4JI6O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji6O00
4NXNO 4NXMO 2E5LO 2UUCO 4DV1O 2UU9O 4OPAA 4B3MO 4DR7O 4B3SO 1X59A 1F7YA 4A5UB 4DR1O 4OPHA 3M8AA 1IBLO 1HNXO 4LF5O 4JI8O 5BY1A 4LFBO 4DV5O 4DR5O 2UUBO 1R6TA 5FLXN 1XNRO 4LF8O 1KUQA 4X65O 1N36O 2VQFO 4JI0O 4B3TO 4LFCO 1FJGO 5LMUO 2AGAA 4JI1O 4DUYO 4B3RO 1FYJA 4YY3O 4JV5O 4YHHO 2UUAO 4JI6O 2ZKOA 2N74A 2DJVA 4DR3O 4JYAO 1AB3A 3J80N 1D2DA 2FKXA 3R66A 3T1HO 1XMOO 3O65A 4DV0O 2ZM6O 5BR8O 1IBKO 2F4VO 4X62O 2UXCO 5A2QN 3OTOO 5LL6Y 4JI2O 3J7AU 4AQYO 3SDLA 3T1YO 4DV3O 4LF4O 4X64O 3J81N 1I94O 1R1BA 2Z0AA 4JI7O 1IBMO 1AILA 4X66O 4DV2O 4LF7O 4DR6O 1N33O 1FKAO 3JAMN 1DK1A 1XEQA 4LF6O 2DOSA 3RT3C 2LW7A 2UXBO 4DV6O 2UXDO 3F5TA 4LF9O 2VQEO 1HNZO 5IT9N 5LMNO 1HNWO 1G1XB 4DV4O 4JI5O 4DR2O 1J5EO 2HHHO 4DV7O 1NS1A 5IWAO 1XMQO 1YZBA 1HR0O 4GKKO 1A32A 4KHPO 4DUZO 4GKJO 2JRIA 4OX9O 5BXZA 4JI3O 4DR4O 4K0KO 4JI4O 1XNQO 4LFAO 1N32O 5H5NA 1N34O
chains in the Genus database with same CATH superfamily
3AG3C 1NU1H 4F6RB 1NKDA 1Q86W 1S72V 4BIOA 3FAVA 1F7YA 1W0JG 4IHJB 1BZKA 5AG2A 1QLNA 2QWPB 1DF4A 4K35A 2GDSA 1KUQA 2HG5C 1ROPA 2KQXA 2F43G 3CX5F 4GX1A 4EKWA 4JI0O 1JJOA 2JDIG 4U3JB 2IJJA 1JVMA 2AGAA 2XTAA 3HKDA 2GTAA 1NH2B 2NLJC 4X89A 1BSMA 2X0LA 4YHHO 1VEWA 1VIBA 2QWRB 3H9VA 4X1YB 3BPZA 5B1AB 1KP2A 1OJHA 3CMAV 5K1XA 2DW4A 1VQ5V 1CPYA 4I55A 3FX7A 1PM9A 1KKDA 4FLVA 3C3SA 4XDJA 3WB1A 4FMTA 1PNKA 3JATB 3UO2A 4FZ1A 2EIMC 1BS3A 5IYZB 3HR0A 1I7FA 4DUYB 5JVDA 2QJ1A 2YXHA 3RW0A 1DK1A 1G4YB 1K4CC 3JAWA 1JOYA 1QLEC 1V54B 4LH7A 3LSUA 1HP8A 4PA4A 4D7TA 4DV2B 3BABA 2DQ0A 1GTOA 2PZSA 5LP6B 4JI5O 4ZHQA 4O4JA 2DN9A 4IGGA 2UXBB 2EIJB 2PYLA 3JCZA 3BEHA 3WB2A 5LMNB 3ZEDA 4FZ0A 3T1CA 1KU9A 2PI5A 2XOKG 4PA7A 5LHGA 3LDEA 1AP6A 3QO7A 3BVOA 3CXCU 2HJFC 3MD0A 1H2SB 4OPHA 1MZEA 1JR9A 2JS5A 5LA6A 1VQMV 2ZR2A 2UUBO 2UUCB 5JQGB 3ZMZA 1V55B 3QVNA 1FFXA 3SJBC 3ZX6A 3K0GA 4PD4F 2YXLA 1S76D 3G67A 4CH5A 2XAHA 3ZMSA 2PI4A 2N74A 3A0RA 3AG2B 4J9YB 1JJ2U 4OXSA 5KHGA 1CXZB 4JGSA 1EBOA 3NXSA 2AW9A 2B1IA 1BQZA 1KYOF 3SJCC 2QGNA 3THOA 1E1QG 4MVOA 3B8NA 1KB9F 3HKEA 4LF4O 1IBKB 3B2EE 4JI2B 5LXTA 1M57C 1AILA 3K08A 1IZ3A 2CGOA 4I55B 3CCRV 3RT3C 1NH2D 3QTCA 1JCHA 3ZHUA 1IDSA 1IBMB 2EULA 1HNZO 3RVYA 1ZL8A 2F93B 2FL4A 1HR0O 3UCSC 4RUEA 5H9CA 1WP8A 4U7NA 4TT3G 2ZR3A 1Y67A 4R8CA 1J5EB 4WBNA 2ADQB 2EINB 3N2GB 3ETEA 4YIPA 4K0KB 1LR1A 5IJ0B 4JF3A 1QR8A 4ZHQB 3IFXA 5IDJA 4O4JB 1N32B 3ZHQA 4FM0A 4I7ZB 1YXBA 1MSDA 4PI2A 1KQSU 1I5XA 4FLXA 4DW0A 2QTOA 4IYIA 2UU9B 2IJKA 1BCCH 4R6ZA 5B3SC 5E79Z 4X65O 4ASUG 3KCYA 3L75H 2ZE5A 4KP4A 4LFCO 4TV8B 3P30A 4FM2A 1N0JA 4OX9B 4Z2WA 4DUYO 4JI1O 4QPKA 1GM9A 3WU2Z 1NTMH 3ZHTA 4J42A 1N34B 3CRQA 2EBOA 1DLBA 4JAAA 3SPHA 1LNQA 3M7MX 4I4TB 4UB6Z 3KZIZ 2IBZH 1FFXB 2WPDG 1TUEB 2LO1A 4AHCA 1IVSA 2YXYA 2CTQA 1LUVA 1N4CA 1SQXH 1RSOA 1U97A 1Q90D 4G28B 1S5JA 1KMIZ 4JYBA 5BR8B 3CJHB 1AROP 5IJ9A 3CCEV 2K1EA 2P7TC 2RCVA 5EZYA 3SYAA 3WG7B 1OZ0A 4X64B 3OFNG 2B9ZA 4LP8A 1WPBA 2YSUB 3L73H 1FXVA 1S5LZ 4X66B 2LGQA 3OMAB 4EEQA 1Z5WA 2CTRA 4ZIBA 1UJWB 4JI3O 5IYDO 3B4SA 5H2FZ 3SPJA 4JYCA 2DYRB 5KMGB 4UCRA 5FPRA 1PP9H 2HHHB 1P49A 1K73W 4NXMO 1YVWA 2LJ2A 2E5LO 4JYYA 1X59A 3HKBB 4C7UA 3ABKB 4CC6A 1WN7A 5GTHZ 1XI1A 4D7SA 2EIKB 3CCMV 2KB1A 2L35A 3TJTA 1R3LC 1R6TA 4DV1B 3E8GA 4MTGA 5B1BC 3LSQA 4TQFA 4WBNB 2ADPA 4DR1B 2JJ2G 2F66C 2EILB 1RFYA 1NTZH 1SERA 1FJGO 2BE3A 2RQ6A 1FXHA 4B3RO 1R6KA 3OR7C 4JV5O 2CDYA 3SYCA 4EFEA 4HNAA 4GYCB 2R70A 1NBMG 3JYCA 1D2DA 1AB3A 2MW2B 2OCHA 3U10A 1WB8A 2LFSA 1GH6A 1JPXA 2F4VO 3AG7A 1K7DA 3OTOO 4DR3B 2G38A 3VBBA 2PTMA 5C93A 3ZJZA 2IJHA 3W7WA 4DV3O 5LYJB 2ZM6B 4ZOLA 1MSWD 1Q6IA 1MZFA 5L3CA 2JGDA 1F23A 3OD4A 2WA3A 1OCZB 4WFGA 1EN5A 4NTYA 3OUSA 4BW5A 1MMMA 4MVRA 1N33O 1SC5B 1FKAO 1NI8A 2WLIA 2VRZA 1K3EA 1IXBA 5EBWC 1BHBA 3Q4HA 4LF9O 1AJPA 1F4MA 1H2LA 3BHPA 4I50B 1KKCA 4CH4A 3A2FA 4KHPO 4DUZO 4OX9O 5BXZA 4FFBA 4CC5A 1XHZA 4EB6A 1R3JC 3AG4B 1XNQO 4DRXA 1K9MW 2P06A 5KHKA 3SR2C 1N34O 4GKKB 4NXNO 2R9AA 4TUYA 5EYPB 1B04A 2HVJC 2HFEC 4YJ3A 2YIAA 1GRJA 3QNEA 3ABTA 1TAEA 2QWOB 1FPOA 4MVUA 2EX3A 1HNXO 2IH3C 2A7WA 4QIWF 1VQ9V 4JI8O 4Z1MG 2KKWA 4DR7B 2GTSA 4TV9B 3QG5A 4W4KA 4B3SB 4MVSA 4CS3A 1SETA 4WF9V 4UFZA 1WPXA 4KFMA 4UVBA 2CH7B 1S3JA 1MOFA 2RMKB 4DR5B 1GN2A 2FB5A 3P3PA 3TCUA 3D3QA 3T4ZA 3X2QB 4LH6A 3CS5A 5A9GA 3OMNB 4FK5C 1I08A 4WFAV 2UUAO 4YIOA 2ZINA 4X20A 1FAFA 3QF7A 4RWUA 3OW2U 3E8FA 1Z5VA 4FJCC 5A2QN 3CYOA 2V4DA 4JI6B 5JJNB 3ZN0A 5C8YB 4K8XA 2X7RB 4HNAB 5LGTA 5BZBA 3CCJV 4BR6A 4ZI7B 5IYCO 5KAFZ 3JD3A 2Q4PA 1IXMA 4PELA 1VF6C 3AG1B 4MSWC 5GW7A 1L1FA 1VQ6V 1DTOA 2M6YA 1JFFB 5JH7B 4LF7O 2ZT9B 2IH1C 2BTQB 4H44B 1KP3A 2YIDA 4W4LA 4ZOLB 2JGDB 3K03A 3JAKA 3VQYA 4EFBA 1UPGA 1Q81W 2UXDB 3VQXA 3LDDA 2XT9A 1SQBH 3K57A 4MVMA 1NQTA 3L70H 1GM7A 2LQTA 4DV7B 5IWAB 1FXKA 3CRAA 1ORQC 5E1AC 2Q9LA 4TOIA 4KL1A 3N27A 4RO2A 4FFBB 3CRCA 3DXRA 2Y0IA 5CA0A 3N2KB 3OUFA 4DRXB 4JAVA 4O2BA 3H1KH 3CCQV 1W2BU 1VQ4V 3I5DA 1BE3H 2QEXV 4LF8O 5DECA 4JZGA 3STLC 2ZCEA 4I5SA 1OCOB 1O9GA 2MK3A 5LMUO 2QDOA 1DF5A 1AVMA 5J2TB 1K92A 3QO5A 5KHJA 2WAMA 1SQGA 3L71H 2DJVA 1HW7A 4YJ2A 3HKCA 2FKXA 1AR4A 3IC7A 3O65A 5B1NA 1QVFU 1JQ0A 1D5AA 3H01A 1AI7A 3H1LH 4NB5A 3CXHF 4FPPA 4X20B 4QNHB 5KUKA 3VQWA 4NTXA 2WLLA 3RYIB 3VQVA 3ZRWA 4GX0A 4D6TH 3WB0A 2W0XA 2GUZB 1I94B 1B3QA 4WFFA 5K1PA 3CCUV 1SF9A 2QM4A 1N0NA 3CRMA 4O2AB 4DV6O 4MW8A 4NR1A 1ZTEA 2YIBA 2LGWA 2ZIMA 3U0ZA 3ABKC 3G71V 4I0XA 4H37A 3WFVA 2ZXWB 2LW1A 5IE9A 2KSDA 3LNNA 3RVZA 3BRCA 1AJNA 4LFAO 4X1IA 2CGNA 1HNWB 3CB2A 4B7EA 3M99B 2VS0A 1WB7A 5B66Z 2EILC 1YSCA 3L72H 2L6LA 5B1OA 5CMUA 3GWKC 1H2GA 3LNMB 3ZRVA 2P4VA 4LCUC 2FTKA 3CEIA 3CC2V 1H2MA 1GN3A 1VF6A 2ZNJA 2O57A 1VQKV 1LUWA 3D8CA 3K79A 1WA8A 2WWWA 5ITZB 2B5UA 3A0HZ 3DXRB 1OCCB 3ZN1A 4TSFG 2ZKOA 3JSLA 4JYAO 1E79G 4Q20A 3JD0A 3JARB 4IT5A 1TVKB 3PN1A 3R66A 2QA4V 2DMXA 4FVMA 5FNVA 1CP9A 3JD4A 5EK0A 1NR7A 3ABMB 2Q0OC 3FAVB 5HFLA 3G6EV 4AQYO 1YTFD 3T1YO 2DWDC 3GWOA 1RPOA 3TXSA 3ABLC 3HKCB 2RJZA 1GMGA 5EIBD 2HJDA 4HBNA 4DK1A 4B3TB 2DYSB 1K4DC 4PA9A 2BSKA 3OEHG 4UCOA 1Q7YW 3FB8C 1JMKC 3BA8A 1COWG 4N23A 3CE2A 4CS2A 1J95A 2R72A 3HKDB 3UO3A 3ASNC 2W6IG 1Q5OA 1VQOV 4PDRA 3T1HB 2WLNA 2WLLB 3ZRWB 1DGSA 3CRRA 2QR4A 4DV4O 4DR2O 1XMQO 5GONA 3ZMVA 5H6QA 1TGOA 1XILA 4O4HA 4RQFA 2VQEB 4U3FH 2Q68A 2AZ0A 2CK3G 1RM1B 1VQLV 2F95B 1PPJH 1OCRB 2XAFA 3X2QC 3UT5A 4FLYA 1XOUA 1BT8A 4X1IB 3FD9A 1BL8A 5JVDB 2D2CB 3F7VC 1AR1B 1URFA 4AILC 4UV9A 3JAWB 1IBLB 4LBEC 1PKXA 1G6UA 5J2UA 4UVAA 3P32A 3KG2A 1XNRB 5TISZ 3E8BA 2ARHA 2VQFB 1Y76A 1EN6A 3FB7C 5JWPA 1K34A 4R50A 2OTJV 3J80N 2Q6AA 3ZCCA 4BIUA 2VWJA 4J10A 1Y6XA 4YY3B 2JIZG 1QQCA 2Y69B 3ML0A 2OWOA 1GM8A 2AXTZ 4UVCA 4DV0B 3VOUA 1SQPH 5LA6B 1EM1A 1CEZA 3OM3B 4HYOA 4X8AA 1Y74A 3SGIA 3RYCA 4DV2O 3BAAA 3FB5C 2YDEA 3K5LA 3JAMN 1TUBA 3I55V 2UXBO 1AI6A 3SPIA 3ZS8C 3CD6V 4J41A 3UKMA 5LMNO 2PY5A 2ZDIC 2BSKB 3HPLC 4LF6B 2ITCC 2E3CA 4RUFA 2WLMA 1GKFA 4MVQA 3AG3B 3OEEG 5EIBC 5DEDA 3HKEB 1OCOC 1AI4A 2YEVA 3HB3B 4Z1VA 5KLVH 2UUCO 4JI7B 2Y0PA 3CWBH 2ILMA 4JI4B 5GONB 5LXTB 2Q67A 2PGGA 5BY1A 5F2VO 2CTPA 2GV9A 5B5EZ 4B3MB 2E74B 4F6EA 1QVGU 1NJIW 1N8RW 2QWQB 4B3TO 4LF5B 3LSSA 4J7ZA 4LFBB 3G4SV 1ZL8B 3GVMA 2KG7A 1H8HG 4LWSA 1N36B 5EBMC 3B09A 1VQ8V 2HR3A 1EZJA 3IC9A 3T1HO 1V9PA 4PI0A 5J2UB 1IBKO 1WP7A 2H94A 5J9PC 1MG1A 3EFFK 5B1AC 1Y4MA 5L3DA 4JI2O 1L0LH 4UXNA 3SDLA 4ZKIA 4DV5B 1Y76B 3ASOB 3W7SA 1BMFG 3J81N 1ZAUA 4UB8Z 2UXCB 4PA6A 1PL0A 3H1JH 2EIMB 1SQVH 4BWAA 1IBMO 3K59A 5GTIZ 4O4IA 5KAIZ 1VARA 1QLEB 2QSAA 3OE7G 4FLZA 1V54C 5IT9N 4DR6B 4X62B 3LUTB 1J5EO 5LP6C 5CA1A 1SQFA 1Q3EA 4K0KO 2EIJC 4UCSA 5CB4A 1N32O 2AHYA 1H2NA 2Y4TA 2JGUA 2A06H 1RSOB 4WFBV 3ZMUA 2UU9O 3E22A 4OPAA 3RYHA 1QU7A 2N05A 2R9RB 3FYIB 5IJ9B 4O4LA 4QJFB 5H6RA 4DW1A 5DN6G 4CH6A 3K5NA 3OMIB 3JD1A 1AP5A 2BOCC 5EZYB 1SESA 3DTUB 1FS0G 5FLXN 1M56B 3JCUZ 4WFHA 3D3IA 2YEVB 3APQA 1V55C 1W59A 4FLWA 3OGIB 1SQQH 5KX5A 1SZXA 1HDJA 3QO8A 1Q8IA 4RQEA 4FLUA 2ZDIA 5LOVA 3CCVV 2BCCH 4JI0B 4BW9A 5CBGA 2XAGA 3AG2C 2ODMA 3CHXA 3TK1A 5L3BA 1XDCA 2M7WA 2CE4A 1OV9A 5BR8O 4X1KA 1Q43A 1QR9A 4YHHB 1K97A 2Q69A 2YS8A 4WFEA 2IU3A 4UCVA 4F6RA 4X64O 3JSNA 4LC1A 1GN6A 4IHJA 3ZRXA 4DYLA 1M57B 4JI7O 1JX9A 1I0HA 2HEPA 1QBZA 1G8MA 2GBOA 4X66O 2Z5UA 2OTLV 2OCCB 5LHHA 1M9NA 4WCEV 2DOSA 2OYQA 3BCCH 2BOBC 3OR6C 3C3TA 3RWRD 5LGUA 4U3JA 3DC6A 4H13B 1G1XB 3OAAG 1NVPB 2HHHO 1R3KC 1YZBA 4MVZA 1A32A 4X9QA 1EZVH 4DK0A 1PNLA 1L8DA 1VQPV 5IY5B 2N04A 2RDCA 4NYKA 4X1YA 4JI5B 5KA5A 1AI5A 3SJQC 2ZE8A 3RFRA 4DV1O 1SA0A 5EBLC 2EINC 4DR1O 1U96A 5CA1B 1RP3B 5EC2C 3CCSV 2Q7EA 2YI8A 3OGCC 1T5EA 2DE0X 3S3XA 4DV5O 5B3SB 3E89A 3KCXA 1P7BA 1Q6UA 3JATA 2WLIB 3SJAC 3EHBB 2NNUA 5IYZA 1S5HC 5CN0A 2H8PC 2XNDG 1Q6HA 3A8TA 2IM9A 3Q4HB 3C90A 4GKJB 2UUBB 4NVPA 4IYHA 1OHHG 2Q0AA 5JJEB 1XHXA 4FLTA 2RNBA 4DR3O 4EB6B 1M93A 2GSMB 2JVDA 3F7YC 1ENVA 2CUGA 2K9PA 2ZM6O 4X62O 4MTOA 4TUYB 3OT7A 1WNSA 4YJ3B 4GUNA 1BHAA 2JK5C 3K3WA 4MW3A 3ZHVA 3CMEV 4MS2A 1XQ8A 4GZRB 4J80A 4MTXA 2A9HA 3SPCA 2OIGA 1YEWA 3K0DA 3K5OA 4QE7A 2WLHA 1QCEA 3WG7C 3K9AA 1WLEA 2Y4UA 3ZBHA 3K04A 2E75B 4GKKO 2XASA 4GCZA 4PV1B 1HNZB 3SYOA 2DYRC 1HR0B 3ETGA 4JZ2A 1YIJV 4DR7O 4AI8A 4B3SO 5JCOC 4P30A 3M8AA 4LNUA 1D5NA 1TA8A 2ATKC 2UXNA 1F4NA 5B1BB 4DR5O 2EIKC 1VQ7V 3TGUH 3AK1A 2ZNIA 4JTDB 1X4TA 2P6JA 1SA0B 1NVPD 3PJSK 3JAKB 1GN4A 5IYBO 3RYFA 4F4LA 4X65B 2YC0A 2V7QG 3ASOC 2XAJA 3E35A 3BA9A 4JI6O 2AZ2A 4LFCB 2PF4E 3ZHRA 3P3NA 4JI1B 3ZRSA 3W7XA 1YJNV 1FXKB 4I9QA 1FFTB 3J7AU 3CP1A 3LDCA 3N2GA 3CPWU 1BQ0A 4K8ZA 4PJ0Z 4L8JA 1BGYH 1EN4A 3E8HA 4R7CA 5CA0B 5IJ0A 3UM7A 2JJ1G 1KBHA 1IURA 1R1BA 3DSQA 4O2BB 2Z0AA 5JJJB 1XUQA 5KHIA 1OCZC 1ZLZA 1XL6A 1YF2A 5KHHA 4ICGA 4G27B 2UXDO 3U11A 1SRYA 4TV8A 3SYPA 3NR7A 2P4KA 1XMOB 4KXRA 5D5PA 1H8EG 4DV7O 1NS1A 4YJ2B 5IWAO 4GKJO 4I9WA 1KD1W 1I5YA 2BTOA 1E1RG 4TQDA 4I4TA 4B7KA 1M56C 1UFIA 3AG4C 4QE9A 2Y48A 4HAMA 5LHIA 4CH3A 3H1IH 1VQNV 4JI3B 3FYEB 5L3EA 1F51A 4XDLA 2XUMA 4MT8A 1M90W 3AK3A 2DWEC 1O9HA 3CJHA 1H2KA 1YI2V 4NXMB 2E5LB 2IU0A 1VP7A 2FYUH 5CA3A 3KKYA 1MABG 4RAIA 2F1MA 5LBQA 1GO3F 1R6NA 4LNUB 1R3IC 4FFKA 4I0XB 2YI9A 3AEIA 3IJ4A 4P2ZA 2HKOA 1XBLA 1R73A 1MA1A 3CC7V 1FJGB 3RGBA 4B3RB 2WLJA 2R9IA 3UQ8A 4JV5B 2EJ7A 2HP8A 2OCCC 4UCUA 5KMGA 5LL6Y 3RYFB 2B1GA 5JCOA 2F4VB 1I94O 3HKBA 1WJZA 3OTOB 1Z2GA 3CSXA 4U7OA 3EXAA 3AG1C 2LFRA 4DV3B 1WA8B 4PDLA 3B77A 5IY5C 1M1KW 1H38A 1K5QA 5KA6A 1YJWV 5D5QA 1KC8W 1HNWO 1N33B 1FD9A 2H3OA 3FFQA 4IIJA 3OTFA 4ZBMA 1JA8A 1YCIA 2P67A 5HFMA 5FNVB 3F5WC 1THZA 4QGPA 2RN9A 4LF9B 3K06A 4CS4A 1S77D 1VMGA 1M4UA 1VF7A 2A0LA 3RN4A 2F23A 4GX2A 4KHPB 4DUZB 3MHSC 5FPOA 4A5UB 1XNQB 4PHZA 5LYJA 3W7TA 4NXNB 2IJIA 3AK2A 4HZ3A 1YJ9V 4GX5A 1NR1A 3MAQA 4X88A 1HNXB 4JI8B 4FM1A 1YHQV 2WSSG 4JASA 4ABMA 2ZE6A 4O4HB 2PYJA 3SPGA 3T2MA 1YDXA 4I50A 3ZMTA 3APOA 1XMOO 4PDMA 2QWNB 4XBFA 2Q7HA 2JS3A 1QHTA 2UUAB 2Q5ZA 4IL6Z 2ZQMA 2CTWA 2FMLA 5EYPA 4TWKA 3RBZA 3UT5B 1PD3A 4XDKA 2EZPA 3IGAC 2HLDG 2X6BA 4BIZA 3S3WA 2VWKA 2YIBD 3MDSA 2IW5A 1P84F 2X6CA 4TV9A 1ZUQA 4P9OA 1PV0A 3JALA 1QNMA 4JTAB 2JEUA 2JEXA 2VQEO 2CH7A 4LF7B 4FIPC 1B6QA 1XREA 2ZE7A 2GHYA 1SS3A 3DC5A 3FB6C 2ITDC 2Q7GA 2JRIA 3JASA 3CC4V 2ZXWC 1NT2B 1NTKH 4LR3A 2QKAA 4QPJA 4CZZA 1ZWIC 4OGQB 4H33A 5L3FA 5H5NA 3K9SA 1IX9A 2PUSA 4IIJB 2EZOA 1PL4A 5C8YA 4E4EA 1IBLO 2Q73A 5CBHA 1Y74B 5L3GA 4ZI7A 3RYCB 3G80A 2V1DA 4P9PA 1Q82W 1XNRO 2OT5A 3D36C 1TUBB 1JFFA 2VQFO 2CAZC 5JH7A 4UUJC 1FXKC 1NZ6A 2BTQA 1RPRA 3W7UA 3ZHSA 4DR4B 2YUAA 3K5MA 4LF8B 4YY3O 4L87A 5BMVA 2NN4A 1OCCC 4JPRA 2D3OW 4JTCB 4J7KA 5LMUB 4JAUA 3TXQA 3ABUA 3H1HH 4DV0O 3E2EA 4E2LA 1EFRG 2OIEA 2P22C 3ABMC 2QKCA 3ABLB 2QM8A 2Q8VA 3E86A 2W6JG 4Q6GA 1HWYA 3I56V 3MHHC 1L0NH 1AR5A 1GK9A 1KECA 4PDVA 2DQ3A 3N2KA 1P7GA 2DYSC 3STZC 4J9ZB 4LF6O 1AJQA 2KG7B 3ASNB 2E76B 3F5TA 4LWSB 3R65A 5LGNA 3A0BZ 2QM7A 5J2TA 2XHBA 4DV6B 1K8AW 4JI4O 1SZTA 1GAXA 3G6BA 3JALB 4CBCA 3SYQA 2P90A 4BAYA 1VF5B 4NTWA 1MNGA 3ETQA 1RM1C 4B3MO 4J7JA 4DXWA 1S0VA 1ZX3A 4LFAB 4N21A 1SKVA 3JASB 3L74H 3GB7C 4LF5O 1K33A 1Y66A 1OCRC 4LFBO 1WAZA 2HVKC 2YICA 4K3AA 3T4DA 4O4IB 3RYIA 1N36O 2NR5A 2WLKA 2LP7A 1P4RA 2GUZA 3DGEA 1W0KG 1K5SA 5CBFA 4O2AA 1FYJA 3O9OA 3BY6A 3CCLV 2QE7G 3EVKA 1M5IA 2AHZA 3FKSG 3ICXA 4J11A 5CB4B 4GLXA 4H0LB 2QKSA 1US6A 2UXCO 3L9DA 5EC1C 2A3QA 3ZIAG 4GT1A 3B40A 4MTFA 1PNMA 3E22B 2WA4A 4YXWG 3RYHB 2XAQA 2Y69C 4NKGB 4JYAB 5BMVB 4O4LB 4G2KA 4KUMA 1ZSPA 1YITV 2QTSA 3BFRA 5KUMA 4AQYB 3JD2A 5LP6A 4PA3A 5DM6V 3T1YB 3K58A 4DR6O 3D36A 1B06A 2X6AA 2EJRA 2Z3YA 1XEQA 2ZIOA 2LW7A 5KX5B 1XL4A 5ITZA 4B08A 5LOVB 2ETNA 2P5OA 3B8MA 2C2AA 2ZD9A 1YTFB 2W0FC 3IAYA 3E83A 4DO2A 3TETA 4UCTA 2UXXA 2A79B 4DR4O 3ETDA 4X1KB 3JARA 1TVKA 5FL7G 4LF4B 5JQGA 4DV4B 4DR2B 4UV8A 1XMQB
chains in the Genus database with same CATH topology
4NXNO 4NXMO 2E5LO 2UUCO 4DV1O 2UU9O 4OPAA 4B3MO 4DR7O 4B3SO 1X59A 1F7YA 4A5UB 4DR1O 4OPHA 3M8AA 1IBLO 1HNXO 4LF5O 4JI8O 5BY1A 4LFBO 4DV5O 4DR5O 2UUBO 1R6TA 5FLXN 1XNRO 4LF8O 1KUQA 4X65O 1N36O 2VQFO 4JI0O 4B3TO 4LFCO 1FJGO 5LMUO 2AGAA 4JI1O 4DUYO 4B3RO 1FYJA 4YY3O 4JV5O 4YHHO 2UUAO 4JI6O 2ZKOA 2N74A 2DJVA 4DR3O 4JYAO 1AB3A 3J80N 1D2DA 2FKXA 3R66A 3T1HO 1XMOO 3O65A 4DV0O 2ZM6O 5BR8O 1IBKO 2F4VO 4X62O 2UXCO 5A2QN 3OTOO 5LL6Y 4JI2O 3J7AU 4AQYO 3SDLA 3T1YO 4DV3O 4LF4O 4X64O 3J81N 1I94O 1R1BA 2Z0AA 4JI7O 1IBMO 1AILA 4X66O 4DV2O 4LF7O 4DR6O 1N33O 1FKAO 3JAMN 1DK1A 1XEQA 4LF6O 2DOSA 3RT3C 2LW7A 2UXBO 4DV6O 2UXDO 3F5TA 4LF9O 2VQEO 1HNZO 5IT9N 5LMNO 1HNWO 1G1XB 4DV4O 4JI5O 4DR2O 1J5EO 2HHHO 4DV7O 1NS1A 5IWAO 1XMQO 1YZBA 1HR0O 4GKKO 1A32A 4KHPO 4DUZO 4GKJO 2JRIA 4OX9O 5BXZA 4JI3O 4DR4O 4K0KO 4JI4O 1XNQO 4LFAO 1N32O 5H5NA 1N34O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN O;  4NXM O;  2E5L O;  2UUC O;  4DV1 O;  2UU9 O;  4OPA A;  4B3M O;  4DR7 O;  4B3S O;  1X59 A;  1F7Y A;  4A5U B;  4DR1 O;  4OPH A;  3M8A A;  1IBL O;  1HNX O;  4LF5 O;  4JI8 O;  5BY1 A;  4LFB O;  4DV5 O;  4DR5 O;  2UUB O;  1R6T A;  5FLX N;  1XNR O;  4LF8 O;  1KUQ A;  4X65 O;  1N36 O;  2VQF O;  4JI0 O;  4B3T O;  4LFC O;  1FJG O;  5LMU O;  2AGA A;  4JI1 O;  4DUY O;  4B3R O;  1FYJ A;  4YY3 O;  4JV5 O;  4YHH O;  2UUA O;  4JI6 O;  2ZKO A;  2N74 A;  2DJV A;  4DR3 O;  4JYA O;  1AB3 A;  3J80 N;  1D2D A;  2FKX A;  3R66 A;  3T1H O;  1XMO O;  3O65 A;  4DV0 O;  2ZM6 O;  5BR8 O;  1IBK O;  2F4V O;  4X62 O;  2UXC O;  5A2Q N;  3OTO O;  5LL6 Y;  4JI2 O;  3J7A U;  4AQY O;  3SDL A;  3T1Y O;  4DV3 O;  4LF4 O;  4X64 O;  3J81 N;  1I94 O;  1R1B A;  2Z0A A;  4JI7 O;  1IBM O;  1AIL A;  4X66 O;  4DV2 O;  4LF7 O;  4DR6 O;  1N33 O;  1FKA O;  3JAM N;  1DK1 A;  1XEQ A;  4LF6 O;  2DOS A;  3RT3 C;  2LW7 A;  2UXB O;  4DV6 O;  2UXD O;  3F5T A;  4LF9 O;  2VQE O;  1HNZ O;  5IT9 N;  5LMN O;  1HNW O;  1G1X B;  4DV4 O;  4JI5 O;  4DR2 O;  1J5E O;  2HHH O;  4DV7 O;  1NS1 A;  5IWA O;  1XMQ O;  1YZB A;  1HR0 O;  4GKK O;  1A32 A;  4KHP O;  4DUZ O;  4GKJ O;  2JRI A;  4OX9 O;  5BXZ A;  4JI3 O;  4DR4 O;  4K0K O;  4JI4 O;  1XNQ O;  4LFA O;  1N32 O;  5H5N A;  1N34 O; 
#chains in the Genus database with same CATH topology
 3AG3 C;  1NU1 H;  4F6R B;  1NKD A;  1Q86 W;  1S72 V;  4BIO A;  3FAV A;  1F7Y A;  1W0J G;  4IHJ B;  1BZK A;  5AG2 A;  1QLN A;  2QWP B;  1DF4 A;  4K35 A;  2GDS A;  1KUQ A;  2HG5 C;  1ROP A;  2KQX A;  2F43 G;  3CX5 F;  4GX1 A;  4EKW A;  4JI0 O;  1JJO A;  2JDI G;  4U3J B;  2IJJ A;  1JVM A;  2AGA A;  2XTA A;  3HKD A;  2GTA A;  1NH2 B;  2NLJ C;  4X89 A;  1BSM A;  2X0L A;  4YHH O;  1VEW A;  1VIB A;  2QWR B;  3H9V A;  4X1Y B;  3BPZ A;  5B1A B;  1KP2 A;  1OJH A;  3CMA V;  5K1X A;  2DW4 A;  1VQ5 V;  1CPY A;  4I55 A;  3FX7 A;  1PM9 A;  1KKD A;  4FLV A;  3C3S A;  4XDJ A;  3WB1 A;  4FMT A;  1PNK A;  3JAT B;  3UO2 A;  4FZ1 A;  2EIM C;  1BS3 A;  5IYZ B;  3HR0 A;  1I7F A;  4DUY B;  5JVD A;  2QJ1 A;  2YXH A;  3RW0 A;  1DK1 A;  1G4Y B;  1K4C C;  3JAW A;  1JOY A;  1QLE C;  1V54 B;  4LH7 A;  3LSU A;  1HP8 A;  4PA4 A;  4D7T A;  4DV2 B;  3BAB A;  2DQ0 A;  1GTO A;  2PZS A;  5LP6 B;  4JI5 O;  4ZHQ A;  4O4J A;  2DN9 A;  4IGG A;  2UXB B;  2EIJ B;  2PYL A;  3JCZ A;  3BEH A;  3WB2 A;  5LMN B;  3ZED A;  4FZ0 A;  3T1C A;  1KU9 A;  2PI5 A;  2XOK G;  4PA7 A;  5LHG A;  3LDE A;  1AP6 A;  3QO7 A;  3BVO A;  3CXC U;  2HJF C;  3MD0 A;  1H2S B;  4OPH A;  1MZE A;  1JR9 A;  2JS5 A;  5LA6 A;  1VQM V;  2ZR2 A;  2UUB O;  2UUC B;  5JQG B;  3ZMZ A;  1V55 B;  3QVN A;  1FFX A;  3SJB C;  3ZX6 A;  3K0G A;  4PD4 F;  2YXL A;  1S76 D;  3G67 A;  4CH5 A;  2XAH A;  3ZMS A;  2PI4 A;  2N74 A;  3A0R A;  3AG2 B;  4J9Y B;  1JJ2 U;  4OXS A;  5KHG A;  1CXZ B;  4JGS A;  1EBO A;  3NXS A;  2AW9 A;  2B1I A;  1BQZ A;  1KYO F;  3SJC C;  2QGN A;  3THO A;  1E1Q G;  4MVO A;  3B8N A;  1KB9 F;  3HKE A;  4LF4 O;  1IBK B;  3B2E E;  4JI2 B;  5LXT A;  1M57 C;  1AIL A;  3K08 A;  1IZ3 A;  2CGO A;  4I55 B;  3CCR V;  3RT3 C;  1NH2 D;  3QTC A;  1JCH A;  3ZHU A;  1IDS A;  1IBM B;  2EUL A;  1HNZ O;  3RVY A;  1ZL8 A;  2F93 B;  2FL4 A;  1HR0 O;  3UCS C;  4RUE A;  5H9C A;  1WP8 A;  4U7N A;  4TT3 G;  2ZR3 A;  1Y67 A;  4R8C A;  1J5E B;  4WBN A;  2ADQ B;  2EIN B;  3N2G B;  3ETE A;  4YIP A;  4K0K B;  1LR1 A;  5IJ0 B;  4JF3 A;  1QR8 A;  4ZHQ B;  3IFX A;  5IDJ A;  4O4J B;  1N32 B;  3ZHQ A;  4FM0 A;  4I7Z B;  1YXB A;  1MSD A;  4PI2 A;  1KQS U;  1I5X A;  4FLX A;  4DW0 A;  2QTO A;  4IYI A;  2UU9 B;  2IJK A;  1BCC H;  4R6Z A;  5B3S C;  5E79 Z;  4X65 O;  4ASU G;  3KCY A;  3L75 H;  2ZE5 A;  4KP4 A;  4LFC O;  4TV8 B;  3P30 A;  4FM2 A;  1N0J A;  4OX9 B;  4Z2W A;  4DUY O;  4JI1 O;  4QPK A;  1GM9 A;  3WU2 Z;  1NTM H;  3ZHT A;  4J42 A;  1N34 B;  3CRQ A;  2EBO A;  1DLB A;  4JAA A;  3SPH A;  1LNQ A;  3M7M X;  4I4T B;  4UB6 Z;  3KZI Z;  2IBZ H;  1FFX B;  2WPD G;  1TUE B;  2LO1 A;  4AHC A;  1IVS A;  2YXY A;  2CTQ A;  1LUV A;  1N4C A;  1SQX H;  1RSO A;  1U97 A;  1Q90 D;  4G28 B;  1S5J A;  1KMI Z;  4JYB A;  5BR8 B;  3CJH B;  1ARO P;  5IJ9 A;  3CCE V;  2K1E A;  2P7T C;  2RCV A;  5EZY A;  3SYA A;  3WG7 B;  1OZ0 A;  4X64 B;  3OFN G;  2B9Z A;  4LP8 A;  1WPB A;  2YSU B;  3L73 H;  1FXV A;  1S5L Z;  4X66 B;  2LGQ A;  3OMA B;  4EEQ A;  1Z5W A;  2CTR A;  4ZIB A;  1UJW B;  4JI3 O;  5IYD O;  3B4S A;  5H2F Z;  3SPJ A;  4JYC A;  2DYR B;  5KMG B;  4UCR A;  5FPR A;  1PP9 H;  2HHH B;  1P49 A;  1K73 W;  4NXM O;  1YVW A;  2LJ2 A;  2E5L O;  4JYY A;  1X59 A;  3HKB B;  4C7U A;  3ABK B;  4CC6 A;  1WN7 A;  5GTH Z;  1XI1 A;  4D7S A;  2EIK B;  3CCM V;  2KB1 A;  2L35 A;  3TJT A;  1R3L C;  1R6T A;  4DV1 B;  3E8G A;  4MTG A;  5B1B C;  3LSQ A;  4TQF A;  4WBN B;  2ADP A;  4DR1 B;  2JJ2 G;  2F66 C;  2EIL B;  1RFY A;  1NTZ H;  1SER A;  1FJG O;  2BE3 A;  2RQ6 A;  1FXH A;  4B3R O;  1R6K A;  3OR7 C;  4JV5 O;  2CDY A;  3SYC A;  4EFE A;  4HNA A;  4GYC B;  2R70 A;  1NBM G;  3JYC A;  1D2D A;  1AB3 A;  2MW2 B;  2OCH A;  3U10 A;  1WB8 A;  2LFS A;  1GH6 A;  1JPX A;  2F4V O;  3AG7 A;  1K7D A;  3OTO O;  4DR3 B;  2G38 A;  3VBB A;  2PTM A;  5C93 A;  3ZJZ A;  2IJH A;  3W7W A;  4DV3 O;  5LYJ B;  2ZM6 B;  4ZOL A;  1MSW D;  1Q6I A;  1MZF A;  5L3C A;  2JGD A;  1F23 A;  3OD4 A;  2WA3 A;  1OCZ B;  4WFG A;  1EN5 A;  4NTY A;  3OUS A;  4BW5 A;  1MMM A;  4MVR A;  1N33 O;  1SC5 B;  1FKA O;  1NI8 A;  2WLI A;  2VRZ A;  1K3E A;  1IXB A;  5EBW C;  1BHB A;  3Q4H A;  4LF9 O;  1AJP A;  1F4M A;  1H2L A;  3BHP A;  4I50 B;  1KKC A;  4CH4 A;  3A2F A;  4KHP O;  4DUZ O;  4OX9 O;  5BXZ A;  4FFB A;  4CC5 A;  1XHZ A;  4EB6 A;  1R3J C;  3AG4 B;  1XNQ O;  4DRX A;  1K9M W;  2P06 A;  5KHK A;  3SR2 C;  1N34 O;  4GKK B;  4NXN O;  2R9A A;  4TUY A;  5EYP B;  1B04 A;  2HVJ C;  2HFE C;  4YJ3 A;  2YIA A;  1GRJ A;  3QNE A;  3ABT A;  1TAE A;  2QWO B;  1FPO A;  4MVU A;  2EX3 A;  1HNX O;  2IH3 C;  2A7W A;  4QIW F;  1VQ9 V;  4JI8 O;  4Z1M G;  2KKW A;  4DR7 B;  2GTS A;  4TV9 B;  3QG5 A;  4W4K A;  4B3S B;  4MVS A;  4CS3 A;  1SET A;  4WF9 V;  4UFZ A;  1WPX A;  4KFM A;  4UVB A;  2CH7 B;  1S3J A;  1MOF A;  2RMK B;  4DR5 B;  1GN2 A;  2FB5 A;  3P3P A;  3TCU A;  3D3Q A;  3T4Z A;  3X2Q B;  4LH6 A;  3CS5 A;  5A9G A;  3OMN B;  4FK5 C;  1I08 A;  4WFA V;  2UUA O;  4YIO A;  2ZIN A;  4X20 A;  1FAF A;  3QF7 A;  4RWU A;  3OW2 U;  3E8F A;  1Z5V A;  4FJC C;  5A2Q N;  3CYO A;  2V4D A;  4JI6 B;  5JJN B;  3ZN0 A;  5C8Y B;  4K8X A;  2X7R B;  4HNA B;  5LGT A;  5BZB A;  3CCJ V;  4BR6 A;  4ZI7 B;  5IYC O;  5KAF Z;  3JD3 A;  2Q4P A;  1IXM A;  4PEL A;  1VF6 C;  3AG1 B;  4MSW C;  5GW7 A;  1L1F A;  1VQ6 V;  1DTO A;  2M6Y A;  1JFF B;  5JH7 B;  4LF7 O;  2ZT9 B;  2IH1 C;  2BTQ B;  4H44 B;  1KP3 A;  2YID A;  4W4L A;  4ZOL B;  2JGD B;  3K03 A;  3JAK A;  3VQY A;  4EFB A;  1UPG A;  1Q81 W;  2UXD B;  3VQX A;  3LDD A;  2XT9 A;  1SQB H;  3K57 A;  4MVM A;  1NQT A;  3L70 H;  1GM7 A;  2LQT A;  4DV7 B;  5IWA B;  1FXK A;  3CRA A;  1ORQ C;  5E1A C;  2Q9L A;  4TOI A;  4KL1 A;  3N27 A;  4RO2 A;  4FFB B;  3CRC A;  3DXR A;  2Y0I A;  5CA0 A;  3N2K B;  3OUF A;  4DRX B;  4JAV A;  4O2B A;  3H1K H;  3CCQ V;  1W2B U;  1VQ4 V;  3I5D A;  1BE3 H;  2QEX V;  4LF8 O;  5DEC A;  4JZG A;  3STL C;  2ZCE A;  4I5S A;  1OCO B;  1O9G A;  2MK3 A;  5LMU O;  2QDO A;  1DF5 A;  1AVM A;  5J2T B;  1K92 A;  3QO5 A;  5KHJ A;  2WAM A;  1SQG A;  3L71 H;  2DJV A;  1HW7 A;  4YJ2 A;  3HKC A;  2FKX A;  1AR4 A;  3IC7 A;  3O65 A;  5B1N A;  1QVF U;  1JQ0 A;  1D5A A;  3H01 A;  1AI7 A;  3H1L H;  4NB5 A;  3CXH F;  4FPP A;  4X20 B;  4QNH B;  5KUK A;  3VQW A;  4NTX A;  2WLL A;  3RYI B;  3VQV A;  3ZRW A;  4GX0 A;  4D6T H;  3WB0 A;  2W0X A;  2GUZ B;  1I94 B;  1B3Q A;  4WFF A;  5K1P A;  3CCU V;  1SF9 A;  2QM4 A;  1N0N A;  3CRM A;  4O2A B;  4DV6 O;  4MW8 A;  4NR1 A;  1ZTE A;  2YIB A;  2LGW A;  2ZIM A;  3U0Z A;  3ABK C;  3G71 V;  4I0X A;  4H37 A;  3WFV A;  2ZXW B;  2LW1 A;  5IE9 A;  2KSD A;  3LNN A;  3RVZ A;  3BRC A;  1AJN A;  4LFA O;  4X1I A;  2CGN A;  1HNW B;  3CB2 A;  4B7E A;  3M99 B;  2VS0 A;  1WB7 A;  5B66 Z;  2EIL C;  1YSC A;  3L72 H;  2L6L A;  5B1O A;  5CMU A;  3GWK C;  1H2G A;  3LNM B;  3ZRV A;  2P4V A;  4LCU C;  2FTK A;  3CEI A;  3CC2 V;  1H2M A;  1GN3 A;  1VF6 A;  2ZNJ A;  2O57 A;  1VQK V;  1LUW A;  3D8C A;  3K79 A;  1WA8 A;  2WWW A;  5ITZ B;  2B5U A;  3A0H Z;  3DXR B;  1OCC B;  3ZN1 A;  4TSF G;  2ZKO A;  3JSL A;  4JYA O;  1E79 G;  4Q20 A;  3JD0 A;  3JAR B;  4IT5 A;  1TVK B;  3PN1 A;  3R66 A;  2QA4 V;  2DMX A;  4FVM A;  5FNV A;  1CP9 A;  3JD4 A;  5EK0 A;  1NR7 A;  3ABM B;  2Q0O C;  3FAV B;  5HFL A;  3G6E V;  4AQY O;  1YTF D;  3T1Y O;  2DWD C;  3GWO A;  1RPO A;  3TXS A;  3ABL C;  3HKC B;  2RJZ A;  1GMG A;  5EIB D;  2HJD A;  4HBN A;  4DK1 A;  4B3T B;  2DYS B;  1K4D C;  4PA9 A;  2BSK A;  3OEH G;  4UCO A;  1Q7Y W;  3FB8 C;  1JMK C;  3BA8 A;  1COW G;  4N23 A;  3CE2 A;  4CS2 A;  1J95 A;  2R72 A;  3HKD B;  3UO3 A;  3ASN C;  2W6I G;  1Q5O A;  1VQO V;  4PDR A;  3T1H B;  2WLN A;  2WLL B;  3ZRW B;  1DGS A;  3CRR A;  2QR4 A;  4DV4 O;  4DR2 O;  1XMQ O;  5GON A;  3ZMV A;  5H6Q A;  1TGO A;  1XIL A;  4O4H A;  4RQF A;  2VQE B;  4U3F H;  2Q68 A;  2AZ0 A;  2CK3 G;  1RM1 B;  1VQL V;  2F95 B;  1PPJ H;  1OCR B;  2XAF A;  3X2Q C;  3UT5 A;  4FLY A;  1XOU A;  1BT8 A;  4X1I B;  3FD9 A;  1BL8 A;  5JVD B;  2D2C B;  3F7V C;  1AR1 B;  1URF A;  4AIL C;  4UV9 A;  3JAW B;  1IBL B;  4LBE C;  1PKX A;  1G6U A;  5J2U A;  4UVA A;  3P32 A;  3KG2 A;  1XNR B;  5TIS Z;  3E8B A;  2ARH A;  2VQF B;  1Y76 A;  1EN6 A;  3FB7 C;  5JWP A;  1K34 A;  4R50 A;  2OTJ V;  3J80 N;  2Q6A A;  3ZCC A;  4BIU A;  2VWJ A;  4J10 A;  1Y6X A;  4YY3 B;  2JIZ G;  1QQC A;  2Y69 B;  3ML0 A;  2OWO A;  1GM8 A;  2AXT Z;  4UVC A;  4DV0 B;  3VOU A;  1SQP H;  5LA6 B;  1EM1 A;  1CEZ A;  3OM3 B;  4HYO A;  4X8A A;  1Y74 A;  3SGI A;  3RYC A;  4DV2 O;  3BAA A;  3FB5 C;  2YDE A;  3K5L A;  3JAM N;  1TUB A;  3I55 V;  2UXB O;  1AI6 A;  3SPI A;  3ZS8 C;  3CD6 V;  4J41 A;  3UKM A;  5LMN O;  2PY5 A;  2ZDI C;  2BSK B;  3HPL C;  4LF6 B;  2ITC C;  2E3C A;  4RUF A;  2WLM A;  1GKF A;  4MVQ A;  3AG3 B;  3OEE G;  5EIB C;  5DED A;  3HKE B;  1OCO C;  1AI4 A;  2YEV A;  3HB3 B;  4Z1V A;  5KLV H;  2UUC O;  4JI7 B;  2Y0P A;  3CWB H;  2ILM A;  4JI4 B;  5GON B;  5LXT B;  2Q67 A;  2PGG A;  5BY1 A;  5F2V O;  2CTP A;  2GV9 A;  5B5E Z;  4B3M B;  2E74 B;  4F6E A;  1QVG U;  1NJI W;  1N8R W;  2QWQ B;  4B3T O;  4LF5 B;  3LSS A;  4J7Z A;  4LFB B;  3G4S V;  1ZL8 B;  3GVM A;  2KG7 A;  1H8H G;  4LWS A;  1N36 B;  5EBM C;  3B09 A;  1VQ8 V;  2HR3 A;  1EZJ A;  3IC9 A;  3T1H O;  1V9P A;  4PI0 A;  5J2U B;  1IBK O;  1WP7 A;  2H94 A;  5J9P C;  1MG1 A;  3EFF K;  5B1A C;  1Y4M A;  5L3D A;  4JI2 O;  1L0L H;  4UXN A;  3SDL A;  4ZKI A;  4DV5 B;  1Y76 B;  3ASO B;  3W7S A;  1BMF G;  3J81 N;  1ZAU A;  4UB8 Z;  2UXC B;  4PA6 A;  1PL0 A;  3H1J H;  2EIM B;  1SQV H;  4BWA A;  1IBM O;  3K59 A;  5GTI Z;  4O4I A;  5KAI Z;  1VAR A;  1QLE B;  2QSA A;  3OE7 G;  4FLZ A;  1V54 C;  5IT9 N;  4DR6 B;  4X62 B;  3LUT B;  1J5E O;  5LP6 C;  5CA1 A;  1SQF A;  1Q3E A;  4K0K O;  2EIJ C;  4UCS A;  5CB4 A;  1N32 O;  2AHY A;  1H2N A;  2Y4T A;  2JGU A;  2A06 H;  1RSO B;  4WFB V;  3ZMU A;  2UU9 O;  3E22 A;  4OPA A;  3RYH A;  1QU7 A;  2N05 A;  2R9R B;  3FYI B;  5IJ9 B;  4O4L A;  4QJF B;  5H6R A;  4DW1 A;  5DN6 G;  4CH6 A;  3K5N A;  3OMI B;  3JD1 A;  1AP5 A;  2BOC C;  5EZY B;  1SES A;  3DTU B;  1FS0 G;  5FLX N;  1M56 B;  3JCU Z;  4WFH A;  3D3I A;  2YEV B;  3APQ A;  1V55 C;  1W59 A;  4FLW A;  3OGI B;  1SQQ H;  5KX5 A;  1SZX A;  1HDJ A;  3QO8 A;  1Q8I A;  4RQE A;  4FLU A;  2ZDI A;  5LOV A;  3CCV V;  2BCC H;  4JI0 B;  4BW9 A;  5CBG A;  2XAG A;  3AG2 C;  2ODM A;  3CHX A;  3TK1 A;  5L3B A;  1XDC A;  2M7W A;  2CE4 A;  1OV9 A;  5BR8 O;  4X1K A;  1Q43 A;  1QR9 A;  4YHH B;  1K97 A;  2Q69 A;  2YS8 A;  4WFE A;  2IU3 A;  4UCV A;  4F6R A;  4X64 O;  3JSN A;  4LC1 A;  1GN6 A;  4IHJ A;  3ZRX A;  4DYL A;  1M57 B;  4JI7 O;  1JX9 A;  1I0H A;  2HEP A;  1QBZ A;  1G8M A;  2GBO A;  4X66 O;  2Z5U A;  2OTL V;  2OCC B;  5LHH A;  1M9N A;  4WCE V;  2DOS A;  2OYQ A;  3BCC H;  2BOB C;  3OR6 C;  3C3T A;  3RWR D;  5LGU A;  4U3J A;  3DC6 A;  4H13 B;  1G1X B;  3OAA G;  1NVP B;  2HHH O;  1R3K C;  1YZB A;  4MVZ A;  1A32 A;  4X9Q A;  1EZV H;  4DK0 A;  1PNL A;  1L8D A;  1VQP V;  5IY5 B;  2N04 A;  2RDC A;  4NYK A;  4X1Y A;  4JI5 B;  5KA5 A;  1AI5 A;  3SJQ C;  2ZE8 A;  3RFR A;  4DV1 O;  1SA0 A;  5EBL C;  2EIN C;  4DR1 O;  1U96 A;  5CA1 B;  1RP3 B;  5EC2 C;  3CCS V;  2Q7E A;  2YI8 A;  3OGC C;  1T5E A;  2DE0 X;  3S3X A;  4DV5 O;  5B3S B;  3E89 A;  3KCX A;  1P7B A;  1Q6U A;  3JAT A;  2WLI B;  3SJA C;  3EHB B;  2NNU A;  5IYZ A;  1S5H C;  5CN0 A;  2H8P C;  2XND G;  1Q6H A;  3A8T A;  2IM9 A;  3Q4H B;  3C90 A;  4GKJ B;  2UUB B;  4NVP A;  4IYH A;  1OHH G;  2Q0A A;  5JJE B;  1XHX A;  4FLT A;  2RNB A;  4DR3 O;  4EB6 B;  1M93 A;  2GSM B;  2JVD A;  3F7Y C;  1ENV A;  2CUG A;  2K9P A;  2ZM6 O;  4X62 O;  4MTO A;  4TUY B;  3OT7 A;  1WNS A;  4YJ3 B;  4GUN A;  1BHA A;  2JK5 C;  3K3W A;  4MW3 A;  3ZHV A;  3CME V;  4MS2 A;  1XQ8 A;  4GZR B;  4J80 A;  4MTX A;  2A9H A;  3SPC A;  2OIG A;  1YEW A;  3K0D A;  3K5O A;  4QE7 A;  2WLH A;  1QCE A;  3WG7 C;  3K9A A;  1WLE A;  2Y4U A;  3ZBH A;  3K04 A;  2E75 B;  4GKK O;  2XAS A;  4GCZ A;  4PV1 B;  1HNZ B;  3SYO A;  2DYR C;  1HR0 B;  3ETG A;  4JZ2 A;  1YIJ V;  4DR7 O;  4AI8 A;  4B3S O;  5JCO C;  4P30 A;  3M8A A;  4LNU A;  1D5N A;  1TA8 A;  2ATK C;  2UXN A;  1F4N A;  5B1B B;  4DR5 O;  2EIK C;  1VQ7 V;  3TGU H;  3AK1 A;  2ZNI A;  4JTD B;  1X4T A;  2P6J A;  1SA0 B;  1NVP D;  3PJS K;  3JAK B;  1GN4 A;  5IYB O;  3RYF A;  4F4L A;  4X65 B;  2YC0 A;  2V7Q G;  3ASO C;  2XAJ A;  3E35 A;  3BA9 A;  4JI6 O;  2AZ2 A;  4LFC B;  2PF4 E;  3ZHR A;  3P3N A;  4JI1 B;  3ZRS A;  3W7X A;  1YJN V;  1FXK B;  4I9Q A;  1FFT B;  3J7A U;  3CP1 A;  3LDC A;  3N2G A;  3CPW U;  1BQ0 A;  4K8Z A;  4PJ0 Z;  4L8J A;  1BGY H;  1EN4 A;  3E8H A;  4R7C A;  5CA0 B;  5IJ0 A;  3UM7 A;  2JJ1 G;  1KBH A;  1IUR A;  1R1B A;  3DSQ A;  4O2B B;  2Z0A A;  5JJJ B;  1XUQ A;  5KHI A;  1OCZ C;  1ZLZ A;  1XL6 A;  1YF2 A;  5KHH A;  4ICG A;  4G27 B;  2UXD O;  3U11 A;  1SRY A;  4TV8 A;  3SYP A;  3NR7 A;  2P4K A;  1XMO B;  4KXR A;  5D5P A;  1H8E G;  4DV7 O;  1NS1 A;  4YJ2 B;  5IWA O;  4GKJ O;  4I9W A;  1KD1 W;  1I5Y A;  2BTO A;  1E1R G;  4TQD A;  4I4T A;  4B7K A;  1M56 C;  1UFI A;  3AG4 C;  4QE9 A;  2Y48 A;  4HAM A;  5LHI A;  4CH3 A;  3H1I H;  1VQN V;  4JI3 B;  3FYE B;  5L3E A;  1F51 A;  4XDL A;  2XUM A;  4MT8 A;  1M90 W;  3AK3 A;  2DWE C;  1O9H A;  3CJH A;  1H2K A;  1YI2 V;  4NXM B;  2E5L B;  2IU0 A;  1VP7 A;  2FYU H;  5CA3 A;  3KKY A;  1MAB G;  4RAI A;  2F1M A;  5LBQ A;  1GO3 F;  1R6N A;  4LNU B;  1R3I C;  4FFK A;  4I0X B;  2YI9 A;  3AEI A;  3IJ4 A;  4P2Z A;  2HKO A;  1XBL A;  1R73 A;  1MA1 A;  3CC7 V;  1FJG B;  3RGB A;  4B3R B;  2WLJ A;  2R9I A;  3UQ8 A;  4JV5 B;  2EJ7 A;  2HP8 A;  2OCC C;  4UCU A;  5KMG A;  5LL6 Y;  3RYF B;  2B1G A;  5JCO A;  2F4V B;  1I94 O;  3HKB A;  1WJZ A;  3OTO B;  1Z2G A;  3CSX A;  4U7O A;  3EXA A;  3AG1 C;  2LFR A;  4DV3 B;  1WA8 B;  4PDL A;  3B77 A;  5IY5 C;  1M1K W;  1H38 A;  1K5Q A;  5KA6 A;  1YJW V;  5D5Q A;  1KC8 W;  1HNW O;  1N33 B;  1FD9 A;  2H3O A;  3FFQ A;  4IIJ A;  3OTF A;  4ZBM A;  1JA8 A;  1YCI A;  2P67 A;  5HFM A;  5FNV B;  3F5W C;  1THZ A;  4QGP A;  2RN9 A;  4LF9 B;  3K06 A;  4CS4 A;  1S77 D;  1VMG A;  1M4U A;  1VF7 A;  2A0L A;  3RN4 A;  2F23 A;  4GX2 A;  4KHP B;  4DUZ B;  3MHS C;  5FPO A;  4A5U B;  1XNQ B;  4PHZ A;  5LYJ A;  3W7T A;  4NXN B;  2IJI A;  3AK2 A;  4HZ3 A;  1YJ9 V;  4GX5 A;  1NR1 A;  3MAQ A;  4X88 A;  1HNX B;  4JI8 B;  4FM1 A;  1YHQ V;  2WSS G;  4JAS A;  4ABM A;  2ZE6 A;  4O4H B;  2PYJ A;  3SPG A;  3T2M A;  1YDX A;  4I50 A;  3ZMT A;  3APO A;  1XMO O;  4PDM A;  2QWN B;  4XBF A;  2Q7H A;  2JS3 A;  1QHT A;  2UUA B;  2Q5Z A;  4IL6 Z;  2ZQM A;  2CTW A;  2FML A;  5EYP A;  4TWK A;  3RBZ A;  3UT5 B;  1PD3 A;  4XDK A;  2EZP A;  3IGA C;  2HLD G;  2X6B A;  4BIZ A;  3S3W A;  2VWK A;  2YIB D;  3MDS A;  2IW5 A;  1P84 F;  2X6C A;  4TV9 A;  1ZUQ A;  4P9O A;  1PV0 A;  3JAL A;  1QNM A;  4JTA B;  2JEU A;  2JEX A;  2VQE O;  2CH7 A;  4LF7 B;  4FIP C;  1B6Q A;  1XRE A;  2ZE7 A;  2GHY A;  1SS3 A;  3DC5 A;  3FB6 C;  2ITD C;  2Q7G A;  2JRI A;  3JAS A;  3CC4 V;  2ZXW C;  1NT2 B;  1NTK H;  4LR3 A;  2QKA A;  4QPJ A;  4CZZ A;  1ZWI C;  4OGQ B;  4H33 A;  5L3F A;  5H5N A;  3K9S A;  1IX9 A;  2PUS A;  4IIJ B;  2EZO A;  1PL4 A;  5C8Y A;  4E4E A;  1IBL O;  2Q73 A;  5CBH A;  1Y74 B;  5L3G A;  4ZI7 A;  3RYC B;  3G80 A;  2V1D A;  4P9P A;  1Q82 W;  1XNR O;  2OT5 A;  3D36 C;  1TUB B;  1JFF A;  2VQF O;  2CAZ C;  5JH7 A;  4UUJ C;  1FXK C;  1NZ6 A;  2BTQ A;  1RPR A;  3W7U A;  3ZHS A;  4DR4 B;  2YUA A;  3K5M A;  4LF8 B;  4YY3 O;  4L87 A;  5BMV A;  2NN4 A;  1OCC C;  4JPR A;  2D3O W;  4JTC B;  4J7K A;  5LMU B;  4JAU A;  3TXQ A;  3ABU A;  3H1H H;  4DV0 O;  3E2E A;  4E2L A;  1EFR G;  2OIE A;  2P22 C;  3ABM C;  2QKC A;  3ABL B;  2QM8 A;  2Q8V A;  3E86 A;  2W6J G;  4Q6G A;  1HWY A;  3I56 V;  3MHH C;  1L0N H;  1AR5 A;  1GK9 A;  1KEC A;  4PDV A;  2DQ3 A;  3N2K A;  1P7G A;  2DYS C;  3STZ C;  4J9Z B;  4LF6 O;  1AJQ A;  2KG7 B;  3ASN B;  2E76 B;  3F5T A;  4LWS B;  3R65 A;  5LGN A;  3A0B Z;  2QM7 A;  5J2T A;  2XHB A;  4DV6 B;  1K8A W;  4JI4 O;  1SZT A;  1GAX A;  3G6B A;  3JAL B;  4CBC A;  3SYQ A;  2P90 A;  4BAY A;  1VF5 B;  4NTW A;  1MNG A;  3ETQ A;  1RM1 C;  4B3M O;  4J7J A;  4DXW A;  1S0V A;  1ZX3 A;  4LFA B;  4N21 A;  1SKV A;  3JAS B;  3L74 H;  3GB7 C;  4LF5 O;  1K33 A;  1Y66 A;  1OCR C;  4LFB O;  1WAZ A;  2HVK C;  2YIC A;  4K3A A;  3T4D A;  4O4I B;  3RYI A;  1N36 O;  2NR5 A;  2WLK A;  2LP7 A;  1P4R A;  2GUZ A;  3DGE A;  1W0K G;  1K5S A;  5CBF A;  4O2A A;  1FYJ A;  3O9O A;  3BY6 A;  3CCL V;  2QE7 G;  3EVK A;  1M5I A;  2AHZ A;  3FKS G;  3ICX A;  4J11 A;  5CB4 B;  4GLX A;  4H0L B;  2QKS A;  1US6 A;  2UXC O;  3L9D A;  5EC1 C;  2A3Q A;  3ZIA G;  4GT1 A;  3B40 A;  4MTF A;  1PNM A;  3E22 B;  2WA4 A;  4YXW G;  3RYH B;  2XAQ A;  2Y69 C;  4NKG B;  4JYA B;  5BMV B;  4O4L B;  4G2K A;  4KUM A;  1ZSP A;  1YIT V;  2QTS A;  3BFR A;  5KUM A;  4AQY B;  3JD2 A;  5LP6 A;  4PA3 A;  5DM6 V;  3T1Y B;  3K58 A;  4DR6 O;  3D36 A;  1B06 A;  2X6A A;  2EJR A;  2Z3Y A;  1XEQ A;  2ZIO A;  2LW7 A;  5KX5 B;  1XL4 A;  5ITZ A;  4B08 A;  5LOV B;  2ETN A;  2P5O A;  3B8M A;  2C2A A;  2ZD9 A;  1YTF B;  2W0F C;  3IAY A;  3E83 A;  4DO2 A;  3TET A;  4UCT A;  2UXX A;  2A79 B;  4DR4 O;  3ETD A;  4X1K B;  3JAR A;  1TVK A;  5FL7 G;  4LF4 B;  5JQG A;  4DV4 B;  4DR2 B;  4UV8 A;  1XMQ B; 
#chains in the Genus database with same CATH homology
 4NXN O;  4NXM O;  2E5L O;  2UUC O;  4DV1 O;  2UU9 O;  4OPA A;  4B3M O;  4DR7 O;  4B3S O;  1X59 A;  1F7Y A;  4A5U B;  4DR1 O;  4OPH A;  3M8A A;  1IBL O;  1HNX O;  4LF5 O;  4JI8 O;  5BY1 A;  4LFB O;  4DV5 O;  4DR5 O;  2UUB O;  1R6T A;  5FLX N;  1XNR O;  4LF8 O;  1KUQ A;  4X65 O;  1N36 O;  2VQF O;  4JI0 O;  4B3T O;  4LFC O;  1FJG O;  5LMU O;  2AGA A;  4JI1 O;  4DUY O;  4B3R O;  1FYJ A;  4YY3 O;  4JV5 O;  4YHH O;  2UUA O;  4JI6 O;  2ZKO A;  2N74 A;  2DJV A;  4DR3 O;  4JYA O;  1AB3 A;  3J80 N;  1D2D A;  2FKX A;  3R66 A;  3T1H O;  1XMO O;  3O65 A;  4DV0 O;  2ZM6 O;  5BR8 O;  1IBK O;  2F4V O;  4X62 O;  2UXC O;  5A2Q N;  3OTO O;  5LL6 Y;  4JI2 O;  3J7A U;  4AQY O;  3SDL A;  3T1Y O;  4DV3 O;  4LF4 O;  4X64 O;  3J81 N;  1I94 O;  1R1B A;  2Z0A A;  4JI7 O;  1IBM O;  1AIL A;  4X66 O;  4DV2 O;  4LF7 O;  4DR6 O;  1N33 O;  1FKA O;  3JAM N;  1DK1 A;  1XEQ A;  4LF6 O;  2DOS A;  3RT3 C;  2LW7 A;  2UXB O;  4DV6 O;  2UXD O;  3F5T A;  4LF9 O;  2VQE O;  1HNZ O;  5IT9 N;  5LMN O;  1HNW O;  1G1X B;  4DV4 O;  4JI5 O;  4DR2 O;  1J5E O;  2HHH O;  4DV7 O;  1NS1 A;  5IWA O;  1XMQ O;  1YZB A;  1HR0 O;  4GKK O;  1A32 A;  4KHP O;  4DUZ O;  4GKJ O;  2JRI A;  4OX9 O;  5BXZ A;  4JI3 O;  4DR4 O;  4K0K O;  4JI4 O;  1XNQ O;  4LFA O;  1N32 O;  5H5N A;  1N34 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...