2O57A

Crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
282
structure length
282
Chain Sequence
SKTVKDNAEIYYDDDDSDRFYFHVWGGEDIHVGLYKEPVDQDEIREASLRTDEWLASELAMTGVLQRQAKGLDLGAGYGGAARFLVRKFGVSIDCLNIAPVQNKRNEEYNNQAGLADNITVKYGSFLEIPCEDNSYDFIWSQDAFLHSPDKLKVFQECARVLKPRGVMAITDPMKEDGIDKSSIQPILDRIKLHDMGSLGLYRSLAKECGLVTLRTFSRPDSLVHHYSKVKAELIKRSSEIASFCSPEFQANMKRGLEHWIEGGRAGKLTWGGMLFRKSDKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative sarcosine dimethylglycine methyltransferase
publication title Crystal Structure of a putative sarcosine dimethylglycine methyltransferase from Galdieria sulphuraria
rcsb
source organism Galdieria sulphuraria
molecule tags Structural genomics, unknown function
total genus 106
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.840 Mainly Alpha Orthogonal Bundle Helix Hairpins Mycolic acid cyclopropane synthase domain like 2o57A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2o57A02
2YX1A 3BGIA 3RIEA 1NBHA 2WA2A 3MQ2A 3DP7A 4QQNA 4RTNA 3CC8A 4CTJA 3EGEA 1R6AA 3KPJA 1V39A 3BGVA 3BWMA 2PV0A 2B25A 1YZ3A 1ZHFA 3MB5A 3DLCA 2HMYB 5F2KA 4KDRA 5C9ZA 2ZCJA 1ZGAA 2YXDA 4Y30A 2YQZA 2UYCA 3LBYA 3KQMA 4GOOD 5FULA 5U4XA 9MHTA 2HNKA 1TW2A 3ELWA 3JWGA 3NDIA 1YFLA 3FTCA 3M6UA 4RTQA 1EJ6A 3DULA 4OA8A 4A6EA 3TFWA 1JSXA 4HGZA 5DX8A 4C07A 5KYGA 2UZ4A 4R6WA 5CVEA 5F2OA 3EVFA 4DZRA 3U81A 1KPHA 5CVJA 4EMSA 2PSSA 2GA9A 5CVDA 3HCCA 4ZTBA 1KPIA 3LDGA 4P7JA 4YUWA 1IY9A 2ZBRA 3BXOA 2GS9A 1F38A 2PX2A 2ZLBA 4PCLA 5ICFA 3NVKI 2PY6A 3NW9A 2O05A 3SSMA 3PVCA 1JTFA 2HR1A 4FGZA 4R8RA 3OFJA 4BY9E 4GEKA 4EK9A 1VPTA 3KQVA 1ZQ9A 1NT2A 4Y2HA 5EMKA 1INLA 1FBNA 1UWVA 1NW6A 2PGXA 3JWIA 1MHTA 3DUWA 3B3FA 1XDUA 4FP9A 5CIYA 2IH4A 5C0OE 3L8DA 2BZGA 3DMFA 1NW7A 4CTKA 2FPOA 3FUVA 3HA7A 3NVMB 5DM2A 4PYMA 2OO3A 4F85A 2AOUB 4PCAA 3NWBA 3SSNA 3KR9A 1TW3A 1N7IA 5DM1A 3NTVA 4P7FA 1RJGA 1JQDA 2O0LA 3HCAA 3T7SA 1WS6A 1FP2A 3ELUA 3KPWA 3OU7A 2CMGA 3M6VA 3EVZA 3PFGA 3BGDA 3LDUA 5E9JA 4EVIA 2ORED 4JXJA 4KIGA 5DRTA 1M6EX 2BM8A 3RODA 3HA3A 3IHTA 3FTFA 3UFBA 5FADA 2PLWA 1N2XA 1IM8A 3X0DA 3PB3A 3R0QA 1G60A 2BR3A 4P58A 3HVHA 3KR1A 2BM9A 3PS9A 4V0QA 3A26A 3SXJA 2AN5A 2AR0A 3UJDA 2UYHA 4RVDA 2YXLA 3ANXA 1YUBA 2R3SA 4FR0A 1X1DA 2NXCA 2AOVA 1ZGJA 2PXCA 2ZIEA 3FPFA 3HVJA 3LCCA 4BLUA 2ADMA 5FA5A 4RTLA 2DPMA 3A27A 5ICEA 2CL5A 3PFHA 2AOUA 3KHKA 3TKYA 4QPPA 5E9QA 2C7RA 5EGSA 3I64A 3GXOA 5GOZA 2FYTA 5HIIA 2FK7A 1G8AA 2VDUE 5E2AA 2XVMA 3FPGA 4RTJA 3MHTA 3QOWA 4NECA 2R6ZA 3ME5A 1BKYA 3FUUA 2N47A 5FCDA 3OZTA 2BR4A 2ZZKA 3P9CA 3B3GA 4KIFA 4RVFA 2NNWB 3I53A 3K6RA 4M36A 2VDVE 2G72A 2PXXA 4B17A 1VLMA 1TPYA 5C1IA 2C7PA 1O9HA 2JHPA 2AOXA 1OR8A 3OZSA 2K4MA 2Z6AA 4E2YA 2FCAA 4MQ4A 3R24A 2AVDA 5DXAA 1UIRA 4PIMA 2QM3A 3HA5A 1AQJA 1B42A 3CJRA 5DM4A 4PNEA 5FWAA 4E31A 4CWAA 2P3QA 1SKMA 3EVDA 3HCDA 2I6GA 2IGTA 5LQJA 1RI2A 4RTMA 2PX8A 4FZVA 5EG5A 5T67A 5KQSA 4AX8A 4CKBA 1X19A 2P7HA 3BWBA 1QYRA 3UWPA 1PRYA 2ZTHA 3P9NA 2B3TA 3HVIA 4U7PB 4E30A 2H00A 2PJDA 2B9EA 4L7VA 3G5TA 4M7RA 2AN4A 1QZZA 3P9IA 2PVCA 2VS1A 1ORIA 3DMHA 3VC2A 4DKJA 2P8JA 5DRYA 3ERCA 3A7DA 1XDSA 2VP3A 1L9KA 1AV6A 4RVGA 2I7CA 2P3OA 5GP1A 1YFJA 3UZUA 4OQEA 2PT6A 5LQRA 4RYLA 4GBED 4HTFB 3GRYA 4U7TB 5DX0A 2CMHA 1XCJA 4PYNA 1VP3A 4H0NA 3DTNA 4PINA 4R8SA 3LCVB 4AZSA 3DH0A 3EVAA 3UJ9A 2XYRA 2ZWAA 3SR4A 2Y1XA 1EIZA 1KYWA 3MTIA 5LQAA 3MERA 3UJ7A 10MHA 1VQ1A 1WZNA 5HIJA 2YVLA 3EEYA 1RI3A 3KQQA 5GINE 1Y8CA 2P3LA 3I9FA 3LKDA 3WSTA 1EG2A 2V7EA 4X60A 3CJTA 4PGGA 5K8VA 2F8LA 1BHJA 3M6WA 3C6MA 5EIFA 4GUAA 4ER7A 3M4XA 2V74B 5GIPE 3TQSA 3TM5A 1HNNA 2YR0A 3GGDA 4FSXA 3AXSA 2OPBA 4P7KA 5D1NA 3RW9A 2PBFA 3P71T 5EIWA 3REOA 3UA3A 3UA4A 4F86A 3CBGA 2NP6A 4HTFA 4QTTB 3KKZA 3GCZA 1L1EA 3NDJA 5E9WA 1ZG3A 1JG2A 2UYQA 3KR0A 4FSDA 3T7RA 4LG1A 4OBXA 3B7PA 4GC5A 1SQGA 1ZKDA 2O07A 2WK1A 1SQFA 3KQTA 3Q7EA 2WA1A 5H02A 4KVZA 3E7PA 5DSXA 3MCTA 1L3CA 3CCFA 5CVVA 5IKMA 5K09A 5DXJA 5FHQA 5K0JA 2NXNA 4RTKA 3I58A 3OE5A 2OYRA 2VZ9A 2GB4A 1VP9A 4RX1A 3FZGA 1NW8A 1G55A 3G7UA 4XUEA 1X1BA 2HV9A 5M5BA 4E2XA 3P9KA 4LWOA 2ZW9A 2C7OA 4QTUB 1U2ZA 1P1BA 4QVKA 1SUIA 3UJCA 3R6TA 1R8XA 4HRAA 3PT9A 1XVAA 2PWPA 4QDKA 1I4WA 5ICGA 4X63A 5FWDA 1VIDA 1D2CA 3FYDA 5FQOA 2GLUA 3A4TA 1QANA 4QVGA 5HOQA 4EQZA 3BWCA 2ZULA 2AOTB 3D2LA 3EGIA 1BOOA 3EVCA 1JQ3A 4WVLA 1JG1A 5LSAA 2ZVJA 1IXKA 1R00A 1SVUA 3ELYA 3KPUA 1EAMA 3UJBA 5K03A 4KDCA 3AXTA 1WG8A 1KIAA 2IFTA 5EKUA 4O29A 5FA8A 4YV2A 1XTPA 5K0LA 3HCEA 2AS0A 4YUVA 4YUZA 3BKXA 1DL5A 5JR3A 4CKEA 3OPNA 3K0BA 2O57A 1WXXA 5K0NA 3ER8A 1KYZA 3HP7A 3A25A 3T7TA 4RTPA 3LSTA 3HCBA 4RV9A 2IPXA 1NE2A 1QAMA 3CKKA 4E2ZA 3B3JA 3DOUA 4PYIA 3LKZA 4C05A 1VBFA 3GRRA 4EKGA 1WY7A 4MTLA 3IEIA 5DTMA 5LQCA 1VE3A 1G8SA 2JHCA 1QAQA 3G2QA 4KWCA 2PX5A 1D2GA 1L3BA 2IH2A 1RJDA 1RJFA 3PX2A 1I9GA 3UJAA 2AN3A 3DXZA 3S68A 1XXLA 3GJYA 3E23A 1X1AA 4PYJA 1X1CA 2FRXA 3ELDA 4HGYA 4PWYA 3R9XB 3THRA 4C03A 3EVBA 3EVEA 3P2EA 3FPEA 1BC5A 3I5UA 4P7GA 5HZMA 2AOTA 2OZVA 4POOA 5LQKA 4YV1A 4DQ0A 3CGGA 4AZVA 2XYVA 1NBIA 2P41A 3AJDA 3B89A 4X1OA 4C4AA 2AOWA 5K0CA 2NP7A 4IV8A 5FHRA 3NWEA 3KQWA 3PX3A 5K05A 1FJXA 4PYKA 1M6YA 5EHGA 2I62A 4OBWA 4A6DA 3MTEA 1G6Q1 4QQKA 5B1SA 3O31A 3C0KA 4AZWA 2IDJA 1DCTA 2QRVB 4BLVA 3JWJA 2BH2A 3G89A 3GIWA 2IH5A 2EX4A 3LGAA 2Q41A 5LQUA 3TLJA 1N7JA 1YZHA 2AVNA 3DLIA 1KPGA 3DXXA 3VC1A 3M6XA 3OE4A 4ISCA 4CKCA 4IV0A 2G1PA 1G38A 4ER6A 5EQJB 4UOEA 2H11A 2ESRA 1NW5A 5DPMA 4R6XA 3DXYA 5E1OA 1I1NA 1T43A 3P97A 2ZFUA 2QYOA 2UYOA 4CXMA 4G56A 2XBMA 3PTAA 3LCUA 5E8JA 3VYWA 1L3IA 2PXAA 2NXEA 2ZBPA 3OCJA 4AUKA 4ER5A 5K0FA 5KVAA 3HCFA 2Z6QA 2B2CA 1KHHA 2EJTA 3GO4A 4HSGA 4ER0A 5FQNA 3BUSA 3O7WA 4FS8A 5E1MA 5GM1A 5DT2A 4V0RA 4XUCA 3LPMA 4RVHA 4DM3A 4ATNA 3LBFA 3FUTA 2QRVA 3P2IA 3LL7A 3KR2A 2IBSA 2NYUA 2OB2A 2FK8A 2QY6A 2ZIGA 3EGVA 3LHDA 4Z2YA 1FPQA 3H2BA 1P1CA 2P1DA 3C3YA 4MWZA 1ORHA 5CCXA 5HEKA 2A14A 1AF7A 2OB1A 3CVOA 3OU6A 2ZWVA 5EHIA 3C3PA 5LR6A 1YB2A 3HEMA 5GWXA 2ERCA 5T64A 2AZTA 3G2OA 3ER9A 2LD4A 3SSOA 5EMJA 2BR5A 2Z6UA 1MJFA 3G88A 5D1HA 5EEGA 5P8WA 2ZBQA 4MIKA 1SG9A 4C06A 3FUWA 3BWYA 4QPNA 1JQEA 3SM3A 5T6BA 5DM0A 2XVAA 2NXJA 3O4FA 3EEOA 3FPJA 3KQSA 4BP1A 2Y1WA 5BP7A 1RI1A 3R3HA 2EFJA 2DULA 4GC9A 1KXZA 1Q0SA 5E2BA 5EMLA 4QDJA 2OBFA 1D2HA 5EZQA 1F3LA 3ORHA 5MHTA 3KU1A 4E33A 5EOVA 3FRHA 3OZRA 3MCZA 4OA5A 2OXTA 4R05A 5K01A 1QAOA 4LWPA 4HC4A 4E2WA 5GIOE 4GF5A 4DMGA 1O54A 5K0EA 1JSZA 3F4KA 3FTDA 1R74A 4PYOA 4BLWA 5BXYA 1HMYA 2OY0A 2JH9A 3BKWA 3P2KA 5HFJA 3GRUA 4F84A 5LQNA 2E5WA 3GU3A 2ONYA 3ID6C 5HILA 1DUSA 2IBTA 5DTQA 5E1BA 2GPYA 1XJ5A 3TOSA 1NKVA 4PGHA 5CD1A 3UJ6A 3G5LA 4DA4A 1PJZA 4FT4A 1JTEA 2XYQA 3M70A 4HG2A 2I9KA 5IH3A 3OU2A 5EC8A 4RSRA 2G8NA 1R18A 5DTRA 2CWWA 3KPYA 5EPEA 5EZSA 1EJ0A 8MHTA 3Q87B 4FT2A 2PT9A 2OKCA 2P35A 1XDZA 3TRKA 3FTEA 5ICCA 3IV6A 2ZSUA 4XCXA 4HH4A 4PYQA 3FUXA 3HTXA 2CKDA 4RTRA 3SGLA 4DCGA 1P91A 3GWZA 4M37A 5CCBA 2ZZMA 5FUBA 5K0BA 1Z3CA 3QV2A 2EJUA 5E8RA 2P7IA 2EG5A 2O06A 5DX1A 1JR4A 2P40A 3JWHA 3M33A 4LECA 3BT7A 1KR5A 3G8AA 4IKPA 2YTZA 3GDHA 3GRZA 5E1DA 2IDKA 3E8SA 3HM2A 1NW3A 3KQPA 5GM2A 5CUQA 5CM2Z 2QE6A 3SX0A 4DF3A 2PWYA 4K6MA 2YXEA 3A7EA 5HIKA 5JUWA 4XUDA 2YUIA 2PX4A 3LX6A 2GAFA 1M0EA 3KQYA 3MAGA 4ER3A 5EKXA 5CVUA 4WXHA 1JG3A 3CJQA 3UBTA 3THSA 3GNLA 3V97A 3KPVA 1UFKA 5HIMA 1NV8A 3C6KA 3IYLW 3NJRA 5BW4A 5FTWA 3FYCA 2B78A 3LECA 1H1DA 3KQOA 5G02A 1R8YA 3G8BA 2G70A 3SMQA 4OX9Y 2VDWA 3FRIA 5EMMA 2G71A 3SVZA 1RI5A 1RJEA 5DLYA 2ZZNA 1EQAA 3PLAE 1WXWA 4KW7A 2JJQA 2IP2A 1JG4A 3B5IA 1AQIA 2HTEA 4YUYA 2C7QA 2ONZA 3FPHA 3TKAA 2KW5A 2ZIFA 4AZTA 4E70A 5BW5A 3AY0A 1YF3A 4YUXA 4GQBA 1VL5A 3MGGA 5EVJA 3OFKA 4OQDA 3V8VA 4DCMA 3NMUF 4YV0A 3TR6A 2GH1A 3E05A 2H1RA 3TMAA 4MHTA 4BP3A 5F2NA 3EVGA 1NV9A 2JHAA 4IWNA 3G2PA 1O9GA 1RI4A 2IIPA 4X41A 3TM4A 3AWIA 3QOXA 3GRVA 4RTSA 5DWQA 3G2MA 2FHPA 3EPPA 4EKIA 2JG3A 1KP9A 5DSTA 1P39A 3DMGA 3DR5A 2HWKA 3TPZA 5ERGB 4PYLA 4C04A 3EMDA 4RWZA 4PONA 4YMGA 1SUSA 1FP1D 1XCLA 3HNRA 4GOND 5EEHA 5KQRA 2PKWA 4C08A 3P8ZA 3LDFA 4GOLD 5K0GA 4X61A 4KRGA 5KS2A 1Q0TA 3UJ8A 3EMBA 4PIPA 2JH8A 4YMHA 3BZBA 4GOMD 3VSEA 4E32A 7MHTA 4M38A 4RTOA 3HVKA 3T0IA
chains in the Genus database with same CATH superfamily
4I4CA 4IIYA 4JGBA 1EZ4A 3IAFA 5JO0A 4F5ZA 5EP4A 1RM3A 1QLHA 3USZA 3P1JA 3G9XA 4N47A 1ZP6A 1YFZA 4HAZA 3R20A 5CVEA 1EUDA 3LPCA 3PE4A 2X19A 1FX0B 4GYCB 2DTXA 1KF0A 4AQYO 3HJUA 1J99A 1P44A 3EBLA 1PS9A 4YJ3A 1YHNA 1WJZA 3UMSA 1GLGA 1QQCA 3IDZA 4PCAA 2Q3EA 4EHKA 3VH2A 3HCAA 3ZDEA 3U7RA 1EFUA 1K3EA 4X7RA 1Y89A 1ZICA 3CXCU 4H31A 5BWMA 1DV2A 3JYLA 4YDRA 1TQHA 1Y1RA 2YYAA 1ZGBA 2Z3VA 2FPPB 4HQOA 3EC7A 3AR6A 1Z3IX 2OVFA 2CDAA 1VQKV 4QPPA 3Q3JB 2YQ4A 2FK7A 2FLWA 2WJHA 4PPQA 3L73H 5IZCC 1Y8RA 3GJ7A 1VIAA 2N3ZA 3OZSA 1K5HA 2YY6A 2UUOA 2QVYX 5JBQA 4PFSA 2CVFA 1BH6A 4FZVA 3A06A 4NE7A 5T6MA 1ZH2A 1PR0A 3CWZA 4I08A 1U96A 1NTOA 2NVUB 4QTZA 1RLOA 4KP4A 1R3UA 1G8MA 4GVLA 4URYR 1D09A 1YRHA 1Q2XA 4OGFA 1ZRNA 4B5LA 1ZMTA 4N18A 4B44A 2QWRB 2DT5A 2PAAA 4US2R 4INAA 3AUUA 2CBGA 4HAOA 3RVNA 3ABLC 4HAWA 4TS3A 1KJ9A 2A59A 2X1VA 4JT9A 4HDCA 4YJ2A 3KR0A 3PDUA 4NCHA 2WU8A 2C84A 3BSYA 3CNHA 2RHBA 4H60A 2PT5A 3E4DA 2ZOSA 5TT0A 2RGUA 1KO4A 5JH7A 3VR2A 2Q1XA 3VAAA 4URHA 1VIDA 4WXPA 2ZR0A 2DUMA 4GMFA 3H4VA 3PR3A 2KS6A 4YREA 5LOVA 2WU1A 5MGBA 1GTG1 2AWNA 1PFVA 4WN3A 4ZXPA 1GGFA 3VBBA 3VVMA 1NVPB 3DW1X 3ZIUA 1IBKB 4D1YA 1B43A 3NBYC 1NBMD 5JNVA 1MOZA 3DKVA 1IYZA 3EY9A 4HDSA 5K0CA 1T5DX 2BFCA 2OMKA 4C3UA 2BCCH 1KMIZ 4IS2A 2V55B 3RYCA 1CUCA 1ZNZA 4OGGA 3TLXA 1ZWIC 5J63A 1JNYA 2NXEA 3EG9A 1STOA 2Q0HA 3WRVA 5CGQB 5B1NA 4WZAE 1ZCZA 2HQ1A 3ZG6A 1PDWA 1W96A 1M2VB 2CVHA 2MSKA 3W6UA 3FVQA 4ILEA 2HAEA 2CXQA 3UK6A 3SPJA 5LYJA 5KYYB 2HCFA 2QM7A 2IUFA 5D6NA 4W8OA 2FZEA 2Q1UA 4YEDA 1NWHA 4PSKA 3ZI4A 1TD1A 3RVMA 1MPTA 4RZIA 5LB4A 1UC5B 2H7XA 5B30A 2FQXA 3NIFB 5CA3A 1K7EB 2XA1A 6GPBA 4Z5XA 1UBSB 3CO0S 4YR9A 3QLVC 2GLTA 4BMZA 2DFNA 1AD2A 3EW9A 2XRZA 2RGBA 4BMYA 4MICA 2FHSA 2OHHA 4RTRA 4V02A 4A8HA 4OMFG 5BSHA 1FDOA 5TJ9A 3UC5A 2W5UA 3WK6A 4NJMA 3KSMA 4LBZA 3JQQA 5FH9A 2VQFB 4Q4AB 3V97A 3RI3A 3PWSA 2X6BA 3E22B 3FWZA 1UEXC 3QU5A 3JALA 1PLJA 4S12A 4N3AA 5JCJA 4GYKA 5ADVA 4DK1A 2WYUA 4RSHA 2VDRB 2IXEA 2NUAB 2PSDA 4L7QA 1GNLA 2VVTA 3PUWA 3V32A 2WLLB 1U7XA 4FFRA 1CYDA 3TBKA 1E4OA 2V03A 2EP7A 1LDBA 3NOOA 5K1ZA 4X1KA 4B34A 4L8GA 3KOUA 5CDFA 1H2EA 3NBMA 4YRSA 3F6EX 4RTOA 2DAPA 3TDNA 4P3YA 2AXPA 5TMPA 1R6AA 1PS8A 3PC8C 2JFOA 2E0IA 2BYTA 2X5OA 3KSAC 5LZ5A 1UAYA 1QV9A 3QE2A 4JV5O 1I32A 3FETA 3I01A 2PQ0A 3GA7A 3G79A 2YHUA 1FCJA 3T7AA 4KXXA 1J5EO 2D0DA 4XWKA 5FL7G 3UC9A 4J0GA 1XN4A 1FMTA 2ZI9A 5IWAB 2ANBA 5TS3A 1PFKA 1R0ZA 4AC9A 4N7JA 1XCBA 1V41E 5G2OA 4XX0A 4ZO7A 3V5NA 1PJLA 5B2EA 3CUSA 1R6TA 1M6EX 3WYFA 4ZQCB 3SXJA 3O1JC 2AR0A 5KHOC 4NYIQ 3U4HA 2XQGA 4KRYA 2RGYA 2HHJA 1JDZA 3NM6B 4MYHA 2J7PA 4EP1A 1I6MA 2BH9A 3KKQA 3HCNA 4NZYA 1QIEA 2Z2IA 4G81A 1HBJA 2OESA 5GONF 2ZI7A 3BIFA 3F74A 4JLAA 1PK7A 4N7MA 4NCIA 2NSJA 5KYNA 2WJZB 4FMCF 1XKTA 3T7EA 1DBQA 1LWNA 3ERCA 3F4LA 1MP0A 4KQIA 1PJRA 1MABB 4R8SA 1EM6A 4DEYA 4J0QA 3SKVA 2WTEA 4IY1A 4H6XA 3KQQA 2QTWB 3S7ZA 1SC5B 3S0JA 1GKUB 5AK5A 3E9EA 1WDLA 1KI7A 1SRRA 2AWOA 3UQ8A 2Y9MB 3UO8B 2YZKA 3ZXUB 1DC8A 2FPSA 1NIPA 4B3MO 4PSUA 1DBWA 2BTOA 5FQOA 4EQZA 3EGIA 3ZWBA 1NDHA 1V5IA 1G98A 4M49A 1ZYUA 4FZ1A 2GHRA 5J5AA 1DQPA 1C9DB 3DYIA 1VLLA 2WV7A 3VJKA 3SHFA 4Q16A 2A1TS 5CB6A 1H3FA 1USKA 2R84A 3SJQC 4ARBA 2B4AA 4C03A 1WP4A 5CLQA 2AHYA 3DT6A 4K40A 2WEKA 3FJ1A 1UP7A 4DUGA 4Y6QA 1Y5MA 5T4FA 4ZKIA 3D8CA 1CQJB 1GRCA 1XZAA 4H4CA 1V47A 3AF0A 4J94A 4CF6A 3D4LA 4BB9A 3GIWA 2D5LA 4FJ1A 1I7LA 4ON9A 4GICA 2QG9A 4BUZA 3FWHA 1EGHA 1NASA 4GXTA 2LW7A 1Y9EA 2WVHA 4W5RA 1JJIA 4DM3A 1E2QA 2QLJA 2ZGVA 5AVSA 4HFRA 3D8NA 4MWZA 1RLJA 5FO0A 3SS9X 2B92A 4IMRA 5JAOA 3ER9A 5KSYA 2F43B 4HEA6 1RI1A 2A30A 4K88A 3U9SA 4FGSA 3PVZA 2F1RA 1CF4A 1QLEB 5CP8A 2I91A 4GE3A 1KIMA 2OK7A 3SGIA 1SVOA 2ZTUA 3SYRA 1O5IA 3SC3A 4LYEA 2A5LA 3D3EA 1OCZB 2WHXA 5DHQA 2GJ4A 4D9GA 4C88A 2A9JA 3FUXA 4KGZA 4FI3C 4YJHA 4ZXFA 2FR8C 4MOWA 1KR5A 4FFOA 1X1RA 2O1XA 3VGJA 1KZ7B 4DF3A 5JJEB 3EZXA 3TSOA 4G84A 4ZJPA 4UASA 3L0SA 4O1HA 1B74A 4H59A 1L4UA 3IKVA 5KNCA 4K9SA 2WHRA 2I7VA 1JEAA 2DWUA 4KW7A 1B16A 2PLRA 1G5RA 4LH6A 3PRYA 4FHZA 1W75A 1IBRA 3QO7A 2BGTA 4UBIA 2NU6A 3EHDA 2VBCA 1WXFA 2FPPA 3ZWNA 3EA4A 3W7BA 1JALA 1Z82A 4EUSA 1K2WA 2XTNA 2ZEJA 4JI6O 3P8ZA 1RYDA 2H1VA 1QORA 3IP6A 4NLLA 3ZGLA 5KYKA 4JAVC 2NIPA 2WA2A 3ABSB 4HZ3A 3D5EA 2O50A 1GZ7A 2IYTA 1CWUA 3F5QA 2EF1A 5HF9A 3K0CC 4P93A 4OH7A 3PEWA 1Y8QA 7REQB 3CNLA 3I30X 4QUIA 4E5MA 1O94A 5KHGA 1V9LA 5L3QB 3GVPA 1WL8A 2PSSA 5J2TA 5IXYA 5FLXN 2QVCA 5KTYA 1DC6A 3ONWA 1L7PA 3RKSA 4G1CA 2I8AA 1VPTA 3QK7A 3AHCA 1R0BA 1NVVQ 2G1UA 4FVTA 2IH4A 1B0UA 1I1QB 3L6RA 4K9MA 3EAQA 4J3NA 1M34E 2O2HA 3DZDA 5BMVB 3UFBA 3WLKX 1A04A 1E5QA 4MR8A 5IUKC 2CZCA 1YDMA 3LCCA 2RK4A 2CD7A 2XSZD 4GYYA 4XM1A 5H1YA 1FFCA 2CL5A 1WMAA 2FPGB 2OAGA 5FJJA 2RBKA 2PYZA 5FCDA 1CEYA 2JJMA 2D2EA 2IELA 1X7XB 4PG5A 2QLTA 1ZDMA 1XZMA 2HREA 1Z0AA 3ZJ4A 5F35A 3MWEB 4R9SA 5CH3A 5JFGA 3WG7B 5ALSA 2WJWA 1VRCA 4UFPA 4MNTA 2CH7A 2IY8A 1QP7A 4J49A 4PLGA 3WNDA 1XE3A 3ACBA 1DK1A 2IV7A 1XHXA 2GN4A 5A9SB 1PX0A 4UUQA 3JD4A 3CRNA 3LXUX 4J80A 4KXNA 1C80A 2VUIB 3CSDA 5EQFA 3W34A 3ZX6A 4RM3A 1S9DA 2UYGA 3SWWA 3REOA 3NIBA 1MB0A 4OBBA 3OUZA 5LQDA 2RKBA 2PGLA 1UM9B 5BRJA 2ADFA 2ZR2A 1KDRA 4IMJB 5TR9A 1M2VA 1ZNQO 3GG2A 4E6EA 4CLHA 3WLOA 2X40A 3RUDA 5BN4A 3CIOA 1TO2E 2PWPA 3URKA 3UUEA 2FMHA 3Q8WA 1KI9A 2EILC 4V3BA 4G5OA 5SZJA 5GGYA 3HKBA 4D5GA 1GM5A 1ECCA 1GR1A 3J7AC 4IEIA 3HP7A 3RSQA 2JEUA 1BMQA 2OA0A 3S68A 1NM5C 2IV3A 3IKTA 2RE8A 2DKFA 4HGYA 3P19A 2OCCC 3BBLA 4ZVNA 2ZYIA 1ONNA 3ZGXA 3SD7A 5B4TA 4LF9O 1QYVA 4HYYA 1WUJS 1NU1H 3PUIA 4NFHA 1TVKB 1LDEA 3KG2A 1GWNA 1O58A 4JIMA 2A0UA 5D3ZA 2ESRA 1J6UA 3OJEA 2C78A 1CDZA 4A0SA 4Q1AA 4BLTA 4QASA 1M6HA 3RYFA 4IIVA 4ZC1A 3VA7A 1BN6A 5FTMA 4M86A 4CG1A 3ML1A 4FZ0A 3CT6A 1XGKA 3B6EA 5IASA 2WLLA 521PA 4HPWA 1XNRB 2OCAA 3Q6NA 1HW7A 2ECKA 1DCKA 5FQNA 4EA6A 3SE7A 2PZMA 4PSCA 1FFXB 1WPQA 5E4JA 3CNOA 5K0EA 2NXWA 5AVXA 4LFBO 2PYJA 5H7XA 2A7QA 2IODA 3HJGA 4ND6A 3FBTA 3KL2A 5HILA 2NSHA 2IBTA 4WZBE 1DGSA 2PRYA 3SDLA 5CT4A 3ZS9A 5ICCA 4J41A 2ZJFA 1L5OA 3DEAA 1KWKA 3WK8A 5DX1A 2IW5A 1U2QA 1WHSA 4GMXA 3CS5A 3O82A 4OFXA 1IQRA 2E7ZA 1BQ3A 3QW2A 1P72A 3R6GA 2D1SA 1UDXA 3EYWA 1JIKA 2D3WA 2IP2A 3G5UA 1R6XA 3AESA 2GN8A 5HIAA 2FB5A 4RY2A 3I9V1 4N5IX 3PJGA 2MMCA 4DIUA 1ZM3A 4QTXA 1N6KA 4L4UA 1D2NA 3PCRB 2SCUB 1V8DA 4Y2GA 1H1LA 2J7KA 1I80A 3AVQA 4CCYA 4BIMA 1F0KA 1ZONA 1YMVA 3EC2A 3DZ8A 2R47A 1ZXXA 3VMFA 4RQAA 2QENA 3RSOA 3LQ2A 1E1QD 1L7EA 3QY9A 2VJPA 4BECA 3GEIA 2X22A 3ISVA 2VPZA 2XX3A 1KK3A 3THWB 2B1GA 4PXAA 1MJ5A 2W6JD 1MABA 5A5VA 4R01A 3ZRSA 1QBGA 4BY9E 4MK4A 4OXKA 4FM0A 5F1PA 5K8UA 1CLEA 1KEKA 4HNVA 1Z06A 4DZZA 2JJ1A 3U3XA 3GP8A 4XA8A 3ZV3A 2OAQ1 2ZRPA 1OI4A 2I2WA 4ID9A 1O4WA 3DZIA 1G8AA 1Q1ZA 4BB0A 2OYSA 4GI5A 2BR4A 3S8MA 3I53A 5AM5A 5FDFA 2GHTA 3DXRA 4O4JA 4JYPA 1QO9A 4GXRA 4JASB 3QYPA 3H9UA 4FC7A 3I2FA 5BO5A 5LUBA 3JQAB 3PE6A 1JHQA 2HU5A 4TL8A 3VC2A 1K33A 5F7ZA 2BN4A 4YRJA 1L9KA 3DTVA 5JD6A 4JQZA 2J87A 1ULSA 5ALIA 2BOVA 4F96A 4H37A 3WV4A 4JBNA 5BQXA 3BE8A 4TT3G 1BS1A 3HP4A 5BSEA 1YS9A 1E9RA 3BIOA 3ELBA 4LCBA 1REQA 4ZEWA 3KLNA 1NF2A 1BHJA 3OKCA 4MVJD 1Z8FA 1DTOA 4P8RA 2F8MA 2OPBA 3N9IA 2HEGA 2E4VA 4HJXA 4G07A 3LM8A 2VK8A 2QE7G 5EHNA 1H42A 4ZYZA 2MCFA 1AKUA 2WMDA 2IH1C 1N5JA 4LF6O 2ZRNA 1RD4A 4AROA 3BMCA 2RG7A 4ZVKA 4HFJA 2IFTA 3N76A 4YUZA 2AS0A 4E88A 4PRLA 3AV3A 2ACKA 1KR2A 2XHBA 4NPCA 1DAGA 5A1TA 3LY8A 4X3OA 5F78A 3MXTA 4NBSA 4LI3X 2HF8A 1E5XA 3IA2A 1USWA 4AL4A 2CNWA 3HEBA 2FWPA 1FNNA 2NT4A 3Q1LA 3IUMA 3W3AD 1Y1KE 1XVVA 3GNTA 4ISCA 4QAJA 5L3FA 4ER6A 3FMGA 3U5TA 1Z7BA 1CUBA 4MWGA 5BYJA 2QJTA 2J3JA 3MRSA 2C1ZA 5HFNA 4V0RA 4DMFA 2EL9A 4O4IB 1U8UA 3FH0A 1N92A 1NUAA 3OU6A 2ZWVA 1TKCA 3AZPA 3IC5A 4UB6Z 1XZCA 5FBKA 1BTOA 3WKAA 1Z6TA 3EXFB 5DN6G 5B7PA 3AG1C 2ZAIA 3DMDA 3W1WA 1SZJG 4R1OA 1FFWA 3WXMA 1X1TA 4WHMA 4W6ZA 3DLTA 2E5WA 2B98A 1H4VB 4PAQA 2IY7A 3ZQ6A 1IN4A 4EI8A 4DA4A 3OBIA 1N0JA 3UMYA 4G4IA 4BLPA 2C58A 2P9YA 2CGOA 4CF5A 2O2EA 1H66A 5IF9A 1PBNA 3SF8B 3SY8A 3S2GA 3F67A 3RNOA 3I2YX 5KYWB 3IXMA 2IH3C 4HI0E 4Q4JB 1EUZA 4LXHA 5HQ3A 2OE2A 4RESA 3PUJA 5BMVA 3X1DA 4HAIA 2ZS8A 4X24A 5E4FA 3GAAA 4BNYA 4Y7DA 4Y2UA 2GF0A 4RAOA 4UVIA 4JCOA 1N2EA 1OJ7A 3E1KA 1GTSA 4KQHA 2AFVA 2PEYA 3ULKA 4JI0B 3FMPB 4FKMA 1F20A 1K2VN 4UJ5A 5EGNA 4P4UA 2HJ9A 4B33A 3HVKA 4HGNA 5HFAA 2A06H 1U2GC 2FUCA 3B1XA 3BHIA 3EIXA 3LBYA 5FULA 1Y3FE 4XVRA 3RJZA 1FLAA 3IH5A 3MGAA 1A7AA 1KFCB 4PC6A 4MMZB 4X94A 1NBAA 3LT1A 2QRQA 2EYUA 1H2KA 4N54A 1TZJA 2YZ2A 1DQNA 2GDSA 4UM9B 2XYGA 3L0ZA 2C2MA 4ZDJA 3ECAA 4TTIA 1BL8A 3BFRA 1CS0A 1K0UA 2QMUA 4MHOA 4ENTA 5IAEA 1XP8A 2NX2A 2WC1A 2FMFA 3N75A 2V97A 1XYVA 1Y4ZA 4PFQA 3ZHOA 3O4GA 1GFWA 2XR1A 1N2HA 1DJOA 3R9WA 4D9HA 2IKSA 2BHLA 1XNQO 5A7HA 3UKMA 1DELA 3SS8A 1UJ2A 1EK5A 1W0JG 2H5IA 1XMJA 3PD0A 2IBMA 2Q29A 4FLWA 4LSWA 2EZOA 4MUGA 3PLRA 1O4VA 3MT8A 1PKXA 1FXWA 3QP9A 3OMLA 4R2XA 4RKEA 1N34O 1JV2B 3IP1A 1MOPA 4KQCA 2P62A 5TQ2A 1FD9A 1CIVA 4TOIA 5EQDA 1E9BA 5C1PA 4IV5A 3K70D 3JARA 1BXRA 3EZFA 1EJ2A 4U00A 4D4JA 1TVKA 4Q18A 3K9BA 4TTTS 4KNYA 3X1KA 2XYRA 4Q9HA 3EF0A 5KSPA 1VQ8V 4BQOA 3HUTA 4BZPA 5CB4F 1YU6A 1JIVA 1QV7A 4BP9A 4FM1A 5JPDA 3ZDDA 3ECSA 3DD1A 3EZLA 3EIWA 4K1XA 1GUFA 2G1KA 4D26A 4ZOAA 4LCJA 2V3CC 3NHJA 2W2TA 4EY8A 4AKSA 1JP7A 3K08A 3EQ8A 1DKRA 2C99A 1LPOA 1JHZA 3DZFA 3WHPA 3QHAA 4UXHA 3ODPA 5CFQA 1PUXA 2FMKA 4PI0A 4OPHA 3A4TA 5DP1A 1ZW1A 3BJEA 1XA3A 2V0GA 1CDEA 5FA8A 1YXMA 3F6BX 4TUYB 4XR9A 4CT5A 4KZKA 1YZYA 2DWEC 1VQ7V 2IPXA 4M22A 3VUFA 3E9QA 1XRQA 1Z2OX 1AROP 1K8XB 3PR2B 5AESA 3P9RA 3WP1B 5CA0B 3C90A 1FFYA 1VJTA 2NP7A 2W8ZA 4HH3C 4ZVUA 4DR6B 1XO1A 4QSMA 1R1BA 2O8FA 1LWOA 1JHOA 4NOMA 1AN9A 4BNUA 2ZJ2A 2ADPA 3WGOA 5FEUA 3PGMA 1F51E 4KOAA 3OIGA 1KMHA 1OFUA 2I29A 5JEDA 3L9WA 3HABA 2GCOB 1U8TA 5ARDA 1RXCA 4JBLA 2ISCA 3QRWA 1UK6A 2PV7A 4PPFA 4KR6A 4J1TC 1KFBB 3U7EB 2C2WA 3ORYA 3V8QA 2HFEC 3W06A 4FOOA 1KDOA 5A0FA 1K8RA 1KAQA 4G0PA 4MEBA 3QM1A 3C15C 3IPYA 4IZHA 5GIOE 2Q6VA 1OWLA 2ISQA 1ABFA 3M4JA 3ABRB 3ET4A 2F3TA 1K88A 3X44A 3U80A 2YWJA 1CB0A 5IDXA 1A95A 2PUSA 1ZIOA 1I8TA 2ZTLA 5HQJA 4MTFA 3K16A 4LA4A 1FRQA 4UHKA 5DP2A 1Z3CA 4KYVA 2PG3A 1L5NA 2DETA 4QPZA 5HIKA 2BBOA 4D96A 4EEXA 3SPGA 1WXIA 1F9EA 3CEAA 3QSGA 3KQOA 3TLGB 4UHHA 3F3MA 1K08A 3LBHA 4FR5A 4F2HA 2RI1A 5KTTA 4X84A 2QR4A 1EN4A 2V9CA 1WB7A 4QOHA 4YUXA 4AJ1A 4DYVA 1IZYA 1HDIA 2Q7EA 2MOKA 3EF3A 2J9YB 2R7NA 1KVTA 2GVDC 2ZJAA 2XQKA 1T9ZA 5D3MA 1Q0QA 4WLFA 3IJ4A 2QUIA 3KKLA 2GCGA 2OC4A 1EUDB 2AD5A 1DRKA 3NO4A 1PNLA 4LPSA 1NS1A 3W7AA 1X13A 2EWWA 3AG3B 5IMBA 2P27A 3OT4A 3IMEA 4JASA 3VX3A 4DBZA 5KVCA 3JQAA 4YJ3B 4UEQA 2ZB2A 3TEMA 1CUJA 4F93B 3UKDA 2Z9CA 2MTBA 2JDIG 4NHEA 1NOKA 3VBEA 4RQEA 2YV3A 1WWKA 4E7OA 4FM2A 1E0AA 2Q1WA 1PN3A 1U1IA 3SR3A 3HGMA 3HO6A 1PTJC 3NM5A 1XDUA 2QLNA 3R40A 4M99A 1YL6A 4N0EA 1E6CA 3RCBA 5CM8B 3UHJA 3SZMA 5TV2A 1UAGA 1Y8RB 1YWGO 2RHCA 4UNIA 1SJ9A 1GRRA 1M75A 5EMNA 2QSUA 3JRXA 4OGKA 2C00A 3L82B 2FG7C 4URWR 4DOMA 3MHTA 1Q84A 5KINB 1L7VC 1U11A 3E27A 4KXYA 2EYQA 1PEDA 2C7PA 2FW6A 4E2YA 3IT1A 2R751 1DOAA 1YDFA 2PZGA 3HI6A 1EXDA 3V6MA 4QPJA 4ZHQA 3FFQA 3BC1A 5EERA 1A9TA 1EFRD 2NQTA 1KH2A 1YQUA 1M2JA 5G3ZA 3ZC3A 4YJ2B 4KHPB 3FFXA 3JQ7A 3OECA 4BFSA 2BJWA 3ZQJA 1L5LA 4DCVA 5FPTA 5EIFA 3NBFA 1DXYA 5D1NA 4TKMA 4E11A 1OV9A 4QO8A 5J1SB 2YVAA 1A8SA 3F7MA 5HKLA 1GT91 3B7PA 3B70A 3T4ZA 1I3OA 5LOVB 3CD6V 3OE5A 3LBAA 5BUCA 1QCYA 1UFOA 2I99A 2ZSBA 2F7SA 1MV5A 3VC7A 2PY5A 3T35A 3Q9NA 4PNHA 3UMMA 4PVDA 3IBCA 2QTSA 3DPIA 4YMSA 4A2WA 4ETMA 3QVNA 2HSWA 1GG2A 2BFCB 3A11A 4MYSA 1Z2CA 3OMNB 2A3NA 4BO6A 5LNK6 5BQOA 1FYVA 1VYTA 3RYCB 1VE3A 4Y1EA 2Z5LA 3B77A 4MV3A 1E3JA 3DVSX 3TZKA 3EWIA 4CMEC 1IHYA 5KWIA 4OBWA 4OLHA 4Q34A 2VRZA 3AX6A 2PYIA 3SF8A 3D3WA 4BVKA 2H4FA 1E9EA 4MULA 1E2MA 3HY6A 3EWAA 2HJVA 5KVAA 2JEYA 3RV4A 3S2UA 2CXOA 1A5AB 4PZCA 5LYJB 4BFXA 2JVKA 3U62A 4M7WA 4DV5B 1VJ1A 3CEHA 5AHKA 4P9OA 1ZSYA 4RD4A 1MC4A 2VL7A 2ATVA 3JYOA 4KLCA 1E9FA 2JZOA 4UFOA 1BU8A 2XT0A 2GZHA 1C9MA 1GGVA 3A9RA 3TAUA 2H07A 2O0JA 2VH5R 2V6GA 1DBSA 2DFKB 1Y4MA 1VIMA 4NJMB 4U7FA 2V8BA 4JXZA 2C9BA 3SYKA 1JAXA 1HT1E 1F12A 1N6NA 3W8DA 5JCZA 4NQZA 9LDBA 3GLRA 3JALB 1TDJA 4KE6A 2FPKA 3KZMA 4IINA 4XVHA 4DCJA 3F9RA 4JR1A 4L9SA 4O59O 3SLGA 2YI9A 5FO1A 1KI3A 4LFAO 4EGSA 3KKYA 4Q19A 4V0SA 3RW0A 2JCGA 3V4SA 2HMAA 3TKAA 1H2YA 4X9QA 5I7AA 2I33A 4LY0A 4GLFA 1QDLB 4O2AB 2YNMC 4Q66C 3ZUGA 2EFYA 4XIIA 3H4IA 4KVGA 4NKRA 1GZVA 1E6WA 1RFLA 1TCUA 2ZPAA 1BWRA 3WVNA 2X8BA 1RYMA 1H94A 4XOUA 1EA5A 2HQBA 3PUKA 1R0RE 2EIKB 2E18A 3O9ZA 2WTAA 3NPAA 1E2JA 3L8MA 2JGNA 4ZARA 3P0EA 3RT3C 1U2DC 2WE7A 2DQ3A 2QTZA 3FDFA 2Z09A 1G20B 3K9AA 4XX0B 3CX4A 1WJGA 1ZUD1 2RGXA 4IIHA 1C7ZA 2RHGB 2OXCA 4FYXA 3K9GA 1WPRA 3MJHA 4B74A 3DV0A 3KV1A 4L85A 3T7SA 1SRQA 2H16A 4CQNA 4US1R 4US0R 3RODA 1HEUA 2B1JA 3NGMA 1ZAKA 3HUUA 4FNOA 2GZDA 5A3RA 3DNPA 5HHTA 2Q3LA 1YR9A 1Y6FA 2EP8A 2GSDA 4MUIA 1FS5A 1Y9ZA 3URMA 1A7UA 3D9QX 3FVVA 1YQXA 2LDBA 3LT0A 1U1CA 1PNKA 1OT3A 2AFIA 2BMFA 2QN8A 1DEHA 4U5QA 1QYCA 3GOQA 3PI7A 4RETA 4C2BA 2HA2A 1A9OA 4QODA 5AKJA 5BV8A 4LR3A 3D0OA 1IHUA 2XIQA 4AF8A 2VPYA 2G1JA 3LUGA 3A28A 3GLHA 2YY7A 1MXFA 2FN9A 2AXQA 1YI8A 4TKVB 2R44A 1DEOA 5EC2C 2NVWA 2V3VA 3PC4A 2QUZA 3IQGX 5CTJA 4P3XA 1Z47A 2ZYSA 2GM5A 4I36A 5SZKB 4ZQIA 5C80A 2CMKA 1LPMA 1N5IA 2CK3G 4QVKA 4OHFA 4GEGA 2B8WA 1HXHA 3L8CA 3ABUA 2W4QA 2HTFA 3ELYA 2FMIA 3SIWA 3OLZA 4P34A 3T4EA 3PN1A 5A4FS 3H84A 3ZWOA 2H8KA 3F4BA 5ISMA 2I4NA 2RBGA 4V0ME 4TMZA 4LOLA 1X15A 4XDJA 2IYZA 5DYYA 3OQHA 1C0IA 4IF4A 3UB2A 2X14A 4A2QA 5DM70 1GCAA 3N2GA 4L73A 3CW2A 3WGJA 2WF5A 2HI0A 4RIHA 1IBCA 4NTYA 4PM4A 3B13B 3WB1A 2A1UA 3HS3A 1KZHA 3RS9A 5JIBA 3BQNB 5AJTA 2UYYA 1MW8X 4IDNA 3A6GA 2RHRA 1LCIA 4FIZA 3T8YA 3SP1A 4TX1A 4KQEA 2WU4A 2FK8A 1FPQA 1QIMA 1NSTA 3NCTA 1WAZA 5LWHA 5FOXA 4B4KA 4QPNA 4HAYA 4X1YA 2IX9A 5FBLB 2V7QD 1L0BA 3TTSA 2CL6X 3R09A 1RQGA 1YRBA 3H5NA 1GZ4A 1L4HA 3ZWKA 3HPQA 1IK4A 4YJHB 1APBA 1BD3A 3AR3A 1CZRA 1TZKA 1M1YE 4NZ9A 1XEXA 5AXCA 1PEKE 4D3ZA 5EZYA 3K71B 5EJ5A 2IVFA 3Q8XB 3RS5A 1HM5A 1XDZA 3CCEV 1KEUA 2GBLA 5ALMA 1XF1A 3TTYA 3QKWA 5JD3A 2QTMA 1BW9A 4RH0A 3W5VA 3GDHA 3GRZA 3T94A 4PSAA 2AJTA 4ZRDA 1ZI8A 3OLVA 1W52X 5CVUA 2H54A 2NU6B 2F8TA 3ZCRA 1SVIA 4JUCA 3PF9A 1DIOB 2F3SA 2N42A 1D2EA 4GDMA 1W5AA 2WJPA 4BMPB 2YHIA 4IDHA 1S01A 3OFKA 1KSHA 3AG2C 2OT3B 2H1RA 1LV7A 3UOAB 3LNNA 4D80A 5DWQA 4X66B 1GGKA 4D4GA 2ZR9A 3EZNA 3KLOA 4PR3A 3VGPA 3OTGA 4R2HA 3OEEA 1Y8QB 4YX9A 2FA9A 4LN1A 3BABA 2BEJA 4LDPA 3OQ1A 3LP8A 4WACA 3LK6A 5J2TB 1M5TA 2GR9A 4EGCB 4RTNA 2ERYA 5AK0A 5KQGA 2Q4TA 4P82A 3SYTA 3HADA 1NIJA 1FZTA 4K3AA 1KZGB 4JI7O 5CX4A 4ZT3A 4DC1A 1K9MW 2GXSA 4HGZA 4LOIA 1GN4A 2HLHA 4F2DA 5CDGA 2WIJA 1SXGA 4Z9FA 1GR0A 2DPLA 2QRHA 4TWZA 1ZVJA 3T38A 2ZT9B 4AFNA 2OBXA 4MR8B 1P5FA 2JFPA 2OFXA 5CIYA 4NPHA 5DM2A 5LMUO 3GPBA 2ZXFA 1TW3A 2C5LA 3AFOA 4BNDA 1DE0A 3FPSA 4PDLA 4UBNA 3KV3O 2V1XA 4B8WA 1E5LA 3I52A 3IMCA 4GR4A 3WB9A 3LS2A 2FYTA 3SF0A 5KYUB 2VOEA 1KDPA 2PS0A 4IZ6A 1VIYA 2ZUTA 3DZCA 4M8KA 2AOXA 4JL8A 2LBPA 5TNXA 2LCQA 2CH7B 3S81A 4PNEA 1TZ2A 4JVMA 3HCDA 1YTFD 1NVAA 1ZU5A 2QPTA 5J4VA 2IE0A 1R50A 1YB7A 3GN2A 1J0XO 3SYLA 4UREA 1QIGA 4J9VA 2PF4E 1WY5A 3H0EA 4NCAA 4RZSA 3UCEA 3S5UA 4WJZA 2Z8XA 1Z17A 4BTLA 3W7VA 1EG2A 3TTWA 1XA4A 4QHYA 1T0UA 3FCOA 4JJEA 2RGCA 3O9VA 5BN4B 3UA3A 1G9XA 5IYBO 2JGIA 4RVSA 4W1QA 1AU9A 3HKBB 5DXJA 4KLRA 1A5TA 2HMUA 4MI1A 3SKXA 2J6HA 2PH7A 5EIBC 4Y3UA 3FZGA 1WNFA 3QQPA 4Y6RA 1LSJA 3G5AA 3W5HA 4EG7A 2J46A 1C4OA 3GYBA 3WADA 4YRPA 2BSQA 4EFKA 3D2LA 3MYYA 2JLBA 4YONB 3P30A 4FUQA 4EB3A 1CUAA 4IX1A 2GBFA 2WHEA 1BQ4A 3TIVA 2Q0OC 5J2UF 1VPLA 4CKBB 1L3BA 3ELDA 5CBKA 2G0NA 4ITRC 4KQFA 3LNTA 1NNI1 3AYZB 1RAHA 4BFTA 3V1TC 1QPBA 1EIWA 2AX3A 3RYFB 5F64A 5BSVA 1J42A 4KXMA 3BWEA 1CX9B 2AMVA 5KDOA 4W1RA 1JPUA 4FE7A 4BVBA 3TZHA 4ADSG 2F00A 2YQ5A 3DE0X 1CUVA 4MARA 1RKUA 5FKJA 1K9SA 5COAA 3QVUA 3HYLA 3FYSA 1UT8A 1S2GA 1I51A 3PEUA 3ROFA 1DO8A 4HPXB 4WOKA 3PEYA 1RE1A 1EB8A 1PJQA 4DSUA 4O2AA 3NC0C 5ELXA 5C5DA 3GLSA 1G2OA 1HNXB 5T6BA 1ZGGA 3BVPA 4G24A 1UKCA 4DR7B 1D2HA 1ZQ1A 3C4JA 2EJBA 2JCBA 1DIHA 2QJFA 1C7RA 1ZUHA 1CEZA 3EVNA 1WHSB 2DFTA 4YAOA 5I4CA 3T1HB 1VB5A 3MF4A 3IO3A 1BIFA 4IEFB 1WDKA 3LPAA 5KIAA 4X64B 1LK7A 1SVMA 2VJKA 3E15A 1G20A 1GRVA 1HT0A 4ALLA 1DKUA 3AESB 1OLSA 1WAMA 4R40A 3H1IH 4LYHA 1JG3A 2OHOA 2J3DA 5IVDA 2B37A 5FD8A 1G66A 2ZYGA 2DYSB 5KTRA 2W6IG 3UH1A 1LSOA 2ZS9A 1H1LB 3D81A 3K5OA 2KLBA 4CCYB 5F9MA 5KC8A 3OJ0A 1K89A 3TMAA 3DP9A 2IXFA 1AP5A 1CJTC 1KU6A 3C1UA 2YUTA 3BTUA 5H8WA 3AGQA 1U0JA 4PYLA 1ESDA 3B6ZA 1CQWA 4GOND 3OT5A 4TV9F 1GD1O 2VXYA 5EJFA 5IRCD 4L51A 2DWOA 1DMRA 3C5EA 3TTUA 3KPJA 4NJOA 2DOKA 4I1UA 3RT1A 3O4JA 1P6UA 3KKNA 3A37A 5K2MA 2D8AA 3BGSA 4JOCA 1WPGA 5A5EA 4DJDC 2R1VA 3GXBA 2C5HA 4NV0A 3LDGA 3RFRA 2WKQA 3GHHA 2FI1A 2Y6VA 3MMZA 4GWGA 2QD2A 2IP1A 3OUTA 4IPTA 3RSCA 1WP8A 1RPJA 1DBIA 1UWVA 3HACA 2J59A 3QF4A 1DAKA 5C1DA 3AUXA 3B20A 1RPRA 4PLTA 4TKVA 4DFDA 4RXMA 1GSIA 3Q6IA 4GVPA 4K28A 2E87A 4FCCA 4JODA 3C3TA 2PLWA 1UJMA 2AYXA 3K0AA 3E9RA 3DXRB 4O4JB 2VT7A 4M6WA 3I23A 4QJ5A 4BMXA 4S1VA 4HDRA 4EDFA 3HR7A 4OX9O 2Q5LA 2ZJ4A 3K6RA 5C1IA 1TYDE 2JKYA 1J0CA 3DTVB 2REOA 2ZT5A 2N75A 3HWSA 4CWAA 4DVJA 1DHRA 2IOHA 1X19A 3BWDD 1D2AA 1G64A 3VQWA 1REQB 2IYQA 2Z83A 3H18A 3GCDA 3OD5A 3QXSA 3SBOA 3QX9A 3UMJA 5TGDA 1T9HA 1RT9A 3Q3EA 4DGQA 3LCVB 5IXJA 2W2LA 2C5BA 2OXFA 2I71A 1RJWA 3K9QO 1RZUA 5IDVA 1OAOA 2Q49A 2H94A 2DBVO 3BA9A 3GL9A 1UCFA 3BMCB 2UYQA 3QA9A 1NYTA 4PX9A 2EZUA 5DKFA 1TC1A 3IBSA 4FGUA 3D7MA 1V48A 2QROA 4ARZA 2YXYA 2CLCX 3JYNA 3IAM6 2OBBA 1T4DA 1JU4A 1J33A 3HVRA 3C2QA 4MQ5A 3VNVA 3IUYA 1KE2A 4FLFA 4HUTA 2OSBA 3T52A 1SQQH 3O03A 4ER3A 4LRTB 5KWEA 4AY3A 4PYJA 2ID7A 4MROA 2A9VA 3NVDA 1J9EA 1D2DA 3G4SV 4C21A 3P0JA 2XQFA 3OIVA 4OV6B 2UUCB 4AZWA 5CFOA 1N3BA 3G89A 3R1IA 2DXIA 3O8NA 2BW0A 4ZZ2A 5EIXA 2R6GA 1LA2A 5ENDA 1L7OA 1D8TA 2YZMA 2GZ2A 5KTMA 3P97A 2V7XA 1IDN1 3S7TA 9GPBA 1ODJA 1LZLA 5GM1A 1P1JA 4H3VA 3LPMA 1NVBA 3U4GA 3I6IA 3BL5A 2XI4A 5ALVA 3LQRA 1BGXT 4DAEA 3H65A 3DKKA 2VK4A 1KEEA 4F9TA 3HXPA 5JAQA 2AE1A 2FEKA 1D0IA 4B40A 1Z2GA 1ZK0A 2HPHA 5ICSA 1FJHA 1GZHB 3LDCA 3II6X 3GUZA 3OJFA 1ISHA 2X6CA 1ZTEA 4JQOA 5DHRA 3WL4A 4OYYA 4EGAA 2WSSG 1AN0A 3WHLA 1FXVA 5LQNA 5CA1F 2JATA 3QTBA 4H9GA 4O4LB 3I04M 2JFBA 5IYDO 2WT9A 1ONOA 3MIIA 2HA5A 2KMLA 3GMSA 8ATCA 3S2YA 5DYWA 4DR1B 4G1BA 5CEEA 5HQ3B 2VT3A 4J0EA 3ZY6A 2P7IA 3AR5A 3GLQA 5LP6B 3WYGA 5CM2Z 4DNOA 2ONCA 3RGBA 3IEVA 4CQJA 3IE2A 5JWHA 1VARA 2PRSA 3UT0A 3WRWA 4DV2B 3VR4H 3I2KA 3SJZA 5H3CA 4JT8A 1FTWA 1NG1A 3DVLA 4JVSB 3O8OA 4MQLA 5CN0A 3O2NA 4IICA 5JJCA 1Z6YA 5ILGA 2FDCA 3TPZA 5KYUA 1Z6GA 4X62O 5EXPA 1XHLA 2I87A 1XEQA 4U8GA 3DDZX 1R66A 1MZFA 1GADO 3VAYA 3PL1A 4QQNA 1O5OA 4B9EA 3LLCA 4JXKA 1TCCA 2WZDA 1YZ3A 4KLNA 2OPHA 1YB1A 1L8LA 3F78A 3VDRA 4MV0A 1CS0B 2QQ5A 1I4LD 4ZCLA 1BGVA 2NVOA 3G68A 2IUYA 2ZD9A 3KNZA 2Q46A 9LDTA 3FJYA 5DX8A 3P4XA 3K4HA 4M0LA 3C3DA 4FHCA 1ZK3A 1Q0ZA 5IM5A 4PV7A 2H31A 1JTFA 4Q9KA 3NOXA 1U2EA 5K4AA 2A7XA 4I14A 1NXPA 2J5BA 2HIMA 3NVMB 3L7IA 4JNCA 2GXAA 2Q5ZA 4DA9A 2JEZA 3RN4A 1KFKB 1RBZA 3U31A 3A0UA 3K0GA 1JDTA 1DNPA 4EGJA 4U6SA 4JUAA 1M76A 4D97A 5EGSA 5TQ2B 3RIMA 1O89A 3RRNA 2CCJA 3HO8A 1YZFA 4IH4A 4UU8A 1OR8A 3R3YA 3JARB 3LKBA 1BXRB 5DXAA 1C8VB 1EDZA 3NNNA 4TZ6A 4CKBA 4RIIA 2WPDA 4RFVA 4B7XA 1N2CA 1X2EA 4MJLA 3K9NA 5HP4A 4AJNA 1AJPA 1RKQA 4MW5A 5HFMA 2Q1TA 1TO1E 5DOZA 3T9CA 1FU4A 5JAIA 2OZLA 3HWX1 4G65A 3VV2A 4MVJE 5L9AA 2X2EA 3OD1A 3WMFA 3VSAA 1HT3A 1HSZA 4GP6A 1ZI9A 3PC6A 5BXQC 2WJ3A 3I9KA 1UBHS 1Q3TA 2PSJA 4LSMA 2XXAB 1A97A 1NVEA 3UMVA 2HV9A 3KXIA 1JVNA 4QTUB 4LMRA 1NATA 2JIOA 4UU7A 3DLAA 4C01A 3IB3A 4URFA 5FWDA 2D4AA 1CK4A 4ALNA 4EB6B 2P11A 4JB0A 4MWDA 4YUVA 2A9HA 1YKSA 5HGXA 4S1OA 1PWEA 3P9ZA 2J0SA 2QS9A 2H3OA 3OKPA 4ALMA 2EV9A 4U1RA 5C5CA 2BKUA 1H2SB 2O8FB 1MOSA 4BFCA 4I9WA 4DPMA 1Z56C 3R9XB 4MRVA 2WUDA 1W0KG 1D3AA 3VNUA 2HA0A 1U0FA 5AW9A 5AKGA 2LUOA 1KMHB 1WUIS 3HXLA 1VGRA 1IXYA 3R75A 4F11A 4F91B 4HR7A 4H4DA 1ZOSA 4RVOA 1ZINA 4LE2A 1QOZA 3SLKA 2WP8J 1J25A 1KVQA 2B2CA 4EAQA 1HRDA 3QWHA 2NYUA 4MB0A 4J7CA 2O2XA 2J3KA 2B35A 4B09A 4BPBA 3T0GA 3FNHA 5SV2A 2XUFA 2PUHA 4H1VA 3H17A 3QWIA 5K4GA 2JS7A 5K8LA 1KXZA 4ZN6A 4KBGA 1Z28A 2ZQYA 5A2GA 1GJRA 2Y1KA 1AR5A 4AS2A 4F1JA 4PGMA 2GLXA 1EHCA 4Y9DA 1SWWA 4WV3A 4UMDA 1T15A 1XZLA 1XQ6A 3GFOA 1M0TA 2QZPA 4A8JA 4Q05A 4RUFA 2OXEA 1E99A 1UMKA 2RD2A 1FXHA 4QXAA 1E3QA 2VUHB 3IV6A 1DKPA 4AX4A 2ZI4A 1YZVA 1MB4A 1B6RA 1JIUA 2LCIA 1N7HA 1KECA 1I0ZA 2CHFA 3IO5A 4CIVA 2XD9A 4GLJA 4GMHA 2WJ6A 4O08A 3H8SA 4L8LA 4MKFA 4YV7A 2H4JA 5LZ4A 2QT9A 4FYHA 3FAVA 5EMMA 3ZD8A 3V4VB 5D3MB 1ABEA 4ARVA 2GQ0A 4GQBA 4JGIA 5SYMA 2CTQA 1KI6A 4HDAA 2RGNA 3M6LA 4OM7A 3CZQA 3L0DA 4EHAA 5KPJA 1LBTA 4F5YA 1I2AA 1EQUA 1W4RA 1HYBA 4MJ3A 2XAHA 2WFZA 5IDQA 2J0UA 1GKLA 5M7EA 1P7ZA 4I7ZB 1UR5A 1ISSA 3ZW7A 3L41A 3TZ6A 1BKSB 3MSXA 1TT5A 1CSEE 2F2TA 3Q5EA 4FCVA 3R7NA 2PVSA 2ZRDA 5FLEX 1PNTA 4F1WA 5GZ3A 1OBOA 3OESA 3EVFA 1NURA 5J3JA 1NT4A 2IDMA 4U7WA 2H6EA 4WNCA 1KAEA 3ICQB 1ZJZA 3H2ZA 4BFYA 1MIOB 4I99A 5BSTA 4HP8A 1VI5A 3CTMA 2QWXA 3MWFA 5DV9A 3HA7A 2O5RA 2H59A 1R9NA 5JDCC 3SSNA 4EFDA 4A3SA 2UVPA 1OIXA 4JSTA 2DR3A 5AJUA 2QPAA 1DO2A 4TV8F 5JAMA 4P30A 1G60A 1SUBA 2GUGA 2C0PA 3TOCA 4BEWA 4B2PA 4DXDA 1YC5A 2E6UX 2ICAA 2F9LA 3Q9LA 5HIIA 1D6SA 5FJIA 1VDMA 4NECA 2ZRKA 4ZHQB 2FSHA 4JDUA 1E2EA 2AA3A 4CS3A 3GJSA 2WWYA 1XZFA 1PQWA 1DLBA 2VP0A 4EUNA 2AMFA 2G17A 4NVRA 3DO6A 4DR2B 4NF2A 3JQ7B 4A1OA 2P7HA 3CX6A 5LBIA 3FVWA 3UH0A 4NYIR 5JG7A 4MW9A 1TO6A 3JZMA 3GFQA 5LQRA 1CUIA 2JCVA 2AQHA 2KYRA 1KAOA 5FB3A 3MINB 4MQMA 3RAPR 3AETB 3ZHUA 5JWPA 3FMOB 2PZFA 5C4IA 1VBMA 3TQSA 2PUBA 1HNNA 4CM9A 3BERA 2H2AA 3BGWA 4OU5A 1H4SA 5IBQA 4UQLA 1RS0A 4RULA 1GNVA 3UKOA 3X1MA 1OFIA 2FZ4A 3ILXA 4TTAA 4EF4A 2GB4A 2DJ5A 4F8JA 4EJFA 3X43A 3HLYA 1WA8B 4WW0A 2F6RA 1T1JA 4TXHA 3CUWA 2RFLA 4PC2A 3UXYA 2RHHA 1KY3A 3N74A 3CSXA 4F5DA 3RUHA 1WLSA 1Z29A 3ICEA 1TQDA 1OBCA 5SICE 1G8SA 4O4LA 3WZ2A 4WCEV 2HO4A 1Z8NA 3D3WB 3JVUA 1AH2A 2UUBB 1TXGA 3N7AA 4H7KA 4L95C 2RH5A 4HMQA 2W37A 4MW0A 4TTSA 4XCQA 4QO7A 2X42A 4PBRA 3WU2Z 3COSA 4CDGA 1YBMA 5LA6A 2Q2WA 1AA6A 5LP6A 5FP0A 3DE1X 2GV9A 1FMJA 2PRJA 1J2UA 5EL0A 5HS4A 1W1WA 4I6GA 3NTRA 1OCCB 3ACDA 4REQB 3QLJA 3ICXA 4GGMX 3CLRC 4BYGA 1GUBA 2GPTA 1GTMA 1O97C 1A98A 4B32A 2IYNA 4AJOA 1Z5UA 3IJEB 3VR5D 4Z2YA 2POQX 3PHGA 1Z68A 5DI9A 4Z1MD 5L3CA 4Q3CA 1HYHA 3TSAA 3AHDA 5THKA 3VKWA 5GTDA 1U7OA 2ZP1A 4HC4A 4IHQA 3VPSA 1OFUX 3K35A 5T4BA 4J43A 4IT5A 4CM8A 3BM5A 2P0AA 4JUIA 3SBEA 2ZT7A 1Z4OA 1EGMB 1WB8A 1G8FA 2CNDA 2EG5A 4BUCA 1EX9A 4EJ0A 3QHQA 4QUGA 3SX0A 5HDBB 2IS2A 4BWYA 4JLWA 3GLGA 3M0EA 3GNLA 1UFKA 5BW4A 2IUTA 3BHJA 3Q7QA 3IULA 4W4KA 4UOQA 1CUGA 1KOFA 3CVWA 3BE6A 1RQRA 3CUUA 1NQWA 2XOKA 2I1VB 1JKIA 1E9VA 1VIBA 1DIGA 1UZNA 4RA9B 2ZIAA 4FNMA 5CITA 5U4QA 5FV4A 4RVCA 3QMVA 3DC7A 3M2TA 4PQEA 3DMNA 2FMLA 2EQBA 2WJIA 4YQFA 4IAOA 3DS8A 2DERA 1UF9A 5K45A 2Q3MA 1U9YA 2JLSA 3WZLA 2OR3A 3VKHA 2EDAA 5LMZA 4KIJA 4EHJA 2PV0A 1WMSA 5EPUA 1A77A 1NLYA 5CHYA 2UYCA 3HN2A 5CXQA 5KAMA 4HB0A 1PJ4A 1CEQA 1B76A 4RPCA 1G4YB 1YZBA 3DV0B 3WGZA 4MJ7A 5TY0A 1UJCA 1XDWA 1XLUA 2HEIA 3OG9A 1JGTA 1DAPA 3L0IB 1LKZA 4NSNA 4NE9A 4G0UA 4MO9A 1RSOB 3B38A 3C16C 4UTPA 3DF9A 4OQNA 5ECYA 3U26A 1RM5A 2VKQA 3E3LA 3NTVA 1AKVA 2CCGA 2VN8A 2GM4A 2H1CA 4ENRA 2VHXA 4FEYA 5CXXA 4W8GA 3UJDA 5BV1A 2XXAA 1OFTA 1E96A 2EQ5A 6PFKA 2J41A 2ZE6A 5HM6A 1KEZA 2AFIB 1NYRA 3AWDA 1CRQA 2UXBB 2EKZA 1GUZA 3MRVA 3TLZA 3RHFA 4EB6A 3QMWA 5CFZA 2JHPA 3WQSB 5FWAA 2ARKA 4FN4A 3EVDA 1UH5A 5LQJA 4J29A 4HWSA 4CEHA 4FX2A 3GLHB 3R9XA 2B9ZA 1TADA 4G27B 1XRRA 3DCJA 2JIDA 5C5IA 4D57A 3CMAV 5HG0A 4PYNA 5ULLA 1IHDA 1YL5A 5HKKA 2NUTA 3APOA 4ALKA 5DMHA 1E1RA 1VQ1A 3NX4A 2Z4TA 1NN1A 1N5LA 4X60A 4HEQA 1C29B 2V74B 1W36D 2WUFA 4OAPA 1YV9A 3AXSA 4KEAA 3FZNA 1WUHS 1P8JA 4UTXA 5FUWA 4ILKA 2V96A 4HH0A 5KYVA 3TVDA 5D86A 3MQFA 1G59A 1QZUA 2C4HA 2BM0A 4QA9A 3T1YB 4R16A 2W6NA 5TX7A 1COWD 2ZJYA 3H1GA 3EEQA 3PGJA 2F9FA 4E3WA 1QANA 1BWPA 1SHUX 4C0SA 1J2TA 4C3VA 3A1EA 5K6TA 3P7MA 3N2GB 3E7XA 3DEJA 3A25A 4R81A 5LQCA 1XJ0A 1FYEA 2PX5A 2A1UB 2X8AA 3QVVA 3ZVLA 2Q9BA 5B3KA 5JYCA 1I5RA 4EATA 4PNPA 1FSSA 2C4UA 2AOWA 4MV7A 3A4LA 2N1MA 1HTBA 4R1LA 2RN9A 1WQ3A 3K05A 2J5RA 4OQQA 4D6TH 3ANSA 1XTKA 4GP9A 1E7WA 1TOAA 2PZ8A 5K0FA 2VHQA 4LF7B 4X1YB 4N9WA 3OAAA 3ANYB 3HG7A 1QZXA 4CUKA 4DGSA 1RW4A 4M1SA 4KIUA 1L4FA 3BD7A 5DNEA 5AFSA 1T8SA 3G1TA 3EFFK 5GWXA 3MJSA 4MKRA 1HG1A 4B6SA 1NE7A 1Z7GA 3QLUC 4UTOA 1TA8A 1XEXB 2FQQA 5AP9A 4TKLA 5EZYB 3KU1A 1VBKA 1C3XA 3SZ3A 1QYDA 2V9PA 1AXGA 5I7VA 3RO7A 2VUSA 1EXMA 1SEVA 1TX4B 1BW9B 5DTQA 2P2SA 3RANA 5E1BA 2VPXA 3IIIA 4YHHB 3TLMA 1NJIW 3L7OA 2CUNA 4Z4GA 3WKCA 4PYQA 2WD8A 4HL6A 1GDDA 2ZIZA 2YHIB 3KKEA 3CVXA 1MIOA 3KPVA 4HLUA 3RKRA 4PZPA 1Y5RA 3AL3A 3J81A 2ZZNA 4IIUA 4LQCA 2A9PA 2WIDA 3I2HA 3ZEDA 2WTBA 4U2EA 2QY9A 5TISZ 2PUGA 5EVJA 1Q43A 3ZMTA 4F2WA 4PELA 4JI2O 1RHKA 2L2QA 4PZUA 4PA6A 4Z1VA 2UXNA 1Y5LA 3GCWA 2QU8A 5JMTA 3BAAA 1LUAA 1TZCA 2HSZA 2VNHA 4RK1A 3KUKA 3C7DB 2B25A 2X4DA 4NEHB 3B1ZA 3NT5A 1JHPA 4WF9V 5KHJA 3JWGA 1JSXA 4FXPA 4UV8A 4LF5O 1Q0RA 1V7ZA 4BNDB 3MINA 4ODIA 2HR1A 3MK31 1KQSU 1SKYE 3BRCA 1UODA 3AETA 2HK7A 3AFIA 1TEZA 3KEOA 5E79Z 1QHGA 3E2PA 4JITA 3U19A 4XGQA 1QZTA 3ZWMA 4E13A 1Y67A 3IHTA 4IDPA 1IM8A 4ME6A 3R0QA 1SCDA 3KR1A 1NBWB 2D1RA 2CFOA 3ABQB 2ODAA 3JASA 2JJ2D 5AK6A 3M8AA 4LXQA 3N8KA 2GBPA 2CXRA 4G9GA 1WA8A 2HW8A 1BKYA 4X91A 4NULA 4G0OA 3R5TA 3VQVA 4DILA 1TPYA 2ETNA 5AJWA 4EBBA 3JQEA 2Y68A 1P49A 3D0RA 4FD2A 4E4TA 4DRZA 3E5RA 1S2NA 2G63A 5KHKA 2UXDO 1JEQA 2I55A 1IDSA 2OMEA 4EPYA 1EPUA 2EP5A 2XXBA 4QUKA 1S02A 4Q4LA 1KQFA 3L1KA 5FF9A 3OTWA 2FDRA 1A88A 2RK3A 2BI8A 1IZZA 1SESA 5ED4A 4U2DA 2JGEA 5E7IA 4Q02A 2GETA 1U9IA 1AQ6A 4GPZA 3T5AA 4YRDA 4IIDA 4REQA 3UO3A 1P61B 4Q5IA 3PYMA 2WILA 3W1VA 1I24A 4B48A 1X7DA 1IBLO 5SY9A 3PU6A 4KVZA 5I4BA 3QVJA 1DC4A 1FUEA 3N53A 2XZLA 4HV4A 1SXJE 3IP5A 1P7BA 3GEGA 1VTKA 1UC9A 1C4KA 1SCIA 2BZSA 3P2YA 3AINA 3BICA 3N5KA 3GT0A 3LRPA 3KPUA 4FYKA 4EARA 2QGFA 4X20A 2CLSA 2QKCA 1S3GA 1FDRA 2GRAA 4L0QA 3E0XA 2W6OA 4V1CI 1YJWV 3C85A 1TGOA 1J24A 3ZZ1A 4M0CA 4I4IA 1R5BA 3WLSA 4BWAA 1P2FA 1TM2A 3EWNA 1GQSA 2HXGA 4ZMRA 4P22A 1XREA 4MPRA 4MINA 3DOHA 4BR6A 2NO7A 1YZKA 3NOVA 3WWZA 3C0KA 3RREA 3VUEA 2XZOA 2QU7A 3QPDA 4FDLA 5BNTA 1OI2A 4LDQA 4MQBA 4L72A 2LXNA 4B79A 3ER8A 1IIBA 4QATA 5HF5A 1UL1X 4BKUA 1C0PA 3LVQE 3T6KA 3CBQA 4G25A 1COZA 2LGJA 3OQNA 4BNGA 1IPEA 3DNFA 4RA9A 1ADJA 3KFLA 1F14A 2W9XA 4WX2B 4MHSA 4M60A 2ZB7A 4QG7A 5AW2A 3OFNG 4R05A 1V1MA 2YBDA 2HOQA 1YR3A 1NI4A 1PJTA 2J4DA 2QUKA 3OUUA 1OLSB 4JX8A 4XTCS 1N4CA 2WUGA 3BXGA 1XWFA 2DHCA 4QUHA 3IRUA 5DTRA 1I3CA 3SVLA 2Y1DA 1VGVA 3WJ2A 2XUJA 3F71A 4W5WA 4WOBA 1Z2AA 3UFXB 4LECA 1QLNA 1JHRA 3LX6A 4OLBA 1QH1B 3DAHA 1RSOA 4XB1A 4EJ6A 4ZIBA 1WXWA 3ZJ5A 1NXTA 3UV3A 4QOJA 5HZGA 3DB1A 4BATA 1NTKH 4TGLA 4Q6BA 1U0RA 4CLOA 3V7FA 3M1YA 4JVLA 121PA 2I1WA 5I9MA 3E48A 4I1OA 4RCYA 5C7OO 3OCWA 1JDUA 1H8EG 3LXRA 1XL6A 1JHYA 3VNRA 1AK2A 4XOIA 2GK4A 3P94A 4C4SA 3T4DA 4Z0NA 2WLIA 3G23A 3QE9Y 2R1VB 2CAZC 1N6RA 3MYRA 1P31A 3TRIA 2VJLA 3BGIA 2OXIA 3F2IA 1O95A 1U1GA 4U7OA 5EA2A 2WD7A 4CV2A 2HNBA 1FYDA 5I7SA 4DDWA 1TTHA 3QF4B 4O4HF 4J2TA 5I8PA 4MIEA 1MG1A 1PD3A 1S7CA 4BIIA 2EF0A 4ZTBA 1MSWD 1L5HA 4UVAA 3CRQA 4BLQA 3HB4X 5BUZA 1VZ2A 2Q0AA 4HQLA 3N2NA 2RH8A 3K0AB 1CRPA 3EN0A 4M6WB 4HVTA 3NWBA 4HDRB 3HV2A 1SXJD 4GI7A 1R8QA 2AK3A 1M66A 4K6HA 2BKLA 2I7DA 2JIZD 4WKNA 2YFQA 4A8PA 5IS2A 3FFBA 2ORYA 1IBKO 4B35A 3IAYA 4RV4A 5JNLA 4C4PA 4DHWA 3A27A 2GSMB 2DSNA 2QNIA 2IPOA 4RVUA 4J2OA 4P54A 5LXTF 4YQYA 3W05A 2PA3A 5FOQA 3DONA 1UJWB 1A2QA 2QX8A 3DHYA 1FBTA 3FTNA 4AICA 2P3SA 1XBTA 4XDKA 1L8OA 4X65B 1M7GA 5EXEA 1HMPA 2X5KO 1JQBA 1Z37A 1QFJA 1KJNA 2WVJA 3RE1A 1CY8A 5KZMB 2VRWA 1GN8A 1DKMA 4FZRA 4Q7QA 2JLZA 1A2KC 1N1MA 4U2BA 3RWOA 3SYAA 4HYEA 4URVR 3PV0A 4CCSA 1P4JA 3OE7A 1U2TA 4IL5A 3BTSA 1V3VA 5HPYB 1ND5A 1HUQA 4ARZB 4ND1A 5EWJB 3PICA 3KZVA 3PHBE 3QA3E 2Q3DA 2VWQA 3HJNA 3PFFA 1DPGA 1KUQA 3LW7A 4B87A 5K0SA 5HGJA 4OXNA 1R4AA 3JD2A 4A2PA 3ZVKA 3AUYA 3ZJZA 2FWNA 3C4QA 3SM9A 3HBNA 4O2RA 3DAYA 1DTWB 4IQ4A 2XUMA 5H9VA 4YACA 1M54A 3IR5A 2VQFO 2V5VA 4E5DA 4NNOA 4S35A 3V4ZA 1M2NA 3G2QA 4PHTA 4MLDA 3E23A 1WDWB 4U2GA 1VQ4V 5JXHA 1EXVA 4BC1A 4GSLA 4UHCA 3PCXA 5K3OA 1SUFA 5T8KA 5LUAA 3KZNA 2LTAA 3RT9A 2QUJA 1JKJB 2FCRA 1BWSA 2WE8A 1PWYE 3HJBA 2J0VA 2NPFA 1IONA 1N7JA 4TQGA 3CZRA 3EE6A 4MGKR 1EZVH 1Y6ZA 1R3IC 3MWKA 4CM3A 1KEEB 3JW8A 1R15A 3QVXA 3ZXYA 1OGJA 4HX2A 1N0NA 5CJJA 3HCWA 3UEOA 5LU8A 4W1SA 3LY5A 4NS4A 2A9FA 1P1CA 5MN6A 5BOSA 2QJWA 2R62A 5IN4A 4JLKA 1PHPA 5EJGA 1UMCA 2A9QA 5A71A 2AHZA 2XODA 4M9ZA 5JC8A 4GGOA 4FZ3A 4OA5A 4I3HA 3FYUA 4AB1A 3FOCA 3WLNA 4B3FX 3I8SA 3P2KA 3PQCA 2ZM6B 3TD2A 4TL6A 3GC6A 1NU8A 1FP6A 5D00A 1L5QA 1PJZA 2Y4UA 4NRDA 4H6WA 3BREA 5H4GA 1J5XA 1O0BA 1JF8A 2EJ7A 4DRYA 1GEGA 1CZLA 1B0AA 4H0FA 3MZ0A 4GU5A 3ABKC 1VXRA 2DQ0A 2C07A 4XQCA 4MLZA 3FVTA 4DV1O 3O8OB 1OTXA 1FUIA 3PXXA 2EBUA 4J8PA 2XZDA 1Q0PA 2LRHA 1Z4MA 4ASUD 1J1UA 1NU6A 4RS4A 4FFMA 5ABPA 4WINA 3IFXA 5KJCA 2OCDA 4JTCB 2HMSA 1CC1S 3STTA 4ZVQA 4PU0A 3AHGA 1BZYA 5A7FA 1IZ8A 1GA1A 3MJRA 4FB4A 4QELA 3OJXA 2X6RA 3OWOA 3VOAA 2WFMA 2HMWA 1M6VA 4OYLA 3TSYA 3NR2A 4ZREA 2HV8A 2Z4RA 3I32A 5JV5A 1J20A 2JIMA 4TXMA 4G89A 1ZJ5A 3IFSA 1MQ9A 4HB3A 5FYDA 1WR8A 3LLMA 4ZC8A 3NP7A 5HKOA 2ORVA 1TQ2A 5ICFA 5EP2A 3B9PA 2GPWA 5KJ1A 2VTEA 4Q37A 1JR9A 4B3JA 5BY2A 4FCTA 5ECGC 1W47A 1ETHA 2BWJA 4A0FA 1MUUA 3COVA 1ILEA 3DAOA 3FSRA 2G8LA 1K5SA 3U9TA 2ZR7A 3X0DA 4FEEA 3OI7A 3FLEA 2JD1A 3OICA 5KCZA 3EZ2A 1L1FA 3ANXA 4FR0A 5H68A 3G59A 1AM4D 4WNYA 1KAGA 2GOYA 3TQHA 5JYDA 1N2CB 5TEVA 2A1IA 1Y1LA 3G85A 1P5ZB 3B2EA 1Q1QA 3HZOA 3X2EA 2WR8A 1I0IA 2QAJA 2DWCA 3NATA 5GPBA 3TQIA 1DAEA 3OH8A 4R50A 4EHNA 4RMNA 2OZLB 1LJLA 5LJIA 1IE3A 1QWOA 3VX4A 1C3LA 5TMDA 4C2UA 3QU4A 4IUYA 3MIZA 1VP3A 3I1JA 5IJ9A 2Z1MA 5BWCA 3I09A 4C20A 1HDCA 1S3FA 2QIOA 3ETCA 4G36A 3P52A 1ZSNA 1K92A 3JSAA 3KVNA 1XRPA 2OCXA 5LL6Y 1R8JA 3GFFA 1RYHA 4DA8A 4RKQA 1ZEJA 3PF8A 4OK6A 3KWJA 2LFRA 1DPFA 4LJ6A 4H35A 3VR2D 2R9VA 3KJXA 3KKOA 2YUAA 1XAHA 1ODFA 4MVWA 3KRTA 1CEXA 4HSEA 2HHLA 4LQDA 3JQRA 1VMAA 4NTWA 4W9NC 1N5RA 4CKEA 3CUTA 1AK9A 1M8JA 3RU2A 2P78A 3L0PA 2AG8A 4AIIA 1EEXB 4NDAA 4O63O 3A6EA 4PWYA 2OORA 3H7IA 1NMQA 2QA4V 4C4AA 4DCPA 3D0KA 2OHGA 4GQAA 2WTMA 3T5CA 4KI0A 3IVCA 3UN1A 3UFXA 3FGOA 1U0TA 4J1QA 3VC1A 1ECBA 1QH1A 1MB2A 2E89A 4JJKA 5DGCA 4HFNA 4RFSA 4EMTA 4IJMA 2BEKA 2WHQA 4HRVA 2AXTZ 4L02A 2YN0A 3OTHA 4IRXA 3ST7A 1R6NA 1RXUA 3H1PA 3DAPA 1XK6A 4R2WA 4TVSA 4EO7A 3CKLA 4KGDA 3RASA 2JCXA 3EIEA 3SC6A 3Q2OA 5DBHX 1Q7BA 1CV2A 4A8JB 2HPAA 1PYDA 1QP4A 1G3QA 2JS3A 1O54A 4ZICA 2XLBA 3ZE2B 4N1AA 4M8LA 3OZFA 4GXNA 4XWYA 4CF3A 4MRPA 5FTKA 2F4NA 3U7GA 4FYIA 3PBKA 1FFTB 1L4BA 5IVKA 1B04A 4TXNA 3VOTA 3HK2A 3FAVB 3K6SA 3HTXA 2YS8A 1NZJA 1OQAA 3DW3X 2EJUA 1WV0A 3I8OA 3WGUA 3WGIA 4XLLA 3EGWA 3HQ4O 2YXEA 1Z16A 1KI6B 1NMYA 3KQYA 3MJTA 5HS6A 1TIPA 1X92A 3NWPA 1XHFA 5FTWA 5DBGA 4BGVA 2JI4A 3ORRA 1K98A 4D92A 5JCJD 2ZTVA 4RLSA 3OZXA 1BMFD 2E5LB 3K09A 4L3WA 2YIBD 3M49A 3C43A 4WLOA 5A2QN 1JDBB 1AHPA 2AX4A 2J0UB 1HF3A 2QRNA 3B1KA 4X41A 1VZ3A 4MAFA 3RTEA 3EPPA 3WDSA 4C4ZA 3EVKA 1TT5B 2BZ0A 3WLPA 4UBKA 2VYCA 4FE4A 5HQTA 3N2EA 4AN0A 3LDHA 5JJ5A 1U2SA 1AMOA 4AXBA 4Q9LA 4IGGA 1C1XA 3SYPA 3T9EA 7MHTA 1ATZA 1UUFA 4MUMA 1V4VA 4AQ7A 4PHFA 4DJFC 2YQZA 4OXIA 2NLJC 4KXLA 3MA0A 2D54A 4F6EA 2UVPB 3OWXA 2ID8A 2PUDA 1U4OA 1VKRA 2W70A 5SY4A 2KG7A 1TUEA 2E4UA 3BRWA 3P9SA 4BNNA 3QO5A 3DPSA 3A0RB 1Z39A 3NT4A 4JLDA 5EWJA 5K1PA 3BA1A 1JLSA 1B6GA 2GEDA 4BNTA 3B5EA 4N49A 3INTA 3VV3A 3HVJA 1JDSA 1PYGA 3H3FA 3K4PA 4IHKA 3LDDA 3SJUA 3UHFA 1SULA 1TEHA 1A69A 2QKAA 1LY1A 5C93A 1DTWA 4YAKA 4AP6A 3NHRA 4UCSA 4JLPA 1N57A 2PK3A 2YWDA 4CM5A 2VT6A 1ZOPA 1MVLA 2DN9A 5KJEA 1EFCA 2CXSA 1HNZB 3QKUA 1SKQA 4AJPA 2VC2B 1T5SA 3HZRA 3QYAA 5KUTA 3LGXA 3UYKA 4M1YA 4X6YA 2P2YA 5EJIA 3HU3A 1JKJA 1XCJA 1S3SA 4NG4A 1SCKA 5AM2A 2ZWIA 3KJEA 4Q6GA 1XNRO 1OH7A 3IKJA 1ZSPA 5G3YA 2UVQA 1PZMA 4J90A 4AF7A 4RELA 4Z3KA 1JECA 4YA6A 4YJKA 1MJGM 4QDXA 1JQ0A 4KQKA 2R8ZA 3WLAA 2AI1A 2HT6A 4JIGA 2FQ1A 1GPAA 2W11A 2C4NA 1DQYA 3KWMA 2JAWA 2WHPA 3UJCA 4A8TA 2Q4OA 4FYMA 2PMFA 2OOKA 1TE2A 4TRNA 3BWCA 2XDAA 3D4OA 4RGVA 3UJBA 5TIIA 4TXJA 1N1GA 4NAHA 2O7QA 1UJ6A 2ACEA 3TL6A 5DEOA 1PBTA 5DTMA 1QAQA 5LA6B 3WOVA 1I9GA 2O3UA 4DUGD 1X1AA 3PXGA 1E79A 2DUJA 4K6OA 2KBFA 1Q74A 3QG1A 5AVKA 5CBFA 5KOIA 2XNDA 3KJHA 5AO9A 3F8TA 3D31A 4A6DA 3S1AA 3NAMA 2ZUDA 4RY9A 2JGKA 1P33A 4JQYA 1SIUA 1PGNA 4XE5A 3VM6A 2IQ5A 1QF9A 5A3QA 1IN1A 2VJMA 3WGHA 2WWGA 3NKLA 1HDOA 2R8BA 3TZLA 3BUSA 2P06A 3AR7A 1K3UB 4ZK6A 4Y6GB 2Q8QA 2WKRA 4RDCA 3CS3A 4FFWA 3IXLA 1F0YA 4UVBA 2R65A 1E7SA 4DLYA 2E82A 4MPTA 3L72H 3UOGA 4CM8B 2CVOA 4ZCQA 1XTVA 3R3HA 4UQPA 3LHSA 5MHTA 1JN0A 1AO3A 1I14A 1TFRA 3G9TA 4KQ6A 5FNVF 3JVIA 3TMYA 4K6GA 3BYZA 5AKYA 2BJHA 2DPHA 2X3UA 5KNBD 3IRVA 1FQJA 4ERNA 5DK6A 4LWQA 4CIXA 3QTTA 3UMFA 3OU2A 4H7IA 3GLGB 3PKJA 4YDQA 1HEYA 1QR8A 2DHQA 3GJ5A 1EFDN 3MUNA 1BVRA 4DG9A 4D44A 4BLOA 1KARA 4UNRA 1JHAA 2C9MA 5EP3A 5HIMA 2J1LA 3BMNA 3GUYA 3A4YA 3AOGA 1NLUA 3IPXA 4I81A 4WSOA 821PA 4QIWF 2HJWA 2C9OA 3C1AA 5EXXA 3SHQA 3M5CA 2OHXA 1IXMA 3HYTA