3CC4V

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cc4V00
2QA4V 1VQOV 4WF9V 1VQPV 1KC8W 3I56V 3CCLV 2D3OW 1JJ2U 1VQ4V 1VQLV 1YJNV 2QEXV 1VQNV 3CCSV 1K8AW 1YJ9V 3CCRV 1YJWV 1Q82W 3OW2U 1N8RW 1KQSU 1VQ9V 2OTJV 4WCEV 1VQKV 3CPWU 3CCQV 3CCMV 3CCEV 3CC7V 1S72V 1YIJV 3CCUV 2OTLV 3G4SV 1YHQV 1K73W 3CC2V 1Q86W 1Q7YW 1VQMV 3CMAV 3CD6V 3CMEV 1R73A 3G71V 1M90W 1VQ5V 1VQ6V 5DM6V 1QVFU 1VQ8V 3G6EV 1QVGU 1VQ7V 3CCVV 1Q81W 1NJIW 3CXCU 1M1KW 1YITV 3I55V 1YI2V 1K9MW 1KD1W 1W2BU 4WFAV 3CC4V 4WFBV 3CCJV
chains in the Genus database with same CATH superfamily
2YIAA 4DUYB 4DV3O 3T1YO 1K8AW 1YJ9V 1JPXA 2QJ1A 3N2KA 4DV1B 4FM1A 2XAQA 3G4SV 3TXSA 3ZMTA 2UUAB 3JATB 1F7YA 2GTAA 1IX9A 4BWAA 4E2LA 4X66B 1N36O 2HJDA 2A0LA 2DMXA 4DW0A 5IWAO 2R70A 1HW7A 1H2MA 1XILA 1H8EG 4O4IA 5JCOA 4MT8A 3H01A 4I0XA 1GAXA 2LW1A 5H5NA 4TV9B 1KD1W 2LQTA 3T2MA 4I4TA 4GYCB 1R3JC 1S5JA 1F4MA 3SYQA 1Q5OA 1TUBA 4LF5O 3JAWA 2WLIA 3E35A 1Q8IA 4I9WA 1NR7A 4YY3O 4B3MB 4J42A 4DUYO 3S3WA 4WFGA 2OYQA 1WA8B 1L8DA 5LGUA 1Q82W 2E75B 3VQXA 1IXMA 2YEVA 5K1PA 4K0KB 3OTOO 3B4SA 3JAMN 1R6TA 5J9PC 1XMQO 5CA3A 3ZMZA 5J2UA 1WPXA 4TSFG 2UUAO 4Q20A 3CC4V 4RAIA 4BW9A 1M5IA 1VQOV 3JASA 1ENVA 3F7VC 2JEUA 2BCCH 1JX9A 4MVUA 3E22B 3ZCCA 4LF8O 3H9VA 2LO1A 4AHCA 5IYZA 4FM2A 3OD4A 4JTCB 2HFEC 2IJKA 4PD4F 4HBNA 1SQXH 1H2NA 2XNDG 1SKVA 4DUZO 4W4KA 4DV7B 4O2BB 3RYCB 2UUCB 1VIBA 1PNMA 4R50A 3ZHUA 2A3QA 3E86A 1R6KA 2UXBO 1S3JA 1FJGO 4DK1A 4JI5O 1M57B 2Q6AA 4U3JB 2IBZH 4ZI7A 5KMGA 5LP6B 4JV5B 4MVMA 2ZKOA 3OW2U 4WBNB 3CYOA 5LA6A 3STLC 2Y0PA 4YHHO 2WLKA 2NN4A 3RVYA 4EEQA 5B1NA 1R1BA 1SZTA 3AG2B 3IFXA 4JAVA 4MVOA 1YTFD 1ZSPA 3JCZA 2GUZB 3T1YB 4H13B 3T4ZA 3SYOA 3OTFA 2Z5UA 1HNXB 1O9HA 3JARA 4IT5A 3LDCA 3CMAV 2O57A 4J7ZA 5JVDB 1SQGA 4YXWG 3D36C 3WFVA 2UXDO 2LW7A 4IIJB 4LF6O 4MTFA 2DOSA 1JOYA 3LDEA 1NI8A 1SQFA 1BGYH 2X6CA 4I50B 4DV4B 1WJZA 5B66Z 3MHHC 4JI4B 5CBHA 1YDXA 2UXBB 3HKDB 1XNRB 4NKGB 3JAKB 1AR4A 1PD3A 1SA0A 3ZMVA 1PL0A 2ZINA 4XDJA 2JEXA 4PI2A 3OMAB 2JGUA 4FLXA 2X0LA 2KG7A 3CMEV 3E8FA 4WFHA 5BZBA 3ZS8C 2EJRA 2FKXA 3TJTA 2EINC 3N27A 2BOCC 3MD0A 1E1QG 1K4DC 3LUTB 3VQVA 2ZNJA 3RWRD 1PM9A 2JS5A 3K9SA 2UU9O 2DW4A 2Y4UA 2DQ0A 2QWOB 1Q6HA 1H8HG 2OCCC 4J41A 2NR5A 2P06A 3ABKB 5KHGA 5IYCO 2QWNB 1HNXO 5D5QA 1NJIW 1V9PA 1EN4A 2EULA 1AROP 1OCOB 3A0RA 3K3WA 3K5MA 5JJEB 1N4CA 3J81N 1LUWA 1WP8A 1IBLB 3FFQA 3H1JH 1F4NA 4FZ0A 3T4DA 2R9IA 2UXCB 1IBMB 3F5TA 1FKAO 4UCVA 2YS8A 4QE9A 4CH3A 1WA8A 4JI7B 2Q67A 1ZAUA 2X7RB 2YEVB 1I94O 5CBGA 1BHBA 2HHHB 3UM7A 4I55B 4DR7O 1EN6A 4FVMA 1T5EA 1EZVH 2WA3A 4CH4A 1BZKA 5J2UB 4DUZB 5IJ9B 2B9ZA 3VBBA 3L9DA 1Q43A 1NBMG 4OPHA 3ABMC 3A0HZ 1FJGB 4JPRA 5FNVB 1GO3F 4NTYA 4Q6GA 5LP6C 1XBLA 1R3IC 4JAUA 3ABTA 2QR4A 4LH6A 1V54B 4GCZA 1JFFB 4A5UB 4DV1O 2YXHA 2UXNA 4JYAO 1K7DA 1P7GA 4NXMB 2CGNA 1RM1B 1TAEA 2JS3A 2D2CB 1K9MW 3OEHG 4XDKA 1QCEA 1J5EO 1K97A 4KHPB 1NTZH 1F51A 2VWKA 3SJQC 2ILMA 4U3JA 2EZOA 3JYCA 4QPKA 1Z5WA 4PI0A 4IHJA 1MABG 3SDLA 1N32B 5KMGB 1LNQA 1H2GA 2ZR3A 1P7BA 1VMGA 5IJ0B 2ZDIC 1GM9A 3HR0A 2WPDG 5LA6B 3EXAA 3L70H 2PZSA 3I55V 4JF3A 3CX5F 4JI0B 4FLYA 4O4HA 1FS0G 3ASOC 1HNWO 1L0NH 5ITZB 4RWUA 5H6RA 2IU3A 4GX0A 1U96A 3ZHQA 1WB7A 4CC5A 2CDYA 1R6NA 1RM1C 1UPGA 1EN5A 1KU9A 1GMGA 1M9NA 2E3CA 1PKXA 4TUYB 1QU7A 2XTAA 1I7FA 5DECA 3FKSG 3AG1C 2EZPA 4MVQA 3CJHA 3ZHRA 1NTMH 4CS3A 3K0GA 4FLZA 3CC7V 2WLLB 2Q0OC 3RYIA 3C90A 4LR3A 2ZE7A 3LSSA 4FFBB 4I50A 5IYDO 1IBKO 4D7TA 4UCTA 5LL6Y 2XAJA 4X1YB 4JYYA 3U0ZA 3CHXA 4CZZA 5LHGA 2QGNA 2W6IG 3HKDA 4DR4B 1XNQO 2Q4PA 3H1IH 2P22C 4R7CA 1J5EB 3IC7A 3JAKA 3ZJZA 3AG7A 5L3GA 3M7MX 5LMNO 4X1IA 4KL1A 3CCVV 4LH7A 2XHBA 4MW8A 1HNWB 1US6A 4ICGA 3HB3B 4DR2B 4MSWC 5JH7B 4J7KA 1MZEA 4DV0O 4R6ZA 4LNUA 5EZYA 1B6QA 4IYIA 4PDVA 1JJOA 4FLTA 1SESA 4JYCA 4XDLA 3G71V 2EIKC 5L3DA 2ZIMA 4YJ2A 2KKWA 4O2AA 3CRMA 3QNEA 1DLBA 1GTOA 2QEXV 3CD6V 5J2TB 1MA1A 4O4JA 4UXNA 4JZGA 1VQMV 3T1HB 4HNAB 2RJZA 3ETQA 2GBOA 1E1RG 1K33A 3ZRWA 2HP8A 4JI1B 2P4KA 2P5OA 1GN3A 4DR1O 4TT3G 5D5PA 4G27B 4ASUG 1BMFG 2YUAA 2E5LB 2H3OA 3IJ4A 3JSLA 4JTDB 4JI3B 1N34O 1N33B 4K35A 4CC6A 3K06A 1TGOA 4UV8A 1LUVA 4QE7A 3FAVB 5FNVA 4B3RO 3Q4HA 2F23A 3X2QC 1HNZO 3CCEV 3EFFK 2OTLV 3VQYA 1DGSA 2ODMA 1R73A 4LCUC 4CS4A 3JD4A 2PYJA 1SERA 2PI5A 1YF2A 2EIMB 2ZXWC 2RN9A 3WB1A 4LF9B 5EYPB 1XNRO 2FL4A 2QTSA 3BEHA 3ABLC 3UCSC 2WSSG 3ZN0A 3IAYA 3QO7A 1JCHA 4OPAA 2QWQB 1OCRB 1K4CC 2XAHA 1H38A 3AG4B 3C3SA 2Y69B 1FPOA 4P30A 5IJ0A 3T1HO 3ZRSA 2EIJC 3BY6A 3AG1B 1FD9A 4FIPC 1S0VA 4PDRA 3CRAA 5H9CA 5IWAB 2QE7G 1QLEB 4NXNO 4JI2O 3OT7A 4GX2A 1YSCA 4X65B 4UVAA 3T1CA 5IDJA 1Z5VA 4ZKIA 3BABA 4XBFA 4DYLA 4ZOLA 3CSXA 1PV0A 2CTQA 2QWPB 2LFSA 1VQPV 5KA5A 2YI9A 2R9RB 2CK3G 3ABMB 5LYJB 2QM8A 1SZXA 1XI1A 4TOIA 1FXKA 2Q73A 1EZJA 4YJ3B 5LMNB 2HVKC 1M90W 2R72A 2EIJB 1M93A 3G80A 3RYIB 1M56B 1M1KW 1IXBA 2YDEA 4FFBA 3ASNC 2MW2B 1K5SA 3OMIB 3OM3B 2WLMA 4X1YA 4O4LB 4LWSB 1AP6A 5CBFA 5B3SC 1AI7A 1HP8A 1E79G 2UUBO 3HKEA 3FX7A 1OCZB 1SRYA 1ZUQA 4RUEA 3GWKC 3H1LH 1NH2D 2CUGA 1XMQB 3LNMB 1EFRG 3ZEDA 4DR5O 4X1IB 1P4RA 3HKBB 3FB8C 4X88A 1DTOA 5IE9A 4DR6B 4N21A 1NU1H 2QM7A 4Z2WA 3CRRA 1DF5A 1TUEB 1VP7A 2P7TC 1BQ0A 5C8YA 1VQKV 4BIOA 2P90A 3N2GA 3CWBH 4DV5B 2EINB 5CA1B 5H2FZ 1MG1A 4LNUB 5EZYB 4Z1VA 5GTIZ 3K08A 4TQFA 3UT5B 2FB5A 2BSKA 5H6QA 2RDCA 4IGGA 2QWRB 4YJ2B 1QNMA 1OCCC 3K5OA 5KLVH 3IGAC 1OCZC 3M8AA 3K57A 3BRCA 2XUMA 2Q69A 2A9HA 2F1MA 3BA9A 5B5EZ 2VQFB 4PA6A 5CB4B 1VQ7V 4O4JB 2E5LO 4JGSA 5BMVA 2NNUA 3DTUB 3SPCA 3AK1A 1M57C 4B3SO 5FLXN 2P67A 3GB7C 1RPRA 2Q7EA 3SJAC 3DSQA 4UB8Z 4O4IB 4LFBO 3J7AU 4I0XB 5EC2C 4TV9A 3SYCA 2CTWA 2UUBB 1S77D 3L71H 1XQ8A 3CXCU 2M7WA 1Q3EA 2A06H 5KX5B 1W59A 5KUMA 1O9GA 1R3LC 1YTFB 1PNKA 4GKJO 1XOUA 3DC6A 1TUBB 5LOVB 1G8MA 2B1GA 1I5YA 2DJVA 4BIZA 2VRZA 2WLHA 1Q86W 4AILC 1BCCH 3BFRA 2BTQA 3E8HA 4LF6B 4K8XA 1Z2GA 2D3OW 4PA4A 4FMTA 5EYPA 1VQNV 2E74B 1XNQB 4Z1MG 4PDMA 3RBZA 4OGQB 3MAQA 4JI2B 3U10A 1WLEA 4NTWA 3L75H 1XMOB 2M6YA 1VF5B 3JASB 4NYKA 4WFFA 1KP2A 2VQFO 2ITDC 4NVPA 3RVZA 3E22A 5IY5B 2XOKG 3DGEA 4DR2O 3AK2A 4B3SB 4EFEA 5IYZB 3QO5A 3TXQA 1BHAA 3CCUV 4DV7O 4X20A 3APQA 1PPJH 4EB6A 5LMUB 1CEZA 4TWKA 4X9QA 1B06A 2PI4A 2YICA 1DK1A 4F4LA 2V1DA 3VQWA 2AHYA 3K79A 5CA0A 4ZOLB 2Q8VA 4NTXA 3E83A 4U3FH 1VQ9V 1BT8A 3HKCB 4DV3B 1HWYA 2Q7HA 5LBQA 1XHXA 2ADPA 1S72V 3FD9A 4AI8A 4G2KA 3TCUA 2A79B 5JJNB 3QVNA 3AEIA 3R66A 4YJ3A 2IU0A 4ZI7B 4LF4B 2IH3C 5BR8B 2JDIG 3D36A 1Q90D 3B77A 3ZRVA 4WFBV 3EHBB 3CCJV 4WBNA 1FFXA 1OCOC 2PF4E 1SS3A 2PY5A 4L8JA 4PA7A 2Z0AA 1H2SB 3KZIZ 3MDSA 4ZHQA 3MHSC 3FB5C 2GHYA 1I0HA 3E8GA 3G6BA 4TV8A 4FJCC 3ZHVA 2CAZC 3B8NA 4UCOA 4UCUA 2OCHA 2Q5ZA 4BW5A 2W6JG 1CP9A 2K1EA 4UVCA 3NXSA 5EBMC 4DR3B 3K59A 1OCRC 3B09A 3W7WA 5E1AC 3JARB 5A9GA 4RUFA 3JD0A 1VF7A 3IC9A 1ZTEA 2Y69C 4YHHB 1AJPA 1JMKC 5C8YB 1KYOF 4DRXA 2AZ0A 3G6EV 2DWDC 4IIJA 1OZ0A 3ICXA 3AG4C 1IVSA 4LF9O 1AB3A 2WLNA 3KG2A 3R65A 1G1XB 4OX9B 1B04A 1QR8A 2Q0AA 3SPHA 1NTKH 3D8CA 1Y74B 4LBEC 1V54C 3LSQA 2GDSA 1QQCA 5K1XA 3BVOA 3TETA 4IYHA 1QLEC 2Q68A 5GW7A 2PUSA 2YIBD 5JWPA 3J80N 5JQGB 1QLNA 3ZMSA 3PJSK 3QF7A 5BR8O 5EBLC 1N0JA 2BTOA 5BMVB 2YXYA 4F6RA 2ZD9A 2QKSA 4PA3A 1MMMA 3ML0A 1FXHA 2KG7B 4J80A 2ZIOA 4DV4O 3E2EA 3O65A 4GX1A 4N23A 4DV2O 5HFLA 3E8BA 2P4VA 5B3SB 2CGOA 3A0BZ 5LXTB 5BXZA 3RW0A 1F23A 1K5QA 2Y4TA 1VQLV 1ROPA 4DR3O 1RSOA 4JZ2A 4LFAO 1NS1A 4I9QA 4RQFA 4KP4A 1ZLZA 2UXCO 5LOVA 4QNHB 3ETGA 2UUCO 3ZHTA 1VQ8V 1YITV 3A8TA 4HAMA 3U11A 2X6BA 4X8AA 3JATA 1MNGA 2FMLA 2JIZG 1N8RW 3NR7A 1SQQH 3OUSA 4OX9O 3SPIA 2VQEB 4B08A 3W7UA 2JGDA 4I55A 1VQ5V 2IW5A 2ADQB 5LMUO 1GM8A 1OCCB 2QM4A 2BE3A 3ABUA 4DR5B 3F7YC 2Q7GA 3P3PA 4K3AA 5IJ9A 3ZHSA 1CPYA 4DV5O 1FXVA 4JI7O 3OTOB 1FXKC 3BCCH 3EVKA 3LNNA 1I94B 1QR9A 5EK0A 2EX3A 4G28B 5L3CA 4KFMA 1CXZB 1AP5A 1OV9A 3JAWB 2WA4A 3CP1A 4EB6B 1KC8W 1EM1A 1JFFA 3LDDA 1KB9F 4FLWA 2RQ6A 4JASA 4LF7B 4JAAA 2PGGA 1JR9A 3H1HH 3FB6C 3CCMV 2VS0A 2OIEA 1YHQV 1FAFA 1UFIA 3HKCA 3PN1A 3K5LA 3TK1A 2HEPA 3K04A 2OWOA 2ZR2A 2QSAA 2G38A 1W2BU 1L0LH 2JVDA 1Y6XA 5FL7G 1MOFA 4TQDA 1XEQA 4J7JA 4IHJB 3QTCA 3SJBC 2HVJC 3B40A 5E79Z 3D3QA 3GVMA 3VOUA 1FYJA 1M56C 3SR2C 2ZQMA 4ZHQB 4B7EA 4EKWA 2ARHA 1AI5A 4IL6Z 5KUKA 1GM7A 3F5WC 4JI5B 1UJWB 1XUQA 3A2FA 2AZ2A 3C3TA 1S5LZ 2EILB 4MTGA 3K03A 1VEWA 4FLVA 3CE2A 1L1FA 2X6AA 2QTOA 3HPLC 4JTAB 1J95A 2WWWA 4O2BA 3RYCA 1KECA 2YIDA 5EBWC 2BOBC 4MTOA 3CJHB 4GLXA 1GN6A 4J9YB 1OJHA 1URFA 1WNSA 5A2QN 1Q6IA 2WLLA 1VF6C 3JD3A 4DR4O 3OR7C 1KP3A 3OGIB 4JYBA 1Y74A 4YIPA 3AK3A 1Q7YW 4DR7B 3JD2A 2A7WA 1FFTB 2CTRA 1H2KA 1SF9A 5L3EA 1YZBA 2P6JA 2C2AA 3FYEB 4WFAV 4FM0A 3BAAA 5LHHA 1KMIZ 4QGPA 1OHHG 1JQ0A 2ZXWB 4H44B 4GT1A 5JQGA 1YJWV 5CMUA 1AI6A 3M99B 4MVSA 5KHHA 3WG7C 1Y67A 2XT9A 1WAZA 1IBKB 2JK5C 2KQXA 3B8MA 1AVMA 1VQ4V 2IJHA 5JVDA 1NKDA 3W7TA 5AG2A 1TVKA 3JALB 3OUFA 5LXTA 4K8ZA 4FK5C 3CCQV 2NLJC 1WPBA 2LFRA 1RSOB 4O2AB 3RN4A 1VQ6V 1EBOA 5EC1C 2DYSC 2W0FC 1PL4A 3ZBHA 1WB8A 4KHPO 5BY1A 1YEWA 2V7QG 2QDOA 1N32O 1V55C 5JJJB 4H33A 4PDLA 3BHPA 1YVWA 4HNAA 4GKKO 5GONA 3TGUH 1SA0B 4QPJA 4JI4O 4LFCO 3W7XA 2F4VB 1Y66A 3CRCA 4P2ZA 2JGDB 3ZRWB 1SETA 1SC5B 2N74A 2Y0IA 2ZT9B 3OFNG 3JCUZ 3CB2A 2LP7A 1MSWD 1IBLO 2DYRB 4KXRA 3ASNB 2Y48A 4JI0O 1PNLA 3SYAA 4B7KA 4FPPA 4LF7O 4RQEA 2DQ3A 4PJ0Z 3SJCC 2W0XA 2LGWA 5KHIA 4B3RB 3AG2C 4UCRA 2HR3A 4EFBA 1K73W 1HNZB 3KCYA 4MW3A 3ZN1A 3FAVA 2DWEC 4ZIBA 5DEDA 3LSUA 4R8CA 4JV5O 1KQSU 3RYHB 3K5NA 3P3NA 4I7ZB 1GK9A 1KBHA 5CN0A 5KAFZ 2QKAA 4KUMA 5C93A 1HR0O 2H94A 4PHZA 1I08A 1RP3B 4X62O 3W7SA 1W0JG 4DO2A 3AG3B 3B2EE 2K9PA 2E76B 3G67A 3K9AA 3OR6C 4OXSA 2B5UA 1IBMO 3CCRV 1I5XA 3RT3C 5B1BB 4LFCB 3DXRA 2F95B 4JYAB 1JA8A 1M4UA 1ZWIC 4GKKB 2CE4A 4NXMO 1VARA 2LGQA 3UKMA 2Z3YA 4U7OA 1JVMA 4PA9A 2XASA 4DV6O 4U7NA 1NZ6A 2WLJA 2AW9A 4DV0B 1YJNV 4DK0A 4HZ3A 1GN2A 1IDSA 4RO2A 4J10A 4B3TO 5JCOC 3JSNA 2F93B 4GX5A 5DM6V 1XHZA 1XDCA 2QKCA 2L6LA 4AQYO 4I5SA 3I56V 3CEIA 1FXKB 5B1BC 2EBOA 2VQEO 3DC5A 4X65O 1NQTA 4L87A 3WB0A 2UXXA 4BIUA 3ZIAG 1Y76A 4X1KA 4GUNA 3RGBA 1SQBH 2Q9LA 1G4YB 4X66O 1NVPB 2ZM6O 2RCVA 5KAIZ 1JJ2U 3X2QB 1BQZA 3O9OA 5IYBO 1G6UA 2DE0X 2UU9B 4O4HB 2OCCB 3OE7G 1Y4MA 1GRJA 3ETDA 5ITZA 1IZ3A 1HDJA 3P32A 1S5HC 1WP7A 2GV9A 1COWG 1N0NA 1D2DA 2GSMB 5TISZ 2YXLA 1N33O 4DV6B 2YC0A 1A32A 1QVFU 3HKBA 5EIBC 4PELA 1YI2V 3SYPA 3OGCC 3CRQA 2RMKB 3ABLB 1THZA 4JI3O 5KHJA 3N2GB 4P9OA 5LHIA 1P84F 4ABMA 5CA1A 2OT5A 4TUYA 3K58A 1KKDA 2ZE8A 1ZL8B 1TVKB 2FYUH 3JALA 3RFRA 3UT5A 2BSKB 2DN9A 2ZDIA 1QVGU 2F4VO 3CS5A 2IJIA 3KCXA 3CCLV 3H1KH 3CCSV 4MS2A 4NR1A 4CS2A 1R3KC 3GWOA 1AJNA 4K0KO 3RYFA 5CB4A 5B1AC 3APOA 2HKOA 5GONB 3ZMUA 2AHZA 4LF4O 5EIBD 3P30A 1YXBA 2F43G 4DW1A 4E4EA 2MK3A 2CTPA 3SPGA 3JD1A 4QJFB 3THOA 3ETEA 4JI8B 2L35A 5HFMA 2R9AA 2JJ1G 4QIWF 1YIJV 2PTMA 2CH7B 4UUJC 1D5NA 5JH7A 3OMNB 4NXNB 5KHKA 5KX5A 4UVBA 4DXWA 1AJQA 1SQPH 4BR6A 4UFZA 2JJ2G 3CXHF 3N2KB 3WG7B 2H8PC 3BA8A 1P49A 2HG5C 3WB2A 4JI1O 5B1AB 3QO8A 4FLUA 1W0KG 2ITCC 3E89A 4CH5A 3RYHA 5J2TA 2BTQB 4ZBMA 3L73H 1AILA 1KUQA 3ASOB 5GTHZ 1BS3A 1NR1A 4HYOA 4CBCA 2AXTZ 2F66C 4W4LA 1K3EA 5L3FA 1QHTA 2DYSB 2XAFA 3SGIA 1MSDA 4P9PA 5FPOA 3CC2V 3UO2A 4I4TB 3DXRB 1KKCA 2HJFC 4D6TH 1V55B 1PP9H 2AGAA 4JI6B 3D3IA 2QA4V 4X64B 2OIGA 4JI8O 4J11A 1GH6A 4UCSA 3SPJA 2N05A 1XREA 4X20B 1VF6A 2WLIB 3Q4HB 1NT2B 2RNBA 4FZ1A 3S3XA 1N34B 2EILC 4DV2B 1MZFA 1DF4A 1XMOO 1Q81W 5CA0B 1IURA 4J9ZB 4LC1A 2FTKA 2UXDB 2ZM6B 3UO3A 3BPZA 1S76D 1GKFA 2KB1A 3WU2Z 2IH1C 4H37A 1AI4A 1K92A 3FYIB 2ZE6A 2EIKB 4FFKA 4BAYA 4WCEV 2ZNIA 5IT9N 2YSUB 2EJ7A 2B1IA 2LJ2A 1SQVH 4MVZA 3I5DA 4PV1B 1TA8A 4MTXA 1FFXB 5B1OA 1QBZA 1NH2B 3L72H 4X1KB 1Y76B 2ZE5A 1H2LA 2OTJV 4F6EA 5L3BA 4TV8B 3QG5A 3AG3C 4UV9A 4NB5A 3OAAG 4LFBB 1BE3H 3FB7C 2YIBA 4GKJB 2KSDA 3L74H 3OEEG 5F2VO 4WF9V 4JI6O 4D7SA 1ORQC 2PYLA 2VWJA 4X64O 1K34A 2GTSA 4DRXB 1AR5A 1NVPD 4LF8B 1ZX3A 5LYJA 1HR0B 5KA6A 2IJJA 1XL4A 1U97A 4CH6A 1X59A 4X62B 1ZL8A 2WAMA 4YIOA 2YI8A 4WFEA 1N36B 3KKYA 3STZC 4LP8A 5LP6A 5IY5C 2V4DA 1B3QA 2ETNA 1RFYA 2HLDG 3UQ8A 4O4LA 2EIMC 4LWSA 1WN7A 4DR1B 3RYFB 1D5AA 3HKEB 5LGNA 2HHHO 2IM9A 1YCIA 2GUZA 1BSMA 1GN4A 1LR1A 3ABKC 4F6RB 1RPOA 1AR1B 2ZCEA 1BL8A 2ATKC 4MVRA 1XL6A 5DN6G 1Q6UA 3CPWU 3ZRXA 3ZX6A 5LGTA 2JRIA 4B3TB 4LFAB 4YY3B 4B3MO 4UB6Z 4GZRB 4X89A 2DYRC 2N04A 4H0LB 2CH7A 4DR6O 4C7UA 4LF5B 2XAGA 3K0DA 5FPRA 1X4TA 4AQYB
chains in the Genus database with same CATH topology
2V1DA 2AHYA 3K79A 3FKSG 3AG1C 2EZPA 4MVQA 3E83A 1K8AW 1YJ9V 4R8CA 1JPXA 1KQSU 1VQ9V 3K0GA 1HWYA 5LBQA 1GK9A 3CC7V 1S72V 2WLLB 5CN0A 4KUMA 2XAQA 5C93A 3G4SV 2H94A 4G2KA 3TCUA 2A79B 3LSSA 3ZMTA 3AEIA 5IYDO 3W7SA 1W0JG 4DO2A 3AG3B 2IU0A 2XAJA 2IH3C 2JDIG 3D36A 4E2LA 3B77A 3ZRVA 4WFBV 5LHGA 4CZZA 3EHBB 3K9AA 3CCJV 1OCOC 2W6IG 3OR6C 4OXSA 4PA7A 2B5UA 2A0LA 3CCRV 1I5XA 4R7CA 3IC7A 3ZJZA 5B1BB 3MHSC 5L3GA 3FB5C 2GHYA 1H8EG 1ZWIC 3E8GA 4FJCC 4MT8A 3B8NA 3H01A 3CCVV 3UKMA 2Z3YA 4U7OA 1JVMA 4BW5A 2W6JG 1CP9A 2XASA 4MW8A 4PA9A 1KD1W 2K1EA 3T2MA 4U7NA 4UVCA 2WLJA 1R3JC 3NXSA 5EBMC 1OCRC 1YJNV 1F4MA 3HB3B 3W7WA 5E1AC 4MSWC 4RUFA 3JD0A 3SYQA 4R6ZA 1B6QA 4HZ3A 4PDVA 2Y69C 1AJPA 4RO2A 1SESA 1MSWD 4JYCA 4XDLA 3G71V 2EIKC 5L3DA 5DM6V 4GX5A 3G6EV 2DWDC 2WLIA 3E35A 4I9WA 1NR7A 1OZ0A 3AG4C 3QNEA 1GTOA 1DLBA 2WLNA 3KG2A 4I5SA 3I56V 3R65A 1QR8A 1FXKB 2QEXV 4WFGA 5B1BC 3CD6V 5LGUA 1Q82W 3SPHA 4LBEC 1IXMA 2EBOA 2YEVA 1V54C 3LSQA 1NQTA 4UXNA 4L87A 1VQMV 5J9PC 2UXXA 3TETA 4BIUA 3ZIAG 1QLEC 2Q68A 5GW7A 5CA3A 3ZMZA 1WPXA 4TSFG 1G4YB 4Q20A 3CC4V 1NVPB 1QLNA 3ZMSA 4RAIA 3PJSK 1VQOV 1E1RG 5EBLC 1ENVA 1K33A 1JJ2U 3X2QB 3ZRWA 3F7VC 5IYBO 2JEUA 2ZD9A 2QKSA 4PA3A 2OCCB 3OE7G 3ML0A 1FXHA 1Y4MA 1JX9A 3ETDA 4MVUA 3P32A 1S5HC 3E2EA 1COWG 3ZCCA 4GX1A 2GSMB 4N23A 4TT3G 1QVFU 4G27B 4ASUG 1BMFG 4PELA 5HFLA 3E8BA 4JTDB 1YI2V 3SYPA 4JTCB 3OGCC 2HFEC 2IJKA 3ABLB 5B3SB 3K06A 1THZA 4UV8A 4QE7A 3RW0A 1F23A 4P9OA 1K5QA 5LHIA 1VQLV 2XNDG 1ROPA 2OT5A 3X2QC 1KKDA 3CCEV 1PNMA 3EFFK 4RQFA 2OTLV 4R50A 4KP4A 3E86A 4QNHB 1R6KA 3ETGA 1S3JA 1R73A 4LCUC 2ZDIA 3JD4A 1VQ8V 1SERA 1QVGU 2PI5A 1YITV 2EIMB 2IJIA 1M57B 2ZXWC 2Q6AA 4HAMA 2X6BA 3BEHA 4X8AA 3CCLV 3ABLC 2WSSG 3ZN0A 2JIZG 3CCSV 4MVMA 1N8RW 4MS2A 3OW2U 1R3KC 3OUSA 3SPIA 3CYOA 3GWOA 3QO7A 1AJNA 1JCHA 3STLC 5B1AC 1OCRB 2WLKA 1K4CC 2XAHA 1H38A 3AG4B 3W7UA 2HKOA 1VQ5V 2IW5A 3RVYA 3ZMUA 5B1NA 2AHZA 1GM8A 3AG2B 1SZTA 1OCCB 2Y69B 3P30A 3ABUA 4P30A 2F43G 3ZRSA 2EIJC 3BY6A 3IFXA 4JAVA 3AG1B 4MVOA 1YTFD 3F7YC 2MK3A 4FIPC 3JCZA 3SPGA 1S0VA 3JD1A 4PDRA 4QJFB 5H9CA 3T4ZA 2QE7G 3ETEA 3SYOA 1QLEB 5HFMA 2Z5UA 2JJ1G 1CPYA 4QIWF 1FXVA 4GX2A 1YIJV 1YSCA 4UVAA 3T1CA 4UUJC 1FXKC 5IDJA 4ZKIA 3OMNB 3LDCA 3CMAV 1QR9A 5EK0A 4UVBA 4XBFA 4G28B 4DXWA 5L3CA 1AJQA 4KFMA 4YXWG 3CP1A 3WFVA 2LFSA 1VQPV 2JJ2G 1KC8W 5KA5A 3LDDA 3WG7B 2H8PC 4JASA 2R9RB 2CK3G 3ABMB 4MTFA 2HG5C 1JOYA 5B1AB 2QM8A 3LDEA 3QO8A 2X6CA 3FB6C 3CCMV 1FXKA 1EZJA 1W0KG 1YHQV 2ITCC 3E89A 2HVKC 1M90W 3MHHC 4ZBMA 2EIJB 3TK1A 3K04A 1M56B 1M1KW 2ZR2A 5CBHA 3ASNC 3ASOB 1W2BU 1K5SA 1NR1A 4HYOA 5FL7G 1MOFA 3OM3B 3OMIB 4CBCA 2WLMA 1PD3A 3ZMVA 1K3EA 1PL0A 5L3FA 5CBFA 2HVJC 4XDJA 2JEXA 5B3SC 2DYSB 1AI7A 3VOUA 1E79G 1M56C 2XAFA 3OMAB 1OCZB 4P9PA 2X0LA 1SRYA 3CC2V 4RUEA 1NH2D 3CMEV 3E8FA 2ZQMA 4WFHA 2HJFC 5BZBA 4EKWA 1AI5A 2EJRA 3LNMB 5KUKA 1EFRG 1GM7A 1V55B 3F5WC 1UJWB 2EINC 2BOCC 3D3IA 1P4RA 1K4DC 1E1QG 3MD0A 3FB8C 3LUTB 4X88A 1DTOA 2EILB 2QA4V 4MTGA 3K03A 4N21A 2QM7A 1DF5A 1TUEB 2DW4A 3SPJA 2P7TC 1VQKV 1L1FA 2DQ0A 2P90A 2X6AA 1H8HG 2OCCC 2EINB 2WLIB 3ABKB 2QTOA 3HPLC 5IYCO 4JTAB 1J95A 2WWWA 1MG1A 1KECA 2EILC 1DF4A 1NJIW 1Q81W 5EBWC 2BOBC 1AROP 3K08A 1OCOB 3A0RA 3K3WA 4MTOA 4J9ZB 4LC1A 5H6QA 2FTKA 4J9YB 1S76D 1GKFA 2KB1A 1F4NA 2IH1C 1OCCC 2WLLA 4H37A 2R9IA 1AI4A 1K92A 1OCZC 3FYIB 2EIKB 3IGAC 3T4DA 4BAYA 4WCEV 3JD3A 2YSUB 2B1IA 3OR7C 1KP3A 4QE9A 4JYBA 4MVZA 2Q67A 2A9HA 2Q69A 1Q7YW 4PA6A 2X7RB 2YEVB 5CBGA 3JD2A 4MTXA 1VQ7V 1BHBA 1FFTB 5B1OA 4JGSA 3UM7A 5L3EA 1QBZA 2P6JA 2C2AA 3FYEB 4WFAV 2NNUA 1NH2B 3DTUB 3SPCA 5LHHA 1M57C 1JQ0A 1OHHG 2ZXWB 2P67A 3GB7C 4GT1A 1RPRA 2OTJV 1YJWV 5CMUA 5L3BA 3VBBA 1AI6A 1NBMG 3M99B 4MVSA 3AG3C 4UV9A 3WG7C 5EC2C 3ABMC 3SYCA 3OAAG 1S77D 2JK5C 3CXCU 4JPRA 3B8MA 3FB7C 2M7WA 1VQ4V 2IJHA 5KUMA 1GO3F 1R3LC 3OEEG 4WF9V 1YTFB 1R3IC 1NKDA 1PNKA 4JAUA 3W7TA 3ABTA 1ORQC 1V54B 4GCZA 1K34A 1G8MA 2B1GA 3OUFA 4FK5C 3CCQV 1I5YA 2NLJC 2UXNA 1K7DA 4BIZA 1NVPD 2LFRA 2WLHA 5KA6A 1Q86W 2IJJA 1VQ6V 1RM1B 1EBOA 1XL4A 2DYSC 2W0FC 5EC1C 2WAMA 1K9MW 4WFEA 3OEHG 3STZC 4XDKA 4LP8A 1QCEA 5IY5C 3E8HA 1K97A 1F51A 2V7QG 2D3OW 3SJQC 4PA4A 1V55C 4FMTA 1VQNV 2EZOA 3JYCA 4H33A 4QPKA 4PDLA 4Z1MG 2HLDG 4PDMA 3RBZA 1MABG 1LNQA 1H2GA 2EIMC 4QPJA 2ZR3A 1P7BA 2ZDIC 1GM9A 1WLEA 2WPDG 5LGNA 3W7XA 3I55V 4WFFA 1Y66A 1KP2A 4P2ZA 3ZRWB 1SETA 4JF3A 3ABKC 3OFNG 2LP7A 1RPOA 1FS0G 2ITDC 1AR1B 2DYRB 3RVZA 3ASOC 1BL8A 2ATKC 3ASNB 2Y48A 4MVRA 2XOKG 5IY5B 1PNLA 3SYAA 4FPPA 3DGEA 5H6RA 2IU3A 4RQEA 2DQ3A 4GX0A 1XL6A 5DN6G 3CPWU 3ZRXA 3AG2C 3QO5A 1BHAA 2HR3A 3CCUV 5LGTA 1R6NA 1RM1C 1K73W 4X89A 2DYRC 1GMGA 1CEZA 4MW3A 3ZN1A 4TWKA 1M9NA 2DWEC 2PI4A 2XAGA 3K0DA 1PKXA 4F4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 V;  1VQO V;  4WF9 V;  1VQP V;  1KC8 W;  3I56 V;  3CCL V;  2D3O W;  1JJ2 U;  1VQ4 V;  1VQL V;  1YJN V;  2QEX V;  1VQN V;  3CCS V;  1K8A W;  1YJ9 V;  3CCR V;  1YJW V;  1Q82 W;  3OW2 U;  1N8R W;  1KQS U;  1VQ9 V;  2OTJ V;  4WCE V;  1VQK V;  3CPW U;  3CCQ V;  3CCM V;  3CCE V;  3CC7 V;  1S72 V;  1YIJ V;  3CCU V;  2OTL V;  3G4S V;  1YHQ V;  1K73 W;  3CC2 V;  1Q86 W;  1Q7Y W;  1VQM V;  3CMA V;  3CD6 V;  3CME V;  1R73 A;  3G71 V;  1M90 W;  1VQ5 V;  1VQ6 V;  5DM6 V;  1QVF U;  1VQ8 V;  3G6E V;  1QVG U;  1VQ7 V;  3CCV V;  1Q81 W;  1NJI W;  3CXC U;  1M1K W;  1YIT V;  3I55 V;  1YI2 V;  1K9M W;  1KD1 W;  1W2B U;  4WFA V;  3CC4 V;  4WFB V;  3CCJ V; 
#chains in the Genus database with same CATH topology
 2YIA A;  4DUY B;  4DV3 O;  3T1Y O;  1K8A W;  1YJ9 V;  1JPX A;  2QJ1 A;  3N2K A;  4DV1 B;  4FM1 A;  2XAQ A;  3G4S V;  3TXS A;  3ZMT A;  2UUA B;  3JAT B;  1F7Y A;  2GTA A;  1IX9 A;  4BWA A;  4E2L A;  4X66 B;  1N36 O;  2HJD A;  2A0L A;  2DMX A;  4DW0 A;  5IWA O;  2R70 A;  1HW7 A;  1H2M A;  1XIL A;  1H8E G;  4O4I A;  5JCO A;  4MT8 A;  3H01 A;  4I0X A;  1GAX A;  2LW1 A;  5H5N A;  4TV9 B;  1KD1 W;  2LQT A;  3T2M A;  4I4T A;  4GYC B;  1R3J C;  1S5J A;  1F4M A;  3SYQ A;  1Q5O A;  1TUB A;  4LF5 O;  3JAW A;  2WLI A;  3E35 A;  1Q8I A;  4I9W A;  1NR7 A;  4YY3 O;  4B3M B;  4J42 A;  4DUY O;  3S3W A;  4WFG A;  2OYQ A;  1WA8 B;  1L8D A;  5LGU A;  1Q82 W;  2E75 B;  3VQX A;  1IXM A;  2YEV A;  5K1P A;  4K0K B;  3OTO O;  3B4S A;  3JAM N;  1R6T A;  5J9P C;  1XMQ O;  5CA3 A;  3ZMZ A;  5J2U A;  1WPX A;  4TSF G;  2UUA O;  4Q20 A;  3CC4 V;  4RAI A;  4BW9 A;  1M5I A;  1VQO V;  3JAS A;  1ENV A;  3F7V C;  2JEU A;  2BCC H;  1JX9 A;  4MVU A;  3E22 B;  3ZCC A;  4LF8 O;  3H9V A;  2LO1 A;  4AHC A;  5IYZ A;  4FM2 A;  3OD4 A;  4JTC B;  2HFE C;  2IJK A;  4PD4 F;  4HBN A;  1SQX H;  1H2N A;  2XND G;  1SKV A;  4DUZ O;  4W4K A;  4DV7 B;  4O2B B;  3RYC B;  2UUC B;  1VIB A;  1PNM A;  4R50 A;  3ZHU A;  2A3Q A;  3E86 A;  1R6K A;  2UXB O;  1S3J A;  1FJG O;  4DK1 A;  4JI5 O;  1M57 B;  2Q6A A;  4U3J B;  2IBZ H;  4ZI7 A;  5KMG A;  5LP6 B;  4JV5 B;  4MVM A;  2ZKO A;  3OW2 U;  4WBN B;  3CYO A;  5LA6 A;  3STL C;  2Y0P A;  4YHH O;  2WLK A;  2NN4 A;  3RVY A;  4EEQ A;  5B1N A;  1R1B A;  1SZT A;  3AG2 B;  3IFX A;  4JAV A;  4MVO A;  1YTF D;  1ZSP A;  3JCZ A;  2GUZ B;  3T1Y B;  4H13 B;  3T4Z A;  3SYO A;  3OTF A;  2Z5U A;  1HNX B;  1O9H A;  3JAR A;  4IT5 A;  3LDC A;  3CMA V;  2O57 A;  4J7Z A;  5JVD B;  1SQG A;  4YXW G;  3D36 C;  3WFV A;  2UXD O;  2LW7 A;  4IIJ B;  4LF6 O;  4MTF A;  2DOS A;  1JOY A;  3LDE A;  1NI8 A;  1SQF A;  1BGY H;  2X6C A;  4I50 B;  4DV4 B;  1WJZ A;  5B66 Z;  3MHH C;  4JI4 B;  5CBH A;  1YDX A;  2UXB B;  3HKD B;  1XNR B;  4NKG B;  3JAK B;  1AR4 A;  1PD3 A;  1SA0 A;  3ZMV A;  1PL0 A;  2ZIN A;  4XDJ A;  2JEX A;  4PI2 A;  3OMA B;  2JGU A;  4FLX A;  2X0L A;  2KG7 A;  3CME V;  3E8F A;  4WFH A;  5BZB A;  3ZS8 C;  2EJR A;  2FKX A;  3TJT A;  2EIN C;  3N27 A;  2BOC C;  3MD0 A;  1E1Q G;  1K4D C;  3LUT B;  3VQV A;  2ZNJ A;  3RWR D;  1PM9 A;  2JS5 A;  3K9S A;  2UU9 O;  2DW4 A;  2Y4U A;  2DQ0 A;  2QWO B;  1Q6H A;  1H8H G;  2OCC C;  4J41 A;  2NR5 A;  2P06 A;  3ABK B;  5KHG A;  5IYC O;  2QWN B;  1HNX O;  5D5Q A;  1NJI W;  1V9P A;  1EN4 A;  2EUL A;  1ARO P;  1OCO B;  3A0R A;  3K3W A;  3K5M A;  5JJE B;  1N4C A;  3J81 N;  1LUW A;  1WP8 A;  1IBL B;  3FFQ A;  3H1J H;  1F4N A;  4FZ0 A;  3T4D A;  2R9I A;  2UXC B;  1IBM B;  3F5T A;  1FKA O;  4UCV A;  2YS8 A;  4QE9 A;  4CH3 A;  1WA8 A;  4JI7 B;  2Q67 A;  1ZAU A;  2X7R B;  2YEV B;  1I94 O;  5CBG A;  1BHB A;  2HHH B;  3UM7 A;  4I55 B;  4DR7 O;  1EN6 A;  4FVM A;  1T5E A;  1EZV H;  2WA3 A;  4CH4 A;  1BZK A;  5J2U B;  4DUZ B;  5IJ9 B;  2B9Z A;  3VBB A;  3L9D A;  1Q43 A;  1NBM G;  4OPH A;  3ABM C;  3A0H Z;  1FJG B;  4JPR A;  5FNV B;  1GO3 F;  4NTY A;  4Q6G A;  5LP6 C;  1XBL A;  1R3I C;  4JAU A;  3ABT A;  2QR4 A;  4LH6 A;  1V54 B;  4GCZ A;  1JFF B;  4A5U B;  4DV1 O;  2YXH A;  2UXN A;  4JYA O;  1K7D A;  1P7G A;  4NXM B;  2CGN A;  1RM1 B;  1TAE A;  2JS3 A;  2D2C B;  1K9M W;  3OEH G;  4XDK A;  1QCE A;  1J5E O;  1K97 A;  4KHP B;  1NTZ H;  1F51 A;  2VWK A;  3SJQ C;  2ILM A;  4U3J A;  2EZO A;  3JYC A;  4QPK A;  1Z5W A;  4PI0 A;  4IHJ A;  1MAB G;  3SDL A;  1N32 B;  5KMG B;  1LNQ A;  1H2G A;  2ZR3 A;  1P7B A;  1VMG A;  5IJ0 B;  2ZDI C;  1GM9 A;  3HR0 A;  2WPD G;  5LA6 B;  3EXA A;  3L70 H;  2PZS A;  3I55 V;  4JF3 A;  3CX5 F;  4JI0 B;  4FLY A;  4O4H A;  1FS0 G;  3ASO C;  1HNW O;  1L0N H;  5ITZ B;  4RWU A;  5H6R A;  2IU3 A;  4GX0 A;  1U96 A;  3ZHQ A;  1WB7 A;  4CC5 A;  2CDY A;  1R6N A;  1RM1 C;  1UPG A;  1EN5 A;  1KU9 A;  1GMG A;  1M9N A;  2E3C A;  1PKX A;  4TUY B;  1QU7 A;  2XTA A;  1I7F A;  5DEC A;  3FKS G;  3AG1 C;  2EZP A;  4MVQ A;  3CJH A;  3ZHR A;  1NTM H;  4CS3 A;  3K0G A;  4FLZ A;  3CC7 V;  2WLL B;  2Q0O C;  3RYI A;  3C90 A;  4LR3 A;  2ZE7 A;  3LSS A;  4FFB B;  4I50 A;  5IYD O;  1IBK O;  4D7T A;  4UCT A;  5LL6 Y;  2XAJ A;  4X1Y B;  4JYY A;  3U0Z A;  3CHX A;  4CZZ A;  5LHG A;  2QGN A;  2W6I G;  3HKD A;  4DR4 B;  1XNQ O;  2Q4P A;  3H1I H;  2P22 C;  4R7C A;  1J5E B;  3IC7 A;  3JAK A;  3ZJZ A;  3AG7 A;  5L3G A;  3M7M X;  5LMN O;  4X1I A;  4KL1 A;  3CCV V;  4LH7 A;  2XHB A;  4MW8 A;  1HNW B;  1US6 A;  4ICG A;  3HB3 B;  4DR2 B;  4MSW C;  5JH7 B;  4J7K A;  1MZE A;  4DV0 O;  4R6Z A;  4LNU A;  5EZY A;  1B6Q A;  4IYI A;  4PDV A;  1JJO A;  4FLT A;  1SES A;  4JYC A;  4XDL A;  3G71 V;  2EIK C;  5L3D A;  2ZIM A;  4YJ2 A;  2KKW A;  4O2A A;  3CRM A;  3QNE A;  1DLB A;  1GTO A;  2QEX V;  3CD6 V;  5J2T B;  1MA1 A;  4O4J A;  4UXN A;  4JZG A;  1VQM V;  3T1H B;  4HNA B;  2RJZ A;  3ETQ A;  2GBO A;  1E1R G;  1K33 A;  3ZRW A;  2HP8 A;  4JI1 B;  2P4K A;  2P5O A;  1GN3 A;  4DR1 O;  4TT3 G;  5D5P A;  4G27 B;  4ASU G;  1BMF G;  2YUA A;  2E5L B;  2H3O A;  3IJ4 A;  3JSL A;  4JTD B;  4JI3 B;  1N34 O;  1N33 B;  4K35 A;  4CC6 A;  3K06 A;  1TGO A;  4UV8 A;  1LUV A;  4QE7 A;  3FAV B;  5FNV A;  4B3R O;  3Q4H A;  2F23 A;  3X2Q C;  1HNZ O;  3CCE V;  3EFF K;  2OTL V;  3VQY A;  1DGS A;  2ODM A;  1R73 A;  4LCU C;  4CS4 A;  3JD4 A;  2PYJ A;  1SER A;  2PI5 A;  1YF2 A;  2EIM B;  2ZXW C;  2RN9 A;  3WB1 A;  4LF9 B;  5EYP B;  1XNR O;  2FL4 A;  2QTS A;  3BEH A;  3ABL C;  3UCS C;  2WSS G;  3ZN0 A;  3IAY A;  3QO7 A;  1JCH A;  4OPA A;  2QWQ B;  1OCR B;  1K4C C;  2XAH A;  1H38 A;  3AG4 B;  3C3S A;  2Y69 B;  1FPO A;  4P30 A;  5IJ0 A;  3T1H O;  3ZRS A;  2EIJ C;  3BY6 A;  3AG1 B;  1FD9 A;  4FIP C;  1S0V A;  4PDR A;  3CRA A;  5H9C A;  5IWA B;  2QE7 G;  1QLE B;  4NXN O;  4JI2 O;  3OT7 A;  4GX2 A;  1YSC A;  4X65 B;  4UVA A;  3T1C A;  5IDJ A;  1Z5V A;  4ZKI A;  3BAB A;  4XBF A;  4DYL A;  4ZOL A;  3CSX A;  1PV0 A;  2CTQ A;  2QWP B;  2LFS A;  1VQP V;  5KA5 A;  2YI9 A;  2R9R B;  2CK3 G;  3ABM B;  5LYJ B;  2QM8 A;  1SZX A;  1XI1 A;  4TOI A;  1FXK A;  2Q73 A;  1EZJ A;  4YJ3 B;  5LMN B;  2HVK C;  1M90 W;  2R72 A;  2EIJ B;  1M93 A;  3G80 A;  3RYI B;  1M56 B;  1M1K W;  1IXB A;  2YDE A;  4FFB A;  3ASN C;  2MW2 B;  1K5S A;  3OMI B;  3OM3 B;  2WLM A;  4X1Y A;  4O4L B;  4LWS B;  1AP6 A;  5CBF A;  5B3S C;  1AI7 A;  1HP8 A;  1E79 G;  2UUB O;  3HKE A;  3FX7 A;  1OCZ B;  1SRY A;  1ZUQ A;  4RUE A;  3GWK C;  3H1L H;  1NH2 D;  2CUG A;  1XMQ B;  3LNM B;  1EFR G;  3ZED A;  4DR5 O;  4X1I B;  1P4R A;  3HKB B;  3FB8 C;  4X88 A;  1DTO A;  5IE9 A;  4DR6 B;  4N21 A;  1NU1 H;  2QM7 A;  4Z2W A;  3CRR A;  1DF5 A;  1TUE B;  1VP7 A;  2P7T C;  1BQ0 A;  5C8Y A;  1VQK V;  4BIO A;  2P90 A;  3N2G A;  3CWB H;  4DV5 B;  2EIN B;  5CA1 B;  5H2F Z;  1MG1 A;  4LNU B;  5EZY B;  4Z1V A;  5GTI Z;  3K08 A;  4TQF A;  3UT5 B;  2FB5 A;  2BSK A;  5H6Q A;  2RDC A;  4IGG A;  2QWR B;  4YJ2 B;  1QNM A;  1OCC C;  3K5O A;  5KLV H;  3IGA C;  1OCZ C;  3M8A A;  3K57 A;  3BRC A;  2XUM A;  2Q69 A;  2A9H A;  2F1M A;  3BA9 A;  5B5E Z;  2VQF B;  4PA6 A;  5CB4 B;  1VQ7 V;  4O4J B;  2E5L O;  4JGS A;  5BMV A;  2NNU A;  3DTU B;  3SPC A;  3AK1 A;  1M57 C;  4B3S O;  5FLX N;  2P67 A;  3GB7 C;  1RPR A;  2Q7E A;  3SJA C;  3DSQ A;  4UB8 Z;  4O4I B;  4LFB O;  3J7A U;  4I0X B;  5EC2 C;  4TV9 A;  3SYC A;  2CTW A;  2UUB B;  1S77 D;  3L71 H;  1XQ8 A;  3CXC U;  2M7W A;  1Q3E A;  2A06 H;  5KX5 B;  1W59 A;  5KUM A;  1O9G A;  1R3L C;  1YTF B;  1PNK A;  4GKJ O;  1XOU A;  3DC6 A;  1TUB B;  5LOV B;  1G8M A;  2B1G A;  1I5Y A;  2DJV A;  4BIZ A;  2VRZ A;  2WLH A;  1Q86 W;  4AIL C;  1BCC H;  3BFR A;  2BTQ A;  3E8H A;  4LF6 B;  4K8X A;  1Z2G A;  2D3O W;  4PA4 A;  4FMT A;  5EYP A;  1VQN V;  2E74 B;  1XNQ B;  4Z1M G;  4PDM A;  3RBZ A;  4OGQ B;  3MAQ A;  4JI2 B;  3U10 A;  1WLE A;  4NTW A;  3L75 H;  1XMO B;  2M6Y A;  1VF5 B;  3JAS B;  4NYK A;  4WFF A;  1KP2 A;  2VQF O;  2ITD C;  4NVP A;  3RVZ A;  3E22 A;  5IY5 B;  2XOK G;  3DGE A;  4DR2 O;  3AK2 A;  4B3S B;  4EFE A;  5IYZ B;  3QO5 A;  3TXQ A;  1BHA A;  3CCU V;  4DV7 O;  4X20 A;  3APQ A;  1PPJ H;  4EB6 A;  5LMU B;  1CEZ A;  4TWK A;  4X9Q A;  1B06 A;  2PI4 A;  2YIC A;  1DK1 A;  4F4L A;  2V1D A;  3VQW A;  2AHY A;  3K79 A;  5CA0 A;  4ZOL B;  2Q8V A;  4NTX A;  3E83 A;  4U3F H;  1VQ9 V;  1BT8 A;  3HKC B;  4DV3 B;  1HWY A;  2Q7H A;  5LBQ A;  1XHX A;  2ADP A;  1S72 V;  3FD9 A;  4AI8 A;  4G2K A;  3TCU A;  2A79 B;  5JJN B;  3QVN A;  3AEI A;  3R66 A;  4YJ3 A;  2IU0 A;  4ZI7 B;  4LF4 B;  2IH3 C;  5BR8 B;  2JDI G;  3D36 A;  1Q90 D;  3B77 A;  3ZRV A;  4WFB V;  3EHB B;  3CCJ V;  4WBN A;  1FFX A;  1OCO C;  2PF4 E;  1SS3 A;  2PY5 A;  4L8J A;  4PA7 A;  2Z0A A;  1H2S B;  3KZI Z;  3MDS A;  4ZHQ A;  3MHS C;  3FB5 C;  2GHY A;  1I0H A;  3E8G A;  3G6B A;  4TV8 A;  4FJC C;  3ZHV A;  2CAZ C;  3B8N A;  4UCO A;  4UCU A;  2OCH A;  2Q5Z A;  4BW5 A;  2W6J G;  1CP9 A;  2K1E A;  4UVC A;  3NXS A;  5EBM C;  4DR3 B;  3K59 A;  1OCR C;  3B09 A;  3W7W A;  5E1A C;  3JAR B;  5A9G A;  4RUF A;  3JD0 A;  1VF7 A;  3IC9 A;  1ZTE A;  2Y69 C;  4YHH B;  1AJP A;  1JMK C;  5C8Y B;  1KYO F;  4DRX A;  2AZ0 A;  3G6E V;  2DWD C;  4IIJ A;  1OZ0 A;  3ICX A;  3AG4 C;  1IVS A;  4LF9 O;  1AB3 A;  2WLN A;  3KG2 A;  3R65 A;  1G1X B;  4OX9 B;  1B04 A;  1QR8 A;  2Q0A A;  3SPH A;  1NTK H;  3D8C A;  1Y74 B;  4LBE C;  1V54 C;  3LSQ A;  2GDS A;  1QQC A;  5K1X A;  3BVO A;  3TET A;  4IYH A;  1QLE C;  2Q68 A;  5GW7 A;  2PUS A;  2YIB D;  5JWP A;  3J80 N;  5JQG B;  1QLN A;  3ZMS A;  3PJS K;  3QF7 A;  5BR8 O;  5EBL C;  1N0J A;  2BTO A;  5BMV B;  2YXY A;  4F6R A;  2ZD9 A;  2QKS A;  4PA3 A;  1MMM A;  3ML0 A;  1FXH A;  2KG7 B;  4J80 A;  2ZIO A;  4DV4 O;  3E2E A;  3O65 A;  4GX1 A;  4N23 A;  4DV2 O;  5HFL A;  3E8B A;  2P4V A;  5B3S B;  2CGO A;  3A0B Z;  5LXT B;  5BXZ A;  3RW0 A;  1F23 A;  1K5Q A;  2Y4T A;  1VQL V;  1ROP A;  4DR3 O;  1RSO A;  4JZ2 A;  4LFA O;  1NS1 A;  4I9Q A;  4RQF A;  4KP4 A;  1ZLZ A;  2UXC O;  5LOV A;  4QNH B;  3ETG A;  2UUC O;  3ZHT A;  1VQ8 V;  1YIT V;  3A8T A;  4HAM A;  3U11 A;  2X6B A;  4X8A A;  3JAT A;  1MNG A;  2FML A;  2JIZ G;  1N8R W;  3NR7 A;  1SQQ H;  3OUS A;  4OX9 O;  3SPI A;  2VQE B;  4B08 A;  3W7U A;  2JGD A;  4I55 A;  1VQ5 V;  2IW5 A;  2ADQ B;  5LMU O;  1GM8 A;  1OCC B;  2QM4 A;  2BE3 A;  3ABU A;  4DR5 B;  3F7Y C;  2Q7G A;  3P3P A;  4K3A A;  5IJ9 A;  3ZHS A;  1CPY A;  4DV5 O;  1FXV A;  4JI7 O;  3OTO B;  1FXK C;  3BCC H;  3EVK A;  3LNN A;  1I94 B;  1QR9 A;  5EK0 A;  2EX3 A;  4G28 B;  5L3C A;  4KFM A;  1CXZ B;  1AP5 A;  1OV9 A;  3JAW B;  2WA4 A;  3CP1 A;  4EB6 B;  1KC8 W;  1EM1 A;  1JFF A;  3LDD A;  1KB9 F;  4FLW A;  2RQ6 A;  4JAS A;  4LF7 B;  4JAA A;  2PGG A;  1JR9 A;  3H1H H;  3FB6 C;  3CCM V;  2VS0 A;  2OIE A;  1YHQ V;  1FAF A;  1UFI A;  3HKC A;  3PN1 A;  3K5L A;  3TK1 A;  2HEP A;  3K04 A;  2OWO A;  2ZR2 A;  2QSA A;  2G38 A;  1W2B U;  1L0L H;  2JVD A;  1Y6X A;  5FL7 G;  1MOF A;  4TQD A;  1XEQ A;  4J7J A;  4IHJ B;  3QTC A;  3SJB C;  2HVJ C;  3B40 A;  5E79 Z;  3D3Q A;  3GVM A;  3VOU A;  1FYJ A;  1M56 C;  3SR2 C;  2ZQM A;  4ZHQ B;  4B7E A;  4EKW A;  2ARH A;  1AI5 A;  4IL6 Z;  5KUK A;  1GM7 A;  3F5W C;  4JI5 B;  1UJW B;  1XUQ A;  3A2F A;  2AZ2 A;  3C3T A;  1S5L Z;  2EIL B;  4MTG A;  3K03 A;  1VEW A;  4FLV A;  3CE2 A;  1L1F A;  2X6A A;  2QTO A;  3HPL C;  4JTA B;  1J95 A;  2WWW A;  4O2B A;  3RYC A;  1KEC A;  2YID A;  5EBW C;  2BOB C;  4MTO A;  3CJH B;  4GLX A;  1GN6 A;  4J9Y B;  1OJH A;  1URF A;  1WNS A;  5A2Q N;  1Q6I A;  2WLL A;  1VF6 C;  3JD3 A;  4DR4 O;  3OR7 C;  1KP3 A;  3OGI B;  4JYB A;  1Y74 A;  4YIP A;  3AK3 A;  1Q7Y W;  4DR7 B;  3JD2 A;  2A7W A;  1FFT B;  2CTR A;  1H2K A;  1SF9 A;  5L3E A;  1YZB A;  2P6J A;  2C2A A;  3FYE B;  4WFA V;  4FM0 A;  3BAA A;  5LHH A;  1KMI Z;  4QGP A;  1OHH G;  1JQ0 A;  2ZXW B;  4H44 B;  4GT1 A;  5JQG A;  1YJW V;  5CMU A;  1AI6 A;  3M99 B;  4MVS A;  5KHH A;  3WG7 C;  1Y67 A;  2XT9 A;  1WAZ A;  1IBK B;  2JK5 C;  2KQX A;  3B8M A;  1AVM A;  1VQ4 V;  2IJH A;  5JVD A;  1NKD A;  3W7T A;  5AG2 A;  1TVK A;  3JAL B;  3OUF A;  5LXT A;  4K8Z A;  4FK5 C;  3CCQ V;  2NLJ C;  1WPB A;  2LFR A;  1RSO B;  4O2A B;  3RN4 A;  1VQ6 V;  1EBO A;  5EC1 C;  2DYS C;  2W0F C;  1PL4 A;  3ZBH A;  1WB8 A;  4KHP O;  5BY1 A;  1YEW A;  2V7Q G;  2QDO A;  1N32 O;  1V55 C;  5JJJ B;  4H33 A;  4PDL A;  3BHP A;  1YVW A;  4HNA A;  4GKK O;  5GON A;  3TGU H;  1SA0 B;  4QPJ A;  4JI4 O;  4LFC O;  3W7X A;  2F4V B;  1Y66 A;  3CRC A;  4P2Z A;  2JGD B;  3ZRW B;  1SET A;  1SC5 B;  2N74 A;  2Y0I A;  2ZT9 B;  3OFN G;  3JCU Z;  3CB2 A;  2LP7 A;  1MSW D;  1IBL O;  2DYR B;  4KXR A;  3ASN B;  2Y48 A;  4JI0 O;  1PNL A;  3SYA A;  4B7K A;  4FPP A;  4LF7 O;  4RQE A;  2DQ3 A;  4PJ0 Z;  3SJC C;  2W0X A;  2LGW A;  5KHI A;  4B3R B;  3AG2 C;  4UCR A;  2HR3 A;  4EFB A;  1K73 W;  1HNZ B;  3KCY A;  4MW3 A;  3ZN1 A;  3FAV A;  2DWE C;  4ZIB A;  5DED A;  3LSU A;  4R8C A;  4JV5 O;  1KQS U;  3RYH B;  3K5N A;  3P3N A;  4I7Z B;  1GK9 A;  1KBH A;  5CN0 A;  5KAF Z;  2QKA A;  4KUM A;  5C93 A;  1HR0 O;  2H94 A;  4PHZ A;  1I08 A;  1RP3 B;  4X62 O;  3W7S A;  1W0J G;  4DO2 A;  3AG3 B;  3B2E E;  2K9P A;  2E76 B;  3G67 A;  3K9A A;  3OR6 C;  4OXS A;  2B5U A;  1IBM O;  3CCR V;  1I5X A;  3RT3 C;  5B1B B;  4LFC B;  3DXR A;  2F95 B;  4JYA B;  1JA8 A;  1M4U A;  1ZWI C;  4GKK B;  2CE4 A;  4NXM O;  1VAR A;  2LGQ A;  3UKM A;  2Z3Y A;  4U7O A;  1JVM A;  4PA9 A;  2XAS A;  4DV6 O;  4U7N A;  1NZ6 A;  2WLJ A;  2AW9 A;  4DV0 B;  1YJN V;  4DK0 A;  4HZ3 A;  1GN2 A;  1IDS A;  4RO2 A;  4J10 A;  4B3T O;  5JCO C;  3JSN A;  2F93 B;  4GX5 A;  5DM6 V;  1XHZ A;  1XDC A;  2QKC A;  2L6L A;  4AQY O;  4I5S A;  3I56 V;  3CEI A;  1FXK B;  5B1B C;  2EBO A;  2VQE O;  3DC5 A;  4X65 O;  1NQT A;  4L87 A;  3WB0 A;  2UXX A;  4BIU A;  3ZIA G;  1Y76 A;  4X1K A;  4GUN A;  3RGB A;  1SQB H;  2Q9L A;  1G4Y B;  4X66 O;  1NVP B;  2ZM6 O;  2RCV A;  5KAI Z;  1JJ2 U;  3X2Q B;  1BQZ A;  3O9O A;  5IYB O;  1G6U A;  2DE0 X;  2UU9 B;  4O4H B;  2OCC B;  3OE7 G;  1Y4M A;  1GRJ A;  3ETD A;  5ITZ A;  1IZ3 A;  1HDJ A;  3P32 A;  1S5H C;  1WP7 A;  2GV9 A;  1COW G;  1N0N A;  1D2D A;  2GSM B;  5TIS Z;  2YXL A;  1N33 O;  4DV6 B;  2YC0 A;  1A32 A;  1QVF U;  3HKB A;  5EIB C;  4PEL A;  1YI2 V;  3SYP A;  3OGC C;  3CRQ A;  2RMK B;  3ABL B;  1THZ A;  4JI3 O;  5KHJ A;  3N2G B;  4P9O A;  5LHI A;  1P84 F;  4ABM A;  5CA1 A;  2OT5 A;  4TUY A;  3K58 A;  1KKD A;  2ZE8 A;  1ZL8 B;  1TVK B;  2FYU H;  3JAL A;  3RFR A;  3UT5 A;  2BSK B;  2DN9 A;  2ZDI A;  1QVG U;  2F4V O;  3CS5 A;  2IJI A;  3KCX A;  3CCL V;  3H1K H;  3CCS V;  4MS2 A;  4NR1 A;  4CS2 A;  1R3K C;  3GWO A;  1AJN A;  4K0K O;  3RYF A;  5CB4 A;  5B1A C;  3APO A;  2HKO A;  5GON B;  3ZMU A;  2AHZ A;  4LF4 O;  5EIB D;  3P30 A;  1YXB A;  2F43 G;  4DW1 A;  4E4E A;  2MK3 A;  2CTP A;  3SPG A;  3JD1 A;  4QJF B;  3THO A;  3ETE A;  4JI8 B;  2L35 A;  5HFM A;  2R9A A;  2JJ1 G;  4QIW F;  1YIJ V;  2PTM A;  2CH7 B;  4UUJ C;  1D5N A;  5JH7 A;  3OMN B;  4NXN B;  5KHK A;  5KX5 A;  4UVB A;  4DXW A;  1AJQ A;  1SQP H;  4BR6 A;  4UFZ A;  2JJ2 G;  3CXH F;  3N2K B;  3WG7 B;  2H8P C;  3BA8 A;  1P49 A;  2HG5 C;  3WB2 A;  4JI1 O;  5B1A B;  3QO8 A;  4FLU A;  1W0K G;  2ITC C;  3E89 A;  4CH5 A;  3RYH A;  5J2T A;  2BTQ B;  4ZBM A;  3L73 H;  1AIL A;  1KUQ A;  3ASO B;  5GTH Z;  1BS3 A;  1NR1 A;  4HYO A;  4CBC A;  2AXT Z;  2F66 C;  4W4L A;  1K3E A;  5L3F A;  1QHT A;  2DYS B;  2XAF A;  3SGI A;  1MSD A;  4P9P A;  5FPO A;  3CC2 V;  3UO2 A;  4I4T B;  3DXR B;  1KKC A;  2HJF C;  4D6T H;  1V55 B;  1PP9 H;  2AGA A;  4JI6 B;  3D3I A;  2QA4 V;  4X64 B;  2OIG A;  4JI8 O;  4J11 A;  1GH6 A;  4UCS A;  3SPJ A;  2N05 A;  1XRE A;  4X20 B;  1VF6 A;  2WLI B;  3Q4H B;  1NT2 B;  2RNB A;  4FZ1 A;  3S3X A;  1N34 B;  2EIL C;  4DV2 B;  1MZF A;  1DF4 A;  1XMO O;  1Q81 W;  5CA0 B;  1IUR A;  4J9Z B;  4LC1 A;  2FTK A;  2UXD B;  2ZM6 B;  3UO3 A;  3BPZ A;  1S76 D;  1GKF A;  2KB1 A;  3WU2 Z;  2IH1 C;  4H37 A;  1AI4 A;  1K92 A;  3FYI B;  2ZE6 A;  2EIK B;  4FFK A;  4BAY A;  4WCE V;  2ZNI A;  5IT9 N;  2YSU B;  2EJ7 A;  2B1I A;  2LJ2 A;  1SQV H;  4MVZ A;  3I5D A;  4PV1 B;  1TA8 A;  4MTX A;  1FFX B;  5B1O A;  1QBZ A;  1NH2 B;  3L72 H;  4X1K B;  1Y76 B;  2ZE5 A;  1H2L A;  2OTJ V;  4F6E A;  5L3B A;  4TV8 B;  3QG5 A;  3AG3 C;  4UV9 A;  4NB5 A;  3OAA G;  4LFB B;  1BE3 H;  3FB7 C;  2YIB A;  4GKJ B;  2KSD A;  3L74 H;  3OEE G;  5F2V O;  4WF9 V;  4JI6 O;  4D7S A;  1ORQ C;  2PYL A;  2VWJ A;  4X64 O;  1K34 A;  2GTS A;  4DRX B;  1AR5 A;  1NVP D;  4LF8 B;  1ZX3 A;  5LYJ A;  1HR0 B;  5KA6 A;  2IJJ A;  1XL4 A;  1U97 A;  4CH6 A;  1X59 A;  4X62 B;  1ZL8 A;  2WAM A;  4YIO A;  2YI8 A;  4WFE A;  1N36 B;  3KKY A;  3STZ C;  4LP8 A;  5LP6 A;  5IY5 C;  2V4D A;  1B3Q A;  2ETN A;  1RFY A;  2HLD G;  3UQ8 A;  4O4L A;  2EIM C;  4LWS A;  1WN7 A;  4DR1 B;  3RYF B;  1D5A A;  3HKE B;  5LGN A;  2HHH O;  2IM9 A;  1YCI A;  2GUZ A;  1BSM A;  1GN4 A;  1LR1 A;  3ABK C;  4F6R B;  1RPO A;  1AR1 B;  2ZCE A;  1BL8 A;  2ATK C;  4MVR A;  1XL6 A;  5DN6 G;  1Q6U A;  3CPW U;  3ZRX A;  3ZX6 A;  5LGT A;  2JRI A;  4B3T B;  4LFA B;  4YY3 B;  4B3M O;  4UB6 Z;  4GZR B;  4X89 A;  2DYR C;  2N04 A;  4H0L B;  2CH7 A;  4DR6 O;  4C7U A;  4LF5 B;  2XAG A;  3K0D A;  5FPR A;  1X4T A;  4AQY B; 
#chains in the Genus database with same CATH homology
 2V1D A;  2AHY A;  3K79 A;  3FKS G;  3AG1 C;  2EZP A;  4MVQ A;  3E83 A;  1K8A W;  1YJ9 V;  4R8C A;  1JPX A;  1KQS U;  1VQ9 V;  3K0G A;  1HWY A;  5LBQ A;  1GK9 A;  3CC7 V;  1S72 V;  2WLL B;  5CN0 A;  4KUM A;  2XAQ A;  5C93 A;  3G4S V;  2H94 A;  4G2K A;  3TCU A;  2A79 B;  3LSS A;  3ZMT A;  3AEI A;  5IYD O;  3W7S A;  1W0J G;  4DO2 A;  3AG3 B;  2IU0 A;  2XAJ A;  2IH3 C;  2JDI G;  3D36 A;  4E2L A;  3B77 A;  3ZRV A;  4WFB V;  5LHG A;  4CZZ A;  3EHB B;  3K9A A;  3CCJ V;  1OCO C;  2W6I G;  3OR6 C;  4OXS A;  4PA7 A;  2B5U A;  2A0L A;  3CCR V;  1I5X A;  4R7C A;  3IC7 A;  3ZJZ A;  5B1B B;  3MHS C;  5L3G A;  3FB5 C;  2GHY A;  1H8E G;  1ZWI C;  3E8G A;  4FJC C;  4MT8 A;  3B8N A;  3H01 A;  3CCV V;  3UKM A;  2Z3Y A;  4U7O A;  1JVM A;  4BW5 A;  2W6J G;  1CP9 A;  2XAS A;  4MW8 A;  4PA9 A;  1KD1 W;  2K1E A;  3T2M A;  4U7N A;  4UVC A;  2WLJ A;  1R3J C;  3NXS A;  5EBM C;  1OCR C;  1YJN V;  1F4M A;  3HB3 B;  3W7W A;  5E1A C;  4MSW C;  4RUF A;  3JD0 A;  3SYQ A;  4R6Z A;  1B6Q A;  4HZ3 A;  4PDV A;  2Y69 C;  1AJP A;  4RO2 A;  1SES A;  1MSW D;  4JYC A;  4XDL A;  3G71 V;  2EIK C;  5L3D A;  5DM6 V;  4GX5 A;  3G6E V;  2DWD C;  2WLI A;  3E35 A;  4I9W A;  1NR7 A;  1OZ0 A;  3AG4 C;  3QNE A;  1GTO A;  1DLB A;  2WLN A;  3KG2 A;  4I5S A;  3I56 V;  3R65 A;  1QR8 A;  1FXK B;  2QEX V;  4WFG A;  5B1B C;  3CD6 V;  5LGU A;  1Q82 W;  3SPH A;  4LBE C;  1IXM A;  2EBO A;  2YEV A;  1V54 C;  3LSQ A;  1NQT A;  4UXN A;  4L87 A;  1VQM V;  5J9P C;  2UXX A;  3TET A;  4BIU A;  3ZIA G;  1QLE C;  2Q68 A;  5GW7 A;  5CA3 A;  3ZMZ A;  1WPX A;  4TSF G;  1G4Y B;  4Q20 A;  3CC4 V;  1NVP B;  1QLN A;  3ZMS A;  4RAI A;  3PJS K;  1VQO V;  1E1R G;  5EBL C;  1ENV A;  1K33 A;  1JJ2 U;  3X2Q B;  3ZRW A;  3F7V C;  5IYB O;  2JEU A;  2ZD9 A;  2QKS A;  4PA3 A;  2OCC B;  3OE7 G;  3ML0 A;  1FXH A;  1Y4M A;  1JX9 A;  3ETD A;  4MVU A;  3P32 A;  1S5H C;  3E2E A;  1COW G;  3ZCC A;  4GX1 A;  2GSM B;  4N23 A;  4TT3 G;  1QVF U;  4G27 B;  4ASU G;  1BMF G;  4PEL A;  5HFL A;  3E8B A;  4JTD B;  1YI2 V;  3SYP A;  4JTC B;  3OGC C;  2HFE C;  2IJK A;  3ABL B;  5B3S B;  3K06 A;  1THZ A;  4UV8 A;  4QE7 A;  3RW0 A;  1F23 A;  4P9O A;  1K5Q A;  5LHI A;  1VQL V;  2XND G;  1ROP A;  2OT5 A;  3X2Q C;  1KKD A;  3CCE V;  1PNM A;  3EFF K;  4RQF A;  2OTL V;  4R50 A;  4KP4 A;  3E86 A;  4QNH B;  1R6K A;  3ETG A;  1S3J A;  1R73 A;  4LCU C;  2ZDI A;  3JD4 A;  1VQ8 V;  1SER A;  1QVG U;  2PI5 A;  1YIT V;  2EIM B;  2IJI A;  1M57 B;  2ZXW C;  2Q6A A;  4HAM A;  2X6B A;  3BEH A;  4X8A A;  3CCL V;  3ABL C;  2WSS G;  3ZN0 A;  2JIZ G;  3CCS V;  4MVM A;  1N8R W;  4MS2 A;  3OW2 U;  1R3K C;  3OUS A;  3SPI A;  3CYO A;  3GWO A;  3QO7 A;  1AJN A;  1JCH A;  3STL C;  5B1A C;  1OCR B;  2WLK A;  1K4C C;  2XAH A;  1H38 A;  3AG4 B;  3W7U A;  2HKO A;  1VQ5 V;  2IW5 A;  3RVY A;  3ZMU A;  5B1N A;  2AHZ A;  1GM8 A;  3AG2 B;  1SZT A;  1OCC B;  2Y69 B;  3P30 A;  3ABU A;  4P30 A;  2F43 G;  3ZRS A;  2EIJ C;  3BY6 A;  3IFX A;  4JAV A;  3AG1 B;  4MVO A;  1YTF D;  3F7Y C;  2MK3 A;  4FIP C;  3JCZ A;  3SPG A;  1S0V A;  3JD1 A;  4PDR A;  4QJF B;  5H9C A;  3T4Z A;  2QE7 G;  3ETE A;  3SYO A;  1QLE B;  5HFM A;  2Z5U A;  2JJ1 G;  1CPY A;  4QIW F;  1FXV A;  4GX2 A;  1YIJ V;  1YSC A;  4UVA A;  3T1C A;  4UUJ C;  1FXK C;  5IDJ A;  4ZKI A;  3OMN B;  3LDC A;  3CMA V;  1QR9 A;  5EK0 A;  4UVB A;  4XBF A;  4G28 B;  4DXW A;  5L3C A;  1AJQ A;  4KFM A;  4YXW G;  3CP1 A;  3WFV A;  2LFS A;  1VQP V;  2JJ2 G;  1KC8 W;  5KA5 A;  3LDD A;  3WG7 B;  2H8P C;  4JAS A;  2R9R B;  2CK3 G;  3ABM B;  4MTF A;  2HG5 C;  1JOY A;  5B1A B;  2QM8 A;  3LDE A;  3QO8 A;  2X6C A;  3FB6 C;  3CCM V;  1FXK A;  1EZJ A;  1W0K G;  1YHQ V;  2ITC C;  3E89 A;  2HVK C;  1M90 W;  3MHH C;  4ZBM A;  2EIJ B;  3TK1 A;  3K04 A;  1M56 B;  1M1K W;  2ZR2 A;  5CBH A;  3ASN C;  3ASO B;  1W2B U;  1K5S A;  1NR1 A;  4HYO A;  5FL7 G;  1MOF A;  3OM3 B;  3OMI B;  4CBC A;  2WLM A;  1PD3 A;  3ZMV A;  1K3E A;  1PL0 A;  5L3F A;  5CBF A;  2HVJ C;  4XDJ A;  2JEX A;  5B3S C;  2DYS B;  1AI7 A;  3VOU A;  1E79 G;  1M56 C;  2XAF A;  3OMA B;  1OCZ B;  4P9P A;  2X0L A;  1SRY A;  3CC2 V;  4RUE A;  1NH2 D;  3CME V;  3E8F A;  2ZQM A;  4WFH A;  2HJF C;  5BZB A;  4EKW A;  1AI5 A;  2EJR A;  3LNM B;  5KUK A;  1EFR G;  1GM7 A;  1V55 B;  3F5W C;  1UJW B;  2EIN C;  2BOC C;  3D3I A;  1P4R A;  1K4D C;  1E1Q G;  3MD0 A;  3FB8 C;  3LUT B;  4X88 A;  1DTO A;  2EIL B;  2QA4 V;  4MTG A;  3K03 A;  4N21 A;  2QM7 A;  1DF5 A;  1TUE B;  2DW4 A;  3SPJ A;  2P7T C;  1VQK V;  1L1F A;  2DQ0 A;  2P90 A;  2X6A A;  1H8H G;  2OCC C;  2EIN B;  2WLI B;  3ABK B;  2QTO A;  3HPL C;  5IYC O;  4JTA B;  1J95 A;  2WWW A;  1MG1 A;  1KEC A;  2EIL C;  1DF4 A;  1NJI W;  1Q81 W;  5EBW C;  2BOB C;  1ARO P;  3K08 A;  1OCO B;  3A0R A;  3K3W A;  4MTO A;  4J9Z B;  4LC1 A;  5H6Q A;  2FTK A;  4J9Y B;  1S76 D;  1GKF A;  2KB1 A;  1F4N A;  2IH1 C;  1OCC C;  2WLL A;  4H37 A;  2R9I A;  1AI4 A;  1K92 A;  1OCZ C;  3FYI B;  2EIK B;  3IGA C;  3T4D A;  4BAY A;  4WCE V;  3JD3 A;  2YSU B;  2B1I A;  3OR7 C;  1KP3 A;  4QE9 A;  4JYB A;  4MVZ A;  2Q67 A;  2A9H A;  2Q69 A;  1Q7Y W;  4PA6 A;  2X7R B;  2YEV B;  5CBG A;  3JD2 A;  4MTX A;  1VQ7 V;  1BHB A;  1FFT B;  5B1O A;  4JGS A;  3UM7 A;  5L3E A;  1QBZ A;  2P6J A;  2C2A A;  3FYE B;  4WFA V;  2NNU A;  1NH2 B;  3DTU B;  3SPC A;  5LHH A;  1M57 C;  1JQ0 A;  1OHH G;  2ZXW B;  2P67 A;  3GB7 C;  4GT1 A;  1RPR A;  2OTJ V;  1YJW V;  5CMU A;  5L3B A;  3VBB A;  1AI6 A;  1NBM G;  3M99 B;  4MVS A;  3AG3 C;  4UV9 A;  3WG7 C;  5EC2 C;  3ABM C;  3SYC A;  3OAA G;  1S77 D;  2JK5 C;  3CXC U;  4JPR A;  3B8M A;  3FB7 C;  2M7W A;  1VQ4 V;  2IJH A;  5KUM A;  1GO3 F;  1R3L C;  3OEE G;  4WF9 V;  1YTF B;  1R3I C;  1NKD A;  1PNK A;  4JAU A;  3W7T A;  3ABT A;  1ORQ C;  1V54 B;  4GCZ A;  1K34 A;  1G8M A;  2B1G A;  3OUF A;  4FK5 C;  3CCQ V;  1I5Y A;  2NLJ C;  2UXN A;  1K7D A;  4BIZ A;  1NVP D;  2LFR A;  2WLH A;  5KA6 A;  1Q86 W;  2IJJ A;  1VQ6 V;  1RM1 B;  1EBO A;  1XL4 A;  2DYS C;  2W0F C;  5EC1 C;  2WAM A;  1K9M W;  4WFE A;  3OEH G;  3STZ C;  4XDK A;  4LP8 A;  1QCE A;  5IY5 C;  3E8H A;  1K97 A;  1F51 A;  2V7Q G;  2D3O W;  3SJQ C;  4PA4 A;  1V55 C;  4FMT A;  1VQN V;  2EZO A;  3JYC A;  4H33 A;  4QPK A;  4PDL A;  4Z1M G;  2HLD G;  4PDM A;  3RBZ A;  1MAB G;  1LNQ A;  1H2G A;  2EIM C;  4QPJ A;  2ZR3 A;  1P7B A;  2ZDI C;  1GM9 A;  1WLE A;  2WPD G;  5LGN A;  3W7X A;  3I55 V;  4WFF A;  1Y66 A;  1KP2 A;  4P2Z A;  3ZRW B;  1SET A;  4JF3 A;  3ABK C;  3OFN G;  2LP7 A;  1RPO A;  1FS0 G;  2ITD C;  1AR1 B;  2DYR B;  3RVZ A;  3ASO C;  1BL8 A;  2ATK C;  3ASN B;  2Y48 A;  4MVR A;  2XOK G;  5IY5 B;  1PNL A;  3SYA A;  4FPP A;  3DGE A;  5H6R A;  2IU3 A;  4RQE A;  2DQ3 A;  4GX0 A;  1XL6 A;  5DN6 G;  3CPW U;  3ZRX A;  3AG2 C;  3QO5 A;  1BHA A;  2HR3 A;  3CCU V;  5LGT A;  1R6N A;  1RM1 C;  1K73 W;  4X89 A;  2DYR C;  1GMG A;  1CEZ A;  4MW3 A;  3ZN1 A;  4TWK A;  1M9N A;  2DWE C;  2PI4 A;  2XAG A;  3K0D A;  1PKX A;  4F4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...