2IJKA

Structure of a rom protein dimer at 1.55 angstrom resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
57
structure length
57
Chain Sequence
TKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title New crystal structures of ColE1 Rom and variants resulting from mutation of a surface exposed residue: Implications for RNA-recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 27
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ijkA00
1B6QA 1RPRA 2IJHA 1F4MA 1RPOA 2IJIA 4DO2A 1PD3A 1F4NA 1NKDA 2IJJA 3K79A 1GTOA 1GMGA 2IJKA 1ROPA 2GHYA
chains in the Genus database with same CATH superfamily
2AHYA 5C93A 1OCOC 3APOA 4RQFA 4PI2A 1SQXH 4PD4F 2IJKA 3OUSA 2OCCB 3ABTA 2F4VO 1FXVA 4DV2B 3ZN0A 1H38A 3OR7C 2DOSA 3KCYA 4WFGA 1XL4A 1VQOV 4X1IB 3AG3B 1KD1W 3N2GA 4UB8Z 3J81N 3JATA 3PJSK 4TQDA 1RP3B 4O2AA 4W4LA 4LR3A 3J7AU 2HFEC 3E8BA 2ADQB 3A8TA 4LC1A 3Q4HB 4GX5A 3T1CA 1YSCA 4TUYA 4LBEC 3RYFA 4I0XA 1NVPB 3ASOC 3GWKC 3ZHRA 4GKKO 4JI5B 3CCRV 1KC8W 4B3MB 1K5QA 1KKDA 3ZRVA 4O4HA 2P22C 2CAZC 4MVUA 1XNRB 5CA3A 2W6IG 4OX9O 3MHHC 2CGOA 3VBBA 3CC7V 2UXNA 3LDEA 1Q3EA 2MK3A 2QR4A 1YITV 1SA0B 5AG2A 1UFIA 3HR0A 2XASA 3CCQV 1AR4A 2DJVA 3WG7C 4EEQA 4DR4B 1N34O 2ZR2A 1F51A 1JJ2U 3ZJZA 3CCVV 5GTHZ 4UV8A 2Q73A 1ZLZA 2RCVA 1WN7A 2E5LO 3JAWA 5LP6B 2QGNA 3M99B 2Y4UA 2DQ0A 1I5YA 1MABG 1MZFA 3CCEV 4LF8B 2JGDB 2L6LA 4X1YA 3H1LH 1GK9A 1FXKC 2RDCA 2A9HA 4DK0A 1ZX3A 4ZHQB 1ORQC 5KLVH 2V4DA 3SJQC 3JD0A 1Y67A 2E3CA 1IBLB 2QTOA 1WA8A 3X2QC 4UCRA 1ZWIC 1U96A 4I5SA 1B6QA 1K34A 2QDOA 5EC2C 2AW9A 3D3QA 4ZKIA 3N27A 5FNVB 5J2TB 1NR7A 4DV3B 3K0DA 2Q4PA 2DYRB 4NXNB 1P7BA 2DQ3A 3RW0A 1NS1A 5IY5C 3OMNB 2P90A 3RBZA 3SGIA 1FJGO 2HVKC 2E75B 5L3EA 3ZEDA 4XBFA 4KXRA 1VQ8V 3TXSA 4PELA 4GT1A 3N2KA 4B3SO 3F5TA 1FXKA 1SQPH 4I9WA 4O4IB 3CRRA 5LXTA 1PV0A 2EILB 2NLJC 4WFFA 4DV6O 2Q7GA 2HEPA 2UUBO 1JMKC 1Y74A 2FYUH 1NTMH 5EYPA 3WU2Z 2PZSA 5K1PA 1VQ6V 1R73A 4YJ3A 2KB1A 2AGAA 4F4LA 1YHQV 2MW2B 4KHPO 4ZOLB 5DECA 5LMUB 5C8YA 3ABKC 3AG7A 3ETQA 4JV5B 1Q43A 1Q81W 1FFXB 4HBNA 3ZMZA 1SF9A 4DUZO 1O9HA 2H8PC 1OJHA 1KYOF 5B1BC 2N04A 3H9VA 4RUFA 2Q69A 4RUEA 5H6RA 1AI4A 3KZIZ 3W7XA 3W7WA 4FZ0A 3ZHSA 3SDLA 2W0XA 2LW7A 3CCUV 4J11A 3CSXA 3ZN1A 3OEHG 3BABA 2YXLA 3OAAG 2QWPB 1B06A 1B04A 4PA9A 5FL7G 1Q7YW 5BZBA 1S5JA 2GHYA 3SPJA 5LGNA 4X89A 4X20B 3QVNA 2ZM6B 3FB7C 4JI5O 1IBKB 4B3MO 1N33B 2HHHB 3ZHUA 1YDXA 1VF7A 3SYAA 2N05A 1PNKA 5D5PA 3ZBHA 4X1KA 4HAMA 1T5EA 4WFEA 4U7NA 4UCTA 1VF6C 1JVMA 3T4DA 3EVKA 2ZKOA 1GM8A 1N0NA 3E89A 4AI8A 3ZS8C 1YEWA 2F1MA 2JVDA 1VARA 3CEIA 2BTQB 3KCXA 1ZUQA 2EULA 3E8HA 2UXCO 3P3PA 4JYCA 1L8DA 4DXWA 2C2AA 2UUAO 1NTZH 2B1IA 1SETA 2HR3A 4CH5A 4LF8O 3W7UA 1BE3H 1P4RA 1AJQA 4I9QA 2KG7B 2NN4A 4W4KA 4TV9B 4J41A 2DN9A 3RFRA 1WJZA 2RJZA 3JAKA 4UVAA 2FB5A 2WLLB 1M56B 4LF7B 4EFBA 3DC5A 3T1YO 1US6A 1VF6A 1SQBH 2WWWA 3RVYA 3HKDB 2UXXA 3C3TA 3B8MA 4KP4A 1ZSPA 1VP7A 3CJHA 5EC1C 1CPYA 4X64O 1IVSA 2EIKC 2CK3G 1EN5A 4P2ZA 2Y4TA 1WPBA 4CH6A 1KECA 5KHGA 1Y6XA 1NR1A 3QO7A 1JOYA 4U7OA 3ML0A 4GX1A 3CXCU 2ZIOA 2R9AA 4K0KB 2F66C 4FIPC 3B8NA 4FM1A 2E74B 2CUGA 1SS3A 1CP9A 1XREA 1AROP 5CA1B 5JH7A 3HKCB 2H94A 5JCOC 1SQFA 4B3RO 2A3QA 2XOKG 1AP6A 1KUQA 1WPXA 4JI4B 5L3BA 3DTUB 5LBQA 1WB7A 1VQ9V 1SQVH 3CRCA 4Z1MG 3MHSC 2GBOA 1OCRB 1HWYA 3ABLC 2IW5A 1BQZA 5B1AB 2QKCA 5JQGA 2UXDB 1ZL8A 2DE0X 3DC6A 3K08A 1JFFB 1R6NA 2GUZA 5ITZB 1RSOA 4NXMO 5H5NA 4LF9O 4PDMA 5KUKA 1SESA 1V55B 5LHIA 1Q8IA 5IYCO 1PNLA 4CS3A 1GN2A 4JI2O 4WBNB 3VQYA 1NKDA 3A0BZ 3S3XA 4QPKA 1WP8A 2EINC 5KX5B 2YEVB 4I55B 2YIAA 3RYCB 2FL4A 5KHHA 3JASA 3E2EA 2OYQA 1S3JA 3CP1A 3AK3A 5JCOA 4DR1B 4KUMA 4DV7B 2EZPA 2Q0OC 3SJBC 4JI3B 2F93B 2YIBD 3BA9A 1EBOA 1TVKB 1MMMA 4JI1B 3S3WA 5IDJA 4D7SA 5LA6B 4I4TA 2F43G 2OCCC 3QO5A 3SPGA 3L74H 3RVZA 1E1QG 4O2BA 1XUQA 3BRCA 4NTYA 1XHZA 1NQTA 2ZE5A 1R3JC 1W59A 4FJCC 5B1OA 2EJRA 5EK0A 3AG3C 4PHZA 3O65A 3HKEA 1NH2D 5LOVB 2H3OA 5BR8O 4JZGA 3OUFA 1YI2V 1FFTB 1SQQH 4WCEV 4B3TO 2ITDC 1NBMG 4TT3G 1EM1A 2Y48A 2EIJB 5CA0A 4EB6B 5B5EZ 3IAYA 2P67A 2YC0A 3L72H 1D2DA 3OTFA 3LUTB 3OM3B 4J80A 1EZJA 3CHXA 1D5AA 4DV4B 2Q8VA 4UCOA 2OIGA 4UCSA 4DUYO 1QBZA 3ZMUA 4J7KA 3E8FA 4IL6Z 4LWSB 1MG1A 2AZ2A 1Q82W 4YHHO 2GV9A 5F2VO 2PF4E 5GONB 4ZI7B 4DR6B 2W0FC 2XAHA 1CEZA 3CD6V 3FAVB 2PYLA 1OCCB 4X1IA 3JCZA 3ZX6A 3I55V 1QNMA 4PA4A 1N8RW 3ZMSA 1XOUA 4AQYB 4CZZA 2WLIB 1M57B 2QA4V 1S76D 4PDVA 4H37A 3CMEV 1I0HA 2IM9A 1XMQO 2AHZA 1DK1A 3AG1B 4K0KO 4UUJC 3Q4HA 2PGGA 2X6BA 3H1JH 1CXZB 4EKWA 1TGOA 2LO1A 1K7DA 2QKSA 3F7VC 2GSMB 4DV1B 1Y4MA 3G6BA 2ZINA 1OZ0A 3STLC 3SYCA 4DV0O 3K04A 3AG4B 4MW3A 1M93A 1UPGA 4LFBB 1XQ8A 3SPIA 4HYOA 1SZXA 1S72V 3OR6C 2Y0IA 2G38A 1K5SA 1Y66A 1YTFD 2F23A 3JCUZ 3JSNA 4JASA 4UCUA 2WPDG 4E2LA 2DYRC 1SA0A 2EIMB 4JZ2A 4J9ZB 1M90W 3W7TA 2ZD9A 5LYJA 4J42A 1KBHA 3CC4V 4FMTA 4BWAA 3P32A 2ATKC 4JYYA 4K3AA 1VQPV 2LGWA 4NTWA 5JJNB 5IJ9A 4FLXA 5KHIA 3EHBB 2UXDO 2LW1A 3BVOA 3JD1A 3C90A 2Q9LA 4GUNA 4A5UB 3FB6C 5J2UA 1YZBA 2JGDA 1K4DC 1I08A 4G2KA 4I50A 3OGIB 4WF9V 3CCLV 2WAMA 2LJ2A 4ZHQA 2EILC 5GTIZ 4JI0B 4F6RB 2CE4A 5LMNB 2JS3A 1XMOB 3D8CA 3ZMTA 3RYFB 5IWAB 3SR2C 2JEXA 1GN3A 3B4SA 3JARB 2ZE8A 2QSAA 4JI3O 2HG5C 4FFBA 4H44B 5J2TA 2Q7HA 3IGAC 4FFKA 5CBGA 4TQFA 1XNQO 4JI1O 2P5OA 4K8XA 3FKSG 1M1KW 4J9YB 1K97A 4OPHA 3RN4A 4XDLA 5KAIZ 5BY1A 4JI8B 4U3JB 4JYAB 2N74A 3LSQA 3OTOB 3CCSV 1N36B 1AJNA 4PV1B 2Z0AA 1AI7A 2ILMA 3P3NA 5E79Z 4XDKA 1NTKH 2IH1C 2JJ1G 2K9PA 2WA4A 4DR3O 1QLNA 4H0LB 1BT8A 4JPRA 3RGBA 1W2BU 4O4IA 4P9OA 4GYCB 5LL6Y 1BMFG 3WB2A 3QO8A 2HP8A 3K5MA 2Z5UA 3E35A 2WLNA 2ADPA 3K3WA 1BHBA 1Y76B 4QE7A 2JGUA 2R72A 3BCCH 2JJ2G 3CMAV 1Z5WA 4GZRB 3R65A 1SKVA 4ZOLA 5B3SC 5KHJA 1I94B 4YXWG 4CC6A 1GTOA 3AG2B 4MVRA 1YVWA 1FFXA 2LFRA 4DR6O 4O4LA 1Q6IA 1HNXB 5DEDA 3ABMC 2KSDA 4X9QA 3IFXA 2WA3A 4FLVA 4FLUA 1WP7A 2HLDG 4MSWC 2LQTA 4AQYO 1VQ7V 1JQ0A 1HR0B 1F4NA 4DV2O 2RN9A 3CX5F 3K5NA 1AVMA 1R1BA 1RPRA 1COWG 5JWPA 1KB9F 3DSQA 4UFZA 3UO2A 3D3IA 1TUEB 3I5DA 3K58A 4TV8B 3K06A 2ZR3A 4RAIA 1HW7A 2ITCC 3UM7A 4CS4A 4X20A 1P49A 3G80A 1R3KC 5CMUA 3NXSA 5CBHA 3APQA 3T2MA 1J5EB 2HKOA 4PDRA 2RQ6A 2OTLV 2XHBA 2VQFB 1BL8A 3MD0A 1L0NH 3ZHTA 3IJ4A 1Q6UA 4DR2B 4DR7B 3BAAA 3FYIB 3WB0A 1P84F 1PNMA 5D5QA 4R50A 5A2QN 5CB4B 3K9AA 3CPWU 4MVSA 1HNZB 4QPJA 4IT5A 1BGYH 1XBLA 4N21A 1K33A 2KKWA 2UUCB 1XNRO 4B7EA 2BTQA 3ZRSA 4LNUB 4N23A 4J10A 5CN0A 5EBMC 2HJFC 1WB8A 4L8JA 4DR5B 4HNAA 5KMGB 4HZ3A 1QR8A 1GO3F 1OHHG 5FLXN 4DR4O 4LFAB 2KG7A 1K9MW 5KHKA 1KP3A 2QKAA 2V1DA 4OGQB 5LMNO 3L75H 5EZYB 2OTJV 2WLLA 5E1AC 2YIDA 2DYSC 4R6ZA 1GH6A 4X62B 2R9IA 5EIBC 1TUBB 3C3SA 1K8AW 1GN4A 1KKCA 1IX9A 1ROPA 3HKDA 4YIPA 4JAAA 3TETA 4MVMA 1QU7A 1IBLO 2VWKA 1R6KA 2PUSA 4JI8O 3CWBH 4YIOA 3SYPA 3OTOO 3JD2A 1N36O 4TWKA 1SC5B 4LF5B 1N4CA 4RO2A 5BMVA 1OCRC 1EFRG 1EZVH 4X88A 3UKMA 3A0RA 3JALB 5B1AC 1VQKV 4DV3O 5B66Z 2A0LA 2Q0AA 1YTFB 5IT9N 4WFAV 1HP8A 1ZAUA 4NXNO 4PA7A 1MSDA 1EN6A 1FS0G 2EX3A 1V55C 4UXNA 3M8AA 2ZIMA 1THZA 2CH7B 5IYZA 4MTFA 1VEWA 3E83A 3K59A 1IBMB 3HB3B 3U11A 4GKJB 2IJHA 2LGQA 4B7KA 4CH4A 5CA1A 1BQ0A 5KAFZ 2X6AA 2FTKA 1LNQA 2BSKB 1F7YA 2ZXWB 4BIZA 3VQVA 2YSUB 4B08A 1QVGU 3LSSA 5JVDA 4YJ2A 1SQGA 4L87A 1L0LH 2YDEA 1DF4A 3JD3A 1AR1B 4OXSA 4UVBA 2EJ7A 3ETEA 1R6TA 1PKXA 2R70A 1HDJA 1QVFU 1HNXO 3TXQA 1JFFA 1QLEB 5LMUO 4H33A 4X8AA 4QNHB 3ZRWB 5ITZA 1DLBA 3CRAA 4JV5O 1QQCA 1H2KA 1V9PA 3HKBB 4WBNA 1OCZB 3ASNB 3FD9A 3H1KH 4BW5A 1HR0O 4I7ZB 1M5IA 5HFMA 3L71H 5KX5A 1Q6HA 3L70H 2YEVA 4FLZA 1LUWA 4FZ1A 1XL6A 2BCCH 1FKAO 3RYHB 1G1XB 2ARHA 3LDDA 4CS2A 1SERA 3FYEB 3P30A 4WFHA 3ZIAG 2P4KA 3FB5C 3ZHVA 2QWNB 4JAVA 2BOBC 1KU9A 3CB2A 1NU1H 2VQFO 4NYKA 1TVKA 4U3FH 5JJEB 3CC2V 4LF6B 4DR2O 3U10A 5LA6A 4H13B 1IZ3A 3DXRB 2XAFA 2PI5A 4JGSA 1MA1A 4IIJB 1RFYA 2ZM6O 1JA8A 5L3FA 1F23A 1IBKO 1N33O 5CBFA 2HHHO 2EIKB 1VQ5V 1OCCC 3E8GA 3KG2A 2UUCO 4NTXA 1JX9A 1KP2A 1P7GA 3F7YC 5LOVA 2PTMA 3D36C 4MVQA 4FLTA 3TCUA 3LNNA 1RM1B 1SZTA 1GKFA 2XNDG 3AG1C 1TAEA 1E79G 4EB6A 1IDSA 4LFAO 4DV5B 4NR1A 4FK5C 2VQEB 5KA6A 3IC7A 4X66B 5EBLC 3RYIB 3E22A 3AG4C 3UQ8A 4R8CA 2IU3A 3O9OA 2YI9A 1URFA 4X62O 4IHJB 4EFEA 1UJWB 4JI6B 3UT5B 1YXBA 4LWSA 2VWJA 1GMGA 4QE9A 1WLEA 1H2NA 1QCEA 1D5NA 1S77D 1PL4A 1BZKA 5GONA 2Q68A 2FKXA 2JRIA 1Q5OA 3FAVA 4LF7O 1FJGB 3CYOA 1BHAA 5HFLA 1PM9A 4CC5A 4LF5O 5DN6G 1N32B 4O2BB 1GRJA 2BOCC 3D36A 1AI6A 2WLIA 2ZCEA 3BHPA 4P30A 5LHHA 3HKEB 2Y0PA 3STZC 4B3SB 3A0HZ 1AJPA 1LR1A 4DV6B 4E4EA 1XI1A 2XTAA 3VOUA 5B1NA 4IGGA 2UU9B 4IYHA 1JPXA 2L35A 5L3DA 4DRXB 5CA0B 4GKJO 3E86A 1K4CC 4O4JB 2YXHA 1YIJV 5LP6C 1MSWD 2D2CB 4FM2A 2IU0A 2CTWA 3QG5A 1A32A 4C7UA 3FB8C 2IJIA 4GX0A 5EBWC 5IJ0B 1XHXA 3B2EE 4KHPB 2HJDA 3OGCC 4IYIA 3OEEG 1G6UA 4LCUC 3CCMV 1X4TA 4DUZB 4QJFB 3CCJV 4FLWA 4JF3A 1YF2A 3K03A 1V54B 4PJ0Z 2GTSA 3B77A 4JI4O 1M9NA 3BPZA 1HNWB 1AI5A 1MZEA 2CTRA 4MT8A 2GTAA 5L3CA 2OWOA 2ODMA 1W0JG 1PPJH 2QM8A 3MDSA 4F6RA 2Y69B 5LP6A 3SYQA 1E1RG 1YJNV 2F95B 3N2GB 3A2FA 1TA8A 3JATB 1SRYA 3JARA 4O2AB 1NI8A 1OV9A 3CS5A 4K8ZA 4D6TH 3FFQA 4ICGA 4GLXA 1U97A 5DM6V 1MOFA 1XEQA 4LF6O 1XILA 4K35A 4RWUA 3AG2C 4TUYB 3BA8A 3K0GA 4U3JA 4DR1O 4Q20A 4I0XB 2X7RB 4DV7O 1H8EG 4UCVA 3SPHA 1R3IC 4BIOA 5LYJB 2WLMA 2XAJA 5H9CA 1OCOB 1YCIA 5FNVA 4O4HB 4ASUG 1L1FA 5IJ9B 3WB1A 1YJ9V 1VMGA 2UXCB 5EIBD 1JCHA 5J2UB 2UUAB 3OFNG 3T1HB 3SYOA 4BAYA 5LHGA 4I50B 1H2GA 4NVPA 1VQMV 3TJTA 2ZDIC 2Q6AA 5H6QA 4DV5O 2WLHA 2VQEO 1Y76A 1W0KG 3OMIB 4X66O 1H2LA 3JAWB 3WFVA 1F4MA 3QF7A 2CGNA 4LFCB 5KUMA 1PL0A 1VF5B 1KQSU 2OIEA 2ZQMA 3T1YB 4FFBB 4X1YB 1QHTA 3GWOA 4JI6O 2XAQA 3LNMB 1G8MA 3BY6A 3DGEA 1Z5VA 1R3LC 1AB3A 3ASOB 2RMKB 1WA8B 5BXZA 2YI8A 3U0ZA 4X64B 4DV4O 4GX2A 4PI0A 1N32O 4WFBV 4FM0A 4YY3B 2JK5C 2YIBA 1VQLV 1FAFA 1YJWV 1GM9A 2UXBB 1FPOA 4J7JA 3OMAB 3WG7B 4JI7B 2ZDIA 2WLKA 2XUMA 2YS8A 4G27B 2A7WA 2DW4A 3G71V 3F5WC 4BIUA 1VQNV 4TV8A 2UU9O 1RPOA 3JD4A 1G4YB 3CRMA 2JDIG 2QTSA 1GN6A 4BW9A 3AK2A 3N2KB 2XT9A 1FXKB 4BR6A 4B3RB 2ZT9B 5LXTB 3THOA 3GB7C 2PY5A 4RQEA 4DV1O 2B5UA 3X2QB 5CB4A 2ZE7A 3ZCCA 1Y74B 4LFBO 2W6JG 2QWRB 4AHCA 4QIWF 3TGUH 3ABUA 1M56C 4O4LB 1K3EA 5EYPB 3UCSC 5L3GA 4AILC 3CXHF 1NH2B 1M4UA 2LP7A 4YJ3B 4ABMA 2AXTZ 3ICXA 4JYBA 4LNUA 1H2SB 2CDYA 1S0VA 5C8YB 4NXMB 2X0LA 2P7TC 3BFRA 4LF9B 5IY5B 1HNWO 5KMGA 3J80N 4JI2B 3UO3A 3ZMVA 1K73W 3OW2U 4JTAB 1WNSA 1MNGA 2E76B 5FPRA 2JEUA 1O9GA 5EZYA 4TSFG 4CH3A 1H2MA 4P9PA 3L73H 3VQWA 3PN1A 4KFMA 1I7FA 1Z2GA 5JJJB 1N0JA 1VQ4V 4D7TA 2ZXWC 5B3SB 1TUBA 3R66A 4TV9A 2BTOA 2XAGA 4JI0O 1XMOO 1ZTEA 4DK1A 1BCCH 1H8HG 5IWAO 4PA6A 1Q86W 2YXYA 3L9DA 1NT2B 3ABMB 4MVOA 2WLJA 3JALA 2Q67A 3ABKB 4X1KB 3G67A 4KL1A 1QLEC 3EXAA 1BSMA 4R7CA 2OT5A 5BR8B 3OE7G 3LDCA 3B40A 2EZOA 3T1HO 2QWOB 3JYCA 4B3TB 1BS3A 3BEHA 5B1BB 4HNAB 4JYAO 2WSSG 1OCZC 2CH7A 3ASNC 3QTCA 2R9RB 3OT7A 1PP9H 1NVPD 1JR9A 5IYBO 5LGTA 2CTQA 5K1XA 4NB5A 1XDCA 2IH3C 4LF4B 4DW1A 2KQXA 3ETGA 1JJOA 2PI4A 2BSKA 4LFCO 4JTDB 1AP5A 1NZ6A 4XDJA 4X65B 3JSLA 4DUYB 2M7WA 3AEIA 2RNBA 3NR7A 4YHHB 3HKCA 3JAKB 3I56V 2QEXV 2YICA 3QNEA 4CBCA 2CTPA 1VIBA 4MW8A 5BMVB 3LSUA 5TISZ 4YY3O 4ZBMA 1I94O 3ZRWA 2B1GA 3JAMN 2F4VB 3HKBA 5IE9A 5LGUA 2UXBO 1XMQB 2VS0A 1LUVA 3HPLC 4JI7O 4DW0A 2DMXA 1RM1C 3CJHB 3T4ZA 2Q7EA 5IYZB 2A79B 3RYHA 2P6JA 4FPPA 4DV0B 1GAXA 4LH7A 3G4SV 4J7ZA 4MTOA 2DYSB 3IC9A 2FMLA 1DTOA 1IXBA 4I55A 3RYCA 2M6YA 5A9GA 2EIJC 4OPAA 2QWQB 5JVDB 1B3QA 2Q5ZA 3TK1A 3DXRA 4MTXA 4YJ2B 2D3OW 2P06A 4MS2A 4IIJA 4GKKB 3MAQA 5JH7B 3W7SA 1I5XA 4QGPA 1J5EO 3SPCA 5H2FZ 1WAZA 1DGSA 3K9SA 3H01A 4OX9B 1S5HC 4DR7O 1K92A 3K57A 2ETNA 2O57A 4JTCB 4Q6GA 2JIZG 1NJIW 2IBZH 3GVMA 1HNZO 1GM7A 1N34B 3KKYA 1AILA 2BE3A 1Q90D 3B09A 4DO2A 2E5LB 1FD9A 5JQGB 1S5LZ 1ZL8B 3CRQA 4UB6Z 3RYIA 2V7QG 4NKGB 2QM7A 3G6EV 2GUZB 1RSOB 3H1IH 5GW7A 4JAUA 1M57C 4DR5O 2AZ0A 4FLYA 4TOIA 5IYDO 2QJ1A 4ZIBA 1ENVA 4IHJA 1KMIZ 3UT5A 4DYLA 3SJAC 1XNQB 4UV9A 3JASB 4LH6A 2EBOA 3ZRXA 1EN4A 5J9PC 2QM4A 4FVMA 2LFSA 4MVZA 2OCHA 4LP8A 2JS5A 4PDLA 3K5LA 3M7MX 2YUAA 1FYJA 2X6CA 1V54C 1DF5A 1J95A 4DR3B 1PD3A 2Z3YA 2VRZA 4ZI7A 2GDSA 1QR9A 2EIMC 1IURA 2B9ZA 1FXHA 4I4TB 3RWRD 3OD4A 3RT3C 3ABLB 3ZHQA 1X59A 2K1EA 2ZNIA 5FPOA 4UVCA 2NNUA 2DWDC 3VQXA 2IJJA 4DRXA 2P4VA 5KA5A 4O4JA 2Y69C 4GCZA 4LF4O 3SJCC 3E22B 3FX7A 4F6EA 4MTGA 4Z1VA 2ZE6A 1AR5A 2QE7G 2ZNJA 2A06H 2EINB 2DWEC 4X65O 5IJ0A 3AK1A 3K5OA 4Z2WA 3EFFK 3ETDA 2NR5A 1IBMO 3CE2A 2PYJA 3K79A 4PA3A 1IXMA 2UUBB 4G28B 2HVJC 3H1HH
chains in the Genus database with same CATH topology
1OCRB 1KQSU 1HWYA 1OHHG 2AHYA 3ABLC 2ZQMA 2IW5A 5C93A 1OCOC 3GWOA 1K9MW 4RQFA 2XAQA 3LNMB 1G8MA 5B1AB 3BY6A 3K08A 1KP3A 2V1DA 3DGEA 1R6NA 2IJKA 3OUSA 1R3LC 2OTJV 2OCCB 3ASOB 3ABTA 2WLLA 4PDMA 5KUKA 5E1AC 1SESA 1V55B 5LHIA 1FXVA 5IYCO 1PNLA 3ZN0A 2DYSC 1H38A 4R6ZA 1NKDA 3OR7C 2R9IA 4QPKA 4GX2A 2EINC 4WFGA 1XL4A 4WFBV 1VQOV 2YEVB 1K8AW 2JK5C 1VQLV 1ROPA 3AG3B 1KD1W 3TETA 3E2EA 4MVMA 1S3JA 3CP1A 1YJWV 1GM9A 4KUMA 1R6KA 3PJSK 2EZPA 3WG7B 3OMAB 3SYPA 3JD2A 2ZDIA 2WLKA 4G27B 4TWKA 2HFEC 3E8BA 4RO2A 1OCRC 2DW4A 4LC1A 1EFRG 3G71V 1EBOA 3F5WC 4X88A 4GX5A 3UKMA 4BIUA 1VQNV 3A0RA 5B1AC 3T1CA 1VQKV 1RPOA 2A0LA 1YTFB 1YSCA 3JD4A 4WFAV 5IDJA 4LBEC 1G4YB 2JDIG 4PA7A 1FS0G 1NVPB 2F43G 2OCCC 3QO5A 3ASOC 3SPGA 1V55C 4UXNA 3CCRV 1KC8W 1K5QA 1KKDA 3ZRVA 1FXKB 1THZA 3RVZA 4MTFA 1E1QG 1NQTA 3E83A 4MVUA 3GB7C 5CA3A 3HB3B 1R3JC 4RQEA 2W6IG 2B5UA 2IJHA 3MHHC 4FJCC 5B1OA 2EJRA 5EK0A 3VBBA 3X2QB 3CC7V 3AG3C 2UXNA 3LDEA 1NH2D 2MK3A 3ZCCA 1YITV 2X6AA 2FTKA 3OUFA 2W6JG 1YI2V 1LNQA 1FFTB 2XASA 4QIWF 4WCEV 3CCQV 3ABUA 1M56C 2ITDC 1K3EA 1NBMG 2ZXWB 4TT3G 3WG7C 5L3GA 2ZR2A 1F51A 4BIZA 1JJ2U 1NH2B 2Y48A 2LP7A 2EIJB 3ZJZA 3CCVV 2YSUB 4UV8A 4JYBA 1QVGU 3LSSA 2P67A 1S0VA 4L87A 2X0LA 2P7TC 1DF4A 3M99B 3JD3A 2DQ0A 1AR1B 1I5YA 5IY5B 3LUTB 1MABG 3OM3B 4OXSA 4UVBA 1EZJA 3CCEV 3ETEA 1PKXA 3ZMVA 1K73W 1QVFU 3OW2U 4JTAB 1GK9A 1FXKC 1QBZA 2A9HA 3ZMUA 3E8FA 1ORQC 2JEUA 1QLEB 1MG1A 3SJQC 1Q82W 4H33A 4X8AA 4QNHB 3ZRWB 1DLBA 3JD0A 4TSFG 2QTOA 4P9PA 3X2QC 4KFMA 1ZWIC 1OCZB 3ASNB 2W0FC 2XAHA 4BW5A 4I5SA 1CEZA 3CD6V 1B6QA 1K34A 5EC2C 5HFMA 1VQ4V 4ZKIA 1OCCB 2ZXWC 5B3SB 2YEVA 3JCZA 3I55V 1XL6A 4PA4A 1NR7A 1N8RW 3K0DA 3ZMSA 2XAGA 2DYRB 1P7BA 2DQ3A 3LDDA 4CZZA 1SERA 3FYEB 3P30A 3RW0A 2WLIB 4WFHA 3ZIAG 1M57B 2QA4V 1S76D 4PDVA 3FB5C 4H37A 3CMEV 1H8HG 5IY5C 3OMNB 4JAVA 4PA6A 2BOBC 2AHZA 2P90A 3RBZA 1Q86W 3AG1B 4UUJC 3ABMB 2HVKC 2X6BA 4EKWA 4MVOA 2WLJA 1K7DA 2QKSA 3F7VC 5L3EA 2GSMB 2Q67A 3CC2V 1Y4MA 3ABKB 4XBFA 1OZ0A 3STLC 3SYCA 1VQ8V 1QLEC 4PELA 3K04A 4R7CA 4GT1A 2OT5A 3AG4B 3OE7G 4MW3A 3LDCA 3SPIA 4HYOA 2EZOA 2XAFA 2PI5A 1S72V 3JYCA 3OR6C 4JGSA 3BEHA 5B1BB 2WSSG 1FXKA 1K5SA 1OCZC 1Y66A 3ASNC 1YTFD 4I9WA 5L3FA 1F23A 4HZ3A 2R9RB 5CBFA 2EILB 2EIKB 2NLJC 4WFFA 4JASA 1VQ5V 1OCCC 1NVPD 2WPDG 3E8GA 5IYBO 3KG2A 4E2LA 1JX9A 5LGTA 1KP2A 3F7YC 2IH3C 2DYRC 3ETGA 2EIMB 4J9ZB 4MVQA 1JOYA 1M90W 2PI4A 3TCUA 3W7TA 2ZD9A 4JTDB 3CC4V 1RM1B 4FMTA 1SZTA 1GKFA 4XDJA 3P32A 2ATKC 1VQ6V 1R73A 1VQPV 2XNDG 3AG1C 2KB1A 1E79G 4F4LA 1YHQV 2M7WA 3AEIA 4FK5C 3EHBB 3JD1A 5KA6A 3IC7A 3ABKC 3FB6C 5EBLC 1Q81W 3AG4C 1K4DC 3ZMZA 4R8CA 2IU3A 3I56V 2QEXV 4G2KA 3QNEA 4CBCA 2H8PC 5B1BC 4WF9V 3CCLV 2WAMA 4RUFA 1UJWB 2Q69A 4RUEA 4MW8A 2EILC 1GMGA 4QE9A 4ZBMA 5H6RA 3ZRWA 1WLEA 1AI4A 3W7XA 1QCEA 3W7WA 2B1GA 1S77D 3ZMTA 5LGUA 2Q68A 3CCUV 3ZN1A 3OEHG 2JEXA 3HPLC 3OAAG 2HG5C 3CYOA 1RM1C 1BHAA 5HFLA 3T4ZA 5DN6G 3IGAC 2A79B 2P6JA 2BOCC 4FPPA 4PA9A 5FL7G 1Q7YW 5BZBA 5CBGA 3D36A 1AI6A 2GHYA 2WLIA 3FKSG 5CMUA 3SPJA 1M1KW 3G4SV 4J9YB 1K97A 5LGNA 5LHHA 4P30A 4MTOA 4XDLA 4X89A 2DYSB 3STZC 3LSQA 3CCSV 3FB7C 1AJPA 1AJNA 1DTOA 3MHSC 3SYAA 1AI7A 1PNKA 4XDKA 3VOUA 5B1NA 2EIJC 4HAMA 2IH1C 1JPXA 5L3DA 2JJ1G 3E86A 1K4CC 4WFEA 4U7NA 3TK1A 1YIJV 4MTXA 1QLNA 2D3OW 1MSWD 4MS2A 1JVMA 2IU0A 3T4DA 3W7SA 4JPRA 1W2BU 1I5XA 4P9OA 3SPCA 3FB8C 2IJIA 1BMFG 4GX0A 1GM8A 5EBWC 3QO8A 3E89A 3H01A 3OGCC 1S5HC 2Z5UA 3E35A 2WLNA 1K92A 3OEEG 3K3WA 1BHBA 3E8HA 4JTCB 2JIZG 1NJIW 4LCUC 4JYCA 4QE7A 3CCMV 4DXWA 2C2AA 2B1IA 1SETA 2HR3A 2JJ2G 1GM7A 4QJFB 3W7UA 3CMAV 3CCJV 1P4RA 1AJQA 4JF3A 3K03A 3R65A 5B3SC 1V54B 4DO2A 4YXWG 1GTOA 3AG2B 3B77A 4MVRA 2V7QG 3G6EV 2QM7A 1M9NA 4UVAA 5GW7A 2LFRA 1AI5A 2WLLB 1M57C 4JAUA 1M56B 5IYDO 1ENVA 4MT8A 5L3CA 3ABMC 1W0JG 2QM8A 2Y69B 3IFXA 3SYQA 2HLDG 1E1RG 2WWWA 4MSWC 4UV9A 3RVYA 1YJNV 2UXXA 1VQ7V 1JQ0A 2EBOA 3B8MA 1SRYA 3ZRXA 4KP4A 5J9PC 1F4NA 5EC1C 2LFSA 1CPYA 4LP8A 4MVZA 1RPRA 1COWG 4PDLA 3D3IA 1TUEB 2EIKC 2CK3G 5DM6V 1MOFA 2X6CA 4P2ZA 1V54C 1DF5A 1J95A 3K06A 1PD3A 2Z3YA 2ZR3A 4RAIA 3AG2C 1KECA 2ITCC 3UM7A 3K0GA 1QR9A 4Q20A 1NR1A 1R3KC 2X7RB 2EIMC 1H8EG 1FXHA 3NXSA 3QO7A 3ML0A 4GX1A 4U7OA 5CBHA 3T2MA 3CXCU 3ABLB 3SPHA 1R3IC 2HKOA 4PDRA 2WLMA 2K1EA 2XAJA 4FIPC 2OTLV 3B8NA 1OCOB 5H9CA 1BL8A 3MD0A 4UVCA 2NNUA 2DWDC 2IJJA 1CP9A 4ASUG 1L1FA 5KA5A 1YJ9V 3FYIB 2Y69C 4GCZA 1AROP 1PNMA 4R50A 1JCHA 3OFNG 3K9AA 3CPWU 3SYOA 4MVSA 4BAYA 2H94A 4QPJA 5LHGA 4MTGA 1H2GA 2QE7G 2EINB 2DWEC 1VQMV 4N21A 2ZDIC 1K33A 2Q6AA 5H6QA 3EFFK 3ETDA 2XOKG 2WLHA 3ZRSA 1WPXA 1W0KG 3K79A 3OMIB 4N23A 4PA3A 1IXMA 5L3BA 3DTUB 5CN0A 3WFVA 4G28B 5EBMC 2HJFC 5LBQA 1F4MA 2HVJC 1VQ9V 5KUMA 4Z1MG 1PL0A 1QR8A 1GO3F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6Q A;  1RPR A;  2IJH A;  1F4M A;  1RPO A;  2IJI A;  4DO2 A;  1PD3 A;  1F4N A;  1NKD A;  2IJJ A;  3K79 A;  1GTO A;  1GMG A;  2IJK A;  1ROP A;  2GHY A; 
#chains in the Genus database with same CATH topology
 2AHY A;  5C93 A;  1OCO C;  3APO A;  4RQF A;  4PI2 A;  1SQX H;  4PD4 F;  2IJK A;  3OUS A;  2OCC B;  3ABT A;  2F4V O;  1FXV A;  4DV2 B;  3ZN0 A;  1H38 A;  3OR7 C;  2DOS A;  3KCY A;  4WFG A;  1XL4 A;  1VQO V;  4X1I B;  3AG3 B;  1KD1 W;  3N2G A;  4UB8 Z;  3J81 N;  3JAT A;  3PJS K;  4TQD A;  1RP3 B;  4O2A A;  4W4L A;  4LR3 A;  3J7A U;  2HFE C;  3E8B A;  2ADQ B;  3A8T A;  4LC1 A;  3Q4H B;  4GX5 A;  3T1C A;  1YSC A;  4TUY A;  4LBE C;  3RYF A;  4I0X A;  1NVP B;  3ASO C;  3GWK C;  3ZHR A;  4GKK O;  4JI5 B;  3CCR V;  1KC8 W;  4B3M B;  1K5Q A;  1KKD A;  3ZRV A;  4O4H A;  2P22 C;  2CAZ C;  4MVU A;  1XNR B;  5CA3 A;  2W6I G;  4OX9 O;  3MHH C;  2CGO A;  3VBB A;  3CC7 V;  2UXN A;  3LDE A;  1Q3E A;  2MK3 A;  2QR4 A;  1YIT V;  1SA0 B;  5AG2 A;  1UFI A;  3HR0 A;  2XAS A;  3CCQ V;  1AR4 A;  2DJV A;  3WG7 C;  4EEQ A;  4DR4 B;  1N34 O;  2ZR2 A;  1F51 A;  1JJ2 U;  3ZJZ A;  3CCV V;  5GTH Z;  4UV8 A;  2Q73 A;  1ZLZ A;  2RCV A;  1WN7 A;  2E5L O;  3JAW A;  5LP6 B;  2QGN A;  3M99 B;  2Y4U A;  2DQ0 A;  1I5Y A;  1MAB G;  1MZF A;  3CCE V;  4LF8 B;  2JGD B;  2L6L A;  4X1Y A;  3H1L H;  1GK9 A;  1FXK C;  2RDC A;  2A9H A;  4DK0 A;  1ZX3 A;  4ZHQ B;  1ORQ C;  5KLV H;  2V4D A;  3SJQ C;  3JD0 A;  1Y67 A;  2E3C A;  1IBL B;  2QTO A;  1WA8 A;  3X2Q C;  4UCR A;  1ZWI C;  1U96 A;  4I5S A;  1B6Q A;  1K34 A;  2QDO A;  5EC2 C;  2AW9 A;  3D3Q A;  4ZKI A;  3N27 A;  5FNV B;  5J2T B;  1NR7 A;  4DV3 B;  3K0D A;  2Q4P A;  2DYR B;  4NXN B;  1P7B A;  2DQ3 A;  3RW0 A;  1NS1 A;  5IY5 C;  3OMN B;  2P90 A;  3RBZ A;  3SGI A;  1FJG O;  2HVK C;  2E75 B;  5L3E A;  3ZED A;  4XBF A;  4KXR A;  1VQ8 V;  3TXS A;  4PEL A;  4GT1 A;  3N2K A;  4B3S O;  3F5T A;  1FXK A;  1SQP H;  4I9W A;  4O4I B;  3CRR A;  5LXT A;  1PV0 A;  2EIL B;  2NLJ C;  4WFF A;  4DV6 O;  2Q7G A;  2HEP A;  2UUB O;  1JMK C;  1Y74 A;  2FYU H;  1NTM H;  5EYP A;  3WU2 Z;  2PZS A;  5K1P A;  1VQ6 V;  1R73 A;  4YJ3 A;  2KB1 A;  2AGA A;  4F4L A;  1YHQ V;  2MW2 B;  4KHP O;  4ZOL B;  5DEC A;  5LMU B;  5C8Y A;  3ABK C;  3AG7 A;  3ETQ A;  4JV5 B;  1Q43 A;  1Q81 W;  1FFX B;  4HBN A;  3ZMZ A;  1SF9 A;  4DUZ O;  1O9H A;  2H8P C;  1OJH A;  1KYO F;  5B1B C;  2N04 A;  3H9V A;  4RUF A;  2Q69 A;  4RUE A;  5H6R A;  1AI4 A;  3KZI Z;  3W7X A;  3W7W A;  4FZ0 A;  3ZHS A;  3SDL A;  2W0X A;  2LW7 A;  3CCU V;  4J11 A;  3CSX A;  3ZN1 A;  3OEH G;  3BAB A;  2YXL A;  3OAA G;  2QWP B;  1B06 A;  1B04 A;  4PA9 A;  5FL7 G;  1Q7Y W;  5BZB A;  1S5J A;  2GHY A;  3SPJ A;  5LGN A;  4X89 A;  4X20 B;  3QVN A;  2ZM6 B;  3FB7 C;  4JI5 O;  1IBK B;  4B3M O;  1N33 B;  2HHH B;  3ZHU A;  1YDX A;  1VF7 A;  3SYA A;  2N05 A;  1PNK A;  5D5P A;  3ZBH A;  4X1K A;  4HAM A;  1T5E A;  4WFE A;  4U7N A;  4UCT A;  1VF6 C;  1JVM A;  3T4D A;  3EVK A;  2ZKO A;  1GM8 A;  1N0N A;  3E89 A;  4AI8 A;  3ZS8 C;  1YEW A;  2F1M A;  2JVD A;  1VAR A;  3CEI A;  2BTQ B;  3KCX A;  1ZUQ A;  2EUL A;  3E8H A;  2UXC O;  3P3P A;  4JYC A;  1L8D A;  4DXW A;  2C2A A;  2UUA O;  1NTZ H;  2B1I A;  1SET A;  2HR3 A;  4CH5 A;  4LF8 O;  3W7U A;  1BE3 H;  1P4R A;  1AJQ A;  4I9Q A;  2KG7 B;  2NN4 A;  4W4K A;  4TV9 B;  4J41 A;  2DN9 A;  3RFR A;  1WJZ A;  2RJZ A;  3JAK A;  4UVA A;  2FB5 A;  2WLL B;  1M56 B;  4LF7 B;  4EFB A;  3DC5 A;  3T1Y O;  1US6 A;  1VF6 A;  1SQB H;  2WWW A;  3RVY A;  3HKD B;  2UXX A;  3C3T A;  3B8M A;  4KP4 A;  1ZSP A;  1VP7 A;  3CJH A;  5EC1 C;  1CPY A;  4X64 O;  1IVS A;  2EIK C;  2CK3 G;  1EN5 A;  4P2Z A;  2Y4T A;  1WPB A;  4CH6 A;  1KEC A;  5KHG A;  1Y6X A;  1NR1 A;  3QO7 A;  1JOY A;  4U7O A;  3ML0 A;  4GX1 A;  3CXC U;  2ZIO A;  2R9A A;  4K0K B;  2F66 C;  4FIP C;  3B8N A;  4FM1 A;  2E74 B;  2CUG A;  1SS3 A;  1CP9 A;  1XRE A;  1ARO P;  5CA1 B;  5JH7 A;  3HKC B;  2H94 A;  5JCO C;  1SQF A;  4B3R O;  2A3Q A;  2XOK G;  1AP6 A;  1KUQ A;  1WPX A;  4JI4 B;  5L3B A;  3DTU B;  5LBQ A;  1WB7 A;  1VQ9 V;  1SQV H;  3CRC A;  4Z1M G;  3MHS C;  2GBO A;  1OCR B;  1HWY A;  3ABL C;  2IW5 A;  1BQZ A;  5B1A B;  2QKC A;  5JQG A;  2UXD B;  1ZL8 A;  2DE0 X;  3DC6 A;  3K08 A;  1JFF B;  1R6N A;  2GUZ A;  5ITZ B;  1RSO A;  4NXM O;  5H5N A;  4LF9 O;  4PDM A;  5KUK A;  1SES A;  1V55 B;  5LHI A;  1Q8I A;  5IYC O;  1PNL A;  4CS3 A;  1GN2 A;  4JI2 O;  4WBN B;  3VQY A;  1NKD A;  3A0B Z;  3S3X A;  4QPK A;  1WP8 A;  2EIN C;  5KX5 B;  2YEV B;  4I55 B;  2YIA A;  3RYC B;  2FL4 A;  5KHH A;  3JAS A;  3E2E A;  2OYQ A;  1S3J A;  3CP1 A;  3AK3 A;  5JCO A;  4DR1 B;  4KUM A;  4DV7 B;  2EZP A;  2Q0O C;  3SJB C;  4JI3 B;  2F93 B;  2YIB D;  3BA9 A;  1EBO A;  1TVK B;  1MMM A;  4JI1 B;  3S3W A;  5IDJ A;  4D7S A;  5LA6 B;  4I4T A;  2F43 G;  2OCC C;  3QO5 A;  3SPG A;  3L74 H;  3RVZ A;  1E1Q G;  4O2B A;  1XUQ A;  3BRC A;  4NTY A;  1XHZ A;  1NQT A;  2ZE5 A;  1R3J C;  1W59 A;  4FJC C;  5B1O A;  2EJR A;  5EK0 A;  3AG3 C;  4PHZ A;  3O65 A;  3HKE A;  1NH2 D;  5LOV B;  2H3O A;  5BR8 O;  4JZG A;  3OUF A;  1YI2 V;  1FFT B;  1SQQ H;  4WCE V;  4B3T O;  2ITD C;  1NBM G;  4TT3 G;  1EM1 A;  2Y48 A;  2EIJ B;  5CA0 A;  4EB6 B;  5B5E Z;  3IAY A;  2P67 A;  2YC0 A;  3L72 H;  1D2D A;  3OTF A;  3LUT B;  3OM3 B;  4J80 A;  1EZJ A;  3CHX A;  1D5A A;  4DV4 B;  2Q8V A;  4UCO A;  2OIG A;  4UCS A;  4DUY O;  1QBZ A;  3ZMU A;  4J7K A;  3E8F A;  4IL6 Z;  4LWS B;  1MG1 A;  2AZ2 A;  1Q82 W;  4YHH O;  2GV9 A;  5F2V O;  2PF4 E;  5GON B;  4ZI7 B;  4DR6 B;  2W0F C;  2XAH A;  1CEZ A;  3CD6 V;  3FAV B;  2PYL A;  1OCC B;  4X1I A;  3JCZ A;  3ZX6 A;  3I55 V;  1QNM A;  4PA4 A;  1N8R W;  3ZMS A;  1XOU A;  4AQY B;  4CZZ A;  2WLI B;  1M57 B;  2QA4 V;  1S76 D;  4PDV A;  4H37 A;  3CME V;  1I0H A;  2IM9 A;  1XMQ O;  2AHZ A;  1DK1 A;  3AG1 B;  4K0K O;  4UUJ C;  3Q4H A;  2PGG A;  2X6B A;  3H1J H;  1CXZ B;  4EKW A;  1TGO A;  2LO1 A;  1K7D A;  2QKS A;  3F7V C;  2GSM B;  4DV1 B;  1Y4M A;  3G6B A;  2ZIN A;  1OZ0 A;  3STL C;  3SYC A;  4DV0 O;  3K04 A;  3AG4 B;  4MW3 A;  1M93 A;  1UPG A;  4LFB B;  1XQ8 A;  3SPI A;  4HYO A;  1SZX A;  1S72 V;  3OR6 C;  2Y0I A;  2G38 A;  1K5S A;  1Y66 A;  1YTF D;  2F23 A;  3JCU Z;  3JSN A;  4JAS A;  4UCU A;  2WPD G;  4E2L A;  2DYR C;  1SA0 A;  2EIM B;  4JZ2 A;  4J9Z B;  1M90 W;  3W7T A;  2ZD9 A;  5LYJ A;  4J42 A;  1KBH A;  3CC4 V;  4FMT A;  4BWA A;  3P32 A;  2ATK C;  4JYY A;  4K3A A;  1VQP V;  2LGW A;  4NTW A;  5JJN B;  5IJ9 A;  4FLX A;  5KHI A;  3EHB B;  2UXD O;  2LW1 A;  3BVO A;  3JD1 A;  3C90 A;  2Q9L A;  4GUN A;  4A5U B;  3FB6 C;  5J2U A;  1YZB A;  2JGD A;  1K4D C;  1I08 A;  4G2K A;  4I50 A;  3OGI B;  4WF9 V;  3CCL V;  2WAM A;  2LJ2 A;  4ZHQ A;  2EIL C;  5GTI Z;  4JI0 B;  4F6R B;  2CE4 A;  5LMN B;  2JS3 A;  1XMO B;  3D8C A;  3ZMT A;  3RYF B;  5IWA B;  3SR2 C;  2JEX A;  1GN3 A;  3B4S A;  3JAR B;  2ZE8 A;  2QSA A;  4JI3 O;  2HG5 C;  4FFB A;  4H44 B;  5J2T A;  2Q7H A;  3IGA C;  4FFK A;  5CBG A;  4TQF A;  1XNQ O;  4JI1 O;  2P5O A;  4K8X A;  3FKS G;  1M1K W;  4J9Y B;  1K97 A;  4OPH A;  3RN4 A;  4XDL A;  5KAI Z;  5BY1 A;  4JI8 B;  4U3J B;  4JYA B;  2N74 A;  3LSQ A;  3OTO B;  3CCS V;  1N36 B;  1AJN A;  4PV1 B;  2Z0A A;  1AI7 A;  2ILM A;  3P3N A;  5E79 Z;  4XDK A;  1NTK H;  2IH1 C;  2JJ1 G;  2K9P A;  2WA4 A;  4DR3 O;  1QLN A;  4H0L B;  1BT8 A;  4JPR A;  3RGB A;  1W2B U;  4O4I A;  4P9O A;  4GYC B;  5LL6 Y;  1BMF G;  3WB2 A;  3QO8 A;  2HP8 A;  3K5M A;  2Z5U A;  3E35 A;  2WLN A;  2ADP A;  3K3W A;  1BHB A;  1Y76 B;  4QE7 A;  2JGU A;  2R72 A;  3BCC H;  2JJ2 G;  3CMA V;  1Z5W A;  4GZR B;  3R65 A;  1SKV A;  4ZOL A;  5B3S C;  5KHJ A;  1I94 B;  4YXW G;  4CC6 A;  1GTO A;  3AG2 B;  4MVR A;  1YVW A;  1FFX A;  2LFR A;  4DR6 O;  4O4L A;  1Q6I A;  1HNX B;  5DED A;  3ABM C;  2KSD A;  4X9Q A;  3IFX A;  2WA3 A;  4FLV A;  4FLU A;  1WP7 A;  2HLD G;  4MSW C;  2LQT A;  4AQY O;  1VQ7 V;  1JQ0 A;  1HR0 B;  1F4N A;  4DV2 O;  2RN9 A;  3CX5 F;  3K5N A;  1AVM A;  1R1B A;  1RPR A;  1COW G;  5JWP A;  1KB9 F;  3DSQ A;  4UFZ A;  3UO2 A;  3D3I A;  1TUE B;  3I5D A;  3K58 A;  4TV8 B;  3K06 A;  2ZR3 A;  4RAI A;  1HW7 A;  2ITC C;  3UM7 A;  4CS4 A;  4X20 A;  1P49 A;  3G80 A;  1R3K C;  5CMU A;  3NXS A;  5CBH A;  3APQ A;  3T2M A;  1J5E B;  2HKO A;  4PDR A;  2RQ6 A;  2OTL V;  2XHB A;  2VQF B;  1BL8 A;  3MD0 A;  1L0N H;  3ZHT A;  3IJ4 A;  1Q6U A;  4DR2 B;  4DR7 B;  3BAA A;  3FYI B;  3WB0 A;  1P84 F;  1PNM A;  5D5Q A;  4R50 A;  5A2Q N;  5CB4 B;  3K9A A;  3CPW U;  4MVS A;  1HNZ B;  4QPJ A;  4IT5 A;  1BGY H;  1XBL A;  4N21 A;  1K33 A;  2KKW A;  2UUC B;  1XNR O;  4B7E A;  2BTQ A;  3ZRS A;  4LNU B;  4N23 A;  4J10 A;  5CN0 A;  5EBM C;  2HJF C;  1WB8 A;  4L8J A;  4DR5 B;  4HNA A;  5KMG B;  4HZ3 A;  1QR8 A;  1GO3 F;  1OHH G;  5FLX N;  4DR4 O;  4LFA B;  2KG7 A;  1K9M W;  5KHK A;  1KP3 A;  2QKA A;  2V1D A;  4OGQ B;  5LMN O;  3L75 H;  5EZY B;  2OTJ V;  2WLL A;  5E1A C;  2YID A;  2DYS C;  4R6Z A;  1GH6 A;  4X62 B;  2R9I A;  5EIB C;  1TUB B;  3C3S A;  1K8A W;  1GN4 A;  1KKC A;  1IX9 A;  1ROP A;  3HKD A;  4YIP A;  4JAA A;  3TET A;  4MVM A;  1QU7 A;  1IBL O;  2VWK A;  1R6K A;  2PUS A;  4JI8 O;  3CWB H;  4YIO A;  3SYP A;  3OTO O;  3JD2 A;  1N36 O;  4TWK A;  1SC5 B;  4LF5 B;  1N4C A;  4RO2 A;  5BMV A;  1OCR C;  1EFR G;  1EZV H;  4X88 A;  3UKM A;  3A0R A;  3JAL B;  5B1A C;  1VQK V;  4DV3 O;  5B66 Z;  2A0L A;  2Q0A A;  1YTF B;  5IT9 N;  4WFA V;  1HP8 A;  1ZAU A;  4NXN O;  4PA7 A;  1MSD A;  1EN6 A;  1FS0 G;  2EX3 A;  1V55 C;  4UXN A;  3M8A A;  2ZIM A;  1THZ A;  2CH7 B;  5IYZ A;  4MTF A;  1VEW A;  3E83 A;  3K59 A;  1IBM B;  3HB3 B;  3U11 A;  4GKJ B;  2IJH A;  2LGQ A;  4B7K A;  4CH4 A;  5CA1 A;  1BQ0 A;  5KAF Z;  2X6A A;  2FTK A;  1LNQ A;  2BSK B;  1F7Y A;  2ZXW B;  4BIZ A;  3VQV A;  2YSU B;  4B08 A;  1QVG U;  3LSS A;  5JVD A;  4YJ2 A;  1SQG A;  4L87 A;  1L0L H;  2YDE A;  1DF4 A;  3JD3 A;  1AR1 B;  4OXS A;  4UVB A;  2EJ7 A;  3ETE A;  1R6T A;  1PKX A;  2R70 A;  1HDJ A;  1QVF U;  1HNX O;  3TXQ A;  1JFF A;  1QLE B;  5LMU O;  4H33 A;  4X8A A;  4QNH B;  3ZRW B;  5ITZ A;  1DLB A;  3CRA A;  4JV5 O;  1QQC A;  1H2K A;  1V9P A;  3HKB B;  4WBN A;  1OCZ B;  3ASN B;  3FD9 A;  3H1K H;  4BW5 A;  1HR0 O;  4I7Z B;  1M5I A;  5HFM A;  3L71 H;  5KX5 A;  1Q6H A;  3L70 H;  2YEV A;  4FLZ A;  1LUW A;  4FZ1 A;  1XL6 A;  2BCC H;  1FKA O;  3RYH B;  1G1X B;  2ARH A;  3LDD A;  4CS2 A;  1SER A;  3FYE B;  3P30 A;  4WFH A;  3ZIA G;  2P4K A;  3FB5 C;  3ZHV A;  2QWN B;  4JAV A;  2BOB C;  1KU9 A;  3CB2 A;  1NU1 H;  2VQF O;  4NYK A;  1TVK A;  4U3F H;  5JJE B;  3CC2 V;  4LF6 B;  4DR2 O;  3U10 A;  5LA6 A;  4H13 B;  1IZ3 A;  3DXR B;  2XAF A;  2PI5 A;  4JGS A;  1MA1 A;  4IIJ B;  1RFY A;  2ZM6 O;  1JA8 A;  5L3F A;  1F23 A;  1IBK O;  1N33 O;  5CBF A;  2HHH O;  2EIK B;  1VQ5 V;  1OCC C;  3E8G A;  3KG2 A;  2UUC O;  4NTX A;  1JX9 A;  1KP2 A;  1P7G A;  3F7Y C;  5LOV A;  2PTM A;  3D36 C;  4MVQ A;  4FLT A;  3TCU A;  3LNN A;  1RM1 B;  1SZT A;  1GKF A;  2XND G;  3AG1 C;  1TAE A;  1E79 G;  4EB6 A;  1IDS A;  4LFA O;  4DV5 B;  4NR1 A;  4FK5 C;  2VQE B;  5KA6 A;  3IC7 A;  4X66 B;  5EBL C;  3RYI B;  3E22 A;  3AG4 C;  3UQ8 A;  4R8C A;  2IU3 A;  3O9O A;  2YI9 A;  1URF A;  4X62 O;  4IHJ B;  4EFE A;  1UJW B;  4JI6 B;  3UT5 B;  1YXB A;  4LWS A;  2VWJ A;  1GMG A;  4QE9 A;  1WLE A;  1H2N A;  1QCE A;  1D5N A;  1S77 D;  1PL4 A;  1BZK A;  5GON A;  2Q68 A;  2FKX A;  2JRI A;  1Q5O A;  3FAV A;  4LF7 O;  1FJG B;  3CYO A;  1BHA A;  5HFL A;  1PM9 A;  4CC5 A;  4LF5 O;  5DN6 G;  1N32 B;  4O2B B;  1GRJ A;  2BOC C;  3D36 A;  1AI6 A;  2WLI A;  2ZCE A;  3BHP A;  4P30 A;  5LHH A;  3HKE B;  2Y0P A;  3STZ C;  4B3S B;  3A0H Z;  1AJP A;  1LR1 A;  4DV6 B;  4E4E A;  1XI1 A;  2XTA A;  3VOU A;  5B1N A;  4IGG A;  2UU9 B;  4IYH A;  1JPX A;  2L35 A;  5L3D A;  4DRX B;  5CA0 B;  4GKJ O;  3E86 A;  1K4C C;  4O4J B;  2YXH A;  1YIJ V;  5LP6 C;  1MSW D;  2D2C B;  4FM2 A;  2IU0 A;  2CTW A;  3QG5 A;  1A32 A;  4C7U A;  3FB8 C;  2IJI A;  4GX0 A;  5EBW C;  5IJ0 B;  1XHX A;  3B2E E;  4KHP B;  2HJD A;  3OGC C;  4IYI A;  3OEE G;  1G6U A;  4LCU C;  3CCM V;  1X4T A;  4DUZ B;  4QJF B;  3CCJ V;  4FLW A;  4JF3 A;  1YF2 A;  3K03 A;  1V54 B;  4PJ0 Z;  2GTS A;  3B77 A;  4JI4 O;  1M9N A;  3BPZ A;  1HNW B;  1AI5 A;  1MZE A;  2CTR A;  4MT8 A;  2GTA A;  5L3C A;  2OWO A;  2ODM A;  1W0J G;  1PPJ H;  2QM8 A;  3MDS A;  4F6R A;  2Y69 B;  5LP6 A;  3SYQ A;  1E1R G;  1YJN V;  2F95 B;  3N2G B;  3A2F A;  1TA8 A;  3JAT B;  1SRY A;  3JAR A;  4O2A B;  1NI8 A;  1OV9 A;  3CS5 A;  4K8Z A;  4D6T H;  3FFQ A;  4ICG A;  4GLX A;  1U97 A;  5DM6 V;  1MOF A;  1XEQ A;  4LF6 O;  1XIL A;  4K35 A;  4RWU A;  3AG2 C;  4TUY B;  3BA8 A;  3K0G A;  4U3J A;  4DR1 O;  4Q20 A;  4I0X B;  2X7R B;  4DV7 O;  1H8E G;  4UCV A;  3SPH A;  1R3I C;  4BIO A;  5LYJ B;  2WLM A;  2XAJ A;  5H9C A;  1OCO B;  1YCI A;  5FNV A;  4O4H B;  4ASU G;  1L1F A;  5IJ9 B;  3WB1 A;  1YJ9 V;  1VMG A;  2UXC B;  5EIB D;  1JCH A;  5J2U B;  2UUA B;  3OFN G;  3T1H B;  3SYO A;  4BAY A;  5LHG A;  4I50 B;  1H2G A;  4NVP A;  1VQM V;  3TJT A;  2ZDI C;  2Q6A A;  5H6Q A;  4DV5 O;  2WLH A;  2VQE O;  1Y76 A;  1W0K G;  3OMI B;  4X66 O;  1H2L A;  3JAW B;  3WFV A;  1F4M A;  3QF7 A;  2CGN A;  4LFC B;  5KUM A;  1PL0 A;  1VF5 B;  1KQS U;  2OIE A;  2ZQM A;  3T1Y B;  4FFB B;  4X1Y B;  1QHT A;  3GWO A;  4JI6 O;  2XAQ A;  3LNM B;  1G8M A;  3BY6 A;  3DGE A;  1Z5V A;  1R3L C;  1AB3 A;  3ASO B;  2RMK B;  1WA8 B;  5BXZ A;  2YI8 A;  3U0Z A;  4X64 B;  4DV4 O;  4GX2 A;  4PI0 A;  1N32 O;  4WFB V;  4FM0 A;  4YY3 B;  2JK5 C;  2YIB A;  1VQL V;  1FAF A;  1YJW V;  1GM9 A;  2UXB B;  1FPO A;  4J7J A;  3OMA B;  3WG7 B;  4JI7 B;  2ZDI A;  2WLK A;  2XUM A;  2YS8 A;  4G27 B;  2A7W A;  2DW4 A;  3G71 V;  3F5W C;  4BIU A;  1VQN V;  4TV8 A;  2UU9 O;  1RPO A;  3JD4 A;  1G4Y B;  3CRM A;  2JDI G;  2QTS A;  1GN6 A;  4BW9 A;  3AK2 A;  3N2K B;  2XT9 A;  1FXK B;  4BR6 A;  4B3R B;  2ZT9 B;  5LXT B;  3THO A;  3GB7 C;  2PY5 A;  4RQE A;  4DV1 O;  2B5U A;  3X2Q B;  5CB4 A;  2ZE7 A;  3ZCC A;  1Y74 B;  4LFB O;  2W6J G;  2QWR B;  4AHC A;  4QIW F;  3TGU H;  3ABU A;  1M56 C;  4O4L B;  1K3E A;  5EYP B;  3UCS C;  5L3G A;  4AIL C;  3CXH F;  1NH2 B;  1M4U A;  2LP7 A;  4YJ3 B;  4ABM A;  2AXT Z;  3ICX A;  4JYB A;  4LNU A;  1H2S B;  2CDY A;  1S0V A;  5C8Y B;  4NXM B;  2X0L A;  2P7T C;  3BFR A;  4LF9 B;  5IY5 B;  1HNW O;  5KMG A;  3J80 N;  4JI2 B;  3UO3 A;  3ZMV A;  1K73 W;  3OW2 U;  4JTA B;  1WNS A;  1MNG A;  2E76 B;  5FPR A;  2JEU A;  1O9G A;  5EZY A;  4TSF G;  4CH3 A;  1H2M A;  4P9P A;  3L73 H;  3VQW A;  3PN1 A;  4KFM A;  1I7F A;  1Z2G A;  5JJJ B;  1N0J A;  1VQ4 V;  4D7T A;  2ZXW C;  5B3S B;  1TUB A;  3R66 A;  4TV9 A;  2BTO A;  2XAG A;  4JI0 O;  1XMO O;  1ZTE A;  4DK1 A;  1BCC H;  1H8H G;  5IWA O;  4PA6 A;  1Q86 W;  2YXY A;  3L9D A;  1NT2 B;  3ABM B;  4MVO A;  2WLJ A;  3JAL A;  2Q67 A;  3ABK B;  4X1K B;  3G67 A;  4KL1 A;  1QLE C;  3EXA A;  1BSM A;  4R7C A;  2OT5 A;  5BR8 B;  3OE7 G;  3LDC A;  3B40 A;  2EZO A;  3T1H O;  2QWO B;  3JYC A;  4B3T B;  1BS3 A;  3BEH A;  5B1B B;  4HNA B;  4JYA O;  2WSS G;  1OCZ C;  2CH7 A;  3ASN C;  3QTC A;  2R9R B;  3OT7 A;  1PP9 H;  1NVP D;  1JR9 A;  5IYB O;  5LGT A;  2CTQ A;  5K1X A;  4NB5 A;  1XDC A;  2IH3 C;  4LF4 B;  4DW1 A;  2KQX A;  3ETG A;  1JJO A;  2PI4 A;  2BSK A;  4LFC O;  4JTD B;  1AP5 A;  1NZ6 A;  4XDJ A;  4X65 B;  3JSL A;  4DUY B;  2M7W A;  3AEI A;  2RNB A;  3NR7 A;  4YHH B;  3HKC A;  3JAK B;  3I56 V;  2QEX V;  2YIC A;  3QNE A;  4CBC A;  2CTP A;  1VIB A;  4MW8 A;  5BMV B;  3LSU A;  5TIS Z;  4YY3 O;  4ZBM A;  1I94 O;  3ZRW A;  2B1G A;  3JAM N;  2F4V B;  3HKB A;  5IE9 A;  5LGU A;  2UXB O;  1XMQ B;  2VS0 A;  1LUV A;  3HPL C;  4JI7 O;  4DW0 A;  2DMX A;  1RM1 C;  3CJH B;  3T4Z A;  2Q7E A;  5IYZ B;  2A79 B;  3RYH A;  2P6J A;  4FPP A;  4DV0 B;  1GAX A;  4LH7 A;  3G4S V;  4J7Z A;  4MTO A;  2DYS B;  3IC9 A;  2FML A;  1DTO A;  1IXB A;  4I55 A;  3RYC A;  2M6Y A;  5A9G A;  2EIJ C;  4OPA A;  2QWQ B;  5JVD B;  1B3Q A;  2Q5Z A;  3TK1 A;  3DXR A;  4MTX A;  4YJ2 B;  2D3O W;  2P06 A;  4MS2 A;  4IIJ A;  4GKK B;  3MAQ A;  5JH7 B;  3W7S A;  1I5X A;  4QGP A;  1J5E O;  3SPC A;  5H2F Z;  1WAZ A;  1DGS A;  3K9S A;  3H01 A;  4OX9 B;  1S5H C;  4DR7 O;  1K92 A;  3K57 A;  2ETN A;  2O57 A;  4JTC B;  4Q6G A;  2JIZ G;  1NJI W;  2IBZ H;  3GVM A;  1HNZ O;  1GM7 A;  1N34 B;  3KKY A;  1AIL A;  2BE3 A;  1Q90 D;  3B09 A;  4DO2 A;  2E5L B;  1FD9 A;  5JQG B;  1S5L Z;  1ZL8 B;  3CRQ A;  4UB6 Z;  3RYI A;  2V7Q G;  4NKG B;  2QM7 A;  3G6E V;  2GUZ B;  1RSO B;  3H1I H;  5GW7 A;  4JAU A;  1M57 C;  4DR5 O;  2AZ0 A;  4FLY A;  4TOI A;  5IYD O;  2QJ1 A;  4ZIB A;  1ENV A;  4IHJ A;  1KMI Z;  3UT5 A;  4DYL A;  3SJA C;  1XNQ B;  4UV9 A;  3JAS B;  4LH6 A;  2EBO A;  3ZRX A;  1EN4 A;  5J9P C;  2QM4 A;  4FVM A;  2LFS A;  4MVZ A;  2OCH A;  4LP8 A;  2JS5 A;  4PDL A;  3K5L A;  3M7M X;  2YUA A;  1FYJ A;  2X6C A;  1V54 C;  1DF5 A;  1J95 A;  4DR3 B;  1PD3 A;  2Z3Y A;  2VRZ A;  4ZI7 A;  2GDS A;  1QR9 A;  2EIM C;  1IUR A;  2B9Z A;  1FXH A;  4I4T B;  3RWR D;  3OD4 A;  3RT3 C;  3ABL B;  3ZHQ A;  1X59 A;  2K1E A;  2ZNI A;  5FPO A;  4UVC A;  2NNU A;  2DWD C;  3VQX A;  2IJJ A;  4DRX A;  2P4V A;  5KA5 A;  4O4J A;  2Y69 C;  4GCZ A;  4LF4 O;  3SJC C;  3E22 B;  3FX7 A;  4F6E A;  4MTG A;  4Z1V A;  2ZE6 A;  1AR5 A;  2QE7 G;  2ZNJ A;  2A06 H;  2EIN B;  2DWE C;  4X65 O;  5IJ0 A;  3AK1 A;  3K5O A;  4Z2W A;  3EFF K;  3ETD A;  2NR5 A;  1IBM O;  3CE2 A;  2PYJ A;  3K79 A;  4PA3 A;  1IXM A;  2UUB B;  4G28 B;  2HVJ C;  3H1H H; 
#chains in the Genus database with same CATH homology
 1OCR B;  1KQS U;  1HWY A;  1OHH G;  2AHY A;  3ABL C;  2ZQM A;  2IW5 A;  5C93 A;  1OCO C;  3GWO A;  1K9M W;  4RQF A;  2XAQ A;  3LNM B;  1G8M A;  5B1A B;  3BY6 A;  3K08 A;  1KP3 A;  2V1D A;  3DGE A;  1R6N A;  2IJK A;  3OUS A;  1R3L C;  2OTJ V;  2OCC B;  3ASO B;  3ABT A;  2WLL A;  4PDM A;  5KUK A;  5E1A C;  1SES A;  1V55 B;  5LHI A;  1FXV A;  5IYC O;  1PNL A;  3ZN0 A;  2DYS C;  1H38 A;  4R6Z A;  1NKD A;  3OR7 C;  2R9I A;  4QPK A;  4GX2 A;  2EIN C;  4WFG A;  1XL4 A;  4WFB V;  1VQO V;  2YEV B;  1K8A W;  2JK5 C;  1VQL V;  1ROP A;  3AG3 B;  1KD1 W;  3TET A;  3E2E A;  4MVM A;  1S3J A;  3CP1 A;  1YJW V;  1GM9 A;  4KUM A;  1R6K A;  3PJS K;  2EZP A;  3WG7 B;  3OMA B;  3SYP A;  3JD2 A;  2ZDI A;  2WLK A;  4G27 B;  4TWK A;  2HFE C;  3E8B A;  4RO2 A;  1OCR C;  2DW4 A;  4LC1 A;  1EFR G;  3G71 V;  1EBO A;  3F5W C;  4X88 A;  4GX5 A;  3UKM A;  4BIU A;  1VQN V;  3A0R A;  5B1A C;  3T1C A;  1VQK V;  1RPO A;  2A0L A;  1YTF B;  1YSC A;  3JD4 A;  4WFA V;  5IDJ A;  4LBE C;  1G4Y B;  2JDI G;  4PA7 A;  1FS0 G;  1NVP B;  2F43 G;  2OCC C;  3QO5 A;  3ASO C;  3SPG A;  1V55 C;  4UXN A;  3CCR V;  1KC8 W;  1K5Q A;  1KKD A;  3ZRV A;  1FXK B;  1THZ A;  3RVZ A;  4MTF A;  1E1Q G;  1NQT A;  3E83 A;  4MVU A;  3GB7 C;  5CA3 A;  3HB3 B;  1R3J C;  4RQE A;  2W6I G;  2B5U A;  2IJH A;  3MHH C;  4FJC C;  5B1O A;  2EJR A;  5EK0 A;  3VBB A;  3X2Q B;  3CC7 V;  3AG3 C;  2UXN A;  3LDE A;  1NH2 D;  2MK3 A;  3ZCC A;  1YIT V;  2X6A A;  2FTK A;  3OUF A;  2W6J G;  1YI2 V;  1LNQ A;  1FFT B;  2XAS A;  4QIW F;  4WCE V;  3CCQ V;  3ABU A;  1M56 C;  2ITD C;  1K3E A;  1NBM G;  2ZXW B;  4TT3 G;  3WG7 C;  5L3G A;  2ZR2 A;  1F51 A;  4BIZ A;  1JJ2 U;  1NH2 B;  2Y48 A;  2LP7 A;  2EIJ B;  3ZJZ A;  3CCV V;  2YSU B;  4UV8 A;  4JYB A;  1QVG U;  3LSS A;  2P67 A;  1S0V A;  4L87 A;  2X0L A;  2P7T C;  1DF4 A;  3M99 B;  3JD3 A;  2DQ0 A;  1AR1 B;  1I5Y A;  5IY5 B;  3LUT B;  1MAB G;  3OM3 B;  4OXS A;  4UVB A;  1EZJ A;  3CCE V;  3ETE A;  1PKX A;  3ZMV A;  1K73 W;  1QVF U;  3OW2 U;  4JTA B;  1GK9 A;  1FXK C;  1QBZ A;  2A9H A;  3ZMU A;  3E8F A;  1ORQ C;  2JEU A;  1QLE B;  1MG1 A;  3SJQ C;  1Q82 W;  4H33 A;  4X8A A;  4QNH B;  3ZRW B;  1DLB A;  3JD0 A;  4TSF G;  2QTO A;  4P9P A;  3X2Q C;  4KFM A;  1ZWI C;  1OCZ B;  3ASN B;  2W0F C;  2XAH A;  4BW5 A;  4I5S A;  1CEZ A;  3CD6 V;  1B6Q A;  1K34 A;  5EC2 C;  5HFM A;  1VQ4 V;  4ZKI A;  1OCC B;  2ZXW C;  5B3S B;  2YEV A;  3JCZ A;  3I55 V;  1XL6 A;  4PA4 A;  1NR7 A;  1N8R W;  3K0D A;  3ZMS A;  2XAG A;  2DYR B;  1P7B A;  2DQ3 A;  3LDD A;  4CZZ A;  1SER A;  3FYE B;  3P30 A;  3RW0 A;  2WLI B;  4WFH A;  3ZIA G;  1M57 B;  2QA4 V;  1S76 D;  4PDV A;  3FB5 C;  4H37 A;  3CME V;  1H8H G;  5IY5 C;  3OMN B;  4JAV A;  4PA6 A;  2BOB C;  2AHZ A;  2P90 A;  3RBZ A;  1Q86 W;  3AG1 B;  4UUJ C;  3ABM B;  2HVK C;  2X6B A;  4EKW A;  4MVO A;  2WLJ A;  1K7D A;  2QKS A;  3F7V C;  5L3E A;  2GSM B;  2Q67 A;  3CC2 V;  1Y4M A;  3ABK B;  4XBF A;  1OZ0 A;  3STL C;  3SYC A;  1VQ8 V;  1QLE C;  4PEL A;  3K04 A;  4R7C A;  4GT1 A;  2OT5 A;  3AG4 B;  3OE7 G;  4MW3 A;  3LDC A;  3SPI A;  4HYO A;  2EZO A;  2XAF A;  2PI5 A;  1S72 V;  3JYC A;  3OR6 C;  4JGS A;  3BEH A;  5B1B B;  2WSS G;  1FXK A;  1K5S A;  1OCZ C;  1Y66 A;  3ASN C;  1YTF D;  4I9W A;  5L3F A;  1F23 A;  4HZ3 A;  2R9R B;  5CBF A;  2EIL B;  2EIK B;  2NLJ C;  4WFF A;  4JAS A;  1VQ5 V;  1OCC C;  1NVP D;  2WPD G;  3E8G A;  5IYB O;  3KG2 A;  4E2L A;  1JX9 A;  5LGT A;  1KP2 A;  3F7Y C;  2IH3 C;  2DYR C;  3ETG A;  2EIM B;  4J9Z B;  4MVQ A;  1JOY A;  1M90 W;  2PI4 A;  3TCU A;  3W7T A;  2ZD9 A;  4JTD B;  3CC4 V;  1RM1 B;  4FMT A;  1SZT A;  1GKF A;  4XDJ A;  3P32 A;  2ATK C;  1VQ6 V;  1R73 A;  1VQP V;  2XND G;  3AG1 C;  2KB1 A;  1E79 G;  4F4L A;  1YHQ V;  2M7W A;  3AEI A;  4FK5 C;  3EHB B;  3JD1 A;  5KA6 A;  3IC7 A;  3ABK C;  3FB6 C;  5EBL C;  1Q81 W;  3AG4 C;  1K4D C;  3ZMZ A;  4R8C A;  2IU3 A;  3I56 V;  2QEX V;  4G2K A;  3QNE A;  4CBC A;  2H8P C;  5B1B C;  4WF9 V;  3CCL V;  2WAM A;  4RUF A;  1UJW B;  2Q69 A;  4RUE A;  4MW8 A;  2EIL C;  1GMG A;  4QE9 A;  4ZBM A;  5H6R A;  3ZRW A;  1WLE A;  1AI4 A;  3W7X A;  1QCE A;  3W7W A;  2B1G A;  1S77 D;  3ZMT A;  5LGU A;  2Q68 A;  3CCU V;  3ZN1 A;  3OEH G;  2JEX A;  3HPL C;  3OAA G;  2HG5 C;  3CYO A;  1RM1 C;  1BHA A;  5HFL A;  3T4Z A;  5DN6 G;  3IGA C;  2A79 B;  2P6J A;  2BOC C;  4FPP A;  4PA9 A;  5FL7 G;  1Q7Y W;  5BZB A;  5CBG A;  3D36 A;  1AI6 A;  2GHY A;  2WLI A;  3FKS G;  5CMU A;  3SPJ A;  1M1K W;  3G4S V;  4J9Y B;  1K97 A;  5LGN A;  5LHH A;  4P30 A;  4MTO A;  4XDL A;  4X89 A;  2DYS B;  3STZ C;  3LSQ A;  3CCS V;  3FB7 C;  1AJP A;  1AJN A;  1DTO A;  3MHS C;  3SYA A;  1AI7 A;  1PNK A;  4XDK A;  3VOU A;  5B1N A;  2EIJ C;  4HAM A;  2IH1 C;  1JPX A;  5L3D A;  2JJ1 G;  3E86 A;  1K4C C;  4WFE A;  4U7N A;  3TK1 A;  1YIJ V;  4MTX A;  1QLN A;  2D3O W;  1MSW D;  4MS2 A;  1JVM A;  2IU0 A;  3T4D A;  3W7S A;  4JPR A;  1W2B U;  1I5X A;  4P9O A;  3SPC A;  3FB8 C;  2IJI A;  1BMF G;  4GX0 A;  1GM8 A;  5EBW C;  3QO8 A;  3E89 A;  3H01 A;  3OGC C;  1S5H C;  2Z5U A;  3E35 A;  2WLN A;  1K92 A;  3OEE G;  3K3W A;  1BHB A;  3E8H A;  4JTC B;  2JIZ G;  1NJI W;  4LCU C;  4JYC A;  4QE7 A;  3CCM V;  4DXW A;  2C2A A;  2B1I A;  1SET A;  2HR3 A;  2JJ2 G;  1GM7 A;  4QJF B;  3W7U A;  3CMA V;  3CCJ V;  1P4R A;  1AJQ A;  4JF3 A;  3K03 A;  3R65 A;  5B3S C;  1V54 B;  4DO2 A;  4YXW G;  1GTO A;  3AG2 B;  3B77 A;  4MVR A;  2V7Q G;  3G6E V;  2QM7 A;  1M9N A;  4UVA A;  5GW7 A;  2LFR A;  1AI5 A;  2WLL B;  1M57 C;  4JAU A;  1M56 B;  5IYD O;  1ENV A;  4MT8 A;  5L3C A;  3ABM C;  1W0J G;  2QM8 A;  2Y69 B;  3IFX A;  3SYQ A;  2HLD G;  1E1R G;  2WWW A;  4MSW C;  4UV9 A;  3RVY A;  1YJN V;  2UXX A;  1VQ7 V;  1JQ0 A;  2EBO A;  3B8M A;  1SRY A;  3ZRX A;  4KP4 A;  5J9P C;  1F4N A;  5EC1 C;  2LFS A;  1CPY A;  4LP8 A;  4MVZ A;  1RPR A;  1COW G;  4PDL A;  3D3I A;  1TUE B;  2EIK C;  2CK3 G;  5DM6 V;  1MOF A;  2X6C A;  4P2Z A;  1V54 C;  1DF5 A;  1J95 A;  3K06 A;  1PD3 A;  2Z3Y A;  2ZR3 A;  4RAI A;  3AG2 C;  1KEC A;  2ITC C;  3UM7 A;  3K0G A;  1QR9 A;  4Q20 A;  1NR1 A;  1R3K C;  2X7R B;  2EIM C;  1H8E G;  1FXH A;  3NXS A;  3QO7 A;  3ML0 A;  4GX1 A;  4U7O A;  5CBH A;  3T2M A;  3CXC U;  3ABL B;  3SPH A;  1R3I C;  2HKO A;  4PDR A;  2WLM A;  2K1E A;  2XAJ A;  4FIP C;  2OTL V;  3B8N A;  1OCO B;  5H9C A;  1BL8 A;  3MD0 A;  4UVC A;  2NNU A;  2DWD C;  2IJJ A;  1CP9 A;  4ASU G;  1L1F A;  5KA5 A;  1YJ9 V;  3FYI B;  2Y69 C;  4GCZ A;  1ARO P;  1PNM A;  4R50 A;  1JCH A;  3OFN G;  3K9A A;  3CPW U;  3SYO A;  4MVS A;  4BAY A;  2H94 A;  4QPJ A;  5LHG A;  4MTG A;  1H2G A;  2QE7 G;  2EIN B;  2DWE C;  1VQM V;  4N21 A;  2ZDI C;  1K33 A;  2Q6A A;  5H6Q A;  3EFF K;  3ETD A;  2XOK G;  2WLH A;  3ZRS A;  1WPX A;  1W0K G;  3K79 A;  3OMI B;  4N23 A;  4PA3 A;  1IXM A;  5L3B A;  3DTU B;  5CN0 A;  3WFV A;  4G28 B;  5EBM C;  2HJF C;  5LBQ A;  1F4M A;  2HVJ C;  1VQ9 V;  5KUM A;  4Z1M G;  1PL0 A;  1QR8 A;  1GO3 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...