2O57A

Crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
282
structure length
282
Chain Sequence
SKTVKDNAEIYYDDDDSDRFYFHVWGGEDIHVGLYKEPVDQDEIREASLRTDEWLASELAMTGVLQRQAKGLDLGAGYGGAARFLVRKFGVSIDCLNIAPVQNKRNEEYNNQAGLADNITVKYGSFLEIPCEDNSYDFIWSQDAFLHSPDKLKVFQECARVLKPRGVMAITDPMKEDGIDKSSIQPILDRIKLHDMGSLGLYRSLAKECGLVTLRTFSRPDSLVHHYSKVKAELIKRSSEIASFCSPEFQANMKRGLEHWIEGGRAGKLTWGGMLFRKSDKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a putative sarcosine dimethylglycine methyltransferase from Galdieria sulphuraria
rcsb
source organism Galdieria sulphuraria
molecule tags Structural genomics, unknown function
molecule keywords putative sarcosine dimethylglycine methyltransferase
total genus 106
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.840 Mainly Alpha Orthogonal Bundle Helix Hairpins Mycolic acid cyclopropane synthase domain like 2o57A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2o57A02
3HCBA 2V7EA 1X1AA 3HNRA 3IEIA 4E2ZA 5C9ZA 3OFKA 4BP3A 4ER6A 3PS9A 1YFLA 4Y2HA 1YF3A 5EQJB 2GPYA 4B17A 2YXEA 2JH9A 4P7GA 4KDRA 5CCXA 5EC8A 1O54A 3EVCA 1EG2A 3UA3A 5EPEA 1P39A 2E5WA 2FCAA 3TKAA 4DZRA 2BZGA 2P40A 4KRGA 3ORHA 2PWPA 2EFJA 1ZGJA 3SR4A 5CVDA 4YUXA 2O57A 1YZHA 4R8SA 1KIAA 3PT9A 3QV2A 3SVZA 2JHAA 4QPPA 2Q41A 2YXDA 3WSTA 3HVIA 4LWPA 4DCGA 1P1BA 2G1PA 1O9GA 4QDJA 2BM9A 2HWKA 3ERCA 4PYKA 1UWVA 3CJTA 4DF3A 3AXSA 3T7RA 3DP7A 3C6KA 3KR9A 2H00A 2PT6A 4PIMA 5DM4A 4POOA 5CIYA 4KW7A 2BR3A 2PX8A 2BM8A 3LGAA 3LKDA 1XTPA 4K6MA 3P9CA 2ZW9A 3FTDA 3KU1A 4XCXA 4HRAA 4DQ0A 2AOWA 3BZBA 3OU6A 4FR0A 3KQMA 1JG2A 4GOOD 4KWCA 2ZULA 4BLVA 3NVKI 2HTEA 5FA8A 1ZGAA 2PV0A 2UYQA 3BWCA 5EMKA 3UJDA 2YXLA 3JWJA 2PX4A 5E1OA 2IBSA 3MCTA 5F2NA 2C7OA 1VPTA 3MGGA 1G8AA 3VC1A 4DCMA 3LHDA 1AF7A 2OYRA 5K8VA 1WZNA 4QTUB 1BKYA 4WVLA 4RX1A 4WXHA 3P2IA 1JTFA 1VBFA 5HILA 1NKVA 3G2QA 4YUZA 2P35A 4CXMA 5K0BA 2PX5A 1N7JA 1YZ3A 2CL5A 2QE6A 2O05A 3V8VA 4OBWA 1N7IA 3B5IA 3VSEA 1I4WA 5LQAA 4EKGA 3C3PA 3EVZA 3PB3A 2YUIA 2ZZNA 2VDVE 4AZTA 3KHKA 2VZ9A 4MTLA 5DRTA 3E8SA 3LDUA 3A4TA 4RTSA 2BR4A 2OPBA 4PYQA 4CTJA 5IKMA 1TW2A 4MHTA 1R00A 2JHCA 3KKZA 4C07A 1R6AA 5C1IA 3ER8A 2VS1A 5E2BA 1NW7A 3PFGA 1X1DA 2P3LA 1HMYA 4GC9A 4RTKA 3OU2A 3HA3A 4M37A 4E2WA 2ESRA 3NWEA 5EIWA 4RVHA 5LQKA 5FHRA 4ER0A 3DR5A 1QAOA 1ZQ9A 5EMMA 3G2MA 5C0OE 3UJCA 1RI3A 3EGIA 3O31A 1JG4A 1JG3A 3EGEA 3MQ2A 4LG1A 5EHIA 4F84A 5K05A 2B9EA 3B3JA 3BWMA 4E32A 1RJGA 3KR1A 5LSAA 3A26A 1SG9A 2OZVA 1VIDA 2PY6A 2H1RA 3CBGA 3C3YA 3FYDA 1M6YA 1FPQA 3LCVB 3L8DA 3KR2A 3DLCA 4P7KA 4KIGA 3A7DA 5ICGA 1RI5A 2IGTA 2ZLBA 2NXEA 5E9JA 2FRXA 5IH3A 3G8BA 3R24A 2JH8A 3LBFA 3A7EA 1SVUA 4P7FA 2UYCA 5LQNA 1ORHA 1RI1A 4GOLD 2V74B 5DXAA 1B42A 2B2CA 2ZFUA 2ZTHA 4PYJA 3TM4A 5DLYA 1ZKDA 4C04A 5EZSA 1XDUA 2ZVJA 3FTCA 4RTNA 3R6TA 3T0IA 3KPYA 1BOOA 3TPZA 2O06A 2O0LA 2PWYA 3AY0A 3HCEA 2ZWVA 3NTVA 4FS8A 5EZQA 4E2YA 3M70A 3T7SA 4CTKA 1TPYA 2ADMA 1F3LA 1T43A 3M6UA 3NW9A 4CKCA 3DXXA 4DM3A 2EJUA 4YUVA 3EMDA 2AOTB 1NW8A 2HR1A 5DX8A 3TOSA 5KYGA 4PWYA 4L7VA 4BP1A 4RTJA 1Q0TA 2WK1A 3B3FA 3FUUA 3KPUA 5GWXA 3BGIA 5DM0A 2FHPA 2ZZKA 3EVFA 3QOXA 4RVDA 4ER5A 5DT2A 4OA8A 1X1CA 2ZWAA 5GINE 4OQEA 2LD4A 3VC2A 3GRYA 1NBIA 1BHJA 3HVHA 2AN5A 3I64A 1JSZA 1WY7A 4AZSA 3TLJA 3RW9A 2P8JA 2Y1WA 5HOQA 4C05A 5DM1A 3KQPA 3LX6A 3BWBA 5KS2A 4V0RA 3HA7A 4BLWA 3U81A 1Q0SA 3M4XA 2P7IA 3A27A 3KPVA 5FTWA 3BT7A 3P9IA 4FT4A 3THRA 3FUTA 4QDKA 5F2KA 1V39A 2OY0A 4P58A 3DOUA 3FPJA 1EIZA 1M6EX 4IV0A 4Y30A 2DPMA 3BGVA 4QQNA 1JG1A 3GNLA 4RWZA 3H2BA 4FT2A 2YTZA 3EEYA 4ISCA 2Z6UA 5DM2A 5EHGA 5LQRA 1FJXA 3C0KA 2WA1A 7MHTA 5CUQA 3KPWA 5DTMA 2HV9A 5EMLA 5FULA 3P9NA 2AVNA 4E31A 2Y1XA 3OZTA 4QVGA 3SSOA 3NWBA 5E9WA 5DWQA 1WS6A 1XJ5A 4X61A 4JXJA 4Z2YA 5U4XA 2BH2A 4U7TB 3RIEA 1HNNA 1NE2A 1P1CA 4MQ4A 3FRIA 5ICEA 1IXKA 2AOUB 4X1OA 3F4KA 3G5TA 3UJ7A 3HVKA 3UA4A 2GH1A 2ONYA 1YB2A 1H1DA 2PVCA 4HTFA 3M33A 3BKXA 3MCZA 3OZRA 3TKYA 5CD1A 2JG3A 1L3BA 3HCDA 3M6XA 4FSDA 4CKEA 3MAGA 4QVKA 2ZBQA 4GUAA 3P9KA 2PXCA 3EMBA 3NJRA 2P41A 4IKPA 3E05A 3FUWA 4U7PB 4PIPA 3LL7A 4ATNA 5JR3A 1TW3A 3LECA 5HIMA 3UJ9A 4YV0A 5K0JA 3TM5A 3PTAA 1I1NA 2G70A 3D2LA 2IH2A 3SXJA 3DTNA 4MIKA 3ID6C 1EJ0A 3TRKA 2JJQA 3EVAA 3MTIA 4PCAA 1UIRA 3R0QA 4RTMA 3GRRA 4V0QA 5D1HA 3TFWA 3SSNA 4C03A 1RJEA 2NXJA 3GGDA 2C7RA 5DXJA 1EAMA 4XUEA 5EVJA 3V97A 3HTXA 1XCJA 3GJYA 5K0NA 4OQDA 5EIFA 2PT9A 4EK9A 3GRVA 2PBFA 5EG5A 2FK7A 2NXCA 4QTTB 3K0BA 4KDCA 2OO3A 2FPOA 3KPJA 2ZBRA 3AWIA 4HGZA 4BLUA 1R8XA 1RI2A 3HP7A 2FK8A 5HIJA 4ER7A 2CMHA 2YR0A 5T67A 2OB1A 4PGGA 5FADA 1RI4A 2IIPA 3JWGA 3EVBA 3Q7EA 3SGLA 5LQJA 2PGXA 5EGSA 3FTFA 3E7PA 2ZZMA 2R3SA 3QOWA 3MB5A 4EVIA 5K01A 2Z6QA 1KYZA 3VYWA 2AOUA 1Y8CA 4CKBA 1NW5A 1VLMA 3PVCA 10MHA 5HZMA 1SUIA 1MJFA 3THSA 4C06A 3UBTA 4BY9E 4RTPA 5EMJA 4E70A 1QAQA 3CJQA 4X41A 3KQYA 2NXNA 2AOVA 3A25A 2GLUA 3CCFA 3KR0A 4IV8A 3FUVA 3KQWA 4PONA 4DMGA 4EMSA 4GEKA 4UOEA 2OKCA 1BC5A 4AUKA 3GWZA 4OA5A 4RVFA 5JUWA 2P1DA 3P2KA 2ORED 4FZVA 2P7HA 4A6DA 5K03A 4HGYA 3OCJA 4X63A 1JQDA 5DRYA 3B3GA 3GRZA 3G2OA 3UJBA 3MERA 2ZCJA 2YX1A 3BWYA 1G8SA 3HA5A 2ERCA 5FQOA 3HEMA 3IV6A 3LPMA 3X0DA 3I9FA 2QM3A 3P8ZA 2PXAA 1QAMA 1YFJA 1NW3A 2R6ZA 3OZSA 5LQCA 3I58A 3ANXA 1SQFA 2N47A 2VDUE 3KQOA 2ONZA 1UFKA 2IH5A 1KPIA 1DCTA 5E1DA 1EQAA 5E8RA 5GP1A 2DULA 3ELDA 4GBED 2C7PA 3ELUA 5K0CA 5CVVA 2I62A 2GS9A 5GOZA 5DPMA 4DKJA 3ELWA 2YQZA 4GOMD 3G8AA 1XDSA 1KPGA 3DMGA 3BKWA 3GCZA 1XCLA 1PJZA 1Z3CA 3CKKA 2ZIFA 3PX3A 2NP6A 1SQGA 3LSTA 1D2GA 5DTRA 1WG8A 4ZTBA 1SKMA 4G56A 4R6XA 2IPXA 3CC8A 4M38A 5G02A 1ZG3A 3R9XB 1L1EA 2EX4A 2I6GA 2B25A 2AVDA 4HG2A 5FQNA 5BW4A 3FPEA 1DUSA 3R3HA 4HTFB 1FP1D 5DSXA 5CM2Z 3G5LA 2OXTA 2B78A 3P2EA 5HIIA 3NVMB 3HCAA 5K09A 4YMHA 1QZZA 5DX1A 3KQTA 2IDJA 2XYVA 3AXTA 4PCLA 4RTOA 3M6WA 1FP2A 3G89A 4ER3A 2Z6AA 1L3IA 5FCDA 3TQSA 1DL5A 3PX2A 3DH0A 1NV9A 2H11A 2ZBPA 3KQQA 2UYOA 3P71T 5K0LA 5BP7A 5LR6A 2PSSA 1INLA 4QQKA 1RJFA 2PXXA 3NMUF 1VP9A 3IYLW 5EKUA 1OR8A 2ZIEA 4QPNA 5EEHA 1X19A 3MTEA 1U2ZA 2PKWA 3RODA 3SM3A 1MHTA 5E8JA 2G72A 2IBTA 4GF5A 1FBNA 5H02A 3EVDA 2GAFA 4RTQA 4E30A 1WXWA 2AR0A 3EEOA 2XYRA 3NDJA 4GOND 3LBYA 4RTLA 3BUSA 4KIFA 4E2XA 2CMGA 2IDKA 3B89A 2XBMA 3FZGA 3DXYA 3ME5A 2OBFA 1QANA 3GDHA 5T64A 5EOVA 3AJDA 2I9KA 3I5UA 1X1BA 4PYOA 2NYUA 4LECA 5FWDA 2PJDA 3HCCA 3FPHA 1XDZA 1JSXA 3HCFA 5EKXA 1XXLA 3P97A 2VP3A 3BXOA 4X60A 4C4AA 2QRVB 3DMHA 3K6RA 3LCUA 5CVUA 4R8RA 2K4MA 4RVGA 5HFJA 4HC4A 5B1SA 3UJAA 5GIOE 3DUWA 2HMYB 1XVAA 1YUBA 5F2OA 1PRYA 1IY9A 5ERGB 4HH4A 1G55A 3FPFA 5P8WA 4KVZA 5FUBA 1VE3A 2C7QA 2AZTA 1JQ3A 3HVJA 2AS0A 1M0EA 1AQIA 2EG5A 3LDFA 5BW5A 4IWNA 5KQRA 2UZ4A 3KQSA 4RSRA 1NW6A 3TMAA 4R6WA 5FWAA 5GM2A 4GC5A 4XUDA 4YUWA 3LDGA 2NNWB 1RJDA 3CJRA 4PYLA 3UFBA 1NT2A 3IHTA 2P3OA 3FRHA 2B3TA 3DULA 4DA4A 1JR4A 1KP9A 1L9KA 2GA9A 3HM2A 2ZIGA 3OE4A 3GXOA 1KYWA 3CVOA 3FUXA 3EGVA 4H0NA 3B7PA 3KQVA 5DX0A 5T6BA 3DLIA 5KVAA 3MHTA 5GM1A 4FSXA 2F8LA 4AZWA 9MHTA 3C6MA 1G60A 2QY6A 3I53A 4F85A 2P3QA 3EPPA 4RV9A 1NBHA 3GIWA 3UJ6A 8MHTA 2NP7A 5DTQA 2ZSUA 1R74A 4CWAA 3OE5A 1R8YA 1KPHA 4MWZA 2JHPA 4PYNA 4EKIA 3LCCA 4FP9A 4HSGA 4NECA 4PYIA 5E1BA 4PNEA 5ICFA 3DXZA 4F86A 2CWWA 2CKDA 2IFTA 2KW5A 3S68A 1AV6A 3CGGA 1VP3A 3JWHA 1KR5A 2A14A 3GRUA 3OFJA 1L3CA 1D2HA 1R18A 1SUSA 2I7CA 5FA5A 1WXXA 2OB2A 5K0GA 5GIPE 1VQ1A 3GO4A 3FYCA 3FPGA 4M36A 3UJ8A 1JTEA 4O29A 1KHHA 1KXZA 2HNKA 1G38A 4YV2A 1AQJA 5ICCA 1QYRA 3NDIA 5K0EA 3ELYA 3EVGA 2PX2A 4PYMA 5CCBA 5KQSA 3T7TA 3ER9A 2WA2A 4PGHA 1F38A 5E2AA 1EJ6A 2G8NA 3REOA 3PFHA 5M5BA 2QYOA 4AX8A 1IM8A 5LQUA 3O7WA 4FGZA 1ZHFA 3O4FA 3DMFA 2YVLA 2O07A 3G7UA 1O9HA 4XUCA 4A6EA 3GU3A 3BGDA 5EEGA 2AN4A 3G2PA 3EVEA 2EJTA 3E23A 5BXYA 1P91A 1ORIA 4C08A 1JQEA 2XYQA 1I9GA 2GB4A 3UWPA 1NV8A 5HEKA 4OX9Y 1VL5A 4R05A 5D1NA 2IH4A 5CVJA 1N2XA 1G6Q1 3LKZA 2BR5A 5HIKA 5CVEA 2UYHA 4OBXA 3TR6A 2VDWA 3G88A 3JWIA 3OPNA 5E1MA 5FHQA 4E33A 3SSMA 2QRVA 4YV1A 3OU7A 4GQBA 2IP2A 2XVAA 5DSTA 1D2CA 3UZUA 4LWOA 4YMGA 2AN3A 3SMQA 4YUYA 5E9QA 4RTRA 2XVMA 4PINA 5MHTA 4AZVA 4EQZA 3FTEA 4RYLA 4M7RA 3PLAE 3M6VA 5K0FA 3Q87B 3SX0A 2PLWA 4P7JA 2AOTA 2G71A 2FYTA 2AOXA
chains in the Genus database with same CATH superfamily
3QVLA 3UPUA 1GPDG 4LF9B 1RIIA 1X86B 5H9CA 1IAVA 3B8EA 1OX5A 3BIJA 1WKBA 3KVOA 1TF7A 1OXBB 2QD4A 2LE0A 1MEEA 4JYCA 3DJYA 2RAUA 3EQ6A 4E09A 5JNUA 3LC7O 1N5JA 1O77A 3PFCA 2V7QG 4HQOA 4HRYA 2NV2B 4JI0O 1Z7EA 2VR1A 2BZGA 4Q00A 3ORHA 2PWPA 2QXTA 2V6IA 3FGOA 2VOJA 3Q15C 4RQBA 4F06A 5A62A 3FFWA 5CVDA 4YUXA 2ILMA 3KSUA 4MGEA 2QZ9A 3CY6A 3QV2A 4Z9FA 2GPTA 4C3OB 3RAEC 4EMUA 2VJYA 5BRJA 4KFTA 3JXEA 2A3RA 1UK9A 1SXHA 1OBOA 4YLYA 1ZA2A 4EW6A 1SD1A 1QX4A 1W46A 3SX2A 3NONA 1UBKS 1OXXK 3WRWA 5EIEA 2ZCVA 3VZRA 1ZLXA 16PKA 3KR9A 4PW0A 5CIYA 3HJCA 4KW7A 2BR3A 4FYJA 2BM8A 4OVKA 1U7ZA 1XTPA 2GBIA 4GMXA 2R97A 4IDPA 4YH1A 5IMSA 1OYVA 1SULA 3QE0A 4R1PA 1E4VA 1YDXA 3BZBA 4HQNA 2GBFA 1P2SA 4N39A 3U6KA 5FPTA 4KX3A 4DW1A 1JG2A 4OYYA 1DINA 4NNOA 3L74H 1JYSA 3VDRA 5JV5A 1O03A 5AIBA 3CXRA 3LFHA 2MSEB 2G9QA 1CE8A 3BWCA 1XZJA 5EMKA 4YHBA 4CLXA 4JBXA 2A1IA 1RU3A 2YZ2A 1IVYA 4OXXA 2XAQA 2C4KA 1G20B 3VC1A 4IUCS 5HMMA 4C7JA 5AUNB 1K3EA 1JF8A 1N5MA 3AUAA 2WG0A 1NVTA 4N4AA 3ZI4A 4LJKA 1WVGA 2ZOSA 4X1IB 1E2IA 3D81A 5H82A 4CXMA 1FUKA 4J0KA 3IRUA 3R0IA 1KVTA 1EX7A 4R0VA 2JVIA 3LYLA 3V8VA 3TEFA 2WFAA 1J06A 3N86A 4M0UA 3A70A 4IIFA 5E79Z 1GWNA 3ZTWA 1F8XA 3A3KA 5SYNA 3A4TA 3QEJA 4ZJYA 1KO5A 4B45A 4FJ2A 4ITVA 3E2MA 2EKLA 2WHEA 4U2GA 2IT1A 2KSQA 1NW7A 2PX0A 2IC5A 3FOBA 4NXNO 4RSGA 3ZV7A 1NI4A 2P3LA 4ZT4A 3VPSA 3H1JH 4BRSA 3C3AA 1ZXXA 3HY4A 4S0XA 2OV3A 2PSJA 1XI2A 4IJ5A 4EFBA 1A8QA 1S4MA 2V7WA 5JDIA 1JVBA 1GZUA 3FAVA 2FUCA 5FF9A 4AG3A 3GLUA 2V8OA 1NJGA 4UCTA 5K20A 5KX5F 1QQTA 1W88A 4LG1A 4G67A 4PSDA 2FUNB 1E2NA 1YFKA 4R8CA 1KETA 2G38A 1J90A 2EZ4A 5CW1A 4JDUA 4E32A 3KR1A 1JEYA 4YROA 5DI9A 4FZ3A 3VR2D 2CNNA 3L8DA 4KITB 1FFGA 2WU1A 5EHXA 3V7FA 4TN5A 1YK0A 4JQYA 2A79B 1LPAB 3DNFA 1B04A 1KYYA 1QZUA 2IYAA 3NWJA 1CY4A 4JFRA 4K03A 2XMRA 3SIPA 2IGTA 2GMWA 5E9JA 1QFZA 4CLRB 2QN1A 2FNAA 1EUCB 2Z98A 3ZEAA 4NK4A 2AI3A 1NXPA 1PT7A 1YO6A 2OO7A 3G2NA 3IT1A 4ILEA 4QE7A 2HN9A 2V74B 3T3DA 1ZGZA 2Q2QA 1PTKA 1MNAA 4C4XA 3VKFA 5IRCD 3O1HB 2BF7A 4PRYA 2C0CA 4U6QA 121PA 1ENOA 1SWVA 1HTTA 1VQLV 1ZKDA 3O82A 4D3FA 2ZUBA 1NYTA 4PQFA 2PFGA 1JKMA 2CLCX 4RF5A 2R8PA 1CRWG 4R50A 1QK3A 3KDAA 4OXRA 4S2EA 3T0IA 5FTLA 4FM2A 2O06A 4J10A 2EBWA 1YIAA 3HDTA 5DNUA 3EA0A 1EYZA 2RHCA 3BF7A 3LDDA 3T7SA 1CIPA 2WTAA 4OI1A 4YASA 3R7LA 3UOWA 3M6UA 4BDTA 2RHJA 1D9ZA 2WLSA 3GFPA 4H08A 4XW2A 3IR6A 5ABPA 1X7XB 2KQXA 1B0UA 2VT6A 4UD2A 5B2FA 2BP7A 2RHOA 3T6KA 1BE3H 3H9QA 5J2UA 1W19A 2OCLA 4ZVSA 1COWD 1DAFA 4B6EA 3TCXB 5J9PC 4CJXA 5J2TA 1LBQA 2LBPA 5AQ1A 2CV2A 1P3JA 3VAAA 1PNKA 4ZBMA 3ETLA 2BFBB 1C7EA 1EQ2A 1FFAA 2CEKA 2R5NA 3I39X 1DLBA 3PQ8A 3QG1A 4F4DA 2OBLA 3PRYA 2QDKA 2NV6A 1W2WB 4DLSA 1WMBA 1WY7A 2GRJA 3GN1A 3HJUA 3K8QA 2OFXA 3RW9A 3EZXA 3VR5A 2GCOB 4P83A 1T2NA 3CEJA 4V0RA 1BMDA 2PYDA 4JBGA 4RA6B 2Y0IA 3TIGA 1YQEA 3DVAA 1SVKA 3BERA 3PX7A 4TWRA 3WZ2A 1TCAA 3OOWA 4V1CI 4J7CA 1U2DC 1MABB 1X7WA 2GASA 2ZEJA 4RV4A 3BJIC 4S35A 2Q7OE 5A4IS 1XEWY 4G4SP 1IEXA 3LNCA 2VQFB 1YR7A 4GR9A 3JSLA 1P2TA 3L46A 4UCXA 1JEDA 4BXOB 5D51S 1W49A 5F98A 3VR2A 4UPDA 3X2SA 2ZRJA 3H9UA 1J95A 2BEUB 2JRCA 4QQNA 4ZDJA 2X23A 3K71B 1XQ1A 2OHHA 4XWOA 1VE5A 2XJ9A 2G63A 3NNSA 4EVQA 2R7MA 2M6YA 3EUAA 5EHGA 3PUKA 3RREA 1F8UA 3N7UA 1YDWA 4KN9S 5DLQC 5IHPA 2FW9A 3T1HO 3JVIA 5KYWB 1ONPA 2HWWA 1CUCA 2QSZA 2Y1XA 3A3YA 3NWBA 4P3KA 1MAAA 5DWQA 4BECA 4ZZ1A 2XF2A 3BVPA 5AJVB 4Z2YA 4Z8YA 3S8EA 2AV6A 2WPDA 1P1CA 4NV3A 5DNCA 3FCSB 4X6LA 1Y5LA 4QUAA 2CGNA 4UEJA 3UJ7A 2JGUA 1IB6A 1XRRA 1ODSA 2M98A 2ONYA 2AFHB 1T4DA 2EHJA 4LY6A 2H1WA 3KUKA 1L3BA 3M6XA 3OPYB 4OG2A 2WEKA 1UZNA 3I1IA 3IBGA 3RJ5A 1P4GA 3GLRA 2WLTA 3CMCO 1NLYA 3NFRA 3SYAA 3ZW7A 4ANFA 1ULUA 3SDZA 4FVTA 1P49A 1L2TA 1JLKA 2PMKA 1ZRMA 3H87A 3B6EA 3OFSA 3B09A 2EG9A 2ZS7A 5DF1A 2X0JA 4MUEA 1AF4A 4MV0A 5HIMA 4K6HA 5H2FZ 3UJ9A 2A0FA 3AKZA 1ZZGA 2H5LA 4PZ9A 3DVSX 3AM3A 3KZXA 2QQFA 3CF4A 3G13A 4ETMA 2BEKA 2QD2A 2WG2A 1NBEA 3GRRA 1XQYA 4IIJB 4RA6A 4NNPA 3LF1A 2PS3A 1QZTA 5SY6A 3TZBA 1GM8A 1RJEA 1CY8A 3EAGA 5IXYA 3QG5A 1AGXA 4H9GA 3SYRA 4DHWA 3IUPA 1ZHOA 2ST1A 3B9QA 1X92A 4K0KB 2PRKA 3MD9A 3R75A 4M9QA 4TPKA 5EVJA 3K72B 1H3FA 3PDHA 4Y0NA 3GNTA 2XASA 3VPDA 3Q0TA 3Q4HA 4JI4O 2PL9A 3NETA 4TL9A 1HETA 2V55B 2WHQA 3ANYB 5FLYA 2EW2A 1JB9A 2RAVA 1Y34E 2NNLD 2NQ2C 1TT5A 2XMPA 3NWPA 1PSWA 4MVZA 2QUHA 1U7XA 3L1KA 1ZONA 1G8YA 5DFAA 2YI9A 1B0PA 2PD3A 3DEAA 2WOJA 1OZ0A 1G3QA 1ZU4A 4HYYA 4NV1A 2RGXA 3PU6A 2Q6OA 2AG1A 3N05A 5F5NA 4E6PA 5GQSA 5KLVH 3RIGA 2W6OA 3G1UA 4NAVA 2HR3A 3BHJA 3PVZA 4OK6A 2PU5A 3C6XA 5KTPA 1K1EA 1WMSA 3QKWA 5HDQA 1F1BA 4JNCA 1R88A 4EVIA 2Y66A 3J81k 3GGPA 3GJ5A 3EWSA 2NPFA 3PKJA 1I7QB 1CEZA 4WKCA 3VVBA 4IX1A 2HA3A 1TTPB 2OZKA 4C4TA 4H33A 4PHCA 2QX8A 5THXA 2VQEB 1IIRA 4C06A 4RTPA 4MV9A 2X0RA 1ZM3A 4JTCB 1CJMA 3EYAA 1PF7E 4FFWA 4HP8A 2X86A 4MS1B 2Q4EA 5EA2A 4KP4A 2ANCA 1GZHB 4RF3A 1Y6JA 2RJNA 4KE6A 3DCIA 3ZTYA 1DAKA 3ABSB 1C3JA 4IILA 1U3UA 5C7IO 1K86A 4CS3A 4RVFA 1D2EA 4FTWA 3GLTA 5ENZA 2IV7A 2XTNA 3L7KA 2Q21A 5HCUA 1L5ZA 3P3PA 3C41J 1LUVA 1XP5A 2PNJA 1YR1A 2VUTA 3BA9A 1B4DA 2JEZA 1XOUA 4MJ3A 3H17A 5HIAA 4N5HX 1WA8B 4DLUA 3S2IA 2AIRA 3M1AA 4FGUA 2K7FA 3WS7A 2XYHA 2OLJA 1QYIA 3QPBA 2QKSA 4LRTB 3S6JA 2QRUA 5KTRA 4AU1A 1XRJA 4J29A 4UXHA 2X6AA 1RPJA 1FZTA 2CSUA 3BYZA 3WWZA 1Y9JA 1ZH6A 4CQMA 3WC4A 4DSUA 1V48A 4MVSA 3HJAA 3ZD6A 5DECA 4KXMA 2IH5A 2K5UA 1CZLA 3LUHA 5I7FA 1AROP 3BTUA 1TIBA 3ELUA 2Q1XA 4OU4A 2B30A 4G2KA 5BXZA 4O4IB 1T5TA 4EGFA 5CBKA 1L4EA 4JGSA 2DUNA 3RBXA 1GH6A 3NALA 1NLMA 4KK4A 4NTYA 3QENA 4CR6A 2ZIFA 4K28A 1HXHA 1B14A 2FWIA 4LS3A 1W76A 1U96A 2CXHA 3R6DA 1I0HA 4HR7A 4E7OA 4D8TA 2DBZA 4DR3B 1KAQA 1USKA 4KK3A 4ZTBA 1MG5A 2OAGA 1FF9A 3TTYA 1VHWA 4ZEVA 2YS8A 3ZHUA 1P6UA 2G0AA 2EX4A 3LLMA 4YN3A 3O90A 4J11A 3BC1A 3I6ZA 3NC1C 3Q85A 1Q15A 1U0EA 2NZXA 3I12A 5CFQA 3ZZ0A 3L8MA 1RFLA 3MZ0A 1KSFX 1BZKA 3E8BA 1C9NA 1ZUIA 3IT2A 5LYJA 3PUZA 1QZZA 1PQUA 2R4UA 4YXWD 2NYVA 1FPOA 3HR7A 1T91A 3NGXA 4S24A 1D4OA 3EEBA 3O2NA 4FBMA 4H1TA 3D8UA 2H11A 2JBAB 2VCYA 4JYMA 5BP7A 1LFAA 1X4TA 3GG2A 4NICA 1YQTA 5K51A 4S1OA 1TJPB 1USIA 2A59A 3C5HA 5EKUA 4HWTA 3VC7A 1U3DA 7AT1A 3FMFA 3P3NA 4CMGA 1E58A 3MG9A 2F3RA 1VCIA 4JJ8A 2ZR3A 4OL0A 2OYSA 2GTIA 5IY5B 4HFRA 1E18A 1T8PA 5ALTA 2HNAA 3PF8A 3T3EA 2C2WA 2HLDD 1KTVA 1IUNA 2MTBA 1B7GO 2QU7A 2R8EA 3CF6R 4LBZA 3TOXA 3OX3A 4RANA 1QG2A 3V7NA 2OGTA 2H57A 2SCUA 4QOSA 3WJ2A 3GEBA 2PFSA 3U7JA 5H6QA 1XG5A 3N53A 1RRGA 3KT8A 2GNPA 3HDQA 4RK5A 4KI7A 3H75A 2Y05A 3LSSA 5EKXA 4NAHA 3W5AA 4AS3A 3AVYA 3OWHA 1AHHA 4MJXA 1XZFA 4MW6A 2IHTA 3VKWA 4CLHA 4RVGA 3THXA 2EBHX 4PICA 2H94A 2C4NA 2JJ2G 1V8PA 2YXYA 1LQTA 3FPFA 2R70A 2ZJ2A 5JNSA 3CT4A 3AF6A 2KM1A 3I5YA 1LXCA 2IUSA 4M1TA 3IAHA 3VTAA 1H9AA 1UPCA 4ZO8A 4EO7A 2I4MA 1SEPA 3RK4A 3AK2A 1GLVA 1GM9A 1RE0A 1SC1A 2YASA 2EG5A 3A3PA 2FFQA 3K15A 3LDFA 3ODPA 1Z2GA 2W6CX 4JJFA 4IIUA 4L1KA 4CZZA 1FX0A 4LHYA 4E15A 2B2XA 4NCAA 1SC4A 1Z6GA 3ZGYA 4EYGA 1F2UB 4OU5A 4RY0A 5I3ZA 3DBRA 3ZG6A 5JJNB 4EF5A 3I83A 3QIVA 4F3YA 2ATIA 5AXBA 1NT2A 2GPBA 4IDGA 4RQUA 1PVDA 4XAQA 1WXQA 1FDOA 2CZQA 5KWEA 1KYWA 1W85A 3EGVA 4I55B 3FUXA 3E70C 3M6LA 1V8BA 5GJCA 4BX9A 2BKXA 5CB4F 2C9CA 3K5HA 1HNZO 3R5SA 4RKWA 4BVGA 9MHTA 1G60A 1JJAA 1FRQA 1M1NB 1A9SA 4EKNB 2CDNA 4DIUA 4UJ5A 4NCJA 2IPOA 2G5GX 5E4JA 4RIEA 4DRXB 4FEYA 1ZK3A 1XVTA 5AJYA 1SXJD 1E1QG 1M2NA 4C4YA 2B4QA 1C1XA 1JKIA 2P77A 1G8HA 5CYGA 3ZNPA 1UUFA 1WEKA 4BV9A 1SKQA 3R4VA 4EYEA 3D1LA 3EIOA 1Y67A 4E4RA 3NUGA 4IS2A 4UQLA 2ZSDA 4M0DA 2X5XA 2A86A 1GN3A 5A6SA 3I1FA 3A2MA 5I9NA 2PX3A 5FXMA 4RK0A 3GVPA 2P79A 1E1NA 5BSGA 3CB2A 1KXJA 1XN4A 1H42A 3H2ZA 4WASA 1IHPA 4BIOA 2E4WA 3ZVKA 2G8NA 4E5PA 3DXFA 4A8JC 5ANRB 1DRKA 1HFWA 4RADA 4F9FA 4QFDA 2QZJA 4BB0A 1CY7A 2HFEC 2R79A 1AK1A 3RU7A 1S2MA 3BH7A 3D8CA 4RMGA 5CNIA 2OM2A 1G17A 1L5MA 1NHWA 1V7ZA 2RCNA 1WKVA 3T4PA 3ZQ4A 2I4NA 2NUAA 3HDVA 4KOAA 4MRMB 4FOOA 3PP8A 2Z2IA 3FGZA 5I47A 2IH4A 5DWDA 4AIRA 4OAQA 1EKXA 5DMHA 6PFKA 1XA4A 2BEWB 3L8GA 3ASVA 3H4TA 4TL6A 1JHAA 1LC0A 1B2LA 1E3QA 2X58A 1QBKC 3LYHA 1F4LA 3K8ZA 3THYA 1GUDA 3BXEA 2FEPA 3UAOA 2CE7A 4O1IA 1GPYA 2MSKA 1TO1E 1H2MA 2P9EA 4CMCA 1LBTA 2GWRA 1D03A 4Q02A 1GGVA 3BOSA 2GK6A 1UPFA 1Q22A 4WN9A 1IQRA 2J0SA 5TISZ 4MUNA 1RRMA 3K0SA 2IHVA 1ULZA 3DDOA 2PYJA 4RE6A 4CKCB 1KY2A 1YONA 4G63A 1A7JA 3GT7A 2M1ZA 4WOPA 1U1DA 1CP3A 4UAVA 1ZR2A 2JLVA 3CPWU 1YJBA 4I46A 4CNQA 1MO5A 3IAYA 4EARA 1OJLA 3AHGA 4MS4A 3VJRA 4KDRA 2CUTA 3JR7A 1Y74B 1ORTA 1G2PA 4IXTA 3ZJ4A 3HCNA 1R73A 3FGPA 4R51A 1ZOOA 1FFEA 2PZFA 1BS9A 1IAQA 3BFXA 4PCUA 3VU9B 3GGOA 1NVFA 1K6EA 3B1YA 3COWA 3WGLA 2R8YA 4ILKA 4RH3A 5BWNA 1XTBA 5I01A 1VARA 1QIFA 3JQAA 1I6LA 2MK3A 3LP5A 3PC6A 3UTCA 4QJFB 4FZ5A 5DTIA 4ZI3A 2Z6VA 5BUQA 4GUNA 3X2QB 1E9DA 1Q74A 4D8XA 3AB8A 3PV0A 221PA 3AFMA 1QO0D 1Q0LA 2V3WA 1XBTA 3HY3A 2GZMA 1T9KA 2XUIA 3LKDA 5FOWA 4TWJA 3JATB 2N05A 4HB3A 4MARA 2W6ID 3M6MD 4QDUA 3BMXA 1QFYA 4IVPA 4TXLA 3ZBQA 4RULA 4JT9A 3G5MA 3H0CA 3GGGA 4OMUA 4CBVA 2XRYA 3FR8A 2XQFA 4FHDA 1VHLA 4KG7A 4A9AA 5ALZA 3WRVA 2P6OA 4AUEA 3JZFA 3UC9A 4JLVA 2W0SA 1T8YA 4EO4A 4C87A 4Z7NB 2VSNA 2QSYA 2OAP1 1FKAO 4RACA 3HRHA 5ALKA 1QYXA 3EEFA 4Y2PA 4D0NA 4FYYA 1JEJA 1QIEA 2XITA 3D3WB 3I6BA 5KNBA 4OHWA 4YAJA 5A02A 4CN8A 1VBFA 3ZDBA 2LV8A 2WWFA 1UBRS 1NFFA 5TPZD 4EDFA 3K8YA 1VLQA 2Y99A 3QKUA 3ZKWB 5BMVA 4HDSB 2BFEA 4WCEV 3TLKA 3GDWA 3EPJA 2WYHA 4AO8A 3LJKA 5HZKA 4RTSA 5KYYA 3HCPA 3Q3IA 2DF8A 2EP5A 6ADHA 3V1UA 2ES4A 1FOEB 2ZKOA 1Z12A 4MCJA 3URKA 4C07A 4GMGA 4A0GA 5JD6A 2VS1A 4UVGA 1ZVQA 1EFPB 3QBDA 4IFBA 9LDTA 2NLJC 2DE0X 1QFJA 3ZGZA 5EUQB 1KKDA 1H2BA 2ZYGA 4R1QA 3ROPA 2D7CA 5EIOA 2Q67A 3CCUV 1W4LA 1ZFNA 4ZIBA 2XQIA 2H52A 4HDMA 3EN0A 4QU5A 3EAFA 2G1AA 5KJCA 3PQEA 4N5MA 3MQ2A 1KYTA 2CJPA 4LKOA 4LDJA 1K7DA 1YS6A 1NZJA 4G0XA 4OJKA 1W0KA 3WQHA 3A26A 5IVDA 1A8IA 2OZVA 1NRXA 1YMUA 3FKQA 1OX4A 4O33A 4CKBB 2ZXFA 4I3HA 1M6YA 2V0GA 1CDOA 4FOTA 1JU9A 1SD5A 4ZVPA 1RI5A 5AHWA 1G7CA 1P19A 2AQKA 2FRXA 5DBIA 4A2PA 1ESDA 4Y2XA 4A73A 2X3FA 1UPUA 3S1AB 2I2XB 4NESA 4XDHA 4CT0A 1ZUWA 4NATA 1QH0A 1G1XB 3FPCA 2WYOA 4MPDA 1VOTA 2D0OB 1XLWA 3ESRA 4WOKA 3DVQX 3PL1A 2HYIC 5B1BC 2JI4A 3LPNA 2DM6A 2ISQA 3AG7A 1XZPA 2V9ZA 3RH0A 1KH2A 4D4JA 1E1MA 3AY0A 1MC4A 3IUQA 3R20A 1UJ4A 3UOGA 1P9LA 3KTAB 2HX1A 3I2HA 1L4FA 1OV9A 1SQSA 3U4HA 4I4TA 4URZR 3HDGA 2HEGA 2V6BA 4FYWA 3OZUA 2RDMA 4LYHA 5A9TA 1SBTA 4MW5A 3FB1A 2ZUUA 4F4HA 1NUTA 1T4CB 2AA3A 3L5KA 1YDMA 3HL0A 5CNMA 2PUEA 3TPFA 2NGRA 2ZIAA 3H3FA 5F7XA 1DQYA 3IESA 2P91A 4CW7A 5GINE 3CRAA 1EUQA 1UT8A 3CX5F 1Q1ZA 3IHWA 4LE0A 1QHYA 3PC8C 3PXXA 2WTUA 4ZZIA 4U7NA 1LW7A 2OSBA 5JXHA 2QOEA 4C78A 2BEWA 4FIPC 2QTNA 1F2TA 1V7CA 4PM4A 2AF4C 4XIFA 2WLMA 1IH8A 2FX2A 2H5EA 4IHJF 3TIVA 4B84A 1F2DA 3VVMA 9LDBA 1E3LA 3HNPA 3BTOA 4KJXA 1RKUA 2FG7C 3N6XA 4BFSA 2IX9A 4OHXA 3X2QC 3BT7A 4JLOA 4RELA 1EXVA 2XKJE 3ZK8A 1GPUA 1YU9A 2LWIA 4QXRA 5AO9A 3SJ7A 1WZUA 2GVDC 5FUMA 1ZWKA 3M6IA 3SQDA 2B7LA 4LF4B 3VXKA 3NANA 5ALYA 4GKJB 4RPCA 5AVJA 4E5MA 1A27A 4QICA 1N2CE 2FOLA 2YTZA 5EIAA 1T1IA 2F23A 1H0SA 1A2BA 3DJFA 1UPGA 1W47A 4QXPA 2NU9A 4J49A 2L18A 2R84A 1A4XA 1UBCA 5JJEB 1MB4A 4BO1A 1KERA 2PZKA 4YMTA 1VL0A 4UAGA 3T1YB 2A7QA 4W1QA 1GT91 4DR5B 2HHCA 4KUHA 3K5MA 1XJ5A 1U0FA 4EA6A 5BUCA 2CDYA 1CEXA 2LGJA 3GHYA 1UDWA 2GXQA 4X85A 3HK2A 2XHZA 3G67A 1K6MA 2NU6B 4MQ4A 4UMEA 4B4KA 4X1OA 1RYDA 4ZQHA 3F4KA 3NPMA 5A05A 1SVIA 5EN4A 1V71A 2OBXA 2IW5A 4IYRA 2CUGA 3DZKA 1BN7A 5L40A 2HJFC 2OZLB 2ZBQA 4TROA 2PXCA 5F4BA 5JJ5A 1RKVA 5DEDA 3QWAA 3TW6A 5B2EA 3C3DA 1RZRA 5BY1A 1KMNA 1QM5A 4KLRA 2GETA 3HBAA 4HNRA 2IYLD 3TM5A 3SYTA 1XL6A 2GN2A 1E3SA 1JR3E 3WB1A 1EJ0A 4UQOA 2PZBA 2QQGA 5CT9A 4ESHA 1SCUB 1UIRA 3R0QA 1G6HA 2PH5A 4N7RA 4R2WA 5D1HA 5J5VA 3U11A 4C03A 2P5SA 5J2UB 2YN4A 4R31A 1KOLA 4WCVA 3QKRB 1PTJC 1SK8A 1H2EA 2XE4A 1Z47A 2ZI5A 4CM9D 4YUAA 1N5OX 2Z5UA 5CBGA 3EC7A 1E1QD 4DNQA 3OWXA 1IHUA 1P9WA 3PHJA 4LDZA 2FRVA 1GILA 4EAQA 2CXSA 3I37X 3OTFA 1CJUC 1QMGA 1EUDB 1OF1A 1P5FA 4KPUB 3BIOA 3A4IA 4C20A 4UOZA 2WDPA 1VQ4V 1QCZA 1TEVA 2Y1EA 1KI2A 4G1CA 2GT1A 3K16A 1ODFA 2Q4TA 3OQ6A 2Q2OA 4BFZA 4Y0VA 1L1FA 4H31A 3W6NA 5GONB 1RYNA 1HH4A 2N46A 3G9TA 3WDKA 3B9RA 4UARA 3RVRA 2Y69B 5JH7A 2VT2A 1Q86W 3G9UA 2NV0A 3GT4A 5AOCA 3Q7EA 2NUTA 1CQXA 1Z22A 2ZT6A 5J47A 3T3OA 1JAHA 2Q49A 3LNTA 2XCSB 1JFFB 1KYZA 3AF5A 4LBYA 4ZQFA 3QV1A 5HX7A 4NV0A 5IZCC 1MORA 4IYHA 5ES4B 1IQ0A 1ORRA 1QHFA 1A9YA 4CGZA 2KBFA 1VTKA 4ZAZA 4ND8A 4YCLA 4O08A 4FNAA 1QO9A 4NOJA 1GQQA 1Z39A 1DO0A 4C1NA 4PQYA 5IWCA 2QBYA 4IVRA 1S5LZ 1M5RA 5EMJA 1RWVA 1IBMO 3E7DA 3PNKA 4R9NA 2DKOA 1N8SA 1OT3A 1YZTA 2IXFA 1O4VA 3FUVA 1E77A 3FKSA 3C5EA 4JWKA 4QYIB 1XDBA 3GG9A 1N0JA 3CG0A 3N8KA 4MEAA 3VO2A 5GJVC 3WHKA 4GBMA 4P5EA 2XJ4A 3TOZA 2ZYAA 1CZUA 1C3OA 4LF6B 3BEHA 4KPEC 3KEQA 5CH8A 4LR3A 3RTCA 4EG8A 3TI9A 4IGEA 5ILOA 1G6OA 4ZT7A 1LI4A 5AYVA 3DAYA 1NN1A 3JWEA 5JRJA 1JDSA 3UT5A 3PDUA 1SUDA 1XROA 3UT6A 4QX6A 5EP2A 3X44A 4ARIA 3H1KH 4MVCA 1YZVA 2WJHA 1YK1A 2D1SA 1JFVA 5HF9A 2XY4A 3F5WC 3T1YO 2WRZA 2QM3A 2D0PB 3D6HA 5B2ZA 5T57A 3WI7A 3WYDA 3IUMA 3I58A 4DG5A 3W7VA 4BLSA 2HVJC 4QGGA 5JZ9A 4YJFA 1MF7A 2OILA 4AD8A 3IDOA 3QKRA 1AQYA 1TYDE 2LRHA 4OHMA 4OHZA 1J22A 5JS2A 3KUCA 3THOA 1Q8IA 2YC2C 2JGIA 1Q90D 1NSYA 1QIKA 3H4IA 1G1AA 3FPAA 2VOEA 1HV8A 3G8AA 2YWCA 1W44A 2ZWOA 1T1RA 3Q10A 1NI3A 3W8DA 3FYHA 3TQTA 1EK5A 4JC8A 3W7UA 1YVWA 1R16A 4PDVA 1Y48E 1PFGA 2JD1A 3AB7A 4XEUA 3U7RA 1BN6A 4RJTA 2DHEA 4XIJA 1TK9A 2NO1A 3CR7A 1SC5B 4BW9A 1PR3A 1BTOA 2H7YA 4ZAWA 5C8VA 3OF5A 1NJSA 1R12A 3RJMA 1KMQA 1CLEA 3GJ3A 2OXTA 2CWDA 2XZOA 1B23P 3HJGA 2P9QA 3UH1A 2DFKB 4EABA 1L5KA 4XX0B 2QTOA 4PCLA 5CLGA 3CA8A 1AG9A 1Z2CA 1ZNZA 4WKPA 3P27A 4JL6A 1MRZA 4KSBA 4LHWA 1EWYA 3KQQA 5REQA 3RKRA 4AN0A 1IDSA 1YZQA 2XE8A 2QN6A 2FZWA 3QVVA 1QR8A 1S3FA 3MHHC 1A71A 1Q2XA 3JD4A 3QVXA 1ZI9A 3PUVA 5FORA 1C30B 4FW9A 1APBA 1N3YA 4PF1A 1Q83A 1Y3DE 1YQQA 5AKGA 1POWA 3E15A 3QYFA 4G0MA 5T41A 4CEHB 2ARHA 3D4PA 3NTQA 5TQVA 3NEAA 3UKOA 5IKPA 4CR8A 1AI7A 3ONVA 1FRZA 1A8UA 4JR0A 1PEAA 4Z4QA 3P96A 3N28A 1M75A 1H2RS 3IMKA 4DYHA 1MXFA 1JSXA 2YW9A 4JFAA 4RXUA 3WLAA 2DH6A 3DLHA 1B0AA 4IDEA 4QGBA 3WJAA 1QCYA 1M83A 4DWOA 4BIZA 3VPAA 5KUKA 4UTNA 1JDBB 4L4ZA 2FWNA 5AUOB 4KQ9A 4CQMB 1T1SA 2ZB2A 1YQ9A 4ZO6A 4GOKA 2QKAA 4X3PA 4EJ0A 3NHWA 1W93A 4QUEA 2AFIB 3VQWA 1EHCA 1P7YA 4QRIA 2ZP1A 4ZMBA 3BGWA 2X0NA 1HF3A 3ETJA 4BNTA 4CM9A 4F4CA 2OXRA 3LT1A 2Q1UA 2DCMA 2DY1A 3H1TA 4C21A 2A9OA 3WLJA 4CV3A 4DFDA 3KQSA 3DEJA 1I2AA 4GLOA 3EWAA 3ITNA 4FFRA 4XPIB 3FH0A 1DRJA 1QGED 2WJ4A 4LRQA 3HLYA 4NZYA 2RGYA 1LK0A 1EQUA 1Y98A 4LX0A 4YAOA 3DULA 2OZLA 3DWEX 4IL5A 2HI0A 2X3YA 1LLUA 3DDZX 4E14A 1NLFA 4JZGA 4FYKA 5FEMA 1MX5A 1DLJA 5GM1A 3GZNA 4PC3A 3ZCPA 4F2WA 2OCBA 5KWSA 3KZMA 1V9SA 4NLLA 3WRYC 4F85A 3EPPA 5CXUA 3FHOA 3DTVB 1DIRA 4GM4A 3IAM6 4LPSA 3JQAB 3SE0A 3G6KA 4LF5B 2JHPA 4FONA 4HDKA 4MS3A 4BN4A 5I5EA 4HNAA 2QN2A 3LCCA 1CYEA 1YNSA 1O7JA 5E1BA 3C24A 4IWYA 1TCUA 2CWWA 3DGEC 2FWJA 4P4TA 3V48A 4DLRA 2YFHA 4FOPA 5HNKA 1S02A 2LVBA 3CO0S 5K1PA 3AX6A 5J1SB 1KY3A 2GK4A 2O48X 3H6HA 3OFJA 4DR3O 4J2HA 4R3WA 4UVEA 3HSSA 1NF3A 2P6UA 3LQ1A 4NTZA 5FA5A 3B7GA 1C0KA 1M5TA 1SUEA 3GO4A 5HGJA 3BXFA 4EI2A 2B5VA 4DMRA 3DL4A 3IKMB 1RQLA 3QFFA 2ATKC 5KHGA 2CCKA 1H0HA 3SEAA 2Y76A 2UAGA 2VYVA 1AQJA 4E08A 1DV2A 2PX2A 5SYAA 1NAHA 3VR6D 3DC2A 2XTAA 2P2NA 5ILGA 3PPYA 4GSKA 1QBZA 1CZOA 3A9VA 2NTEA 4IUDS 2AZMA 1K9SA 1MAUA 1KS9A 5E2AA 2VSYA 5E6SB 2NZJA 2ZI9A 2ZR8A 2A30A 2YIJA 3HMKA 5EJAA 5LZ8A 4E1VA 1S7CA 3OQVA 1A4UA 1F2UA 1QH1B 1RKXA 1SPXA 2X7XA 2ZBGA 2C5AA 3DUFB 4WY5A 4XVRA 3APQA 2QKYA 2HF8A 3G7UA 2G9VA 3RYCB 1TB4A 5G0VA 3VKVA 4RHEA 5BUSA 5DYNA 2GPJA 2OCHA 2KSDA 1NQAO 4TUYA 1P60A 3C98A 5IKXA 1B93A 2QTVB 2D74A 4U3JB 1EU1A 8OHMA 1Y3IA 2NZ2A 2XSZA 3K6KA 3QYJA 2QAIA 3TZ6A 1W0KG 3REQA 1J1ZA 1H2NA 5IX8A 4L5AA 4RPJA 4BUCA 1RXIA 2BR5A 1NMEA 4KXVA 5DK4A 4I50B 1SVOA 4DREA 1C8LA 4QXAA 1N1MA 5IARA 3OPNA 4GYKA 4DLTA 4YV1A 3FZNA 4OREX 5KSOA 1EE2A 1U1IA 4MYDA 1XXHE 1VBNA 3AUJB 4H6PA 4B44A 3QW2A 5F77A 1E2EA 3ETQA 5C31A 2QR3A 3F8TA 4KJZA 5H70A 4FILA 2BGTA 1RBMA 4ZA2A 1V3TA 2F3PA 1MVLA 2PUHA 3IJ5A 1H6DA 1V4NA 3SGIA 2XDYA 1ZN9A 1D6SA 3OT5A 3SKXA 3FKJA 1SQ0A 2FYTA 3GLHA 3W6PA 4OXKA 4TYNA 1W1IA 2BCCH 4LP8A 1I32A 2I3DA 1RSOB 1UBEA 3NX4A 4F6RA 3L8FA 2WV7A 1A9QA 3P30A 4OQMA 1J21A 2VDMB 2WSLA 3KX2A 3DF9A 3B6MA 1N5DA 1J99A 1ESNA 1OZHA 5COBA 3OOYA 2VHVA 3INGA 3FFBA 2R9IA 4P0PB 4WK4B 2JAPA 4HMPA 4KQCA 2EFJA 4OHUA 2ZIVB 4HNAB 4GMHA 5EZYA 1BNCA 3PT9A 4MW3A 1M10A 3K9CA 5IKOA 4NZ9A 2RKBA 2C54A 3PNOA 1IM5A 1SC6A 2MSLA 4KGDA 3TQRA 2HOQA 3WSTA 1FC0A 5I5GA 3I2YX 4KCGA 1O9GA 5J40A 3WL7A 5LOVA 2A35A 2ALJA 2KG7A 1DX4A 2BFMA 1O89A 2FMKA 2QS9A 4JKYA 5B1IA 4CCAA 3IGAC 5AVRA 4BGUA 1SH7A 4RPKA 1AHPA 1T0JB 3WP1B 3HFSA 2ZW9A 4O0LA 1LEHA 3CM0A 4HRAA 4BO5A 2QG6A 1AK9A 2W8BA 4JJ4A 1IEWA 3FYSA 1WETA 1KU0A 2EC5A 3B51X 4G81A 4RQAA 5H1YA 2PS1A 3TTTA 1BRMA 2BSAA 4UEQA 3HSKA 3RS4A 2JS7A 5IPFA 2RGRA 3A4MA 4M1KA 3BX1A 2UYQA 3IDFA 4IH4A 4BFLA 3L9DA 1TX4B 1WUIS 3EQZA 3WK4A 3TD9A 3E7WA 3U56A 2Y0DA 3BFVA 3GVHA 4W5HA 3TXXA 4QTUB 1NC3A 3ENVA 4MVJA 2QP3A 1LSJA 4Z99A 4EVSA 4ENRA 1GV1A 2HPHA 2HGSA 3OM0A 4A8JB 4ALNA 1V5WA 1AURA 1W96A 4XDLA 2H29A 3K4HA 3B5IA 3C1TA 2VH2A 4JEHA 2WKPA 4II7A 1TF2A 2QGFA 1EWQA 2ZZNA 1KRXA 4NPCA 3K2EA 4KO1S 4Q66C 2OENG 5TF0A 2VZ9A 1XILA 3NAGA 1GQYA 4JLKA 1HO3A 4JITA 4L5YA 4E03A 3GFTA 4POAA 3V1TC 3VH3A 3B2EE 1WMFA 2E49A 2HDNB 5KPDA 3L18A 4NKRA 4Q3DA 2HQRA 4KL1A 1S76D 2EOAA 3VGJA 2EKPA 4F2HA 2VCEA 4RBNA 4RYDA 4EG4A 4MUYA 2AZ4A 4UHJA 1B2RA 1GUAA 2H2IA 4Y8VA 1Q7YW 4DJAA 1GZ5A 2ZJ6A 4D82A 5L3VA 4LDNA 3ONEA 1X7ZB 3JASA 3K5OA 1NRIA 3U5TA 1PHPA 3WAGA 1PX0A 3ESZA 5KDLA 1ZH8A 3L40A 1TUGA 3BRSA 5JMTA 1M56B 4BBZA 2O2SA 1JG3A 3BHIA 3NDPA 5CLIA 3TMKA 4W5WA 2R48A 3QVNA 4NF2A 2QJ1A 3OMNB 1HT2E 1P61B 2Q5CA 1MKYA 2QUKA 1X9GA 4HAOA 4X0EA 1EDOA 1UFIA 5K1XA 3W7TA 1TXGA 1TD9A 2H06A 1IBLO 2XNKA 3BB1A 3E22A 2PS9A 3CRNA 4FINA 4OB7A 4P7KA 1Z5WA 3DGFC 1TC2A 2G9NA 4TWAA 1USWA 1WKCA 2H0QA 4H77A 3WGIA 4URYR 3CEMA 4WFQA 3TINA 5AI9A 3U48A 1U97A 5BSWA 4L0MA 4RZHA 5JEDA 2WW8A 4G5XA 5GTHZ 5LQNA 1RRFA 4UATA 4GOLD 2JI9A 3GT0A 1OI7A 4PLTA 4LF9O 3K04A 1T8TA 2VTBB 3BULA 3H0EA 1K2WA 3SC2B 1ZUHA 3BEOA 1HW7A 4P3PA 1ZN7A 1CUFA 1W0JA 3ZMVA 3ZIAA 1K6XA 2Q28A 2JJ8A 2J4CA 2ZRHA 1M54A 2AFIE 5CRIA 5IT4A 1MZVA 3ZMUA 2PL3A 4YP5A 2YXBA 2NT3A 4MTCA 4OV6B 2YH2A 3DG9A 3I52A 4DEVA 3N2KA 1O94D 1J0AA 1OIWA 3KUDA 1GGHA 2AOTB 5DGCA 3QITA 4D56A 2WK1A 3FUUA 4L78A 5ITWA 3W5BA 1P7VA 3F9RA 4B71A 1R1BA 2QD5A 2FHPA 2QTWB 2X13A 3AKCA 2GFIA 1T3GA 3A1CA 4Q03A 1NUAA 2QLBA 4UXIA 4BAGA 4OQEA 2Y9MB 2H18A 4J7ZA 1ISSA 3IULA 3U3RA 4TV8B 4RETA 3VC2A 1MOSA 3AERA 5K3EA 4H4DA 3CS3A 3HVHA 1B00A 2DH5A 1P5HA 2V1XA 3QK7A 1V7PC 1MIOA 4CEHA 1J0DA 3IPYA 4S12A 2CD7A 2JLUA 4B4UA 1EVJA 1I6WA 3IIJA 4INOA 1GP2A 3LX6A 1UBNA 2JFNA 4BFUA 1U8EA 4ZYVA 3OLXA 1M2VB 4RGQA 3A27A 3WLQA 1US8B 3EYWA 2JVKA 1P0FA 3EQ7A 2Q5FA 1OX6A 3GLQA 3P9IA 3ZDZB 2PGOA 2X5JO 3BA1A 5F9MA 5F7ZA 5BV7A 5JBNA 4LGMA 2V7TA 5H5JA 3IVXA 2X77A 1BS3A 5BNIA 1CNMA 1TEZA 1Z4KA 4K35A 1J5XA 5ITZA 3OD5A 3D8SA 3PFNA 2CNWA 3S70A 4ZK6A 1RXWA 2FSFA 1FJXA 4LZOA 3WK6A 4UXJA 1UJWB 2JFQA 4Z4CA 2IH1C 2DPHA 1K6IA 4J43A 1ENPA 5FULA 2VJCA 1JG6A 3JQ7A 3AHEA 5DW0A 1KKLA 1TJ3A 1Z06A 1RM4A 2AUMA 1LRKA 1SO8A 4OO3A 2HCBA 4P92A 1M4UA 1WMDA 3EC2A 2J4FA 3LWZA 3CNNA 4Q4CA 5JCXA 2WF6A 4LNUA 4MKGA 5FD8A 3SJUA 3WA6A 1R8QA 1Z9BA 3TR0A 1IXKA 3U3JA 5B7NA 5BWMA 4W8GA 5BWLA 1B8OA 3KYIB 3UA4A 1KNQA 4ZMSA 3CVUA 2IJIA 4B83A 2YOHA 2E76B 4IMIB 4JT4A 5ESDA 4GX2A 1UMCB 2QA5A 5BW8A 5JPCA 5JY1A 3R9XA 4AFNA 1C9DB 1XYYA 4ZRDA 2ZTLA 5SZIA 5SZKB 5BSVA 2GCOA 4U7PB 1J07A 2WKWA 4NOKA 4UBJA 1CJKC 3HUFA 2A0UA 2Z2KA 4NPHA 4QDXA 3LECA 3AVUA 2G4VA 1JMKC 1E0DA 2GI4A 5EXDA 3DTNA 5IF9A 1PP4A 1FSPA 1NQVA 2OOSA 4O4IA 2WSSD 3KD3A 4FD2A 5JT1A 1Y6GA 5HS6A 1H2AS 5FPYA 4F92B 3FOAA 4AI6A 4Q4AB 1E2QA 4EGJA 1Y82A 3TRFA 3HUEA 3U19A 1F5NA 1SOUA 1P29A 1ZH0A 4GDMA 4U02A 2CL6X 1SXJB 3IBYA 4GS5A 2RDCA 3FCYA 3LTEA 1LNQA 2AXEA 3KE9A 1VYHA 2WLLB 1T0IA 1ZD2P 2G1JA 2GN4A 2IRWA 1Z5GA 2FX5A 3DBIA 4LQDA 4M76B 4EEKA 5B1AC 2PZGA 3KZNA 1CR2A 3QU4A 2C2AA 3CC4V 3GRVA 2Q7DA 3CVJA 4CU5A 1PHRA 4OQPA 4XDKA 3VDQA 4LE2A 1ZRSA 4HRVA 4GNKA 1QTIA 1WSDA 2W2LA 5G41A 2OCKA 1G8PA 3P45A 1MMFB 3OVMA 4OQNA 3TXQA 2WIDA 4NYMQ 2RHWA 4WK2B 1ZJWA 1DIOB 1H1LB 4XWAA 2DVMA 1VC2A 2IYEA 3DGEA 3D4IA 4O25A 3DW3X 3E8MA 4REQA 5HIJA 3R76A 2CHEA 3CNLA 1IN6A 1Y6RA 3Q3JB 1M34E 3ROGA 3I4FA 3S55A 4D80A 4XZ3A 2W8ZA 2O14A 4Z1MA 3ZRWB 1T25A 3IXQA 2C57A 5CBPB 1OFIA 3RV4A 3FTFA 2VS0A 1N33B 1JLLB 2FSVC 1EUZA 4B0OA 2JEOA 1UPAA 3FFAA 2A8YA 3I2KA 4JP2A 3W7BA 4D2IA 1GN6A 2VUHB 1Z7YA 4RWEA 5EHQA 1JHUA 4ENVA 1QRAA 1MG1A 3KQLA 3ADDA 2PMFA 5K1ZA 5C8DA 1XFAA 4G0OA 1GUYA 4L8GA 2TSYB 5JBQA 3OT7A 1S8NA 3AP1A 3BFJA 1KI7A 2CXXA 4X41A 4MVUA 5KYVA 1I5EA 2JANA 1Z2PX 2NG1A 3MC1A 4XXHA 3S1LA 1GKYA 3A25A 5J43A 3NUZA 5I9SA 2W83A 4O63O 1YULA 4EUHA 4HN2A 4MPRA 2H59A 1B43A 4RJ2A 4JJAA 1WHSB 3HI6A 3GWGA 2WF5A 2O54A 4F6RB 2Q8NA 4N7JA 5MHTA 4NCHA 3TRHA 1FXKC 1OI2A 2D3TA 2QM8A 3E58A 2P4EA 3EH1A 3OCVA 5DRYA 4AF8A 5A5EA 1FMCA 3UJBA 3G2OA 1SUCA 3GLFA 4EKYA 1WDWB 3RAFC 2X15A 4CMIB 5J4YA 2VPQA 5CITA 1ND6A 5KAMA 2EHDA 1LLQA 5L3FA 2CGOA 1JKFA 1KI6B 1B6TA 2VP9A 1I1QB 2YYYA 3AU9A 5AVTA 2WSYB 5EESA 4WDQA 2HM7A 1J2YA 2Q3JA 2R6HA 3LK6A 3M82A 2Q2VA 2W6PA 3O1IC 4WLFA 5AOVA 1VF6C 2IV3A 3IEVA 4JBLA 2GCEA 4ARBA 2EGHA 4AYXA 2D8MA 5JJIA 5B1OA 5TV2A 4CM3A 1YQGA 1BXGB 3BQMB 1FMJA 1G20A 5TMEA 3RVYA 5JCJA 4V02A 5BSKA 3R5JA 2DLNA 3HI4A 1ZM9A 1OLSB 1UKEA 3GLIE 4YCBA 2Q4PA 4FW8A 1VI5A 1Y1SA 3ZD7A 1XZ8A 4AUNA 5LGUA 1MT0A 2WAMA 5D3ZA 5KMGA 4DUYO 1I7NA 4QPDA 4KR2A 2IJJA 1NVWQ 2C2XA 3DMGA 3QYPA 1ZIXA 3QGMA 4E22A 2Z3VA 4BEWA 2NP6A 3DDNA 5CMUA 4DV1B 2E55A 4RENA 1DAEA 4Z1MD 4O2BA 3W5IA 2YOGA 3EZ9A 1E8DA 2ZJOA 1IVSA 4N40A 2NW6A 3SIWA 4C7UA 2AVDA 4QSHA 4IXDA 1PNRA 3R3HA 3B5EA 1Z45A 4BLRA 4NPAA 4L8FA 5LZ5A 4NDAA 4BMXA 4GRDA 1QV9A 1UODA 3SEZA 5C1PA 5K0ZA 3PEUA 1Z2DA 1K66A 4AMZA 5LBQA 2XODA 5A6SB 2R9AA 3WQBA 4YRBA 2PUFA 1KYVA 2QU8A 2DSNA 3PT5A 4MQUA 4H1VA 5AHKA 2YBDA 3ORQA 1LK7A 2Z9CA 1YMQA 3B12A 3VQXA 4W82A 3WRYA 2QP9X 2VBIA 2HWXA 3H2SA 1YA6A 1DEHA 1G291 4JIMA 3QUBA 2G72A 4ZV7A 4YR7A 4M54A 4D98A 1QPGA 5JHGB 3KLMX 1JYEA 1IWPB 3QJGA 4ARUA 1WXWA 2AR0A 2JLCA 3TQOA 4D3YA 2HSJA 2XYRA 4M8IA 3G4SV 2P6NA 1BHBA 4HLQB 4UNPA 4ZP1A 3M3PA 4OBEA 1CNEA 4RTLA 4KRFA 2FUG1 1I7PA 3FZGA 3ME5A 4N9QA 4HZ3A 3DEZA 3GDHA 5GPBA 5I4BA 4QEZA 5FPSA 2QAJA 2Z95A 3SSAA 3X1YA 3QO5A 3OEEA 4JLBA 3WDLA 1JPUA 2I67A 4R9SA 4RFLA 3OWOA 2H9YA 4TQAA 1G5HA 3CWQA 4HDCA 3OCYA 4JB8A 4QT0A 1XXLA 1EBUA 2VP3A 5F33A 4UFZA 1JHVA 4PO3X 5D3QA 1XRNA 3WIVA 3WL4A 3SQLA 2D0DA 4C0LA 5ELXA 5DISB 1DGQA 1E6WA 1JHOA 3ONFA 3W34A 4FEEA 4OPHA 3FBWA 4MHSA 4Y6GB 3U61B 1J7JA 2J3QA 3B40A 1I0IA 4N23A 3FHCB 1E2JA 3I2GA 4FYVA 1S8OA 3K79A 2OO5A 2R8BA 1RBYA 2VYQA 4DA8A 4D5GA 1XHLA 4JPRA 4E13A 721PA 5IK2D 3A10A 4J4HA 4W6QA 4ZTUB 2QI9F 1NZ6A 3Q9SA 3BMNB 3H1GA 3WK8A 4QEKA 4Z3KA 5AW7A 5D5QA 1IG3A 3R3ZA 2D5LA 3OPVA 3H11B 4QDTA 2R25B 4M9XA 2GARA 4WECA 2J31A 3T1NA 3LOUA 4L3VA 3FAKA 2IU6A 1YGPA 4RFSA 2FPXA 1R9NA 3PEEA 3TMYA 3UFBA 2OC9A 2YVUA 3UWSA 3EGXB 4YREA 2X14A 1QP8A 3ISJA 4DR4B 3NHUA 2IKQA 1ABBA 4FZ0A 3MHTA 1H2HA 1CDEA 3UBMA 1R5NA 4OP3A 2CY0A 5KVAA 3N0RA 1IRIA 2X2PA 3VNSA 3VNQA 4EFLA 1JDZA 5JFGA 3DMNA 2GESA 1IHDA 1WUHS 2VRCA 3EPRA 2FZ4A 2IYZA 1U8CB 3MTGA 4AB1A 2WSSG 5DTQA 5NLLA 3K20A 1KIMA 1OC4A 4PYNA 3ESYA 3HDHA 4DLNA 3S81A 2IZ6A 3HXPA 5DCUA 2BZ0A 2OAEA 1ZSNA 4LAFA 2ZE6A 1QG0A 2PKYX 4WFAV 4LXHA 1DG1G 2OMEA 5HR5A 1FYWA 5LZ4A 1WZEA 1E2BA 1RBQA 1CUVA 1EN5A 1WXXA 2IV2X 4NMMA 5AKLA 2F1KA 3D5TA 1ISPA 3FPGA 1BKSB 1HYEA 4J0DA 1G63A 4M36A 3UYLA 4GXNA 2A5LA 1DBQA 3HO6A 1T9DA 1ZH4A 2KQUA 3PUJA 1XTRA 3GPBA 4W8HA 1XQ6A 3AG3B 4LFBO 1W4RA 3P5BA 5KOYA 4RAIA 4M1EA 3OKCA 3EDRA 2Z83A 1PIWA 3JQRA 3WNBA 3VNUA 2F43A 4A7PA 1ZK2A 2QWPB 3CCLV 1PU2A 1D5CA 4BVHA 1JW9B 2ZUCA 1JPNA 1T4MA 1XRLA 4NWIA 2IITA 3P0IA 4KU4A 2YVLA 2ZB7A 2V4MA 4TS3A 2WICA 2HO5A 1G20E 5AH0A 2EERA 4G0ZA 1YC2A 2DPLA 4XB1A 4LGVA 5H83A 4OLJA 2HJGA 3BILA 1UMKA 3M0EA 4AJ1A 1NATA 2GX6A 3EASA 4HSEA 3X1ZA 2RIRA 2AFIA 4HGRA 3DLBA 2JAQA 2WUWE 1KC1A 2EYQA 1LJLA 1UC4B 1UDAA 1DWPA 1R2QA 5KU1A 3LPCA 3AG2B 4XLLA 3ZY4A 4AKSA 1HEUA 3BJMA 4DQDA 2JIBA 2N3ZA 1NN3A 4DY4A 2OMKA 3U44A 3NYRA 4JJKA 2ORWA 4BFCA 4JZ2A 3ZH9B 5K0FA 5B58C 3C3WA 2BPOA 4BMVA 1H66A 4X88A 3A11A 1X1AA 5C9ZA 1YBFA 1HYGA 3A58B 3PS9A 2W58A 1OVGA 4Q93A 4LCJA 3SLKA 4C4OA 3DBHA 4MAFA 2ACKA 4OBBA 2HLDG 1DT3A 4MV8A 4QDOA 4BVBA 4NBUA 4RM3A 3PDJA 1OHHD 1CRQA 3QMMA 5F1YA 1UOQA 1IBCA 4KMMA 4EBBA 4GGPA 1ZAUA 4EG5A 1YIDA 2QZZA 5CA0F 1SM4A 5BNZA 2YIVX 1U7DA 2H07A 1KP2A 4Q1DA 4EYOA 2O57A 1YZHA 2VSFA 3N1UA 3BH6A 5H80A 1WWKA 3VOBA 2B82A 1TK2A 3QHPA 4HH0A 2P0EA 2ASVA 1CUWA 1C4XA 3UMJA 1AUOA 1XD9A 2Q41A 3ZYCA 5B5EZ 1U5BA 1VQKV 2YC0A 1B41A 1F4PA 1ODKA 1FYJA 2J3KA 2Q1SA 1CZRA 4PYKA 4RDCA 1GTJ1 4JJIA 1MNQA 2VQDA 4ZJZA 1C7RA 4EGSA 4NG5A 3NPAA 4Q4HB 4JUCA 4Q1VA 4R7ZA 4PHGA 3S29A 4X45A 5FJJA 1YU6A 1E1RG 4JLMA 4Q3AA 3S8YA 2AGVA 3H5VA 1VZ3A 2XOKA 1LQUA 1G0OA 4UU8A 2NQTA 2B21A 1M8JA 2ZINA 1TZBA 2LCIA 2DQKA 2WOOA 3VRHA 1P74A 4MQFB 2J6BA 3EW7A 1EJBA 4DADA 1AUXA 2OHXA 1OU0A 2R1VA 3PD7A 4DABA 2O5RA 1DP4A 1YJXA 1XB2A 4BUJA 5BRAA 5CG2A 3I9NA 3M9WA 2CHUA 1HL7A 2JLSA 5AUPB 2BHNA 4H0LB 1PJQA 4K8ZA 3DDUA 2WTBA 3U31A 3FYUC 3W78A 2BYTA 1QDLB 2GAJA 3M4NA 4KHPB 1JX9A 1L5OA 4NG4A 4KSCA 1A5ZA 3DT9A 3RF6A 1XREA 2Q0AA 3CZAA 3LYUA 3QPCA 2TS1A 3P2IA 4OJNA 5I7SA 1W7AA 1ZUNA 3KDPA 5HFMA 4YMSA 2ZI6A 4FOSA 3V8PA 1NPDA 3PHCA 1G9SA 4GP9A 3O8OA 4B3XA 3O83A 2Y4NA 2IF0A 3FE2A 2O2IA 3VYUB 3ROMA 3BDAA 3TLCA 1C2TA 1Q84A 4YJ2A 2BJVA 1DX6A 3JYHA 5E7JA 4MTGA 3V8NA 3GCXA 4BEJA 3E6AA 4E6EA 1FJHA 4K86A 2YJ6A 1N9KA 4LYGA 4AYWA 1Y33E 2FPGB 3TVTA 4HDRA 3FYTA 4BASA 4JB3A 1LJ8A 3HYCA 4GC9A 4FBLA 4RTKA 4OI0A 4KRXA 4HHEA 2PUAA 1U8UA 3Q7SA 1GKLA 3UT5B 1XUQA 4OQZA 4UVBA 5FHRA 4ZRMA 4BBAA 3DR5A 3KSBC 1FVFA 2QWOB 5ALUA 3UJCA 3FWHA 2HTFA 2QN3A 3DTVA 4OGKA 5K8JB 1KDPA 1KGSA 1P1IA 4DUZO 2B9EA 3L82B 2NU7B 3IPCA 1C9JA 3GR6A 3IDSA 3H1AA 1QORA 3CO5A 1SG9A 3LXUX 4KQKA 1DBIA 2FPMA 1OFVA 3L1IA 4V0SA 4WOJA 2FW6A 1ZMOA 2JGKA 1LBSA 4PLZA 3ZXSA 1EFRD 2LNDA 3FZYA 1DU4A 4MICA 2IU0A 5LOVB 1Z6TA 2F66C 1HT3A 4M8KA 4W9MC 3PA8A 2WT9A 4H3SA 1H2GA 4H4CA 3AF1A 4GKBA 2PO7A 2FZ5A 3IA7A 4QFBA 3BJZA 5D8DA 2WLJA 1WXFA 1S2LA 4MUAA 4K6OA 4PXYA 1QPBA 1OV4A 1WVIA 3WFIA 1GVNB 3QKIA 2ZE7A 2O0LA 3VPXA 2PWYA 3UPTA 5ALPA 3S99A 5DDIP 3RD5A 5IVKA 3JRXA 4EG1A 1M57C 4MRNA 4A91A 4CEIA 1VKNA 3L49A 4IAOA 1T43A 5BQ5A 1U3CA 4KQMA 3VR0A 3MGAA 5A3JA 4GPAA 5DNYB 3Q8KA 2IW3A 2RFLA 3IGFA 1R0WA 2D00A 2JIPA 5L3EA 3WP0A 2BZ1A 2MU1A 3C3XA 1SCQA 2VRCD 4QWMA 5TQJA 2FSSA 5L3BA 2Q9AA 2J1LA 2Q6IA 1X7HA 4OA8A 1T3LA 1X1CA 4EYSA 2LD4A 3SS9X 4EY4A 1IBLB 1U9ZA 3RDPA 3TG8A 1DTOA 4GLLA 1K5DA 3EXEB 2F3TA 3WLPA 1X9HA 3I64A 2O7SA 3KTAA 4YDQA 3V3TA 4Z7JA 1P1RA 5JZOA 1IMJA 1SRQA 3PICA 1ISHA 2RI1A 2X2OA 1M7HA 1VA5A 4IIVA 1UBUS 2ADFA 3I2FA 3BAZA 4P3NA 5KC9A 2GCPA 2Q5LA 2Z4TA 3H97A 3DEFA 4B82A 4F9EA 1I5XA 3KZ1E 1WB9A 2XB2A 1LV8A 3RNOA 4YRTA 3OMIB 2VNHA 3KPVA 2ZYIA 2BDEA 1K2VN 4YC7A 3CPHA 1PNOA 1TYAE 1KMIY 1YZNA 3UXYA 4TZTA 3CVXA 3SN6A 2I2CA 2FOIA 1SHJA 3MEQA 1WXEA 3QX8A 3OZEA 4HCJA 3ROFA 4EFNA 5BV0A 1LRJA 3KLPX 1OGYA 1EIZA 2C7BA 3UM9A 3EULA 2DPMA 1JV2B 3ZXIA 2H4FA 1JG1A 1KJ9A 1DEKA 3IT0A 4RWZA 2XCTB 2EINB 2AZXA 2KLHA 1VKRA 2NTVA 2VPXA 4H27A 4PSCA 3ROKA 3IEPA 1IK6A 3L7NA 4RV5A 4BC0A 3TIFA 3CWZA 4BLQA 2AMJA 1T9ZA 4YRPA 3AZQA 1HURA 4FYIA 1NUSA 4YAUA 1W73A 1VFPA 3P2JA 4RKEA 1RPZA 1VKHA 1HG1A 2GD0A 5BORA 4X24A 5IULC 2OHFA 1UC9A 1H2YA 1ORDA 1CJBA 1EX1A 4QNHB 1EVZA 3VVLA 3NKLA 1XJQA 2GILA 3FFQA 3QF7A 4G1FA 1GAEO 3MBKA 4LJ7A 4CTJA 1TGYA 2DFTA 2PVCA 3GVIA 3UWDA 8ABPA 1KEEB 3KJFA 1G6KA 3PXUA 3UXMA 3W6OA 1GLGA 2F48A 3V00A 2F64A 4YRJA 4LYFA 4AMYA 1UEJA 3DM9B 1CY0A 1QS0A 4FE7A 1JSLA 1ZJZA 1ORVA 2J30A 2OV6A 2WMYA 3FPBA 2GUWA 4GMDA 4U63A 3VZBA 3KB8A 4MP3A 4EFEA 1FVOA 1S4QA 3FPKA 3DQPA 3RBVA 1QLJA 4BPBA 3PD0A 4MIKA 5A03A 5C7OO 3I5XA 3TRKA 1N9GA 3ABMB 1YA4A 4LHSA 4D4LA 3RV3A 4X44A 1R6DA 1B8PA 1WAZA 2WMDA 5AW5A 3VR4D 1PKXA 4CMHA 1MDBA 3D8NA 3K2QA 1Z4QA 3QVWA 1TZ2A 2H4JA 4I8DA 5CEJA 4DQVA 3SNKA 3L9XA 3Q3GE 2YFQA 4I7ZB 4B5KA 2C7RA 4M49A 2J3EA 2FE4A 2O7QA 1Q57A 3L05A 5FBRB 4NDNE 3ED5A 4XJSA 2BI8A 1SBYA 4BRZA 4CLDA 1YL7A 4ZQCB 3OUFA 9ABPA 4FCWA 1G9TA 4INZA 2R6CA 4EY7A 8GPBA 4LSGA 1TAGA 4UVAA 2IGBA 5I6DA 3BRQA 2BFFA 3M1YA 3TB4A 3RQIA 2BMJA 3PGMA 3HFGA 3X1MA 4KNWA 3ASZA 3ZWDA 4AQ7A 1SQ6A 1YRYE 1HPLA 4L4YA 2XTJA 2YNMD 1FMTA 2JK0A 3CF2A 4TWIA 2CMHA 2PNFA 4HAWA 3TBHA 3EQ9A 4X6XA 4QJBA 3TE6A 3EUEA 1SOAA 1PKEA 4TMKA 5CW2A 4WCFB 4NIMA 3AK1A 5CR9A 5AMXA 1SUWA 2AL7A 3NTUA 2ZUTA 5BN1A 4GM0A 3RS0A 2PGXA 5MFZA 4LE1A 3UXEA 2XQJA 4KHZA 2DFPA 6AT1A 3HXQA 4I1SA 1BMFG 4JLUA 4OHYA 3RU2A 1V6SA 3WGJA 1NJFA 3TUIC 2V4ZA 1MV5A 1KDOA 4ZOCA 5GONA 1J2JA 3VUFA 3GLGE 3UBTA 1YR8A 2O7NA 1HDIA 3F7OA 4NXMB 2IEZA 2QUZA 4HNSA 4MCIA 4UASA 5DN6A 1PWYE 2LP4Y 4HDAA 2FR1A 1D5WA 1XTSA 4GPIB 4ZVUA 1A9PA 1U6JA 2JLXA 4BNIA 5JMPA 2COEA 2YIBA 1VQOV 1QGZA 1ZCFA 4BMPB 2QYTA 1ID8A 4WOCA 3VOUA 4I5GA 2VP6A 1IZ7A 1FRNA 1V11B 1YDFA 1JDUA 2DJ5A 2FWPA 3HYTA 4BC1A 3SPXA 2EIJC 2VHYA 4P31A 2NMVA 4OB6A 2POCA 1X13A 3LQKA 3ADPA 3GRFA 5AW8A 4M0FA 1FFTB 1RMYA 2B35A 5EWLB 3UUWA 2PD6A 2B0JA 3RPEA 3QVKA 4PA7A 1V37A 1SQPH 2BP7B 3C6ZA 1DZ3A 3CTMA 4FJ1A 3T52A 4G8CA 4GMFA 2O8CB 4GX0A 1CUYA 2TMDA 2R6ZA 4AO7A 1V54C 1GCIA 1RVDA 2QL9A 5BQPA 1UFKA 1XKXA 4DMFA 1KKCA 1TUBB 2GK3A 1VG0B 3A6KA 5E1DA 5T5QA 3U7GA 2OE2A 2YJGA 3V8BA 4NABA 3HYNA 4Y7DA 4QNMA 2GDZA 5FOVA 4MQEA 1WDLA 2VCHA 4GOMD 4O5OA 2WJPA 3JQGB 4ZC1A 4F7DA 2IPLA 5HHTA 3LNMB 2F7SA 2O2ZA 1E1DA 2Y77A 2FPSA 3LY5A 3OOHA 3V2UA 9GPBA 5JJLA 5B66Z 5HG0A 3O8RA 1NVPD 4C7VA 3WO1A 4CMBA 3OETA 3PJEA 2GYVA 4LHEA 5L3RA 3RIMA 2QV7A 3E48A 3MINB 2FL4A 1NH2B 1XNQB 1X7YB 4LTDA 5BW4A 2EFCB 5IFLA 3K30A 5AD1A 3PPVA 3VU3A 5CM2Z 3CUWA 3W9UA 1KAEA 3AZOA 3I01M 2PKQO 1EJ2A 5GZ6A 1DXHA 1XMVA 2HZ7A 2ZDGA 5K4GA 4DHEA 5A4AA 2QHXA 2P2YA 4RTOA 3EIUA 3M6WA 5FI0B 1ZKMA 1ONOA 1LPMA 1YS2X 2G36A 5K8VA 1U9YA 5HRAA 3B60A 2E82A 3FZQA 4MKIA 4WFIA 4BJ1A 5CNJA 4I4TF 4QQKA 3T1TA 1Z28A 1KBHA 1NE7A 1YZYA 2DHRA 2G4LA 3IYLW 3KKPA 1FS4A 4X89A 1GQFA 4G9EA 5EEHA 2A92A 2PKWA 2XR1A 3A06A 4IOLA 3RC8A 3KKQA 3CNBA 4H6XA 1YR6A 4WH0A 5H02A 4ME6A 3GW8A 4Q7JB 5AKZA 4LZZA 4CDRA 2QUIA 1YD7A 3AF0A 3D7MA 1XTJA 5CH5A 2XAAA 5EUMA 5ESXA 2GV9A 1GU0A 1OWPA 4RIGA 2CMGA 2QLFA 1LU9A 1L5WA 3QKTA 4FMPA 4DIFA 4O4LA 4ARVA 1OLUB 3ZJTA 1VRWA 4B73A 1X8KA 2BRUA 3Q5EA 2WE8A 4TV9B 3IR5A 4ZCMA 4CKWA 3OMWA 1DQPA 3ZCUA 4L2IB 4PYOA 1Z8DA 1DARA 2ODPA 3OKAA 1PDWA 4HAYA 4V03A 3V4PB 3KZOA 1ORQC 1X80A 1YVUA 3HBNA 3W5JA 1VHJA 1GXSB 1ML4A 1ENYA 2CHFA 2XVXA 3O26A 1GDDA 3UHOA 4EYQA 4X9QA 5ELLA 3DAPA 5H0IA 1YCIA 2VDWB 1BVRA 1XTIA 4ZCLA 2XMGA 1ZITA 2NVBA 3THYB 2Q9LA 3Q88A 4LYDA 4F3RA 4RCZA 1JAIA 2RJ3A 1GN9A 1Q7GA 3A31A 3I23A 4HJRA 4TKZA 4MUJA 5AICA 3E8FA 1MD9A 4WTOA 5IG2A 1SELA 4QARA 4M88A 3NKVA 4L07A 2PAFA 4AAYA 1O96B 4IPTA 1T2CA 1TECE 4OK3A 3BRWD 2BSQA 1CEYA 3I5DA 1B15A 3W9SA 3WWOA 3ZCTA 4DBLE 3WGOA 4XUDA 2XX3A 1JT2A 1T0UA 1UZAA 2QPAA 3ZLTA 4Z1VA 5L7WA 4HB4A 5C35A 4AZ3A 2I8CA 1X80B 5KYTA 1GXSA 4UDYX 4F4JA 2DEUA 2DT8A 4ARSA 4HZUA 4IHJB 3BTSA 4OIFA 3KQVA 2CJWB 2R1UA 1UM8A 3NT4A 5JOQA 3C87A 4IJMA 4PO9A 3G2IA 5JMWA 3G0HA 2RH8A 2X40A 2DYSC 1N8RW 4NXNB 1I14A 1LWOA 2CBGA 5FT9A 3NIDB 3QRWA 5D3MA 4ROSA 4CWAA 4EKIA 5AVXA 4UFOA 2I6XA 4FP9A 4TLEA 1XV5A 1PYOA 1QF7A 1JJIA 1H1TA 4QUGA 5ICFA 1ZIOA 1M8GA 1XK7A 2WINI 5HBRA 4YX9A 2OXEA 1O08A 4KO4S 3FNIA 2QTSA 3EMKA 4NYIQ 1C0PA 4UW9A 3FVWA 2CXNA 2VA8A 2VF2A 1VMAA 4LZNA 3RQSA 4ZEXA 5HK9A 2QVXX 3PHGA 4PRZA 1FTYA 2QG9A 1CB0A 1JTEA 2JASA 2F3UA 5D5PA 1J49A 3NG1A 4I6GA 3RUIA 3TJMA 3U4IA 5B1EA 1CZNA 5AVQA 2HFKA 2OD7A 3ICVA 3I45A 2YZMA 5J2TF 1S5JA 1OXTA 2LR0A 4JCCA 2VYND 4R3UC 3F9IA 5IW8A 3PFHA 3KQNA 1X38A 4WLNA 3UENA 3SJQC 1N5LA 4U7HA 5D3MB 5ARCA 1ZHFA 2GF2A 4NU5A 4X90A 5GW7A 4OH1A 1Z5ZA 2Q0QA 4TWKA 4R68A 1N3LA 2A58A 4Y9SA 3OZFA 2H2DA 3FCUB 4M2LA 4BCBA 1Z15A 2WAXA 1DZIA 2AN4A 2ATEA 2F8MA 1QB7A 4JGGA 4D9NA 2GZSA 4JSRA 5D84A 4CT5A 1HZZC 4YCAA 1NX9A 2IY9A 3NAQA 4L74A 3FYUB 3E82A 4CCSA 3HJNA 2N0SA 2WNIA 4K1XA 4MEBA 4UTXA 3D2AA 3D43A 3E5RA 3EARA 3INRA 4JJGA 4I0XB 3O4IA 2W6JG 1U8ZA 4WY8A 4C0KA 2H1OA 3WTBA 4Q16A 1IDN1 4KP7A 2AEFA 3JWIA 4YAFA 1CUZA 3LS2A 3U7FB 2BUAA 1ZL8A 3BF8A 3F98A 2BLNA 1D2CA 1O1YA 1Y3HA 2J9GA 4WBSA 4YMGA 5JJKA 4FPXA 2N04A 1BW9B 1E2DA 1SCAA 2XVMA 4L76A 4DPKA 3L4BA 4WNYA 4M7RA 5HS4A 3Q87B 2EV9A 2VJAA 1O97D 3A0UA 3B20A 5HW0A 1P4JA 3LWNA 3DPIA 3PQ6A 3AHCA 3RVMA 1ESEA 2Q27A 1N25A 1YIOA 5K8IA 1KEKA 3ONDA 4FDTA 4B3SO 2DUMA 1N0WA 1D2MA 3CT6A 4WKOA 3W5DA 4WFGA 1WCIA 1XDCA 2WVGA 1PV1A 4INAA 4P4SB 2E87A 2Q68A 2C4WA 2D2VA 2FVYA 1E2MA 3R7AA 3SG0A 4YWHA 4CGYA 5BQFA 5AK3A 1SGWA 3N0XA 2OGSA 5TR9A 1M0WA 5BSRA 1A98A 1LZKA 3M8KA 5ESWA 2HRQA 4Y98A 3ABTA 4EQ6A 1Q6IA 2EKZA 1AKQA 2Q3CA 4PZ0A 2I0FA 5ENVA 2I4OA 1TLFA 1UINA 4J0GA 4MZXA 5LMUO 5EXXA 4E5DA 4PV7A 5DN9A 2DWPA 3A1UA 3O73A 1QJ4A 4F46A 3KQUA 1W5TA 1MFZA 1Q17A 4DRXA 2PJRA 2HWYA 3OFNA 3PDIB 4RPGA 5TF4A 4DDKA 2BHRA 3CB4A 1COZA 2CZCA 5DNDA 4Y1RA