2IJKA

Structure of a rom protein dimer at 1.55 angstrom resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
57
structure length
57
Chain Sequence
b'TKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 27
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijkA00
1PD3A 1RPOA 2GHYA 2IJJA 2IJKA 4DO2A 2IJHA 2IJIA 3K79A 1RPRA 1F4MA 1B6QA 1F4NA 1NKDA 1GTOA 1GMGA 1ROPA
chains in the Genus database with same CATH superfamily
1XMOO 5FPRA 2P90A 3RYIA 4DUZO 3F5TA 3E35A 2NLJC 4PDMA 2FL4A 2QWQB 1GRJA 1L1FA 2QWNB 2KKWA 4LF5B 5IDJA 1H38A 3T4ZA 5JJJB 1GMGA 3A0BZ 3NR7A 2QM8A 1OZ0A 3ASOC 4MVSA 2Z5UA 1X59A 5LP6A 4GKJB 1PP9H 1YZBA 4MTFA 5CBGA 4LF7O 1GM8A 3BHPA 3KCXA 4LFAB 1BHBA 4FFKA 2ZE5A 2GSMB 1AI5A 1K3EA 4LP8A 4UCTA 5L3DA 2QM7A 2Q6AA 3L71H 2QSAA 4LF4B 4O4IA 3DXRA 3CRMA 3ZHSA 1GM9A 4LBEC 4D6TH 4XDLA 2EIJC 2DYSC 3OMAB 3E86A 1W59A 3E8HA 4BAYA 2VQEO 4U3FH 2QKCA 4R6ZA 2UUCB 1S76D 3J81N 5BR8B 3K0DA 2ZR3A 1GN6A 1R73A 4B3SB 1BT8A 2EIKB 4JGSA 1JR9A 1VQKV 1IZ3A 1OCCB 4YJ3A 1SC5B 5KHHA 2R72A 3K9SA 3M99B 1SZXA 4K0KO 2AHYA 3K08A 4DW0A 1SQVH 4J41A 2RMKB 1EN4A 3OMIB 1I08A 1T5EA 3LNMB 4YJ2A 2Z0AA 5H6QA 2IH3C 4J80A 1JVMA 3STZC 4DUYB 3JD1A 1G6UA 3WU2Z 2LO1A 2F95B 3B2EE 2AGAA 3GB7C 4PA9A 1HNZO 2FMLA 3Q4HB 2K1EA 4DR4O 2IBZH 1CPYA 1PNMA 2PTMA 1Z2GA 2CE4A 3K03A 4OPAA 3SGIA 2WLIA 4QE9A 1BCCH 2W0XA 5LBQA 1V54C 3TK1A 3AG4C 3ASOB 2IW5A 4XDKA 4X66B 1IXMA 4X1YB 4FPPA 3CXCU 3P30A 3CCEV 3BABA 2BTQA 2B9ZA 3HKBB 3K79A 1IDSA 1L0LH 5EZYB 3K58A 1K97A 3JALB 1FFXB 3I5DA 5IYBO 5GONA 2EIJB 4ZOLA 2DYSB 4O2AB 1FXKA 3G67A 1ZSPA 1JFFB 3E8GA 4FLZA 3FX7A 1BGYH 4OX9B 2WA3A 1YHQV 3FYIB 3IC9A 4TV9A 1XNRO 2NN4A 3X2QC 2F23A 4QNHB 2P22C 2ARHA 5H2FZ 4UV8A 2Q7GA 1FS0G 3FB8C 4QIWF 3TETA 2V1DA 3D3IA 5B1OA 2WLMA 3JCUZ 5IYZB 2F1MA 1OCOC 3T1HO 3N2KA 5IT9N 3HB3B 1U97A 1MG1A 2BE3A 4TQDA 2P5OA 4QJFB 1PL4A 1D2DA 4U7NA 1K34A 4ZHQA 2B5UA 1NTZH 2C2AA 4CZZA 1QLEB 2AW9A 1XOUA 2Q68A 2W0FC 1SA0B 3JD0A 2JJ2G 2N74A 2ZR2A 4MTOA 1Q43A 3F5WC 3BAAA 1NZ6A 3H9VA 2Y0PA 1W0JG 3FYEB 2KG7B 5J2TA 2UUBB 1BL8A 3B40A 3K0GA 1DF5A 2ODMA 4W4LA 3J80N 4UV9A 4ZBMA 5CA1B 1I5YA 2RCVA 2BOCC 1E1QG 3ZHUA 4MS2A 3VOUA 4LC1A 1NI8A 3SYAA 4O4HA 1GM7A 3DC6A 1SQXH 3VQWA 4CH3A 4P30A 4U3JA 3L75H 1F23A 3F7VC 3S3WA 1ORQC 4BIOA 5HFMA 3OTOB 2LW1A 3CRAA 3ETDA 5EK0A 1JJOA 5JH7A 5E79Z 4TUYA 1ZL8A 1P49A 3HKCA 5BXZA 1FJGO 1XBLA 1K9MW 1QQCA 1QHTA 5B66Z 4LR3A 5L3BA 4EB6A 4GUNA 2G38A 2VQEB 5B3SB 1Q5OA 1KQSU 4JI4O 1OHHG 3WB1A 1WA8B 4ZKIA 4CH4A 5CA0A 2ZIMA 4O2BA 5B1AC 2ILMA 1VF5B 2QKSA 2Z3YA 2HLDG 4K0KB 4JI2O 4DR2O 4JV5O 4DR3O 1R6NA 2PI4A 1OCOB 1GK9A 4CH6A 4NXMO 2OTJV 4JYCA 3GVMA 4PHZA 5EIBC 3CS5A 3SPIA 4LFBB 4DV5B 1WP7A 4GX2A 2PY5A 4PDVA 5C8YB 1H8HG 2JJ1G 3VBBA 1YDXA 4JYYA 2DQ3A 4TT3G 3JARB 4H44B 1WLEA 2RDCA 1XUQA 3B8MA 1HNZB 2UXCO 2X7RB 4DR4B 4DXWA 2CTWA 1SS3A 2YI9A 3P3PA 4I7ZB 4KP4A 2F43G 3T1YB 2GUZA 2H94A 4F6RB 4JI6B 3RYFA 2F4VO 3RYHA 3AG3B 3ICXA 2Q4PA 1M93A 1UPGA 4B3RO 1I5XA 4LWSA 4A5UB 2ZCEA 3JCZA 3G80A 4DO2A 1LUWA 4LNUB 4L87A 1U96A 4UCVA 3K5LA 3RVZA 4TOIA 1V55C 1SESA 2QTSA 2ZE7A 1VQMV 5LA6A 2JGUA 4X89A 3CJHB 2ZNIA 3SYPA 4R50A 4WFFA 2V4DA 1CEZA 2JK5C 3CC4V 1Y66A 3NXSA 3L9DA 1R3LC 1QU7A 1S77D 2UUAO 3JASA 2XOKG 3WG7C 2Q5ZA 3IGAC 3OT7A 2FYUH 4RUEA 3T2MA 2XUMA 3HKEB 2NNUA 5IJ9A 5EYPB 4TV8A 2GV9A 5EBMC 1KC8W 3RWRD 3BA9A 1ZWIC 2A79B 1VQ7V 3OGCC 4FLWA 3T1HB 1VQ9V 4C7UA 3OGIB 3SYQA 3ABUA 2WA4A 4DW1A 5KHKA 5A9GA 4UVCA 2XAQA 3JATA 3BA8A 2P06A 4Z1MG 1EZJA 2ZQMA 2R9RB 3FAVB 4I4TB 3UO3A 4DR1O 3OE7G 4X1IA 2WLLA 1GO3F 4JI1B 5EBLC 1VF6A 5IJ0A 4K8XA 1KUQA 2GHYA 3JAWB 3CD6V 1AI6A 4X65O 1CP9A 5DN6G 3H1KH 1SQPH 1OJHA 3W7UA 1N33O 1R3IC 2ZKOA 1XEQA 5L3GA 3CE2A 5J2UA 4DV2O 5LXTA 5JVDA 1UFIA 3UT5B 1P84F 1V55B 1VQ6V 3K5MA 5CMUA 3HKDB 4WFGA 1I94O 1YXBA 2FTKA 3FFQA 2EULA 3BRCA 4I55B 1MABG 1M90W 1WP8A 4O4JB 4NKGB 3E2EA 1VIBA 2E3CA 4K8ZA 1IBLO 4GX5A 5BY1A 4LH6A 1J5EO 3RN4A 1KBHA 1MSWD 4OXSA 3WG7B 2QTOA 3K06A 2BSKB 3JAMN 1Q81W 2EIKC 2LFSA 4ICGA 3TXQA 2A3QA 5BMVB 2EJ7A 4JI7O 1OCCC 2ZE8A 3K04A 4HNAA 2E5LO 2AZ2A 3FB7C 1N36B 1TVKA 1HNXB 2YS8A 1K8AW 1AI4A 5CB4A 3E8BA 1RSOA 1HP8A 4JV5B 3F7YC 2QA4V 5LL6Y 3AG1B 4MVOA 4H0LB 4NXMB 3OMNB 4LF9O 2MW2B 1KD1W 3WFVA 2AZ0A 1SQFA 4R7CA 3RYIB 2YIBA 2ZE6A 4JPRA 1BSMA 2LGQA 1H2KA 2RN9A 2UXCB 3QF7A 5JCOA 1FXHA 3U11A 2PYJA 5ITZA 1XILA 3EXAA 3EHBB 3JAKA 2WPDG 3GWOA 2F4VB 1W0KG 3JSNA 1TUBA 4J9YB 3SJCC 2QWPB 5LP6B 1J95A 4B3RB 5FLXN 4DV1O 5FNVA 1N4CA 5L3FA 2ZDIA 4JI3O 3CCQV 3W7SA 4O4IB 2YUAA 3DXRB 1L0NH 1NT2B 3H01A 4I0XA 3TJTA 2YXHA 1FXKC 3MHHC 1DK1A 1VQPV 1Q6IA 2HJFC 5KMGA 3VQYA 1VQ4V 3OUFA 3ZMUA 3DTUB 3UCSC 3AEIA 2WLHA 2XT9A 1I0HA 2ATKC 4DV6B 2UUAB 5H5NA 3IJ4A 3CC2V 4YJ3B 3ZJZA 4JAUA 3H1JH 1FYJA 3RYCA 5LMNO 2CH7A 2DJVA 2Q7HA 4B08A 4PV1B 4FJCC 4AHCA 1A32A 2IU0A 1ENVA 4DV4B 2UU9O 4J42A 2UXBO 4YJ2B 4RUFA 2XAFA 2VQFO 1PKXA 3D3QA 2QDOA 1F7YA 3ZCCA 1H2NA 4FM2A 3TGUH 1LNQA 3G6BA 4XDJA 3OR7C 1HWYA 1QLEC 4YIPA 1XMQO 4I9WA 4AQYO 3M7MX 4UUJC 2A7WA 1VQLV 4MTGA 3ZMSA 2WLIB 1H2SB 1SF9A 1IBMB 3OD4A 2IU3A 2QEXV 2JIZG 4DR1B 4JTAB 4TWKA 3LDEA 2P67A 4DV3B 1NQTA 2EX3A 3KG2A 3OEEG 2QWOB 2M7WA 3Q4HA 2UXNA 4B3TO 1YITV 1K92A 1WN7A 3C90A 4PDRA 2BTQB 1N33B 1N0JA 4DR5B 1S5JA 1JPXA 4PD4F 1IURA 2VWJA 3BFRA 4IL6Z 1WPXA 4KFMA 3AG2C 5GONB 4ZOLB 1GKFA 1FXKB 2Y4TA 1I94B 1HR0O 4FIPC 4MT8A 3LSQA 5JWPA 4J7KA 5KHJA 4IIJA 2GBOA 1K4CC 2Y4UA 1DF4A 2JEUA 4FZ0A 4GT1A 3TXSA 1RFYA 1IBLB 5B3SC 3HKBA 3JYCA 4TV9B 1VMGA 4YY3B 1G8MA 2YIDA 2R9IA 4FM0A 4PI0A 3OW2U 3SPJA 4X62O 3CC7V 4JI7B 3RGBA 1E1RG 4DR6O 2E5LB 1QR9A 2E76B 2JGDA 3N2KB 3ABLC 1NVPD 1GTOA 3CYOA 3CCRV 1YEWA 2KQXA 4UB8Z 4J9ZB 3LSSA 4ZHQB 3ABMC 4LF9B 1NS1A 2DQ0A 3JD3A 1AP6A 1GN2A 4GX0A 4LF8B 1AR4A 5CBFA 3ZRXA 1ZLZA 1XNQO 1XREA 1XMOB 1JOYA 3ETQA 1VP7A 4FFBA 5J2TB 4DUZB 1ZTEA 3ZHQA 1SQBH 5KA5A 3N27A 2ETNA 3P32A 3AG3C 1GAXA 2DN9A 5A2QN 2H8PC 3QO5A 4NXNO 3PN1A 1MMMA 5J9PC 4YXWG 4PDLA 4O4HB 3A0RA 1MZEA 3CMAV 3K9AA 4U3JB 3WB2A 3G6EV 4DV1B 4DK1A 1K7DA 4FLVA 4LF7B 4JI3B 4J10A 4E4EA 5JQGA 1IBKO 3AG2B 1BQZA 5JH7B 4TUYB 4LFCO 1ZL8B 3HKCB 4JASA 3CCSV 4O4LA 1RP3B 5IWAO 3W7WA 1S72V 4PJ0Z 3L70H 4DV7O 4EB6B 1YTFD 4X64O 1M56B 5BZBA 4HBNA 5C93A 5CA0B 1HW7A 3K57A 4O2BB 1RM1C 2PZSA 3B77A 1QVGU 1LR1A 1M5IA 2HR3A 3IC7A 3ETGA 3H1IH 2DOSA 2Y69C 4IYIA 2PF4E 4N21A 1BS3A 1X4TA 2PUSA 5LMNB 2EZPA 2Q8VA 4K3AA 4DRXA 2CTQA 1SETA 3ABLB 2UU9B 3RT3C 2XASA 4OPHA 5LOVA 5EC2C 4LF6O 3OM3B 1BZKA 2F93B 3ABMB 3EFFK 1SQQH 1HDJA 4FK5C 1WJZA 2X6AA 3G71V 1S3JA 4MVRA 1KKDA 4AQYB 3OUSA 3SJAC 4U7OA 1XHZA 4WCEV 2XNDG 3FD9A 4JI5O 2GUZB 4P9PA 4X20A 3RYFB 2DMXA 3RYHB 3ZRWA 4PA3A 5LGNA 1QBZA 3ABKB 3ZHTA 2X6CA 1NH2D 4J7JA 4LWSB 5LYJA 4JZGA 3JD2A 1OCRB 3PJSK 1ZX3A 2HG5C 2CTRA 4PA4A 3QO7A 2F66C 3UQ8A 2WWWA 5KX5A 5LHHA 5KLVH 4B3TB 1EN6A 4G27B 1EN5A 1YJ9V 3MDSA 3N2GA 2YC0A 5LA6B 1YVWA 1AJNA 4WFHA 4GKJO 3BY6A 4WBNA 4D7SA 4LFAO 1P7GA 1HR0B 3CCMV 2OIEA 1SQGA 3JASB 1NTKH 1JMKC 4LF4O 4JYBA 1Y76A 1FKAO 3H1HH 4Z2WA 1AROP 5CN0A 1RM1B 3FB6C 5IJ9B 4DV0O 2HHHO 2Y69B 4G2KA 4J11A 1KMIZ 1XNRB 1Y74B 4B7EA 1OCZC 1XI1A 4TV8B 1NVPB 5BR8O 1M9NA 1Z5WA 5IYCO 2CUGA 3HR0A 4QGPA 2PYLA 2B1IA 1EM1A 4UVAA 2LP7A 4UCOA 1RPOA 4DR6B 1QNMA 3AG1C 4I50A 2YICA 5EBWC 1S0VA 4ZI7A 4P9OA 4TSFG 2ZINA 1SRYA 2HJDA 1Q7YW 3BPZA 4IHJA 2JEXA 4WFAV 2YXYA 2QE7G 3THOA 2XAHA 4AI8A 4DK0A 5B5EZ 2HKOA 2VS0A 1AILA 3JATB 3G4SV 4FLXA 4UCSA 2HFEC 3CRRA 3SPGA 1XNQB 2OYQA 1K5SA 5JCOC 4X1IB 5GW7A 1GH6A 3ASNC 2WLLB 2MK3A 3BVOA 2JS5A 1WB7A 2EINB 1PNLA 4NYKA 5IJ0B 3ZMTA 1EFRG 2YI8A 4P2ZA 2YEVA 5LP6C 1FPOA 5H6RA 4YHHO 3FB5C 1PNKA 3ZMVA 4NXNB 1LUVA 4MSWC 1N0NA 5J2UB 5LXTB 5JVDB 3DSQA 1R6KA 3KKYA 1IX9A 2RQ6A 5FL7G 4UCUA 4N23A 1M57B 2WLKA 1KB9F 4X66O 2LW7A 3OAAG 3W7TA 1YTFB 2QWRB 1AP5A 1VEWA 1EZVH 4JZ2A 1SKVA 4MVZA 3RW0A 3CCLV 2OT5A 4X1KA 4BR6A 4FLUA 1I7FA 4LFCB 5KUKA 3I55V 2CGNA 4UVBA 1FJGB 5GTIZ 3K3WA 2HVKC 2W6JG 4DV7B 3QG5A 2BCCH 4X64B 4RQEA 1D5AA 1B06A 4JI4B 3U10A 3CPWU 4Q6GA 2EILB 1OCZB 4GKKO 4HNAB 3CEIA 1TVKB 2ADPA 2A9HA 5CB4B 4LCUC 1RSOB 5KAFZ 4WFEA 3OR6C 3APQA 3BEHA 1B6QA 4JI0O 2LQTA 4JI2B 4DR2B 4H13B 4DR3B 2R70A 3K59A 2CGOA 5L3EA 3AK3A 3D36A 5CA3A 1L8DA 4QPKA 1FFTB 3SYOA 4RWUA 4HAMA 1YI2V 3E22A 4EKWA 1WB8A 2GTSA 1N34O 4XBFA 3QNEA 4BIZA 2OWOA 3MD0A 4QPJA 2WAMA 3M8AA 4HYOA 1AB3A 2ITCC 2IM9A 3H1LH 4YIOA 1NH2B 1V9PA 4JI8O 2YXLA 2HVJC 1WAZA 4JF3A 4JI5B 3ASNB 3ABTA 2QM4A 5ITZB 5KUMA 4FLTA 1TUBB 1G1XB 2ZM6O 1Q6HA 3CRQA 1Q6UA 5JJEB 4G28B 1NU1H 2IJJA 5IE9A 5FNVB 2IJHA 2KSDA 2RJZA 2ZXWB 2UUBO 1BQ0A 4ZIBA 1FAFA 1NTMH 4GX1A 4I0XB 3QVNA 2E74B 1M1KW 4KXRA 3ZMZA 3D8CA 5DM6V 2OCCC 1YIJV 3L73H 5KMGB 5FPOA 4GZRB 4OGQB 3OTOO 3B4SA 1Q82W 2EIMB 3JD4A 2LGWA 3SR2C 1D5NA 4FM1A 2ZIOA 2B1GA 4F6EA 4WFBV 1YF2A 3RYCB 2CH7B 2DWEC 3TCUA 4DV0B 1OV9A 2HHHB 1DTOA 4NTWA 5K1XA 1NR7A 4IT5A 2A06H 1VQNV 3AG7A 2E75B 4NB5A 5E1AC 1W2BU 1H2GA 4KL1A 2H3OA 5CBHA 3ZS8C 2WLNA 3UO2A 1BE3H 2R9AA 1VARA 4PI2A 3ZRSA 1VQOV 1KP3A 2XAGA 1MNGA 3O9OA 3HPLC 4JAVA 3CX5F 2X6BA 1KYOF 4KHPO 2DYRC 1VQ5V 4LFBO 2DWDC 2Q7EA 4DV5O 3DC5A 3I56V 3GWKC 4I5SA 2PGGA 4ABMA 5JJNB 3UM7A 2W6IG 1QCEA 3R66A 1Y67A 3C3SA 3L74H 3K5OA 3CXHF 2KB1A 2N05A 1Q3EA 1BHAA 3CWBH 2LJ2A 3T4DA 3T1YO 4YHHB 2IJIA 1B04A 1P7BA 4JI6O 4X65B 2BOBC 1EBOA 2L6LA 4PA6A 3W7XA 3AK1A 1SERA 4DV2B 4L8JA 5GTHZ 3ETEA 4MVUA 2OCCB 5LGTA 1MZFA 3CHXA 1US6A 3QTCA 4IIJB 1PPJH 4E2LA 1NJIW 4X1YA 4NR1A 4J7ZA 3SPCA 1M56C 1J5EB 1K4DC 2D3OW 5EZYA 1Q86W 4PA7A 1F51A 3JALA 1FFXA 2ZNJA 1QLNA 3CSXA 1GN3A 4MVQA 3IFXA 4O2AA 3CMEV 1R3JC 1JFFA 4GKKB 5D5QA 2JGDB 3ML0A 4CS3A 1Q8IA 2QJ1A 4FLYA 1R1BA 4UB6Z 1K5QA 1PL0A 4JI0B 3R65A 3APOA 4NTXA 3A0HZ 2IH1C 3B8NA 5AG2A 4BIUA 2ZD9A 1O9HA 2CDYA 2XHBA 2P4KA 1NKDA 1N34B 1KU9A 1Y4MA 4CBCA 3LDCA 3O65A 5IYZA 2P6JA 2DYRB 2OIGA 4FFBB 3CCJV 3KZIZ 4JI8B 4BWAA 2PI5A 3ABKC 5EIBD 4DR7O 1JA8A 1SA0A 2K9PA 2ZM6B 1YCIA 1OCRC 4Q20A 1N32O 1XL4A 1Z5VA 2O57A 4IYHA 4IGGA 2HEPA 4LH7A 3E83A 3OEHG 3T1CA 5KHIA 4JI1O 3OTFA 1FD9A 4NVPA 5JQGB 2KG7A 5LMUO 1TAEA 1V54B 3DGEA 4BW5A 4FMTA 3AG4B 5CA1A 1MOFA 4O4LB 2UXDO 2X0LA 2OCHA 1AR5A 1K33A 4EFBA 4JTDB 4BW9A 1Y6XA 4W4KA 4UCRA 2GTAA 1Q90D 3LSUA 2UXXA 3LUTB 3VQXA 4JYAO 1K73W 4CC6A 3UKMA 4MW8A 4B3MO 1F4NA 1TA8A 3ZX6A 3A8TA 3WB0A 5HFLA 1F4MA 3ZN0A 1R3KC 2RNBA 1AJQA 4UFZA 1TGOA 4DRXB 1H2LA 1COWG 1WA8A 5LOVB 3EVKA 2UXBB 3X2QB 2VQFB 1N36O 1HNXO 4K35A 2QKAA 3ZBHA 1R6TA 3SJBC 4X9QA 1IXBA 1N8RW 3S3XA 2EBOA 1KP2A 1YSCA 1XMQB 1P4RA 1ZUQA 2ITDC 1QR8A 3P3NA 2VRZA 4WF9V 1HNWO 4X20B 2AHZA 4KHPB 2CAZC 1TUEB 2M6YA 3ZRWB 2YIBD 1YJWV 5LHGA 1AR1B 2EINC 5LYJB 4GYCB 1VF6C 5C8YA 1PM9A 1B3QA 3U0ZA 5B1BC 3ZRVA 3JARA 1NBMG 5IY5C 5KX5B 2IJKA 4EEQA 5KHGA 3STLC 4LF5O 2N04A 2WSSG 1H2MA 5KA6A 1O9GA 3SYCA 5L3CA 3N2GB 4F6RA 1SZTA 1JX9A 1M57C 2QGNA 3VQVA 2YDEA 4AILC 1RPRA 4WBNB 1MA1A 2XAJA 3ZHVA 1DGSA 2CK3G 3ZEDA 4LNUA 3K5NA 4HZ3A 4I9QA 1Y76B 1XL6A 4RQFA 2NR5A 1ROPA 4X88A 1AI7A 3QO8A 3CJHA 2EILC 2UUCO 1ZAUA 3JSLA 4X62B 4MW3A 3SJQC 4B3SO 4QE7A 4NTYA 4GLXA 4DV6O 4EFEA 1WNSA 3LNNA 1VQ8V 4JAAA 4RAIA 3ZN1A 4I50B 5IYDO 4F4LA 3D36C 5B1AB 4TQFA 4ZI7B 4DYLA 1CXZB 2ADQB 3HKEA 4IHJB 5KAIZ 2FKXA 1PV0A 4R8CA 2P7TC 4GCZA 1Y74A 5EYPA 2OTLV 4DV4O 1XQ8A 2L35A 4FZ1A 4X8AA 1QVFU 1URFA 2JDIG 4DUYO 1M4UA 1S5HC 4H33A 1THZA 4ASUG 2DW4A 4PELA 5DECA 3E8FA 1E79G 4FVMA 2FB5A 4CH5A 5B1NA 1S5LZ 4B7KA 4RO2A 3RVYA 3MAQA 2YEVB 1KKCA 2Q9LA 5B1BB 2DE0X 2Y48A 1IBMO 4DR7B 5IY5B 3SPHA 2A0LA 2ZDIC 2Q0OC 1XHXA 4MTXA 2YSUB 2ZXWC 2YIAA 1N32B 2VWKA 2WLJA 5LHIA 1AJPA 3FAVA 4I4TA 2Y0IA 2JS3A 2XTAA 2ZT9B 3ZHRA 4DV3O 5LMUB 4UXNA 2GDSA 1IBKB 4X1KB 2CTPA 3ZIAG 4Z1VA 3JAWA 2JVDA 2UXDB 3IAYA 5IWAB 4DR5O 2D2CB 1YJNV 3CRCA 3RFRA 3A2FA 3SDLA 2AXTZ 2EIMC 3CCUV 3CB2A 5K1PA 1DLBA 2Q67A 3UT5A 4H37A 5TISZ 4JYAB 3HKDA 4CS2A 3LDDA 2EJRA 3MHSC 1H8EG 2QR4A 3FKSG 4B3MB 4I55A 4OX9O 4O4JA 4CC5A 5F2VO 1IVSA 1JJ2U 1MSDA 4YY3O 3AK2A 4JTCB 5DEDA 3CP1A 5D5PA 4MVMA 3RBZA 2BSKA 3BCCH 3J7AU 1GN4A 2Q69A 2BTOA 3C3TA 5BMVA 3E22B 3OFNG 1VF7A 1PD3A 5H9CA 2Q0AA 5LGUA 2HP8A 4LF6B 1JCHA 1JQ0A 4D7TA 1WPBA 1XDCA 2V7QG 1KECA 4CS4A 3E89A 1G4YB 1FXVA 1NR1A 3CCVV 1AVMA 5EC1C 2EZOA 3B09A 3KCYA 1UJWB 1HNWB 3JAKB 2LFRA 4LF8O 2P4VA 4KUMA 2JRIA 2Q73A 3L72H 1BMFG
chains in the Genus database with same CATH topology
3ETEA 4MVUA 2OCCB 5LGTA 1RM1C 2A79B 1VQ7V 2P90A 3B77A 3OGCC 1VQ9V 1QVGU 3IC7A 2HR3A 3E35A 2NLJC 3ETGA 4PDMA 4E2LA 1NJIW 2Y69C 3SYQA 3ABUA 4N21A 1L1FA 2EZPA 4UVCA 3SPCA 5IDJA 1M56C 2XAQA 1H38A 3T4ZA 1GMGA 2QM8A 1K4DC 2D3OW 1SETA 3ABLB 1OZ0A 1Q86W 3ASOC 4PA7A 1F51A 4MVSA 2Z5UA 2XASA 1QLNA 4MVQA 3IFXA 4Z1MG 5EC2C 1EZJA 2ZQMA 3OM3B 3CMEV 4MTFA 3ABMB 1R3JC 5CBGA 2R9RB 3EFFK 1GM8A 1BHBA 4FK5C 3OE7G 2GSMB 2X6AA 1AI5A 3ML0A 2WLLA 1K3EA 4LP8A 1GO3F 5L3DA 3G71V 2QM7A 2Q6AA 1S3JA 4MVRA 1KKDA 5EBLC 3OUSA 2GHYA 1GM9A 1K5QA 4LBEC 1PL0A 4U7OA 4XDLA 2EIJC 3R65A 4WCEV 2DYSC 2XNDG 3CD6V 1AI6A 3OMAB 1CP9A 5DN6G 3E86A 2IH1C 3B8NA 3W7UA 4BIUA 1R3IC 4P9PA 3E8HA 4BAYA 2ZD9A 3ZRWA 5L3GA 4PA3A 4R6ZA 5LGNA 1S76D 1QBZA 3ABKB 1V55B 2X6CA 3K0DA 1NH2D 1VQ6V 1NKDA 2ZR3A 1R73A 5CMUA 4WFGA 2EIKB 2FTKA 1Y4MA 3JD2A 4CBCA 3LDCA 4JGSA 1OCRB 2P6JA 3PJSK 2HG5C 2DYRB 4PA4A 1VQKV 3QO7A 1OCCB 3CCJV 2WWWA 1MABG 3M99B 1M90W 2AHYA 3E2EA 5LHHA 3K08A 4GX5A 4G27B 2PI5A 3ABKC 1MSWD 4OXSA 3WG7B 1YJ9V 2QTOA 3K06A 1AJNA 4WFHA 3OMIB 1Q81W 2EIKC 3LNMB 2LFSA 5H6QA 1OCRC 2IH3C 3BY6A 4Q20A 1JVMA 1OCCC 1XL4A 3STZC 3K04A 3E83A 3OEHG 3T1CA 3CCMV 3FB7C 3JD1A 1K8AW 1AI4A 4JYBA 1V54B 3DGEA 3E8BA 4FMTA 4BW5A 3AG4B 1AROP 3GB7C 5CN0A 4PA9A 3F7YC 2QA4V 1RM1B 3FB6C 2K1EA 1MOFA 3AG1B 4MVOA 1CPYA 2X0LA 1PNMA 3OMNB 1K33A 2Y69B 4G2KA 3K03A 1OCZC 2WLIA 4JTDB 4QE9A 1NVPB 1M9NA 5IYCO 1KD1W 2UXXA 3WFVA 3LUTB 5LBQA 2B1IA 4UVAA 2LP7A 1V54C 3TK1A 1K73W 1RPOA 3AG4C 4R7CA 3ASOB 3UKMA 2IW5A 4MW8A 4XDKA 4JPRA 1F4NA 3AG1C 1IXMA 4FPPA 5EBWC 1S0VA 4P9OA 4TSFG 1F4MA 5HFLA 3ZN0A 3CXCU 1SRYA 1Q7YW 3P30A 2JEXA 3CCEV 1FXHA 4WFAV 1R3KC 1AJQA 2QE7G 3K79A 2XAHA 3EHBB 2WPDG 3GWOA 1COWG 2HKOA 1W0KG 3G4SV 1K97A 4J9YB 5IYBO 1J95A 2EIJB 2DYSB 1FXKA 3X2QB 2HFEC 3SPGA 5L3FA 1K5SA 2ZDIA 3E8GA 5GW7A 3ASNC 2WLLB 2MK3A 3W7SA 3CCQV 2EINB 1PNLA 1N8RW 3H01A 2EBOA 1KP2A 1YSCA 3ZMTA 1EFRG 1P4RA 3FYIB 4P2ZA 1YHQV 2YEVA 5H6RA 1FXKC 2ITDC 1QR8A 3FB5C 1PNKA 3MHHC 4WF9V 3ZMVA 2AHZA 3X2QC 4QNHB 1VQPV 1TUEB 3ZRWB 4MSWC 2HJFC 1YJWV 5LHGA 1VQ4V 1R6KA 1AR1B 4UV8A 1FS0G 3FB8C 4QIWF 5FL7G 3TETA 2V1DA 2EINC 3OUFA 3ZMUA 3DTUB 3D3IA 4N23A 1M57B 2WLKA 3AEIA 5B1OA 2WLMA 2WLHA 1OCOC 2ATKC 3OAAG 3W7TA 1YTFB 3CC2V 5B1BC 3HB3B 3ZRVA 3RW0A 1NBMG 4MVZA 1MG1A 3CCLV 5IY5C 3ZJZA 4JAUA 2OT5A 2IJKA 4QJFB 5KUKA 4U7NA 3STLC 2WSSG 1K34A 3I55V 4UVBA 5KA6A 4FJCC 2B5UA 2C2AA 3SYCA 4CZZA 5L3CA 1QLEB 3K3WA 2HVKC 2W6JG 1SZTA 1ENVA 2IU0A 4RQEA 1JX9A 1M57C 2Q68A 2W0FC 3JD0A 2JJ2G 4RUFA 2XAFA 2ZR2A 4MTOA 1RPRA 1PKXA 2XAJA 3F5WC 3CPWU 2EILB 1OCZB 2CK3G 3ZCCA 1LNQA 1W0JG 3FYEB 2A9HA 4HZ3A 4LCUC 4XDJA 1BL8A 3OR7C 1HWYA 1XL6A 3K0GA 1QLEC 1DF5A 4I9WA 4WFEA 4RQFA 3OR6C 4UV9A 3BEHA 4ZBMA 1B6QA 4UUJC 1I5YA 1ROPA 4X88A 2BOCC 1VQLV 4MTGA 1E1QG 3ZMSA 4MS2A 3VOUA 4LC1A 5L3EA 1AI7A 2WLIB 3D36A 3QO8A 5CA3A 3SYAA 1GM7A 2EILC 4QPKA 1FFTB 3SYOA 4HAMA 1YI2V 4EKWA 4P30A 2IU3A 1F23A 4MW3A 3SJQC 3F7VC 4QE7A 1ORQC 2QEXV 2JIZG 5HFMA 4XBFA 3QNEA 4JTAB 1VQ8V 4TWKA 4BIZA 3MD0A 4QPJA 2WAMA 3ETDA 4RAIA 3ZN1A 5EK0A 3LDEA 2P67A 5IYDO 4F4LA 4HYOA 2ITCC 1NQTA 3KG2A 5B1AB 3OEEG 2M7WA 2UXNA 1NH2B 1YITV 1K92A 4R8CA 2P7TC 4PDRA 4GCZA 1K9MW 2OTLV 2HVJC 4JF3A 3ASNB 3ABTA 5L3BA 5KUMA 5B3SB 1KQSU 1JPXA 1OHHG 4ZKIA 1WPXA 4KFMA 3AG2C 4X8AA 1QVFU 1GKFA 1FXKB 2JDIG 1S5HC 2IJJA 4G28B 4H33A 1THZA 2IJHA 5B1AC 4FIPC 4MT8A 4ASUG 2DW4A 2QKSA 3LSQA 4PELA 3E8FA 2Z3YA 2HLDG 2ZXWB 1E79G 1K4CC 5B1NA 1DF4A 2JEUA 4GT1A 4GX1A 4RO2A 3RVYA 5B3SC 1R6NA 1M1KW 2PI4A 1OCOB 2YEVB 3JYCA 1GK9A 3ZMZA 5B1BB 1G8MA 2OTJV 4JYCA 5DM6V 2OCCC 2Y48A 2R9IA 5IY5B 1YIJV 3OW2U 3SPHA 3SPJA 3SPIA 2A0LA 2ZDIC 4MTXA 2YSUB 2ZXWC 3CC7V 1E1RG 5LHIA 2WLJA 1AJPA 4GX2A 1Q82W 4PDVA 2EIMB 3JD4A 1H8HG 1QR9A 2JJ1G 3VBBA 4UXNA 2DQ3A 4TT3G 3ABLC 2B1GA 1NVPD 1WLEA 1GTOA 3CYOA 4WFBV 3ZIAG 3CCRV 3B8MA 2DWEC 2X7RB 4DXWA 3TCUA 4J9ZB 3LSSA 3ABMC 4KP4A 2F43G 2H94A 2DQ0A 3JD3A 1YJNV 1DTOA 3AG3B 1NR7A 2EIMC 3CCUV 1VQNV 1DLBA 2Q67A 4H37A 4GX0A 1I5XA 5CBFA 3ZRXA 3JCZA 5E1AC 3LDDA 1W2BU 2EJRA 3MHSC 1JOYA 1H8EG 1H2GA 4DO2A 3FKSG 5CBHA 2WLNA 4L87A 3RVZA 1JJ2U 5KA5A 3ZRSA 3P32A 3AG3C 1V55C 1VQOV 1SESA 4JTCB 1KP3A 2XAGA 3CP1A 2H8PC 3QO5A 3HPLC 4MVMA 1VQMV 3RBZA 4JAVA 4X89A 2X6BA 5J9PC 4YXWG 2DYRC 4PDLA 1VQ5V 3A0RA 2DWDC 2Q69A 3CMAV 3SYPA 4R50A 3K9AA 3I56V 4WFFA 3OFNG 1CEZA 4I5SA 3G6EV 1PD3A 2JK5C 5H9CA 1Y66A 3NXSA 3UM7A 2W6IG 1R3LC 5LGUA 3CC4V 1S77D 1K7DA 1QCEA 1JCHA 2XOKG 3WG7C 1JQ0A 3AG2B 2KB1A 3IGAC 2V7QG 4RUEA 3T2MA 1BHAA 4JASA 1KECA 2NNUA 3E89A 3CCSV 1G4YB 1FXVA 1NR1A 3T4DA 3CCVV 3W7WA 2IJIA 1S72V 1P7BA 5EC1C 2EZOA 1UJWB 1YTFD 2BOBC 1EBOA 4PA6A 5EBMC 3W7XA 2LFRA 1KC8W 1M56B 4KUMA 5BZBA 1SERA 1ZWIC 5C93A 1BMFG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD3 A;  1RPO A;  2GHY A;  2IJJ A;  2IJK A;  4DO2 A;  2IJH A;  2IJI A;  3K79 A;  1RPR A;  1F4M A;  1B6Q A;  1F4N A;  1NKD A;  1GTO A;  1GMG A;  1ROP A; 
#chains in the Genus database with same CATH topology
 1XMO O;  5FPR A;  2P90 A;  3RYI A;  4DUZ O;  3F5T A;  3E35 A;  2NLJ C;  4PDM A;  2FL4 A;  2QWQ B;  1GRJ A;  1L1F A;  2QWN B;  2KKW A;  4LF5 B;  5IDJ A;  1H38 A;  3T4Z A;  5JJJ B;  1GMG A;  3A0B Z;  3NR7 A;  2QM8 A;  1OZ0 A;  3ASO C;  4MVS A;  2Z5U A;  1X59 A;  5LP6 A;  4GKJ B;  1PP9 H;  1YZB A;  4MTF A;  5CBG A;  4LF7 O;  1GM8 A;  3BHP A;  3KCX A;  4LFA B;  1BHB A;  4FFK A;  2ZE5 A;  2GSM B;  1AI5 A;  1K3E A;  4LP8 A;  4UCT A;  5L3D A;  2QM7 A;  2Q6A A;  3L71 H;  2QSA A;  4LF4 B;  4O4I A;  3DXR A;  3CRM A;  3ZHS A;  1GM9 A;  4LBE C;  4D6T H;  4XDL A;  2EIJ C;  2DYS C;  3OMA B;  3E86 A;  1W59 A;  3E8H A;  4BAY A;  2VQE O;  4U3F H;  2QKC A;  4R6Z A;  2UUC B;  1S76 D;  3J81 N;  5BR8 B;  3K0D A;  2ZR3 A;  1GN6 A;  1R73 A;  4B3S B;  1BT8 A;  2EIK B;  4JGS A;  1JR9 A;  1VQK V;  1IZ3 A;  1OCC B;  4YJ3 A;  1SC5 B;  5KHH A;  2R72 A;  3K9S A;  3M99 B;  1SZX A;  4K0K O;  2AHY A;  3K08 A;  4DW0 A;  1SQV H;  4J41 A;  2RMK B;  1EN4 A;  3OMI B;  1I08 A;  1T5E A;  3LNM B;  4YJ2 A;  2Z0A A;  5H6Q A;  2IH3 C;  4J80 A;  1JVM A;  3STZ C;  4DUY B;  3JD1 A;  1G6U A;  3WU2 Z;  2LO1 A;  2F95 B;  3B2E E;  2AGA A;  3GB7 C;  4PA9 A;  1HNZ O;  2FML A;  3Q4H B;  2K1E A;  4DR4 O;  2IBZ H;  1CPY A;  1PNM A;  2PTM A;  1Z2G A;  2CE4 A;  3K03 A;  4OPA A;  3SGI A;  2WLI A;  4QE9 A;  1BCC H;  2W0X A;  5LBQ A;  1V54 C;  3TK1 A;  3AG4 C;  3ASO B;  2IW5 A;  4XDK A;  4X66 B;  1IXM A;  4X1Y B;  4FPP A;  3CXC U;  3P30 A;  3CCE V;  3BAB A;  2BTQ A;  2B9Z A;  3HKB B;  3K79 A;  1IDS A;  1L0L H;  5EZY B;  3K58 A;  1K97 A;  3JAL B;  1FFX B;  3I5D A;  5IYB O;  5GON A;  2EIJ B;  4ZOL A;  2DYS B;  4O2A B;  1FXK A;  3G67 A;  1ZSP A;  1JFF B;  3E8G A;  4FLZ A;  3FX7 A;  1BGY H;  4OX9 B;  2WA3 A;  1YHQ V;  3FYI B;  3IC9 A;  4TV9 A;  1XNR O;  2NN4 A;  3X2Q C;  2F23 A;  4QNH B;  2P22 C;  2ARH A;  5H2F Z;  4UV8 A;  2Q7G A;  1FS0 G;  3FB8 C;  4QIW F;  3TET A;  2V1D A;  3D3I A;  5B1O A;  2WLM A;  3JCU Z;  5IYZ B;  2F1M A;  1OCO C;  3T1H O;  3N2K A;  5IT9 N;  3HB3 B;  1U97 A;  1MG1 A;  2BE3 A;  4TQD A;  2P5O A;  4QJF B;  1PL4 A;  1D2D A;  4U7N A;  1K34 A;  4ZHQ A;  2B5U A;  1NTZ H;  2C2A A;  4CZZ A;  1QLE B;  2AW9 A;  1XOU A;  2Q68 A;  2W0F C;  1SA0 B;  3JD0 A;  2JJ2 G;  2N74 A;  2ZR2 A;  4MTO A;  1Q43 A;  3F5W C;  3BAA A;  1NZ6 A;  3H9V A;  2Y0P A;  1W0J G;  3FYE B;  2KG7 B;  5J2T A;  2UUB B;  1BL8 A;  3B40 A;  3K0G A;  1DF5 A;  2ODM A;  4W4L A;  3J80 N;  4UV9 A;  4ZBM A;  5CA1 B;  1I5Y A;  2RCV A;  2BOC C;  1E1Q G;  3ZHU A;  4MS2 A;  3VOU A;  4LC1 A;  1NI8 A;  3SYA A;  4O4H A;  1GM7 A;  3DC6 A;  1SQX H;  3VQW A;  4CH3 A;  4P30 A;  4U3J A;  3L75 H;  1F23 A;  3F7V C;  3S3W A;  1ORQ C;  4BIO A;  5HFM A;  3OTO B;  2LW1 A;  3CRA A;  3ETD A;  5EK0 A;  1JJO A;  5JH7 A;  5E79 Z;  4TUY A;  1ZL8 A;  1P49 A;  3HKC A;  5BXZ A;  1FJG O;  1XBL A;  1K9M W;  1QQC A;  1QHT A;  5B66 Z;  4LR3 A;  5L3B A;  4EB6 A;  4GUN A;  2G38 A;  2VQE B;  5B3S B;  1Q5O A;  1KQS U;  4JI4 O;  1OHH G;  3WB1 A;  1WA8 B;  4ZKI A;  4CH4 A;  5CA0 A;  2ZIM A;  4O2B A;  5B1A C;  2ILM A;  1VF5 B;  2QKS A;  2Z3Y A;  2HLD G;  4K0K B;  4JI2 O;  4DR2 O;  4JV5 O;  4DR3 O;  1R6N A;  2PI4 A;  1OCO B;  1GK9 A;  4CH6 A;  4NXM O;  2OTJ V;  4JYC A;  3GVM A;  4PHZ A;  5EIB C;  3CS5 A;  3SPI A;  4LFB B;  4DV5 B;  1WP7 A;  4GX2 A;  2PY5 A;  4PDV A;  5C8Y B;  1H8H G;  2JJ1 G;  3VBB A;  1YDX A;  4JYY A;  2DQ3 A;  4TT3 G;  3JAR B;  4H44 B;  1WLE A;  2RDC A;  1XUQ A;  3B8M A;  1HNZ B;  2UXC O;  2X7R B;  4DR4 B;  4DXW A;  2CTW A;  1SS3 A;  2YI9 A;  3P3P A;  4I7Z B;  4KP4 A;  2F43 G;  3T1Y B;  2GUZ A;  2H94 A;  4F6R B;  4JI6 B;  3RYF A;  2F4V O;  3RYH A;  3AG3 B;  3ICX A;  2Q4P A;  1M93 A;  1UPG A;  4B3R O;  1I5X A;  4LWS A;  4A5U B;  2ZCE A;  3JCZ A;  3G80 A;  4DO2 A;  1LUW A;  4LNU B;  4L87 A;  1U96 A;  4UCV A;  3K5L A;  3RVZ A;  4TOI A;  1V55 C;  1SES A;  2QTS A;  2ZE7 A;  1VQM V;  5LA6 A;  2JGU A;  4X89 A;  3CJH B;  2ZNI A;  3SYP A;  4R50 A;  4WFF A;  2V4D A;  1CEZ A;  2JK5 C;  3CC4 V;  1Y66 A;  3NXS A;  3L9D A;  1R3L C;  1QU7 A;  1S77 D;  2UUA O;  3JAS A;  2XOK G;  3WG7 C;  2Q5Z A;  3IGA C;  3OT7 A;  2FYU H;  4RUE A;  3T2M A;  2XUM A;  3HKE B;  2NNU A;  5IJ9 A;  5EYP B;  4TV8 A;  2GV9 A;  5EBM C;  1KC8 W;  3RWR D;  3BA9 A;  1ZWI C;  2A79 B;  1VQ7 V;  3OGC C;  4FLW A;  3T1H B;  1VQ9 V;  4C7U A;  3OGI B;  3SYQ A;  3ABU A;  2WA4 A;  4DW1 A;  5KHK A;  5A9G A;  4UVC A;  2XAQ A;  3JAT A;  3BA8 A;  2P06 A;  4Z1M G;  1EZJ A;  2ZQM A;  2R9R B;  3FAV B;  4I4T B;  3UO3 A;  4DR1 O;  3OE7 G;  4X1I A;  2WLL A;  1GO3 F;  4JI1 B;  5EBL C;  1VF6 A;  5IJ0 A;  4K8X A;  1KUQ A;  2GHY A;  3JAW B;  3CD6 V;  1AI6 A;  4X65 O;  1CP9 A;  5DN6 G;  3H1K H;  1SQP H;  1OJH A;  3W7U A;  1N33 O;  1R3I C;  2ZKO A;  1XEQ A;  5L3G A;  3CE2 A;  5J2U A;  4DV2 O;  5LXT A;  5JVD A;  1UFI A;  3UT5 B;  1P84 F;  1V55 B;  1VQ6 V;  3K5M A;  5CMU A;  3HKD B;  4WFG A;  1I94 O;  1YXB A;  2FTK A;  3FFQ A;  2EUL A;  3BRC A;  4I55 B;  1MAB G;  1M90 W;  1WP8 A;  4O4J B;  4NKG B;  3E2E A;  1VIB A;  2E3C A;  4K8Z A;  1IBL O;  4GX5 A;  5BY1 A;  4LH6 A;  1J5E O;  3RN4 A;  1KBH A;  1MSW D;  4OXS A;  3WG7 B;  2QTO A;  3K06 A;  2BSK B;  3JAM N;  1Q81 W;  2EIK C;  2LFS A;  4ICG A;  3TXQ A;  2A3Q A;  5BMV B;  2EJ7 A;  4JI7 O;  1OCC C;  2ZE8 A;  3K04 A;  4HNA A;  2E5L O;  2AZ2 A;  3FB7 C;  1N36 B;  1TVK A;  1HNX B;  2YS8 A;  1K8A W;  1AI4 A;  5CB4 A;  3E8B A;  1RSO A;  1HP8 A;  4JV5 B;  3F7Y C;  2QA4 V;  5LL6 Y;  3AG1 B;  4MVO A;  4H0L B;  4NXM B;  3OMN B;  4LF9 O;  2MW2 B;  1KD1 W;  3WFV A;  2AZ0 A;  1SQF A;  4R7C A;  3RYI B;  2YIB A;  2ZE6 A;  4JPR A;  1BSM A;  2LGQ A;  1H2K A;  2RN9 A;  2UXC B;  3QF7 A;  5JCO A;  1FXH A;  3U11 A;  2PYJ A;  5ITZ A;  1XIL A;  3EXA A;  3EHB B;  3JAK A;  2WPD G;  3GWO A;  2F4V B;  1W0K G;  3JSN A;  1TUB A;  4J9Y B;  3SJC C;  2QWP B;  5LP6 B;  1J95 A;  4B3R B;  5FLX N;  4DV1 O;  5FNV A;  1N4C A;  5L3F A;  2ZDI A;  4JI3 O;  3CCQ V;  3W7S A;  4O4I B;  2YUA A;  3DXR B;  1L0N H;  1NT2 B;  3H01 A;  4I0X A;  3TJT A;  2YXH A;  1FXK C;  3MHH C;  1DK1 A;  1VQP V;  1Q6I A;  2HJF C;  5KMG A;  3VQY A;  1VQ4 V;  3OUF A;  3ZMU A;  3DTU B;  3UCS C;  3AEI A;  2WLH A;  2XT9 A;  1I0H A;  2ATK C;  4DV6 B;  2UUA B;  5H5N A;  3IJ4 A;  3CC2 V;  4YJ3 B;  3ZJZ A;  4JAU A;  3H1J H;  1FYJ A;  3RYC A;  5LMN O;  2CH7 A;  2DJV A;  2Q7H A;  4B08 A;  4PV1 B;  4FJC C;  4AHC A;  1A32 A;  2IU0 A;  1ENV A;  4DV4 B;  2UU9 O;  4J42 A;  2UXB O;  4YJ2 B;  4RUF A;  2XAF A;  2VQF O;  1PKX A;  3D3Q A;  2QDO A;  1F7Y A;  3ZCC A;  1H2N A;  4FM2 A;  3TGU H;  1LNQ A;  3G6B A;  4XDJ A;  3OR7 C;  1HWY A;  1QLE C;  4YIP A;  1XMQ O;  4I9W A;  4AQY O;  3M7M X;  4UUJ C;  2A7W A;  1VQL V;  4MTG A;  3ZMS A;  2WLI B;  1H2S B;  1SF9 A;  1IBM B;  3OD4 A;  2IU3 A;  2QEX V;  2JIZ G;  4DR1 B;  4JTA B;  4TWK A;  3LDE A;  2P67 A;  4DV3 B;  1NQT A;  2EX3 A;  3KG2 A;  3OEE G;  2QWO B;  2M7W A;  3Q4H A;  2UXN A;  4B3T O;  1YIT V;  1K92 A;  1WN7 A;  3C90 A;  4PDR A;  2BTQ B;  1N33 B;  1N0J A;  4DR5 B;  1S5J A;  1JPX A;  4PD4 F;  1IUR A;  2VWJ A;  3BFR A;  4IL6 Z;  1WPX A;  4KFM A;  3AG2 C;  5GON B;  4ZOL B;  1GKF A;  1FXK B;  2Y4T A;  1I94 B;  1HR0 O;  4FIP C;  4MT8 A;  3LSQ A;  5JWP A;  4J7K A;  5KHJ A;  4IIJ A;  2GBO A;  1K4C C;  2Y4U A;  1DF4 A;  2JEU A;  4FZ0 A;  4GT1 A;  3TXS A;  1RFY A;  1IBL B;  5B3S C;  3HKB A;  3JYC A;  4TV9 B;  1VMG A;  4YY3 B;  1G8M A;  2YID A;  2R9I A;  4FM0 A;  4PI0 A;  3OW2 U;  3SPJ A;  4X62 O;  3CC7 V;  4JI7 B;  3RGB A;  1E1R G;  4DR6 O;  2E5L B;  1QR9 A;  2E76 B;  2JGD A;  3N2K B;  3ABL C;  1NVP D;  1GTO A;  3CYO A;  3CCR V;  1YEW A;  2KQX A;  4UB8 Z;  4J9Z B;  3LSS A;  4ZHQ B;  3ABM C;  4LF9 B;  1NS1 A;  2DQ0 A;  3JD3 A;  1AP6 A;  1GN2 A;  4GX0 A;  4LF8 B;  1AR4 A;  5CBF A;  3ZRX A;  1ZLZ A;  1XNQ O;  1XRE A;  1XMO B;  1JOY A;  3ETQ A;  1VP7 A;  4FFB A;  5J2T B;  4DUZ B;  1ZTE A;  3ZHQ A;  1SQB H;  5KA5 A;  3N27 A;  2ETN A;  3P32 A;  3AG3 C;  1GAX A;  2DN9 A;  5A2Q N;  2H8P C;  3QO5 A;  4NXN O;  3PN1 A;  1MMM A;  5J9P C;  4YXW G;  4PDL A;  4O4H B;  3A0R A;  1MZE A;  3CMA V;  3K9A A;  4U3J B;  3WB2 A;  3G6E V;  4DV1 B;  4DK1 A;  1K7D A;  4FLV A;  4LF7 B;  4JI3 B;  4J10 A;  4E4E A;  5JQG A;  1IBK O;  3AG2 B;  1BQZ A;  5JH7 B;  4TUY B;  4LFC O;  1ZL8 B;  3HKC B;  4JAS A;  3CCS V;  4O4L A;  1RP3 B;  5IWA O;  3W7W A;  1S72 V;  4PJ0 Z;  3L70 H;  4DV7 O;  4EB6 B;  1YTF D;  4X64 O;  1M56 B;  5BZB A;  4HBN A;  5C93 A;  5CA0 B;  1HW7 A;  3K57 A;  4O2B B;  1RM1 C;  2PZS A;  3B77 A;  1QVG U;  1LR1 A;  1M5I A;  2HR3 A;  3IC7 A;  3ETG A;  3H1I H;  2DOS A;  2Y69 C;  4IYI A;  2PF4 E;  4N21 A;  1BS3 A;  1X4T A;  2PUS A;  5LMN B;  2EZP A;  2Q8V A;  4K3A A;  4DRX A;  2CTQ A;  1SET A;  3ABL B;  2UU9 B;  3RT3 C;  2XAS A;  4OPH A;  5LOV A;  5EC2 C;  4LF6 O;  3OM3 B;  1BZK A;  2F93 B;  3ABM B;  3EFF K;  1SQQ H;  1HDJ A;  4FK5 C;  1WJZ A;  2X6A A;  3G71 V;  1S3J A;  4MVR A;  1KKD A;  4AQY B;  3OUS A;  3SJA C;  4U7O A;  1XHZ A;  4WCE V;  2XND G;  3FD9 A;  4JI5 O;  2GUZ B;  4P9P A;  4X20 A;  3RYF B;  2DMX A;  3RYH B;  3ZRW A;  4PA3 A;  5LGN A;  1QBZ A;  3ABK B;  3ZHT A;  2X6C A;  1NH2 D;  4J7J A;  4LWS B;  5LYJ A;  4JZG A;  3JD2 A;  1OCR B;  3PJS K;  1ZX3 A;  2HG5 C;  2CTR A;  4PA4 A;  3QO7 A;  2F66 C;  3UQ8 A;  2WWW A;  5KX5 A;  5LHH A;  5KLV H;  4B3T B;  1EN6 A;  4G27 B;  1EN5 A;  1YJ9 V;  3MDS A;  3N2G A;  2YC0 A;  5LA6 B;  1YVW A;  1AJN A;  4WFH A;  4GKJ O;  3BY6 A;  4WBN A;  4D7S A;  4LFA O;  1P7G A;  1HR0 B;  3CCM V;  2OIE A;  1SQG A;  3JAS B;  1NTK H;  1JMK C;  4LF4 O;  4JYB A;  1Y76 A;  1FKA O;  3H1H H;  4Z2W A;  1ARO P;  5CN0 A;  1RM1 B;  3FB6 C;  5IJ9 B;  4DV0 O;  2HHH O;  2Y69 B;  4G2K A;  4J11 A;  1KMI Z;  1XNR B;  1Y74 B;  4B7E A;  1OCZ C;  1XI1 A;  4TV8 B;  1NVP B;  5BR8 O;  1M9N A;  1Z5W A;  5IYC O;  2CUG A;  3HR0 A;  4QGP A;  2PYL A;  2B1I A;  1EM1 A;  4UVA A;  2LP7 A;  4UCO A;  1RPO A;  4DR6 B;  1QNM A;  3AG1 C;  4I50 A;  2YIC A;  5EBW C;  1S0V A;  4ZI7 A;  4P9O A;  4TSF G;  2ZIN A;  1SRY A;  2HJD A;  1Q7Y W;  3BPZ A;  4IHJ A;  2JEX A;  4WFA V;  2YXY A;  2QE7 G;  3THO A;  2XAH A;  4AI8 A;  4DK0 A;  5B5E Z;  2HKO A;  2VS0 A;  1AIL A;  3JAT B;  3G4S V;  4FLX A;  4UCS A;  2HFE C;  3CRR A;  3SPG A;  1XNQ B;  2OYQ A;  1K5S A;  5JCO C;  4X1I B;  5GW7 A;  1GH6 A;  3ASN C;  2WLL B;  2MK3 A;  3BVO A;  2JS5 A;  1WB7 A;  2EIN B;  1PNL A;  4NYK A;  5IJ0 B;  3ZMT A;  1EFR G;  2YI8 A;  4P2Z A;  2YEV A;  5LP6 C;  1FPO A;  5H6R A;  4YHH O;  3FB5 C;  1PNK A;  3ZMV A;  4NXN B;  1LUV A;  4MSW C;  1N0N A;  5J2U B;  5LXT B;  5JVD B;  3DSQ A;  1R6K A;  3KKY A;  1IX9 A;  2RQ6 A;  5FL7 G;  4UCU A;  4N23 A;  1M57 B;  2WLK A;  1KB9 F;  4X66 O;  2LW7 A;  3OAA G;  3W7T A;  1YTF B;  2QWR B;  1AP5 A;  1VEW A;  1EZV H;  4JZ2 A;  1SKV A;  4MVZ A;  3RW0 A;  3CCL V;  2OT5 A;  4X1K A;  4BR6 A;  4FLU A;  1I7F A;  4LFC B;  5KUK A;  3I55 V;  2CGN A;  4UVB A;  1FJG B;  5GTI Z;  3K3W A;  2HVK C;  2W6J G;  4DV7 B;  3QG5 A;  2BCC H;  4X64 B;  4RQE A;  1D5A A;  1B06 A;  4JI4 B;  3U10 A;  3CPW U;  4Q6G A;  2EIL B;  1OCZ B;  4GKK O;  4HNA B;  3CEI A;  1TVK B;  2ADP A;  2A9H A;  5CB4 B;  4LCU C;  1RSO B;  5KAF Z;  4WFE A;  3OR6 C;  3APQ A;  3BEH A;  1B6Q A;  4JI0 O;  2LQT A;  4JI2 B;  4DR2 B;  4H13 B;  4DR3 B;  2R70 A;  3K59 A;  2CGO A;  5L3E A;  3AK3 A;  3D36 A;  5CA3 A;  1L8D A;  4QPK A;  1FFT B;  3SYO A;  4RWU A;  4HAM A;  1YI2 V;  3E22 A;  4EKW A;  1WB8 A;  2GTS A;  1N34 O;  4XBF A;  3QNE A;  4BIZ A;  2OWO A;  3MD0 A;  4QPJ A;  2WAM A;  3M8A A;  4HYO A;  1AB3 A;  2ITC C;  2IM9 A;  3H1L H;  4YIO A;  1NH2 B;  1V9P A;  4JI8 O;  2YXL A;  2HVJ C;  1WAZ A;  4JF3 A;  4JI5 B;  3ASN B;  3ABT A;  2QM4 A;  5ITZ B;  5KUM A;  4FLT A;  1TUB B;  1G1X B;  2ZM6 O;  1Q6H A;  3CRQ A;  1Q6U A;  5JJE B;  4G28 B;  1NU1 H;  2IJJ A;  5IE9 A;  5FNV B;  2IJH A;  2KSD A;  2RJZ A;  2ZXW B;  2UUB O;  1BQ0 A;  4ZIB A;  1FAF A;  1NTM H;  4GX1 A;  4I0X B;  3QVN A;  2E74 B;  1M1K W;  4KXR A;  3ZMZ A;  3D8C A;  5DM6 V;  2OCC C;  1YIJ V;  3L73 H;  5KMG B;  5FPO A;  4GZR B;  4OGQ B;  3OTO O;  3B4S A;  1Q82 W;  2EIM B;  3JD4 A;  2LGW A;  3SR2 C;  1D5N A;  4FM1 A;  2ZIO A;  2B1G A;  4F6E A;  4WFB V;  1YF2 A;  3RYC B;  2CH7 B;  2DWE C;  3TCU A;  4DV0 B;  1OV9 A;  2HHH B;  1DTO A;  4NTW A;  5K1X A;  1NR7 A;  4IT5 A;  2A06 H;  1VQN V;  3AG7 A;  2E75 B;  4NB5 A;  5E1A C;  1W2B U;  1H2G A;  4KL1 A;  2H3O A;  5CBH A;  3ZS8 C;  2WLN A;  3UO2 A;  1BE3 H;  2R9A A;  1VAR A;  4PI2 A;  3ZRS A;  1VQO V;  1KP3 A;  2XAG A;  1MNG A;  3O9O A;  3HPL C;  4JAV A;  3CX5 F;  2X6B A;  1KYO F;  4KHP O;  2DYR C;  1VQ5 V;  4LFB O;  2DWD C;  2Q7E A;  4DV5 O;  3DC5 A;  3I56 V;  3GWK C;  4I5S A;  2PGG A;  4ABM A;  5JJN B;  3UM7 A;  2W6I G;  1QCE A;  3R66 A;  1Y67 A;  3C3S A;  3L74 H;  3K5O A;  3CXH F;  2KB1 A;  2N05 A;  1Q3E A;  1BHA A;  3CWB H;  2LJ2 A;  3T4D A;  3T1Y O;  4YHH B;  2IJI A;  1B04 A;  1P7B A;  4JI6 O;  4X65 B;  2BOB C;  1EBO A;  2L6L A;  4PA6 A;  3W7X A;  3AK1 A;  1SER A;  4DV2 B;  4L8J A;  5GTH Z;  3ETE A;  4MVU A;  2OCC B;  5LGT A;  1MZF A;  3CHX A;  1US6 A;  3QTC A;  4IIJ B;  1PPJ H;  4E2L A;  1NJI W;  4X1Y A;  4NR1 A;  4J7Z A;  3SPC A;  1M56 C;  1J5E B;  1K4D C;  2D3O W;  5EZY A;  1Q86 W;  4PA7 A;  1F51 A;  3JAL A;  1FFX A;  2ZNJ A;  1QLN A;  3CSX A;  1GN3 A;  4MVQ A;  3IFX A;  4O2A A;  3CME V;  1R3J C;  1JFF A;  4GKK B;  5D5Q A;  2JGD B;  3ML0 A;  4CS3 A;  1Q8I A;  2QJ1 A;  4FLY A;  1R1B A;  4UB6 Z;  1K5Q A;  1PL0 A;  4JI0 B;  3R65 A;  3APO A;  4NTX A;  3A0H Z;  2IH1 C;  3B8N A;  5AG2 A;  4BIU A;  2ZD9 A;  1O9H A;  2CDY A;  2XHB A;  2P4K A;  1NKD A;  1N34 B;  1KU9 A;  1Y4M A;  4CBC A;  3LDC A;  3O65 A;  5IYZ A;  2P6J A;  2DYR B;  2OIG A;  4FFB B;  3CCJ V;  3KZI Z;  4JI8 B;  4BWA A;  2PI5 A;  3ABK C;  5EIB D;  4DR7 O;  1JA8 A;  1SA0 A;  2K9P A;  2ZM6 B;  1YCI A;  1OCR C;  4Q20 A;  1N32 O;  1XL4 A;  1Z5V A;  2O57 A;  4IYH A;  4IGG A;  2HEP A;  4LH7 A;  3E83 A;  3OEH G;  3T1C A;  5KHI A;  4JI1 O;  3OTF A;  1FD9 A;  4NVP A;  5JQG B;  2KG7 A;  5LMU O;  1TAE A;  1V54 B;  3DGE A;  4BW5 A;  4FMT A;  3AG4 B;  5CA1 A;  1MOF A;  4O4L B;  2UXD O;  2X0L A;  2OCH A;  1AR5 A;  1K33 A;  4EFB A;  4JTD B;  4BW9 A;  1Y6X A;  4W4K A;  4UCR A;  2GTA A;  1Q90 D;  3LSU A;  2UXX A;  3LUT B;  3VQX A;  4JYA O;  1K73 W;  4CC6 A;  3UKM A;  4MW8 A;  4B3M O;  1F4N A;  1TA8 A;  3ZX6 A;  3A8T A;  3WB0 A;  5HFL A;  1F4M A;  3ZN0 A;  1R3K C;  2RNB A;  1AJQ A;  4UFZ A;  1TGO A;  4DRX B;  1H2L A;  1COW G;  1WA8 A;  5LOV B;  3EVK A;  2UXB B;  3X2Q B;  2VQF B;  1N36 O;  1HNX O;  4K35 A;  2QKA A;  3ZBH A;  1R6T A;  3SJB C;  4X9Q A;  1IXB A;  1N8R W;  3S3X A;  2EBO A;  1KP2 A;  1YSC A;  1XMQ B;  1P4R A;  1ZUQ A;  2ITD C;  1QR8 A;  3P3N A;  2VRZ A;  4WF9 V;  1HNW O;  4X20 B;  2AHZ A;  4KHP B;  2CAZ C;  1TUE B;  2M6Y A;  3ZRW B;  2YIB D;  1YJW V;  5LHG A;  1AR1 B;  2EIN C;  5LYJ B;  4GYC B;  1VF6 C;  5C8Y A;  1PM9 A;  1B3Q A;  3U0Z A;  5B1B C;  3ZRV A;  3JAR A;  1NBM G;  5IY5 C;  5KX5 B;  2IJK A;  4EEQ A;  5KHG A;  3STL C;  4LF5 O;  2N04 A;  2WSS G;  1H2M A;  5KA6 A;  1O9G A;  3SYC A;  5L3C A;  3N2G B;  4F6R A;  1SZT A;  1JX9 A;  1M57 C;  2QGN A;  3VQV A;  2YDE A;  4AIL C;  1RPR A;  4WBN B;  1MA1 A;  2XAJ A;  3ZHV A;  1DGS A;  2CK3 G;  3ZED A;  4LNU A;  3K5N A;  4HZ3 A;  4I9Q A;  1Y76 B;  1XL6 A;  4RQF A;  2NR5 A;  1ROP A;  4X88 A;  1AI7 A;  3QO8 A;  3CJH A;  2EIL C;  2UUC O;  1ZAU A;  3JSL A;  4X62 B;  4MW3 A;  3SJQ C;  4B3S O;  4QE7 A;  4NTY A;  4GLX A;  4DV6 O;  4EFE A;  1WNS A;  3LNN A;  1VQ8 V;  4JAA A;  4RAI A;  3ZN1 A;  4I50 B;  5IYD O;  4F4L A;  3D36 C;  5B1A B;  4TQF A;  4ZI7 B;  4DYL A;  1CXZ B;  2ADQ B;  3HKE A;  4IHJ B;  5KAI Z;  2FKX A;  1PV0 A;  4R8C A;  2P7T C;  4GCZ A;  1Y74 A;  5EYP A;  2OTL V;  4DV4 O;  1XQ8 A;  2L35 A;  4FZ1 A;  4X8A A;  1QVF U;  1URF A;  2JDI G;  4DUY O;  1M4U A;  1S5H C;  4H33 A;  1THZ A;  4ASU G;  2DW4 A;  4PEL A;  5DEC A;  3E8F A;  1E79 G;  4FVM A;  2FB5 A;  4CH5 A;  5B1N A;  1S5L Z;  4B7K A;  4RO2 A;  3RVY A;  3MAQ A;  2YEV B;  1KKC A;  2Q9L A;  5B1B B;  2DE0 X;  2Y48 A;  1IBM O;  4DR7 B;  5IY5 B;  3SPH A;  2A0L A;  2ZDI C;  2Q0O C;  1XHX A;  4MTX A;  2YSU B;  2ZXW C;  2YIA A;  1N32 B;  2VWK A;  2WLJ A;  5LHI A;  1AJP A;  3FAV A;  4I4T A;  2Y0I A;  2JS3 A;  2XTA A;  2ZT9 B;  3ZHR A;  4DV3 O;  5LMU B;  4UXN A;  2GDS A;  1IBK B;  4X1K B;  2CTP A;  3ZIA G;  4Z1V A;  3JAW A;  2JVD A;  2UXD B;  3IAY A;  5IWA B;  4DR5 O;  2D2C B;  1YJN V;  3CRC A;  3RFR A;  3A2F A;  3SDL A;  2AXT Z;  2EIM C;  3CCU V;  3CB2 A;  5K1P A;  1DLB A;  2Q67 A;  3UT5 A;  4H37 A;  5TIS Z;  4JYA B;  3HKD A;  4CS2 A;  3LDD A;  2EJR A;  3MHS C;  1H8E G;  2QR4 A;  3FKS G;  4B3M B;  4I55 A;  4OX9 O;  4O4J A;  4CC5 A;  5F2V O;  1IVS A;  1JJ2 U;  1MSD A;  4YY3 O;  3AK2 A;  4JTC B;  5DED A;  3CP1 A;  5D5P A;  4MVM A;  3RBZ A;  2BSK A;  3BCC H;  3J7A U;  1GN4 A;  2Q69 A;  2BTO A;  3C3T A;  5BMV A;  3E22 B;  3OFN G;  1VF7 A;  1PD3 A;  5H9C A;  2Q0A A;  5LGU A;  2HP8 A;  4LF6 B;  1JCH A;  1JQ0 A;  4D7T A;  1WPB A;  1XDC A;  2V7Q G;  1KEC A;  4CS4 A;  3E89 A;  1G4Y B;  1FXV A;  1NR1 A;  3CCV V;  1AVM A;  5EC1 C;  2EZO A;  3B09 A;  3KCY A;  1UJW B;  1HNW B;  3JAK B;  2LFR A;  4LF8 O;  2P4V A;  4KUM A;  2JRI A;  2Q73 A;  3L72 H;  1BMF G; 
#chains in the Genus database with same CATH homology
 3ETE A;  4MVU A;  2OCC B;  5LGT A;  1RM1 C;  2A79 B;  1VQ7 V;  2P90 A;  3B77 A;  3OGC C;  1VQ9 V;  1QVG U;  3IC7 A;  2HR3 A;  3E35 A;  2NLJ C;  3ETG A;  4PDM A;  4E2L A;  1NJI W;  2Y69 C;  3SYQ A;  3ABU A;  4N21 A;  1L1F A;  2EZP A;  4UVC A;  3SPC A;  5IDJ A;  1M56 C;  2XAQ A;  1H38 A;  3T4Z A;  1GMG A;  2QM8 A;  1K4D C;  2D3O W;  1SET A;  3ABL B;  1OZ0 A;  1Q86 W;  3ASO C;  4PA7 A;  1F51 A;  4MVS A;  2Z5U A;  2XAS A;  1QLN A;  4MVQ A;  3IFX A;  4Z1M G;  5EC2 C;  1EZJ A;  2ZQM A;  3OM3 B;  3CME V;  4MTF A;  3ABM B;  1R3J C;  5CBG A;  2R9R B;  3EFF K;  1GM8 A;  1BHB A;  4FK5 C;  3OE7 G;  2GSM B;  2X6A A;  1AI5 A;  3ML0 A;  2WLL A;  1K3E A;  4LP8 A;  1GO3 F;  5L3D A;  3G71 V;  2QM7 A;  2Q6A A;  1S3J A;  4MVR A;  1KKD A;  5EBL C;  3OUS A;  2GHY A;  1GM9 A;  1K5Q A;  4LBE C;  1PL0 A;  4U7O A;  4XDL A;  2EIJ C;  3R65 A;  4WCE V;  2DYS C;  2XND G;  3CD6 V;  1AI6 A;  3OMA B;  1CP9 A;  5DN6 G;  3E86 A;  2IH1 C;  3B8N A;  3W7U A;  4BIU A;  1R3I C;  4P9P A;  3E8H A;  4BAY A;  2ZD9 A;  3ZRW A;  5L3G A;  4PA3 A;  4R6Z A;  5LGN A;  1S76 D;  1QBZ A;  3ABK B;  1V55 B;  2X6C A;  3K0D A;  1NH2 D;  1VQ6 V;  1NKD A;  2ZR3 A;  1R73 A;  5CMU A;  4WFG A;  2EIK B;  2FTK A;  1Y4M A;  3JD2 A;  4CBC A;  3LDC A;  4JGS A;  1OCR B;  2P6J A;  3PJS K;  2HG5 C;  2DYR B;  4PA4 A;  1VQK V;  3QO7 A;  1OCC B;  3CCJ V;  2WWW A;  1MAB G;  3M99 B;  1M90 W;  2AHY A;  3E2E A;  5LHH A;  3K08 A;  4GX5 A;  4G27 B;  2PI5 A;  3ABK C;  1MSW D;  4OXS A;  3WG7 B;  1YJ9 V;  2QTO A;  3K06 A;  1AJN A;  4WFH A;  3OMI B;  1Q81 W;  2EIK C;  3LNM B;  2LFS A;  5H6Q A;  1OCR C;  2IH3 C;  3BY6 A;  4Q20 A;  1JVM A;  1OCC C;  1XL4 A;  3STZ C;  3K04 A;  3E83 A;  3OEH G;  3T1C A;  3CCM V;  3FB7 C;  3JD1 A;  1K8A W;  1AI4 A;  4JYB A;  1V54 B;  3DGE A;  3E8B A;  4FMT A;  4BW5 A;  3AG4 B;  1ARO P;  3GB7 C;  5CN0 A;  4PA9 A;  3F7Y C;  2QA4 V;  1RM1 B;  3FB6 C;  2K1E A;  1MOF A;  3AG1 B;  4MVO A;  1CPY A;  2X0L A;  1PNM A;  3OMN B;  1K33 A;  2Y69 B;  4G2K A;  3K03 A;  1OCZ C;  2WLI A;  4JTD B;  4QE9 A;  1NVP B;  1M9N A;  5IYC O;  1KD1 W;  2UXX A;  3WFV A;  3LUT B;  5LBQ A;  2B1I A;  4UVA A;  2LP7 A;  1V54 C;  3TK1 A;  1K73 W;  1RPO A;  3AG4 C;  4R7C A;  3ASO B;  3UKM A;  2IW5 A;  4MW8 A;  4XDK A;  4JPR A;  1F4N A;  3AG1 C;  1IXM A;  4FPP A;  5EBW C;  1S0V A;  4P9O A;  4TSF G;  1F4M A;  5HFL A;  3ZN0 A;  3CXC U;  1SRY A;  1Q7Y W;  3P30 A;  2JEX A;  3CCE V;  1FXH A;  4WFA V;  1R3K C;  1AJQ A;  2QE7 G;  3K79 A;  2XAH A;  3EHB B;  2WPD G;  3GWO A;  1COW G;  2HKO A;  1W0K G;  3G4S V;  1K97 A;  4J9Y B;  5IYB O;  1J95 A;  2EIJ B;  2DYS B;  1FXK A;  3X2Q B;  2HFE C;  3SPG A;  5L3F A;  1K5S A;  2ZDI A;  3E8G A;  5GW7 A;  3ASN C;  2WLL B;  2MK3 A;  3W7S A;  3CCQ V;  2EIN B;  1PNL A;  1N8R W;  3H01 A;  2EBO A;  1KP2 A;  1YSC A;  3ZMT A;  1EFR G;  1P4R A;  3FYI B;  4P2Z A;  1YHQ V;  2YEV A;  5H6R A;  1FXK C;  2ITD C;  1QR8 A;  3FB5 C;  1PNK A;  3MHH C;  4WF9 V;  3ZMV A;  2AHZ A;  3X2Q C;  4QNH B;  1VQP V;  1TUE B;  3ZRW B;  4MSW C;  2HJF C;  1YJW V;  5LHG A;  1VQ4 V;  1R6K A;  1AR1 B;  4UV8 A;  1FS0 G;  3FB8 C;  4QIW F;  5FL7 G;  3TET A;  2V1D A;  2EIN C;  3OUF A;  3ZMU A;  3DTU B;  3D3I A;  4N23 A;  1M57 B;  2WLK A;  3AEI A;  5B1O A;  2WLM A;  2WLH A;  1OCO C;  2ATK C;  3OAA G;  3W7T A;  1YTF B;  3CC2 V;  5B1B C;  3HB3 B;  3ZRV A;  3RW0 A;  1NBM G;  4MVZ A;  1MG1 A;  3CCL V;  5IY5 C;  3ZJZ A;  4JAU A;  2OT5 A;  2IJK A;  4QJF B;  5KUK A;  4U7N A;  3STL C;  2WSS G;  1K34 A;  3I55 V;  4UVB A;  5KA6 A;  4FJC C;  2B5U A;  2C2A A;  3SYC A;  4CZZ A;  5L3C A;  1QLE B;  3K3W A;  2HVK C;  2W6J G;  1SZT A;  1ENV A;  2IU0 A;  4RQE A;  1JX9 A;  1M57 C;  2Q68 A;  2W0F C;  3JD0 A;  2JJ2 G;  4RUF A;  2XAF A;  2ZR2 A;  4MTO A;  1RPR A;  1PKX A;  2XAJ A;  3F5W C;  3CPW U;  2EIL B;  1OCZ B;  2CK3 G;  3ZCC A;  1LNQ A;  1W0J G;  3FYE B;  2A9H A;  4HZ3 A;  4LCU C;  4XDJ A;  1BL8 A;  3OR7 C;  1HWY A;  1XL6 A;  3K0G A;  1QLE C;  1DF5 A;  4I9W A;  4WFE A;  4RQF A;  3OR6 C;  4UV9 A;  3BEH A;  4ZBM A;  1B6Q A;  4UUJ C;  1I5Y A;  1ROP A;  4X88 A;  2BOC C;  1VQL V;  4MTG A;  1E1Q G;  3ZMS A;  4MS2 A;  3VOU A;  4LC1 A;  5L3E A;  1AI7 A;  2WLI B;  3D36 A;  3QO8 A;  5CA3 A;  3SYA A;  1GM7 A;  2EIL C;  4QPK A;  1FFT B;  3SYO A;  4HAM A;  1YI2 V;  4EKW A;  4P30 A;  2IU3 A;  1F23 A;  4MW3 A;  3SJQ C;  3F7V C;  4QE7 A;  1ORQ C;  2QEX V;  2JIZ G;  5HFM A;  4XBF A;  3QNE A;  4JTA B;  1VQ8 V;  4TWK A;  4BIZ A;  3MD0 A;  4QPJ A;  2WAM A;  3ETD A;  4RAI A;  3ZN1 A;  5EK0 A;  3LDE A;  2P67 A;  5IYD O;  4F4L A;  4HYO A;  2ITC C;  1NQT A;  3KG2 A;  5B1A B;  3OEE G;  2M7W A;  2UXN A;  1NH2 B;  1YIT V;  1K92 A;  4R8C A;  2P7T C;  4PDR A;  4GCZ A;  1K9M W;  2OTL V;  2HVJ C;  4JF3 A;  3ASN B;  3ABT A;  5L3B A;  5KUM A;  5B3S B;  1KQS U;  1JPX A;  1OHH G;  4ZKI A;  1WPX A;  4KFM A;  3AG2 C;  4X8A A;  1QVF U;  1GKF A;  1FXK B;  2JDI G;  1S5H C;  2IJJ A;  4G28 B;  4H33 A;  1THZ A;  2IJH A;  5B1A C;  4FIP C;  4MT8 A;  4ASU G;  2DW4 A;  2QKS A;  3LSQ A;  4PEL A;  3E8F A;  2Z3Y A;  2HLD G;  2ZXW B;  1E79 G;  1K4C C;  5B1N A;  1DF4 A;  2JEU A;  4GT1 A;  4GX1 A;  4RO2 A;  3RVY A;  5B3S C;  1R6N A;  1M1K W;  2PI4 A;  1OCO B;  2YEV B;  3JYC A;  1GK9 A;  3ZMZ A;  5B1B B;  1G8M A;  2OTJ V;  4JYC A;  5DM6 V;  2OCC C;  2Y48 A;  2R9I A;  5IY5 B;  1YIJ V;  3OW2 U;  3SPH A;  3SPJ A;  3SPI A;  2A0L A;  2ZDI C;  4MTX A;  2YSU B;  2ZXW C;  3CC7 V;  1E1R G;  5LHI A;  2WLJ A;  1AJP A;  4GX2 A;  1Q82 W;  4PDV A;  2EIM B;  3JD4 A;  1H8H G;  1QR9 A;  2JJ1 G;  3VBB A;  4UXN A;  2DQ3 A;  4TT3 G;  3ABL C;  2B1G A;  1NVP D;  1WLE A;  1GTO A;  3CYO A;  4WFB V;  3ZIA G;  3CCR V;  3B8M A;  2DWE C;  2X7R B;  4DXW A;  3TCU A;  4J9Z B;  3LSS A;  3ABM C;  4KP4 A;  2F43 G;  2H94 A;  2DQ0 A;  3JD3 A;  1YJN V;  1DTO A;  3AG3 B;  1NR7 A;  2EIM C;  3CCU V;  1VQN V;  1DLB A;  2Q67 A;  4H37 A;  4GX0 A;  1I5X A;  5CBF A;  3ZRX A;  3JCZ A;  5E1A C;  3LDD A;  1W2B U;  2EJR A;  3MHS C;  1JOY A;  1H8E G;  1H2G A;  4DO2 A;  3FKS G;  5CBH A;  2WLN A;  4L87 A;  3RVZ A;  1JJ2 U;  5KA5 A;  3ZRS A;  3P32 A;  3AG3 C;  1V55 C;  1VQO V;  1SES A;  4JTC B;  1KP3 A;  2XAG A;  3CP1 A;  2H8P C;  3QO5 A;  3HPL C;  4MVM A;  1VQM V;  3RBZ A;  4JAV A;  4X89 A;  2X6B A;  5J9P C;  4YXW G;  2DYR C;  4PDL A;  1VQ5 V;  3A0R A;  2DWD C;  2Q69 A;  3CMA V;  3SYP A;  4R50 A;  3K9A A;  3I56 V;  4WFF A;  3OFN G;  1CEZ A;  4I5S A;  3G6E V;  1PD3 A;  2JK5 C;  5H9C A;  1Y66 A;  3NXS A;  3UM7 A;  2W6I G;  1R3L C;  5LGU A;  3CC4 V;  1S77 D;  1K7D A;  1QCE A;  1JCH A;  2XOK G;  3WG7 C;  1JQ0 A;  3AG2 B;  2KB1 A;  3IGA C;  2V7Q G;  4RUE A;  3T2M A;  1BHA A;  4JAS A;  1KEC A;  2NNU A;  3E89 A;  3CCS V;  1G4Y B;  1FXV A;  1NR1 A;  3T4D A;  3CCV V;  3W7W A;  2IJI A;  1S72 V;  1P7B A;  5EC1 C;  2EZO A;  1UJW B;  1YTF D;  2BOB C;  1EBO A;  4PA6 A;  5EBM C;  3W7X A;  2LFR A;  1KC8 W;  1M56 B;  4KUM A;  5BZB A;  1SER A;  1ZWI C;  5C93 A;  1BMF G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...