2IJKA

Structure of a rom protein dimer at 1.55 angstrom resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
57
structure length
57
Chain Sequence
TKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijkA00
1RPRA 1RPOA 1GTOA 3K79A 4DO2A 1F4MA 1NKDA 1PD3A 2IJKA 2IJHA 2IJIA 2IJJA 1GMGA 1ROPA 2GHYA 1B6QA 1F4NA
chains in the Genus database with same CATH superfamily
3T1HO 1GN3A 1WA8A 4MW8A 5JH7B 3AG1B 4JI8B 4FPPA 1V9PA 4CH5A 1COWG 4I55B 4JV5B 2QM8A 3CHXA 2DN9A 4JI2B 1Z5VA 4MVSA 2EILB 2ITCC 3L70H 4TV8B 5EBLC 4FM0A 3I55V 1MG1A 1Q81W 4HAMA 2Q7EA 3H01A 2QA4V 1XNQB 4X20A 3JD1A 3CRAA 3CJHB 5L3CA 4GLXA 1K4CC 2DYSB 2WLLB 2P06A 1N34O 1TUEB 2HHHB 4I4TA 1AP6A 4TSFG 2AZ0A 4DR6O 2QWQB 1NT2B 3G67A 1YTFD 2WLIB 3P32A 1NQTA 1MMMA 2UXBB 3QO8A 4KP4A 4EB6A 3SGIA 1GM7A 4GYCB 1F51A 3PJSK 3RW0A 1NR1A 3B8MA 3T1CA 2RN9A 1XOUA 5TISZ 4DR1O 4X1KB 3JATA 1ZAUA 4I50B 2QM7A 2PUSA 1JPXA 4UCVA 3CYOA 2EIMC 2XT9A 1QLEB 1LR1A 1ZL8A 2CE4A 5DEDA 2YXHA 4WBNB 3SPCA 1A32A 4DV2B 5JH7A 1BS3A 1KYOF 2QEXV 2OT5A 2XOKG 2HR3A 1V55B 2FL4A 1URFA 1YF2A 5GTHZ 2HVKC 2R9IA 5JQGB 3ASOB 4JI1B 2QKSA 3OTOB 1VQ8V 1YZBA 3X2QB 5IJ9A 4JI3B 1HR0B 1SF9A 4TV8A 2WLKA 1S76D 5J9PC 1Z5WA 4YHHO 3E86A 5BZBA 4MVQA 3CEIA 2VQEB 3E83A 4P30A 5LMNB 3K9AA 3AG7A 4DV5O 1M90W 1SZXA 3QF7A 3K03A 1XBLA 3S3XA 1BMFG 2WLLA 2OTJV 2XAHA 4G2KA 4LCUC 1JFFB 3R66A 3RN4A 3SJBC 4DR3B 3JSNA 4WCEV 1CXZB 3K9SA 2WLIA 1G6UA 2CGNA 2FKXA 3ZRXA 2A3QA 2VQFO 1FFTB 3ZMTA 2JVDA 1E1QG 2V1DA 3ZHUA 5BR8B 1VARA 5IJ0B 2F43G 2IM9A 2DWEC 3DXRB 1VQ4V 2KKWA 4HBNA 5IDJA 1CP9A 3J7AU 2P6JA 4X1KA 3CXHF 4PA7A 1NKDA 3ZRSA 4I50A 4P9PA 1N0NA 2EIJC 4DV6O 4LF7B 4JI6O 2EIKC 4GKKO 3SPJA 3CS5A 5JCOA 1W0KG 2PZSA 3JARB 5JVDB 3ZJZA 4LF9O 1Y6XA 2CGOA 4XDJA 4AI8A 3BHPA 5JQGA 4U7OA 1OCZC 3J80N 3E8GA 1BSMA 1S72V 3K04A 1FFXB 3MDSA 3N27A 5L3FA 1AILA 2WAMA 1Y4MA 1WB8A 4GX2A 2X6AA 1OCCC 5LHGA 2DYRB 3H1JH 2HKOA 4DV7O 1VQOV 4GX0A 4O2BB 3EHBB 4NXNB 2JJ2G 2UUAB 1HNWO 5K1XA 4GCZA 4LFBO 2ZM6O 4R7CA 3HKDB 3JCZA 2WLHA 4LC1A 4FK5C 1JFFA 4YY3O 3JALB 4WF9V 4YIPA 3L75H 3ABLB 4J11A 4L8JA 4FLZA 2DW4A 4EFEA 4OX9B 5LBQA 2CTRA 3ZHQA 4GZRB 3IC9A 3UO3A 4BWAA 4FLTA 3C3SA 1GMGA 1ZSPA 1IBLB 2HEPA 2PF4E 3FD9A 2WWWA 5IJ0A 5LHIA 2A79B 4XBFA 4A5UB 2DWDC 4J9ZB 3DXRA 4ZI7B 4DUYO 2OIGA 3H1KH 2CTPA 4MVMA 1AVMA 3D3QA 2D2CB 2B1IA 5J2UA 2ZQMA 1GN4A 5IYDO 4PD4F 4JI7B 5JVDA 4UV9A 1KMIZ 5ITZB 4GKJO 1N0JA 3UCSC 1WAZA 5LP6C 5BXZA 1K3EA 3E89A 1N33B 1IXBA 3SJAC 5CA3A 2QR4A 4KXRA 4LFAO 4HZ3A 3AG1C 1FFXA 4KUMA 2NN4A 5KX5B 2KSDA 1ZX3A 1QBZA 4JAVA 1VP7A 1TAEA 4MVUA 1AR1B 4CS4A 4QJFB 4UB6Z 2YEVB 1YHQV 2EILC 4O2BA 3ZBHA 5IY5B 1HNXO 2Q69A 1PD3A 3BY6A 1TGOA 1EN6A 3K5MA 2ZR2A 3HKDA 1R6TA 4PV1B 3FFQA 3I5DA 3JALA 2AHYA 2EBOA 3RYFB 4O4JA 1PL4A 1GN2A 3APOA 5CBFA 1R3KC 2DYSC 3LNMB 2A7WA 3CC2V 4B7KA 4B3RB 3ABKB 1N32O 3LSUA 3ZHVA 3U10A 2ITDC 2P22C 4FIPC 4F6RB 1IURA 3Q4HB 1QCEA 4K0KO 2QKAA 3TXSA 5EK0A 4O2AB 4ZI7A 5IT9N 4DXWA 1J5EB 2Y69B 3NR7A 1KKDA 1JQ0A 3OFNG 3CC4V 1WPBA 4J7JA 3CRMA 1CEZA 2W6IG 1AI4A 4N23A 5JJEB 4K35A 1QVGU 1U96A 1MSDA 4NXMO 5KHHA 4RAIA 4JF3A 1QLEC 1PPJH 3OUSA 4ZIBA 5DM6V 3OAAG 4QIWF 5IWAO 2JEXA 1O9HA 1JA8A 5FPOA 3KKYA 4NTXA 2XNDG 1V55C 5GTIZ 4OPHA 1I94O 1QHTA 1S5HC 3ASOC 5HFLA 2IH3C 2Q0AA 3F5TA 2YC0A 4JAAA 2YEVA 3X2QC 4LF4O 1R6NA 1AJQA 5L3GA 5LMUB 1H38A 2XUMA 1XREA 4RQFA 5B1AC 4PDMA 4D7TA 3RYFA 3OMNB 4X89A 4CBCA 5L3DA 4LF6B 2B5UA 1NS1A 2F4VO 1FYJA 1EN4A 2WLJA 1F23A 1RFYA 4AQYB 2GDSA 4X8AA 4JI4B 1W0JG 2VS0A 4RO2A 4F6RA 3Q4HA 3QTCA 2YS8A 3A0BZ 2P5OA 1L0NH 3JCUZ 3S3WA 4O2AA 3G6BA 4OGQB 3DTUB 3C3TA 1EZVH 3TETA 4IYHA 3R65A 4FLYA 4H0LB 1IDSA 4LF5O 5CN0A 3SR2C 4J10A 3KZIZ 1BT8A 5H6QA 3AG3B 2EJRA 5A9GA 1H2NA 1QQCA 3BVOA 4JYAO 3CCUV 3SYCA 1VQKV 4PI0A 2RMKB 3CSXA 3KG2A 4CS2A 1H2LA 1F7YA 2RCVA 3W7SA 3WB2A 3VBBA 2LGQA 1PNMA 1FJGB 2IH1C 4NB5A 3OR7C 5GONB 4Z1VA 2ZE6A 4I9WA 1UJWB 2XAGA 2Y4UA 2YUAA 1U97A 3T1HB 1I08A 2QWOB 1B04A 1UPGA 1IX9A 3JAKA 4UFZA 3VQVA 4CC6A 5KHIA 4KHPB 2DYRC 2IJHA 1GM8A 2ZR3A 4DR5B 2IU0A 1N8RW 4H13B 4MTFA 4OXSA 3BABA 3QO5A 1E79G 4PA6A 2CH7A 1GKFA 2OIEA 3MHHC 4JZGA 4RUEA 5CA1B 1N36B 4DR4O 2Y0IA 1QNMA 3ABLC 1LUVA 3FB6C 3BCCH 4X62O 4WFBV 3WG7B 3CCEV 4JAUA 2N74A 2DQ0A 1HDJA 4NTYA 4LNUB 1N34B 4FM2A 4QE7A 4LBEC 3LUTB 1M56B 4DR6B 2QWRB 2LW7A 1CPYA 1G1XB 1WN7A 4P2ZA 1SQXH 1KD1W 1H2GA 2NNUA 3K3WA 1SQFA 2BOCC 4DV4O 1QR8A 1Q6IA 3LDCA 1P49A 4ZOLB 3K5NA 3BEHA 2HLDG 2XASA 1GK9A 3WU2Z 1ZL8B 4MTGA 5GONA 1MZEA 5E79Z 3IAYA 1DTOA 3ETQA 3CCLV 5JJJB 4X66O 4NYKA 2FYUH 4UCUA 2X6CA 1AJPA 1NTZH 2LQTA 4XDKA 3QVNA 1K33A 2P4VA 4RWUA 5LHHA 1JR9A 5IJ9B 5IY5C 1S0VA 2ZNIA 1VF6A 3CE2A 4PDLA 1PM9A 5E1AC 3ZHRA 5CA1A 2F1MA 3D3IA 2UXDO 5DECA 3SJCC 3BA8A 4YJ3B 1NTMH 4DR7O 1JOYA 3CCJV 3RYHB 3ABMB 4FVMA 4JGSA 4LFCO 3QO7A 2UXCB 3ABKC 3EFFK 3P30A 2Y4TA 4QPJA 4DV5B 1QU7A 4D6TH 3JD2A 1IBMO 4CH6A 4LNUA 5FL7G 5B3SB 1BZKA 3ZMUA 1I0HA 3K0GA 3ZHSA 2Y69C 3ZCCA 4B7EA 1XMQB 2ZIMA 3ABTA 2VQFB 2JS3A 4O4LB 4UCTA 5KAFZ 1AROP 2N05A 3IC7A 3CB2A 3B4SA 4Z1MG 3OT7A 5EIBC 2M7WA 1BQ0A 2ZIOA 1VF7A 4ZOLA 3E8HA 1R3LC 1P4RA 1JJ2U 3CD6V 1K7DA 5C93A 3T1YO 1UFIA 1TA8A 1V54B 4DV6B 1NJIW 4GKKB 4R50A 2E5LO 1YITV 4ICGA 1XDCA 3MD0A 2VRZA 1JJOA 2E74B 2G38A 2GV9A 3K06A 4JTAB 1IXMA 2DOSA 5D5QA 4FZ1A 3STZC 4X1IA 4JI8O 3FKSG 3WFVA 1EZJA 4Q6GA 5FPRA 4LF8O 4JV5O 3ZEDA 1VQMV 2WSSG 2Y0PA 1KP3A 3UQ8A 3KCXA 2OCCB 3ZHTA 3L72H 2IW5A 4E4EA 2KG7B 4MVRA 4YJ3A 3IFXA 4JPRA 4W4KA 2Q8VA 3RYHA 2WPDG 2KB1A 1AJNA 2QJ1A 5CMUA 4WFEA 4QGPA 2GHYA 2B1GA 3H1LH 1HNWB 4DRXA 4TWKA 2UUCO 3VQWA 2HHHO 4X64O 1W2BU 4GUNA 1BGYH 1K5QA 1SERA 2CTWA 2UXBO 4O4LA 4MVZA 1SQBH 4K8ZA 4DV3B 5D5PA 4LH6A 3CPWU 2F93B 2HJFC 3AG3C 2E75B 4DUYB 1OCRB 4X88A 5EIBD 5J2UB 3L74H 4BAYA 1DGSA 1YSCA 4FLUA 4JZ2A 3ASNB 5EYPA 4NKGB 1ZWIC 1YVWA 1X4TA 4DR2B 4J9YB 3IJ4A 4FFKA 1SZTA 3G4SV 4QPKA 5H6RA 1HNZB 2XAFA 3GWKC 4CS3A 1FXVA 4DV2O 2QTSA 4GKJB 2ZNJA 3AG2B 4LFAB 4R8CA 4B3TB 2O57A 4O4IB 4EFBA 1NH2B 4FZ0A 3JD0A 4JI1O 3G6EV 1BE3H 1TVKA 2KG7A 2PI5A 2F66C 3D36A 1YJNV 4MTXA 1HR0O 1VF6C 3BFRA 1XI1A 1XNRB 2YXYA 2BTQA 2YICA 3DC6A 5CB4A 5LL6Y 2VQEO 4B3SB 1HNXB 2F23A 1L0LH 4IT5A 3AK3A 2K9PA 2ZD9A 4O4JB 2JEUA 3WG7C 3U0ZA 1VQ6V 5KA6A 5H2FZ 4UV8A 1JX9A 2LP7A 4LH7A 4J7KA 2WA3A 3ZS8C 1YJWV 1D5NA 4P9OA 3K79A 4DR3O 2ZDIA 1T5EA 1VF5B 2JJ1G 1S77D 1VQNV 1M56C 2ZE5A 1N32B 1VQ7V 5KHJA 3OD4A 4X65B 3O65A 3BAAA 1F4NA 1YEWA 2AXTZ 1SQQH 5BR8O 1GAXA 1XUQA 3ZRWB 3W7XA 4KL1A 4EKWA 1FPOA 4FLXA 2FTKA 2OCHA 3B8NA 1L1FA 1Q6HA 2VWKA 1NVPB 4DUZB 4QE9A 3JD4A 3OUFA 2JGDB 2ETNA 5KLVH 3JD3A 4JYYA 4NXMB 5CBGA 3OM3B 2WA4A 2ZT9B 1OZ0A 1NR7A 5IWAB 2RQ6A 4MTOA 4RQEA 1QR9A 4O4IA 4GX1A 1HWYA 1QVFU 3P3NA 1M1KW 1ROPA 4ZKIA 3HR0A 5L3EA 4RUFA 3FB5C 2V4DA 2W0FC 4TT3G 5KMGB 3STLC 5EC2C 1FAFA 3ZN0A 4GT1A 1KUQA 2F95B 4AHCA 4PA9A 4LF4B 3MAQA 1H8HG 5GW7A 3N2GA 3ABMC 3AK1A 3SDLA 4BR6A 3E8BA 3K0DA 5B1BB 1PKXA 2YXLA 1Q86W 4XDLA 2BCCH 2W0XA 1KU9A 5B3SC 2QDOA 5FNVB 3HKBB 4OX9O 1DF5A 3FAVB 1EN5A 2UU9O 4TUYB 1IBLO 3AG4B 2Y48A 3EVKA 3ZRWA 1BCCH 1SC5B 2E3CA 5DN6G 3G80A 1Y66A 2M6YA 3RFRA 4LF5B 2IBZH 5JJNB 1M57B 3CC7V 1Q8IA 2JGDA 1WJZA 3A2FA 5JCOC 3W7TA 2GUZB 1IBKB 2OYQA 1V54C 1WP7A 2ADPA 2CTQA 4BIZA 1M9NA 2EZOA 1PP9H 2EX3A 2FMLA 2IJKA 1GRJA 1VQ9V 3JAWB 3HB3B 4JTDB 4DV0O 4K8XA 1VEWA 3K57A 1SQPH 3JASB 2GTSA 1NTKH 2YDEA 4F4LA 3TXQA 1P7GA 1MABG 3JAKB 5KMGA 2P90A 4UB8Z 1IZ3A 2L6LA 2OCCC 3A0HZ 1TUBB 4JASA 2AGAA 3D36C 4UVAA 3B09A 4FFBA 3OW2U 1FKAO 5IYCO 2CH7B 3K08A 5B1OA 1I5XA 1N4CA 1FXKB 3FB8C 1G4YB 1BHBA 5FNVA 4DR4B 3HKBA 2ARHA 3MHSC 3FAVA 4IYIA 3HKEB 3K5OA 2ZDIC 3F7VC 4X62B 3F5WC 1EM1A 4TUYA 3LSSA 1DK1A 3CWBH 1D5AA 3OMIB 2VWJA 1H2SB 2Q4PA 4U3JB 2EINB 1P84F 3RYCB 1J5EO 3JYCA 3HPLC 2NR5A 1OCRC 1YJ9V 1XEQA 3VQXA 1VMGA 3ASNC 4J7ZA 2GUZA 3W7WA 2YIBA 3GWOA 3T4ZA 2AW9A 1YCIA 2Z5UA 3RGBA 1I5YA 3H9VA 3JAWA 3JASA 3ETEA 2YSUB 5B66Z 1XL6A 2X0LA 3RYIB 2PYJA 3AG2C 1Y76B 3ZX6A 2GTAA 1Q6UA 1TUBA 3CCVV 3UKMA 1Q7YW 4MSWC 1NI8A 2RJZA 4NR1A 1GO3F 1WP8A 2PYLA 4TQFA 5KHGA 1FXKA 1K5SA 3OGIB 4LF6O 4X1YB 3N2KB 2UXDB 4AQYO 5EZYB 3HKEA 2D3OW 2NLJC 1M5IA 1SRYA 1KQSU 2JRIA 2KQXA 1Q5OA 3O9OA 1EFRG 2X6BA 4U3JA 4O4HB 3SJQC 3TK1A 1BL8A 2QWPB 5HFMA 3RYCA 2YI9A 2WLMA 1R73A 3B2EE 3SPGA 5F2VO 4JI5O 5EC1C 4G28B 2LFSA 3HKCB 4DR1B 2Q68A 2UUBO 2XAJA 3K59A 2IJJA 2ILMA 2K1EA 4I0XB 3OE7G 1FJGO 4PA3A 3RYIA 3BPZA 5IE9A 1Y76A 1RM1B 5BMVB 1SQVH 3SPHA 4X1IB 2OWOA 3CMAV 1NH2D 2YIDA 1F4MA 3CRCA 1VIBA 3ABUA 4DK1A 4KHPO 4I7ZB 3OMAB 1Q90D 4LF8B 4DR5O 2ZXWB 5B1NA 3DC5A 1XILA 2Q7GA 5KHKA 2AZ2A 4X1YA 4LP8A 3N2KA 4YHHB 1M93A 1MSWD 5EZYA 2MW2B 4IIJB 2A0LA 1N36O 5B1BC 4B3MO 3B40A 1SQGA 4TOIA 4JI0O 4DO2A 2AHZA 4UXNA 1I7FA 4DRXB 2QSAA 1ZUQA 4ZHQB 3RT3C 4K3AA 4DYLA 1YIJV 1B06A 4KFMA 4O4HA 2H8PC 2UUCB 3AG4C 1AP5A 2RNBA 2BOBC 4X64B 1AR5A 3CMEV 3IGAC 1RPOA 4BW9A 1XMOO 5K1PA 2Q6AA 4FJCC 4IGGA 3B77A 3HKCA 2A9HA 2A06H 1NVPD 1M57C 1BQZA 3FYIB 4HNAB 3FX7A 1LNQA 1QLNA 4DV1O 5EYPB 4IHJA 4I0XA 4JI6B 2JS5A 4W4LA 3I56V 3CRQA 1MA1A 3TJTA 1Q82W 3RWRD 3CXCU 5LOVB 3LSQA 1SA0B 4LF9B 5BMVA 1JVMA 3VQYA 4BW5A 5LP6A 1BHAA 3AEIA 3UM7A 4WFHA 2QTOA 4BIUA 4JI2O 1TVKB 1OHHG 4I55A 4HYOA 3A8TA 1PL0A 2RDCA 5KA5A 2Z0AA 4DV7B 2BTQB 4IIJA 1B6QA 1XNQO 1FXKC 5CB4B 2LW1A 3ZIAG 1K97A 4LFBB 4UCOA 2ZM6B 3NXSA 3A0RA 1GN6A 1MZFA 1H2KA 1XL4A 4ZHQA 4YY3B 2ZINA 3APQA 3E22B 2UXCO 5B1AB 2N04A 1AI7A 3CJHA 1DLBA 3OEEG 2GBOA 3SYOA 2PY5A 1WPXA 2ZKOA 2BSKB 3BA9A 3L9DA 3GB7C 4MW3A 4PI2A 3TCUA 3ZMZA 2EINC 1L8DA 3DGEA 2IU3A 1XMQO 4YIOA 1FS0G 3LDDA 4HNAA 1THZA 1K4DC 3DSQA 3LNNA 4Z2WA 2UXXA 2E76B 2Z3YA 1S5JA 4DW1A 4N21A 1EBOA 1P7BA 2YIBD 3JAMN 3T2MA 4H37A 5LOVA 4MS2A 1SA0A 1GH6A 1S5LZ 1Q3EA 4WFGA 2QM4A 4WBNA 3CRRA 3TGUH 1KKCA 1O9GA 2DJVA 4PHZA 3OTOO 3F7YC 1K92A 5CA0B 4JI3O 3CP1A 1XQ8A 1HP8A 3P3PA 1K8AW 1JMKC 3WB1A 5LMNO 3UT5B 2ATKC 2UXNA 3VOUA 3N2GB 2HVJC 2BE3A 5IYZB 3BRCA 2BTOA 1NZ6A 1K73W 3E22A 4CH3A 2C2AA 4UCRA 4FLWA 3SYAA 1AR4A 4PELA 2H3OA 2BSKA 1OCOB 4MT8A 4K0KB 5IYBO 2R9RB 1S3JA 1YTFB 3EXAA 2UU9B 3ICXA 3QNEA 2H94A 4DV3O 2XTAA 1Q43A 2Q9LA 4LR3A 1M4UA 3ML0A 4UCSA 4CC5A 4LF7O 4LWSB 4ABMA 4UVBA 3E2EA 2CAZC 1WB7A 3L71H 4DR2O 3ZMSA 4JYCA 1HNZO 1Z2GA 4H33A 3J81N 1RM1C 3JARA 2LO1A 4UUJC 3SYQA 2JIZG 3CCQV 1I94B 4CH4A 3FB7C 2P67A 2EJ7A 5CA0A 4CZZA 1JCHA 2X7RB 4DV0B 4B3TO 2GSMB 3T4DA 1RSOB 5H5NA 1Y74B 5LGTA 4NVPA 2XHBA 2DQ3A 4QNHB 2QGNA 2ZXWC 4JYBA 4J41A 5J2TB 3UT5A 2LJ2A 1XNRO 4NXNO 4FFBB 1SKVA 2UUAO 5IYZA 2EULA 2YI8A 3CCMV 3RVYA 5FLXN 1LUWA 4B08A 2WLNA 5L3BA 4B3SO 4TQDA 2F4VB 4U3FH 2DE0X 1MOFA 5BY1A 4JTCB 2JGUA 1KC8W 3D8CA 4DK0A 3OGCC 2CUGA 3G71V 4PA4A 2Q67A 2R70A 2R72A 1AI6A 1XHZA 2HJDA 1PV0A 5C8YB 2Q5ZA 4MVOA 5EBWC 3KCYA 4X65O 4I9QA 1YI2V 1HW7A 3L73H 5A2QN 1GTOA 4I5SA 2B9ZA 3QG5A 1ZTEA 4LWSA 1WLEA 2Q0OC 3C90A 5H9CA 4JI7O 4JYAB 1PNKA 4DUZO 1VQPV 1ORQC 4EEQA 1KECA 2CK3G 5LA6B 2ZCEA 4PJ0Z 4L87A 1VQLV 1N33O 1RPRA 5EBMC 3THOA 1R6KA 1J95A 2MK3A 3ETDA 1X59A 5ITZA 4NTWA 2OTLV 1VQ5V 2EIMB 4E2LA 1OV9A 1H8EG 1NBMG 2LFRA 1RSOA 5KX5A 1Y74A 4TV9B 1YDXA 2XAQA 5J2TA 2PI4A 1NU1H 1KBHA 5KUKA 3RVZA 1RP3B 2P7TC 2ADQB 1KB9F 4YJ2B 3WB0A 1AB3A 4UVCA 4D7SA 1WNSA 2EZPA 2Q73A 4B3RO 2ZE8A 1R3JC 2JDIG 3M8AA 5LYJB 4FM1A 2R9AA 5C8YA 5KUMA 3E35A 5B5EZ 2PTMA 3OTFA 4OPAA 2ZE7A 2QKCA 2JK5C 2CDYA 5LGNA 3RBZA 3W7UA 3LDEA 1GM9A 1R3IC 2IJIA 5LXTB 2DMXA 4H44B 3CX5F 4JI5B 4DV4B 3SYPA 5LA6A 5CBHA 1IBKO 2EIJB 1XHXA 1FD9A 4FLVA 3AK2A 4U7NA 4J80A 2UUBB 2EIKB 4G27B 2HFEC 1KP2A 4WFFA 1D2DA 3PN1A 4X66B 2YIAA 4TV9A 3H1HH 4IL6Z 2QWNB 3E8FA 4X9QA 1PNLA 4BIOA 1WA8B 1FXHA 1OCZB 4ASUG 2HP8A 1G8MA 1H2MA 1OJHA 5AG2A 5LMUO 2HG5C 1K34A 4PDRA 4YJ2A 2Q7HA 1K9MW 1B3QA 1AI5A 1OCCB 3GVMA 3FYEB 3OEHG 4R6ZA 4YXWG 5JWPA 1SESA 4JI4O 3M99B 3ZMVA 2QE7G 4DR7B 3U11A 1R1BA 1US6A 2V7QG 3OR6C 4LFCB 3K58A 5LYJA 4ZBMA 4X20B 1Y67A 1IVSA 1OCOC 4B3MB 4JI0B 2PGGA 1IBMB 2P4KA 1SS3A 3UO2A 5KAIZ 4PDVA 4WFAV 4I4TB 1ENVA 2FB5A 4F6EA 3ETGA 1DF4A 1W59A 2LGWA 4C7UA 3JSLA 4AILC 5LXTA 3SPIA 1SETA 5LGUA 3H1IH 1ZLZA 4Q20A 3ZN1A 4EB6B 3CCSV 1XMOB 2L35A 3CCRV 4FMTA 4IHJB 1YXBA 1MNGA 3ZRVA 3K5LA 2ODMA 4GX5A 3JATB 3T1YB 4J42A 4DV1B 1E1RG 3M7MX 4DW0A 2E5LB 2W6JG 5LP6B
chains in the Genus database with same CATH topology
1OZ0A 1NR7A 3GB7C 4MTOA 4MW3A 4MW8A 3AG1B 1QR9A 3DTUB 4RQEA 3TCUA 3ZMZA 2EINC 4GX1A 4FPPA 3DGEA 1HWYA 2IU3A 3TETA 3R65A 1QVFU 1COWG 1M1KW 1ROPA 2QM8A 4ZKIA 5L3EA 4RUFA 3FB5C 2W0FC 4TT3G 3STLC 5EC2C 5CN0A 3ZN0A 4GT1A 1FS0G 3LDDA 4MVSA 5H6QA 3AG3B 2EJRA 4PA9A 2EILB 2ITCC 1THZA 1K4DC 5EBLC 1H8HG 3I55V 1MG1A 2UXXA 5GW7A 1Q81W 2Z3YA 4HAMA 3CCUV 3ABMC 3SYCA 3H01A 1VQKV 4N21A 2QA4V 1EBOA 1P7BA 3KG2A 3E8BA 3T2MA 3JD1A 3K0DA 4H37A 5B1BB 1PKXA 4MS2A 5L3CA 3W7SA 1Q86W 3VBBA 4XDLA 1K4CC 1PNMA 2DYSB 2WLLB 5B3SC 4WFGA 1TUEB 2IH1C 3OR7C 1DF5A 4TSFG 4I9WA 1UJWB 2XAGA 1YTFD 2WLIB 3AG4B 2Y48A 3P32A 1NQTA 3F7YC 1K92A 3ZRWA 3QO8A 4KP4A 3CP1A 2DYRC 2IJHA 1GM7A 1K8AW 1GM8A 1F51A 5DN6G 2ZR3A 3PJSK 3RW0A 2IU0A 1N8RW 1NR1A 1Y66A 3B8MA 4MTFA 2ATKC 4OXSA 3T1CA 2UXNA 3VOUA 3QO5A 2HVJC 1M57B 3CC7V 1E79G 4PA6A 3MHHC 1GKFA 1K73W 4RUEA 2QM7A 3W7TA 2C2AA 1V54C 3ABLC 1JPXA 4BIZA 3FB6C 1M9NA 2EZOA 3CYOA 4WFBV 3SYAA 3WG7B 2EIMC 4PELA 3CCEV 1QLEB 2IJKA 1VQ9V 4JAUA 3SPCA 3HB3B 1OCOB 4MT8A 4JTDB 2DQ0A 2QEXV 2OT5A 2XOKG 5IYBO 2HR3A 1V55B 2R9RB 4QE7A 4LBEC 3LUTB 4F4LA 1M56B 1MABG 2HVKC 1S3JA 2R9IA 1YTFB 3ASOB 3QNEA 2H94A 2P90A 2QKSA 2OCCC 1CPYA 4P2ZA 4JASA 1KD1W 1VQ8V 1H2GA 4UVAA 3X2QB 2NNUA 3K3WA 3ML0A 2WLKA 1S76D 3OW2U 2BOCC 1QR8A 5J9PC 5IYCO 3E86A 5BZBA 3LDCA 4MVQA 3K08A 5B1OA 1I5XA 3E83A 1FXKB 4P30A 4UVBA 3E2EA 3BEHA 3K9AA 2HLDG 2XASA 3FB8C 1M90W 3K03A 1GK9A 1BMFG 2WLLA 3ZMSA 2XAHA 4G2KA 4JYCA 4LCUC 2OTJV 1G4YB 4MTGA 1BHBA 3MHSC 4WCEV 2ZDIC 3F7VC 4H33A 1RM1C 1DTOA 3CCLV 3F5WC 4UUJC 2WLIA 3SYQA 2JIZG 3LSSA 3CCQV 3FB7C 3ZRXA 2P67A 2X6CA 1AJPA 4CZZA 3OMIB 1JCHA 2X7RB 4XDKA 1FFTB 2GSMB 3ZMTA 2EINB 3T4DA 1K33A 5LGTA 3JYCA 1E1QG 2V1DA 3HPLC 2DQ3A 4QNHB 2F43G 5LHHA 2ZXWC 4JYBA 5IY5C 1S0VA 1OCRC 2DWEC 1VQ4V 1YJ9V 4PDLA 5IDJA 1CP9A 2P6JA 5E1AC 4PA7A 1NKDA 3D3IA 3ZRSA 3CCMV 3ASNC 3RVYA 4P9PA 2WLNA 5L3BA 2EIJC 3W7WA 1JOYA 3CCJV 3ABMB 2EIKC 3GWOA 3T4ZA 4JGSA 2Z5UA 1MOFA 3SPJA 1I5YA 3QO7A 4JTCB 3ABKC 1W0KG 3EFFK 3P30A 1KC8W 4QPJA 3ZJZA 3JD2A 3OGCC 4XDJA 5FL7G 3ETEA 5B3SB 2YSUB 3G71V 1XL6A 2X0LA 4PA4A 2Q67A 3ZMUA 3AG2C 4U7OA 1OCZC 1AI6A 1WPXA 3E8GA 3K0GA 1S72V 4MVOA 3K04A 5EBWC 2Y69C 3ZCCA 5L3FA 3CCVV 1YI2V 2WAMA 3UKMA 1Q7YW 1Y4MA 4MSWC 4GX2A 3ABTA 2X6AA 1GTOA 1OCCC 5LHGA 1AROP 4I5SA 2DYRB 3IC7A 2HKOA 4Z1MG 1GO3F 1WLEA 2M7WA 1VQOV 1FXKA 4GX0A 1K5SA 5H9CA 3EHBB 3E8HA 2JJ2G 1PNKA 4GCZA 1VQPV 1ORQC 1R3LC 4R7CA 1KECA 2CK3G 1P4RA 2WLHA 3JCZA 4LC1A 4FK5C 4L87A 1JJ2U 1VQLV 3CD6V 4WF9V 1K7DA 1RPRA 5C93A 5EBMC 2D3OW 2NLJC 1R6KA 1V54B 3ABLB 1NJIW 1J95A 2MK3A 1SRYA 3ETDA 2OTLV 1KQSU 2DW4A 1VQ5V 2EIMB 4R50A 4E2LA 1H8EG 1NBMG 1YITV 3MD0A 5LBQA 3K06A 1EFRG 2LFRA 4JTAB 1IXMA 2X6BA 3SJQC 3TK1A 3STZC 1BL8A 3FKSG 5HFMA 1GMGA 3WFVA 1EZJA 2WWWA 5LHIA 2A79B 2XAQA 4XBFA 2WLMA 2PI4A 1R73A 5KUKA 3SPGA 2DWDC 4J9ZB 2WSSG 1VQMV 3RVZA 1KP3A 5EC1C 2OCCB 2P7TC 4G28B 4MVMA 2IW5A 4MVRA 4UVCA 2LFSA 2B1IA 3IFXA 4JPRA 2ZQMA 2EZPA 2Q68A 2WPDG 2KB1A 1AJNA 5CMUA 4WFEA 2XAJA 5IYDO 2IJJA 2GHYA 2B1GA 4UV9A 2K1EA 3OE7G 4TWKA 1R3JC 2JDIG 1K3EA 3E89A 4PA3A 5CA3A 4HZ3A 1RM1B 3AG1C 1W2BU 5KUMA 3E35A 4KUMA 3SPHA 1K5QA 1SERA 3CMAV 1NH2D 1F4MA 1QBZA 4JAVA 3ABUA 2JK5C 4MVZA 5LGNA 3RBZA 4MVUA 3W7UA 1AR1B 3OMAB 3LDEA 1GM9A 4QJFB 1R3IC 3CPWU 2YEVB 2HJFC 2IJIA 3AG3C 1YHQV 2EILC 2ZXWB 5B1NA 5IY5B 1OCRB 4X88A 2Q69A 1PD3A 3BY6A 4BAYA 4LP8A 2ZR2A 3SYPA 1YSCA 1MSWD 5CBHA 2A0LA 2AHYA 3ASNB 2EBOA 5B1BC 2EIJB 5CBFA 1R3KC 1ZWIC 4DO2A 2AHZA 4U7NA 4J9YB 2DYSC 3LNMB 4UXNA 2EIKB 1SZTA 3G4SV 4QPKA 5H6RA 4G27B 3CC2V 2HFEC 2XAFA 1KP2A 4WFFA 3ABKB 1YIJV 1FXVA 2ITDC 4KFMA 4FIPC 2H8PC 1QCEA 3AG4C 3E8FA 2BOBC 5EK0A 1PNLA 3CMEV 3IGAC 3AG2B 4R8CA 1FXHA 1RPOA 1OCZB 4ASUG 1G8MA 1NH2B 4DXWA 2HG5C 3JD0A 2Y69B 1K34A 1KKDA 2Q6AA 4FJCC 3G6EV 4PDRA 1JQ0A 3B77A 2PI5A 3OFNG 3D36A 1YJNV 1K9MW 4MTXA 3CC4V 2A9HA 1AI5A 1OCCB 3FYEB 1M57C 3OEHG 1NVPD 1CEZA 2W6IG 1AI4A 4N23A 4R6ZA 4YXWG 1SESA 3FYIB 1QVGU 1LNQA 3M99B 1QLNA 3ZMVA 2QE7G 2ZD9A 2JEUA 2V7QG 3OR6C 4JF3A 4RAIA 3WG7C 1VQ6V 5KA6A 1QLEC 3I56V 4UV8A 1JX9A 1Q82W 3OUSA 2LP7A 4ZBMA 3OAAG 5DM6V 1YJWV 4QIWF 4P9OA 1OCOC 2JEXA 3K79A 3CXCU 3LSQA 2ZDIA 2JJ1G 1JVMA 1S77D 1VQNV 2XNDG 4BW5A 1V55C 4PDVA 4WFAV 1M56C 1ENVA 1BHAA 3AEIA 1VQ7V 3UM7A 3ETGA 1DF4A 1S5HC 3ASOC 5HFLA 4WFHA 2QTOA 4BIUA 2IH3C 2YEVA 1F4NA 1OHHG 4HYOA 3SPIA 3X2QC 3ZRWB 3W7XA 1PL0A 1R6NA 1AJQA 1SETA 5LGUA 4Q20A 3ZN1A 3CCSV 5L3GA 1H38A 5KA5A 4EKWA 1B6QA 4RQFA 1FXKC 5B1AC 2FTKA 4PDMA 3ZIAG 1K97A 3B8NA 3OMNB 4X89A 1L1FA 4FMTA 4CBCA 3CCRV 1NVPB 5L3DA 4QE9A 3ZRVA 2B5UA 3NXSA 3JD4A 2WLJA 3A0RA 3OUFA 1F23A 4GX5A 1XL4A 4X8AA 5B1AB 1W0JG 3JD3A 1AI7A 5CBGA 1DLBA 4RO2A 3OM3B 3OEEG 1E1RG 3SYOA 2W6JG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPR A;  1RPO A;  1GTO A;  3K79 A;  4DO2 A;  1F4M A;  1NKD A;  1PD3 A;  2IJK A;  2IJH A;  2IJI A;  2IJJ A;  1GMG A;  1ROP A;  2GHY A;  1B6Q A;  1F4N A; 
#chains in the Genus database with same CATH topology
 3T1H O;  1GN3 A;  1WA8 A;  4MW8 A;  5JH7 B;  3AG1 B;  4JI8 B;  4FPP A;  1V9P A;  4CH5 A;  1COW G;  4I55 B;  4JV5 B;  2QM8 A;  3CHX A;  2DN9 A;  4JI2 B;  1Z5V A;  4MVS A;  2EIL B;  2ITC C;  3L70 H;  4TV8 B;  5EBL C;  4FM0 A;  3I55 V;  1MG1 A;  1Q81 W;  4HAM A;  2Q7E A;  3H01 A;  2QA4 V;  1XNQ B;  4X20 A;  3JD1 A;  3CRA A;  3CJH B;  5L3C A;  4GLX A;  1K4C C;  2DYS B;  2WLL B;  2P06 A;  1N34 O;  1TUE B;  2HHH B;  4I4T A;  1AP6 A;  4TSF G;  2AZ0 A;  4DR6 O;  2QWQ B;  1NT2 B;  3G67 A;  1YTF D;  2WLI B;  3P32 A;  1NQT A;  1MMM A;  2UXB B;  3QO8 A;  4KP4 A;  4EB6 A;  3SGI A;  1GM7 A;  4GYC B;  1F51 A;  3PJS K;  3RW0 A;  1NR1 A;  3B8M A;  3T1C A;  2RN9 A;  1XOU A;  5TIS Z;  4DR1 O;  4X1K B;  3JAT A;  1ZAU A;  4I50 B;  2QM7 A;  2PUS A;  1JPX A;  4UCV A;  3CYO A;  2EIM C;  2XT9 A;  1QLE B;  1LR1 A;  1ZL8 A;  2CE4 A;  5DED A;  2YXH A;  4WBN B;  3SPC A;  1A32 A;  4DV2 B;  5JH7 A;  1BS3 A;  1KYO F;  2QEX V;  2OT5 A;  2XOK G;  2HR3 A;  1V55 B;  2FL4 A;  1URF A;  1YF2 A;  5GTH Z;  2HVK C;  2R9I A;  5JQG B;  3ASO B;  4JI1 B;  2QKS A;  3OTO B;  1VQ8 V;  1YZB A;  3X2Q B;  5IJ9 A;  4JI3 B;  1HR0 B;  1SF9 A;  4TV8 A;  2WLK A;  1S76 D;  5J9P C;  1Z5W A;  4YHH O;  3E86 A;  5BZB A;  4MVQ A;  3CEI A;  2VQE B;  3E83 A;  4P30 A;  5LMN B;  3K9A A;  3AG7 A;  4DV5 O;  1M90 W;  1SZX A;  3QF7 A;  3K03 A;  1XBL A;  3S3X A;  1BMF G;  2WLL A;  2OTJ V;  2XAH A;  4G2K A;  4LCU C;  1JFF B;  3R66 A;  3RN4 A;  3SJB C;  4DR3 B;  3JSN A;  4WCE V;  1CXZ B;  3K9S A;  2WLI A;  1G6U A;  2CGN A;  2FKX A;  3ZRX A;  2A3Q A;  2VQF O;  1FFT B;  3ZMT A;  2JVD A;  1E1Q G;  2V1D A;  3ZHU A;  5BR8 B;  1VAR A;  5IJ0 B;  2F43 G;  2IM9 A;  2DWE C;  3DXR B;  1VQ4 V;  2KKW A;  4HBN A;  5IDJ A;  1CP9 A;  3J7A U;  2P6J A;  4X1K A;  3CXH F;  4PA7 A;  1NKD A;  3ZRS A;  4I50 A;  4P9P A;  1N0N A;  2EIJ C;  4DV6 O;  4LF7 B;  4JI6 O;  2EIK C;  4GKK O;  3SPJ A;  3CS5 A;  5JCO A;  1W0K G;  2PZS A;  3JAR B;  5JVD B;  3ZJZ A;  4LF9 O;  1Y6X A;  2CGO A;  4XDJ A;  4AI8 A;  3BHP A;  5JQG A;  4U7O A;  1OCZ C;  3J80 N;  3E8G A;  1BSM A;  1S72 V;  3K04 A;  1FFX B;  3MDS A;  3N27 A;  5L3F A;  1AIL A;  2WAM A;  1Y4M A;  1WB8 A;  4GX2 A;  2X6A A;  1OCC C;  5LHG A;  2DYR B;  3H1J H;  2HKO A;  4DV7 O;  1VQO V;  4GX0 A;  4O2B B;  3EHB B;  4NXN B;  2JJ2 G;  2UUA B;  1HNW O;  5K1X A;  4GCZ A;  4LFB O;  2ZM6 O;  4R7C A;  3HKD B;  3JCZ A;  2WLH A;  4LC1 A;  4FK5 C;  1JFF A;  4YY3 O;  3JAL B;  4WF9 V;  4YIP A;  3L75 H;  3ABL B;  4J11 A;  4L8J A;  4FLZ A;  2DW4 A;  4EFE A;  4OX9 B;  5LBQ A;  2CTR A;  3ZHQ A;  4GZR B;  3IC9 A;  3UO3 A;  4BWA A;  4FLT A;  3C3S A;  1GMG A;  1ZSP A;  1IBL B;  2HEP A;  2PF4 E;  3FD9 A;  2WWW A;  5IJ0 A;  5LHI A;  2A79 B;  4XBF A;  4A5U B;  2DWD C;  4J9Z B;  3DXR A;  4ZI7 B;  4DUY O;  2OIG A;  3H1K H;  2CTP A;  4MVM A;  1AVM A;  3D3Q A;  2D2C B;  2B1I A;  5J2U A;  2ZQM A;  1GN4 A;  5IYD O;  4PD4 F;  4JI7 B;  5JVD A;  4UV9 A;  1KMI Z;  5ITZ B;  4GKJ O;  1N0J A;  3UCS C;  1WAZ A;  5LP6 C;  5BXZ A;  1K3E A;  3E89 A;  1N33 B;  1IXB A;  3SJA C;  5CA3 A;  2QR4 A;  4KXR A;  4LFA O;  4HZ3 A;  3AG1 C;  1FFX A;  4KUM A;  2NN4 A;  5KX5 B;  2KSD A;  1ZX3 A;  1QBZ A;  4JAV A;  1VP7 A;  1TAE A;  4MVU A;  1AR1 B;  4CS4 A;  4QJF B;  4UB6 Z;  2YEV B;  1YHQ V;  2EIL C;  4O2B A;  3ZBH A;  5IY5 B;  1HNX O;  2Q69 A;  1PD3 A;  3BY6 A;  1TGO A;  1EN6 A;  3K5M A;  2ZR2 A;  3HKD A;  1R6T A;  4PV1 B;  3FFQ A;  3I5D A;  3JAL A;  2AHY A;  2EBO A;  3RYF B;  4O4J A;  1PL4 A;  1GN2 A;  3APO A;  5CBF A;  1R3K C;  2DYS C;  3LNM B;  2A7W A;  3CC2 V;  4B7K A;  4B3R B;  3ABK B;  1N32 O;  3LSU A;  3ZHV A;  3U10 A;  2ITD C;  2P22 C;  4FIP C;  4F6R B;  1IUR A;  3Q4H B;  1QCE A;  4K0K O;  2QKA A;  3TXS A;  5EK0 A;  4O2A B;  4ZI7 A;  5IT9 N;  4DXW A;  1J5E B;  2Y69 B;  3NR7 A;  1KKD A;  1JQ0 A;  3OFN G;  3CC4 V;  1WPB A;  4J7J A;  3CRM A;  1CEZ A;  2W6I G;  1AI4 A;  4N23 A;  5JJE B;  4K35 A;  1QVG U;  1U96 A;  1MSD A;  4NXM O;  5KHH A;  4RAI A;  4JF3 A;  1QLE C;  1PPJ H;  3OUS A;  4ZIB A;  5DM6 V;  3OAA G;  4QIW F;  5IWA O;  2JEX A;  1O9H A;  1JA8 A;  5FPO A;  3KKY A;  4NTX A;  2XND G;  1V55 C;  5GTI Z;  4OPH A;  1I94 O;  1QHT A;  1S5H C;  3ASO C;  5HFL A;  2IH3 C;  2Q0A A;  3F5T A;  2YC0 A;  4JAA A;  2YEV A;  3X2Q C;  4LF4 O;  1R6N A;  1AJQ A;  5L3G A;  5LMU B;  1H38 A;  2XUM A;  1XRE A;  4RQF A;  5B1A C;  4PDM A;  4D7T A;  3RYF A;  3OMN B;  4X89 A;  4CBC A;  5L3D A;  4LF6 B;  2B5U A;  1NS1 A;  2F4V O;  1FYJ A;  1EN4 A;  2WLJ A;  1F23 A;  1RFY A;  4AQY B;  2GDS A;  4X8A A;  4JI4 B;  1W0J G;  2VS0 A;  4RO2 A;  4F6R A;  3Q4H A;  3QTC A;  2YS8 A;  3A0B Z;  2P5O A;  1L0N H;  3JCU Z;  3S3W A;  4O2A A;  3G6B A;  4OGQ B;  3DTU B;  3C3T A;  1EZV H;  3TET A;  4IYH A;  3R65 A;  4FLY A;  4H0L B;  1IDS A;  4LF5 O;  5CN0 A;  3SR2 C;  4J10 A;  3KZI Z;  1BT8 A;  5H6Q A;  3AG3 B;  2EJR A;  5A9G A;  1H2N A;  1QQC A;  3BVO A;  4JYA O;  3CCU V;  3SYC A;  1VQK V;  4PI0 A;  2RMK B;  3CSX A;  3KG2 A;  4CS2 A;  1H2L A;  1F7Y A;  2RCV A;  3W7S A;  3WB2 A;  3VBB A;  2LGQ A;  1PNM A;  1FJG B;  2IH1 C;  4NB5 A;  3OR7 C;  5GON B;  4Z1V A;  2ZE6 A;  4I9W A;  1UJW B;  2XAG A;  2Y4U A;  2YUA A;  1U97 A;  3T1H B;  1I08 A;  2QWO B;  1B04 A;  1UPG A;  1IX9 A;  3JAK A;  4UFZ A;  3VQV A;  4CC6 A;  5KHI A;  4KHP B;  2DYR C;  2IJH A;  1GM8 A;  2ZR3 A;  4DR5 B;  2IU0 A;  1N8R W;  4H13 B;  4MTF A;  4OXS A;  3BAB A;  3QO5 A;  1E79 G;  4PA6 A;  2CH7 A;  1GKF A;  2OIE A;  3MHH C;  4JZG A;  4RUE A;  5CA1 B;  1N36 B;  4DR4 O;  2Y0I A;  1QNM A;  3ABL C;  1LUV A;  3FB6 C;  3BCC H;  4X62 O;  4WFB V;  3WG7 B;  3CCE V;  4JAU A;  2N74 A;  2DQ0 A;  1HDJ A;  4NTY A;  4LNU B;  1N34 B;  4FM2 A;  4QE7 A;  4LBE C;  3LUT B;  1M56 B;  4DR6 B;  2QWR B;  2LW7 A;  1CPY A;  1G1X B;  1WN7 A;  4P2Z A;  1SQX H;  1KD1 W;  1H2G A;  2NNU A;  3K3W A;  1SQF A;  2BOC C;  4DV4 O;  1QR8 A;  1Q6I A;  3LDC A;  1P49 A;  4ZOL B;  3K5N A;  3BEH A;  2HLD G;  2XAS A;  1GK9 A;  3WU2 Z;  1ZL8 B;  4MTG A;  5GON A;  1MZE A;  5E79 Z;  3IAY A;  1DTO A;  3ETQ A;  3CCL V;  5JJJ B;  4X66 O;  4NYK A;  2FYU H;  4UCU A;  2X6C A;  1AJP A;  1NTZ H;  2LQT A;  4XDK A;  3QVN A;  1K33 A;  2P4V A;  4RWU A;  5LHH A;  1JR9 A;  5IJ9 B;  5IY5 C;  1S0V A;  2ZNI A;  1VF6 A;  3CE2 A;  4PDL A;  1PM9 A;  5E1A C;  3ZHR A;  5CA1 A;  2F1M A;  3D3I A;  2UXD O;  5DEC A;  3SJC C;  3BA8 A;  4YJ3 B;  1NTM H;  4DR7 O;  1JOY A;  3CCJ V;  3RYH B;  3ABM B;  4FVM A;  4JGS A;  4LFC O;  3QO7 A;  2UXC B;  3ABK C;  3EFF K;  3P30 A;  2Y4T A;  4QPJ A;  4DV5 B;  1QU7 A;  4D6T H;  3JD2 A;  1IBM O;  4CH6 A;  4LNU A;  5FL7 G;  5B3S B;  1BZK A;  3ZMU A;  1I0H A;  3K0G A;  3ZHS A;  2Y69 C;  3ZCC A;  4B7E A;  1XMQ B;  2ZIM A;  3ABT A;  2VQF B;  2JS3 A;  4O4L B;  4UCT A;  5KAF Z;  1ARO P;  2N05 A;  3IC7 A;  3CB2 A;  3B4S A;  4Z1M G;  3OT7 A;  5EIB C;  2M7W A;  1BQ0 A;  2ZIO A;  1VF7 A;  4ZOL A;  3E8H A;  1R3L C;  1P4R A;  1JJ2 U;  3CD6 V;  1K7D A;  5C93 A;  3T1Y O;  1UFI A;  1TA8 A;  1V54 B;  4DV6 B;  1NJI W;  4GKK B;  4R50 A;  2E5L O;  1YIT V;  4ICG A;  1XDC A;  3MD0 A;  2VRZ A;  1JJO A;  2E74 B;  2G38 A;  2GV9 A;  3K06 A;  4JTA B;  1IXM A;  2DOS A;  5D5Q A;  4FZ1 A;  3STZ C;  4X1I A;  4JI8 O;  3FKS G;  3WFV A;  1EZJ A;  4Q6G A;  5FPR A;  4LF8 O;  4JV5 O;  3ZED A;  1VQM V;  2WSS G;  2Y0P A;  1KP3 A;  3UQ8 A;  3KCX A;  2OCC B;  3ZHT A;  3L72 H;  2IW5 A;  4E4E A;  2KG7 B;  4MVR A;  4YJ3 A;  3IFX A;  4JPR A;  4W4K A;  2Q8V A;  3RYH A;  2WPD G;  2KB1 A;  1AJN A;  2QJ1 A;  5CMU A;  4WFE A;  4QGP A;  2GHY A;  2B1G A;  3H1L H;  1HNW B;  4DRX A;  4TWK A;  2UUC O;  3VQW A;  2HHH O;  4X64 O;  1W2B U;  4GUN A;  1BGY H;  1K5Q A;  1SER A;  2CTW A;  2UXB O;  4O4L A;  4MVZ A;  1SQB H;  4K8Z A;  4DV3 B;  5D5P A;  4LH6 A;  3CPW U;  2F93 B;  2HJF C;  3AG3 C;  2E75 B;  4DUY B;  1OCR B;  4X88 A;  5EIB D;  5J2U B;  3L74 H;  4BAY A;  1DGS A;  1YSC A;  4FLU A;  4JZ2 A;  3ASN B;  5EYP A;  4NKG B;  1ZWI C;  1YVW A;  1X4T A;  4DR2 B;  4J9Y B;  3IJ4 A;  4FFK A;  1SZT A;  3G4S V;  4QPK A;  5H6R A;  1HNZ B;  2XAF A;  3GWK C;  4CS3 A;  1FXV A;  4DV2 O;  2QTS A;  4GKJ B;  2ZNJ A;  3AG2 B;  4LFA B;  4R8C A;  4B3T B;  2O57 A;  4O4I B;  4EFB A;  1NH2 B;  4FZ0 A;  3JD0 A;  4JI1 O;  3G6E V;  1BE3 H;  1TVK A;  2KG7 A;  2PI5 A;  2F66 C;  3D36 A;  1YJN V;  4MTX A;  1HR0 O;  1VF6 C;  3BFR A;  1XI1 A;  1XNR B;  2YXY A;  2BTQ A;  2YIC A;  3DC6 A;  5CB4 A;  5LL6 Y;  2VQE O;  4B3S B;  1HNX B;  2F23 A;  1L0L H;  4IT5 A;  3AK3 A;  2K9P A;  2ZD9 A;  4O4J B;  2JEU A;  3WG7 C;  3U0Z A;  1VQ6 V;  5KA6 A;  5H2F Z;  4UV8 A;  1JX9 A;  2LP7 A;  4LH7 A;  4J7K A;  2WA3 A;  3ZS8 C;  1YJW V;  1D5N A;  4P9O A;  3K79 A;  4DR3 O;  2ZDI A;  1T5E A;  1VF5 B;  2JJ1 G;  1S77 D;  1VQN V;  1M56 C;  2ZE5 A;  1N32 B;  1VQ7 V;  5KHJ A;  3OD4 A;  4X65 B;  3O65 A;  3BAA A;  1F4N A;  1YEW A;  2AXT Z;  1SQQ H;  5BR8 O;  1GAX A;  1XUQ A;  3ZRW B;  3W7X A;  4KL1 A;  4EKW A;  1FPO A;  4FLX A;  2FTK A;  2OCH A;  3B8N A;  1L1F A;  1Q6H A;  2VWK A;  1NVP B;  4DUZ B;  4QE9 A;  3JD4 A;  3OUF A;  2JGD B;  2ETN A;  5KLV H;  3JD3 A;  4JYY A;  4NXM B;  5CBG A;  3OM3 B;  2WA4 A;  2ZT9 B;  1OZ0 A;  1NR7 A;  5IWA B;  2RQ6 A;  4MTO A;  4RQE A;  1QR9 A;  4O4I A;  4GX1 A;  1HWY A;  1QVF U;  3P3N A;  1M1K W;  1ROP A;  4ZKI A;  3HR0 A;  5L3E A;  4RUF A;  3FB5 C;  2V4D A;  2W0F C;  4TT3 G;  5KMG B;  3STL C;  5EC2 C;  1FAF A;  3ZN0 A;  4GT1 A;  1KUQ A;  2F95 B;  4AHC A;  4PA9 A;  4LF4 B;  3MAQ A;  1H8H G;  5GW7 A;  3N2G A;  3ABM C;  3AK1 A;  3SDL A;  4BR6 A;  3E8B A;  3K0D A;  5B1B B;  1PKX A;  2YXL A;  1Q86 W;  4XDL A;  2BCC H;  2W0X A;  1KU9 A;  5B3S C;  2QDO A;  5FNV B;  3HKB B;  4OX9 O;  1DF5 A;  3FAV B;  1EN5 A;  2UU9 O;  4TUY B;  1IBL O;  3AG4 B;  2Y48 A;  3EVK A;  3ZRW A;  1BCC H;  1SC5 B;  2E3C A;  5DN6 G;  3G80 A;  1Y66 A;  2M6Y A;  3RFR A;  4LF5 B;  2IBZ H;  5JJN B;  1M57 B;  3CC7 V;  1Q8I A;  2JGD A;  1WJZ A;  3A2F A;  5JCO C;  3W7T A;  2GUZ B;  1IBK B;  2OYQ A;  1V54 C;  1WP7 A;  2ADP A;  2CTQ A;  4BIZ A;  1M9N A;  2EZO A;  1PP9 H;  2EX3 A;  2FML A;  2IJK A;  1GRJ A;  1VQ9 V;  3JAW B;  3HB3 B;  4JTD B;  4DV0 O;  4K8X A;  1VEW A;  3K57 A;  1SQP H;  3JAS B;  2GTS A;  1NTK H;  2YDE A;  4F4L A;  3TXQ A;  1P7G A;  1MAB G;  3JAK B;  5KMG A;  2P90 A;  4UB8 Z;  1IZ3 A;  2L6L A;  2OCC C;  3A0H Z;  1TUB B;  4JAS A;  2AGA A;  3D36 C;  4UVA A;  3B09 A;  4FFB A;  3OW2 U;  1FKA O;  5IYC O;  2CH7 B;  3K08 A;  5B1O A;  1I5X A;  1N4C A;  1FXK B;  3FB8 C;  1G4Y B;  1BHB A;  5FNV A;  4DR4 B;  3HKB A;  2ARH A;  3MHS C;  3FAV A;  4IYI A;  3HKE B;  3K5O A;  2ZDI C;  3F7V C;  4X62 B;  3F5W C;  1EM1 A;  4TUY A;  3LSS A;  1DK1 A;  3CWB H;  1D5A A;  3OMI B;  2VWJ A;  1H2S B;  2Q4P A;  4U3J B;  2EIN B;  1P84 F;  3RYC B;  1J5E O;  3JYC A;  3HPL C;  2NR5 A;  1OCR C;  1YJ9 V;  1XEQ A;  3VQX A;  1VMG A;  3ASN C;  4J7Z A;  2GUZ A;  3W7W A;  2YIB A;  3GWO A;  3T4Z A;  2AW9 A;  1YCI A;  2Z5U A;  3RGB A;  1I5Y A;  3H9V A;  3JAW A;  3JAS A;  3ETE A;  2YSU B;  5B66 Z;  1XL6 A;  2X0L A;  3RYI B;  2PYJ A;  3AG2 C;  1Y76 B;  3ZX6 A;  2GTA A;  1Q6U A;  1TUB A;  3CCV V;  3UKM A;  1Q7Y W;  4MSW C;  1NI8 A;  2RJZ A;  4NR1 A;  1GO3 F;  1WP8 A;  2PYL A;  4TQF A;  5KHG A;  1FXK A;  1K5S A;  3OGI B;  4LF6 O;  4X1Y B;  3N2K B;  2UXD B;  4AQY O;  5EZY B;  3HKE A;  2D3O W;  2NLJ C;  1M5I A;  1SRY A;  1KQS U;  2JRI A;  2KQX A;  1Q5O A;  3O9O A;  1EFR G;  2X6B A;  4U3J A;  4O4H B;  3SJQ C;  3TK1 A;  1BL8 A;  2QWP B;  5HFM A;  3RYC A;  2YI9 A;  2WLM A;  1R73 A;  3B2E E;  3SPG A;  5F2V O;  4JI5 O;  5EC1 C;  4G28 B;  2LFS A;  3HKC B;  4DR1 B;  2Q68 A;  2UUB O;  2XAJ A;  3K59 A;  2IJJ A;  2ILM A;  2K1E A;  4I0X B;  3OE7 G;  1FJG O;  4PA3 A;  3RYI A;  3BPZ A;  5IE9 A;  1Y76 A;  1RM1 B;  5BMV B;  1SQV H;  3SPH A;  4X1I B;  2OWO A;  3CMA V;  1NH2 D;  2YID A;  1F4M A;  3CRC A;  1VIB A;  3ABU A;  4DK1 A;  4KHP O;  4I7Z B;  3OMA B;  1Q90 D;  4LF8 B;  4DR5 O;  2ZXW B;  5B1N A;  3DC5 A;  1XIL A;  2Q7G A;  5KHK A;  2AZ2 A;  4X1Y A;  4LP8 A;  3N2K A;  4YHH B;  1M93 A;  1MSW D;  5EZY A;  2MW2 B;  4IIJ B;  2A0L A;  1N36 O;  5B1B C;  4B3M O;  3B40 A;  1SQG A;  4TOI A;  4JI0 O;  4DO2 A;  2AHZ A;  4UXN A;  1I7F A;  4DRX B;  2QSA A;  1ZUQ A;  4ZHQ B;  3RT3 C;  4K3A A;  4DYL A;  1YIJ V;  1B06 A;  4KFM A;  4O4H A;  2H8P C;  2UUC B;  3AG4 C;  1AP5 A;  2RNB A;  2BOB C;  4X64 B;  1AR5 A;  3CME V;  3IGA C;  1RPO A;  4BW9 A;  1XMO O;  5K1P A;  2Q6A A;  4FJC C;  4IGG A;  3B77 A;  3HKC A;  2A9H A;  2A06 H;  1NVP D;  1M57 C;  1BQZ A;  3FYI B;  4HNA B;  3FX7 A;  1LNQ A;  1QLN A;  4DV1 O;  5EYP B;  4IHJ A;  4I0X A;  4JI6 B;  2JS5 A;  4W4L A;  3I56 V;  3CRQ A;  1MA1 A;  3TJT A;  1Q82 W;  3RWR D;  3CXC U;  5LOV B;  3LSQ A;  1SA0 B;  4LF9 B;  5BMV A;  1JVM A;  3VQY A;  4BW5 A;  5LP6 A;  1BHA A;  3AEI A;  3UM7 A;  4WFH A;  2QTO A;  4BIU A;  4JI2 O;  1TVK B;  1OHH G;  4I55 A;  4HYO A;  3A8T A;  1PL0 A;  2RDC A;  5KA5 A;  2Z0A A;  4DV7 B;  2BTQ B;  4IIJ A;  1B6Q A;  1XNQ O;  1FXK C;  5CB4 B;  2LW1 A;  3ZIA G;  1K97 A;  4LFB B;  4UCO A;  2ZM6 B;  3NXS A;  3A0R A;  1GN6 A;  1MZF A;  1H2K A;  1XL4 A;  4ZHQ A;  4YY3 B;  2ZIN A;  3APQ A;  3E22 B;  2UXC O;  5B1A B;  2N04 A;  1AI7 A;  3CJH A;  1DLB A;  3OEE G;  2GBO A;  3SYO A;  2PY5 A;  1WPX A;  2ZKO A;  2BSK B;  3BA9 A;  3L9D A;  3GB7 C;  4MW3 A;  4PI2 A;  3TCU A;  3ZMZ A;  2EIN C;  1L8D A;  3DGE A;  2IU3 A;  1XMQ O;  4YIO A;  1FS0 G;  3LDD A;  4HNA A;  1THZ A;  1K4D C;  3DSQ A;  3LNN A;  4Z2W A;  2UXX A;  2E76 B;  2Z3Y A;  1S5J A;  4DW1 A;  4N21 A;  1EBO A;  1P7B A;  2YIB D;  3JAM N;  3T2M A;  4H37 A;  5LOV A;  4MS2 A;  1SA0 A;  1GH6 A;  1S5L Z;  1Q3E A;  4WFG A;  2QM4 A;  4WBN A;  3CRR A;  3TGU H;  1KKC A;  1O9G A;  2DJV A;  4PHZ A;  3OTO O;  3F7Y C;  1K92 A;  5CA0 B;  4JI3 O;  3CP1 A;  1XQ8 A;  1HP8 A;  3P3P A;  1K8A W;  1JMK C;  3WB1 A;  5LMN O;  3UT5 B;  2ATK C;  2UXN A;  3VOU A;  3N2G B;  2HVJ C;  2BE3 A;  5IYZ B;  3BRC A;  2BTO A;  1NZ6 A;  1K73 W;  3E22 A;  4CH3 A;  2C2A A;  4UCR A;  4FLW A;  3SYA A;  1AR4 A;  4PEL A;  2H3O A;  2BSK A;  1OCO B;  4MT8 A;  4K0K B;  5IYB O;  2R9R B;  1S3J A;  1YTF B;  3EXA A;  2UU9 B;  3ICX A;  3QNE A;  2H94 A;  4DV3 O;  2XTA A;  1Q43 A;  2Q9L A;  4LR3 A;  1M4U A;  3ML0 A;  4UCS A;  4CC5 A;  4LF7 O;  4LWS B;  4ABM A;  4UVB A;  3E2E A;  2CAZ C;  1WB7 A;  3L71 H;  4DR2 O;  3ZMS A;  4JYC A;  1HNZ O;  1Z2G A;  4H33 A;  3J81 N;  1RM1 C;  3JAR A;  2LO1 A;  4UUJ C;  3SYQ A;  2JIZ G;  3CCQ V;  1I94 B;  4CH4 A;  3FB7 C;  2P67 A;  2EJ7 A;  5CA0 A;  4CZZ A;  1JCH A;  2X7R B;  4DV0 B;  4B3T O;  2GSM B;  3T4D A;  1RSO B;  5H5N A;  1Y74 B;  5LGT A;  4NVP A;  2XHB A;  2DQ3 A;  4QNH B;  2QGN A;  2ZXW C;  4JYB A;  4J41 A;  5J2T B;  3UT5 A;  2LJ2 A;  1XNR O;  4NXN O;  4FFB B;  1SKV A;  2UUA O;  5IYZ A;  2EUL A;  2YI8 A;  3CCM V;  3RVY A;  5FLX N;  1LUW A;  4B08 A;  2WLN A;  5L3B A;  4B3S O;  4TQD A;  2F4V B;  4U3F H;  2DE0 X;  1MOF A;  5BY1 A;  4JTC B;  2JGU A;  1KC8 W;  3D8C A;  4DK0 A;  3OGC C;  2CUG A;  3G71 V;  4PA4 A;  2Q67 A;  2R70 A;  2R72 A;  1AI6 A;  1XHZ A;  2HJD A;  1PV0 A;  5C8Y B;  2Q5Z A;  4MVO A;  5EBW C;  3KCY A;  4X65 O;  4I9Q A;  1YI2 V;  1HW7 A;  3L73 H;  5A2Q N;  1GTO A;  4I5S A;  2B9Z A;  3QG5 A;  1ZTE A;  4LWS A;  1WLE A;  2Q0O C;  3C90 A;  5H9C A;  4JI7 O;  4JYA B;  1PNK A;  4DUZ O;  1VQP V;  1ORQ C;  4EEQ A;  1KEC A;  2CK3 G;  5LA6 B;  2ZCE A;  4PJ0 Z;  4L87 A;  1VQL V;  1N33 O;  1RPR A;  5EBM C;  3THO A;  1R6K A;  1J95 A;  2MK3 A;  3ETD A;  1X59 A;  5ITZ A;  4NTW A;  2OTL V;  1VQ5 V;  2EIM B;  4E2L A;  1OV9 A;  1H8E G;  1NBM G;  2LFR A;  1RSO A;  5KX5 A;  1Y74 A;  4TV9 B;  1YDX A;  2XAQ A;  5J2T A;  2PI4 A;  1NU1 H;  1KBH A;  5KUK A;  3RVZ A;  1RP3 B;  2P7T C;  2ADQ B;  1KB9 F;  4YJ2 B;  3WB0 A;  1AB3 A;  4UVC A;  4D7S A;  1WNS A;  2EZP A;  2Q73 A;  4B3R O;  2ZE8 A;  1R3J C;  2JDI G;  3M8A A;  5LYJ B;  4FM1 A;  2R9A A;  5C8Y A;  5KUM A;  3E35 A;  5B5E Z;  2PTM A;  3OTF A;  4OPA A;  2ZE7 A;  2QKC A;  2JK5 C;  2CDY A;  5LGN A;  3RBZ A;  3W7U A;  3LDE A;  1GM9 A;  1R3I C;  2IJI A;  5LXT B;  2DMX A;  4H44 B;  3CX5 F;  4JI5 B;  4DV4 B;  3SYP A;  5LA6 A;  5CBH A;  1IBK O;  2EIJ B;  1XHX A;  1FD9 A;  4FLV A;  3AK2 A;  4U7N A;  4J80 A;  2UUB B;  2EIK B;  4G27 B;  2HFE C;  1KP2 A;  4WFF A;  1D2D A;  3PN1 A;  4X66 B;  2YIA A;  4TV9 A;  3H1H H;  4IL6 Z;  2QWN B;  3E8F A;  4X9Q A;  1PNL A;  4BIO A;  1WA8 B;  1FXH A;  1OCZ B;  4ASU G;  2HP8 A;  1G8M A;  1H2M A;  1OJH A;  5AG2 A;  5LMU O;  2HG5 C;  1K34 A;  4PDR A;  4YJ2 A;  2Q7H A;  1K9M W;  1B3Q A;  1AI5 A;  1OCC B;  3GVM A;  3FYE B;  3OEH G;  4R6Z A;  4YXW G;  5JWP A;  1SES A;  4JI4 O;  3M99 B;  3ZMV A;  2QE7 G;  4DR7 B;  3U11 A;  1R1B A;  1US6 A;  2V7Q G;  3OR6 C;  4LFC B;  3K58 A;  5LYJ A;  4ZBM A;  4X20 B;  1Y67 A;  1IVS A;  1OCO C;  4B3M B;  4JI0 B;  2PGG A;  1IBM B;  2P4K A;  1SS3 A;  3UO2 A;  5KAI Z;  4PDV A;  4WFA V;  4I4T B;  1ENV A;  2FB5 A;  4F6E A;  3ETG A;  1DF4 A;  1W59 A;  2LGW A;  4C7U A;  3JSL A;  4AIL C;  5LXT A;  3SPI A;  1SET A;  5LGU A;  3H1I H;  1ZLZ A;  4Q20 A;  3ZN1 A;  4EB6 B;  3CCS V;  1XMO B;  2L35 A;  3CCR V;  4FMT A;  4IHJ B;  1YXB A;  1MNG A;  3ZRV A;  3K5L A;  2ODM A;  4GX5 A;  3JAT B;  3T1Y B;  4J42 A;  4DV1 B;  1E1R G;  3M7M X;  4DW0 A;  2E5L B;  2W6J G;  5LP6 B; 
#chains in the Genus database with same CATH homology
 1OZ0 A;  1NR7 A;  3GB7 C;  4MTO A;  4MW3 A;  4MW8 A;  3AG1 B;  1QR9 A;  3DTU B;  4RQE A;  3TCU A;  3ZMZ A;  2EIN C;  4GX1 A;  4FPP A;  3DGE A;  1HWY A;  2IU3 A;  3TET A;  3R65 A;  1QVF U;  1COW G;  1M1K W;  1ROP A;  2QM8 A;  4ZKI A;  5L3E A;  4RUF A;  3FB5 C;  2W0F C;  4TT3 G;  3STL C;  5EC2 C;  5CN0 A;  3ZN0 A;  4GT1 A;  1FS0 G;  3LDD A;  4MVS A;  5H6Q A;  3AG3 B;  2EJR A;  4PA9 A;  2EIL B;  2ITC C;  1THZ A;  1K4D C;  5EBL C;  1H8H G;  3I55 V;  1MG1 A;  2UXX A;  5GW7 A;  1Q81 W;  2Z3Y A;  4HAM A;  3CCU V;  3ABM C;  3SYC A;  3H01 A;  1VQK V;  4N21 A;  2QA4 V;  1EBO A;  1P7B A;  3KG2 A;  3E8B A;  3T2M A;  3JD1 A;  3K0D A;  4H37 A;  5B1B B;  1PKX A;  4MS2 A;  5L3C A;  3W7S A;  1Q86 W;  3VBB A;  4XDL A;  1K4C C;  1PNM A;  2DYS B;  2WLL B;  5B3S C;  4WFG A;  1TUE B;  2IH1 C;  3OR7 C;  1DF5 A;  4TSF G;  4I9W A;  1UJW B;  2XAG A;  1YTF D;  2WLI B;  3AG4 B;  2Y48 A;  3P32 A;  1NQT A;  3F7Y C;  1K92 A;  3ZRW A;  3QO8 A;  4KP4 A;  3CP1 A;  2DYR C;  2IJH A;  1GM7 A;  1K8A W;  1GM8 A;  1F51 A;  5DN6 G;  2ZR3 A;  3PJS K;  3RW0 A;  2IU0 A;  1N8R W;  1NR1 A;  1Y66 A;  3B8M A;  4MTF A;  2ATK C;  4OXS A;  3T1C A;  2UXN A;  3VOU A;  3QO5 A;  2HVJ C;  1M57 B;  3CC7 V;  1E79 G;  4PA6 A;  3MHH C;  1GKF A;  1K73 W;  4RUE A;  2QM7 A;  3W7T A;  2C2A A;  1V54 C;  3ABL C;  1JPX A;  4BIZ A;  3FB6 C;  1M9N A;  2EZO A;  3CYO A;  4WFB V;  3SYA A;  3WG7 B;  2EIM C;  4PEL A;  3CCE V;  1QLE B;  2IJK A;  1VQ9 V;  4JAU A;  3SPC A;  3HB3 B;  1OCO B;  4MT8 A;  4JTD B;  2DQ0 A;  2QEX V;  2OT5 A;  2XOK G;  5IYB O;  2HR3 A;  1V55 B;  2R9R B;  4QE7 A;  4LBE C;  3LUT B;  4F4L A;  1M56 B;  1MAB G;  2HVK C;  1S3J A;  2R9I A;  1YTF B;  3ASO B;  3QNE A;  2H94 A;  2P90 A;  2QKS A;  2OCC C;  1CPY A;  4P2Z A;  4JAS A;  1KD1 W;  1VQ8 V;  1H2G A;  4UVA A;  3X2Q B;  2NNU A;  3K3W A;  3ML0 A;  2WLK A;  1S76 D;  3OW2 U;  2BOC C;  1QR8 A;  5J9P C;  5IYC O;  3E86 A;  5BZB A;  3LDC A;  4MVQ A;  3K08 A;  5B1O A;  1I5X A;  3E83 A;  1FXK B;  4P30 A;  4UVB A;  3E2E A;  3BEH A;  3K9A A;  2HLD G;  2XAS A;  3FB8 C;  1M90 W;  3K03 A;  1GK9 A;  1BMF G;  2WLL A;  3ZMS A;  2XAH A;  4G2K A;  4JYC A;  4LCU C;  2OTJ V;  1G4Y B;  4MTG A;  1BHB A;  3MHS C;  4WCE V;  2ZDI C;  3F7V C;  4H33 A;  1RM1 C;  1DTO A;  3CCL V;  3F5W C;  4UUJ C;  2WLI A;  3SYQ A;  2JIZ G;  3LSS A;  3CCQ V;  3FB7 C;  3ZRX A;  2P67 A;  2X6C A;  1AJP A;  4CZZ A;  3OMI B;  1JCH A;  2X7R B;  4XDK A;  1FFT B;  2GSM B;  3ZMT A;  2EIN B;  3T4D A;  1K33 A;  5LGT A;  3JYC A;  1E1Q G;  2V1D A;  3HPL C;  2DQ3 A;  4QNH B;  2F43 G;  5LHH A;  2ZXW C;  4JYB A;  5IY5 C;  1S0V A;  1OCR C;  2DWE C;  1VQ4 V;  1YJ9 V;  4PDL A;  5IDJ A;  1CP9 A;  2P6J A;  5E1A C;  4PA7 A;  1NKD A;  3D3I A;  3ZRS A;  3CCM V;  3ASN C;  3RVY A;  4P9P A;  2WLN A;  5L3B A;  2EIJ C;  3W7W A;  1JOY A;  3CCJ V;  3ABM B;  2EIK C;  3GWO A;  3T4Z A;  4JGS A;  2Z5U A;  1MOF A;  3SPJ A;  1I5Y A;  3QO7 A;  4JTC B;  3ABK C;  1W0K G;  3EFF K;  3P30 A;  1KC8 W;  4QPJ A;  3ZJZ A;  3JD2 A;  3OGC C;  4XDJ A;  5FL7 G;  3ETE A;  5B3S B;  2YSU B;  3G71 V;  1XL6 A;  2X0L A;  4PA4 A;  2Q67 A;  3ZMU A;  3AG2 C;  4U7O A;  1OCZ C;  1AI6 A;  1WPX A;  3E8G A;  3K0G A;  1S72 V;  4MVO A;  3K04 A;  5EBW C;  2Y69 C;  3ZCC A;  5L3F A;  3CCV V;  1YI2 V;  2WAM A;  3UKM A;  1Q7Y W;  1Y4M A;  4MSW C;  4GX2 A;  3ABT A;  2X6A A;  1GTO A;  1OCC C;  5LHG A;  1ARO P;  4I5S A;  2DYR B;  3IC7 A;  2HKO A;  4Z1M G;  1GO3 F;  1WLE A;  2M7W A;  1VQO V;  1FXK A;  4GX0 A;  1K5S A;  5H9C A;  3EHB B;  3E8H A;  2JJ2 G;  1PNK A;  4GCZ A;  1VQP V;  1ORQ C;  1R3L C;  4R7C A;  1KEC A;  2CK3 G;  1P4R A;  2WLH A;  3JCZ A;  4LC1 A;  4FK5 C;  4L87 A;  1JJ2 U;  1VQL V;  3CD6 V;  4WF9 V;  1K7D A;  1RPR A;  5C93 A;  5EBM C;  2D3O W;  2NLJ C;  1R6K A;  1V54 B;  3ABL B;  1NJI W;  1J95 A;  2MK3 A;  1SRY A;  3ETD A;  2OTL V;  1KQS U;  2DW4 A;  1VQ5 V;  2EIM B;  4R50 A;  4E2L A;  1H8E G;  1NBM G;  1YIT V;  3MD0 A;  5LBQ A;  3K06 A;  1EFR G;  2LFR A;  4JTA B;  1IXM A;  2X6B A;  3SJQ C;  3TK1 A;  3STZ C;  1BL8 A;  3FKS G;  5HFM A;  1GMG A;  3WFV A;  1EZJ A;  2WWW A;  5LHI A;  2A79 B;  2XAQ A;  4XBF A;  2WLM A;  2PI4 A;  1R73 A;  5KUK A;  3SPG A;  2DWD C;  4J9Z B;  2WSS G;  1VQM V;  3RVZ A;  1KP3 A;  5EC1 C;  2OCC B;  2P7T C;  4G28 B;  4MVM A;  2IW5 A;  4MVR A;  4UVC A;  2LFS A;  2B1I A;  3IFX A;  4JPR A;  2ZQM A;  2EZP A;  2Q68 A;  2WPD G;  2KB1 A;  1AJN A;  5CMU A;  4WFE A;  2XAJ A;  5IYD O;  2IJJ A;  2GHY A;  2B1G A;  4UV9 A;  2K1E A;  3OE7 G;  4TWK A;  1R3J C;  2JDI G;  1K3E A;  3E89 A;  4PA3 A;  5CA3 A;  4HZ3 A;  1RM1 B;  3AG1 C;  1W2B U;  5KUM A;  3E35 A;  4KUM A;  3SPH A;  1K5Q A;  1SER A;  3CMA V;  1NH2 D;  1F4M A;  1QBZ A;  4JAV A;  3ABU A;  2JK5 C;  4MVZ A;  5LGN A;  3RBZ A;  4MVU A;  3W7U A;  1AR1 B;  3OMA B;  3LDE A;  1GM9 A;  4QJF B;  1R3I C;  3CPW U;  2YEV B;  2HJF C;  2IJI A;  3AG3 C;  1YHQ V;  2EIL C;  2ZXW B;  5B1N A;  5IY5 B;  1OCR B;  4X88 A;  2Q69 A;  1PD3 A;  3BY6 A;  4BAY A;  4LP8 A;  2ZR2 A;  3SYP A;  1YSC A;  1MSW D;  5CBH A;  2A0L A;  2AHY A;  3ASN B;  2EBO A;  5B1B C;  2EIJ B;  5CBF A;  1R3K C;  1ZWI C;  4DO2 A;  2AHZ A;  4U7N A;  4J9Y B;  2DYS C;  3LNM B;  4UXN A;  2EIK B;  1SZT A;  3G4S V;  4QPK A;  5H6R A;  4G27 B;  3CC2 V;  2HFE C;  2XAF A;  1KP2 A;  4WFF A;  3ABK B;  1YIJ V;  1FXV A;  2ITD C;  4KFM A;  4FIP C;  2H8P C;  1QCE A;  3AG4 C;  3E8F A;  2BOB C;  5EK0 A;  1PNL A;  3CME V;  3IGA C;  3AG2 B;  4R8C A;  1FXH A;  1RPO A;  1OCZ B;  4ASU G;  1G8M A;  1NH2 B;  4DXW A;  2HG5 C;  3JD0 A;  2Y69 B;  1K34 A;  1KKD A;  2Q6A A;  4FJC C;  3G6E V;  4PDR A;  1JQ0 A;  3B77 A;  2PI5 A;  3OFN G;  3D36 A;  1YJN V;  1K9M W;  4MTX A;  3CC4 V;  2A9H A;  1AI5 A;  1OCC B;  3FYE B;  1M57 C;  3OEH G;  1NVP D;  1CEZ A;  2W6I G;  1AI4 A;  4N23 A;  4R6Z A;  4YXW G;  1SES A;  3FYI B;  1QVG U;  1LNQ A;  3M99 B;  1QLN A;  3ZMV A;  2QE7 G;  2ZD9 A;  2JEU A;  2V7Q G;  3OR6 C;  4JF3 A;  4RAI A;  3WG7 C;  1VQ6 V;  5KA6 A;  1QLE C;  3I56 V;  4UV8 A;  1JX9 A;  1Q82 W;  3OUS A;  2LP7 A;  4ZBM A;  3OAA G;  5DM6 V;  1YJW V;  4QIW F;  4P9O A;  1OCO C;  2JEX A;  3K79 A;  3CXC U;  3LSQ A;  2ZDI A;  2JJ1 G;  1JVM A;  1S77 D;  1VQN V;  2XND G;  4BW5 A;  1V55 C;  4PDV A;  4WFA V;  1M56 C;  1ENV A;  1BHA A;  3AEI A;  1VQ7 V;  3UM7 A;  3ETG A;  1DF4 A;  1S5H C;  3ASO C;  5HFL A;  4WFH A;  2QTO A;  4BIU A;  2IH3 C;  2YEV A;  1F4N A;  1OHH G;  4HYO A;  3SPI A;  3X2Q C;  3ZRW B;  3W7X A;  1PL0 A;  1R6N A;  1AJQ A;  1SET A;  5LGU A;  4Q20 A;  3ZN1 A;  3CCS V;  5L3G A;  1H38 A;  5KA5 A;  4EKW A;  1B6Q A;  4RQF A;  1FXK C;  5B1A C;  2FTK A;  4PDM A;  3ZIA G;  1K97 A;  3B8N A;  3OMN B;  4X89 A;  1L1F A;  4FMT A;  4CBC A;  3CCR V;  1NVP B;  5L3D A;  4QE9 A;  3ZRV A;  2B5U A;  3NXS A;  3JD4 A;  2WLJ A;  3A0R A;  3OUF A;  1F23 A;  4GX5 A;  1XL4 A;  4X8A A;  5B1A B;  1W0J G;  3JD3 A;  1AI7 A;  5CBG A;  1DLB A;  4RO2 A;  3OM3 B;  3OEE G;  1E1R G;  3SYO A;  2W6J G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...