3CWBH

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cwbH00
2BCCH 1NTZH 3L73H 1SQPH 2FYUH 1L0LH 1SQXH 1PPJH 1SQQH 1BGYH 2IBZH 4D6TH 3H1KH 3L74H 2A06H 1EZVH 3L72H 1KB9F 1P84F 1PP9H 3H1HH 3H1LH 3L75H 4U3FH 1BCCH 1NTKH 1SQVH 4PD4F 3L71H 1BE3H 5KLVH 3CX5F 1L0NH 3H1JH 3CWBH 3H1IH 1NU1H 1NTMH 3BCCH 3L70H 3TGUH 1SQBH 3CXHF 1KYOF
chains in the Genus database with same CATH superfamily
4QGPA 3K03A 1IBLB 2YXLA 4UCUA 1YF2A 4XDLA 1F51A 1PNKA 1Z2GA 4OXSA 1WN7A 1H2GA 4CS2A 4AQYB 1F7YA 3JATA 4WFAV 1K97A 1XOUA 1Y4MA 1E1RG 4I4TA 5KMGA 4TSFG 3AK3A 1S72V 3FB7C 1DF5A 4JV5O 2JS5A 3OD4A 5EC1C 1MABG 1MSDA 1XMOO 2YIBA 4JI2B 3ZMTA 2UXBB 1SC5B 4B3TO 3F5TA 2P06A 3BCCH 1UFIA 2CUGA 2UUBO 5BMVA 4XBFA 3AK1A 2JJ1G 3QNEA 1JX9A 1BQZA 1M93A 3K57A 3JD4A 4Z2WA 5IYCO 1VQ9V 2A06H 4GX1A 3RW0A 1IBMB 4UVAA 4LFBO 3R65A 1FKAO 3DXRA 3D3QA 4GX0A 5LP6B 2E3CA 4ZI7A 3SPJA 2WLMA 2YC0A 3OEHG 4NTYA 1QR9A 1E79G 2YIBD 4UCSA 2LW7A 3SYQA 4FLTA 2JEXA 5JH7B 2VWJA 4FLXA 1OZ0A 5FPOA 1YJ9V 3J7AU 4J7JA 1N32O 3JYCA 1WLEA 5KLVH 4B7KA 3CMEV 1PNLA 2JGUA 1FAFA 3RYCB 4FJCC 2DQ3A 2BOCC 1DLBA 3TXSA 2UXNA 2ZINA 3VQYA 3ZN1A 2QR4A 3O65A 1VP7A 2EJRA 2YICA 3OTOO 1P49A 2IW5A 2KG7B 2ZIMA 3QF7A 4FM0A 3ZHUA 4GX2A 3H1IH 4X65O 4ICGA 3AG3B 2JVDA 3A0HZ 1K5SA 3S3WA 2UUCO 2BCCH 1VQKV 3APQA 3JD0A 2VWKA 1Z5VA 2Q0OC 3D8CA 4PA3A 5DM6V 1GN4A 4X64B 4NKGB 1QVFU 2WWWA 1NTKH 3U11A 4DW0A 1PM9A 3L71H 3PJSK 1K9MW 4YJ2B 3RT3C 5LP6A 4WFFA 3SR2C 2XOKG 2ZXWC 4O2AB 5IWAO 4FLVA 1QLNA 1NT2B 4CS3A 4D6TH 4QNHB 5JH7A 2Y69B 5D5PA 3BEHA 3UQ8A 1AJQA 3QVNA 5L3FA 2QM8A 1SQVH 4MTOA 2QE7G 2YIAA 1SKVA 2YI9A 1M1KW 2QWOB 3CCVV 4ZHQB 1H38A 2X0LA 1D5NA 3RYCA 5FPRA 1W59A 2EIMC 4B3SO 3ETQA 1AR5A 1IVSA 3ETGA 5BR8O 5DN6G 2KG7A 3ZMZA 3CX5F 1IURA 1SS3A 3F7VC 4CH6A 3CPWU 4WFEA 1WP7A 2B1GA 2Y48A 5A2QN 5EIBD 5FNVB 1X4TA 4MSWC 4IL6Z 2OIGA 1HR0O 1R3IC 4B08A 3SJAC 1IBKB 2G38A 4UB6Z 3FAVB 2XAGA 4OX9O 1TGOA 3ZBHA 2Q0AA 2HLDG 4JZGA 4DV6O 1I5YA 4YJ2A 2ZR3A 1RSOB 1HNZO 1BHBA 3STZC 1GMGA 3STLC 3JARB 3P30A 4O2AA 2P90A 4NB5A 2EINC 4JV5B 4UCTA 2R9AA 3A0RA 1Y66A 2GBOA 2B9ZA 3A8TA 4XDJA 3SYPA 3WB2A 1NVPB 4P9OA 4YHHO 3RYHB 2UXDO 4BIZA 3RBZA 4JI4B 4U7OA 4LF5B 4UXNA 4ZHQA 1K4CC 3HKDA 4UUJC 3E8FA 3H1KH 5KHIA 3RVZA 2RDCA 3FFQA 2AXTZ 1PD3A 4Q20A 2IU0A 1YTFB 1S0VA 1FJGO 4BW9A 1I7FA 1FS0G 4DV4O 4RO2A 2CGNA 4LNUB 2IM9A 4N21A 4R6ZA 1EZVH 3JASB 2Q5ZA 3UT5B 4CC5A 3SYOA 3OMAB 4K8ZA 3H01A 3R66A 3FAVA 1B04A 3JSLA 3NR7A 2EZOA 2JEUA 1RSOA 1COWG 5C93A 3OMNB 1PNMA 4KP4A 3W7XA 2FYUH 5KAIZ 1KU9A 3JARA 3MD0A 4O4JB 5IJ0B 2EIJC 2R9IA 1Q82W 4U7NA 2ARHA 1Q90D 2ODMA 2BTQB 5IY5B 1QBZA 3ML0A 1N34B 4FZ0A 1BS3A 3RYHA 3F7YC 1KP3A 2ZR2A 4BIUA 1XI1A 2CH7B 4TQDA 4Q6GA 2E76B 3CCQV 2HHHO 4PA9A 5F2VO 4JYAB 4MVZA 2IJIA 3G80A 4JTAB 3JAMN 4RQFA 1TA8A 1IBLO 4R8CA 1DTOA 4DR1B 1NR1A 1XDCA 2Q7EA 1VQ8V 1YI2V 1MG1A 1YIJV 2OCCC 1XHZA 4AQYO 3D3IA 4LNUA 1ZLZA 3RYIB 1NVPD 3OW2U 4DYLA 4O4HB 3L72H 3ETDA 3JASA 4D7SA 3UT5A 2LFRA 4DUZB 2UXBO 4ZKIA 3TXQA 4HAMA 1D2DA 2PGGA 2Q9LA 4MVOA 3LSQA 3EXAA 2QM4A 2QKAA 2YXYA 2RNBA 3ZHVA 5D5QA 2E5LB 1BGYH 2ETNA 4UVBA 1YTFD 4O4JA 4WCEV 1WA8A 1V54B 4PDVA 1OCOC 2UXCB 1ZWIC 2XT9A 1IBMO 4LR3A 3OT7A 2BTQA 2CE4A 1NI8A 3OMIB 1GH6A 3N2GB 3WFVA 3T1HB 3TJTA 3CCUV 3OAAG 3D36A 3ZS8C 1HW7A 2CH7A 3JD2A 1FFTB 2M6YA 5ITZB 1JFFB 2Q68A 1BL8A 3APOA 1HR0B 2PF4E 3ABLB 5H5NA 1B06A 4KHPB 2DW4A 2GDSA 2F1MA 1V9PA 1S5LZ 5L3BA 3SJCC 3WG7C 4JTCB 3ABTA 3CEIA 1XNRB 2NNUA 3SYCA 1CP9A 4PA7A 4GKKB 2LQTA 1V55B 1KKDA 1G1XB 1SA0B 5EBLC 1GKFA 2LO1A 4O4HA 5EZYB 4DR4B 4K3AA 1ZX3A 2Z5UA 1HNWO 1I08A 2CAZC 3VBBA 4JI7B 2P4VA 3L9DA 4J7ZA 4FM2A 1B6QA 1J5EB 3JSNA 1CEZA 5JJJB 5GTIZ 4RWUA 4DR2B 3QO7A 1XQ8A 4E4EA 1FFXB 2XHBA 4X64O 2DWDC 1KKCA 1NU1H 4GUNA 1M57C 1OCRB 2XUMA 3N2GA 2QWNB 3E86A 4JZ2A 4J41A 1R3LC 5ITZA 1JFFA 1IZ3A 1WPBA 2ZDIC 2ZE7A 4X1KA 2R72A 1GM7A 1E1QG 5JWPA 3T4DA 4L87A 4R50A 2YSUB 2IJJA 4J11A 3U0ZA 3ZMUA 5LXTB 4DV0B 3T1YB 2ZKOA 1FPOA 3B8MA 2X6AA 1AJNA 4JYYA 5B1AB 3BVOA 1NR7A 2EILB 4CS4A 2UXXA 4CH4A 2GSMB 3N27A 1P7GA 5EZYA 3WB0A 1O9HA 3DC5A 3E8HA 5H9CA 1HDJA 3UO2A 2VQFB 1GTOA 1SERA 5LHGA 2K9PA 3RWRD 3FB6C 1BHAA 3DC6A 1YDXA 5JJEB 1M4UA 1Q6HA 4FMTA 3K5LA 3K08A 5KHHA 1IBKO 3CC2V 2PI4A 1FFXA 4P30A 3CCLV 3CSXA 3ZHSA 3K5OA 3IC9A 1ZL8B 1SZTA 3WU2Z 1XREA 3OR7C 1NTZH 4OPAA 5K1PA 1WNSA 5CA1B 2MW2B 1S5HC 3SJQC 1KUQA 4JI6B 2D3OW 4J42A 1DF4A 3KKYA 3E8BA 2HR3A 1Q8IA 5EBWC 3MHHC 4JI5B 3DGEA 4LF8B 1T5EA 5CMUA 4JI4O 1S77D 4LF5O 3ZHRA 3W7UA 1W0KG 1KMIZ 4OGQB 5LXTA 3A0BZ 1M90W 2VS0A 2OCHA 4W4LA 4DXWA 2LJ2A 2FL4A 1FXKB 3ASOC 4MTGA 2V7QG 3H1JH 4MVMA 4RQEA 5LMUB 2VQEB 1GAXA 2W0FC 3E83A 3SPHA 4H13B 4ASUG 1RM1C 4I50B 1F4MA 2IBZH 3FYIB 4K35A 1KBHA 2CTWA 4MT8A 1PKXA 2B5UA 2ZCEA 1MZEA 2PI5A 4YJ3B 4NTWA 2WLKA 2H8PC 3OTFA 2EIKC 2FMLA 2A7WA 1ZL8A 5GONB 3CB2A 1H2SB 1ORQC 3HKCB 1YZBA 5CA1A 4HBNA 5LA6B 3AG2B 2CTPA 3ZMVA 1VF6C 5C8YB 4FLYA 3K06A 4YY3B 1HNWB 1N4CA 1Q7YW 4FFKA 4FLWA 1VQOV 2KQXA 3AG1B 5JQGB 3NXSA 1N34O 4TWKA 2X6CA 3K79A 4JAAA 1NQTA 1TVKB 1JMKC 2Y4UA 4BIOA 4DV2B 1GO3F 4JYAO 1N0NA 2D2CB 1OV9A 2PTMA 3B09A 3LSSA 1GK9A 1QNMA 4DR1O 4DV1B 1FXKA 4JGSA 5LP6C 2XTAA 4DO2A 4A5UB 2P4KA 2F43G 3CXHF 1JQ0A 2AHYA 5L3GA 1N8RW 3K9SA 1VF5B 4AHCA 3VQVA 5JCOA 4I50A 4OPHA 4QJFB 2RN9A 3I55V 1SESA 4GT1A 1EZJA 3ABKB 1BE3H 4YJ3A 1IX9A 1XHXA 3ZRXA 4DUZO 4C7UA 1VQ5V 5B1NA 4UCRA 5H6QA 2OIEA 2Q69A 2Y0PA 3HKDB 3EHBB 2OYQA 1B3QA 2WA4A 3CCJV 4IGGA 5GONA 2Q7HA 3C3SA 4LBEC 4FIPC 2QEXV 1QCEA 2E5LO 3HKCA 5B1BC 5J2UB 1GM9A 4MW8A 3K5MA 3BAAA 5LA6A 1U97A 5C8YA 2XAQA 2UXCO 3SPGA 1M5IA 3ZX6A 2A9HA 4I9QA 1EN5A 1MNGA 4GKJB 5JQGA 1NKDA 3AK2A 1SQGA 1YVWA 3T1HO 2RMKB 4LF4B 1TVKA 4CC6A 5BY1A 1Y74B 3W7TA 3AG4C 1LUVA 3TETA 1N36B 2JS3A 1VEWA 1VQMV 4FK5C 4G28B 3CCMV 1SF9A 3SGIA 3BA9A 5L3EA 4KHPO 2XNDG 1NTMH 3ETEA 3Q4HB 2P22C 3K0DA 2A0LA 3E22B 4MTFA 2DN9A 2FKXA 3FYEB 3GWOA 4RAIA 1XNRO 4DR3B 2HG5C 4GKKO 3CD6V 2Y69C 1NJIW 3HKEB 4QIWF 4G2KA 5B3SB 1FD9A 3BY6A 4DR4O 2NLJC 2E75B 3ZEDA 1D5AA 1THZA 4JI7O 1EN4A 2EIJB 1J5EO 1ZTEA 1MOFA 4MVSA 1LUWA 5B66Z 5J2UA 4DR2O 1NZ6A 2QJ1A 5J2TA 1OHHG 2DOSA 5IYDO 2YIDA 1Y6XA 2AZ2A 2W6IG 3IFXA 1AILA 4FM1A 5HFLA 2N05A 2WSSG 1W0JG 3SYAA 1PPJH 4P2ZA 3HKBB 1RFYA 2W6JG 1Y74A 1H2KA 2X6BA 2XASA 2QWQB 1W2BU 4JI3B 4UCVA 1Q5OA 4PHZA 3OGCC 3HR0A 1YSCA 4PELA 4NVPA 3Q4HA 4LF7B 1VF7A 1JA8A 1URFA 3E22A 4K0KO 3K0GA 4DV0O 3ZHQA 3T1YO 1GN6A 1WA8B 1MA1A 1AR1B 1BT8A 3HKEA 3G4SV 4RUEA 2WLHA 3ZRWB 3ZMSA 1WB8A 3CCSV 3LNNA 2FB5A 1LR1A 2VQFO 3PN1A 5FLXN 3G6BA 2ITDC 1RPOA 2WA3A 5L3CA 2GHYA 2P5OA 2A3QA 1R3JC 2ZNIA 2ZD9A 3IGAC 2JK5C 4FLUA 2AGAA 1AJPA 2QWRB 1SQFA 2ZT9B 3GB7C 4DRXB 1JCHA 1U96A 1S5JA 2Q8VA 3FD9A 3LNMB 4BW5A 1IXMA 3THOA 2IJKA 3ASNB 1JR9A 2CTRA 1ZSPA 2BSKB 2CDYA 5CA3A 3HKBA 4I55B 5KHGA 2DWEC 4DR7B 2DJVA 5H6RA 3I5DA 4JI6O 4FLZA 2ILMA 3FKSG 1Z5WA 5IYBO 3ZIAG 3WG7B 1I94B 4GZRB 4LWSB 3OFNG 4JI5O 1MMMA 4LF8O 1RPRA 1GRJA 3JCZA 3CMAV 3SJBC 4I5SA 3CCRV 1MSWD 3H1LH 2WLJA 4JYBA 1K4DC 2JRIA 4PA6A 3ZRSA 2QA4V 3AEIA 3JALB 3ZRWA 3CWBH 1AP5A 5CN0A 2V1DA 4IIJB 4KXRA 3D36C 5LMUO 2VQEO 1Q43A 1OCCB 1AVMA 1N33B 2DYRC 1EM1A 2ZM6B 3FX7A 4MTXA 4X1KB 4F6RB 3CRRA 1CPYA 3X2QB 4N23A 2ZQMA 2DYSC 4TUYB 5KUMA 3G67A 3QO5A 4DRXA 4GCZA 4NXNO 1OCZC 5KA5A 4KL1A 1QLEB 1M56B 1S76D 2BSKA 4D7TA 1X59A 1Q6IA 4I55A 1Y67A 4DR5B 4W4KA 4O4IB 1I5XA 4GLXA 4YY3O 2QSAA 4X1IB 3M7MX 4H33A 1K34A 4DW1A 2QDOA 2F66C 4AI8A 2PUSA 4LWSA 4I0XB 1SQPH 5LYJB 3JAKA 2V4DA 5LGNA 2Z0AA 2PYJA 3ABMB 4UVCA 4DV2O 4X8AA 2A79B 3F5WC 1G4YB 1H2MA 1QU7A 2HVJC 3EFFK 2UU9B 1AI6A 1XL4A 2F4VO 3JALA 3M8AA 2RCVA 4E2LA 2HFEC 3T4ZA 4X1YA 4DV1O 2QKSA 3HB3B 1AB3A 4IIJA 5IT9N 3WB1A 1K7DA 2P7TC 4YIOA 1XMQB 3ABLC 3UO3A 3B4SA 1AI7A 3L75H 4LP8A 3KCXA 4ZOLB 3ZN0A 2R9RB 4F6RA 5LHHA 4HZ3A 4QE9A 1PL4A 5FL7G 2EBOA 4TUYA 4K0KB 2VRZA 1AI5A 3B8NA 4TT3G 3OEEG 1V55C 1SRYA 4IYHA 4JASA 5CBGA 4MVQA 3P3NA 4GX5A 2ZDIA 5LGUA 4DK1A 4NR1A 2YS8A 4JTDB 4L8JA 1HP8A 3K58A 1JVMA 4O4IA 1FXHA 4P9PA 4X1IA 3ICXA 2LW1A 3RYFB 5IJ9B 5EYPB 1SZXA 4GKJO 2F23A 1JOYA 4I0XA 1SQQH 2DE0X 5LYJA 1L8DA 1KC8W 1UJWB 4LF4O 3KG2A 4PI2A 4LF6B 2KB1A 2ADPA 1KB9F 2WLNA 3ASOB 1N36O 3B2EE 3JD1A 2ZE5A 2EULA 3L70H 4IHJB 4X62B 1J95A 2EJ7A 2HVKC 1YEWA 1WB7A 1RM1B 2GTAA 2IH3C 2GTSA 4DR3O 5CA0B 4QE7A 2MK3A 2FTKA 1QHTA 3JD3A 4J7KA 2ZIOA 4ZOLA 4LFCB 3DTUB 5EC2C 2M7WA 2JJ2G 1VARA 5B5EZ 3K5NA 3TCUA 2EIKB 2K1EA 3BFRA 2HKOA 5LOVA 2GV9A 2YUAA 3CRCA 5KX5B 1QVGU 5LBQA 5LMNB 5CB4B 4F6EA 1G6UA 1YXBA 3E8GA 3CJHB 4JI0B 2O57A 1VQNV 2UUAB 3TK1A 5B1AC 2EILC 1TUBB 4WFHA 1K8AW 3CRMA 3FB5C 1XNQB 1DGSA 3AG7A 2JGDB 3G71V 1VQ7V 2WAMA 1GN3A 3QO8A 1GN2A 3OM3B 3RYFA 2GUZB 4B7EA 5IJ9A 1FXVA 3CRAA 4JI8B 4I7ZB 5L3DA 2QWPB 2YEVA 5EYPA 3E2EA 3KCYA 5EK0A 4FVMA 3E35A 2C2AA 1M9NA 1H8HG 4DV5B 4JI3O 5JVDA 2XAHA 4B3MO 1YJWV 2ZXWB 3OUSA 3RN4A 4IHJA 2AW9A 2P67A 4NXNB 4UCOA 4TV9B 4WFGA 1AROP 4LF7O 4B3RO 1Y76B 3BRCA 5DECA 1R6NA 2OWOA 3LUTB 5LGTA 5CA0A 1L1FA 2RQ6A 1L0NH 3RVYA 4I9WA 4ABMA 5KX5A 2EX3A 2KKWA 4MW3A 2EIMB 4UFZA 5CB4A 4X66B 3OGIB 4MVRA 5B1BB 2WLIB 1S3JA 3HPLC 3IAYA 1KD1W 4PA4A 4UB8Z 1VF6A 3CJHA 4R7CA 2B1IA 4BR6A 1FYJA 4LF9B 2Z3YA 2CTQA 2F4VB 1FXKC 4HNAB 1TUBA 4AILC 1GM8A 3TGUH 3BA8A 2JGDA 4X20B 3LDCA 2GUZA 3AG4B 3LDEA 5AG2A 5JCOC 2BOBC 4DV3O 3ABUA 1Q86W 4DV7O 5EIBC 1NBMG 3T1CA 4DR7O 3BPZA 1K73W 4UV9A 5E79Z 2PY5A 1A32A 1VIBA 1HNXB 4DR6B 5E1AC 2OTLV 4IT5A 1I94O 2EINB 2Q7GA 4TV9A 5TISZ 3K04A 3L74H 4RUFA 1JJ2U 1Y76A 4LCUC 3AG2C 4DK0A 1K33A 3CE2A 2QM7A 5J2TB 4KFMA 2ZE8A 3AG1C 4X88A 3CRQA 1WP8A 4NXMO 3N2KB 5IYZB 2ZE6A 1VQ6V 3AG3C 4BWAA 1QR8A 4DUYB 2WLIA 1N33O 2Q6AA 1JJOA 3M99B 2XAFA 4U3FH 3A2FA 2ZM6O 4J80A 2H3OA 3S3XA 4LFAB 1EBOA 1IDSA 1Q3EA 3LSUA 4HNAA 4KUMA 4H44B 4X20A 5KUKA 1CXZB 3ZJZA 1H2LA 2L35A 2W0XA 4Z1VA 4J9ZB 2PZSA 2ZNJA 1AR4A 4EEQA 2X7RB 4LH6A 4ZIBA 4CBCA 2RJZA 3LDDA 3ABKC 1VQPV 3GWKC 4NTXA 2EZPA 4DR5O 1VQ4V 4O2BB 4PJ0Z 5GW7A 1HWYA 3L73H 4WFBV 2PYLA 1ZUQA 4G27B 3IJ4A 3CCEV 1XMOB 4QPJA 1VMGA 1WAZA 1XILA 3K59A 4B3TB 5B1OA 3C90A 1IXBA 1BCCH 4PD4F 4MS2A 2UUBB 2UU9O 4MVUA 2ATKC 1KP2A 1MZFA 4Z1MG 3N2KA 5IYZA 1NH2B 4TOIA 3CP1A 3OUFA 2Q67A 4JYCA 2CGOA 4LFBB 1US6A 1YCIA 1XMQO 4B3MB 3J81N 5CBFA 2IH1C 1ROPA 2HJDA 2OCCB 4JI1O 3T2MA 5FNVA 4B3RB 1L0LH 5HFMA 1R73A 1H2NA 1N32B 2WPDG 3JAWB 3CXCU 1P7BA 1YHQV 3H1HH 4JF3A 1DK1A 2L6LA 3P3PA 3ZCCA 5B3SC 2H94A 4BAYA 2KSDA 1YITV 4O2BA 4EKWA 3GVMA 1SQXH 1WPXA 2LFSA 3CC4V 2HEPA 4XDKA 3CS5A 3E89A 3OTOB 2F95B 1R6KA 4CH3A 1LNQA 1P84F 1OCOB 1H8EG 4LF6O 5KHJA 4X65B 1NS1A 2AHZA 2IU3A 4X89A 4EFBA 2UUCB 3CHXA 3U10A 1EN6A 3QG5A 1KYOF 4X62O 5IDJA 1SETA 2DYRB 1TAEA 3C3TA 3VOUA 4FZ1A 4DV3B 4DV7B 1WJZA 4PI0A 2YXHA 3UKMA 2BTOA 4LH7A 2YI8A 5A9GA 2OTJV 2Q4PA 5BZBA 4LFCO 3K3WA 2DYSB 1BMFG 5IWAB 4LC1A 2QKCA 4H37A 4CZZA 1OCZB 2JIZG 3JAKB 1K5QA 5LMNO 4X9QA 2LP7A 1O9GA 1BQ0A 3FB8C 4JAVA 5IE9A 3ZRVA 4YXWG 4TV8B 2NR5A 2LGWA 3JAWA 3UM7A 4JI0O 3G6EV 2F93B 2QTOA 2UUAO 4JI2O 5K1XA 1JPXA 1TUEB 1NH2D 2DMXA 4NXMB 1XL6A 4O4LB 5IY5C 4X1YB 1XNQO 2IJHA 3DSQA 5EBMC 3K9AA 4B3SB 1R6TA 3BABA 3O9OA 2WLLB 3VQXA 3B40A 3RFRA 5IJ0A 4JI8O 1R3KC 3SDLA 4WF9V 5BR8B 2N04A 1YJNV 1RP3B 3RGBA 4PV1B 4PDLA 4H0LB 1KQSU 4PDMA 5KA6A 4DV5O 5H2FZ 2CK3G 1M57B 4UV8A 4F4LA 3ZHTA 4JPRA 5KHKA 1P4RA 3OR6C 1G8MA 5JJNB 2Y4TA 3ASNC 5DEDA 2AZ0A 3H9VA 4OX9B 3OE7G 4WBNB 2XAJA 4EB6B 4J9YB 4DV6B 2Y0IA 5CBHA 1HNZB 3JCUZ 1XBLA 1F23A 4FFBB 4J10A 2OT5A 1R1BA 3CYOA 4U3JB 3RYIA 5KAFZ 4X66O 3BHPA 1XEQA 4TV8A 1V54C 1N0JA 3W7SA 1I0HA 4YHHB 1XUQA 2UXDB 4LF9O 2LGQA 1ENVA 1K3EA 3J80N 1UPGA 2Q73A 2QGNA 4O4LA 4YIPA 3MAQA 2E74B 1OCCC 1QQCA 2WLLA 3MDSA 4PDRA 1BZKA 5LHIA 1PP9H 3B77A 1FJGB 3SPIA 1F4NA 4DV4B 2NN4A 4HYOA 4QPKA 3P32A 3JATB 1Q81W 3X2QC 5LOVB 2R70A 3UCSC 1EFRG 1HNXO 2HJFC 4DR6O 4JI1B 4EFEA 2JDIG 4I4TB 5KMGB 1QLEC 1M56C 4NYKA 2DQ0A 4CH5A 2N74A 1KECA 4GYCB 2HP8A 1AI4A 5LL6Y 3VQWA 4WBNA 4EB6A 3IC7A 5BMVB 4ZBMA 4JAUA 4TQFA 3QTCA 3EVKA 4FFBA 1PV0A 5J9PC 4K8XA 1Q6UA 5BXZA 1PL0A 1OJHA 1ZAUA 2YEVB 1VQLV 1BSMA 4U3JA 2ITCC 3ABMC 1SA0A 3I56V 2BE3A 3DXRB 3SPCA 3CC7V 2YDEA 4IYIA 4DUYO 3W7WA 5JVDB 1AP6A 2ADQB 4FPPA 2P6JA 2QTSA 4ZI7B 1K92A 3KZIZ 5GTHZ 4LFAO 1SQBH 3MHSC 2HHHB 1OCRC
chains in the Genus database with same CATH topology
2BCCH 1NTZH 3L73H 1SQPH 2FYUH 1L0LH 1SQXH 1PPJH 1SQQH 1BGYH 2IBZH 4D6TH 3H1KH 3L74H 2A06H 1EZVH 3L72H 1KB9F 1P84F 1PP9H 3H1HH 3H1LH 3L75H 4U3FH 1BCCH 1NTKH 1SQVH 4PD4F 3L71H 1BE3H 5KLVH 3CX5F 1L0NH 3H1JH 3CWBH 3H1IH 1NU1H 1NTMH 3BCCH 3L70H 3TGUH 1SQBH 3CXHF 1KYOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC H;  1NTZ H;  3L73 H;  1SQP H;  2FYU H;  1L0L H;  1SQX H;  1PPJ H;  1SQQ H;  1BGY H;  2IBZ H;  4D6T H;  3H1K H;  3L74 H;  2A06 H;  1EZV H;  3L72 H;  1KB9 F;  1P84 F;  1PP9 H;  3H1H H;  3H1L H;  3L75 H;  4U3F H;  1BCC H;  1NTK H;  1SQV H;  4PD4 F;  3L71 H;  1BE3 H;  5KLV H;  3CX5 F;  1L0N H;  3H1J H;  3CWB H;  3H1I H;  1NU1 H;  1NTM H;  3BCC H;  3L70 H;  3TGU H;  1SQB H;  3CXH F;  1KYO F; 
#chains in the Genus database with same CATH topology
 4QGP A;  3K03 A;  1IBL B;  2YXL A;  4UCU A;  1YF2 A;  4XDL A;  1F51 A;  1PNK A;  1Z2G A;  4OXS A;  1WN7 A;  1H2G A;  4CS2 A;  4AQY B;  1F7Y A;  3JAT A;  4WFA V;  1K97 A;  1XOU A;  1Y4M A;  1E1R G;  4I4T A;  5KMG A;  4TSF G;  3AK3 A;  1S72 V;  3FB7 C;  1DF5 A;  4JV5 O;  2JS5 A;  3OD4 A;  5EC1 C;  1MAB G;  1MSD A;  1XMO O;  2YIB A;  4JI2 B;  3ZMT A;  2UXB B;  1SC5 B;  4B3T O;  3F5T A;  2P06 A;  3BCC H;  1UFI A;  2CUG A;  2UUB O;  5BMV A;  4XBF A;  3AK1 A;  2JJ1 G;  3QNE A;  1JX9 A;  1BQZ A;  1M93 A;  3K57 A;  3JD4 A;  4Z2W A;  5IYC O;  1VQ9 V;  2A06 H;  4GX1 A;  3RW0 A;  1IBM B;  4UVA A;  4LFB O;  3R65 A;  1FKA O;  3DXR A;  3D3Q A;  4GX0 A;  5LP6 B;  2E3C A;  4ZI7 A;  3SPJ A;  2WLM A;  2YC0 A;  3OEH G;  4NTY A;  1QR9 A;  1E79 G;  2YIB D;  4UCS A;  2LW7 A;  3SYQ A;  4FLT A;  2JEX A;  5JH7 B;  2VWJ A;  4FLX A;  1OZ0 A;  5FPO A;  1YJ9 V;  3J7A U;  4J7J A;  1N32 O;  3JYC A;  1WLE A;  5KLV H;  4B7K A;  3CME V;  1PNL A;  2JGU A;  1FAF A;  3RYC B;  4FJC C;  2DQ3 A;  2BOC C;  1DLB A;  3TXS A;  2UXN A;  2ZIN A;  3VQY A;  3ZN1 A;  2QR4 A;  3O65 A;  1VP7 A;  2EJR A;  2YIC A;  3OTO O;  1P49 A;  2IW5 A;  2KG7 B;  2ZIM A;  3QF7 A;  4FM0 A;  3ZHU A;  4GX2 A;  3H1I H;  4X65 O;  4ICG A;  3AG3 B;  2JVD A;  3A0H Z;  1K5S A;  3S3W A;  2UUC O;  2BCC H;  1VQK V;  3APQ A;  3JD0 A;  2VWK A;  1Z5V A;  2Q0O C;  3D8C A;  4PA3 A;  5DM6 V;  1GN4 A;  4X64 B;  4NKG B;  1QVF U;  2WWW A;  1NTK H;  3U11 A;  4DW0 A;  1PM9 A;  3L71 H;  3PJS K;  1K9M W;  4YJ2 B;  3RT3 C;  5LP6 A;  4WFF A;  3SR2 C;  2XOK G;  2ZXW C;  4O2A B;  5IWA O;  4FLV A;  1QLN A;  1NT2 B;  4CS3 A;  4D6T H;  4QNH B;  5JH7 A;  2Y69 B;  5D5P A;  3BEH A;  3UQ8 A;  1AJQ A;  3QVN A;  5L3F A;  2QM8 A;  1SQV H;  4MTO A;  2QE7 G;  2YIA A;  1SKV A;  2YI9 A;  1M1K W;  2QWO B;  3CCV V;  4ZHQ B;  1H38 A;  2X0L A;  1D5N A;  3RYC A;  5FPR A;  1W59 A;  2EIM C;  4B3S O;  3ETQ A;  1AR5 A;  1IVS A;  3ETG A;  5BR8 O;  5DN6 G;  2KG7 A;  3ZMZ A;  3CX5 F;  1IUR A;  1SS3 A;  3F7V C;  4CH6 A;  3CPW U;  4WFE A;  1WP7 A;  2B1G A;  2Y48 A;  5A2Q N;  5EIB D;  5FNV B;  1X4T A;  4MSW C;  4IL6 Z;  2OIG A;  1HR0 O;  1R3I C;  4B08 A;  3SJA C;  1IBK B;  2G38 A;  4UB6 Z;  3FAV B;  2XAG A;  4OX9 O;  1TGO A;  3ZBH A;  2Q0A A;  2HLD G;  4JZG A;  4DV6 O;  1I5Y A;  4YJ2 A;  2ZR3 A;  1RSO B;  1HNZ O;  1BHB A;  3STZ C;  1GMG A;  3STL C;  3JAR B;  3P30 A;  4O2A A;  2P90 A;  4NB5 A;  2EIN C;  4JV5 B;  4UCT A;  2R9A A;  3A0R A;  1Y66 A;  2GBO A;  2B9Z A;  3A8T A;  4XDJ A;  3SYP A;  3WB2 A;  1NVP B;  4P9O A;  4YHH O;  3RYH B;  2UXD O;  4BIZ A;  3RBZ A;  4JI4 B;  4U7O A;  4LF5 B;  4UXN A;  4ZHQ A;  1K4C C;  3HKD A;  4UUJ C;  3E8F A;  3H1K H;  5KHI A;  3RVZ A;  2RDC A;  3FFQ A;  2AXT Z;  1PD3 A;  4Q20 A;  2IU0 A;  1YTF B;  1S0V A;  1FJG O;  4BW9 A;  1I7F A;  1FS0 G;  4DV4 O;  4RO2 A;  2CGN A;  4LNU B;  2IM9 A;  4N21 A;  4R6Z A;  1EZV H;  3JAS B;  2Q5Z A;  3UT5 B;  4CC5 A;  3SYO A;  3OMA B;  4K8Z A;  3H01 A;  3R66 A;  3FAV A;  1B04 A;  3JSL A;  3NR7 A;  2EZO A;  2JEU A;  1RSO A;  1COW G;  5C93 A;  3OMN B;  1PNM A;  4KP4 A;  3W7X A;  2FYU H;  5KAI Z;  1KU9 A;  3JAR A;  3MD0 A;  4O4J B;  5IJ0 B;  2EIJ C;  2R9I A;  1Q82 W;  4U7N A;  2ARH A;  1Q90 D;  2ODM A;  2BTQ B;  5IY5 B;  1QBZ A;  3ML0 A;  1N34 B;  4FZ0 A;  1BS3 A;  3RYH A;  3F7Y C;  1KP3 A;  2ZR2 A;  4BIU A;  1XI1 A;  2CH7 B;  4TQD A;  4Q6G A;  2E76 B;  3CCQ V;  2HHH O;  4PA9 A;  5F2V O;  4JYA B;  4MVZ A;  2IJI A;  3G80 A;  4JTA B;  3JAM N;  4RQF A;  1TA8 A;  1IBL O;  4R8C A;  1DTO A;  4DR1 B;  1NR1 A;  1XDC A;  2Q7E A;  1VQ8 V;  1YI2 V;  1MG1 A;  1YIJ V;  2OCC C;  1XHZ A;  4AQY O;  3D3I A;  4LNU A;  1ZLZ A;  3RYI B;  1NVP D;  3OW2 U;  4DYL A;  4O4H B;  3L72 H;  3ETD A;  3JAS A;  4D7S A;  3UT5 A;  2LFR A;  4DUZ B;  2UXB O;  4ZKI A;  3TXQ A;  4HAM A;  1D2D A;  2PGG A;  2Q9L A;  4MVO A;  3LSQ A;  3EXA A;  2QM4 A;  2QKA A;  2YXY A;  2RNB A;  3ZHV A;  5D5Q A;  2E5L B;  1BGY H;  2ETN A;  4UVB A;  1YTF D;  4O4J A;  4WCE V;  1WA8 A;  1V54 B;  4PDV A;  1OCO C;  2UXC B;  1ZWI C;  2XT9 A;  1IBM O;  4LR3 A;  3OT7 A;  2BTQ A;  2CE4 A;  1NI8 A;  3OMI B;  1GH6 A;  3N2G B;  3WFV A;  3T1H B;  3TJT A;  3CCU V;  3OAA G;  3D36 A;  3ZS8 C;  1HW7 A;  2CH7 A;  3JD2 A;  1FFT B;  2M6Y A;  5ITZ B;  1JFF B;  2Q68 A;  1BL8 A;  3APO A;  1HR0 B;  2PF4 E;  3ABL B;  5H5N A;  1B06 A;  4KHP B;  2DW4 A;  2GDS A;  2F1M A;  1V9P A;  1S5L Z;  5L3B A;  3SJC C;  3WG7 C;  4JTC B;  3ABT A;  3CEI A;  1XNR B;  2NNU A;  3SYC A;  1CP9 A;  4PA7 A;  4GKK B;  2LQT A;  1V55 B;  1KKD A;  1G1X B;  1SA0 B;  5EBL C;  1GKF A;  2LO1 A;  4O4H A;  5EZY B;  4DR4 B;  4K3A A;  1ZX3 A;  2Z5U A;  1HNW O;  1I08 A;  2CAZ C;  3VBB A;  4JI7 B;  2P4V A;  3L9D A;  4J7Z A;  4FM2 A;  1B6Q A;  1J5E B;  3JSN A;  1CEZ A;  5JJJ B;  5GTI Z;  4RWU A;  4DR2 B;  3QO7 A;  1XQ8 A;  4E4E A;  1FFX B;  2XHB A;  4X64 O;  2DWD C;  1KKC A;  1NU1 H;  4GUN A;  1M57 C;  1OCR B;  2XUM A;  3N2G A;  2QWN B;  3E86 A;  4JZ2 A;  4J41 A;  1R3L C;  5ITZ A;  1JFF A;  1IZ3 A;  1WPB A;  2ZDI C;  2ZE7 A;  4X1K A;  2R72 A;  1GM7 A;  1E1Q G;  5JWP A;  3T4D A;  4L87 A;  4R50 A;  2YSU B;  2IJJ A;  4J11 A;  3U0Z A;  3ZMU A;  5LXT B;  4DV0 B;  3T1Y B;  2ZKO A;  1FPO A;  3B8M A;  2X6A A;  1AJN A;  4JYY A;  5B1A B;  3BVO A;  1NR7 A;  2EIL B;  4CS4 A;  2UXX A;  4CH4 A;  2GSM B;  3N27 A;  1P7G A;  5EZY A;  3WB0 A;  1O9H A;  3DC5 A;  3E8H A;  5H9C A;  1HDJ A;  3UO2 A;  2VQF B;  1GTO A;  1SER A;  5LHG A;  2K9P A;  3RWR D;  3FB6 C;  1BHA A;  3DC6 A;  1YDX A;  5JJE B;  1M4U A;  1Q6H A;  4FMT A;  3K5L A;  3K08 A;  5KHH A;  1IBK O;  3CC2 V;  2PI4 A;  1FFX A;  4P30 A;  3CCL V;  3CSX A;  3ZHS A;  3K5O A;  3IC9 A;  1ZL8 B;  1SZT A;  3WU2 Z;  1XRE A;  3OR7 C;  1NTZ H;  4OPA A;  5K1P A;  1WNS A;  5CA1 B;  2MW2 B;  1S5H C;  3SJQ C;  1KUQ A;  4JI6 B;  2D3O W;  4J42 A;  1DF4 A;  3KKY A;  3E8B A;  2HR3 A;  1Q8I A;  5EBW C;  3MHH C;  4JI5 B;  3DGE A;  4LF8 B;  1T5E A;  5CMU A;  4JI4 O;  1S77 D;  4LF5 O;  3ZHR A;  3W7U A;  1W0K G;  1KMI Z;  4OGQ B;  5LXT A;  3A0B Z;  1M90 W;  2VS0 A;  2OCH A;  4W4L A;  4DXW A;  2LJ2 A;  2FL4 A;  1FXK B;  3ASO C;  4MTG A;  2V7Q G;  3H1J H;  4MVM A;  4RQE A;  5LMU B;  2VQE B;  1GAX A;  2W0F C;  3E83 A;  3SPH A;  4H13 B;  4ASU G;  1RM1 C;  4I50 B;  1F4M A;  2IBZ H;  3FYI B;  4K35 A;  1KBH A;  2CTW A;  4MT8 A;  1PKX A;  2B5U A;  2ZCE A;  1MZE A;  2PI5 A;  4YJ3 B;  4NTW A;  2WLK A;  2H8P C;  3OTF A;  2EIK C;  2FML A;  2A7W A;  1ZL8 A;  5GON B;  3CB2 A;  1H2S B;  1ORQ C;  3HKC B;  1YZB A;  5CA1 A;  4HBN A;  5LA6 B;  3AG2 B;  2CTP A;  3ZMV A;  1VF6 C;  5C8Y B;  4FLY A;  3K06 A;  4YY3 B;  1HNW B;  1N4C A;  1Q7Y W;  4FFK A;  4FLW A;  1VQO V;  2KQX A;  3AG1 B;  5JQG B;  3NXS A;  1N34 O;  4TWK A;  2X6C A;  3K79 A;  4JAA A;  1NQT A;  1TVK B;  1JMK C;  2Y4U A;  4BIO A;  4DV2 B;  1GO3 F;  4JYA O;  1N0N A;  2D2C B;  1OV9 A;  2PTM A;  3B09 A;  3LSS A;  1GK9 A;  1QNM A;  4DR1 O;  4DV1 B;  1FXK A;  4JGS A;  5LP6 C;  2XTA A;  4DO2 A;  4A5U B;  2P4K A;  2F43 G;  3CXH F;  1JQ0 A;  2AHY A;  5L3G A;  1N8R W;  3K9S A;  1VF5 B;  4AHC A;  3VQV A;  5JCO A;  4I50 A;  4OPH A;  4QJF B;  2RN9 A;  3I55 V;  1SES A;  4GT1 A;  1EZJ A;  3ABK B;  1BE3 H;  4YJ3 A;  1IX9 A;  1XHX A;  3ZRX A;  4DUZ O;  4C7U A;  1VQ5 V;  5B1N A;  4UCR A;  5H6Q A;  2OIE A;  2Q69 A;  2Y0P A;  3HKD B;  3EHB B;  2OYQ A;  1B3Q A;  2WA4 A;  3CCJ V;  4IGG A;  5GON A;  2Q7H A;  3C3S A;  4LBE C;  4FIP C;  2QEX V;  1QCE A;  2E5L O;  3HKC A;  5B1B C;  5J2U B;  1GM9 A;  4MW8 A;  3K5M A;  3BAA A;  5LA6 A;  1U97 A;  5C8Y A;  2XAQ A;  2UXC O;  3SPG A;  1M5I A;  3ZX6 A;  2A9H A;  4I9Q A;  1EN5 A;  1MNG A;  4GKJ B;  5JQG A;  1NKD A;  3AK2 A;  1SQG A;  1YVW A;  3T1H O;  2RMK B;  4LF4 B;  1TVK A;  4CC6 A;  5BY1 A;  1Y74 B;  3W7T A;  3AG4 C;  1LUV A;  3TET A;  1N36 B;  2JS3 A;  1VEW A;  1VQM V;  4FK5 C;  4G28 B;  3CCM V;  1SF9 A;  3SGI A;  3BA9 A;  5L3E A;  4KHP O;  2XND G;  1NTM H;  3ETE A;  3Q4H B;  2P22 C;  3K0D A;  2A0L A;  3E22 B;  4MTF A;  2DN9 A;  2FKX A;  3FYE B;  3GWO A;  4RAI A;  1XNR O;  4DR3 B;  2HG5 C;  4GKK O;  3CD6 V;  2Y69 C;  1NJI W;  3HKE B;  4QIW F;  4G2K A;  5B3S B;  1FD9 A;  3BY6 A;  4DR4 O;  2NLJ C;  2E75 B;  3ZED A;  1D5A A;  1THZ A;  4JI7 O;  1EN4 A;  2EIJ B;  1J5E O;  1ZTE A;  1MOF A;  4MVS A;  1LUW A;  5B66 Z;  5J2U A;  4DR2 O;  1NZ6 A;  2QJ1 A;  5J2T A;  1OHH G;  2DOS A;  5IYD O;  2YID A;  1Y6X A;  2AZ2 A;  2W6I G;  3IFX A;  1AIL A;  4FM1 A;  5HFL A;  2N05 A;  2WSS G;  1W0J G;  3SYA A;  1PPJ H;  4P2Z A;  3HKB B;  1RFY A;  2W6J G;  1Y74 A;  1H2K A;  2X6B A;  2XAS A;  2QWQ B;  1W2B U;  4JI3 B;  4UCV A;  1Q5O A;  4PHZ A;  3OGC C;  3HR0 A;  1YSC A;  4PEL A;  4NVP A;  3Q4H A;  4LF7 B;  1VF7 A;  1JA8 A;  1URF A;  3E22 A;  4K0K O;  3K0G A;  4DV0 O;  3ZHQ A;  3T1Y O;  1GN6 A;  1WA8 B;  1MA1 A;  1AR1 B;  1BT8 A;  3HKE A;  3G4S V;  4RUE A;  2WLH A;  3ZRW B;  3ZMS A;  1WB8 A;  3CCS V;  3LNN A;  2FB5 A;  1LR1 A;  2VQF O;  3PN1 A;  5FLX N;  3G6B A;  2ITD C;  1RPO A;  2WA3 A;  5L3C A;  2GHY A;  2P5O A;  2A3Q A;  1R3J C;  2ZNI A;  2ZD9 A;  3IGA C;  2JK5 C;  4FLU A;  2AGA A;  1AJP A;  2QWR B;  1SQF A;  2ZT9 B;  3GB7 C;  4DRX B;  1JCH A;  1U96 A;  1S5J A;  2Q8V A;  3FD9 A;  3LNM B;  4BW5 A;  1IXM A;  3THO A;  2IJK A;  3ASN B;  1JR9 A;  2CTR A;  1ZSP A;  2BSK B;  2CDY A;  5CA3 A;  3HKB A;  4I55 B;  5KHG A;  2DWE C;  4DR7 B;  2DJV A;  5H6R A;  3I5D A;  4JI6 O;  4FLZ A;  2ILM A;  3FKS G;  1Z5W A;  5IYB O;  3ZIA G;  3WG7 B;  1I94 B;  4GZR B;  4LWS B;  3OFN G;  4JI5 O;  1MMM A;  4LF8 O;  1RPR A;  1GRJ A;  3JCZ A;  3CMA V;  3SJB C;  4I5S A;  3CCR V;  1MSW D;  3H1L H;  2WLJ A;  4JYB A;  1K4D C;  2JRI A;  4PA6 A;  3ZRS A;  2QA4 V;  3AEI A;  3JAL B;  3ZRW A;  3CWB H;  1AP5 A;  5CN0 A;  2V1D A;  4IIJ B;  4KXR A;  3D36 C;  5LMU O;  2VQE O;  1Q43 A;  1OCC B;  1AVM A;  1N33 B;  2DYR C;  1EM1 A;  2ZM6 B;  3FX7 A;  4MTX A;  4X1K B;  4F6R B;  3CRR A;  1CPY A;  3X2Q B;  4N23 A;  2ZQM A;  2DYS C;  4TUY B;  5KUM A;  3G67 A;  3QO5 A;  4DRX A;  4GCZ A;  4NXN O;  1OCZ C;  5KA5 A;  4KL1 A;  1QLE B;  1M56 B;  1S76 D;  2BSK A;  4D7T A;  1X59 A;  1Q6I A;  4I55 A;  1Y67 A;  4DR5 B;  4W4K A;  4O4I B;  1I5X A;  4GLX A;  4YY3 O;  2QSA A;  4X1I B;  3M7M X;  4H33 A;  1K34 A;  4DW1 A;  2QDO A;  2F66 C;  4AI8 A;  2PUS A;  4LWS A;  4I0X B;  1SQP H;  5LYJ B;  3JAK A;  2V4D A;  5LGN A;  2Z0A A;  2PYJ A;  3ABM B;  4UVC A;  4DV2 O;  4X8A A;  2A79 B;  3F5W C;  1G4Y B;  1H2M A;  1QU7 A;  2HVJ C;  3EFF K;  2UU9 B;  1AI6 A;  1XL4 A;  2F4V O;  3JAL A;  3M8A A;  2RCV A;  4E2L A;  2HFE C;  3T4Z A;  4X1Y A;  4DV1 O;  2QKS A;  3HB3 B;  1AB3 A;  4IIJ A;  5IT9 N;  3WB1 A;  1K7D A;  2P7T C;  4YIO A;  1XMQ B;  3ABL C;  3UO3 A;  3B4S A;  1AI7 A;  3L75 H;  4LP8 A;  3KCX A;  4ZOL B;  3ZN0 A;  2R9R B;  4F6R A;  5LHH A;  4HZ3 A;  4QE9 A;  1PL4 A;  5FL7 G;  2EBO A;  4TUY A;  4K0K B;  2VRZ A;  1AI5 A;  3B8N A;  4TT3 G;  3OEE G;  1V55 C;  1SRY A;  4IYH A;  4JAS A;  5CBG A;  4MVQ A;  3P3N A;  4GX5 A;  2ZDI A;  5LGU A;  4DK1 A;  4NR1 A;  2YS8 A;  4JTD B;  4L8J A;  1HP8 A;  3K58 A;  1JVM A;  4O4I A;  1FXH A;  4P9P A;  4X1I A;  3ICX A;  2LW1 A;  3RYF B;  5IJ9 B;  5EYP B;  1SZX A;  4GKJ O;  2F23 A;  1JOY A;  4I0X A;  1SQQ H;  2DE0 X;  5LYJ A;  1L8D A;  1KC8 W;  1UJW B;  4LF4 O;  3KG2 A;  4PI2 A;  4LF6 B;  2KB1 A;  2ADP A;  1KB9 F;  2WLN A;  3ASO B;  1N36 O;  3B2E E;  3JD1 A;  2ZE5 A;  2EUL A;  3L70 H;  4IHJ B;  4X62 B;  1J95 A;  2EJ7 A;  2HVK C;  1YEW A;  1WB7 A;  1RM1 B;  2GTA A;  2IH3 C;  2GTS A;  4DR3 O;  5CA0 B;  4QE7 A;  2MK3 A;  2FTK A;  1QHT A;  3JD3 A;  4J7K A;  2ZIO A;  4ZOL A;  4LFC B;  3DTU B;  5EC2 C;  2M7W A;  2JJ2 G;  1VAR A;  5B5E Z;  3K5N A;  3TCU A;  2EIK B;  2K1E A;  3BFR A;  2HKO A;  5LOV A;  2GV9 A;  2YUA A;  3CRC A;  5KX5 B;  1QVG U;  5LBQ A;  5LMN B;  5CB4 B;  4F6E A;  1G6U A;  1YXB A;  3E8G A;  3CJH B;  4JI0 B;  2O57 A;  1VQN V;  2UUA B;  3TK1 A;  5B1A C;  2EIL C;  1TUB B;  4WFH A;  1K8A W;  3CRM A;  3FB5 C;  1XNQ B;  1DGS A;  3AG7 A;  2JGD B;  3G71 V;  1VQ7 V;  2WAM A;  1GN3 A;  3QO8 A;  1GN2 A;  3OM3 B;  3RYF A;  2GUZ B;  4B7E A;  5IJ9 A;  1FXV A;  3CRA A;  4JI8 B;  4I7Z B;  5L3D A;  2QWP B;  2YEV A;  5EYP A;  3E2E A;  3KCY A;  5EK0 A;  4FVM A;  3E35 A;  2C2A A;  1M9N A;  1H8H G;  4DV5 B;  4JI3 O;  5JVD A;  2XAH A;  4B3M O;  1YJW V;  2ZXW B;  3OUS A;  3RN4 A;  4IHJ A;  2AW9 A;  2P67 A;  4NXN B;  4UCO A;  4TV9 B;  4WFG A;  1ARO P;  4LF7 O;  4B3R O;  1Y76 B;  3BRC A;  5DEC A;  1R6N A;  2OWO A;  3LUT B;  5LGT A;  5CA0 A;  1L1F A;  2RQ6 A;  1L0N H;  3RVY A;  4I9W A;  4ABM A;  5KX5 A;  2EX3 A;  2KKW A;  4MW3 A;  2EIM B;  4UFZ A;  5CB4 A;  4X66 B;  3OGI B;  4MVR A;  5B1B B;  2WLI B;  1S3J A;  3HPL C;  3IAY A;  1KD1 W;  4PA4 A;  4UB8 Z;  1VF6 A;  3CJH A;  4R7C A;  2B1I A;  4BR6 A;  1FYJ A;  4LF9 B;  2Z3Y A;  2CTQ A;  2F4V B;  1FXK C;  4HNA B;  1TUB A;  4AIL C;  1GM8 A;  3TGU H;  3BA8 A;  2JGD A;  4X20 B;  3LDC A;  2GUZ A;  3AG4 B;  3LDE A;  5AG2 A;  5JCO C;  2BOB C;  4DV3 O;  3ABU A;  1Q86 W;  4DV7 O;  5EIB C;  1NBM G;  3T1C A;  4DR7 O;  3BPZ A;  1K73 W;  4UV9 A;  5E79 Z;  2PY5 A;  1A32 A;  1VIB A;  1HNX B;  4DR6 B;  5E1A C;  2OTL V;  4IT5 A;  1I94 O;  2EIN B;  2Q7G A;  4TV9 A;  5TIS Z;  3K04 A;  3L74 H;  4RUF A;  1JJ2 U;  1Y76 A;  4LCU C;  3AG2 C;  4DK0 A;  1K33 A;  3CE2 A;  2QM7 A;  5J2T B;  4KFM A;  2ZE8 A;  3AG1 C;  4X88 A;  3CRQ A;  1WP8 A;  4NXM O;  3N2K B;  5IYZ B;  2ZE6 A;  1VQ6 V;  3AG3 C;  4BWA A;  1QR8 A;  4DUY B;  2WLI A;  1N33 O;  2Q6A A;  1JJO A;  3M99 B;  2XAF A;  4U3F H;  3A2F A;  2ZM6 O;  4J80 A;  2H3O A;  3S3X A;  4LFA B;  1EBO A;  1IDS A;  1Q3E A;  3LSU A;  4HNA A;  4KUM A;  4H44 B;  4X20 A;  5KUK A;  1CXZ B;  3ZJZ A;  1H2L A;  2L35 A;  2W0X A;  4Z1V A;  4J9Z B;  2PZS A;  2ZNJ A;  1AR4 A;  4EEQ A;  2X7R B;  4LH6 A;  4ZIB A;  4CBC A;  2RJZ A;  3LDD A;  3ABK C;  1VQP V;  3GWK C;  4NTX A;  2EZP A;  4DR5 O;  1VQ4 V;  4O2B B;  4PJ0 Z;  5GW7 A;  1HWY A;  3L73 H;  4WFB V;  2PYL A;  1ZUQ A;  4G27 B;  3IJ4 A;  3CCE V;  1XMO B;  4QPJ A;  1VMG A;  1WAZ A;  1XIL A;  3K59 A;  4B3T B;  5B1O A;  3C90 A;  1IXB A;  1BCC H;  4PD4 F;  4MS2 A;  2UUB B;  2UU9 O;  4MVU A;  2ATK C;  1KP2 A;  1MZF A;  4Z1M G;  3N2K A;  5IYZ A;  1NH2 B;  4TOI A;  3CP1 A;  3OUF A;  2Q67 A;  4JYC A;  2CGO A;  4LFB B;  1US6 A;  1YCI A;  1XMQ O;  4B3M B;  3J81 N;  5CBF A;  2IH1 C;  1ROP A;  2HJD A;  2OCC B;  4JI1 O;  3T2M A;  5FNV A;  4B3R B;  1L0L H;  5HFM A;  1R73 A;  1H2N A;  1N32 B;  2WPD G;  3JAW B;  3CXC U;  1P7B A;  1YHQ V;  3H1H H;  4JF3 A;  1DK1 A;  2L6L A;  3P3P A;  3ZCC A;  5B3S C;  2H94 A;  4BAY A;  2KSD A;  1YIT V;  4O2B A;  4EKW A;  3GVM A;  1SQX H;  1WPX A;  2LFS A;  3CC4 V;  2HEP A;  4XDK A;  3CS5 A;  3E89 A;  3OTO B;  2F95 B;  1R6K A;  4CH3 A;  1LNQ A;  1P84 F;  1OCO B;  1H8E G;  4LF6 O;  5KHJ A;  4X65 B;  1NS1 A;  2AHZ A;  2IU3 A;  4X89 A;  4EFB A;  2UUC B;  3CHX A;  3U10 A;  1EN6 A;  3QG5 A;  1KYO F;  4X62 O;  5IDJ A;  1SET A;  2DYR B;  1TAE A;  3C3T A;  3VOU A;  4FZ1 A;  4DV3 B;  4DV7 B;  1WJZ A;  4PI0 A;  2YXH A;  3UKM A;  2BTO A;  4LH7 A;  2YI8 A;  5A9G A;  2OTJ V;  2Q4P A;  5BZB A;  4LFC O;  3K3W A;  2DYS B;  1BMF G;  5IWA B;  4LC1 A;  2QKC A;  4H37 A;  4CZZ A;  1OCZ B;  2JIZ G;  3JAK B;  1K5Q A;  5LMN O;  4X9Q A;  2LP7 A;  1O9G A;  1BQ0 A;  3FB8 C;  4JAV A;  5IE9 A;  3ZRV A;  4YXW G;  4TV8 B;  2NR5 A;  2LGW A;  3JAW A;  3UM7 A;  4JI0 O;  3G6E V;  2F93 B;  2QTO A;  2UUA O;  4JI2 O;  5K1X A;  1JPX A;  1TUE B;  1NH2 D;  2DMX A;  4NXM B;  1XL6 A;  4O4L B;  5IY5 C;  4X1Y B;  1XNQ O;  2IJH A;  3DSQ A;  5EBM C;  3K9A A;  4B3S B;  1R6T A;  3BAB A;  3O9O A;  2WLL B;  3VQX A;  3B40 A;  3RFR A;  5IJ0 A;  4JI8 O;  1R3K C;  3SDL A;  4WF9 V;  5BR8 B;  2N04 A;  1YJN V;  1RP3 B;  3RGB A;  4PV1 B;  4PDL A;  4H0L B;  1KQS U;  4PDM A;  5KA6 A;  4DV5 O;  5H2F Z;  2CK3 G;  1M57 B;  4UV8 A;  4F4L A;  3ZHT A;  4JPR A;  5KHK A;  1P4R A;  3OR6 C;  1G8M A;  5JJN B;  2Y4T A;  3ASN C;  5DED A;  2AZ0 A;  3H9V A;  4OX9 B;  3OE7 G;  4WBN B;  2XAJ A;  4EB6 B;  4J9Y B;  4DV6 B;  2Y0I A;  5CBH A;  1HNZ B;  3JCU Z;  1XBL A;  1F23 A;  4FFB B;  4J10 A;  2OT5 A;  1R1B A;  3CYO A;  4U3J B;  3RYI A;  5KAF Z;  4X66 O;  3BHP A;  1XEQ A;  4TV8 A;  1V54 C;  1N0J A;  3W7S A;  1I0H A;  4YHH B;  1XUQ A;  2UXD B;  4LF9 O;  2LGQ A;  1ENV A;  1K3E A;  3J80 N;  1UPG A;  2Q73 A;  2QGN A;  4O4L A;  4YIP A;  3MAQ A;  2E74 B;  1OCC C;  1QQC A;  2WLL A;  3MDS A;  4PDR A;  1BZK A;  5LHI A;  1PP9 H;  3B77 A;  1FJG B;  3SPI A;  1F4N A;  4DV4 B;  2NN4 A;  4HYO A;  4QPK A;  3P32 A;  3JAT B;  1Q81 W;  3X2Q C;  5LOV B;  2R70 A;  3UCS C;  1EFR G;  1HNX O;  2HJF C;  4DR6 O;  4JI1 B;  4EFE A;  2JDI G;  4I4T B;  5KMG B;  1QLE C;  1M56 C;  4NYK A;  2DQ0 A;  4CH5 A;  2N74 A;  1KEC A;  4GYC B;  2HP8 A;  1AI4 A;  5LL6 Y;  3VQW A;  4WBN A;  4EB6 A;  3IC7 A;  5BMV B;  4ZBM A;  4JAU A;  4TQF A;  3QTC A;  3EVK A;  4FFB A;  1PV0 A;  5J9P C;  4K8X A;  1Q6U A;  5BXZ A;  1PL0 A;  1OJH A;  1ZAU A;  2YEV B;  1VQL V;  1BSM A;  4U3J A;  2ITC C;  3ABM C;  1SA0 A;  3I56 V;  2BE3 A;  3DXR B;  3SPC A;  3CC7 V;  2YDE A;  4IYI A;  4DUY O;  3W7W A;  5JVD B;  1AP6 A;  2ADQ B;  4FPP A;  2P6J A;  2QTS A;  4ZI7 B;  1K92 A;  3KZI Z;  5GTH Z;  4LFA O;  1SQB H;  3MHS C;  2HHH B;  1OCR C; 
#chains in the Genus database with same CATH homology
 2BCC H;  1NTZ H;  3L73 H;  1SQP H;  2FYU H;  1L0L H;  1SQX H;  1PPJ H;  1SQQ H;  1BGY H;  2IBZ H;  4D6T H;  3H1K H;  3L74 H;  2A06 H;  1EZV H;  3L72 H;  1KB9 F;  1P84 F;  1PP9 H;  3H1H H;  3H1L H;  3L75 H;  4U3F H;  1BCC H;  1NTK H;  1SQV H;  4PD4 F;  3L71 H;  1BE3 H;  5KLV H;  3CX5 F;  1L0N H;  3H1J H;  3CWB H;  3H1I H;  1NU1 H;  1NTM H;  3BCC H;  3L70 H;  3TGU H;  1SQB H;  3CXH F;  1KYO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...