3CC4V

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cc4V00
1VQNV 5DM6V 1YJNV 3CCEV 3CCVV 1VQ7V 2QA4V 1VQ4V 2QEXV 1R73A 1Q7YW 1VQ5V 2OTLV 3I56V 1YITV 1VQPV 1NJIW 3CCRV 1VQ9V 1YJWV 1K9MW 2D3OW 3CMAV 1VQMV 1M1KW 3CC2V 3CCSV 1N8RW 3G71V 4WFBV 3I55V 1VQKV 3CCQV 1YI2V 1Q86W 1K8AW 1YJ9V 1W2BU 3CCUV 1VQLV 1VQOV 3CXCU 1Q82W 1KC8W 1M90W 3G6EV 3CCMV 4WFAV 3CC7V 1YIJV 3CC4V 1VQ6V 1Q81W 3CD6V 3G4SV 3OW2U 3CCLV 1S72V 1QVFU 1K73W 4WF9V 2OTJV 1KD1W 3CMEV 3CPWU 1KQSU 3CCJV 1JJ2U 1QVGU 4WCEV 1YHQV 1VQ8V
chains in the Genus database with same CATH superfamily
3T1YB 2PF4E 4HYOA 2QTSA 3HKBA 4ZOLB 4LWSA 2YIDA 1YITV 1HDJA 4FLTA 4B3RO 1Z2GA 4OGQB 2Q7EA 1IURA 3CJHA 1QLNA 4EB6B 4I50B 4X62O 1AILA 3G67A 4OPHA 2XASA 5B1AB 5KA6A 4XDLA 1H38A 3JALA 3SPHA 5CA3A 3N2GB 1YCIA 4LF4B 4AI8A 4TQDA 2Y4UA 1T5EA 1Q6HA 3E8FA 1L0LH 4DV7O 4IYIA 4MVRA 5L3CA 3Q4HB 2IU0A 1IZ3A 4DUZB 3UM7A 3N2GA 4H37A 5GTHZ 4DV7B 5FL7G 1G6UA 4YJ2B 4MW8A 3T2MA 2WLHA 5GONB 4JI8B 1MA1A 5GTIZ 4X1KA 3BY6A 4IL6Z 3P30A 4B3MB 3B09A 3ZMVA 3JD0A 2P7TC 1D5AA 1NTZH 4QE7A 5KAFZ 1FFTB 2RN9A 1I5YA 3SGIA 2CAZC 1I94B 2YC0A 2WLLB 4TV8A 3IGAC 3A2FA 1GN3A 3OM3B 1IXBA 4B3SO 1M1KW 1EN5A 2EJRA 1AR4A 3JATB 4I55A 3HPLC 3LNNA 3OGCC 1XL4A 1KD1W 4FM2A 3RYFA 1JMKC 2N74A 4JI2O 1U96A 3LUTB 1K5SA 1XHXA 1S77D 5KUMA 2CK3G 1I0HA 4X65B 3H1KH 1E79G 4GYCB 4QIWF 4E2LA 1VQ6V 4EKWA 4FLWA 2M7WA 4J41A 3WFVA 1FKAO 3FB5C 5IYBO 4GKJO 4JYBA 1IVSA 3BFRA 4LF6B 2LGWA 1XNQO 3I56V 1GN2A 5J2UB 1UJWB 2QJ1A 1N34O 1QBZA 3ABTA 3E83A 2ZM6B 2Q7GA 1W2BU 3HKCB 5LP6B 3ABKC 3OR7C 3JAWB 4YIOA 3ABLB 1NR7A 4QGPA 4BIUA 4BW5A 1BQ0A 3W7WA 4IHJA 5CN0A 1GO3F 3ABLC 4MVSA 4PI0A 1S3JA 1XNQB 2ITCC 4LF6O 3RYHA 1US6A 1Y67A 4JGSA 4EFBA 3HB3B 1H2KA 3UO3A 2ZT9B 3OW2U 3OFNG 5DECA 2Z0AA 4DV1O 1QU7A 3H01A 2ZIOA 1SA0A 2NNUA 1Q3EA 3U11A 5LOVB 2ZM6O 3CCQV 1YJ9V 1KMIZ 3THOA 5B5EZ 5KHHA 3E8GA 4J7KA 3MD0A 2P4VA 4JI4O 2ADQB 3FB8C 5GONA 5BXZA 3LSSA 1PV0A 3JD3A 3K06A 3K9AA 1HNZO 1VEWA 1B04A 1GH6A 2FMLA 2JJ1G 4JI6B 4NR1A 3CCUV 1R6KA 4X1KB 1FFXB 4DUZO 2V7QG 4FVMA 4NB5A 3ASNC 2F43G 4TV9B 1NS1A 1JA8A 1FD9A 1SKVA 1OHHG 1SS3A 5IYDO 2IJHA 4DV5B 1J5EB 2ZE6A 1FXKC 2L35A 4UB6Z 5KHIA 1WP8A 3EXAA 2ZD9A 2E75B 2DWEC 1K8AW 2WA3A 4JAVA 1CPYA 5AG2A 5JCOA 2JVDA 2JEUA 2P4KA 5LYJA 4DV6B 5H2FZ 1Y76B 4PDRA 4OX9O 2AHZA 2A9HA 4YY3O 3AK2A 4O2AA 4LF4O 3PJSK 4TOIA 4RUEA 3CX5F 2ARHA 1BL8A 1MABG 4X66O 1RPRA 1VQNV 4DR6B 3L74H 1THZA 4D7SA 4U3JB 3MDSA 1G4YB 2CGOA 4ZKIA 3JSNA 1PP9H 1VF7A 5IY5C 2HVJC 4GKJB 1DF5A 2EIKB 2WLIA 2UXBO 1SQQH 1OCRC 2FB5A 2EJ7A 5LMNB 3RYCB 1JFFA 2IJJA 3ZIAG 1JJOA 2UUAO 3CRRA 3OTOB 5BZBA 2V1DA 5IWAB 4JI0B 3G6BA 5IT9N 1VARA 1OCRB 4QJFB 2GBOA 3BEHA 1KP2A 1F4MA 4UCOA 3SDLA 2KG7B 3K0GA 3OR6C 3CHXA 2JS5A 1NKDA 5JH7B 1MOFA 2HVKC 2CH7A 3M99B 2WLKA 2H3OA 2ZR3A 2XT9A 4H33A 4IHJB 4DV4O 4JV5O 2LJ2A 3WG7B 2PYLA 1XREA 2GHYA 5EZYA 3F7VC 3ML0A 3JAWA 3RWRD 4X64B 4O4JA 2YXYA 1HNXB 1V54C 2UUBO 3L73H 4JI5B 2QM4A 2OTJV 2C2AA 5IJ9A 1FJGB 4GX1A 1NU1H 1JJ2U 2A7WA 5FNVB 1WB8A 3E22A 4PA9A 1PNLA 2OTLV 2DMXA 2LO1A 3VBBA 5IYZA 2R9AA 3QO7A 4ZHQA 4P30A 3PN1A 1ENVA 4NXMO 1HWYA 1YJNV 2UUCB 1P7BA 4LCUC 4GZRB 3ZMSA 2WLNA 4FZ0A 4TSFG 1TA8A 3BABA 3CC2V 2VQEO 1R3JC 4B3RB 2YEVA 4O4IB 5L3GA 4F6RB 2QKCA 2YXHA 3LNMB 4D7TA 5H9CA 2ZIMA 5BMVB 4N21A 2AW9A 4J7ZA 4UCTA 4O2AB 2ZE5A 3C3SA 4MT8A 3K5MA 5KHKA 1CXZB 1IX9A 1Z5VA 4FZ1A 3AK3A 1PNKA 3O9OA 1VF6C 5EYPB 3OEHG 5B1OA 4DR2B 1D2DA 4G27B 4F4LA 3Q4HA 4GKKO 1R3IC 2YS8A 2LP7A 1SQPH 1PM9A 2AHYA 1OCZB 4YIPA 1ZX3A 2BTQB 1AI6A 1ZUQA 2YIBA 3SJAC 3JARB 1JPXA 4HBNA 1YTFD 3X2QB 3N2KA 3JAKB 3SPGA 1IBKO 3KCXA 1EN4A 1YZBA 3T1YO 5LL6Y 4JASA 4ASUG 3X2QC 2ATKC 1YSCA 4UV9A 1S5HC 3W7XA 1M56B 4TV9A 1K9MW 3ZJZA 5EC1C 1PKXA 3ZRWB 5JVDA 5DEDA 3OTFA 1Q82W 2PUSA 1FAFA 4DR3B 4RQFA 4DR1O 1MSWD 3G4SV 1Y66A 4PA7A 4DV0O 1OZ0A 2H94A 4ZOLA 1KQSU 5EBLC 4LFCB 5LOVA 3K5LA 4WBNA 3SPCA 2IH3C 1VQ7V 2Q5ZA 5HFLA 1GM7A 1JX9A 4DR4B 3CP1A 1XI1A 2H8PC 3ABUA 1GN4A 3WU2Z 2VRZA 1WNSA 1K7DA 2Q8VA 1BCCH 2VWJA 2DN9A 5GW7A 1LR1A 4MVUA 5B3SC 2JEXA 1P84F 2HG5C 3ZMUA 2VWKA 5FNVA 3RVYA 2XAHA 2XAFA 5EIBC 2DOSA 2RNBA 4PD4F 1IDSA 1GK9A 2HKOA 5BR8B 2PY5A 4K0KO 3D36C 5IY5B 5ITZB 1YIJV 4GCZA 5IYZB 1NVPD 1NVPB 2JDIG 1KUQA 3KZIZ 5LMUB 3EFFK 3HR0A 4FFBA 3CPWU 3CCJV 1QCEA 2BTOA 3IFXA 4UCRA 5J2TA 3A8TA 5FPRA 1M57B 4CC5A 3UCSC 4UFZA 2UU9B 4J42A 3G71V 2QWPB 1S5LZ 3ETDA 4JI4B 2E3CA 5CA1A 4ZIBA 5L3BA 1N36B 1RSOA 5E1AC 2Q73A 1W59A 5LHGA 4ZI7A 2LGQA 1KKCA 1MZEA 2N05A 5BR8O 2UXDO 4MTOA 3WG7C 1MMMA 2KG7A 1AP5A 2DW4A 1Q86W 3RYCA 2CTQA 4IIJB 4JYAB 4TQFA 3FB6C 1GN6A 4IGGA 3U10A 1FS0G 3K3WA 1KBHA 4PA4A 2R9RB 1JFFB 3A0BZ 3I5DA 3L70H 3ABKB 4LNUB 3AK1A 3OMNB 3ZHSA 4X66B 2EINC 1Q81W 4ICGA 3KG2A 4C7UA 1FXKA 3ABMB 5LA6A 2XNDG 4K35A 3ZMTA 2EZOA 4YJ2A 4I4TA 2DE0X 3ZN1A 3IC7A 1OCOC 2BE3A 5LHIA 3CMAV 3CRAA 1BMFG 1VP7A 4GX0A 2P5OA 3CE2A 5JVDB 3ZRWA 1NQTA 3VQYA 2ZXWC 5LGUA 1GM8A 2XOKG 1FPOA 5LMNO 3CRQA 4CH6A 1QQCA 2W6IG 2YSUB 4LBEC 1VF6A 4TUYA 1A32A 2EILC 1MSDA 1M5IA 3H1LH 3IC9A 2E76B 4X1YA 4I0XA 4G2KA 2VS0A 3S3XA 5IYCO 4DW1A 2CTRA 1HR0O 2AGAA 1IBKB 3B77A 3HKBB 2ZDIA 2E5LB 1EZJA 3BA8A 4Z1MG 3TCUA 4UXNA 5K1PA 1NR1A 4FLYA 3GWOA 4J10A 1ZLZA 1S5JA 5B1BB 4LF7O 5A9GA 1RP3B 1TGOA 4J9YB 2UUBB 1G1XB 1XNRB 2EULA 1S76D 1AVMA 1FXKB 1PL0A 2QWNB 5LA6B 2JK5C 4LFAO 3ICXA 1BS3A 1GKFA 1R73A 4XBFA 5IJ0B 3AG3B 2IW5A 2JS3A 2A06H 1PD3A 4AQYO 1AB3A 4R8CA 4B08A 4DV6O 1Q5OA 1QHTA 3FD9A 4YXWG 2DWDC 1XEQA 3AG3C 1SA0B 1PNMA 2HFEC 3L75H 4KP4A 2WAMA 2CDYA 2E74B 4PDLA 1I08A 3R66A 5B1AC 2LQTA 5A2QN 3RYHB 1IBLO 1MG1A 2CTPA 2QWOB 4U7NA 2Q68A 3AG4B 2UXBB 3F7YC 3BAAA 3E35A 1K3EA 1VQ4V 4K0KB 4UVCA 3FFQA 1LNQA 5CA1B 4OXSA 2ZNJA 2F1MA 3D3QA 5KX5B 3ZMZA 4DR5O 5LGNA 5B3SB 5EK0A 2KB1A 2RJZA 3F5TA 1ZTEA 2UXNA 3HKDB 3LDCA 1SESA 2ETNA 4WF9V 4DR1B 2WLJA 4JI3B 3DTUB 1F51A 1TUEB 4RUFA 3N27A 4CS3A 5LMUO 4I9QA 4PA3A 1SF9A 2IJIA 3RYIB 4PHZA 1N34B 4F6EA 4DUYB 4PDVA 3DC6A 3ZCCA 3HKEA 1E1RG 1N8RW 5ITZA 4DRXA 3TETA 5IWAO 1Q6IA 2A79B 3P3NA 1SETA 4J7JA 4HZ3A 1XBLA 3SYQA 2PI5A 2Q0AA 1YHQV 4PI2A 4B7KA 2QM8A 3VQWA 4I5SA 2VQFO 1HNWB 1XQ8A 2PGGA 3ZX6A 2GUZA 3RBZA 2WLLA 3RYFB 2HJFC 1NJIW 5IE9A 1VQMV 3SJCC 1AP6A 2R72A 4E4EA 4RO2A 3G80A 4EFEA 4UCVA 1VQLV 2Q0OC 3ETEA 3CC7V 1SQXH 3CB2A 3P3PA 2LW7A 2M6YA 2OT5A 4U3JA 4TV8B 1BHAA 3K0DA 1YVWA 4DV0B 2FTKA 4FM1A 3MHSC 2D3OW 3JASB 3GVMA 2ZDIC 4X1YB 3TGUH 3LSUA 5LBQA 2GV9A 2XUMA 1YDXA 1J95A 1DK1A 2X7RB 4KL1A 1EZVH 4JYYA 2ZNIA 3JD2A 2QWRB 5LP6C 4DO2A 2UXCB 4I0XB 1XILA 1AJPA 4MVZA 2XAGA 2A3QA 1VQKV 2UXDB 2YI8A 5EBMC 1OCOB 1HP8A 2EZPA 2B9ZA 2X6AA 4MS2A 3CEIA 5L3FA 4EB6A 3L72H 4X8AA 5EBWC 1AI4A 1ROPA 2MW2B 2ZXWB 4JI6O 4LWSB 3VQVA 3APOA 4JI1B 4KHPO 4JYCA 1XL6A 2JRIA 3FAVA 3D8CA 1Y74A 3SYAA 2HEPA 5LHHA 5LGTA 4A5UB 4I50A 1K33A 2F95B 4Z2WA 5CB4A 3SYCA 4DV3O 5FPOA 3MAQA 2EIMC 4JI1O 4JI5O 2YUAA 4L8JA 1VF5B 4QPKA 1VMGA 2ZINA 4LNUA 3RW0A 5H6QA 5J9PC 1O9GA 1VQ8V 4GLXA 2YDEA 3STZC 2EX3A 3BPZA 1TUBA 4KHPB 3L71H 2BCCH 2Y0PA 1QLEC 3O65A 3RVZA 4UB8Z 1IBMB 4H13B 4H44B 4I9WA 3OD4A 3RGBA 2WA4A 1SQFA 1NI8A 1BHBA 1B6QA 4QPJA 5CBHA 2G38A 3F5WC 2F66C 4LH7A 1QLEB 5JJJB 4X62B 4J9ZB 3FX7A 1ZL8A 2B5UA 3ZHTA 2P90A 1N32B 1M90W 5KLVH 4ZHQB 2OIEA 3T1HO 3E89A 3ETGA 1IXMA 2UUAB 3EVKA 2OIGA 2X6BA 2R9IA 2Y69C 3QO8A 4CBCA 3CYOA 4FJCC 5IJ9B 1G8MA 1RM1C 3A0RA 3NXSA 1R1BA 1YF2A 1Q43A 4W4KA 4HNAA 2CH7B 2YIAA 4WFAV 4RWUA 4FLXA 3B8MA 1VIBA 2IU3A 2HHHB 3AG4C 4UCSA 2BSKA 3C90A 4JI8O 4NYKA 4NTYA 3K79A 1N32O 2P67A 4YY3B 4O2BA 4LF9B 4DV2B 3ASOC 4WFGA 4DR6O 3D3IA 1ZSPA 4FLVA 1SERA 5HFMA 1DLBA 1SQGA 2A0LA 5IJ0A 4O4LA 5EIBD 3ASOB 2GTAA 1F4NA 2EIJC 2QA4V 2EIKC 1YTFB 1KECA 5CBFA 4RQEA 3OEEG 4DR5B 1WP7A 1VQOV 3L9DA 4J80A 2R70A 2CUGA 5CB4B 1N36O 5LXTA 1IBMO 4Q20A 3BCCH 1UFIA 3M7MX 1I94O 3CRCA 4DV3B 2CTWA 1QVGU 3DGEA 3E86A 2XAQA 2ZE7A 4NTWA 4B3SB 2DQ0A 3APQA 1HNZB 1JR9A 3DXRB 1MNGA 5L3EA 1GAXA 2Q67A 1L1FA 3R65A 1XNRO 1Y74B 1FXHA 1J5EO 4DV5O 1WAZA 4OX9B 1N0NA 3JAKA 4AILC 1XHZA 4IT5A 4H0LB 1OV9A 2MK3A 4JAAA 3CCEV 5B66Z 3JARA 1Q7YW 4O4HB 1V54B 4P9PA 1EM1A 2XTAA 4MTGA 2DYRB 2HJDA 2Q7HA 3OE7G 5FLXN 1X59A 1S72V 2F23A 2FYUH 3A0HZ 1NBMG 3ZHUA 1NH2B 4ZBMA 3ABMC 1FXVA 3JD4A 2DYRC 3K9SA 3UKMA 3CCVV 4ABMA 1LUVA 3CWBH 4KFMA 4X88A 5KMGB 1N33O 3H1HH 3UQ8A 4YHHB 4BR6A 4LF8O 3SR2C 3ETQA 4K3AA 3ZHQA 3TXSA 5EYPA 1GMGA 2RMKB 4DR7O 2W6JG 3LSQA 4DV4B 1BGYH 4DYLA 1Q6UA 4WFHA 3U0ZA 4JI7O 4FK5C 1Q8IA 3CSXA 3IAYA 4AHCA 1LUWA 2X0LA 1D5NA 3KCYA 5LXTB 1QR8A 2WSSG 4CC6A 4DUYO 1MZFA 2Y48A 1K92A 2YEVB 4O4IA 1XMQO 3G6EV 2UXCO 2ILMA 1SRYA 1ZWIC 1K34A 2JJ2G 2GUZB 4XDJA 1NT2B 1N4CA 1AROP 3E8BA 4LFBB 4O4LB 2GTSA 3ZHVA 4ZI7B 4MW3A 4GT1A 2QTOA 5JCOC 5K1XA 2NR5A 4LF9O 4DK0A 1JVMA 3E2EA 2WWWA 4G28B 2B1IA 1P4RA 2WPDG 1TAEA 3HKEB 4JI7B 3HKCA 5LP6A 3E8HA 4FPPA 1WPBA 5J2UA 3ASNB 4JF3A 5J2TB 1IBLB 4LF8B 2DQ3A 4YHHO 4NVPA 4UCUA 5KHGA 3SPJA 1KYOF 2IM9A 3H1IH 3SPIA 2HP8A 3CCMV 5B1NA 5CA0A 3JCZA 2KKWA 4JI3O 4JI2B 4R7CA 1BQZA 4FLUA 2YXLA 5C8YA 4MVQA 3OGIB 1BSMA 3OT7A 2PYJA 1U97A 3K03A 1AR5A 3CS5A 4MVOA 3WB1A 2DJVA 2Y69B 3DC5A 4FFBB 2QKAA 1F23A 1H8HG 1KB9F 2Q4PA 3SJQC 2OWOA 5D5PA 4Z1VA 1UPGA 2CE4A 3EHBB 3B40A 4KUMA 3VOUA 3OMIB 1I7FA 3AG1B 3CXHF 2F4VB 3J81N 3CD6V 1BT8A 2PTMA 1TVKB 1OCCC 4I55B 3B4SA 1I5XA 3IJ4A 5F2VO 1SZXA 2FL4A 5CMUA 3ZRSA 3GWKC 4DXWA 1XMOO 1URFA 1OJHA 2ZCEA 4W4LA 4AQYB 3ZHRA 3CRMA 3FYIB 2QR4A 4LF7B 1K4DC 1V55C 3QNEA 3STLC 4WBNB 2IBZH 4JAUA 3FAVB 4QE9A 1BZKA 2IJKA 4WFEA 4BAYA 3K57A 2QEXV 2WLMA 3CCRV 1P49A 1P7GA 1JCHA 5LYJB 4JTCB 4I7ZB 1FYJA 1V55B 4JV5B 5EC2C 2W0XA 5KA5A 2E5LO 5KMGA 1M9NA 1KP3A 3VQXA 4TUYB 4HAMA 4FMTA 3K04A 4NTXA 4J11A 4YJ3B 3OAAG 4B3TO 2BTQA 1CP9A 1RFYA 3H1JH 2P06A 1XOUA 3C3TA 2VQFB 1HNWO 2P22C 3K59A 3N2KB 4PA6A 3FKSG 3CJHB 3KKYA 3ZEDA 4X20A 1XMQB 1WPXA 1KKDA 3SYPA 4BWAA 3T1CA 1YJWV 1EFRG 3QF7A 4WFBV 1WA8A 3UT5B 1K5QA 4DW0A 2ZQMA 4MSWC 2BOCC 3JASA 4B7EA 2PZSA 1V9PA 3B2EE 1W0JG 4R6ZA 4L87A 4UVAA 1X4TA 2XAJA 2D2CB 3JYCA 1WLEA 1SC5B 5BMVA 2QM7A 4X65O 5JWPA 4JTDB 4UV8A 2UUCO 3LDDA 2QSAA 4P9OA 1NTKH 2ZR2A 3W7SA 4X1IA 4IIJA 2F4VO 4DK1A 3AG2B 3S3WA 4K8XA 4MTFA 3ZBHA 4NXNB 2VQEB 4UVBA 3OMAB 4LH6A 3JCUZ 3T4DA 2YI9A 3QG5A 2YICA 3MHHC 1BE3H 3FYEB 2EIMB 4IYHA 5H5NA 3JAMN 2LW1A 3J80N 2EBOA 4GX5A 4LFAB 2OYQA 3RFRA 1GM9A 1SQVH 2JGUA 3E22B 5KX5A 4GKKB 2X6CA 2K9PA 5DM6V 4BIZA 4Q6GA 5KUKA 2EILB 2QGNA 1OCZC 4CH5A 2OCCB 3JD1A 1NZ6A 2Z3YA 3T4ZA 1Y4MA 5IDJA 3K58A 5CA0B 4LP8A 4PDMA 2UU9O 4NXNO 2CGNA 3H9VA 5JH7A 1EBOA 2XHBA 3CC4V 4FM0A 2OCHA 1HR0B 1ZL8B 1L8DA 3WB0A 4NXMB 2AZ0A 4N23A 2B1GA 1B06A 2W0FC 4LF5B 1EN6A 2LFSA 1PL4A 4JYAO 1Z5WA 4LR3A 2ADPA 1XDCA 4FLZA 1H2MA 1AI5A 1M56C 1KC8W 1R6TA 2QDOA 1XUQA 3ZRVA 3JSLA 4DV1B 4TT3G 3ZS8C 4LFCO 1B3QA 3JATA 4K8ZA 4EEQA 3BA9A 1TUBB 4CS2A 1CEZA 1H2SB 3J7AU 4DV2O 2P6JA 1RM1B 4FIPC 4X1IB 4MTXA 3QTCA 1KU9A 1YI2V 4GUNA 1AJNA 4D6TH 2N04A 1R6NA 2HHHO 4CS4A 2JGDB 2RCVA 3AG1C 3SYOA 1OCCB 2K1EA 5JQGA 5BY1A 1ZAUA 1N33B 4DR3O 1VQ5V 3CCSV 5C93A 4LC1A 5KHJA 1H2LA 2IH1C 1WA8B 3UT5A 1RPOA 1QVFU 2L6LA 3BVOA 4RAIA 2Q9LA 2QE7G 2ZE8A 3GB7C 3K5OA 4O4HA 4X20B 2EIJB 3AG7A 3TK1A 1Y76A 1COWG 4BW9A 2V4DA 2RDCA 3FB7C 3OUFA 5TISZ 3JALB 1WB7A 2JIZG 1M57C 3RT3C 1PPJH 1FFXA 3CCLV 1DF4A 2Q6AA 2HR3A 4YJ3A 3DXRA 1Y6XA 2FKXA 1DTOA 4JZGA 3AEIA 4GX2A 4I4TB 4CH4A 4PJ0Z 1L0NH 2PI4A 5CBGA 2ITDC 1HW7A 1XMOB 1S0VA 2DYSC 2YIBD 4P2ZA 1WN7A 4DR7B 1SQBH 4PV1B 5JQGB 5JJNB 2Z5UA 4JTAB 3QVNA 2JGDA 2AZ2A 3TJTA 2DYSB 4F6RA 5L3DA 3I55V 5KAIZ 4U3FH 3K08A 1M93A 4FFKA 3W7UA 1YXBA 1QR9A 1YEWA 2GSMB 2NN4A 4JZ2A 2RQ6A 3QO5A 2EINB 1K97A 1ORQC 3UO2A 3TXQA 3ZN0A 3RYIA 2BSKB 1H2GA 4DR2O 1TVKA 1WJZA 2KSDA 3K5NA 2ZKOA 4O2BB 3B8NA 4U7OA 4DRXB 1FJGO 4LF5O 2NLJC 5D5QA 4O4JB 4X9QA 3BHPA 1H8EG 5EZYB 4DR4O 3ZRXA 2QWQB 2QKSA 3D36A 1RSOB 2AXTZ 3AG2C 4R50A 5C8YB 4XDKA 5E79Z 1VQPV 2LFRA 4X64O 2KQXA 4MVMA 3HKDA 3M8AA 2HLDG 4HNAB 2F93B 2Y4TA 4LFBO 1R3LC 1Q90D 1K73W 1NTMH 3NR7A 4X89A 1GRJA 1N0JA 3CMEV 3P32A 2Q69A 5JJEB 3LDEA 4WCEV 1HNXO 1GTOA 2GDSA 2UXXA 4WFFA 4OPAA 1M4UA 1E1QG 1JQ0A 4NKGB 1AR1B 4QNHB 1AJQA 1R3KC 4JI0O 5DN6G 4PELA 2OCCC 1W0KG 4B3TB 3CXCU 1DGSA 3OTOO 3BRCA 2WLIB 1NH2D 1SZTA 4CZZA 3T1HB 3W7TA 2ODMA 5B1BC 2O57A 4KXRA 4UUJC 4TWKA 3RN4A 5H6RA 3WB2A 1H2NA 4BIOA 1VQ9V 1JOYA 1F7YA 2BOBC 1AI7A 1QNMA 4JPRA 1O9HA 3DSQA 3SJBC 4CH3A 4B3MO 3OUSA 2Y0IA 1K4CC
chains in the Genus database with same CATH topology
3K0DA 4MT8A 4QE9A 4HYOA 2FTKA 2IJKA 4WFEA 4BAYA 2QEXV 1YITV 3MHSC 2WLMA 1PNKA 3CCRV 2D3OW 1JCHA 4JTCB 3OEHG 1V55B 1QLNA 5B1OA 5EC2C 4G27B 4F4LA 5KA5A 1R3IC 2ZDIC 2XASA 2LP7A 1M9NA 5B1AB 5KA6A 1KP3A 4XDLA 5LBQA 1H38A 2AHYA 1OCZB 1J95A 3SPHA 4HAMA 2X7RB 4FMTA 5CA3A 1AI6A 3K04A 3JD2A 1JPXA 3OAAG 4DO2A 1AJPA 1CP9A 1YTFD 4MVZA 3X2QB 2XAGA 1VQKV 3SPGA 3E8FA 5EBMC 1OCOB 4MVRA 5L3CA 4PA6A 2EZPA 2X6AA 4MS2A 2IU0A 5L3FA 3FKSG 4X8AA 4JASA 4ASUG 3UM7A 5EBWC 1AI4A 3X2QC 1ROPA 4H37A 2ATKC 2ZXWB 1YSCA 1WPXA 4UV9A 1KKDA 3SYPA 5FL7G 4JYCA 1S5HC 4MW8A 3W7XA 1M56B 1XL6A 3T2MA 2WLHA 3T1CA 1YJWV 1K9MW 3ZJZA 1EFRG 5EC1C 1PKXA 3SYAA 4WFBV 5LHHA 3ZRWB 1K5QA 5LGTA 2ZQMA 1K33A 3BY6A 4MSWC 1Q82W 2BOCC 3SYCA 3P30A 3ZMVA 4RQFA 3JD0A 2EIMC 2P7TC 1MSWD 3G4SV 1Y66A 4PA7A 1OZ0A 4QPKA 1W0JG 4R6ZA 4QE7A 5H6QA 4L87A 3RW0A 2H94A 5J9PC 1FFTB 5EBLC 1KQSU 1I5YA 4UVAA 1VQ8V 2XAJA 2WLLB 3SPCA 2IH3C 3IGAC 3STZC 1VQ7V 3JYCA 1WLEA 2QM7A 4JTDB 3OM3B 4UV8A 5HFLA 1M1KW 1GM7A 1JX9A 3LDDA 2EJRA 3CP1A 2H8PC 3ABUA 4P9OA 3HPLC 3OGCC 2ZR2A 1QLEC 1XL4A 3W7SA 3RVZA 1K7DA 1KD1W 3AG2B 4I9WA 1BHBA 4MTFA 1B6QA 4QPJA 5GW7A 4MVUA 5CBHA 3LUTB 5B3SC 2JEXA 1K5SA 3F5WC 1S77D 2HG5C 1QLEB 3ZMUA 4UVBA 4J9ZB 3OMAB 5KUMA 3RVYA 2XAHA 3T4DA 2XAFA 2B5UA 2P90A 2CK3G 3MHHC 1GK9A 3FYEB 2HKOA 2EIMB 1M90W 1E79G 4E2LA 4QIWF 5IY5B 3E89A 2EBOA 3ETGA 1IXMA 4GX5A 4GCZA 4EKWA 1YIJV 2M7WA 2JDIG 1NVPD 1NVPB 3WFVA 1GM9A 3EFFK 3CPWU 3CCJV 2X6BA 1QCEA 2R9IA 2Y69C 3FB5C 2X6CA 3QO8A 4CBCA 3CYOA 3IFXA 5DM6V 5IYBO 4BIZA 4JYBA 5KUKA 2EILB 4FJCC 1G8MA 1M57B 1OCZC 2OCCB 3I56V 3JD1A 2Z3YA 1RM1C 1UJWB 3A0RA 3T4ZA 1Y4MA 5IDJA 1QBZA 3NXSA 3G71V 3ABTA 3E83A 4LP8A 4PDMA 1W2BU 3ABKC 3ETDA 3OR7C 1EBOA 4WFAV 3CC4V 3ABLB 3B8MA 2IU3A 1NR7A 5L3BA 4BIUA 4BW5A 3AG4C 3W7WA 5E1AC 4N23A 2B1GA 5LHGA 5CN0A 2W0FC 2LFSA 1GO3F 3ABLC 4MVSA 3K79A 4MTOA 3WG7C 1S3JA 2P67A 2ITCC 2DW4A 1Q86W 1AI5A 1M56C 1KC8W 3ASOC 4JGSA 3ZRVA 3HB3B 4WFGA 3OW2U 4TT3G 3OFNG 3D3IA 3FB6C 1SERA 5HFMA 1DLBA 1FS0G 3K3WA 1CEZA 2A0LA 4PA4A 3H01A 2R9RB 2P6JA 3ASOB 2NNUA 1F4NA 2EIJC 3STLC 4FIPC 2EIKC 2QA4V 1RM1B 1YTFB 1KECA 5CBFA 4MTXA 4RQEA 3ABKB 1YI2V 3CCQV 3OEEG 3OMNB 1YJ9V 1AJNA 1VQOV 2EINC 1R6NA 1Q81W 3KG2A 3E8GA 4Q20A 3AG1C 3MD0A 3SYOA 3FB8C 1QVGU 1OCCB 3DGEA 2K1EA 3E86A 1FXKA 3ABMB 3LSSA 2XAQA 2XNDG 3ZMTA 2EZOA 3JD3A 3K06A 3K9AA 1VQ5V 3ZN1A 2DQ0A 3IC7A 1OCOC 5LHIA 3CMAV 2JJ1G 3CCSV 1BMFG 5C93A 5L3EA 4LC1A 3CCUV 4GX0A 1R6KA 2IH1C 2Q67A 1L1FA 3ZRWA 3R65A 1RPOA 2V7QG 1NQTA 3ASNC 1FXHA 1QVFU 2F43G 2ZXWC 4RAIA 5LGUA 2QE7G 1OHHG 1GM8A 3GB7C 2IJHA 5IYDO 2XOKG 2EIJB 2MK3A 3TK1A 3CCEV 1FXKC 1COWG 3FB7C 1Q7YW 2W6IG 2YSUB 3OUFA 4LBEC 1V54B 4P9PA 4MTGA 2DYRB 2EILC 1VQ6V 3OE7G 2ZD9A 1K8AW 2DWEC 2JIZG 1M57C 4JAVA 1CPYA 1S72V 3CCLV 1DF4A 2Q6AA 2HR3A 4G2KA 1NBMG 1NH2B 5IYCO 2JEUA 4ZBMA 3ABMC 1FXVA 3JD4A 1DTOA 2DYRC 4PDRA 2AHZA 2A9HA 3AEIA 3UKMA 4GX2A 3B77A 3CCVV 2ZDIA 1EZJA 4Z1MG 3TCUA 4KFMA 4X88A 4UXNA 2PI4A 3PJSK 5CBGA 1NR1A 2ITDC 4RUEA 1GMGA 3GWOA 1BL8A 2W6JG 3LSQA 1S0VA 2DYSC 5B1BB 4J9YB 4P2ZA 4WFHA 1MABG 1S76D 1PL0A 1FXKB 1RPRA 1VQNV 4FK5C 2JK5C 1THZA 2Z5UA 4JTAB 1GKFA 2X0LA 1G4YB 1R73A 4XBFA 4ZKIA 1QR8A 2WSSG 2IW5A 2DYSB 3AG3B 5IY5C 1PD3A 2HVJC 5L3DA 3I55V 1DF5A 2EIKB 2Y48A 4R8CA 1K92A 3K08A 2YEVB 2WLIA 3G6EV 3W7UA 1SRYA 1OCRC 1ZWIC 1QR9A 2GSMB 1K34A 4YXWG 2IJJA 2JJ2G 3ZIAG 2DWDC 4XDJA 3AG3C 3QO5A 3E8BA 2EINB 1AROP 1K97A 1ORQC 5BZBA 1PNMA 2V1DA 2HFEC 3ZN0A 4MW3A 4GT1A 4KP4A 2QTOA 2WAMA 1H2GA 4PDLA 1OCRB 4QJFB 3BEHA 5B1AC 1KP2A 1JVMA 3E2EA 2WWWA 4G28B 1F4MA 1MG1A 3B8NA 2B1IA 1P4RA 3K0GA 4U7OA 3OR6C 4U7NA 2NLJC 2WPDG 2Q68A 1NKDA 3AG4B 1MOFA 2HVKC 1H8EG 3M99B 2WLKA 3E8HA 2ZR3A 4H33A 4FPPA 3F7YC 3ASNB 3ZRXA 2QKSA 3E35A 3WG7B 3D36A 1K3EA 4JF3A 3AG2C 1VQ4V 4R50A 4UVCA 4XDKA 1LNQA 2GHYA 2DQ3A 4OXSA 2LFRA 1VQPV 3F7VC 4MVMA 3ML0A 3ZMZA 5LGNA 5B3SB 2HLDG 2KB1A 5EK0A 3SPJA 3SPIA 2UXNA 3CCMV 5B1NA 1V54C 3LDCA 3JCZA 1SESA 1R3LC 4R7CA 1K73W 4WF9V 4X89A 2OTJV 2C2AA 3CMEV 4MVQA 3P32A 2Q69A 2WLJA 4GX1A 3DTUB 1JJ2U 1F51A 3LDEA 4WCEV 1GTOA 2UXXA 4WFFA 1TUEB 4RUFA 3K03A 4MVOA 4PA3A 1E1QG 1JQ0A 2Y69B 4PA9A 2IJIA 1PNLA 1F23A 1H8HG 2OTLV 1AR1B 4PDVA 3SJQC 3VBBA 3ZCCA 4QNHB 1AJQA 1E1RG 1R3KC 5DN6G 1N8RW 3QO7A 3TETA 3EHBB 4PELA 2OCCC 2A79B 4KUMA 1W0KG 3CXCU 3VOUA 3OMIB 4P30A 1SETA 3AG1B 3CD6V 4HZ3A 2WLIB 3SYQA 1OCCC 1NH2D 1SZTA 1I5XA 1ENVA 4CZZA 5CMUA 3ZRSA 2PI5A 1HWYA 4DXWA 1YHQV 2QM8A 4I5SA 3W7TA 5B1BC 1YJNV 1P7BA 4LCUC 3RBZA 4UUJC 3ZMSA 2WLLA 4TWKA 2WLNA 2HJFC 5H6RA 1NJIW 4TSFG 1VQ9V 1JOYA 3CC2V 1VQMV 2BOBC 1R3JC 4RO2A 2YEVA 1AI7A 3FYIB 1VQLV 5L3GA 3ETEA 4JPRA 3CC7V 3LNMB 5H9CA 1K4DC 1V55C 3QNEA 2OT5A 3OUSA 4N21A 1BHAA 1K4CC 4JAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN V;  5DM6 V;  1YJN V;  3CCE V;  3CCV V;  1VQ7 V;  2QA4 V;  1VQ4 V;  2QEX V;  1R73 A;  1Q7Y W;  1VQ5 V;  2OTL V;  3I56 V;  1YIT V;  1VQP V;  1NJI W;  3CCR V;  1VQ9 V;  1YJW V;  1K9M W;  2D3O W;  3CMA V;  1VQM V;  1M1K W;  3CC2 V;  3CCS V;  1N8R W;  3G71 V;  4WFB V;  3I55 V;  1VQK V;  3CCQ V;  1YI2 V;  1Q86 W;  1K8A W;  1YJ9 V;  1W2B U;  3CCU V;  1VQL V;  1VQO V;  3CXC U;  1Q82 W;  1KC8 W;  1M90 W;  3G6E V;  3CCM V;  4WFA V;  3CC7 V;  1YIJ V;  3CC4 V;  1VQ6 V;  1Q81 W;  3CD6 V;  3G4S V;  3OW2 U;  3CCL V;  1S72 V;  1QVF U;  1K73 W;  4WF9 V;  2OTJ V;  1KD1 W;  3CME V;  3CPW U;  1KQS U;  3CCJ V;  1JJ2 U;  1QVG U;  4WCE V;  1YHQ V;  1VQ8 V; 
#chains in the Genus database with same CATH topology
 3T1Y B;  2PF4 E;  4HYO A;  2QTS A;  3HKB A;  4ZOL B;  4LWS A;  2YID A;  1YIT V;  1HDJ A;  4FLT A;  4B3R O;  1Z2G A;  4OGQ B;  2Q7E A;  1IUR A;  3CJH A;  1QLN A;  4EB6 B;  4I50 B;  4X62 O;  1AIL A;  3G67 A;  4OPH A;  2XAS A;  5B1A B;  5KA6 A;  4XDL A;  1H38 A;  3JAL A;  3SPH A;  5CA3 A;  3N2G B;  1YCI A;  4LF4 B;  4AI8 A;  4TQD A;  2Y4U A;  1T5E A;  1Q6H A;  3E8F A;  1L0L H;  4DV7 O;  4IYI A;  4MVR A;  5L3C A;  3Q4H B;  2IU0 A;  1IZ3 A;  4DUZ B;  3UM7 A;  3N2G A;  4H37 A;  5GTH Z;  4DV7 B;  5FL7 G;  1G6U A;  4YJ2 B;  4MW8 A;  3T2M A;  2WLH A;  5GON B;  4JI8 B;  1MA1 A;  5GTI Z;  4X1K A;  3BY6 A;  4IL6 Z;  3P30 A;  4B3M B;  3B09 A;  3ZMV A;  3JD0 A;  2P7T C;  1D5A A;  1NTZ H;  4QE7 A;  5KAF Z;  1FFT B;  2RN9 A;  1I5Y A;  3SGI A;  2CAZ C;  1I94 B;  2YC0 A;  2WLL B;  4TV8 A;  3IGA C;  3A2F A;  1GN3 A;  3OM3 B;  1IXB A;  4B3S O;  1M1K W;  1EN5 A;  2EJR A;  1AR4 A;  3JAT B;  4I55 A;  3HPL C;  3LNN A;  3OGC C;  1XL4 A;  1KD1 W;  4FM2 A;  3RYF A;  1JMK C;  2N74 A;  4JI2 O;  1U96 A;  3LUT B;  1K5S A;  1XHX A;  1S77 D;  5KUM A;  2CK3 G;  1I0H A;  4X65 B;  3H1K H;  1E79 G;  4GYC B;  4QIW F;  4E2L A;  1VQ6 V;  4EKW A;  4FLW A;  2M7W A;  4J41 A;  3WFV A;  1FKA O;  3FB5 C;  5IYB O;  4GKJ O;  4JYB A;  1IVS A;  3BFR A;  4LF6 B;  2LGW A;  1XNQ O;  3I56 V;  1GN2 A;  5J2U B;  1UJW B;  2QJ1 A;  1N34 O;  1QBZ A;  3ABT A;  3E83 A;  2ZM6 B;  2Q7G A;  1W2B U;  3HKC B;  5LP6 B;  3ABK C;  3OR7 C;  3JAW B;  4YIO A;  3ABL B;  1NR7 A;  4QGP A;  4BIU A;  4BW5 A;  1BQ0 A;  3W7W A;  4IHJ A;  5CN0 A;  1GO3 F;  3ABL C;  4MVS A;  4PI0 A;  1S3J A;  1XNQ B;  2ITC C;  4LF6 O;  3RYH A;  1US6 A;  1Y67 A;  4JGS A;  4EFB A;  3HB3 B;  1H2K A;  3UO3 A;  2ZT9 B;  3OW2 U;  3OFN G;  5DEC A;  2Z0A A;  4DV1 O;  1QU7 A;  3H01 A;  2ZIO A;  1SA0 A;  2NNU A;  1Q3E A;  3U11 A;  5LOV B;  2ZM6 O;  3CCQ V;  1YJ9 V;  1KMI Z;  3THO A;  5B5E Z;  5KHH A;  3E8G A;  4J7K A;  3MD0 A;  2P4V A;  4JI4 O;  2ADQ B;  3FB8 C;  5GON A;  5BXZ A;  3LSS A;  1PV0 A;  3JD3 A;  3K06 A;  3K9A A;  1HNZ O;  1VEW A;  1B04 A;  1GH6 A;  2FML A;  2JJ1 G;  4JI6 B;  4NR1 A;  3CCU V;  1R6K A;  4X1K B;  1FFX B;  4DUZ O;  2V7Q G;  4FVM A;  4NB5 A;  3ASN C;  2F43 G;  4TV9 B;  1NS1 A;  1JA8 A;  1FD9 A;  1SKV A;  1OHH G;  1SS3 A;  5IYD O;  2IJH A;  4DV5 B;  1J5E B;  2ZE6 A;  1FXK C;  2L35 A;  4UB6 Z;  5KHI A;  1WP8 A;  3EXA A;  2ZD9 A;  2E75 B;  2DWE C;  1K8A W;  2WA3 A;  4JAV A;  1CPY A;  5AG2 A;  5JCO A;  2JVD A;  2JEU A;  2P4K A;  5LYJ A;  4DV6 B;  5H2F Z;  1Y76 B;  4PDR A;  4OX9 O;  2AHZ A;  2A9H A;  4YY3 O;  3AK2 A;  4O2A A;  4LF4 O;  3PJS K;  4TOI A;  4RUE A;  3CX5 F;  2ARH A;  1BL8 A;  1MAB G;  4X66 O;  1RPR A;  1VQN V;  4DR6 B;  3L74 H;  1THZ A;  4D7S A;  4U3J B;  3MDS A;  1G4Y B;  2CGO A;  4ZKI A;  3JSN A;  1PP9 H;  1VF7 A;  5IY5 C;  2HVJ C;  4GKJ B;  1DF5 A;  2EIK B;  2WLI A;  2UXB O;  1SQQ H;  1OCR C;  2FB5 A;  2EJ7 A;  5LMN B;  3RYC B;  1JFF A;  2IJJ A;  3ZIA G;  1JJO A;  2UUA O;  3CRR A;  3OTO B;  5BZB A;  2V1D A;  5IWA B;  4JI0 B;  3G6B A;  5IT9 N;  1VAR A;  1OCR B;  4QJF B;  2GBO A;  3BEH A;  1KP2 A;  1F4M A;  4UCO A;  3SDL A;  2KG7 B;  3K0G A;  3OR6 C;  3CHX A;  2JS5 A;  1NKD A;  5JH7 B;  1MOF A;  2HVK C;  2CH7 A;  3M99 B;  2WLK A;  2H3O A;  2ZR3 A;  2XT9 A;  4H33 A;  4IHJ B;  4DV4 O;  4JV5 O;  2LJ2 A;  3WG7 B;  2PYL A;  1XRE A;  2GHY A;  5EZY A;  3F7V C;  3ML0 A;  3JAW A;  3RWR D;  4X64 B;  4O4J A;  2YXY A;  1HNX B;  1V54 C;  2UUB O;  3L73 H;  4JI5 B;  2QM4 A;  2OTJ V;  2C2A A;  5IJ9 A;  1FJG B;  4GX1 A;  1NU1 H;  1JJ2 U;  2A7W A;  5FNV B;  1WB8 A;  3E22 A;  4PA9 A;  1PNL A;  2OTL V;  2DMX A;  2LO1 A;  3VBB A;  5IYZ A;  2R9A A;  3QO7 A;  4ZHQ A;  4P30 A;  3PN1 A;  1ENV A;  4NXM O;  1HWY A;  1YJN V;  2UUC B;  1P7B A;  4LCU C;  4GZR B;  3ZMS A;  2WLN A;  4FZ0 A;  4TSF G;  1TA8 A;  3BAB A;  3CC2 V;  2VQE O;  1R3J C;  4B3R B;  2YEV A;  4O4I B;  5L3G A;  4F6R B;  2QKC A;  2YXH A;  3LNM B;  4D7T A;  5H9C A;  2ZIM A;  5BMV B;  4N21 A;  2AW9 A;  4J7Z A;  4UCT A;  4O2A B;  2ZE5 A;  3C3S A;  4MT8 A;  3K5M A;  5KHK A;  1CXZ B;  1IX9 A;  1Z5V A;  4FZ1 A;  3AK3 A;  1PNK A;  3O9O A;  1VF6 C;  5EYP B;  3OEH G;  5B1O A;  4DR2 B;  1D2D A;  4G27 B;  4F4L A;  3Q4H A;  4GKK O;  1R3I C;  2YS8 A;  2LP7 A;  1SQP H;  1PM9 A;  2AHY A;  1OCZ B;  4YIP A;  1ZX3 A;  2BTQ B;  1AI6 A;  1ZUQ A;  2YIB A;  3SJA C;  3JAR B;  1JPX A;  4HBN A;  1YTF D;  3X2Q B;  3N2K A;  3JAK B;  3SPG A;  1IBK O;  3KCX A;  1EN4 A;  1YZB A;  3T1Y O;  5LL6 Y;  4JAS A;  4ASU G;  3X2Q C;  2ATK C;  1YSC A;  4UV9 A;  1S5H C;  3W7X A;  1M56 B;  4TV9 A;  1K9M W;  3ZJZ A;  5EC1 C;  1PKX A;  3ZRW B;  5JVD A;  5DED A;  3OTF A;  1Q82 W;  2PUS A;  1FAF A;  4DR3 B;  4RQF A;  4DR1 O;  1MSW D;  3G4S V;  1Y66 A;  4PA7 A;  4DV0 O;  1OZ0 A;  2H94 A;  4ZOL A;  1KQS U;  5EBL C;  4LFC B;  5LOV A;  3K5L A;  4WBN A;  3SPC A;  2IH3 C;  1VQ7 V;  2Q5Z A;  5HFL A;  1GM7 A;  1JX9 A;  4DR4 B;  3CP1 A;  1XI1 A;  2H8P C;  3ABU A;  1GN4 A;  3WU2 Z;  2VRZ A;  1WNS A;  1K7D A;  2Q8V A;  1BCC H;  2VWJ A;  2DN9 A;  5GW7 A;  1LR1 A;  4MVU A;  5B3S C;  2JEX A;  1P84 F;  2HG5 C;  3ZMU A;  2VWK A;  5FNV A;  3RVY A;  2XAH A;  2XAF A;  5EIB C;  2DOS A;  2RNB A;  4PD4 F;  1IDS A;  1GK9 A;  2HKO A;  5BR8 B;  2PY5 A;  4K0K O;  3D36 C;  5IY5 B;  5ITZ B;  1YIJ V;  4GCZ A;  5IYZ B;  1NVP D;  1NVP B;  2JDI G;  1KUQ A;  3KZI Z;  5LMU B;  3EFF K;  3HR0 A;  4FFB A;  3CPW U;  3CCJ V;  1QCE A;  2BTO A;  3IFX A;  4UCR A;  5J2T A;  3A8T A;  5FPR A;  1M57 B;  4CC5 A;  3UCS C;  4UFZ A;  2UU9 B;  4J42 A;  3G71 V;  2QWP B;  1S5L Z;  3ETD A;  4JI4 B;  2E3C A;  5CA1 A;  4ZIB A;  5L3B A;  1N36 B;  1RSO A;  5E1A C;  2Q73 A;  1W59 A;  5LHG A;  4ZI7 A;  2LGQ A;  1KKC A;  1MZE A;  2N05 A;  5BR8 O;  2UXD O;  4MTO A;  3WG7 C;  1MMM A;  2KG7 A;  1AP5 A;  2DW4 A;  1Q86 W;  3RYC A;  2CTQ A;  4IIJ B;  4JYA B;  4TQF A;  3FB6 C;  1GN6 A;  4IGG A;  3U10 A;  1FS0 G;  3K3W A;  1KBH A;  4PA4 A;  2R9R B;  1JFF B;  3A0B Z;  3I5D A;  3L70 H;  3ABK B;  4LNU B;  3AK1 A;  3OMN B;  3ZHS A;  4X66 B;  2EIN C;  1Q81 W;  4ICG A;  3KG2 A;  4C7U A;  1FXK A;  3ABM B;  5LA6 A;  2XND G;  4K35 A;  3ZMT A;  2EZO A;  4YJ2 A;  4I4T A;  2DE0 X;  3ZN1 A;  3IC7 A;  1OCO C;  2BE3 A;  5LHI A;  3CMA V;  3CRA A;  1BMF G;  1VP7 A;  4GX0 A;  2P5O A;  3CE2 A;  5JVD B;  3ZRW A;  1NQT A;  3VQY A;  2ZXW C;  5LGU A;  1GM8 A;  2XOK G;  1FPO A;  5LMN O;  3CRQ A;  4CH6 A;  1QQC A;  2W6I G;  2YSU B;  4LBE C;  1VF6 A;  4TUY A;  1A32 A;  2EIL C;  1MSD A;  1M5I A;  3H1L H;  3IC9 A;  2E76 B;  4X1Y A;  4I0X A;  4G2K A;  2VS0 A;  3S3X A;  5IYC O;  4DW1 A;  2CTR A;  1HR0 O;  2AGA A;  1IBK B;  3B77 A;  3HKB B;  2ZDI A;  2E5L B;  1EZJ A;  3BA8 A;  4Z1M G;  3TCU A;  4UXN A;  5K1P A;  1NR1 A;  4FLY A;  3GWO A;  4J10 A;  1ZLZ A;  1S5J A;  5B1B B;  4LF7 O;  5A9G A;  1RP3 B;  1TGO A;  4J9Y B;  2UUB B;  1G1X B;  1XNR B;  2EUL A;  1S76 D;  1AVM A;  1FXK B;  1PL0 A;  2QWN B;  5LA6 B;  2JK5 C;  4LFA O;  3ICX A;  1BS3 A;  1GKF A;  1R73 A;  4XBF A;  5IJ0 B;  3AG3 B;  2IW5 A;  2JS3 A;  2A06 H;  1PD3 A;  4AQY O;  1AB3 A;  4R8C A;  4B08 A;  4DV6 O;  1Q5O A;  1QHT A;  3FD9 A;  4YXW G;  2DWD C;  1XEQ A;  3AG3 C;  1SA0 B;  1PNM A;  2HFE C;  3L75 H;  4KP4 A;  2WAM A;  2CDY A;  2E74 B;  4PDL A;  1I08 A;  3R66 A;  5B1A C;  2LQT A;  5A2Q N;  3RYH B;  1IBL O;  1MG1 A;  2CTP A;  2QWO B;  4U7N A;  2Q68 A;  3AG4 B;  2UXB B;  3F7Y C;  3BAA A;  3E35 A;  1K3E A;  1VQ4 V;  4K0K B;  4UVC A;  3FFQ A;  1LNQ A;  5CA1 B;  4OXS A;  2ZNJ A;  2F1M A;  3D3Q A;  5KX5 B;  3ZMZ A;  4DR5 O;  5LGN A;  5B3S B;  5EK0 A;  2KB1 A;  2RJZ A;  3F5T A;  1ZTE A;  2UXN A;  3HKD B;  3LDC A;  1SES A;  2ETN A;  4WF9 V;  4DR1 B;  2WLJ A;  4JI3 B;  3DTU B;  1F51 A;  1TUE B;  4RUF A;  3N27 A;  4CS3 A;  5LMU O;  4I9Q A;  4PA3 A;  1SF9 A;  2IJI A;  3RYI B;  4PHZ A;  1N34 B;  4F6E A;  4DUY B;  4PDV A;  3DC6 A;  3ZCC A;  3HKE A;  1E1R G;  1N8R W;  5ITZ A;  4DRX A;  3TET A;  5IWA O;  1Q6I A;  2A79 B;  3P3N A;  1SET A;  4J7J A;  4HZ3 A;  1XBL A;  3SYQ A;  2PI5 A;  2Q0A A;  1YHQ V;  4PI2 A;  4B7K A;  2QM8 A;  3VQW A;  4I5S A;  2VQF O;  1HNW B;  1XQ8 A;  2PGG A;  3ZX6 A;  2GUZ A;  3RBZ A;  2WLL A;  3RYF B;  2HJF C;  1NJI W;  5IE9 A;  1VQM V;  3SJC C;  1AP6 A;  2R72 A;  4E4E A;  4RO2 A;  3G80 A;  4EFE A;  4UCV A;  1VQL V;  2Q0O C;  3ETE A;  3CC7 V;  1SQX H;  3CB2 A;  3P3P A;  2LW7 A;  2M6Y A;  2OT5 A;  4U3J A;  4TV8 B;  1BHA A;  3K0D A;  1YVW A;  4DV0 B;  2FTK A;  4FM1 A;  3MHS C;  2D3O W;  3JAS B;  3GVM A;  2ZDI C;  4X1Y B;  3TGU H;  3LSU A;  5LBQ A;  2GV9 A;  2XUM A;  1YDX A;  1J95 A;  1DK1 A;  2X7R B;  4KL1 A;  1EZV H;  4JYY A;  2ZNI A;  3JD2 A;  2QWR B;  5LP6 C;  4DO2 A;  2UXC B;  4I0X B;  1XIL A;  1AJP A;  4MVZ A;  2XAG A;  2A3Q A;  1VQK V;  2UXD B;  2YI8 A;  5EBM C;  1OCO B;  1HP8 A;  2EZP A;  2B9Z A;  2X6A A;  4MS2 A;  3CEI A;  5L3F A;  4EB6 A;  3L72 H;  4X8A A;  5EBW C;  1AI4 A;  1ROP A;  2MW2 B;  2ZXW B;  4JI6 O;  4LWS B;  3VQV A;  3APO A;  4JI1 B;  4KHP O;  4JYC A;  1XL6 A;  2JRI A;  3FAV A;  3D8C A;  1Y74 A;  3SYA A;  2HEP A;  5LHH A;  5LGT A;  4A5U B;  4I50 A;  1K33 A;  2F95 B;  4Z2W A;  5CB4 A;  3SYC A;  4DV3 O;  5FPO A;  3MAQ A;  2EIM C;  4JI1 O;  4JI5 O;  2YUA A;  4L8J A;  1VF5 B;  4QPK A;  1VMG A;  2ZIN A;  4LNU A;  3RW0 A;  5H6Q A;  5J9P C;  1O9G A;  1VQ8 V;  4GLX A;  2YDE A;  3STZ C;  2EX3 A;  3BPZ A;  1TUB A;  4KHP B;  3L71 H;  2BCC H;  2Y0P A;  1QLE C;  3O65 A;  3RVZ A;  4UB8 Z;  1IBM B;  4H13 B;  4H44 B;  4I9W A;  3OD4 A;  3RGB A;  2WA4 A;  1SQF A;  1NI8 A;  1BHB A;  1B6Q A;  4QPJ A;  5CBH A;  2G38 A;  3F5W C;  2F66 C;  4LH7 A;  1QLE B;  5JJJ B;  4X62 B;  4J9Z B;  3FX7 A;  1ZL8 A;  2B5U A;  3ZHT A;  2P90 A;  1N32 B;  1M90 W;  5KLV H;  4ZHQ B;  2OIE A;  3T1H O;  3E89 A;  3ETG A;  1IXM A;  2UUA B;  3EVK A;  2OIG A;  2X6B A;  2R9I A;  2Y69 C;  3QO8 A;  4CBC A;  3CYO A;  4FJC C;  5IJ9 B;  1G8M A;  1RM1 C;  3A0R A;  3NXS A;  1R1B A;  1YF2 A;  1Q43 A;  4W4K A;  4HNA A;  2CH7 B;  2YIA A;  4WFA V;  4RWU A;  4FLX A;  3B8M A;  1VIB A;  2IU3 A;  2HHH B;  3AG4 C;  4UCS A;  2BSK A;  3C90 A;  4JI8 O;  4NYK A;  4NTY A;  3K79 A;  1N32 O;  2P67 A;  4YY3 B;  4O2B A;  4LF9 B;  4DV2 B;  3ASO C;  4WFG A;  4DR6 O;  3D3I A;  1ZSP A;  4FLV A;  1SER A;  5HFM A;  1DLB A;  1SQG A;  2A0L A;  5IJ0 A;  4O4L A;  5EIB D;  3ASO B;  2GTA A;  1F4N A;  2EIJ C;  2QA4 V;  2EIK C;  1YTF B;  1KEC A;  5CBF A;  4RQE A;  3OEE G;  4DR5 B;  1WP7 A;  1VQO V;  3L9D A;  4J80 A;  2R70 A;  2CUG A;  5CB4 B;  1N36 O;  5LXT A;  1IBM O;  4Q20 A;  3BCC H;  1UFI A;  3M7M X;  1I94 O;  3CRC A;  4DV3 B;  2CTW A;  1QVG U;  3DGE A;  3E86 A;  2XAQ A;  2ZE7 A;  4NTW A;  4B3S B;  2DQ0 A;  3APQ A;  1HNZ B;  1JR9 A;  3DXR B;  1MNG A;  5L3E A;  1GAX A;  2Q67 A;  1L1F A;  3R65 A;  1XNR O;  1Y74 B;  1FXH A;  1J5E O;  4DV5 O;  1WAZ A;  4OX9 B;  1N0N A;  3JAK A;  4AIL C;  1XHZ A;  4IT5 A;  4H0L B;  1OV9 A;  2MK3 A;  4JAA A;  3CCE V;  5B66 Z;  3JAR A;  1Q7Y W;  4O4H B;  1V54 B;  4P9P A;  1EM1 A;  2XTA A;  4MTG A;  2DYR B;  2HJD A;  2Q7H A;  3OE7 G;  5FLX N;  1X59 A;  1S72 V;  2F23 A;  2FYU H;  3A0H Z;  1NBM G;  3ZHU A;  1NH2 B;  4ZBM A;  3ABM C;  1FXV A;  3JD4 A;  2DYR C;  3K9S A;  3UKM A;  3CCV V;  4ABM A;  1LUV A;  3CWB H;  4KFM A;  4X88 A;  5KMG B;  1N33 O;  3H1H H;  3UQ8 A;  4YHH B;  4BR6 A;  4LF8 O;  3SR2 C;  3ETQ A;  4K3A A;  3ZHQ A;  3TXS A;  5EYP A;  1GMG A;  2RMK B;  4DR7 O;  2W6J G;  3LSQ A;  4DV4 B;  1BGY H;  4DYL A;  1Q6U A;  4WFH A;  3U0Z A;  4JI7 O;  4FK5 C;  1Q8I A;  3CSX A;  3IAY A;  4AHC A;  1LUW A;  2X0L A;  1D5N A;  3KCY A;  5LXT B;  1QR8 A;  2WSS G;  4CC6 A;  4DUY O;  1MZF A;  2Y48 A;  1K92 A;  2YEV B;  4O4I A;  1XMQ O;  3G6E V;  2UXC O;  2ILM A;  1SRY A;  1ZWI C;  1K34 A;  2JJ2 G;  2GUZ B;  4XDJ A;  1NT2 B;  1N4C A;  1ARO P;  3E8B A;  4LFB B;  4O4L B;  2GTS A;  3ZHV A;  4ZI7 B;  4MW3 A;  4GT1 A;  2QTO A;  5JCO C;  5K1X A;  2NR5 A;  4LF9 O;  4DK0 A;  1JVM A;  3E2E A;  2WWW A;  4G28 B;  2B1I A;  1P4R A;  2WPD G;  1TAE A;  3HKE B;  4JI7 B;  3HKC A;  5LP6 A;  3E8H A;  4FPP A;  1WPB A;  5J2U A;  3ASN B;  4JF3 A;  5J2T B;  1IBL B;  4LF8 B;  2DQ3 A;  4YHH O;  4NVP A;  4UCU A;  5KHG A;  3SPJ A;  1KYO F;  2IM9 A;  3H1I H;  3SPI A;  2HP8 A;  3CCM V;  5B1N A;  5CA0 A;  3JCZ A;  2KKW A;  4JI3 O;  4JI2 B;  4R7C A;  1BQZ A;  4FLU A;  2YXL A;  5C8Y A;  4MVQ A;  3OGI B;  1BSM A;  3OT7 A;  2PYJ A;  1U97 A;  3K03 A;  1AR5 A;  3CS5 A;  4MVO A;  3WB1 A;  2DJV A;  2Y69 B;  3DC5 A;  4FFB B;  2QKA A;  1F23 A;  1H8H G;  1KB9 F;  2Q4P A;  3SJQ C;  2OWO A;  5D5P A;  4Z1V A;  1UPG A;  2CE4 A;  3EHB B;  3B40 A;  4KUM A;  3VOU A;  3OMI B;  1I7F A;  3AG1 B;  3CXH F;  2F4V B;  3J81 N;  3CD6 V;  1BT8 A;  2PTM A;  1TVK B;  1OCC C;  4I55 B;  3B4S A;  1I5X A;  3IJ4 A;  5F2V O;  1SZX A;  2FL4 A;  5CMU A;  3ZRS A;  3GWK C;  4DXW A;  1XMO O;  1URF A;  1OJH A;  2ZCE A;  4W4L A;  4AQY B;  3ZHR A;  3CRM A;  3FYI B;  2QR4 A;  4LF7 B;  1K4D C;  1V55 C;  3QNE A;  3STL C;  4WBN B;  2IBZ H;  4JAU A;  3FAV B;  4QE9 A;  1BZK A;  2IJK A;  4WFE A;  4BAY A;  3K57 A;  2QEX V;  2WLM A;  3CCR V;  1P49 A;  1P7G A;  1JCH A;  5LYJ B;  4JTC B;  4I7Z B;  1FYJ A;  1V55 B;  4JV5 B;  5EC2 C;  2W0X A;  5KA5 A;  2E5L O;  5KMG A;  1M9N A;  1KP3 A;  3VQX A;  4TUY B;  4HAM A;  4FMT A;  3K04 A;  4NTX A;  4J11 A;  4YJ3 B;  3OAA G;  4B3T O;  2BTQ A;  1CP9 A;  1RFY A;  3H1J H;  2P06 A;  1XOU A;  3C3T A;  2VQF B;  1HNW O;  2P22 C;  3K59 A;  3N2K B;  4PA6 A;  3FKS G;  3CJH B;  3KKY A;  3ZED A;  4X20 A;  1XMQ B;  1WPX A;  1KKD A;  3SYP A;  4BWA A;  3T1C A;  1YJW V;  1EFR G;  3QF7 A;  4WFB V;  1WA8 A;  3UT5 B;  1K5Q A;  4DW0 A;  2ZQM A;  4MSW C;  2BOC C;  3JAS A;  4B7E A;  2PZS A;  1V9P A;  3B2E E;  1W0J G;  4R6Z A;  4L87 A;  4UVA A;  1X4T A;  2XAJ A;  2D2C B;  3JYC A;  1WLE A;  1SC5 B;  5BMV A;  2QM7 A;  4X65 O;  5JWP A;  4JTD B;  4UV8 A;  2UUC O;  3LDD A;  2QSA A;  4P9O A;  1NTK H;  2ZR2 A;  3W7S A;  4X1I A;  4IIJ A;  2F4V O;  4DK1 A;  3AG2 B;  3S3W A;  4K8X A;  4MTF A;  3ZBH A;  4NXN B;  2VQE B;  4UVB A;  3OMA B;  4LH6 A;  3JCU Z;  3T4D A;  2YI9 A;  3QG5 A;  2YIC A;  3MHH C;  1BE3 H;  3FYE B;  2EIM B;  4IYH A;  5H5N A;  3JAM N;  2LW1 A;  3J80 N;  2EBO A;  4GX5 A;  4LFA B;  2OYQ A;  3RFR A;  1GM9 A;  1SQV H;  2JGU A;  3E22 B;  5KX5 A;  4GKK B;  2X6C A;  2K9P A;  5DM6 V;  4BIZ A;  4Q6G A;  5KUK A;  2EIL B;  2QGN A;  1OCZ C;  4CH5 A;  2OCC B;  3JD1 A;  1NZ6 A;  2Z3Y A;  3T4Z A;  1Y4M A;  5IDJ A;  3K58 A;  5CA0 B;  4LP8 A;  4PDM A;  2UU9 O;  4NXN O;  2CGN A;  3H9V A;  5JH7 A;  1EBO A;  2XHB A;  3CC4 V;  4FM0 A;  2OCH A;  1HR0 B;  1ZL8 B;  1L8D A;  3WB0 A;  4NXM B;  2AZ0 A;  4N23 A;  2B1G A;  1B06 A;  2W0F C;  4LF5 B;  1EN6 A;  2LFS A;  1PL4 A;  4JYA O;  1Z5W A;  4LR3 A;  2ADP A;  1XDC A;  4FLZ A;  1H2M A;  1AI5 A;  1M56 C;  1KC8 W;  1R6T A;  2QDO A;  1XUQ A;  3ZRV A;  3JSL A;  4DV1 B;  4TT3 G;  3ZS8 C;  4LFC O;  1B3Q A;  3JAT A;  4K8Z A;  4EEQ A;  3BA9 A;  1TUB B;  4CS2 A;  1CEZ A;  1H2S B;  3J7A U;  4DV2 O;  2P6J A;  1RM1 B;  4FIP C;  4X1I B;  4MTX A;  3QTC A;  1KU9 A;  1YI2 V;  4GUN A;  1AJN A;  4D6T H;  2N04 A;  1R6N A;  2HHH O;  4CS4 A;  2JGD B;  2RCV A;  3AG1 C;  3SYO A;  1OCC B;  2K1E A;  5JQG A;  5BY1 A;  1ZAU A;  1N33 B;  4DR3 O;  1VQ5 V;  3CCS V;  5C93 A;  4LC1 A;  5KHJ A;  1H2L A;  2IH1 C;  1WA8 B;  3UT5 A;  1RPO A;  1QVF U;  2L6L A;  3BVO A;  4RAI A;  2Q9L A;  2QE7 G;  2ZE8 A;  3GB7 C;  3K5O A;  4O4H A;  4X20 B;  2EIJ B;  3AG7 A;  3TK1 A;  1Y76 A;  1COW G;  4BW9 A;  2V4D A;  2RDC A;  3FB7 C;  3OUF A;  5TIS Z;  3JAL B;  1WB7 A;  2JIZ G;  1M57 C;  3RT3 C;  1PPJ H;  1FFX A;  3CCL V;  1DF4 A;  2Q6A A;  2HR3 A;  4YJ3 A;  3DXR A;  1Y6X A;  2FKX A;  1DTO A;  4JZG A;  3AEI A;  4GX2 A;  4I4T B;  4CH4 A;  4PJ0 Z;  1L0N H;  2PI4 A;  5CBG A;  2ITD C;  1HW7 A;  1XMO B;  1S0V A;  2DYS C;  2YIB D;  4P2Z A;  1WN7 A;  4DR7 B;  1SQB H;  4PV1 B;  5JQG B;  5JJN B;  2Z5U A;  4JTA B;  3QVN A;  2JGD A;  2AZ2 A;  3TJT A;  2DYS B;  4F6R A;  5L3D A;  3I55 V;  5KAI Z;  4U3F H;  3K08 A;  1M93 A;  4FFK A;  3W7U A;  1YXB A;  1QR9 A;  1YEW A;  2GSM B;  2NN4 A;  4JZ2 A;  2RQ6 A;  3QO5 A;  2EIN B;  1K97 A;  1ORQ C;  3UO2 A;  3TXQ A;  3ZN0 A;  3RYI A;  2BSK B;  1H2G A;  4DR2 O;  1TVK A;  1WJZ A;  2KSD A;  3K5N A;  2ZKO A;  4O2B B;  3B8N A;  4U7O A;  4DRX B;  1FJG O;  4LF5 O;  2NLJ C;  5D5Q A;  4O4J B;  4X9Q A;  3BHP A;  1H8E G;  5EZY B;  4DR4 O;  3ZRX A;  2QWQ B;  2QKS A;  3D36 A;  1RSO B;  2AXT Z;  3AG2 C;  4R50 A;  5C8Y B;  4XDK A;  5E79 Z;  1VQP V;  2LFR A;  4X64 O;  2KQX A;  4MVM A;  3HKD A;  3M8A A;  2HLD G;  4HNA B;  2F93 B;  2Y4T A;  4LFB O;  1R3L C;  1Q90 D;  1K73 W;  1NTM H;  3NR7 A;  4X89 A;  1GRJ A;  1N0J A;  3CME V;  3P32 A;  2Q69 A;  5JJE B;  3LDE A;  4WCE V;  1HNX O;  1GTO A;  2GDS A;  2UXX A;  4WFF A;  4OPA A;  1M4U A;  1E1Q G;  1JQ0 A;  4NKG B;  1AR1 B;  4QNH B;  1AJQ A;  1R3K C;  4JI0 O;  5DN6 G;  4PEL A;  2OCC C;  1W0K G;  4B3T B;  3CXC U;  1DGS A;  3OTO O;  3BRC A;  2WLI B;  1NH2 D;  1SZT A;  4CZZ A;  3T1H B;  3W7T A;  2ODM A;  5B1B C;  2O57 A;  4KXR A;  4UUJ C;  4TWK A;  3RN4 A;  5H6R A;  3WB2 A;  1H2N A;  4BIO A;  1VQ9 V;  1JOY A;  1F7Y A;  2BOB C;  1AI7 A;  1QNM A;  4JPR A;  1O9H A;  3DSQ A;  3SJB C;  4CH3 A;  4B3M O;  3OUS A;  2Y0I A;  1K4C C; 
#chains in the Genus database with same CATH homology
 3K0D A;  4MT8 A;  4QE9 A;  4HYO A;  2FTK A;  2IJK A;  4WFE A;  4BAY A;  2QEX V;  1YIT V;  3MHS C;  2WLM A;  1PNK A;  3CCR V;  2D3O W;  1JCH A;  4JTC B;  3OEH G;  1V55 B;  1QLN A;  5B1O A;  5EC2 C;  4G27 B;  4F4L A;  5KA5 A;  1R3I C;  2ZDI C;  2XAS A;  2LP7 A;  1M9N A;  5B1A B;  5KA6 A;  1KP3 A;  4XDL A;  5LBQ A;  1H38 A;  2AHY A;  1OCZ B;  1J95 A;  3SPH A;  4HAM A;  2X7R B;  4FMT A;  5CA3 A;  1AI6 A;  3K04 A;  3JD2 A;  1JPX A;  3OAA G;  4DO2 A;  1AJP A;  1CP9 A;  1YTF D;  4MVZ A;  3X2Q B;  2XAG A;  1VQK V;  3SPG A;  3E8F A;  5EBM C;  1OCO B;  4MVR A;  5L3C A;  4PA6 A;  2EZP A;  2X6A A;  4MS2 A;  2IU0 A;  5L3F A;  3FKS G;  4X8A A;  4JAS A;  4ASU G;  3UM7 A;  5EBW C;  1AI4 A;  3X2Q C;  1ROP A;  4H37 A;  2ATK C;  2ZXW B;  1YSC A;  1WPX A;  4UV9 A;  1KKD A;  3SYP A;  5FL7 G;  4JYC A;  1S5H C;  4MW8 A;  3W7X A;  1M56 B;  1XL6 A;  3T2M A;  2WLH A;  3T1C A;  1YJW V;  1K9M W;  3ZJZ A;  1EFR G;  5EC1 C;  1PKX A;  3SYA A;  4WFB V;  5LHH A;  3ZRW B;  1K5Q A;  5LGT A;  2ZQM A;  1K33 A;  3BY6 A;  4MSW C;  1Q82 W;  2BOC C;  3SYC A;  3P30 A;  3ZMV A;  4RQF A;  3JD0 A;  2EIM C;  2P7T C;  1MSW D;  3G4S V;  1Y66 A;  4PA7 A;  1OZ0 A;  4QPK A;  1W0J G;  4R6Z A;  4QE7 A;  5H6Q A;  4L87 A;  3RW0 A;  2H94 A;  5J9P C;  1FFT B;  5EBL C;  1KQS U;  1I5Y A;  4UVA A;  1VQ8 V;  2XAJ A;  2WLL B;  3SPC A;  2IH3 C;  3IGA C;  3STZ C;  1VQ7 V;  3JYC A;  1WLE A;  2QM7 A;  4JTD B;  3OM3 B;  4UV8 A;  5HFL A;  1M1K W;  1GM7 A;  1JX9 A;  3LDD A;  2EJR A;  3CP1 A;  2H8P C;  3ABU A;  4P9O A;  3HPL C;  3OGC C;  2ZR2 A;  1QLE C;  1XL4 A;  3W7S A;  3RVZ A;  1K7D A;  1KD1 W;  3AG2 B;  4I9W A;  1BHB A;  4MTF A;  1B6Q A;  4QPJ A;  5GW7 A;  4MVU A;  5CBH A;  3LUT B;  5B3S C;  2JEX A;  1K5S A;  3F5W C;  1S77 D;  2HG5 C;  1QLE B;  3ZMU A;  4UVB A;  4J9Z B;  3OMA B;  5KUM A;  3RVY A;  2XAH A;  3T4D A;  2XAF A;  2B5U A;  2P90 A;  2CK3 G;  3MHH C;  1GK9 A;  3FYE B;  2HKO A;  2EIM B;  1M90 W;  1E79 G;  4E2L A;  4QIW F;  5IY5 B;  3E89 A;  2EBO A;  3ETG A;  1IXM A;  4GX5 A;  4GCZ A;  4EKW A;  1YIJ V;  2M7W A;  2JDI G;  1NVP D;  1NVP B;  3WFV A;  1GM9 A;  3EFF K;  3CPW U;  3CCJ V;  2X6B A;  1QCE A;  2R9I A;  2Y69 C;  3FB5 C;  2X6C A;  3QO8 A;  4CBC A;  3CYO A;  3IFX A;  5DM6 V;  5IYB O;  4BIZ A;  4JYB A;  5KUK A;  2EIL B;  4FJC C;  1G8M A;  1M57 B;  1OCZ C;  2OCC B;  3I56 V;  3JD1 A;  2Z3Y A;  1RM1 C;  1UJW B;  3A0R A;  3T4Z A;  1Y4M A;  5IDJ A;  1QBZ A;  3NXS A;  3G71 V;  3ABT A;  3E83 A;  4LP8 A;  4PDM A;  1W2B U;  3ABK C;  3ETD A;  3OR7 C;  1EBO A;  4WFA V;  3CC4 V;  3ABL B;  3B8M A;  2IU3 A;  1NR7 A;  5L3B A;  4BIU A;  4BW5 A;  3AG4 C;  3W7W A;  5E1A C;  4N23 A;  2B1G A;  5LHG A;  5CN0 A;  2W0F C;  2LFS A;  1GO3 F;  3ABL C;  4MVS A;  3K79 A;  4MTO A;  3WG7 C;  1S3J A;  2P67 A;  2ITC C;  2DW4 A;  1Q86 W;  1AI5 A;  1M56 C;  1KC8 W;  3ASO C;  4JGS A;  3ZRV A;  3HB3 B;  4WFG A;  3OW2 U;  4TT3 G;  3OFN G;  3D3I A;  3FB6 C;  1SER A;  5HFM A;  1DLB A;  1FS0 G;  3K3W A;  1CEZ A;  2A0L A;  4PA4 A;  3H01 A;  2R9R B;  2P6J A;  3ASO B;  2NNU A;  1F4N A;  2EIJ C;  3STL C;  4FIP C;  2EIK C;  2QA4 V;  1RM1 B;  1YTF B;  1KEC A;  5CBF A;  4MTX A;  4RQE A;  3ABK B;  1YI2 V;  3CCQ V;  3OEE G;  3OMN B;  1YJ9 V;  1AJN A;  1VQO V;  2EIN C;  1R6N A;  1Q81 W;  3KG2 A;  3E8G A;  4Q20 A;  3AG1 C;  3MD0 A;  3SYO A;  3FB8 C;  1QVG U;  1OCC B;  3DGE A;  2K1E A;  3E86 A;  1FXK A;  3ABM B;  3LSS A;  2XAQ A;  2XND G;  3ZMT A;  2EZO A;  3JD3 A;  3K06 A;  3K9A A;  1VQ5 V;  3ZN1 A;  2DQ0 A;  3IC7 A;  1OCO C;  5LHI A;  3CMA V;  2JJ1 G;  3CCS V;  1BMF G;  5C93 A;  5L3E A;  4LC1 A;  3CCU V;  4GX0 A;  1R6K A;  2IH1 C;  2Q67 A;  1L1F A;  3ZRW A;  3R65 A;  1RPO A;  2V7Q G;  1NQT A;  3ASN C;  1FXH A;  1QVF U;  2F43 G;  2ZXW C;  4RAI A;  5LGU A;  2QE7 G;  1OHH G;  1GM8 A;  3GB7 C;  2IJH A;  5IYD O;  2XOK G;  2EIJ B;  2MK3 A;  3TK1 A;  3CCE V;  1FXK C;  1COW G;  3FB7 C;  1Q7Y W;  2W6I G;  2YSU B;  3OUF A;  4LBE C;  1V54 B;  4P9P A;  4MTG A;  2DYR B;  2EIL C;  1VQ6 V;  3OE7 G;  2ZD9 A;  1K8A W;  2DWE C;  2JIZ G;  1M57 C;  4JAV A;  1CPY A;  1S72 V;  3CCL V;  1DF4 A;  2Q6A A;  2HR3 A;  4G2K A;  1NBM G;  1NH2 B;  5IYC O;  2JEU A;  4ZBM A;  3ABM C;  1FXV A;  3JD4 A;  1DTO A;  2DYR C;  4PDR A;  2AHZ A;  2A9H A;  3AEI A;  3UKM A;  4GX2 A;  3B77 A;  3CCV V;  2ZDI A;  1EZJ A;  4Z1M G;  3TCU A;  4KFM A;  4X88 A;  4UXN A;  2PI4 A;  3PJS K;  5CBG A;  1NR1 A;  2ITD C;  4RUE A;  1GMG A;  3GWO A;  1BL8 A;  2W6J G;  3LSQ A;  1S0V A;  2DYS C;  5B1B B;  4J9Y B;  4P2Z A;  4WFH A;  1MAB G;  1S76 D;  1PL0 A;  1FXK B;  1RPR A;  1VQN V;  4FK5 C;  2JK5 C;  1THZ A;  2Z5U A;  4JTA B;  1GKF A;  2X0L A;  1G4Y B;  1R73 A;  4XBF A;  4ZKI A;  1QR8 A;  2WSS G;  2IW5 A;  2DYS B;  3AG3 B;  5IY5 C;  1PD3 A;  2HVJ C;  5L3D A;  3I55 V;  1DF5 A;  2EIK B;  2Y48 A;  4R8C A;  1K92 A;  3K08 A;  2YEV B;  2WLI A;  3G6E V;  3W7U A;  1SRY A;  1OCR C;  1ZWI C;  1QR9 A;  2GSM B;  1K34 A;  4YXW G;  2IJJ A;  2JJ2 G;  3ZIA G;  2DWD C;  4XDJ A;  3AG3 C;  3QO5 A;  3E8B A;  2EIN B;  1ARO P;  1K97 A;  1ORQ C;  5BZB A;  1PNM A;  2V1D A;  2HFE C;  3ZN0 A;  4MW3 A;  4GT1 A;  4KP4 A;  2QTO A;  2WAM A;  1H2G A;  4PDL A;  1OCR B;  4QJF B;  3BEH A;  5B1A C;  1KP2 A;  1JVM A;  3E2E A;  2WWW A;  4G28 B;  1F4M A;  1MG1 A;  3B8N A;  2B1I A;  1P4R A;  3K0G A;  4U7O A;  3OR6 C;  4U7N A;  2NLJ C;  2WPD G;  2Q68 A;  1NKD A;  3AG4 B;  1MOF A;  2HVK C;  1H8E G;  3M99 B;  2WLK A;  3E8H A;  2ZR3 A;  4H33 A;  4FPP A;  3F7Y C;  3ASN B;  3ZRX A;  2QKS A;  3E35 A;  3WG7 B;  3D36 A;  1K3E A;  4JF3 A;  3AG2 C;  1VQ4 V;  4R50 A;  4UVC A;  4XDK A;  1LNQ A;  2GHY A;  2DQ3 A;  4OXS A;  2LFR A;  1VQP V;  3F7V C;  4MVM A;  3ML0 A;  3ZMZ A;  5LGN A;  5B3S B;  2HLD G;  2KB1 A;  5EK0 A;  3SPJ A;  3SPI A;  2UXN A;  3CCM V;  5B1N A;  1V54 C;  3LDC A;  3JCZ A;  1SES A;  1R3L C;  4R7C A;  1K73 W;  4WF9 V;  4X89 A;  2OTJ V;  2C2A A;  3CME V;  4MVQ A;  3P32 A;  2Q69 A;  2WLJ A;  4GX1 A;  3DTU B;  1JJ2 U;  1F51 A;  3LDE A;  4WCE V;  1GTO A;  2UXX A;  4WFF A;  1TUE B;  4RUF A;  3K03 A;  4MVO A;  4PA3 A;  1E1Q G;  1JQ0 A;  2Y69 B;  4PA9 A;  2IJI A;  1PNL A;  1F23 A;  1H8H G;  2OTL V;  1AR1 B;  4PDV A;  3SJQ C;  3VBB A;  3ZCC A;  4QNH B;  1AJQ A;  1E1R G;  1R3K C;  5DN6 G;  1N8R W;  3QO7 A;  3TET A;  3EHB B;  4PEL A;  2OCC C;  2A79 B;  4KUM A;  1W0K G;  3CXC U;  3VOU A;  3OMI B;  4P30 A;  1SET A;  3AG1 B;  3CD6 V;  4HZ3 A;  2WLI B;  3SYQ A;  1OCC C;  1NH2 D;  1SZT A;  1I5X A;  1ENV A;  4CZZ A;  5CMU A;  3ZRS A;  2PI5 A;  1HWY A;  4DXW A;  1YHQ V;  2QM8 A;  4I5S A;  3W7T A;  5B1B C;  1YJN V;  1P7B A;  4LCU C;  3RBZ A;  4UUJ C;  3ZMS A;  2WLL A;  4TWK A;  2WLN A;  2HJF C;  5H6R A;  1NJI W;  4TSF G;  1VQ9 V;  1JOY A;  3CC2 V;  1VQM V;  2BOB C;  1R3J C;  4RO2 A;  2YEV A;  1AI7 A;  3FYI B;  1VQL V;  5L3G A;  3ETE A;  4JPR A;  3CC7 V;  3LNM B;  5H9C A;  1K4D C;  1V55 C;  3QNE A;  2OT5 A;  3OUS A;  4N21 A;  1BHA A;  1K4C C;  4JAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...