CH7A 4GX1A 1G6UA 1JR9A 5JQGA 3ASNB 1QR8A 2B1GA 1YF2A 4CS3A 2ZNIA 3ZIAG 3A2FA 2XHBA 1KU9A 3IC7A 3ASOB 2UXDB 3R65A 1SZTA 5GONA 2GUZB 2XNDG 2GHYA 4PDMA 3E8HA 2XTAA 1E1QG 2CTPA 3T1HB 2FTKA 5C8YB 2EINC 2F1MA 2YI8A 1VQ6V 3JAMN 5BZBA 1K9MW 1YITV 2ODMA 3TGUH 1K8AW 2QTSA 4DR2O 1MMMA 1AP6A 3KCYA 1TAEA 4HZ3A 4WBNB 2Y69B 1K5SA 2EIKC 5IY5C 2WLJA 3E86A 2QWOB 3JARA 4LF6B 1SQGA 1V55C 3K0GA 3L70H 2PI5A 1N33B 1Y76B 2ZE8A 4UCOA 4JI2O 4LF7O 4IT5A 5GTHZ 3D3QA 2CGOA 3K3WA 4DUYB 3B8NA 1SC5B 2V4DA 1GN6A 1F51A 2RN9A 4WBNA 1OZ0A 3O65A 1I0HA 4MVOA 3ZN1A 1YHQV 1R6TA 3FB8C 4BIUA 4TV9B 4NXMO 1SQFA 1GAXA 1VF7A 3OM3B 4ABMA 1N36O 5CB4A 4DV0O 3D36A 2QWRB 1QVGU 3ZMUA 4D7SA 4X1IB 5K1PA 3LSQA 4LWSB 3ZX6A 1S72V 3CS5A 1HR0B 1G8MA 5LHGA 4EEQA 4DR7B 3ICXA 1IX9A 5KLVH 1Q86W 1YDXA 5J2TA 2AHYA 5L3BA 3VQWA 2ZDIC 1VQ9V 1M9NA 4IHJA 4AQYB 3P3NA 3FB5C 3ABKC 5LL6Y 4H33A 1PNLA 3TXSA 4J7KA 1PPJH 3ASNC 5LHIA 5A9GA 2ILMA 4QPKA 3FAVA 5EYPB 1GKFA 4YJ3B 1FFXB 3IGAC 4LFAB 2P6JA 1QCEA 2W0FC 4KFMA 4TT3G 4TWKA 4I50A 1WPBA 4PA4A 2Q67A 2NNUA 2UU9B 1L0NH 3ZHSA 1QBZA 2HG5C 3VQVA 5LA6A 2F4VB 4X1YB 1UJWB 2UU9O 3CRRA 3Q4HA 2ZQMA 4DK1A 3BRCA 4NB5A 3EHBB 2GSMB 1J5EO 3ABUA 4WFBV 2XAHA 4WFHA 3SPIA 3HKEA 1K92A 2UXXA 1WP7A 3EFFK 5KAFZ 2OCCB 4DR7O 4LF8O 3EXAA 2LO1A 5J2UB 1SQVH 1YJWV 3H01A 1N8RW 1M56B 3JAWB 1AI7A 2HHHO 2ZXWB 3SJQC 3H1IH 3L71H 4PD4F 4BWAA 4B3TO 3UCSC 2RNBA 3FKSG 1MOFA 4O4LB 1YSCA 4X8AA 1FD9A 5B1BC 2ZINA 3K58A 2RJZA 3JSNA 5EBWC 2WLIA 5GW7A 3C90A 3TXQA 4DO2A 2X0LA 2Q9LA 1H8HG 1EFRG 2EZOA 4UVCA 2A7WA 4KHPB 5H9CA 1Q6HA 5CN0A 1MZFA 2YXHA 1OCZB 2P67A 4I7ZB 2UUBO 1Q3EA 2X6BA 4UCUA 1S76D 4H37A 4ZKIA 2RDCA 1DF5A 3CD6V 4P9PA 5C93A 2ZE7A 1RFYA 4JAAA 5C8YA 4LF5B 3RYFB 1JX9A 4I0XA 4J41A 1K33A 3A0HZ 4CBCA 4DXWA 2GTSA 4UCRA 3OTOB 4OXSA 1XUQA 4PHZA 2WLHA 4J9YB 1H2MA 1KB9F 4HNAB 5IDJA 3G4SV 4X9QA 2YSUB 1BCCH 1WA8B 3OR6C 3UO3A 3LNMB 3CCSV 3AK1A 3RYHB 2JS3A 3G67A 2V7QG 4X1IA 4D7TA 2JIZG 1S77D 4NYKA 2UXDO 5BMVA 3RYFA 4JV5O 1XI1A 1FAFA 3AG1C 1P7GA 4GYCB 2L35A 5IY5B 3OEEG 3ZCCA 5CA1A 3CPWU 5GONB 4QE7A 2XAJA 3FFQA 3N2GB 2JDIG 1SS3A 1KUQA 2P4KA 4GLXA 3CC4V 2YEVB 1JQ0A 1SKVA 2JS5A 4ZOLB 1HP8A 1LNQA 5FPOA 5FL7G 4BW9A 2E3CA 2E76B 4CH3A 3MDSA 1BS3A 4LNUA 2DJVA 2VRZA 1TUEB 3AG4C 3QNEA 4LFCB 1F4NA 3J80N 4RWUA 4I55A 1NH2B 2QTOA 1TA8A 2YUAA 4IL6Z 2PF4E 3DGEA 3GWOA 3W7TA 2H3OA 2HVKC 2H94A 4ASUG 1XNRB 1FKAO 2GV9A 4QJFB 1SQBH 1M57B 2EILB 1D2DA 3BA8A 1ROPA 4JYBA 1PM9A 5B66Z 2DYRC 4DV5B 3B8MA 2QR4A 2WLLB 4JI6O 4WFAV 3CCJV 4KUMA 4U3FH 1FS0G 4DV4B 4R50A 4FPPA 3ZHRA 2ETNA 5H6RA 3SJCC 3T4ZA 1JVMA 3DTUB 4FLVA 3K03A 2F93B 4DV7B 5B1OA 5LXTA 1GN4A 4HBNA 3JD4A 1M56C 4MW8A 1YI2V 2B5UA 2AW9A 4XDLA 4DV6O 1YEWA 2AZ0A 1JFFB 4JV5B 1IXBA 3SYQA 3H1KH 3A8TA 1G4YB 4JI6B 1WA8A 2L6LA 2D2CB 4MVQA 5LMNB 4IIJB 1KD1W 2DMXA 4HNAA 3ABLC 1Y67A 4J80A 1G1XB 1DLBA 4IYHA 5JVDB 3G71V 2K1EA 2Y4UA 1M93A 5B1NA 3LNNA 1L8DA 1F4MA 3E22A 3L72H 3BAAA 4PA6A 4LBEC 1XL6A 1K4CC 4O4IB 5K1XA 4X20A 3U11A 3AG2C 3F5TA 2EIMC 1OCOB 3OE7G 4RQFA 4TV9A 3WU2Z 2KQXA 4FLWA 1B3QA 3ZRSA 3G6EV 2OIGA 3SYAA 4X1KB 3UM7A 5KHJA 5IWAB 3OMAB 2DN9A 1WN7A 5IJ0B 4I4TB 2ARHA 2WLKA 3CRQA 4HAMA 3LSUA 4U7NA 3K04A 1JMKC 5IYCO 3RYCA 2ZT9B 1Y76A 4OPAA 3THOA 3UT5A 4J10A 2CE4A 4EFBA 3SR2C 1IVSA 2XAFA 1KKDA 4P9OA 4ZHQB 3K5LA 1FXVA 2CK3G 2DYRB 2XASA 3HB3B 1P7BA 4JPRA 1US6A 3I56V 4O4JB 4X65O 1TUBB 3CXHF 2Q68A 3CCVV 5B1AB 1Q8IA 1EN4A 4DR4O 4D6TH 3RYHA 2X7RB 3G6BA 2A9HA 2EJRA 4TSFG 1W0JG 1N0JA 1XHXA 2GDSA 5LA6B 3D3IA 4GKKB 2PZSA 4NXNO 4NVPA 4A5UB 4GCZA 3HR0A 3OTOO 1BT8A 2IH1C 5KAIZ 5KHIA 3C3TA 4UV8A 5IJ9B 4RAIA 4FLYA 2QM8A 4OGQB 5JH7B 3JCUZ 4E4EA 1E1RG 2UUCO 2VQEB 2IJKA 5CBGA 3DC6A 2DWDC 2NR5A 2OTJV 3JAWA 1WAZA 3CCEV 4X1KA 4YJ3A 1NS1A 2QA4V 4W4KA 3FAVB 1ZWIC 2AHZA 2XOKG 3S3WA 2UXBB 1RM1C 4EFEA 4YIPA 3S3XA 4YHHO 3QO7A 3OD4A 4OX9B 4DV1B 1URFA 3CX5F 3OTFA 1BHBA 4R6ZA 2F23A 4WFFA 2WLIB 4CH6A 3CSXA 2W6JG 2YS8A 2YIDA 1DTOA 3GVMA 4AQYO 1NQTA 5H5NA 4UVBA 3E83A 3L74H 1LR1A 1W0KG 1DGSA 2F4VO 4O4LA 1MABG 1XMQB 4B3TB 1VQMV 4JI1B 5KX5B 3VBBA 1E79G 2HKOA 3U0ZA 1WNSA 4FK5C 4TQFA 1XL4A 3ETQA 1P4RA 2ZD9A 1GRJA 4JYAO 4MTGA 2BCCH 3LDCA 2ZE6A 2ZKOA 3RBZA 1Y66A 1GM8A 2UUBB 1FXKC 4ZI7B 3FD9A 4ICGA 5CBFA 1QLEB 3O9OA 1OHHG 3DC5A 1M90W 2X6CA 4FM2A 3OAAG 3LDEA 2EZPA 3UO2A 2D3OW 4PDVA 4CZZA 2E5LO 1R3LC 2YXYA 1BE3H 1EZVH 1OCRC 1KBHA 1YVWA 2HFEC 1XMQO 3BPZA 4DUYO 1H2KA 3A0RA 3DSQA 1RP3B 5J9PC 5JCOA 1KP3A 3ZHTA 5B5EZ 4JI2B 5KMGA 4DV7O 5L3CA 3N2GA 1YIJV 1K73W 4G2KA 5CA1B 3ABMB 1VQNV 1WB8A 3J81N 4YHHB 1K97A 1OCOC 5L3EA 2ZM6O 5EZYA 2UXBO 3RVYA 3CEIA 2JJ2G 1TUBA 4LC1A 1AR1B 2ZNJA 1NVPD 1VQ4V 3R66A 1U96A 4H44B 3STZC 2V1DA 3AEIA 3SDLA 2B9ZA 1H2GA 2R9RB 1CEZA 1VF6C 3RVZA 3CCMV 2ITDC 1QLEC 4UB8Z 1WLEA 2Y4TA 3HKBA 2CH7B 3TCUA 1XHZA 4YJ2B 3FYIB 4AI8A 3M8AA 1HNXO 4KXRA 5LOVA 2BTQA 4LR3A 1AB3A 2QSAA 5LP6C 2RQ6A 4I5SA 1NR7A 4JYCA 2VQEO 1XMOB 1OV9A 2FYUH 4H13B 2WSSG 3SPGA 2PGGA 3BEHA 4J42A 4C7UA 5B1AC 4X20B 1DK1A 5LMUO 2W0XA 5KX5A 4NXNB 3CE2A 3E8BA 4UVAA 1H8EG 3H1LH 2W6IG 3E22B 3AK3A 5KMGB 1WJZA 2DQ0A 2YIBA 2BSKB 4J9ZB 3RFRA 2CTWA 3QVNA 3HKCA 1KQSU 1THZA 2HJDA 5IWAO 5L3DA 4X66O 2PY5A 2QKCA 4NTYA 2LGWA 2BE3A 4JI0B 1VQ7V 3LSSA 1JFFA 1IBMB 1NTKH 5IJ0A 2NLJC 4MVMA 1VF6A 4U7OA 1IURA 1XNQB 4UFZA 5DN6G 2YC0A 4K0KB 1S5JA 2XAGA 3DXRB 2P4VA 3ABLB 1Q6IA 3UT5B 3B40A 4UCVA 2KG7B 3VQXA 4BIZA 4LF7B 2F43G 1ZL8A 1IBMO 2HLDG 1VP7A 4FFKA 3GB7C 2F66C 2WA4A 1AJQA 3NR7A 1EZJA 2HVJC 1WP8A 4DR5B 2NN4A 1GM7A 2DE0X 1Q82W 4DV3O 1S0VA 4PDLA 5JJEB 2M6YA 1R73A 1N32B 2GTAA 4MT8A 4DR3B 2DWEC 1QNMA 5DEDA 1O9GA 1R3IC 2ZR3A 4ZI7A 2QM7A 4GX0A 1SQPH 2WWWA 3CB2A 4PJ0Z 4LFBO 3AG2B 4IYIA 4JTDB 3OMNB 3X2QC 4JI5B 3K08A 4GX5A 1VEWA 2QM4A 1WPXA 4P2ZA 4G27B 2EULA 2YIBD 1AILA 1LUVA 1BL8A 3JYCA 4DV5O 4N23A 4B3RO 1N32O 2ADQB 3WG7B 4RO2A 3K5MA 2WLLA 2UUAB 1I08A 1PP9H 4DR6B 3M7MX 1YZBA 4TV8A 4LNUB 1SQQH 4AILC 2ZDIA 2DQ3A 4DV4O 3JAKB 3N2KB 3CXCU 1GK9A 1NZ6A 3DXRA 5E79Z 1MA1A 3FX7A 4L8JA 1FXKA 4JI1O 4B3MO 3M99B 3E8GA 4F6RB 4YIOA 2N74A 3B2EE 5H6QA 1FPOA 1B04A 5FNVB 1P49A 1ZAUA 3T1YO 1RPOA 2DOSA 2OYQA 5D5PA 2DW4A 1YJ9V 2N05A 2P7TC 2YXLA 1X4TA 3CCQV 4H0LB 3CMEV 4DR6O 3SJBC 5LGUA 3F7VC 1L1FA 1ENVA 1YJNV 3CP1A 1I5YA 2XAQA 3KCXA 1RM1B 4JI8O 2ZIOA 3W7WA 4PDRA 1VQ8V 5KHHA 2VS0A 4F4LA 2QWNB 4X64O 2QWQB 2YIAA 1NU1H 1W59A 3HKDB 5ITZA 1N34O 1Y74A 3H9VA 1HDJA 4LFBB 4JAUA 2EJ7A 1JA8A 2WLNA 1AROP 4O2BA 4F6EA 2QKSA 4K8ZA 5LP6B 4FJCC 4LFCO 4LF4B 4FM1A 3K79A 1NBMG 1BHAA 4TV8B 2ZCEA 4PA3A 1Y6XA 2ATKC 2PUSA 2ITCC 4DR5O 1KC8W 4O2BB 1PNKA 4O2AB 1H38A 1FXKB 4G28B 1P84F 1HNXB 1TGOA 3RW0A 3ZHUA 1QHTA 4PI2A 1I7FA 1V55B 1K3EA 2IM9A 4UXNA 3ZMTA 4RQEA 3JARB 1SA0A 1Q81W 4KHPO 4X88A 3HKEB 2R9IA 1IXMA 4BR6A 4B7EA 1AI6A 4HYOA 4UCTA 4TQDA 1XNQO 1AR4A 3Q4HB 2Q7HA 5BR8O 3QTCA 1AI4A 4JTAB 3B4SA 1VQ5V 2XUMA 3SYPA 1BGYH 1Z5WA 1GM9A 2UXCO 4OPHA 5FPRA 2UXNA 1FJGO 2UXCB 2KG7A 1N4CA 4GZRB 3CYOA 3IAYA 4MVZA 1GN2A 1IBKO 1EN6A 2A79B 4X89A 4TOIA 1Y74B 4LF8B 4WCEV 2FL4A 3X2QB 5LMUB 1JJOA 2CAZC 2FB5A 4X64B 1XEQA 3KKYA 2HEPA 2A3QA 2FMLA 4Z1VA 1GTOA 2ZIMA 1XMOO 1HWYA 2G38A 4UV9A 2QDOA 3ETEA 2R72A 3E35A 1VQKV 4O4HA 2ZR2A 1SESA 1XREA 1ZLZA 4IHJB 3ZRWB 4WF9V 1HNZO 5EIBC 2VWKA 3JD3A 1M1KW 2FKXA 1VQLV 2QJ1A 3SYCA 1B6QA 2LFRA 4LH6A 4I9WA 3P3PA 2EIJB 1NTMH 3NXSA 2WA3A 1SA0B 1R6NA 4QNHB 1PKXA 4MVSA 4MTFA 1NT2B 3APOA 2OTLV 1MNGA 3AG4B 1OCCC 1NR1A 1FFXA 2LQTA 4B3MB 4YY3B
chains in the Genus database with same CATH topology
4QIWF 1S76D 2DYSC 4H37A 4LC1A 4ZKIA 1DF5A 3QO5A 1AR1B 3CD6V 4P9PA 5C93A 2JEXA 4Q20A 3FYEB 1NVPD 3OEHG 2IJIA 3VOUA 1VQ4V 1JX9A 1K33A 5KA6A 4CBCA 1K34A 4DXWA 2QEXV 2KB1A 3OFNG 2V1DA 3STZC 4EKWA 3AEIA 3JD1A 4OXSA 2WLHA 1H2GA 2R9RB 4J9YB 3B77A 1CEZA 3RVZA 3CCMV 2ITDC 5IDJA 5LGTA 3G4SV 1QLEC 2YSUB 1WLEA 2WLMA 3ABTA 3OR6C 4QPJA 3ZMZA 1NVPB 3LNMB 3CCSV 1K5QA 1ORQC 1M57C 3TCUA 2V7QG 4JASA 3SPCA 2JIZG 1S77D 3FYIB 3KG2A 2A0LA 3MHSC 3T4DA 2YEVA 3AG1C 1R3KC 1OCRB 2EBOA 3OW2U 1GMGA 5EC2C 5DM6V 5IY5B 2WPDG 3ASOC 2B1IA 3OEEG 3WG7C 3ZCCA 2H8PC 3CPWU 3MD0A 3T2MA 1QVFU 4XDKA 4QE7A 1QR9A 2XAJA 3W7XA 1JPXA 2JDIG 4I5SA 4BW5A 3ML0A 1NR7A 2Y48A 4JYCA 3SYOA 2Z5UA 3CC4V 2WSSG 2YEVB 1JQ0A 3UKMA 2IU0A 4QE9A 3ETGA 3K06A 3SPGA 5E1AC 2LFSA 3SPJA 2LP7A 3BEHA 1LNQA 5FL7G 5B1AC 3AG1B 2Q6AA 4FMTA 4KP4A 1Q7YW 2JJ1G 3E8BA 4UVAA 1H8EG 1TUEB 1OCZC 3AG4C 3QNEA 5L3FA 3CCRV 2PI4A 2HR3A 2W6IG 1VQPV 2X6AA 1NKDA 4N21A 2Z3YA 1F4NA 2DQ0A 2JK5C 4J9ZB 4RUFA 1JCHA 1PNMA 5L3GA 1SETA 3ZRVA 1AI5A 1YTFD 1KQSU 3HPLC 1NH2B 3OGCC 2QTOA 1THZA 1V54B 3P30A 5L3DA 4JF3A 4MVUA 3DGEA 3GWOA 3W7TA 2IW5A 5EK0A 1VQ7V 3LSSA 3ETDA 3IFXA 4LP8A 2HVKC 2H94A 3P32A 4ASUG 5CA3A 3W7SA 5LBQA 1QLNA 2NLJC 1CPYA 4MVMA 5EBLC 3ZMSA 4U7OA 4QJFB 2QE7G 1M57B 1MG1A 2EILB 2ZXWC 5DN6G 5LHHA 1COWG 2XAGA 5KUKA 2IJHA 1ROPA 5CBHA 4JYBA 3TETA 2DYRC 3ABLB 1S5HC 3B8MA 4BIZA 2EIMB 2F43G 2HLDG 2WLLB 4R7CA 3CC2V 4WFAV 3GB7C 3CCJV 1AJQA 3OUSA 5B1BB 4KUMA 1EZJA 1FS0G 3MHHC 4RUEA 1PD3A 2HVJC 4R50A 5HFMA 1JJ2U 4FPPA 3ZRWA 1GM7A 3F7YC 5H6RA 5B3SC 1Q82W 5HFLA 3T4ZA 1S0VA 1JVMA 3DTUB 4PDLA 1JOYA 1R73A 3K03A 5EC1C 4MT8A 3CMAV 5B1OA 2Y69C 2DWEC 3I55V 1R3IC 1I5XA 2ZR3A 1K7DA 5IYBO 3CC7V 2QM7A 4GX0A 2P90A 3JD4A 2IJJA 1M56C 4MW8A 1YI2V 2B5UA 3F5WC 1Y4MA 2WWWA 2WAMA 3OUFA 1GO3F 4XDLA 3LDDA 3AG2B 4JTDB 3OMNB 3X2QC 4R8CA 1AJNA 3K08A 3SYQA 3K0DA 5CMUA 3AG3B 4GX2A 5KUMA 4GX5A 3CCLV 1G4YB 1WPXA 4GT1A 4P2ZA 4G27B 4GX1A 4MVQA 1SERA 1KD1W 3ASNB 3ABLC 1QR8A 2B1GA 1DLBA 1BL8A 3JYCA 4N23A 3ZIAG 3G71V 3ABKB 2K1EA 3WG7B 3IC7A 3ASOB 2IU3A 4RO2A 5B1NA 1F4MA 2BOCC 3R65A 2WLLA 1SZTA 2EIJC 4PA6A 2XNDG 2GHYA 4LBEC 2DYSB 1XL6A 4PDMA 1K4CC 3E89A 3E8HA 1E1QG 2FTKA 2ZDIA 2EINC 3STLC 1SRYA 1VQOV 2DQ3A 1VQ6V 3AG2C 5BZBA 1K9MW 1YITV 4PA7A 2EIMC 1BMFG 1OCOB 3OE7G 3BY6A 4UUJC 4RQFA 3CXCU 1GK9A 1K8AW 2HJFC 4MS2A 4Z1MG 1FXKA 3ZRSA 3G6EV 3M99B 3E8GA 3SYAA 2Q69A 4HZ3A 3UM7A 5H6QA 1NH2D 4MTXA 2Y69B 1K5SA 3OMAB 2EIKC 5IY5C 2WLJA 3E86A 2IH3C 1RPOA 4BAYA 3ZN0A 2WLKA 1OCCB 1V55C 3K0GA 2PI5A 3E8FA 4HAMA 1F23A 2DW4A 4U7NA 1YJ9V 3K04A 3TK1A 2P7TC 5IYCO 2EIKB 4XBFA 3CCQV 3CMEV 3K9AA 1J95A 5LGUA 3F7VC 3K3WA 1L1FA 2XAFA 1KKDA 1ENVA 1YJNV 4P9OA 3CP1A 4ZBMA 3B8NA 1I5YA 2XAQA 3E2EA 1FXVA 3ABMC 1RM1B 2CK3G 2DYRB 2XASA 3HB3B 1F51A 1P7BA 4JPRA 5EBMC 3I56V 1OZ0A 3W7WA 3AG3C 4PDRA 4MVOA 1VQ8V 3ZN1A 1S3JA 1YHQV 2BOBC 4F4LA 3SPHA 3FB8C 4BIUA 4YXWG 2Q68A 3CCVV 5B1AB 3OM3B 4XDJA 2X7RB 4JAUA 1CP9A 3QO8A 2A9HA 2EJRA 4TSFG 3D36A 1W0JG 1QVGU 2WLNA 3ZMUA 1AROP 2QKSA 3LSQA 1S72V 4FJCC 3LUTB 1G8MA 4L87A 5LHGA 3K79A 3D3IA 1NBMG 1BHAA 4GCZA 4PA3A 4JTCB 2IH1C 2ATKC 1RPRA 1Q86W 4UV8A 3JD0A 4RAIA 2EINB 2ITCC 2AHYA 2QM8A 1KC8W 5L3BA 1PNKA 1H38A 1E1RG 2ZDIC 1VQ9V 1FXKB 1V54C 4G28B 1M9NA 2IJKA 5CBGA 3FB5C 2DWDC 3RW0A 2OTJV 5IYDO 3ABKC 3CCEV 1PL0A 4H33A 1V55B 1K3EA 4UXNA 2QA4V 1PNLA 3ZMTA 4RQEA 1ZWIC 2AHZA 2XOKG 1Q81W 3FB7C 1RM1C 3ASNC 5LHIA 4QPKA 3CCUV 3FB6C 2MK3A 4X88A 3QO7A 1GKFA 3JD2A 1AJPA 2R9IA 4MW3A 4WFEA 1IXMA 3IGAC 1BHBA 1AI6A 1W2BU 4HYOA 4P30A 2P6JA 1QCEA 4WFGA 4R6ZA 4WFFA 2W0FC 4PELA 2WLIB 4KFMA 2W6JG 4TT3G 4TWKA 1DTOA 1AI4A 4JTAB 4JGSA 1VQ5V 1NQTA 4PA4A 4UVBA 2Q67A 2NNUA 3E83A 1W0KG 4LCUC 3SYPA 1GM9A 3ZMVA 1MABG 2UXNA 1QBZA 1VQMV 1YTFB 2HG5C 3VBBA 1E79G 1KECA 2HKOA 1UJWB 3CYOA 4FK5C 4MVZA 4E2LA 1XL4A 2ZQMA 1P4RA 2ZD9A 5B3SB 3EHBB 1K4DC 2GSMB 2A79B 4MTGA 3ABUA 3LDCA 4X89A 4WFBV 3RBZA 1Y66A 1GM8A 5LGNA 1MSWD 2XAHA 4WFHA 3SPIA 3OMIB 1FXKC 1NR1A 4WCEV 1K92A 2UXXA 3EFFK 2OCCB 3OR7C 1QLEB 5CBFA 3X2QB 4FIPC 2JEUA 3ZRXA 1OHHG 3W7UA 1YJWV 3H01A 1N8RW 1M56B 1M90W 2X6CA 1GTOA 3LDEA 3OAAG 2EZPA 2OT5A 1HWYA 1AI7A 4UV9A 2D3OW 4PDVA 1R6KA 4CZZA 1R3LC 4JAVA 2ZXWB 3SJQC 3ETEA 1OCRC 1R3JC 2EILC 3PJSK 3E35A 2HFEC 4MVRA 1VQKV 2M7WA 2ZR2A 1DF4A 3A0RA 1SESA 3JCZA 3FKSG 4MTOA 3ZRWB 1MOFA 5J9PC 4WF9V 1YSCA 4X8AA 1KP3A 3JD3A 1M1KW 1FFTB 1NJIW 1VQLV 5B1BC 1EBOA 4PA9A 3SYCA 2OCCC 1B6QA 3T1CA 2LFRA 2WLIA 5EBWC 1FXHA 1KP2A 5GW7A 4I9WA 3ZJZA 5L3CA 1YIJV 4DO2A 1K73W 4MSWC 4G2KA 2X0LA 1H8HG 2EIJB 3NXSA 1EFRG 2EZOA 4UVCA 3ABMB 1VQNV 1R6NA 4QNHB 1PKXA 4MVSA 4MTFA 1K97A 5H9CA 1OCOC 5CN0A 5L3EA 2C2AA 3WFVA 2OTLV 1OCZB 2P67A 3AG4B 3RVYA 5KA5A 1OCCC 2X6BA 2JJ2G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTO A;  2IJI A;  1F4M A;  2IJJ A;  4DO2 A;  2IJH A;  1PD3 A;  2GHY A;  1GMG A;  2IJK A;  1B6Q A;  3K79 A;  1ROP A;  1RPO A;  1NKD A;  1RPR A;  1F4N A; 
#chains in the Genus database with same CATH topology
 5CA0 B;  1L0L H;  3QO5 A;  5EYP A;  2BSK A;  1D5A A;  3FYE B;  2XT9 A;  2IJI A;  3VOU A;  3WB1 A;  5KA6 A;  1K34 A;  3JAT A;  4YY3 O;  4DW1 A;  5H2F Z;  4EKW A;  2P22 C;  1H2N A;  2Q8V A;  4X1Y A;  3HKB B;  3B77 A;  1MZE A;  4FZ1 A;  5LGT A;  5FNV A;  2WLM A;  3PN1 A;  3ZMZ A;  5KHK A;  4J7Z A;  4DRX B;  5J2T B;  1M57 C;  2LGQ A;  4JAS A;  2JGU A;  3SPC A;  3JAT B;  3JAS A;  4FLU A;  5BXZ A;  3KG2 A;  2A0L A;  1XDC A;  2YEV A;  4UB6 Z;  5IE9 A;  4DUZ B;  2MW2 B;  1R3K C;  2EBO A;  1GMG A;  5EC2 C;  4CS4 A;  2Q7G A;  4NXM B;  2WPD G;  3ASO C;  2B1I A;  3WG7 C;  3D36 C;  3T2M A;  4I0X B;  1QVF U;  4Q6G A;  1YXB A;  3W7X A;  2Y48 A;  2Z5U A;  2OIE A;  1KMI Z;  4DR3 O;  1HR0 O;  2IU0 A;  2PYL A;  4QE9 A;  3RYI B;  2RMK B;  5JCO C;  2LFS A;  3SPJ A;  5EZY B;  2LP7 A;  4O4H B;  2UUA O;  1SF9 A;  1SZX A;  3AG1 B;  2Q6A A;  4DV2 O;  4FMT A;  2JJ1 G;  1OCZ C;  4B7K A;  2PI4 A;  2X6A A;  1NKD A;  1GN3 A;  2Z3Y A;  3WB0 A;  2CUG A;  4JYA B;  1PNM A;  3K9S A;  3JAL B;  4LWS A;  1AI5 A;  5JJJ B;  1YTF D;  5IT9 N;  3RYC B;  3HPL C;  5CB4 B;  1V54 B;  3P30 A;  4JF3 A;  4JI5 O;  4MVU A;  4TUY B;  1MSD A;  2IW5 A;  1NI8 A;  5EK0 A;  3ETD A;  1A32 A;  4K0K O;  1KYO F;  1WB7 A;  2Q0O C;  5LYJ B;  3T1H O;  1MG1 A;  2ZXW C;  5CA0 A;  4JZ2 A;  4CH5 A;  2LW7 A;  4TUY A;  2YI9 A;  2IJH A;  4OX9 O;  5CBH A;  3B09 A;  2CTQ A;  1VMG A;  1S5H C;  1FYJ A;  4EB6 B;  1N0N A;  4GKJ B;  2EIM B;  2Q4P A;  3RGB A;  4AHC A;  2GUZ A;  4JI0 O;  1BZK A;  4FVM A;  3IJ4 A;  5B1B B;  4X66 B;  4GKJ O;  4RUE A;  5HFM A;  1JJ2 U;  3ZRW A;  3F7Y C;  5B3S C;  5HFL A;  4I50 B;  1JOY A;  5EC1 C;  1H2L A;  3CMA V;  2QKA A;  2Y69 C;  2Z0A A;  1VIB A;  3ZBH A;  2JRI A;  1K7D A;  5IYB O;  2IJJ A;  2JGD B;  2VWJ A;  3F5W C;  1Y4M A;  2WAM A;  5LOV B;  4KL1 A;  3QG5 A;  1IDS A;  2Q0A A;  4U3J B;  1N34 B;  4DR4 B;  2O57 A;  4NR1 A;  4R8C A;  4DUZ O;  1I94 B;  5CMU A;  5KUM A;  3AG3 B;  4DV6 B;  4X62 B;  4JI4 O;  1Z2G A;  3JAL A;  1LUW A;  2LW1 A;  1SER A;  1Q43 A;  4X65 B;  2P06 A;  3ABK B;  1U97 A;  3L73 H;  3L9D A;  2IU3 A;  2BOC C;  2EIJ C;  2IBZ H;  2DYS B;  4FFB B;  4JI3 B;  1Q6U A;  3RT3 C;  4DYL A;  3E89 A;  3STL C;  1SRY A;  1VQO V;  2JGD A;  5EIB D;  3HKD A;  4CC6 A;  5LYJ A;  4PA7 A;  4FM0 A;  1BMF G;  4UUJ C;  3BY6 A;  1UPG A;  2HJF C;  4MS2 A;  4Z1M G;  1S5L Z;  1PV0 A;  2PTM A;  4K35 A;  2Q69 A;  1NH2 D;  4MTX A;  1Q90 D;  4NTW A;  2IH3 C;  3ZS8 C;  1EM1 A;  2KSD A;  4BAY A;  3ZN0 A;  3UQ8 A;  1OCC B;  2E74 B;  3E8F A;  1D5N A;  1F23 A;  2JVD A;  1M5I A;  2EX3 A;  3CRA A;  3J7A U;  3TK1 A;  4DV2 B;  2EIK B;  2F95 B;  4XBF A;  3K57 A;  1XNR O;  3K9A A;  1J95 A;  4I4T A;  4ZBM A;  4DK0 A;  3JSL A;  3ZHV A;  3E2E A;  3ABM C;  3C3S A;  5EBM C;  3AG3 C;  1S3J A;  2BOB C;  3SPH A;  1ZTE A;  4YXW G;  2QWP B;  2ZE5 A;  3JAS B;  4JI7 O;  1RSO B;  4XDJ A;  5FLX N;  4FLZ A;  1CP9 A;  3QO8 A;  2Q7E A;  4B3S O;  2CGN A;  3GWK C;  3ZED A;  2N04 A;  1HW7 A;  2QGN A;  5JVD A;  3LUT B;  4L87 A;  4CC5 A;  4IGG A;  2PYJ A;  3OT7 A;  3BFR A;  4JTC B;  1RPR A;  4DV3 B;  3MAQ A;  3VQY A;  3JD0 A;  4J7J A;  2EIN B;  1V54 C;  2CDY A;  4NTX A;  2E5L B;  1VAR A;  2E75 B;  5IYD O;  3CHX A;  3EVK A;  1PL0 A;  1TVK A;  2LJ2 A;  4PI0 A;  3FB7 C;  3CRM A;  3CCU V;  3FB6 C;  2MK3 A;  3I5D A;  3JD2 A;  1AJP A;  2YDE A;  4MW3 A;  1GH6 A;  4WFE A;  1AP5 A;  2AZ2 A;  1BQ0 A;  2YIC A;  4B08 A;  1W2B U;  4BIO A;  4P30 A;  4K8X A;  1N33 O;  3N2K A;  4WFG A;  4DV1 O;  1ZL8 B;  1IBK B;  4UCS A;  4PEL A;  4JGS A;  5JWP A;  1HNZ B;  4LCU C;  5IYZ A;  2AXT Z;  3ZMV A;  1YTF B;  2Q73 A;  4JYY A;  5GTI Z;  1KEC A;  1OJH A;  4E2L A;  2UUC B;  5B3S B;  1K4D C;  3CWB H;  1O9H A;  3WB2 A;  5LGN A;  1MSW D;  3OMI B;  1EN5 A;  1IBL B;  1M4U A;  3OR7 C;  4FIP C;  2JEU A;  3ZRX A;  4CS2 A;  1IBL O;  3W7U A;  2Y0P A;  2OWO A;  2P5O A;  4DR1 B;  4QGP A;  4O4I A;  4FZ0 A;  2OT5 A;  4JI4 B;  1R6K A;  2HHH B;  1I94 O;  4JAV A;  1R3J C;  2EIL C;  3K59 A;  1FJG B;  3PJS K;  4MVR A;  2M7W A;  1DF4 A;  2Q5Z A;  3JCZ A;  4MTO A;  2GBO A;  1FFT B;  1NJI W;  3AK2 A;  3BAB A;  5BR8 B;  2ADP A;  1EBO A;  4PA9 A;  3T1C A;  2OCC C;  4GKK O;  5LP6 A;  1FXH A;  1KP2 A;  3G80 A;  3ZJZ A;  4MSW C;  1J5E B;  4ZOL A;  3H1J H;  4DR1 O;  2R70 A;  4O4J A;  2C2A A;  5DEC A;  1QQC A;  3WFV A;  1ZSP A;  5KA5 A;  1KKC A;  3OGI B;  4ZHQ A;  4O2A A;  4QIW F;  2DYS C;  1ZUQ A;  2JEX A;  1SQX H;  4Q20 A;  4J11 A;  3OEH G;  4LF5 O;  2VQF B;  4JI8 B;  4NKG B;  2QEX V;  3D8C A;  4YJ2 A;  2KB1 A;  2BTO A;  3OFN G;  3JD1 A;  4I9Q A;  2A06 H;  3CJH A;  2ZM6 B;  4K3A A;  1IZ3 A;  5BMV B;  1ZX3 A;  1XQ8 A;  3U10 A;  5F2V O;  3ABT A;  4QPJ A;  1NVP B;  1K5Q A;  1ORQ C;  5LMN O;  3L75 H;  1X59 A;  3CRC A;  3MHS C;  3T4D A;  3T1Y B;  3SGI A;  3CJH B;  4FLT A;  4JI7 B;  1OCR B;  3OW2 U;  4F6R A;  5A2Q N;  5DM6 V;  1V9P A;  2H8P C;  1CXZ B;  5BY1 A;  3RYI A;  3MD0 A;  4XDK A;  1QR9 A;  3N27 A;  4JZG A;  4LH7 A;  1JPX A;  4BW5 A;  3ML0 A;  1TVK B;  1R1B A;  3SYO A;  3UKM A;  3ETG A;  3K06 A;  1HNW B;  3SJA C;  3K5N A;  4PV1 B;  4IIJ A;  5E1A C;  1AVM A;  3HKC B;  4DV0 B;  4B3S B;  4I55 B;  1HNW O;  1XIL A;  5TIS Z;  4LF9 B;  4KP4 A;  3BA9 A;  2RCV A;  1Q7Y W;  4FFB A;  1BSM A;  5L3F A;  3CCR V;  3RN4 A;  4LF4 O;  2HR3 A;  3IC9 A;  1VQP V;  4N21 A;  5AG2 A;  4ZIB A;  2JK5 C;  1YCI A;  4RUF A;  1JCH A;  4DRX A;  4Z2W A;  5L3G A;  1SET A;  3ZRV A;  2CTR A;  3H1H H;  3OGC C;  2R9A A;  3BVO A;  2K9P A;  3JAK A;  3KZI Z;  5ITZ B;  3IFX A;  4LP8 A;  3P32 A;  3ZHQ A;  1XBL A;  5CA3 A;  3W7S A;  5LBQ A;  1QLN A;  3ZMS A;  1CPY A;  5EBL C;  2AGA A;  4FLX A;  2QE7 G;  3APQ A;  3BHP A;  1Z5V A;  5LHH A;  4LFA O;  1COW G;  5KUK A;  2KKW A;  5D5Q A;  1NTZ H;  1H2S B;  4LF6 O;  1AR5 A;  3TET A;  2VQF O;  2OCH A;  4GUN A;  5KHG A;  1VF5 B;  4R7C A;  4DR2 B;  3CC2 V;  1T5E A;  2HP8 A;  1F7Y A;  4X62 O;  2Y0I A;  3A0B Z;  3AG7 A;  3OUS A;  4EB6 A;  3MHH C;  1PD3 A;  5J2U A;  1PL4 A;  4CH4 A;  5JQG B;  3BCC H;  5IYZ B;  1UFI A;  1BQZ A;  4JI3 O;  5JJN B;  1RSO A;  3RWR D;  3I55 V;  4U3J A;  1XOU A;  1I5X A;  4LF9 O;  5LXT B;  4DW0 A;  2BTQ B;  3CC7 V;  2P90 A;  3TJT A;  4W4L A;  1QU7 A;  3OUF A;  1N36 B;  1GO3 F;  3LDD A;  3K5O A;  4B3R B;  1AJN A;  3K0D A;  4GX2 A;  5JH7 A;  1Q5O A;  3CCL V;  3QF7 A;  1B06 A;  5IJ9 A;  4GT1 A;  2CH7 A;  4GX1 A;  1G6U A;  1JR9 A;  5JQG A;  3ASN B;  1QR8 A;  2B1G A;  1YF2 A;  4CS3 A;  2ZNI A;  3ZIA G;  3A2F A;  2XHB A;  1KU9 A;  3IC7 A;  3ASO B;  2UXD B;  3R65 A;  1SZT A;  5GON A;  2GUZ B;  2XND G;  2GHY A;  4PDM A;  3E8H A;  2XTA A;  1E1Q G;  2CTP A;  3T1H B;  2FTK A;  5C8Y B;  2EIN C;  2F1M A;  2YI8 A;  1VQ6 V;  3JAM N;  5BZB A;  1K9M W;  1YIT V;  2ODM A;  3TGU H;  1K8A W;  2QTS A;  4DR2 O;  1MMM A;  1AP6 A;  3KCY A;  1TAE A;  4HZ3 A;  4WBN B;  2Y69 B;  1K5S A;  2EIK C;  5IY5 C;  2WLJ A;  3E86 A;  2QWO B;  3JAR A;  4LF6 B;  1SQG A;  1V55 C;  3K0G A;  3L70 H;  2PI5 A;  1N33 B;  1Y76 B;  2ZE8 A;  4UCO A;  4JI2 O;  4LF7 O;  4IT5 A;  5GTH Z;  3D3Q A;  2CGO A;  3K3W A;  4DUY B;  3B8N A;  1SC5 B;  2V4D A;  1GN6 A;  1F51 A;  2RN9 A;  4WBN A;  1OZ0 A;  3O65 A;  1I0H A;  4MVO A;  3ZN1 A;  1YHQ V;  1R6T A;  3FB8 C;  4BIU A;  4TV9 B;  4NXM O;  1SQF A;  1GAX A;  1VF7 A;  3OM3 B;  4ABM A;  1N36 O;  5CB4 A;  4DV0 O;  3D36 A;  2QWR B;  1QVG U;  3ZMU A;  4D7S A;  4X1I B;  5K1P A;  3LSQ A;  4LWS B;  3ZX6 A;  1S72 V;  3CS5 A;  1HR0 B;  1G8M A;  5LHG A;  4EEQ A;  4DR7 B;  3ICX A;  1IX9 A;  5KLV H;  1Q86 W;  1YDX A;  5J2T A;  2AHY A;  5L3B A;  3VQW A;  2ZDI C;  1VQ9 V;  1M9N A;  4IHJ A;  4AQY B;  3P3N A;  3FB5 C;  3ABK C;  5LL6 Y;  4H33 A;  1PNL A;  3TXS A;  4J7K A;  1PPJ H;  3ASN C;  5LHI A;  5A9G A;  2ILM A;  4QPK A;  3FAV A;  5EYP B;  1GKF A;  4YJ3 B;  1FFX B;  3IGA C;  4LFA B;  2P6J A;  1QCE A;  2W0F C;  4KFM A;  4TT3 G;  4TWK A;  4I50 A;  1WPB A;  4PA4 A;  2Q67 A;  2NNU A;  2UU9 B;  1L0N H;  3ZHS A;  1QBZ A;  2HG5 C;  3VQV A;  5LA6 A;  2F4V B;  4X1Y B;  1UJW B;  2UU9 O;  3CRR A;  3Q4H A;  2ZQM A;  4DK1 A;  3BRC A;  4NB5 A;  3EHB B;  2GSM B;  1J5E O;  3ABU A;  4WFB V;  2XAH A;  4WFH A;  3SPI A;  3HKE A;  1K92 A;  2UXX A;  1WP7 A;  3EFF K;  5KAF Z;  2OCC B;  4DR7 O;  4LF8 O;  3EXA A;  2LO1 A;  5J2U B;  1SQV H;  1YJW V;  3H01 A;  1N8R W;  1M56 B;  3JAW B;  1AI7 A;  2HHH O;  2ZXW B;  3SJQ C;  3H1I H;  3L71 H;  4PD4 F;  4BWA A;  4B3T O;  3UCS C;  2RNB A;  3FKS G;  1MOF A;  4O4L B;  1YSC A;  4X8A A;  1FD9 A;  5B1B C;  2ZIN A;  3K58 A;  2RJZ A;  3JSN A;  5EBW C;  2WLI A;  5GW7 A;  3C90 A;  3TXQ A;  4DO2 A;  2X0L A;  2Q9L A;  1H8H G;  1EFR G;  2EZO A;  4UVC A;  2A7W A;  4KHP B;  5H9C A;  1Q6H A;  5CN0 A;  1MZF A;  2YXH A;  1OCZ B;  2P67 A;  4I7Z B;  2UUB O;  1Q3E A;  2X6B A;  4UCU A;  1S76 D;  4H37 A;  4ZKI A;  2RDC A;  1DF5 A;  3CD6 V;  4P9P A;  5C93 A;  2ZE7 A;  1RFY A;  4JAA A;  5C8Y A;  4LF5 B;  3RYF B;  1JX9 A;  4I0X A;  4J41 A;  1K33 A;  3A0H Z;  4CBC A;  4DXW A;  2GTS A;  4UCR A;  3OTO B;  4OXS A;  1XUQ A;  4PHZ A;  2WLH A;  4J9Y B;  1H2M A;  1KB9 F;  4HNA B;  5IDJ A;  3G4S V;  4X9Q A;  2YSU B;  1BCC H;  1WA8 B;  3OR6 C;  3UO3 A;  3LNM B;  3CCS V;  3AK1 A;  3RYH B;  2JS3 A;  3G67 A;  2V7Q G;  4X1I A;  4D7T A;  2JIZ G;  1S77 D;  4NYK A;  2UXD O;  5BMV A;  3RYF A;  4JV5 O;  1XI1 A;  1FAF A;  3AG1 C;  1P7G A;  4GYC B;  2L35 A;  5IY5 B;  3OEE G;  3ZCC A;  5CA1 A;  3CPW U;  5GON B;  4QE7 A;  2XAJ A;  3FFQ A;  3N2G B;  2JDI G;  1SS3 A;  1KUQ A;  2P4K A;  4GLX A;  3CC4 V;  2YEV B;  1JQ0 A;  1SKV A;  2JS5 A;  4ZOL B;  1HP8 A;  1LNQ A;  5FPO A;  5FL7 G;  4BW9 A;  2E3C A;  2E76 B;  4CH3 A;  3MDS A;  1BS3 A;  4LNU A;  2DJV A;  2VRZ A;  1TUE B;  3AG4 C;  3QNE A;  4LFC B;  1F4N A;  3J80 N;  4RWU A;  4I55 A;  1NH2 B;  2QTO A;  1TA8 A;  2YUA A;  4IL6 Z;  2PF4 E;  3DGE A;  3GWO A;  3W7T A;  2H3O A;  2HVK C;  2H94 A;  4ASU G;  1XNR B;  1FKA O;  2GV9 A;  4QJF B;  1SQB H;  1M57 B;  2EIL B;  1D2D A;  3BA8 A;  1ROP A;  4JYB A;  1PM9 A;  5B66 Z;  2DYR C;  4DV5 B;  3B8M A;  2QR4 A;  2WLL B;  4JI6 O;  4WFA V;  3CCJ V;  4KUM A;  4U3F H;  1FS0 G;  4DV4 B;  4R50 A;  4FPP A;  3ZHR A;  2ETN A;  5H6R A;  3SJC C;  3T4Z A;  1JVM A;  3DTU B;  4FLV A;  3K03 A;  2F93 B;  4DV7 B;  5B1O A;  5LXT A;  1GN4 A;  4HBN A;  3JD4 A;  1M56 C;  4MW8 A;  1YI2 V;  2B5U A;  2AW9 A;  4XDL A;  4DV6 O;  1YEW A;  2AZ0 A;  1JFF B;  4JV5 B;  1IXB A;  3SYQ A;  3H1K H;  3A8T A;  1G4Y B;  4JI6 B;  1WA8 A;  2L6L A;  2D2C B;  4MVQ A;  5LMN B;  4IIJ B;  1KD1 W;  2DMX A;  4HNA A;  3ABL C;  1Y67 A;  4J80 A;  1G1X B;  1DLB A;  4IYH A;  5JVD B;  3G71 V;  2K1E A;  2Y4U A;  1M93 A;  5B1N A;  3LNN A;  1L8D A;  1F4M A;  3E22 A;  3L72 H;  3BAA A;  4PA6 A;  4LBE C;  1XL6 A;  1K4C C;  4O4I B;  5K1X A;  4X20 A;  3U11 A;  3AG2 C;  3F5T A;  2EIM C;  1OCO B;  3OE7 G;  4RQF A;  4TV9 A;  3WU2 Z;  2KQX A;  4FLW A;  1B3Q A;  3ZRS A;  3G6E V;  2OIG A;  3SYA A;  4X1K B;  3UM7 A;  5KHJ A;  5IWA B;  3OMA B;  2DN9 A;  1WN7 A;  5IJ0 B;  4I4T B;  2ARH A;  2WLK A;  3CRQ A;  4HAM A;  3LSU A;  4U7N A;  3K04 A;  1JMK C;  5IYC O;  3RYC A;  2ZT9 B;  1Y76 A;  4OPA A;  3THO A;  3UT5 A;  4J10 A;  2CE4 A;  4EFB A;  3SR2 C;  1IVS A;  2XAF A;  1KKD A;  4P9O A;  4ZHQ B;  3K5L A;  1FXV A;  2CK3 G;  2DYR B;  2XAS A;  3HB3 B;  1P7B A;  4JPR A;  1US6 A;  3I56 V;  4O4J B;  4X65 O;  1TUB B;  3CXH F;  2Q68 A;  3CCV V;  5B1A B;  1Q8I A;  1EN4 A;  4DR4 O;  4D6T H;  3RYH A;  2X7R B;  3G6B A;  2A9H A;  2EJR A;  4TSF G;  1W0J G;  1N0J A;  1XHX A;  2GDS A;  5LA6 B;  3D3I A;  4GKK B;  2PZS A;  4NXN O;  4NVP A;  4A5U B;  4GCZ A;  3HR0 A;  3OTO O;  1BT8 A;  2IH1 C;  5KAI Z;  5KHI A;  3C3T A;  4UV8 A;  5IJ9 B;  4RAI A;  4FLY A;  2QM8 A;  4OGQ B;  5JH7 B;  3JCU Z;  4E4E A;  1E1R G;  2UUC O;  2VQE B;  2IJK A;  5CBG A;  3DC6 A;  2DWD C;  2NR5 A;  2OTJ V;  3JAW A;  1WAZ A;  3CCE V;  4X1K A;  4YJ3 A;  1NS1 A;  2QA4 V;  4W4K A;  3FAV B;  1ZWI C;  2AHZ A;  2XOK G;  3S3W A;  2UXB B;  1RM1 C;  4EFE A;  4YIP A;  3S3X A;  4YHH O;  3QO7 A;  3OD4 A;  4OX9 B;  4DV1 B;  1URF A;  3CX5 F;  3OTF A;  1BHB A;  4R6Z A;  2F23 A;  4WFF A;  2WLI B;  4CH6 A;  3CSX A;  2W6J G;  2YS8 A;  2YID A;  1DTO A;  3GVM A;  4AQY O;  1NQT A;  5H5N A;  4UVB A;  3E83 A;  3L74 H;  1LR1 A;  1W0K G;  1DGS A;  2F4V O;  4O4L A;  1MAB G;  1XMQ B;  4B3T B;  1VQM V;  4JI1 B;  5KX5 B;  3VBB A;  1E79 G;  2HKO A;  3U0Z A;  1WNS A;  4FK5 C;  4TQF A;  1XL4 A;  3ETQ A;  1P4R A;  2ZD9 A;  1GRJ A;  4JYA O;  4MTG A;  2BCC H;  3LDC A;  2ZE6 A;  2ZKO A;  3RBZ A;  1Y66 A;  1GM8 A;  2UUB B;  1FXK C;  4ZI7 B;  3FD9 A;  4ICG A;  5CBF A;  1QLE B;  3O9O A;  1OHH G;  3DC5 A;  1M90 W;  2X6C A;  4FM2 A;  3OAA G;  3LDE A;  2EZP A;  3UO2 A;  2D3O W;  4PDV A;  4CZZ A;  2E5L O;  1R3L C;  2YXY A;  1BE3 H;  1EZV H;  1OCR C;  1KBH A;  1YVW A;  2HFE C;  1XMQ O;  3BPZ A;  4DUY O;  1H2K A;  3A0R A;  3DSQ A;  1RP3 B;  5J9P C;  5JCO A;  1KP3 A;  3ZHT A;  5B5E Z;  4JI2 B;  5KMG A;  4DV7 O;  5L3C A;  3N2G A;  1YIJ V;  1K73 W;  4G2K A;  5CA1 B;  3ABM B;  1VQN V;  1WB8 A;  3J81 N;  4YHH B;  1K97 A;  1OCO C;  5L3E A;  2ZM6 O;  5EZY A;  2UXB O;  3RVY A;  3CEI A;  2JJ2 G;  1TUB A;  4LC1 A;  1AR1 B;  2ZNJ A;  1NVP D;  1VQ4 V;  3R66 A;  1U96 A;  4H44 B;  3STZ C;  2V1D A;  3AEI A;  3SDL A;  2B9Z A;  1H2G A;  2R9R B;  1CEZ A;  1VF6 C;  3RVZ A;  3CCM V;  2ITD C;  1QLE C;  4UB8 Z;  1WLE A;  2Y4T A;  3HKB A;  2CH7 B;  3TCU A;  1XHZ A;  4YJ2 B;  3FYI B;  4AI8 A;  3M8A A;  1HNX O;  4KXR A;  5LOV A;  2BTQ A;  4LR3 A;  1AB3 A;  2QSA A;  5LP6 C;  2RQ6 A;  4I5S A;  1NR7 A;  4JYC A;  2VQE O;  1XMO B;  1OV9 A;  2FYU H;  4H13 B;  2WSS G;  3SPG A;  2PGG A;  3BEH A;  4J42 A;  4C7U A;  5B1A C;  4X20 B;  1DK1 A;  5LMU O;  2W0X A;  5KX5 A;  4NXN B;  3CE2 A;  3E8B A;  4UVA A;  1H8E G;  3H1L H;  2W6I G;  3E22 B;  3AK3 A;  5KMG B;  1WJZ A;  2DQ0 A;  2YIB A;  2BSK B;  4J9Z B;  3RFR A;  2CTW A;  3QVN A;  3HKC A;  1KQS U;  1THZ A;  2HJD A;  5IWA O;  5L3D A;  4X66 O;  2PY5 A;  2QKC A;  4NTY A;  2LGW A;  2BE3 A;  4JI0 B;  1VQ7 V;  3LSS A;  1JFF A;  1IBM B;  1NTK H;  5IJ0 A;  2NLJ C;  4MVM A;  1VF6 A;  4U7O A;  1IUR A;  1XNQ B;  4UFZ A;  5DN6 G;  2YC0 A;  4K0K B;  1S5J A;  2XAG A;  3DXR B;  2P4V A;  3ABL B;  1Q6I A;  3UT5 B;  3B40 A;  4UCV A;  2KG7 B;  3VQX A;  4BIZ A;  4LF7 B;  2F43 G;  1ZL8 A;  1IBM O;  2HLD G;  1VP7 A;  4FFK A;  3GB7 C;  2F66 C;  2WA4 A;  1AJQ A;  3NR7 A;  1EZJ A;  2HVJ C;  1WP8 A;  4DR5 B;  2NN4 A;  1GM7 A;  2DE0 X;  1Q82 W;  4DV3 O;  1S0V A;  4PDL A;  5JJE B;  2M6Y A;  1R73 A;  1N32 B;  2GTA A;  4MT8 A;  4DR3 B;  2DWE C;  1QNM A;  5DED A;  1O9G A;  1R3I C;  2ZR3 A;  4ZI7 A;  2QM7 A;  4GX0 A;  1SQP H;  2WWW A;  3CB2 A;  4PJ0 Z;  4LFB O;  3AG2 B;  4IYI A;  4JTD B;  3OMN B;  3X2Q C;  4JI5 B;  3K08 A;  4GX5 A;  1VEW A;  2QM4 A;  1WPX A;  4P2Z A;  4G27 B;  2EUL A;  2YIB D;  1AIL A;  1LUV A;  1BL8 A;  3JYC A;  4DV5 O;  4N23 A;  4B3R O;  1N32 O;  2ADQ B;  3WG7 B;  4RO2 A;  3K5M A;  2WLL A;  2UUA B;  1I08 A;  1PP9 H;  4DR6 B;  3M7M X;  1YZB A;  4TV8 A;  4LNU B;  1SQQ H;  4AIL C;  2ZDI A;  2DQ3 A;  4DV4 O;  3JAK B;  3N2K B;  3CXC U;  1GK9 A;  1NZ6 A;  3DXR A;  5E79 Z;  1MA1 A;  3FX7 A;  4L8J A;  1FXK A;  4JI1 O;  4B3M O;  3M99 B;  3E8G A;  4F6R B;  4YIO A;  2N74 A;  3B2E E;  5H6Q A;  1FPO A;  1B04 A;  5FNV B;  1P49 A;  1ZAU A;  3T1Y O;  1RPO A;  2DOS A;  2OYQ A;  5D5P A;  2DW4 A;  1YJ9 V;  2N05 A;  2P7T C;  2YXL A;  1X4T A;  3CCQ V;  4H0L B;  3CME V;  4DR6 O;  3SJB C;  5LGU A;  3F7V C;  1L1F A;  1ENV A;  1YJN V;  3CP1 A;  1I5Y A;  2XAQ A;  3KCX A;  1RM1 B;  4JI8 O;  2ZIO A;  3W7W A;  4PDR A;  1VQ8 V;  5KHH A;  2VS0 A;  4F4L A;  2QWN B;  4X64 O;  2QWQ B;  2YIA A;  1NU1 H;  1W59 A;  3HKD B;  5ITZ A;  1N34 O;  1Y74 A;  3H9V A;  1HDJ A;  4LFB B;  4JAU A;  2EJ7 A;  1JA8 A;  2WLN A;  1ARO P;  4O2B A;  4F6E A;  2QKS A;  4K8Z A;  5LP6 B;  4FJC C;  4LFC O;  4LF4 B;  4FM1 A;  3K79 A;  1NBM G;  1BHA A;  4TV8 B;  2ZCE A;  4PA3 A;  1Y6X A;  2ATK C;  2PUS A;  2ITC C;  4DR5 O;  1KC8 W;  4O2B B;  1PNK A;  4O2A B;  1H38 A;  1FXK B;  4G28 B;  1P84 F;  1HNX B;  1TGO A;  3RW0 A;  3ZHU A;  1QHT A;  4PI2 A;  1I7F A;  1V55 B;  1K3E A;  2IM9 A;  4UXN A;  3ZMT A;  4RQE A;  3JAR B;  1SA0 A;  1Q81 W;  4KHP O;  4X88 A;  3HKE B;  2R9I A;  1IXM A;  4BR6 A;  4B7E A;  1AI6 A;  4HYO A;  4UCT A;  4TQD A;  1XNQ O;  1AR4 A;  3Q4H B;  2Q7H A;  5BR8 O;  3QTC A;  1AI4 A;  4JTA B;  3B4S A;  1VQ5 V;  2XUM A;  3SYP A;  1BGY H;  1Z5W A;  1GM9 A;  2UXC O;  4OPH A;  5FPR A;  2UXN A;  1FJG O;  2UXC B;  2KG7 A;  1N4C A;  4GZR B;  3CYO A;  3IAY A;  4MVZ A;  1GN2 A;  1IBK O;  1EN6 A;  2A79 B;  4X89 A;  4TOI A;  1Y74 B;  4LF8 B;  4WCE V;  2FL4 A;  3X2Q B;  5LMU B;  1JJO A;  2CAZ C;  2FB5 A;  4X64 B;  1XEQ A;  3KKY A;  2HEP A;  2A3Q A;  2FML A;  4Z1V A;  1GTO A;  2ZIM A;  1XMO O;  1HWY A;  2G38 A;  4UV9 A;  2QDO A;  3ETE A;  2R72 A;  3E35 A;  1VQK V;  4O4H A;  2ZR2 A;  1SES A;  1XRE A;  1ZLZ A;  4IHJ B;  3ZRW B;  4WF9 V;  1HNZ O;  5EIB C;  2VWK A;  3JD3 A;  1M1K W;  2FKX A;  1VQL V;  2QJ1 A;  3SYC A;  1B6Q A;  2LFR A;  4LH6 A;  4I9W A;  3P3P A;  2EIJ B;  1NTM H;  3NXS A;  2WA3 A;  1SA0 B;  1R6N A;  4QNH B;  1PKX A;  4MVS A;  4MTF A;  1NT2 B;  3APO A;  2OTL V;  1MNG A;  3AG4 B;  1OCC C;  1NR1 A;  1FFX A;  2LQT A;  4B3M B;  4YY3 B; 
#chains in the Genus database with same CATH homology
 4QIW F;  1S76 D;  2DYS C;  4H37 A;  4LC1 A;  4ZKI A;  1DF5 A;  3QO5 A;  1AR1 B;  3CD6 V;  4P9P A;  5C93 A;  2JEX A;  4Q20 A;  3FYE B;  1NVP D;  3OEH G;  2IJI A;  3VOU A;  1VQ4 V;  1JX9 A;  1K33 A;  5KA6 A;  4CBC A;  1K34 A;  4DXW A;  2QEX V;  2KB1 A;  3OFN G;  2V1D A;  3STZ C;  4EKW A;  3AEI A;  3JD1 A;  4OXS A;  2WLH A;  1H2G A;  2R9R B;  4J9Y B;  3B77 A;  1CEZ A;  3RVZ A;  3CCM V;  2ITD C;  5IDJ A;  5LGT A;  3G4S V;  1QLE C;  2YSU B;  1WLE A;  2WLM A;  3ABT A;  3OR6 C;  4QPJ A;  3ZMZ A;  1NVP B;  3LNM B;  3CCS V;  1K5Q A;  1ORQ C;  1M57 C;  3TCU A;  2V7Q G;  4JAS A;  3SPC A;  2JIZ G;  1S77 D;  3FYI B;  3KG2 A;  2A0L A;  3MHS C;  3T4D A;  2YEV A;  3AG1 C;  1R3K C;  1OCR B;  2EBO A;  3OW2 U;  1GMG A;  5EC2 C;  5DM6 V;  5IY5 B;  2WPD G;  3ASO C;  2B1I A;  3OEE G;  3WG7 C;  3ZCC A;  2H8P C;  3CPW U;  3MD0 A;  3T2M A;  1QVF U;  4XDK A;  4QE7 A;  1QR9 A;  2XAJ A;  3W7X A;  1JPX A;  2JDI G;  4I5S A;  4BW5 A;  3ML0 A;  1NR7 A;  2Y48 A;  4JYC A;  3SYO A;  2Z5U A;  3CC4 V;  2WSS G;  2YEV B;  1JQ0 A;  3UKM A;  2IU0 A;  4QE9 A;  3ETG A;  3K06 A;  3SPG A;  5E1A C;  2LFS A;  3SPJ A;  2LP7 A;  3BEH A;  1LNQ A;  5FL7 G;  5B1A C;  3AG1 B;  2Q6A A;  4FMT A;  4KP4 A;  1Q7Y W;  2JJ1 G;  3E8B A;  4UVA A;  1H8E G;  1TUE B;  1OCZ C;  3AG4 C;  3QNE A;  5L3F A;  3CCR V;  2PI4 A;  2HR3 A;  2W6I G;  1VQP V;  2X6A A;  1NKD A;  4N21 A;  2Z3Y A;  1F4N A;  2DQ0 A;  2JK5 C;  4J9Z B;  4RUF A;  1JCH A;  1PNM A;  5L3G A;  1SET A;  3ZRV A;  1AI5 A;  1YTF D;  1KQS U;  3HPL C;  1NH2 B;  3OGC C;  2QTO A;  1THZ A;  1V54 B;  3P30 A;  5L3D A;  4JF3 A;  4MVU A;  3DGE A;  3GWO A;  3W7T A;  2IW5 A;  5EK0 A;  1VQ7 V;  3LSS A;  3ETD A;  3IFX A;  4LP8 A;  2HVK C;  2H94 A;  3P32 A;  4ASU G;  5CA3 A;  3W7S A;  5LBQ A;  1QLN A;  2NLJ C;  1CPY A;  4MVM A;  5EBL C;  3ZMS A;  4U7O A;  4QJF B;  2QE7 G;  1M57 B;  1MG1 A;  2EIL B;  2ZXW C;  5DN6 G;  5LHH A;  1COW G;  2XAG A;  5KUK A;  2IJH A;  1ROP A;  5CBH A;  4JYB A;  3TET A;  2DYR C;  3ABL B;  1S5H C;  3B8M A;  4BIZ A;  2EIM B;  2F43 G;  2HLD G;  2WLL B;  4R7C A;  3CC2 V;  4WFA V;  3GB7 C;  3CCJ V;  1AJQ A;  3OUS A;  5B1B B;  4KUM A;  1EZJ A;  1FS0 G;  3MHH C;  4RUE A;  1PD3 A;  2HVJ C;  4R50 A;  5HFM A;  1JJ2 U;  4FPP A;  3ZRW A;  1GM7 A;  3F7Y C;  5H6R A;  5B3S C;  1Q82 W;  5HFL A;  3T4Z A;  1S0V A;  1JVM A;  3DTU B;  4PDL A;  1JOY A;  1R73 A;  3K03 A;  5EC1 C;  4MT8 A;  3CMA V;  5B1O A;  2Y69 C;  2DWE C;  3I55 V;  1R3I C;  1I5X A;  2ZR3 A;  1K7D A;  5IYB O;  3CC7 V;  2QM7 A;  4GX0 A;  2P90 A;  3JD4 A;  2IJJ A;  1M56 C;  4MW8 A;  1YI2 V;  2B5U A;  3F5W C;  1Y4M A;  2WWW A;  2WAM A;  3OUF A;  1GO3 F;  4XDL A;  3LDD A;  3AG2 B;  4JTD B;  3OMN B;  3X2Q C;  4R8C A;  1AJN A;  3K08 A;  3SYQ A;  3K0D A;  5CMU A;  3AG3 B;  4GX2 A;  5KUM A;  4GX5 A;  3CCL V;  1G4Y B;  1WPX A;  4GT1 A;  4P2Z A;  4G27 B;  4GX1 A;  4MVQ A;  1SER A;  1KD1 W;  3ASN B;  3ABL C;  1QR8 A;  2B1G A;  1DLB A;  1BL8 A;  3JYC A;  4N23 A;  3ZIA G;  3G71 V;  3ABK B;  2K1E A;  3WG7 B;  3IC7 A;  3ASO B;  2IU3 A;  4RO2 A;  5B1N A;  1F4M A;  2BOC C;  3R65 A;  2WLL A;  1SZT A;  2EIJ C;  4PA6 A;  2XND G;  2GHY A;  4LBE C;  2DYS B;  1XL6 A;  4PDM A;  1K4C C;  3E89 A;  3E8H A;  1E1Q G;  2FTK A;  2ZDI A;  2EIN C;  3STL C;  1SRY A;  1VQO V;  2DQ3 A;  1VQ6 V;  3AG2 C;  5BZB A;  1K9M W;  1YIT V;  4PA7 A;  2EIM C;  1BMF G;  1OCO B;  3OE7 G;  3BY6 A;  4UUJ C;  4RQF A;  3CXC U;  1GK9 A;  1K8A W;  2HJF C;  4MS2 A;  4Z1M G;  1FXK A;  3ZRS A;  3G6E V;  3M99 B;  3E8G A;  3SYA A;  2Q69 A;  4HZ3 A;  3UM7 A;  5H6Q A;  1NH2 D;  4MTX A;  2Y69 B;  1K5S A;  3OMA B;  2EIK C;  5IY5 C;  2WLJ A;  3E86 A;  2IH3 C;  1RPO A;  4BAY A;  3ZN0 A;  2WLK A;  1OCC B;  1V55 C;  3K0G A;  2PI5 A;  3E8F A;  4HAM A;  1F23 A;  2DW4 A;  4U7N A;  1YJ9 V;  3K04 A;  3TK1 A;  2P7T C;  5IYC O;  2EIK B;  4XBF A;  3CCQ V;  3CME V;  3K9A A;  1J95 A;  5LGU A;  3F7V C;  3K3W A;  1L1F A;  2XAF A;  1KKD A;  1ENV A;  1YJN V;  4P9O A;  3CP1 A;  4ZBM A;  3B8N A;  1I5Y A;  2XAQ A;  3E2E A;  1FXV A;  3ABM C;  1RM1 B;  2CK3 G;  2DYR B;  2XAS A;  3HB3 B;  1F51 A;  1P7B A;  4JPR A;  5EBM C;  3I56 V;  1OZ0 A;  3W7W A;  3AG3 C;  4PDR A;  4MVO A;  1VQ8 V;  3ZN1 A;  1S3J A;  1YHQ V;  2BOB C;  4F4L A;  3SPH A;  3FB8 C;  4BIU A;  4YXW G;  2Q68 A;  3CCV V;  5B1A B;  3OM3 B;  4XDJ A;  2X7R B;  4JAU A;  1CP9 A;  3QO8 A;  2A9H A;  2EJR A;  4TSF G;  3D36 A;  1W0J G;  1QVG U;  2WLN A;  3ZMU A;  1ARO P;  2QKS A;  3LSQ A;  1S72 V;  4FJC C;  3LUT B;  1G8M A;  4L87 A;  5LHG A;  3K79 A;  3D3I A;  1NBM G;  1BHA A;  4GCZ A;  4PA3 A;  4JTC B;  2IH1 C;  2ATK C;  1RPR A;  1Q86 W;  4UV8 A;  3JD0 A;  4RAI A;  2EIN B;  2ITC C;  2AHY A;  2QM8 A;  1KC8 W;  5L3B A;  1PNK A;  1H38 A;  1E1R G;  2ZDI C;  1VQ9 V;  1FXK B;  1V54 C;  4G28 B;  1M9N A;  2IJK A;  5CBG A;  3FB5 C;  2DWD C;  3RW0 A;  2OTJ V;  5IYD O;  3ABK C;  3CCE V;  1PL0 A;  4H33 A;  1V55 B;  1K3E A;  4UXN A;  2QA4 V;  1PNL A;  3ZMT A;  4RQE A;  1ZWI C;  2AHZ A;  2XOK G;  1Q81 W;  3FB7 C;  1RM1 C;  3ASN C;  5LHI A;  4QPK A;  3CCU V;  3FB6 C;  2MK3 A;  4X88 A;  3QO7 A;  1GKF A;  3JD2 A;  1AJP A;  2R9I A;  4MW3 A;  4WFE A;  1IXM A;  3IGA C;  1BHB A;  1AI6 A;  1W2B U;  4HYO A;  4P30 A;  2P6J A;  1QCE A;  4WFG A;  4R6Z A;  4WFF A;  2W0F C;  4PEL A;  2WLI B;  4KFM A;  2W6J G;  4TT3 G;  4TWK A;  1DTO A;  1AI4 A;  4JTA B;  4JGS A;  1VQ5 V;  1NQT A;  4PA4 A;  4UVB A;  2Q67 A;  2NNU A;  3E83 A;  1W0K G;  4LCU C;  3SYP A;  1GM9 A;  3ZMV A;  1MAB G;  2UXN A;  1QBZ A;  1VQM V;  1YTF B;  2HG5 C;  3VBB A;  1E79 G;  1KEC A;  2HKO A;  1UJW B;  3CYO A;  4FK5 C;  4MVZ A;  4E2L A;  1XL4 A;  2ZQM A;  1P4R A;  2ZD9 A;  5B3S B;  3EHB B;  1K4D C;  2GSM B;  2A79 B;  4MTG A;  3ABU A;  3LDC A;  4X89 A;  4WFB V;  3RBZ A;  1Y66 A;  1GM8 A;  5LGN A;  1MSW D;  2XAH A;  4WFH A;  3SPI A;  3OMI B;  1FXK C;  1NR1 A;  4WCE V;  1K92 A;  2UXX A;  3EFF K;  2OCC B;  3OR7 C;  1QLE B;  5CBF A;  3X2Q B;  4FIP C;  2JEU A;  3ZRX A;  1OHH G;  3W7U A;  1YJW V;  3H01 A;  1N8R W;  1M56 B;  1M90 W;  2X6C A;  1GTO A;  3LDE A;  3OAA G;  2EZP A;  2OT5 A;  1HWY A;  1AI7 A;  4UV9 A;  2D3O W;  4PDV A;  1R6K A;  4CZZ A;  1R3L C;  4JAV A;  2ZXW B;  3SJQ C;  3ETE A;  1OCR C;  1R3J C;  2EIL C;  3PJS K;  3E35 A;  2HFE C;  4MVR A;  1VQK V;  2M7W A;  2ZR2 A;  1DF4 A;  3A0R A;  1SES A;  3JCZ A;  3FKS G;  4MTO A;  3ZRW B;  1MOF A;  5J9P C;  4WF9 V;  1YSC A;  4X8A A;  1KP3 A;  3JD3 A;  1M1K W;  1FFT B;  1NJI W;  1VQL V;  5B1B C;  1EBO A;  4PA9 A;  3SYC A;  2OCC C;  1B6Q A;  3T1C A;  2LFR A;  2WLI A;  5EBW C;  1FXH A;  1KP2 A;  5GW7 A;  4I9W A;  3ZJZ A;  5L3C A;  1YIJ V;  4DO2 A;  1K73 W;  4MSW C;  4G2K A;  2X0L A;  1H8H G;  2EIJ B;  3NXS A;  1EFR G;  2EZO A;  4UVC A;  3ABM B;  1VQN V;  1R6N A;  4QNH B;  1PKX A;  4MVS A;  4MTF A;  1K97 A;  5H9C A;  1OCO C;  5CN0 A;  5L3E A;  2C2A A;  3WFV A;  2OTL V;  1OCZ B;  2P67 A;  3AG4 B;  3RVY A;  5KA5 A;  1OCC C;  2X6B A;  2JJ2 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...