3CC4V

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cc4V00
2QA4V 1QVGU 1QVFU 3G4SV 3CCJV 1M90W 1VQPV 3G71V 3CC4V 1VQ4V 3CCEV 3CMAV 1VQ7V 1YHQV 3OW2U 3CC2V 1N8RW 3I56V 3CCUV 1VQMV 1Q7YW 1Q86W 1YIJV 4WF9V 1VQ8V 1K8AW 1YJNV 2D3OW 5DM6V 3CD6V 3G6EV 1S72V 3CCMV 1M1KW 1VQOV 1YJWV 1W2BU 1KQSU 4WFBV 1KC8W 1Q82W 2OTJV 2OTLV 3CMEV 1Q81W 1R73A 4WCEV 3CCQV 1NJIW 3CXCU 3CCRV 3CPWU 1VQLV 1K73W 1K9MW 3CCLV 3CCVV 3CC7V 1VQ9V 4WFAV 1YJ9V 1KD1W 1JJ2U 1VQ5V 3I55V 2QEXV 1VQ6V 1YI2V 1YITV 1VQKV 1VQNV 3CCSV
chains in the Genus database with same CATH superfamily
4DV7B 1XEQA 3ETQA 1AR1B 4JI8B 2F66C 1JX9A 2FB5A 1Q6HA 3E8BA 4XDJA 4FPPA 1PL4A 1GH6A 1EBOA 3IFXA 4PDRA 3K57A 4WFFA 2W6IG 1KP3A 4FLVA 3CCQV 1Q5OA 2JJ2G 1F7YA 2A7WA 3G6BA 4FM2A 4TV8B 1RPOA 2YS8A 2B1IA 3CYOA 4DR4B 1VF6A 1FXHA 3ABMB 2V7QG 4YIPA 4DW0A 5B66Z 1CPYA 3JSNA 1TUEB 3RVYA 4IIJA 4LF4B 4CC6A 3W7XA 3GB7C 4D7TA 3AEIA 1AVMA 2H3OA 5JVDB 3RYIB 5H6RA 4DV2O 1J5EO 2NN4A 2UXDO 1F4MA 3KCXA 4GKKO 2RNBA 2ZINA 2OTJV 3Q4HB 1KB9F 3VQWA 1QNMA 1K9MW 5LGNA 2F93B 4W4LA 1Y76A 1GKFA 2BOBC 2Z3YA 3K03A 4KUMA 2PF4E 3FB8C 2ZE5A 2GBOA 5LOVA 3W7WA 1N0NA 3NXSA 1BHBA 3CEIA 4I55B 3K9SA 1FXKA 5JCOC 1M57C 3JALA 1YDXA 3C3SA 4LF6O 3FAVA 5LXTA 4DV0B 1YTFB 4UXNA 3FYIB 3L70H 2OYQA 1LNQA 1QLNA 3P3NA 1QVFU 4O4JA 2F1MA 2P6JA 1H2KA 1M90W 4LH7A 4GX2A 5LA6A 3IC7A 5IT9N 1PNMA 2WLLA 5JQGA 1K33A 4WF9V 3JD1A 1KUQA 2X6CA 1N32B 2AHYA 2XAQA 1NVPD 1LR1A 3STZC 2ETNA 3K5NA 2Y4TA 4D6TH 4K35A 1MZEA 3UO3A 4JZ2A 4KHPB 1HNZB 2VQEO 1K92A 2KB1A 1I5XA 4PA3A 4FLWA 4FM0A 1AB3A 1JA8A 2PI4A 4EEQA 3B8MA 2RJZA 2IM9A 3W7TA 1VIBA 4B3MO 1SKVA 4HNAB 3ZN1A 3QNEA 4BR6A 3RYCA 4I50B 4NXMB 3E89A 1JJ2U 3P32A 3LNNA 4H0LB 4DV1O 1SQPH 5LYJB 1E79G 2KG7B 1W59A 3K79A 1M57B 3JCZA 3CXHF 2WLMA 4BW9A 1XNQO 4JI6B 3T1CA 3OUFA 4P30A 2F4VO 4O2AA 3ZRWB 2M6YA 2JVDA 3ETEA 1YZBA 3FB7C 4JASA 4LF5B 2KQXA 5BY1A 1VQKV 2GV9A 4JPRA 1OCZC 1URFA 4UCUA 4YXWG 4K8XA 2CUGA 4DV3B 1YSCA 4E2LA 3NR7A 5IJ9A 3M7MX 1R1BA 2XTAA 4TV8A 1ZL8B 3G6EV 3THOA 3BEHA 1FD9A 4HZ3A 3IJ4A 5ITZB 5IY5C 1UJWB 4TV9A 4DUZO 2Y0IA 1IDSA 1N36O 3O9OA 1I08A 2YUAA 3OT7A 4YY3O 3K58A 4LFBO 1K97A 3HKDA 1FAFA 2QTOA 3LDEA 1V55C 3GWKC 2PUSA 1X4TA 2EIJC 4OX9O 5GONA 1TAEA 2X0LA 3M99B 3SPGA 5EC2C 1ZAUA 3CPWU 5CA1A 3CCLV 2ADPA 3SYOA 4JAAA 4RAIA 3OGIB 2CK3G 2C2AA 3ZBHA 3LSUA 1PM9A 4JI7O 4MVMA 4MT8A 1PNKA 4Z1VA 1VQ7V 2R9AA 2LJ2A 3MD0A 3RYFB 4TT3G 3ZS8C 4DR7O 2CTWA 4TSFG 5B1BC 1R3IC 4JYCA 1O9HA 1OCZB 1HDJA 1VARA 1VQ6V 4DV2B 1GRJA 1J5EB 2RDCA 4YJ3B 2UXDB 3FB6C 3R66A 4X66B 4YHHB 2HG5C 3BPZA 4X1YB 2Z0AA 3QG5A 5LP6C 1K4DC 1K3EA 3CMAV 1W0JG 2GUZA 2Q7EA 5E1AC 5IY5B 4K0KO 2NNUA 2Q7GA 4KP4A 2UUBB 1S3JA 4G28B 1SA0B 1PD3A 4B3TO 3CSXA 2WA4A 1G6UA 1LUVA 4DUYB 3N27A 4IGGA 2Q73A 1V55B 2ZQMA 2PZSA 2EIJB 1PP9H 1S5JA 3MHSC 4DV5O 1D2DA 4GYCB 2KSDA 1L1FA 5CBFA 4LF6B 4G27B 1EN6A 3B09A 5EBWC 5KHGA 4HBNA 2CTRA 5KAIZ 1HNXB 5IE9A 2DE0X 4LF7B 5IJ0B 4HYOA 4DR1O 4QPJA 4HNAA 1MA1A 4IHJB 4UUJC 4PJ0Z 5C93A 5B1BB 4I50A 2ATKC 1MZFA 3JD2A 3B8NA 3UT5B 2HJFC 3LSQA 3ML0A 2Q0AA 3ZMSA 3RGBA 3TJTA 3HPLC 2IJKA 2UUAO 4MVSA 2HHHO 4CH6A 4K8ZA 1TUBB 4QE7A 3T4DA 5LP6B 4WFAV 1VF7A 2EILC 3HKBB 3ZRWA 3CCJV 2YXHA 2QWPB 2IU0A 2AXTZ 2GTSA 1HWYA 5KUMA 4DV1B 1SQBH 4U7NA 5BMVB 3L75H 1JR9A 2EZOA 2ZNJA 3DSQA 1R6NA 3AG7A 2F43G 5E79Z 1VQNV 4BAYA 3TXQA 3LUTB 1XNQB 5ITZA 4KL1A 4B3SO 3B77A 2Q68A 3OTFA 1K34A 3JASA 5EZYB 5L3GA 1MOFA 3PN1A 5CN0A 4QE9A 1EN5A 4UVAA 3TXSA 3UQ8A 2BSKB 4DV4O 4DR4O 2OTLV 2D2CB 3CX5F 5H2FZ 4JAVA 1WP8A 3L74H 3JAMN 1NT2B 2ZDIC 2JGDB 1AI4A 2QKSA 1MABG 2DYRC 2R9RB 3CRCA 1OJHA 4EFEA 3ZIAG 4ZHQA 4B7EA 3AK1A 4MW3A 1RM1C 1GO3F 5F2VO 2WPDG 4DUZB 2ZE7A 2A06H 5DEDA 5LHIA 2CGNA 1N36B 2EILB 3ZMZA 4JI0O 2OIGA 5CA0B 4YY3B 4LFBB 3QVNA 3RYFA 1VQLV 4D7SA 2ODMA 4XDKA 4FFBA 2IJHA 2ARHA 4LFAO 2E3CA 5EYPA 1ROPA 4ZOLB 1WB7A 4JAUA 4I9WA 4F6EA 3CJHA 1EZJA 4JI7B 4X1IA 1SERA 5KUKA 1VF5B 1SA0A 4DR7B 2W6JG 4OPHA 5EK0A 3ZHVA 2F23A 3K0GA 2N05A 1J95A 1WLEA 3JAKA 4TWKA 2LFRA 1VQ8V 2A79B 3JCUZ 2Q7HA 3JSLA 4LC1A 1QBZA 4QGPA 2DYRB 2XNDG 2YXYA 4CBCA 2IW5A 3CCVV 3MAQA 2K9PA 1RM1B 2Z5UA 4X20B 3RW0A 4K0KB 5FLXN 2RMKB 4AQYB 1K5SA 5KLVH 2HLDG 2Q8VA 3SPCA 3OR6C 4P2ZA 4KHPO 4F6RA 1HNZO 3E22A 4O4HA 2DN9A 1OV9A 2CTPA 2ZE6A 1BZKA 2OT5A 3T2MA 4DV5B 3RN4A 4PD4F 3ZHUA 3T1HO 4U3JA 2DQ0A 1YI2V 2EX3A 3HKCB 2LQTA 1AJPA 4GX5A 1CXZB 3HKEA 4X65O 2JEUA 3HKBA 3ABLC 2CDYA 2IBZH 4DR1B 4J41A 1Y66A 2PI5A 3KKYA 4RUEA 3L73H 4O4LB 3X2QC 2BTQB 4DR3O 2B1GA 3APOA 1Q90D 1YXBA 1AP6A 1Z2GA 5LHHA 3QO7A 2UUAB 2HHHB 1SQFA 2XT9A 2WLIB 4JTAB 3CCEV 1XI1A 3DC5A 5B5EZ 3CCUV 1E1RG 4MTOA 2FMLA 2F95B 5AG2A 2YDEA 4FJCC 2QR4A 4DV3O 2PY5A 1HW7A 4LNUA 4MVQA 5J9PC 1JFFA 4TUYB 4Q20A 1XMOO 2X7RB 3P30A 1M4UA 1Q86W 1F51A 1FXVA 1NBMG 3AG2C 4X62B 1IBKB 5BZBA 1S5LZ 2A3QA 1VP7A 3EHBB 2QM4A 3D8CA 1SETA 4B3SB 4LCUC 4PV1B 1VMGA 3DGEA 3U11A 3ABLB 2ZR3A 1NQTA 1FFTB 2CH7B 2GHYA 3OMIB 4DV4B 2YIDA 3WB1A 4LWSA 1RP3B 3X2QB 4HAMA 3E8GA 3J7AU 1OHHG 3UO2A 4ZOLA 1B06A 3BHPA 3KZIZ 4NVPA 3SYAA 2RN9A 3RFRA 2Y0PA 1QLEC 4TQFA 5B3SC 4JI0B 3JAWB 4RQFA 3JATA 2Y69C 3SJQC 1G8MA 4UCOA 4X1KA 3J81N 2WWWA 4X66O 1WB8A 4YHHO 1GK9A 4J80A 4LFAB 3A2FA 4X8AA 2ZDIA 3IGAC 5L3CA 2QEXV 4H37A 5TISZ 2UUBO 2XASA 3MDSA 2XAJA 1KYOF 3AG2B 4NKGB 5CB4A 1M56C 3CHXA 1WAZA 5KHHA 2B5UA 2ZIOA 1X59A 4DUYO 2PTMA 4LR3A 5FNVB 1V54C 4JTCB 1DF5A 4GT1A 3N2KB 4WFBV 3ZMUA 4OGQB 2YEVB 3DXRA 3N2GA 1MSWD 1YITV 4ZBMA 5J2UA 3ZMTA 1HNXO 3VBBA 4WFHA 4LF7O 1WNSA 2QTSA 4J7KA 3T4ZA 2GSMB 1VQMV 2FL4A 3FFQA 1QLEB 4UCSA 4EB6A 5IYCO 1XDCA 5B3SB 3DTUB 4FLTA 3D3IA 3C90A 3ABKC 2Y69B 5LGUA 4E4EA 2DOSA 4FM1A 2DWEC 3OMAB 4QNHB 5HFLA 1AI6A 1QR9A 1P4RA 4I7ZB 1YHQV 1BGYH 4O4IA 2A9HA 3STLC 3T1HB 1XMQB 1ZTEA 4GUNA 1COWG 2WLIA 4EKWA 1M56B 2E74B 2JEXA 4A5UB 2ZXWC 1NS1A 5IYZB 4X65B 1AILA 5H9CA 2IH3C 1V54B 4PI2A 2VS0A 1TVKB 4DR3B 1XNRO 3QO5A 3ZHQA 2QM8A 2IH1C 3SPHA 5GW7A 4I0XB 1YJNV 2YIBD 4JI4O 3BA8A 4MVOA 2ADQB 3K5MA 1R3JC 3CC7V 1WN7A 5KA6A 1BCCH 4J9YB 4UV9A 2PYLA 1H8EG 2ZM6O 1NH2B 5EBMC 4B08A 1H2LA 1CP9A 1N8RW 4B3RO 2P4VA 1Y6XA 3K06A 4JI3O 2CH7A 3ABKB 1P84F 3AK3A 2QWOB 4CH3A 1HR0B 1XMOB 4H44B 2OCCC 1IXMA 2H94A 5CA3A 3SYQA 1GM9A 1UFIA 1KP2A 2DW4A 1L0LH 3K3WA 4LH6A 2BCCH 4OXSA 3FYEB 4W4KA 3VOUA 1NTMH 4DK0A 2W0FC 5FPOA 4DV6O 1L8DA 1AROP 5JH7B 4QJFB 2D3OW 2ZXWB 5JVDA 3ABUA 3RYIA 4H33A 1Q81W 1NJIW 3G80A 3R65A 1PNLA 3BA9A 2EIKC 1VQ5V 1H38A 4JV5O 2QGNA 3T1YO 5JJJB 1QU7A 4Q6GA 3Q4HA 1RSOB 2Y4UA 3FKSG 5IWAO 2QM7A 2YI9A 4FLXA 1R3KC 3L9DA 1H2MA 2CAZC 5A2QN 1YVWA 2XOKG 1WA8B 2DMXA 2AZ2A 2YI8A 4I55A 2AGAA 4MVRA 3AK2A 1JVMA 4GLXA 3BAAA 3G4SV 4DR6B 5EIBC 1PL0A 5DECA 1FYJA 1XOUA 1AJNA 2JIZG 4BW5A 5KMGB 2HEPA 1T5EA 2Q4PA 4U7OA 2OCCB 2EBOA 4CS3A 1UPGA 2PGGA 2CE4A 2QWNB 1DK1A 3OEHG 1KQSU 2WLHA 1JPXA 4ZIBA 4AQYO 4DXWA 1SC5B 1YF2A 4I4TB 4ZI7B 2O57A 1AR4A 3ABTA 4B7KA 3APQA 2QKCA 4AHCA 2VWJA 1FPOA 2AHZA 3OUSA 4FLUA 4MS2A 3OFNG 3I56V 1NZ6A 2EIKB 1NU1H 5B1OA 4BWAA 5KHKA 3CCMV 2JRIA 4GX0A 4YJ2B 1BMFG 2BE3A 2V1DA 5HFMA 1R73A 3OD4A 4J10A 3TGUH 3IAYA 4EFBA 3VQVA 4ICGA 3A0BZ 4X88A 4UCVA 5J2TB 3TETA 1EM1A 5LYJA 2KG7A 4K3AA 4OPAA 1BSMA 3H1JH 4JYBA 4DO2A 1XL6A 4BIOA 1TVKA 5JCOA 3F5TA 1SQVH 2EULA 4X64O 5C8YB 4N23A 2AZ0A 3H01A 1NTKH 4DRXB 3EXAA 3CRQA 3CWBH 1PV0A 1ENVA 3FB5C 4L8JA 2JGUA 2WLJA 2PYJA 3WG7C 4FMTA 4BIZA 4J7ZA 3BY6A 1XNRB 1ZL8A 4X62O 1IBKO 1ZUQA 3K08A 2DYSC 1VF6C 4JI4B 1Q6IA 3OTOO 2BOCC 1IZ3A 1WJZA 1G1XB 1K8AW 4PELA 1W2BU 4CH4A 2ZM6B 4LFCO 2UXBB 1AP5A 3K0DA 4CH5A 2L6LA 3ZHRA 4LBEC 4O2BB 4B3RB 1N33O 5CMUA 4LF8O 4JI3B 5KHIA 4J42A 1S0VA 4ABMA 2YXLA 4NTYA 3CRAA 1YCIA 4GZRB 4JZGA 2ZIMA 1AR5A 1IX9A 2EJRA 1KKCA 3MHHC 1W0KG 4NTWA 5L3DA 1I0HA 3H9VA 4ZKIA 5GTHZ 4DR5O 4DV6B 3DC6A 3B2EE 4WFEA 4PDVA 4UFZA 5KHJA 1WA8A 5L3FA 5JJEB 2R72A 3WG7B 2R9IA 4JTDB 4YJ3A 3A0RA 5BXZA 1FXKC 4JV5B 3EFFK 4X1YA 3T1YB 4FK5C 1RPRA 2DYSB 4QIWF 5IWAB 1EZVH 1IBLB 2RCVA 2YIBA 1V9PA 1Q43A 4CS2A 4DYLA 4JI5O 1BS3A 4IIJB 3E8FA 3OM3B 1MSDA 3L72H 3OE7G 1VEWA 3AG3C 1KC8W 3H1KH 3WU2Z 1BHAA 3B4SA 4FFKA 3AG1C 3CXCU 3BABA 3CD6V 4NR1A 3SJCC 1S5HC 1GN4A 5EBLC 4YJ2A 2A0LA 1S76D 2EJ7A 3U10A 1QQCA 3SYPA 2JS3A 5IJ0A 4GKJB 5FL7G 2K1EA 4UVCA 4I9QA 1QCEA 4IHJA 2Q0OC 1Y76B 5J2TA 5EC1C 5CBHA 3RBZA 1QHTA 3UT5A 1N34O 4UCTA 4WCEV 5LOVB 2XUMA 4XDLA 1XL4A 4R50A 3SYCA 1XMQO 2DQ3A 2EIMC 2NR5A 4FVMA 2LW1A 1FXKB 1TUBA 3BCCH 1I7FA 3JALB 1EFRG 3HB3B 5LP6A 2ZR2A 5BR8O 5LMUB 4JYYA 1K7DA 3FAVB 5LXTB 1XUQA 2NLJC 4JI1O 3WB0A 3F7VC 1HNWO 3CCRV 1NKDA 1NR7A 3ASOC 3JD4A 5LA6B 5JWPA 3BFRA 5JQGB 5H6QA 5KX5B 5KA5A 5BMVA 2IU3A 3G67A 3AG3B 3AG1B 1SZXA 2W0XA 4X64B 1HP8A 2HKOA 4AI8A 4L87A 3JYCA 4I5SA 4IT5A 5EZYA 3CRRA 1YTFD 2BSKA 2HVJC 2XAGA 1HR0O 3O65A 2HP8A 2JGDA 1YIJV 3CB2A 2EIMB 4FLYA 1OCRB 2E5LO 3OTOB 3ZHTA 1SF9A 3SJAC 1H2NA 5CA0A 1E1QG 2QKAA 4O2AB 1MG1A 3JARB 1PKXA 4LFCB 1BQZA 2ZD9A 3ASOB 4IYIA 4UB8Z 1N4CA 1N33B 3SPIA 3E2EA 1WP7A 4LF8B 3K5OA 1JCHA 5IJ9B 1KD1W 2P67A 1SRYA 3CP1A 2ZT9B 3KCYA 2E75B 4JI2O 4CC5A 5K1XA 3SPJA 5LMNO 4TQDA 3VQYA 2OWOA 1A32A 4TV9B 4LP8A 2MW2B 1ZSPA 2P06A 3D3QA 4DR5B 4DR6O 2VRZA 3ZRXA 3HKDB 5A9GA 4JGSA 4UVBA 5GONB 3W7UA 1OCOC 1NH2D 1R3LC 1PPJH 1KECA 4NTXA 3G71V 1M5IA 5CA1B 4X20A 1EN4A 2V4DA 3ZN0A 1S77D 1LUWA 1Z5WA 2RQ6A 3ETGA 2JJ1G 4XBFA 4JI5B 2DJVA 1H2GA 3SGIA 1KMIZ 4FZ1A 1FS0G 5LL6Y 2UXCO 1U96A 1NTZH 2X6AA 4P9PA 1FKAO 3HKCA 1BQ0A 2XAFA 1SQGA 1R6KA 3EVKA 1D5AA 4DW1A 1U97A 5L3BA 1GAXA 5DN6G 3IC9A 1BL8A 2GUZB 3RT3C 4Z1MG 3W7SA 3F7YC 4IL6Z 3U0ZA 2LFSA 4UV8A 4O4LA 2BTQA 3QTCA 1N34B 4X89A 2WAMA 2IJIA 5KX5A 1K5QA 5D5PA 3JD0A 2UU9B 4CZZA 4MTGA 1OCOB 5BR8B 1I94B 1Q8IA 3K59A 4JI1B 2WSSG 4G2KA 1HNWB 2ZKOA 3QO8A 4PI0A 3BVOA 3ZX6A 3S3WA 4TUYA 2BTOA 3P3PA 4R8CA 1H8HG 2UUCO 3I55V 2N04A 4FZ0A 2QDOA 3OR7C 3OGCC 1IBMO 4JYAO 2UXBO 1GM7A 5K1PA 3OAAG 1Q7YW 3CE2A 5CBGA 4GX1A 4DR2O 1M1KW 3L71H 1VQOV 2XHBA 3JARA 1SQXH 2LGWA 2R70A 3E83A 1N0JA 1P49A 3A8TA 1M93A 2QJ1A 3K04A 1OCCC 5IYDO 1Y74B 1AI5A 5L3EA 1KKDA 3S3XA 2IJJA 5KAFZ 3CC2V 3WB2A 3LNMB 2E5LB 3UKMA 2YC0A 4NB5A 3JAWA 5EIBD 1MNGA 2P4KA 1BT8A 2ZNIA 2HR3A 3JASB 2VQFO 1QVGU 4TOIA 1THZA 1TGOA 4LF9O 2JDIG 4F4LA 2MK3A 3ZJZA 4RO2A 1RFYA 1IBLO 1SQQH 2JK5C 1M9NA 3UM7A 2B9ZA 2P7TC 3RWRD 1NI8A 4YIOA 1NVPB 3CMEV 4ZHQB 4JI2B 2UXNA 5GTIZ 5LMNB 1B3QA 5FNVA 3UCSC 3CCSV 3B40A 2M7WA 3TK1A 3N2KA 2AW9A 2YEVA 4NXNO 4N21A 4PDMA 4AILC 1DLBA 2ITCC 4FFBB 1IXBA 1OCCB 2Q5ZA 1Q82W 4GKJO 2QWQB 5EYPB 4RQEA 3ZRSA 1FJGO 4GKKB 2JS5A 4H13B 1VQPV 3CJHB 4R6ZA 3ZHSA 1I5YA 4DK1A 3ICXA 1K4CC 4X1IB 1XQ8A 2VWKA 1QR8A 4QPKA 2Q6AA 2H8PC 2UXCB 5LMUO 4J9ZB 1XREA 4PA4A 1XBLA 3JAKB 3K9AA 2OCHA 3K5LA 3LSSA 2FTKA 3PJSK 2EINC 1G4YB 1VQ4V 5IYZA 2GDSA 3E35A 1US6A 4FIPC 4WBNB 3F5WC 3LDDA 1Z5VA 1IURA 1GN2A 3AG4C 1DF4A 2XAHA 1VQ9V 3D36C 4X9QA 4I0XA 3E86A 1ZWIC 3SDLA 4F6RB 3E22B 4O4HB 4MW8A 1IVSA 3I5DA 1ZX3A 3GWOA 4U3JB 1CEZA 4C7UA 4PDLA 4U3FH 2VQEB 2Q69A 1KBHA 4BIUA 5IDJA 2P22C 1YJ9V 3HKEB 1OZ0A 2ITDC 2Y48A 2N74A 4B3MB 3RYHB 1Y74A 2QE7G 3LDCA 4DV7O 2UUCB 3ZEDA 2G38A 4JI8O 5B1AC 1FFXB 4NYKA 3WFVA 1IBMB 4JYAB 4GCZA 2EINB 4RUFA 2WA3A 4JF3A 1Q3EA 5JH7A 4DR2B 2F4VB 4IYHA 1R6TA 3CC4V 5D5QA 3AG4B 1GN6A 3OEEG 4LNUB 2DWDC 1S72V 1JFFB 3ZMVA 1RSOA 3E8HA 1P7BA 4RWUA 1L0NH 3CRMA 1Q6UA 1GMGA 3RVZA 3C3TA 5LHGA 1GTOA 1TA8A 4KXRA 1O9GA 3OW2U 2OIEA 4LF4O 4PHZA 4PA6A 2L35A 2VQFB 3FX7A 4MSWC 4LF9B 3ZCCA 1Y4MA 5KMGA 3CS5A 4LWSB 1XHXA 2QA4V 1WPBA 2HFEC 4OX9B 3GVMA 3SJBC 1ZLZA 1XHZA 4I4TA 5B1AB 2QSAA 2LW7A 3TCUA 4ZI7A 2P90A 5LGTA 2WLKA 2QWRB 2CTQA 4NXNB 2X6BA 3JATB 3KG2A 4X1KB 4P9OA 1B6QA 3QF7A 1Y67A 1JOYA 1WPXA 2HVKC 4MVZA 4DV0O 3M8AA 3ETDA 2Q9LA 1SESA 3H1HH 1AI7A 4MTFA 5DM6V 1JQ0A 1FJGB 3HR0A 5CB4B 1SS3A 4Z2WA 1AJQA 3BRCA 5LBQA 4WBNA 1DGSA 4KFMA 1MMMA 4J11A 2P5OA 4MVUA 3ASNC 1JJOA 1N32O 1NR1A 2UU9O 3H1LH 4B3TB 1OCRC 2CGOA 4MTXA 4UB6Z 4J7JA 5JJNB 1D5NA 1I94O 3H1IH 3DXRB 3N2GB 4PA9A 2EZPA 1GN3A 5C8YA 2ZCEA 2Q67A 1B04A 5J2UB 4DRXA 4O4JB 4FLZA 3OMNB 5H5NA 2YSUB 2GTAA 2FYUH 1H2SB 4CS4A 2WLLB 1F23A 2KKWA 4NXMO 1SZTA 2UXXA 3A0HZ 2LP7A 3FD9A 4EB6B 4R7CA 2WLNA 2FKXA 1JMKC 4UCRA 3RYHA 1YJWV 1KU9A 3VQXA 3ABMC 5FPRA 3ZRVA 2E76B 2ILMA 1BE3H 1K73W 3JD3A 5B1NA 4O4IB 4JI6O 4PA7A 2YIAA 1FFXA 1GM8A 2HJDA 2YICA 4LF5O 1P7GA 1XILA 3J80N 3RYCB 1DTOA 2ZE8A 4O2BA 1F4NA 4WFGA 2LGQA 5IYBO 3ASNB 3SR2C 2LO1A 1YEWA 4ASUG 1ORQC 3D36A
chains in the Genus database with same CATH topology
2IJHA 3ABTA 1AR1B 2WSSG 4G2KA 1JX9A 2AHZA 3OUSA 3E8BA 1ROPA 3QO8A 4FPPA 4MS2A 4XDJA 3OFNG 3I56V 4JAUA 1EBOA 2EIKB 5B1OA 3IFXA 4PDRA 4I9WA 4WFFA 3CCMV 4GX0A 2W6IG 4R8CA 1BMFG 2V1DA 1H8HG 1EZJA 1KP3A 5HFMA 1R73A 3CCQV 2JJ2G 1SERA 3I55V 5KUKA 3OR7C 3OGCC 2W6JG 1RPOA 4X88A 2B1IA 3CYOA 5EK0A 3TETA 1FXHA 3ABMB 3K0GA 1J95A 1GM7A 1WLEA 2V7QG 4TWKA 3OAAG 1Q7YW 2LFRA 1CPYA 1VQ8V 2A79B 5CBGA 4GX1A 1M1KW 1VQOV 1TUEB 4LC1A 4JYBA 1QBZA 4DO2A 2DYRB 1XL6A 2XNDG 3RVYA 4CBCA 2IW5A 3E83A 3CCVV 1RM1B 3K04A 2Z5UA 1OCCC 5IYDO 3RW0A 3W7XA 3GB7C 4N23A 3AEIA 1AI5A 5L3EA 3H01A 1KKDA 2IJJA 5H6RA 1K5SA 2HLDG 3CC2V 3SPCA 1F4MA 3LNMB 1ENVA 3FB5C 3OR6C 4P2ZA 3UKMA 2OTJV 2WLJA 3WG7C 4FMTA 2OT5A 3T2MA 1K9MW 5LGNA 4BIZA 2DQ0A 2HR3A 1YI2V 3BY6A 1QVGU 1GKFA 2BOBC 2Z3YA 3K03A 1THZA 4KUMA 3K08A 3FB8C 2DYSC 2JDIG 4F4LA 2MK3A 3ZJZA 1AJPA 4RO2A 3W7WA 4GX5A 3NXSA 2BOCC 2JEUA 2JK5C 1BHBA 1M9NA 3UM7A 3ABLC 1K8AW 2P7TC 4PELA 1Y66A 1W2BU 2PI5A 1FXKA 1M57C 1NVPB 4RUEA 3CMEV 3X2QC 3K0DA 2UXNA 2B1GA 1YTFB 4UXNA 3FYIB 4LBEC 1LNQA 3CCSV 1QLNA 5CMUA 1QVFU 2M7WA 3TK1A 5LHHA 3QO7A 2P6JA 1M90W 1S0VA 2YEVA 2WLIB 4GX2A 4JTAB 3CCEV 3IC7A 1PNMA 4N21A 2WLLA 4PDMA 3CCUV 1DLBA 1K33A 4WF9V 3JD1A 1E1RG 2EJRA 4MTOA 2ITCC 3MHHC 1W0KG 1OCCB 5L3DA 2X6CA 4FJCC 1Q82W 2AHYA 2XAQA 1NVPD 3STZC 4ZKIA 4MVQA 5J9PC 4RQEA 3ZRSA 4WFEA 4PDVA 4Q20A 1K92A 2KB1A 1VQPV 1I5XA 4PA3A 5L3FA 2X7RB 4R6ZA 1I5YA 3P30A 2PI4A 3B8MA 3WG7B 2R9IA 4JTDB 1K4CC 1Q86W 1F51A 1FXVA 3AG2C 1NBMG 3A0RA 3W7TA 1FXKC 1QR8A 3EFFK 5BZBA 3ZN1A 4QPKA 3QNEA 2Q6AA 2H8PC 3EHBB 4FK5C 1SETA 3E89A 1RPRA 2DYSB 4LCUC 4J9ZB 4QIWF 1JJ2U 3P32A 4PA4A 3K9AA 3LSSA 1E79G 3DGEA 3ABLB 2FTKA 2ZR3A 3PJSK 1NQTA 1FFTB 2GHYA 2EINC 1G4YB 3OMIB 1VQ4V 3K79A 1M57B 3JCZA 3X2QB 2WLMA 3E35A 4HAMA 3E8FA 4FIPC 3E8GA 3OM3B 3F5WC 3LDDA 3T1CA 3OE7G 1OHHG 3OUFA 4P30A 3AG3C 1KC8W 3ZRWB 3AG4C 1DF4A 3ETEA 2XAHA 1BHAA 3FB7C 3AG1C 4JASA 3CXCU 1VQ9V 3CD6V 3SYAA 1VQKV 1S5HC 5EBLC 3E86A 2A0LA 4JPRA 1S76D 1QLEC 1OCZC 1ZWIC 4YXWG 3SYPA 5B3SC 4MW8A 4RQFA 1YSCA 4E2LA 2Y69C 5FL7G 3SJQC 1G8MA 2K1EA 4UVCA 3GWOA 1QCEA 1CEZA 2WWWA 3G6EV 5EC1C 4PDLA 1GK9A 5CBHA 3RBZA 3BEHA 2Q69A 4HZ3A 4WCEV 4BIUA 5IY5C 1UJWB 4X8AA 5IDJA 2ZDIA 4XDLA 3IGAC 1XL4A 5L3CA 1YJ9V 2QEXV 4R50A 3SYCA 2DQ3A 2ITDC 1OZ0A 4H37A 2XASA 2Y48A 2EIMC 2XAJA 3AG2B 1K97A 1M56C 1FXKB 2B5UA 1EFRG 3HB3B 2ZR2A 2QTOA 3LDEA 1V55C 1K7DA 2QE7G 3LDCA 2EIJC 2NLJC 1V54C 4JTCB 1DF5A 4GT1A 2X0LA 3M99B 3SPGA 4WFBV 5B1AC 3ZMUA 3F7VC 3WFVA 2YEVB 5EC2C 3CCRV 3CPWU 1NKDA 1NR7A 3ASOC 3JD4A 4GCZA 2EINB 3CCLV 1MSWD 4RUFA 4JF3A 1YITV 3SYOA 4RAIA 4ZBMA 5H6QA 2CK3G 3ZMTA 5KA5A 2C2AA 2IU3A 4MVMA 4MT8A 3AG3B 3CC4V 3VBBA 4WFHA 1PNKA 1VQ7V 3AG4B 3OEEG 3AG1B 3MD0A 3T4ZA 4TT3G 2GSMB 1VQMV 4TSFG 2DWDC 1R3IC 5B1BC 4JYCA 1S72V 3ZMVA 2HKOA 3E8HA 1P7BA 1QLEB 1OCZB 4L87A 5IYCO 5B3SB 3DTUB 3JYCA 4I5SA 1VQ6V 3D3IA 1YTFD 3ABKC 2Y69B 5LGUA 1GMGA 3FB6C 2DWEC 3OMAB 3RVZA 2HG5C 2HVJC 2XAGA 4QNHB 5HFLA 5LHGA 1AI6A 1GTOA 1K4DC 1K3EA 1P4RA 1QR9A 1W0JG 3CMAV 3OW2U 1YHQV 5E1AC 5IY5B 2A9HA 2NNUA 3STLC 1YIJV 4PA6A 4KP4A 1S3JA 1COWG 4G28B 2WLIA 1PD3A 4EKWA 4MSWC 2EIMB 3ZCCA 1M56B 1OCRB 1Y4MA 2JEXA 2ZXWC 1V55B 2ZQMA 2QA4V 5H9CA 2HFEC 2EIJB 3MHSC 1E1QG 2IH3C 1V54B 1MG1A 5B1AB 1PKXA 3TCUA 2P90A 3QO5A 1L1FA 5CBFA 2ZD9A 4G27B 2QM8A 2IH1C 3ASOB 5LGTA 3SPHA 5GW7A 1YJNV 5EBWC 2WLKA 3SPIA 3E2EA 4MVOA 1R3JC 2X6BA 1JCHA 3CC7V 1KD1W 3KG2A 2P67A 4HYOA 5KA6A 4J9YB 4QPJA 4P9OA 1SRYA 4UV9A 3CP1A 4UUJC 1B6QA 5C93A 1H8EG 1NH2B 5B1BB 1JOYA 2ATKC 5EBMC 3JD2A 3SPJA 3B8NA 1WPXA 2HVKC 4MVZA 2HJFC 3LSQA 1CP9A 4LP8A 3ETDA 3ML0A 3ZMSA 1N8RW 1SESA 1AI7A 3HPLC 3K06A 4MTFA 2IJKA 5DM6V 1JQ0A 4MVSA 3ABKB 3ZRXA 1AJQA 4JGSA 4QE7A 3T4DA 5LBQA 2OCCC 4WFAV 1IXMA 4KFMA 2EILC 2H94A 4MVUA 5CA3A 3ASNC 3SYQA 1GM9A 3ZRWA 1KP2A 3CCJV 2DW4A 1NR1A 3K3WA 4UVBA 1OCOC 3W7UA 1NH2D 1R3LC 4OXSA 1KECA 1OCRC 3FYEB 2IU0A 4MTXA 3VOUA 3G71V 2W0FC 1HWYA 5KUMA 4PA9A 2EZPA 1AROP 4QJFB 3ZN0A 2D3OW 2ZXWB 2Q67A 4U7NA 1S77D 3ABUA 4H33A 3ETGA 3OMNB 1Q81W 2JJ1G 1NJIW 3R65A 1PNLA 2EZOA 2EIKC 2YSUB 4XBFA 1R6NA 1VQ5V 2F43G 1H38A 1H2GA 1VQNV 2WLLB 4BAYA 1FS0G 3LUTB 1F23A 1SZTA 3B77A 3FKSG 2Q68A 2UXXA 1K34A 2LP7A 2QM7A 4R7CA 2WLNA 5L3GA 2X6AA 1MOFA 1R3KC 4P9PA 5CN0A 4QE9A 4UVAA 1YJWV 3ABMC 2XAFA 3ZRVA 4JAVA 2XOKG 2OTLV 1R6KA 1K73W 2ZDIC 5L3BA 5DN6G 4MVRA 3JD3A 1JVMA 1BL8A 5B1NA 4PA7A 1AI4A 2QKSA 1MABG 2R9RB 2DYRC 1GM8A 4Z1MG 3W7SA 3F7YC 3G4SV 1PL0A 2LFSA 4UV8A 3ZIAG 4MW3A 1RM1C 1GO3F 1DTOA 2WAMA 4X89A 1AJNA 1F4NA 2JIZG 2WPDG 4WFGA 4BW5A 2IJIA 4U7OA 2OCCB 5IYBO 2EBOA 1K5QA 5LHIA 2EILB 3ZMZA 3JD0A 3OEHG 1KQSU 3ASNB 2WLHA 4CZZA 1JPXA 4MTGA 1OCOB 4ASUG 4DXWA 1VQLV 1ORQC 3D36A 4XDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 V;  1QVG U;  1QVF U;  3G4S V;  3CCJ V;  1M90 W;  1VQP V;  3G71 V;  3CC4 V;  1VQ4 V;  3CCE V;  3CMA V;  1VQ7 V;  1YHQ V;  3OW2 U;  3CC2 V;  1N8R W;  3I56 V;  3CCU V;  1VQM V;  1Q7Y W;  1Q86 W;  1YIJ V;  4WF9 V;  1VQ8 V;  1K8A W;  1YJN V;  2D3O W;  5DM6 V;  3CD6 V;  3G6E V;  1S72 V;  3CCM V;  1M1K W;  1VQO V;  1YJW V;  1W2B U;  1KQS U;  4WFB V;  1KC8 W;  1Q82 W;  2OTJ V;  2OTL V;  3CME V;  1Q81 W;  1R73 A;  4WCE V;  3CCQ V;  1NJI W;  3CXC U;  3CCR V;  3CPW U;  1VQL V;  1K73 W;  1K9M W;  3CCL V;  3CCV V;  3CC7 V;  1VQ9 V;  4WFA V;  1YJ9 V;  1KD1 W;  1JJ2 U;  1VQ5 V;  3I55 V;  2QEX V;  1VQ6 V;  1YI2 V;  1YIT V;  1VQK V;  1VQN V;  3CCS V; 
#chains in the Genus database with same CATH topology
 4DV7 B;  1XEQ A;  3ETQ A;  1AR1 B;  4JI8 B;  2F66 C;  1JX9 A;  2FB5 A;  1Q6H A;  3E8B A;  4XDJ A;  4FPP A;  1PL4 A;  1GH6 A;  1EBO A;  3IFX A;  4PDR A;  3K57 A;  4WFF A;  2W6I G;  1KP3 A;  4FLV A;  3CCQ V;  1Q5O A;  2JJ2 G;  1F7Y A;  2A7W A;  3G6B A;  4FM2 A;  4TV8 B;  1RPO A;  2YS8 A;  2B1I A;  3CYO A;  4DR4 B;  1VF6 A;  1FXH A;  3ABM B;  2V7Q G;  4YIP A;  4DW0 A;  5B66 Z;  1CPY A;  3JSN A;  1TUE B;  3RVY A;  4IIJ A;  4LF4 B;  4CC6 A;  3W7X A;  3GB7 C;  4D7T A;  3AEI A;  1AVM A;  2H3O A;  5JVD B;  3RYI B;  5H6R A;  4DV2 O;  1J5E O;  2NN4 A;  2UXD O;  1F4M A;  3KCX A;  4GKK O;  2RNB A;  2ZIN A;  2OTJ V;  3Q4H B;  1KB9 F;  3VQW A;  1QNM A;  1K9M W;  5LGN A;  2F93 B;  4W4L A;  1Y76 A;  1GKF A;  2BOB C;  2Z3Y A;  3K03 A;  4KUM A;  2PF4 E;  3FB8 C;  2ZE5 A;  2GBO A;  5LOV A;  3W7W A;  1N0N A;  3NXS A;  1BHB A;  3CEI A;  4I55 B;  3K9S A;  1FXK A;  5JCO C;  1M57 C;  3JAL A;  1YDX A;  3C3S A;  4LF6 O;  3FAV A;  5LXT A;  4DV0 B;  1YTF B;  4UXN A;  3FYI B;  3L70 H;  2OYQ A;  1LNQ A;  1QLN A;  3P3N A;  1QVF U;  4O4J A;  2F1M A;  2P6J A;  1H2K A;  1M90 W;  4LH7 A;  4GX2 A;  5LA6 A;  3IC7 A;  5IT9 N;  1PNM A;  2WLL A;  5JQG A;  1K33 A;  4WF9 V;  3JD1 A;  1KUQ A;  2X6C A;  1N32 B;  2AHY A;  2XAQ A;  1NVP D;  1LR1 A;  3STZ C;  2ETN A;  3K5N A;  2Y4T A;  4D6T H;  4K35 A;  1MZE A;  3UO3 A;  4JZ2 A;  4KHP B;  1HNZ B;  2VQE O;  1K92 A;  2KB1 A;  1I5X A;  4PA3 A;  4FLW A;  4FM0 A;  1AB3 A;  1JA8 A;  2PI4 A;  4EEQ A;  3B8M A;  2RJZ A;  2IM9 A;  3W7T A;  1VIB A;  4B3M O;  1SKV A;  4HNA B;  3ZN1 A;  3QNE A;  4BR6 A;  3RYC A;  4I50 B;  4NXM B;  3E89 A;  1JJ2 U;  3P32 A;  3LNN A;  4H0L B;  4DV1 O;  1SQP H;  5LYJ B;  1E79 G;  2KG7 B;  1W59 A;  3K79 A;  1M57 B;  3JCZ A;  3CXH F;  2WLM A;  4BW9 A;  1XNQ O;  4JI6 B;  3T1C A;  3OUF A;  4P30 A;  2F4V O;  4O2A A;  3ZRW B;  2M6Y A;  2JVD A;  3ETE A;  1YZB A;  3FB7 C;  4JAS A;  4LF5 B;  2KQX A;  5BY1 A;  1VQK V;  2GV9 A;  4JPR A;  1OCZ C;  1URF A;  4UCU A;  4YXW G;  4K8X A;  2CUG A;  4DV3 B;  1YSC A;  4E2L A;  3NR7 A;  5IJ9 A;  3M7M X;  1R1B A;  2XTA A;  4TV8 A;  1ZL8 B;  3G6E V;  3THO A;  3BEH A;  1FD9 A;  4HZ3 A;  3IJ4 A;  5ITZ B;  5IY5 C;  1UJW B;  4TV9 A;  4DUZ O;  2Y0I A;  1IDS A;  1N36 O;  3O9O A;  1I08 A;  2YUA A;  3OT7 A;  4YY3 O;  3K58 A;  4LFB O;  1K97 A;  3HKD A;  1FAF A;  2QTO A;  3LDE A;  1V55 C;  3GWK C;  2PUS A;  1X4T A;  2EIJ C;  4OX9 O;  5GON A;  1TAE A;  2X0L A;  3M99 B;  3SPG A;  5EC2 C;  1ZAU A;  3CPW U;  5CA1 A;  3CCL V;  2ADP A;  3SYO A;  4JAA A;  4RAI A;  3OGI B;  2CK3 G;  2C2A A;  3ZBH A;  3LSU A;  1PM9 A;  4JI7 O;  4MVM A;  4MT8 A;  1PNK A;  4Z1V A;  1VQ7 V;  2R9A A;  2LJ2 A;  3MD0 A;  3RYF B;  4TT3 G;  3ZS8 C;  4DR7 O;  2CTW A;  4TSF G;  5B1B C;  1R3I C;  4JYC A;  1O9H A;  1OCZ B;  1HDJ A;  1VAR A;  1VQ6 V;  4DV2 B;  1GRJ A;  1J5E B;  2RDC A;  4YJ3 B;  2UXD B;  3FB6 C;  3R66 A;  4X66 B;  4YHH B;  2HG5 C;  3BPZ A;  4X1Y B;  2Z0A A;  3QG5 A;  5LP6 C;  1K4D C;  1K3E A;  3CMA V;  1W0J G;  2GUZ A;  2Q7E A;  5E1A C;  5IY5 B;  4K0K O;  2NNU A;  2Q7G A;  4KP4 A;  2UUB B;  1S3J A;  4G28 B;  1SA0 B;  1PD3 A;  4B3T O;  3CSX A;  2WA4 A;  1G6U A;  1LUV A;  4DUY B;  3N27 A;  4IGG A;  2Q73 A;  1V55 B;  2ZQM A;  2PZS A;  2EIJ B;  1PP9 H;  1S5J A;  3MHS C;  4DV5 O;  1D2D A;  4GYC B;  2KSD A;  1L1F A;  5CBF A;  4LF6 B;  4G27 B;  1EN6 A;  3B09 A;  5EBW C;  5KHG A;  4HBN A;  2CTR A;  5KAI Z;  1HNX B;  5IE9 A;  2DE0 X;  4LF7 B;  5IJ0 B;  4HYO A;  4DR1 O;  4QPJ A;  4HNA A;  1MA1 A;  4IHJ B;  4UUJ C;  4PJ0 Z;  5C93 A;  5B1B B;  4I50 A;  2ATK C;  1MZF A;  3JD2 A;  3B8N A;  3UT5 B;  2HJF C;  3LSQ A;  3ML0 A;  2Q0A A;  3ZMS A;  3RGB A;  3TJT A;  3HPL C;  2IJK A;  2UUA O;  4MVS A;  2HHH O;  4CH6 A;  4K8Z A;  1TUB B;  4QE7 A;  3T4D A;  5LP6 B;  4WFA V;  1VF7 A;  2EIL C;  3HKB B;  3ZRW A;  3CCJ V;  2YXH A;  2QWP B;  2IU0 A;  2AXT Z;  2GTS A;  1HWY A;  5KUM A;  4DV1 B;  1SQB H;  4U7N A;  5BMV B;  3L75 H;  1JR9 A;  2EZO A;  2ZNJ A;  3DSQ A;  1R6N A;  3AG7 A;  2F43 G;  5E79 Z;  1VQN V;  4BAY A;  3TXQ A;  3LUT B;  1XNQ B;  5ITZ A;  4KL1 A;  4B3S O;  3B77 A;  2Q68 A;  3OTF A;  1K34 A;  3JAS A;  5EZY B;  5L3G A;  1MOF A;  3PN1 A;  5CN0 A;  4QE9 A;  1EN5 A;  4UVA A;  3TXS A;  3UQ8 A;  2BSK B;  4DV4 O;  4DR4 O;  2OTL V;  2D2C B;  3CX5 F;  5H2F Z;  4JAV A;  1WP8 A;  3L74 H;  3JAM N;  1NT2 B;  2ZDI C;  2JGD B;  1AI4 A;  2QKS A;  1MAB G;  2DYR C;  2R9R B;  3CRC A;  1OJH A;  4EFE A;  3ZIA G;  4ZHQ A;  4B7E A;  3AK1 A;  4MW3 A;  1RM1 C;  1GO3 F;  5F2V O;  2WPD G;  4DUZ B;  2ZE7 A;  2A06 H;  5DED A;  5LHI A;  2CGN A;  1N36 B;  2EIL B;  3ZMZ A;  4JI0 O;  2OIG A;  5CA0 B;  4YY3 B;  4LFB B;  3QVN A;  3RYF A;  1VQL V;  4D7S A;  2ODM A;  4XDK A;  4FFB A;  2IJH A;  2ARH A;  4LFA O;  2E3C A;  5EYP A;  1ROP A;  4ZOL B;  1WB7 A;  4JAU A;  4I9W A;  4F6E A;  3CJH A;  1EZJ A;  4JI7 B;  4X1I A;  1SER A;  5KUK A;  1VF5 B;  1SA0 A;  4DR7 B;  2W6J G;  4OPH A;  5EK0 A;  3ZHV A;  2F23 A;  3K0G A;  2N05 A;  1J95 A;  1WLE A;  3JAK A;  4TWK A;  2LFR A;  1VQ8 V;  2A79 B;  3JCU Z;  2Q7H A;  3JSL A;  4LC1 A;  1QBZ A;  4QGP A;  2DYR B;  2XND G;  2YXY A;  4CBC A;  2IW5 A;  3CCV V;  3MAQ A;  2K9P A;  1RM1 B;  2Z5U A;  4X20 B;  3RW0 A;  4K0K B;  5FLX N;  2RMK B;  4AQY B;  1K5S A;  5KLV H;  2HLD G;  2Q8V A;  3SPC A;  3OR6 C;  4P2Z A;  4KHP O;  4F6R A;  1HNZ O;  3E22 A;  4O4H A;  2DN9 A;  1OV9 A;  2CTP A;  2ZE6 A;  1BZK A;  2OT5 A;  3T2M A;  4DV5 B;  3RN4 A;  4PD4 F;  3ZHU A;  3T1H O;  4U3J A;  2DQ0 A;  1YI2 V;  2EX3 A;  3HKC B;  2LQT A;  1AJP A;  4GX5 A;  1CXZ B;  3HKE A;  4X65 O;  2JEU A;  3HKB A;  3ABL C;  2CDY A;  2IBZ H;  4DR1 B;  4J41 A;  1Y66 A;  2PI5 A;  3KKY A;  4RUE A;  3L73 H;  4O4L B;  3X2Q C;  2BTQ B;  4DR3 O;  2B1G A;  3APO A;  1Q90 D;  1YXB A;  1AP6 A;  1Z2G A;  5LHH A;  3QO7 A;  2UUA B;  2HHH B;  1SQF A;  2XT9 A;  2WLI B;  4JTA B;  3CCE V;  1XI1 A;  3DC5 A;  5B5E Z;  3CCU V;  1E1R G;  4MTO A;  2FML A;  2F95 B;  5AG2 A;  2YDE A;  4FJC C;  2QR4 A;  4DV3 O;  2PY5 A;  1HW7 A;  4LNU A;  4MVQ A;  5J9P C;  1JFF A;  4TUY B;  4Q20 A;  1XMO O;  2X7R B;  3P30 A;  1M4U A;  1Q86 W;  1F51 A;  1FXV A;  1NBM G;  3AG2 C;  4X62 B;  1IBK B;  5BZB A;  1S5L Z;  2A3Q A;  1VP7 A;  3EHB B;  2QM4 A;  3D8C A;  1SET A;  4B3S B;  4LCU C;  4PV1 B;  1VMG A;  3DGE A;  3U11 A;  3ABL B;  2ZR3 A;  1NQT A;  1FFT B;  2CH7 B;  2GHY A;  3OMI B;  4DV4 B;  2YID A;  3WB1 A;  4LWS A;  1RP3 B;  3X2Q B;  4HAM A;  3E8G A;  3J7A U;  1OHH G;  3UO2 A;  4ZOL A;  1B06 A;  3BHP A;  3KZI Z;  4NVP A;  3SYA A;  2RN9 A;  3RFR A;  2Y0P A;  1QLE C;  4TQF A;  5B3S C;  4JI0 B;  3JAW B;  4RQF A;  3JAT A;  2Y69 C;  3SJQ C;  1G8M A;  4UCO A;  4X1K A;  3J81 N;  2WWW A;  4X66 O;  1WB8 A;  4YHH O;  1GK9 A;  4J80 A;  4LFA B;  3A2F A;  4X8A A;  2ZDI A;  3IGA C;  5L3C A;  2QEX V;  4H37 A;  5TIS Z;  2UUB O;  2XAS A;  3MDS A;  2XAJ A;  1KYO F;  3AG2 B;  4NKG B;  5CB4 A;  1M56 C;  3CHX A;  1WAZ A;  5KHH A;  2B5U A;  2ZIO A;  1X59 A;  4DUY O;  2PTM A;  4LR3 A;  5FNV B;  1V54 C;  4JTC B;  1DF5 A;  4GT1 A;  3N2K B;  4WFB V;  3ZMU A;  4OGQ B;  2YEV B;  3DXR A;  3N2G A;  1MSW D;  1YIT V;  4ZBM A;  5J2U A;  3ZMT A;  1HNX O;  3VBB A;  4WFH A;  4LF7 O;  1WNS A;  2QTS A;  4J7K A;  3T4Z A;  2GSM B;  1VQM V;  2FL4 A;  3FFQ A;  1QLE B;  4UCS A;  4EB6 A;  5IYC O;  1XDC A;  5B3S B;  3DTU B;  4FLT A;  3D3I A;  3C90 A;  3ABK C;  2Y69 B;  5LGU A;  4E4E A;  2DOS A;  4FM1 A;  2DWE C;  3OMA B;  4QNH B;  5HFL A;  1AI6 A;  1QR9 A;  1P4R A;  4I7Z B;  1YHQ V;  1BGY H;  4O4I A;  2A9H A;  3STL C;  3T1H B;  1XMQ B;  1ZTE A;  4GUN A;  1COW G;  2WLI A;  4EKW A;  1M56 B;  2E74 B;  2JEX A;  4A5U B;  2ZXW C;  1NS1 A;  5IYZ B;  4X65 B;  1AIL A;  5H9C A;  2IH3 C;  1V54 B;  4PI2 A;  2VS0 A;  1TVK B;  4DR3 B;  1XNR O;  3QO5 A;  3ZHQ A;  2QM8 A;  2IH1 C;  3SPH A;  5GW7 A;  4I0X B;  1YJN V;  2YIB D;  4JI4 O;  3BA8 A;  4MVO A;  2ADQ B;  3K5M A;  1R3J C;  3CC7 V;  1WN7 A;  5KA6 A;  1BCC H;  4J9Y B;  4UV9 A;  2PYL A;  1H8E G;  2ZM6 O;  1NH2 B;  5EBM C;  4B08 A;  1H2L A;  1CP9 A;  1N8R W;  4B3R O;  2P4V A;  1Y6X A;  3K06 A;  4JI3 O;  2CH7 A;  3ABK B;  1P84 F;  3AK3 A;  2QWO B;  4CH3 A;  1HR0 B;  1XMO B;  4H44 B;  2OCC C;  1IXM A;  2H94 A;  5CA3 A;  3SYQ A;  1GM9 A;  1UFI A;  1KP2 A;  2DW4 A;  1L0L H;  3K3W A;  4LH6 A;  2BCC H;  4OXS A;  3FYE B;  4W4K A;  3VOU A;  1NTM H;  4DK0 A;  2W0F C;  5FPO A;  4DV6 O;  1L8D A;  1ARO P;  5JH7 B;  4QJF B;  2D3O W;  2ZXW B;  5JVD A;  3ABU A;  3RYI A;  4H33 A;  1Q81 W;  1NJI W;  3G80 A;  3R65 A;  1PNL A;  3BA9 A;  2EIK C;  1VQ5 V;  1H38 A;  4JV5 O;  2QGN A;  3T1Y O;  5JJJ B;  1QU7 A;  4Q6G A;  3Q4H A;  1RSO B;  2Y4U A;  3FKS G;  5IWA O;  2QM7 A;  2YI9 A;  4FLX A;  1R3K C;  3L9D A;  1H2M A;  2CAZ C;  5A2Q N;  1YVW A;  2XOK G;  1WA8 B;  2DMX A;  2AZ2 A;  2YI8 A;  4I55 A;  2AGA A;  4MVR A;  3AK2 A;  1JVM A;  4GLX A;  3BAA A;  3G4S V;  4DR6 B;  5EIB C;  1PL0 A;  5DEC A;  1FYJ A;  1XOU A;  1AJN A;  2JIZ G;  4BW5 A;  5KMG B;  2HEP A;  1T5E A;  2Q4P A;  4U7O A;  2OCC B;  2EBO A;  4CS3 A;  1UPG A;  2PGG A;  2CE4 A;  2QWN B;  1DK1 A;  3OEH G;  1KQS U;  2WLH A;  1JPX A;  4ZIB A;  4AQY O;  4DXW A;  1SC5 B;  1YF2 A;  4I4T B;  4ZI7 B;  2O57 A;  1AR4 A;  3ABT A;  4B7K A;  3APQ A;  2QKC A;  4AHC A;  2VWJ A;  1FPO A;  2AHZ A;  3OUS A;  4FLU A;  4MS2 A;  3OFN G;  3I56 V;  1NZ6 A;  2EIK B;  1NU1 H;  5B1O A;  4BWA A;  5KHK A;  3CCM V;  2JRI A;  4GX0 A;  4YJ2 B;  1BMF G;  2BE3 A;  2V1D A;  5HFM A;  1R73 A;  3OD4 A;  4J10 A;  3TGU H;  3IAY A;  4EFB A;  3VQV A;  4ICG A;  3A0B Z;  4X88 A;  4UCV A;  5J2T B;  3TET A;  1EM1 A;  5LYJ A;  2KG7 A;  4K3A A;  4OPA A;  1BSM A;  3H1J H;  4JYB A;  4DO2 A;  1XL6 A;  4BIO A;  1TVK A;  5JCO A;  3F5T A;  1SQV H;  2EUL A;  4X64 O;  5C8Y B;  4N23 A;  2AZ0 A;  3H01 A;  1NTK H;  4DRX B;  3EXA A;  3CRQ A;  3CWB H;  1PV0 A;  1ENV A;  3FB5 C;  4L8J A;  2JGU A;  2WLJ A;  2PYJ A;  3WG7 C;  4FMT A;  4BIZ A;  4J7Z A;  3BY6 A;  1XNR B;  1ZL8 A;  4X62 O;  1IBK O;  1ZUQ A;  3K08 A;  2DYS C;  1VF6 C;  4JI4 B;  1Q6I A;  3OTO O;  2BOC C;  1IZ3 A;  1WJZ A;  1G1X B;  1K8A W;  4PEL A;  1W2B U;  4CH4 A;  2ZM6 B;  4LFC O;  2UXB B;  1AP5 A;  3K0D A;  4CH5 A;  2L6L A;  3ZHR A;  4LBE C;  4O2B B;  4B3R B;  1N33 O;  5CMU A;  4LF8 O;  4JI3 B;  5KHI A;  4J42 A;  1S0V A;  4ABM A;  2YXL A;  4NTY A;  3CRA A;  1YCI A;  4GZR B;  4JZG A;  2ZIM A;  1AR5 A;  1IX9 A;  2EJR A;  1KKC A;  3MHH C;  1W0K G;  4NTW A;  5L3D A;  1I0H A;  3H9V A;  4ZKI A;  5GTH Z;  4DR5 O;  4DV6 B;  3DC6 A;  3B2E E;  4WFE A;  4PDV A;  4UFZ A;  5KHJ A;  1WA8 A;  5L3F A;  5JJE B;  2R72 A;  3WG7 B;  2R9I A;  4JTD B;  4YJ3 A;  3A0R A;  5BXZ A;  1FXK C;  4JV5 B;  3EFF K;  4X1Y A;  3T1Y B;  4FK5 C;  1RPR A;  2DYS B;  4QIW F;  5IWA B;  1EZV H;  1IBL B;  2RCV A;  2YIB A;  1V9P A;  1Q43 A;  4CS2 A;  4DYL A;  4JI5 O;  1BS3 A;  4IIJ B;  3E8F A;  3OM3 B;  1MSD A;  3L72 H;  3OE7 G;  1VEW A;  3AG3 C;  1KC8 W;  3H1K H;  3WU2 Z;  1BHA A;  3B4S A;  4FFK A;  3AG1 C;  3CXC U;  3BAB A;  3CD6 V;  4NR1 A;  3SJC C;  1S5H C;  1GN4 A;  5EBL C;  4YJ2 A;  2A0L A;  1S76 D;  2EJ7 A;  3U10 A;  1QQC A;  3SYP A;  2JS3 A;  5IJ0 A;  4GKJ B;  5FL7 G;  2K1E A;  4UVC A;  4I9Q A;  1QCE A;  4IHJ A;  2Q0O C;  1Y76 B;  5J2T A;  5EC1 C;  5CBH A;  3RBZ A;  1QHT A;  3UT5 A;  1N34 O;  4UCT A;  4WCE V;  5LOV B;  2XUM A;  4XDL A;  1XL4 A;  4R50 A;  3SYC A;  1XMQ O;  2DQ3 A;  2EIM C;  2NR5 A;  4FVM A;  2LW1 A;  1FXK B;  1TUB A;  3BCC H;  1I7F A;  3JAL B;  1EFR G;  3HB3 B;  5LP6 A;  2ZR2 A;  5BR8 O;  5LMU B;  4JYY A;  1K7D A;  3FAV B;  5LXT B;  1XUQ A;  2NLJ C;  4JI1 O;  3WB0 A;  3F7V C;  1HNW O;  3CCR V;  1NKD A;  1NR7 A;  3ASO C;  3JD4 A;  5LA6 B;  5JWP A;  3BFR A;  5JQG B;  5H6Q A;  5KX5 B;  5KA5 A;  5BMV A;  2IU3 A;  3G67 A;  3AG3 B;  3AG1 B;  1SZX A;  2W0X A;  4X64 B;  1HP8 A;  2HKO A;  4AI8 A;  4L87 A;  3JYC A;  4I5S A;  4IT5 A;  5EZY A;  3CRR A;  1YTF D;  2BSK A;  2HVJ C;  2XAG A;  1HR0 O;  3O65 A;  2HP8 A;  2JGD A;  1YIJ V;  3CB2 A;  2EIM B;  4FLY A;  1OCR B;  2E5L O;  3OTO B;  3ZHT A;  1SF9 A;  3SJA C;  1H2N A;  5CA0 A;  1E1Q G;  2QKA A;  4O2A B;  1MG1 A;  3JAR B;  1PKX A;  4LFC B;  1BQZ A;  2ZD9 A;  3ASO B;  4IYI A;  4UB8 Z;  1N4C A;  1N33 B;  3SPI A;  3E2E A;  1WP7 A;  4LF8 B;  3K5O A;  1JCH A;  5IJ9 B;  1KD1 W;  2P67 A;  1SRY A;  3CP1 A;  2ZT9 B;  3KCY A;  2E75 B;  4JI2 O;  4CC5 A;  5K1X A;  3SPJ A;  5LMN O;  4TQD A;  3VQY A;  2OWO A;  1A32 A;  4TV9 B;  4LP8 A;  2MW2 B;  1ZSP A;  2P06 A;  3D3Q A;  4DR5 B;  4DR6 O;  2VRZ A;  3ZRX A;  3HKD B;  5A9G A;  4JGS A;  4UVB A;  5GON B;  3W7U A;  1OCO C;  1NH2 D;  1R3L C;  1PPJ H;  1KEC A;  4NTX A;  3G71 V;  1M5I A;  5CA1 B;  4X20 A;  1EN4 A;  2V4D A;  3ZN0 A;  1S77 D;  1LUW A;  1Z5W A;  2RQ6 A;  3ETG A;  2JJ1 G;  4XBF A;  4JI5 B;  2DJV A;  1H2G A;  3SGI A;  1KMI Z;  4FZ1 A;  1FS0 G;  5LL6 Y;  2UXC O;  1U96 A;  1NTZ H;  2X6A A;  4P9P A;  1FKA O;  3HKC A;  1BQ0 A;  2XAF A;  1SQG A;  1R6K A;  3EVK A;  1D5A A;  4DW1 A;  1U97 A;  5L3B A;  1GAX A;  5DN6 G;  3IC9 A;  1BL8 A;  2GUZ B;  3RT3 C;  4Z1M G;  3W7S A;  3F7Y C;  4IL6 Z;  3U0Z A;  2LFS A;  4UV8 A;  4O4L A;  2BTQ A;  3QTC A;  1N34 B;  4X89 A;  2WAM A;  2IJI A;  5KX5 A;  1K5Q A;  5D5P A;  3JD0 A;  2UU9 B;  4CZZ A;  4MTG A;  1OCO B;  5BR8 B;  1I94 B;  1Q8I A;  3K59 A;  4JI1 B;  2WSS G;  4G2K A;  1HNW B;  2ZKO A;  3QO8 A;  4PI0 A;  3BVO A;  3ZX6 A;  3S3W A;  4TUY A;  2BTO A;  3P3P A;  4R8C A;  1H8H G;  2UUC O;  3I55 V;  2N04 A;  4FZ0 A;  2QDO A;  3OR7 C;  3OGC C;  1IBM O;  4JYA O;  2UXB O;  1GM7 A;  5K1P A;  3OAA G;  1Q7Y W;  3CE2 A;  5CBG A;  4GX1 A;  4DR2 O;  1M1K W;  3L71 H;  1VQO V;  2XHB A;  3JAR A;  1SQX H;  2LGW A;  2R70 A;  3E83 A;  1N0J A;  1P49 A;  3A8T A;  1M93 A;  2QJ1 A;  3K04 A;  1OCC C;  5IYD O;  1Y74 B;  1AI5 A;  5L3E A;  1KKD A;  3S3X A;  2IJJ A;  5KAF Z;  3CC2 V;  3WB2 A;  3LNM B;  2E5L B;  3UKM A;  2YC0 A;  4NB5 A;  3JAW A;  5EIB D;  1MNG A;  2P4K A;  1BT8 A;  2ZNI A;  2HR3 A;  3JAS B;  2VQF O;  1QVG U;  4TOI A;  1THZ A;  1TGO A;  4LF9 O;  2JDI G;  4F4L A;  2MK3 A;  3ZJZ A;  4RO2 A;  1RFY A;  1IBL O;  1SQQ H;  2JK5 C;  1M9N A;  3UM7 A;  2B9Z A;  2P7T C;  3RWR D;  1NI8 A;  4YIO A;  1NVP B;  3CME V;  4ZHQ B;  4JI2 B;  2UXN A;  5GTI Z;  5LMN B;  1B3Q A;  5FNV A;  3UCS C;  3CCS V;  3B40 A;  2M7W A;  3TK1 A;  3N2K A;  2AW9 A;  2YEV A;  4NXN O;  4N21 A;  4PDM A;  4AIL C;  1DLB A;  2ITC C;  4FFB B;  1IXB A;  1OCC B;  2Q5Z A;  1Q82 W;  4GKJ O;  2QWQ B;  5EYP B;  4RQE A;  3ZRS A;  1FJG O;  4GKK B;  2JS5 A;  4H13 B;  1VQP V;  3CJH B;  4R6Z A;  3ZHS A;  1I5Y A;  4DK1 A;  3ICX A;  1K4C C;  4X1I B;  1XQ8 A;  2VWK A;  1QR8 A;  4QPK A;  2Q6A A;  2H8P C;  2UXC B;  5LMU O;  4J9Z B;  1XRE A;  4PA4 A;  1XBL A;  3JAK B;  3K9A A;  2OCH A;  3K5L A;  3LSS A;  2FTK A;  3PJS K;  2EIN C;  1G4Y B;  1VQ4 V;  5IYZ A;  2GDS A;  3E35 A;  1US6 A;  4FIP C;  4WBN B;  3F5W C;  3LDD A;  1Z5V A;  1IUR A;  1GN2 A;  3AG4 C;  1DF4 A;  2XAH A;  1VQ9 V;  3D36 C;  4X9Q A;  4I0X A;  3E86 A;  1ZWI C;  3SDL A;  4F6R B;  3E22 B;  4O4H B;  4MW8 A;  1IVS A;  3I5D A;  1ZX3 A;  3GWO A;  4U3J B;  1CEZ A;  4C7U A;  4PDL A;  4U3F H;  2VQE B;  2Q69 A;  1KBH A;  4BIU A;  5IDJ A;  2P22 C;  1YJ9 V;  3HKE B;  1OZ0 A;  2ITD C;  2Y48 A;  2N74 A;  4B3M B;  3RYH B;  1Y74 A;  2QE7 G;  3LDC A;  4DV7 O;  2UUC B;  3ZED A;  2G38 A;  4JI8 O;  5B1A C;  1FFX B;  4NYK A;  3WFV A;  1IBM B;  4JYA B;  4GCZ A;  2EIN B;  4RUF A;  2WA3 A;  4JF3 A;  1Q3E A;  5JH7 A;  4DR2 B;  2F4V B;  4IYH A;  1R6T A;  3CC4 V;  5D5Q A;  3AG4 B;  1GN6 A;  3OEE G;  4LNU B;  2DWD C;  1S72 V;  1JFF B;  3ZMV A;  1RSO A;  3E8H A;  1P7B A;  4RWU A;  1L0N H;  3CRM A;  1Q6U A;  1GMG A;  3RVZ A;  3C3T A;  5LHG A;  1GTO A;  1TA8 A;  4KXR A;  1O9G A;  3OW2 U;  2OIE A;  4LF4 O;  4PHZ A;  4PA6 A;  2L35 A;  2VQF B;  3FX7 A;  4MSW C;  4LF9 B;  3ZCC A;  1Y4M A;  5KMG A;  3CS5 A;  4LWS B;  1XHX A;  2QA4 V;  1WPB A;  2HFE C;  4OX9 B;  3GVM A;  3SJB C;  1ZLZ A;  1XHZ A;  4I4T A;  5B1A B;  2QSA A;  2LW7 A;  3TCU A;  4ZI7 A;  2P90 A;  5LGT A;  2WLK A;  2QWR B;  2CTQ A;  4NXN B;  2X6B A;  3JAT B;  3KG2 A;  4X1K B;  4P9O A;  1B6Q A;  3QF7 A;  1Y67 A;  1JOY A;  1WPX A;  2HVK C;  4MVZ A;  4DV0 O;  3M8A A;  3ETD A;  2Q9L A;  1SES A;  3H1H H;  1AI7 A;  4MTF A;  5DM6 V;  1JQ0 A;  1FJG B;  3HR0 A;  5CB4 B;  1SS3 A;  4Z2W A;  1AJQ A;  3BRC A;  5LBQ A;  4WBN A;  1DGS A;  4KFM A;  1MMM A;  4J11 A;  2P5O A;  4MVU A;  3ASN C;  1JJO A;  1N32 O;  1NR1 A;  2UU9 O;  3H1L H;  4B3T B;  1OCR C;  2CGO A;  4MTX A;  4UB6 Z;  4J7J A;  5JJN B;  1D5N A;  1I94 O;  3H1I H;  3DXR B;  3N2G B;  4PA9 A;  2EZP A;  1GN3 A;  5C8Y A;  2ZCE A;  2Q67 A;  1B04 A;  5J2U B;  4DRX A;  4O4J B;  4FLZ A;  3OMN B;  5H5N A;  2YSU B;  2GTA A;  2FYU H;  1H2S B;  4CS4 A;  2WLL B;  1F23 A;  2KKW A;  4NXM O;  1SZT A;  2UXX A;  3A0H Z;  2LP7 A;  3FD9 A;  4EB6 B;  4R7C A;  2WLN A;  2FKX A;  1JMK C;  4UCR A;  3RYH A;  1YJW V;  1KU9 A;  3VQX A;  3ABM C;  5FPR A;  3ZRV A;  2E76 B;  2ILM A;  1BE3 H;  1K73 W;  3JD3 A;  5B1N A;  4O4I B;  4JI6 O;  4PA7 A;  2YIA A;  1FFX A;  1GM8 A;  2HJD A;  2YIC A;  4LF5 O;  1P7G A;  1XIL A;  3J80 N;  3RYC B;  1DTO A;  2ZE8 A;  4O2B A;  1F4N A;  4WFG A;  2LGQ A;  5IYB O;  3ASN B;  3SR2 C;  2LO1 A;  1YEW A;  4ASU G;  1ORQ C;  3D36 A; 
#chains in the Genus database with same CATH homology
 2IJH A;  3ABT A;  1AR1 B;  2WSS G;  4G2K A;  1JX9 A;  2AHZ A;  3OUS A;  3E8B A;  1ROP A;  3QO8 A;  4FPP A;  4MS2 A;  4XDJ A;  3OFN G;  3I56 V;  4JAU A;  1EBO A;  2EIK B;  5B1O A;  3IFX A;  4PDR A;  4I9W A;  4WFF A;  3CCM V;  4GX0 A;  2W6I G;  4R8C A;  1BMF G;  2V1D A;  1H8H G;  1EZJ A;  1KP3 A;  5HFM A;  1R73 A;  3CCQ V;  2JJ2 G;  1SER A;  3I55 V;  5KUK A;  3OR7 C;  3OGC C;  2W6J G;  1RPO A;  4X88 A;  2B1I A;  3CYO A;  5EK0 A;  3TET A;  1FXH A;  3ABM B;  3K0G A;  1J95 A;  1GM7 A;  1WLE A;  2V7Q G;  4TWK A;  3OAA G;  1Q7Y W;  2LFR A;  1CPY A;  1VQ8 V;  2A79 B;  5CBG A;  4GX1 A;  1M1K W;  1VQO V;  1TUE B;  4LC1 A;  4JYB A;  1QBZ A;  4DO2 A;  2DYR B;  1XL6 A;  2XND G;  3RVY A;  4CBC A;  2IW5 A;  3E83 A;  3CCV V;  1RM1 B;  3K04 A;  2Z5U A;  1OCC C;  5IYD O;  3RW0 A;  3W7X A;  3GB7 C;  4N23 A;  3AEI A;  1AI5 A;  5L3E A;  3H01 A;  1KKD A;  2IJJ A;  5H6R A;  1K5S A;  2HLD G;  3CC2 V;  3SPC A;  1F4M A;  3LNM B;  1ENV A;  3FB5 C;  3OR6 C;  4P2Z A;  3UKM A;  2OTJ V;  2WLJ A;  3WG7 C;  4FMT A;  2OT5 A;  3T2M A;  1K9M W;  5LGN A;  4BIZ A;  2DQ0 A;  2HR3 A;  1YI2 V;  3BY6 A;  1QVG U;  1GKF A;  2BOB C;  2Z3Y A;  3K03 A;  1THZ A;  4KUM A;  3K08 A;  3FB8 C;  2DYS C;  2JDI G;  4F4L A;  2MK3 A;  3ZJZ A;  1AJP A;  4RO2 A;  3W7W A;  4GX5 A;  3NXS A;  2BOC C;  2JEU A;  2JK5 C;  1BHB A;  1M9N A;  3UM7 A;  3ABL C;  1K8A W;  2P7T C;  4PEL A;  1Y66 A;  1W2B U;  2PI5 A;  1FXK A;  1M57 C;  1NVP B;  4RUE A;  3CME V;  3X2Q C;  3K0D A;  2UXN A;  2B1G A;  1YTF B;  4UXN A;  3FYI B;  4LBE C;  1LNQ A;  3CCS V;  1QLN A;  5CMU A;  1QVF U;  2M7W A;  3TK1 A;  5LHH A;  3QO7 A;  2P6J A;  1M90 W;  1S0V A;  2YEV A;  2WLI B;  4GX2 A;  4JTA B;  3CCE V;  3IC7 A;  1PNM A;  4N21 A;  2WLL A;  4PDM A;  3CCU V;  1DLB A;  1K33 A;  4WF9 V;  3JD1 A;  1E1R G;  2EJR A;  4MTO A;  2ITC C;  3MHH C;  1W0K G;  1OCC B;  5L3D A;  2X6C A;  4FJC C;  1Q82 W;  2AHY A;  2XAQ A;  1NVP D;  3STZ C;  4ZKI A;  4MVQ A;  5J9P C;  4RQE A;  3ZRS A;  4WFE A;  4PDV A;  4Q20 A;  1K92 A;  2KB1 A;  1VQP V;  1I5X A;  4PA3 A;  5L3F A;  2X7R B;  4R6Z A;  1I5Y A;  3P30 A;  2PI4 A;  3B8M A;  3WG7 B;  2R9I A;  4JTD B;  1K4C C;  1Q86 W;  1F51 A;  1FXV A;  3AG2 C;  1NBM G;  3A0R A;  3W7T A;  1FXK C;  1QR8 A;  3EFF K;  5BZB A;  3ZN1 A;  4QPK A;  3QNE A;  2Q6A A;  2H8P C;  3EHB B;  4FK5 C;  1SET A;  3E89 A;  1RPR A;  2DYS B;  4LCU C;  4J9Z B;  4QIW F;  1JJ2 U;  3P32 A;  4PA4 A;  3K9A A;  3LSS A;  1E79 G;  3DGE A;  3ABL B;  2FTK A;  2ZR3 A;  3PJS K;  1NQT A;  1FFT B;  2GHY A;  2EIN C;  1G4Y B;  3OMI B;  1VQ4 V;  3K79 A;  1M57 B;  3JCZ A;  3X2Q B;  2WLM A;  3E35 A;  4HAM A;  3E8F A;  4FIP C;  3E8G A;  3OM3 B;  3F5W C;  3LDD A;  3T1C A;  3OE7 G;  1OHH G;  3OUF A;  4P30 A;  3AG3 C;  1KC8 W;  3ZRW B;  3AG4 C;  1DF4 A;  3ETE A;  2XAH A;  1BHA A;  3FB7 C;  3AG1 C;  4JAS A;  3CXC U;  1VQ9 V;  3CD6 V;  3SYA A;  1VQK V;  1S5H C;  5EBL C;  3E86 A;  2A0L A;  4JPR A;  1S76 D;  1QLE C;  1OCZ C;  1ZWI C;  4YXW G;  3SYP A;  5B3S C;  4MW8 A;  4RQF A;  1YSC A;  4E2L A;  2Y69 C;  5FL7 G;  3SJQ C;  1G8M A;  2K1E A;  4UVC A;  3GWO A;  1QCE A;  1CEZ A;  2WWW A;  3G6E V;  5EC1 C;  4PDL A;  1GK9 A;  5CBH A;  3RBZ A;  3BEH A;  2Q69 A;  4HZ3 A;  4WCE V;  4BIU A;  5IY5 C;  1UJW B;  4X8A A;  5IDJ A;  2ZDI A;  4XDL A;  3IGA C;  1XL4 A;  5L3C A;  1YJ9 V;  2QEX V;  4R50 A;  3SYC A;  2DQ3 A;  2ITD C;  1OZ0 A;  4H37 A;  2XAS A;  2Y48 A;  2EIM C;  2XAJ A;  3AG2 B;  1K97 A;  1M56 C;  1FXK B;  2B5U A;  1EFR G;  3HB3 B;  2ZR2 A;  2QTO A;  3LDE A;  1V55 C;  1K7D A;  2QE7 G;  3LDC A;  2EIJ C;  2NLJ C;  1V54 C;  4JTC B;  1DF5 A;  4GT1 A;  2X0L A;  3M99 B;  3SPG A;  4WFB V;  5B1A C;  3ZMU A;  3F7V C;  3WFV A;  2YEV B;  5EC2 C;  3CCR V;  3CPW U;  1NKD A;  1NR7 A;  3ASO C;  3JD4 A;  4GCZ A;  2EIN B;  3CCL V;  1MSW D;  4RUF A;  4JF3 A;  1YIT V;  3SYO A;  4RAI A;  4ZBM A;  5H6Q A;  2CK3 G;  3ZMT A;  5KA5 A;  2C2A A;  2IU3 A;  4MVM A;  4MT8 A;  3AG3 B;  3CC4 V;  3VBB A;  4WFH A;  1PNK A;  1VQ7 V;  3AG4 B;  3OEE G;  3AG1 B;  3MD0 A;  3T4Z A;  4TT3 G;  2GSM B;  1VQM V;  4TSF G;  2DWD C;  1R3I C;  5B1B C;  4JYC A;  1S72 V;  3ZMV A;  2HKO A;  3E8H A;  1P7B A;  1QLE B;  1OCZ B;  4L87 A;  5IYC O;  5B3S B;  3DTU B;  3JYC A;  4I5S A;  1VQ6 V;  3D3I A;  1YTF D;  3ABK C;  2Y69 B;  5LGU A;  1GMG A;  3FB6 C;  2DWE C;  3OMA B;  3RVZ A;  2HG5 C;  2HVJ C;  2XAG A;  4QNH B;  5HFL A;  5LHG A;  1AI6 A;  1GTO A;  1K4D C;  1K3E A;  1P4R A;  1QR9 A;  1W0J G;  3CMA V;  3OW2 U;  1YHQ V;  5E1A C;  5IY5 B;  2A9H A;  2NNU A;  3STL C;  1YIJ V;  4PA6 A;  4KP4 A;  1S3J A;  1COW G;  4G28 B;  2WLI A;  1PD3 A;  4EKW A;  4MSW C;  2EIM B;  3ZCC A;  1M56 B;  1OCR B;  1Y4M A;  2JEX A;  2ZXW C;  1V55 B;  2ZQM A;  2QA4 V;  5H9C A;  2HFE C;  2EIJ B;  3MHS C;  1E1Q G;  2IH3 C;  1V54 B;  1MG1 A;  5B1A B;  1PKX A;  3TCU A;  2P90 A;  3QO5 A;  1L1F A;  5CBF A;  2ZD9 A;  4G27 B;  2QM8 A;  2IH1 C;  3ASO B;  5LGT A;  3SPH A;  5GW7 A;  1YJN V;  5EBW C;  2WLK A;  3SPI A;  3E2E A;  4MVO A;  1R3J C;  2X6B A;  1JCH A;  3CC7 V;  1KD1 W;  3KG2 A;  2P67 A;  4HYO A;  5KA6 A;  4J9Y B;  4QPJ A;  4P9O A;  1SRY A;  4UV9 A;  3CP1 A;  4UUJ C;  1B6Q A;  5C93 A;  1H8E G;  1NH2 B;  5B1B B;  1JOY A;  2ATK C;  5EBM C;  3JD2 A;  3SPJ A;  3B8N A;  1WPX A;  2HVK C;  4MVZ A;  2HJF C;  3LSQ A;  1CP9 A;  4LP8 A;  3ETD A;  3ML0 A;  3ZMS A;  1N8R W;  1SES A;  1AI7 A;  3HPL C;  3K06 A;  4MTF A;  2IJK A;  5DM6 V;  1JQ0 A;  4MVS A;  3ABK B;  3ZRX A;  1AJQ A;  4JGS A;  4QE7 A;  3T4D A;  5LBQ A;  2OCC C;  4WFA V;  1IXM A;  4KFM A;  2EIL C;  2H94 A;  4MVU A;  5CA3 A;  3ASN C;  3SYQ A;  1GM9 A;  3ZRW A;  1KP2 A;  3CCJ V;  2DW4 A;  1NR1 A;  3K3W A;  4UVB A;  1OCO C;  3W7U A;  1NH2 D;  1R3L C;  4OXS A;  1KEC A;  1OCR C;  3FYE B;  2IU0 A;  4MTX A;  3VOU A;  3G71 V;  2W0F C;  1HWY A;  5KUM A;  4PA9 A;  2EZP A;  1ARO P;  4QJF B;  3ZN0 A;  2D3O W;  2ZXW B;  2Q67 A;  4U7N A;  1S77 D;  3ABU A;  4H33 A;  3ETG A;  3OMN B;  1Q81 W;  2JJ1 G;  1NJI W;  3R65 A;  1PNL A;  2EZO A;  2EIK C;  2YSU B;  4XBF A;  1R6N A;  1VQ5 V;  2F43 G;  1H38 A;  1H2G A;  1VQN V;  2WLL B;  4BAY A;  1FS0 G;  3LUT B;  1F23 A;  1SZT A;  3B77 A;  3FKS G;  2Q68 A;  2UXX A;  1K34 A;  2LP7 A;  2QM7 A;  4R7C A;  2WLN A;  5L3G A;  2X6A A;  1MOF A;  1R3K C;  4P9P A;  5CN0 A;  4QE9 A;  4UVA A;  1YJW V;  3ABM C;  2XAF A;  3ZRV A;  4JAV A;  2XOK G;  2OTL V;  1R6K A;  1K73 W;  2ZDI C;  5L3B A;  5DN6 G;  4MVR A;  3JD3 A;  1JVM A;  1BL8 A;  5B1N A;  4PA7 A;  1AI4 A;  2QKS A;  1MAB G;  2R9R B;  2DYR C;  1GM8 A;  4Z1M G;  3W7S A;  3F7Y C;  3G4S V;  1PL0 A;  2LFS A;  4UV8 A;  3ZIA G;  4MW3 A;  1RM1 C;  1GO3 F;  1DTO A;  2WAM A;  4X89 A;  1AJN A;  1F4N A;  2JIZ G;  2WPD G;  4WFG A;  4BW5 A;  2IJI A;  4U7O A;  2OCC B;  5IYB O;  2EBO A;  1K5Q A;  5LHI A;  2EIL B;  3ZMZ A;  3JD0 A;  3OEH G;  1KQS U;  3ASN B;  2WLH A;  4CZZ A;  1JPX A;  4MTG A;  1OCO B;  4ASU G;  4DXW A;  1VQL V;  1ORQ C;  3D36 A;  4XDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...