3CWBH

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cwbH00
3H1JH 3L71H 1PP9H 3H1LH 3BCCH 3CX5F 4U3FH 3H1HH 1SQXH 1SQPH 1SQBH 1KB9F 4D6TH 3TGUH 2IBZH 3H1IH 1BCCH 1BGYH 1NTMH 3CXHF 4PD4F 1BE3H 2BCCH 1EZVH 3H1KH 3L72H 1SQQH 2FYUH 1NU1H 1L0LH 1KYOF 1PPJH 3L70H 1NTZH 3L74H 5KLVH 2A06H 1L0NH 1NTKH 1P84F 3CWBH 3L75H 3L73H 1SQVH
chains in the Genus database with same CATH superfamily
2R72A 4Q6GA 2HHHB 3I5DA 2CK3G 4B3SB 3H1IH 2WLLB 4YXWG 1THZA 4DR3B 1HNWB 4G2KA 1UFIA 3AK3A 2R70A 3QO5A 3CCVV 5DM6V 3M7MX 1L0NH 1RFYA 4GLXA 3K5NA 2LJ2A 4PA7A 3ASOB 1XNRB 1BHAA 1Q3EA 4PI0A 4Z2WA 2IJJA 3AG3B 3K08A 3N2KB 1N33O 4X8AA 4NR1A 2ZXWC 4QJFB 5KHGA 2ILMA 1YSCA 1ZSPA 3JARB 4BWAA 1M90W 3FB5C 5KAFZ 2QM8A 3BPZA 1F4MA 2CGOA 3LSSA 3AG1C 1TVKB 3ZIAG 4B08A 4U7NA 4I4TA 1QR8A 3K0DA 5L3CA 3G80A 4I4TB 3B2EE 2ADPA 5IYCO 3RVZA 1GH6A 2QTSA 2A7WA 4JI2B 1Z5WA 1RSOB 2CGNA 5FL7G 4FLYA 1VQ8V 2YIDA 3EVKA 1J5EB 2GTSA 3J80N 3RFRA 4UCUA 3STLC 4P9PA 4MVMA 2KG7A 2XTAA 3ABKC 2ZIOA 1HNZB 4LF8O 4AQYB 3AG2C 1JX9A 2IJIA 4JI1O 1PPJH 4UUJC 3SJQC 4PJ0Z 3VQXA 2QKAA 2NN4A 5BR8O 1PL4A 3C3SA 3JCZA 4PHZA 3OTFA 2EINC 3VQWA 5IYBO 2LFRA 1P4RA 4NXNO 1X4TA 2XHBA 2JJ2G 4OGQB 2IJHA 2P22C 1JVMA 5EIBD 1GM8A 1QLNA 1G8MA 2LO1A 4EFBA 2AW9A 2Q8VA 4MT8A 1V55C 4PDRA 5IYZA 4IIJA 2DJVA 4MVSA 4IIJB 1U96A 4UCVA 1AR5A 4MSWC 3OMIB 4HAMA 3OGCC 2UXCB 3BCCH 2ZR2A 3CRQA 4F4LA 3LDDA 2V4DA 3OR7C 5BMVA 5LP6A 2UXXA 5BMVB 2ZNJA 1EM1A 1K5QA 2ATKC 4WFGA 3ZRXA 3CRMA 3JD1A 2E74B 3C90A 4QPKA 3UT5A 3CD6V 2WLIA 4GKKB 3T1HO 1GMGA 2WLIB 4TSFG 4TV9B 2Y4TA 4FMTA 4D6TH 4LFAB 4O4LA 1FXHA 4H33A 4DR6B 3U0ZA 1K92A 2N05A 2OCHA 4O4LB 1FAFA 4I55A 1A32A 2PY5A 1IBLO 4W4LA 3G71V 3OTOB 3CCQV 1HNXO 1I94O 5B1BB 4P30A 3I55V 2P5OA 1L8DA 2OCCB 4LNUB 4LCUC 4DV4O 5H6QA 1FFXB 2R9RB 5J2UA 3K06A 4K3AA 2ETNA 1I5XA 1W0KG 4F6EA 4R7CA 2F4VB 1F7YA 2JJ1G 2BSKB 1KU9A 1WLEA 3GVMA 2F66C 1P49A 2KSDA 5CBHA 2IH3C 5FPRA 1RPOA 3GB7C 3K5OA 4JTCB 1KQSU 3H1JH 4X66O 5E1AC 3OE7G 1EZVH 4CZZA 2F93B 3K0GA 3BA8A 4LF4O 4UXNA 4X62B 1WB7A 1S5JA 4Z1MG 1H8EG 1P84F 1B04A 3HKBA 4A5UB 2H8PC 4UCSA 1SQBH 5KAIZ 3ASOC 2YUAA 4X65B 5B66Z 4IT5A 3FAVB 1SS3A 1XMQO 2W0XA 3J7AU 1I5YA 4TT3G 2P06A 3EHBB 2A06H 3ZMZA 1OHHG 3D3IA 5GW7A 1IZ3A 1V54B 2XAHA 1EZJA 5B1AB 3JATB 5ITZA 4JYAO 3SPIA 5CB4A 1HDJA 2W6JG 2GBOA 2CTWA 4FIPC 1YVWA 2ZE5A 3RBZA 4LR3A 2ZCEA 4X1KA 2Q0OC 4JV5O 4GKJO 4JI6O 2YIBA 3CWBH 3IFXA 2DOSA 4J41A 4JGSA 4X1KB 3ABLB 2OT5A 2YC0A 5KHIA 1YDXA 4CBCA 2IJKA 4WF9V 2F1MA 4LFBB 3RYFB 3ZN1A 1NT2B 2Y69B 4X1YB 1UJWB 5KX5A 1NU1H 4K8ZA 1Z5VA 4UCOA 1WA8B 3CCRV 1GO3F 3R66A 4LFCB 3VOUA 4TUYA 2Y0IA 2QA4V 2BE3A 4YY3O 3FD9A 2JS3A 1YTFD 4X88A 1LUVA 2QDOA 5LBQA 3JSNA 2FMLA 1QR9A 3UO3A 4X20A 2E75B 5JQGA 2CTPA 3GWKC 2VWKA 4J10A 5K1XA 3A2FA 4DV0B 2WWWA 5LHIA 2CUGA 2JS5A 3UQ8A 2AHYA 1LUWA 1G1XB 3JCUZ 4DR1B 1ORQC 5B1OA 4HBNA 4GX2A 2YSUB 2PZSA 2OIEA 3WB0A 2EIMB 2CH7A 1CP9A 2YEVB 4DV7B 3OEHG 2NR5A 4U3JA 1KC8W 2GTAA 4U3JB 3FKSG 1VQLV 3TXSA 1IXBA 3M99B 2Q68A 4NTYA 4DV5B 3QO8A 3K9AA 4DR4B 1BL8A 3JYCA 5H6RA 2KQXA 5IJ0B 4NKGB 5EC1C 3N2GA 4N21A 2WLHA 1Q86W 3N2GB 3ASNC 1I0HA 5L3GA 1FFTB 5B1BC 4DV3O 2FL4A 2HKOA 2OCCC 3FFQA 4HYOA 1S0VA 3DSQA 1BT8A 1E1QG 4I0XB 3ABUA 5L3BA 2XUMA 4WBNB 4LWSB 4WFHA 2ITDC 1GM9A 1VQ4V 1VP7A 4TWKA 3BVOA 2AHZA 5C93A 2UXDO 3E86A 3E89A 1G6UA 4E4EA 3H1LH 3CX5F 1OCOB 2G38A 3RW0A 4DUZB 1QBZA 4R6ZA 1KMIZ 3ABKB 4HNAB 4LF9O 1OCCB 4KHPB 1H2LA 1N34O 3AG2B 1PM9A 1XOUA 1MOFA 1VQOV 4DUYO 5KLVH 1ROPA 3F7YC 5EZYA 3FYIB 3S3WA 5LXTA 3E2EA 3MD0A 5EZYB 1XUQA 4IGGA 3UKMA 4IHJA 5LXTB 1AJNA 3LUTB 4DV6O 4X89A 4O2AB 3B77A 1FXKA 2ARHA 4YIPA 4YJ3B 5LGNA 1ZX3A 3G67A 4RQFA 4Q20A 3RT3C 1V55B 2MW2B 1M1KW 3BRCA 4K0KB 4BR6A 1TUEB 4FLTA 4K35A 3ICXA 3RYHB 5K1PA 1V54C 3HPLC 4DV1B 2M6YA 4JPRA 2AZ2A 4MTXA 1VF6A 5B1AC 2CTQA 2UUAO 1XNQO 3APQA 1I7FA 3KCYA 3Q4HA 4TV8A 3DXRB 3Q4HB 1Y4MA 1AI6A 3CCSV 1K97A 4MW3A 2WSSG 2ZDIA 2PI5A 4I9QA 2OYQA 1K33A 3SPGA 1GN4A 2V7QG 4FZ1A 1WJZA 2GUZB 4DR7B 3OFNG 1VF7A 4QE7A 3FYEB 4O4JB 3W7UA 2Y69C 5KUKA 4LH6A 3DGEA 3IC7A 2DQ0A 2EBOA 1W2BU 2CDYA 3B8MA 4DR3O 1SZTA 1NJIW 2E3CA 1R3LC 3HKCA 4YHHO 2VQFO 2HEPA 2FB5A 1EN4A 1JA8A 1QCEA 3HKCB 3W7SA 3W7TA 1I08A 3RN4A 1D5NA 1DLBA 4YJ2A 3ZEDA 1XNRO 5J2TA 4JI5O 3T1CA 1DTOA 3MAQA 3JD0A 2GSMB 5HFMA 3KG2A 1NR1A 1OZ0A 4B3MO 5KUMA 3WB1A 4E2LA 4NB5A 1SQVH 2P6JA 2ZD9A 1FS0G 2HP8A 1GAXA 1WP8A 4O2BB 1QHTA 3TGUH 3E8GA 3T4DA 1S77D 2UU9O 4LF7B 2CAZC 4PV1B 4JI8O 2QSAA 4LH7A 3QNEA 2EIMC 1VEWA 4JI4O 2UXBO 4CS3A 1F4NA 4B3RB 1NI8A 2QWRB 3STZC 2UUCO 4RQEA 5DECA 1PP9H 1HR0O 1SQPH 2ODMA 4CS2A 4NTXA 4OX9B 2VWJA 1JOYA 2ZT9B 1NZ6A 3ZHVA 3OAAG 1YZBA 4ASUG 1L0LH 2PYJA 2IU0A 1TUBA 1S72V 2E76B 1X59A 2P67A 5JWPA 4CC6A 2H94A 4JI7B 2HG5C 5BXZA 5L3FA 3OD4A 1XMOO 1S5HC 2HJDA 5LMUO 5EBMC 1BHBA 5IY5B 4JAVA 2QJ1A 4NVPA 1GTOA 3ETDA 4FFBA 1OCOC 5H9CA 4DYLA 3ZN0A 1Q43A 1DF4A 1KKCA 1OCCC 4PDMA 5CMUA 2KG7B 1JR9A 2C2AA 1XDCA 3G6EV 2ZNIA 4CH3A 3ZMUA 1DGSA 2DYRC 3E22A 3W7WA 5EBWC 4UVBA 4BAYA 1AR4A 2DWDC 1H8HG 2P7TC 4I50A 1LNQA 1GN6A 4WFAV 1QLEB 4GKKO 4GT1A 4I50B 3ZCCA 4UCRA 2P4VA 4F6RA 4DW1A 3G4SV 4LC1A 5CA1A 2DW4A 1K3EA 1R3IC 1Y76A 4CH5A 5CA1B 5BY1A 3L75H 5IYZB 4J9ZB 3FB8C 3CSXA 3F5TA 3L71H 3T1YO 4OPHA 1IDSA 3ZX6A 1FPOA 3JD3A 1AI7A 1K34A 2BTQA 2DE0X 3ETQA 3B4SA 5LP6B 3CCLV 2VQEB 2Q6AA 3FB6C 3HKEA 2P90A 1VQPV 3S3XA 3R65A 3E8BA 5CBFA 2N74A 4DK1A 5KA6A 4FLUA 3UT5B 2LW7A 4LF8B 2RDCA 2RN9A 2ZDIC 2QM4A 2JVDA 4X1IA 2BOCC 3O65A 5KHHA 1SQQH 5BR8B 4X1IB 2RMKB 1Y74A 2Y48A 1Q5OA 1ZWIC 2EJ7A 4X64O 4NXNB 1NVPB 4I55B 3X2QB 1F23A 2QTOA 3ASNB 1JQ0A 1Y74B 3MDSA 1JFFA 3CPWU 3IAYA 1AJQA 1JFFB 4FJCC 1N32O 2EIJC 2LGQA 2PTMA 3BAAA 5J2UB 1OCRC 2BCCH 4R8CA 1MSWD 1BSMA 1R6NA 3SGIA 1AP5A 2WAMA 1ZL8A 5L3EA 1AVMA 3ZRSA 2ZE6A 3VQVA 2CE4A 4MW8A 2W0FC 4O4IA 4UFZA 3JAWA 4O4IB 4UVAA 1N0NA 1VARA 2X6AA 2R9AA 3T1HB 4I7ZB 5D5PA 2B9ZA 2ZINA 1P7GA 5EK0A 2AXTZ 1FJGO 4JI3O 4PI2A 1ZUQA 2OTLV 4NXMO 1IBLB 4GUNA 3FX7A 3HKBB 3OUFA 3OUSA 1I94B 1HNXB 4LF6O 4MTFA 2OTJV 3AEIA 1IURA 2QM7A 2YS8A 4DV4B 4RAIA 1KYOF 1CPYA 4ZOLA 1M9NA 1MG1A 1EN5A 2K9PA 1MSDA 1QVFU 2HLDG 3OMNB 1BCCH 1NTMH 3MHSC 2Z5UA 1NH2B 4ZI7A 1IBMB 5ITZB 2IU3A 3ZHTA 4LP8A 3WFVA 1XHZA 2A0LA 5CB4B 4X66B 4O4HA 1K5SA 3UCSC 3BHPA 1MABG 4BIOA 4PELA 4O4HB 4PA6A 5IY5C 1M93A 4LF4B 5LOVA 4GX1A 4H44B 1N4CA 2IW5A 2XASA 5LMNO 1KP3A 2X7RB 5KMGA 1ZLZA 4ZBMA 3CB2A 5KX5B 5KMGB 2OWOA 1UPGA 3WB2A 4TUYB 4MVOA 3UM7A 4JZGA 1PNKA 1H2KA 2PGGA 4FLWA 3OW2U 1PNLA 1M56B 2GHYA 1PL0A 4EFEA 2FTKA 2EILC 2LGWA 4J7JA 1D2DA 4DO2A 5CA3A 4AILC 2VS0A 1QLEC 4UV8A 4DV5O 2RCVA 4X20B 3WG7B 5JQGB 4LF5O 3H9VA 3RWRD 5CA0A 4XDLA 1F51A 4JYAB 1TAEA 4B3TO 2A9HA 1S76D 1SESA 3OT7A 3JALA 3RVYA 4BIUA 3K03A 5JJNB 5LGUA 2X0LA 2ITCC 2UXNA 3ML0A 3DTUB 2JK5C 2Q9LA 4ICGA 4GKJB 4JV5B 4JI6B 4KXRA 2M7WA 4LBEC 5LP6C 3IJ4A 1TA8A 2CH7B 4NTWA 3K57A 2F95B 3HB3B 3CS5A 4DXWA 4KUMA 3H1HH 5KHJA 3ABTA 3JD4A 3ETGA 3CC7V 4FM1A 5FNVA 1RPRA 5L3DA 4UB6Z 1NQTA 4YY3B 2P4KA 1N36O 4WFFA 4DUZO 4DW0A 1VQNV 3X2QC 3THOA 1IVSA 1PD3A 4JI0O 1B3QA 4JYYA 4EKWA 3JSLA 4Z1VA 1SQXH 4DR2O 1KB9F 4XBFA 1S5LZ 1QU7A 3SDLA 4BW5A 1ENVA 4JAAA 1MMMA 3QTCA 2JEUA 2QEXV 2YICA 2QR4A 2YXHA 4P9OA 1T5EA 1NTKH 4H37A 3B8NA 4PDLA 2PUSA 1ZTEA 3CC2V 3L9DA 2YDEA 3KKYA 4QE9A 2YI8A 3OEEG 1AILA 5DN6G 1SC5B 3P3NA 4MVRA 4DR5O 3QF7A 1XREA 2DYRB 4PDVA 1DK1A 1YCIA 1VMGA 3SYAA 1M57C 3PN1A 5A9GA 1IBKO 3KCXA 1NR7A 3EFFK 3BFRA 1YF2A 3VBBA 5GTIZ 4IHJB 3F7VC 4DV3B 1BS3A 4DV2B 1FXKB 2Q67A 1XILA 2ADQB 2EZPA 2GDSA 2JRIA 4U7OA 3AG4C 4KL1A 5GONA 2Y4UA 1SETA 4UCTA 1IX9A 1BE3H 4P2ZA 2Q7GA 4GCZA 5LHHA 4MS2A 2UXDB 1KD1W 1VQ7V 1FKAO 4TV8B 3OM3B 1Y67A 5JJJB 1EBOA 5JH7A 4LF9B 1RM1B 1N34B 2UUBO 4DUYB 2RNBA 3TJTA 1Q81W 2EJRA 2JGDA 1H38A 2HHHO 5CN0A 2JGDB 2QE7G 2ZM6B 2CTRA 4B3SO 2LQTA 4WFBV 1VQ6V 1O9HA 1Q82W 4DV6B 4IYIA 2Q7HA 3E8FA 2QGNA 2B1IA 3LNMB 1HNWO 3A0RA 2EIJB 3BA9A 5HFLA 1IXMA 5LGTA 3D36A 1GK9A 2N04A 3LNNA 3A8TA 2HVKC 1OCRB 2HFEC 1VIBA 2IM9A 1J95A 2XNDG 4OPAA 3ZHQA 4D7SA 3JASA 1M56C 1FD9A 3L72H 4J80A 5EYPA 3O9OA 1GN2A 2PYLA 2WLNA 3JASB 4JAUA 5EYPB 2Q73A 3HKDA 4DRXA 3CC4V 5IT9N 4RUEA 4YJ2B 1Q6HA 3WG7C 4DRXB 4ZIBA 5J2TB 3B09A 3ZJZA 2UUAB 1XNQB 1RP3B 2VRZA 1G4YB 1W0JG 3SJAC 5CBGA 1GRJA 3RGBA 3ZS8C 5H5NA 3HR0A 1VQ9V 4GYCB 2ZE7A 2EZOA 1PV0A 4KFMA 3T2MA 4WFEA 1QQCA 1H2NA 5LHGA 1YEWA 4D7TA 1H2SB 1US6A 2H3OA 2KB1A 1P7BA 3LSQA 2WLLA 4FK5C 3P3PA 4H13B 4JI2O 3NXSA 1WN7A 3K5MA 1OCZB 5D5QA 1EFRG 1AJPA 2HJFC 1J5EO 4YHHB 1PNMA 1WP7A 2VQFB 2E5LB 1HWYA 1PKXA 3SYQA 1JPXA 1V9PA 2K1EA 2WLKA 3SYCA 3ZHUA 2Q0AA 1HNZO 4AHCA 4TQDA 4J9YB 4AQYO 4JZ2A 1YTFB 1TUBB 4J7ZA 3ZBHA 4JI5B 4B3MB 1K4DC 3N2KA 1XL6A 2LFSA 5J9PC 4QGPA 5JVDA 1XI1A 3AK1A 4ABMA 2QWOB 4KP4A 5EIBC 5JVDB 2YXLA 4GX5A 5IWAB 5A2QN 3JARA 5B5EZ 1JCHA 2UU9B 4FLZA 1EN6A 4IL6Z 1TVKA 3WU2Z 1JJ2U 4JI8B 3LDCA 4JF3A 1CXZB 3QVNA 1K8AW 4JI4B 4FFBB 2UXBB 1HP8A 3SR2C 1R1BA 2UXCO 5LYJA 2UUCB 5LL6Y 1XQ8A 4WCEV 1HR0B 4CH4A 5LYJB 3IGAC 1RSOA 1AI5A 1GM7A 1L1FA 3E35A 2VQEO 3SJCC 3E22B 3B40A 1DF5A 1ZAUA 3OMAB 1N33B 3ZMVA 2EILB 2ZQMA 3H1KH 1MZFA 1SF9A 2MK3A 4LFAO 1FXKC 3IC9A 4F6RB 4DR6O 4QIWF 3FB7C 3SYOA 2EX3A 4UV9A 1Y76B 3H01A 1YIJV 2Z0AA 1XMOB 3OTOO 1KUQA 1M4UA 2X6BA 3ABMC 1GN3A 1MZEA 5LMUB 4R50A 4RUFA 2JDIG 3ZMTA 5IE9A 2A3QA 2BTQB 1VF6C 2RQ6A 3J81N 4GX0A 1B6QA 2RJZA 3HKEB 2F4VO 5AG2A 3D3QA 1RM1C 4ZHQA 1K73W 4IYHA 4B7KA 4C7UA 4JI1B 4ZHQB 3T4ZA 3K9SA 4L8JA 3E83A 4B7EA 3ZHRA 2XT9A 4EB6A 3BABA 4EB6B 3CP1A 1N0JA 4TV9A 2Z3YA 1B06A 2V1DA 3CCJV 3OGIB 1R6KA 4X62O 3JAKA 2DYSB 3JAKB 3ZRVA 4PD4F 1FXVA 3D36C 4BIZA 2NNUA 3T1YB 4LNUA 2L6LA 4G27B 1VQ5V 4X65O 4FLXA 1AP6A 1FFXA 1ZL8B 1Z2GA 5BZBA 1HW7A 4CS4A 2HVJC 3CHXA 2BSKA 1MA1A 3CCMV 2QKSA 2FYUH 2Q4PA 3JAWB 1H2MA 2PF4E 4I5SA 5KHKA 4FVMA 1IBMO 3TETA 1M57B 2DWEC 2EULA 2EIKC 2GV9A 3CRCA 2BOBC 4X64B 3QG5A 3NR7A 3CEIA 1SRYA 3G6BA 4ZKIA 5LA6A 3CJHA 3F5WC 1OCZC 1YXBA 1QVGU 5LA6B 1N32B 5F2VO 3CJHB 2WLJA 4JTDB 4LFBO 2HR3A 4FM0A 4G28B 5JCOA 1MNGA 2B1GA 3AG4B 4ZOLB 4U3FH 1NBMG 1Q90D 5GTHZ 4LFCO 3FAVA 5B1NA 3CMEV 1FYJA 3SPHA 2WA4A 2QWPB 2AZ0A 3CRAA 1Y66A 3AG3C 4ZI7B 3LDEA 3L74H 2OIGA 4H0LB 3P32A 3JATA 5JJEB 1WAZA 4HZ3A 1KKDA 2IBZH 4DV0O 3A0HZ 1BGYH 1K7DA 2JIZG 5LOVB 3MHHC 3ETEA 3CMAV 5B3SB 1FJGB 4FM2A 4JI3B 1OJHA 2WLMA 5TISZ 2JGUA 1CEZA 4NXMB 2LP7A 1SERA 3L70H 4DR1O 3SYPA 3RYCA 2QWQB 1E1RG 2F23A 1M5IA 4LF6B 4PA3A 2Y0PA 4XDJA 1R6TA 3RYCB 5FLXN 4RWUA 3UO2A 3RYFA 1XMQB 4JYCA 4X1YA 4DV7O 4YIOA 4NYKA 2Q69A 4I9WA 1Y6XA 2DMXA 2XAGA 1WA8A 4MTOA 4BW9A 3EXAA 2D2CB 3APOA 3AG7A 3TCUA 4DR4O 4L87A 1YJ9V 2L35A 4MVZA 4J7KA 1JMKC 5CA0B 2FKXA 1QNMA 1SZXA 3ZMSA 3JALB 1WB8A 2B5UA 2Q7EA 2XAFA 2YI9A 3TK1A 4MVQA 1W59A 1YITV 1BZKA 2LW1A 3DC5A 5H2FZ 4MTGA 2Q5ZA 1E79G 1BQ0A 5LMNB 3JD2A 1R73A 4DK0A 2O57A 3SJBC 1LR1A 1URFA 4JASA 2YEVA 3K59A 2W6IG 4W4KA 3CXCU 5FNVB 1N8RW 4J42A 1SQFA 3CRRA 1AR1B 2D3OW 1D5AA 3L73H 4KHPO 4J11A 3K04A 2IH1C 1SA0A 1O9GA 5IJ0A 3M8AA 2DYSC 2BTOA 3I56V 4LF5B 3U10A 1SA0B 3K58A 3ZHSA 5EBLC 4B3TB 3K79A 4FFKA 4AI8A 2JEXA 2ZXWB 2A79B 4TOIA 1Q8IA 4GZRB 3CCUV 3OR6C 1NS1A 4DV2O 1U97A 3AG1B 3ZRWA 1VF5B 1S3JA 4JYBA 3BY6A 4I0XA 3ZRWB 3BEHA 4WBNA 4K0KO 4UVCA 1R3KC 4LWSA 4CH6A 3KZIZ 4FLVA 1BMFG 1SQGA 2ZIMA 3GWOA 3U11A 5IYDO 4DV1O 2X6CA 1KBHA 2XOKG 1Q6UA 1N36B 1KECA 3K5LA 1SKVA 2YXYA 3CYOA 3DC6A 4MVUA 4QPJA 3CE2A 4HNAA 5E79Z 1NKDA 3SPCA 4X9QA 2DQ3A 2ZKOA 1NVPD 4JI0B 3W7XA 4DR2B 4DR7O 1NTZH 5KA5A 2F43G 1XBLA 2EINB 2R9IA 1JJOA 2NLJC 4XDKA 1WPXA 3D8CA 2ZM6O 5EC2C 4RO2A 2AGAA 5JCOC 4O2AA 3ABMB 3JAMN 4YJ3A 4FZ0A 4N23A 5GONB 2XAJA 3CXHF 2XAQA 5IDJA 1GKFA 1XL4A 1VQMV 2ZE8A 2YIAA 3SPJA 3RYHA 5DEDA 3VQYA 4K8XA 5JH7B 3QO7A 2ZR3A 1BQZA 4DR5B 3K3WA 3DXRA 3N27A 5B3SC 1IBKB 1YJWV 3A0BZ 4LF7O 1TGOA 4OXSA 4PA4A 1YHQV 1H2GA 3ABLC 1AROP 2GUZA 3C3TA 1K4CC 4O4JA 5IJ9A 1Q6IA 4B3RO 1KP2A 5IJ9B 2QWNB 3LSUA 1YI2V 1WNSA 4PA9A 2WPDG 3TXQA 3CCEV 4OX9O 5C8YA 1XEQA 3HKDB 2WA3A 3RYIA 5C8YB 2QKCA 2E5LO 3RYIB 5FPOA 3E8HA 4JTAB 3P30A 3AK2A 1NH2D 2PI4A 3PJSK 4FPPA 2KKWA 1COWG 1K9MW 1VQKV 2DN9A 4EEQA 4TQFA 1OV9A 4JI7O 1R3JC 1WPBA 1XHXA 2UUBB 1AI4A 4QNHB 4CC5A 4O2BA 1Q7YW 2EIKB 4UB8Z 1AB3A 1YJNV 2YIBD 5IWAO
chains in the Genus database with same CATH topology
3H1JH 3L71H 1PP9H 3H1LH 3BCCH 3CX5F 4U3FH 3H1HH 1SQXH 1SQPH 1SQBH 1KB9F 4D6TH 3TGUH 2IBZH 3H1IH 1BCCH 1BGYH 1NTMH 3CXHF 4PD4F 1BE3H 2BCCH 1EZVH 3H1KH 3L72H 1SQQH 2FYUH 1NU1H 1L0LH 1KYOF 1PPJH 3L70H 1NTZH 3L74H 5KLVH 2A06H 1L0NH 1NTKH 1P84F 3CWBH 3L75H 3L73H 1SQVH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1J H;  3L71 H;  1PP9 H;  3H1L H;  3BCC H;  3CX5 F;  4U3F H;  3H1H H;  1SQX H;  1SQP H;  1SQB H;  1KB9 F;  4D6T H;  3TGU H;  2IBZ H;  3H1I H;  1BCC H;  1BGY H;  1NTM H;  3CXH F;  4PD4 F;  1BE3 H;  2BCC H;  1EZV H;  3H1K H;  3L72 H;  1SQQ H;  2FYU H;  1NU1 H;  1L0L H;  1KYO F;  1PPJ H;  3L70 H;  1NTZ H;  3L74 H;  5KLV H;  2A06 H;  1L0N H;  1NTK H;  1P84 F;  3CWB H;  3L75 H;  3L73 H;  1SQV H; 
#chains in the Genus database with same CATH topology
 2R72 A;  4Q6G A;  2HHH B;  3I5D A;  2CK3 G;  4B3S B;  3H1I H;  2WLL B;  4YXW G;  1THZ A;  4DR3 B;  1HNW B;  4G2K A;  1UFI A;  3AK3 A;  2R70 A;  3QO5 A;  3CCV V;  5DM6 V;  3M7M X;  1L0N H;  1RFY A;  4GLX A;  3K5N A;  2LJ2 A;  4PA7 A;  3ASO B;  1XNR B;  1BHA A;  1Q3E A;  4PI0 A;  4Z2W A;  2IJJ A;  3AG3 B;  3K08 A;  3N2K B;  1N33 O;  4X8A A;  4NR1 A;  2ZXW C;  4QJF B;  5KHG A;  2ILM A;  1YSC A;  1ZSP A;  3JAR B;  4BWA A;  1M90 W;  3FB5 C;  5KAF Z;  2QM8 A;  3BPZ A;  1F4M A;  2CGO A;  3LSS A;  3AG1 C;  1TVK B;  3ZIA G;  4B08 A;  4U7N A;  4I4T A;  1QR8 A;  3K0D A;  5L3C A;  3G80 A;  4I4T B;  3B2E E;  2ADP A;  5IYC O;  3RVZ A;  1GH6 A;  2QTS A;  2A7W A;  4JI2 B;  1Z5W A;  1RSO B;  2CGN A;  5FL7 G;  4FLY A;  1VQ8 V;  2YID A;  3EVK A;  1J5E B;  2GTS A;  3J80 N;  3RFR A;  4UCU A;  3STL C;  4P9P A;  4MVM A;  2KG7 A;  2XTA A;  3ABK C;  2ZIO A;  1HNZ B;  4LF8 O;  4AQY B;  3AG2 C;  1JX9 A;  2IJI A;  4JI1 O;  1PPJ H;  4UUJ C;  3SJQ C;  4PJ0 Z;  3VQX A;  2QKA A;  2NN4 A;  5BR8 O;  1PL4 A;  3C3S A;  3JCZ A;  4PHZ A;  3OTF A;  2EIN C;  3VQW A;  5IYB O;  2LFR A;  1P4R A;  4NXN O;  1X4T A;  2XHB A;  2JJ2 G;  4OGQ B;  2IJH A;  2P22 C;  1JVM A;  5EIB D;  1GM8 A;  1QLN A;  1G8M A;  2LO1 A;  4EFB A;  2AW9 A;  2Q8V A;  4MT8 A;  1V55 C;  4PDR A;  5IYZ A;  4IIJ A;  2DJV A;  4MVS A;  4IIJ B;  1U96 A;  4UCV A;  1AR5 A;  4MSW C;  3OMI B;  4HAM A;  3OGC C;  2UXC B;  3BCC H;  2ZR2 A;  3CRQ A;  4F4L A;  3LDD A;  2V4D A;  3OR7 C;  5BMV A;  5LP6 A;  2UXX A;  5BMV B;  2ZNJ A;  1EM1 A;  1K5Q A;  2ATK C;  4WFG A;  3ZRX A;  3CRM A;  3JD1 A;  2E74 B;  3C90 A;  4QPK A;  3UT5 A;  3CD6 V;  2WLI A;  4GKK B;  3T1H O;  1GMG A;  2WLI B;  4TSF G;  4TV9 B;  2Y4T A;  4FMT A;  4D6T H;  4LFA B;  4O4L A;  1FXH A;  4H33 A;  4DR6 B;  3U0Z A;  1K92 A;  2N05 A;  2OCH A;  4O4L B;  1FAF A;  4I55 A;  1A32 A;  2PY5 A;  1IBL O;  4W4L A;  3G71 V;  3OTO B;  3CCQ V;  1HNX O;  1I94 O;  5B1B B;  4P30 A;  3I55 V;  2P5O A;  1L8D A;  2OCC B;  4LNU B;  4LCU C;  4DV4 O;  5H6Q A;  1FFX B;  2R9R B;  5J2U A;  3K06 A;  4K3A A;  2ETN A;  1I5X A;  1W0K G;  4F6E A;  4R7C A;  2F4V B;  1F7Y A;  2JJ1 G;  2BSK B;  1KU9 A;  1WLE A;  3GVM A;  2F66 C;  1P49 A;  2KSD A;  5CBH A;  2IH3 C;  5FPR A;  1RPO A;  3GB7 C;  3K5O A;  4JTC B;  1KQS U;  3H1J H;  4X66 O;  5E1A C;  3OE7 G;  1EZV H;  4CZZ A;  2F93 B;  3K0G A;  3BA8 A;  4LF4 O;  4UXN A;  4X62 B;  1WB7 A;  1S5J A;  4Z1M G;  1H8E G;  1P84 F;  1B04 A;  3HKB A;  4A5U B;  2H8P C;  4UCS A;  1SQB H;  5KAI Z;  3ASO C;  2YUA A;  4X65 B;  5B66 Z;  4IT5 A;  3FAV B;  1SS3 A;  1XMQ O;  2W0X A;  3J7A U;  1I5Y A;  4TT3 G;  2P06 A;  3EHB B;  2A06 H;  3ZMZ A;  1OHH G;  3D3I A;  5GW7 A;  1IZ3 A;  1V54 B;  2XAH A;  1EZJ A;  5B1A B;  3JAT B;  5ITZ A;  4JYA O;  3SPI A;  5CB4 A;  1HDJ A;  2W6J G;  2GBO A;  2CTW A;  4FIP C;  1YVW A;  2ZE5 A;  3RBZ A;  4LR3 A;  2ZCE A;  4X1K A;  2Q0O C;  4JV5 O;  4GKJ O;  4JI6 O;  2YIB A;  3CWB H;  3IFX A;  2DOS A;  4J41 A;  4JGS A;  4X1K B;  3ABL B;  2OT5 A;  2YC0 A;  5KHI A;  1YDX A;  4CBC A;  2IJK A;  4WF9 V;  2F1M A;  4LFB B;  3RYF B;  3ZN1 A;  1NT2 B;  2Y69 B;  4X1Y B;  1UJW B;  5KX5 A;  1NU1 H;  4K8Z A;  1Z5V A;  4UCO A;  1WA8 B;  3CCR V;  1GO3 F;  3R66 A;  4LFC B;  3VOU A;  4TUY A;  2Y0I A;  2QA4 V;  2BE3 A;  4YY3 O;  3FD9 A;  2JS3 A;  1YTF D;  4X88 A;  1LUV A;  2QDO A;  5LBQ A;  3JSN A;  2FML A;  1QR9 A;  3UO3 A;  4X20 A;  2E75 B;  5JQG A;  2CTP A;  3GWK C;  2VWK A;  4J10 A;  5K1X A;  3A2F A;  4DV0 B;  2WWW A;  5LHI A;  2CUG A;  2JS5 A;  3UQ8 A;  2AHY A;  1LUW A;  1G1X B;  3JCU Z;  4DR1 B;  1ORQ C;  5B1O A;  4HBN A;  4GX2 A;  2YSU B;  2PZS A;  2OIE A;  3WB0 A;  2EIM B;  2CH7 A;  1CP9 A;  2YEV B;  4DV7 B;  3OEH G;  2NR5 A;  4U3J A;  1KC8 W;  2GTA A;  4U3J B;  3FKS G;  1VQL V;  3TXS A;  1IXB A;  3M99 B;  2Q68 A;  4NTY A;  4DV5 B;  3QO8 A;  3K9A A;  4DR4 B;  1BL8 A;  3JYC A;  5H6R A;  2KQX A;  5IJ0 B;  4NKG B;  5EC1 C;  3N2G A;  4N21 A;  2WLH A;  1Q86 W;  3N2G B;  3ASN C;  1I0H A;  5L3G A;  1FFT B;  5B1B C;  4DV3 O;  2FL4 A;  2HKO A;  2OCC C;  3FFQ A;  4HYO A;  1S0V A;  3DSQ A;  1BT8 A;  1E1Q G;  4I0X B;  3ABU A;  5L3B A;  2XUM A;  4WBN B;  4LWS B;  4WFH A;  2ITD C;  1GM9 A;  1VQ4 V;  1VP7 A;  4TWK A;  3BVO A;  2AHZ A;  5C93 A;  2UXD O;  3E86 A;  3E89 A;  1G6U A;  4E4E A;  3H1L H;  3CX5 F;  1OCO B;  2G38 A;  3RW0 A;  4DUZ B;  1QBZ A;  4R6Z A;  1KMI Z;  3ABK B;  4HNA B;  4LF9 O;  1OCC B;  4KHP B;  1H2L A;  1N34 O;  3AG2 B;  1PM9 A;  1XOU A;  1MOF A;  1VQO V;  4DUY O;  5KLV H;  1ROP A;  3F7Y C;  5EZY A;  3FYI B;  3S3W A;  5LXT A;  3E2E A;  3MD0 A;  5EZY B;  1XUQ A;  4IGG A;  3UKM A;  4IHJ A;  5LXT B;  1AJN A;  3LUT B;  4DV6 O;  4X89 A;  4O2A B;  3B77 A;  1FXK A;  2ARH A;  4YIP A;  4YJ3 B;  5LGN A;  1ZX3 A;  3G67 A;  4RQF A;  4Q20 A;  3RT3 C;  1V55 B;  2MW2 B;  1M1K W;  3BRC A;  4K0K B;  4BR6 A;  1TUE B;  4FLT A;  4K35 A;  3ICX A;  3RYH B;  5K1P A;  1V54 C;  3HPL C;  4DV1 B;  2M6Y A;  4JPR A;  2AZ2 A;  4MTX A;  1VF6 A;  5B1A C;  2CTQ A;  2UUA O;  1XNQ O;  3APQ A;  1I7F A;  3KCY A;  3Q4H A;  4TV8 A;  3DXR B;  3Q4H B;  1Y4M A;  1AI6 A;  3CCS V;  1K97 A;  4MW3 A;  2WSS G;  2ZDI A;  2PI5 A;  4I9Q A;  2OYQ A;  1K33 A;  3SPG A;  1GN4 A;  2V7Q G;  4FZ1 A;  1WJZ A;  2GUZ B;  4DR7 B;  3OFN G;  1VF7 A;  4QE7 A;  3FYE B;  4O4J B;  3W7U A;  2Y69 C;  5KUK A;  4LH6 A;  3DGE A;  3IC7 A;  2DQ0 A;  2EBO A;  1W2B U;  2CDY A;  3B8M A;  4DR3 O;  1SZT A;  1NJI W;  2E3C A;  1R3L C;  3HKC A;  4YHH O;  2VQF O;  2HEP A;  2FB5 A;  1EN4 A;  1JA8 A;  1QCE A;  3HKC B;  3W7S A;  3W7T A;  1I08 A;  3RN4 A;  1D5N A;  1DLB A;  4YJ2 A;  3ZED A;  1XNR O;  5J2T A;  4JI5 O;  3T1C A;  1DTO A;  3MAQ A;  3JD0 A;  2GSM B;  5HFM A;  3KG2 A;  1NR1 A;  1OZ0 A;  4B3M O;  5KUM A;  3WB1 A;  4E2L A;  4NB5 A;  1SQV H;  2P6J A;  2ZD9 A;  1FS0 G;  2HP8 A;  1GAX A;  1WP8 A;  4O2B B;  1QHT A;  3TGU H;  3E8G A;  3T4D A;  1S77 D;  2UU9 O;  4LF7 B;  2CAZ C;  4PV1 B;  4JI8 O;  2QSA A;  4LH7 A;  3QNE A;  2EIM C;  1VEW A;  4JI4 O;  2UXB O;  4CS3 A;  1F4N A;  4B3R B;  1NI8 A;  2QWR B;  3STZ C;  2UUC O;  4RQE A;  5DEC A;  1PP9 H;  1HR0 O;  1SQP H;  2ODM A;  4CS2 A;  4NTX A;  4OX9 B;  2VWJ A;  1JOY A;  2ZT9 B;  1NZ6 A;  3ZHV A;  3OAA G;  1YZB A;  4ASU G;  1L0L H;  2PYJ A;  2IU0 A;  1TUB A;  1S72 V;  2E76 B;  1X59 A;  2P67 A;  5JWP A;  4CC6 A;  2H94 A;  4JI7 B;  2HG5 C;  5BXZ A;  5L3F A;  3OD4 A;  1XMO O;  1S5H C;  2HJD A;  5LMU O;  5EBM C;  1BHB A;  5IY5 B;  4JAV A;  2QJ1 A;  4NVP A;  1GTO A;  3ETD A;  4FFB A;  1OCO C;  5H9C A;  4DYL A;  3ZN0 A;  1Q43 A;  1DF4 A;  1KKC A;  1OCC C;  4PDM A;  5CMU A;  2KG7 B;  1JR9 A;  2C2A A;  1XDC A;  3G6E V;  2ZNI A;  4CH3 A;  3ZMU A;  1DGS A;  2DYR C;  3E22 A;  3W7W A;  5EBW C;  4UVB A;  4BAY A;  1AR4 A;  2DWD C;  1H8H G;  2P7T C;  4I50 A;  1LNQ A;  1GN6 A;  4WFA V;  1QLE B;  4GKK O;  4GT1 A;  4I50 B;  3ZCC A;  4UCR A;  2P4V A;  4F6R A;  4DW1 A;  3G4S V;  4LC1 A;  5CA1 A;  2DW4 A;  1K3E A;  1R3I C;  1Y76 A;  4CH5 A;  5CA1 B;  5BY1 A;  3L75 H;  5IYZ B;  4J9Z B;  3FB8 C;  3CSX A;  3F5T A;  3L71 H;  3T1Y O;  4OPH A;  1IDS A;  3ZX6 A;  1FPO A;  3JD3 A;  1AI7 A;  1K34 A;  2BTQ A;  2DE0 X;  3ETQ A;  3B4S A;  5LP6 B;  3CCL V;  2VQE B;  2Q6A A;  3FB6 C;  3HKE A;  2P90 A;  1VQP V;  3S3X A;  3R65 A;  3E8B A;  5CBF A;  2N74 A;  4DK1 A;  5KA6 A;  4FLU A;  3UT5 B;  2LW7 A;  4LF8 B;  2RDC A;  2RN9 A;  2ZDI C;  2QM4 A;  2JVD A;  4X1I A;  2BOC C;  3O65 A;  5KHH A;  1SQQ H;  5BR8 B;  4X1I B;  2RMK B;  1Y74 A;  2Y48 A;  1Q5O A;  1ZWI C;  2EJ7 A;  4X64 O;  4NXN B;  1NVP B;  4I55 B;  3X2Q B;  1F23 A;  2QTO A;  3ASN B;  1JQ0 A;  1Y74 B;  3MDS A;  1JFF A;  3CPW U;  3IAY A;  1AJQ A;  1JFF B;  4FJC C;  1N32 O;  2EIJ C;  2LGQ A;  2PTM A;  3BAA A;  5J2U B;  1OCR C;  2BCC H;  4R8C A;  1MSW D;  1BSM A;  1R6N A;  3SGI A;  1AP5 A;  2WAM A;  1ZL8 A;  5L3E A;  1AVM A;  3ZRS A;  2ZE6 A;  3VQV A;  2CE4 A;  4MW8 A;  2W0F C;  4O4I A;  4UFZ A;  3JAW A;  4O4I B;  4UVA A;  1N0N A;  1VAR A;  2X6A A;  2R9A A;  3T1H B;  4I7Z B;  5D5P A;  2B9Z A;  2ZIN A;  1P7G A;  5EK0 A;  2AXT Z;  1FJG O;  4JI3 O;  4PI2 A;  1ZUQ A;  2OTL V;  4NXM O;  1IBL B;  4GUN A;  3FX7 A;  3HKB B;  3OUF A;  3OUS A;  1I94 B;  1HNX B;  4LF6 O;  4MTF A;  2OTJ V;  3AEI A;  1IUR A;  2QM7 A;  2YS8 A;  4DV4 B;  4RAI A;  1KYO F;  1CPY A;  4ZOL A;  1M9N A;  1MG1 A;  1EN5 A;  2K9P A;  1MSD A;  1QVF U;  2HLD G;  3OMN B;  1BCC H;  1NTM H;  3MHS C;  2Z5U A;  1NH2 B;  4ZI7 A;  1IBM B;  5ITZ B;  2IU3 A;  3ZHT A;  4LP8 A;  3WFV A;  1XHZ A;  2A0L A;  5CB4 B;  4X66 B;  4O4H A;  1K5S A;  3UCS C;  3BHP A;  1MAB G;  4BIO A;  4PEL A;  4O4H B;  4PA6 A;  5IY5 C;  1M93 A;  4LF4 B;  5LOV A;  4GX1 A;  4H44 B;  1N4C A;  2IW5 A;  2XAS A;  5LMN O;  1KP3 A;  2X7R B;  5KMG A;  1ZLZ A;  4ZBM A;  3CB2 A;  5KX5 B;  5KMG B;  2OWO A;  1UPG A;  3WB2 A;  4TUY B;  4MVO A;  3UM7 A;  4JZG A;  1PNK A;  1H2K A;  2PGG A;  4FLW A;  3OW2 U;  1PNL A;  1M56 B;  2GHY A;  1PL0 A;  4EFE A;  2FTK A;  2EIL C;  2LGW A;  4J7J A;  1D2D A;  4DO2 A;  5CA3 A;  4AIL C;  2VS0 A;  1QLE C;  4UV8 A;  4DV5 O;  2RCV A;  4X20 B;  3WG7 B;  5JQG B;  4LF5 O;  3H9V A;  3RWR D;  5CA0 A;  4XDL A;  1F51 A;  4JYA B;  1TAE A;  4B3T O;  2A9H A;  1S76 D;  1SES A;  3OT7 A;  3JAL A;  3RVY A;  4BIU A;  3K03 A;  5JJN B;  5LGU A;  2X0L A;  2ITC C;  2UXN A;  3ML0 A;  3DTU B;  2JK5 C;  2Q9L A;  4ICG A;  4GKJ B;  4JV5 B;  4JI6 B;  4KXR A;  2M7W A;  4LBE C;  5LP6 C;  3IJ4 A;  1TA8 A;  2CH7 B;  4NTW A;  3K57 A;  2F95 B;  3HB3 B;  3CS5 A;  4DXW A;  4KUM A;  3H1H H;  5KHJ A;  3ABT A;  3JD4 A;  3ETG A;  3CC7 V;  4FM1 A;  5FNV A;  1RPR A;  5L3D A;  4UB6 Z;  1NQT A;  4YY3 B;  2P4K A;  1N36 O;  4WFF A;  4DUZ O;  4DW0 A;  1VQN V;  3X2Q C;  3THO A;  1IVS A;  1PD3 A;  4JI0 O;  1B3Q A;  4JYY A;  4EKW A;  3JSL A;  4Z1V A;  1SQX H;  4DR2 O;  1KB9 F;  4XBF A;  1S5L Z;  1QU7 A;  3SDL A;  4BW5 A;  1ENV A;  4JAA A;  1MMM A;  3QTC A;  2JEU A;  2QEX V;  2YIC A;  2QR4 A;  2YXH A;  4P9O A;  1T5E A;  1NTK H;  4H37 A;  3B8N A;  4PDL A;  2PUS A;  1ZTE A;  3CC2 V;  3L9D A;  2YDE A;  3KKY A;  4QE9 A;  2YI8 A;  3OEE G;  1AIL A;  5DN6 G;  1SC5 B;  3P3N A;  4MVR A;  4DR5 O;  3QF7 A;  1XRE A;  2DYR B;  4PDV A;  1DK1 A;  1YCI A;  1VMG A;  3SYA A;  1M57 C;  3PN1 A;  5A9G A;  1IBK O;  3KCX A;  1NR7 A;  3EFF K;  3BFR A;  1YF2 A;  3VBB A;  5GTI Z;  4IHJ B;  3F7V C;  4DV3 B;  1BS3 A;  4DV2 B;  1FXK B;  2Q67 A;  1XIL A;  2ADQ B;  2EZP A;  2GDS A;  2JRI A;  4U7O A;  3AG4 C;  4KL1 A;  5GON A;  2Y4U A;  1SET A;  4UCT A;  1IX9 A;  1BE3 H;  4P2Z A;  2Q7G A;  4GCZ A;  5LHH A;  4MS2 A;  2UXD B;  1KD1 W;  1VQ7 V;  1FKA O;  4TV8 B;  3OM3 B;  1Y67 A;  5JJJ B;  1EBO A;  5JH7 A;  4LF9 B;  1RM1 B;  1N34 B;  2UUB O;  4DUY B;  2RNB A;  3TJT A;  1Q81 W;  2EJR A;  2JGD A;  1H38 A;  2HHH O;  5CN0 A;  2JGD B;  2QE7 G;  2ZM6 B;  2CTR A;  4B3S O;  2LQT A;  4WFB V;  1VQ6 V;  1O9H A;  1Q82 W;  4DV6 B;  4IYI A;  2Q7H A;  3E8F A;  2QGN A;  2B1I A;  3LNM B;  1HNW O;  3A0R A;  2EIJ B;  3BA9 A;  5HFL A;  1IXM A;  5LGT A;  3D36 A;  1GK9 A;  2N04 A;  3LNN A;  3A8T A;  2HVK C;  1OCR B;  2HFE C;  1VIB A;  2IM9 A;  1J95 A;  2XND G;  4OPA A;  3ZHQ A;  4D7S A;  3JAS A;  1M56 C;  1FD9 A;  3L72 H;  4J80 A;  5EYP A;  3O9O A;  1GN2 A;  2PYL A;  2WLN A;  3JAS B;  4JAU A;  5EYP B;  2Q73 A;  3HKD A;  4DRX A;  3CC4 V;  5IT9 N;  4RUE A;  4YJ2 B;  1Q6H A;  3WG7 C;  4DRX B;  4ZIB A;  5J2T B;  3B09 A;  3ZJZ A;  2UUA B;  1XNQ B;  1RP3 B;  2VRZ A;  1G4Y B;  1W0J G;  3SJA C;  5CBG A;  1GRJ A;  3RGB A;  3ZS8 C;  5H5N A;  3HR0 A;  1VQ9 V;  4GYC B;  2ZE7 A;  2EZO A;  1PV0 A;  4KFM A;  3T2M A;  4WFE A;  1QQC A;  1H2N A;  5LHG A;  1YEW A;  4D7T A;  1H2S B;  1US6 A;  2H3O A;  2KB1 A;  1P7B A;  3LSQ A;  2WLL A;  4FK5 C;  3P3P A;  4H13 B;  4JI2 O;  3NXS A;  1WN7 A;  3K5M A;  1OCZ B;  5D5Q A;  1EFR G;  1AJP A;  2HJF C;  1J5E O;  4YHH B;  1PNM A;  1WP7 A;  2VQF B;  2E5L B;  1HWY A;  1PKX A;  3SYQ A;  1JPX A;  1V9P A;  2K1E A;  2WLK A;  3SYC A;  3ZHU A;  2Q0A A;  1HNZ O;  4AHC A;  4TQD A;  4J9Y B;  4AQY O;  4JZ2 A;  1YTF B;  1TUB B;  4J7Z A;  3ZBH A;  4JI5 B;  4B3M B;  1K4D C;  3N2K A;  1XL6 A;  2LFS A;  5J9P C;  4QGP A;  5JVD A;  1XI1 A;  3AK1 A;  4ABM A;  2QWO B;  4KP4 A;  5EIB C;  5JVD B;  2YXL A;  4GX5 A;  5IWA B;  5A2Q N;  3JAR A;  5B5E Z;  1JCH A;  2UU9 B;  4FLZ A;  1EN6 A;  4IL6 Z;  1TVK A;  3WU2 Z;  1JJ2 U;  4JI8 B;  3LDC A;  4JF3 A;  1CXZ B;  3QVN A;  1K8A W;  4JI4 B;  4FFB B;  2UXB B;  1HP8 A;  3SR2 C;  1R1B A;  2UXC O;  5LYJ A;  2UUC B;  5LL6 Y;  1XQ8 A;  4WCE V;  1HR0 B;  4CH4 A;  5LYJ B;  3IGA C;  1RSO A;  1AI5 A;  1GM7 A;  1L1F A;  3E35 A;  2VQE O;  3SJC C;  3E22 B;  3B40 A;  1DF5 A;  1ZAU A;  3OMA B;  1N33 B;  3ZMV A;  2EIL B;  2ZQM A;  3H1K H;  1MZF A;  1SF9 A;  2MK3 A;  4LFA O;  1FXK C;  3IC9 A;  4F6R B;  4DR6 O;  4QIW F;  3FB7 C;  3SYO A;  2EX3 A;  4UV9 A;  1Y76 B;  3H01 A;  1YIJ V;  2Z0A A;  1XMO B;  3OTO O;  1KUQ A;  1M4U A;  2X6B A;  3ABM C;  1GN3 A;  1MZE A;  5LMU B;  4R50 A;  4RUF A;  2JDI G;  3ZMT A;  5IE9 A;  2A3Q A;  2BTQ B;  1VF6 C;  2RQ6 A;  3J81 N;  4GX0 A;  1B6Q A;  2RJZ A;  3HKE B;  2F4V O;  5AG2 A;  3D3Q A;  1RM1 C;  4ZHQ A;  1K73 W;  4IYH A;  4B7K A;  4C7U A;  4JI1 B;  4ZHQ B;  3T4Z A;  3K9S A;  4L8J A;  3E83 A;  4B7E A;  3ZHR A;  2XT9 A;  4EB6 A;  3BAB A;  4EB6 B;  3CP1 A;  1N0J A;  4TV9 A;  2Z3Y A;  1B06 A;  2V1D A;  3CCJ V;  3OGI B;  1R6K A;  4X62 O;  3JAK A;  2DYS B;  3JAK B;  3ZRV A;  4PD4 F;  1FXV A;  3D36 C;  4BIZ A;  2NNU A;  3T1Y B;  4LNU A;  2L6L A;  4G27 B;  1VQ5 V;  4X65 O;  4FLX A;  1AP6 A;  1FFX A;  1ZL8 B;  1Z2G A;  5BZB A;  1HW7 A;  4CS4 A;  2HVJ C;  3CHX A;  2BSK A;  1MA1 A;  3CCM V;  2QKS A;  2FYU H;  2Q4P A;  3JAW B;  1H2M A;  2PF4 E;  4I5S A;  5KHK A;  4FVM A;  1IBM O;  3TET A;  1M57 B;  2DWE C;  2EUL A;  2EIK C;  2GV9 A;  3CRC A;  2BOB C;  4X64 B;  3QG5 A;  3NR7 A;  3CEI A;  1SRY A;  3G6B A;  4ZKI A;  5LA6 A;  3CJH A;  3F5W C;  1OCZ C;  1YXB A;  1QVG U;  5LA6 B;  1N32 B;  5F2V O;  3CJH B;  2WLJ A;  4JTD B;  4LFB O;  2HR3 A;  4FM0 A;  4G28 B;  5JCO A;  1MNG A;  2B1G A;  3AG4 B;  4ZOL B;  4U3F H;  1NBM G;  1Q90 D;  5GTH Z;  4LFC O;  3FAV A;  5B1N A;  3CME V;  1FYJ A;  3SPH A;  2WA4 A;  2QWP B;  2AZ0 A;  3CRA A;  1Y66 A;  3AG3 C;  4ZI7 B;  3LDE A;  3L74 H;  2OIG A;  4H0L B;  3P32 A;  3JAT A;  5JJE B;  1WAZ A;  4HZ3 A;  1KKD A;  2IBZ H;  4DV0 O;  3A0H Z;  1BGY H;  1K7D A;  2JIZ G;  5LOV B;  3MHH C;  3ETE A;  3CMA V;  5B3S B;  1FJG B;  4FM2 A;  4JI3 B;  1OJH A;  2WLM A;  5TIS Z;  2JGU A;  1CEZ A;  4NXM B;  2LP7 A;  1SER A;  3L70 H;  4DR1 O;  3SYP A;  3RYC A;  2QWQ B;  1E1R G;  2F23 A;  1M5I A;  4LF6 B;  4PA3 A;  2Y0P A;  4XDJ A;  1R6T A;  3RYC B;  5FLX N;  4RWU A;  3UO2 A;  3RYF A;  1XMQ B;  4JYC A;  4X1Y A;  4DV7 O;  4YIO A;  4NYK A;  2Q69 A;  4I9W A;  1Y6X A;  2DMX A;  2XAG A;  1WA8 A;  4MTO A;  4BW9 A;  3EXA A;  2D2C B;  3APO A;  3AG7 A;  3TCU A;  4DR4 O;  4L87 A;  1YJ9 V;  2L35 A;  4MVZ A;  4J7K A;  1JMK C;  5CA0 B;  2FKX A;  1QNM A;  1SZX A;  3ZMS A;  3JAL B;  1WB8 A;  2B5U A;  2Q7E A;  2XAF A;  2YI9 A;  3TK1 A;  4MVQ A;  1W59 A;  1YIT V;  1BZK A;  2LW1 A;  3DC5 A;  5H2F Z;  4MTG A;  2Q5Z A;  1E79 G;  1BQ0 A;  5LMN B;  3JD2 A;  1R73 A;  4DK0 A;  2O57 A;  3SJB C;  1LR1 A;  1URF A;  4JAS A;  2YEV A;  3K59 A;  2W6I G;  4W4K A;  3CXC U;  5FNV B;  1N8R W;  4J42 A;  1SQF A;  3CRR A;  1AR1 B;  2D3O W;  1D5A A;  3L73 H;  4KHP O;  4J11 A;  3K04 A;  2IH1 C;  1SA0 A;  1O9G A;  5IJ0 A;  3M8A A;  2DYS C;  2BTO A;  3I56 V;  4LF5 B;  3U10 A;  1SA0 B;  3K58 A;  3ZHS A;  5EBL C;  4B3T B;  3K79 A;  4FFK A;  4AI8 A;  2JEX A;  2ZXW B;  2A79 B;  4TOI A;  1Q8I A;  4GZR B;  3CCU V;  3OR6 C;  1NS1 A;  4DV2 O;  1U97 A;  3AG1 B;  3ZRW A;  1VF5 B;  1S3J A;  4JYB A;  3BY6 A;  4I0X A;  3ZRW B;  3BEH A;  4WBN A;  4K0K O;  4UVC A;  1R3K C;  4LWS A;  4CH6 A;  3KZI Z;  4FLV A;  1BMF G;  1SQG A;  2ZIM A;  3GWO A;  3U11 A;  5IYD O;  4DV1 O;  2X6C A;  1KBH A;  2XOK G;  1Q6U A;  1N36 B;  1KEC A;  3K5L A;  1SKV A;  2YXY A;  3CYO A;  3DC6 A;  4MVU A;  4QPJ A;  3CE2 A;  4HNA A;  5E79 Z;  1NKD A;  3SPC A;  4X9Q A;  2DQ3 A;  2ZKO A;  1NVP D;  4JI0 B;  3W7X A;  4DR2 B;  4DR7 O;  1NTZ H;  5KA5 A;  2F43 G;  1XBL A;  2EIN B;  2R9I A;  1JJO A;  2NLJ C;  4XDK A;  1WPX A;  3D8C A;  2ZM6 O;  5EC2 C;  4RO2 A;  2AGA A;  5JCO C;  4O2A A;  3ABM B;  3JAM N;  4YJ3 A;  4FZ0 A;  4N23 A;  5GON B;  2XAJ A;  3CXH F;  2XAQ A;  5IDJ A;  1GKF A;  1XL4 A;  1VQM V;  2ZE8 A;  2YIA A;  3SPJ A;  3RYH A;  5DED A;  3VQY A;  4K8X A;  5JH7 B;  3QO7 A;  2ZR3 A;  1BQZ A;  4DR5 B;  3K3W A;  3DXR A;  3N27 A;  5B3S C;  1IBK B;  1YJW V;  3A0B Z;  4LF7 O;  1TGO A;  4OXS A;  4PA4 A;  1YHQ V;  1H2G A;  3ABL C;  1ARO P;  2GUZ A;  3C3T A;  1K4C C;  4O4J A;  5IJ9 A;  1Q6I A;  4B3R O;  1KP2 A;  5IJ9 B;  2QWN B;  3LSU A;  1YI2 V;  1WNS A;  4PA9 A;  2WPD G;  3TXQ A;  3CCE V;  4OX9 O;  5C8Y A;  1XEQ A;  3HKD B;  2WA3 A;  3RYI A;  5C8Y B;  2QKC A;  2E5L O;  3RYI B;  5FPO A;  3E8H A;  4JTA B;  3P30 A;  3AK2 A;  1NH2 D;  2PI4 A;  3PJS K;  4FPP A;  2KKW A;  1COW G;  1K9M W;  1VQK V;  2DN9 A;  4EEQ A;  4TQF A;  1OV9 A;  4JI7 O;  1R3J C;  1WPB A;  1XHX A;  2UUB B;  1AI4 A;  4QNH B;  4CC5 A;  4O2B A;  1Q7Y W;  2EIK B;  4UB8 Z;  1AB3 A;  1YJN V;  2YIB D;  5IWA O; 
#chains in the Genus database with same CATH homology
 3H1J H;  3L71 H;  1PP9 H;  3H1L H;  3BCC H;  3CX5 F;  4U3F H;  3H1H H;  1SQX H;  1SQP H;  1SQB H;  1KB9 F;  4D6T H;  3TGU H;  2IBZ H;  3H1I H;  1BCC H;  1BGY H;  1NTM H;  3CXH F;  4PD4 F;  1BE3 H;  2BCC H;  1EZV H;  3H1K H;  3L72 H;  1SQQ H;  2FYU H;  1NU1 H;  1L0L H;  1KYO F;  1PPJ H;  3L70 H;  1NTZ H;  3L74 H;  5KLV H;  2A06 H;  1L0N H;  1NTK H;  1P84 F;  3CWB H;  3L75 H;  3L73 H;  1SQV H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...