3CC4V

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cc4V00
1W2BU 3CPWU 1YHQV 1R73A 3CC2V 1VQ5V 1YITV 1QVGU 1VQNV 1VQMV 1VQPV 1K9MW 1S72V 1N8RW 3CCLV 1M1KW 1M90W 3I56V 3CXCU 2OTLV 3CD6V 3OW2U 1YIJV 3CCMV 3CCJV 1Q7YW 1KC8W 3CMAV 4WCEV 1YI2V 3I55V 1K8AW 3CCRV 5DM6V 2OTJV 1YJWV 3G71V 1VQLV 1YJNV 1QVFU 1Q86W 1KQSU 1VQKV 1KD1W 1VQ8V 1VQOV 3CC7V 1Q82W 3CCSV 3CC4V 3CCEV 3G6EV 3CCUV 3CCVV 1YJ9V 2QEXV 4WF9V 3CMEV 2D3OW 1JJ2U 1Q81W 3CCQV 1VQ9V 4WFAV 1VQ7V 1K73W 1VQ6V 1VQ4V 2QA4V 1NJIW 4WFBV 3G4SV
chains in the Genus database with same CATH superfamily
2QE7G 4DV5B 4JI0B 3ZHTA 4GKJO 2OTLV 1GK9A 5B1BB 4JI2O 3TETA 4LF6B 4KXRA 4L87A 3LDDA 4K3AA 1QU7A 1IDSA 3LUTB 4DR5B 1P7GA 3JALB 3CPWU 1RPOA 1IZ3A 3ZMVA 1JA8A 1Q6IA 3JASA 1HP8A 2GTAA 1GH6A 1YJWV 2HKOA 2KSDA 2A3QA 3AG4C 2LQTA 4G28B 2IJKA 3HKBA 4NB5A 3ZHRA 4CH3A 1GN4A 3DC5A 1HNXO 1NBMG 2B5UA 4FMTA 4JTAB 2ZXWC 1AR5A 3H1IH 1V9PA 1KECA 5D5QA 1T5EA 4KP4A 1PPJH 4FLVA 1ZX3A 1RPRA 2KKWA 3D3QA 4FJCC 1O9GA 4UVBA 5LYJB 4JTCB 4DRXA 3HPLC 4EFEA 5B3SC 2OCCC 1FFXA 3PJSK 4IYHA 4YHHB 3SJBC 4D7TA 1P84F 1R6NA 1A32A 3L9DA 3W7WA 3VBBA 1IXBA 1SA0A 1SETA 2JRIA 3TXSA 3ZHUA 2X7RB 3ABLC 1VARA 5FPOA 3THOA 2UU9O 1SQPH 2XTAA 3ETDA 4H0LB 2P4KA 1OCOB 2X6AA 5LGTA 1THZA 2GV9A 4DV0B 2EX3A 4E2LA 3H1JH 1I94O 2LO1A 4ASUG 4OPAA 4D6TH 4X66B 1K3EA 1OHHG 3NR7A 3GB7C 4DR7O 1HR0B 4QE9A 3CRQA 3FB5C 4X88A 5BR8B 4JYAO 4DV1O 1VQ8V 2JK5C 2H3OA 1JJ2U 3ZS8C 1PD3A 5FNVB 2JGDA 2X0LA 3UKMA 1JFFA 1W2BU 4YY3O 4ICGA 1J5EO 1MZEA 2AZ2A 5EC1C 1AI6A 4GT1A 4KFMA 4IL6Z 1X59A 5DN6G 2A7WA 5LA6B 1H2LA 3IGAC 1YJNV 5C8YB 4E4EA 4L8JA 5LP6A 1GRJA 4RUFA 1WB8A 4WFFA 1VQ7V 3HKDB 1XNRO 5EYPB 3BFRA 1L1FA 4XDLA 3AG3B 1EN5A 1B3QA 2YIAA 4O4IB 3BRCA 1BMFG 2Q7EA 1QR9A 3BCCH 3HB3B 4JV5O 1WAZA 2ZNIA 2UUCO 3VQYA 5GW7A 3KKYA 3RYIA 1YXBA 3FB8C 2ADPA 5J2TA 4H33A 4OGQB 2XHBA 2O57A 4UFZA 4HAMA 4K0KB 3K57A 1N32O 4UUJC 4MTXA 1XMOB 5EIBC 4X1IA 1VIBA 1Y76A 4BIOA 1V54B 1SQQH 5B1AB 5IYZB 1AROP 1YF2A 1QBZA 1PL0A 1UPGA 3K9SA 4PJ0Z 1WP8A 1EFRG 3C90A 3DTUB 1Y67A 4MVUA 1TVKA 3L70H 5ITZA 4JASA 4IIJA 3CCMV 1S0VA 2A79B 2CDYA 4JI1B 3RYFA 1K8AW 3I55V 1AJQA 3EFFK 2NNUA 3HR0A 1IURA 4X8AA 2YEVA 4WFEA 2P22C 3SJCC 4WFHA 4PA9A 4BIUA 2D3OW 4J7KA 2GDSA 3IC7A 4JAUA 1L0NH 5L3FA 4DW0A 2Q4PA 3AG1B 1F4NA 4CZZA 4MW8A 1F4MA 4X20A 4B3MB 3B77A 1CP9A 2W0XA 4RAIA 2GUZB 5IWAO 1FAFA 1TA8A 3JSNA 1S77D 1EZVH 3DXRA 2QTSA 2WAMA 5JVDA 3ZRWB 5LGNA 2HEPA 3W7UA 2PZSA 4I0XA 1ENVA 2IH1C 4OX9B 2WWWA 1VQ6V 4WFBV 3N27A 4YJ3B 1AP5A 4EKWA 4BWAA 4X9QA 5H2FZ 4FLWA 1K9MW 4DUYO 1K7DA 3ETGA 5CA1B 4GX2A 3BABA 1L8DA 2Y4UA 2IJJA 1WPXA 4LC1A 4QPJA 3TCUA 1FXKC 1NTKH 2XAHA 3SYOA 2Y0PA 1G6UA 1H8EG 4X65O 5IJ9B 1M57C 1TUBA 2VS0A 2F66C 2WLLA 4DR6O 3LNMB 1JR9A 2LJ2A 4I50B 5K1PA 1R6TA 1RSOB 4X64O 4NXNO 4IT5A 2R70A 1OCCB 1K5SA 3RVYA 4CH6A 3TGUH 2EILC 1NTZH 2YIDA 4UCUA 1KQSU 2ATKC 1NZ6A 1JCHA 4BW5A 3UCSC 3BHPA 4MW3A 4DV4B 4J7ZA 2RNBA 3H1KH 2HJFC 2DYRC 2BTQA 3I5DA 4LFCB 2LFSA 3VQVA 4WBNB 4LWSA 3W7XA 1Q6UA 4DV7O 3HKCB 3J81N 1KD1W 3B8MA 2OIGA 4Q20A 4O4HA 3SPHA 5BY1A 5LMUB 3OGCC 4YIOA 4CH5A 3FFQA 1YDXA 5KMGA 2EIKB 3ZBHA 1G4YB 2VRZA 2Y4TA 2PYLA 2UXXA 2CH7A 1XMQO 3JAKA 5L3EA 2Q69A 1J95A 5EZYA 3B09A 3FX7A 3CC7V 1QQCA 4JYBA 3CRAA 4CS4A 1COWG 1RM1C 1AR1B 2YS8A 1XBLA 1N8RW 1K4CC 4B3TO 1HDJA 3DGEA 3CJHB 3K06A 1IBKB 1D5AA 4KHPB 3E22B 3QF7A 4HNAA 3G71V 1ORQC 3T2MA 1K97A 3L74H 3QNEA 3CCVV 1H8HG 4MVZA 4BIZA 2VQFB 2UXDB 5CMUA 4DV5O 1NJIW 2EINC 2HVJC 2E5LO 1LUWA 2EZPA 1S5HC 3JALA 3BY6A 1S5JA 1XNQB 2BOCC 1NR1A 3EHBB 3I56V 4H44B 2Q7GA 2Z5UA 4YXWG 1G8MA 3QO5A 1MZFA 2IM9A 4LF6O 3RYCB 1F7YA 2WLIB 4PA7A 4J10A 3LSQA 3R65A 3P3NA 3J80N 3H9VA 2A0LA 1PKXA 1P49A 2EJRA 4BW9A 1K4DC 1H2GA 4W4LA 3ZMZA 3UO3A 4R7CA 2WLKA 1KB9F 2AHZA 3LSSA 3SPIA 3ZHQA 5KX5B 2RCVA 1U96A 2OIEA 2FTKA 2JJ2G 3ML0A 3W7TA 2QEXV 4TV8A 3WB1A 4MS2A 4JI6B 3T1YB 4I5SA 5CA3A 1PNLA 2HP8A 2IJHA 5IYDO 2H8PC 3L75H 1HNWB 1WLEA 3OR6C 3JCUZ 2HG5C 5LYJA 3ETEA 3WB2A 4QNHB 2CTRA 1Z2GA 3U0ZA 4Z1MG 4RWUA 2KG7B 4JI8B 4ZIBA 4TV9B 4DR3B 3DSQA 4FLUA 3E8BA 3CP1A 1F51A 4UB6Z 1I7FA 2Q6AA 1XDCA 3QG5A 3MHHC 5LHIA 4RQEA 3OUSA 2FKXA 2RDCA 3G67A 4X89A 1EM1A 4O4JB 3G6BA 5C93A 4J7JA 3ZJZA 2QDOA 4JI3O 3ZHSA 1N36O 1AVMA 3M8AA 4DR1B 2Q73A 3ASNC 3OMNB 2ODMA 3WB0A 5HFMA 2PY5A 1XILA 2XAQA 3KCYA 4DV0O 4LF8B 1VEWA 5LMNB 1DLBA 4EFBA 4ZKIA 1I5YA 4GCZA 1AR4A 5IJ0B 1IBMB 4X66O 5CBFA 4I55B 1Z5VA 2UUAB 1HR0O 4O2AB 4MTOA 4F6EA 3R66A 5L3GA 2XAGA 5BMVB 5BR8O 3AEIA 3RN4A 1V55B 1WA8B 1JQ0A 2ZINA 3JCZA 3C3TA 3RYHB 4H37A 2M6YA 3AK2A 2VWJA 5KHIA 3HKDA 3CS5A 2Y48A 2LGWA 3O9OA 4H13B 5EYPA 1YITV 2OT5A 1YIJV 3ZX6A 4CBCA 1YI2V 2ZM6O 1SQGA 3ABTA 3E86A 1LNQA 1URFA 2A06H 4HBNA 3B2EE 5IT9N 1H2SB 3L73H 4AQYB 3JD0A 4PD4F 4TQDA 3H1HH 5KHKA 4JI4B 4BR6A 4FVMA 1S76D 1KYOF 4LF7O 2JGUA 1SF9A 2B1IA 2WLJA 1CPYA 3QTCA 3WU2Z 4B3RO 1SS3A 5JQGB 4NTXA 3WFVA 1ZUQA 5B1OA 2DW4A 4MVMA 3F5WC 2Z3YA 2R72A 3OEEG 1E79G 2BE3A 4DV6O 4OPHA 4R6ZA 3LNNA 1XMOO 3L72H 2YXYA 3K59A 1Q7YW 4W4KA 2IH3C 2DN9A 3A0BZ 4UVAA 2DQ3A 2DMXA 1SC5B 1BQZA 3N2GB 1YZBA 5GONB 4DV3O 4B3SO 4A5UB 2YICA 3CHXA 5LHGA 1W0JG 2P6JA 1PM9A 1VF5B 3AK1A 4JI7B 1XQ8A 2G38A 2QM8A 2DYSB 1OCRB 3QO8A 1M4UA 4JI1O 3OTOB 3VQWA 2QWQB 1BQ0A 4DR2B 4IHJB 2DWEC 2P90A 1FS0G 4IYIA 1JOYA 2GTSA 2QGNA 4PHZA 3OE7G 1YJ9V 3JAWB 4UV8A 1N4CA 2RN9A 4GX5A 2BSKA 1ZTEA 4JYYA 2AHYA 4JZGA 4LFBB 5IYBO 1KU9A 4YJ3A 2H94A 5KUKA 3T1HB 3ABKC 2JEUA 3ZCCA 1XL4A 3C3SA 2F1MA 1AI4A 2CTWA 4U3JA 4LNUB 3P32A 3JATA 2ARHA 1NI8A 4LR3A 3AG4B 5IY5C 4MTGA 3ZN1A 1R73A 5CB4B 5FLXN 1HW7A 3OGIB 4X1YB 1IVSA 1R3IC 4GKJB 1RSOA 4GX0A 2F43G 2ZXWB 3Q4HB 4PDRA 4PELA 1K92A 3OMAB 1MABG 4AHCA 3ZHVA 1RFYA 1KC8W 3CMAV 1JJOA 4WBNA 1Z5WA 5E79Z 4DV4O 1BGYH 5H6QA 5B3SB 2P4VA 4ZI7B 3BA9A 4LF5B 3CCQV 2OCCB 4LFCO 1XEQA 2WLHA 1I0HA 3D36A 2IW5A 3K5MA 4GLXA 4CC6A 1MOFA 4JF3A 5EBMC 3ABLB 4YIPA 1GAXA 4UCTA 3S3WA 3HKBB 1QNMA 2ZE6A 1M56C 5LMUO 1QLEC 3M99B 1SQBH 2MW2B 4NXMO 4FIPC 2ZT9B 1P4RA 5LP6C 4DK0A 3SPGA 3QO7A 2QTOA 2L35A 3BA8A 1GN6A 2D2CB 2LW7A 2BOBC 3APQA 3E89A 2EZOA 1JPXA 3E22A 2E75B 4EB6B 3E35A 1YEWA 5KA6A 1KUQA 1ZL8A 3E8FA 2V7QG 3RGBA 3K79A 3AG2C 4PA4A 2JEXA 4KHPO 1CXZB 3P30A 1NT2B 5BXZA 1FFXB 1UFIA 3NXSA 4LF9O 2X6BA 4I4TB 2N05A 2UU9B 4U7NA 4O2BA 2FYUH 3OAAG 4NTYA 2VQFO 3D36C 2UXDO 1SA0B 3RYCA 3S3XA 1WNSA 2DJVA 3AG7A 3LSUA 3ZRXA 4U3FH 4R8CA 3RWRD 2OYQA 1R3KC 2F23A 4X1KA 1XNQO 3JD2A 4U7OA 1AILA 4F6RA 3CC2V 1M9NA 5LXTA 1WPBA 1I94B 4OXSA 1VQPV 2Y69C 3CCLV 2RMKB 5DECA 3SYQA 4F4LA 3CCJV 2DWDC 4QIWF 2AXTZ 4DR7B 1VQOV 3STLC 2Q9LA 4UCOA 3UO2A 4DV1B 4JYAB 2PGGA 3K03A 4WFAV 1BZKA 4JI5B 1US6A 3UT5A 5A9GA 2RQ6A 5B1NA 5LOVB 4HZ3A 3N2KB 4FPPA 2Q5ZA 5J2UB 2VQEO 2JDIG 3BPZA 3JARA 1KKDA 4UCSA 3CX5F 1IX9A 4PA6A 1NKDA 2HVKC 2YSUB 1TUEB 3T1YO 4TUYB 1JFFB 1FJGB 2KQXA 4WF9V 5IYCO 1Q81W 1SESA 5CA0A 1I08A 3SPJA 1XNRB 1WJZA 5JJJB 1WN7A 4TV9A 1OCZC 1K33A 2E76B 1Q6HA 1Y66A 2N74A 1N34B 2P67A 3T1CA 4LFAO 2EIMC 4JI8O 2HHHO 3L71H 5EBLC 4FFBA 4DR3O 4ZOLA 1VQ4V 2AZ0A 2BTOA 1M5IA 3VOUA 2FMLA 3E83A 2K9PA 3ASOC 2PUSA 2EIJC 2WLNA 4I9WA 4YJ2A 2ZE5A 2IU0A 4WCEV 5KLVH 2FL4A 1AJNA 2QKAA 3FYIB 1U97A 3E2EA 4ZBMA 3RYIB 3ZEDA 4DR4B 4Z2WA 3KG2A 5J2TB 1AI7A 1H2NA 4N21A 1PNMA 5LGUA 3HKEB 4JAVA 5H5NA 5KAIZ 2Q0AA 5A2QN 4X1IB 2N04A 3A0HZ 2WLMA 3ZMSA 3CE2A 4X62B 4O2AA 3TK1A 4DW1A 3JSLA 3ZRSA 5BMVA 2OCHA 4LF8O 2ZQMA 5FL7G 1WA8A 3K9AA 2W6JG 5EBWC 2Q67A 2UXNA 4NR1A 4GYCB 3RYHA 2UXBB 2F95B 2GHYA 4TWKA 1FXKB 3RBZA 2EULA 2UUAO 1NTMH 5ITZB 1HNZB 4JI0O 1VQNV 1N0JA 3WG7C 1SQFA 1M90W 1M57B 1S5LZ 3A2FA 3X2QC 2CK3G 3FYEB 2YEVB 2X6CA 3K0GA 4B08A 3K0DA 5B66Z 5IWAB 1ZSPA 2EILB 1M93A 3CMEV 4CC5A 4DR5O 4X20B 4LP8A 2GBOA 3ABMC 1Y6XA 2DYRB 1BE3H 3DXRB 2Q7HA 2P06A 2DOSA 2LW1A 4EEQA 1LUVA 4CS3A 4I0XB 5BZBA 2YUAA 2JIZG 1Q3EA 3M7MX 4RO2A 1BCCH 3T4ZA 4GKKB 2PYJA 1SZXA 3ICXA 4BAYA 5JJNB 1OZ0A 3BAAA 1VQ5V 5B1BC 1WB7A 1GM7A 1BL8A 5B5EZ 1M1KW 2PF4E 4UVCA 3JD3A 4D7SA 3APOA 4DUZB 1VQKV 1OJHA 3EVKA 2ZR2A 1GTOA 3CCEV 1IBLB 2WLLB 1FKAO 1DF4A 5IDJA 1MA1A 4O4LB 1DK1A 1RM1B 2Y0IA 4NKGB 3CXCU 3D3IA 3FAVB 1Y74B 4HYOA 5KA5A 4YHHO 1K34A 4FFKA 4B7EA 3E8HA 3RW0A 1JVMA 2BTQB 3ZMTA 2UXCB 5KHJA 3CSXA 3FB7C 3JAWA 3OTOO 2K1EA 3MHSC 1YVWA 2AGAA 3K58A 4J11A 4DR2O 4UCRA 2EINB 4GZRB 4DV2B 2Q68A 3MAQA 2JS3A 4PI2A 5JWPA 1LR1A 1GKFA 2A9HA 1HWYA 5KMGB 4LF4B 4XDJA 4LFBO 1OV9A 3JYCA 2CH7B 3JAKB 5FNVA 1VF6A 3T1HO 4Q6GA 1ROPA 5K1XA 1FYJA 1R3LC 3F5TA 3A0RA 1KKCA 4X1YA 3J7AU 2UUBB 1EBOA 2PI5A 5LA6A 3RT3C 2F4VB 5JH7B 3BVOA 5C8YA 2DE0X 4PDMA 2ZIOA 2ZE8A 3FB6C 2LP7A 3ETQA 5J9PC 2GSMB 5KHHA 2E3CA 2QWOB 3ZRVA 4HNAB 2E5LB 3P3PA 1Q90D 2ITDC 1OCOC 2V4DA 5H6RA 3OMIB 2EJ7A 4O4IA 2CE4A 2ZD9A 3OEHG 1K73W 5CBGA 2QA4V 1N33B 1DF5A 2XNDG 4ZI7A 1O9HA 2V1DA 2YXHA 3FKSG 5E1AC 1ZAUA 1MMMA 2EBOA 3E8GA 1SQVH 4P30A 5D5PA 1B6QA 4I9QA 4ZHQB 4LH7A 2M7WA 1L0LH 4LF5O 1FPOA 5JJEB 4JPRA 1E1QG 3CRMA 1VF6C 2KB1A 2ADQB 1PNKA 2P7TC 5AG2A 3MD0A 3OTFA 1VF7A 1AI5A 5IYZA 4K0KO 1QCEA 4QGPA 1S72V 2QKSA 3CD6V 4FK5C 2JJ1G 2WSSG 3CCRV 1YTFB 3D8CA 1BHBA 2XT9A 4TV8B 1SERA 3ASNB 1P7BA 1VQ9V 3CRCA 1R1BA 3AG3C 3SJQC 2W0FC 4EB6A 2AW9A 3B4SA 4J80A 3CB2A 1WP7A 2IJIA 5GTIZ 1VMGA 2QR4A 1XOUA 2OTJV 2GUZA 1Y4MA 4I4TA 1NS1A 2R9AA 2F93B 3ZRWA 2JVDA 3F7YC 3OR7C 4MT8A 2YDEA 3AK3A 2QM4A 4B3MO 4FLZA 3IC9A 4JI3B 1N36B 1GM8A 1V54C 4I7ZB 1CEZA 5B1AC 3OT7A 4Z1VA 4OX9O 1XL6A 4PV1B 5CA1A 1XUQA 4JYCA 3H1LH 1BT8A 2CGNA 3ZN0A 4NYKA 5IJ9A 5LOVA 5TISZ 5LL6Y 4C7UA 3N2KA 1MNGA 4I50A 3RFRA 4DK1A 5J2UA 4J41A 5L3BA 4JI5O 1B04A 4JI2B 3UM7A 2YIBD 1TAEA 3AG1C 1Q8IA 3TJTA 4TUYA 1PL4A 1SKVA 3K3WA 4G2KA 2JS5A 3SPCA 4TSFG 5L3DA 3PN1A 5EC2C 4FM1A 1NQTA 4N23A 3LDCA 2B1GA 3K5NA 1FJGO 4J9YB 2ZM6B 4B7KA 3DC6A 3K5LA 3HKCA 2NLJC 4PA3A 1QHTA 2WA4A 3CEIA 4UCVA 4JZ2A 2XAJA 3UQ8A 4JAAA 2ILMA 3JASB 1MG1A 4CH4A 2ZE7A 1N34O 1MSDA 2Q0OC 1HNXB 4LF7B 1Q5OA 2QSAA 2ZR3A 5DM6V 2HR3A 2ZNJA 2WPDG 2B9ZA 4B3RB 1N0NA 2L6LA 4KL1A 1FD9A 1QLNA 5LHHA 1OCCC 3HKEA 5IE9A 4DV6B 4PDVA 3GWKC 1GN2A 4LCUC 4FLTA 1Q43A 3JAMN 1D5NA 4PDLA 2NN4A 1ZLZA 4DR4O 2E74B 2P5OA 1R3JC 2QWNB 5FPRA 3CJHA 1X4TA 1GMGA 3ABKB 4DV3B 4B3SB 2IU3A 1KMIZ 1SQXH 2ZCEA 1BHAA 2HJDA 4DRXB 3TXQA 1FXKA 2W6IG 4X62O 3EXAA 3KZIZ 2ZDIA 1IBKO 5IY5B 1XHXA 1W0KG 2YC0A 2BCCH 3JD1A 4AI8A 4QE7A 2UXBO 5KUMA 2QKCA 4TT3G 1AJPA 4AILC 1HNZO 2EIKC 2QM7A 4TQFA 2QWPB 2WLIA 1XI1A 4NVPA 1YTFD 2CAZC 2WA3A 4JTDB 4UXNA 2CTPA 4NTWA 1VP7A 2CUGA 3IFXA 1JMKC 4GUNA 4PI0A 5L3CA 4FM0A 1KBHA 4QJFB 1SZTA 1F23A 4RQFA 1B06A 2BSKB 3SYAA 4P2ZA 5KX5A 1FFTB 2HFEC 4UV9A 1NVPB 3CRRA 4YY3B 1J5EB 4MVQA 2QWRB 4MVOA 1NH2B 4U3JB 2ZKOA 4GKKO 4KUMA 4TOIA 2CGOA 3JATB 4DXWA 1AB3A 3BEHA 3K5OA 3CYOA 3SJAC 2ZDIC 2JGDB 5EK0A 4JI6O 1QVFU 4MSWC 1UJWB 2PI4A 1M56B 1QLEB 3GWOA 2KG7A 1HNWO 4RUEA 4O4LA 4DUZO 4J9ZB 1NR7A 3SGIA 1GM9A 5LP6B 3FAVA 1Y74A 1IBLO 4P9OA 3CC4V 1JX9A 3STZC 4FM2A 3ZIAG 4JV5B 3OM3B 2NR5A 2UUCB 2R9IA 1BS3A 5GTHZ 1PV0A 5HFLA 4O4JA 1H2KA 2YI9A 4DYLA 3A8TA 3MDSA 4WFGA 3CXHF 3IAYA 2YIBA 2XUMA 3AG2B 1N32B 1D2DA 1EN6A 3SR2C 3OD4A 2C2AA 3CCSV 2UXCO 4JGSA 4UB8Z 4MVSA 3KCXA 4LH6A 4DR1O 4NXMB 1QVGU 2ETNA 3GVMA 4DV2O 2PTMA 3ABUA 5IJ0A 4P9PA 1Y76B 4I55A 5LBQA 5KHGA 4CS2A 2RJZA 1ZWIC 1YCIA 2Y69B 3F7VC 2CTQA 3RVZA 1AP6A 4QPKA 3CCUV 3G6EV 5LMNO 4LF4O 1I5XA 1IBMO 1E1RG 5JH7A 1TVKB 3OUFA 4IIJB 3RYFB 3QVNA 3SDLA 1H38A 5KAFZ 2UUBO 2F4VO 3K04A 2XAFA 4LF9B 3ZMUA 1ZL8B 5DEDA 3VQXA 3K08A 3OFNG 2DQ0A 4DO2A 1XREA 3G4SV 4ABMA 1YHQV 3B40A 5JCOA 4O2BB 5JVDB 2XASA 2Z0AA 1OCZB 4DUYB 4ZHQA 4AQYO 1N33O 4X1KB 1FXHA 4F6RB 2EIMB 5LXTB 5JQGA 4JI4O 1DTOA 4X65B 1NU1H 1V55C 2YXLA 3W7SA 2R9RB 1KP3A 4DR6B 3ASOB 4X64B 4NXNB 4IGGA 2VQEB 1MSWD 2EIJB 1Q82W 1FXVA 3UT5B 1W59A 1K5QA 3G80A 2OWOA 1TUBB 5H9CA 3N2GA 5CN0A 1DGSA 4MTFA 5GONA 3U11A 4R50A 2IBZH 1KP2A 4XDKA 3H01A 1H2MA 3JARB 1GO3F 4FZ0A 3OW2U 2XOKG 4FLYA 2LFRA 4DV7B 3T4DA 5CA0B 4IHJA 1NVPD 4LFAB 1BSMA 3IJ4A 1QR8A 5JCOC 3FD9A 2HHHB 2FB5A 1G1XB 4G27B 1NH2D 4JI7O 4XBFA 1R6KA 4FLXA 4LWSB 2HLDG 3SYCA 1YSCA 5CBHA 5EIBD 3U10A 4FFBB 1IXMA 3WG7B 1PP9H 4K35A 3X2QB 1XMQB 1XHZA 4ZOLB 2ZIMA 4O4HB 2MK3A 1SRYA 2LGQA 3B8NA 4LNUA 2ITCC 1EN4A 1S3JA 1TGOA 4MVRA 4YJ2B 4GX1A 3CWBH 3JD4A 1VQMV 5CB4A 5EZYB 2VWKA 3ABMB 4B3TB 4J42A 5F2VO 1EZJA 1VQLV 1Q86W 4K8ZA 1RP3B 4FZ1A 2YI8A 3SYPA 2DYSC 1GN3A 3LDEA 2Q8VA 3O65A 1OCRC 4K8XA 2QJ1A 3Q4HA 4LBEC
chains in the Genus database with same CATH topology
2EINC 3JD2A 4U7OA 2QE7G 3CC2V 2HVJC 1M9NA 4OXSA 3ZN0A 1VQPV 2EZPA 2Y69C 1S5HC 3CCLV 3BY6A 2BOCC 1NR1A 3EHBB 3I56V 2OTLV 3SYQA 4F4LA 3CCJV 1GK9A 5B1BB 2DWDC 4QIWF 2Z5UA 4YXWG 1G8MA 3QO5A 1VQOV 5L3BA 2WLIB 3STLC 4PA7A 3TETA 3LSQA 3R65A 4L87A 3UM7A 3LDDA 3AG1C 3K03A 4WFAV 2A0LA 3LUTB 5B1NA 3CPWU 3K3WA 4HZ3A 1PKXA 4G2KA 2EJRA 3SPCA 1RPOA 1K4DC 1H2GA 4TSFG 5L3DA 3ZMVA 3ZMZA 4FPPA 5EC2C 1NQTA 4R7CA 2WLKA 4N23A 2JDIG 3LDCA 2AHZA 3LSSA 1YJWV 3SPIA 2B1GA 1KKDA 4J9YB 2HKOA 4PA6A 1NKDA 2JJ2G 2FTKA 2NLJC 2HVKC 1TUEB 3AG4C 2YSUB 3ML0A 4G28B 4PA3A 3W7TA 2QEXV 4WF9V 5IYCO 2IJKA 1Q81W 1SESA 4MS2A 4I5SA 5CA3A 1PNLA 3SPJA 2XAJA 2IJHA 1MG1A 1NBMG 5IYDO 2H8PC 1OCZC 1WLEA 2B5UA 1K33A 4FMTA 4JTAB 2ZXWC 3OR6C 1Y66A 2HG5C 3ETEA 2P67A 2ZR3A 5DM6V 3T1CA 2HR3A 4QNHB 2EIMC 5EBLC 1KECA 2WPDG 4Z1MG 4KP4A 1VQ4V 3VOUA 3E83A 1QLNA 5LHHA 1RPRA 1OCCC 4FJCC 3ASOC 4UVBA 4PDVA 4LCUC 4JTCB 3E8BA 2EIJC 4PDLA 2WLNA 4I9WA 3CP1A 2IU0A 4WCEV 1AJNA 1F51A 1R3JC 3FYIB 3HPLC 5B3SC 3E2EA 4ZBMA 2Q6AA 2OCCC 3MHHC 3PJSK 5LHIA 4RQEA 3OUSA 3KG2A 1GMGA 3ABKB 1AI7A 4X89A 1R6NA 4N21A 3W7WA 2IU3A 1PNMA 5LGUA 3VBBA 5C93A 4JAVA 3ZJZA 1SETA 1BHAA 2X7RB 1FXKA 3ABLC 2W6IG 2ZDIA 5IY5B 2WLMA 3ZMSA 3ASNC 3OMNB 3TK1A 1W0KG 3ZRSA 3ETDA 3JD1A 2ZQMA 4QE7A 5FL7G 5HFMA 3K9AA 2W6JG 2XAQA 5KUMA 4TT3G 5EBWC 1AJPA 2Q67A 1OCOB 2UXNA 2X6AA 2EIKC 1THZA 2QM7A 5LGTA 2GHYA 1DLBA 1FXKB 4TWKA 2WLIA 3RBZA 1I5YA 4GCZA 4ZKIA 4E2LA 1YTFD 5CBFA 1VQNV 4JTDB 4ASUG 4UXNA 3WG7C 4MTOA 1K3EA 1M90W 5L3GA 1M57B 1OHHG 2XAGA 3GB7C 3X2QC 2CK3G 3FYEB 2YEVB 2X6CA 3AEIA 3IFXA 3K0GA 1V55B 4QE9A 1JQ0A 3FB5C 3K0DA 4X88A 3JCZA 5L3CA 1VQ8V 4QJFB 2JK5C 1SZTA 2EILB 4H37A 1F23A 4RQFA 3CMEV 1JJ2U 3SYAA 4P2ZA 1PD3A 1FFTB 2HFEC 2X0LA 3UKMA 4LP8A 1W2BU 2Y48A 3ABMC 5EC1C 1YITV 1AI6A 4UV9A 1NVPB 4GT1A 4KFMA 2DYRB 4MVQA 5DN6G 4MVOA 1NH2B 2OT5A 1YIJV 4CBCA 1YI2V 4KUMA 3ABTA 3IGAC 4DXWA 5BZBA 1YJNV 3E86A 2JIZG 1LNQA 4RO2A 3T4ZA 3BEHA 3CYOA 2ZDIC 4RUFA 5EK0A 4BAYA 1QVFU 4WFFA 1VQ7V 3JD0A 1OZ0A 4MSWC 1UJWB 2PI4A 1M56B 1QLEB 1L1FA 3GWOA 4XDLA 1VQ5V 5B1BC 3AG3B 4RUEA 1GM7A 4J9ZB 1BL8A 1S76D 1M1KW 1NR7A 4UVCA 2B1IA 3JD3A 1GM9A 1BMFG 2WLJA 1CPYA 1QR9A 3HB3B 1VQKV 4P9OA 2ZR2A 3CC4V 1JX9A 1GTOA 3STZC 5GW7A 3CCEV 3WFVA 3ZIAG 2WLLB 3OM3B 5B1OA 1DF4A 2DW4A 4MVMA 3F5WC 3FB8C 2R9IA 5IDJA 2Z3YA 3OEEG 1E79G 4H33A 4R6ZA 5HFLA 4HAMA 1RM1B 4WFGA 3CXCU 3D3IA 1Q7YW 4UUJC 4MTXA 2IH3C 4HYOA 4UVAA 5KA5A 2DQ3A 1K34A 3AG2B 1V54B 2C2AA 3CCSV 3E8HA 5B1AB 3RW0A 4JGSA 1JVMA 5LHGA 3ZMTA 1AROP 1QBZA 1PL0A 1W0JG 4MVSA 3FB7C 2P6JA 2K1EA 2QM8A 3MHSC 2DYSB 1EFRG 1OCRB 3DTUB 3QO8A 1QVGU 4MVUA 3ABUA 4P9PA 4JASA 2EINB 3CCMV 1S0VA 5LBQA 2A79B 2Q68A 1ZWIC 3I55V 1K8AW 1AJQA 2Y69B 3EFFK 2DWEC 3F7VC 2P90A 2NNUA 3RVZA 1FS0G 4X8AA 1JOYA 2YEVA 4WFEA 4QPKA 1GKFA 3G6EV 2A9HA 3OE7G 4WFHA 1HWYA 4PA9A 4BIUA 3CCUV 1YJ9V 1I5XA 2D3OW 4UV8A 1E1RG 3IC7A 4JAUA 4XDJA 5L3FA 4GX5A 3AG1B 1F4NA 3JYCA 2AHYA 4CZZA 4MW8A 3OUFA 1F4MA 3B77A 1CP9A 5IYBO 4RAIA 1ROPA 2H94A 5KUKA 1H38A 1R3LC 3A0RA 3ABKC 2JEUA 1S77D 3ZCCA 1XL4A 2WAMA 1AI4A 3K04A 2XAFA 3ZRWB 5LGNA 3W7UA 3ZMUA 1EBOA 3P32A 2PI5A 1ENVA 2IH1C 3K08A 2WWWA 3OFNG 4PDMA 1VQ6V 2DQ0A 4DO2A 3AG4B 4WFBV 3FB6C 3G4SV 5IY5C 2LP7A 4MTGA 3ZN1A 1R73A 5J9PC 1YHQV 2GSMB 4EKWA 3ZRVA 1K9MW 1K7DA 3ETGA 1R3IC 2XASA 4GX2A 4GX0A 2F43G 1OCZB 2ITDC 1OCOC 2ZXWB 2IJJA 3OMIB 5H6RA 1WPXA 4LC1A 4QPJA 3TCUA 1FXKC 4PDRA 2ZD9A 2XAHA 3OEHG 1FXHA 1K73W 5CBGA 3SYOA 4PELA 2EIMB 2QA4V 1K92A 1DTOA 1H8EG 1DF5A 2XNDG 1M57C 2V1DA 2WLLA 3OMAB 3LNMB 3FKSG 1MABG 5E1AC 5CMUA 1NJIW 1V55C 2EBOA 3W7SA 2R9RB 1KP3A 3E8GA 4P30A 1OCCB 1K5SA 3RVYA 1B6QA 1KC8W 3CMAV 3ASOB 2EILC 1MSWD 2M7WA 1KQSU 2EIJB 2ATKC 4JPRA 1Q82W 1E1QG 1FXVA 2KB1A 1JCHA 5H6QA 1K5QA 1PNKA 4BW5A 5B3SB 2P7TC 3CCQV 5H9CA 2OCCB 5CN0A 4MW3A 4MTFA 3MD0A 2HJFC 1AI5A 2DYRC 4R50A 1KP2A 2WLHA 4XDKA 1QCEA 3D36A 2IW5A 3H01A 1S72V 2QKSA 1MOFA 2LFSA 1GO3F 3CD6V 3OW2U 4FK5C 4JF3A 3W7XA 2JJ1G 5EBMC 3ABLB 2WSSG 3CCRV 1YTFB 1BHBA 2XOKG 2LFRA 1SERA 3ASNB 1KD1W 3T4DA 3B8MA 1M56C 1P7BA 1NVPD 1QLEC 1QR8A 3M99B 1VQ9V 4Q20A 4G27B 3AG3C 3SJQC 1NH2D 2W0FC 3SPHA 3OGCC 4XBFA 1R6KA 4FIPC 1P4RA 2EIKB 1G4YB 2IJIA 3SPGA 2HLDG 3SYCA 1YSCA 5CBHA 3QO7A 2QTOA 2UXXA 5L3EA 2Q69A 1IXMA 3WG7B 2OTJV 1J95A 2BOBC 3E89A 2EZOA 3X2QB 3CC7V 1JPXA 1Y4MA 4JYBA 2MK3A 1SRYA 3E35A 3B8NA 3ZRWA 1COWG 1RM1C 1AR1B 5KA6A 3F7YC 2ITCC 3OR7C 4MT8A 3E8FA 1S3JA 2V7QG 4MVRA 4GX1A 3JD4A 3K79A 1VQMV 1N8RW 1K4CC 3AG2C 4PA4A 2JEXA 3DGEA 3P30A 1GM8A 1V54C 1CEZA 3K06A 3ABMB 3NXSA 5B1AC 2X6BA 1EZJA 1ORQC 3G71V 1VQLV 3T2MA 4U7NA 1Q86W 3OAAG 1K97A 1XL6A 3QNEA 3CCVV 1H8HG 4MVZA 3SYPA 2DYSC 4BIZA 3LDEA 4JYCA 1OCRC 3ZRXA 4R8CA 4LBEC 1R3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B U;  3CPW U;  1YHQ V;  1R73 A;  3CC2 V;  1VQ5 V;  1YIT V;  1QVG U;  1VQN V;  1VQM V;  1VQP V;  1K9M W;  1S72 V;  1N8R W;  3CCL V;  1M1K W;  1M90 W;  3I56 V;  3CXC U;  2OTL V;  3CD6 V;  3OW2 U;  1YIJ V;  3CCM V;  3CCJ V;  1Q7Y W;  1KC8 W;  3CMA V;  4WCE V;  1YI2 V;  3I55 V;  1K8A W;  3CCR V;  5DM6 V;  2OTJ V;  1YJW V;  3G71 V;  1VQL V;  1YJN V;  1QVF U;  1Q86 W;  1KQS U;  1VQK V;  1KD1 W;  1VQ8 V;  1VQO V;  3CC7 V;  1Q82 W;  3CCS V;  3CC4 V;  3CCE V;  3G6E V;  3CCU V;  3CCV V;  1YJ9 V;  2QEX V;  4WF9 V;  3CME V;  2D3O W;  1JJ2 U;  1Q81 W;  3CCQ V;  1VQ9 V;  4WFA V;  1VQ7 V;  1K73 W;  1VQ6 V;  1VQ4 V;  2QA4 V;  1NJI W;  4WFB V;  3G4S V; 
#chains in the Genus database with same CATH topology
 2QE7 G;  4DV5 B;  4JI0 B;  3ZHT A;  4GKJ O;  2OTL V;  1GK9 A;  5B1B B;  4JI2 O;  3TET A;  4LF6 B;  4KXR A;  4L87 A;  3LDD A;  4K3A A;  1QU7 A;  1IDS A;  3LUT B;  4DR5 B;  1P7G A;  3JAL B;  3CPW U;  1RPO A;  1IZ3 A;  3ZMV A;  1JA8 A;  1Q6I A;  3JAS A;  1HP8 A;  2GTA A;  1GH6 A;  1YJW V;  2HKO A;  2KSD A;  2A3Q A;  3AG4 C;  2LQT A;  4G28 B;  2IJK A;  3HKB A;  4NB5 A;  3ZHR A;  4CH3 A;  1GN4 A;  3DC5 A;  1HNX O;  1NBM G;  2B5U A;  4FMT A;  4JTA B;  2ZXW C;  1AR5 A;  3H1I H;  1V9P A;  1KEC A;  5D5Q A;  1T5E A;  4KP4 A;  1PPJ H;  4FLV A;  1ZX3 A;  1RPR A;  2KKW A;  3D3Q A;  4FJC C;  1O9G A;  4UVB A;  5LYJ B;  4JTC B;  4DRX A;  3HPL C;  4EFE A;  5B3S C;  2OCC C;  1FFX A;  3PJS K;  4IYH A;  4YHH B;  3SJB C;  4D7T A;  1P84 F;  1R6N A;  1A32 A;  3L9D A;  3W7W A;  3VBB A;  1IXB A;  1SA0 A;  1SET A;  2JRI A;  3TXS A;  3ZHU A;  2X7R B;  3ABL C;  1VAR A;  5FPO A;  3THO A;  2UU9 O;  1SQP H;  2XTA A;  3ETD A;  4H0L B;  2P4K A;  1OCO B;  2X6A A;  5LGT A;  1THZ A;  2GV9 A;  4DV0 B;  2EX3 A;  4E2L A;  3H1J H;  1I94 O;  2LO1 A;  4ASU G;  4OPA A;  4D6T H;  4X66 B;  1K3E A;  1OHH G;  3NR7 A;  3GB7 C;  4DR7 O;  1HR0 B;  4QE9 A;  3CRQ A;  3FB5 C;  4X88 A;  5BR8 B;  4JYA O;  4DV1 O;  1VQ8 V;  2JK5 C;  2H3O A;  1JJ2 U;  3ZS8 C;  1PD3 A;  5FNV B;  2JGD A;  2X0L A;  3UKM A;  1JFF A;  1W2B U;  4YY3 O;  4ICG A;  1J5E O;  1MZE A;  2AZ2 A;  5EC1 C;  1AI6 A;  4GT1 A;  4KFM A;  4IL6 Z;  1X59 A;  5DN6 G;  2A7W A;  5LA6 B;  1H2L A;  3IGA C;  1YJN V;  5C8Y B;  4E4E A;  4L8J A;  5LP6 A;  1GRJ A;  4RUF A;  1WB8 A;  4WFF A;  1VQ7 V;  3HKD B;  1XNR O;  5EYP B;  3BFR A;  1L1F A;  4XDL A;  3AG3 B;  1EN5 A;  1B3Q A;  2YIA A;  4O4I B;  3BRC A;  1BMF G;  2Q7E A;  1QR9 A;  3BCC H;  3HB3 B;  4JV5 O;  1WAZ A;  2ZNI A;  2UUC O;  3VQY A;  5GW7 A;  3KKY A;  3RYI A;  1YXB A;  3FB8 C;  2ADP A;  5J2T A;  4H33 A;  4OGQ B;  2XHB A;  2O57 A;  4UFZ A;  4HAM A;  4K0K B;  3K57 A;  1N32 O;  4UUJ C;  4MTX A;  1XMO B;  5EIB C;  4X1I A;  1VIB A;  1Y76 A;  4BIO A;  1V54 B;  1SQQ H;  5B1A B;  5IYZ B;  1ARO P;  1YF2 A;  1QBZ A;  1PL0 A;  1UPG A;  3K9S A;  4PJ0 Z;  1WP8 A;  1EFR G;  3C90 A;  3DTU B;  1Y67 A;  4MVU A;  1TVK A;  3L70 H;  5ITZ A;  4JAS A;  4IIJ A;  3CCM V;  1S0V A;  2A79 B;  2CDY A;  4JI1 B;  3RYF A;  1K8A W;  3I55 V;  1AJQ A;  3EFF K;  2NNU A;  3HR0 A;  1IUR A;  4X8A A;  2YEV A;  4WFE A;  2P22 C;  3SJC C;  4WFH A;  4PA9 A;  4BIU A;  2D3O W;  4J7K A;  2GDS A;  3IC7 A;  4JAU A;  1L0N H;  5L3F A;  4DW0 A;  2Q4P A;  3AG1 B;  1F4N A;  4CZZ A;  4MW8 A;  1F4M A;  4X20 A;  4B3M B;  3B77 A;  1CP9 A;  2W0X A;  4RAI A;  2GUZ B;  5IWA O;  1FAF A;  1TA8 A;  3JSN A;  1S77 D;  1EZV H;  3DXR A;  2QTS A;  2WAM A;  5JVD A;  3ZRW B;  5LGN A;  2HEP A;  3W7U A;  2PZS A;  4I0X A;  1ENV A;  2IH1 C;  4OX9 B;  2WWW A;  1VQ6 V;  4WFB V;  3N27 A;  4YJ3 B;  1AP5 A;  4EKW A;  4BWA A;  4X9Q A;  5H2F Z;  4FLW A;  1K9M W;  4DUY O;  1K7D A;  3ETG A;  5CA1 B;  4GX2 A;  3BAB A;  1L8D A;  2Y4U A;  2IJJ A;  1WPX A;  4LC1 A;  4QPJ A;  3TCU A;  1FXK C;  1NTK H;  2XAH A;  3SYO A;  2Y0P A;  1G6U A;  1H8E G;  4X65 O;  5IJ9 B;  1M57 C;  1TUB A;  2VS0 A;  2F66 C;  2WLL A;  4DR6 O;  3LNM B;  1JR9 A;  2LJ2 A;  4I50 B;  5K1P A;  1R6T A;  1RSO B;  4X64 O;  4NXN O;  4IT5 A;  2R70 A;  1OCC B;  1K5S A;  3RVY A;  4CH6 A;  3TGU H;  2EIL C;  1NTZ H;  2YID A;  4UCU A;  1KQS U;  2ATK C;  1NZ6 A;  1JCH A;  4BW5 A;  3UCS C;  3BHP A;  4MW3 A;  4DV4 B;  4J7Z A;  2RNB A;  3H1K H;  2HJF C;  2DYR C;  2BTQ A;  3I5D A;  4LFC B;  2LFS A;  3VQV A;  4WBN B;  4LWS A;  3W7X A;  1Q6U A;  4DV7 O;  3HKC B;  3J81 N;  1KD1 W;  3B8M A;  2OIG A;  4Q20 A;  4O4H A;  3SPH A;  5BY1 A;  5LMU B;  3OGC C;  4YIO A;  4CH5 A;  3FFQ A;  1YDX A;  5KMG A;  2EIK B;  3ZBH A;  1G4Y B;  2VRZ A;  2Y4T A;  2PYL A;  2UXX A;  2CH7 A;  1XMQ O;  3JAK A;  5L3E A;  2Q69 A;  1J95 A;  5EZY A;  3B09 A;  3FX7 A;  3CC7 V;  1QQC A;  4JYB A;  3CRA A;  4CS4 A;  1COW G;  1RM1 C;  1AR1 B;  2YS8 A;  1XBL A;  1N8R W;  1K4C C;  4B3T O;  1HDJ A;  3DGE A;  3CJH B;  3K06 A;  1IBK B;  1D5A A;  4KHP B;  3E22 B;  3QF7 A;  4HNA A;  3G71 V;  1ORQ C;  3T2M A;  1K97 A;  3L74 H;  3QNE A;  3CCV V;  1H8H G;  4MVZ A;  4BIZ A;  2VQF B;  2UXD B;  5CMU A;  4DV5 O;  1NJI W;  2EIN C;  2HVJ C;  2E5L O;  1LUW A;  2EZP A;  1S5H C;  3JAL A;  3BY6 A;  1S5J A;  1XNQ B;  2BOC C;  1NR1 A;  3EHB B;  3I56 V;  4H44 B;  2Q7G A;  2Z5U A;  4YXW G;  1G8M A;  3QO5 A;  1MZF A;  2IM9 A;  4LF6 O;  3RYC B;  1F7Y A;  2WLI B;  4PA7 A;  4J10 A;  3LSQ A;  3R65 A;  3P3N A;  3J80 N;  3H9V A;  2A0L A;  1PKX A;  1P49 A;  2EJR A;  4BW9 A;  1K4D C;  1H2G A;  4W4L A;  3ZMZ A;  3UO3 A;  4R7C A;  2WLK A;  1KB9 F;  2AHZ A;  3LSS A;  3SPI A;  3ZHQ A;  5KX5 B;  2RCV A;  1U96 A;  2OIE A;  2FTK A;  2JJ2 G;  3ML0 A;  3W7T A;  2QEX V;  4TV8 A;  3WB1 A;  4MS2 A;  4JI6 B;  3T1Y B;  4I5S A;  5CA3 A;  1PNL A;  2HP8 A;  2IJH A;  5IYD O;  2H8P C;  3L75 H;  1HNW B;  1WLE A;  3OR6 C;  3JCU Z;  2HG5 C;  5LYJ A;  3ETE A;  3WB2 A;  4QNH B;  2CTR A;  1Z2G A;  3U0Z A;  4Z1M G;  4RWU A;  2KG7 B;  4JI8 B;  4ZIB A;  4TV9 B;  4DR3 B;  3DSQ A;  4FLU A;  3E8B A;  3CP1 A;  1F51 A;  4UB6 Z;  1I7F A;  2Q6A A;  1XDC A;  3QG5 A;  3MHH C;  5LHI A;  4RQE A;  3OUS A;  2FKX A;  2RDC A;  3G67 A;  4X89 A;  1EM1 A;  4O4J B;  3G6B A;  5C93 A;  4J7J A;  3ZJZ A;  2QDO A;  4JI3 O;  3ZHS A;  1N36 O;  1AVM A;  3M8A A;  4DR1 B;  2Q73 A;  3ASN C;  3OMN B;  2ODM A;  3WB0 A;  5HFM A;  2PY5 A;  1XIL A;  2XAQ A;  3KCY A;  4DV0 O;  4LF8 B;  1VEW A;  5LMN B;  1DLB A;  4EFB A;  4ZKI A;  1I5Y A;  4GCZ A;  1AR4 A;  5IJ0 B;  1IBM B;  4X66 O;  5CBF A;  4I55 B;  1Z5V A;  2UUA B;  1HR0 O;  4O2A B;  4MTO A;  4F6E A;  3R66 A;  5L3G A;  2XAG A;  5BMV B;  5BR8 O;  3AEI A;  3RN4 A;  1V55 B;  1WA8 B;  1JQ0 A;  2ZIN A;  3JCZ A;  3C3T A;  3RYH B;  4H37 A;  2M6Y A;  3AK2 A;  2VWJ A;  5KHI A;  3HKD A;  3CS5 A;  2Y48 A;  2LGW A;  3O9O A;  4H13 B;  5EYP A;  1YIT V;  2OT5 A;  1YIJ V;  3ZX6 A;  4CBC A;  1YI2 V;  2ZM6 O;  1SQG A;  3ABT A;  3E86 A;  1LNQ A;  1URF A;  2A06 H;  4HBN A;  3B2E E;  5IT9 N;  1H2S B;  3L73 H;  4AQY B;  3JD0 A;  4PD4 F;  4TQD A;  3H1H H;  5KHK A;  4JI4 B;  4BR6 A;  4FVM A;  1S76 D;  1KYO F;  4LF7 O;  2JGU A;  1SF9 A;  2B1I A;  2WLJ A;  1CPY A;  3QTC A;  3WU2 Z;  4B3R O;  1SS3 A;  5JQG B;  4NTX A;  3WFV A;  1ZUQ A;  5B1O A;  2DW4 A;  4MVM A;  3F5W C;  2Z3Y A;  2R72 A;  3OEE G;  1E79 G;  2BE3 A;  4DV6 O;  4OPH A;  4R6Z A;  3LNN A;  1XMO O;  3L72 H;  2YXY A;  3K59 A;  1Q7Y W;  4W4K A;  2IH3 C;  2DN9 A;  3A0B Z;  4UVA A;  2DQ3 A;  2DMX A;  1SC5 B;  1BQZ A;  3N2G B;  1YZB A;  5GON B;  4DV3 O;  4B3S O;  4A5U B;  2YIC A;  3CHX A;  5LHG A;  1W0J G;  2P6J A;  1PM9 A;  1VF5 B;  3AK1 A;  4JI7 B;  1XQ8 A;  2G38 A;  2QM8 A;  2DYS B;  1OCR B;  3QO8 A;  1M4U A;  4JI1 O;  3OTO B;  3VQW A;  2QWQ B;  1BQ0 A;  4DR2 B;  4IHJ B;  2DWE C;  2P90 A;  1FS0 G;  4IYI A;  1JOY A;  2GTS A;  2QGN A;  4PHZ A;  3OE7 G;  1YJ9 V;  3JAW B;  4UV8 A;  1N4C A;  2RN9 A;  4GX5 A;  2BSK A;  1ZTE A;  4JYY A;  2AHY A;  4JZG A;  4LFB B;  5IYB O;  1KU9 A;  4YJ3 A;  2H94 A;  5KUK A;  3T1H B;  3ABK C;  2JEU A;  3ZCC A;  1XL4 A;  3C3S A;  2F1M A;  1AI4 A;  2CTW A;  4U3J A;  4LNU B;  3P32 A;  3JAT A;  2ARH A;  1NI8 A;  4LR3 A;  3AG4 B;  5IY5 C;  4MTG A;  3ZN1 A;  1R73 A;  5CB4 B;  5FLX N;  1HW7 A;  3OGI B;  4X1Y B;  1IVS A;  1R3I C;  4GKJ B;  1RSO A;  4GX0 A;  2F43 G;  2ZXW B;  3Q4H B;  4PDR A;  4PEL A;  1K92 A;  3OMA B;  1MAB G;  4AHC A;  3ZHV A;  1RFY A;  1KC8 W;  3CMA V;  1JJO A;  4WBN A;  1Z5W A;  5E79 Z;  4DV4 O;  1BGY H;  5H6Q A;  5B3S B;  2P4V A;  4ZI7 B;  3BA9 A;  4LF5 B;  3CCQ V;  2OCC B;  4LFC O;  1XEQ A;  2WLH A;  1I0H A;  3D36 A;  2IW5 A;  3K5M A;  4GLX A;  4CC6 A;  1MOF A;  4JF3 A;  5EBM C;  3ABL B;  4YIP A;  1GAX A;  4UCT A;  3S3W A;  3HKB B;  1QNM A;  2ZE6 A;  1M56 C;  5LMU O;  1QLE C;  3M99 B;  1SQB H;  2MW2 B;  4NXM O;  4FIP C;  2ZT9 B;  1P4R A;  5LP6 C;  4DK0 A;  3SPG A;  3QO7 A;  2QTO A;  2L35 A;  3BA8 A;  1GN6 A;  2D2C B;  2LW7 A;  2BOB C;  3APQ A;  3E89 A;  2EZO A;  1JPX A;  3E22 A;  2E75 B;  4EB6 B;  3E35 A;  1YEW A;  5KA6 A;  1KUQ A;  1ZL8 A;  3E8F A;  2V7Q G;  3RGB A;  3K79 A;  3AG2 C;  4PA4 A;  2JEX A;  4KHP O;  1CXZ B;  3P30 A;  1NT2 B;  5BXZ A;  1FFX B;  1UFI A;  3NXS A;  4LF9 O;  2X6B A;  4I4T B;  2N05 A;  2UU9 B;  4U7N A;  4O2B A;  2FYU H;  3OAA G;  4NTY A;  2VQF O;  3D36 C;  2UXD O;  1SA0 B;  3RYC A;  3S3X A;  1WNS A;  2DJV A;  3AG7 A;  3LSU A;  3ZRX A;  4U3F H;  4R8C A;  3RWR D;  2OYQ A;  1R3K C;  2F23 A;  4X1K A;  1XNQ O;  3JD2 A;  4U7O A;  1AIL A;  4F6R A;  3CC2 V;  1M9N A;  5LXT A;  1WPB A;  1I94 B;  4OXS A;  1VQP V;  2Y69 C;  3CCL V;  2RMK B;  5DEC A;  3SYQ A;  4F4L A;  3CCJ V;  2DWD C;  4QIW F;  2AXT Z;  4DR7 B;  1VQO V;  3STL C;  2Q9L A;  4UCO A;  3UO2 A;  4DV1 B;  4JYA B;  2PGG A;  3K03 A;  4WFA V;  1BZK A;  4JI5 B;  1US6 A;  3UT5 A;  5A9G A;  2RQ6 A;  5B1N A;  5LOV B;  4HZ3 A;  3N2K B;  4FPP A;  2Q5Z A;  5J2U B;  2VQE O;  2JDI G;  3BPZ A;  3JAR A;  1KKD A;  4UCS A;  3CX5 F;  1IX9 A;  4PA6 A;  1NKD A;  2HVK C;  2YSU B;  1TUE B;  3T1Y O;  4TUY B;  1JFF B;  1FJG B;  2KQX A;  4WF9 V;  5IYC O;  1Q81 W;  1SES A;  5CA0 A;  1I08 A;  3SPJ A;  1XNR B;  1WJZ A;  5JJJ B;  1WN7 A;  4TV9 A;  1OCZ C;  1K33 A;  2E76 B;  1Q6H A;  1Y66 A;  2N74 A;  1N34 B;  2P67 A;  3T1C A;  4LFA O;  2EIM C;  4JI8 O;  2HHH O;  3L71 H;  5EBL C;  4FFB A;  4DR3 O;  4ZOL A;  1VQ4 V;  2AZ0 A;  2BTO A;  1M5I A;  3VOU A;  2FML A;  3E83 A;  2K9P A;  3ASO C;  2PUS A;  2EIJ C;  2WLN A;  4I9W A;  4YJ2 A;  2ZE5 A;  2IU0 A;  4WCE V;  5KLV H;  2FL4 A;  1AJN A;  2QKA A;  3FYI B;  1U97 A;  3E2E A;  4ZBM A;  3RYI B;  3ZED A;  4DR4 B;  4Z2W A;  3KG2 A;  5J2T B;  1AI7 A;  1H2N A;  4N21 A;  1PNM A;  5LGU A;  3HKE B;  4JAV A;  5H5N A;  5KAI Z;  2Q0A A;  5A2Q N;  4X1I B;  2N04 A;  3A0H Z;  2WLM A;  3ZMS A;  3CE2 A;  4X62 B;  4O2A A;  3TK1 A;  4DW1 A;  3JSL A;  3ZRS A;  5BMV A;  2OCH A;  4LF8 O;  2ZQM A;  5FL7 G;  1WA8 A;  3K9A A;  2W6J G;  5EBW C;  2Q67 A;  2UXN A;  4NR1 A;  4GYC B;  3RYH A;  2UXB B;  2F95 B;  2GHY A;  4TWK A;  1FXK B;  3RBZ A;  2EUL A;  2UUA O;  1NTM H;  5ITZ B;  1HNZ B;  4JI0 O;  1VQN V;  1N0J A;  3WG7 C;  1SQF A;  1M90 W;  1M57 B;  1S5L Z;  3A2F A;  3X2Q C;  2CK3 G;  3FYE B;  2YEV B;  2X6C A;  3K0G A;  4B08 A;  3K0D A;  5B66 Z;  5IWA B;  1ZSP A;  2EIL B;  1M93 A;  3CME V;  4CC5 A;  4DR5 O;  4X20 B;  4LP8 A;  2GBO A;  3ABM C;  1Y6X A;  2DYR B;  1BE3 H;  3DXR B;  2Q7H A;  2P06 A;  2DOS A;  2LW1 A;  4EEQ A;  1LUV A;  4CS3 A;  4I0X B;  5BZB A;  2YUA A;  2JIZ G;  1Q3E A;  3M7M X;  4RO2 A;  1BCC H;  3T4Z A;  4GKK B;  2PYJ A;  1SZX A;  3ICX A;  4BAY A;  5JJN B;  1OZ0 A;  3BAA A;  1VQ5 V;  5B1B C;  1WB7 A;  1GM7 A;  1BL8 A;  5B5E Z;  1M1K W;  2PF4 E;  4UVC A;  3JD3 A;  4D7S A;  3APO A;  4DUZ B;  1VQK V;  1OJH A;  3EVK A;  2ZR2 A;  1GTO A;  3CCE V;  1IBL B;  2WLL B;  1FKA O;  1DF4 A;  5IDJ A;  1MA1 A;  4O4L B;  1DK1 A;  1RM1 B;  2Y0I A;  4NKG B;  3CXC U;  3D3I A;  3FAV B;  1Y74 B;  4HYO A;  5KA5 A;  4YHH O;  1K34 A;  4FFK A;  4B7E A;  3E8H A;  3RW0 A;  1JVM A;  2BTQ B;  3ZMT A;  2UXC B;  5KHJ A;  3CSX A;  3FB7 C;  3JAW A;  3OTO O;  2K1E A;  3MHS C;  1YVW A;  2AGA A;  3K58 A;  4J11 A;  4DR2 O;  4UCR A;  2EIN B;  4GZR B;  4DV2 B;  2Q68 A;  3MAQ A;  2JS3 A;  4PI2 A;  5JWP A;  1LR1 A;  1GKF A;  2A9H A;  1HWY A;  5KMG B;  4LF4 B;  4XDJ A;  4LFB O;  1OV9 A;  3JYC A;  2CH7 B;  3JAK B;  5FNV A;  1VF6 A;  3T1H O;  4Q6G A;  1ROP A;  5K1X A;  1FYJ A;  1R3L C;  3F5T A;  3A0R A;  1KKC A;  4X1Y A;  3J7A U;  2UUB B;  1EBO A;  2PI5 A;  5LA6 A;  3RT3 C;  2F4V B;  5JH7 B;  3BVO A;  5C8Y A;  2DE0 X;  4PDM A;  2ZIO A;  2ZE8 A;  3FB6 C;  2LP7 A;  3ETQ A;  5J9P C;  2GSM B;  5KHH A;  2E3C A;  2QWO B;  3ZRV A;  4HNA B;  2E5L B;  3P3P A;  1Q90 D;  2ITD C;  1OCO C;  2V4D A;  5H6R A;  3OMI B;  2EJ7 A;  4O4I A;  2CE4 A;  2ZD9 A;  3OEH G;  1K73 W;  5CBG A;  2QA4 V;  1N33 B;  1DF5 A;  2XND G;  4ZI7 A;  1O9H A;  2V1D A;  2YXH A;  3FKS G;  5E1A C;  1ZAU A;  1MMM A;  2EBO A;  3E8G A;  1SQV H;  4P30 A;  5D5P A;  1B6Q A;  4I9Q A;  4ZHQ B;  4LH7 A;  2M7W A;  1L0L H;  4LF5 O;  1FPO A;  5JJE B;  4JPR A;  1E1Q G;  3CRM A;  1VF6 C;  2KB1 A;  2ADQ B;  1PNK A;  2P7T C;  5AG2 A;  3MD0 A;  3OTF A;  1VF7 A;  1AI5 A;  5IYZ A;  4K0K O;  1QCE A;  4QGP A;  1S72 V;  2QKS A;  3CD6 V;  4FK5 C;  2JJ1 G;  2WSS G;  3CCR V;  1YTF B;  3D8C A;  1BHB A;  2XT9 A;  4TV8 B;  1SER A;  3ASN B;  1P7B A;  1VQ9 V;  3CRC A;  1R1B A;  3AG3 C;  3SJQ C;  2W0F C;  4EB6 A;  2AW9 A;  3B4S A;  4J80 A;  3CB2 A;  1WP7 A;  2IJI A;  5GTI Z;  1VMG A;  2QR4 A;  1XOU A;  2OTJ V;  2GUZ A;  1Y4M A;  4I4T A;  1NS1 A;  2R9A A;  2F93 B;  3ZRW A;  2JVD A;  3F7Y C;  3OR7 C;  4MT8 A;  2YDE A;  3AK3 A;  2QM4 A;  4B3M O;  4FLZ A;  3IC9 A;  4JI3 B;  1N36 B;  1GM8 A;  1V54 C;  4I7Z B;  1CEZ A;  5B1A C;  3OT7 A;  4Z1V A;  4OX9 O;  1XL6 A;  4PV1 B;  5CA1 A;  1XUQ A;  4JYC A;  3H1L H;  1BT8 A;  2CGN A;  3ZN0 A;  4NYK A;  5IJ9 A;  5LOV A;  5TIS Z;  5LL6 Y;  4C7U A;  3N2K A;  1MNG A;  4I50 A;  3RFR A;  4DK1 A;  5J2U A;  4J41 A;  5L3B A;  4JI5 O;  1B04 A;  4JI2 B;  3UM7 A;  2YIB D;  1TAE A;  3AG1 C;  1Q8I A;  3TJT A;  4TUY A;  1PL4 A;  1SKV A;  3K3W A;  4G2K A;  2JS5 A;  3SPC A;  4TSF G;  5L3D A;  3PN1 A;  5EC2 C;  4FM1 A;  1NQT A;  4N23 A;  3LDC A;  2B1G A;  3K5N A;  1FJG O;  4J9Y B;  2ZM6 B;  4B7K A;  3DC6 A;  3K5L A;  3HKC A;  2NLJ C;  4PA3 A;  1QHT A;  2WA4 A;  3CEI A;  4UCV A;  4JZ2 A;  2XAJ A;  3UQ8 A;  4JAA A;  2ILM A;  3JAS B;  1MG1 A;  4CH4 A;  2ZE7 A;  1N34 O;  1MSD A;  2Q0O C;  1HNX B;  4LF7 B;  1Q5O A;  2QSA A;  2ZR3 A;  5DM6 V;  2HR3 A;  2ZNJ A;  2WPD G;  2B9Z A;  4B3R B;  1N0N A;  2L6L A;  4KL1 A;  1FD9 A;  1QLN A;  5LHH A;  1OCC C;  3HKE A;  5IE9 A;  4DV6 B;  4PDV A;  3GWK C;  1GN2 A;  4LCU C;  4FLT A;  1Q43 A;  3JAM N;  1D5N A;  4PDL A;  2NN4 A;  1ZLZ A;  4DR4 O;  2E74 B;  2P5O A;  1R3J C;  2QWN B;  5FPR A;  3CJH A;  1X4T A;  1GMG A;  3ABK B;  4DV3 B;  4B3S B;  2IU3 A;  1KMI Z;  1SQX H;  2ZCE A;  1BHA A;  2HJD A;  4DRX B;  3TXQ A;  1FXK A;  2W6I G;  4X62 O;  3EXA A;  3KZI Z;  2ZDI A;  1IBK O;  5IY5 B;  1XHX A;  1W0K G;  2YC0 A;  2BCC H;  3JD1 A;  4AI8 A;  4QE7 A;  2UXB O;  5KUM A;  2QKC A;  4TT3 G;  1AJP A;  4AIL C;  1HNZ O;  2EIK C;  2QM7 A;  4TQF A;  2QWP B;  2WLI A;  1XI1 A;  4NVP A;  1YTF D;  2CAZ C;  2WA3 A;  4JTD B;  4UXN A;  2CTP A;  4NTW A;  1VP7 A;  2CUG A;  3IFX A;  1JMK C;  4GUN A;  4PI0 A;  5L3C A;  4FM0 A;  1KBH A;  4QJF B;  1SZT A;  1F23 A;  4RQF A;  1B06 A;  2BSK B;  3SYA A;  4P2Z A;  5KX5 A;  1FFT B;  2HFE C;  4UV9 A;  1NVP B;  3CRR A;  4YY3 B;  1J5E B;  4MVQ A;  2QWR B;  4MVO A;  1NH2 B;  4U3J B;  2ZKO A;  4GKK O;  4KUM A;  4TOI A;  2CGO A;  3JAT B;  4DXW A;  1AB3 A;  3BEH A;  3K5O A;  3CYO A;  3SJA C;  2ZDI C;  2JGD B;  5EK0 A;  4JI6 O;  1QVF U;  4MSW C;  1UJW B;  2PI4 A;  1M56 B;  1QLE B;  3GWO A;  2KG7 A;  1HNW O;  4RUE A;  4O4L A;  4DUZ O;  4J9Z B;  1NR7 A;  3SGI A;  1GM9 A;  5LP6 B;  3FAV A;  1Y74 A;  1IBL O;  4P9O A;  3CC4 V;  1JX9 A;  3STZ C;  4FM2 A;  3ZIA G;  4JV5 B;  3OM3 B;  2NR5 A;  2UUC B;  2R9I A;  1BS3 A;  5GTH Z;  1PV0 A;  5HFL A;  4O4J A;  1H2K A;  2YI9 A;  4DYL A;  3A8T A;  3MDS A;  4WFG A;  3CXH F;  3IAY A;  2YIB A;  2XUM A;  3AG2 B;  1N32 B;  1D2D A;  1EN6 A;  3SR2 C;  3OD4 A;  2C2A A;  3CCS V;  2UXC O;  4JGS A;  4UB8 Z;  4MVS A;  3KCX A;  4LH6 A;  4DR1 O;  4NXM B;  1QVG U;  2ETN A;  3GVM A;  4DV2 O;  2PTM A;  3ABU A;  5IJ0 A;  4P9P A;  1Y76 B;  4I55 A;  5LBQ A;  5KHG A;  4CS2 A;  2RJZ A;  1ZWI C;  1YCI A;  2Y69 B;  3F7V C;  2CTQ A;  3RVZ A;  1AP6 A;  4QPK A;  3CCU V;  3G6E V;  5LMN O;  4LF4 O;  1I5X A;  1IBM O;  1E1R G;  5JH7 A;  1TVK B;  3OUF A;  4IIJ B;  3RYF B;  3QVN A;  3SDL A;  1H38 A;  5KAF Z;  2UUB O;  2F4V O;  3K04 A;  2XAF A;  4LF9 B;  3ZMU A;  1ZL8 B;  5DED A;  3VQX A;  3K08 A;  3OFN G;  2DQ0 A;  4DO2 A;  1XRE A;  3G4S V;  4ABM A;  1YHQ V;  3B40 A;  5JCO A;  4O2B B;  5JVD B;  2XAS A;  2Z0A A;  1OCZ B;  4DUY B;  4ZHQ A;  4AQY O;  1N33 O;  4X1K B;  1FXH A;  4F6R B;  2EIM B;  5LXT B;  5JQG A;  4JI4 O;  1DTO A;  4X65 B;  1NU1 H;  1V55 C;  2YXL A;  3W7S A;  2R9R B;  1KP3 A;  4DR6 B;  3ASO B;  4X64 B;  4NXN B;  4IGG A;  2VQE B;  1MSW D;  2EIJ B;  1Q82 W;  1FXV A;  3UT5 B;  1W59 A;  1K5Q A;  3G80 A;  2OWO A;  1TUB B;  5H9C A;  3N2G A;  5CN0 A;  1DGS A;  4MTF A;  5GON A;  3U11 A;  4R50 A;  2IBZ H;  1KP2 A;  4XDK A;  3H01 A;  1H2M A;  3JAR B;  1GO3 F;  4FZ0 A;  3OW2 U;  2XOK G;  4FLY A;  2LFR A;  4DV7 B;  3T4D A;  5CA0 B;  4IHJ A;  1NVP D;  4LFA B;  1BSM A;  3IJ4 A;  1QR8 A;  5JCO C;  3FD9 A;  2HHH B;  2FB5 A;  1G1X B;  4G27 B;  1NH2 D;  4JI7 O;  4XBF A;  1R6K A;  4FLX A;  4LWS B;  2HLD G;  3SYC A;  1YSC A;  5CBH A;  5EIB D;  3U10 A;  4FFB B;  1IXM A;  3WG7 B;  1PP9 H;  4K35 A;  3X2Q B;  1XMQ B;  1XHZ A;  4ZOL B;  2ZIM A;  4O4H B;  2MK3 A;  1SRY A;  2LGQ A;  3B8N A;  4LNU A;  2ITC C;  1EN4 A;  1S3J A;  1TGO A;  4MVR A;  4YJ2 B;  4GX1 A;  3CWB H;  3JD4 A;  1VQM V;  5CB4 A;  5EZY B;  2VWK A;  3ABM B;  4B3T B;  4J42 A;  5F2V O;  1EZJ A;  1VQL V;  1Q86 W;  4K8Z A;  1RP3 B;  4FZ1 A;  2YI8 A;  3SYP A;  2DYS C;  1GN3 A;  3LDE A;  2Q8V A;  3O65 A;  1OCR C;  4K8X A;  2QJ1 A;  3Q4H A;  4LBE C; 
#chains in the Genus database with same CATH homology
 2EIN C;  3JD2 A;  4U7O A;  2QE7 G;  3CC2 V;  2HVJ C;  1M9N A;  4OXS A;  3ZN0 A;  1VQP V;  2EZP A;  2Y69 C;  1S5H C;  3CCL V;  3BY6 A;  2BOC C;  1NR1 A;  3EHB B;  3I56 V;  2OTL V;  3SYQ A;  4F4L A;  3CCJ V;  1GK9 A;  5B1B B;  2DWD C;  4QIW F;  2Z5U A;  4YXW G;  1G8M A;  3QO5 A;  1VQO V;  5L3B A;  2WLI B;  3STL C;  4PA7 A;  3TET A;  3LSQ A;  3R65 A;  4L87 A;  3UM7 A;  3LDD A;  3AG1 C;  3K03 A;  4WFA V;  2A0L A;  3LUT B;  5B1N A;  3CPW U;  3K3W A;  4HZ3 A;  1PKX A;  4G2K A;  2EJR A;  3SPC A;  1RPO A;  1K4D C;  1H2G A;  4TSF G;  5L3D A;  3ZMV A;  3ZMZ A;  4FPP A;  5EC2 C;  1NQT A;  4R7C A;  2WLK A;  4N23 A;  2JDI G;  3LDC A;  2AHZ A;  3LSS A;  1YJW V;  3SPI A;  2B1G A;  1KKD A;  4J9Y B;  2HKO A;  4PA6 A;  1NKD A;  2JJ2 G;  2FTK A;  2NLJ C;  2HVK C;  1TUE B;  3AG4 C;  2YSU B;  3ML0 A;  4G28 B;  4PA3 A;  3W7T A;  2QEX V;  4WF9 V;  5IYC O;  2IJK A;  1Q81 W;  1SES A;  4MS2 A;  4I5S A;  5CA3 A;  1PNL A;  3SPJ A;  2XAJ A;  2IJH A;  1MG1 A;  1NBM G;  5IYD O;  2H8P C;  1OCZ C;  1WLE A;  2B5U A;  1K33 A;  4FMT A;  4JTA B;  2ZXW C;  3OR6 C;  1Y66 A;  2HG5 C;  3ETE A;  2P67 A;  2ZR3 A;  5DM6 V;  3T1C A;  2HR3 A;  4QNH B;  2EIM C;  5EBL C;  1KEC A;  2WPD G;  4Z1M G;  4KP4 A;  1VQ4 V;  3VOU A;  3E83 A;  1QLN A;  5LHH A;  1RPR A;  1OCC C;  4FJC C;  3ASO C;  4UVB A;  4PDV A;  4LCU C;  4JTC B;  3E8B A;  2EIJ C;  4PDL A;  2WLN A;  4I9W A;  3CP1 A;  2IU0 A;  4WCE V;  1AJN A;  1F51 A;  1R3J C;  3FYI B;  3HPL C;  5B3S C;  3E2E A;  4ZBM A;  2Q6A A;  2OCC C;  3MHH C;  3PJS K;  5LHI A;  4RQE A;  3OUS A;  3KG2 A;  1GMG A;  3ABK B;  1AI7 A;  4X89 A;  1R6N A;  4N21 A;  3W7W A;  2IU3 A;  1PNM A;  5LGU A;  3VBB A;  5C93 A;  4JAV A;  3ZJZ A;  1SET A;  1BHA A;  2X7R B;  1FXK A;  3ABL C;  2W6I G;  2ZDI A;  5IY5 B;  2WLM A;  3ZMS A;  3ASN C;  3OMN B;  3TK1 A;  1W0K G;  3ZRS A;  3ETD A;  3JD1 A;  2ZQM A;  4QE7 A;  5FL7 G;  5HFM A;  3K9A A;  2W6J G;  2XAQ A;  5KUM A;  4TT3 G;  5EBW C;  1AJP A;  2Q67 A;  1OCO B;  2UXN A;  2X6A A;  2EIK C;  1THZ A;  2QM7 A;  5LGT A;  2GHY A;  1DLB A;  1FXK B;  4TWK A;  2WLI A;  3RBZ A;  1I5Y A;  4GCZ A;  4ZKI A;  4E2L A;  1YTF D;  5CBF A;  1VQN V;  4JTD B;  4ASU G;  4UXN A;  3WG7 C;  4MTO A;  1K3E A;  1M90 W;  5L3G A;  1M57 B;  1OHH G;  2XAG A;  3GB7 C;  3X2Q C;  2CK3 G;  3FYE B;  2YEV B;  2X6C A;  3AEI A;  3IFX A;  3K0G A;  1V55 B;  4QE9 A;  1JQ0 A;  3FB5 C;  3K0D A;  4X88 A;  3JCZ A;  5L3C A;  1VQ8 V;  4QJF B;  2JK5 C;  1SZT A;  2EIL B;  4H37 A;  1F23 A;  4RQF A;  3CME V;  1JJ2 U;  3SYA A;  4P2Z A;  1PD3 A;  1FFT B;  2HFE C;  2X0L A;  3UKM A;  4LP8 A;  1W2B U;  2Y48 A;  3ABM C;  5EC1 C;  1YIT V;  1AI6 A;  4UV9 A;  1NVP B;  4GT1 A;  4KFM A;  2DYR B;  4MVQ A;  5DN6 G;  4MVO A;  1NH2 B;  2OT5 A;  1YIJ V;  4CBC A;  1YI2 V;  4KUM A;  3ABT A;  3IGA C;  4DXW A;  5BZB A;  1YJN V;  3E86 A;  2JIZ G;  1LNQ A;  4RO2 A;  3T4Z A;  3BEH A;  3CYO A;  2ZDI C;  4RUF A;  5EK0 A;  4BAY A;  1QVF U;  4WFF A;  1VQ7 V;  3JD0 A;  1OZ0 A;  4MSW C;  1UJW B;  2PI4 A;  1M56 B;  1QLE B;  1L1F A;  3GWO A;  4XDL A;  1VQ5 V;  5B1B C;  3AG3 B;  4RUE A;  1GM7 A;  4J9Z B;  1BL8 A;  1S76 D;  1M1K W;  1NR7 A;  4UVC A;  2B1I A;  3JD3 A;  1GM9 A;  1BMF G;  2WLJ A;  1CPY A;  1QR9 A;  3HB3 B;  1VQK V;  4P9O A;  2ZR2 A;  3CC4 V;  1JX9 A;  1GTO A;  3STZ C;  5GW7 A;  3CCE V;  3WFV A;  3ZIA G;  2WLL B;  3OM3 B;  5B1O A;  1DF4 A;  2DW4 A;  4MVM A;  3F5W C;  3FB8 C;  2R9I A;  5IDJ A;  2Z3Y A;  3OEE G;  1E79 G;  4H33 A;  4R6Z A;  5HFL A;  4HAM A;  1RM1 B;  4WFG A;  3CXC U;  3D3I A;  1Q7Y W;  4UUJ C;  4MTX A;  2IH3 C;  4HYO A;  4UVA A;  5KA5 A;  2DQ3 A;  1K34 A;  3AG2 B;  1V54 B;  2C2A A;  3CCS V;  3E8H A;  5B1A B;  3RW0 A;  4JGS A;  1JVM A;  5LHG A;  3ZMT A;  1ARO P;  1QBZ A;  1PL0 A;  1W0J G;  4MVS A;  3FB7 C;  2P6J A;  2K1E A;  2QM8 A;  3MHS C;  2DYS B;  1EFR G;  1OCR B;  3DTU B;  3QO8 A;  1QVG U;  4MVU A;  3ABU A;  4P9P A;  4JAS A;  2EIN B;  3CCM V;  1S0V A;  5LBQ A;  2A79 B;  2Q68 A;  1ZWI C;  3I55 V;  1K8A W;  1AJQ A;  2Y69 B;  3EFF K;  2DWE C;  3F7V C;  2P90 A;  2NNU A;  3RVZ A;  1FS0 G;  4X8A A;  1JOY A;  2YEV A;  4WFE A;  4QPK A;  1GKF A;  3G6E V;  2A9H A;  3OE7 G;  4WFH A;  1HWY A;  4PA9 A;  4BIU A;  3CCU V;  1YJ9 V;  1I5X A;  2D3O W;  4UV8 A;  1E1R G;  3IC7 A;  4JAU A;  4XDJ A;  5L3F A;  4GX5 A;  3AG1 B;  1F4N A;  3JYC A;  2AHY A;  4CZZ A;  4MW8 A;  3OUF A;  1F4M A;  3B77 A;  1CP9 A;  5IYB O;  4RAI A;  1ROP A;  2H94 A;  5KUK A;  1H38 A;  1R3L C;  3A0R A;  3ABK C;  2JEU A;  1S77 D;  3ZCC A;  1XL4 A;  2WAM A;  1AI4 A;  3K04 A;  2XAF A;  3ZRW B;  5LGN A;  3W7U A;  3ZMU A;  1EBO A;  3P32 A;  2PI5 A;  1ENV A;  2IH1 C;  3K08 A;  2WWW A;  3OFN G;  4PDM A;  1VQ6 V;  2DQ0 A;  4DO2 A;  3AG4 B;  4WFB V;  3FB6 C;  3G4S V;  5IY5 C;  2LP7 A;  4MTG A;  3ZN1 A;  1R73 A;  5J9P C;  1YHQ V;  2GSM B;  4EKW A;  3ZRV A;  1K9M W;  1K7D A;  3ETG A;  1R3I C;  2XAS A;  4GX2 A;  4GX0 A;  2F43 G;  1OCZ B;  2ITD C;  1OCO C;  2ZXW B;  2IJJ A;  3OMI B;  5H6R A;  1WPX A;  4LC1 A;  4QPJ A;  3TCU A;  1FXK C;  4PDR A;  2ZD9 A;  2XAH A;  3OEH G;  1FXH A;  1K73 W;  5CBG A;  3SYO A;  4PEL A;  2EIM B;  2QA4 V;  1K92 A;  1DTO A;  1H8E G;  1DF5 A;  2XND G;  1M57 C;  2V1D A;  2WLL A;  3OMA B;  3LNM B;  3FKS G;  1MAB G;  5E1A C;  5CMU A;  1NJI W;  1V55 C;  2EBO A;  3W7S A;  2R9R B;  1KP3 A;  3E8G A;  4P30 A;  1OCC B;  1K5S A;  3RVY A;  1B6Q A;  1KC8 W;  3CMA V;  3ASO B;  2EIL C;  1MSW D;  2M7W A;  1KQS U;  2EIJ B;  2ATK C;  4JPR A;  1Q82 W;  1E1Q G;  1FXV A;  2KB1 A;  1JCH A;  5H6Q A;  1K5Q A;  1PNK A;  4BW5 A;  5B3S B;  2P7T C;  3CCQ V;  5H9C A;  2OCC B;  5CN0 A;  4MW3 A;  4MTF A;  3MD0 A;  2HJF C;  1AI5 A;  2DYR C;  4R50 A;  1KP2 A;  2WLH A;  4XDK A;  1QCE A;  3D36 A;  2IW5 A;  3H01 A;  1S72 V;  2QKS A;  1MOF A;  2LFS A;  1GO3 F;  3CD6 V;  3OW2 U;  4FK5 C;  4JF3 A;  3W7X A;  2JJ1 G;  5EBM C;  3ABL B;  2WSS G;  3CCR V;  1YTF B;  1BHB A;  2XOK G;  2LFR A;  1SER A;  3ASN B;  1KD1 W;  3T4D A;  3B8M A;  1M56 C;  1P7B A;  1NVP D;  1QLE C;  1QR8 A;  3M99 B;  1VQ9 V;  4Q20 A;  4G27 B;  3AG3 C;  3SJQ C;  1NH2 D;  2W0F C;  3SPH A;  3OGC C;  4XBF A;  1R6K A;  4FIP C;  1P4R A;  2EIK B;  1G4Y B;  2IJI A;  3SPG A;  2HLD G;  3SYC A;  1YSC A;  5CBH A;  3QO7 A;  2QTO A;  2UXX A;  5L3E A;  2Q69 A;  1IXM A;  3WG7 B;  2OTJ V;  1J95 A;  2BOB C;  3E89 A;  2EZO A;  3X2Q B;  3CC7 V;  1JPX A;  1Y4M A;  4JYB A;  2MK3 A;  1SRY A;  3E35 A;  3B8N A;  3ZRW A;  1COW G;  1RM1 C;  1AR1 B;  5KA6 A;  3F7Y C;  2ITC C;  3OR7 C;  4MT8 A;  3E8F A;  1S3J A;  2V7Q G;  4MVR A;  4GX1 A;  3JD4 A;  3K79 A;  1VQM V;  1N8R W;  1K4C C;  3AG2 C;  4PA4 A;  2JEX A;  3DGE A;  3P30 A;  1GM8 A;  1V54 C;  1CEZ A;  3K06 A;  3ABM B;  3NXS A;  5B1A C;  2X6B A;  1EZJ A;  1ORQ C;  3G71 V;  1VQL V;  3T2M A;  4U7N A;  1Q86 W;  3OAA G;  1K97 A;  1XL6 A;  3QNE A;  3CCV V;  1H8H G;  4MVZ A;  3SYP A;  2DYS C;  4BIZ A;  3LDE A;  4JYC A;  1OCR C;  3ZRX A;  4R8C A;  4LBE C;  1R3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...