2O57A

Crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
282
structure length
282
Chain Sequence
SKTVKDNAEIYYDDDDSDRFYFHVWGGEDIHVGLYKEPVDQDEIREASLRTDEWLASELAMTGVLQRQAKGLDLGAGYGGAARFLVRKFGVSIDCLNIAPVQNKRNEEYNNQAGLADNITVKYGSFLEIPCEDNSYDFIWSQDAFLHSPDKLKVFQECARVLKPRGVMAITDPMKEDGIDKSSIQPILDRIKLHDMGSLGLYRSLAKECGLVTLRTFSRPDSLVHHYSKVKAELIKRSSEIASFCSPEFQANMKRGLEHWIEGGRAGKLTWGGMLFRKSDKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative sarcosine dimethylglycine methyltransferase
publication title Crystal Structure of a putative sarcosine dimethylglycine methyltransferase from Galdieria sulphuraria
rcsb
source organism Galdieria sulphuraria
total genus 106
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.840 Mainly Alpha Orthogonal Bundle Helix Hairpins Mycolic acid cyclopropane synthase domain like 2o57A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2o57A02
4ER0A 2IH2A 2XVMA 2OZVA 3UJCA 4F86A 5HIMA 4M7RA 3EVEA 3LHDA 3MAGA 5FWDA 5FTWA 2AN5A 2OB2A 3MB5A 5D1HA 3SMQA 4CXMA 1ORIA 5HIJA 3M4XA 5CVVA 5K0GA 5GP1A 5K0EA 2P40A 3PFGA 2NYUA 4EQZA 2O0LA 1N7IA 4HH4A 5BW5A 3KHKA 4E2XA 1O9GA 2AOTA 4G56A 2P7IA 3ER9A 2IBTA 4GBED 2B2CA 3K6RA 5GINE 2PX8A 4PYLA 3KPWA 2UYCA 2YTZA 5CCXA 2V74B 1KYWA 4PCAA 5HILA 5DPMA 5K01A 4BLUA 2EX4A 5T67A 4DQ0A 2N47A 4KRGA 2K4MA 3UJAA 3FPGA 2XYVA 3QOXA 2Q41A 2Z6UA 3FUWA 3EGIA 3EEOA 2HV9A 3DXZA 4DA4A 2VDVE 3Q87B 4KWCA 5GWXA 5MHTA 3P8ZA 4V0RA 5K05A 3LCVB 1L3IA 3KPUA 3TR6A 3BZBA 3OZSA 3G2MA 2BM8A 3DXYA 3P2KA 4O29A 5DTQA 4WVLA 5GIPE 2OO3A 2NP7A 4YV0A 3QV2A 1INLA 2R3SA 1FP2A 2PXAA 4V0QA 1G8SA 1PRYA 4CTKA 3TKYA 5DM2A 2AS0A 5E2AA 3TMAA 4RVHA 1Q0TA 3HCBA 1XCJA 2QYOA 3M6VA 4PYOA 4RVGA 5GM1A 2ZIGA 3RODA 1ZGAA 3TM4A 1BHJA 1BKYA 4FSDA 5U4XA 5CD1A 2NXNA 4ZTBA 2UZ4A 3UJ6A 4EKGA 4ER7A 3FYDA 4MIKA 2HMYB 4U7TB 5P8WA 2FRXA 4B17A 1QAOA 5LQCA 4MQ4A 4P7JA 4YUYA 5KQSA 3DXXA 4X1OA 5DSXA 3NVMB 1UIRA 3C0KA 3KQWA 4HC4A 3OPNA 3A7DA 3KR1A 4PINA 1BC5A 2ORED 3UJ9A 2I62A 2XVAA 2PX2A 2IPXA 3E23A 2OKCA 1RI3A 5F2KA 1SQFA 1VLMA 1ORHA 4GEKA 3MCZA 1MHTA 5F2OA 4PONA 1SQGA 2UYOA 4HGYA 5ERGB 5LQUA 5B1SA 5DXAA 3FTCA 2H11A 2B9EA 2HNKA 1L3BA 3BWYA 5CVUA 3SGLA 3D2LA 3PT9A 2JJQA 3NWEA 3F4KA 1R8XA 3FTEA 3G8BA 2IH5A 3CCFA 3A27A 1NKVA 3OU2A 5KYGA 3MERA 1VBFA 2UYQA 2ZSUA 3HCEA 4GF5A 4WXHA 5GOZA 4OBXA 5DWQA 5E1OA 2AN3A 5T64A 4YUZA 1YB2A 3BGIA 1ZKDA 3FPJA 4C08A 3HEMA 4CTJA 4E70A 2P8JA 3KQOA 4Y2HA 5CUQA 4RSRA 1KPIA 4AZSA 1NBIA 5DRTA 2VZ9A 5JUWA 1N2XA 2WK1A 5EIWA 5CM2Z 4X63A 2GH1A 2QY6A 1X1CA 3IYLW 5FADA 3VYWA 5FUBA 4C03A 2CMHA 4BP3A 3GWZA 3LGAA 4P58A 4DF3A 3DULA 3KQQA 2AOUB 1RJEA 2O07A 5K0JA 4L7VA 3UZUA 2PY6A 1YF3A 3MTEA 3EVCA 4LG1A 3ER8A 1IY9A 1L1EA 5KVAA 2P3QA 1NW5A 4QTTB 5EEGA 2PX5A 5EQJB 3EMDA 3PS9A 1MJFA 3RIEA 4KIGA 5FCDA 2ZBRA 1WXWA 3C6KA 4BY9E 3GRYA 3FPFA 3H2BA 3DLCA 3L8DA 3LKDA 2C7PA 3BKXA 1KXZA 3GCZA 4MTLA 3E8SA 10MHA 1RJDA 3PX2A 5EHGA 1P1CA 2IP2A 5EMMA 3REOA 4RTLA 1YZ3A 2F8LA 3R3HA 2QE6A 2KW5A 4PYMA 3P9IA 4MWZA 3NVKI 3KU1A 4RTPA 3GDHA 2FYTA 3I9FA 4QDJA 2WA1A 1P39A 3DR5A 2AOTB 4PIPA 1VIDA 1ZGJA 3B3JA 5FWAA 1NE2A 4C06A 1O54A 3VC2A 3UA3A 3EVFA 1T43A 1G60A 2ZWAA 2O05A 4RTOA 4IKPA 3P71T 1M6EX 1IM8A 3UA4A 3HCAA 5K0LA 5LQKA 3KR0A 2YQZA 5EZSA 4GUAA 4GOLD 2ONYA 2VS1A 4M38A 1XTPA 1SKMA 3O31A 4FZVA 4QDKA 2B3TA 3PVCA 3M6WA 2ZZMA 3OCJA 4HTFB 1AQIA 3G8AA 2NXEA 3MTIA 4E30A 1AV6A 1KHHA 4RTSA 3DMFA 3TPZA 4YUVA 2OB1A 3HCDA 4LWPA 3U81A 4DKJA 2LD4A 2ZZKA 4FS8A 4A6DA 2I7CA 3LCCA 2NNWB 4R6WA 1WS6A 4X61A 3EGEA 2BH2A 2BR5A 3T7TA 5K09A 4CKCA 1NW3A 3V8VA 3KQYA 1EAMA 3HVIA 4PYIA 2ZZNA 2IDJA 2G70A 3OU7A 3B3GA 2AVDA 3BWMA 2H1RA 3EVAA 3GO4A 3TQSA 2WA2A 3EEYA 4K6MA 4M37A 2AOWA 5E9QA 4FP9A 3T7SA 3R9XB 3CJTA 2AOXA 3B5IA 1TW3A 3M6UA 2AR0A 2PT9A 1P1BA 3Q7EA 3R6TA 4EK9A 3IHTA 2CWWA 4NECA 4Z2YA 4C4AA 1JG1A 1QZZA 4R8RA 3FUXA 1RI1A 1WY7A 1X1DA 3C6MA 3G7UA 1EIZA 5K0NA 1SUIA 3DUWA 4QQKA 4RTMA 3OE4A 3QOWA 4XUDA 1JG4A 4A6EA 2PXXA 1G6Q1 5EIFA 1UFKA 1Z3CA 3FYCA 2Z6AA 4FSXA 3GRZA 4FT2A 4PNEA 3LBFA 2OBFA 1JG3A 9MHTA 3PLAE 3G89A 3LBYA 4GQBA 2GA9A 5FA5A 4C05A 2PJDA 5EC8A 2DULA 2P3LA 2PWPA 2OXTA 2FCAA 2O57A 1DCTA 1QYRA 3KR9A 2ONZA 3P2IA 2YXLA 4E33A 2PVCA 5CIYA 4RX1A 1FBNA 4KIFA 5DM1A 1YFJA 4QVGA 3CC8A 3HM2A 1XJ5A 5T6BA 1X1AA 3LDFA 3IV6A 4HGZA 3KPYA 1RI2A 1JR4A 3LCUA 4R8SA 3I53A 4KDCA 5DTMA 5BW4A 4EMSA 5FHQA 3FUUA 2YUIA 3MCTA 5EOVA 4BLVA 4ER3A 5F2NA 4YV1A 5IKMA 3BT7A 3EGVA 2H00A 3OE5A 4E2YA 2UYHA 2B78A 5K0FA 4RYLA 3GIWA 4YUXA 5K03A 3V97A 2PX4A 2JHPA 3SSNA 1JG2A 3KQMA 2CKDA 5JR3A 1D2CA 4IV0A 4OQDA 2I6GA 2E5WA 3I58A 1RJGA 1EG2A 4M36A 1QAMA 2PLWA 4RV9A 3TM5A 4AZWA 3CJQA 1XDUA 3FPHA 4Y30A 3SR4A 3FUVA 3DP7A 3G2PA 4X60A 4E2WA 4QTUB 5GM2A 5E2BA 1NBHA 1G8AA 1JTFA 2CMGA 3DLIA 3LX6A 3HA5A 3HA3A 2XYRA 5DXJA 3T7RA 3I64A 4PIMA 2GB4A 1O9HA 2FHPA 4ER6A 3A4TA 2ZBQA 4PCLA 2ZIFA 3HVKA 2EJUA 4OQEA 3ERCA 2QM3A 2ESRA 1NV8A 3LKZA 3P9NA 2IH4A 4MHTA 2G72A 1I4WA 2FK8A 3GXOA 3ID6C 5LQNA 1ZG3A 2ZCJA 3GJYA 5DRYA 2CL5A 4RTRA 1VP9A 2P1DA 4JXJA 4QVKA 3A26A 1RI4A 2B25A 5FHRA 4ISCA 2QRVA 3AXTA 4PYQA 3TKAA 2VP3A 3A25A 3NW9A 5EVJA 4RTJA 1G38A 2JG3A 4AZTA 5E9JA 5K0CA 3HVJA 3ELWA 3RW9A 3SM3A 2I9KA 4H0NA 5CVJA 1DL5A 1VP3A 4PYJA 8MHTA 4P7FA 4GC9A 2GPYA 3ELYA 3AY0A 1HNNA 2BR3A 2PV0A 1VQ1A 2IFTA 3PFHA 5E1BA 3HCCA 2OPBA 3G5LA 3O7WA 1TW2A 2ZW9A 4LECA 3CGGA 1IXKA 2YXEA 1KIAA 2G8NA 3M6XA 3TRKA 1R18A 5E1DA 2AOUA 3ELUA 4OBWA 4R05A 3BXOA 3T0IA 3X0DA 2C7OA 1KPHA 2Z6QA 2ZIEA 3UBTA 2NXCA 5M5BA 3JWGA 1D2GA 1QAQA 5HOQA 4E2ZA 5EG5A 4C04A 4F85A 1JQEA 3CKKA 5EGSA 2HR1A 3HTXA 2IIPA 2R6ZA 4DM3A 3LECA 3G5TA 2EFJA 4ATNA 2AOVA 2JH9A 3EVGA 1XXLA 1YZHA 4F84A 2BZGA 1NW6A 3G88A 1AF7A 2NP6A 1NT2A 5DX1A 5EPEA 2PGXA 2PWYA 4PGGA 1U2ZA 4QPPA 3KKZA 4KDRA 5EMLA 5EZQA 4C07A 5LQJA 4EVIA 1OR8A 5FA8A 1WXXA 3B89A 5HIKA 1SVUA 3NMUF 5KS2A 2XBMA 3OZTA 3MQ2A 3SSMA 1EQAA 3KPVA 4LWOA 5FQOA 4DCMA 1AQJA 3BUSA 4PYKA 2BR4A 3DH0A 3EVDA 3LDGA 3OFKA 4R6XA 3BWCA 4HRAA 5DTRA 3FTFA 5CVEA 3M70A 5HFJA 1JQ3A 4P7KA 3GNLA 1TPYA 1NW8A 2ZTHA 3UJ8A 5ICGA 5C9ZA 2EG5A 1V39A 3NTVA 2GLUA 3K0BA 1I9GA 3SXJA 4E32A 5CCBA 2C7QA 5K8VA 4AX8A 4IWNA 2ZLBA 3HA7A 3MGGA 4XUEA 4UOEA 3AXSA 4OA5A 5DSTA 1L3CA 1L9KA 2NXJA 3LDUA 4QQNA 5KQRA 3G2OA 4XUCA 3ORHA 1VE3A 5EMKA 2OYRA 2EJTA 1YFLA 2FK7A 1EJ0A 3DTNA 3LSTA 1PJZA 5E8RA 3NDIA 3G2QA 4HSGA 4HTFA 2C7RA 1RJFA 1P91A 2IDKA 4XCXA 3LPMA 5G02A 1RI5A 1KPGA 1XCLA 2FPOA 2YX1A 3SX0A 5DT2A 1JSXA 3DOUA 2VDUE 3I5UA 5HIIA 2ERCA 3VC1A 3PB3A 4YUWA 1JTEA 5E1MA 4KVZA 3EMBA 4EKIA 4RTNA 1X1BA 2ZBPA 2HTEA 3E7PA 1YUBA 4YMGA 3KPJA 3KQSA 5EEHA 3BGVA 1JSZA 1R74A 5FQNA 1FJXA 1F38A 5LQRA 4OX9Y 4AUKA 3TFWA 2O06A 3GRUA 2Y1XA 3DMHA 4X41A 1B42A 2OY0A 2ZFUA 3HCFA 4GOOD 4CKBA 4E31A 1BOOA 5LQAA 5LR6A 1R8YA 4OA8A 2VDWA 2XYQA 2YR0A 1R6AA 3TLJA 1DUSA 1HMYA 5EHIA 4DZRA 2G71A 2P7HA 3GRRA 5E9WA 1D2HA 3GU3A 1M0EA 3CBGA 3AJDA 2P35A 2JHCA 2HWKA 3LL7A 3O4FA 1ZQ9A 3VSEA 3BKWA 3UJ7A 3MHTA 1SG9A 1JQDA 4FR0A 1I1NA 4KW7A 1NV9A 3FPEA 1KYZA 5EMJA 2V7EA 5BP7A 4ER5A 3OZRA 1R00A 1EJ6A 2P3OA 5BXYA 4GOMD 4DCGA 5HZMA 2QRVB 3KQTA 4RVDA 3THSA 3NJRA 5D1NA 3PTAA 1XVAA 3HP7A 3TOSA 4YMHA 3P9CA 5C0OE 1N7JA 4P7GA 3UFBA 1X19A 3OFJA 4PGHA 4U7PB 4POOA 3M33A 2GAFA 1WG8A 3B7PA 3FUTA 5DLYA 3JWHA 4RTKA 1QANA 5DM0A 5ICFA 2PT6A 5DX8A 3UWPA 4FT4A 4FGZA 1M6YA 5C1IA 3KR2A 5DM4A 2ZWVA 3P9KA 5LSAA 2G1PA 1H1DA 5IH3A 3PX3A 3JWIA 1G55A 5FULA 2JH8A 2PBFA 3GRVA 5DX0A 2AN4A 3NDJA 1XDZA 3C3YA 4RWZA 1NW7A 2BM9A 3ME5A 4GOND 4DMGA 1F3LA 1FPQA 7MHTA 3GGDA 4BP1A 2AZTA 1Y8CA 2ADMA 3HVHA 3KQPA 2GS9A 5EKUA 3P97A 3FRIA 4AZVA 3BWBA 3ELDA 3S68A 3SVZA 1WZNA 2JHAA 3AWIA 3FTDA 4RTQA 3ANXA 3A7EA 3R24A 5ICCA 3E05A 4PWYA 2PKWA 5H02A 3THRA 1FP1D 5GIOE 4YV2A 3FRHA 2DPMA 5ICEA 2ZULA 2YXDA 5HEKA 4CKEA 3B3FA 1UWVA 4HG2A 3EVZA 1SUSA 3FZGA 5K0BA 1KR5A 4CWAA 2P41A 2PSSA 3DMGA 3IEIA 3OU6A 3P2EA 5CVDA 3UJDA 4IV8A 4BLWA 2A14A 3NWBA 4GC5A 2ZVJA 2AVNA 1ZHFA 3C3PA 3EPPA 3CJRA 5E8JA 3SSOA 4PYNA 3WSTA 1XDSA 2Y1WA 2IGTA 2PXCA 3EVBA 3JWJA 3KQVA 2YVLA 1VL5A 3R0QA 4RVFA 5EKXA 3UJBA 3HNRA 1Q0SA 3CVOA 1VPTA 4QPNA 1KP9A 3BGDA 2IBSA
chains in the Genus database with same CATH superfamily
4PLWA 3TGWA 1QHHA 1MVOA 4RLHA 1YHZA 3OQMA 5D1HA 3RVRA 4FYVA 2V9CA 4OXRA 4CR7A 4FD2A 2P22C 1PNRA 2YIBD 4BQRA 1W9HA 2VEOA 4LAFA 1O94D 2X0FA 2VKTA 2ZSDA 1OXBB 3DBOB 3SZUA 5DO9A 3UMRA 2J6CA 4YCAA 2R9AA 2XT9A 4CTKA 4RJTA 3K3PA 3ZQ4A 1J33A 2VAMA 2BTQA 4Q3BA 4BQFA 2LJ2A 3SF0A 1EE2A 4Y1GA 3I2HA 1GKYA 3HGQA 3OF5A 1NUUA 4AMGA 2F3RA 5C53B 1BGYH 1FP4B 1N9KA 2OVBA 5DEOA 1VM6A 2Z3WA 3L6OO 3ZRWB 5HVNA 4BLPA 1NASA 5FOSA 4DT1B 1CZLA 4BX3A 1YB2A 5EZYB 1U7TA 3Q8XB 4J0FA 1RKVA 3QPDA 4P32A 2JASA 1T8PA 4M9SA 1CRQA 3MTEA 1TYAE 4PZAA 2Q9LA 3ZIAA 2HWYA 4U8HA 3P5BA 2G5GX 1ULUA 2ST1A 3CRZA 4UBMA 3FNEA 4EB6A 3MYYA 2QTOA 5BUSA 5TVKA 3T6KA 3G2LA 4GYKA 2JLRA 1ZRNA 4LKOA 2O8NA 2J8ZA 3NHAA 4IDOA 1VLJA 3ZVNA 4PX9A 2A1TR 4LK3A 1OT5A 4HKTA 4WW0A 3H19A 1V26A 2OFXA 2IXAA 3N7UA 4ZQEA 4UC0A 4TWZA 4DVGA 5JC8A 3U16A 1WY7A 4XLZA 4PVDA 2A3NA 3REFA 2EERA 2EV9A 3SVTA 4IOJA 2XHZA 4AF6A 4YDHB 3JX9A 3EDYA 2B36A 4HGOA 1G8YA 5JD4A 4AURA 1JR3A 4LVNA 4OQNA 1P6XA 1F23A 2DR3A 2FWAA 3OUUA 1B76A 3L9WA 5FHQA 4X90A 4YHBA 2C20A 3IJ4A 5HP4A 4GR4A 1VJ0A 3CBQA 2R7KA 5K0FA 5IWAB 2ZUVA 4P08A 4V2IA 5A5FA 5EMHA 2OTLV 3FVVA 2ECQA 1E4OA 3U3MA 2CV1A 3IA2A 2QZPA 2H1FA 5KHKA 1IK4A 4AD8A 3F71A 4CM8A 3WMEA 1H6AA 3R8CA 4LNHA 5K8JB 2ZCJA 4TKLA 3I12A 1Z5ZA 1JFRA 4PQGA 5DNVA 3EDOA 2GYUA 2D1FA 3CLSC 3BFXA 3HBAA 3LBAA 3D31A 3FB1A 1LQUA 5ENZA 5CEEA 3PDHA 2VQEB 1TW2A 2OAQ1 3A4MA 1GNPA 3O7MA 2NXCA 2BEVB 1J00A 4JT8A 5KNCH 4PLHA 1FW8A 4HGRA 3T3IA 5AK3A 3GFVA 1DMRA 4PAOA 2YYAA 3D2AA 5DHRA 3TRDA 4KDRA 3BA9A 1P1RA 5KS2A 3IIEA 4OD0A 4DRXB 4WT7A 3BF8A 1RHUA 1VA5A 3RE1A 2HHAA 3SXJA 4F5EA 2AE1A 4L95C 1N8KA 3E5NA 1BS2A 4ZQGA 1I9CA 1NLUA 2BRUC 1I4TD 4BQSA 4DFDA 5HQTA 3DMHA 1PTJC 5KWIA 1R6AA 1CUXA 4ZT2A 4OJKA 3H8JA 3LP8A 1N4AA 4OI2A 2AX4A 4CMGA 3JVUA 5BSKA 4KUHA 1D1SA 3RSCA 1ENYA 5ALGA 2VZ8A 1ACLA 1SRRA 2GEDA 4Y2SA 2FTKE 1DJLA 6AT1A 3CLUD 3WK7A 2ZAYA 1SKUA 3C3SA 3KLOA 1OSNA 1UWVA 1WKVA 5K0BA 3KXDA 1KQOA 3OD1A 1DAPA 1L5HB 2WIFA 4Y7DA 4TKVA 1G3UA 3EVBA 2CBXA 1OCZB 4X3PA 1EVQA 3TX2A 1FNSA 4TTPA 4ZAXA 2DTXA 1N5RA 3TZEA 4IOKA 4B6RA 3MB5A 4MGHA 3G6WA 5J1SB 1JHZA 1MA3A 4EZEA 4M9ZA 4S04A 4AQYO 4QOGA 3A10A 4NG5A 4MVJI 4LK2A 1ESEA 4PPQA 3AEYA 3KPUA 4HAOA 6PFKA 4X7PA 3U5ZB 4IVNA 4UATA 2R8PA 4XQEA 1F48A 3Q10A 4MTOA 5D3ZA 2NXNA 4O1IA 2EZ4A 1LX7A 1QBZA 1RPJA 1ONOA 2KQUA 1OV9A 3HEBA 5CJPA 3KZOA 1KRXA 5FR1A 1N7HA 4O8CA 3MEQA 4IRUB 3EXEA 1ZL0A 3TDNA 4D9MA 2HPVA 1XNJA 1OU4A 1L3BA 3C74A 5IFKA 5EBMC 1WHSB 2B8JA 2C5FA 5DBGA 2CT8A 4R8LA 5T4FA 1Q7RA 3HV0A 3R76A 4AZSA 3S2EA 1FYVA 3EWNA 3D0KA 5JWPA 1GAEO 3OX2A 2GF9A 3OCZA 5K8CA 3ZMVA 3VNQA 5FCDA 2Q21A 3N6XA 2O19A 3S6JA 2JIZA 1RW4A 4LDNA 4P7BA 3T1YB 1ZH2A 1M90W 3DZCA 5AM2A 4KXRA 2J6IA 5FO0A 5KREA 3VQYA 1NW4A 1KUQA 4IXTA 5CA1B 2RH5A 2WLLA 4HTFB 1ORTA 3MBIA 2QP4A 3IT2A 5DLDA 1V8ZA 1SKBA 3JAKA 2R84A 2C61A 2C1EA 3DE1X 4WJLA 2X8AA 1TTQB 1A9OA 1UFKA 3VBBA 3FSEA 2ZE8A 5IBRA 2PMDA 2PJDA 1BDJA 3OR7C 4RPLA 5JECA 4GOJA 3FF4A 4P4TA 1NZDA 5DM1A 4BGIA 4M0DA 1GADO 1RS0A 3NHBA 3UCEA 4KUGA 4PAQA 1Z6TA 1KJ9A 5GW7A 1PVVA 4LWSB 2EIJB 2OYCA 4X9QA 2ATEA 3OKCA 2FR8A 1F12A 2PLWA 3NBUA 4D6YA 2AG8A 3LXMA 2HGZA 2P79A 4MRVA 4NWIA 3OTOB 4CT4B 2BKLA 5IAJA 4JI8B 1I13A 3S8YA 1BDIA 4CGZA 1DXHA 4YRJA 5FX2A 3LT5A 2GJ9A 3PZRA 4EDHA 3KU4A 5AI0A 4IGIA 2Z0MA 1Q1ZA 2PGOA 4PN7A 5C4MA 5AI9A 4MQ6A 2HHCA 4NH0A 3HYSA 1W5SA 5L3BA 5FEMA 1RIFA 2PGXA 3O26A 3VQVA 2QMEA 2WFLA 3DMTC 5SY4A 2V1XA 1HL7A 2WD8A 4H33A 1Z15A 1PJ4A 4J1TC 4MJ7A 5HKKD 3AY7A 3DHNA 2EG5A 3VM6A 4EF6A 1YRBA 4OA5A 4NBKA 3LSTA 5IYDO 1H23A 3GVHA 3DJFA 1DE0A 1Y82A 1OJLA 3DOUA 1XA3A 3IAS6 3UT5A 3AUAA 3ZK9A 5EEHA 1IZYA 2WP0A 2XOKD 2PS0A 2GETA 1FMTA 4WY2A 2C8KA 4UBKA 2GN1A 3GJ3A 2WU3A 4RVDA 4ERXA 3NC0C 4C88A 1T8TA 1E61A 4YMWA 1I4DD 2GZHA 5AOBA 3DOOA 3M1YA 4RCYA 4GOND 2QQFA 2OQRA 4BP1A 2ON6A 4ZIRB 4OXYA 1WP8A 1R9JA 3BCUA 2BJHA 3SHFA 4RESA 3PTZA 1SETA 4WK0B 3A7EA 4FFPA 4QGSA 2GNAA 2ZRAA 5IZ4A 4P0PB 5G0UA 3ACBA 1ZEJA 3ITDA 3RVQA 3VNAA 3C8HA 2QDXA 4M89A 3P2YA 3HYRA 1Z5PA 2QD4A 5KYUB 2Y99A 3KC2A 4PAWA 4BGVA 2XR1A 2C7VA 2VNSA 2WY2D 4JI6O 3BRWD 1XQYA 2Z6UA 1GGJA 1CUZA 4GMHA 4RDXA 1CZUA 5CBGA 1ZI6A 4KK3A 1OGIA 4PR3A 3KTOA 1A9SA 1KKLA 5A2GA 4LZJA 5GIPE 1RJ9B 1O96B 2CMFA 1WUHS 4MW9A 1BKYA 1FPOA 4OCZA 1KHTA 4YUYA 3HVUA 1G6OA 3OESA 1KZ6A 1MV8A 2ORED 3LQRA 1OXTA 3F1KA 1ORHA 1NOIA 2GESA 5DHFA 3Q12A 4BIIA 4LX0A 4JK3A 4B6OA 2N0SA 2LPMA 1ZNYA 2JA2A 2ZI3A 2B1GA 1NW9B 4ZYYA 3QPBA 4NKRA 5F78A 1ZKDA 1AM4D 3ASVA 1WB5A 3ZD6A 1JXAA 2RH8A 1OCRC 4PX2A 2QY6A 1U1IA 1QF9A 2H7VA 4JGGA 4K1LA 1SVLA 3WG7C 4ABMA 2A33A 2PUVA 4DCSA 2CGEA 3KSMA 3UHOA 1BAPA 1YH3A 2F00A 1DBVO 2ZYTX 3EXIB 4NBLA 4KX5A 4JZYA 1RE0A 4FCCA 1NVVQ 2V4DA 1O54A 4E03A 1WUYA 2HMWA 2R72A 3JRXA 1F4NA 4TWJA 3L4BA 4HUTA 3N87A 5LB2A 2PJUA 3QYAA 4B3JA 4OHUA 4JJ8A 3AF2A 1K5PA 1E2UA 4IDNA 3T7TA 3ABUA 1DEHA 4PYIA 4LJ6A 4BLRA 4UM7A 4BBPA 1BYUA 1XTBA 4U3JB 3C3MA 2CNOA 4G1MB 4W5RA 2WQZA 1AQUA 1KZ7B 4ZVRA 4EI7A 3E8GA 3AEQA 3RREA 3KPYA 1XZ8A 3ADKA 4XRRA 1OZFA 4BLVA 3PWKA 2QAIA 1CUSA 2R5WA 3ZHTA 1NPTO 3NWOA 3CEMA 2GN2A 4JCOA 5K8IA 5JU6A 2XUIA 1MMMA 2Y05A 3B6MA 4F3KA 3T7RA 1SQXH 1KVSA 3OJ0A 5HW0A 2QM3A 4DC0A 2ZVPX 1TM2A 4Q4HA 3CUWA 2Z56A 9GPBA 4QUAA 1OXUA 3OZEA 2E1RA 1UF9A 3KZIZ 4OGKA 2IYZA 3TL6A 4Q15A 3WZLA 1JU4A 1HXHA 3LDHA 4UUAA 4JAAA 3AFHA 1OA1A 2DJIA 4KGVA 4JS0A 1YB7A 3NOVA 2P77A 2X4LA 3EIHA 3QRWA 4POAA 1WTCA 3SZRA 2ZUFA 1KZ9A 5FBWB 3E83A 5FA8A 3OT1A 2X0KA 4RPGA 3ZHOA 1EX6A 3BF7A 1ANKA 5DTRA 4EI9A 2ECKA 1Z6GA 1TPYA 4UTNA 3R7BA 2IUFA 5KB3A 1QZ3A 1TECE 1VHQA 2W0SA 1N34O 4Y3UA 5FYQA 2WLIA 5ETJA 3GPDG 1C1XB 3CCMV 1FQJA 3FX7A 1H94A 1SXGA 1ISFA 1MW8X 1UFIA 3B6ZA 3TQQA 1IAVA 2GCEA 1IY0A 1NXPA 3B51X 5KC9A 1CZHA 3PTAA 4D6TH 4DNFA 4QGAA 1V7CA 4PGHA 1T8WA 4RTKA 4MI6A 3BMNB 3D1VA 4AX4A 4BV8A 3T4UA 2FUCA 2VA9A 4IZ6A 2KLHA 4ZCMA 3B1FA 4U1RA 3QENA 1ORVA 2BN4A 1M34A 3CCLV 3WOHA 2P0EA 2P7TC 1EQUA 4ZFNA 1I7PA 5TQVA 4LZNA 1LPSA 5LMNB 3HNRA 3TR6A 2FPRA 3DBHA 1WXEA 3I9JA 3SP1A 1M1NB 1W44A 3AVYA 1ZY2A 1NVEA 3GQBA 4G56A 5KWEA 5JZBA 3NBYC 5KNDA 4BW9A 1PLLA 5KX5A 4DV4O 1V47A 1XV5A 4ZBMA 1L5YA 2VBCA 5CM9C 1B4DA 4Y2PA 4PLGA 1ZN8A 1PI3A 3ZZ1A 3C5EA 4UXIA 4KVGA 3GT7A 2GTSA 3DLPX 3IAM1 3H2SA 2V7UA 4EGFA 1B1CA 2ZE5A 2GFHA 2BGNA 1GTMA 2A6PA 3D8HA 1ZH8A 3K8OE 3RKSA 1H2LA 1T6BY 3QVUA 5DOZA 2WIKA 4G36A 2FPKA 4B4WA 2DPGA 3OWXA 5IS2A 1PGOA 2ICAA 4WASA 3CCVV 1F0YA 4MQ5A 3GB9A 4K40A 5CUQA 3TLEA 4RSRA 2WU8A 3MD9A 5H80A 2IYFA 3GWZA 1RLIA 4P58A 3ZY4A 1RPOA 1YVWA 3NRCA 4EI8A 2G8LA 2VP4A 1GUYA 4UZSA 3W1VA 2WWRA 4B9EA 1QGUA 1F2VA 2JFOA 3K5PA 1I14A 4EBBA 3ROMA 2D8AA 4RGYA 2VRNA 4Y6GB 5LQKA 4QARA 5JDIA 1JIIA 1JR6A 2P2NA 3KZMA 1Y3DE 2ODMA 1RFYA 1YTUA 1JNXX 5JI2E 1FTWA 2I7CA 3HACA 3GVMA 2GM5A 4E5MA 3KYDB 2X8BA 2IYPA 1BCRB 3I92A 3ILVA 3QFHA 1Q0PA 1G8HA 4Y18A 4IF4A 2OGZA 4KWEA 1VQNV 4OXIA 3QPCA 2A0KA 5AKYA 1MN6A 2IXFA 3LBYA 4UBNA 4ZXPA 1NC1A 5LWQA 4RJIA 1YDWA 2PVCA 4XD7D 4TTQA 4CI0B 1X1AA 3VTZA 1L5ZA 3TFQA 1E6LA 1PJCA 1BQZA 1ODJA 2ECOA 3HPRA 1AD2A 3KQMA 3CTPA 4MW3A 2I6GA 4TWAA 5KTYA 1E79D 1T0BA 5IDXA 2XRMA 3SQMA 5FL7G 2CMGA 3AX6A 3I64A 1KMHA 1OXMA 3V80A 3WGZA 3K4QA 1Y8RA 4WH0A 4ZT7A 2Y76A 4AN1A 3AXTA 2PLAA 4F60A 2I71A 3H5RA 4ZP1A 1FNCA 2JEZA 5J4HA 3AF1A 4LJ5A 2RHDA 2D4HA 4P4NA 1QCDA 2JGKA 3GI1A 5B4VA 2WJYA 2WSMA 4J8PA 3WMXA 2ZSFA 1VQMV 2QG6A 3M89A 5KDOA 3DCIA 4WCEV 4RJ2A 3I6YA 3OSUA 4RF4A 2B34A 2DUNA 3NUQA 1XUOA 1H8HG 2D1RA 4AULA 2FG5A 5JWHA 4ZI7A 2W8ZA 1OI3A 3CLTD 4BVEA 2IU0A 1E5DA 1BE6A 3SYNA 4E1BA 2OCHA 1KU0A 2AZMA 3IAAA 5KCMA 1GCOA 5A5GA 2D0DA 2B4QA 3GRCA 1ACMA 1NUQA 4LOIA 6LDHA 1JSZA 1DKOA 4P84A 2ZRLA 2YHUA 4X41A 2OGUA 2J5XA 5CBKA 4G28B 4FIDA 1U94A 2EJVA 1CTQA 1RAEA 1VPLA 4C78A 1HQKA 3D54D 3ONEA 2EWMA 4UCTA 4E08A 3O9ZA 4Y6LA 1XDBA 3ROZA 1XQXA 2QAGA 3JWHA 3NNSA 1P7ZA 3IBSA 3L06A 2QWQB 2ORVA 1P75A 4DMCA 1PV2A 2CLLB 2YWCA 1WCWA 3QHAA 2NU9A 1TCVA 4RETA 1AJNA 2YXDA 1B26A 2FH5B 2PZMA 2CH7A 1XOUA 3G6KA 3O8QB 4LHSA 4Y67A 5ED0A 2HC9A 5KA6A 1RPTA 4KQEA 3FB5C 3MCAA 3NIWA 3DD5A 3R74A 1OCOB 1RQLA 1EP9A 2ZYHA 4Z0NA 3DHYA 4MRMB 1UXGA 3K09C 3V8BA 1CP2A 2AA3A 2XNDG 1YZUA 1ZD8A 1J2TA 1MVLA 1ZXLA 3LAWA 1P60A 3WNZA 4P3PA 2BUBA 4K9NA 4JI1O 3L77A 2GHTA 2VNAA 4L02A 3EG5A 1Q19A 4PX5A 1PL6A 1SF9A 3FZNA 3UJ6A 4K1XA 1QV7A 3VPBA 4J4BA 4KQGA 1U0SY 1ZL2A 3QW4B 4MRPA 4DR4O 2QN2A 3SJCA 5BR7A 1XC7A 4HAXA 4JROA 4URVR 1BJTA 3H0CA 4Z9XA 1LI7A 2IUYA 3N2LA 3FMVA 1IB0A 4MVJE 5GV8A 4BMCA 1SBIA 4MAAA 3GV0A 1K68A 3OFSA 5T41A 3L41A 4RD0A 3SR0A 3C90A 1G21B 1CP3A 1JZTA 2O54A 3HB1A 3IA7A 3KT8A 2QPAA 2VHEA 2QUJA 3UMCA 5KUTA 1GCIA 5H16A 2O8EA 2WA1A 1GCGA 1NX6A 2JI6A 5ANRB 1V9PA 3ONWA 2X0EA 1U7ZA 5IC5A 2K7FA 5ALTA 5KEIA 2L19A 2JDIA 4YPFA 4V0NA 5KDDA 4Y1EA 1NBEA 1AV6A 1KHHA 3E22B 1OTXA 2XZPA 4ISBA 2R4TA 2E4VA 2QTTA 3CRVA 1PFQA 3C7AA 3DOCA 1T5OA 1KVRA 4O4LA 4UTXA 2RMKB 5FWXA 1P0IA 3IBCA 4B2YA 1WCXA 4XGNA 4JP5A 3Q9NA 2FOIA 4WCFC 3UAOA 4B46A 3H9EO 3MB8A 1F2TA 2P9JA 3ZDAA 1L4KA 4JEUA 4TTAA 4AJ4A 2AGVA 1K8YB 4LRQA 2OLJA 2YHBA 3EIQA 5D01A 3FMOB 4QOIA 2AHRA 3TXYA 2XUPA 2WT9A 1JVBA 3GFPA 4MVOA 1JWAB 4MR7A 1G8GA 4FFDA 2QW0X 4QWMA 5EWLB 2RH4A 3E03A 4KNVA 4PM4A 1C80A 1C14A 4P30A 2Z58A 4D4GA 5B6JA 4B73A 2IIBA 3I04A 3CZRA 4QSMA 2XTAA 3LV8A 1EWVA 3RIGA 1M57C 3JTEA 3VPSA 8MHTA 1G5PA 3UO8B 4EKDA 4RKQA 2YZ7A 1PIWA 1NVVR 3ENZA 3UBTA 4YDSA 2ZTMA 3ZCXA 4L0QA 1NYTA 3L02A 5DEIA 3DKRA 4EECA 1A97A 1W5EA 4JX9A 2XB8A 4YRRA 4ESVA 3IKTA 3V8QA 2PKEA 1X13A 4FHGA 1NJGA 3OZTA 4PFKA 4J7KA 2JGDB 3K15A 3P9QA 2AXQA 3B85A 4P3YA 1FSGA 1JQ3A 4NB5A 2Q6AA 1GGVA 4ENWA 4XUCA 1KORA 3TLGB 4K9RA 3PGMA 3NNNA 4RY9A 4JAVC 3KPJA 3HGMA 3NX4A 2QB5A 2XI4A 2VDWA 2QM0A 3CBGA 1FX0B 4BJ3A 4EFMA 3WGMA 3UK0A 4MV3A 4GOMD 2IS6A 4ZVKA 4CM7A 3AEIA 3TI9A 4LF7O 5ICFA 1KQFA 4XWKA 3TL2A 4I5SA 4DK0A 2JH8A 1ZR2A 1KSHA 3MINB 1NF2A 2WSSD 1ADCA 2P27A 3OMIB 3FYUC 4UAUA 3QKSA 5EKUA 3HPLC 4G01B 1N8RW 2PX6A 2ZQ5A 4JT2A 4EVQA 4Q3CA 2NAFA 4LISA 4ITRC 1EFCA 1V9CA 2A92A 1SOAA 1DV1A 3Q8LA 4MYHA 3V48A 3C4QA 4M7RA 1VE5A 2R6JA 1KEKA 1ULAA 1NI4B 3A37A 3EIFA 1F3OA 3HMKA 3CZMA 5HJ2A 1HM5A 2QENA 4K87A 3CV3A 3ND6A 1GG8A 4J6EA 1IPEA 3OMWA 2CKMA 4FYJA 2W2XA 2WIAA 3DQQA 4F0JA 4LYGA 1ML3A 1UOQA 4FFBB 4RQAA 1E20A 2JW5A 2QYHA 1DRVA 4BZZA 3OAAG 1GN3A 5K1PA 5IBCA 3NUGA 2WHQA 2H59A 1SB9A 4XWAA 3BTVA 2IHZA 3GGCA 3MLEA 4LTMA 3MJHA 4NMWA 3NWJA 5AVSA 4QXAA 4CG3A 2EIHA 4DZTA 1AMUA 4I9FA 4C7MA 1WUIS 5AW6A 3ZBUA 1ZNQO 5C8YA 4TN5A 2GM4A 5LJIA 3UKDA 2J9FB 4QEDA 4CKEB 4EJ2A 3KG2A 3SBEA 4LG1A 4OFXA 1IY9A 3KWJA 3OGIB 3HB3B 2H48A 5AXCA 4AO7A 2AJ8A 2XUAA 2CYAA 2BFCB 4PLVA 2H54A 3V2GA 1U65A 4UNPA 3NTUA 3NVAA 1K0FA 3EA0A 4GI3A 4NOKA 4KYVA 3JQ8B 1I0IA 1YS4A 3IP9A 4TVBA 4BTLA 4OL9A 1K0UA 3WK5A 1K86A 2FV8A 3SVLA 1J90A 3VU8A 3T7IA 2IDMA 4RTSA 2H2IA 2AYXA 4DBLC 4ZRMA 1QIIA 1M2KA 4GPTA 2FZWA 3VGJA 2XDYA 3KVVA 5CM8B 1NJ1A 3DC7A 2GSDA 2AOXA 3TH5A 3I8OA 3THYB 8OHMA 2DXIA 5K0NA 1XA0A 4D0RA 2FMFA 3NEPX 1U0EA 1NE7A 4PNEA 3CHYA 4ZYTA 1IULA 2GA9A 2FCAA 5CIYA 1N2JA 2I4LA 1DJOA 4IIJF 4EG4A 1HUQA 3NHZA 3WFVA 4IXNA 1AKVA 4J10A 3D4LA 4G5GA 3T3OA 3DP7A 4RHEA 4Y2XA 1N2CB 4R3NA 4IIEA 4CZ2A 1O9HA 3KOXA 2QT0A 5CDYA 2IP4A 2ID4A 3HB9A 1BXGA 3DAYA 4QE7A 4X92A 4WDRA 2ORIA 3I4CA 4TMTA 3H4VA 5J2TB 3AYZB 4G63A 2WZDA 1W46A 5CNKA 1YJAA 3OM0A 2I2CA 2PGDA 4PXAA 1LXCA 4HO1X 1E2BA 2QMHA 3E2PA 1GM7A 2IF2A 3MFQA 5L3QB 1QORA 4BMYA 3JWGA 2FPUA 1HC7A 3EGOA 1FDVA 1RRGA 1K6MA 3L0PA 1DAHA 1QVFU 4C9BA 3QE4A 3KQHA 1K3FA 1J22A 4UEJA 4AP5A 5F4BA 3WLNA 5GZ3A 2QSUA 2AHZA 2ETXA 1GA4A 2GI4A 2F66C 1PD0A 2VF5X 3O73A 2H9IA 1O9BA 3CS5A 2IUTA 3DBVO 3T34A 3OPQA 1YB1A 1T2AA 3ZU6A 3KYCB 3TZHA 4BQOA 3OJWA 4H0LB 2ZBPA 3FLMA 3VX4A 4WI1A 4XFDA 3K9CA 1UFOA 3EEFA 1RTKA 4EA8A 3TTUA 1TEVA 4RC9A 2M2IA 4WRRA 2GF2A 2IH1C 2I4OA 5CDSA 3B40A 2OWDA 3BM5A 1DG1G 4I0XA 3FUTA 3I28A 2Z98A 4MA0A 3AZPA 5CBHA 2JGRA 5CK5A 3NT5A 3Q5DA 4DMLA 4LXGA 1NYLA 3AVTA 2VT6A 2X1MA 1UXJA 3RVDA 2RJ3A 3P1JA 4R2MA 4EW3A 1UC8A 3KVOA 2VP2A 3MCUA 2BGTA 1PX2A 4R4JA 2Z43A 4GO1A 2J1LA 5FV4A 3KJEA 1CB7A 1AS0A 2Q7EA 3LHDA 1PT8A 4AKTA 3OC0A 2ZUBA 1GILA 4UAVA 3IDZA 5C5EA 3L72H 1MC8A 2MU1A 2DG2A 3S29A 1GQOA 1FRNA 3CMEV 3Q9UA 3CXHF 1Y5NA 1T4CA 3P3PA 1JIUA 2FW0A 2F43G 4WZAE 5CGQB 2XYGA 3B9QA 1JQBA 1MB3A 4Q6GA 3I2FA 1Z28A 2PR2A 3PHCA 2ZCVA 2GQ0A 2UVPB 3FTQA 5ALPA 3KKMA 4EFBA 1Z45A 4XWWA 2I34A 4IG4A 4EA6A 4KQJA 4Z7QB 4PFSA 1YB4A 4U02A 3HBMA 4FHZA 2TS1A 5COAA 1U7HA 3OPNA 1P77A 1VSQA 5CN0A 2YC0A 4YC7A 1YONA 1A4RA 3PSAA 3U7FB 3QXJA 1K5GA 2B8NA 3MJEA 4LNUA 1CYEA 3GMIA 3OF2A 5DWQA 2QL9A 3IC9A 3MUNA 1KMQA 3B70A 2LGJA 2BUAA 2QR2A 7GPBA 1DAMA 1E1QD 2P1ZA 1HFJA 3FGZA 1Z3IX 3MN1A 1ISIA 1V4NA 3H9JA 5ITZB 2NPFA 2V98A 2O5VA 4L6AA 1GUZA 4BVLA 1OFVA 3CUKA 2C54A 1YZVA 3KR0A 4UUJC 5IM4A 3JZAA 2WDZA 3KT0A 1YS9A 3DEHA 4XVHA 2F8TA 3HJTA 2UDPA 2R6CA 1B3BA 3Q11A 1L2TA 5JS6A 5JS8A 4MS3B 4LVUA 1DBRA 1KJZA 1MOQA 3IHTA 2FE1A 4UTZA 2BFFB 3LNNA 5B5SA 4DABA 3ABLC 2FG7C 4DTCA 3NEYA 1C2YA 1XJWA 3ONFA 4PFJA 3DHWC 1P61B 4LBYA 3DZKA 4Y6RA 1NZ6A 2O1SA 2WYVA 5F3RA 5KCZA 5IW8A 1P5ZB 3AB7A 3ESYA 3NH6A 1WDKA 1MOPA 2QS9A 3RUPA 4TT3A 1B41A 3H9UA 3R7SA 2GCGA 4QUHA 4YPVA 2PMFA 3E27A 1ECFA 3G3EA 2H07A 4MGIR 5C1PA 4JL5A 1D5AA 1NFQA 1YR3A 2ZIFA 2WWHA 2CFOA 3HXLA 4LY9A 3ABKC 3ZWPA 4G4SO 1TM4E 4QC2A 4Q1CA 4LJ7A 2HGSA 1ZIOA 4RORA 1MKYA 2WW8A 4PBTA 3WLPA 1DOHA 1ZLXA 1WHTB 1HL3A 1VMIA 4QYIA 1IWBB 5B36A 4MEBA 3FB4A 2Z3VA 3AETA 2XUGA 1K4DC 2EARA 3K0FB 4TLDA 2IY7A 1D4ZA 1FXWF 3IIMA 1P62B 1Q7TA 1DQZA 4GKAA 2D7CA 3QIAA 1DBSA 1H8HD 1F14A 3ND9A 2CL0X 2J5RA 5BW8A 4WN9B 3Q2KA 1AKQA 4A26A 1LDNA 4IQ8A 3RF6A 3A6FA 3AKZA 4YK7A 3NBKA 3IFXA 3SS8A 2FP4A 1N57A 4RZIA 3PGVA 4D96A 3TZQA 2PFSA 4KXUA 5FP0A 3WC4A 1WUTA 3RI3A 4MLDA 3SQXA 2XSZD 4XB2A 3O47A 3Q6IA 3OBIA 3R44A 5J2TF 5FBLB 3NM5A 1D2HA 1SOMA 2IYOA 2BOCC 4YO7A 3BRWA 4N5HX 1T1IA 5AD1A 4B32A 1LEHA 3M1IA 5E7JA 1A8QA 4HAMA 1L4HA 3RCBA 1ZK1A 2PYLA 2RHRA 3MS4A 1HLFA 4MUKA 4BEJA 5DM4A 2P9QA 2QWOB 2OCDA 3GUCA 5LD2B 4MVJM 1XEQA 2Q2OA 1PT5A 1KYTA 4QFCA 2ZSKA 2V6MA 1PGPA 3IAEA 4CQLB 5IRCD 1Y8CA 4DR6O 3T3EA 3PEUA 4WLEA 4QFDA 4F9FA 2BHLA 4S1WA 4DDHA 4KBYA 1DRKA 3LFUA 4ZVPA 3PVSA 3IEIA 3U2QA 4L8JA 3JQPA 1WZEA 2OCGA 1OCRB 2EBFX 2VHUA 4EAQA 3WG7B 4X45A 2IZOA 5KMGA 4K6CA 5ICMA 4RQUA 1TKBA 1KNQA 1OV4A 1ZHOA 4DYHA 3B38A 1GAJA 1KKCA 2RHWA 2BM8A 2XVXA 2NSJA 3AOGA 4Q3AA 5M04A 1M0WA 1PRYA 2UXDO 4U9HS 1V5WA 1GV0A 3BRQA 3MJ4A 3V3KA 3F7OA 1Q74A 1CVIA 2HMYB 2FMIA 1RLTA 3BG5A 4FZ0A 4GBGA 3OHSX 2HXYA 1F5SA 4FYKA 3T5TA 1QCZA 3ZCCA 2CJWB 3B13B 1CUEA 2HSEA 4GNKA 5JSHA 1E3MA 2R7NA 1ZM7A 2G5CA 2GZ3A 2B9EA 3G8BA 1SK8A 4Z9AA 5B30A 4YYEA 4WXHA 1YRHA 4TXLA 5T64A 5KC8A 3IEVA 3IGAC 2XMDA 1AJQA 3CPSA 1B04A 2OWOA 4KYUA 4LI0A 1KWKA 1JIXA 2OBYA 3CW2A 4NE2A 2J4FA 3AERB 3L1KA 1Z0KA 1I2AA 3TW8B 4OU5A 2VYNA 2FVXA 1KXZA 2WAAA 1BVUA 1ZX3A 4H60A 4E5YA 2ZT6A 4H31A 1NQTA 1M5UA 3WOVA 2XUZA 2VWKA 2O05A 1FC0A 1B7GO 2V5UA 3K8YA 3PEYA 3UANA 2IZ1A 1SKMA 1SIWA 1KFJB 1ZW6A 3HB7A 4A5SA 4ASUG 1ILWA 5LVAA 2FJ0A 3OTFA 3BWMA 2DN9A 1NDQA 1Z4PX 4W4TA 1H2ZA 3BA6A 2PUEA 1Y0BA 4M22A 4P38A 2ZJ7A 3JWPA 3BMOB 1QRAA 3H9GA 2D0OB 1D6NA 5L3FA 2IUEA 2W5UA 1DS6A 3CKMA 5CYFA 1FS5A 4V1CB 3F6RA 3CSDA 4YJGA 3SEFA 4RA6B 4F06A 4MGYR 1PV4A 5IP5A 1UK8A 1TYZA 4JP1A 1ZWKA 4WE3A 1R9MA 1G8FA 1JKJA 4YMUA 3O8CA 4D02A 2PX4A 1YMVA 1M8PA 1VYTA 3CNEA 4DLNA 1NWHA 2XXJA 2LW1A 2X0IA 3LMKA 3UC5A 3VZCA 3D6MA 1JLLB 3TJMA 1EEXB 2K7ZA 1EZVH 4JDUA 5KWSA 1XHFA 2X58A 4DANA 1PWHA 4O3MA 5EVJA 2HLDA 3C3WA 3VR2A 4ARCA 2IHJA 2B7BA 2QTRA 3K06A 4CG1A 4NKGB 4BNJA 1E77A 1UQTA 3IDSA 4OHBA 4US0R 3K9BA 5HMLA 1AQ6A 1V0JA 4A23A 4ANFA 1PWEA 1WB6A 1OTHA 1G5QA 2JFBA 3TB4A 4MQMA 5L7TA 1XFAA 2AN1A 4XJVA 3FTPA 2OFWA 2FWNA 5HSGA 3K0BA 3D81A 2H2AA 1J49A 3A9VA 4UTVA 5EUMA 3OQBA 1VYHA 4B8YA 3QXSA 2ZM6B 2WJWA 1TK9A 2ZSEA 3O9VA 4HQOA 1TM3E 3TIFA 3U31A 5BWOA 1G0OA 4LJRA 4EYQA 2P9HA 1NJIW 4ZKIA 4EB3A 1IE3A 2Y1KA 5TE9A 3SYQA 4F6CA 1LBTA 2G25A 4EVSA 3SZMA 4FFLA 2OD9A 2MSDB 4UXNA 1NXQA 1U96A 1TYBE 1AUQA 3HUTA 3KQTA 1O6ZA 2NWQA 3E9MA 2W93A 3J7AC 3QNUA 1R3DA 2HJDA 5H9WA 1LFAA 4TS3A 5FOTA 3FIJA 2H16A 2A0LA 4L9SA 2FETA 3CLHA 1QMGA 3AVUA 4OJMX 1K9VF 1HEIA 1KQPA 6REQB 5DDIP 1UBLS 3GOHA 3D7LA 3NKFA 4ZV9A 521PA 3W79A 5J43A 2ZXFA 1X1QA 2RE8A 1BA3A 5DNEA 3ZDRA 2A1UA 4RLFA 5FWDA 3IP7A 1NWCA 1E2KA 3EZGA 5CX1B 1GSAA 4DLVA 4Z9FA 2YTZA 4R41A 5C7YA 4EF5A 3K0AA 1Z68A 4RSGA 5GWXA 3LCJA 4V0RA 3GFBA 1OJHA 2PL5A 4WOJA 1T9AA 3FN4A 1E3WB 2C07A 3CX8A 3SIRA 3TMAA 4KPEC 5KSYA 3WJ2A 4FJ1A 4P92A 4LE0A 1OXXK 3VH3A 3A6EA 5HTOA 4RSMA 1TYEB 3WSVA 2MMCA 3ABZA 3C0KA 4DJAA 1J8MF 1EUDB 1G5RA 4YDQA 3V7NA 1N6NA 4FX2A 4LZOA 2H4FA 2WF5A 3FB8C 2G0TA 2C2OA 1SERA 1E8DA 2XGMA 1SVSA 4UQLA 5NULA 1A9YA 5FADA 4EDFA 1UJMA 4WZZA 3LH5A 3NTLA 3K5MA 2DY1A 4XPIB 2JB9A 4H4CA 1BVHA 3K58A 2YDEA 2C31A 1NATA 1BWRA 2Q8NA 2HKIA 1H2KA 4MZDA 1U8AA 1Q1GA 3BN3A 4MKGA 4R1PA 2JLAA 4R2HA 3RYTC 1E79A 1Y7LA 5FV7A 1NVAA 2Z9DA 2ZI7A 2FR8C 2XUHA 4HGQA 4M55A 3IESA 4G1VA 3LC1O 2C42A 4QTYA 5GVRA 5DNDA 2FGKA 4FPPA 5J4LA 1T5BA 3DHEA 1QO7A 1GA6A 2D54A 3D43A 1XZCA 4CKCA 2Z3ZA 4CLRA 4DV0B 4Z4QA 3OLYA 5T4BA 2FEMA 3W6OA 2A5LA 2WQ7A 4KZKA 4GXTA 1XA4A 2B4RO 5M29A 4EPXA 3GFFA 2G0NA 4LN1A 3PITA 2ZWIA 4MPRA 5MN5A 4NSNA 4JAUA 2X5XA 5ALWA 3AF5A 3PRKE 2GBFA 1G1XB 5EYPA 1VIBA 1K8QA 4Z99A 4LFBB 4RZXA 4X6LA 1Y9ZA 5K03A 4QATA 1QIMA 3B1KA 3BSFA 3TB6A 1XPRA 3WQHA 1GN9A 3RSHA 1M8FA 1NDUA 2DYSB 5K3FB 1PX0A 4MUMA 4J9VA 4JLPA 4G24A 3EOBI 1DAKA 3U6KA 2AZ0A 4PSDA 2IH4A 4MHTA 3STUA 1U0GA 2FK8A 1SQQH 3DM9B 3PNSA 1OBHA 3NDPA 1IHXA 2F2TA 4OU4A 3ZJYA 2QJOA 1CU1A 4RIFA 1IN8A 2V4UA 1WXDA 2XV1A 2AQIA 5EKTA 2GPBA 4KV9A 4MO9A 16PKA 2O6LA 3UV7A 5EG5A 5EJ2A 4DR5O 4H7KA 1YZHA 3ZHBA 2Q4BA 4Z4HA 2WUEA 4PJ0Z 1HZZA 3CU5A 5HIKA 3DZBA 2PO7A 2QQGA 4U2GA 3BBLA 1VI6A 5CCBA 3LUGA 5JXWA 3KJFA 4ZC1A 2ZUWA 3H99A 1EJ0A 4BL5A 3NFYA 3ZD9A 2IZ0A 3E2EA 3OQPA 5CH5A 5AJWA 3K72B 2P2DA 3ENKA 3RQIA 1T9HA 1CNFA 5BYAA 3EF0A 5CFNA 1C4KA 3UMSA 2HJ9A 1SUAA 1Q17A 5BP7A 1BX0A 2BKEA 1IVSA 3C15C 5HZMA 2V3VA 3EDCA 3QM1A 2QLNA 1T2VA 5BVGB 4BGUA 4JI3B 1QWOA 2JHGA 3W4IA 1JI0A 4NTYA 1R9GA 4UHEA 3R8XA 2PV7A 1N5IA 1N8SA 3FAVA 2Y4OA 1DJNA 1X8KA 3EF1A 4ZCQA 4KFUA 5LP6A 3DEKA 1ATIA 2L17A 3FTNA 1ICEA 2QLLA 4JFAA 5D51S 4KACA 3LI2A 2JVKA 1XJQA 2DOKA 1XQ1A 1XTKA 3CT4A 2Z2JA 2UUBO 4G5HA 4V3BA 5FXMA 3WSTA 3KQVA 4Q4LA 4RPCA 3V8RA 3PQ8A 1TZ2A 4W63A 1ZUNA 5H59A 4FBMA 4L0CA 4EQZA 5GINE 4XVQA 1E2DA 2VPTA 3ZS9A 1GM5A 1Y6ZA 1SA0A 3GYGA 1TT7A 4C76A 4ZV4A 2I0FA 1SUFA 4JI2B 2PGIA 5E2AA 1IQPA 3D8RA 1XTQA 1QG2A 1W94A 3W0LB 2G1PA 3V8EA 1NMEA 4GWGA 1U3DA 3L4BC 3AUUA 3NPAA 1QC5A 2H4JA 1Z0DA 2PX2A 1LLDA 1S9DA 3ECSA 4UMFA 3L7LA 5ESWA 3FMIA 3J80A 2P6RA 1B15A 2V8BA 5GGXA 4GPAA 5FI5A 2C84A 1PQ4A 4HDKB 2C5HA 3RYHB 4UUOA 2JFVA 3EMKA 5B2ZA 4XSHA 2QM8A 2HOQA 1ZJJA 2O2YA 2IX3A 1M10A 4WCFB 3V9AA 2HF7A 3DULA 1EFAA 2P4VA 1LZKA 4CEHA 1JWBB 5EWMB 1NPDA 4Q9AA 2HSGA 5BSGA 1SOUA 3H05A 3QKUA 4UM8B 1YZ3A 5LIRA 3P9IA 1ENZA 1ODTC 3GLUA 3NHKA 4H6VA 3E53A 3C3AA 2WTBA 1NE2A 3DYVA 2GVNA 4A2QA 5HIAA 4PNHA 2GK4A 2AG6A 2Q5EA 1Q0HA 5F9FA 2JJ2A 4GGMX 3QE9Y 1WUJS 2E4AA 1BXRA 2D59A 3FDFA 4IOLA 3IXQA 4ZYWA 4IEIA 5G1OA 1M57B 1A9XB 3TVYA 3R0XA 4TRNA 4BN4A 3HP4A 2ZYGA 5DLEA 4C4AA 2PSDA 4YR9A 2QSYA 2B21A 3ZWDA 3T5GA 4EHAA 3SC3A 1MNQA 1AKYA 2G5TA 5KUKA 1QFMA 3PNQA 4WOBA 1ARZA 2GXSA 4AZ0A 1BCSB 1RU3A 1GMGA 3TJZA 1MC5A 2Y92A 1TEHA 2RJZA 3WDKA 1OAKA 3NIBA 2NN3C 3KB8A 3RABA 1AA6A 1W75A 1VIAA 3L7OA 2FPWA 1P8AA 4BNFA 2QD5A 1T3TA 5JAMA 3CFYA 3MHSC 3PU6A 2RGAA 1IX9A 4DPLA 3O8DA 1KJQA 1COWG 1SHJA 2B25A 3MZ0A 3U26A 1S02A 1BRMA 3PKIA 1K6XA 4AZTA 4C89A 5K0CA 1M2NA 4IFBA 5AHRA 2JAQA 4RLSA 4UQPA 2BFBA 2PV0A 3SX2A 1W4ZA 4LYDA 3JARA 2AOUA 1C7QA 4CLOA 4EUKA 1MEJA 1FFDA 1D8AA 2YXYA 1GRJA 1OLUB 5DP1A 1PFVA 3FYUB 4WBNB 5EMLA 4LZWA 2WSSA 3EPRA 2IEDA 1JGTA 2BL4A 3V2UA 2BBTA 4LYYA 4ND2A 4GDMA 5EQDA 3R3JA 1Q7CA 2O2ZA 4Q12A 5A0VA 3HLYA 2QRGA 3I72A 1ENPA 4QJ4A 3DHVA 1QZXA 3TNFA 5HCUA 3ANTA 3CEHA 2IPOA 4BO8A 4KVZA 1XLUA 1FJXA 4UCUA 4UFZA 2IA5A 1OXSC 4R8VA 1BU5A 4RGQA 4INOA 3MA0A 2YH2A 3S1AB 4W8OA 2BGWA 4EGQA 1OLXA 4D79A 2C3OA 3E7FA 4RPKA 5K8LA 3BWVA 1GSOA 2AUNA 3THOA 1C0EA 4TLAA 2OXIA 4F9TA 1GYRA 3G4SV 4FDVA 2G6BA 1LD3A 3P9KA 1IAQA 2G36A 1J24A 3DF7A 5AW7A 3RVBA 2YIMA 2WD7A 1VG9B 1XTUA 5JPCA 1FPQA 4A0FA 2AX3A 4EIWA 1HG1A 2AZTA 2ZSAA 1GNSA 5EJMA 3PGA1 1KYXA 3TRHA 3OOEA 4DO2A 3IBYA 3W8DA 1U4SA 4WZBA 2MINA 1ZVQA 3CUEF 3AEUA 1BKSB 2PRKA 5FTNA 1OHHG 4RU1A 1ORDA 5D7NA 3HCRA 2Q3JA 1BGXT 3UGJA 1C50A 3QK7A 2IBTA 1R3IC 3Q0IA 4RD4A 2VDLB 1Z36A 5LDGA 3Q6NA 3PENA 4K3VA 2R4QA 5HE8A 1SCNE 4CTNA 2QR4A 3WKCA 3PDJA 2PEYA 5BNWA 5CD1A 2UU9B 4NJMA 3BULA 3MVEA 5BZBA 2GFQA 4UD6A 4ESEA 3DXXA 4AJEA 4B4OA 3CD6V 4G4GA 1UQRA 3KHSA 5I9SA 1TM5E 5JDIC 1M5IA 1PDWA 1E3EA 5B1SA 2JJQA 1E96A 3ABMC 4EZIA 3P0RA 1EFLA 2VAVA 3HCEA 4EHLA 2AN3A 2JAOA 4RD6A 1KPIA 3R6LA 1DG9A 4AU1A 5I8ZA 3HABA 2DWOA 2VPZA 3UYKA 1UBNA 3E70C 2FRVA 4FMBB 2BFDB 5AVOA 5CPFA 2GPWA 4ROTA 1XI2A 1Q57A 3GCZA 4DXDA 4UBOA 1IUPA 4HPXB 1R0BA 1R4AA 1ND5A 2QLMA 3EZYA 1UWKA 1AS2A 3AUKA 4UEKA 4Y6OA 4PG6A 4NZPA 4FDAA 1VE7A 1RWPA 2QUHA 3EIOA 2Q9AA 5IVPA 4BNTA 3TE7A 4BWAA 1TK2A 3OPYA 3S2UA 2AYYA 2PBLA 5KOHA 1CR0A 4WNYA 4CKBB 2E82A 2JBHA 3ZLJA 3BERA 4Z3KA 3RGGA 5EHXA 3H17A 4CF7A 4K9DA 2F9MA 2B82A 1NOKA 2ZIXA 3PQDA 4DR3O 1VHTA 2ZBFA 1L4UA 2Q9UA 1GP2A 4JI0B 4BQIA 1JPVA 1C29B 4JL8A 3KUCA 5BQFA 5CT9A 2OV4A 4R8SA 5IE9A 1EVLA 1UMBA 5TY0A 1C0PA 1N8NA 4LWQA 3PHBE 2P9ZA 1SGWA 2BHSA 2BCCH 4WSOA 1HE8B 4GVPA 1XAJA 3X43A 1II0A 3TM5A 1IUNA 4KOAA 3ZE1B 3HGTA 4N0PA 5LOVB 2XYRA 2VTKA 2IEAA 4DEXA 3OF3A 1QP7A 2QTAA 3L1JA 1RQNA 4RTRA 2HQOA 2NXWA 2BC9A 2ZU0C 1PSZA 1NG1A 1LJLA 3GDOA 3ZXXA 1TI7A 1DL5A 1QHFA 4ABTA 3ZU5A 1RRCA 2YFHA 2CCJA 1BD4A 2IOFA 2ECPA 3AM3A 2X8WA 2K87A 2BM1A 5LDHA 1R12A 3SLKA 2Z04A 5CR9A 2IIPA 3N2YA 2XMRA 5JAPA 4HWRA 3L05A 4X8OA 4LQLA 5JJKA 2BGMA 2GAIA 4MP3A 2PWAA 1NH2D 4UU8A 1AQJA 4DV6B 5HFMA 1PQUA 4TSRA 1DX4A 2WWTA 3VXKA 3O5AA 5KTOA 2W6ZA 3CVWA 2XEDA 1XN1A 3O2JA 4S0XA 4KZPA 621PA 2HJGA 2B4AA 4OQYA 1P91A 2V3CC 3V32A 3IDFA 4UAJA 1HORA 4LF6B 3I30X 1P45A 3U7HB 3MWDB 2DUMA 1HDXA 3O9MA 3RRNA 3PC6A 4L75A 4M49A 1IEWA 3ZIUA 2JGJA 2XOXA 1YAJA 3IMEA 4F4DA 1IUKA 2X0DA 3AFGA 4XCVA 4U7PB 1P4RA 2VK1A 1T0HB 4CR8A 1K5SA 1PCXA 1TQ8A 3KDPA 1T6ZA 4WBNF 1O6GA 3TG2A 1A8PA 1JS1X 1KAEA 2L82A 3AHHA 5EP2A 2DHRA 3WGQA 1UBEA 5A3QA 2MSEB 5KOJA 4DQUA 4IIJB 5K99A 5BR8O 2IOYA 3SJCC 4U63A 1JDJA 2JI8A 1V3VA 2OHJA 4BEBA 3LO5A 4PCVA 1YBVA 4OMCA 3AFOA 3KD3A 5KJCA 1MOZA 3IR5A 1MG1A 4BNHA 3T7DA 5ENVA 3N6RA 1GTOA 4URUR 3ZK7A 2VSYA 3QUBA 2VXOA 3FX2A 3AVXA 1FTQA 1XNHA 2CE2X 2P6JA 2PI4A 4ZTBA 1HNZB 4AZ3A 4YCLA 4DHWA 4DGQA 2LW7A 5KYYB 4Q5IA 3J7TA 1F7UA 4PINA 4IRXA 3O2SB 1JFVA 2DWCA 4GEKA 4NVRA 2EULA 5EUBA 2WG2A 3PXDA 1N3BA 3HADA 3SGLA 3A27A 1G5IA 2OHXA 1JR9A 4G6ZA 3T4XA 4YJHB 4NCBA 4HEA1 1L7DA 1FTSA 3H5VA 2WQ6A 4QBIA 2PYZA 1CRPA 3WGJA 1D4FA 3RIEA 5JW6A 3RUIA 2TMKA 4W7SA 1K89A 4XTRA 4JYZA 4OXQA 4B3RB 2B2XA 2W8BA 3ABIA 3UFXA 3AM1A 3DEJA 5JSKA 5TQ0A 3HM9A 1XCGB 2FMLA 2CN1A 5B1AC 3ABKB 2GWHA 1IU9A 3ZLBA 3TLYA 2JAXA 5BW6B 4NU5A 4YMSA 4I4IA 4LWPA 2QQ0A 4HBZA 1V9SA 3L8ZA 3IRUA 1BJKA 2KYRA 4LV5B 3PPVA 3NBAA 4GP7A 4P5DA 1NQAO 3UT0A 2XMSA 4NECA 1A77A 1B73A 3SXUB 4WNCA 5TJ9A 3RYFA 3PQ2A 4IUDS 5L53A 1W0JA 4NC9A 3AL2A 3GR6A 1QYWA 2E2WA 5A9SA 4V0SA 3ZH2A 2O48X 1SCBA 3BHIA 2CFRA 3O8RA 4MHOA 3P27A 3GZNA 4Y0AA 1JHDA 2YIBA 1LFDB 5JH7A 1W93A 2X6TA 4F93B 3IO5A 3CLRD 1O94A 3E9CA 1EXMA 4AKEA 3IBGA 4R83A 3ZVMA 3U4IA 1DXQA 1UJBA 5JTUA 3T1NA 1NY5A 2MWMA 1QHHB 1WOMA 2EQAA 1D2MA 5C93A 5FHRA 2OZLA 1CEZA 4G5XA 4ZEXA 5DW0A 5JLJA 2HSZA 4LDAA 2BYTA 2HJVA 2XOEA 4EW6A 1RM1C 2HWUA 1L4BA 3IIKA 2RG7A 1B43A 3GJ6A 4LECA 2QE7G 3AKDA 1RSOA 1NSYA 5EINA 2FUKA 1TX4B 2RC5A 3BE8A 3OZBA 5KIAA 4M6WA 4ZPJA 1JLMA 2C2YA 2JCVA 4UVBA 2Z5LA 2QWXA 1Y3FE 4DCMA 3F7MA 1AG9A 4H3VA 3RC9A 1RABA 1DOZA 5LOVF 5DN6G 4G0ZA 4Q3KA 3BGWA 3PEVA 3MOIA 2A0XA 1C7JA 1QJ4A 4B4VA 1J0DA 1BW9A 1ZIYA 2OXCA 3AESA 1G4HA 3JQDA 1SVNA 2BP7B 1PFUA 4GKJB 3ORFA 2C03A 4MTXA 2EDCA 4MUEA 4G0VA 1IBSA 3AU9A 5I9BA 1XQWA 3VSEA 3G6BA 3IAUA 1SCJA 2VQFB 3N05A 4JGSA 1JH8A 3QELA 4KXYA 4RAIA 2YWRA 2CLCX 2GK7A 2NYRA 2NZUG 3AUFA 2CUZA 1NIPA 3GGJA 1I2DA 1E5VA 1QGED 3L49A 1B6TA 2FPSA 3RSOA 4ZICA 2EFYA 3SDZA 5H82A 1GTRA 3JVVA 1U2DA 2YZ2A 1YHYA 4QX6A 5TQ2B 5BN3B 3DTVD 4EHDA 4O4JA 2JHAA 4F4IA 2DHCA 4HDNA 2E6UX 1YBAA 4A0QA 5HEKA 4WJKB 1B8OA 2JATA 4YRIA 4K8ZA 4KAXA 2P41A 4D3SA 3PFCA 5HK8A 2XCSB 2G3YA 2XVMA 4OGQB 3HZHA 4QNHB 4H7FA 1C3XA 2E5LO 2AN5A 1KKMA 3VZSA 2CUGA 2BKXA 4UCFA 1KJWA 3KBBA 2BGGA 5DGIA 1NT4A 1YQQA 2P11A 4B85A 2GASA 2D7JA 1T9ZA 2RK4A 5IXJA 1NVTA 3VUEA 3EGIA 1XD8A 1H2EA 4JVSB 1L3IA 4MUHA 4F5YA 4MUFA 5ILOA 1R9NA 2QMOA 1RWNA 4PI0A 3PYXA 3L4KA 4MQBA 2AFHB 3ENNA 4LVCA 4C7JA 1JU9A 1QHNA 2WA4A 2ZJOA 1XNRB 3H3JA 3K05A 2DBZA 4D9IA 1GZ7A 1GZSA 4JTDB 1G20B 5IDVA 3TZLA 2EZOA 2CTRA 4BLSA 3AI2A 3JAMN 3I2GA 1E1YA 4UBLA 1ZIDA 5SY9A 2VJMA 2EX0A 5LMUB 3AUSA 2CTPA 3IEPA 1IZ8A 4ZXFA 5EE5B 3VKHA 4XIFA 1ZU4A 3MJCA 1MJFA 2NZ2A 5EVCA 4CIAA 1FFXA 4KP7A 4YJ2A 4RTLA 2RHJA 4Z8XA 2F8LA 1Q14A 4F1WA 1L5KA 3E3OA 2HDNB 4IGFA 4LJ8A 1MG0A 4MGKR 3RRXA 4KQWA 1X7DA 4MTFA 1XZNA 4RADA 2JGNA 3PVCA 1JT9A 1DKQA 4PLYA 3MUOA 4DV7O 1QHSA 4LZZA 1NQUA 2LD4A 4N41A 4FUTA 1Q81W 4PBRA 4BFYA 2BCGY 4G65A 1PWXA 1QFXA 1GPDG 5TPZD 1TUEA 1ATZA 3BGSA 1EWTA 4MWTA 4JWTA 2HJRA 3NBXX 2ZJ6A 4MS2A 4JI5O 2ZVDA 1XILA 2GZAA 4GZMA 1QRSA 2R8YA 1GSIA 4WFAV 3VGPA 1O87A 4YRGA 1G8KA 3E3AA 4BNUA 1WMSA 3T4EA 3LU1A 5BYBA 2GVZC 1OY1A 3EJ6A 3P0HA 4AS1A 2CJYA 4AZWA 3DXFA 2LDBA 5EQFA 3OETA 1EK6A 4O59O 3C3JA 3MK31 4FGLA 3O3OB 1J20A 2X8LA 4I1IA 4QNRA 4XQ9A 1Z33A 4ZALA 3VOAA 1GRVA 4YJ3A 1G9SA 3DAOA 3RW9A 4BYMA 4H0NA 4AWBA 3HKBA 2JL1A 1JQ0A 4L2IA 4NXMB 2X4IA 3OTWA 1NQWA 1P72A 1A5ZA 1BSMA 3BEOA 4BMSA 3U3JA 3A6KA 5KNLA 3CKKA 5A04A 2EFEB 1O8BA 1E1CA 3HNPA 1R6NA 1AF7A 1HETA 5DX1A 5FFFA 2F1JA 4O25A 2PIDA 4GSYA 4JCCA 2JIPA 2XBMA 2LV8A 1XHZA 3E18A 1S0VA 3FH0A 5AXBA 2GLUA 3EXEB 1W4RA 1CF9A 3BL5A 5D3QA 4MW7A 3FNGA 3ZBHA 4URHA 3WNBA 5IU6A 1A82A 3LQ2A 4NYJR 1XBLA 5KWJA 4ZT5A 2J33A 1PUIA 4YUWA 3L0DA 1P5HA 2MYUA 2OBBA 4BMDA 2GBOA 4B7EA 1W1WA 1KDYA 4Z2WA 5M2QA 3PX7A 3CCJV 2Y0IA 3IVMA 3ZW7A 4IY1A 1Y5RA 4URZR 2R8OA 1ZR4A 4N76A 2AJDA 3PLNA 3ISJA 4K35A 4QPJA 1OA0A 1D07A 2B5UA 1IN1A 1T5SA 1LPNA 3LPLA 5BSEA 4YQFA 1YULA 4G0OA 3ODGA 5CG2A 1PL0A 3LT4A 1DB3A 2VIIA 2E4ZA 1M6YA 1H1DA 1Z4KA 5FWNA 3P0IA 2NU8A 1GSHA 2IELA 2PBFA 3QW2A 4K6GA 4A0HA 2B2NA 1HRDA 1T35A 7ABPA 4F97A 3G0IA 3PWTA 4XR9A 1P73A 5ICEA 1R3LC 3JAKB 3NDBB 1U6JA 3BFPA 4NBNA 5HFLA 4OTZA 3I37X 4EB0A 1E9RA 2EGGA 1JHQA 4OLFA 4QAQA 4Y2VA 1KP9A 7REQA 1T5LA 2VLBA 1YO6A 3RFVA 4XA8A 4Q3OA 4MO2A 4GBED 5HJEA 5BMVA 4FYWA 2OENG 2RGGA 1PNLA 1SUCA 2QU7A 4JYCA 4KRYA 3RDPA 4UM9B 3TK1A 4B7CA 2VPYA 4B3IA 5HYVA 1NMZA 1L6RA 3MWYW 4EKGA 4QBTA 3TL3A 4IO1A 1W2HA 3CB4A 1XL1A 1TIKA 3KB2A 1B0PA 2AEMA 5CVCA 1UDWA 2H3HA 2DM6A 1VJDA 5HKKA 1J97A 1NJ8A 1N36B 4KYIB 2GYVA 4CR6A 1IXRC 3D7RA 5FL7D 3EHDA 2GR9A 1EXDA 2QN7A 3KQQA 3UMMA 3KB1A 4NCAA 4YP9A 2SCUA 4D4HA 1QIDA 1JECA 3DZGA 2CLHB 2ZT5A 2W6JG 4NZZA 3DZDA 4HNAA 4GE0A 1YZGA 2KW5A 1XNQB 2XOKA 1BDHA 4B3XA 1E4EB 1B6QA 2XLCA 4W9NA 2AKEA 5I9IA 3EVFA 1DLIA 4OQ4A 3SPXA 4EO7A 2X0JA 2GAOA 3KLBA 1VLVA 2ZJ8A 1AE1A 4MDFA 2D2VA 3OQVA 2UUPA 3KWLA 2EKPA 4DKJA 3BIXA 3UT5B 3X1JA 5B4TA 4MCHA 3W1WA 3RASA 3QIVA 1AILA 2CYBA 3QSYA 2ARHA 2G70A 4AHCA 3MTJA 3ZOZA 1JE1A 5AUQA 4Z2YA 1JEOA 1RI1A 4O2LA 5LUAA 3QOWA 3HU2A 1PP4A 4QA9A 1D4AA 5B7GA 1B8UA 1JI3A 4MNTA 1LSSA 1XKTA 4YIOA 4R9NA 1AY0A 3O84A 4L51A 3GJ7A 4MYTA 3G1TA 4ZCIA 3T95A 4Q7QA 3D3JA 4GPZA 5FLEX 3IT1A 4OI1A 3LOPA 3EXG2 1EFKA 1KXJA 3TTYA 2CLMB 2DFDA 2PUGA 3GH1A 1N6KA 4IMIB 4GLXA 4QT4A 2Y69C 3HJHA 3VYUB 4L0DA 1LPMA 3UAVA 2VAWA 1HT0A 2V6FA 3AI3A 4RF3A 1FAFA 4ZVQA 4EPRA 1E69A 4GWKA 4YT2A 1YQUA 2RHMA 4XWYA 3K2IA 3KE9A 1GVNB 1MFPA 2CNWD 2QLJA 5IZCA 3UC9A 3HVJA 2XUQA 2OT3B 3PJRA 3BL6A 1QJCA 4BKRA 1SRQA 2C9YA 2PNJA 4X66O 1Y80A 2OK7A 5JMPA 4G9EA 3O4JA 4JN6B 4JSRA 1I2ZA 4I4TB 4EPWA 4TV8A 5INTA 1USWA 4S05A 2AXEA 2CXOA 4I3HA 1MX1A 2RHHA 3AF3A 3TN7A 2HL6A 3SEQA 2A1IA 2DAPA 5FUWA 4M9QA 1NRJB 2XADA 1DIAA 1V2HE 4P7KA 2UVQA 4URFA 2XNDD 4NJOA 4J7AA 5AT1A 3EAGA 1Z5GA 3RW0A 1YRYE 1WZ2A 4I6EA 3H2KA 3W2GA 1GT6A 4ZVLA 1CSEE 1DVRA 2H06A 3PUHA 3AZOA 2OD7A 2NMVA 2NTVA 1PNMA 4OX9Y 4EMTA 1YRLA 3W2EA 1L5LA 4LQDA 4DM4A 3ZJZA 2C59A 2DHQA 3R40A 1Q6ZA 2UZ3A 1I1NA 4CC6A 3QHQA 1H6DA 1JLRA 1T0PA 5D1NA 3NNDA 4L6IA 3OLVA 4DDTA 2NTYC 2R00A 5G4KB 4Z4IA 2YL2A 5FLXN 1O3YA 2QL5A 1AGNA 3UWPA 3KQLA 4WDQA 2C7BA 3OQOA 1E2QA 2ODEA 1WXFA 2LE0A 4M86A 1KZHA 3AM4A 3H9VA 4NYMQ 4A6PA 1DLBA 1TA8A 5LL6Y 1AZSC 2I91A 3O2QB 2J9RA 1I3KA 2ZRBA 2FVYA 2VNJA 1KR5A 2FEXA 1J8QA 4DUYB 2NSYA 4RPHA 1SXQA 1ZSNA 1J2YA 2ZAMA 3L1UA 1JAZA 1MEOA 3OLCX 2VK2A 4XWOA 2YZGA 5C7LO 4TRJA 4G4IA 2WVAA 5LC1A 2P5SA 4JXZA 2JS7A 5T67A 2B5VA 2F3PA 2EP8A 3WYFA 5IYZA 1MRZA 4YJFA 4V3CA 1ZONA 1NS1A 3QV2A 1FP2A 1TAQA 4F3CA 2I65A 3GUVA 4X71A 3FGOA 4MV9A 4OFBA 1VIMA 1EKXA 1ABBA 3LX8A 1W6UA 4CVNA 4DEYA 5AKKA 5JJNB 4TZ6A 4QREA 4V0OA 3HWX1 4GZLA 5JNWA 3LTNC 3WHPA 1CDOA 4RH1A 2IZ7A 4OBXA 1RLUA 1V45E 2VTBB 3H4TA 5JXJA 2XA1A 5DRTA 1YJXA 4M9XA 1DGQA 2A4KA 3U4GA 2CMHA 1YL6A 5JIBA 2QNBA 3O9OA 3PXGA 1NW5A 4L7QA 3VZQA 2XZDA 5CYOA 1WXIA 2Z8YM 1FS6A 1QU3A 1PKXA 4KXVA 1TF5A 2QUIA 2Q2WA 2WI8A 4LF4O 4MVUA 3I42A 2C0PA 1S2DA 1M54A 2GSMB 2A59A 1SVWA 3IOCA 4KNYA 3HR8A 2ZR8A 1RCFA 2EIKC 2BMDA 1WBJB 3K70D 3LPCA 4NCJA 1XZIA 2XMZA 2Q73A 4XRGA 2W83A 2WLIB 4MYSA 2G17A 3WL7A 2VYVD 2PQMA 2WTUA 2ZZNA 4D8UA 1MO6A 1P1BA 1E0JA 1D0SA 4UXHA 4JNKA 4D80A 2VP5A 2R8EA 3DDOA 1JAIA 2F64A 4U7NA 1SB8A 2A35A 2R1TB 2GERA 5H2FZ 1P3JA 5K4AA 5C46F 1DC4A 4L5BA 2QORA 1X7GA 3MCTA 4UMEA 3TIGA 2D1YA 1CHNA 2GTPA 1YOBA 2B78A 3SSNA 3TOCA 3SY8A 4Q37A 5DULA 2R44A 2A9FA 1W2GA 3V55A 1BNCA 2EF1A 1HMPA 2ZJ4A 3FNHA 4ZGGA 5FJJA 3S2IA 3TNJA 1W9MA 1M34B 1FNBA 3QVWA 1NXOA 3IAFA 4CEIA 3ND7A 1UT6A 4FUQA 4C4OA 1XO1A 5I51A 4U7WA 3R09A 3K59A 4KDEA 4UCOA 3DV2A 3ILSA 3L8YA 1AI6A 4R7CA 4WLNA 5BWLA 4AY3A 3KXKA 4J75A 3NM6B 1JQJC 3N76A 3G0HA 3ADBA 2I8CA 4I4LA 2QE7D 4OKSA 2BV3A 1VCNA 2X77A 3R4CA 2FPPA 2P91A 1QRRA 4GDFA 2DCMA 4JI4O 1Q83A 3CX5F 2JLZA 5FJIA 4A6XA 4K9QA 1PR3A 1IY1A 2BR4A 1S6YA 4MI9A 3A4YA 1WF3A 4QU8A 3G7SA 5CRIA 2YWEA 2AV6A 3R6DA 5DN6D 3C8ZA 3IHLA 2GDZA 2OCYC 2D1QA 4PN3A 3W34A 3OX4A 3TZCA 4WY5A 5DK4A 3U09A 1CT9A 5DM60 3OAAD 3IXMA 5IJ9A 2CJXA 1IG3A 4ZMBA 5MDHA 5EIHA 1R8YA 5IK2D 5LCXA 2YR0A 1CBUA 3G9QA 4OUKX 1A4IA 3O0DA 5E7MA 2O8BB 3IKJA 2YN4A 5EPUA 3KE8A 1GPH1 3WQRA 4LJKA 3S4YA 5J47A 4OO3A 5DYGA 3IEUA 1SC6A 5IEBA 2GO1A 4I4TF 1Q6YA 4PBSA 3S7TA 5JXHA 1Y1LA 2PKRA 1FUKA 3ULKA 1AKTA 4BXOA 3N07A 5ULLA 4TYMA 2ODTX 1JFSA 5EERA 1PF7E 3NOQA 4QODA 4NS1A 3PNKA 4TKMA 4XD7A 5EBLC 2Q1SA 2WAMA 3L70H 3F78A 3RVJA 1M66A 3ZRXA 1R1DA 5D5QA 5FO1A 1QH0A 3NHRA 3ZBQA 1V2GA 3BIOA 1GGMA 1ELOA 2FMTA 1WWKA 3OIGA 3UGTA 4KI7A 3N2KB 5FUXA 1XMOO 1I2BA 3K79A 1EESA 4OPMA 4JBHA 4C7OB 2O7SA 1WCIB 2BEUA 1KYWA 1ODLA 3WIEA 1FMCA 4AMUA 4NHOA 4D3DA 2NR5A 1TU0A 4INAA 1GOTA 1QRTA 4RZHA 2ZYWX 3NDRA 4WKBA 1PNOA 3RSFA 1W36D 1PT7A 5U4XA 1G42A 3P9YA 1GPLA 1QAOA 3F9CA 4BVBA 1Y66A 1KDVA 4N3NA 3U11A 2WR8A 5F2KA 4D99A 3R41A 2EDAA 2DR2A 1TRHA 1NF9A 4EFKA 5KYGA 3LYAA 5DCWA 1ODFA 3RVMA 1R15A 2G28A 1L1QA 2AZ2A 1QP4A 1RXEA 2WFZA 3MQFA 1M1ZA 1AV7A 2NUPB 3WIBA 3RSZA 2H9AA 3ER8A 4GT1A 2I6TA 3DWGA 3IDQA 4GI7A 4NFYA 1IATA 1IY2A 3DV0A 4C3ZA 4EMUA 3A4IA 4M9CA 4RH0A 2Z95A 3E48A 3PNOA 2POQX 5I9LA 5ILGA 1KB9F 2YV2A 3BXHA 2KG7B 1Z63A 4R1UA 1G21E 5U4QA 2ZBUA 3LLMA 3N8GA 4RABA 4ZOLA 5GOTA 3COYA 5LKAA 1D5WA 1VHJA 5IAOA 3CA8A 1Y5MA 2RGNA 2WILA 4KKVA 1DKMA 2VNHA 1S3GA 1FXSA 2ZWMA 3DMDA 5KAPA 4GNRA 5AKHA 2XGSA 2FPIA 5FOUA 1RYMA 3AG3C 4GM0A 4HVCA 1JG4A 4I2VA 1D6JA 2RIPA 1QPBA 1RAFA 1I1OA 5E3JA 1ODSA 3SDBA 3WGLA 2JJ1G 2PGAA 4XOIA 1MH1A 3HM2A 5K8TA 5F7XA 3R0IA 3ETJA 3K9SA 1FLDA 1YEWA 2YMLA 2E1PA 1KYYA 2QNIA 4EFNA 1JYFA 5EJ8A 4ID9A 1U5CA 3O2NA 5HKAA 2DQKA 3O3MB 1KL7A 1Z39A 1U28A 3ON5A 1H2XA 2QN3A 3A4TA 4F4CA 3EC1A 2DZDA 3E2IA 2I2WA 4MH0R 2ESRA 4HADA 4NI5A 2F17A 3GWGA 1VP9A 2V6IA 1EU1A 4TX1A 2VP3A 3NW9A 3QA9A 4OJYA 3VJRA 2GRUA 1Z7GA 2VNKA 5AOCA 1WCYA 1KBOA 3O7WA 5F35A 5EHQA 5F2VO 3Q9LA 2NVBA 4AMYA 2HI0A 2HEPA 2KJQA 3MAJA 2YS8A 3ZBPA 2QKCA 1D03A 1U8ZA 1XTZA 2PWYA 4LXUA 2OV6A 1IJKA 5IJ0B 1B3QA 1MABA 4C20A 1VL1A 3DZHA 3II6X 3UHFA 4AJLA 5CHYA 4YHHB 5AESA 1SD2A 4UVDA 3CWZA 1H6BA 2BMAA 1JP7A 3JQAD 4HN2A 2HU5A 1PJZA 4HSGA 4DQVA 3MMZA 4NFSA 1W96A 1E2MA 4NCNA 5IC6A 3IH5A 3DL4A 3C85A 1QR2A 4YMGA 3I8SA 3HCFA 3FHLA 4BYGA 4KFMA 1IEQA 2QIOA 3PPYA 3QKRB 1K7SN 4ZAWA 2DVMA 3PRHA 3OCXA 1CVRA 5H1YA 1NN0A 4JD5A 1EX7A 3AVQA 2N46A 1JT2A 5FOXA 5L6MB 4E5PA 2W9XA 3CPWU 1IVYA 4BW5A 1LV8A 2Y1OA 5DLYA 4WXPA 5JAQA 3ENWA 4LJ4A 4KE7A 1H4SA 1FXUA 2QRLA 1CR6A 2L0XA 1TA0A 1XLVA 4F8JA 4HJXA 1JHAA 3OHMA 3GGDA 2OG2A 4UVHA 4KXLA 3MDSA 1WZNA 5IVHA 2GSWA 3VJLA 4ZVUA 1DIHA 4X6YA 3GJ0A 4I9NA 1TTPB 3LBIA 2FN8A 4LA4A 2QVXX 3C3PA 1Z2OX 3DBRA 2W42A 2H85A 3K53A 2GUGA 3L1VA 2Q7DA 3EZXA 5BQ3A 3B9PA 2LBPA 3R4VA 1E60A 3TTWA 3I6MA 4Z3DA 2YHAA 3OIDA 2K2WA 5CGZA 4QGHA 3JQCA 3CRAA 3QOXA 2IEGA 4M1WA 3HXPA 4TTJA 3BCCH 1TA4A 3LJKA 4HYYA 3H1EA 4M4SA 2BDEA 2RDMA 4FI3C 1NULA 4HB4A