3CWBH

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cwbH00
1P84F 3L73H 1NTZH 3H1IH 3L75H 2BCCH 3L72H 4PD4F 1SQPH 3L70H 3CXHF 1L0NH 1NTMH 1SQQH 1L0LH 2A06H 3H1LH 3H1JH 2IBZH 1PP9H 4U3FH 4D6TH 1BE3H 1SQVH 1BCCH 1PPJH 3H1HH 3H1KH 3TGUH 1KYOF 1NTKH 1EZVH 5KLVH 3L71H 1SQBH 3CWBH 2FYUH 1KB9F 3CX5F 3BCCH 1NU1H 3L74H 1SQXH 1BGYH
chains in the Genus database with same CATH superfamily
1IBMB 4UCOA 1BMFG 2V1DA 1HP8A 5LHHA 5EBMC 1QHTA 2QGNA 1JQ0A 5IY5B 2A3QA 4H13B 1VF6A 2A0LA 3SYQA 3P3NA 3JALA 2JJ1G 5EK0A 3EFFK 3G67A 3K0DA 3O9OA 5IDJA 4YJ2A 4PA6A 2IJIA 1H2NA 4MTXA 1P7GA 3N2GB 2Q7HA 1X59A 1Y74A 3M8AA 4GKKB 4GLXA 4PV1B 4UUJC 4P9OA 2EIJC 3ASNB 5KHIA 3F5WC 5IJ0A 2XAJA 5LMNB 4K3AA 4O4IB 1KYOF 1OCRB 3OEEG 4LFCB 5B3SB 4DV7B 2QE7G 4IIJB 4LF8O 4DW0A 2AHZA 2ODMA 2QDOA 3L9DA 1NTZH 3BFRA 4OPAA 1XMOB 3VQWA 4RQEA 2E76B 1O9GA 1JJOA 2LW1A 4JV5O 3E2EA 3IJ4A 1FJGO 4FM1A 2B1IA 4JYAB 1M1KW 1XMQB 4YXWG 3IFXA 4ZI7A 4GYCB 1Q81W 5F2VO 4FFKA 4H0LB 2GUZA 3I55V 1K92A 4XDKA 1UFIA 4LF9O 3MAQA 1R3KC 3HB3B 1I5XA 3OTFA 1COWG 2HVJC 3K9AA 2QWQB 1E1QG 4O2AA 3R66A 2CK3G 4GX2A 3X2QB 1N34B 2DJVA 4DR6O 4DV1O 3QO5A 1M93A 4RUFA 3HKDB 3ZBHA 5JQGB 2EIKC 2DYRB 4ZOLB 3CJHA 4J9ZB 2WAMA 4OX9B 5FPOA 5DM6V 1ZSPA 2ZNIA 3CRCA 4LF8B 5CA0A 4JI6B 3AG3B 2QM8A 4CH6A 5ITZB 4TUYA 1L0NH 4GX0A 5LMUB 1Y4MA 4DV4O 1ZLZA 3K04A 1OCZC 5KX5A 4DYLA 4J42A 1VQOV 5KHHA 2ZD9A 2RN9A 2WLLA 2R9RB 3FB6C 1K34A 4CS3A 2ZDIA 1N32O 2BE3A 2EBOA 1WJZA 3G71V 1BZKA 4PDRA 2XAFA 5KAFZ 1NT2B 1VQ8V 1D5AA 1LR1A 1HNZB 1OCOC 4LR3A 1ZWIC 3IC9A 1F7YA 2IM9A 4H44B 2Z5UA 4UB6Z 3K3WA 5K1XA 5B1NA 2JRIA 2XAQA 1LUVA 1RSOA 2CTRA 1QR8A 3AG1B 4DR1B 3E83A 3ABLC 1YVWA 3I56V 4QNHB 1K7DA 1DGSA 3A2FA 1AJQA 1QCEA 4EFBA 3JD1A 4NTXA 2DQ0A 3A8TA 3OTOB 2IJJA 5BMVB 1TVKA 2JGDA 2A7WA 4X62O 2ZE6A 4MTFA 4Z1VA 3ICXA 1OCZB 1D2DA 2JEUA 3KG2A 5JVDB 1TUEB 3ZRWB 4DV0B 4J11A 2QWPB 2UU9O 3HR0A 3JAKA 2QTSA 4ICGA 5D5QA 5J2UA 1JFFA 2UUBB 1VF6C 2ZM6B 2YEVA 1K4DC 4FLUA 2VWKA 1QU7A 2H8PC 4JI0O 4J80A 2EULA 2AW9A 2Y69C 1EN4A 4NXMB 5EZYA 1QLNA 4AILC 1SA0A 2A79B 3PN1A 5BY1A 1XNRO 4GCZA 4J41A 3RYCB 2VQEO 1AI7A 3FAVA 3QVNA 4F6RA 4U3JB 4A5UB 3ABLB 4FLTA 2YS8A 2ZT9B 2A06H 4D7SA 1QR9A 5IYDO 4MVMA 2PGGA 1GN6A 1YF2A 2L35A 5LA6A 2Y69B 5JCOA 3ZHQA 5IWAB 4X1KB 3CCJV 1QBZA 3JARA 4LF7O 4UV9A 2BSKA 2P7TC 4WFEA 4X8AA 3K5MA 3KCXA 1GM8A 1YTFB 3OR7C 1P4RA 4ZBMA 1AI4A 1PL4A 4JI5B 1EBOA 4U3FH 3CCVV 1QLEC 3EXAA 4IHJB 3VQVA 3TGUH 3B8NA 3JD3A 2ITCC 2JGUA 4KFMA 2ARHA 2UUBO 1HDJA 1RPOA 1KMIZ 3ZX6A 1MABG 2Q8VA 1JA8A 5CA1A 4EEQA 4MVRA 3JD2A 5E1AC 2UXDO 1H2GA 2HLDG 3WU2Z 3DSQA 4DK0A 4UVAA 4NVPA 2DYRC 4OXSA 1IBLB 4DR4O 1XNRB 4ZIBA 1M56B 3DC6A 2F66C 5JJNB 1GN4A 5IJ9B 2JJ2G 1ZX3A 3T1YO 5CB4B 1SZXA 1NQTA 1GAXA 1WA8B 2DMXA 4FLVA 1WPBA 4WBNA 1G6UA 2IBZH 1YSCA 2JIZG 5H5NA 2QM4A 2RCVA 1SQGA 3TXSA 1M9NA 5JJEB 4LBEC 4TQDA 5IYZB 4TQFA 1DLBA 4MTOA 3K08A 3S3XA 4I55B 3ZMSA 1SKVA 3AG3C 2ETNA 4LCUC 1U97A 2HKOA 3LNNA 4LC1A 2FL4A 4JAVA 4LF6B 1SQVH 4DR3O 1CXZB 4DV7O 3SJQC 1F4MA 1IVSA 1BHBA 1IDSA 1ORQC 3W7TA 1Q6UA 1IXBA 3D3QA 1NU1H 2UUAB 4DR7B 1N4CA 1JJ2U 1DTOA 3SYCA 1VARA 2HEPA 5JH7A 4NKGB 3Q4HA 1KP3A 2CGNA 3OUFA 4DUZB 4DV2O 2UXXA 4B3MO 1BCCH 2UUCO 4PA4A 2YSUB 4LF4O 4UCRA 1XMQO 4OGQB 2WLNA 2QKAA 1JVMA 2FYUH 2AZ0A 1H2KA 4JI1B 1R6NA 1I94B 4JYCA 5LXTA 1T5EA 3SPCA 2MW2B 2PI5A 4PD4F 2ADPA 3I5DA 4LF9B 3K79A 2UUCB 3DXRB 3TETA 3D3IA 4XDJA 4B08A 5LMNO 1HNXB 4K0KB 1FJGB 2PYJA 1ENVA 1GRJA 2EILC 3RYHB 3BCCH 2LFSA 3K9SA 2L6LA 4LWSB 1YTFD 1P84F 3JCZA 4JI7B 1HW7A 3N2GA 1N34O 3OAAG 1EN6A 4RO2A 2R72A 4QJFB 3CE2A 2OCCB 3ZHRA 3H1KH 4JYBA 1TA8A 4OPHA 2UUAO 4GKJO 4HNAB 5EIBD 4GX1A 3ZRVA 3U11A 1Z2GA 4B3SO 1WPXA 3T1HB 3JATB 3RN4A 3CPWU 3KZIZ 2Y0PA 1IBKB 1H8EG 1FXHA 1NTKH 4GX5A 4CBCA 1SQBH 5CBGA 4P2ZA 2QJ1A 2WPDG 2AZ2A 3K03A 2CDYA 5JCOC 2EINB 4O2BA 1WP7A 3TXQA 4ZI7B 1I94O 4K35A 1HNZO 2NR5A 2RDCA 4I50A 2IU3A 5EC1C 1KP2A 3THOA 4Q6GA 3E8BA 3OR6C 3DC5A 1D5NA 1N0JA 4G27B 2B5UA 4QE9A 4PDMA 4KHPO 3BABA 2Q5ZA 4X1YB 5EYPB 2F95B 4J7JA 1ZUQA 1K5QA 1E1RG 3B4SA 4IYIA 2F23A 4O4HA 1IX9A 4I0XB 1KUQA 1JR9A 1NZ6A 3CC4V 1B04A 2ZCEA 1TUBA 1BS3A 1M56C 1VQMV 1OV9A 4NTWA 1WP8A 2YC0A 1PNMA 4ZOLA 3B8MA 4LFBO 2AGAA 4J7KA 1MZFA 3HKBB 4FJCC 1CP9A 2PZSA 1R6TA 1Y76B 3LSQA 1K97A 2DW4A 3OGCC 3HKEA 3RYFA 1E79G 5ITZA 3F7YC 2UU9B 3S3WA 2LQTA 4R7CA 4I5SA 3CCUV 3ZIAG 2C2AA 2N04A 5LYJB 4PA7A 4DRXB 3UT5B 1G1XB 2QSAA 2HHHB 4IGGA 1MG1A 3TCUA 1JCHA 2ZQMA 4UCVA 4FFBA 4RWUA 2ATKC 2X6BA 1J5EB 4BR6A 4GUNA 2F43G 4U7OA 3MHHC 2DN9A 1OCCB 4JI3B 2BTQB 4Z2WA 2H3OA 3HPLC 1L8DA 3T4DA 5LL6Y 1H38A 1PM9A 3H1IH 1NVPD 3BVOA 1S0VA 4UFZA 3G6BA 3NR7A 1ZAUA 3A0RA 4DV5B 1RSOB 1PPJH 3LUTB 4NXMO 4DV0O 1XL6A 4QPKA 1YJNV 4FMTA 3DGEA 5J2TB 5KLVH 1TAEA 1ZL8A 1KKDA 1FXKA 3C3TA 4DUYO 4E4EA 4YHHO 4DV6B 3W7XA 3CCLV 4YY3B 4LFAB 2FB5A 4AHCA 5LOVB 2JGDB 3JCUZ 3ZMTA 4QGPA 1M4UA 1QVGU 1MSDA 4MVSA 4X20A 1BE3H 3ZRWA 1KU9A 3GVMA 4PI2A 3JAKB 1N36B 2WA3A 1Q5OA 2EX3A 2ZIMA 3T1CA 2OT5A 4I7ZB 2WLMA 4I4TA 2WLKA 2VQEB 1YHQV 1SZTA 2HHHO 2R9AA 4PJ0Z 1R6KA 4EB6B 1PP9H 3EVKA 4RQFA 4X1IB 2NN4A 3RWRD 3JYCA 1YIJV 1V55B 4ABMA 2OIGA 5LP6A 1SA0B 3JAWA 4CH5A 5KUKA 2HJFC 3RYIA 2QTOA 2Z3YA 5C8YA 2OTJV 3MD0A 1B06A 3SYPA 2CH7B 5GTIZ 5FNVB 3E86A 2UXDB 4PDVA 1EZJA 2X7RB 1JPXA 2ZR2A 3JSNA 2WLIB 3JD4A 5KMGA 3N2KA 2KG7B 3CRMA 3L73H 2ZNJA 3CCQV 3JARB 4NXNO 3OMNB 4WFBV 2BSKB 4FZ1A 4N23A 1VQ9V 1AP5A 3B77A 1I7FA 1A32A 4LF6O 2OTLV 3CP1A 4JTDB 1I5YA 1M57C 2EIJB 2YICA 1N36O 1O9HA 2E75B 4R50A 1N32B 4MSWC 4DO2A 3OMIB 4DXWA 1PKXA 3EHBB 3JSLA 2M7WA 1SRYA 4CS4A 3W7UA 2GSMB 4PA9A 3N27A 3ZN0A 4KUMA 4LNUB 4G2KA 4B3MB 4DR6B 2H94A 5H2FZ 3STLC 3JALB 2EIMC 2QR4A 3OFNG 1NH2D 3T2MA 5LGUA 3ABTA 4TWKA 1BHAA 3OGIB 1MOFA 2Q6AA 3ETDA 3L72H 1JOYA 3FB8C 5J9PC 2DWDC 5CB4A 2WA4A 4DR2O 1K3EA 3F5TA 4DV4B 4RUEA 3AG2B 1M5IA 2YIBA 5JWPA 5LBQA 5IJ0B 4PHZA 1HNXO 4B7EA 3CCRV 5A2QN 3BHPA 3E35A 1KBHA 4AI8A 1KKCA 1OJHA 4IIJA 4NR1A 1VQLV 3WFVA 5BXZA 3CMEV 3CC2V 4JI7O 1N33O 4E2LA 1SQQH 1VQ6V 1H2LA 4FK5C 2QM7A 3CCEV 1XEQA 2DQ3A 1B6QA 5JJJB 5LGTA 2JS5A 3ETGA 2PYLA 3E8FA 1NJIW 3UKMA 3T1HO 4JTAB 3ZMVA 4OX9O 2QKCA 4B3SB 3CHXA 4TV8B 3UO2A 1XQ8A 1VQ4V 2XNDG 3SPIA 4ZKIA 1VQKV 1K9MW 3K58A 1SS3A 2GV9A 1Q3EA 4CC5A 4DR1O 5IYCO 5JH7B 5L3DA 4FVMA 4P9PA 4UVBA 1I0HA 4BIOA 2P06A 4FIPC 2ILMA 3SR2C 1GN2A 4K8ZA 2ZE8A 4O2AB 2Y48A 1NR1A 2HFEC 2P4VA 3ETEA 2Q4PA 2E5LO 1AP6A 3ZJZA 3OW2U 2KQXA 4JI2O 1R3IC 1Z5WA 3G80A 1MMMA 4EKWA 4DR2B 3IC7A 4LF7B 2K1EA 2EJRA 4KHPB 2QWRB 1EFRG 3HKDA 3SJAC 1LNQA 1XREA 5KHGA 3WG7C 4X9QA 1PNKA 2Z0AA 3CCSV 1JMKC 1KC8W 1GM7A 3P32A 1N8RW 1YDXA 5CA0B 3UCSC 2YIDA 3K5OA 3RT3C 2Q7GA 3E22A 1V55C 1LUWA 2R9IA 4KP4A 1VIBA 1MNGA 4YJ3B 1P7BA 1VMGA 1UJWB 1VP7A 3AG7A 2E3CA 3K59A 2BOBC 4N21A 3H9VA 4WF9V 1BQ0A 1FFXB 1XL4A 3W7SA 3JATA 2UXBO 4NYKA 1WNSA 3ETQA 4FLZA 1HR0O 2RNBA 3IGAC 1KQSU 4FM2A 2EILB 3AG1C 4JZ2A 3ZCCA 1RPRA 4H37A 4O2BB 5GONA 4LFBB 1XOUA 1XDCA 4LFCO 1V9PA 4I50B 4JI2B 2Q0AA 5L3GA 4JI4B 4JGSA 5B1BB 4X65B 4QPJA 3D8CA 2NNUA 4DV3B 4X1YA 1TVKB 1S72V 5EYPA 1Y67A 4CH4A 1L0LH 3BA8A 3FYEB 4DV5O 2P22C 2LW7A 3CS5A 4X89A 4O4HB 1AILA 2GTAA 2QWNB 3CSXA 4X66B 2UXCO 3ABKC 3CB2A 4JAUA 4YHHB 5IY5C 1M57B 4UB8Z 1JFFB 4TT3G 1YITV 1PL0A 2PY5A 4J10A 3CD6V 1Y74B 1K33A 4DV3O 1RM1C 1SQXH 3D36A 3ASOB 4YY3O 3WB1A 2OIEA 4X88A 1VQ5V 1VF7A 3SPGA 1SESA 1ROPA 4O4IA 2VS0A 4RAIA 5EZYB 1VQNV 1AJPA 3HKEB 4UCSA 4L8JA 1K8AW 3A0BZ 2X0LA 1GN3A 2GDSA 4J9YB 1W59A 3K5NA 3B40A 2JK5C 4DV6O 3SYOA 4JF3A 4J7ZA 4X62B 4BIUA 3R65A 5B5EZ 3FB5C 4G28B 5LA6B 2B9ZA 2BTQA 2ADQB 2GBOA 1W0JG 3ZN1A 1SERA 4X1KA 3AEIA 3RBZA 3FKSG 2XAHA 3X2QC 5CMUA 2W0FC 3T1YB 4O4LB 2P90A 2XAGA 1MA1A 4FM0A 5B1AB 2Y4TA 2XHBA 1NKDA 2IU0A 4B3RO 3E8HA 3VOUA 1YCIA 4IHJA 2XUMA 1HWYA 1FXKB 5GW7A 4JI1O 3OM3B 4HAMA 4XBFA 1YJ9V 1AI5A 1G4YB 1N0NA 5LHIA 2DYSB 1BQZA 2PTMA 1VF5B 3H1LH 5CA1B 3BEHA 2AHYA 4DUZO 4DV2B 3BY6A 3HKCA 5C93A 5JQGA 1J95A 4DR5B 1IBLO 4DR4B 2YXYA 4BIZA 2HP8A 3WG7B 1R73A 3QO8A 5B1AC 3L74H 1GK9A 2CAZC 2IH1C 5FL7G 4TUYB 4DK1A 1FS0G 4K8XA 1XILA 1Q7YW 4GKKO 1IURA 4TV9A 3JASA 1K73W 1FYJA 1V54C 4DR7O 3GWKC 1NH2B 2OWOA 5KX5B 3M7MX 4WBNB 2PUSA 2DWEC 3H1HH 1XNQO 2CTWA 5KA6A 4X64O 5BR8O 1GO3F 5B1BC 2F4VO 4GKJB 1MZEA 1M90W 2Q67A 2LO1A 3F7VC 3RYIB 3RVYA 4FZ0A 1Q82W 4O4JB 2Q73A 4UCUA 5BZBA 5L3CA 2HJDA 3OE7G 5BR8B 2RMKB 2CH7A 3ZS8C 2YIBD 4B3RB 4H33A 1WB7A 2OYQA 1VQ7V 3BAAA 1SF9A 2EJ7A 2WLIA 2ZE5A 5KMGB 2MK3A 1OZ0A 1N33B 3ZMZA 1NBMG 3O65A 5L3EA 1R3JC 1IBKO 1FD9A 1AB3A 5TISZ 2YXHA 2V7QG 3UO3A 1Y66A 2O57A 1G8MA 2VWJA 3CCMV 3STZC 1Q6HA 5HFMA 2RJZA 5JVDA 5EBLC 4D7TA 2DOSA 1XMOO 5J2UB 3H1JH 1AJNA 4BAYA 2YEVB 5DEDA 4LNUA 4K0KO 4L87A 4MTGA 3KKYA 4HBNA 2ZXWB 1KB9F 1DF4A 3RYHA 2PI4A 3MHSC 4LWSA 1WN7A 4TOIA 1SQPH 1PD3A 3ZRSA 4B3TB 2EINC 3SJCC 3LDEA 1YZBA 5HFLA 3B2EE 1GH6A 4FPPA 3OTOO 2HR3A 3WB0A 3ZRXA 3CRQA 3K06A 4ZHQB 2IH3C 3SYAA 4MW8A 4P30A 1W2BU 4DW1A 2UXNA 3CC7V 4HNAA 5A9GA 2P6JA 4IL6Z 5K1PA 1I08A 4JI8O 1BSMA 3AG2C 5B66Z 2GTSA 5EC2C 4CH3A 4TSFG 2W6IG 3W7WA 1KD1W 3L75H 5FLXN 3RW0A 1DK1A 1S76D 1AR5A 2JVDA 2P67A 3RVZA 1L1FA 4KXRA 5KA5A 1GM9A 2NLJC 4PI0A 5KUMA 3CYOA 2R70A 5FPRA 5B3SC 5L3BA 1QNMA 2VQFO 4MVZA 5GTHZ 4UVCA 2EZOA 3FB7C 2HVKC 4WFGA 4I9WA 4JASA 4DR3B 1NI8A 3ASNC 1FPOA 4YJ2B 3ZHUA 3K57A 4B3TO 1FKAO 4LF5O 2JDIG 5IJ9A 4NXNB 4R6ZA 3SPHA 1TUBB 2IW5A 2IJKA 2N05A 1WA8A 4JYYA 1Q43A 3OEHG 1BL8A 2LFRA 3ZMUA 1YI2V 2JS3A 3CXHF 4LF4B 2XT9A 2PF4E 4HYOA 3LSSA 2X6AA 1WLEA 2CUGA 3JD0A 1EZVH 2P4KA 3ABMC 2KKWA 1XI1A 5LYJA 2Q0OC 3BA9A 4DRXA 3APOA 2F93B 4AQYO 4MVUA 5IE9A 1Z5VA 3FX7A 4FFBB 2QKSA 4WCEV 3ZEDA 2P5OA 1FXKC 2Q68A 2ITDC 2DE0X 1FFXA 2Q9LA 1CEZA 2Q7EA 2LGWA 3L71H 2GUZB 4AQYB 1Q90D 1EN5A 4C7UA 2ZDIC 5KAIZ 1FXVA 4MS2A 4JI5O 3CRAA 4XDLA 5H9CA 3TJTA 2M6YA 5AG2A 3G4SV 1XUQA 3VQYA 1ZL8B 2CTQA 4MVOA 2ZIOA 1EM1A 1KECA 3DTUB 4JZGA 1RFYA 1P49A 3CXCU 3WB2A 5EIBC 3DXRA 1NS1A 2W6JG 5LOVA 5LP6C 4DR5O 1H2MA 4LH7A 1Q86W 3CJHB 3APQA 2Y0IA 4ASUG 5DN6G 2D3OW 4WFHA 1J5EO 4X20B 1SQFA 2YUAA 2YDEA 3AG4C 1GKFA 2V4DA 1QVFU 1NVPB 2F1MA 3ABUA 5IWAO 3VQXA 2XASA 4U7NA 3VBBA 4IT5A 1OCOB 2W0XA 2K9PA 2Q69A 4JV5B 2GHYA 4EB6A 3ABKB 2VRZA 2WLLB 2BOCC 2A9HA 3JAWB 3ASOC 3ZHTA 1AR4A 1YXBA 2FTKA 1URFA 4BW9A 2ZXWC 1R1BA 4LFAO 1AROP 3OT7A 3G6EV 3QTCA 1XNQB 1THZA 1UPGA 3OMAB 1OHHG 1Y6XA 4GZRB 1AI6A 1U96A 4JPRA 3J81N 3B09A 5FNVA 3CRRA 4GT1A 2KSDA 3SGIA 1RM1B 1BGYH 1S3JA 5KHKA 2EIMB 3IAYA 3PJSK 4QE7A 4CZZA 3N2KB 3JAMN 1NR7A 3RGBA 4MVQA 2G38A 3UQ8A 3FYIB 1IZ3A 3AG4B 1XHXA 4YIOA 4D6TH 4DV1B 5EBWC 3FD9A 1XBLA 4O4LA 5E79Z 3ZHSA 3E8GA 3UM7A 3H01A 4BWAA 2ZKOA 1TGOA 5BMVA 3LDCA 3D36C 3ABMB 1ZTEA 4FLXA 2OCCC 3SPJA 1US6A 4X64B 1X4TA 1K5SA 2LJ2A 4I0XA 4WFAV 1OCRC 4JI6O 2EZPA 3NXSA 4MT8A 5CA3A 4WFFA 1HNWO 3HKCB 5D5PA 1S5HC 2YIAA 1XHZA 1VQPV 2QA4V 5CBHA 3CEIA 2IJHA 3HKBA 2F4VB 2BCCH 1Y76A 4CS2A 2HG5C 3RYFB 3FFQA 4FLWA 3L70H 3OD4A 4CC6A 2FKXA 4JI4O 1F4NA 2CGOA 2XTAA 3JASB 4TV9B 1QLEB 1Q6IA 3ZHVA 1JX9A 4X65O 4FLYA 1MSWD 4LP8A 3UT5A 4Z1MG 3RYCA 3SDLA 1OCCC 3BRCA 1RP3B 1W0KG 3FAVB 2YXLA 4BW5A 4F6RB 1S5JA 4U3JA 4JI0B 1IXMA 1B3QA 3QO7A 5B1OA 5DECA 4IYHA 2YI9A 4X66O 2UXCB 4W4LA 1CPYA 2ZE7A 2ZM6O 1K4CC 4Q20A 4YIPA 2UXBB 2LP7A 4EFEA 4B7KA 4O4JA 3QG5A 4KL1A 3TK1A 4HZ3A 1HR0B 4PA3A 3J7AU 4UV8A 2E74B 4UXNA 2CTPA 4MW3A 1H2SB 2YI8A 2OCHA 2RQ6A 3AK3A 1R3LC 2X6CA 4JI8B 4TV8A 1SC5B 3SJBC 5J2TA 5CBFA 4LH6A 3RFRA 1GMGA 2VQFB 1H8HG 1HNWB 1FAFA 3E89A 2QEXV 2FMLA 3QNEA 2ZR3A 5H6RA 3A0HZ 5L3FA 3P30A 4JAAA 3ML0A 1PNLA 1S77D 3K0GA 3J80N 1YJWV 5LMUO 3T4ZA 1SETA 1GTOA 2JEXA 3LSUA 4LF5B 2KB1A 3K5LA 4NB5A 3AK1A 4I4TB 1VEWA 5IYBO 3CWBH 4JTCB 1DF5A 2N74A 1IBMO 5KHJA 2D2CB 1YEWA 2ZINA 3AK2A 3BPZA 2BTOA 4X1IA 2DYSC 4W4KA 1AR1B 5LP6B 2QWOB 4R8CA 3M99B 2AXTZ 3E22B 2CE4A 3CMAV 5IYZA 1WAZA 1FFTB 3GWOA 4PELA 4I55A 2LGQA 4QIWF 4YJ3A 3GB7C 4ZHQA 3MDSA 4UCTA 5C8YB 3C3SA 4NTYA 3U10A 1NTMH 3OUSA 1S5LZ 3P3PA 1F51A 1V54B 4PDLA 1QQCA 2WLHA 2E5LB 4JI3O 1PV0A 1WB8A 3U0ZA 2EIKB 5CN0A 2WSSG 2KG7A 2XOKG 1BT8A 3LNMB 5LHGA 4I9QA 3QF7A 5IT9N 3Q4HB 4F4LA 4F6EA 4JYAO 5GONB 3KCYA 3C90A 5LGNA 1F23A 2WWWA 1Q8IA 4DUYB 3LDDA 1AVMA 2WLJA 5H6QA 5LXTB 2B1GA 2Y4UA 3CX5F
chains in the Genus database with same CATH topology
1P84F 3L73H 1NTZH 3H1IH 3L75H 2BCCH 3L72H 4PD4F 1SQPH 3L70H 3CXHF 1L0NH 1NTMH 1SQQH 1L0LH 2A06H 3H1LH 3H1JH 2IBZH 1PP9H 4U3FH 4D6TH 1BE3H 1SQVH 1BCCH 1PPJH 3H1HH 3H1KH 3TGUH 1KYOF 1NTKH 1EZVH 5KLVH 3L71H 1SQBH 3CWBH 2FYUH 1KB9F 3CX5F 3BCCH 1NU1H 3L74H 1SQXH 1BGYH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 F;  3L73 H;  1NTZ H;  3H1I H;  3L75 H;  2BCC H;  3L72 H;  4PD4 F;  1SQP H;  3L70 H;  3CXH F;  1L0N H;  1NTM H;  1SQQ H;  1L0L H;  2A06 H;  3H1L H;  3H1J H;  2IBZ H;  1PP9 H;  4U3F H;  4D6T H;  1BE3 H;  1SQV H;  1BCC H;  1PPJ H;  3H1H H;  3H1K H;  3TGU H;  1KYO F;  1NTK H;  1EZV H;  5KLV H;  3L71 H;  1SQB H;  3CWB H;  2FYU H;  1KB9 F;  3CX5 F;  3BCC H;  1NU1 H;  3L74 H;  1SQX H;  1BGY H; 
#chains in the Genus database with same CATH topology
 1IBM B;  4UCO A;  1BMF G;  2V1D A;  1HP8 A;  5LHH A;  5EBM C;  1QHT A;  2QGN A;  1JQ0 A;  5IY5 B;  2A3Q A;  4H13 B;  1VF6 A;  2A0L A;  3SYQ A;  3P3N A;  3JAL A;  2JJ1 G;  5EK0 A;  3EFF K;  3G67 A;  3K0D A;  3O9O A;  5IDJ A;  4YJ2 A;  4PA6 A;  2IJI A;  1H2N A;  4MTX A;  1P7G A;  3N2G B;  2Q7H A;  1X59 A;  1Y74 A;  3M8A A;  4GKK B;  4GLX A;  4PV1 B;  4UUJ C;  4P9O A;  2EIJ C;  3ASN B;  5KHI A;  3F5W C;  5IJ0 A;  2XAJ A;  5LMN B;  4K3A A;  4O4I B;  1KYO F;  1OCR B;  3OEE G;  4LFC B;  5B3S B;  4DV7 B;  2QE7 G;  4IIJ B;  4LF8 O;  4DW0 A;  2AHZ A;  2ODM A;  2QDO A;  3L9D A;  1NTZ H;  3BFR A;  4OPA A;  1XMO B;  3VQW A;  4RQE A;  2E76 B;  1O9G A;  1JJO A;  2LW1 A;  4JV5 O;  3E2E A;  3IJ4 A;  1FJG O;  4FM1 A;  2B1I A;  4JYA B;  1M1K W;  1XMQ B;  4YXW G;  3IFX A;  4ZI7 A;  4GYC B;  1Q81 W;  5F2V O;  4FFK A;  4H0L B;  2GUZ A;  3I55 V;  1K92 A;  4XDK A;  1UFI A;  4LF9 O;  3MAQ A;  1R3K C;  3HB3 B;  1I5X A;  3OTF A;  1COW G;  2HVJ C;  3K9A A;  2QWQ B;  1E1Q G;  4O2A A;  3R66 A;  2CK3 G;  4GX2 A;  3X2Q B;  1N34 B;  2DJV A;  4DR6 O;  4DV1 O;  3QO5 A;  1M93 A;  4RUF A;  3HKD B;  3ZBH A;  5JQG B;  2EIK C;  2DYR B;  4ZOL B;  3CJH A;  4J9Z B;  2WAM A;  4OX9 B;  5FPO A;  5DM6 V;  1ZSP A;  2ZNI A;  3CRC A;  4LF8 B;  5CA0 A;  4JI6 B;  3AG3 B;  2QM8 A;  4CH6 A;  5ITZ B;  4TUY A;  1L0N H;  4GX0 A;  5LMU B;  1Y4M A;  4DV4 O;  1ZLZ A;  3K04 A;  1OCZ C;  5KX5 A;  4DYL A;  4J42 A;  1VQO V;  5KHH A;  2ZD9 A;  2RN9 A;  2WLL A;  2R9R B;  3FB6 C;  1K34 A;  4CS3 A;  2ZDI A;  1N32 O;  2BE3 A;  2EBO A;  1WJZ A;  3G71 V;  1BZK A;  4PDR A;  2XAF A;  5KAF Z;  1NT2 B;  1VQ8 V;  1D5A A;  1LR1 A;  1HNZ B;  1OCO C;  4LR3 A;  1ZWI C;  3IC9 A;  1F7Y A;  2IM9 A;  4H44 B;  2Z5U A;  4UB6 Z;  3K3W A;  5K1X A;  5B1N A;  2JRI A;  2XAQ A;  1LUV A;  1RSO A;  2CTR A;  1QR8 A;  3AG1 B;  4DR1 B;  3E83 A;  3ABL C;  1YVW A;  3I56 V;  4QNH B;  1K7D A;  1DGS A;  3A2F A;  1AJQ A;  1QCE A;  4EFB A;  3JD1 A;  4NTX A;  2DQ0 A;  3A8T A;  3OTO B;  2IJJ A;  5BMV B;  1TVK A;  2JGD A;  2A7W A;  4X62 O;  2ZE6 A;  4MTF A;  4Z1V A;  3ICX A;  1OCZ B;  1D2D A;  2JEU A;  3KG2 A;  5JVD B;  1TUE B;  3ZRW B;  4DV0 B;  4J11 A;  2QWP B;  2UU9 O;  3HR0 A;  3JAK A;  2QTS A;  4ICG A;  5D5Q A;  5J2U A;  1JFF A;  2UUB B;  1VF6 C;  2ZM6 B;  2YEV A;  1K4D C;  4FLU A;  2VWK A;  1QU7 A;  2H8P C;  4JI0 O;  4J80 A;  2EUL A;  2AW9 A;  2Y69 C;  1EN4 A;  4NXM B;  5EZY A;  1QLN A;  4AIL C;  1SA0 A;  2A79 B;  3PN1 A;  5BY1 A;  1XNR O;  4GCZ A;  4J41 A;  3RYC B;  2VQE O;  1AI7 A;  3FAV A;  3QVN A;  4F6R A;  4U3J B;  4A5U B;  3ABL B;  4FLT A;  2YS8 A;  2ZT9 B;  2A06 H;  4D7S A;  1QR9 A;  5IYD O;  4MVM A;  2PGG A;  1GN6 A;  1YF2 A;  2L35 A;  5LA6 A;  2Y69 B;  5JCO A;  3ZHQ A;  5IWA B;  4X1K B;  3CCJ V;  1QBZ A;  3JAR A;  4LF7 O;  4UV9 A;  2BSK A;  2P7T C;  4WFE A;  4X8A A;  3K5M A;  3KCX A;  1GM8 A;  1YTF B;  3OR7 C;  1P4R A;  4ZBM A;  1AI4 A;  1PL4 A;  4JI5 B;  1EBO A;  4U3F H;  3CCV V;  1QLE C;  3EXA A;  4IHJ B;  3VQV A;  3TGU H;  3B8N A;  3JD3 A;  2ITC C;  2JGU A;  4KFM A;  2ARH A;  2UUB O;  1HDJ A;  1RPO A;  1KMI Z;  3ZX6 A;  1MAB G;  2Q8V A;  1JA8 A;  5CA1 A;  4EEQ A;  4MVR A;  3JD2 A;  5E1A C;  2UXD O;  1H2G A;  2HLD G;  3WU2 Z;  3DSQ A;  4DK0 A;  4UVA A;  4NVP A;  2DYR C;  4OXS A;  1IBL B;  4DR4 O;  1XNR B;  4ZIB A;  1M56 B;  3DC6 A;  2F66 C;  5JJN B;  1GN4 A;  5IJ9 B;  2JJ2 G;  1ZX3 A;  3T1Y O;  5CB4 B;  1SZX A;  1NQT A;  1GAX A;  1WA8 B;  2DMX A;  4FLV A;  1WPB A;  4WBN A;  1G6U A;  2IBZ H;  1YSC A;  2JIZ G;  5H5N A;  2QM4 A;  2RCV A;  1SQG A;  3TXS A;  1M9N A;  5JJE B;  4LBE C;  4TQD A;  5IYZ B;  4TQF A;  1DLB A;  4MTO A;  3K08 A;  3S3X A;  4I55 B;  3ZMS A;  1SKV A;  3AG3 C;  2ETN A;  4LCU C;  1U97 A;  2HKO A;  3LNN A;  4LC1 A;  2FL4 A;  4JAV A;  4LF6 B;  1SQV H;  4DR3 O;  1CXZ B;  4DV7 O;  3SJQ C;  1F4M A;  1IVS A;  1BHB A;  1IDS A;  1ORQ C;  3W7T A;  1Q6U A;  1IXB A;  3D3Q A;  1NU1 H;  2UUA B;  4DR7 B;  1N4C A;  1JJ2 U;  1DTO A;  3SYC A;  1VAR A;  2HEP A;  5JH7 A;  4NKG B;  3Q4H A;  1KP3 A;  2CGN A;  3OUF A;  4DUZ B;  4DV2 O;  2UXX A;  4B3M O;  1BCC H;  2UUC O;  4PA4 A;  2YSU B;  4LF4 O;  4UCR A;  1XMQ O;  4OGQ B;  2WLN A;  2QKA A;  1JVM A;  2FYU H;  2AZ0 A;  1H2K A;  4JI1 B;  1R6N A;  1I94 B;  4JYC A;  5LXT A;  1T5E A;  3SPC A;  2MW2 B;  2PI5 A;  4PD4 F;  2ADP A;  3I5D A;  4LF9 B;  3K79 A;  2UUC B;  3DXR B;  3TET A;  3D3I A;  4XDJ A;  4B08 A;  5LMN O;  1HNX B;  4K0K B;  1FJG B;  2PYJ A;  1ENV A;  1GRJ A;  2EIL C;  3RYH B;  3BCC H;  2LFS A;  3K9S A;  2L6L A;  4LWS B;  1YTF D;  1P84 F;  3JCZ A;  4JI7 B;  1HW7 A;  3N2G A;  1N34 O;  3OAA G;  1EN6 A;  4RO2 A;  2R72 A;  4QJF B;  3CE2 A;  2OCC B;  3ZHR A;  3H1K H;  4JYB A;  1TA8 A;  4OPH A;  2UUA O;  4GKJ O;  4HNA B;  5EIB D;  4GX1 A;  3ZRV A;  3U11 A;  1Z2G A;  4B3S O;  1WPX A;  3T1H B;  3JAT B;  3RN4 A;  3CPW U;  3KZI Z;  2Y0P A;  1IBK B;  1H8E G;  1FXH A;  1NTK H;  4GX5 A;  4CBC A;  1SQB H;  5CBG A;  4P2Z A;  2QJ1 A;  2WPD G;  2AZ2 A;  3K03 A;  2CDY A;  5JCO C;  2EIN B;  4O2B A;  1WP7 A;  3TXQ A;  4ZI7 B;  1I94 O;  4K35 A;  1HNZ O;  2NR5 A;  2RDC A;  4I50 A;  2IU3 A;  5EC1 C;  1KP2 A;  3THO A;  4Q6G A;  3E8B A;  3OR6 C;  3DC5 A;  1D5N A;  1N0J A;  4G27 B;  2B5U A;  4QE9 A;  4PDM A;  4KHP O;  3BAB A;  2Q5Z A;  4X1Y B;  5EYP B;  2F95 B;  4J7J A;  1ZUQ A;  1K5Q A;  1E1R G;  3B4S A;  4IYI A;  2F23 A;  4O4H A;  1IX9 A;  4I0X B;  1KUQ A;  1JR9 A;  1NZ6 A;  3CC4 V;  1B04 A;  2ZCE A;  1TUB A;  1BS3 A;  1M56 C;  1VQM V;  1OV9 A;  4NTW A;  1WP8 A;  2YC0 A;  1PNM A;  4ZOL A;  3B8M A;  4LFB O;  2AGA A;  4J7K A;  1MZF A;  3HKB B;  4FJC C;  1CP9 A;  2PZS A;  1R6T A;  1Y76 B;  3LSQ A;  1K97 A;  2DW4 A;  3OGC C;  3HKE A;  3RYF A;  1E79 G;  5ITZ A;  3F7Y C;  2UU9 B;  3S3W A;  2LQT A;  4R7C A;  4I5S A;  3CCU V;  3ZIA G;  2C2A A;  2N04 A;  5LYJ B;  4PA7 A;  4DRX B;  3UT5 B;  1G1X B;  2QSA A;  2HHH B;  4IGG A;  1MG1 A;  3TCU A;  1JCH A;  2ZQM A;  4UCV A;  4FFB A;  4RWU A;  2ATK C;  2X6B A;  1J5E B;  4BR6 A;  4GUN A;  2F43 G;  4U7O A;  3MHH C;  2DN9 A;  1OCC B;  4JI3 B;  2BTQ B;  4Z2W A;  2H3O A;  3HPL C;  1L8D A;  3T4D A;  5LL6 Y;  1H38 A;  1PM9 A;  3H1I H;  1NVP D;  3BVO A;  1S0V A;  4UFZ A;  3G6B A;  3NR7 A;  1ZAU A;  3A0R A;  4DV5 B;  1RSO B;  1PPJ H;  3LUT B;  4NXM O;  4DV0 O;  1XL6 A;  4QPK A;  1YJN V;  4FMT A;  3DGE A;  5J2T B;  5KLV H;  1TAE A;  1ZL8 A;  1KKD A;  1FXK A;  3C3T A;  4DUY O;  4E4E A;  4YHH O;  4DV6 B;  3W7X A;  3CCL V;  4YY3 B;  4LFA B;  2FB5 A;  4AHC A;  5LOV B;  2JGD B;  3JCU Z;  3ZMT A;  4QGP A;  1M4U A;  1QVG U;  1MSD A;  4MVS A;  4X20 A;  1BE3 H;  3ZRW A;  1KU9 A;  3GVM A;  4PI2 A;  3JAK B;  1N36 B;  2WA3 A;  1Q5O A;  2EX3 A;  2ZIM A;  3T1C A;  2OT5 A;  4I7Z B;  2WLM A;  4I4T A;  2WLK A;  2VQE B;  1YHQ V;  1SZT A;  2HHH O;  2R9A A;  4PJ0 Z;  1R6K A;  4EB6 B;  1PP9 H;  3EVK A;  4RQF A;  4X1I B;  2NN4 A;  3RWR D;  3JYC A;  1YIJ V;  1V55 B;  4ABM A;  2OIG A;  5LP6 A;  1SA0 B;  3JAW A;  4CH5 A;  5KUK A;  2HJF C;  3RYI A;  2QTO A;  2Z3Y A;  5C8Y A;  2OTJ V;  3MD0 A;  1B06 A;  3SYP A;  2CH7 B;  5GTI Z;  5FNV B;  3E86 A;  2UXD B;  4PDV A;  1EZJ A;  2X7R B;  1JPX A;  2ZR2 A;  3JSN A;  2WLI B;  3JD4 A;  5KMG A;  3N2K A;  2KG7 B;  3CRM A;  3L73 H;  2ZNJ A;  3CCQ V;  3JAR B;  4NXN O;  3OMN B;  4WFB V;  2BSK B;  4FZ1 A;  4N23 A;  1VQ9 V;  1AP5 A;  3B77 A;  1I7F A;  1A32 A;  4LF6 O;  2OTL V;  3CP1 A;  4JTD B;  1I5Y A;  1M57 C;  2EIJ B;  2YIC A;  1N36 O;  1O9H A;  2E75 B;  4R50 A;  1N32 B;  4MSW C;  4DO2 A;  3OMI B;  4DXW A;  1PKX A;  3EHB B;  3JSL A;  2M7W A;  1SRY A;  4CS4 A;  3W7U A;  2GSM B;  4PA9 A;  3N27 A;  3ZN0 A;  4KUM A;  4LNU B;  4G2K A;  4B3M B;  4DR6 B;  2H94 A;  5H2F Z;  3STL C;  3JAL B;  2EIM C;  2QR4 A;  3OFN G;  1NH2 D;  3T2M A;  5LGU A;  3ABT A;  4TWK A;  1BHA A;  3OGI B;  1MOF A;  2Q6A A;  3ETD A;  3L72 H;  1JOY A;  3FB8 C;  5J9P C;  2DWD C;  5CB4 A;  2WA4 A;  4DR2 O;  1K3E A;  3F5T A;  4DV4 B;  4RUE A;  3AG2 B;  1M5I A;  2YIB A;  5JWP A;  5LBQ A;  5IJ0 B;  4PHZ A;  1HNX O;  4B7E A;  3CCR V;  5A2Q N;  3BHP A;  3E35 A;  1KBH A;  4AI8 A;  1KKC A;  1OJH A;  4IIJ A;  4NR1 A;  1VQL V;  3WFV A;  5BXZ A;  3CME V;  3CC2 V;  4JI7 O;  1N33 O;  4E2L A;  1SQQ H;  1VQ6 V;  1H2L A;  4FK5 C;  2QM7 A;  3CCE V;  1XEQ A;  2DQ3 A;  1B6Q A;  5JJJ B;  5LGT A;  2JS5 A;  3ETG A;  2PYL A;  3E8F A;  1NJI W;  3UKM A;  3T1H O;  4JTA B;  3ZMV A;  4OX9 O;  2QKC A;  4B3S B;  3CHX A;  4TV8 B;  3UO2 A;  1XQ8 A;  1VQ4 V;  2XND G;  3SPI A;  4ZKI A;  1VQK V;  1K9M W;  3K58 A;  1SS3 A;  2GV9 A;  1Q3E A;  4CC5 A;  4DR1 O;  5IYC O;  5JH7 B;  5L3D A;  4FVM A;  4P9P A;  4UVB A;  1I0H A;  4BIO A;  2P06 A;  4FIP C;  2ILM A;  3SR2 C;  1GN2 A;  4K8Z A;  2ZE8 A;  4O2A B;  2Y48 A;  1NR1 A;  2HFE C;  2P4V A;  3ETE A;  2Q4P A;  2E5L O;  1AP6 A;  3ZJZ A;  3OW2 U;  2KQX A;  4JI2 O;  1R3I C;  1Z5W A;  3G80 A;  1MMM A;  4EKW A;  4DR2 B;  3IC7 A;  4LF7 B;  2K1E A;  2EJR A;  4KHP B;  2QWR B;  1EFR G;  3HKD A;  3SJA C;  1LNQ A;  1XRE A;  5KHG A;  3WG7 C;  4X9Q A;  1PNK A;  2Z0A A;  3CCS V;  1JMK C;  1KC8 W;  1GM7 A;  3P32 A;  1N8R W;  1YDX A;  5CA0 B;  3UCS C;  2YID A;  3K5O A;  3RT3 C;  2Q7G A;  3E22 A;  1V55 C;  1LUW A;  2R9I A;  4KP4 A;  1VIB A;  1MNG A;  4YJ3 B;  1P7B A;  1VMG A;  1UJW B;  1VP7 A;  3AG7 A;  2E3C A;  3K59 A;  2BOB C;  4N21 A;  3H9V A;  4WF9 V;  1BQ0 A;  1FFX B;  1XL4 A;  3W7S A;  3JAT A;  2UXB O;  4NYK A;  1WNS A;  3ETQ A;  4FLZ A;  1HR0 O;  2RNB A;  3IGA C;  1KQS U;  4FM2 A;  2EIL B;  3AG1 C;  4JZ2 A;  3ZCC A;  1RPR A;  4H37 A;  4O2B B;  5GON A;  4LFB B;  1XOU A;  1XDC A;  4LFC O;  1V9P A;  4I50 B;  4JI2 B;  2Q0A A;  5L3G A;  4JI4 B;  4JGS A;  5B1B B;  4X65 B;  4QPJ A;  3D8C A;  2NNU A;  4DV3 B;  4X1Y A;  1TVK B;  1S72 V;  5EYP A;  1Y67 A;  4CH4 A;  1L0L H;  3BA8 A;  3FYE B;  4DV5 O;  2P22 C;  2LW7 A;  3CS5 A;  4X89 A;  4O4H B;  1AIL A;  2GTA A;  2QWN B;  3CSX A;  4X66 B;  2UXC O;  3ABK C;  3CB2 A;  4JAU A;  4YHH B;  5IY5 C;  1M57 B;  4UB8 Z;  1JFF B;  4TT3 G;  1YIT V;  1PL0 A;  2PY5 A;  4J10 A;  3CD6 V;  1Y74 B;  1K33 A;  4DV3 O;  1RM1 C;  1SQX H;  3D36 A;  3ASO B;  4YY3 O;  3WB1 A;  2OIE A;  4X88 A;  1VQ5 V;  1VF7 A;  3SPG A;  1SES A;  1ROP A;  4O4I A;  2VS0 A;  4RAI A;  5EZY B;  1VQN V;  1AJP A;  3HKE B;  4UCS A;  4L8J A;  1K8A W;  3A0B Z;  2X0L A;  1GN3 A;  2GDS A;  4J9Y B;  1W59 A;  3K5N A;  3B40 A;  2JK5 C;  4DV6 O;  3SYO A;  4JF3 A;  4J7Z A;  4X62 B;  4BIU A;  3R65 A;  5B5E Z;  3FB5 C;  4G28 B;  5LA6 B;  2B9Z A;  2BTQ A;  2ADQ B;  2GBO A;  1W0J G;  3ZN1 A;  1SER A;  4X1K A;  3AEI A;  3RBZ A;  3FKS G;  2XAH A;  3X2Q C;  5CMU A;  2W0F C;  3T1Y B;  4O4L B;  2P90 A;  2XAG A;  1MA1 A;  4FM0 A;  5B1A B;  2Y4T A;  2XHB A;  1NKD A;  2IU0 A;  4B3R O;  3E8H A;  3VOU A;  1YCI A;  4IHJ A;  2XUM A;  1HWY A;  1FXK B;  5GW7 A;  4JI1 O;  3OM3 B;  4HAM A;  4XBF A;  1YJ9 V;  1AI5 A;  1G4Y B;  1N0N A;  5LHI A;  2DYS B;  1BQZ A;  2PTM A;  1VF5 B;  3H1L H;  5CA1 B;  3BEH A;  2AHY A;  4DUZ O;  4DV2 B;  3BY6 A;  3HKC A;  5C93 A;  5JQG A;  1J95 A;  4DR5 B;  1IBL O;  4DR4 B;  2YXY A;  4BIZ A;  2HP8 A;  3WG7 B;  1R73 A;  3QO8 A;  5B1A C;  3L74 H;  1GK9 A;  2CAZ C;  2IH1 C;  5FL7 G;  4TUY B;  4DK1 A;  1FS0 G;  4K8X A;  1XIL A;  1Q7Y W;  4GKK O;  1IUR A;  4TV9 A;  3JAS A;  1K73 W;  1FYJ A;  1V54 C;  4DR7 O;  3GWK C;  1NH2 B;  2OWO A;  5KX5 B;  3M7M X;  4WBN B;  2PUS A;  2DWE C;  3H1H H;  1XNQ O;  2CTW A;  5KA6 A;  4X64 O;  5BR8 O;  1GO3 F;  5B1B C;  2F4V O;  4GKJ B;  1MZE A;  1M90 W;  2Q67 A;  2LO1 A;  3F7V C;  3RYI B;  3RVY A;  4FZ0 A;  1Q82 W;  4O4J B;  2Q73 A;  4UCU A;  5BZB A;  5L3C A;  2HJD A;  3OE7 G;  5BR8 B;  2RMK B;  2CH7 A;  3ZS8 C;  2YIB D;  4B3R B;  4H33 A;  1WB7 A;  2OYQ A;  1VQ7 V;  3BAA A;  1SF9 A;  2EJ7 A;  2WLI A;  2ZE5 A;  5KMG B;  2MK3 A;  1OZ0 A;  1N33 B;  3ZMZ A;  1NBM G;  3O65 A;  5L3E A;  1R3J C;  1IBK O;  1FD9 A;  1AB3 A;  5TIS Z;  2YXH A;  2V7Q G;  3UO3 A;  1Y66 A;  2O57 A;  1G8M A;  2VWJ A;  3CCM V;  3STZ C;  1Q6H A;  5HFM A;  2RJZ A;  5JVD A;  5EBL C;  4D7T A;  2DOS A;  1XMO O;  5J2U B;  3H1J H;  1AJN A;  4BAY A;  2YEV B;  5DED A;  4LNU A;  4K0K O;  4L87 A;  4MTG A;  3KKY A;  4HBN A;  2ZXW B;  1KB9 F;  1DF4 A;  3RYH A;  2PI4 A;  3MHS C;  4LWS A;  1WN7 A;  4TOI A;  1SQP H;  1PD3 A;  3ZRS A;  4B3T B;  2EIN C;  3SJC C;  3LDE A;  1YZB A;  5HFL A;  3B2E E;  1GH6 A;  4FPP A;  3OTO O;  2HR3 A;  3WB0 A;  3ZRX A;  3CRQ A;  3K06 A;  4ZHQ B;  2IH3 C;  3SYA A;  4MW8 A;  4P30 A;  1W2B U;  4DW1 A;  2UXN A;  3CC7 V;  4HNA A;  5A9G A;  2P6J A;  4IL6 Z;  5K1P A;  1I08 A;  4JI8 O;  1BSM A;  3AG2 C;  5B66 Z;  2GTS A;  5EC2 C;  4CH3 A;  4TSF G;  2W6I G;  3W7W A;  1KD1 W;  3L75 H;  5FLX N;  3RW0 A;  1DK1 A;  1S76 D;  1AR5 A;  2JVD A;  2P67 A;  3RVZ A;  1L1F A;  4KXR A;  5KA5 A;  1GM9 A;  2NLJ C;  4PI0 A;  5KUM A;  3CYO A;  2R70 A;  5FPR A;  5B3S C;  5L3B A;  1QNM A;  2VQF O;  4MVZ A;  5GTH Z;  4UVC A;  2EZO A;  3FB7 C;  2HVK C;  4WFG A;  4I9W A;  4JAS A;  4DR3 B;  1NI8 A;  3ASN C;  1FPO A;  4YJ2 B;  3ZHU A;  3K57 A;  4B3T O;  1FKA O;  4LF5 O;  2JDI G;  5IJ9 A;  4NXN B;  4R6Z A;  3SPH A;  1TUB B;  2IW5 A;  2IJK A;  2N05 A;  1WA8 A;  4JYY A;  1Q43 A;  3OEH G;  1BL8 A;  2LFR A;  3ZMU A;  1YI2 V;  2JS3 A;  3CXH F;  4LF4 B;  2XT9 A;  2PF4 E;  4HYO A;  3LSS A;  2X6A A;  1WLE A;  2CUG A;  3JD0 A;  1EZV H;  2P4K A;  3ABM C;  2KKW A;  1XI1 A;  5LYJ A;  2Q0O C;  3BA9 A;  4DRX A;  3APO A;  2F93 B;  4AQY O;  4MVU A;  5IE9 A;  1Z5V A;  3FX7 A;  4FFB B;  2QKS A;  4WCE V;  3ZED A;  2P5O A;  1FXK C;  2Q68 A;  2ITD C;  2DE0 X;  1FFX A;  2Q9L A;  1CEZ A;  2Q7E A;  2LGW A;  3L71 H;  2GUZ B;  4AQY B;  1Q90 D;  1EN5 A;  4C7U A;  2ZDI C;  5KAI Z;  1FXV A;  4MS2 A;  4JI5 O;  3CRA A;  4XDL A;  5H9C A;  3TJT A;  2M6Y A;  5AG2 A;  3G4S V;  1XUQ A;  3VQY A;  1ZL8 B;  2CTQ A;  4MVO A;  2ZIO A;  1EM1 A;  1KEC A;  3DTU B;  4JZG A;  1RFY A;  1P49 A;  3CXC U;  3WB2 A;  5EIB C;  3DXR A;  1NS1 A;  2W6J G;  5LOV A;  5LP6 C;  4DR5 O;  1H2M A;  4LH7 A;  1Q86 W;  3CJH B;  3APQ A;  2Y0I A;  4ASU G;  5DN6 G;  2D3O W;  4WFH A;  1J5E O;  4X20 B;  1SQF A;  2YUA A;  2YDE A;  3AG4 C;  1GKF A;  2V4D A;  1QVF U;  1NVP B;  2F1M A;  3ABU A;  5IWA O;  3VQX A;  2XAS A;  4U7N A;  3VBB A;  4IT5 A;  1OCO B;  2W0X A;  2K9P A;  2Q69 A;  4JV5 B;  2GHY A;  4EB6 A;  3ABK B;  2VRZ A;  2WLL B;  2BOC C;  2A9H A;  3JAW B;  3ASO C;  3ZHT A;  1AR4 A;  1YXB A;  2FTK A;  1URF A;  4BW9 A;  2ZXW C;  1R1B A;  4LFA O;  1ARO P;  3OT7 A;  3G6E V;  3QTC A;  1XNQ B;  1THZ A;  1UPG A;  3OMA B;  1OHH G;  1Y6X A;  4GZR B;  1AI6 A;  1U96 A;  4JPR A;  3J81 N;  3B09 A;  5FNV A;  3CRR A;  4GT1 A;  2KSD A;  3SGI A;  1RM1 B;  1BGY H;  1S3J A;  5KHK A;  2EIM B;  3IAY A;  3PJS K;  4QE7 A;  4CZZ A;  3N2K B;  3JAM N;  1NR7 A;  3RGB A;  4MVQ A;  2G38 A;  3UQ8 A;  3FYI B;  1IZ3 A;  3AG4 B;  1XHX A;  4YIO A;  4D6T H;  4DV1 B;  5EBW C;  3FD9 A;  1XBL A;  4O4L A;  5E79 Z;  3ZHS A;  3E8G A;  3UM7 A;  3H01 A;  4BWA A;  2ZKO A;  1TGO A;  5BMV A;  3LDC A;  3D36 C;  3ABM B;  1ZTE A;  4FLX A;  2OCC C;  3SPJ A;  1US6 A;  4X64 B;  1X4T A;  1K5S A;  2LJ2 A;  4I0X A;  4WFA V;  1OCR C;  4JI6 O;  2EZP A;  3NXS A;  4MT8 A;  5CA3 A;  4WFF A;  1HNW O;  3HKC B;  5D5P A;  1S5H C;  2YIA A;  1XHZ A;  1VQP V;  2QA4 V;  5CBH A;  3CEI A;  2IJH A;  3HKB A;  2F4V B;  2BCC H;  1Y76 A;  4CS2 A;  2HG5 C;  3RYF B;  3FFQ A;  4FLW A;  3L70 H;  3OD4 A;  4CC6 A;  2FKX A;  4JI4 O;  1F4N A;  2CGO A;  2XTA A;  3JAS B;  4TV9 B;  1QLE B;  1Q6I A;  3ZHV A;  1JX9 A;  4X65 O;  4FLY A;  1MSW D;  4LP8 A;  3UT5 A;  4Z1M G;  3RYC A;  3SDL A;  1OCC C;  3BRC A;  1RP3 B;  1W0K G;  3FAV B;  2YXL A;  4BW5 A;  4F6R B;  1S5J A;  4U3J A;  4JI0 B;  1IXM A;  1B3Q A;  3QO7 A;  5B1O A;  5DEC A;  4IYH A;  2YI9 A;  4X66 O;  2UXC B;  4W4L A;  1CPY A;  2ZE7 A;  2ZM6 O;  1K4C C;  4Q20 A;  4YIP A;  2UXB B;  2LP7 A;  4EFE A;  4B7K A;  4O4J A;  3QG5 A;  4KL1 A;  3TK1 A;  4HZ3 A;  1HR0 B;  4PA3 A;  3J7A U;  4UV8 A;  2E74 B;  4UXN A;  2CTP A;  4MW3 A;  1H2S B;  2YI8 A;  2OCH A;  2RQ6 A;  3AK3 A;  1R3L C;  2X6C A;  4JI8 B;  4TV8 A;  1SC5 B;  3SJB C;  5J2T A;  5CBF A;  4LH6 A;  3RFR A;  1GMG A;  2VQF B;  1H8H G;  1HNW B;  1FAF A;  3E89 A;  2QEX V;  2FML A;  3QNE A;  2ZR3 A;  5H6R A;  3A0H Z;  5L3F A;  3P30 A;  4JAA A;  3ML0 A;  1PNL A;  1S77 D;  3K0G A;  3J80 N;  1YJW V;  5LMU O;  3T4Z A;  1SET A;  1GTO A;  2JEX A;  3LSU A;  4LF5 B;  2KB1 A;  3K5L A;  4NB5 A;  3AK1 A;  4I4T B;  1VEW A;  5IYB O;  3CWB H;  4JTC B;  1DF5 A;  2N74 A;  1IBM O;  5KHJ A;  2D2C B;  1YEW A;  2ZIN A;  3AK2 A;  3BPZ A;  2BTO A;  4X1I A;  2DYS C;  4W4K A;  1AR1 B;  5LP6 B;  2QWO B;  4R8C A;  3M99 B;  2AXT Z;  3E22 B;  2CE4 A;  3CMA V;  5IYZ A;  1WAZ A;  1FFT B;  3GWO A;  4PEL A;  4I55 A;  2LGQ A;  4QIW F;  4YJ3 A;  3GB7 C;  4ZHQ A;  3MDS A;  4UCT A;  5C8Y B;  3C3S A;  4NTY A;  3U10 A;  1NTM H;  3OUS A;  1S5L Z;  3P3P A;  1F51 A;  1V54 B;  4PDL A;  1QQC A;  2WLH A;  2E5L B;  4JI3 O;  1PV0 A;  1WB8 A;  3U0Z A;  2EIK B;  5CN0 A;  2WSS G;  2KG7 A;  2XOK G;  1BT8 A;  3LNM B;  5LHG A;  4I9Q A;  3QF7 A;  5IT9 N;  3Q4H B;  4F4L A;  4F6E A;  4JYA O;  5GON B;  3KCY A;  3C90 A;  5LGN A;  1F23 A;  2WWW A;  1Q8I A;  4DUY B;  3LDD A;  1AVM A;  2WLJ A;  5H6Q A;  5LXT B;  2B1G A;  2Y4U A;  3CX5 F; 
#chains in the Genus database with same CATH homology
 1P84 F;  3L73 H;  1NTZ H;  3H1I H;  3L75 H;  2BCC H;  3L72 H;  4PD4 F;  1SQP H;  3L70 H;  3CXH F;  1L0N H;  1NTM H;  1SQQ H;  1L0L H;  2A06 H;  3H1L H;  3H1J H;  2IBZ H;  1PP9 H;  4U3F H;  4D6T H;  1BE3 H;  1SQV H;  1BCC H;  1PPJ H;  3H1H H;  3H1K H;  3TGU H;  1KYO F;  1NTK H;  1EZV H;  5KLV H;  3L71 H;  1SQB H;  3CWB H;  2FYU H;  1KB9 F;  3CX5 F;  3BCC H;  1NU1 H;  3L74 H;  1SQX H;  1BGY H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...