1PV0A

Structure of the sda antikinase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
MRKLSDELLIESYFKATEMNLNRDFIELIENEIKRRSLGHIISVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sda
publication title Structure and mechanism of Sda: an inhibitor of the histidine kinases that regulate initiation of sporulation in Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2003-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08970 Sda Sporulation inhibitor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1100 Mainly Alpha Orthogonal Bundle Helix Hairpins Sporulation inhibitor A 1pv0A01
1PV0A 3D36C
chains in the Genus database with same CATH superfamily
4DR2O 3ZJZA 2HKOA 4DV4O 4LFAB 2XAJA 1HWYA 4FLVA 3I56V 1EBOA 2HP8A 5KUKA 3CXCU 3OTFA 3CJHA 2QWRB 1AI5A 2WLIB 1L8DA 2PGGA 1XUQA 3M8AA 3BFRA 3BA9A 2QM4A 3ZIAG 4R7CA 4K0KB 1XBLA 2JS5A 3B09A 2KQXA 1VQOV 1SERA 1DF4A 1N0NA 3JD2A 4YHHB 1U96A 2OCHA 5KMGA 3K79A 1PNMA 3CRMA 3FAVB 1AILA 3JAWA 5A2QN 3OT7A 1HW7A 1LR1A 2B9ZA 4FLYA 3Q4HB 5B1BC 2ZXWC 5J2UB 3CCLV 4BIUA 5FNVB 1R6NA 2XNDG 2Z3YA 4O4JA 2WLHA 1G8MA 5IJ9B 5BMVB 3RYFB 2WLNA 3ETQA 3FKSG 4JYAO 4TT3G 2ILMA 3FYIB 2FYUH 4KP4A 1S0VA 1ZUQA 1N32B 2CE4A 3OE7G 3QO7A 4O2BA 4BIOA 1RPRA 2F43G 1KP2A 1JA8A 1Z5VA 4O4HA 1H8HG 3RVZA 1K5QA 2ADQB 4ZI7B 5CA0A 4JI4B 3UO2A 3OAAG 4RAIA 1SA0B 1R3KC 4JV5B 2UUCB 3CCJV 4DR6O 2Z5UA 4EEQA 4K0KO 1KP3A 1FJGB 2XUMA 1YF2A 4DRXB 1YSCA 1I94O 3ABMB 1NH2B 4FZ0A 3WB0A 4F6EA 2Q73A 4P30A 1HNXB 4IIJA 5EK0A 1GN3A 3H1HH 2XT9A 4K3AA 1HNWO 3U10A 2JJ2G 3J80N 3JARA 4JASA 2YSUB 1XMQB 3K5MA 3DGEA 5B3SB 1T5EA 1BGYH 4YJ2A 1AJNA 3SJQC 2ZE6A 3K3WA 3KKYA 5K1XA 2HR3A 2ZKOA 3RYCA 4OPAA 1MSDA 2YIAA 3HKDB 2DWDC 5B1AC 1QLNA 2YI9A 4HZ3A 4PDMA 3JD1A 1H2LA 3ASOB 3VQVA 1GAXA 5C8YA 4I50A 2IW5A 3TK1A 2X6BA 4PV1B 2P06A 1YI2V 1XREA 2BCCH 3ZRSA 2CUGA 1QNMA 3B77A 4LF8B 2ZCEA 3SR2C 4BW9A 1D5AA 2UUCO 5B1NA 5CN0A 1Q81W 4X66B 4JZGA 1EM1A 1Y74A 3A0RA 1BQZA 4DUZO 1W0JG 3WB2A 5KHIA 4DR5O 2B1GA 4GX5A 2A0LA 3LDDA 3CRAA 1MG1A 2DMXA 1NT2B 1K5SA 4DV0B 2E74B 1XOUA 4YIPA 1S5JA 1SQVH 1WNSA 1PD3A 2FB5A 1W59A 2YC0A 4UB8Z 3ZMVA 4JPRA 3RVYA 5CBGA 4ZOLB 4I5SA 1WA8A 1R3LC 1JJ2U 1AJQA 2XTAA 3X2QC 1IDSA 1UPGA 2GTSA 4LH7A 5EBWC 1W2BU 4RQEA 2WLJA 3ICXA 1O9HA 1XI1A 2ZIOA 5LHGA 4LFBO 5IY5C 5IYDO 1AP6A 3D3QA 1COWG 2VS0A 5BY1A 3BEHA 3D8CA 1G4YB 3VBBA 2P90A 4WBNA 1YEWA 3FAVA 5CA3A 4LF7B 4Z2WA 1HP8A 4EFBA 5EBMC 4X1IA 4RUEA 2A79B 1QR9A 4MVQA 5J2UA 1J5EB 4TV8B 5H2FZ 5B66Z 3ZCCA 1GM8A 1K33A 4UVBA 3R65A 5BMVA 1MZEA 4NTWA 2QGNA 4O2AB 3G80A 3S3XA 3N27A 3ZMSA 2NR5A 2E76B 1F23A 1TVKA 2YUAA 2JEUA 1KKDA 1S76D 1SQXH 4RWUA 2YXHA 3ZRVA 3CHXA 5CA1A 5KAIZ 3ZHVA 4YXWG 5LP6B 2GTAA 4DW0A 2LW1A 5DM6V 3N2GA 2UU9B 5LGNA 2UXDB 2EIMB 4JI0B 3D36C 4LFCO 2GUZB 1OV9A 4I55A 1Y66A 2Q0OC 2QKCA 4NYKA 1Q82W 1OJHA 4MSWC 2XASA 3CCMV 4W4LA 1QBZA 4FLTA 1ZL8B 3ASNC 2Q7EA 1XDCA 1M57B 2EJ7A 4X1YA 4B3MB 4DV7B 2X6CA 4D6TH 3F7VC 5LHHA 4P9PA 2AW9A 2RN9A 3ABLC 5D5PA 2CH7A 3T4DA 4PD4F 4JAVA 1Q43A 1M93A 2EZPA 4ZKIA 1MZFA 3LDCA 3ZHSA 3LSUA 1Y76B 3SJCC 2OT5A 2H3OA 1OCZC 3BA8A 4FFBB 3HPLC 1HNZO 3BPZA 3JCZA 4JI8B 3L72H 3SYOA 4J9ZB 4B3TB 2YEVA 5JJNB 1LUWA 4LF5B 4GLXA 1R6TA 1NTKH 3G71V 1IVSA 4FVMA 1Y4MA 3E89A 1QVFU 4NVPA 3E8FA 5BR8O 2ZE5A 3K57A 2PTMA 1AR1B 2YXYA 3TCUA 1NS1A 3E8GA 4LF4B 4X20A 3VOUA 1WB8A 4U7OA 2ZNIA 1VQ7V 2UU9O 2UXDO 3GWOA 2WLLB 2VQFB 2F95B 5KMGB 3OUSA 2XAFA 3JAWB 1KQSU 2QWQB 4UCOA 3G4SV 1J95A 2ETNA 1RM1B 2ZR3A 3RYHA 2LJ2A 2LP7A 4DV7O 4B3MO 2Z0AA 4O4JB 1PP9H 1S72V 1VQ4V 4AHCA 3ETEA 5IWAO 3RYIB 3ZHQA 2KB1A 1AI6A 3B2EE 1R73A 1UJWB 1ZSPA 3L74H 1R3JC 3CCRV 2ZDIC 4F6RA 2F4VO 1JQ0A 4B3TO 3WFVA 4LF5O 3RN4A 2BTQA 1VF7A 3C3SA 2ZM6B 2EILB 5CA0B 4HBNA 5KLVH 1YTFB 2Q68A 5KHKA 3CC7V 2KSDA 2ZNJA 4JAAA 3TETA 1K7DA 2FMLA 2IM9A 4D7TA 2N74A 3N2KB 1OCOB 2LW7A 4LF4O 1FXKC 4UXNA 1ORQC 5LGTA 4LCUC 2VQFO 3ZN1A 1LNQA 1VF5B 4J9YB 1R6KA 4XDJA 5KA6A 1VIBA 3CX5F 4OGQB 4IIJB 1XHXA 1IBKB 3DC6A 2M7WA 3FB6C 2DW4A 4LH6A 5BZBA 4KUMA 4MVUA 4TV8A 2LO1A 2DYRC 3JARB 3M7MX 2Q7GA 1NBMG 4YJ2B 2JGDB 3SYAA 3AG1B 2UXCO 5B1OA 4LF9B 4DUYB 1DTOA 3RYCB 4BW5A 4B7EA 1JJOA 5C8YB 4I50B 4OPHA 2OWOA 1LUVA 4JI1O 1US6A 4FM1A 4BWAA 1AB3A 3UO3A 2IJKA 2R72A 3EXAA 4MW8A 4HYOA 4LF6B 1QLEB 1XNRB 1GM7A 1Y74B 2JRIA 3J7AU 4AQYB 1M56B 2DOSA 2Y69B 3HB3B 1YVWA 3G6BA 4JTAB 1YJ9V 1M1KW 1I5XA 4JF3A 3ZS8C 4JYBA 2QA4V 2M6YA 4PI0A 5IDJA 2D2CB 4OX9O 3UQ8A 1Z5WA 3UKMA 2YXLA 3CRCA 4LF9O 4DUYO 3SYPA 1WA8B 3GWKC 1XILA 2EINB 1N33B 1JCHA 3LSSA 1MABG 1GN2A 4HNAB 4U3JA 1NR1A 1EN6A 2OCCB 3A0BZ 3SYQA 2VRZA 4I7ZB 3OW2U 1VF6A 1N34O 2YICA 4UVCA 2WLLA 5FPRA 4WFFA 2Y4TA 4H33A 4WBNB 3T2MA 4LF6O 2IJIA 1MA1A 2Y48A 1XNQO 1XNRO 4CS2A 4J11A 4X1IB 1NKDA 2H8PC 4Z1MG 1QQCA 3JAKA 4AQYO 3MHSC 5EIBC 1THZA 1Q7YW 2WA4A 2HVKC 2QM7A 3OUFA 4X88A 3FX7A 5KHGA 2EIJB 4Q20A 3RYIA 1GO3F 4FM2A 4TV9A 3WU2Z 2K1EA 4X64O 1TVKB 2HEPA 2KG7A 2PF4E 4ASUG 3ZN0A 2HJDA 2P5OA 1JMKC 5H6RA 2WA3A 4CH3A 4LFAO 1MSWD 1WJZA 5CA1B 3L73H 2GDSA 3K9AA 3CP1A 1YDXA 3CCEV 3N2GB 4JZ2A 2L6LA 1N33O 3SDLA 1UFIA 1ENVA 4I55B 3ZHRA 4IL6Z 2ADPA 4GCZA 2K9PA 3AK3A 3N2KA 2HFEC 5CB4A 1EZJA 2IH1C 4FLZA 2CK3G 2XAQA 4O4LA 2LGWA 2JVDA 2ZE8A 1MOFA 4YHHO 4X1YB 5EZYB 2ATKC 3JSLA 4K35A 1EN4A 4D7SA 2W6JG 4MT8A 5JJEB 3P30A 4MTGA 3IJ4A 2CH7B 5B5EZ 1P7GA 2QKSA 2W6IG 2JDIG 4YJ3A 5B1BB 5DECA 5EIBD 3CYOA 4LWSB 4PDLA 2UXNA 1KECA 1F51A 4GYCB 4CS3A 4EKWA 2ITDC 4H0LB 2OYQA 3H9VA 1BZKA 1KB9F 3CRQA 2YEVB 2JGDA 4MTFA 3CWBH 1DGSA 4DV6B 1N32O 3CB2A 3DSQA 2Q69A 1PNLA 4FIPC 1FKAO 5LXTA 4IYIA 1R1BA 1YIJV 4BR6A 5LBQA 3MD0A 1Q6HA 4NTYA 4PDRA 4JI4O 1F4NA 4X20B 5LA6B 3AK2A 4FLXA 3E83A 1XMOB 3APOA 4JV5O 4X62B 5L3BA 4TOIA 3AG4B 4G2KA 2A06H 2IJJA 1N8RW 4JI7B 4DV1B 2DQ3A 3UCSC 3K58A 3IGAC 1FJGO 4JAUA 3LNMB 2AGAA 1VQKV 1ZWIC 1FXKA 1TAEA 3C90A 4UUJC 3RYHB 4IYHA 5F2VO 3VQWA 3JYCA 1HNXO 3OMNB 4JGSA 2QR4A 4DW1A 1DF5A 1GKFA 1AI7A 4FFKA 4BIZA 1NJIW 1RPOA 3RFRA 2E3CA 3HKEA 1XMQO 3JALA 4R8CA 4F6RB 4UV9A 5IYCO 2FKXA 2YIBD 4I4TB 2BOBC 2AZ2A 2BTQB 3D3IA 1V55B 4DV6O 3JATB 4ZBMA 3ZHUA 2RDCA 3VQXA 4HNAA 1AJPA 4UCRA 4GX1A 4U7NA 2DYSC 1Z2GA 5LP6C 2JIZG 2F93B 1Q90D 2AZ0A 3TXQA 4LF8O 4DK1A 3H1JH 4X62O 3ABKC 4IHJB 4I0XA 4WFEA 5J9PC 4X66O 2OIGA 4DR1B 1K3EA 1Q8IA 3W7UA 3SGIA 1BHAA 4IGGA 2PYJA 2HJFC 3AG3C 3ZMTA 2IJHA 1BHBA 1BE3H 1NVPD 4J10A 2Q0AA 1GRJA 1XHZA 4DV0O 3E8BA 5JCOC 3FYEB 3K04A 5KHHA 5LGUA 4B3SB 3CSXA 4J42A 4UB6Z 1WAZA 1B06A 2EX3A 1RFYA 1OCRC 1VP7A 4P9OA 4J7KA 2L35A 2X0LA 4U3FH 4TSFG 1YJNV 3UT5A 3IFXA 3H1KH 5LOVA 1GK9A 1IXMA 3DTUB 4XBFA 4UCUA 1GH6A 1AR4A 4YY3B 1WLEA 4LBEC 1PL4A 1JX9A 4QIWF 5LYJA 2PZSA 4XDLA 4JTDB 1BT8A 1ZX3A 5IY5B 3QG5A 1KBHA 2O57A 4UFZA 5EZYA 4F4LA 4JI3B 3K0GA 2B5UA 4LNUA 1SQFA 4LF7O 3FB8C 4EB6A 1CPYA 5LMNB 2UUAB 3STZC 2NNUA 4MTXA 3KZIZ 1OCCC 5HFLA 4JI2B 1NZ6A 3ZRXA 5H6QA 1EZVH 5GW7A 1RM1C 1J5EO 1OZ0A 4FPPA 4MW3A 1Q6UA 4H44B 4LWSA 3AG2B 2F1MA 4G27B 1GN4A 4P2ZA 3GVMA 4C7UA 1NU1H 1AROP 3MAQA 1B6QA 4QJFB 4TQDA 4E4EA 2ODMA 2ZIMA 1L0NH 1W0KG 1L0LH 1FFXA 2RCVA 3QVNA 5KAFZ 3K5OA 2Q8VA 4DO2A 4JYCA 1BMFG 1OHHG 2WLMA 4U3JB 3GB7C 4CZZA 2P6JA 5LA6A 2IU0A 1GMGA 4I9QA 2EILC 4KFMA 4JI0O 5LMUB 1TUBA 4BAYA 1N4CA 3OEHG 3CC2V 5L3DA 2LFRA 5E1AC 4NB5A 4PA3A 1BSMA 3K03A 5LL6Y 1OCOC 3E86A 3WG7C 2Q67A 2Y4UA 2EJRA 3JAKB 1KUQA 4DXWA 2D3OW 3ASNB 2HLDG 1CEZA 1B3QA 5EBLC 1CP9A 2UUAO 4J7ZA 3HKBA 1P84F 1JFFA 1V54B 4TV9B 3ZEDA 1E79G 2KG7B 4QE9A 1FD9A 5JWPA 1KD1W 1OCZB 4JI8O 2ITCC 5KHJA 4I4TA 2YIBA 4MVRA 1VQ9V 1ZAUA 1VQ8V 2BSKA 4L87A 3JATA 1F4MA 3L70H 2VQEB 4RQFA 1FFTB 1S5LZ 2ZT9B 2V4DA 3IC9A 1SQPH 1SS3A 5CB4B 3I55V 2QE7G 1H38A 2PI4A 4DR3B 4O4LB 3ZHTA 3E22A 5LMUO 3RT3C 1FS0G 1VMGA 1KC8W 3HR0A 2KKWA 4IHJA 1N36B 3KG2A 5CBFA 1IBLB 4WFHA 3OD4A 4JI6B 2NN4A 2AXTZ 1K4DC 3ZMUA 4YJ3B 1M56C 2EIKB 1TGOA 4QE7A 1D2DA 3VQYA 2JJ1G 2QWNB 4H13B 1GTOA 2BOCC 4GZRB 5IYBO 3RW0A 5JVDA 3F5TA 3T1HB 3DXRA 5LHIA 1AP5A 2HHHB 4GX2A 4JTCB 1SETA 2CTWA 2Q7HA 5LXTB 5C93A 2CTRA 1I08A 4GX0A 3TJTA 2DE0X 3QF7A 3E8HA 4ZIBA 4DV4B 2Y0IA 1EFRG 1NTZH 1SQQH 1V9PA 1D5NA 2ZM6O 3QNEA 1O9GA 4B08A 2EINC 3L75H 3TXSA 4JYYA 3BY6A 4IT5A 4RO2A 3ETGA 4PHZA 3FFQA 2Q6AA 4CS4A 1FXKB 5TISZ 1VQ5V 2ARHA 2VWJA 4DR3O 2DQ0A 2YS8A 1I5YA 4NTXA 3K08A 4WFGA 2QKAA 2WWWA 4KL1A 5EC2C 1U97A 2V1DA 1IBLO 1IBKO 4JI6O 2CAZC 4HAMA 2P4KA 3MDSA 4ICGA 5JQGA 4KHPB 3SYCA 1WP7A 3HKEB 1XL6A 3JALB 3J81N 4I9WA 1SZTA 2DYRB 4PA6A 1H2GA 3H01A 3LDEA 4MVSA 2EBOA 3OM3B 2C2AA 2JS3A 2DJVA 2DWEC 2EIJC 2AHZA 4YIOA 3BAAA 2MK3A 1BS3A 1F7YA 1ZLZA 1HDJA 1RSOA 3I5DA 1BQ0A 4DR4B 3F7YC 5EYPB 1K4CC 3D36A 3K06A 4B7KA 3EVKA 4DR6B 5D5QA 4I0XB 3SPHA 4MTOA 3K5NA 4FM0A 3IC7A 1ROPA 3ABMC 5GONB 4DV3B 3K59A 1I94B 1DLBA 3B40A 1M90W 5ITZA 5FPOA 2OTJV 4MVMA 2UXBB 2IBZH 2RJZA 2QEXV 3CCSV 3OGIB 2RQ6A 3OFNG 1HNWB 4KHPO 4DV5B 3A0HZ 2ZE7A 2HVJC 5B3SC 2CTQA 3UT5B 3CC4V 5LOVB 5E79Z 1PV0A 3FD9A 4JI5B 2YDEA 1QR8A 2R9IA 3KCYA 3TGUH 1VQLV 4X8AA 3ASOC 4CH4A 2UXXA 1Q6IA 5LYJB 1HR0B 1PPJH 4K8ZA 3ABTA 4DR4O 1IZ3A 4L8JA 3PN1A 5KUMA 1XQ8A 5JH7A 4O4IB 2RMKB 3AG4C 4LNUB 3OMIB 2UUBB 4PELA 4EB6B 3ZX6A 3R66A 3STLC 3P3NA 5IJ0B 2QTOA 1Q86W 4DV3O 4DUZB 3QO5A 3AK1A 1TUEB 3HKCA 4DR5B 1NH2D 3SPJA 2ZXWB 5L3GA 2JK5C 2UXBO 1URFA 4E2LA 4J80A 3JASA 5H5NA 1AR5A 2NLJC 3OEEG 4DV5O 1FXHA 1FPOA 2DN9A 1FFXB 3C3TA 1S5HC 3T1YB 4GKKB 3U11A 1CXZB 2ZDIA 5EC1C 2ZQMA 4A5UB 5CMUA 1V55C 4LP8A 3OR6C 2CGNA 4JI5O 4X1KA 2PUSA 4DR7B 3SJBC 1QCEA 1IXBA 5IYZB 1TUBB 1FAFA 2F23A 4ZHQA 3P32A 2N04A 4PDVA 2N05A 1I0HA 3FB5C 4NXMB 3SPGA 1GM9A 2QWOB 4GUNA 1HR0O 3E35A 4X65B 2ZR2A 4LFBB 2ZD9A 1YITV 4Z1VA 3T4ZA 5DEDA 5KX5A 1MMMA 1IX9A 2UUBO 3CCVV 3LNNA 3A2FA 1H2KA 1PNKA 1H2NA 5IE9A 3F5WC 3HKBB 1JFFB 1M5IA 2IH3C 2XOKG 1KMIZ 1AVMA 1JR9A 2BTOA 5J2TA 2P67A 3O9OA 3JAMN 4FJCC 2P7TC 4G28B 4DK0A 4J41A 2BSKB 2CGOA 1H2SB 4PI2A 3K9SA 5FLXN 1YCIA 4UCVA 3T1YO 1P49A 1YHQV 2LQTA 5B1AB 3BHPA 4GKKO 2R70A 1WB7A 5GTHZ 3W7XA 2JGUA 2LFSA 1X59A 2Q4PA 2A7WA 1WP8A 2XAHA 4PA4A 1XMOO 2WLIA 3H1LH 2PY5A 4DR7O 1NTMH 2AHYA 5EYPA 2EIMC 3E22B 1SRYA 4LFCB 4JI7O 4DV1O 1G6UA 4NXMO 1KU9A 4DV2B 4N21A 4X65O 5GONA 4UCTA 2CTPA 2WLKA 4CC6A 1M57C 4AI8A 3UM7A 1IURA 4NXNB 4QPKA 4CH6A 3CS5A 3CEIA 4FLUA 1NVPB 3PJSK 2XAGA 3M99B 1BL8A 5JJJB 5JVDB 3MHHC 1IBMB 3CE2A 3DXRB 1VARA 2VWKA 1B04A 2P22C 3ABUA 3Q4HA 4H37A 3CCQV 1H8EG 4K8XA 5FNVA 4TUYB 2HG5C 3AG2C 4MVZA 5IJ9A 1HNZB 1K8AW 2BE3A 3RYFA 4NR1A 3IAYA 4KXRA 5GTIZ 3THOA 4B3RB 2WSSG 1EN5A 4PJ0Z 3L9DA 3X2QB 4ABMA 3B8NA 1SQGA 2E5LB 1A32A 2P4VA 4J7JA 3EHBB 2WAMA 3FB7C 4EFEA 5BR8B 2B1IA 3G6EV 2Y0PA 3JSNA 2DYSB 1AI4A 4ZI7A 2X6AA 3JD3A 1VF6C 5K1PA 2QJ1A 3O65A 4GKJB 4O4IA 2RNBA 1SA0A 1YXBA 2IU3A 3ABKB 5DN6G 3W7SA 4UVAA 3DC5A 4QGPA 4DR1O 2WPDG 5IJ0A 4UCSA 3JD4A 4DV2O 2OIEA 1QU7A 4DRXA 2W0XA 3CXHF 4W4KA 5JQGB 4R50A 4QNHB 1ZTEA 2G38A 3LUTB 4NXNO 3CD6V 3AG3B 4MVOA 1K92A 1Y67A 3RGBA 1M9NA 1IBMO 1BCCH 3AEIA 2XHBA 5IWAB 1S77D 1JVMA 1KYOF 4B3SO 1V54C 3W7WA 4TWKA 3T1CA 5BXZA 3ZRWB 3ML0A 4N23A 3APQA 2GHYA 2A9HA 1VQ6V 2CDYA 1Q5OA 4TQFA 1OCRB 1NR7A 4X89A 1RSOB 2EULA 2F4VB 3A8TA 3ETDA 5A9GA 4B3RO 3BCCH 4LC1A 3CJHB 4CBCA 3H1IH 3HKDA 3SPCA 2E5LO 5IYZA 1E1RG 4YY3O 2H94A 2LGQA 4FMTA 2GV9A 1DK1A 1K97A 2A3QA 4WFAV 5L3CA 2QSAA 2ZINA 2QTSA 3CPWU 3CMAV 5L3EA 1N0JA 3NXSA 4AILC 2QM8A 1PKXA 4Q6GA 3OR7C 1VQMV 4GKJO 1SESA 3OMAB 4FZ1A 4JI3O 2QWPB 5ITZB 3B8MA 2YIDA 1NQTA 3S3WA 1PL0A 5LMNO 1JOYA 4PA9A 4PA7A 4CC5A 1L1FA 4FLWA 3ABLB 4JI2O 1OCCB 2MW2B 3JD0A 2PYLA 1XL4A 2Q9LA 2EZOA 2EIKC 2JEXA 2PI5A 3WB1A 3OTOB 3KCXA 1SF9A 1RP3B 1S3JA 2Q5ZA 2GSMB 3L71H 1K73W 2GBOA 3AG1C 5L3FA 1XEQA 1FXVA 2YI8A 2UXCB 2FL4A 4FK5C 4QPJA 1VQPV 4O2BB 4WCEV 3BRCA 3CRRA 3CMEV 3AG7A 3P3PA 4O4HB 1I7FA 3SPIA 1MNGA 4R6ZA 4ZOLA 4JI1B 2QDOA 1SZXA 5AG2A 5JH7B 1Y6XA 1K34A 1VEWA 1YTFD 5KA5A 1QLEC 4OXSA 4LR3A 1NI8A 3ZBHA 3WG7B 3JCUZ 2W0FC 3HKCB 5HFMA 2Y69C 1KKCA 4XDKA 2R9AA 1FYJA 3JASB 1P7BA 4X9QA 1P4RA 1H2MA 4NKGB 3U0ZA 4MS2A 1QHTA 1SQBH 5IT9N 4TUYA 3OTOO 2V7QG 4GT1A 1TA8A 2FTKA 2R9RB 3BVOA 4DR2B 1PM9A 1SC5B 4OX9B 4O2AA 3OGCC 1G1XB 2F66C 4WF9V 1M4UA 3QTCA 4X1KB 2VQEO 1SKVA 1WN7A 1X4TA 3G67A 4ZHQB 3CCUV 1QVGU 1WPBA 2OCCC 5LP6A 3K5LA 1E1QG 4CH5A 1R3IC 1N34B 5KX5B 2GUZA 1GN6A 4UV8A 1N36O 3QO8A 3NR7A 1JPXA 1YZBA 5CBHA 1XNQB 3BABA 2E75B 3SJAC 1VQNV 1WPXA 3LSQA 1YJWV 3ZMZA 4WFBV 1ZL8A 3B4SA 2OTLV 4DYLA 5J2TB 3T1HO 4RUFA 4JYAB 3EFFK 2HHHO 3RBZA 5JCOA 3W7TA 3E2EA 5FL7G 3RWRD 1Y76A 3ZRWA 1Q3EA 4X64B 1K9MW 2X7RB 4FFBA 3K0DA 5H9CA
chains in the Genus database with same CATH topology
1PV0A 3D36C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PV0 A;  3D36 C; 
#chains in the Genus database with same CATH topology
 4DR2 O;  3ZJZ A;  2HKO A;  4DV4 O;  4LFA B;  2XAJ A;  1HWY A;  4FLV A;  3I56 V;  1EBO A;  2HP8 A;  5KUK A;  3CXC U;  3OTF A;  3CJH A;  2QWR B;  1AI5 A;  2WLI B;  1L8D A;  2PGG A;  1XUQ A;  3M8A A;  3BFR A;  3BA9 A;  2QM4 A;  3ZIA G;  4R7C A;  4K0K B;  1XBL A;  2JS5 A;  3B09 A;  2KQX A;  1VQO V;  1SER A;  1DF4 A;  1N0N A;  3JD2 A;  4YHH B;  1U96 A;  2OCH A;  5KMG A;  3K79 A;  1PNM A;  3CRM A;  3FAV B;  1AIL A;  3JAW A;  5A2Q N;  3OT7 A;  1HW7 A;  1LR1 A;  2B9Z A;  4FLY A;  3Q4H B;  5B1B C;  2ZXW C;  5J2U B;  3CCL V;  4BIU A;  5FNV B;  1R6N A;  2XND G;  2Z3Y A;  4O4J A;  2WLH A;  1G8M A;  5IJ9 B;  5BMV B;  3RYF B;  2WLN A;  3ETQ A;  3FKS G;  4JYA O;  4TT3 G;  2ILM A;  3FYI B;  2FYU H;  4KP4 A;  1S0V A;  1ZUQ A;  1N32 B;  2CE4 A;  3OE7 G;  3QO7 A;  4O2B A;  4BIO A;  1RPR A;  2F43 G;  1KP2 A;  1JA8 A;  1Z5V A;  4O4H A;  1H8H G;  3RVZ A;  1K5Q A;  2ADQ B;  4ZI7 B;  5CA0 A;  4JI4 B;  3UO2 A;  3OAA G;  4RAI A;  1SA0 B;  1R3K C;  4JV5 B;  2UUC B;  3CCJ V;  4DR6 O;  2Z5U A;  4EEQ A;  4K0K O;  1KP3 A;  1FJG B;  2XUM A;  1YF2 A;  4DRX B;  1YSC A;  1I94 O;  3ABM B;  1NH2 B;  4FZ0 A;  3WB0 A;  4F6E A;  2Q73 A;  4P30 A;  1HNX B;  4IIJ A;  5EK0 A;  1GN3 A;  3H1H H;  2XT9 A;  4K3A A;  1HNW O;  3U10 A;  2JJ2 G;  3J80 N;  3JAR A;  4JAS A;  2YSU B;  1XMQ B;  3K5M A;  3DGE A;  5B3S B;  1T5E A;  1BGY H;  4YJ2 A;  1AJN A;  3SJQ C;  2ZE6 A;  3K3W A;  3KKY A;  5K1X A;  2HR3 A;  2ZKO A;  3RYC A;  4OPA A;  1MSD A;  2YIA A;  3HKD B;  2DWD C;  5B1A C;  1QLN A;  2YI9 A;  4HZ3 A;  4PDM A;  3JD1 A;  1H2L A;  3ASO B;  3VQV A;  1GAX A;  5C8Y A;  4I50 A;  2IW5 A;  3TK1 A;  2X6B A;  4PV1 B;  2P06 A;  1YI2 V;  1XRE A;  2BCC H;  3ZRS A;  2CUG A;  1QNM A;  3B77 A;  4LF8 B;  2ZCE A;  3SR2 C;  4BW9 A;  1D5A A;  2UUC O;  5B1N A;  5CN0 A;  1Q81 W;  4X66 B;  4JZG A;  1EM1 A;  1Y74 A;  3A0R A;  1BQZ A;  4DUZ O;  1W0J G;  3WB2 A;  5KHI A;  4DR5 O;  2B1G A;  4GX5 A;  2A0L A;  3LDD A;  3CRA A;  1MG1 A;  2DMX A;  1NT2 B;  1K5S A;  4DV0 B;  2E74 B;  1XOU A;  4YIP A;  1S5J A;  1SQV H;  1WNS A;  1PD3 A;  2FB5 A;  1W59 A;  2YC0 A;  4UB8 Z;  3ZMV A;  4JPR A;  3RVY A;  5CBG A;  4ZOL B;  4I5S A;  1WA8 A;  1R3L C;  1JJ2 U;  1AJQ A;  2XTA A;  3X2Q C;  1IDS A;  1UPG A;  2GTS A;  4LH7 A;  5EBW C;  1W2B U;  4RQE A;  2WLJ A;  3ICX A;  1O9H A;  1XI1 A;  2ZIO A;  5LHG A;  4LFB O;  5IY5 C;  5IYD O;  1AP6 A;  3D3Q A;  1COW G;  2VS0 A;  5BY1 A;  3BEH A;  3D8C A;  1G4Y B;  3VBB A;  2P90 A;  4WBN A;  1YEW A;  3FAV A;  5CA3 A;  4LF7 B;  4Z2W A;  1HP8 A;  4EFB A;  5EBM C;  4X1I A;  4RUE A;  2A79 B;  1QR9 A;  4MVQ A;  5J2U A;  1J5E B;  4TV8 B;  5H2F Z;  5B66 Z;  3ZCC A;  1GM8 A;  1K33 A;  4UVB A;  3R65 A;  5BMV A;  1MZE A;  4NTW A;  2QGN A;  4O2A B;  3G80 A;  3S3X A;  3N27 A;  3ZMS A;  2NR5 A;  2E76 B;  1F23 A;  1TVK A;  2YUA A;  2JEU A;  1KKD A;  1S76 D;  1SQX H;  4RWU A;  2YXH A;  3ZRV A;  3CHX A;  5CA1 A;  5KAI Z;  3ZHV A;  4YXW G;  5LP6 B;  2GTA A;  4DW0 A;  2LW1 A;  5DM6 V;  3N2G A;  2UU9 B;  5LGN A;  2UXD B;  2EIM B;  4JI0 B;  3D36 C;  4LFC O;  2GUZ B;  1OV9 A;  4I55 A;  1Y66 A;  2Q0O C;  2QKC A;  4NYK A;  1Q82 W;  1OJH A;  4MSW C;  2XAS A;  3CCM V;  4W4L A;  1QBZ A;  4FLT A;  1ZL8 B;  3ASN C;  2Q7E A;  1XDC A;  1M57 B;  2EJ7 A;  4X1Y A;  4B3M B;  4DV7 B;  2X6C A;  4D6T H;  3F7V C;  5LHH A;  4P9P A;  2AW9 A;  2RN9 A;  3ABL C;  5D5P A;  2CH7 A;  3T4D A;  4PD4 F;  4JAV A;  1Q43 A;  1M93 A;  2EZP A;  4ZKI A;  1MZF A;  3LDC A;  3ZHS A;  3LSU A;  1Y76 B;  3SJC C;  2OT5 A;  2H3O A;  1OCZ C;  3BA8 A;  4FFB B;  3HPL C;  1HNZ O;  3BPZ A;  3JCZ A;  4JI8 B;  3L72 H;  3SYO A;  4J9Z B;  4B3T B;  2YEV A;  5JJN B;  1LUW A;  4LF5 B;  4GLX A;  1R6T A;  1NTK H;  3G71 V;  1IVS A;  4FVM A;  1Y4M A;  3E89 A;  1QVF U;  4NVP A;  3E8F A;  5BR8 O;  2ZE5 A;  3K57 A;  2PTM A;  1AR1 B;  2YXY A;  3TCU A;  1NS1 A;  3E8G A;  4LF4 B;  4X20 A;  3VOU A;  1WB8 A;  4U7O A;  2ZNI A;  1VQ7 V;  2UU9 O;  2UXD O;  3GWO A;  2WLL B;  2VQF B;  2F95 B;  5KMG B;  3OUS A;  2XAF A;  3JAW B;  1KQS U;  2QWQ B;  4UCO A;  3G4S V;  1J95 A;  2ETN A;  1RM1 B;  2ZR3 A;  3RYH A;  2LJ2 A;  2LP7 A;  4DV7 O;  4B3M O;  2Z0A A;  4O4J B;  1PP9 H;  1S72 V;  1VQ4 V;  4AHC A;  3ETE A;  5IWA O;  3RYI B;  3ZHQ A;  2KB1 A;  1AI6 A;  3B2E E;  1R73 A;  1UJW B;  1ZSP A;  3L74 H;  1R3J C;  3CCR V;  2ZDI C;  4F6R A;  2F4V O;  1JQ0 A;  4B3T O;  3WFV A;  4LF5 O;  3RN4 A;  2BTQ A;  1VF7 A;  3C3S A;  2ZM6 B;  2EIL B;  5CA0 B;  4HBN A;  5KLV H;  1YTF B;  2Q68 A;  5KHK A;  3CC7 V;  2KSD A;  2ZNJ A;  4JAA A;  3TET A;  1K7D A;  2FML A;  2IM9 A;  4D7T A;  2N74 A;  3N2K B;  1OCO B;  2LW7 A;  4LF4 O;  1FXK C;  4UXN A;  1ORQ C;  5LGT A;  4LCU C;  2VQF O;  3ZN1 A;  1LNQ A;  1VF5 B;  4J9Y B;  1R6K A;  4XDJ A;  5KA6 A;  1VIB A;  3CX5 F;  4OGQ B;  4IIJ B;  1XHX A;  1IBK B;  3DC6 A;  2M7W A;  3FB6 C;  2DW4 A;  4LH6 A;  5BZB A;  4KUM A;  4MVU A;  4TV8 A;  2LO1 A;  2DYR C;  3JAR B;  3M7M X;  2Q7G A;  1NBM G;  4YJ2 B;  2JGD B;  3SYA A;  3AG1 B;  2UXC O;  5B1O A;  4LF9 B;  4DUY B;  1DTO A;  3RYC B;  4BW5 A;  4B7E A;  1JJO A;  5C8Y B;  4I50 B;  4OPH A;  2OWO A;  1LUV A;  4JI1 O;  1US6 A;  4FM1 A;  4BWA A;  1AB3 A;  3UO3 A;  2IJK A;  2R72 A;  3EXA A;  4MW8 A;  4HYO A;  4LF6 B;  1QLE B;  1XNR B;  1GM7 A;  1Y74 B;  2JRI A;  3J7A U;  4AQY B;  1M56 B;  2DOS A;  2Y69 B;  3HB3 B;  1YVW A;  3G6B A;  4JTA B;  1YJ9 V;  1M1K W;  1I5X A;  4JF3 A;  3ZS8 C;  4JYB A;  2QA4 V;  2M6Y A;  4PI0 A;  5IDJ A;  2D2C B;  4OX9 O;  3UQ8 A;  1Z5W A;  3UKM A;  2YXL A;  3CRC A;  4LF9 O;  4DUY O;  3SYP A;  1WA8 B;  3GWK C;  1XIL A;  2EIN B;  1N33 B;  1JCH A;  3LSS A;  1MAB G;  1GN2 A;  4HNA B;  4U3J A;  1NR1 A;  1EN6 A;  2OCC B;  3A0B Z;  3SYQ A;  2VRZ A;  4I7Z B;  3OW2 U;  1VF6 A;  1N34 O;  2YIC A;  4UVC A;  2WLL A;  5FPR A;  4WFF A;  2Y4T A;  4H33 A;  4WBN B;  3T2M A;  4LF6 O;  2IJI A;  1MA1 A;  2Y48 A;  1XNQ O;  1XNR O;  4CS2 A;  4J11 A;  4X1I B;  1NKD A;  2H8P C;  4Z1M G;  1QQC A;  3JAK A;  4AQY O;  3MHS C;  5EIB C;  1THZ A;  1Q7Y W;  2WA4 A;  2HVK C;  2QM7 A;  3OUF A;  4X88 A;  3FX7 A;  5KHG A;  2EIJ B;  4Q20 A;  3RYI A;  1GO3 F;  4FM2 A;  4TV9 A;  3WU2 Z;  2K1E A;  4X64 O;  1TVK B;  2HEP A;  2KG7 A;  2PF4 E;  4ASU G;  3ZN0 A;  2HJD A;  2P5O A;  1JMK C;  5H6R A;  2WA3 A;  4CH3 A;  4LFA O;  1MSW D;  1WJZ A;  5CA1 B;  3L73 H;  2GDS A;  3K9A A;  3CP1 A;  1YDX A;  3CCE V;  3N2G B;  4JZ2 A;  2L6L A;  1N33 O;  3SDL A;  1UFI A;  1ENV A;  4I55 B;  3ZHR A;  4IL6 Z;  2ADP A;  4GCZ A;  2K9P A;  3AK3 A;  3N2K A;  2HFE C;  5CB4 A;  1EZJ A;  2IH1 C;  4FLZ A;  2CK3 G;  2XAQ A;  4O4L A;  2LGW A;  2JVD A;  2ZE8 A;  1MOF A;  4YHH O;  4X1Y B;  5EZY B;  2ATK C;  3JSL A;  4K35 A;  1EN4 A;  4D7S A;  2W6J G;  4MT8 A;  5JJE B;  3P30 A;  4MTG A;  3IJ4 A;  2CH7 B;  5B5E Z;  1P7G A;  2QKS A;  2W6I G;  2JDI G;  4YJ3 A;  5B1B B;  5DEC A;  5EIB D;  3CYO A;  4LWS B;  4PDL A;  2UXN A;  1KEC A;  1F51 A;  4GYC B;  4CS3 A;  4EKW A;  2ITD C;  4H0L B;  2OYQ A;  3H9V A;  1BZK A;  1KB9 F;  3CRQ A;  2YEV B;  2JGD A;  4MTF A;  3CWB H;  1DGS A;  4DV6 B;  1N32 O;  3CB2 A;  3DSQ A;  2Q69 A;  1PNL A;  4FIP C;  1FKA O;  5LXT A;  4IYI A;  1R1B A;  1YIJ V;  4BR6 A;  5LBQ A;  3MD0 A;  1Q6H A;  4NTY A;  4PDR A;  4JI4 O;  1F4N A;  4X20 B;  5LA6 B;  3AK2 A;  4FLX A;  3E83 A;  1XMO B;  3APO A;  4JV5 O;  4X62 B;  5L3B A;  4TOI A;  3AG4 B;  4G2K A;  2A06 H;  2IJJ A;  1N8R W;  4JI7 B;  4DV1 B;  2DQ3 A;  3UCS C;  3K58 A;  3IGA C;  1FJG O;  4JAU A;  3LNM B;  2AGA A;  1VQK V;  1ZWI C;  1FXK A;  1TAE A;  3C90 A;  4UUJ C;  3RYH B;  4IYH A;  5F2V O;  3VQW A;  3JYC A;  1HNX O;  3OMN B;  4JGS A;  2QR4 A;  4DW1 A;  1DF5 A;  1GKF A;  1AI7 A;  4FFK A;  4BIZ A;  1NJI W;  1RPO A;  3RFR A;  2E3C A;  3HKE A;  1XMQ O;  3JAL A;  4R8C A;  4F6R B;  4UV9 A;  5IYC O;  2FKX A;  2YIB D;  4I4T B;  2BOB C;  2AZ2 A;  2BTQ B;  3D3I A;  1V55 B;  4DV6 O;  3JAT B;  4ZBM A;  3ZHU A;  2RDC A;  3VQX A;  4HNA A;  1AJP A;  4UCR A;  4GX1 A;  4U7N A;  2DYS C;  1Z2G A;  5LP6 C;  2JIZ G;  2F93 B;  1Q90 D;  2AZ0 A;  3TXQ A;  4LF8 O;  4DK1 A;  3H1J H;  4X62 O;  3ABK C;  4IHJ B;  4I0X A;  4WFE A;  5J9P C;  4X66 O;  2OIG A;  4DR1 B;  1K3E A;  1Q8I A;  3W7U A;  3SGI A;  1BHA A;  4IGG A;  2PYJ A;  2HJF C;  3AG3 C;  3ZMT A;  2IJH A;  1BHB A;  1BE3 H;  1NVP D;  4J10 A;  2Q0A A;  1GRJ A;  1XHZ A;  4DV0 O;  3E8B A;  5JCO C;  3FYE B;  3K04 A;  5KHH A;  5LGU A;  4B3S B;  3CSX A;  4J42 A;  4UB6 Z;  1WAZ A;  1B06 A;  2EX3 A;  1RFY A;  1OCR C;  1VP7 A;  4P9O A;  4J7K A;  2L35 A;  2X0L A;  4U3F H;  4TSF G;  1YJN V;  3UT5 A;  3IFX A;  3H1K H;  5LOV A;  1GK9 A;  1IXM A;  3DTU B;  4XBF A;  4UCU A;  1GH6 A;  1AR4 A;  4YY3 B;  1WLE A;  4LBE C;  1PL4 A;  1JX9 A;  4QIW F;  5LYJ A;  2PZS A;  4XDL A;  4JTD B;  1BT8 A;  1ZX3 A;  5IY5 B;  3QG5 A;  1KBH A;  2O57 A;  4UFZ A;  5EZY A;  4F4L A;  4JI3 B;  3K0G A;  2B5U A;  4LNU A;  1SQF A;  4LF7 O;  3FB8 C;  4EB6 A;  1CPY A;  5LMN B;  2UUA B;  3STZ C;  2NNU A;  4MTX A;  3KZI Z;  1OCC C;  5HFL A;  4JI2 B;  1NZ6 A;  3ZRX A;  5H6Q A;  1EZV H;  5GW7 A;  1RM1 C;  1J5E O;  1OZ0 A;  4FPP A;  4MW3 A;  1Q6U A;  4H44 B;  4LWS A;  3AG2 B;  2F1M A;  4G27 B;  1GN4 A;  4P2Z A;  3GVM A;  4C7U A;  1NU1 H;  1ARO P;  3MAQ A;  1B6Q A;  4QJF B;  4TQD A;  4E4E A;  2ODM A;  2ZIM A;  1L0N H;  1W0K G;  1L0L H;  1FFX A;  2RCV A;  3QVN A;  5KAF Z;  3K5O A;  2Q8V A;  4DO2 A;  4JYC A;  1BMF G;  1OHH G;  2WLM A;  4U3J B;  3GB7 C;  4CZZ A;  2P6J A;  5LA6 A;  2IU0 A;  1GMG A;  4I9Q A;  2EIL C;  4KFM A;  4JI0 O;  5LMU B;  1TUB A;  4BAY A;  1N4C A;  3OEH G;  3CC2 V;  5L3D A;  2LFR A;  5E1A C;  4NB5 A;  4PA3 A;  1BSM A;  3K03 A;  5LL6 Y;  1OCO C;  3E86 A;  3WG7 C;  2Q67 A;  2Y4U A;  2EJR A;  3JAK B;  1KUQ A;  4DXW A;  2D3O W;  3ASN B;  2HLD G;  1CEZ A;  1B3Q A;  5EBL C;  1CP9 A;  2UUA O;  4J7Z A;  3HKB A;  1P84 F;  1JFF A;  1V54 B;  4TV9 B;  3ZED A;  1E79 G;  2KG7 B;  4QE9 A;  1FD9 A;  5JWP A;  1KD1 W;  1OCZ B;  4JI8 O;  2ITC C;  5KHJ A;  4I4T A;  2YIB A;  4MVR A;  1VQ9 V;  1ZAU A;  1VQ8 V;  2BSK A;  4L87 A;  3JAT A;  1F4M A;  3L70 H;  2VQE B;  4RQF A;  1FFT B;  1S5L Z;  2ZT9 B;  2V4D A;  3IC9 A;  1SQP H;  1SS3 A;  5CB4 B;  3I55 V;  2QE7 G;  1H38 A;  2PI4 A;  4DR3 B;  4O4L B;  3ZHT A;  3E22 A;  5LMU O;  3RT3 C;  1FS0 G;  1VMG A;  1KC8 W;  3HR0 A;  2KKW A;  4IHJ A;  1N36 B;  3KG2 A;  5CBF A;  1IBL B;  4WFH A;  3OD4 A;  4JI6 B;  2NN4 A;  2AXT Z;  1K4D C;  3ZMU A;  4YJ3 B;  1M56 C;  2EIK B;  1TGO A;  4QE7 A;  1D2D A;  3VQY A;  2JJ1 G;  2QWN B;  4H13 B;  1GTO A;  2BOC C;  4GZR B;  5IYB O;  3RW0 A;  5JVD A;  3F5T A;  3T1H B;  3DXR A;  5LHI A;  1AP5 A;  2HHH B;  4GX2 A;  4JTC B;  1SET A;  2CTW A;  2Q7H A;  5LXT B;  5C93 A;  2CTR A;  1I08 A;  4GX0 A;  3TJT A;  2DE0 X;  3QF7 A;  3E8H A;  4ZIB A;  4DV4 B;  2Y0I A;  1EFR G;  1NTZ H;  1SQQ H;  1V9P A;  1D5N A;  2ZM6 O;  3QNE A;  1O9G A;  4B08 A;  2EIN C;  3L75 H;  3TXS A;  4JYY A;  3BY6 A;  4IT5 A;  4RO2 A;  3ETG A;  4PHZ A;  3FFQ A;  2Q6A A;  4CS4 A;  1FXK B;  5TIS Z;  1VQ5 V;  2ARH A;  2VWJ A;  4DR3 O;  2DQ0 A;  2YS8 A;  1I5Y A;  4NTX A;  3K08 A;  4WFG A;  2QKA A;  2WWW A;  4KL1 A;  5EC2 C;  1U97 A;  2V1D A;  1IBL O;  1IBK O;  4JI6 O;  2CAZ C;  4HAM A;  2P4K A;  3MDS A;  4ICG A;  5JQG A;  4KHP B;  3SYC A;  1WP7 A;  3HKE B;  1XL6 A;  3JAL B;  3J81 N;  4I9W A;  1SZT A;  2DYR B;  4PA6 A;  1H2G A;  3H01 A;  3LDE A;  4MVS A;  2EBO A;  3OM3 B;  2C2A A;  2JS3 A;  2DJV A;  2DWE C;  2EIJ C;  2AHZ A;  4YIO A;  3BAA A;  2MK3 A;  1BS3 A;  1F7Y A;  1ZLZ A;  1HDJ A;  1RSO A;  3I5D A;  1BQ0 A;  4DR4 B;  3F7Y C;  5EYP B;  1K4C C;  3D36 A;  3K06 A;  4B7K A;  3EVK A;  4DR6 B;  5D5Q A;  4I0X B;  3SPH A;  4MTO A;  3K5N A;  4FM0 A;  3IC7 A;  1ROP A;  3ABM C;  5GON B;  4DV3 B;  3K59 A;  1I94 B;  1DLB A;  3B40 A;  1M90 W;  5ITZ A;  5FPO A;  2OTJ V;  4MVM A;  2UXB B;  2IBZ H;  2RJZ A;  2QEX V;  3CCS V;  3OGI B;  2RQ6 A;  3OFN G;  1HNW B;  4KHP O;  4DV5 B;  3A0H Z;  2ZE7 A;  2HVJ C;  5B3S C;  2CTQ A;  3UT5 B;  3CC4 V;  5LOV B;  5E79 Z;  1PV0 A;  3FD9 A;  4JI5 B;  2YDE A;  1QR8 A;  2R9I A;  3KCY A;  3TGU H;  1VQL V;  4X8A A;  3ASO C;  4CH4 A;  2UXX A;  1Q6I A;  5LYJ B;  1HR0 B;  1PPJ H;  4K8Z A;  3ABT A;  4DR4 O;  1IZ3 A;  4L8J A;  3PN1 A;  5KUM A;  1XQ8 A;  5JH7 A;  4O4I B;  2RMK B;  3AG4 C;  4LNU B;  3OMI B;  2UUB B;  4PEL A;  4EB6 B;  3ZX6 A;  3R66 A;  3STL C;  3P3N A;  5IJ0 B;  2QTO A;  1Q86 W;  4DV3 O;  4DUZ B;  3QO5 A;  3AK1 A;  1TUE B;  3HKC A;  4DR5 B;  1NH2 D;  3SPJ A;  2ZXW B;  5L3G A;  2JK5 C;  2UXB O;  1URF A;  4E2L A;  4J80 A;  3JAS A;  5H5N A;  1AR5 A;  2NLJ C;  3OEE G;  4DV5 O;  1FXH A;  1FPO A;  2DN9 A;  1FFX B;  3C3T A;  1S5H C;  3T1Y B;  4GKK B;  3U11 A;  1CXZ B;  2ZDI A;  5EC1 C;  2ZQM A;  4A5U B;  5CMU A;  1V55 C;  4LP8 A;  3OR6 C;  2CGN A;  4JI5 O;  4X1K A;  2PUS A;  4DR7 B;  3SJB C;  1QCE A;  1IXB A;  5IYZ B;  1TUB B;  1FAF A;  2F23 A;  4ZHQ A;  3P32 A;  2N04 A;  4PDV A;  2N05 A;  1I0H A;  3FB5 C;  4NXM B;  3SPG A;  1GM9 A;  2QWO B;  4GUN A;  1HR0 O;  3E35 A;  4X65 B;  2ZR2 A;  4LFB B;  2ZD9 A;  1YIT V;  4Z1V A;  3T4Z A;  5DED A;  5KX5 A;  1MMM A;  1IX9 A;  2UUB O;  3CCV V;  3LNN A;  3A2F A;  1H2K A;  1PNK A;  1H2N A;  5IE9 A;  3F5W C;  3HKB B;  1JFF B;  1M5I A;  2IH3 C;  2XOK G;  1KMI Z;  1AVM A;  1JR9 A;  2BTO A;  5J2T A;  2P67 A;  3O9O A;  3JAM N;  4FJC C;  2P7T C;  4G28 B;  4DK0 A;  4J41 A;  2BSK B;  2CGO A;  1H2S B;  4PI2 A;  3K9S A;  5FLX N;  1YCI A;  4UCV A;  3T1Y O;  1P49 A;  1YHQ V;  2LQT A;  5B1A B;  3BHP A;  4GKK O;  2R70 A;  1WB7 A;  5GTH Z;  3W7X A;  2JGU A;  2LFS A;  1X59 A;  2Q4P A;  2A7W A;  1WP8 A;  2XAH A;  4PA4 A;  1XMO O;  2WLI A;  3H1L H;  2PY5 A;  4DR7 O;  1NTM H;  2AHY A;  5EYP A;  2EIM C;  3E22 B;  1SRY A;  4LFC B;  4JI7 O;  4DV1 O;  1G6U A;  4NXM O;  1KU9 A;  4DV2 B;  4N21 A;  4X65 O;  5GON A;  4UCT A;  2CTP A;  2WLK A;  4CC6 A;  1M57 C;  4AI8 A;  3UM7 A;  1IUR A;  4NXN B;  4QPK A;  4CH6 A;  3CS5 A;  3CEI A;  4FLU A;  1NVP B;  3PJS K;  2XAG A;  3M99 B;  1BL8 A;  5JJJ B;  5JVD B;  3MHH C;  1IBM B;  3CE2 A;  3DXR B;  1VAR A;  2VWK A;  1B04 A;  2P22 C;  3ABU A;  3Q4H A;  4H37 A;  3CCQ V;  1H8E G;  4K8X A;  5FNV A;  4TUY B;  2HG5 C;  3AG2 C;  4MVZ A;  5IJ9 A;  1HNZ B;  1K8A W;  2BE3 A;  3RYF A;  4NR1 A;  3IAY A;  4KXR A;  5GTI Z;  3THO A;  4B3R B;  2WSS G;  1EN5 A;  4PJ0 Z;  3L9D A;  3X2Q B;  4ABM A;  3B8N A;  1SQG A;  2E5L B;  1A32 A;  2P4V A;  4J7J A;  3EHB B;  2WAM A;  3FB7 C;  4EFE A;  5BR8 B;  2B1I A;  3G6E V;  2Y0P A;  3JSN A;  2DYS B;  1AI4 A;  4ZI7 A;  2X6A A;  3JD3 A;  1VF6 C;  5K1P A;  2QJ1 A;  3O65 A;  4GKJ B;  4O4I A;  2RNB A;  1SA0 A;  1YXB A;  2IU3 A;  3ABK B;  5DN6 G;  3W7S A;  4UVA A;  3DC5 A;  4QGP A;  4DR1 O;  2WPD G;  5IJ0 A;  4UCS A;  3JD4 A;  4DV2 O;  2OIE A;  1QU7 A;  4DRX A;  2W0X A;  3CXH F;  4W4K A;  5JQG B;  4R50 A;  4QNH B;  1ZTE A;  2G38 A;  3LUT B;  4NXN O;  3CD6 V;  3AG3 B;  4MVO A;  1K92 A;  1Y67 A;  3RGB A;  1M9N A;  1IBM O;  1BCC H;  3AEI A;  2XHB A;  5IWA B;  1S77 D;  1JVM A;  1KYO F;  4B3S O;  1V54 C;  3W7W A;  4TWK A;  3T1C A;  5BXZ A;  3ZRW B;  3ML0 A;  4N23 A;  3APQ A;  2GHY A;  2A9H A;  1VQ6 V;  2CDY A;  1Q5O A;  4TQF A;  1OCR B;  1NR7 A;  4X89 A;  1RSO B;  2EUL A;  2F4V B;  3A8T A;  3ETD A;  5A9G A;  4B3R O;  3BCC H;  4LC1 A;  3CJH B;  4CBC A;  3H1I H;  3HKD A;  3SPC A;  2E5L O;  5IYZ A;  1E1R G;  4YY3 O;  2H94 A;  2LGQ A;  4FMT A;  2GV9 A;  1DK1 A;  1K97 A;  2A3Q A;  4WFA V;  5L3C A;  2QSA A;  2ZIN A;  2QTS A;  3CPW U;  3CMA V;  5L3E A;  1N0J A;  3NXS A;  4AIL C;  2QM8 A;  1PKX A;  4Q6G A;  3OR7 C;  1VQM V;  4GKJ O;  1SES A;  3OMA B;  4FZ1 A;  4JI3 O;  2QWP B;  5ITZ B;  3B8M A;  2YID A;  1NQT A;  3S3W A;  1PL0 A;  5LMN O;  1JOY A;  4PA9 A;  4PA7 A;  4CC5 A;  1L1F A;  4FLW A;  3ABL B;  4JI2 O;  1OCC B;  2MW2 B;  3JD0 A;  2PYL A;  1XL4 A;  2Q9L A;  2EZO A;  2EIK C;  2JEX A;  2PI5 A;  3WB1 A;  3OTO B;  3KCX A;  1SF9 A;  1RP3 B;  1S3J A;  2Q5Z A;  2GSM B;  3L71 H;  1K73 W;  2GBO A;  3AG1 C;  5L3F A;  1XEQ A;  1FXV A;  2YI8 A;  2UXC B;  2FL4 A;  4FK5 C;  4QPJ A;  1VQP V;  4O2B B;  4WCE V;  3BRC A;  3CRR A;  3CME V;  3AG7 A;  3P3P A;  4O4H B;  1I7F A;  3SPI A;  1MNG A;  4R6Z A;  4ZOL A;  4JI1 B;  2QDO A;  1SZX A;  5AG2 A;  5JH7 B;  1Y6X A;  1K34 A;  1VEW A;  1YTF D;  5KA5 A;  1QLE C;  4OXS A;  4LR3 A;  1NI8 A;  3ZBH A;  3WG7 B;  3JCU Z;  2W0F C;  3HKC B;  5HFM A;  2Y69 C;  1KKC A;  4XDK A;  2R9A A;  1FYJ A;  3JAS B;  1P7B A;  4X9Q A;  1P4R A;  1H2M A;  4NKG B;  3U0Z A;  4MS2 A;  1QHT A;  1SQB H;  5IT9 N;  4TUY A;  3OTO O;  2V7Q G;  4GT1 A;  1TA8 A;  2FTK A;  2R9R B;  3BVO A;  4DR2 B;  1PM9 A;  1SC5 B;  4OX9 B;  4O2A A;  3OGC C;  1G1X B;  2F66 C;  4WF9 V;  1M4U A;  3QTC A;  4X1K B;  2VQE O;  1SKV A;  1WN7 A;  1X4T A;  3G67 A;  4ZHQ B;  3CCU V;  1QVG U;  1WPB A;  2OCC C;  5LP6 A;  3K5L A;  1E1Q G;  4CH5 A;  1R3I C;  1N34 B;  5KX5 B;  2GUZ A;  1GN6 A;  4UV8 A;  1N36 O;  3QO8 A;  3NR7 A;  1JPX A;  1YZB A;  5CBH A;  1XNQ B;  3BAB A;  2E75 B;  3SJA C;  1VQN V;  1WPX A;  3LSQ A;  1YJW V;  3ZMZ A;  4WFB V;  1ZL8 A;  3B4S A;  2OTL V;  4DYL A;  5J2T B;  3T1H O;  4RUF A;  4JYA B;  3EFF K;  2HHH O;  3RBZ A;  5JCO A;  3W7T A;  3E2E A;  5FL7 G;  3RWR D;  1Y76 A;  3ZRW A;  1Q3E A;  4X64 B;  1K9M W;  2X7R B;  4FFB A;  3K0D A;  5H9C A; 
#chains in the Genus database with same CATH homology
 1PV0 A;  3D36 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...