2O57A

Crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
282
structure length
282
Chain Sequence
b'SKTVKDNAEIYYDDDDSDRFYFHVWGGEDIHVGLYKEPVDQDEIREASLRTDEWLASELAMTGVLQRQAKGLDLGAGYGGAARFLVRKFGVSIDCLNIAPVQNKRNEEYNNQAGLADNITVKYGSFLEIPCEDNSYDFIWSQDAFLHSPDKLKVFQECARVLKPRGVMAITDPMKEDGIDKSSIQPILDRIKLHDMGSLGLYRSLAKECGLVTLRTFSRPDSLVHHYSKVKAELIKRSSEIASFCSPEFQANMKRGLEHWIEGGRAGKLTWGGMLFRKSDKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative sarcosine dimethylglycine methyltransferase
molecule tags Structural genomics, unknown function
source organism Galdieria sulphuraria
publication title Crystal Structure of a putative sarcosine dimethylglycine methyltransferase from Galdieria sulphuraria
rcsb
total genus 106
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.840 Mainly Alpha Orthogonal Bundle Helix Hairpins Mycolic acid cyclopropane synthase domain like 2o57A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2o57A02
3O4FA 3RODA 5E1DA 4AZSA 4DCGA 5EKUA 1AF7A 4GC5A 4EKIA 2G71A 3BGIA 3BWBA 2B78A 4OBWA 2UYOA 1SVUA 3FUWA 4BY9E 1DL5A 4RVFA 1WS6A 5EHGA 1YFJA 3T7TA 3I53A 3E8SA 1ZKDA 2EFJA 2GA9A 1MJFA 3PVCA 3UWPA 3KPJA 5KQRA 2NP6A 3BWMA 3CJTA 5E9WA 2Q41A 3LX6A 1I9GA 2B2CA 3NWEA 1WZNA 4ER0A 2YX1A 1ZGJA 3Q87B 2ZZKA 4RTNA 5T64A 5EZQA 5CVDA 4GOMD 4UOEA 3P9IA 5LQUA 3AJDA 2YQZA 5FCDA 1NE2A 3IV6A 3MTIA 4DA4A 1NW3A 4R6XA 3T0IA 1YZHA 5HIJA 5EOVA 4YUZA 2Z6UA 3UBTA 5EGSA 3G88A 4R6WA 3DULA 3EVFA 1YFLA 5BP7A 2P7HA 3HCCA 2NYUA 1X1BA 2P1DA 2IFTA 3VC1A 1VP3A 1WXXA 3P9NA 1I4WA 2JHPA 4IWNA 3MHTA 1SKMA 5BW4A 2OKCA 2NXNA 2OY0A 3PLAE 4F86A 1KXZA 5EQJB 3U81A 4A6DA 3GNLA 3QV2A 3T7RA 4FZVA 4CXMA 4RTRA 1NW8A 3CKKA 4BLWA 2AS0A 5P8WA 4C07A 2PV0A 5IH3A 3AXTA 1JQ3A 5K0NA 5DM1A 2VDWA 2ZBPA 3KQMA 2EG5A 4EKGA 3L8DA 2O07A 5EHIA 3TLJA 2AVNA 3PB3A 1WY7A 2CL5A 4KIGA 5DXAA 5ICGA 2NNWB 4GBED 1O54A 2XYRA 3ELUA 3HCAA 3KQYA 2GAFA 3KKZA 3BUSA 3FYDA 3LKZA 3CCFA 1L3IA 5DX0A 5C1IA 3GXOA 4X41A 4PIMA 1FJXA 1QAQA 4HSGA 2YVLA 3ELYA 3KR1A 4MTLA 4U7TB 5CM2Z 1RI3A 4FSXA 4R05A 5K05A 2YXEA 4M38A 4RTPA 1M6YA 2LD4A 4HTFA 4OA8A 2CMHA 5BXYA 5HZMA 2OBFA 4DKJA 2ZBQA 5CCXA 4RTMA 3DR5A 1BOOA 5K0FA 3LGAA 3EPPA 4RVHA 2HR1A 1F38A 2XVMA 4DZRA 3TR6A 1NV8A 5K0GA 1R6AA 3A25A 3EGVA 4QPPA 1G8AA 2PGXA 5K03A 4YUWA 5CCBA 3HP7A 4XUCA 3GRZA 3D2LA 4QTUB 1JG4A 3RIEA 1RI2A 2C7OA 1NBIA 1OR8A 4KVZA 4EK9A 8MHTA 3EVGA 1T43A 3BXOA 5K0EA 4PWYA 5ICCA 1JTEA 2I6GA 5DM0A 5K0CA 2H00A 3NJRA 2UYQA 5LQAA 3C3PA 2OPBA 2BR4A 1VLMA 3I64A 3X0DA 5LQRA 3PTAA 3KQSA 4PYQA 4QQNA 2O0LA 2IH4A 4OX9Y 3DXYA 2P3OA 4WXHA 1V39A 2DULA 4X61A 1FPQA 3KQOA 3VYWA 1XTPA 5KVAA 4F85A 3R3HA 1L9KA 5FQNA 2AOVA 2ONYA 2QE6A 10MHA 5FADA 2IGTA 3MTEA 3KPVA 2Z6AA 4GOND 1VBFA 3LCCA 2IIPA 1JG1A 2VZ9A 2BM9A 2VDUE 4HC4A 4XUEA 5FHQA 5GWXA 2PJDA 4FR0A 4RVGA 4ER7A 5EMKA 5T67A 3VSEA 5BW5A 4C04A 3Q7EA 5C0OE 3G2OA 5E8RA 3FPHA 2PWPA 2OYRA 1Y8CA 2Y1XA 3KU1A 3TKYA 3LKDA 4QPNA 1Q0SA 3FPJA 3IEIA 1JG2A 1UIRA 3M6UA 4V0QA 5DX1A 3NMUF 3FTCA 3HCBA 3UJ6A 3O7WA 1EAMA 2IDKA 3HM2A 4ER3A 5EIFA 2DPMA 5DSTA 2O05A 2PT6A 2FPOA 3HA3A 3MB5A 1ZQ9A 5E2AA 3PS9A 3TFWA 3S68A 1RI1A 2P41A 1P1CA 5B1SA 4GEKA 3P9KA 2ZFUA 3UJCA 2G8NA 4GF5A 3THSA 2AN5A 2OZVA 4HGYA 5EG5A 3QOWA 4KW7A 5EVJA 3BKXA 1PJZA 5F2KA 5FWDA 1L1EA 3BKWA 4ER5A 1P91A 3AY0A 3P71T 5FQOA 1H1DA 4L7VA 4RTQA 1KPGA 1XXLA 2XYQA 2IH5A 2CKDA 3FUTA 1R8YA 2ZBRA 3C0KA 1BHJA 3LDFA 4LWPA 4ZTBA 2B25A 2UYCA 4KWCA 4PGHA 3B3FA 1O9HA 1SG9A 2JH9A 4GOLD 1XVAA 5DWQA 2B3TA 4QDKA 1D2GA 4E2YA 2ONZA 2PY6A 4RTOA 5K8VA 2IP2A 4YV0A 3GCZA 3OZSA 2JG3A 2ADMA 5GIOE 1N7IA 4YMGA 4ATNA 3OU2A 5E1BA 4IV0A 5EMLA 3IHTA 2IDJA 1NW5A 2XYVA 2WA2A 3EVEA 2XVAA 4CKEA 5DLYA 1M0EA 5KQSA 1NKVA 3UZUA 3GRRA 5CVUA 3KR0A 2P40A 5DRYA 1ZHFA 3GGDA 4DMGA 3BZBA 5CIYA 3ORHA 4AX8A 3AWIA 3DMHA 2B9EA 2QRVB 3B3GA 3KQPA 3FTDA 3MERA 3M4XA 2EX4A 3FZGA 3P2EA 1L3CA 3HCDA 4PINA 1NT2A 1UFKA 4Z2YA 4AZVA 3EEOA 4V0RA 1MHTA 3HNRA 3V97A 5FTWA 3LCUA 1YF3A 2AN4A 3FYCA 1RJGA 1KPHA 5FWAA 5DTMA 4FP9A 4OA5A 2P3QA 4KIFA 1IM8A 2JHAA 3SGLA 1HNNA 3GDHA 5IKMA 3FUUA 2PKWA 3EVAA 5JUWA 2FK7A 3CBGA 1IXKA 3UJDA 1DUSA 4RYLA 3B89A 3ERCA 3CVOA 3GRYA 2ZLBA 5E1MA 3G2QA 2GS9A 4XCXA 5K0JA 4CWAA 1EJ6A 4YUYA 3NVKI 3MCZA 1JR4A 3EMBA 1RJFA 3A26A 4RTSA 2HWKA 3SSMA 5MHTA 2OXTA 4MQ4A 4ISCA 4E70A 5LQJA 5U4XA 2IBSA 2P7IA 1XDZA 3G2PA 2R6ZA 3P97A 1FBNA 3KR9A 4QQKA 1NW7A 2PVCA 3I58A 3G7UA 2H11A 2H1RA 2PWYA 2PX5A 2QYOA 4EMSA 3G89A 5FHRA 2UYHA 3NWBA 4MWZA 3GO4A 2OB2A 5M5BA 1JSZA 5DM2A 2P8JA 1JQEA 1O9GA 4MHTA 5FUBA 4F84A 3O31A 1WXWA 4P7JA 3OFKA 5C9ZA 2HTEA 4YUXA 1RJEA 3NDIA 4DM3A 2G1PA 2AOTB 3R6TA 3LDGA 1X1DA 3P9CA 3OFJA 3T7SA 3TKAA 1EJ0A 1R00A 4P7KA 2HNKA 3EVDA 4K6MA 3SXJA 5GM2A 1B42A 1YB2A 3GWZA 5DXJA 5K0LA 3DUWA 4GQBA 4GOOD 5E9JA 2ZZNA 3DMGA 2C7PA 2YR0A 4A6EA 1NW6A 4POOA 1JTFA 3P8ZA 4RTKA 4E2ZA 1N7JA 2G72A 4R8SA 2ESRA 3K0BA 4PCLA 3UFBA 5EZSA 3HCFA 3JWHA 2PLWA 3UA3A 5EMJA 2E5WA 3PFHA 3TMAA 2ORED 2FCAA 3P2KA 1BC5A 4YV2A 4QTTB 4ER6A 4HG2A 3BWYA 4EQZA 2ZIFA 2ZWAA 3FRIA 5CVVA 7MHTA 1KHHA 4AZWA 3DOUA 2FYTA 3V8VA 2NP7A 3TM4A 2Z6QA 1FP2A 1JG3A 5LQCA 1XDSA 3A7DA 1Q0TA 3M6VA 4C08A 3KQVA 2QRVA 5EEGA 3MGGA 3I5UA 1EG2A 3OU6A 5EMMA 3OCJA 4E31A 1RI4A 2K4MA 2NXEA 4PNEA 1NV9A 4HTFB 5F2OA 1INLA 4QVKA 5FA8A 3FPEA 3TPZA 5KYGA 4KDRA 4E32A 3FTEA 4X63A 5CVEA 2GH1A 3NVMB 5EIWA 5ERGB 1KR5A 2FK8A 3P2IA 3M6XA 3IYLW 4RTLA 1RJDA 1XDUA 2FRXA 2JH8A 3M70A 5GOZA 1VL5A 1KIAA 1M6EX 3SR4A 5HOQA 3CJRA 4E2WA 3LBYA 4PYNA 4RV9A 2EJTA 5E8JA 4BLUA 5LSAA 3FPGA 3VC2A 3HVJA 1TPYA 4Y30A 1P39A 3SMQA 1R8XA 5DM4A 4OQDA 1JSXA 5CUQA 5K09A 3CGGA 3TOSA 3ER9A 3JWJA 4M37A 3M33A 5DT2A 4NECA 2GB4A 3DXZA 2AOWA 5DRTA 2OB1A 4JXJA 3UJBA 4CKCA 5JR3A 5DX8A 1SUSA 3LHDA 3ID6C 2IH2A 2KW5A 2I9KA 4FGZA 1WG8A 4LG1A 3LBFA 3OE5A 1QZZA 1PRYA 4X60A 3F4KA 3ER8A 1G8SA 3PFGA 5ICEA 2AN3A 3HA5A 1QANA 4GUAA 4IKPA 3E23A 5LR6A 3EVBA 4YV1A 5HILA 1ZG3A 2Y1WA 2ZW9A 3I9FA 2IPXA 3GRUA 1G60A 3KPYA 5E2BA 2ZZMA 1N2XA 3BWCA 4PYMA 5FULA 2NXCA 4M36A 2OO3A 2R3SA 2PXXA 2PSSA 1D2HA 2ERCA 2PXAA 2JHCA 3DH0A 3ELWA 3SX0A 2ZIGA 3HTXA 1EIZA 1KYWA 3GIWA 2C7QA 2O06A 3SSNA 4CTKA 4H0NA 2AR0A 1F3LA 4FT2A 1NBHA 2G70A 1G6Q1 2BH2A 3GRVA 3DLCA 4IV8A 4U7PB 4C06A 3A7EA 3HCEA 3FUXA 2PX8A 2ZIEA 4LECA 3C6MA 5EEHA 3KQTA 1U2ZA 3REOA 2YXLA 3CC8A 3SSOA 4PYJA 3LL7A 4E30A 4MIKA 4PIPA 3FPFA 3R9XB 2WA1A 3DXXA 3EVZA 3MAGA 3M6WA 5D1NA 3UJ9A 9MHTA 1EQAA 2HMYB 5T6BA 5GP1A 2VS1A 5DTQA 2CMGA 2I62A 2EJUA 4PCAA 5E9QA 3KPWA 1VP9A 1G55A 1L3BA 1R74A 3A4TA 3GJYA 3LDUA 3MQ2A 4O29A 4RWZA 2PX2A 1I1NA 2GPYA 2HV9A 3LSTA 4KDCA 4P7GA 3UJ7A 1R18A 2AOXA 2ZWVA 2F8LA 4P7FA 5GINE 3PX3A 1XCLA 1QAOA 1Z3CA 1TW3A 3HVKA 1YUBA 3OU7A 1HMYA 2BR5A 2P35A 2YXDA 3B5IA 3EVCA 3G5LA 3LCVB 4DF3A 1G38A 3DP7A 4HGZA 1X19A 1X1CA 2C7RA 3FUVA 4GC9A 4PGGA 2AOUA 3SVZA 4FSDA 4RVDA 3OE4A 1DCTA 1KPIA 3TRKA 2NXJA 3HA7A 3SM3A 5LQNA 2P3LA 5D1HA 4DQ0A 3G5TA 3EEYA 4CKBA 4BLVA 2BM8A 2UZ4A 1FP1D 3OPNA 2VP3A 5K0BA 4YUVA 2YUIA 4AUKA 3DMFA 3DTNA 2QM3A 4AZTA 2GLUA 4PYIA 4EVIA 2QY6A 4M7RA 4B17A 3TQSA 5HIKA 5FA5A 2I7CA 5DTRA 5LQKA 1BKYA 1SUIA 1SQGA 1KP9A 3NDJA 1VQ1A 4QVGA 1AQJA 1VIDA 2VDVE 3MCTA 3H2BA 4E33A 4RTJA 2ZVJA 2XBMA 5CD1A 4Y2HA 3PX2A 4C4AA 4PYKA 3EGIA 3B7PA 2WK1A 2V74B 2IBTA 1XCJA 2PX4A 3E05A 2ZTHA 3KR2A 1JQDA 4C03A 4G56A 5HFJA 5G02A 3BGDA 1XJ5A 2FHPA 4DCMA 2O57A 3UJAA 1UWVA 4PONA 2ZULA 5HIIA 1ZGAA 1VPTA 2ZSUA 3C3YA 1IY9A 2YTZA 3KHKA 3ANXA 1VE3A 5CVJA 2BZGA 2PXCA 3BGVA 3CJQA 5GM1A 5H02A 4C05A 3JWIA 3AXSA 5E1OA 4X1OA 3LPMA 3UJ8A 1D2CA 3KQQA 4OBXA 3THRA 5HIMA 2N47A 1AV6A 3FRHA 1SQFA 4QDJA 5HEKA 4BP1A 3R0QA 5F2NA 3R24A 4FT4A 4HH4A 5EPEA 3UA4A 2JJQA 3A27A 1ORHA 2AOTA 3ELDA 5EKXA 4LWOA 2V7EA 3GU3A 3DLIA 3QOXA 4R8RA 3BT7A 4WVLA 5KS2A 1QYRA 4E2XA 3OZRA 3HVIA 1RI5A 3JWGA 3NTVA 3C6KA 1KYZA 1P1BA 2BR3A 3B3JA 3ME5A 3E7PA 3NW9A 4HRAA 3G8AA 4YMHA 4P58A 3FTFA 3K6RA 3G8BA 3G2MA 1X1AA 4RSRA 5K01A 3HEMA 2CWWA 4PYOA 2A14A 1YZ3A 3TM5A 3RW9A 3EMDA 3KPUA 3WSTA 3EGEA 3PT9A 5EC8A 1AQIA 4OQEA 3KQWA 3LECA 5DSXA 2ZCJA 1ORIA 3OZTA 1TW2A 5DPMA 5GIPE 1QAMA 3HVHA 4FS8A 4BP3A 4XUDA 4PYLA 4CTJA 2AZTA 4RX1A 5ICFA 2PBFA 2AOUB 4KRGA 2PT9A 2AVDA
chains in the Genus database with same CATH superfamily
1A5AB 1PJ2A 3O4FA 1THGA 4X1YA 2GRJA 4R2XA 1WZ2A 1ZRSA 3WQRA 1CUWA 4GC5A 1EGVB 2FEPA 2KE5A 3R1IA 2AT1A 2A92A 3FUWA 1VPLA 1S2LA 1T26A 2BF4A 3JYPA 5JQGF 3WLFA 4Z2AA 4N0EA 3NONA 3AUKA 1YFJA 1RRMA 2Q5HA 3BOSA 3F4BA 3LXRA 2GA9A 1OI4A 1EA7A 4P2ZA 1XVVA 4RENA 4CIVA 1ZR2A 3OLWA 3ZD6A 2NP6A 3EG9B 3EUFA 1UBLS 5E9WA 1ZBDA 2OG2A 3ABMB 2FETA 2WFLB 5C8XA 3HR7A 4MPTA 4TLBA 1Q7TA 1ZGJA 5LJIA 3W2GA 2HRDA 2VPTA 4IGEA 3SPIA 1U7DA 5EPOA 1N5LA 3JSXA 1EEXB 2NO4A 3CCRV 2YHUA 4EVIA 4O0LA 4LY3A 2N9UA 4RETA 1D8TA 1NI3A 3VVMA 4LWSB 2Q6VA 1FF9A 3QU2A 5EOVA 4NEQA 3FTPA 4G37A 1RE0A 5DYYA 2C5LA 1PWYE 4MW1A 1E1QD 1I5OA 1IHYA 1YZVA 3GCWA 5BZBA 3T1HO 2W6IG 1EFVA 1SQ0A 1WHSB 2DWUA 2DPYA 2WDZA 3MS7A 4ZP1A 1YFLA 4P4UA 4D3XA 2QYSA 4H17A 2O0KA 3COWA 1LBHA 1R5BA 2EP8A 3ACDA 3O9ZA 1NUUA 4B71A 2YJ5A 3HL0A 4R1PA 1VPDA 5D84A 4A6DA 4IHQA 4RDIA 5GZ6A 2HU2A 4BO3A 3M0EA 2WTEA 3K15A 4NZYA 1P1KA 2PBLA 5KVQA 3OIUA 5IH3A 4MW4A 3U09A 2E6KA 2O6LA 2V6JA 4R3WA 4P3NA 3K6SB 2OPHA 4IOKA 4DR7B 5ITWA 5JH7A 4WOJA 2YMMA 1T15A 4MAAA 2VHZA 2IP1A 2ZT7A 4IMIB 4UCVA 1HETA 1SBQA 4UEKA 4KIGA 4RPCA 5T4HA 3QP9A 2F00A 5HP4A 4BUJA 5L3GA 3G79A 3HCAA 3IQWA 4JBWA 2WICA 4PA9A 1KQGA 2VHQA 5DK4A 5GJCA 4N76A 4K86A 2W6JA 4N7JA 2Q45A 3DMTA 4E07A 3EYAA 3GXOA 1V2GA 3HNOA 2VYND 4PIMA 1VF6C 1C4XA 3LUDA 1PTJA 4FDLA 1Y4MA 3LA8A 5CM2Z 5E4YA 1JDSA 3DNFA 4NTWA 4IHJA 4H4CA 4PLHA 1WLYA 5BXYA 5AHOA 2WE7A 1S6YA 3UT0A 4H6XA 3ZHCA 3QNUA 1DMRA 2B4RO 2WNSA 3CN7A 3DZDA 4DW1A 2XUOA 3PRYA 4XGRA 3V6MA 1W2WB 3LE8A 1QGED 3PPYA 4KQ6A 2PPLA 3BRWD 1W0JA 3U1VA 3J81k 2FR1A 4LV5B 2CNOA 1NV8A 5KA5A 2NUPA 3JX9A 4NZOA 4UQPA 1DBSA 4WKOA 4HB0A 3NBYC 3EQ7A 3G6EV 1GTZA 3ANMA 2C7OA 2D1FA 3PUKA 2II6A 3LT0A 4DMKA 3UWOA 2CVFA 3VH2A 4BMXA 1U8CB 2A9JA 3MT8A 2WJIA 3PE3A 1A5ZA 1P0FA 3PUXA 4PWYA 2VTBB 2I6GA 4HH0A 5KMGA 2UYQA 5DW0A 5KHJA 3C3PA 1M57B 1SZCA 1ZK3A 3HHEA 1IUNA 3PEWA 2CNWD 1E9DA 3U4GA 3UC5A 3G80A 3FTNA 2BTEA 3L41A 4O4HA 1G5FA 3BWVA 5JAPA 1H2HA 1YDXA 5M7EA 3GZNB 4EEKA 3RW0A 2Y0CA 2CXSA 2ET6A 4YMTA 2WSLA 1I6MA 2W4QA 5IKPA 2XMQA 5T3UA 3T1YO 3EYWA 2G6TA 1FW6A 3OURA 4KUEA 4JZYA 3GCDA 2CAZC 2X3UA 3Q2IA 4G0WA 4AM8A 5ALOA 1H8EG 2Z09A 2ZAMA 3SYRA 4ZQCB 3WL3A 3ZWMA 2NMVA 3MA0A 2UU9B 3UV7A 1CBUA 2RJOA 3BFJA 5EMKA 2CGNA 3G7SA 2FEAA 1XPUA 1LF5A 4GKAA 4GM1A 2OYRA 1KOLA 3ON5A 4D4LA 1XAHA 4QPNA 3B40A 4L8JA 1SCUB 5CTJA 4JXKA 5ULLA 1RFYA 1J2TA 1KVSA 4X1KB 1L8QA 1QFJA 2EP7A 2FZLA 2F1KA 2IODA 3C7AA 3UV6A 3VKWA 3EPKA 2C9CA 1WAZA 2DWQA 1L7DA 1Z0AA 3IBCA 3ZGLA 4YCSA 4BRZA 2AA3A 2X8JB 2YCBA 1K1EA 3CNEA 3V00A 3AVWA 5ALLA 4OX9B 2HPHA 3Q10A 2PNFA 1EVKA 2HWXA 3OIYA 4HGYA 1F9EA 5L6MB 4MA5A 2JLUA 4ZVUA 2VEDA 3KLMX 2Q6AA 3AG4C 2D06A 3OWXA 2F7SA 4WESB 1QGUA 2D1RA 4F4JA 2HLDG 3R0VA 2IH5A 3RC1A 1OJ7A 3KE9A 3QUBA 4EW3A 2ZUSA 4H33A 2QRGA 3ROQA 2CXPA 4BECA 5B2EA 2Q7OE 1BHJA 5BR4A 1SCKA 2P2DA 3EDMA 4NH0A 4J75A 1G8GA 1UPBA 2PL1A 3JYQA 4EPTA 3U3MA 3I9V6 4CQMD 3USZA 5AW8A 5GOTA 1EN4A 1VXOA 1E6KA 2BD0A 1BHBA 3I2JA 1WKVA 2GNOA 3NRCA 4E15A 2Z6VA 5JATA 5LZ9A 1CJTC 3UXEA 2CVOA 3NM4A 4XOUA 3WA6A 4IV0A 3O9OA 2Q1UA 5M29A 1Y37A 3JASB 1U0JA 3JCUZ 1EFTA 2CN1A 3KP1A 4E46A 1LLFA 4OM7A 4AJKA 2W22A 3APQA 4KFMA 4IIBA 4FM0A 5B5EZ 4D4MA 2BFAA 2P40A 1TYCA 3QFHA 3QJ5A 4RH0A 4NXMB 1Z4KA 3UOAB 3ORHA 2CDRA 4MRSA 3UVEA 4F3YA 3BHJA 2ZJ7A 2D7DA 1I13A 3QX3A 2EX4A 4X66O 4UCUA 3Q9UA 3G1WA 1L3CA 1JIXA 1EPUA 1YNOA 3AB8A 3KO8A 1JQJC 1ONOA 3O8OB 2H8PC 3RC2A 1NNUA 4G01B 5J23A 2P68A 3WLRA 5EL0A 3S2SA 4IIJA 3NKVA 1HT0A 3LCUA 1G21A 3TAUA 2Q0QA 2AN4A 3IS3A 4FDUA 1T8WA 3NHPA 5CAEB 1P17A 4JN6B 4Q9AA 2C88A 4R8LA 4EG7A 3JZDA 4JU9A 4W7IA 2EJ7A 1UEJA 2C99A 4U7HA 5AT1A 4CF3A 2QTCA 4AS3A 2HWUA 3MTGA 3FI9A 4BQPA 2B8WA 2ZDIC 1YI8A 4U9HS 5AI8A 1XF9A 4OLFA 4RPGA 2H85A 5K3OA 4HEA6 2W6MA 4WN9A 5E1MA 4BNWA 5TLSA 2ZD9A 4RZ3A 1JVSA 4EJ0A 3C4VA 1SO8A 2YJTD 3RSCA 3STXA 3RN4A 2ASVA 1M10A 2VCYA 2FPLA 1HT1E 3CCBA 3T7DA 3R77A 1EDBA 2VT7A 4GBMA 4R7CA 1PYGA 4MYSA 4BRUA 4CR8A 1PR5A 4AKTA 2XRZA 1CUXA 3Q3JB 1WMAA 3EARA 1IATA 2QE7D 1EWTA 5AHWA 3KV3O 1NMYA 1SKQA 3I9JA 3LH5A 3VZDA 1U7ZA 2C5GA 3H8JA 3GPBA 3OQ1A 4GS5A 1J5PA 3CT6A 5FHRA 5JWHA 3UOWA 3LBAA 1EE9A 1GUAA 3TBFA 4UBNA 2VHEA 3IE0A 2O14A 3CSDA 1TYEB 3D81A 4ETIA 2E9SA 2QAIA 3TRFA 1RJWA 4XDKA 2FRVA 3QE0A 4ARSA 4ECAA 3MJDA 1F14A 4KR6A 1SBZA 2YJZA 3CLSC 5KX5B 3OZCA 1SURA 3T7SA 3EDQA 4LN1A 5DIZA 4P31A 5I8WA 3GRAA 1IPHA 1OI3A 1BCRA 5LMUO 2R1ZA 2ZR8A 1FTNA 3OQ6A 4FYIA 4PW0A 4CE6A 5CMLA 3FPKA 3PG5A 1OZAA 2BELA 3ZDRA 1YI2V 4WLFA 1R0SA 2OV4A 4U5XA 3S29A 4U7DA 2HZ7A 4ZXPA 2H7XA 3K3PA 1E7YA 2JRIA 4MUXA 3ICQB 2HJSA 1IXBA 2G06A 2V97A 2REXB 1H5QA 1LTKA 1K4KA 2Q0AA 1D8AA 2FCAA 2Z58A 3A2LA 1R64A 1R4ZA 2ZEJA 2VOEA 3CO5A 2Z9CA 1JUDA 1KSJA 3ZN0A 4Q48A 4EQZA 3G9TA 4MVJH 3W6UA 2J3IA 1IDOA 4JVNA 1FJGB 4CKEB 4NCAA 4ASUG 1E3DA 5JMTA 1LX7A 3DMYA 1QFSA 2RGAA 2UKDA 2W2PA 4KBYA 5AW4A 4G2NA 5G0VA 1X13A 3CNOA 5E7JA 3ZGNA 2AGAA 1E6UA 3OTHA 5A6VA 3V4RA 4DXWA 1U5CA 2RHMA 2X8BA 3TJZA 3I5UA 5TEWA 3L8ZA 1QDEA 1HT3A 3GG9A 1LVUA 2RGNC 4PV7A 2HN9A 1XMOB 3NVAA 4ZJYA 5BT8A 3DAOA 4RPLA 3PDHA 3R0XA 1AF4A 2EIMC 4TSFG 1NVPD 1UOQA 4Z9FA 3TJTA 1Z4PX 4PTLA 2MIIA 1ABEA 3O8LA 4X90A 1IM2A 2ILMA 1T36B 4MV1A 2XLCA 3AU9A 5EC1C 1BS1A 1QWOA 4WFBV 3ZPXA 1P6QA 1W36D 3TIVA 2V3CC 1BU5A 2JH8A 2PL5A 2UDPA 5J4YA 4NE9A 5T6MA 4UHCA 5IN4A 2A79B 2PTMA 3WWPA 5AI0A 2I2FA 1PVOA 1KAGA 1QV7A 2Z8YA 1W2GA 4OHXA 1NRWA 2C3OA 5EXTA 2AQIA 1XKLA 3TXAA 2AMLA 4LRYA 2PBRA 1RPJA 2GZ3A 1C1DB 3CRZA 3ONEA 1E2MA 3VA7A 4PICA 1R50A 4ZTUB 3CHXA 1F17A 1W4CA 5K09A 3LMKA 2ILVA 1ACLA 3BPZA 2OHVA 4F8EA 3M33A 2YIBA 1C81A 1G64A 1GOTA 2VC2B 3ITDA 2GN8A 3DYBA 2ZRPA 3NHUA 3G4SV 5FTJA 4F0JA 3DE1X 5JV5A 1NVAA 1P77A 1Y3FE 2WNIA 4IIXA 1J2YA 3LHDA 4DHWA 4MZDA 4KNWA 4QFCA 1R66A 1IY0A 3AEZA 4G86A 1DKNA 1Z47A 3S8MA 3ZQKA 2PZBA 4RAOA 5B4UA 5ICEA 1DEAA 2AZ0A 2ZYDA 3FDZA 3E23A 4LF4B 1M73E 1NN0A 3EVBA 3IQFA 4M1TA 4KCGA 2PTGA 3G13A 1R3LC 2Y69B 4HAIA 4UUAA 1LQ2A 4W5JA 3ZCCA 5TV2A 4AIRA 1A97A 4F3KA 2A58A 4GL2A 3LUKA 4KPGA 5B1BB 4TVBA 1WB8A 2QN2A 3SZLA 4YRBA 6REQB 4R40A 5H1YA 3ICWA 3WLQA 1EWVA 3R4CA 4TWBA 4TXMA 2O06A 4CL0A 3IIKA 1N8TA 4IWYA 4ISBA 3EIHA 3ZV5A 5ECWA 1SJ9A 2B5WA 3IV7A 1EDEA 3PYMA 3Q8KA 5FUYA 1LX6A 3E27A 2WF7A 3A7EA 3HCEA 4J0CA 1K98A 2WILA 5CBKA 1Q0RA 1U3FA 2AR9A 1MC5A 2J08A 2UXCO 3CEPB 4AJJA 1K97A 2EZPA 3PA6A 4RQTA 5AW3A 2VNSA 4N49A 4Q9IA 2PQ0A 1QO0A 1NHWA 1S5HC 3Q3EA 4CTNA 3SBDA 3OEHG 4FZ1A 1TUBB 1PTKA 2H54A 2PH3A 2B4AA 3BCRA 4H3KB 3RC7A 3ZDDA 1KH3A 1YRLA 2W0XA 3TQOA 3DT6A 5JZOA 5K45A 1B2LA 1B2RA 1JHMA 1XILA 1EBOA 1AA9A 3OA2A 1WA5A 2G7ZA 2X0IA 2ZIAA 3RVZA 5GP1A 4AXBA 4ACAA 1H9BA 4Q12A 1QM5A 3K72B 4RWZA 1I8TA 4N5IX 2YHIB 4Q4CA 2XVZA 5GONF 4HAYA 3UATA 2HV9A 2ID9A 2ODPA 2WJ6A 4UAUA 4CIYA 4K26A 3W8EA 1JH9A 1E9VA 1BVUA 4YQZA 3Q8WA 2GDJA 2UVDA 3VNQA 5BR8B 1C5KA 4X64O 5COBA 5CW2A 2M7WA 1L0NH 4U8GA 4WVFA 4TLDA 3ZK7A 5JNRA 4KRFA 3Q5GA 5HMLA 4PAQA 4DHEA 2G07A 4QU8A 3P0RA 2WTUA 4C7UA 1Z07A 5DKFA 1YDHA 3FUVA 3A14A 3LI2A 2PMFA 1FVXA 3T3OA 1VKJA 1OOEA 2CNDA 4DQ0A 2PGGA 4YDHB 5EJ9A 2P9ZA 4GXRA 4HNTA 2AC4A 3E5MA 3AONB 2O5VA 3L7AA 1PZNA 4HPJB 4P3KA 3ZZ0A 4F5YA 2AZXA 5K4AA 3ZWOA 1U4OA 4TV9A 3NKFA 2P9JA 5EP4A 5BVHA 4UHEA 4EB6B 4YJ2B 3RGBA 1ZD4A 2CLDX 3L40A 3H65A 2Z56A 4HAXA 1SC4A 2WVGA 3K6KA 1XYVA 4EGCB 1V8FA 1WX1A 3D7LA 4UUPA 3W9BA 4ZO4A 4AJ9A 2PYJA 3HFRA 3MFYA 4KDEA 4DM4A 3OIFA 4FBGA 5E6UB 4B3XA 4DZZA 3WIBA 2D7JA 3F3YA 3BYZA 2LTAA 2G88A 1Z7WA 3B9RA 4RIFA 3PK0A 4F71A 2OCCB 2GA8A 4TMVA 4XD2A 3TD2A 3WLKX 1FSSA 1O6CA 2AN1A 4C20A 1KJIA 2JARA 1WQ3A 3PC2A 1A8IA 4MWEA 4DCMA 3DA8A 3EDYA 4PLPA 4WESA 4HSEA 4WDQA 4K9DA 3K9AA 4O2BA 1QGUB 2G9VA 2XWBF 3PFBA 4MSUA 2VYNA 4RGQA 2VWQA 5HIIA 3TR0A 3V4OA 4HEHA 3KHKA 4LSMA 1AJNA 1JALA 2BM0A 2IPAB 2V4UA 3USCS 5CVJA 5C32A 1WU7A 2RGRA 4CF6A 4AICA 3GHYA 1GRVA 3JYCA 3BGVA 5IC4A 2BGIA 2EZ8A 3I45A 1L5HA 3SF8B 5I5GA 3TQFA 4YAOA 4DWWA 3V1YA 3BXXA 2Q0XA 5JSQA 2C03A 3LPMA 3WWOA 2JFGA 3AUXA 2P77A 3GJ3A 3KK0A 3SYNA 4BVFA 3WIEA 3K0DA 4AWBA 1C0EA 3B8EA 3FRHA 1Z0SA 3IKJA 2E1PA 1NJIW 3JZMA 5KTSA 3EY9A 1ZH6A 3P9SA 3KZNA 4J0QA 4ALJA 4O02B 1NWCA 1XZKA 3UMRA 4DRYA 1XI1A 3AVXA 1TVEA 4DAOA 4G07A 5EIAA 3ZKWB 3LHIA 2J48A 4OIMA 1LPBB 1I4LD 4O4JF 3RUIA 5L3VA 1KDRA 2YCLA 4GPTA 2A14A 1MTZA 5HS4A 1KQFA 1SHLA 2R8OA 3ISJA 3KD2A 4H0CA 1IBSA 4WXEA 1MT0A 3DW1X 3RV3A 3TNLA 3LECA 1K75A 1P3DA 3CLVA 3TTWA 3W79A 3ZBPA 1RM3A 4A91A 4CT4B 4CZZA 4DV2O 3AV3A 3PRHA 5CFZA 2DYRC 4M8LA 1IJKA 4RM3A 3HK2A 1NBAA 5ALTA 3N8IA 2EW2A 1Q6IA 5T3YA 3AFNA 5CLIA 5EIOA 5JSYA 3COVA 1U31A 1BE3H 1GPYA 2JASA 5EKUA 5KNBH 1Y1SA 4FEEA 4ZYLA 2DQSA 4BO1A 4C1NA 4MQLA 3K71B 4F3CA 3K1AB 4N3NA 2BOVA 3KM0A 1C7FA 5DM60 1GN4A 2ONCA 4G1VA 3TJRA 1W46A 3GH3A 1WW3A 3OO1A 4JP3A 4G1FA 4OKNA 1YR6A 1ZITA 5EJGA 3QX9A 4EA9A 5ITVA 1EFRD 3THWA 1NGSA 4WUVA 3BWEA 4YI3A 1WZNA 1KEVA 1RYYA 1IQRA 3D2BA 4GWGA 3THXA 2ZZKA 4HCJA 3DOEA 2QN6A 4CQJA 4TQDA 3T2MA 3JQ9A 3R76A 4GT1A 3KVRA 2VHXA 1XMSA 3E0QA 4IRMA 4J7AA 3A9VA 1A9SA 4ND5A 4NBVA 2X5XA 3VTAA 1P5ZB 3EQZA 4LJSA 2X2FA 4EY5A 1KY2A 4UCQA 2DFLA 2Y8EA 1ZH4A 1LZKA 3EFOA 3I6MA 1CP3A 4NRDA 3WHPA 2H4XA 2YOGA 1UC5B 3L1JA 3DSQA 4Z9BA 3CCQV 4QXAA 1A98A 5L7YA 3SE7A 3DL7A 2E55A 1K5SA 2VUIB 4PZ9A 4R2KA 5EY5B 3WQBA 2EILB 1OKKD 2OGWA 3HCCA 4GI5A 5FIUA 4QYTA 3VC1A 1WXXA 4XYMA 3VFDA 4Q7EA 3KYBA 1BCRB 4UCOA 1PR6A 3S2EA 1P5RA 4FIZA 3SC3A 2AX4A 4OOFA 2GNPA 1VSUA 3ZKWA 5LJLA 1EINA 4RTRA 2B99A 2DHRA 3RVJA 2VRWA 3SZUA 5H9CA 1XL0A 4BLWA 3A10A 5REQA 3AXTA 2F3RA 5J5AA 3S44A 3UMFA 3HJFA 1IHPA 1N1EA 4OM8A 5SYMA 4ZKDA 3NGMA 3D1JA 4ZV4A 5HDQA 4UFOA 2X0LA 5TJHA 3CEAA 2AVNA 4KR2A 1Y33E 4B3RO 1L8OA 3VHLB 1QF6A 4GBED 1ZIOA 5DU2A 4M1MA 1LPNA 4JLPA 5DYGA 2W2KB 1E2PA 1SZJG 1Z36A 2D59A 2CLFB 2HWWA 1FRFS 1E0SA 4C3UA 5KQPA 3M83A 2DFKB 4F4FA 2JFQA 1MR3F 3TGUH 2IOFA 2NTJA 4QQFA 5I8PA 4I3HA 4JODA 3OZFA 3SPJA 2EZ4A 4HSGA 4G09A 4GYYA 2JD2A 5CFOA 1B1CA 1ZCZA 3A6KA 3EEBA 1IXRC 2P1ZA 3FSEA 3GZJA 3LY9A 2F48A 2ZBQA 4KE7A 4XUGB 5CCXA 2DQ4A 2Q6OA 5K8UA 2CNWA 2YC2C 4JD5A 4HDRA 4C4TA 4JASA 2BE9A 2XVMA 5IAJA 3W8FA 5KHHA 2AKAB 2BSAA 2V6GA 1SRQA 3H8SA 5AOCA 1B00A 4G8CA 4J7JA 1TM3E 3T5PA 2PN1A 4B7KA 3NOQA 2Y2VA 3LQQA 5A06A 2G9RA 1SVSA 1NQOA 4HNGA 2GKGA 4WI1A 4DLAA 2PUWA 2CXRA 2X9GA 4O4IA 1ONSA 1KJJA 3BFXA 1PNQA 1DHRA 4S2UA 1KMIZ 2XAFA 5AO9A 2XDYA 3DBOB 4KVZA 5IC5A 4DYDA 1DO8A 1H1LA 2NU9B 1T43A 1C1DA 2ZUCA 3ANNA 4NULA 3SFTA 3PQ7A 3OLYA 4BQEA 2B8TA 1B43A 1VDZA 2AJLI 2MJLA 2OPBA 3WGQA 4AP6A 1SVLA 2JPDA 5C7LO 3P4YA 2C2OA 4KC0A 4B3DA 4X61A 4D5EA 2XY4A 1O96A 4B6OA 4AROA 3QPWA 3GRPA 5EZYF 1VRCA 2BFMA 2XNJA 4MYRA 2M6SA 3KT0A 3MT7A 1JI3A 2GN1A 1UZUA 2HH9A 4EHBA 2Q1WA 4WNCA 2B8JA 1GFZA 3MCAA 4OQYA 1JMKC 5JDCA 3AFHA 3C45A 2VZ9A 1QR9A 3VJMA 3L01A 2WT4A 2FWAA 2A0LA 1YIAA 1N0HA 3OGCC 2FP4A 2X3YA 3R40A 4HATA 3WNZA 1QVVA 1QMGA 2I3BA 3HGTA 4IIYA 4MQ6A 4P32A 4C04A 3AF4A 3PFNA 1SIWA 4XH9B 5EP1A 2GEUA 3OR6C 1ZA1A 3IEIA 3LQ4A 3TQIA 4CMEC 5CH5A 4YLYA 4FYHA 1H8HD 1QJCA 2EIKC 3LSQA 2GCEA 1M4UA 1A5SB 1VMDA 2VEOA 2PQMA 3I8OA 2Q0OC 4X20B 3JTMA 4MMYB 5CG2A 3U3JA 1CXZB 3LDHA 3O8BA 4CQNA 3AO0B 3F2IA 5BQPA 2O20A 1HRKA 4PZAA 4NZPA 1YIDA 1V4BA 2ETXA 4JC5A 3JQAB 2ZFUA 4C0JA 3SLGA 1HNWO 4J1TC 4WOCA 2DR2A 1LUVA 1CY7A 2ODTX 3DFKA 1HKHA 3K05A 5EG5A 1DAOA 3PD0A 4GVLA 4O8CA 2XXJA 3GP5A 3V42A 3HKDB 1TUBA 1QU7A 4MR9B 2JLRA 4X3OA 4LY9A 4F4DA 1NIPA 3JV7A 1O0BA 1H4SA 1R8YA 5GMOA 4W5WA 4E4YA 1ZHHA 4PRKA 1XT6A 4Q1DA 4B8WA 1JZSA 3AY7A 1JQKA 5JAQA 1E2EA 4CV3A 4RGVA 3KBOA 4F96A 3GGPA 1LPOA 2YHIA 1C4OA 3T4XA 3Q0TA 1G6KA 2Q73A 3GLHA 4WAUA 2J3MA 3F6SA 4MDYA 4RTOA 4MCAA 1RXWA 3PC6A 2D13A 4YJGB 1PT6A 3TLGB 4C2AA 1XJQA 5GIOE 1KO1A 2RJ3A 3IOCA 3QELB 4MGHA 5DHAA 3S3TA 4BBZA 4D0SA 1ISSA 1E1QA 1DTWA 3NNNA 2ZS8A 2QG4A 3NRBA 3TIXB 3FVRA 4JHXA 2P4HX 3FKJA 3HBNA 1MD9A 3WFJA 1R9NA 4M0UA 5F2VO 1YJCA 4Y7CA 5H0IA 4A10A 3LHFA 1I6LA 2Y0EA 4QJFB 1ZOIA 5M04A 4I9WA 4X62B 4HRYA 3WXMA 1Z7EA 2BBSA 3VBBA 2J0UA 4XPIB 1JQ0A 2JFBA 2Z1DA 2GI4A 3MERA 4MULA 1T0PA 4ETWA 6AT1A 1FJHA 5IMBA 4Q24A 5DT9A 2L17A 2FV8A 4RO2A 3FZGA 4LRWA 3KSBC 4PR3A 1ZJYA 4EGJA 3K06A 1OH6A 3F7OA 1IEWA 4TV9B 2ID7A 1VYVA 3HYLA 4RDHA 3OUUA 1AHHA 3PI7A 1XG5A 4KQWA 2XJ9A 1CNMA 4YJKA 3RBXA 4BYMA 1MHTA 3VDMA 1RAHA 1S4MA 1ZIXA 3H5VA 3KHUA 3MAJA 3OE7G 4L8VA 2UZ1A 1Q3KA 2BUAA 3L07A 1Z7YA 1BXGA 4ZT7A 1HG0A 4YROA 4DEVA 4ZYXA 5BMVF 1AXEA 2XCIA 2XQVA 1M6WA 1ZK2A 3CRCA 2O7SA 2OHHA 3TZKA 1E3QA 2FPGB 2JIBA 3CLSD 3DVLA 1U65A 4Q9LA 4Q1EA 2NPFA 3IC9A 3UAZA 5ILOA 1HNZB 1JU3A 1YOVA 3THWB 4HWTA 3SI7A 1W0CA 4M8NE 2BFCA 1LBEA 2DFVA 5F5NA 3VR6A 1TT5B 1GAXA 2ODNA 1XDDA 4CWAA 3W5AA 2YC0A 1RJFA 2ZJZA 4O1HA 1SY7A 2PH1A 4JI2B 2EX0A 2ARKA 2HEIA 1BRTA 2XQIA 3BK2A 2AE2A 3IEVA 5HW0A 1GTSA 4ZHQB 3JW8A 1YJBA 4D9HA 3M6MD 4KYVA 2JLQA 2XUZA 4BJHB 1TO1E 3TXQA 2Z9DA 3GX1A 4BFXA 4LF5O 4WWHA 1ETHA 3NRJA 1GPNA 1GQRA 2WPNA 5K1ZA 3VVCA 4KZKA 3O83A 4BLTA 1EMDA 4UVDA 4XVCA 3BMQA 1IBKB 1KRHA 2JLSA 3PQCA 4OJTA 1GA1A 1MIOB 4MQEB 4EJFA 3HJHA 1SQSA 1SXGA 5L3CA 1Y8ZA 4BO4A 3ENQA 4GMFA 5C34B 2VLIA 4HQRA 3T5GA 2IU6A 1GWNA 4AUMA 3QSGA 1I6WA 5E2IA 3PPXA 2OXCA 3D6UA 5JZSA 5IJAA 2HFEC 3A1WA 1R4NA 1T9ZA 2HNKA 2X3FA 1II8B 1FTSA 1R9JA 2X86A 4YREA 3PDIA 3O1HB 4Q7QA 4RY2A 1ZEJA 4KXFB 1WXDA 1B06A 2R6GA 3GLSA 1FSPA 2CBXA 2Y48A 3IP7A 3K0BA 1P29A 2QJFA 3BDIA 3N1UA 4PCLA 5EZSA 5I9BA 4QOJA 4FK5C 2JFUA 3MGCA 1DARA 4BNDA 4CNBA 5EMJA 2TMKA 5DGCA 1EGQA 1FDSA 3P2KA 2EGHA 1VJDA 3AERA 4QHYA 3R74A 4G6ZA 3PNYA 4OHFA 1M5IA 2ZSIA 4V0OA 1L7PA 5CVVA 4N8DA 4L3WA 1UOOA 3PI6A 4N23A 1HYEA 3D59A 1LEHA 1DKLA 1JHUA 2QQ5A 4JKIA 4QBKA 1KE2A 4YYEA 4ALIA 1X77A 2G28A 4BJ3A 1W52X 2QXYA 4I4NA 2Z2XA 5EEGA 2QRVA 2HBRA 3AKEA 4DJDC 3GLKA 3QPUA 1EK1A 3DNMA 5EMMA 1EFRA 3OC0A 2PS3A 3L0BA 3UKDA 2YQ5A 3AP3A 3O8DA 4P3PA 4D3YA 1VQPV 5PGMA 1QTNA 2C4TA 1DG9A 2SECE 1A1VA 1M5UA 3BK7A 4O5AA 4NPAA 1NTMH 2IYPA 4KQMA 4O08A 3ZLVA 1M2OB 1KYTA 1SC1A 2IHZA 3I1JA 1NMSA 3ET5A 3OQIA 4PANA 1RJDA 3ROPA 1KOGA 3LF2A 4A36A 3LK6A 2J9FB 2P65A 4A15A 2BY4A 2A9KA 1BZYA 1CW2B 1EP1B 4BLUA 5LSAA 1HI9A 1NQVA 3DE6X 4M83A 1O6BA 4EKDA 1G8PA 3O03A 4DRZA 4KXNA 5DEIA 1RM4A 4XDGA 3F74A 1ZUNA 1EHIA 1PK7A 1JDTA 3NALA 1E9SA 1PK8A 4OQDA 2GBOA 3CCMV 2DUJA 5BQOA 4D8UA 1CUGA 4DLNA 1Q43A 1E89A 1MQ8B 1VEWA 3COPA 5A4KA 1OX5A 2Y9PB 5EI5A 4U7GA 1TFUA 2WM2A 3LT5A 4Y2JA 2WM9B 4ME6A 1WG8A 5REQB 1RLTA 1PRYA 1MJGM 5IYBO 2XVXA 5AHKA 1JILA 2B1GA 1E5VA 1CRWG 1P7PA 1VFNA 3BH7A 5H83A 4BZXA 1ZQ1A 1I5EA 1TK9A 4ON9A 4CLOA 4EMUA 5FUQA 2ZUVA 3KWJA 4XTRA 1GO3F 3MGKA 4Q9JA 2A5JA 5BNIA 2QA5A 4JC4A 2RHGB 1RYFA 2WTNA 2XCLA 3TECE 3U44A 1KKLA 1X3LA 2AG8A 1Z6YA 2W0MA 3WKBA 3FDFA 3UWDA 2YRFA 3AV0B 5AIAA 1OBFO 4A26A 2JHCA 3IC5A 16PKA 1FFYA 4JI1B 5LZ7A 4DQUA 1T6BY 1XDGA 3IT2A 4M1YA 2FUNB 2NO0A 3DMPA 1XL6A 2AR0A 3C4QA 3KKKA 3RT3C 4IS2A 1HOTA 1VHTA 3T3DA 1CUVA 5FF9A 4YRAA 5J1TB 4ZCTA 2C4KA 3PHIA 4E5SA 1YBHA 4AHCA 4PG7A 1FRQA 4PC6A 4AKHA 1DDOA 4U1RA 4ZQEA 2IW5A 3UJHA 1YJNV 4N7RA 5ALQA 2V6FA 3EUEA 1XZNA 2A84A 2PT5A 4Y9DA 1H5NA 1TK2A 2PZEA 2KB1A 3D4LA 3OX2A 5WRFA 2AKEA 1FLDA 3AF3A 1H65A 2GPWA 3HBAA 1RYEA 3LLCA 1XMOO 3FOAA 2OOKA 1BEEA 3K3WA 3MAGA 3PLRA 4ABYA 3UJ9A 3B1JA 4J4HA 4C3ZA 4CL2A 3GW8A 3QUCA 1KQPA 3LZCA 1SG6A 5A9SB 3QK7A 2PUGA 1YRWA 5B57C 2DCUA 2OIEA 3IBGA 3ICOA 1G55A 4GLBA 4D8TA 1ZXBA 4NDNE 2C8KA 5AI4A 4IUBS 1DIGA 4EVRA 4KX3A 1KJ8A 1FMFA 2C9BA 1BD3A 2BFEB 3WC4A 1E2LA 4HLUA 1NQAO 2Q8PA 4ZV9A 4UVIA 1TW3A 1WUKS 3C48A 2A86A 2BR5A 3NPAA 2FSGA 4FR2A 3PFWO 4TN1A 5T4FA 4DABA 1RXEA 3ZCTA 4IF4A 1PPJH 4HMPA 2PIAA 1WA8B 1F9AA 3JRNA 5IU6A 4D4KA 2GEJA 3QBDA 4RZXA 4BB0A 2JLXA 2IYEA 1V7QA 2WRZA 1VIAA 1JLHA 1WVMA 3S7TA 1TT7A 4WZZA 1QU3A 2HXYA 3OCCA 3QH4A 1KH2A 3ROKA 3QPAA 4FKMA 1XKXA 4AN1A 2IXGA 2P22C 1LPSA 4YRLA 4L2IA 2WLNA 3S1LA 4A5SA 2UXBO 1EDDA 2WIFA 3L1KA 3OM9A 5KSPA 2O8BA 3MCUA 1VGVA 4KVGA 4YCDA 2CCKA 4U63A 4B5KA 4FHCA 2RCVA 1V3UA 3D9QX 4OHWA 3BVPA 5ERYA 5LQKA 1W6RA 5F51A 3WJAA 1PYOA 2HKOA 4Z4GA 4EFDA 1FDIA 1D5NA 1J00A 1YCDA 3F5DA 3IIJA 4TWJA 4F92B 4M1KA 4CL8A 2DLCX 1V47A 1KVUA 1W30A 4B3SB 3FF4A 4P93A 4ODIA 3BREA 4LNAA 1TECE 2DTEA 5HCIA 5HOEA 4CT0A 1NDHA 2XKBA 4LK2A 5G02A 4XI9A 3GVXA 5AI6A 5LDDC 4LMBA 1VMGA 1YH3A 2D2VA 2RHOA 1OV4A 3U7HB 3I39X 1TM4E 4MR9A 4YO8A 2G76A 3H1TA 4Q3OA 6LDHA 1MORA 2JGNA 3IXQA 2ZUWA 1S9DA 2QMZA 4ZFNA 1LK5A 3CJQA 2IJHA 1J97A 3AF0A 4MVXA 4Y6LA 3JVIA 3WRWA 3VZQA 2ATEA 2BEKA 3F1KA 5EJ5A 5L3ZA 1AMUA 2VWHA 2NACA 3LZ6A 4BWVA 5ADUS 3L70H 4N21A 4MRAA 3ROXA 1R3IC 3TLGA 2IS6A 2C98A 2I6UA 1Z12A 3D2CA 3QELA 1IEQA 1ESZA 3DL4A 1HTTA 4QDJA 1U94A 5BN1A 2JGKA 1OMOA 3OJWA 3MWFA 3OOWA 4TN5A 1G9SA 2VBIA 2QRHA 3VH3A 5KS2A 1IUOA 1ZOOA 3AYXB 1B41A 1K3FA 1P1IA 1MA3A 4QIWF 4UU7A 2A2ZA 1AE1A 3DEJA 4HAMA 2XSZD 3GEMA 3K9CA 3L8YA 1ZIYA 3AR9A 2CWWA 3HEMA 5FO1A 5HG0A 3BTVA 2C1ZA 1Q1GA 3NAMA 2ZYIA 2X4LA 5T7BA 4KXYA 3U7QB 1ODSA 5DCYA 2RDCA 4GPZA 2PMKA 5GTHZ 4X24A 4DNQA 2D74A 4L4RA 3C6XA 2XUDA 1MQAA 2QJWA 2VHVA 3O4RA 4IYRA 4MVUA 1RM1B 1YIJV 1AZWA 1Z4IA 2GYVA 2UZ1B 1FPOA 2W2NA 4XM1A 3FGOA 5TARA 5KSWB 3K08A 5DEOA 1QRUA 1S72V 1C9KA 2ZJ2A 3IJPA 4DCGA 4GKKB 2CL6X 4REOA 1B26A 4CN9A 4MHOA 3WL4A 1T8UA 3RSHA 4TTIA 1E99A 2E4AA 1DL5A 2BFCB 3H9BA 4DV0B 1M7GA 3G9ZA 3ILSA 5CRIA 5EHGA 1A5BB 3I53A 3KEQA 3H8WA 2EFJA 4ESEA 4XRGA 4JJAA 3UWPA 3BSYA 5KQRA 4KTVE 4HGQA 1EQ2A 5ESXA 4D9JA 2DH6A 1SQ5A 1BGYH 3R5KA 1ITZA 1GZ4A 5BSEA 4ABMA 2R47A 2XNSA 3QWHA 4R2WA 3IQIX 4DBZA 5K8JB 3JQRA 1P1HA 1T29A 3I4FA 4UD6A 3W7TA 4EG0A 1NE2A 1L4HA 2H51A 2Q3LA 3K0EA 2VDKB 4K6GA 3FPLA 4P1ZA 1FMTA 1E5XA 4RMNA 2AHOA 1ZGCA 2OHJA 1D4OA 2ZS9A 3TEFA 1G8HA 4KQGA 3WG7B 4J8PA 1G2OA 1DQSA 1TJ3A 3SOZA 4EZEA 1YKSA 1NF2A 1VP3A 1R4NB 3I73A 4AK9A 3BY6A 1RAEA 3EIUA 4Z4HA 2VK8A 2YY7A 4YRKA 4OOEA 1G5IA 3PQ2A 1I30A 5CVCA 3HP4A 3KCYA 3GNLA 3K4QA 3L6EA 4ZAZA 5FKJA 2PGJA 3OF5A 3Q2KA 3ZN1A 1F5NA 4OLJA 2PSHA 1WHTB 1VFPA 2Z2YA 1GZDA 4J0FA 2R7AA 3I5AA 3GIDA 1EKXA 1N25A 4N01A 2ZBPA 1GO2A 5IP5A 5KTYA 4BVGA 2DTDA 3FN4A 2DHEA 3HUEA 4XEHA 3ZE1B 4DGSA 2BSQA 1XZAA 3AERB 1PW5A 3N58A 4DEYA 2OO5C 4KWHA 4IJ5A 5ICGA 1S5JA 3SXUB 1KO5A 1ZRNA 3BL5A 3WGLA 3VBCA 1XCMA 4RWUA 2OL4A 2QM7A 5T5QA 2CTQA 2IEIA 1MO5A 1JLRA 4RMIA 1QJ4A 3IGAC 4NAUA 3UXYA 2NUAA 3LO8A 5IT4A 3ZZ1A 1FS0G 1ZJ6A 3V2GA 1L8XA 3RS2A 1Z0KA 3DVQX 3V7FA 4EQ6B 2I29A 4OJYA 3OOHA 4IZ6A 1O8CA 1OE0A 1PVVA 2R7LA 3DB2A 3M6FA 1Q6ZA 2PGIA 3AUYA 4OUDB 5SV2A 2OP1A 1UT8A 1NBWB 2HQRA 3IDAA 4D96A 2EBFX 3DDCA 2JATA 3EZ2A 1RKQA 5K0GA 3L18A 3CT4A 3R9XA 3UB3A 1NQUA 1PBNA 4EHDA 4RZQA 1EIWA 1JIVA 1PFKA 4UQOA 3R7NA 5EERA 5FWNA 4MXDA 2E75B 4AQYO 5A9RA 3ZQ6A 1QQBA 1MOSA 1SOUA 2Q4OA 1YI0A 4Z9XA 5BSHA 1UJ5A 5LQRA 1HTWA 1H2XA 3DE5X 4BZWA 4WXHA 2C1XA 2R6R1 1JEQA 1T3HA 2G1AA 4J16C 4FM1A 1XTPA 2P7TC 1K8ZB 2OTLV 1Z4JA 4Z2WA 2GYWA 3A9CA 3B7WA 4CTOA 5BV2P 5DWVA 3CNHA 2YH2A 3N2GB 3SJ7A 3FCAA 3HB3B 4AT1A 5HX7A 4DFDA 2UU9O 3OFNA 4HXFB 1XRQA 4LJ6A 4AP9A 5LWHA 2Z6AA 2IIPA 3LCRA 4B84A 1AHNA 1FU8A 1ZX1A 4X94A 4J3NA 5AK5A 3LPLA 1MW8X 1ZK0A 2FI1A 4QJ5A 4YCMA 2AL7A 2NOAA 5E8RA 5IMSA 1QUFA 5AI9A 5A71A 4K6HA 4QUKA 3GLIE 1S8AA 1C0KA 2B7LA 3Q7IA 4KITB 5KYKA 4QGSA 1TNDA 3FTCA 3SPGA 3Q9NA 4FLTA 2R6DA 3JPYA 1V55B 5D8DA 2B98A 4KQCA 1OVGA 2O3RA 5TEVA 1DPFA 2XA2A 3PS9A 4CLRA 4KOAA 4DMFA 4WFQA 3C1AA 1ZAYA 3FB4A 4HWOA 1MH9A 1LI4A 2HHAA 1HZJA 3OY2A 5DECA 5DVZA 3AHGA 2OFFA 3G2IA 4WK0B 5K0ZA 4E2LA 3NJ4A 1Q86W 4R3UC 2BLLA 2KB0A 4EG5A 3LQYA 2X0EA 3GEHA 1EGAA 3U6KA 2D0PB 2I6QA 4RD6A 2F43A 4RSHA 5B12A 3ENKA 1JJVA 3C3WA 1PZHA 4R8KA 3GLFB 2P1RA 1IBRA 5BV7A 1ENYA 2WHRA 5U4QA 3B09A 3QJGA 1Y7IA 2E21A 1QHXA 5IBRA 1Q2XA 3P9YA 1J0XO 3TTUA 1VLZA 1VCOA 1EM1A 3SN6A 1BDBA 1C9DB 1D2GA 1G6HA 1PZXA 1VSQA 2ZBUA 5MN4A 3DVAB 5A7GA 3CP1A 2ZPUA 2OZPA 4TXNA 2OECA 1Q20A 4RL6A 4ZU6X 5IJ0A 4ATNA 1OFVA 1DOHA 4OHRA 2QX7A 5KLVH 4MUYA 3S5JA 5IWCA 1E1NA 2IYTA 4L78A 3WZMA 1KVTA 2PEYA 1W93A 1Q90D 4OJNA 2QPOA 5KVSA 2WA2A 3TR5A 1V7PC 1D9XA 2X4DA 4MVYA 4Q4JB 4FE3A 5JSHA 1MH1A 2ZYWX 4DR5O 3ZE2B 4DREA 4L5JA 1TKBA 2IC5A 3DZ8A 4EKNB 1MABG 2BMVA 4IDEA 2DB3A 3GGDA 2Z3WA 4L9AA 5I4BA 1XZGA 2FW0A 3LUPA 1YCIA 4Q4DA 3SJBA 2VYFA 3N0TA 2CXQA 3OTIA 4IX1A 3CLRC 3PXXA 4UOQA 2BFNA 2ZRJA 5CDSA 2R8BA 3CX8A 2OTJV 1FFAA 2H4WA 3MPOA 3ZXYA 4KQ9A 5FTKA 2P6JA 1TGOA 3V97A 5KCZA 1KZYC 3SQNA 3CJHA 2ZB4A 4ZPJA 3OHPA 4CVNA 4GZ6A 3QVOA 4AD8A 3G6KA 2HSDA 1QH1B 3F47A 3NT2A 3SGLA 3GCXA 3UQZA 4AG3A 5IKMA 4P0QB 4DLVA 3NUQA 4RHYA 5IZCA 2W6JG 1OASA 3T3GA 2Q6KA 5LMZA 3ETJA 4LF9O 1DAGA 2HJWA 2VJLA 2RHDA 3GRYA 1N2JA 3UOGA 3D8TA 4IVRA 1LXCA 1EJ6A 1NE7A 2EXXA 4QAQA 5DI9A 3A26A 2RHWA 2A0YA 1P74A 1WEHA 3NV9A 4L5AA 1OCRC 4PHHA 4YN3A 3SSMA 1CVRA 4EUNA 1CEXA 5TJ9A 1DKUA 2GWHA 1JDBB 5JNVA 2EZUA 5LQJA 1FRVA 3JATB 3QHQA 1OA0A 1WSAA 3QOYA 1RU3A 2PVCA 2X8WA 2XXBA 4FN5A 3CRNA 3TKLA 4E7PA 2H1RA 2I87A 2PFKA 2HXGA 2UYYA 4Y2SA 4Z7OB 1OILA 3DTTA 3NWBA 3STVA 1J09A 4E2FA 4F04A 1UBFA 2X4IA 3H7IA 3DV9A 4MYUA 5ALWA 4EWLA 2P8JA 1H4TA 1ZESA 4OFBA 1QYIA 4RH3A 1OB5A 1FFGA 4URVR 2QVZX 3P20A 5JXIA 1Q7CA 3E83A 3HACA 1RJEA 3LWZA 3PEFA 1NMQA 4IGAA 4P4NA 2LP4Y 4W5HA 1A9QA 4HQKA 4JMPA 3VSBA 5BR7A 2AOTB 4DR3O 1TZBA 2GN2A 1X8LA 3AF1A 5A03A 1AS2A 1KEZA 1ZGHA 3KAPA 4TQ9A 1US6A 1G5HA 2HV8A 2PL9A 4RPKA 2QN9A 3SXJA 1XZEA 2LW7A 2LBPA 3A3PA 4L8LA 3NFRA 4R68A 4JCOA 1CJSA 5TQVA 3SEQA 2HRCA 4TYYA 3KZOA 1YMQA 3RR2A 4AJNA 4C7MA 2V7BA 2C2ZA 2D54A 3B5JA 4YX9A 1K2VN 2XMZA 2PM8A 4TS1A 3RK0A 3OZ7A 1I33A 3CCLV 1J9ZA 4B1FA 2QT0A 1CJKC 2PZ8A 5LDHA 5BWCA 1MX3A 3FD9A 3QE2A 2KLBA 4EFBA 2WWXA 3L02A 3QPBA 2E0IA 1RVDA 4JB2A 4KQ2A 5CGQB 4BEBA 3K1ZA 1ZLYA 3BA9A 4CM9A 5BN4A 4W7SA 2FWNA 2AJDA 3IAFA 1JCHA 4M53A 4QPZA 5AK3A 5CJPA 1FTQA 3WSTA 2V54A 4DA8A 2WE8A 1N0JA 1HURA 4EHIA 3PWSA 1C1HA 1FXHA 4L0CA 5SYNA 1YS4A 2JIPA 4B0PA 3BZWA 3KQVA 1UXHA 1AHIA 2VNAA 3B1WA 3QLVC 1EFDN 1GQOA 1JJ2U 3W7BA 3ZS8A 3GN1A 4HTFB 4NU0A 1W88A 3ABZA 1U7WA 4UPDA 3SPCA 3ZU3A 1SUBA 2A3RA 2GD6A 1PD3A 2WIAA 4TTVA 3ND9A 3MUFA 3PEVA 5AOVA 4JB8A 3R09A 4TMTA 1YZNA 3FTEA 3M5CA 1JKJA 1AP6A 3NVMB 3ZUPA 2BDEA 3EOZA 2DJVA 1XNQB 5IM5A 2XDQB 1NBOA 4CI0B 4YAWA 5A4DA 4X8AA 2J4CA 3F0TA 3HLYA 4IINA 3HO1A 2V5AA 1FTYA 1EWYA 1DI0A 2D0OB 1U0LA 2CSUA 1ZKMA 3R5XA 4HQ0A 4PYNA 1OGJA 2EBHX 5FWYB 4DLYA 1YKFA 5B66Z 3A6GA 2HTFA 2AHZA 3N3AC 1A50B 3STZC 4GOXA 4Y30A 3AW9A 2IY8A 4Q20A 1PFQA 2AWNA 2GDSA 2PS0A 1P18A 3GNSA 4BDSA 3VU8A 4ERNA 5BWMA 5L51A 4CMIB 1O0CA 3RUAA 4C0XA 3WYAA 2CH7A 5CUQA 2Q7DA 4HDMA 5JAMA 1ZCAA 2FKNA 3ZRWA 5DT2A 4CKXA 1N9GA 2XB6A 2YIJA 5JPIA 1RACA 1ISIA 1LJUA 1K6EA 2AE1A 4TXLA 3DSRA 3MF4A 1X1TA 3LU1A 5JSZA 2WYUA 2IH2A 3ZV6A 3ER6A 2RB4A 1RCTE 1U7TA 3FETA 1ST2A 1ZSVA 3RT1A 3CCCA 2YOFA 5KOHB 1GMGA 2Y1KA 4RANA 4Q4LA 2H8KA 1F6BA 5C2JB 3MTAA 1WPXA 2SNIE 3SYAA 3L73H 4DRXA 1E5LA 5KYXB 1CF4A 1WCIA 3GBPA 5ALPA 4DV1O 4MQUA 3T94A 4Y6PA 2O7NA 1CDEA 3LDEA 4XM0A 1HF3A 1QH8B 4M9RA 3ZEAA 4F2PA 4F4HA 1U7OA 3SX0A 1OXSC 3BB1A 1SC6A 3K0SA 1U7XA 1WKCA 1VMIA 3GGJA 1YDGA 5ALHA 2Q8VA 2HK8A 4HDAA 2F1RA 1LH0A 1L2TA 2IOQA 3OIGA 1X7DA 3MW8A 1PYDA 1Y7HA 1JDVA 4JI8B 2CC2A 2HSGA 3DLTA 3E48A 1RPAA 3N70A 4LJ4A 3TUIC 3V5NA 4WK6A 1G6Q1 3K30A 3TLXA 4P5DA 1WMSA 2EILC 3AC0A 3GRVA 3PFIA 1LZLA 1YU9A 1R15A 2Q0HA 2ZRMA 4PQGA 4QVIA 3P0HA 4QYSA 2EQBA 4X92A 3STLC 3ASVA 3D6NB 5K3AA 2OHFA 2ZROA 2ZM6O 2KMLA 5DN6A 2X7XA 2BTQA 1U2GC 2QSZA 4RHTA 3R9XB 4KXMA 1Z2AA 2WA1A 4LGMA 4RACA 2YIBD 5AG2A 1ZWLA 1ILWA 4U39A 9MHTA 5CLLA 4EJSC 5ALVA 4G4SO 2BZ0A 3C70A 4NYJQ 3I9MA 3LA6A 4ZOBA 3ZWNA 4CM5A 5EFZA 4FZ3A 4O1MA 2E74B 2XUMA 1OV6A 3KXPA 4L5BA 3V1LA 1KY5A 2AG6A 2XE8A 5BRJA 1ZM7A 5I7OA 2C5AA 1ANKA 3PDUA 4EY4A 1MG0A 3GJ7A 2W6NA 3FLAA 2GF0A 4GI3A 3L84A 4ND3A 3X2EA 1MB3A 3OU7A 1T8PA 1YUBA 2RONA 1E9FA 3SHWA 1I24A 1XEXB 2YXDA 3SKXA 2PZKA 1U9CA 1JPVA 2ZVQX 4J2TA 4Q21A 3WDLA 4XB6B 4EUHA 3A9RA 3H2GA 3NAZA 4GD3Q 4RHFA 4MA4A 2IPMA 2GEVA 1D6SA 2F8MA 5IVHA 3KOOA 4E12A 3CHYA 1ZXLA 2MMGA 1EFUA 3L06A 2O8CA 4ND8B 1M1YB 4D7SA 4UXHA 1CRPA 4KP7A 4TKUA 1G3RA 4IXNA 1D2DA 1Z25A 4IOMA 4HNSA 3IBSA 2EW1A 4UCXA 4XOIA 5DLPA 3U31A 5DTQA 3OUFA 2ZSAA 1RBQA 3EIOA 1PR9A 1N6NA 4ND1A 3WYNA 4A03A 1JOYA 3WHLA 3K59A 1PNVA 2FN4A 3HJAA 5CN0A 5DI3A 3R7WA 2WLLA 2G4CA 4D8VA 1JHYA 1NJSA 3TTYA 2RFLA 4CBCA 1Q5OA 1SQGA 4WHMA 3EWSA 2AFIE 3CIFA 2E4ZA 3EFHA 1NN5A 3LD9A 1GL7A 1M2VA 3OLZA 1NPYA 2C42A 5D86A 5FV7A 3GFOA 4C4AA 4YJHA 4YRCA 1PJCA 4XDLA 1KEPA 2JJ1A 2VJNA 4C1BA 2TMGA 1ENVA 3KR2A 1Y1QA 3ZMTA 4Y9SA 4KHPO 1AK1A 2GN9A 5A2GA 1PK9A 3B12A 3H5WA 4CEHA 1ONNA 1FFSA 3I4CA 1KMQA 4NPCA 4NI5A 2XUPA 5FBRB 3OI7A 1Z17A 3MOGA 4IT5A 4OP3A 9ATCA 3C3YA 1GADO 1IY9A 2H5JA 3GLFA 1U2DA 3G85A 5DTEA 3DTVD 1V16B 1T5DX 1YRAA 2DBZA 4R98A 3ZNQA 1LPMA 4NX2A 4LOLA 2JKYA 2FPRA 3J80A 1DINA 1HSZA 2B6HA 3WR5A 3K70C 4Q3DA 1PUJA 1GTMA 1E98A 2J4DA 4LSWA 2WTMA 2H4FA 3NQ41 2XCUA 3F78A 5BSUA 1JWBB 1P2SA 3O4VA 5HIMA 2QTNA 2H2FA 4ZI5A 3RVNA 6GPBA 4FLXA 3I6QA 3DYVA 1U3DA 4HH4A 4TMKA 1KBHA 1MGOA 3AEKB 1OFGA 1AVMA 1TCCA 1YTLA 3FOWA 4KMOA 4LBYA 3ZDZB 2I91A 2XWJI 3L6DA 3KSAC 5CH3A 1C3XA 2VT2A 1H8ED 3LPCA 3OZXA 3B3JA 2BR3A 4NABA 3BJEA 3GY0A 3FTFA 3G8BA 4PJ0Z 3BQNB 3G2MA 3X1WA 1XIVA 3BAZA 4FFWA 3ZHUA 3JQ9C 3RYFA 5ELMA 1Q77A 1I7QB 1MCZA 3TM5A 1C8VB 1GQ2A 2B4KA 4PXSA 3M7IA 4TVKA 2NG1A 1XOUA 1QG6A 3DDZX 2E4YA 3EGEA 1ODIA 5EC8A 3HB1A 1J1UA 1RRPA 3VNBA 1FL9A 2J0QA 4N48A 3K0CC 1FU7A 1P31A 3HVHA 1IYZA 5JFTA 5HE8A 1RZRA 4XUDA 2VXCA 4CTJA 5HMMA 1B15A 1FXKC 1GT6A 3A70A 3RSFA 4LF6B 4EKWA 1EK2A 1XNGA 5IZ4A 1DKRA 5FP0A 1NC1A 8AT1A 2XWSA 3CLTC 1UXJA 1PNLA 2OCDA 2D3TA 4JBNA 5JY6A 5ITZA 3ZLJA 1SNYA 2ZI7A 3BWBA 1M1ZA 3MVEA 4TWAA 4BIZA 3WLJA 3E58A 4K28A 5IKXA 3ZMZA 1KMHB 1JB1A 2QSJA 4I5SA 2YS6A 4JBXA 2CXXA 3OD4A 2VDRB 4KMRA 5EP3A 3EJWA 4WNAA 5GV7A 1T10A 5I7AA 5K5EA 2BFOA 1HR0O 5BYBA 3A1DA 1KDTA 1MIHA 1MJFA 1SA0A 5FPSA 2J7PA 4D80A 1H9AA 2X0DA 3HXMA 3AJEA 1E7SA 2A9QA 3R0JA 3DO6A 5CB4B 1I9GA 4MKHA 5FFNA 2BOBC 1MUUA 2JRCA 4FE7A 2GJ9A 1THMA 1VECA 2HF8A 5F9HA 1K8AW 4XDHA 1Y3CE 4MW5A 4J7KA 3WSVA 4PXAA 3CCUV 4UOEA 5FCDA 5A3RA 3N2YA 5JD4A 4DMCA 2O0MA 2KQXA 4CLEA 3IV6A 1NKSA 3CZ4A 4YUZA 2B1IA 4LNUB 1MC4A 1NXQA 2FR0A 3RM3A 3T7JA 5ADHA 3PNKA 5IN5A 2FFQA 1MOPA 3ESRA 1CERA 2FFHA 4QUAA 4P4LA 4BLOA 1G4AE 1MX9A 4JI4B 1QBKC 2P6UA 3D3NA 4OCZA 2W00A 2XE4A 2HC9A 2QUHA 1R8JA 3W5SA 3P9NA 1MOFA 4L1KA 4MRNA 4M1WA 4OHUA 1FQWA 4EPVA 3ZHVA 2ZCUA 4DPKA 5TY0A 1VHDA 4LVCA 4CQLB 1D4ZA 1JT2A 1RBMA 5IY5C 4FZVA 4W4TA 3SSAA 3WB2A 1ZLZA 1NW8A 4L0MA 4X5OA 4MWCA 4LP8A 3THYA 3ZWWA 3L82B 4UB8Z 4QICA 4UQLA 3CSUA 3KQMA 4BGUA 1A8HA 1WW8A 4GYCB 2VSXA 4TYNA 5FLKA 2O4UX 5B37A 1E5QA 1UJBA 2AI3A 4ZDWA 2XYRA 3K79A 1UXOA 1I2CA 3EISA 4XGKA 3ELUA 4MS1A 5DMXA 2Q9UA 2BEJA 3TUJC 1NP6A 3VTFA 1SKBA 2YWDA 1CY4A 3BUSA 5G41A 1R4AA 1W0KG 1QTIA 1YGPA 3G2LA 2CMFA 4R51A 3ZJVA 2PKCA 4QOGA 4MTLA 4MV9A 4BNUA 1IY8A 4F2WA 5IX8A 5FR2A 3GVPA 4HTFA 2Y05A 2CDNA 3H11B 3UMSA 1N4DA 1ODFA 2WQZA 3OKCA 4U2BA 1Y66A 1NVVQ 4CR7A 3I9LA 4Z53A 2WFMA 4CDGA 1VF6A 1AB3A 3LNTA 5FPYA 1ZNQO 3L8CA 5B7GA 3IR7A 2X76A 4W5RA 3UAVA 4C7OB 4OH7A 2ZR2A 2FWIA 2GJSA 2NIPA 3ES9A 4QPPA 3W5CA 2F90A 2JLAA 3FY4A 3I8SA 2XR1A 3AVOA 3RIEA 5J59A 1AX9A 4XWOA 5A6SB 2XGMA 4Y2XA 4W4LA 4HBNA 1OR8A 2GESA 2OC9A 3QU5A 3X2FA 1Q91A 1S96A 2GCGA 3E8FA 3S2GA 3ENVA 3QEMB 1B16A 2Q5EA 4LYEA 4CM3A 5KNBD 1JTEA 2ZQZA 2AC7A 2X22A 3GGCA 1VF7A 3PGA1 1I08A 3PQ5A 3QHPA 5EXEA 1WMBA 4AS1A 1TVMA 1RRVA 2PUAA 4PSAA 4OI1A 2Q62A 2R1TA 1FPQA 1FUIA 1RWNA 3B1YA 4KQXA 3RYCA 4LWQA 5FUWA 3STTA 2RK4A 1L9KA 1ZL2A 1OI7A 4PO3X 5FQNA 3RQIA 4DPMA 1FTGA 1Q8IA 2Y0IA 4KR9A 3H1JH 3L8MA 3Q72A 4XRRA 3MTEA 1XEQA 1B4DA 3GAZA 4IJVA 3E9RA 1AJPA 1VGQA 3RK1A 4OHCA 4B4OA 2G08A 1FYDA 1NH2B 3KJEA 1I3CA 1FS6A 1R3UA 5BWNA 1G1XB 1THZA 3LW7A 5GY7A 1HE5A 5K6TA 3QEJA 2PFSA 1VKHA 2C59A 3KKLA 2P2LA 2OAQ1 3FPHA 2PWPA 2Y1XA 3TKYA 2WF8A 4M55A 4JS0A 3LNMB 1PHRA 3A9TA 4D9BA 3K5LA 1NBMD 2NUTB 1XWFA 2J9GA 2R4TA 2Z5GA 3QKTA 4HH3C 1CQPA 1AB6A 3HM2A 4X54A 3OFNG 2QTGA 4DLUA 5DSTA 4GUDA 5DCLA 2ZE5A 5CCDA 2I99A 2J0SA 1RI1A 3UO8B 4W6ZA 2AC2A 1N77A 3P9KA 4JEHA 1A4IA 1ZJZA 1RXCA 3AG1C 2UAGA 2WZDA 1B0ZA 1JPNA 4N0PA 4RUEA 4K0RA 1W5EA 2Z8ZA 1J23A 1MRNA 1T2AA 2BT4A 2ZSFA 2GF9A 1EVYA 3AR7A 4FCCA 1PJZA 2I1VB 2BTQB 1HR0B 1RM0A 3WNQA 1JFSA 4KSCA 2AYXA 2FP3A 3ABSB 3SS8A 3I52A 4OGQB 3A1CA 1N2BA 1T9GR 1YL6A 2X15A 1NVBA 3CISA 3FUTA 3OPMA 3REQA 4ZK6A 5C5EA 4JYCA 1G7CA 2MOKA 1N33O 1BS2A 4NL4H 4WLVA 4HB4A 2DX7A 2WQ6A 1M33A 2DMRA 2QGZA 3FYHA 3GRFA 4BMVA 2YKGA 5FD8A 1XVAA 2VRCD 2MK3A 1ZAKA 1SPXA 3ENZA 1GNRA 2QTRA 2PIDA 4O4JB 3HU3A 2YXHA 5D7NA 1GKLA 5F4BA 3FCUB 2PYIA 2C2KA 2IPOA 3RS3A 1PT7A 2ZJ3A 4EY7A 4JTDB 1HNZO 2F1HA 3HJNA 2F59A 2GEBA 5H81A 1QQCA 1SCNE 2ORVA 3GLUA 1RWVA 3EVEA 2WU4A 4MYCA 4P6VF 1D1TA 5ALUA 4UVHA 4I8XA 3WYBA 1M0EA 3I2FA 3I2HA 4FNOA 5CVUA 1S4QA 3R3ZA 1K7CA 1YQGA 4KKVA 3IELA 3TNYA 1M67A 1UDWA 4TLAA 3ZI0A 2AZ4A 1A9RA 2V7WA 2D7CA 1ATIA 5B6IA 5ILGA 1SXHA 3HDGA 3F73A 4IQ0A 4MUJA 3V8RA 3S81A 1EVIA 1PJAA 3GARA 4FE4A 2HA0A 2C4VA 1GA6A 1EP2B 1V96A 3VZSA 2EFHB 1KJYA 1QE5A 3FHCB 3T5DA 5E7IA 3CCEV 1IZZA 1UFOA 2Y1OA 4G5HA 4OJMX 2GCIA 3TSOA 3ZS9A 2HCTA 3G49A 2IUFA 3SYQA 3DCIA 1W581 2QDKA 3BG5A 1KYXA 4TTQA 5L95A 3H19A 4NCXA 3I5XA 4W5NA 3B89A 2ZIXB 3FOCA 3H86A 3L8EA 2XDWA 4P30A 4JLNA 2ZXWB 4QRDA 1SMKA 5E0OA 3RJ5A 3K1JA 3FRJA 3TLAA 2A0FA 2K7FA 1T5SA 1ATZA 4WN3A 1RWXA 5JDCC 4ISCA 5AOBA 3UCXA 4F21A 2O8DA 4AI6A 4JUDX 3V6LA 5MFPA 3O93A 2COEA 4P35A 4X71A 1FBNA 4ADSG 2FWRA 3G1UA 3I58A 4OXYA 5ERXA 5HSGA 1BVYF 1GL6A 1KI7A 1JZTA 2R8YA 4LE0A 4ZAGA 3S0JA 1QU2A 4D6XA 3R5JA 1D4FA 3RFFA 1JFFA 1X7WB 4N0DA 3RH0A 1E2UA 1S2NA 1C1YA 3M2PA 3MCVA 4DV4O 2Q3MA 4LY0A 4S1TA 4RXTA 4DWJA 5LKRA 1T8YA 3BHMA 1P49A 3IPAA 3PC8C 4OO3A 2ETVA 1FZQA 1DAHA 5B1EA 1SUCA 3P9CA 3VPDA 4IP0A 2XNCA 1KSGA 4I50B 1A9TA 3OEYA 3TNFA 4BLQA 1YITV 1PV2A 2JRLA 4JF3A 2IDZA 4DY6A 5F3RA 4GBJA 4G0ZA 4I1UA 3SJUA 1ID1A 1VI6A 2C7PA 1M8PA 4OL9A 4QDZA 1EFAA 2XGOA 4NMWA 3RYFB 1MO3A 4CM7A 3TW8A 1GUYA 3PPIA 3X44A 3VNSA 1Q84A 2AUTA 3C2QA 5J2UB 4JI7O 2IJIA 2ZWOA 4UZEA 3PRJA 4DKXA 2HVKC 1SH7A 3LRPA 1H2YA 1XREA 5HQJA 2ENUA 2ZIFA 3LUBA 3TUZC 5DWDA 1FNDA 3QTBA 4LCUC 4QWWA 1QHIA 2RGGA 1EHCA 1UWKA 1X7ZB 3DOUA 1JFTA 4NKRA 2ODMA 3FXAA 3ZDQA 4C08A 3R3JA 4NMLA 4LV6A 2RKBA 4BQOA 2AGVA 1Z5UA 3F6BX 4LXHA 4U00A 1NT2B 3RHTA 2TS1A 1INLA 4RESA 1FVOA 4ALKA 1U2PA 1SA0B 5J4LA 2WKWA 1SQQH 2J5QA 3BGOS 3GA7A 4AN4A 4BAGA 4CQMA 5SZHB 2X6AA 1EXWA 5CVEA 3VR0A 1OBCA 4MI3A 4OD0A 5CEJA 3V1KA 1N75A 1Z2PX 1NHGA 4GWKA 4HDOB 5EIWA 5TDHA 2QG9A 3U48A 3GR6A 3OZDA 1HE2A 3U3OA 2JD0A 4PAGA 1FJ2A 2BEWB 2Q8QA 1XLTA 1QR6A 1V5FA 5BOVA 1JAXA 4KACA 4BFSA 2YY6A 1XPRA 3HYSA 4L8YA 1LK0A 3KE8A 5ECGC 4HUTA 1POWA 3PNVA 4L74A 1ZMXA 3D3WB 4R1LA 1GM7A 4ESOA 1EFVB 1WHSA 1Y89A 1GLNA 1H23A 4D2IA 1JPJA 1K68A 3AIKA 3DXRB 4BB5A 1NXOA 3ZCPA 1V5IA 4U6NA 2GNAA 3DUFB 5IJXA 3G0DA 3ZZUA 3FBWA 1GCAA 1T91A 2WT8A 1L7AA 1U6IA 4REMA 4CQLA 3FNQA 1HORA 2NSDA 1FDUA 2DY0A 3T0GA 1FSZA 4UU0A 3FJ1A 5A2QN 1Z37A 5CYFA 2B8EA 1EN5A 2XIQA 3CINA 3RV4A 421PA 1GFSA 1KZHA 4YMUA 2VDQB 1JHXA 2Y0BA 3CE2A 3UKJA 5EJEA 1U0FA 1RP3B 3O26A 3D36C 4DSNA 4KRYA 2XA1A 1CIVA 4MV0A 1GRJA 4PSDA 4Z54A 4ID9A 1Z75A 2UUPA 3M8KA 3E7XA 1KS2A 4M0DA 2DGDA 1QQ6A 1PS9A 4X3PA 3GRUA 4U2GA 1WVIA 1YDWA 6NULA 2QD5A 5B1OA 3PRKE 2PXXA 3DH0A 4KPUB 3D5EA 3RNLA 1NG1A 1QVAA 2CHQA 2PEZA 3T61A 1FFHA 2QKCA 3MTBA 1J8QA 1OXTA 2Q5LA 3EMKA 4PFSA 3LLMA 1VG9B 3GIWA 4YPFA 3OQPA 1BT8A 3RTCA 4UE3S 3HSKA 1DBWA 2I4RA 3HB5X 2EDCA 4FT2A 4M7PA 2H8GA 1RJ9A 3H11A 1W5BA 2QOEA 1LWNA 2CUGA 3BBPA 3PHGA 5SY4A 4B6GA 3FUXA 3OPYB 3UWSA 4TZ0A 1UPUA 2G5PA 1Z15A 2ZRDA 1YHNA 2J32A 1E2JA 3EIXA 4J1NA 3HZZA 4O4HF 1E5DA 1I6KA 3AM4A 1S5LZ 3E5RA 3REOA 1P0PA 3QSYA 3OIDA 1L4BA 1M8FA 3SU8A 1JDPA 4PLCA 2XA9A 3TQCA 1UKVY 2VNJA 1T0UA 2WG2A 3DXXA 1NOJA 2R4UA 4IMRA 1U3WA 5IKEA 2W8BB 4FMBB 2H31A 1UBRS 1F20A 4C30A 1BMTA 2PI4A 3ZCXA 1GYQA 1PEYA 1U81A 1CHNA 1TKAA 3LSSA 4Z1VA 2GZDA 2XADA 2YBEA 3MWKA 4FDMA 4KUHA 4PCAA 3A4TA 4K35A 3A6JA 3ISTA 4ZO9A 521PA 3WQSB 3F7TA 2VTBA 3W2IA 4OV6B 4YT8A 3IUMA 2PWZA 3Q2OA 4NV1A 4DSUA 3PX3A 1T25A 2HZBA 2WFZA 3O2JA 1DCFA 1GGNA 2WJ4A 2ANCA 2QORA 3CQ9A 4JWKA 3ZTYA 5D51S 4IXTA 1J42A 5BV8A 5HZHA 1PGPA 1XK6A 1G38A 2PZLA 2I76A 4DC9A 2ODWA 3QTCA 2VR1A 4FQ8A 2QLJA 4XAQA 3IE1A 3MWDA 4FSDA 4NCKA 3UM9A 4DC0A 4NFSA 4TL9A 3HA7A 3AG4B 2BCJQ 5LQNA 4I9HA 1I7PA 2J59A 3L74H 4OXKA 1GM8A 1R0CA 4RJKA 1HL3A 1PLKA 1MBZA 2EU8A 3BIXA 4UAGA 4I9GA 1QXSA 4C4SA 1MJHA 1WR8A 3KOWA 4F6RB 2C2GA 3P0EA 3UY4A 1KAOA 3UUEA 1LBTA 2YV1A 1VB3A 4AUKA 5ALMA 4DSOA 4EA6A 1KEKA 4OPAA 2PU5A 2PWAA 5HIKA 3FIUA 5KQLA 2NUTA 3GEIA 1SUIA 3NGXA 2VNHA 3BSFA 1Y63A 3WWEA 4JYYA 3NLLA 2A59A 1QO9A 2VDVE 3MC1A 3R3XA 4E33A 5AVOA 3BXFA 1TMGE 2OAP1 1J1IA 2ZP1A 4E03A 3AINA 3NPMA 1G2QA 1PT5A 3SK0A 1RE1A 1SKYB 2XOKD 4D3DA 1DJOA 3HKCB 1BQ4A 2EWVA 3BXEA 2IWRA 2I8CA 2IT1A 1Q2UA 2HMVA 3LPNA 5AKYA 3RS4A 1JHZA 1V37A 2ZU0C 1WAMA 1YD7A 4QE9A 2EBOA 2WLJA 3D8UA 3I2IA 3C7TA 1ISGA 3EVTA 1WDMA 1N6IA 3PHLA 4LJ7A 4PONA 4LF9B 1ZGAA 5TF0A 4CEIB 4E5YA 4AJLA 4KHZA 1N0IA 3NI2A 4DCOA 1WL8A 1XKQA 4X8HA 1E32A 3W1EA 5IXSA 3I5DA 2DM6A 3SVLA 1U4NA 1HRDA 1ULZA 4GXQA 4Q5IA 4RZHA 4ZOCA 4ZANA 4D0RA 3I9NA 3SKYA 4R16A 2KS6A 4AP5A 1ZJWA 4XWWA 3OIWA 2RHJA 3RYHA 1UEXC 4R8CA 3ZK8A 4KXVA 3GVHA 3KSZO 4H27A 2P4EA 2K2WA 4LYJA 5EPEA 4BTLA 2OHIA 2QX6A 3UPTA 1T5LA 3FOEC 5EKXA 4RCYA 2V7EA 1KXJA 1T4MA 4DQXA 5TC4A 2FU5C 2ZI3A 3FDXA 2JBHA 3N39C 5DBEX