2O57A

Crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
282
structure length
282
Chain Sequence
SKTVKDNAEIYYDDDDSDRFYFHVWGGEDIHVGLYKEPVDQDEIREASLRTDEWLASELAMTGVLQRQAKGLDLGAGYGGAARFLVRKFGVSIDCLNIAPVQNKRNEEYNNQAGLADNITVKYGSFLEIPCEDNSYDFIWSQDAFLHSPDKLKVFQECARVLKPRGVMAITDPMKEDGIDKSSIQPILDRIKLHDMGSLGLYRSLAKECGLVTLRTFSRPDSLVHHYSKVKAELIKRSSEIASFCSPEFQANMKRGLEHWIEGGRAGKLTWGGMLFRKSDKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative sarcosine dimethylglycine methyltransferase
publication title Crystal Structure of a putative sarcosine dimethylglycine methyltransferase from Galdieria sulphuraria
rcsb
source organism Galdieria sulphuraria
molecule tags Structural genomics, unknown function
total genus 106
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.840 Mainly Alpha Orthogonal Bundle Helix Hairpins Mycolic acid cyclopropane synthase domain like 2o57A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2o57A02
5CVUA 3MCTA 4ISCA 5LSAA 2I6GA 3GU3A 5HIIA 3UA4A 1RI4A 2NYUA 1G38A 4P7GA 4PYMA 1X1CA 4X61A 3LECA 4CKBA 2PT6A 3O4FA 4V0RA 1VP9A 3PVCA 3EVFA 2OY0A 2QY6A 2AVDA 4YUVA 3DMHA 4X63A 5DRTA 1SQGA 5G02A 2GH1A 3JWHA 4AZTA 4RTSA 3TQSA 4MWZA 3EVEA 3G7UA 3HCBA 4GOMD 5E8RA 3H2BA 2EJTA 7MHTA 2FK8A 5GP1A 3KHKA 1G60A 2FPOA 3EGVA 3P2EA 5BW4A 2F8LA 3KQSA 1XXLA 4FR0A 3C6KA 3M6VA 3IEIA 5EKUA 3PX2A 4CWAA 5ICEA 3VC1A 3ER9A 4JXJA 5GIOE 1V39A 1NW7A 3C6MA 4C08A 3X0DA 1R18A 3EGEA 3FPHA 5HFJA 3I58A 3NWBA 5EZSA 1KP9A 4PYQA 2ZBQA 5KQRA 2K4MA 5EQJB 3CC8A 1HNNA 5CVJA 1KPIA 3OZSA 4M36A 3V97A 1TW3A 3AWIA 2PT9A 3FUUA 2XVMA 3FYCA 5E1DA 2IH2A 3SX0A 2BM8A 3HA3A 2NXCA 3I5UA 4P7FA 4X41A 3M6XA 1P91A 5GIPE 5T64A 1WG8A 1I4WA 2ZTHA 5FA5A 3SSNA 2AZTA 2E5WA 3CVOA 3ME5A 3RW9A 3L8DA 3HEMA 3R6TA 5ICFA 1KPGA 5F2KA 2Y1WA 2YX1A 2ONZA 5LQAA 1UWVA 1F38A 3EVCA 2EX4A 3OE5A 4NECA 2C7QA 3DP7A 3HNRA 1M0EA 4RTLA 2NP6A 2IFTA 5HOQA 1TPYA 2B2CA 1RJFA 3EMDA 4DCGA 3KPUA 1U2ZA 3DMFA 3G5LA 4FT2A 2AN4A 3UJDA 1YUBA 2R6ZA 4BP1A 3HM2A 3SMQA 4A6EA 5KVAA 3GGDA 9MHTA 3LSTA 1M6YA 1R8YA 3A25A 5EOVA 3BGVA 2EJUA 1YZHA 2IDKA 5K0FA 4C04A 1RI2A 2PX2A 1WXXA 5K0BA 3MHTA 3SSOA 4GC5A 4GEKA 3B3FA 1XDSA 1VPTA 1WZNA 4KIGA 4E32A 3JWJA 5C9ZA 4EK9A 5K05A 2P7HA 2ZBPA 4PYIA 3BWYA 2IH4A 2B78A 5GM1A 3LKDA 3HCDA 3HVHA 3LCUA 3OU7A 4C03A 5LQRA 4RWZA 3OZTA 4PGGA 3S68A 2GB4A 3FUVA 3BZBA 1NW8A 5EMMA 1BKYA 3GRRA 4HGYA 2BR4A 2OBFA 4RTNA 1M6EX 3CJTA 4PYJA 2HR1A 3ERCA 4HGZA 4YMHA 5K0EA 1ZQ9A 3KR1A 3PLAE 1O9HA 1N7IA 2B9EA 3I64A 3IYLW 4GOND 3T7SA 3A27A 3DOUA 4X60A 3AXSA 3TOSA 2ZCJA 2AOUB 5LQKA 1XDUA 3I53A 5K0LA 1DCTA 2PXAA 2I62A 3FTEA 3SSMA 3LDUA 3M33A 3G2PA 4XUCA 5DXJA 4CTJA 1G8SA 3OU2A 3G8BA 5FQOA 1WY7A 2QRVB 3E8SA 5HEKA 4KWCA 3IHTA 1G55A 3B89A 4QDJA 4FZVA 2AOXA 8MHTA 1VE3A 3P9NA 3G2MA 4L7VA 4UOEA 2ZIGA 4PYKA 3P8ZA 3JWGA 5BW5A 3OU6A 1IM8A 4R6XA 5K0JA 3ORHA 2P40A 3EEYA 2AVNA 3HVKA 5DRYA 3BXOA 5E1OA 3SR4A 3EVBA 1JG2A 5K0CA 2PX8A 4FP9A 5FHRA 5B1SA 4RTJA 2G70A 2V7EA 1WS6A 4P7JA 3EVZA 5CVDA 2B25A 2PJDA 4LECA 1D2HA 2P41A 4XUEA 2IBTA 1SG9A 4F86A 3BWMA 2UYHA 3TRKA 2AOTA 4GF5A 1AF7A 3JWIA 1SKMA 1JG4A 2GPYA 1NV8A 1ZHFA 3DXXA 3R3HA 1I1NA 4H0NA 2ZZMA 1VQ1A 1XCJA 1RI5A 2JH9A 3HVJA 5EC8A 2ZIFA 3UJBA 3UJ8A 2Z6AA 4FT4A 5P8WA 1AV6A 3M70A 2JHCA 2WK1A 2B3TA 2G71A 3CJRA 4IV8A 1ORHA 2HTEA 2O07A 5C0OE 5FQNA 4QVKA 4BLUA 5U4XA 3GRZA 3KR9A 1L3IA 1P39A 2O06A 2JHAA 4EKIA 5ICGA 2GLUA 1B42A 3G5TA 3DULA 3PFHA 1AQJA 1VIDA 3Q87B 2AS0A 2YUIA 3EEOA 2AR0A 1EG2A 3FPJA 3FUXA 3ELYA 4RTRA 3UJ7A 4DKJA 3SVZA 3G2OA 3LDGA 1BC5A 2NXJA 4OQDA 3DLCA 4E70A 2H11A 2NNWB 2P3OA 4FSDA 2GAFA 4RYLA 2EFJA 1KR5A 2GA9A 2HV9A 2KW5A 3RIEA 5K0NA 4RTOA 3A7EA 3E7PA 1D2CA 2JJQA 5DM0A 4X1OA 5FHQA 2C7RA 3EPPA 2O0LA 1X1AA 4GOOD 4E2YA 2PY6A 1RI3A 2UYOA 2V74B 2PGXA 5FULA 3HCAA 4E2WA 2CL5A 3ELDA 2QE6A 1I9GA 5EG5A 2Z6QA 4EQZA 1NW5A 2WA2A 3KPWA 2AN3A 3OFKA 5EMKA 4RVFA 2OXTA 4PONA 1ZGAA 1SUIA 2PX5A 3OCJA 1O54A 1NT2A 3NW9A 3REOA 2IP2A 1NW3A 3FZGA 4O29A 3TM4A 2PSSA 4KVZA 3EVDA 2NXNA 3DMGA 5FWDA 4AZVA 2ADMA 3LCVB 1L3CA 2JH8A 1RJGA 3FTCA 4QTTB 5JR3A 2Y1XA 3WSTA 2HMYB 2ZBRA 3QV2A 4F85A 5M5BA 1RJDA 5KQSA 4BY9E 4KRGA 3KQYA 3P97A 2UYCA 2JHPA 4ER3A 3O7WA 2CWWA 4E31A 4RV9A 2ZLBA 4PNEA 4RTPA 2VDWA 1JQDA 1PJZA 2IGTA 4QVGA 1VL5A 5DPMA 1RI1A 4E2XA 5K0GA 3PX3A 4M7RA 5EHGA 5EIFA 3THRA 3NJRA 4HSGA 4CXMA 3GNLA 2ZVJA 1NBHA 1TW2A 4ZTBA 1DL5A 3T7TA 3GWZA 4HG2A 3NMUF 5GM2A 1JSXA 3LPMA 1UIRA 1VLMA 2O57A 2IDJA 3HVIA 3NVMB 2XBMA 4GBED 4M38A 3THSA 3MTIA 3NDJA 4AZWA 2PXXA 5D1HA 2UYQA 4G56A 4EKGA 5FTWA 4OQEA 1KIAA 3B5IA 3R9XB 2FCAA 4EMSA 3B7PA 5LQCA 5BXYA 5FA8A 3R0QA 4DCMA 3LL7A 3LBFA 4YMGA 1ZKDA 5HZMA 1QANA 1QYRA 5CM2Z 2ZWAA 1YB2A 4HTFB 4PGHA 4E33A 2PV0A 5KS2A 3ANXA 2LD4A 2G8NA 3FUWA 3KPYA 3A26A 4V0QA 5DM1A 4RVDA 2ZIEA 4QDKA 2H00A 5E1MA 1NBIA 5FCDA 4PCLA 3HTXA 3AY0A 2VP3A 5BP7A 3ELWA 4R6WA 2BM9A 1QAQA 5DX0A 1YZ3A 5T67A 4DMGA 4HH4A 1L1EA 3E23A 3CBGA 3O31A 1R8XA 2H1RA 5K09A 3HCEA 3G88A 3QOWA 3BUSA 3MCZA 4U7PB 4Y2HA 5EGSA 4U7TB 4GOLD 1NKVA 2AN5A 2PWPA 3DUWA 2IPXA 2DULA 3OE4A 5HIJA 1OR8A 1SUSA 3FYDA 4FGZA 5E8JA 4DQ0A 3FRHA 3EMBA 4PINA 1G6Q1 4MIKA 2C7OA 3K6RA 3B3JA 3C3PA 1XVAA 2OB2A 2VDUE 4QTUB 3TPZA 5IKMA 5EKXA 4R8SA 3TR6A 2JG3A 2WA1A 2I7CA 4PWYA 3D2LA 2NXEA 4QQKA 1FP1D 5E9JA 1JQEA 1JG3A 3IV6A 2QM3A 3NDIA 5ICCA 4OBXA 3FUTA 3Q7EA 5CCBA 2UZ4A 5CCXA 1KHHA 1JTEA 3EVAA 2YXEA 2ZSUA 4WVLA 4YUYA 1ORIA 1FPQA 2OB1A 4Z2YA 3BGIA 4ER5A 1EAMA 2BH2A 1EQAA 4RTQA 5DLYA 3CCFA 3G89A 2XYQA 3P2IA 2PBFA 1INLA 2ONYA 2P1DA 3VYWA 4OBWA 5E9QA 4ER7A 4YV0A 3CKKA 4YUXA 2YTZA 3KPVA 1MHTA 5DX1A 1JSZA 1FBNA 3DH0A 3GRVA 2AOTB 3FTFA 5E9WA 1YFLA 3KQQA 4GUAA 4RX1A 2P3LA 1R00A 2YR0A 3R24A 5DTMA 4KDCA 5K01A 3FPFA 5LQJA 1KXZA 4AZSA 2GS9A 2AOVA 4OA8A 4P7KA 1NE2A 3T7RA 4E2ZA 3BKXA 2ORED 4MHTA 4FSXA 3AJDA 4LG1A 4DM3A 5GWXA 3BWBA 1ZG3A 3TMAA 3MAGA 3F4KA 3UA3A 4F84A 4OX9Y 3HCCA 2PKWA 2VDVE 4LWPA 5H02A 1IXKA 2ERCA 3HA5A 3QOXA 5EHIA 2OKCA 1JTFA 4QQNA 3FPEA 3UJCA 2CKDA 3DXYA 5MHTA 3TM5A 5LQNA 5EPEA 3RODA 4RVGA 1R74A 1VP3A 3P9CA 3VC2A 2QYOA 1KPHA 1YFJA 3PS9A 5KYGA 4KIFA 5HIKA 3FRIA 3K0BA 4R8RA 2ZW9A 4PYNA 4XUDA 3EVGA 2BR3A 4M37A 5FADA 2IBSA 5E2BA 5DM4A 2ZWVA 3SXJA 2P35A 3DR5A 4BLVA 4YV2A 3DLIA 1PRYA 2A14A 5CVEA 3LGAA 3MGGA 1Y8CA 2ZZNA 2ZFUA 2Z6UA 4PIPA 4ATNA 1MJFA 1H1DA 3TKYA 5DSTA 3T0IA 4DZRA 2IIPA 2AOWA 3FPGA 3G2QA 1O9GA 4C4AA 2CMGA 3VSEA 5DM2A 10MHA 3NWEA 3DTNA 3M6UA 5EMLA 4BP3A 1YF3A 3HA7A 5CVVA 1UFKA 1G8AA 3C3YA 3SGLA 4B17A 1BHJA 3HCFA 1FP2A 3MB5A 1JR4A 1P1CA 4FS8A 4HC4A 4IKPA 3GXOA 2VZ9A 1IY9A 5EZQA 5EEHA 1EJ0A 1ZGJA 3CJQA 3A7DA 3OPNA 5E1BA 1SQFA 3LHDA 4Y30A 5DWQA 1XJ5A 2FHPA 2VS1A 1XCLA 5HIMA 1AQIA 4GC9A 3TFWA 2R3SA 3BWCA 2OYRA 3P9KA 1Z3CA 4XCXA 2YXDA 4PCAA 1SVUA 1X1BA 3PT9A 3ID6C 2FK7A 2P8JA 1JG1A 4MTLA 4WXHA 3OFJA 2ESRA 2G1PA 1N7JA 5E2AA 3KR0A 2G72A 3M4XA 5DSXA 2YQZA 2HNKA 2PXCA 5F2OA 5LR6A 2DPMA 4QPNA 3KQTA 3LX6A 4LWOA 4QPPA 3G8AA 2IH5A 3M6WA 1EJ6A 4A6DA 2C7PA 3NVKI 3MTEA 2P3QA 3UJ6A 1QAOA 4YUZA 3DXZA 3B3GA 3LBYA 3UJ9A 1QZZA 4IWNA 3KQPA 3EGIA 3I9FA 4HTFA 5EIWA 4AX8A 3KQOA 5CIYA 1FJXA 1NV9A 3OZRA 5ERGB 1L9KA 1L3BA 3LKZA 4AUKA 5D1NA 5DXAA 5FUBA 4PYLA 1XDZA 5HILA 3ER8A 5GOZA 4POOA 1KYZA 4OA5A 5C1IA 2PVCA 3A4TA 2AOUA 5K8VA 5DX8A 5GINE 4RSRA 2YXLA 3FTDA 3LDFA 3MQ2A 3KQWA 5EVJA 3SM3A 1T43A 4MQ4A 4RVHA 4DA4A 3KKZA 2PX4A 4KDRA 3KPJA 4CTKA 4HRAA 1WXWA 2XYRA 2QRVA 3KR2A 2HWKA 5DT2A 1DUSA 4PIMA 1EIZA 3GDHA 1X19A 2XYVA 2FYTA 5FWAA 1VBFA 2PWYA 3E05A 5DTQA 2OZVA 3U81A 3BT7A 2ZZKA 3KQMA 3P2KA 1XTPA 3BGDA 1RJEA 3PFGA 4ER6A 4CKCA 1D2GA 2PLWA 4C07A 4EVIA 2Q41A 3UBTA 3GCZA 4BLWA 2OO3A 3TKAA 3P71T 4GQBA 1F3LA 4YUWA 3PB3A 3GJYA 3P9IA 1NW6A 1N2XA 4E30A 1P1BA 1R6AA 5F2NA 3UJAA 5LQUA 3ELUA 3KQVA 3UFBA 4YV1A 3MERA 5IH3A 1HMYA 2ZULA 3AXTA 3HP7A 3LCCA 4P58A 5EMJA 1BOOA 1Q0TA 4RTMA 3C0KA 5T6BA 1KYWA 4DF3A 5DTRA 3GIWA 2NP7A 2I9KA 2FRXA 4KW7A 4CKEA 2XVAA 4R05A 3TLJA 4RTKA 4ER0A 2O05A 2OPBA 2BZGA 5JUWA 3BKWA 3UWPA 3NTVA 4C06A 5K03A 3GRUA 4K6MA 3GO4A 1X1DA 4IV0A 1JQ3A 2YVLA 2EG5A 3KU1A 4PYOA 4C05A 1Q0SA 2N47A 3CGGA 5EEGA 3UZUA 2P7IA 5CD1A 5CUQA 3PTAA 2BR5A 3V8VA 2CMHA 1QAMA 3GRYA
chains in the Genus database with same CATH superfamily
1C9JA 1KS2A 1M8GA 3WGJA 3W0LB 1B06A 1RI4A 4J9ZB 2PMKA 1LS6A 3RIHA 3HCWA 3QFFA 2JAHA 2DF8A 3TDNA 4IINA 3CN9A 5AQ1A 9LDBA 2J0QA 4ZT2A 3DOCA 4LNUB 4CS2A 1WMAA 3R3UA 4ALJA 4R81A 3IOMA 1Z16A 3U1TA 1H69A 5AKHA 4HUQA 1HETA 1JWBB 1WKVA 1WXEA 2FAXA 2XE6A 1BJKA 3R6TA 4WN9A 1GCOA 4BX9A 3EEBA 1C1DB 1GVNB 1HSZA 3R6WA 2EBUA 1I7QB 1SK9A 5KYUA 1IMOA 4HL6A 3BEDA 1GQRA 3SS7X 4FC6A 2Y1GA 4N9QA 4CQNA 1CJBA 3EJ6A 3N0VA 4BB0A 1LI5A 2G36A 3C3KA 1XO1A 3T1HO 1UJNA 2ECPA 5JSYA 4EEXA 4U2FA 1NVKA 4DMRA 1M5RA 4HB4A 3GNSA 3LYLA 3GPLA 2V7EA 3A58B 3P0EA 3L6UA 4IMPA 3I1JA 1V1MB 1XVTA 1NSTA 3R7SA 4NJMA 1SF9A 3OWXA 3VU3A 1IEQA 3NVAA 4R2MA 3NKVA 2MYUA 4RUKA 4Z6KA 4Q9DA 2FUEA 3OJCA 2R5FA 4DKJA 3EN0A 3N1UA 3IBCA 4UPDA 3H1JH 2QA5A 2Q3DA 4E2FA 4AJ2A 4MR8B 1RBQA 4B5KA 1J99A 2QJ1A 1RKVA 3DTUB 3IEVA 4QICA 4CMJA 4PPYA 5T4FA 4YRTA 3GAMA 4CF5A 2N04A 4DR2B 2JGRA 5E95A 3IIEA 2VPPA 3GDOA 5KQGA 1PL0A 4QEKA 3SDZA 4EENA 3TIXB 4HQFA 5DCUA 1IBMO 3M83A 5SZHB 2I1LA 1AS3A 4ZYZA 2R68A 1L5OA 1TT5A 4OFZA 1EESA 1XWWA 3HBNA 4CH3A 3KT8A 3QIAA 1JR3E 4YR9A 3AFGA 2VHYA 3NRBA 5TRTA 4M21A 3D3WA 3PQ3A 1QH9A 3IODA 5EQFA 4CKCB 2GKOA 4OI1A 1U3TA 4MS3A 1SCIA 1VF5B 2PUJA 1GQOA 4HNRA 1CY0A 2RGAA 1O5IA 3ILXA 1NL3A 5B7NA 4Q6GA 3CG4A 3T3HA 3UG7A 2B1QA 1V3QE 2BF4A 4GUNA 5LQJA 1N2IA 4P82A 1ATZA 3K2IA 1HTWA 2Z2YA 3LY8A 3F4KA 4GLXA 4IIHA 2P4QA 4WZZA 1AK9A 1GSIA 3VC2A 1T9AA 2XCUA 3FOCA 2VHCA 3URMA 3EVGA 1ZBQA 4P5DA 5DSTA 2CY0A 2YXYA 3MS4A 2XUPA 4KQ2A 5DTEA 4P6VF 1ZJ6A 3CNBA 5K3AA 2YCLA 3COZA 1VKNA 3ICWA 4QPNA 3EHEA 5KU1A 4A6DA 1EJ6A 5K3CA 4R6ZA 2GEBA 3Q85A 2GD1O 2ID8A 1VCOA 3UV7A 4DQUA 2JCYA 2UXDB 3BTUA 1TTPB 5B1AC 1VJGA 1P61B 4FK5C 4MVJP 2PX4A 4DR4B 2VL7A 1VBFA 2PJRA 1GPNA 4I19A 5KCZA 1I8TA 3HI4A 2QU8A 1FDWA 3DHEA 3C3EA 4J7AA 1FU8A 3ILSA 5LQUA 3Q6IA 5EIEA 4P58A 3G0OA 4MWEA 2QGZA 3TLAA 2PO7A 2NO9A 4G5QA 5KX5F 4G63A 4CG0A 3ZOZA 3KVOA 4EF6A 5L3ZA 3W06A 1GL7A 3QFHA 1YEWA 2ZS9A 3M6IA 5F64A 4FB5A 1LW6E 3ASOB 4Q48A 1XLUA 3WHPA 3CVJA 3BAZA 2XCSB 1ZHOA 2NZWA 2HFKA 1HXHA 1Z6XA 3LLSA 2W0XA 4WEQA 4C4SA 3HY4A 2EDAA 1GM7A 1TA4A 2G83A 3A9UA 3PL5A 3QUQA 3SX0A 3RFXA 6REQA 2DQSA 4AJNA 4GLLA 1E2MA 5HGJA 2MDTA 4ASUA 1F38A 2AD5A 3MOGA 5KVAA 1SA0A 3LQ2A 3BQNB 4P81A 3MHTA 4ZVVA 3G8YA 3L9XA 4I1PA 4EB0A 2R85A 2ZRIA 3V7FA 2BR4A 1FFCA 3T4PA 3FDZB 1Q77A 4YH1A 5TB5A 2QWXA 3TOSA 1LK7A 1RHJA 3E8BA 1Q11A 2HMWA 1VF6A 4BFYA 1I7PA 1F2VA 5F21A 2I1QA 4JFAA 4M83A 4URVR 4NCHA 5J2TB 4MWTA 1THMA 2X3FA 2RJ3A 1BROA 4FYKA 4Q3OA 4NG4A 4BRZA 1D1PA 1YRYE 1FDUA 2Z4SA 5BVHB 3N8GA 4LYGA 2YH2A 2O7VA 1W9HA 1WZEA 3OM8A 3U3JA 3ZZNA 2X5NA 4U2BA 3TGWA 13PKA 3ISVA 5L3FA 4S1OA 3NIGB 1GKIA 2A30A 1IB6A 1XT6A 3T9DA 2WIJA 3A7EA 3D1JA 1VIBA 4M9QA 3ABZA 4KPYA 3HNPA 3ITNA 5EE5B 2ZIVB 3SJAA 3GB7C 4BNUA 2OHHA 5GTIZ 1N25A 1FF9A 4WCFA 1ZVQA 1I7FA 3GUVA 2R1TB 2AW9A 5IUJC 4YO8A 3VI4B 4I4IA 1JIQA 3CCUV 3Q8LA 2P67A 4YMIA 3W2EA 4JGSA 2WP8J 1DOHA 3SYNA 2I80A 5K0SA 1N8SA 3ENKA 1TW2A 2H65A 3N8DA 5JJIA 2ODWA 2OT3B 4HMQA 4P3PA 2J6CA 4YMGA 4LNHA 3U1BA 3AHCA 2E4WA 3BQ9A 2CLMB 1W1IA 4EB3A 2HF2A 2ODNA 4K8XA 3H6GA 3KE9A 4DV2B 1D09A 1IOVA 4I3FA 5KA5A 1WNTA 4IICA 4QQRA 3C14C 5HIJA 1OR8A 3KHUA 5EYPA 2YHIB 3TLGA 1N4AA 1QTIA 1BN7A 2RQ6A 4QTUB 4ZDIA 4OP3A 2JZOA 3O9ZA 3MIIA 1UPUA 4TZTA 3DFMA 4QQKA 1H0SA 5ESXA 2WSSA 4MVXA 3WK4A 1T26A 4OQZA 3VISA 5JZVA 1UDAA 2OGWA 2NU9A 1M93A 5TARA 4L4ZA 1YDXA 4DV0B 4NWIA 3G0GA 2MYPA 2O4CA 4MGIR 4I5FA 3CXCU 3NAZA 3I04M 5GVRA 4QPJC 2WTXA 1EXVA 4V2UA 1DK1A 1FXUA 4CS3A 1OFUX 4LNUA 2GWHA 3VUEA 3N2KA 1ZH8A 2BPOA 4ESHA 2JFHA 1J8MF 2GYVA 1KMHB 3I0MA 4C3OB 3UQZA 1UFKA 1EGHA 2WKSA 1NT2B 3NVKI 1E2QA 1C1DA 2I0FA 4RDCA 3RWMB 3ROQA 2A0KA 2ASVA 2VDWB 2BCCH 2YJ5A 1I1QB 3K58A 2AHYA 1SUDA 5JSHA 1CUSA 1U94A 1WLEA 2GM4A 1MOSA 4RADA 3BCUA 1Q44A 1T2NA 3BFJA 3ASZA 5LNK6 4DK0A 5B1BB 4KDRA 1Q20A 2WYIA 3ZYZA 1G63A 1PU2A 4ZQIA 2NUPB 4RYDA 3OCZA 4XM2A 3MGCA 4L22A 1I0ZA 4D9EA 1KWGA 1BXZA 1GDDA 1ZUQA 3HG7A 4K9QA 1V1MA 4LHWA 2CNNA 2GQ0A 3MQ4A 4BFZA 4X65O 5COBA 2UAGA 2ZIZA 1M7BA 1UK9A 3UBMA 3W3AA 1HMPA 2AKEA 2JA2A 1T91A 4LHSA 4MKGA 3TZHA 1H2HA 1VP9A 4KO8A 1XTSA 4L87A 2BKVA 1UPBA 3C5CA 3V1NA 5EIXA 4X8OA 3BZWA 4MR8A 4NOJA 1K8ZB 2PGJA 4PLCA 1RU3A 1GD1O 4XEUA 3HKDB 3OPYI 4YI5A 4PYQA 3WYNA 2XT0A 1NPYA 5EESA 3K9GA 4B2YA 4P7FA 3AG2C 5K8IA 1R6NA 4WDQA 3HADA 3RIYA 2BFFB 4JR2A 4YECA 1OQAA 3UOAB 4EY8A 2C7QA 3DP7A 2FPRA 4MVCA 2PSDA 2Z8ZA 1OW3B 1POXA 4EG8A 3NEAA 2VH2A 1U3GA 3LSTA 4PQEA 5ELMA 2L18A 5ENZA 4QJFB 4ZQBA 2DRIA 2Y4UA 1K34A 4ZYVA 4IFBA 3A1NA 5ITWA 1TJ5A 2GDZA 1FFEA 5KWEA 3C5VA 4D4KA 4HGZA 3TTYA 3L02A 5CYOA 4CL2A 3FTPA 1UBRS 4LXHA 3DLPX 4TL8A 1O95A 1JZSA 3DWIA 5HDBB 3K9SA 2EZUA 3BD7A 3ZHOA 2F3QA 1CF9A 4HNHA 3R3ZA 4X1KB 3QXHA 4BBAA 4LISA 4TWBA 2A67A 4W9NC 1U2SA 3GFPA 1A4IA 2V97A 4MWBA 4ZICA 4PDMA 4QRDA 3TKLA 1EM6A 4B8ZA 8ADHA 4BLUA 2FOIA 1TZCA 2H16A 1FSFA 5H82A 2XUDA 2BEWA 3A05A 4PTZA 3WG9A 4OK5A 5JYCA 4BMSA 2M6KA 4DHWA 3AR8A 1XNQO 3BEHA 3C8HA 1RM4A 5C3MA 2I4RA 1US6A 5K8JB 4JI4O 2O20A 3SQOA 4JKIA 2V7PA 2FSUA 5I7EA 4HLUA 5E79Z 4W7SA 2JHPA 1HA3A 4MRAA 3AJAA 4HOYA 2OESA 4HSGA 3U7FB 3T7TA 1JSXA 1MT0A 2EYQA 4NONA 1JHDA 3OUTA 3W5AA 4I6GA 1VBMA 1Y3HA 4P1ZA 3CJHB 4ND4A 4OKSA 3L0DA 2FMLA 3ZI7A 4JT9A 1U1EA 4FZRA 4R6WA 4HH4A 1DLBA 2P22C 4W5HA 1E4EB 2H1RA 3MCZA 2OGSA 2AG0A 3WAJA 2PF4E 2XJ4A 2WYWA 5MF6A 2A79B 2JD0A 1DBIA 2QN1A 5AXAA 3IRUA 1S6YA 5ER6A 2HT6A 3SCZA 4WY5A 1O95D 4Q4HB 2O4UX 4FVMA 4B7AA 1X8KA 4L7QA 5JJNB 1Z83A 2QEQA 4DNFA 4FGLA 1SHLA 1IJKA 4GLFA 1BQ4A 2PLFA 4XARA 1YB6A 2BOCC 2C3YA 2ZBDA 2PZGA 4K6KA 2NPIA 1D6MA 4YFYA 2IPNA 2FEOA 5LFAA 3PE6A 1G5QA 2V1XA 2WG0A 5JBIA 4JI1O 3VHLB 3KHSA 2VRZA 3I5XA 3E1SA 3ABQB 3H42B 4JROA 1IZ3A 4FNOA 2GZ2A 2VA9A 3GPBA 1IHOA 4EYGA 4MKRA 3UMFA 2M7WA 3GFFA 1FCJA 3WRXC 5ALVA 3S55A 3D8NA 2CL7X 2YICA 3G02A 4AG6A 3CEHA 4FYIA 4L4SA 4GM0A 4QATA 2AWOA 3ZWCA 1C3JA 4O4JB 1BX3A 2C8JA 3FDZA 1A04A 5D1NA 4BEBA 5GV7A 2ZDQA 3LP6A 2YXLA 1XQ8A 2OK7A 5C80A 2QN2A 5HF6A 4IJVA 3QF4B 3LSYA 1IY2A 1ZH0A 1KAHA 5J2TA 1KD1W 1XLVA 5LP1A 4UAGA 3V00A 5KQMA 3AEXA 2LQTA 1ZA2A 3LC2O 3ZKAA 1J09A 5GTDA 2GYYA 3AVOA 2O05A 4WKPA 1CUHA 4HRXA 1J07A 2ETXA 2VDLB 3VR5A 1OCZC 1VIMA 3KEMA 1U8AA 3V8VA 4QYMA 3ND5A 4J2OA 2MT9A 1H65A 5GONF 1V2HE 3W9UA 2WHYA 3HKBB 4G86A 3O5AA 4JI8O 3BTSA 4AO7A 2R1TA 4REMA 4JEMA 3KBOA 1SHJA 3WAKA 5B30A 5I9LA 1LPSA 1UXGA 3QW4B 4DMKA 4QYXA 5M04A 1KBHA 1E89A 4ZA2A 3QYJA 4OSEA 2JDIA 2CXRA 1KYIA 1D9ZA 3EFOB 5KPDA 1ZAKA 1JLKA 4TOIA 4KUGA 2F8SA 2G4LA 1RHMA 4IT5A 2NO7A 1G8MA 4XTRA 5K0EA 1FY2A 2YHIA 4ZU1X 2YZ7A 4RGVA 4C5CA 4Y3UA 1ZNYA 4BNIA 1U0NA 4MP3A 1DRVA 4CIBA 7YASA 1X8LA 3AY6A 3N74A 2PJDA 2UVPB 5DIZA 2J9FB 2VYNA 4MUBA 4Q4DA 4DJEC 4UE3S 2HBRA 2EWMA 4FGJA 5P8WA 4QA9A 3TZQA 1GSOA 4R8VA 5AKKA 1JEAA 2W2NA 2QHXA 1JZQA 4GI3A 4AUNA 4E70A 1BXGB 2QWRB 1KMHA 4INOA 4KFCA 2QUZA 1GGNA 2W6NA 1SUIA 1NT2A 1JEYA 3H2GA 2LRHA 2QP9X 2VZ8A 1Y42X 1RE1A 2QZ4A 1UDXA 3P2JA 3M6FA 2VDWA 2GLTA 2XYHA 3BAAA 4C2AA 4ZQFA 2XMCA 1BFDA 2G9VA 5EC2C 4EO4A 2R65A 2WLKA 5F5NA 5EJFA 3PJEA 4JODA 3HPQA 2Z2XA 2ZWAA 3NHUA 1QU3A 4KQ1A 3TOZA 1HO3A 2BC9A 2C2GA 2R8BA 4N39A 2Y0DA 3WQBA 4R54A 4KQJA 4ZEOA 3C43A 3PX7A 4KDFA 4Y2HA 2IXTA 2JDID 3LZ6A 3E7DA 3QA3E 1J0XO 4ENUA 2NTJA 2NUPA 1RVV1 5A71A 2O2SA 3CRCA 3LYHA 4PSAA 3FNQA 4M0PA 3C15C 2MYNA 3KB8A 4Z2YA 1PIWA 3WYAA 2ILTA 2VP5A 3CLKA 1N3YA 4DLBA 3O8LA 3T52A 3UGQA 1DJNA 2PX0A 4RXUA 1K9MW 2DXIA 4LH7A 4P0TA 2VYND 1EFRA 4TX1A 2UU9B 4FYJA 4I5DA 4DB4A 5FL7G 3ABKB 5HK8A 4LJ7A 4DCPA 3UAOA 3HKDA 1GNQA 3PC3A 3J7AC 1CJCA 4B40A 1KERA 2VATA 3C3WA 5JPIA 2PS1A 2FSIA 5ETJA 3KOZA 1LUVA 4KH0A 5IBQA 4AI8A 4FFVA 2BFFA 4A8JB 4X6UA 1WUTA 1KSFX 3JQQA 3GVMA 4AXBA 1ECJA 3E48A 4CZ2A 2E3JA 3E9ZA 1RPAA 2PQ6A 4PZAA 821PA 2TECE 3K0EA 1RXSA 1FXSA 1CUCA 3Q12A 2YVUA 4TVKA 4CBCA 5FOUA 3I3OA 2HIMA 4JLKA 4DCOA 1GTJ1 2XDWA 4XZ3A 1HK7A 3C3CA 3MSXA 4Q9KA 1Z75A 5JEEA 1F4VA 4BAGA 2G1KA 1XTPA 5J1SB 4X1KA 2UXDO 2RC6A 3OPYB 5EMJA 2JLVA 5BNZA 3COJA 1CEZA 2FRXA 3IUPA 2GFIA 1GFWA 1L4FA 1ZAUA 4D3YA 1JIIA 5CN0A 1R3JC 1GPMA 5LCXA 2H2WA 3TVTA 1NIJA 1V6SA 2JEXA 2PU5A 1OWNA 4YEDA 3UICA 1XL0A 4B3MO 4ALNA 2WJJA 1QHTA 2ODBA 1SCJA 4WNCA 4Q9NA 1GAJA 5JRZA 3UQ8A 2WY2D 3Q3GE 2QTHA 5DMHA 2WZDA 2PT9A 1H9AA 1FS5A 2O0MA 4BKUA 3AJ8A 1IBMB 1GZUA 3GR6A 4KEAA 1G4YB 2NYAA 4RO0A 1UAYA 1V55C 4R8CA 3DM5A 3KWFA 5IPFA 1QZUA 3CJHA 3CLUD 5EZYF 1GOTA 2QTCA 4PYIA 2PUVA 4G37A 3CMMA 5T8KC 5A9SB 2L6LA 3WLMA 3BFXA 1VLHA 4B0OA 1ZM9A 2I62A 2AG8A 3AIOA 3BY6A 3I2YX 3UV3A 5B5EZ 4PA7A 3UIEA 1JAHA 5DULA 2P2ZA 4FFDA 3FPBA 3W05A 1NVMB 4R2XA 1Q0ZA 3DHYA 1E6KA 1QYIA 1FNMA 3QUBA 3FFBA 4V0OA 4RJIA 3ZJYA 4CG3A 1AV6A 2QLBA 2B4YA 2HNAA 2OSBA 2WK1A 3DONA 1I5OA 2HVKC 4XSVA 5B7PA 3RTAA 3RYHB 3S2GA 3EF0A 3SIPA 1VCHA 1M56C 2GX6A 3B8NA 4R9UC 3ZMTA 4E2WA 1JKJA 4M6WB 4QDZA 3IGAC 2AN3A 2CLKB 4HHEA 1G2OA 5G4LA 2G7MC 4YCBA 2XD9A 4Y18A 1TCCA 4M49A 2QTOA 5CFLA 4LMPA 3OC6A 2E18A 1XZKA 4RCYA 4XOIA 2Q1WA 3AUFA 3UT6A 3PUHA 1Q3KA 1UKEA 3TCKA 4AY5A 5JS6A 4ND3A 4LZWA 1N5JA 1SZXA 5D1HA 4OGGA 4RF5A 4J0JA 2PUHA 4DCMA 4ZCQA 1X9GA 1FRQA 3L9WA 4OQNA 1Q1NA 4E5PA 2DC1A 4PCLA 2H9IA 5D3QA 2NTNA 5KJFA 1YZ3A 4DMGA 3KTAB 4XM0A 2LGWA 5A05A 4FFSA 3DEJA 3QF4A 5BWBA 4BGVA 4CM1A 3QE0A 4YDRA 3RG8A 4NR1A 3UT5A 4DV2O 3CBQA 4ND8B 3DYVA 1ZSPA 2I3AA 3AFIA 1I2AA 3QM1A 2OBNA 3IILA 1DMSA 2XYQA 2ZRMA 2CC2A 4EVRA 1Z2GA 1LVUA 1KVRA 3E3OA 2GAOA 1SZPA 3E9EA 4ZTZB 3WJ1A 2E4ZA 1U02A 3HCCA 1JPUA 4LWPA 1GN9A 1XTIA 5GGXA 1EE2A 2E4UA 2HGZA 3REQB 3HKBA 5BMVB 2H57A 1JU3A 1CF2O 3A4YA 1NULA 1Z2DA 2P4SA 2Q0XA 3LYAA 2Q5CA 1B76A 4QXPA 1U7HA 2J3MA 2XB9A 4C4OA 3M6UA 4OX9O 1H2AS 2WQ6A 3C87A 2HPZA 1EFLA 3AM5A 4KJZA 3LNMB 2ZJ4A 4RIHA 4J7JA 3GLQA 5HMLA 1RPOA 3ZZUA 2VTKA 3W79A 4R2KA 4OPAA 3EFOA 5TQVA 5JCOA 4WECA 1PDOA 3B3GA 1JLRA 4EB6B 3PEVA 2O1WA 5HILA 4NULA 2DKFA 4LZAA 4XRRA 1HRDA 3JAWB 1DUSA 3Q1LA 4IM7A 2P9FA 3IAS1 1TIKA 2EATA 2KYRA 1H3NA 2YZGA 2EINC 1E99A 1W75A 4Q1DA 1RDFA 3AYZB 3K3WA 2OLEA 3ABRB 1UP7A 2UVPA 2J9FA 2QJWA 3H5LA 3MN1A 2UVDA 4BPRA 4ZT4A 5C4GB 3UCFA 3F0TA 3NKLA 2ZIOA 1OLUB 3CSSA 3F78A 4ZVPA 2NNLD 1U0EA 4IJUA 4TM8A 3MLAA 4K8ZA 4L76A 3IAXA 1NTZH 4YPFA 1QM5A 2WDPA 1QIFA 2XGMA 4JVMA 3P0FA 1MMMA 1BCRB 5P21A 3V6MA 3WOVA 4BIIA 4MVJH 5LC1A 3VNBA 4Q15A 2DTEA 4QVIA 1MTZA 3BMQB 1QF9A 2X7HA 2V1DA 3VR1A 3H65A 4PSKA 1G1AA 2R25B 3K5OA 2F2TA 2JGIA 4U8GA 1W6RA 4WF9V 2EFDB 3CKLA 1BQ0A 3N0WA 1IIBA 2Y77A 2ZJ1A 4C2UA 2O5EA 1WZNA 2XAFA 1KSGA 5EIAA 5IKXA 3NBXX 1YRBA 3INYA 3MTQA 1XELA 1I4LD 1Q1ZA 4D9NA 2XCRB 2RC5A 2A88A 4CEIB 3AXSA 1OE0A 2X2OA 1Y1RA 3U13A 2QM4A 1YCFA 3O38A 1O6CA 4JTCB 5UKDA 2WWHA 4U7DA 1F5NA 4S04A 1MD9A 2LDBA 2LFRA 1K4YA 5EZ6B 1IY1A 5F9MA 4E5VA 4RVOA 3PR2B 1WXHA 5CT5A 1NXOA 3UJBA 1CUDA 4Q34A 5IDJA 1I4DD 3VVCA 1X74A 4IDHA 4KLAA 4Q66C 1FYXA 2DKOA 2OG2A 4Q12A 3X1ZA 3TW6A 2X0JA 2EEZA 4MB2A 4OFBA 5AW6A 2VF4X 1HQDA 4KR9A 2NG1A 4M0UA 2IXEA 4CMIB 4CF7A 4BFXA 2YC2C 5AI9A 2YCBA 4A8JA 2CL0X 4QNMA 421PA 3QO5A 3L7YA 3U40A 4DV6O 4CV1A 3BM5A 2NO4A 4MVJE 5FUMA 4E2XA 1WBBA 4GRDA 4G0XA 2BP7B 3GWZA 1ZN8A 1MC5A 3K96A 2PGNA 1ZUWA 4HFRA 1SNYA 4FJ1A 1RS0A 5HZMA 4G0UA 3WYDA 4LH6A 4HN9A 4EGJA 4M0KA 3ECAA 3T3GA 2FR8C 4XR4A 1UBHS 3MD9A 3U56A 5SV2A 2JGDB 4G8DA 5LMNO 2DULA 3IBYA 1J23A 1IPFA 4Q6BA 2D74A 2HP8A 2FB5A 1H2FA 3K5NA 8OHMA 3OPYA 2WZCA 2JAUA 3AUXA 4KXFB 3T5CA 4X65B 3RLIA 4DA9A 2ZI5A 5IY5C 4OHKA 2IOFK 2OL4A 3UTDA 3WDMA 4KXXA 4HZGA 4IOLA 5HCIA 1ZMBA 2G1UA 4PBRA 4YQZA 1NVPB 2O2DA 1TFRA 3T61A 2C61A 1JALA 1SIUA 4ZGGA 3WMWA 4KXVA 1E0SA 2QG4A 4KU4A 1E9VA 1WDLA 2RB4A 4PBSA 1C30B 3QX7A 1K86A 3ZWYA 2XOKA 6PFKA 5ESDA 4QOFA 2GWRA 2HQOA 2V4DA 3C2QA 4MUXA 3JU3A 5AVRA 3WAGA 4JPRA 4DIEA 1VHJA 1FVXA 1VQ9V 5KKCA 3LUAA 4DR5O 3OURA 1XI2A 2X9LA 5A9SA 3V9PA 2BCJQ 4IHKA 3KQOA 1OHHG 2IP4A 1YUMA 2C9OA 1Z4OA 2PVCA 4MGHA 3LHSA 1D04A 1ELOA 1UOEA 1J0CA 3FFXA 5HQ3B 2JNWA 1FPOA 1WBDA 3C74A 2VF8A 5KNDA 3T9CA 4IWXA 1OV9A 2YWHA 4MWSA 2QTGA 4OYRA 2Q9UA 1RXUA 3ET5A 3QXJA 1B3QA 1EFTA 1D4FA 3TSYA 2EHJA 3UATA 1QAMA 4NFLA 1QHIA 1KKDA 3RYHA 2JI4A 2K2QB 3EZNA 3V1UA 2UUCO 1K1EA 1LXCA 4MVQA 3K53A 5EWJB 4UW9A 4UU7A 5K51A 4AZTA 4MINA 3CZPA 4JI4B 1PM9A 3EVEA 3DGEA 4B73A 4G9GA 3MQFA 3KHKA 3U4MA 4M6WA 3ROXA 2VCEA 1GA4A 1MXHA 1FMCA 3FDXA 3GGOA 2IM9A 3OZSA 1S5HC 2WPDA 1I4WA 3PGLA 1QK4A 3MG9A 4QUIA 1M2NA 1CUUA 5ITSA 2NP6A 1O94C 1CKEA 3S1AB 5AK6A 3RROA 2R6ZA 5DNAA 1Y76B 1DADA 1TA0A 3ZD6A 2J41A 4O5AA 4NENB 1WXXA 2H63A 3QTLA 2D1TA 2QSYA 3H6KA 1MSWD 4WT7A 1IONA 2EGGA 3KTAA 3P19A 3QOFA 1GH6A 1TF7A 2HSDA 4GOND 5FYQA 2WSBA 1KDRA 1HFEL 5KCMA 3E9QA 2Q4OA 3W5IA 1G9TA 4UUJC 2F9FA 4BB9A 5HKAA 4I1OA 1NXVA 4ZI2A 4ND8A 1OI4A 6AT1A 1M6VB 1VYVA 3H13A 1NR1A 3PGKA 1LWOA 2R6CA 3T99A 2X0IA 3UC5A 1Z4JA 2Q6LA 4LUCA 3CR7A 1IULA 3RG2A 3DVLA 4IVRA 4H60A 5TGZA 3UHOA 1T24A 3SC2B 3REQA 4K28A 2DWUA 5FLYA 1NJ5A 3GJ5A 3OFVA 2AFHE 1UBOS 5U1PA 4DQXA 5K45A 2PYJA 4WK2B 3WBBA 1UADA 3L6RA 3V8NA 4CMHA 5SYNA 2NXNA 3Q2KA 2LZ0A 3IMEA 2NM0A 1YFKA 4KQHA 3IMKA 4UU0A 1T2FA 2I67A 3IT2A 5FEMA 3MC1A 3ZV3A 3IUBA 5E7JA 4ZTBA 2XTMA 4R8KA 1BHSA 4L85A 3MTIA 1JR2A 1YE8A 2Z8YM 2O2IA 5WRFA 3NRCA 2F8MA 4EB6A 4F4IA 1H6BA 5IT0A 4NYMR 2VP0A 1YA8A 2Y0CA 4JI0O 4KQWA 2WWXA 3JAWA 3QE3A 3V2UA 1QC5A 3QOWA 3W5JA 4GYCB 5IMBA 3ZVKA 2RG1A 4J80A 4KMMA 5DBEX 4PINA 1S4MA 4L08A 4RPHA 1EA7A 3SBEA 1OH6A 1EKXA 3RH0A 4TV8F 3DE1X 5YASA 3D2LA 3SGIA 2WA4A 3HCPA 5EUBA 3RD5A 1O89A 1TCUA 1URPA 2CFSA 1YH3A 3SZUA 1EFAA 1OLUA 1TGVA 3EAFA 4YRQA 3ZE2B 1RE0A 1JLMA 3QVVA 3FFTA 4NZMA 5MFPA 4MV6A 5JISA 3O92A 3RK4A 3ABLB 1SBTA 4DB2A 4JI8B 4JD5A 2BRUC 4FNMA 3G7NA 5ALGA 4BIMA 3HXPA 4DXHA 2ACWA 2VTBB 4YDSA 5EIBD 2UU9O 3BMQA 3S40A 3E5RA 1SEVA 1U28C 2G08A 1ZD4A 4BQQA 3WMRA 1CQWA 4RHFA 1FFTB 4HJRA 4KK3A 1L8QA 4EVSA 5FH9A 1YHQV 2REBA 1TJNA 3RC7A 3R65A 2C7PA 1M6NA 4O4IF 3SIRA 3B8EA 3LWZA 5EIWA 3AEYA 1MV8A 1BVHA 4CEIA 2EZTA 2GCIA 2ONJA 1BA3A 4JI6O 1W5SA 3IIKA 1B7GO 3P4UA 3WLPA 2JRLA 2IPAB 3WLTA 5BQPA 1MJGM 3CX6A 1SRYA 2PV7A 1WU7A 1D2GA 2I6SA 5FTJA 3I6QA 3DE0X 1E62A 4EJSC 4ESEA 4DFDA 2B0CA 2XDAA 4DG8A 1EX7A 2P4UA 1GAEO 1SURA 3W7XA 1RBMA 4DUZO 4R1MA 1EVQA 4ZC1A 4WDRA 2FEWB 2E82A 2E7ZA 3CGGA 1J42A 3TMKA 4EHAA 3WLKX 3RUEA 2PT7A 2QDKA 1YS4A 1PUXA 5BY2A 5CT8A 4CMIA 2ANBA 4C9BA 2OO7A 1ZGZA 4RPKA 2Y71A 1VE1A 2X6AA 2NWQA 2QPAA 5FPTA 1N9KA 2XB6A 5T64A 1RR6A 3JZAA 3VNVA 1F7UA 2XB4A 3IQGX 4L4UA 3K30A 2P75A 4ZCPA 2BP7A 1GPUA 3HB4X 3WKCA 4V0MA 3U7HB 2QM8A 4Q93A 2OT5A 1CFJA 3WBKA 3H0CA 3E70C 2WQ7A 5AVTA 5C8DA 2FRDA 2BD0A 2JGDA 2MW2B 1F0KA 2RI0A 3PV0A 4KPEC 4UCSA 4OXKA 2C4KA 3VA7A 3LJKA 2ZCJA 2DW4A 1G66A 3D3QA 1P5JA 4J41A 2PK3A 2EZ4A 3H2SA 1VA5A 4EFKA 1E98A 1SUFA 3LQYA 3ZDRA 1PJLA 3R1IA 3BILA 4Q1AA 1D2HA 1NS1A 1EUCB 2OHGA 2PGIA 1BW9B 3AI7A 2FW6A 2FFJA 3TTVA 3I76A 2JHCA 3QELA 3OBIA 1EDDA 1L7OA 1T1IA 2VVTA 3STYA 1QGED 4JEHA 5LXTA 2GLUA 1M1UA 3MLBA 4YDHB 3ZWQA 3PFKA 2V7GA 2WJ4A 1ST3A 1S1MA 1BH6A 3PPXA 3WRYC 4ERXA 5AD1A 1UWKA 1T3ZA 4UAJA 2A5JA 3V7UA 1Z9BA 1ZGAA 1C30A 3EB9A 1RAHA 1SVSA 1LTQA 1FTGA 3LIIA 1OFGA 1L1FA 4WUVA 3ESCA 5BSHA 1FRVA 1XTZA 4NR0A 3EW9A 1QLNA 3VU1A 1MX5A 1RTKA 3FDIA 1DFHA 2IWRA 2PI4A 1PJBA 2XITA 5C52B 1FLNA 5TJHA 3QW2A 1JJIA 3ORQA 4ARZB 1ZD5A 1MABB 2IKSA 3WGLA 1YI2V 1G21E 3GD7A 4B3XA 1NF2A 2M32A 1I2MA 5HQ3A 3EYWA 3U4CA 1RJ9B 1NBAA 4WQMA 4IHJF 4IDNA 4C7XA 5BRJA 1CY6A 1TM3E 3G0BA 3WL5A 1UEXC 2P11A 4QGGA 1VRWA 2OV4A 2JJ1G 2D1RA 3AP1A 5CXQA 4YMLA 2HCBA 2CVOA 4MPJA 3PENA 4FDAA 2X22A 3SZGA 4B8YA 1E4VA 3O93A 2X77A 4B3MB 1V96A 4KSCA 1Z5VA 1XQVA 3AG6A 1MGPA 3ZQJA 1KS9A 1EFKA 4WUTA 4LVOA 3G6WA 3IC9A 5EWJA 1KIFA 2ZT5A 2VJLA 5KHHA 4I50B 4NDNE 3SXJA 3OMNB 1NVPD 1W5FA 2Z5UA 1Q19A 1JAZA 2HA3A 1FFWA 2H06A 1NW4A 2SHKA 5KZMB 1FP2A 2ZYUX 2HJDA 4JIMA 3EQZA 2JATA 1KEWA 5KC8A 3S1AA 2BBWA 2H3HA 1Y76A 2DUJA 1Y6QA 3PLNA 3SZRA 5LUBA 2YQZA 3QYFA 2PXCA 5DW3A 4FCCA 3NOXA 4DDKA 4GSKA 4AO6A 4FQ5A 1L9KA 1RM0A 2Q9CA 4MS2A 3HQ4O 1PV2A 4HQNA 2WRZA 4M9UA 3IUJA 2BJVA 3KKZA 4MCIA 2HUPA 1GV1A 2Z2JA 3ZOKA 1U7TA 1M6VA 2PLWA 1IY8A 4G5YA 1OFVA 3L1VA 1JMKC 3E9CA 2EAUA 1QU2A 4OQQA 4RNCA 5H68A 1W36C 4G5OA 1LC3A 4C76A 3UWOA 4O2AF 4UV9A 1SKBA 1PS9A 5E4JA 1M2FA 1JKXA 5JI2E 2Q73A 1VI5A 9LDTA 1AM4D 3LL4A 3H0KA 3IDOA 1T4BA 2AMJA 5AOBA 4Q1VA 1QSGA 3K71B 2DJVA 2O59A 2I8AA 3NTOA 4GR4A 3WA7A 4LTDA 1EG7A 3WIOA 2H8PC 1AK2A 3LGXA 2C78A 4P0PB 1FNSA 4FLZA 1RHKA 1SKYE 3LUGA 1Y3AA 1S3IA 1V45E 5DTJA 5HM6A 2JCSA 1T2DA 3ETGA 2Y48A 2BFBB 2IEDA 5B1NA 3TCNA 3G9ZA 3PQFA 4LZZA 3T5DA 4LDRA 2G9ZA 4QREA 2UXXA 2XRMA 2ZAOA 2OBFA 5LYJA 1MA1A 3BDIA 1XTTA 4GE3A 1N1MA 4UDNA 1NF9A 1MB2A 2VYFA 3JQBA 3A6KA 4AY6A 3B6MA 1XZFA 3Q3IA 1UKBA 2JW5A 2ZIGA 4BV2A 4UPEA 1B15A 3F4BA 3FIJA 2OBYA 4BMCA 3BULA 1WS6A 3RADC 3SEQA 2KHZA 3Q5DA 3QPVA 1DTSA 4GF5A 4OHCA 3VYVA 4DV7O 4BFWA 2ZUUA 3UG6A 3PHHA 1K7EB 2N46A 3A70A 3HSKA 2XH8A 1W7AA 2E2WA 2MIIA 2G71A 3ZKWB 3A11A 4RSHA 4EKIA 5B1IA 4IG9A 2O5CA 2JA1A 3MJCA 4IJKA 2B1JA 1C3XA 4OX9B 5CDYA 4OHXA 2C8VA 5TXGA 4DCVA 3PJGA 1LD3A 1IN7A 4FW9A 4CE6A 4WOBA 2BYTA 2X0NA 3SJUA 4NK4A 1KQOA 3T3DA 4BY9E 1OX5A 4A8TA 1Z8HA 1UM9B 1VSUA 5DB4A 3U62A 2REQB 4MO9A 1I2BA 1UBKS 4Y6GB 3NHYA 3OQOA 2ZYAA 1IC6A 1BIFA 4EKGA 3UYLA 2VS0A 2Q45A 5KVSA 3EDQA 2YJ6A 1GN6A 1E0AA 2EKPA 2PZJA 2RGNA 3LC7O 1X7WB 1LRJA 4GUDA 2D59A 2B5WA 4QTZA 1AILA 4CDNA 3ZCRA 4OHYA 2CXPA 3PSHA 1Z22A 4C4RA 1JQEA 4QU8A 5AVJA 1AE1A 1UJ4A 1XZBA 2HJFC 1DAGA 4ICIA 4YRCA 1WBJB 4J0FA 1TA9A 3ASNB 4IIXA 1ZJ5A 2YR0A 5FXMA 3PGVA 3AWDA 1KK3A 3HEBA 3PP8A 3I1YA 2DHCA 5L7TA 4MHTA 4IH9A 4MV5A 5CRIA 1PJCA 4DZZA 2CFOA 2R00C 1UANA 5HFMA 2P2SA 2Q29A 1UPFA 4PG8A 1BMFA 1TYZA 3ZJ4A 3TI7A 1ODFA 1Q6UA 1FVHA 3TTWA 3PHBE 4MDFA 1TMGE 1TU0A 3QE4A 4C87A 2QENA 1JN0A 5DGHA 1YBHA 3K9BA 3PG5A 2P9EA 3R5TA 2QUHA 3L9DA 3L6EA 2VRCD 1R6VA 3CTPA 4R2WA 4O59O 1NM5C 3KJQA 1PYGA 2JS5A 2PRIA 4J94A 2OFPA 1FJXA 5L6MB 4TLCA 3WOHA 2YZMA 3OHMA 2QTWB 2YYSA 3UF0A 1TEHA 1U8FO 1UR5A 1Y80A 3ESDA 4HNVA 1T35A 1DPGA 2CGEA 1CY2A 4G24A 3A1WA 2VHTA 2Z0MA 3VU8A 5AW2A 4C7OB 4CKCA 2HKIA 2JS3A 2HEIA 3GCZA 2BIFA 4Z4FA 4GRIA 5BZBA 1J2RA 2FY8A 4QYIB 4I0WB 4QD3A 3BGWA 1BW9A 4RA9B 2OCIA 1HE8B 3P32A 4OMUA 3ZW9A 3ICPA 1VQ4V 1J39A 4EKDA 1CFZA 2AN9A 1HC7A 2WLHA 1NTKH 1KA9H 3F7VC 1ZX1A 1TYCA 3E5NA 2YQ5A 1UZUA 2A33A 4F92B 3CO0S 1XNJA 5DSZA 5HCNA 4OHPA 2NR5A 3JYPA 3C6KA 3NASA 2VHZA 4DV6B 4WBXC 4L02A 2AMLA 5IAOA 3ZS8A 2INGX 3ESYA 1K6MA 1BMFD 3T4UA 3SBXA 5CG1A 4IBOA 2EFHB 5AUNB 1LTKA 3HM2A 1QIEA 1M1XB 2YYZA 2F9LA 3L40A 3S27A 2PD3A 3RT3C 3JWJA 1DV1A 5LMNB 5DBOA 4ARZA 1MABA 1BKDR 2VF2A 3GP5A 4L5CA 4ZT5A 4PHHA 5C51B 1RWXA 4C3UA 1RJ9A 3M0EA 1KBOA 2X6BA 3FM9A 3LG2A 2F90A 1YA6A 3I53A 5HUHA 1SESA 2FG6C 1OROA 4UBNA 5G3ZA 4UUNA 4BV9A 1K3FA 3IX7A 4YI3A 1MOZA 3OUSA 3IB3A 3H5IA 4R9VA 3RPEA 2J30A 1RXVA 621PA 4UE6A 3NHSA 1O8CA 1FFHA 3R0JA 4YPOA 4PXAA 3DO6A 1Z4PX 4D0NA 2G63A 5IXYA 2WU0A 2N75A 4GH5A 1MJNA 4ZHQF 1VQ5V 4I50A 3G2OA 3FVWA 1DC7A 1G291 4CKBB 4JAVA 2GSDA 4ZT3A 3K16A 1GTSA 1TVEA 4TTIA 3OIDA 4OB8A 3ND8A 1ZUD1 2PGXA 4QBHA 2QTTA 2JKVA 3EBOA 2DMXA 2IP2A 1OPXA 2BOVA 3DZIA 1KMMA 3QLJA 2H0RA 2GM9A 4V0LA 3EOBI 4DR5B 3O2NA 1H85A 2E6KA 4F6LA 3OY2A 2ES4A 1ZDMA 1UBCA 1QDEA 4P08A 3A1FA 3WFZA 2QN3A 2PBRA 4DYHA 1BDMA 1JV2B 1UOQA 3Q3JB 4G07A 3HCEA 3DUWA 2O3RA 3I28A 1IURA 4RMNA 4EG0A 3QOYA 3OPVA 2ZB2A 5HJEA 4BRWA 4HQLA 3FYUC 1TGOA 3LX4A 4FCVA 5HA5A 1TTHA 2O8DB 1K3TA 4ETWA 4AILC 4MAMA 2UUCB 5BVHA 4A3SA 2RGBA 3AFNA 3B53X 4Z4IA 2ZXUA 3CLRD 5B55A 1U4SA 3IFXA 3HA5A 1SKUA 1V9SA 4L8YA 2FSPA 4FLTA 2Q6VA 5JC1A 1QWSA 4FN4A 4D4JA 4PF1A 3NIWA 5D87A 4BZWA 4ES6A 4EJFA 1Y5MA 3GH3A 1Q22A 2I8LA 2QE7G 3FHOA 3OPNA 3K20A 4N6NA 3MWLA 5DWQA 5A7FA 2AHOA 2BFBA 2VOJA 4PWZA 1Z0FA 1RYFA 3ABIA 1GK9A 4DNXA 3ND7A 4W9RA 2JIRA 2DCMA 3E8MA 3O26A 4RIIA 1Z6QA 2JLBA 5JQGF 2CK3A 2A06H 4QLOA 4MHOA 3H9QA 1A2QA 2OUIA 2HZ7A 4PNPA 6LDHA 4F56A 4HYQA 1TKRA 2H6EA 4MROA 2IXFA 1ZOPA 2I8CA 2CB0A 5T6BA 4V2IA 3QFRA 1U3FA 5C1BA 1NPTO 4ZYUA 3OTQA 3ZKWA 1IMJA 1YR3A 3O3MB 3AINA 5FNZA 4JP3A 1A2OA 4KREA 1CUFA 3CB4A 1TMYA 3EVFA 3JWHA 3WNQA 3Q0IA 1HT1E 5LZ9A 2DG2A 1YOVB 1KAQA 4KL8S 2ZT9B 2F62A 4X3CA 1FRZA 4B7UA 2CYCA 2XTNA 2F64A 5ALYA 4WINA 1MOFA 2F23A 3KL2A 3AWIA 3RJMA 4KC0A 4D99A 4CM3A 1UM9A 4HEA1 2D5LA 5JRJA 5TGDA 2REQA 3DSQA 3GELA 1N36B 5LUAA 2FTKE 2RHWA 1ZW1A 2IFTA 4LWSB 4UOQA 2O19A 3CWZA 5EOVA 4XDZA 2AUTA 3M9LA 1RI2A 4JI0B 5H2FZ 5K8UA 1KFKB 3AVTA 4D9KA 1NHWA 1PJRA 1U99A 4TLBA 5LQRA 3F8SA 1M54A 1Q7BA 2FX2A 1DINA 3RTBA 2GHYA 2I3DA 2OORC 1QO9A 5MDHA 3PUWA 2I4LA 4NY1A 4D41A 2JFYA 5L45A 3G2PA 4HDOB 4EGCB 5DN6G 3BSFA 4KX3A 4HYTA 2CK3D 5HF9A 3L7NA 1EIWA 1Z4IA 1U3CA 2ID9A 4LBYA 4BQFA 1PNQA 3R3HA 2BDTA 2ZZMA 2HM7A 2ZIFA 4DPKA 4RZUA 2ZBFA 3KYCB 3RT7A 4IV8A 4YAKA 4BV8A 8GPBA 3LQFA 3LA6A 4IGGA 3CRVA 3T7IA 3PJRA 1L3IA 3FLMA 1KMIY 2CLOB 1LNSA 4RTRA 4CT5A 4LGVA 1ODSA 3S2EA 4EW2A 2FW0A 4KODA 1HDZA 5C93A 1HY3A 5DP1A 4GPIB 1BU5A 2AIRA 5EG5A 1JHVA 1Y33E 2B5OA 2FYUH 4UD6A 4O29A 3QE9Y 2ZUVA 2B7BA 3DW1X 5BNWA 4MKIA 4U7FA 3IUSA 3B60A 2ZRBA 5FTMA 4WFAV 3F9CA 3WHIA 4LDPA 2KI5A 4CXMA 3LO5A 1G16A 1O6GA 1JSCA 4GRAA 4AP9A 3OLYA 3R9XB 1H2XA 3AJ9A 4JI6B 3FTQA 4EY7A 2FVXA 5AFSA 4IUYA 3ZXSA 1H4TA 3UOWA 1QLEC 3F5MA 3ZRSA 4IDAA 3FSJX 3ORRA 1MC1A 3WL3A 2X6RA 4YACA 3WKEA 3OE4A 4DQ0A 2OCAA 3EMBA 4C7OA 4N5MA 1FDTA 4WFFA 3AM3A 4BCDA 1VG0B 4F5WA 1Q0HA 4QYIA 1R64A 2XCLA 3HWWA 2B1RA 1UPGA 4RA9A 2HJSA 4UM7A 4DUZB 2G09A 2DZDA 4QBIA 5HE9A 4MP8A 3P9QA 4PJ0Z 3T9FA 1SHKA 2NN4A 3NWJA 4GOJA 3D8SA 4L74A 1KO4A 4QIHA 2Y8EA 4ZCLA 1VPLA 4YYEA 1YL7A 2PA3A 5I4KA 4KQ9A 3MGGA 1HI9A 1NP3A 2JFOA 3IRVA 3VHRA 3D64A 3FPGA 1NBME 2AL7A 3O4VA 3ZCSA 4FFKA 3VJRA 2W6ZA 4UEKA 4GC9A 3PQDA 3OFJA 2G1PA 1TI7A 3A6JA 3RC1A 1K6JA 4TUYF 3KSBC 1XEAA 4MUYA 3CRW1 3M6WA 2ATIA 1NQVA 4FHZA 2IU6A 2ADPA 3LBYA 2JCGA 1Y3IA 1PVOA 3HYSA 2FRVA 4H08A 1DTWB 3ES9A 3ROPA 1R15A 1K6XA 1E4EA 3SP1A 2LWIA 2YV4A 3KR2A 2FYTA 2AC4A 1T0BA 3KXKA 5B3SB 2W6OA 5FFMA 2QRGA 1S96A 2PR7A 3UJAA 2PL3A 1SBIA 4EWLA 4CV0A 2IS6A 2QM7A 2PUTA 3QBDA 4Q4HA 3F1LA 1WF3A 1I3CA 4K3UA 3S29A 3LBNA 3ANSA 3L4SO 4K6MA 1HYGA 2PCJA 2QG9A 2WMNB 4M8SA 4WXEA 4FR5A 2FZCA 1M83A 1T9ZA 2GCPA 4CKBA 3GWGA 2AVDA 3IKJA 1UQTA 4OM7A 4JL5A 4MWZA 4Z8YA 1TXGA 3N2YA 4N82A 1MIOB 1NW7A 3X0DA 3K0DA 1DGSA 5EJMA 1OIVA 2C7GA 2NO1A 5K6AC 4R16A 5BUCA 2BM8A 1DDOA 4MYTA 5LZ4A 1XZDA 2ZRGA 3PVSA 4IGEA 4NPAA 4FNAA 1RWWA 2QTFA 1RAEA 1VJTA 3G7SA 4K9SA 1LR1A 4ASUG 4GMXA 1YJCA 1P1JA 1GU0A 5FP0A 4PO8A 1EVKA 3LKDA 5KEIA 3DEKA 2OD7A 1LBIA 1EWRA 3RC8A 4O4JA 4GBJA 1JYFA 4PDVA 4BMDA 1GIAA 3IKVA 4AN4A 4WASA 4XGIA 1BSMA 3T7SA 3A27A 4LYFA 2XMQA 3PGXA 2QIOA 1SUAA 2ZVDA 2QN7A 1NLFA 3LXXA 4KWCA 5F1OA 2OSVA 3WS7A 1G59A 3N9IA 2NPOA 2PEZA 1J1ZA 3NIFB 3A9SA 3GLGE 1BNCA 4QXMA 1ZA1A 5JALA 1GDHA 5BRNA 4P4NA 2BBTA 3RGBA 2ZRHA 4C6SA 2O8DA 4Z1VA 4Q3BA 2WKWA 3HY3A 4L0MA 4J0IA 5A06A 5B7QA 1HRKA 2UYHA 2V7UA 1CHDA 4E21A 4D96A 1QTNA 3VZPA 2YY7A 5IAJA 2JFPA 3O74A 2VH1A 2OWEA 2J0EA 3PJFA 1ZOIA 3KR9A 3ZN0A 2O06A 3E4CA 2JHAA 3JSLA 4PAQA 3VGJA 3RVOA 1GPBA 3LDGA 1BC5A 5H59A 3J80N 3IJRA 1YXBA 1E2IA 1NX6A 3VBBA 1GYPA 5EMKA 4EYOA 1JBQA 3O4HA 4AZVA 1A5AB 1E2JA 1NN1A 3QV2A 2QR3A 1RJDA 5BWNA 2HB6A 1Q17A 1HTBA 1KHTA 4RULA 2WWVD 4IQGA 3VSCA 3E4DA 5JWRA 2JLWA 4CN9A 2DBVO 1UFRA 2UYQA 2ZAMA 5ER9A 1YTUA 1MU0A 3OZDA 1G98A 3IQIX 4FLWA 5FOVA 1XZJA 1FA9A 4AKTA 1XJQA 5L7YA 1XCOA 5EPOA 4C0SA 1NVWQ 3PNMA 3DYIA 1PWHA 2FU5C 3OZCA 4B3SO 5I8WA 2IIBA 1K88A 3KKQA 3TR6A 3BF8A 4IEIA 2QM3A 2ILMA 5EKSA 5AOVA 4R71A 5A0VA 5IAKA 3RYIB 3EGOA 2C57A 2D0PB 3ZZ1A 5DLYA 1ZLYA 1PF7E 3ZIAD 2WSSG 1ISMA 4XVUA 1UP4A 4UFZA 3FPFA 4JR1A 3P4XA 3BKXA 3FGOA 1TD9A 1E1CB 4OGLA 2PMFA 4RIGA 4UEWA 3E9NA 4A0FA 1BXGA 1YOVA 2Q7HA 5HIKA 3MPUA 4R01A 2DYSC 1Y6RA 3K5IA 3TBFA 2BUBA 2IIPA 3PFIA 1XZAA 4QTXA 1LRLA 3HCFA 4B7CA 5C5DA 3WNZA 2ZYDA 4LWSA 3AUJB 1H2RS 4JLMA 5LJLA 1SQPH 1IZ9A 3TRDA 3FYSA 5MN5A 2AG5A 3OLZA 2BM1A 2ZDIA 1DVRA 1S2DA 4XQ9A 2D5CA 1XQYA 5TMBA 3HN7A 4IIUA 1FTWA 2DFTA 1HDGO 1TUIA 1XE3A 1FNDA 3KOXA 1QV7A 1BE8A 2WLMA 2QX9A 4BCCA 3VR3D 1X8XA 5CBGA 3P2KA 1A1SA 1IK4A 3RFFA 5IW8A 4FFMA 1NI5A 4DV7B 1YS7A 4B4OA 5BSGA 1TUEB 3IEPA 1Y81A 3K72B 1T3GA 1GQSA 1KOGA 3D3IA 3KYCA 4DRZA 2VI5A 2W2LD 1E6UA 2GNOA 3V7NA 3KU1A 1TGYA 2Q3LA 4HEJA 4IW3B 1AH2A 3NTUA 4M88A 3EEIA 3WP1B 1VF7A 4UVHA 2E49A 4D44A 2YXNA 3O4FA 3VNSA 2PUCA 1HURA 1L7MA 3SQDA 3K09A 4KOAA 4LV8B 4LV6A 5E2IA 2CFRA 4BN4A 5JFOA 2J9ZB 2D2EA 1M1YB 2YOHA 2ZATA 4IGFA 1PWYE 4YP7A 5BQXA 1OXBB 3SPJA 1Z12A 3CNOA 1SUPA 1WHTB 1FFBA 3GOHA 1I4EB 1WQ1R 3VDQA 3R9XA 2DBRA 4C04A 3G1WA 3W2FA 4DT1B 3L5KA 1L5FA 4HUTA 3JAMA 1WDKA 1B73A 1SZDA 3ZW7A 1CR4A 4LI0A 1G17A 3H9CA 4TMKA 2F6RA 4BPBA 2Z2IA 2XWBF 3BAFA 1GG9A 2CD7A 1H2GA 3CPSA 2J9RA 3ZBHA 4ZWNA 1PUJA 1P5FA 1JG2A 5JECA 5EY5B 3DNFA 4DLVA 1SB8A 2Q2QA 4RTJA 1XG5A 3U48A 3P20A 4LYYA 4FYVA 4GPEA 4O1IA 4H0LB 4HXYA 3JWPA 3G2KA 1WCWA 3KB1A 4HZIA 3M70A 3CJRA 4O2LA 1XQ9A 3PXUA 4QASA 4QJ4A 4YN3A 4DLUA 4OSPA 2VHVA 1DIAA 4XJVA 2HRQA 1FPMA 3R3WA 4S1WA 5HKKD 3SHFA 3K2BA 3QV1A 4HYOA 3UQYS 1ID8A 1IQ0A 4WSOA 1P7ZA 4Q3CA 4X3PA 4LRSB 3RCBA 1SXIA 1QRDA 3DUFB 3JQ9A 4PV7A 5H5JA 2P5YA 3SZLA 4MUAA 2EEPA 3F9IA 5L51A 1VIYA 5DJ5A 4UCXA 1DL5A 4PO1A 3QLUC 2GTIA 4NBWA 4FVTA 1WY5A 1DJOA 3R41A 1PKEA 1DTWA 2RBEA 2F48A 2HU7A 1ZCZA 3BF7A 1YNSA 4U7NA 3IQDB 4LVNA 2O1EA 5BR8O 3NFRA 4Y9DA 1NZ6A 3SDLA 5KVVA 3ZPXA 4L15A 3IOBA 2JFXA 4PWYA 3F5FA 1JG3A 5H4HA 4TV9B 4NE7A 3KM0A 1R5JA 3RWBA 1C0EA 4BRSA 1I3KA 2AC7A 3EFBA 4UDYX 1VYUA 3HYCA 3TLKA 3L7LA 1UL1X 2VC2B 3I0NA 4FYYA 4FEYA 1WM1A 5IUKC 3Q7IA 3F7TA 2NUAB 5F3WB 1DI0A 4UULA 5E3JA 3VPSA 3B1FA 2R66A 3T9EA 1MIOA 3I01M 1G2QA 4WFBV 3MWJA 1II0A 4MUMA 1JDSA 2IV7A 1HNXO 1DX4A 3GEDA 4JN6B 4JJZA 2HSWA 3C7TA 4J7ZA 2IYLD 1W2WB 3KKMA 1DFGA 3OA0A 3ZK7A 2IYXA 1IK6A 4CH4A 3T1TA 1LFDB 2R2GA 1MG5A 2X4GA 3OM1A 3ID6C 2O48X 1ENOA 3AG3C 2HNKA 1KI6B 3TL2A 1LPOA 3KQPA 3I9FA 4W5NA 3LUHA 5D7NA 4TLLB 3U4QB 3I32A 1ONBA 1KBQA 3X1DA 5J58A 4F12A 4O0MA 3D6VA 1XA4A 4E4TA 3K92A 1JU4A 1RJEA 1BEZA 4EYQA 4D57A 4R2LA 4AJHA 3CVWA 2G82A 3TOXA 1PZNA 4CLOB 4ENTA 3SHQA 3IEUA 1P7PA 4R50A 2QKSA 2WW8A 4DG5A 3D1LA 2X42A 2ZUDA 2QXTA 2EP7A 3RU3A 1PJSA 4TXMA 4UEOA 1FUKA 1U2QA 3KEOA 4FMDB 1YVPA 5FTNA 1X7HA 5FORA 2I6GA 3GHHA 1YMQA 2ROQA 3HP1A 1C1HA 3H8WA 4V0RA 1YQTA 5NLLA 4B3FX 1WPRA 3WDSA 4AKSA 5BMVA 4AL4A 1K7YA 4OOEA 4WV3A 1PT5A 1ZGCA 3IPRA 2X7JA 4OSOA 2KLBA 3M49A 3QXGA 5FA5A 4RH3A 2HWUA 1RYHA 1FAFA 3CURA 3GN1A 2O7RA 3UM9A 2K2WA 2OCGA 3OHPA 3GGDA 1A98A 1M6YA 1DMRA 2V7BA 3FB5C 1ZESA 4PHZA 4CG1A 2XEDA 4A27A 4D9GA 5AW7A 5C9ZA 2ZR8A 2A9HA 2AQHA 1N36O 3UUGA 2IJIA 1VPWA 3M1AA 5LBQA 3F6EX 4AQ7A 4PIVA 5CB0A 2W93A 3ERCA 1XOIA 2JFFA 2J3KA 2ZYIA 4NLLA 1GPDG 1OLOA 5K0LA 3KOYA 5I45A 2QNBA 3GZ4A 5DM6V 5ARDA 3CUKA 3V1TC 4DIMA 3E8SA 1MO5A 2OV2A 2P78A 4OL9A 4BIZA 2BLLA 5E1OA 3RYIA 3JVVA 5CX4A 4EHJA 5J5AA 3AVYA 1Y1QA 1YIDA 3AR3A 4N3NA 4PS1A 2P0AA 5IWAB 3OE7A 1PFGA 3AR7A 2PVSA 4FT4A 1FB5A 1E1CA 2E5FA 1G8KA 2ZXWB 1EFUA 1B42A 2SCUB 1P7WA 4XYLA 4I3GA 4TLDA 1BCRA 3JSAA 5GZ1A 2CEKA 3BA9A 3ZDFA 2BJHA 4ZDKA 4Y1GA 1Z3IX 1JPXA 2Q6TA 3O4IA 5K4AA 1PJ2A 4YMUA 3ZD7A 2X9QA 1LBQA 2H4HA 2OBBA 4B3GA 1U7UA 3VM6A 2G1JA 2VPIA 1T4DA 1NBHA 1PSZA 2HF7A 3W9YA 3RAFC 2P65A 2XKKA 4KV7A 4URFA 5DBGA 1U4OA 1QANA 1XHEA 2G8NA 3KPYA 1QH1B 3RBXA 4TXJA 2JFQA 2ZITA 3EUAA 4EKEA 3LXRA 5LM3A 1AUPA 2V54A 2C77A 3O31A 4U7PB 3LFHA 4H7EA 2Q5OA 3G23A 1SUSA 1ORRA 1NSFA 4NMXB 2QX8A 3C70A 4Z2AA 3C3PA 4AX4A 5IXSA 3TZ6A 1TUEA 4JJ4A 1TF5A 1ULUA 2I7CA 3WFJA 4G81A 2ZQ5A 4XGQA 5A3SA 3SQLA 3ZQUA 4K05A 1JTEA 4BWFB 2A1IA 2VDQB 1EQAA 2HPAA 4Y6SA 2R9AA 4OBWA 1T9BA 4GUAA 5G4KB 3SR3A 1Y34E 2N3ZA 1JP7A 1Q8IA 5AIBA 4C7KA 1V1RB 3ZMSA 1HKHA 2VWQA 2BHSA 3Q4HB 3OE7D 5DOZA 3DO8A 1R74A 2Z8XA 4H7KA 3WLFA 3B1VA 1E6MA 3CUSA 4MTGA 1EFRG 4IJQA 3AHJA 2AF4C 5FDFA 1DRJA 1EBBA 4HWRA 1DAIA 4WE3A 1NC1A 2X5XA 3V7WA 4WZBE 5KHGA 1JXQA 1M1YA 4HC4A 3BH7A 3FBWA 5BW8A 1KOLA 4Y0NA 3BXPA 1RM5A 4CKXA 3N27A 1WHTA 4FQ8A 3VNQA 4DT1A 3C6YA 1T1GA 3JYNA 2VPWA 1EN4A 1N2HA 3EUEA 1T0JB 3DXZA 4MHSA 4A91A 5BWMA 1RRKA 4A2PA 5H70A 2WTMA 3LY5A 2FN7A 1DPFA 1ZC4A 2XAJA 4UJ5A 4REQB 3V55A 4S1PA 1GM8A 2R9VA 2X6TA 4RGBA 3IA7A 4F8EA 1BXKA 3WV4A 3IOYA 4D43A 5BYAA 2GSMB 2J9YB 3CC7V 4J1TC 3R5FA 1ANKA 2YWRA 3REGA 3TNFA 2G67A 3ZE6A 4PZPA 1JG6A 4UB8Z 5JYDA 4QYSA 3VYTB 3MRXA 3UA4A 1R6UA 1ISSA 4KPFC 4BTVA 2YIAA 3NOVA 4DXAA 5KQLA 1I24A 5I5GA 1KO7A 3WWCA 1FIUA 2FW8A 1VFNA 2I7VA 1YC2A 1HNZO 2PMCA 2QLTA 3AONB 4RV5A 3DUFA 3BIXA 4JT4A 1C3LA 1WG8A 3VAZA 2ZTHA 3WA6A 2WPNA 3DBRB 4ZOAA 1Z6GA 3DMTC 2PRSA 2GEKA 1RBYA 1C0LA 1W4LA 2XB8A 4JJ6A 5LYYA 4XLZA 3TNLA 3QJ5A 4V03A 4GM4A 4RVCA 4J03A 2J31A 2G76A 3CRAA 2Q5QA 4LC9A 3SFZA 1P6UA 2I7TA 2C7BA 4UNIA 4F91B 3FOEC 2GM5A 2I4NA 1GKUB 3ICVA 2JD1A 3B70A 4TGLA 2VNSA 3G8BA 1MC8A 4TV9A 4NCNA 4FZ5A 3RARA 3EVBA 5K8TA 2G70A 4OQXA 2EHDA 4KFMA 2RI6A 3ZV7A 1CULC 2HCTA 3MMSA 2IDZA 1XZLA 2GZDA 3DXXA 4J16C 2VYVD 4IOMA 4Q01A 4BATA 2NUAA 4TXHA 4O4IB 2VWPA 2W42A 1WUKS 5BSMA 3KXPA 2Q7EA 5DLQC 5KKAA 1DELA 4IKOA 4K1XA 1ODKA 3EZ7A 5F78A 4F3RA 2AYXA 2B1IA 1CR2A 4IMIB 3CU5A 4X95A 2GN0A 3OIUA 1W88B 5B7GA 1WLYA 3DTVD 3HRKA 3IPLA 4OIFA 3UK6A 1JQDA 4CVNA 1GSAA 1KI6A 2I4IA 3R3JA 2JL1A 3V6LA 1D7AA 4NENA 4AY3A 3W5BA 3LX8A 4OREX 5JCPA 1Z4KA 4V0QA 1H2ZA 4U9HS 4F1WA 3SJBA 4LJLA 2BFCB 3U4QA 1U2DC 5AI6A 3VPBA 2H3OA 1A77A 4R7ZA 1E5XA 1KC8W 3U0ZA 1D6SA 2C2OA 4H17A 4XDGA 2Y9MB 2C7OA 3UGKA 3VNUA 5K3DA 4LGCA 1FUYB 5C8ZA 2GD0A 2XCTB 2NXEA 1XMVA 4L9RA 5E4FA 1C81A 4CLOA 3L0SA 5ALMA 1N6LA 3PGMA 3JXEA 1XEXB 4IMJB 3L18A 4QAJA 4MKFA 5IH7A 2Q0OC 1M2WA 3DJYA 3LY9A 1UC8A 1N2BA 4UVCA 3AIMA 2BEVB 4Y9SA 4LZPA 4FPPA 4H77A 3SC2A 3WL8A 4ZVQA 1I4OA 1KKCA 1Y98A 1N6OA 5HCUA 4HJXA 4UTOA 5ALDA 3ZW8A 4R7CA 2RHTA 3N0RA 3UH1A 2V98A 1IY0A 4IX9A 2C92A 1F0NA 1XXHB 2UDPA 4PIPA 3IAYA 2WJPA 3G2QA 3FPLA 1QQBA 3DTNA 3M4NA 3CV3A 4BNYA 1P1CA 4ND1A 2VZ9A 4P7BA 1ZGJA 5HMMA 1W44A 1YCHA 2R87A 3KEFA 5DDIP 2Y27A 5FB3A 1XWIA 4I1IA 3JW8A 1VFPA 3HFSA 1XKXA 2EZOA 2PZ8A 3FHTA 1YI8A 3L0ZA 3HL4A 1C4WA 2ZREA 1HSOA 5FUBA 5IAGA 1PCXA 4J7UA 3T6KA 2C8KA 3OMXA 3WG7B 1WXWA 2O5VA 5B3JC 4HFNA 1KVSA 2D06A 1L6IA 2FUKA 5AW3A 4LGYA 3IP9A 1N2XA 2ZWOA 1GHTA 5HW0A 4J49A 3QKRB 4N4AA 3OM3B 1ADCA 2AW3A 2RIRA 1ZK4A 1LSUA 4UMDA 4GCZA 1XU9A 5EAIA 2ZE5A 3AI2A 4W82A 3IP7A 2AMFA 3OIFA 2ZOSA 5CUQA 2SCUA 2C98A 1TZJA 2UV8A 2Z09A 2KBEA 3A9TA 5G3YA 5T5QA 1QHHB 2G9NA 1KJYA 4N9WA 3NBAA 2QQ0A 1LH0A 4ITRC 3CT6A 3RGGA 4MGKR 3STZC 2I91A 3KQSA 2UZIR 5GIOE 1PEYA 3LAWA 1ID1A 1PQ4A 3C45A 4YNBA 2VTBA 2WKRA 5U9CA 3WKAA 1ZKMA 3I5UA 2B7CA 3NHKA 5AKIA 3NDRA 5B53A 2WJAA 2RCVA 2VRCA 1V8BA 5F2KA 3RDPA 3SC4A 3D1VA 4FFWA 2BAGA 3ONDA 5KX5B 4BVJA 3V4OA 4IZ6A 3W5HA 4LBVA 3MD0A 4EK9A 1QH1A 3TOVA 4D8YA 1FNCA 3P9XA 2JIZA 3MB8A 2HR1A 2W2PA 4B3SB 1H2BA 1U5BB 4GX5A 4H4DA 2R60A 1EDOA 3MUEA 3G1UA 4HEQA 3LIPA 2QGFA 4RBNA 4Y1EA 4EF4A 2NIPA 1YCGA 1XU4A 2OOKA 3VO1A 5G4KA 2OFWA 2X9NA 1VGVA 2C97A 4AI6A 1V1RA 2PYDA 1E9RA 3EX7C 4FCTA 2RH9B 2PTGA 3S2FA 3Q4HA 4OLFA 2WJ6A 4UBMA 1PKXA 1NF3A 1MTOA 1PD1A 4RYLA 2XVXA 1R4ZA 3P2MA 2GEVA 4LK2A 2QTBA 2CL5A 1ZCBA 3GMIA 1HQKA 1CUXA 1MPXA 4L07A 4O4HF 1TQ2A 1WUHS 4OMFG 3N05A 3A14A 2JF0A 4EJ6A 2CFTA 1NVFA 1HT3A 2Y1DA 4KBYA 1CDDA 2HADA 2C8LA 1AK1A 2OYQA 1SUEA 3THSA 3NDJA 3RQIA 2CLEB 1K4DC 3PQEA 1DCKA 4YRIA 1PVDA 4JK3A 2W0SA 2OAP1 3OAAD 4REQA 4N7MA 4KLCA 3HV2A 1N5KA 2JIZD 3LM8A 1Z45A 4P31A 3M82A 1UKVY 3V1YA 1E3LA 3QBEA 4MB0A 5ALNA 1MB0A 1Y37A 4LOIA 4A1OA 4JBHA 2CLDX 3UWDA 4Y8VA 1EZJA 1N2GA 4L8JA 1U7OA 4EYSA 1EUCA 1KEVA 3BQMB 3ZDQA 2KG7B 4IIDA 4MWOA 1I7LA 1JPVA 4US1R 3JWEA 2VCYA 3CWBH 3OLQA 4MI3A 3RAPR 2Z9CA 2HHHB 4MP6A 1TUBB 4GECA 3RSFA 4F3KA 1PDWA 3TSAA 3QQPA 3UMBA 2WF5A 4FBMA 4PCVA 1NXWA 1CQIB 3SS9X 5BRAA 1ZN9A 5B1HA 5AKXA 1N32O 3TTTA 1GQQA 4CLEA 4MS1B 2OECA 4WADA 2P4HX 3ZQKA 3JD3A 1Q0UA 4B82A 1XFDA 3KDPA 4RE6A 4CMKA 3DBRA 3ZU2A 1J97A 5DM60 4Z8XA 3SXUB 4EHNA 4DLAA 5HIMA 2OV1A 3BWCA 2ASEA 4M1ZA 2FK7A 1QIMA 4MTLA 2XOKG 2XI4A 4OLHA 1EVJA 4J90A 4INJA 4OATA 2H08A 2HAEA 4QHTA 2BGUA 3I6ZA 2XZPA 3O8OB 5DGTA 2IHYA 5JBQA 2GHQA 1BX1A 3LKZA 4PYLA 4WD3A 4HZUB 2X0DA 4PG4A 1LPMA 2E4AA 1YVRA 1SOVA 4AIIA 3UK7A 1WCXA 1MEEA 2O8VA 1P9WA 4A4DA 2QLJA 2CYAA 2F3SA 4PICA 3GVHA 4JB8A 2AG1A 3EXHC 2WWYA 3Q0EA 4HVCA 3G5AA 1EX6A 1VPVA 4XLTA 2WTUA 1DKNA 1LZLA 4O4IA 1J25A 4PAWA 2F1RA 3BTOA 1EK6A 1KETA 2CLSA 4ND2A 4AM8A 2P9YA 1QTQA 4LHEA 1S2NA 4XQCA 2JHGA 5HQJA 4NEHB 4UARA 2FE4A 3ZNQA 4LMAA 3W8DA 4PC1A 3OQ6A 3H2BA 3T9BA 1W88A 2FK8A 2PQ2A 3JQFA 1F7VA 2BF7A 3O90A 1I5XA 4ZCMA 1UBUS 2WYHA 2ET6A 3FB4A 5SY9A 4YO7A 1CR1A 4GLBA 3B3AA 3OT4A 3B78A 4ZQHA 3UAXA 2HMUA 4RTLA 2WPDG 3LWDA 1E59A 3NWOA 1VQ7V 5JEDA 2FPGB 1O6BA 2C7VA 2HCJB 2RHLA 1AT1A 1SKQA 5I3CA 2JEUA 1R3IC 2AI1A 3OZTA 5BR8B 1EGAA 3KOMA 3GLHE 4S12A 3Q9UA 3L1IA 4CHGA 2B9EA 1PQPA 2O2YA 4X60A 6GPBA 3BCRA 1ISRA 1CB7A 3OY7A 3SICE 3B7WA 3GRCA 4QPZA 5TQ2B 1KRWA 5B1AB 3ESAA 2AFIB 3EEYA 4BX3A 1PGQA 5FHRA 2PUSA 4D0RA 3LD9A 2DYKA 1XEXA 3LYUA 4QEZA 1HYBA 4RKRA 2J32A 4LY0A 4XPZA 1PNTA 2BEVA 1K5HA 1IBKO 3UAZA 3LE8A 3OD5A 4B2IA 3V32A 5KYXB 5IWAO 1L9XA 1HNXB 1SC3A 4RY9A 1XXHA 4PQFA 2P9BA 3HCAA 5BORA 3A6DA 5K2OA 4XBFA 3QKUA 1DO2A 4EG6A 4L6IA 3AL2A 2FSGA 3W34A 2WIBA 4ER3A 1K5GA 4P8RA 4RAOA 1G6UA 4D79A 1GFSA 4M7PA 1W2GA 5TVKA 2IJGX 4Q3KA 4CKZA 3C6BA 5IHPA 3ZMZA 2IZ0A 1ENPA 1NVTA 1V41E 1RP1A 3QXXA 3TSCA 3OE1A 3PIRA 3AB8A 4D4HA 1DRWA 5T67A