3CWBH

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cwbH00
1BE3H 4D6TH 4PD4F 1SQXH 3BCCH 1NTMH 3H1LH 1SQVH 2FYUH 1KB9F 1BCCH 5KLVH 1BGYH 3TGUH 1SQBH 3CX5F 3CWBH 3CXHF 3H1KH 1L0NH 1NTKH 2A06H 1PP9H 3H1JH 3L70H 4U3FH 3H1IH 3L73H 1NU1H 1PPJH 1EZVH 1P84F 1SQQH 2BCCH 3L71H 3L74H 1L0LH 2IBZH 3L75H 3L72H 1SQPH 3H1HH 1NTZH 1KYOF
chains in the Genus database with same CATH superfamily
3OE7G 2KSDA 5EC2C 3AK3A 3OTOB 3WB2A 1VQ5V 4YJ3B 3FB8C 2CK3G 5J2UB 3P3PA 4FZ0A 2Y0IA 1MABG 5AG2A 1TVKB 3ZMUA 3CCMV 1N34O 2F43G 3D3QA 1NI8A 5IJ0A 5E79Z 4CZZA 1S3JA 2HLDG 1XI1A 4FLUA 1AJQA 4WFBV 3J7AU 5ITZA 3H1KH 2YDEA 3OTOO 2ZE6A 4ZKIA 5IY5B 4B7EA 4TV8B 4I50B 4ZOLB 2YXYA 1SQQH 3L71H 1AVMA 3VBBA 3H1HH 4N21A 2CTQA 2OIEA 1KBHA 1ZTEA 1YCIA 3EXAA 3SPGA 3SYQA 1R3JC 2XT9A 1Y74A 5JJJB 2Y69C 2EBOA 2VQEB 2E3CA 3UT5A 1VQ6V 4DR5B 3E83A 4UV8A 3JAWA 4L87A 4BWAA 2Z5UA 4KHPB 3G80A 4MW8A 3UQ8A 1YI2V 4PDVA 1M93A 3PN1A 2E5LO 2XTAA 2VQEO 4WBNA 3NXSA 4NTXA 2PTMA 5C93A 5EK0A 3ABLB 2RMKB 4DR5O 3THOA 4K0KB 1FXHA 4DUZB 4KHPO 3ETGA 2KQXA 4H13B 5LOVB 4LF9B 3CCLV 5CBHA 2NLJC 3FYIB 4RAIA 1M57B 3JD0A 2ODMA 1E79G 2EINB 3ABUA 3KZIZ 2AGAA 2ZIMA 1GN3A 4K0KO 1VEWA 4DV4B 2MW2B 4RO2A 3N2KA 4ABMA 2OCCC 4DUZO 4DK0A 5KMGA 4PA9A 4PA4A 3BVOA 5KHJA 2DJVA 1BCCH 4LF9O 4QE9A 4J7ZA 2ZXWB 2ZR2A 3LSSA 4DRXB 1I7FA 5JJEB 1K7DA 2CUGA 3OT7A 2Q68A 3B40A 2BSKB 5C8YA 5BR8B 2P6JA 4DV4O 2HG5C 3SYAA 2HEPA 4EFBA 1YZBA 1NR7A 3SJAC 1L8DA 3CWBH 1K97A 2H3OA 5KHKA 2CH7A 2QA4V 2Q6AA 4TQFA 1I5XA 5CB4B 4B3MB 1WNSA 5BR8O 2JDIG 3G71V 4ZIBA 1LUVA 1P7GA 2JS5A 2X6BA 3M99B 4GX2A 1OCOC 5CA1B 5H5NA 1ZWIC 2QGNA 1Q8IA 2WLNA 4JZGA 4X64B 2QWOB 1FFXB 4J9ZB 4LWSA 2JIZG 5EBMC 5LXTB 1OCRB 1SRYA 4WFAV 4QJFB 4B3MO 2UUAB 3T4DA 3CE2A 4TWKA 3CYOA 1NTMH 3H1LH 2X0LA 3OGIB 1SQVH 3LSQA 4O4HB 2Q67A 1HNZB 3LDDA 1Q82W 2VQFB 3ZEDA 2B5UA 1Q81W 1AJNA 2Y48A 5LGNA 3BY6A 1AJPA 4DR3B 3ABKB 1ZAUA 2EJ7A 3E22A 2BTQB 2CE4A 3BPZA 4X64O 3CC2V 1YTFD 2Y4TA 2HR3A 3N27A 3SYPA 2LW7A 2IBZH 2WAMA 3HKEA 5J9PC 2QEXV 3ZHQA 4F6RA 4EFEA 3ZHUA 2UUAO 4MTOA 5H6RA 1W0JG 1AI4A 3JASA 3I56V 3W7UA 5LMUB 3U0ZA 4HYOA 1HNZO 5GTHZ 4DR6B 3TETA 1I94B 2VQFO 4DR7B 3ZMSA 1VP7A 5CA0A 4DR3O 3T1HB 4J11A 1NU1H 5FNVB 3J80N 5A9GA 4Q6GA 1S76D 3D8CA 1NQTA 2FTKA 1NBMG 1SZTA 4QNHB 4YIOA 3JAMN 4BIUA 5IJ0B 1MA1A 3W7TA 5LMUO 5ITZB 4DR6O 4GX5A 1RM1C 4JZ2A 1I94O 5EZYA 4ZHQB 1N36B 4DR7O 3K57A 1TAEA 3IGAC 1M5IA 4CH4A 3CCRV 3T1HO 4FLXA 2OWOA 4TV9A 2NN4A 1F51A 2YI9A 4DV5O 4IHJA 5H2FZ 2BTOA 5L3DA 2P06A 5IY5C 1Y74B 1FYJA 4J80A 3D36C 2Q0OC 3L9DA 1JR9A 3CD6V 1GN4A 2BOCC 3UT5B 4FK5C 1N36O 4JI3B 4DR2B 2WLLA 3JAWB 3B2EE 1SC5B 1QU7A 4R6ZA 4JASA 2YXLA 1BSMA 2LP7A 4I5SA 1XNQB 1IBMB 1H2KA 4EEQA 2GBOA 2VWKA 1SESA 2A06H 1JCHA 4JAUA 4UCUA 5KAFZ 2R72A 3TXQA 3KKYA 4HBNA 4JI3O 1VQ8V 4DR2O 1PL0A 1NVPD 3G6BA 5FL7G 2DE0X 4KUMA 3P30A 2D2CB 4PD4F 4F6EA 4MVSA 3AG2C 3WB0A 1XNQO 3ABLC 4LC1A 1IBMO 2QTOA 1GKFA 4PA3A 1KC8W 1GH6A 1O9HA 4OPAA 1H2NA 5B1BB 2OYQA 3ZIAG 1NH2B 2Y69B 3H1JH 3D36A 2YIDA 4ZOLA 2PI5A 3TK1A 4WCEV 2EIKC 2V4DA 2DQ0A 4CH5A 3CP1A 1M57C 3ZS8C 3OUFA 3N2KB 3RYIA 2GTAA 1MG1A 5KMGB 5IYDO 1OCZC 4WFEA 2Q7GA 4NYKA 4JI6B 5IT9N 2HHHB 3K9SA 1VQKV 1XHZA 1JVMA 3ZRVA 3CJHA 2PZSA 3JCZA 3FB7C 1UJWB 4J10A 5C8YB 4I7ZB 2ADPA 3T1CA 3ASNC 3AG7A 1SKVA 4CBCA 1T5EA 4FPPA 4XDJA 4K8ZA 4IIJA 5CMUA 4QGPA 5KA6A 2DW4A 4YIPA 4D7TA 1OV9A 4JI6O 4B3TB 2HHHO 1QQCA 2CH7B 4IL6Z 1ROPA 4UV9A 2PI4A 4R7CA 1FAFA 4KFMA 2X6AA 3UO3A 2UXXA 1G6UA 3OEHG 3STZC 2JGDA 1S77D 2Q7EA 4OXSA 4LCUC 3ASOC 4PI0A 1XBLA 3JARB 5BY1A 1NTKH 4FLWA 3K5MA 3MHSC 1R6KA 4B3TO 1N0JA 1PD3A 4LWSB 1H2GA 1XL4A 5KUKA 5DN6G 3APOA 4JTCB 4RWUA 1SQPH 3GWKC 2A7WA 4WFFA 3BCCH 4X8AA 2QWQB 3DC6A 3ZMVA 3JSLA 5HFLA 1HDJA 2P4KA 4X65B 1OCRC 4FM2A 1AILA 2Q9LA 1AP5A 2BSKA 3WU2Z 4GX1A 1WJZA 3E22B 5LHIA 4FVMA 2WPDG 4O2AA 1DF5A 4JI7B 2H8PC 2UXCB 3HKEB 1BE3H 1XILA 1KKDA 3QTCA 1WPBA 4F6RB 1N32B 2ZKOA 3ABKC 2JS3A 1Y4MA 3HB3B 4X65O 2XAJA 3ETQA 3JCUZ 3L73H 5CA0B 4PJ0Z 1YJ9V 1U96A 5LHHA 2EX3A 3HR0A 1A32A 4MS2A 1JA8A 4UCSA 4JI7O 3QF7A 4JI8B 2ZDIA 1F4MA 4BW9A 1U97A 1XOUA 2UXCO 1MOFA 1K4CC 3CRAA 4JI5B 4X1IA 5KHHA 4LF5B 3RYCA 2XAFA 4PI2A 1N32O 1SA0A 4MTGA 2IH1C 3CSXA 2A3QA 4I9WA 4LH6A 1EN4A 1NVPB 4OGQB 1K8AW 5EZYB 1BT8A 5KUMA 3ZN0A 2Q5ZA 2DWDC 4UVAA 1SQFA 3U10A 5TISZ 1XL6A 1JJOA 3ZCCA 4JI8O 4TV9B 3VQVA 4I0XA 2A9HA 5EIBD 4JI5O 4IHJB 3F7VC 4LF5O 4A5UB 2Z0AA 3DC5A 2ZE7A 2DMXA 2OIGA 4F4LA 4UVCA 1QR8A 3RFRA 4GLXA 2WLLB 3PJSK 1YVWA 2V1DA 3JYCA 3R65A 1TA8A 3SPHA 2GV9A 3FYEB 1RPOA 3B77A 2WLKA 1D5AA 1AR4A 5K1PA 5LGTA 5GTIZ 1NR1A 2E75B 1UPGA 5JH7A 4L8JA 1WB7A 2UXDB 4NXMB 4CS3A 2QJ1A 4UCOA 5FNVA 1Q3EA 1VQNV 1FKAO 4UB6Z 3OFNG 1RM1B 2P7TC 4OX9B 3GWOA 1Q5OA 4TOIA 2X7RB 1P4RA 3HKDA 1H8EG 4KXRA 3SGIA 1KB9F 1VQ9V 1RPRA 2RNBA 3F5WC 5JVDA 1KU9A 4ZHQA 2CAZC 4LFAB 2UXDO 4NXMO 3JSNA 3SR2C 3K0GA 2ZE8A 2ZNJA 4DV2B 4JV5B 4FLYA 2Y0PA 4OX9O 4K35A 5EC1C 3ZRXA 4JGSA 5B1BC 3RYIB 3E8BA 2E5LB 2QDOA 5L3BA 2NR5A 3ZMTA 2VS0A 5B1NA 1V54B 1FXKB 2AZ0A 1KECA 3DTUB 3EHBB 1HNWB 4MVRA 3APQA 3CJHB 3QO8A 4LFAO 2ZQMA 1VQ7V 4GZRB 3QG5A 2W6JG 4DV2O 4JV5O 2DYRB 2K1EA 1PM9A 4IIJB 4IGGA 4AILC 4MVQA 3LNMB 5H6QA 1OCCC 3SJBC 2AZ2A 3FAVA 3AG2B 4PHZA 5B1AC 4UB8Z 3AK1A 3L70H 3JD4A 1HNWO 1IXMA 3K3WA 1RSOA 4O4JA 3OMIB 1R1BA 2IJJA 1WB8A 2CTWA 3BA8A 4LR3A 1CEZA 4FLVA 1Q6IA 2DN9A 4NKGB 2JGDB 2EIKB 2DQ3A 3CX5F 1VF7A 4E4EA 4FJCC 1R73A 1ZLZA 1QHTA 4B7KA 5EYPB 2ARHA 1OCZB 1PNMA 4Z1VA 2N05A 2GDSA 2EZPA 4ASUG 1XUQA 3IAYA 2FL4A 3QO7A 5B66Z 4GYCB 1SQBH 4ZI7A 1FJGB 3X2QB 4NVPA 1FPOA 2B1GA 3ASNB 2VRZA 1TUEB 2ZD9A 4E2LA 2QSAA 4NTWA 1GRJA 4D7SA 2Q73A 4O2AB 1NTZH 1WA8B 3H9VA 3MHHC 2JJ2G 1PV0A 2IJIA 3OTFA 3G4SV 2FMLA 5LA6A 1FJGO 4NR1A 3LNNA 2HJFC 1JFFA 1K5SA 1G1XB 3AK2A 4G27B 1K92A 3ASOB 1EZVH 1SS3A 3L74H 2QKAA 2ZIOA 4CH6A 3N2GA 5IYCO 2ITCC 2PYLA 1PNLA 2FYUH 5IJ9A 1ORQC 1QCEA 4DV3B 4X1IB 3CXHF 3RYCB 3JARA 2R9AA 1SA0B 2DWEC 1NT2B 2IM9A 3AG1C 1BS3A 3U11A 4EKWA 5K1XA 4CS2A 1UFIA 2L35A 1XREA 2GUZA 4MSWC 4FIPC 2ILMA 2IU0A 1DGSA 1R3IC 1Y76B 2LGQA 1QLEC 4I0XB 4DV3O 4NTYA 1DLBA 4LH7A 3ZBHA 3RBZA 1VF5B 3IC9A 2CTRA 5D5PA 4RUFA 4DV1B 2CDYA 3RGBA 2ITDC 1JMKC 2Y4UA 3CRCA 3ZHRA 4MTXA 5KHIA 2WLJA 4GKJB 1S5LZ 3EFFK 5EBWC 3E86A 2YC0A 3OMNB 4JTDB 4MVMA 5JH7B 3SDLA 2YSUB 4ZBMA 2BCCH 4MVUA 3B4SA 3OR7C 4DV1O 2WSSG 4DV5B 2EILC 3HKDB 4GKJO 3K79A 5JVDB 4FMTA 2F4VB 3OD4A 2JGUA 5LMNB 3CPWU 1O9GA 5B3SC 3TCUA 4YHHB 3E2EA 1YXBA 1BHAA 3I5DA 4Z1MG 1AI7A 4TSFG 3ZMZA 1M90W 5JWPA 5F2VO 5KHGA 1B3QA 4U3FH 2F4VO 5LMNO 3UKMA 4DW1A 1P84F 1RP3B 1EFRG 4WF9V 2XAGA 2W0XA 1KYOF 4YHHO 1Q6HA 2IW5A 1S0VA 1V54C 3VOUA 1HP8A 3ZRWA 1KQSU 1FXKC 4U7NA 2MK3A 4TUYA 5GONB 1AI5A 5E1AC 1I5YA 1L1FA 3FAVB 2R70A 2LFSA 1MSDA 1Z5WA 1XHXA 4UVBA 4AQYB 3WG7C 2DYRC 4JPRA 1RSOB 4O4JB 4P30A 4H33A 4J7KA 2LO1A 2WA4A 4J7JA 4PA7A 5LP6B 3FB5C 3E89A 3I55V 1SERA 3NR7A 3OMAB 2Q7HA 3STLC 2QWNB 3LSUA 2DYSC 3OR6C 3OAAG 2A0LA 2BOBC 1BMFG 3LUTB 2YUAA 4AQYO 3WFVA 2F95B 2P22C 3BABA 3D3IA 1QBZA 3QVNA 4ZI7B 2QKSA 1FXKA 1G4YB 4JI1B 2LW1A 1PP9H 3CB2A 2HVKC 3SPCA 2LJ2A 2R9IA 2KB1A 4JAAA 1OCCB 2ETNA 2N74A 4XBFA 3L72H 1H2SB 3X2QC 5B1AB 2EZOA 5D5QA 2CTPA 1Q7YW 5LGUA 2UXBB 3W7WA 1CPYA 4AI8A 4WFGA 1WP7A 3SPJA 1KKCA 1Y66A 3ZN1A 5LA6B 1ZL8B 1JFFB 1YTFB 2UU9O 4JI0B 5EIBC 5FPOA 4JI1O 3CS5A 4X1YA 3H1IH 2HVJC 2IJKA 4PDLA 4O2BA 3ZJZA 1PKXA 4X1KA 1EZJA 5JCOC 5BMVA 5J2TA 2AHZA 3N2GB 3K06A 2UXBO 5IJ9B 2P67A 2G38A 2RJZA 3JD2A 5EYPA 3AG4C 3GVMA 2UUBB 4TQDA 5KX5A 4JI0O 3CRQA 2ZDIC 1LR1A 2GUZB 1JQ0A 4JYAB 3E35A 2ZE5A 3HKBA 1QR9A 4CS4A 3SYCA 3C3TA 3CCUV 3H01A 3K5OA 1TGOA 4HNAA 2YIBA 1S5JA 1Z2GA 2E74B 1RFYA 1KMIZ 1TUBA 3B8NA 2UUBO 1HW7A 3M8AA 3ZHTA 1WA8A 1SQXH 4OPHA 5IE9A 2YXHA 1R6NA 1Y6XA 4JYAO 1BHBA 4JI4B 4Q20A 5JCOA 2ZNIA 3HKCB 3TGUH 4P2ZA 1GN6A 3KCYA 1YJNV 3DGEA 4JYBA 4UCRA 1HNXB 2F66C 4FLTA 2PUSA 2Z3YA 3SJQC 3K0DA 4LF4B 3DXRA 3AG1B 1YSCA 4LFBB 3MDSA 2EULA 4GX0A 1YEWA 1S5HC 1FXVA 3CHXA 4DV7B 4O4LA 1D2DA 3A8TA 4JI4O 4FFKA 4J9YB 4PDMA 2JJ1G 4P9PA 1QLEB 2ZINA 1YITV 4MVZA 1HNXO 2YIBD 5HFMA 3K59A 2VWJA 4LF4O 1Y76A 4XDLA 4LFBO 3O9OA 1YDXA 3ZHSA 4PDRA 2WLHA 2CGOA 4YJ2B 4DV7O 1AR5A 1LNQA 2KKWA 3P32A 2BE3A 3Q4HA 3AEIA 4LFCO 1FFTB 4K3AA 4AHCA 1R3KC 3ZRSA 1DTOA 2WWWA 4JAVA 4DW0A 3K5LA 3TJTA 1N8RW 3RW0A 3ICXA 2UUCB 1JOYA 2QR4A 4DO2A 1VIBA 2WLIA 2OT5A 1ENVA 5IDJA 1XDCA 3ZRWB 1KUQA 1K73W 4P9OA 4TUYB 2EILB 1E1QG 1XQ8A 1G8MA 1VF6C 1EN6A 3B8MA 4LF7B 4H0LB 1WAZA 2XASA 5CN0A 4G28B 2PYJA 5BZBA 5FPRA 3C3SA 4BAYA 4UCVA 2UUCO 2XAHA 1ZUQA 3IFXA 2YIAA 4YY3B 1PL4A 1D5NA 5B3SB 1GM7A 2ZCEA 4FFBA 1AI6A 2IJHA 2QKCA 2XUMA 2ZT9B 3G67A 1Y67A 3EVKA 2DOSA 4LF7O 2CGNA 3K04A 4MT8A 1X59A 4ICGA 1WPXA 4PELA 5LP6C 3CXCU 5LYJA 2WA3A 3ZX6A 4YY3O 3SYOA 3K58A 5DECA 1XNRB 1BZKA 5CBGA 1IXBA 1YHQV 2M6YA 1DK1A 1HWYA 4FM1A 1EN5A 1VF6A 1GAXA 4IYHA 2HP8A 4LNUA 1OJHA 4J42A 3MAQA 3LDCA 3JD1A 1K4DC 4R8CA 2ZM6B 2YEVA 3WG7B 2XAQA 4FZ1A 5GONA 1VQMV 1XNRO 1GMGA 1S72V 1BQZA 3A0HZ 2RDCA 3BHPA 1MMMA 1WN7A 4X1YB 4O2BB 4UFZA 5L3FA 1M4UA 4X1KB 5J2TB 5BMVB 2DYSB 2ZM6O 2UXNA 5LP6A 1GTOA 3CCSV 3AG3C 3SJCC 3FX7A 4HZ3A 1H2LA 1PNKA 5FLXN 3KCXA 3RWRD 5KX5B 3E8FA 5L3EA 3S3WA 1SF9A 2AW9A 3CEIA 2AHYA 2ZR3A 2HKOA 3K9AA 3HKBB 4PV1B 4DV6B 4MW3A 2QTSA 4G2KA 1GM8A 4C7UA 1VQ4V 3MD0A 5IYZA 1N33B 2EIMB 5EBLC 4HNAB 1COWG 1M56C 1TUBB 4I55B 1QLNA 3OGCC 4KL1A 3VQYA 1W0KG 3P3NA 3VQWA 1BL8A 1FS0G 1V55B 3KG2A 1F23A 2B9ZA 5KA5A 4DV6O 1V9PA 5LHGA 1OZ0A 1ZL8A 3K08A 4EB6B 4RQEA 2RCVA 2D3OW 4I4TA 4DXWA 1N33O 5LBQA 3FD9A 1ZX3A 3ABMB 4W4LA 2JEXA 2YS8A 2PF4E 2V7QG 3AG4B 1OHHG 4X62B 2F1MA 3IC7A 3DXRB 2Q8VA 4JYYA 3UO2A 1THZA 4NXNB 3OEEG 4O4LB 4BR6A 4RQFA 1JJ2U 2IU3A 3OM3B 1CP9A 3ML0A 3BFRA 2LFRA 4N23A 2EIJB 4QPKA 1NH2D 4H44B 4CC5A 2HJDA 5JQGA 5L3GA 2C2AA 3RYFA 4GUNA 3M7MX 4X62O 3QO5A 2YI8A 3WB1A 3CC7V 4NXNO 1Q43A 2P90A 3JAKB 1KD1W 2Q4PA 3Q4HB 5B1OA 2Q69A 1VQLV 3DSQA 1JX9A 5DEDA 3T1YB 5GW7A 3A0RA 1K3EA 1GM9A 3ETDA 3HKCA 4Z2WA 2XNDG 2WLIB 1NS1A 3E8GA 1CXZB 2JRIA 5IWAB 4DYLA 1F4NA 1IURA 2QM7A 2PGGA 4LF8B 1EBOA 3RT3C 3RYHB 3E8HA 4X89A 2W0FC 1VMGA 4D6TH 3T1YO 1AP6A 3LDEA 4UCTA 1US6A 2KG7A 4U3JA 1R3LC 1QNMA 4BIOA 1YJWV 4GKKB 4FFBB 2IH3C 2YICA 4X9QA 4FM0A 3CCJV 1SQGA 3GB7C 5IWAO 1F7YA 3JALA 2A79B 1JPXA 3CCQV 5JJNB 1Q86W 4LF8O 4X20A 1XMQB 4O4IA 1YF2A 5LYJB 4YJ2A 1B06A 2H94A 4KP4A 1N0NA 4GKKO 5KAIZ 1QVFU 2NNUA 3JATA 2F23A 5BXZA 1WP8A 3SPIA 1MZEA 4LP8A 1GK9A 2E76B 3IJ4A 3CMAV 1KP3A 4K8XA 4LNUB 1XMQO 3UCSC 4JF3A 2QWRB 2YEVB 5B5EZ 3K03A 3S3XA 1AROP 3C90A 2M7WA 4PA6A 4B3SB 1NZ6A 2JK5C 3F7YC 4R50A 1M1KW 2P5OA 1P7BA 2GTSA 3CCEV 4YJ3A 1K33A 3RVZA 3A2FA 1Q90D 1IVSA 5J2UA 4TT3G 3W7XA 2ADQB 4MTFA 4WBNB 2GSMB 3JD3A 2Q0AA 3BAAA 2X6CA 4QPJA 1K9MW 1TVKA 4GT1A 4H37A 5CBFA 4B3SO 3CRMA 1ZSPA 2O57A 4QIWF 5LL6Y 1SZXA 4U7OA 4XDKA 4BIZA 4UXNA 5DM6V 4RUEA 5IYBO 4QE7A 5IYZB 2UU9B 3K5NA 4TV8A 2OTJV 4I50A 1VQPV 3OW2U 1IDSA 4HAMA 2N04A 2AXTZ 5H9CA 1MSWD 1X4TA 4YXWG 2FB5A 2HFEC 1J95A 2EINC 2EIMC 3OUSA 1YIJV 2JEUA 3HPLC 1H38A 2PY5A 1NKDA 1GN2A 2W6IG 1H2MA 4I4TB 1MZFA 3AG3B 3CC4V 1V55C 2ZXWC 2ATKC 4JYCA 2F93B 4DR1B 1SETA 1H8HG 1FD9A 1AB3A 3VQXA 4CH3A 1XMOB 4JTAB 3G6EV 3ABMC 2RN9A 2WLMA 4LBEC 1PPJH 1VARA 1BQ0A 5LOVA 2LQTA 5JQGB 1NJIW 2RQ6A 3BEHA 4B08A 3RYFB 1M9NA 1LUWA 1M56B 1IBLB 5KLVH 4DR1O 2LGWA 2OCCB 1DF4A 1XMOO 2L6LA 2EIJC 2K9PA 4DV0B 2EJRA 1B6QA 2JVDA 1Q6UA 1XEQA 3ETEA 1W59A 4I55A 3W7SA 3TXSA 4GCZA 4LF6B 4CC6A 3QNEA 1IBLO 3UM7A 4DRXA 3CMEV 1WLEA 1N4CA 1L0NH 4EB6A 4DV0O 1EM1A 1AR1B 5L3CA 3FKSG 3FB6C 4X66B 4B3RB 1W2BU 1I08A 4IYIA 3O65A 2QWPB 3T4ZA 1J5EB 4LF6O 3JASB 1QVGU 2KG7B 4J41A 4U3JB 1VQOV 4DR4B 3BA9A 1I0HA 4LFCB 1OCOB 5CB4A 1IZ3A 5CA3A 3JALB 3CCVV 1GO3F 4X66O 3J81N 4B3RO 1IBKB 1URFA 4FLZA 4WFHA 2P4VA 3ABTA 3B09A 4X20B 4X88A 5CA1A 4O4IB 4DUYB 3RN4A 1HR0B 1J5EO 4DK1A 3JAKA 4DR4O 1K5QA 1FFXA 4MVOA 4NB5A 2FKXA 5LXTA 3CRRA 4W4KA 1P49A 3JATB 2QE7G 1IX9A 2QM4A 3FFQA 3A0BZ 3BRCA 1L0LH 4JI2B 1Z5VA 2XHBA 2GHYA 1K34A 1IBKO 2B1IA 2R9RB 1B04A 4O4HA 2OTLV 4BW5A 3R66A 1BGYH 4DUYO 1HR0O 1KP2A 4I9QA 2QM8A 2BTQA 1MNGA 3ZHVA 1E1RG 4UUJC 2XOKG 2OCHA 3F5TA 3T2MA 3RVYA 3RYHA 3L75H 4IT5A 1N34B 1R6TA 4JI2O 5A2QN
chains in the Genus database with same CATH topology
1BE3H 4D6TH 4PD4F 1SQXH 3BCCH 1NTMH 3H1LH 1SQVH 2FYUH 1KB9F 1BCCH 5KLVH 1BGYH 3TGUH 1SQBH 3CX5F 3CWBH 3CXHF 3H1KH 1L0NH 1NTKH 2A06H 1PP9H 3H1JH 3L70H 4U3FH 3H1IH 3L73H 1NU1H 1PPJH 1EZVH 1P84F 1SQQH 2BCCH 3L71H 3L74H 1L0LH 2IBZH 3L75H 3L72H 1SQPH 3H1HH 1NTZH 1KYOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 H;  4D6T H;  4PD4 F;  1SQX H;  3BCC H;  1NTM H;  3H1L H;  1SQV H;  2FYU H;  1KB9 F;  1BCC H;  5KLV H;  1BGY H;  3TGU H;  1SQB H;  3CX5 F;  3CWB H;  3CXH F;  3H1K H;  1L0N H;  1NTK H;  2A06 H;  1PP9 H;  3H1J H;  3L70 H;  4U3F H;  3H1I H;  3L73 H;  1NU1 H;  1PPJ H;  1EZV H;  1P84 F;  1SQQ H;  2BCC H;  3L71 H;  3L74 H;  1L0L H;  2IBZ H;  3L75 H;  3L72 H;  1SQP H;  3H1H H;  1NTZ H;  1KYO F; 
#chains in the Genus database with same CATH topology
 3OE7 G;  2KSD A;  5EC2 C;  3AK3 A;  3OTO B;  3WB2 A;  1VQ5 V;  4YJ3 B;  3FB8 C;  2CK3 G;  5J2U B;  3P3P A;  4FZ0 A;  2Y0I A;  1MAB G;  5AG2 A;  1TVK B;  3ZMU A;  3CCM V;  1N34 O;  2F43 G;  3D3Q A;  1NI8 A;  5IJ0 A;  5E79 Z;  4CZZ A;  1S3J A;  2HLD G;  1XI1 A;  4FLU A;  1AJQ A;  4WFB V;  3J7A U;  5ITZ A;  3H1K H;  2YDE A;  3OTO O;  2ZE6 A;  4ZKI A;  5IY5 B;  4B7E A;  4TV8 B;  4I50 B;  4ZOL B;  2YXY A;  1SQQ H;  3L71 H;  1AVM A;  3VBB A;  3H1H H;  4N21 A;  2CTQ A;  2OIE A;  1KBH A;  1ZTE A;  1YCI A;  3EXA A;  3SPG A;  3SYQ A;  1R3J C;  2XT9 A;  1Y74 A;  5JJJ B;  2Y69 C;  2EBO A;  2VQE B;  2E3C A;  3UT5 A;  1VQ6 V;  4DR5 B;  3E83 A;  4UV8 A;  3JAW A;  4L87 A;  4BWA A;  2Z5U A;  4KHP B;  3G80 A;  4MW8 A;  3UQ8 A;  1YI2 V;  4PDV A;  1M93 A;  3PN1 A;  2E5L O;  2XTA A;  2VQE O;  4WBN A;  3NXS A;  4NTX A;  2PTM A;  5C93 A;  5EK0 A;  3ABL B;  2RMK B;  4DR5 O;  3THO A;  4K0K B;  1FXH A;  4DUZ B;  4KHP O;  3ETG A;  2KQX A;  4H13 B;  5LOV B;  4LF9 B;  3CCL V;  5CBH A;  2NLJ C;  3FYI B;  4RAI A;  1M57 B;  3JD0 A;  2ODM A;  1E79 G;  2EIN B;  3ABU A;  3KZI Z;  2AGA A;  2ZIM A;  1GN3 A;  4K0K O;  1VEW A;  4DV4 B;  2MW2 B;  4RO2 A;  3N2K A;  4ABM A;  2OCC C;  4DUZ O;  4DK0 A;  5KMG A;  4PA9 A;  4PA4 A;  3BVO A;  5KHJ A;  2DJV A;  1BCC H;  4LF9 O;  4QE9 A;  4J7Z A;  2ZXW B;  2ZR2 A;  3LSS A;  4DRX B;  1I7F A;  5JJE B;  1K7D A;  2CUG A;  3OT7 A;  2Q68 A;  3B40 A;  2BSK B;  5C8Y A;  5BR8 B;  2P6J A;  4DV4 O;  2HG5 C;  3SYA A;  2HEP A;  4EFB A;  1YZB A;  1NR7 A;  3SJA C;  1L8D A;  3CWB H;  1K97 A;  2H3O A;  5KHK A;  2CH7 A;  2QA4 V;  2Q6A A;  4TQF A;  1I5X A;  5CB4 B;  4B3M B;  1WNS A;  5BR8 O;  2JDI G;  3G71 V;  4ZIB A;  1LUV A;  1P7G A;  2JS5 A;  2X6B A;  3M99 B;  4GX2 A;  1OCO C;  5CA1 B;  5H5N A;  1ZWI C;  2QGN A;  1Q8I A;  2WLN A;  4JZG A;  4X64 B;  2QWO B;  1FFX B;  4J9Z B;  4LWS A;  2JIZ G;  5EBM C;  5LXT B;  1OCR B;  1SRY A;  4WFA V;  4QJF B;  4B3M O;  2UUA B;  3T4D A;  3CE2 A;  4TWK A;  3CYO A;  1NTM H;  3H1L H;  2X0L A;  3OGI B;  1SQV H;  3LSQ A;  4O4H B;  2Q67 A;  1HNZ B;  3LDD A;  1Q82 W;  2VQF B;  3ZED A;  2B5U A;  1Q81 W;  1AJN A;  2Y48 A;  5LGN A;  3BY6 A;  1AJP A;  4DR3 B;  3ABK B;  1ZAU A;  2EJ7 A;  3E22 A;  2BTQ B;  2CE4 A;  3BPZ A;  4X64 O;  3CC2 V;  1YTF D;  2Y4T A;  2HR3 A;  3N27 A;  3SYP A;  2LW7 A;  2IBZ H;  2WAM A;  3HKE A;  5J9P C;  2QEX V;  3ZHQ A;  4F6R A;  4EFE A;  3ZHU A;  2UUA O;  4MTO A;  5H6R A;  1W0J G;  1AI4 A;  3JAS A;  3I56 V;  3W7U A;  5LMU B;  3U0Z A;  4HYO A;  1HNZ O;  5GTH Z;  4DR6 B;  3TET A;  1I94 B;  2VQF O;  4DR7 B;  3ZMS A;  1VP7 A;  5CA0 A;  4DR3 O;  3T1H B;  4J11 A;  1NU1 H;  5FNV B;  3J80 N;  5A9G A;  4Q6G A;  1S76 D;  3D8C A;  1NQT A;  2FTK A;  1NBM G;  1SZT A;  4QNH B;  4YIO A;  3JAM N;  4BIU A;  5IJ0 B;  1MA1 A;  3W7T A;  5LMU O;  5ITZ B;  4DR6 O;  4GX5 A;  1RM1 C;  4JZ2 A;  1I94 O;  5EZY A;  4ZHQ B;  1N36 B;  4DR7 O;  3K57 A;  1TAE A;  3IGA C;  1M5I A;  4CH4 A;  3CCR V;  3T1H O;  4FLX A;  2OWO A;  4TV9 A;  2NN4 A;  1F51 A;  2YI9 A;  4DV5 O;  4IHJ A;  5H2F Z;  2BTO A;  5L3D A;  2P06 A;  5IY5 C;  1Y74 B;  1FYJ A;  4J80 A;  3D36 C;  2Q0O C;  3L9D A;  1JR9 A;  3CD6 V;  1GN4 A;  2BOC C;  3UT5 B;  4FK5 C;  1N36 O;  4JI3 B;  4DR2 B;  2WLL A;  3JAW B;  3B2E E;  1SC5 B;  1QU7 A;  4R6Z A;  4JAS A;  2YXL A;  1BSM A;  2LP7 A;  4I5S A;  1XNQ B;  1IBM B;  1H2K A;  4EEQ A;  2GBO A;  2VWK A;  1SES A;  2A06 H;  1JCH A;  4JAU A;  4UCU A;  5KAF Z;  2R72 A;  3TXQ A;  3KKY A;  4HBN A;  4JI3 O;  1VQ8 V;  4DR2 O;  1PL0 A;  1NVP D;  3G6B A;  5FL7 G;  2DE0 X;  4KUM A;  3P30 A;  2D2C B;  4PD4 F;  4F6E A;  4MVS A;  3AG2 C;  3WB0 A;  1XNQ O;  3ABL C;  4LC1 A;  1IBM O;  2QTO A;  1GKF A;  4PA3 A;  1KC8 W;  1GH6 A;  1O9H A;  4OPA A;  1H2N A;  5B1B B;  2OYQ A;  3ZIA G;  1NH2 B;  2Y69 B;  3H1J H;  3D36 A;  2YID A;  4ZOL A;  2PI5 A;  3TK1 A;  4WCE V;  2EIK C;  2V4D A;  2DQ0 A;  4CH5 A;  3CP1 A;  1M57 C;  3ZS8 C;  3OUF A;  3N2K B;  3RYI A;  2GTA A;  1MG1 A;  5KMG B;  5IYD O;  1OCZ C;  4WFE A;  2Q7G A;  4NYK A;  4JI6 B;  5IT9 N;  2HHH B;  3K9S A;  1VQK V;  1XHZ A;  1JVM A;  3ZRV A;  3CJH A;  2PZS A;  3JCZ A;  3FB7 C;  1UJW B;  4J10 A;  5C8Y B;  4I7Z B;  2ADP A;  3T1C A;  3ASN C;  3AG7 A;  1SKV A;  4CBC A;  1T5E A;  4FPP A;  4XDJ A;  4K8Z A;  4IIJ A;  5CMU A;  4QGP A;  5KA6 A;  2DW4 A;  4YIP A;  4D7T A;  1OV9 A;  4JI6 O;  4B3T B;  2HHH O;  1QQC A;  2CH7 B;  4IL6 Z;  1ROP A;  4UV9 A;  2PI4 A;  4R7C A;  1FAF A;  4KFM A;  2X6A A;  3UO3 A;  2UXX A;  1G6U A;  3OEH G;  3STZ C;  2JGD A;  1S77 D;  2Q7E A;  4OXS A;  4LCU C;  3ASO C;  4PI0 A;  1XBL A;  3JAR B;  5BY1 A;  1NTK H;  4FLW A;  3K5M A;  3MHS C;  1R6K A;  4B3T O;  1N0J A;  1PD3 A;  4LWS B;  1H2G A;  1XL4 A;  5KUK A;  5DN6 G;  3APO A;  4JTC B;  4RWU A;  1SQP H;  3GWK C;  2A7W A;  4WFF A;  3BCC H;  4X8A A;  2QWQ B;  3DC6 A;  3ZMV A;  3JSL A;  5HFL A;  1HDJ A;  2P4K A;  4X65 B;  1OCR C;  4FM2 A;  1AIL A;  2Q9L A;  1AP5 A;  2BSK A;  3WU2 Z;  4GX1 A;  1WJZ A;  3E22 B;  5LHI A;  4FVM A;  2WPD G;  4O2A A;  1DF5 A;  4JI7 B;  2H8P C;  2UXC B;  3HKE B;  1BE3 H;  1XIL A;  1KKD A;  3QTC A;  1WPB A;  4F6R B;  1N32 B;  2ZKO A;  3ABK C;  2JS3 A;  1Y4M A;  3HB3 B;  4X65 O;  2XAJ A;  3ETQ A;  3JCU Z;  3L73 H;  5CA0 B;  4PJ0 Z;  1YJ9 V;  1U96 A;  5LHH A;  2EX3 A;  3HR0 A;  1A32 A;  4MS2 A;  1JA8 A;  4UCS A;  4JI7 O;  3QF7 A;  4JI8 B;  2ZDI A;  1F4M A;  4BW9 A;  1U97 A;  1XOU A;  2UXC O;  1MOF A;  1K4C C;  3CRA A;  4JI5 B;  4X1I A;  5KHH A;  4LF5 B;  3RYC A;  2XAF A;  4PI2 A;  1N32 O;  1SA0 A;  4MTG A;  2IH1 C;  3CSX A;  2A3Q A;  4I9W A;  4LH6 A;  1EN4 A;  1NVP B;  4OGQ B;  1K8A W;  5EZY B;  1BT8 A;  5KUM A;  3ZN0 A;  2Q5Z A;  2DWD C;  4UVA A;  1SQF A;  3U10 A;  5TIS Z;  1XL6 A;  1JJO A;  3ZCC A;  4JI8 O;  4TV9 B;  3VQV A;  4I0X A;  2A9H A;  5EIB D;  4JI5 O;  4IHJ B;  3F7V C;  4LF5 O;  4A5U B;  2Z0A A;  3DC5 A;  2ZE7 A;  2DMX A;  2OIG A;  4F4L A;  4UVC A;  1QR8 A;  3RFR A;  4GLX A;  2WLL B;  3PJS K;  1YVW A;  2V1D A;  3JYC A;  3R65 A;  1TA8 A;  3SPH A;  2GV9 A;  3FYE B;  1RPO A;  3B77 A;  2WLK A;  1D5A A;  1AR4 A;  5K1P A;  5LGT A;  5GTI Z;  1NR1 A;  2E75 B;  1UPG A;  5JH7 A;  4L8J A;  1WB7 A;  2UXD B;  4NXM B;  4CS3 A;  2QJ1 A;  4UCO A;  5FNV A;  1Q3E A;  1VQN V;  1FKA O;  4UB6 Z;  3OFN G;  1RM1 B;  2P7T C;  4OX9 B;  3GWO A;  1Q5O A;  4TOI A;  2X7R B;  1P4R A;  3HKD A;  1H8E G;  4KXR A;  3SGI A;  1KB9 F;  1VQ9 V;  1RPR A;  2RNB A;  3F5W C;  5JVD A;  1KU9 A;  4ZHQ A;  2CAZ C;  4LFA B;  2UXD O;  4NXM O;  3JSN A;  3SR2 C;  3K0G A;  2ZE8 A;  2ZNJ A;  4DV2 B;  4JV5 B;  4FLY A;  2Y0P A;  4OX9 O;  4K35 A;  5EC1 C;  3ZRX A;  4JGS A;  5B1B C;  3RYI B;  3E8B A;  2E5L B;  2QDO A;  5L3B A;  2NR5 A;  3ZMT A;  2VS0 A;  5B1N A;  1V54 B;  1FXK B;  2AZ0 A;  1KEC A;  3DTU B;  3EHB B;  1HNW B;  4MVR A;  3APQ A;  3CJH B;  3QO8 A;  4LFA O;  2ZQM A;  1VQ7 V;  4GZR B;  3QG5 A;  2W6J G;  4DV2 O;  4JV5 O;  2DYR B;  2K1E A;  1PM9 A;  4IIJ B;  4IGG A;  4AIL C;  4MVQ A;  3LNM B;  5H6Q A;  1OCC C;  3SJB C;  2AZ2 A;  3FAV A;  3AG2 B;  4PHZ A;  5B1A C;  4UB8 Z;  3AK1 A;  3L70 H;  3JD4 A;  1HNW O;  1IXM A;  3K3W A;  1RSO A;  4O4J A;  3OMI B;  1R1B A;  2IJJ A;  1WB8 A;  2CTW A;  3BA8 A;  4LR3 A;  1CEZ A;  4FLV A;  1Q6I A;  2DN9 A;  4NKG B;  2JGD B;  2EIK B;  2DQ3 A;  3CX5 F;  1VF7 A;  4E4E A;  4FJC C;  1R73 A;  1ZLZ A;  1QHT A;  4B7K A;  5EYP B;  2ARH A;  1OCZ B;  1PNM A;  4Z1V A;  2N05 A;  2GDS A;  2EZP A;  4ASU G;  1XUQ A;  3IAY A;  2FL4 A;  3QO7 A;  5B66 Z;  4GYC B;  1SQB H;  4ZI7 A;  1FJG B;  3X2Q B;  4NVP A;  1FPO A;  2B1G A;  3ASN B;  2VRZ A;  1TUE B;  2ZD9 A;  4E2L A;  2QSA A;  4NTW A;  1GRJ A;  4D7S A;  2Q73 A;  4O2A B;  1NTZ H;  1WA8 B;  3H9V A;  3MHH C;  2JJ2 G;  1PV0 A;  2IJI A;  3OTF A;  3G4S V;  2FML A;  5LA6 A;  1FJG O;  4NR1 A;  3LNN A;  2HJF C;  1JFF A;  1K5S A;  1G1X B;  3AK2 A;  4G27 B;  1K92 A;  3ASO B;  1EZV H;  1SS3 A;  3L74 H;  2QKA A;  2ZIO A;  4CH6 A;  3N2G A;  5IYC O;  2ITC C;  2PYL A;  1PNL A;  2FYU H;  5IJ9 A;  1ORQ C;  1QCE A;  4DV3 B;  4X1I B;  3CXH F;  3RYC B;  3JAR A;  2R9A A;  1SA0 B;  2DWE C;  1NT2 B;  2IM9 A;  3AG1 C;  1BS3 A;  3U11 A;  4EKW A;  5K1X A;  4CS2 A;  1UFI A;  2L35 A;  1XRE A;  2GUZ A;  4MSW C;  4FIP C;  2ILM A;  2IU0 A;  1DGS A;  1R3I C;  1Y76 B;  2LGQ A;  1QLE C;  4I0X B;  4DV3 O;  4NTY A;  1DLB A;  4LH7 A;  3ZBH A;  3RBZ A;  1VF5 B;  3IC9 A;  2CTR A;  5D5P A;  4RUF A;  4DV1 B;  2CDY A;  3RGB A;  2ITD C;  1JMK C;  2Y4U A;  3CRC A;  3ZHR A;  4MTX A;  5KHI A;  2WLJ A;  4GKJ B;  1S5L Z;  3EFF K;  5EBW C;  3E86 A;  2YC0 A;  3OMN B;  4JTD B;  4MVM A;  5JH7 B;  3SDL A;  2YSU B;  4ZBM A;  2BCC H;  4MVU A;  3B4S A;  3OR7 C;  4DV1 O;  2WSS G;  4DV5 B;  2EIL C;  3HKD B;  4GKJ O;  3K79 A;  5JVD B;  4FMT A;  2F4V B;  3OD4 A;  2JGU A;  5LMN B;  3CPW U;  1O9G A;  5B3S C;  3TCU A;  4YHH B;  3E2E A;  1YXB A;  1BHA A;  3I5D A;  4Z1M G;  1AI7 A;  4TSF G;  3ZMZ A;  1M90 W;  5JWP A;  5F2V O;  5KHG A;  1B3Q A;  4U3F H;  2F4V O;  5LMN O;  3UKM A;  4DW1 A;  1P84 F;  1RP3 B;  1EFR G;  4WF9 V;  2XAG A;  2W0X A;  1KYO F;  4YHH O;  1Q6H A;  2IW5 A;  1S0V A;  1V54 C;  3VOU A;  1HP8 A;  3ZRW A;  1KQS U;  1FXK C;  4U7N A;  2MK3 A;  4TUY A;  5GON B;  1AI5 A;  5E1A C;  1I5Y A;  1L1F A;  3FAV B;  2R70 A;  2LFS A;  1MSD A;  1Z5W A;  1XHX A;  4UVB A;  4AQY B;  3WG7 C;  2DYR C;  4JPR A;  1RSO B;  4O4J B;  4P30 A;  4H33 A;  4J7K A;  2LO1 A;  2WA4 A;  4J7J A;  4PA7 A;  5LP6 B;  3FB5 C;  3E89 A;  3I55 V;  1SER A;  3NR7 A;  3OMA B;  2Q7H A;  3STL C;  2QWN B;  3LSU A;  2DYS C;  3OR6 C;  3OAA G;  2A0L A;  2BOB C;  1BMF G;  3LUT B;  2YUA A;  4AQY O;  3WFV A;  2F95 B;  2P22 C;  3BAB A;  3D3I A;  1QBZ A;  3QVN A;  4ZI7 B;  2QKS A;  1FXK A;  1G4Y B;  4JI1 B;  2LW1 A;  1PP9 H;  3CB2 A;  2HVK C;  3SPC A;  2LJ2 A;  2R9I A;  2KB1 A;  4JAA A;  1OCC B;  2ETN A;  2N74 A;  4XBF A;  3L72 H;  1H2S B;  3X2Q C;  5B1A B;  2EZO A;  5D5Q A;  2CTP A;  1Q7Y W;  5LGU A;  2UXB B;  3W7W A;  1CPY A;  4AI8 A;  4WFG A;  1WP7 A;  3SPJ A;  1KKC A;  1Y66 A;  3ZN1 A;  5LA6 B;  1ZL8 B;  1JFF B;  1YTF B;  2UU9 O;  4JI0 B;  5EIB C;  5FPO A;  4JI1 O;  3CS5 A;  4X1Y A;  3H1I H;  2HVJ C;  2IJK A;  4PDL A;  4O2B A;  3ZJZ A;  1PKX A;  4X1K A;  1EZJ A;  5JCO C;  5BMV A;  5J2T A;  2AHZ A;  3N2G B;  3K06 A;  2UXB O;  5IJ9 B;  2P67 A;  2G38 A;  2RJZ A;  3JD2 A;  5EYP A;  3AG4 C;  3GVM A;  2UUB B;  4TQD A;  5KX5 A;  4JI0 O;  3CRQ A;  2ZDI C;  1LR1 A;  2GUZ B;  1JQ0 A;  4JYA B;  3E35 A;  2ZE5 A;  3HKB A;  1QR9 A;  4CS4 A;  3SYC A;  3C3T A;  3CCU V;  3H01 A;  3K5O A;  1TGO A;  4HNA A;  2YIB A;  1S5J A;  1Z2G A;  2E74 B;  1RFY A;  1KMI Z;  1TUB A;  3B8N A;  2UUB O;  1HW7 A;  3M8A A;  3ZHT A;  1WA8 A;  1SQX H;  4OPH A;  5IE9 A;  2YXH A;  1R6N A;  1Y6X A;  4JYA O;  1BHB A;  4JI4 B;  4Q20 A;  5JCO A;  2ZNI A;  3HKC B;  3TGU H;  4P2Z A;  1GN6 A;  3KCY A;  1YJN V;  3DGE A;  4JYB A;  4UCR A;  1HNX B;  2F66 C;  4FLT A;  2PUS A;  2Z3Y A;  3SJQ C;  3K0D A;  4LF4 B;  3DXR A;  3AG1 B;  1YSC A;  4LFB B;  3MDS A;  2EUL A;  4GX0 A;  1YEW A;  1S5H C;  1FXV A;  3CHX A;  4DV7 B;  4O4L A;  1D2D A;  3A8T A;  4JI4 O;  4FFK A;  4J9Y B;  4PDM A;  2JJ1 G;  4P9P A;  1QLE B;  2ZIN A;  1YIT V;  4MVZ A;  1HNX O;  2YIB D;  5HFM A;  3K59 A;  2VWJ A;  4LF4 O;  1Y76 A;  4XDL A;  4LFB O;  3O9O A;  1YDX A;  3ZHS A;  4PDR A;  2WLH A;  2CGO A;  4YJ2 B;  4DV7 O;  1AR5 A;  1LNQ A;  2KKW A;  3P32 A;  2BE3 A;  3Q4H A;  3AEI A;  4LFC O;  1FFT B;  4K3A A;  4AHC A;  1R3K C;  3ZRS A;  1DTO A;  2WWW A;  4JAV A;  4DW0 A;  3K5L A;  3TJT A;  1N8R W;  3RW0 A;  3ICX A;  2UUC B;  1JOY A;  2QR4 A;  4DO2 A;  1VIB A;  2WLI A;  2OT5 A;  1ENV A;  5IDJ A;  1XDC A;  3ZRW B;  1KUQ A;  1K73 W;  4P9O A;  4TUY B;  2EIL B;  1E1Q G;  1XQ8 A;  1G8M A;  1VF6 C;  1EN6 A;  3B8M A;  4LF7 B;  4H0L B;  1WAZ A;  2XAS A;  5CN0 A;  4G28 B;  2PYJ A;  5BZB A;  5FPR A;  3C3S A;  4BAY A;  4UCV A;  2UUC O;  2XAH A;  1ZUQ A;  3IFX A;  2YIA A;  4YY3 B;  1PL4 A;  1D5N A;  5B3S B;  1GM7 A;  2ZCE A;  4FFB A;  1AI6 A;  2IJH A;  2QKC A;  2XUM A;  2ZT9 B;  3G67 A;  1Y67 A;  3EVK A;  2DOS A;  4LF7 O;  2CGN A;  3K04 A;  4MT8 A;  1X59 A;  4ICG A;  1WPX A;  4PEL A;  5LP6 C;  3CXC U;  5LYJ A;  2WA3 A;  3ZX6 A;  4YY3 O;  3SYO A;  3K58 A;  5DEC A;  1XNR B;  1BZK A;  5CBG A;  1IXB A;  1YHQ V;  2M6Y A;  1DK1 A;  1HWY A;  4FM1 A;  1EN5 A;  1VF6 A;  1GAX A;  4IYH A;  2HP8 A;  4LNU A;  1OJH A;  4J42 A;  3MAQ A;  3LDC A;  3JD1 A;  1K4D C;  4R8C A;  2ZM6 B;  2YEV A;  3WG7 B;  2XAQ A;  4FZ1 A;  5GON A;  1VQM V;  1XNR O;  1GMG A;  1S72 V;  1BQZ A;  3A0H Z;  2RDC A;  3BHP A;  1MMM A;  1WN7 A;  4X1Y B;  4O2B B;  4UFZ A;  5L3F A;  1M4U A;  4X1K B;  5J2T B;  5BMV B;  2DYS B;  2ZM6 O;  2UXN A;  5LP6 A;  1GTO A;  3CCS V;  3AG3 C;  3SJC C;  3FX7 A;  4HZ3 A;  1H2L A;  1PNK A;  5FLX N;  3KCX A;  3RWR D;  5KX5 B;  3E8F A;  5L3E A;  3S3W A;  1SF9 A;  2AW9 A;  3CEI A;  2AHY A;  2ZR3 A;  2HKO A;  3K9A A;  3HKB B;  4PV1 B;  4DV6 B;  4MW3 A;  2QTS A;  4G2K A;  1GM8 A;  4C7U A;  1VQ4 V;  3MD0 A;  5IYZ A;  1N33 B;  2EIM B;  5EBL C;  4HNA B;  1COW G;  1M56 C;  1TUB B;  4I55 B;  1QLN A;  3OGC C;  4KL1 A;  3VQY A;  1W0K G;  3P3N A;  3VQW A;  1BL8 A;  1FS0 G;  1V55 B;  3KG2 A;  1F23 A;  2B9Z A;  5KA5 A;  4DV6 O;  1V9P A;  5LHG A;  1OZ0 A;  1ZL8 A;  3K08 A;  4EB6 B;  4RQE A;  2RCV A;  2D3O W;  4I4T A;  4DXW A;  1N33 O;  5LBQ A;  3FD9 A;  1ZX3 A;  3ABM B;  4W4L A;  2JEX A;  2YS8 A;  2PF4 E;  2V7Q G;  3AG4 B;  1OHH G;  4X62 B;  2F1M A;  3IC7 A;  3DXR B;  2Q8V A;  4JYY A;  3UO2 A;  1THZ A;  4NXN B;  3OEE G;  4O4L B;  4BR6 A;  4RQF A;  1JJ2 U;  2IU3 A;  3OM3 B;  1CP9 A;  3ML0 A;  3BFR A;  2LFR A;  4N23 A;  2EIJ B;  4QPK A;  1NH2 D;  4H44 B;  4CC5 A;  2HJD A;  5JQG A;  5L3G A;  2C2A A;  3RYF A;  4GUN A;  3M7M X;  4X62 O;  3QO5 A;  2YI8 A;  3WB1 A;  3CC7 V;  4NXN O;  1Q43 A;  2P90 A;  3JAK B;  1KD1 W;  2Q4P A;  3Q4H B;  5B1O A;  2Q69 A;  1VQL V;  3DSQ A;  1JX9 A;  5DED A;  3T1Y B;  5GW7 A;  3A0R A;  1K3E A;  1GM9 A;  3ETD A;  3HKC A;  4Z2W A;  2XND G;  2WLI B;  1NS1 A;  3E8G A;  1CXZ B;  2JRI A;  5IWA B;  4DYL A;  1F4N A;  1IUR A;  2QM7 A;  2PGG A;  4LF8 B;  1EBO A;  3RT3 C;  3RYH B;  3E8H A;  4X89 A;  2W0F C;  1VMG A;  4D6T H;  3T1Y O;  1AP6 A;  3LDE A;  4UCT A;  1US6 A;  2KG7 A;  4U3J A;  1R3L C;  1QNM A;  4BIO A;  1YJW V;  4GKK B;  4FFB B;  2IH3 C;  2YIC A;  4X9Q A;  4FM0 A;  3CCJ V;  1SQG A;  3GB7 C;  5IWA O;  1F7Y A;  3JAL A;  2A79 B;  1JPX A;  3CCQ V;  5JJN B;  1Q86 W;  4LF8 O;  4X20 A;  1XMQ B;  4O4I A;  1YF2 A;  5LYJ B;  4YJ2 A;  1B06 A;  2H94 A;  4KP4 A;  1N0N A;  4GKK O;  5KAI Z;  1QVF U;  2NNU A;  3JAT A;  2F23 A;  5BXZ A;  1WP8 A;  3SPI A;  1MZE A;  4LP8 A;  1GK9 A;  2E76 B;  3IJ4 A;  3CMA V;  1KP3 A;  4K8X A;  4LNU B;  1XMQ O;  3UCS C;  4JF3 A;  2QWR B;  2YEV B;  5B5E Z;  3K03 A;  3S3X A;  1ARO P;  3C90 A;  2M7W A;  4PA6 A;  4B3S B;  1NZ6 A;  2JK5 C;  3F7Y C;  4R50 A;  1M1K W;  2P5O A;  1P7B A;  2GTS A;  3CCE V;  4YJ3 A;  1K33 A;  3RVZ A;  3A2F A;  1Q90 D;  1IVS A;  5J2U A;  4TT3 G;  3W7X A;  2ADQ B;  4MTF A;  4WBN B;  2GSM B;  3JD3 A;  2Q0A A;  3BAA A;  2X6C A;  4QPJ A;  1K9M W;  1TVK A;  4GT1 A;  4H37 A;  5CBF A;  4B3S O;  3CRM A;  1ZSP A;  2O57 A;  4QIW F;  5LL6 Y;  1SZX A;  4U7O A;  4XDK A;  4BIZ A;  4UXN A;  5DM6 V;  4RUE A;  5IYB O;  4QE7 A;  5IYZ B;  2UU9 B;  3K5N A;  4TV8 A;  2OTJ V;  4I50 A;  1VQP V;  3OW2 U;  1IDS A;  4HAM A;  2N04 A;  2AXT Z;  5H9C A;  1MSW D;  1X4T A;  4YXW G;  2FB5 A;  2HFE C;  1J95 A;  2EIN C;  2EIM C;  3OUS A;  1YIJ V;  2JEU A;  3HPL C;  1H38 A;  2PY5 A;  1NKD A;  1GN2 A;  2W6I G;  1H2M A;  4I4T B;  1MZF A;  3AG3 B;  3CC4 V;  1V55 C;  2ZXW C;  2ATK C;  4JYC A;  2F93 B;  4DR1 B;  1SET A;  1H8H G;  1FD9 A;  1AB3 A;  3VQX A;  4CH3 A;  1XMO B;  4JTA B;  3G6E V;  3ABM C;  2RN9 A;  2WLM A;  4LBE C;  1PPJ H;  1VAR A;  1BQ0 A;  5LOV A;  2LQT A;  5JQG B;  1NJI W;  2RQ6 A;  3BEH A;  4B08 A;  3RYF B;  1M9N A;  1LUW A;  1M56 B;  1IBL B;  5KLV H;  4DR1 O;  2LGW A;  2OCC B;  1DF4 A;  1XMO O;  2L6L A;  2EIJ C;  2K9P A;  4DV0 B;  2EJR A;  1B6Q A;  2JVD A;  1Q6U A;  1XEQ A;  3ETE A;  1W59 A;  4I55 A;  3W7S A;  3TXS A;  4GCZ A;  4LF6 B;  4CC6 A;  3QNE A;  1IBL O;  3UM7 A;  4DRX A;  3CME V;  1WLE A;  1N4C A;  1L0N H;  4EB6 A;  4DV0 O;  1EM1 A;  1AR1 B;  5L3C A;  3FKS G;  3FB6 C;  4X66 B;  4B3R B;  1W2B U;  1I08 A;  4IYI A;  3O65 A;  2QWP B;  3T4Z A;  1J5E B;  4LF6 O;  3JAS B;  1QVG U;  2KG7 B;  4J41 A;  4U3J B;  1VQO V;  4DR4 B;  3BA9 A;  1I0H A;  4LFC B;  1OCO B;  5CB4 A;  1IZ3 A;  5CA3 A;  3JAL B;  3CCV V;  1GO3 F;  4X66 O;  3J81 N;  4B3R O;  1IBK B;  1URF A;  4FLZ A;  4WFH A;  2P4V A;  3ABT A;  3B09 A;  4X20 B;  4X88 A;  5CA1 A;  4O4I B;  4DUY B;  3RN4 A;  1HR0 B;  1J5E O;  4DK1 A;  3JAK A;  4DR4 O;  1K5Q A;  1FFX A;  4MVO A;  4NB5 A;  2FKX A;  5LXT A;  3CRR A;  4W4K A;  1P49 A;  3JAT B;  2QE7 G;  1IX9 A;  2QM4 A;  3FFQ A;  3A0B Z;  3BRC A;  1L0L H;  4JI2 B;  1Z5V A;  2XHB A;  2GHY A;  1K34 A;  1IBK O;  2B1I A;  2R9R B;  1B04 A;  4O4H A;  2OTL V;  4BW5 A;  3R66 A;  1BGY H;  4DUY O;  1HR0 O;  1KP2 A;  4I9Q A;  2QM8 A;  2BTQ A;  1MNG A;  3ZHV A;  1E1R G;  4UUJ C;  2XOK G;  2OCH A;  3F5T A;  3T2M A;  3RVY A;  3RYH A;  3L75 H;  4IT5 A;  1N34 B;  1R6T A;  4JI2 O;  5A2Q N; 
#chains in the Genus database with same CATH homology
 1BE3 H;  4D6T H;  4PD4 F;  1SQX H;  3BCC H;  1NTM H;  3H1L H;  1SQV H;  2FYU H;  1KB9 F;  1BCC H;  5KLV H;  1BGY H;  3TGU H;  1SQB H;  3CX5 F;  3CWB H;  3CXH F;  3H1K H;  1L0N H;  1NTK H;  2A06 H;  1PP9 H;  3H1J H;  3L70 H;  4U3F H;  3H1I H;  3L73 H;  1NU1 H;  1PPJ H;  1EZV H;  1P84 F;  1SQQ H;  2BCC H;  3L71 H;  3L74 H;  1L0L H;  2IBZ H;  3L75 H;  3L72 H;  1SQP H;  3H1H H;  1NTZ H;  1KYO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...