4JI6O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 34
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji6O00
5H5NA 4JI8O 1XMOO 4JI0O 4JI6O 4B3RO 3T1HO 2UUAO 4B3SO 1FJGO 4DR6O 5LL6Y 4DR7O 2JRIA 4YHHO 1DK1A 2DOSA 1XNQO 1HNWO 1X59A 5IT9N 2LW7A 4LF6O 4JYAO 3J7AU 4LFCO 4KHPO 1J5EO 4OX9O 1N32O 3SDLA 4JI5O 4DR1O 4OPAA 1XNRO 3R66A 4DUZO 1AB3A 2UXDO 4DR4O 1IBMO 5BXZA 4JI4O 4DUYO 4A5UB 1N33O 4LF9O 1XEQA 4DV5O 3F5TA 4LF5O 4JI2O 2UXBO 4OPHA 4DR5O 1D2DA 4DR2O 2ZM6O 4JV5O 4LF4O 4X66O 1FYJA 5LMNO 1HNZO 2VQFO 4LFBO 4DV6O 4X64O 1R6TA 3T1YO 4NXNO 4DV0O 4DV4O 1FKAO 4GKKO 1A32A 4JI3O 4DV2O 2N74A 2AGAA 3J81N 2UXCO 4LFAO 5LMUO 4DV1O 4DV3O 3J80N 4JI7O 1NS1A 2HHHO 1HR0O 4B3TO 1IBKO 2UUBO 1R1BA 4X65O 4JI1O 5BY1A 3M8AA 5FLXN 4YY3O 5IWAO 4LF7O 4AQYO 2Z0AA 3RT3C 3JAMN 4GKJO 2F4VO 2UU9O 1I94O 4K0KO 4DR3O 1IBLO 3O65A 2UUCO 2FKXA 4B3MO 2E5LO 5BR8O 3OTOO 5A2QN 1F7YA 2ZKOA 4X62O 1AILA 1N36O 1HNXO 1XMQO 1G1XB 1KUQA 2DJVA 1N34O 2VQEO 1YZBA 4DV7O 4NXMO 4LF8O
chains in the Genus database with same CATH superfamily
4JI4B 5H5NA 3CCRV 2IJHA 2JS5A 1SKVA 3L9DA 3ML0A 3OE7G 5KUKA 3K5MA 3CSXA 1QVFU 1US6A 1ZTEA 2YI8A 5GONA 3T1CA 1W2BU 2EINB 2YDEA 1U96A 3HKDB 2PY5A 2Y0PA 2KG7A 4FLYA 1I94B 2ZT9B 2YSUB 3BEHA 3VQWA 1LUVA 1NU1H 4B3MB 3STZC 1H2LA 1FXKC 4YJ2B 3B77A 1RM1C 4J11A 5KHKA 3ASOB 4TSFG 1KC8W 5LP6C 1N34B 2ZR3A 2PI5A 1IZ3A 4IYIA 1NTZH 2GUZB 2FMLA 3JYCA 5EC1C 1IX9A 3APQA 2WA3A 3T1YO 1H8HG 1PNKA 5IY5B 4BAYA 2EJ7A 1Q86W 2JDIG 1JMKC 3W7WA 1XOUA 4KL1A 4WCEV 2YC0A 4LWSB 2EULA 2JGUA 2A3QA 4D7SA 1HR0O 3UO2A 2BSKA 4LF8B 1QLEB 5D5PA 3THOA 1FFTB 4K8XA 3SYAA 3L71H 1AR1B 3WB2A 1THZA 2B1GA 4LF5B 4GX1A 1H8EG 2BTQB 2FB5A 4X20B 5LA6B 3S3WA 4YJ3A 1YJWV 4ZIBA 4F6RB 4QJFB 4KUMA 4QPKA 5LHIA 1E79G 2E75B 4LF4B 4X62O 3AG7A 4ZI7B 2GTSA 2XNDG 1EBOA 3N2KB 4JI8O 1Q7YW 4DV5B 1QNMA 2ITCC 4K8ZA 2GHYA 1IURA 1YDXA 1VARA 2UUAO 3E22B 4UVBA 1GN3A 5LL6Y 3ZIAG 3T2MA 4X1KB 2W6IG 5EIBC 4YJ2A 5JH7B 2EJRA 1F4MA 1MA1A 4P9PA 1P4RA 2WLLB 2QKSA 1FXKB 4LP8A 4TQDA 4DR4O 2GUZA 5KUMA 3OTOB 4LFAB 2WLKA 4WBNB 1K34A 5LP6B 5DM6V 1V54B 2FTKA 3ABKB 3ZJZA 3RYIB 3HKEA 1B3QA 4LCUC 4DR2O 2XAQA 1IVSA 3A0HZ 5L3EA 2A0LA 5EC2C 4LWSA 4R50A 3UM7A 2DN9A 4JAAA 3A2FA 2EX3A 4DV4O 2L6LA 1Q8IA 2BTQA 1M5IA 2VRZA 4X20A 5LA6A 5EBMC 1NS1A 1Y6XA 4FLZA 1VQKV 1N8RW 2IJKA 4NVPA 2XUMA 1DTOA 3BA9A 1M4UA 3FYEB 4ZI7A 2D3OW 4IIJA 2EIMB 1Q43A 2DMXA 4JI6B 2GTAA 3L74H 4TUYB 4CC6A 2Q8VA 5LBQA 3HB3B 4DW1A 3N2KA 2OCCC 1AJQA 2K1EA 5BR8O 2YICA 3OMAB 2IM9A 3SJQC 3RVYA 3E22A 4ASUG 1BQZA 1KUQA 3UKMA 2R9IA 2CGNA 3BABA 3IFXA 4BIOA 5JH7A 2GSMB 4U3JB 2C2AA 4O2BA 2NR5A 2B1IA 1BE3H 1FXKA 2M7WA 4B3SO 3IC7A 1MNGA 2HR3A 4XDLA 1NKDA 4WBNA 1K3EA 1QVGU 3ZHQA 5LP6A 2Q9LA 1OCOB 4LC1A 4MVUA 3RYIA 3UT5B 3OT7A 1N32O 3G71V 2H94A 3BPZA 1AB3A 1GO3F 3SJBC 4ZHQB 3RYFA 1KU9A 5ITZB 3OM3B 4DV1B 2FYUH 3U0ZA 4OPHA 2H3OA 3SJCC 4WFHA 4UV9A 3B4SA 3CMEV 2GDSA 4XDKA 2DYSB 2UU9B 4UCSA 3JCUZ 1R3IC 1VP7A 3FX7A 5EBLC 4BW9A 1OHHG 5FL7G 1SF9A 1K5QA 2HFEC 2X6AA 4LNUB 4ZBMA 4PDRA 2Q0OC 4JYAB 4TWKA 1F51A 1IBKO 2ILMA 3I56V 4I4TB 2O57A 3M8AA 4MTOA 2Y69C 2ADQB 4DRXB 3JALB 4N21A 4RQFA 1JQ0A 3G6BA 4H13B 4I50A 2OCCB 4O2AB 2PGGA 2AXTZ 4X88A 4U3JA 2E5LO 3BHPA 1QR8A 3LDDA 2WLHA 2ZKOA 1M56C 4DV6B 4FFBB 4F4LA 5EK0A 2XAFA 1OJHA 2HLDG 3UT5A 1AI4A 3TJTA 1GKFA 3T1HO 4WFFA 4Z2WA 3JAKB 2NLJC 5ITZA 3WG7C 2ZIMA 2OTJV 2LW7A 3H1HH 2VQFB 4KHPO 4GKJB 4BW5A 5EYPB 1Q6IA 4OPAA 2W0FC 2LGQA 5E79Z 3FB5C 3CCLV 1QBZA 3SJAC 3ZMVA 1KKDA 2AZ2A 4LR3A 5B66Z 2QR4A 1BZKA 3R65A 4O4LB 1MSWD 5B1AC 1EN4A 1GK9A 2JEXA 4I4TA 1M57B 4GX0A 3K04A 3DXRB 3OW2U 4DRXA 5B1BC 3JALA 3FB8C 3E8BA 1NT2B 5EBWC 2P67A 2Y69B 5CA1B 1YI2V 4NKGB 3EVKA 3ZMSA 2VWKA 1JVMA 1XNRB 4Z1MG 3CCMV 1SC5B 2P7TC 3OUFA 4NTYA 2V1DA 2Q4PA 4UUJC 1JA8A 2Q6AA 2IH1C 1ZL8B 4MSWC 1ZAUA 5IYBO 3MDSA 2ZM6B 1KECA 3FKSG 5CN0A 2H8PC 4LFCB 2ZINA 3E86A 4LFBB 3JAKA 4L8JA 4O4IB 1QQCA 3H1JH 3DTUB 4MVOA 1F23A 5KLVH 5LGUA 2BTOA 1Q82W 2R9AA 3I55V 2UXBB 4R6ZA 4B3RO 4EB6B 3RFRA 3H9VA 2ZE7A 3E8FA 4RO2A 1GM7A 2X0LA 2IU0A 5H6RA 2HKOA 5GTHZ 1SQFA 1KMIZ 1VIBA 4KP4A 4X64B 1J5EO 3MD0A 4O4LA 2QEXV 3LDCA 2JIZG 4PDLA 1EFRG 4JZ2A 4JI2O 1P84F 3DXRA 5B1AB 2ODMA 3OR7C 1G4YB 4YY3B 2QWNB 1QU7A 2RNBA 3RWRD 1PV0A 1PNMA 3CCQV 3P30A 3AG3C 5CA1A 3AK2A 3WFVA 4DK0A 2LW1A 1VF6C 2NNUA 5B1BB 1GTOA 3VQVA 1PL4A 2UUCB 5GONB 2Q0AA 1Y76B 5LMUO 5LGNA 4B3TO 1ZL8A 4X65O 1WN7A 2X6CA 1MABG 1YXBA 1B04A 5CBFA 2CGOA 4JAVA 3QF7A 4LF9B 2P6JA 3CYOA 4O4IA 1CP9A 2X6BA 1PM9A 2EZOA 4YHHB 1JJOA 4JV5B 4FPPA 3TCUA 1HNWB 5IDJA 4J7KA 4EB6A 5L3BA 3ZEDA 3MHSC 2Q73A 1YZBA 3ETDA 1Y74B 2IU3A 2PTMA 2GBOA 4NXMO 1MOFA 2DE0X 2YXLA 1R3KC 5H6QA 2UXCB 5KHGA 2BCCH 1SQBH 3CCVV 4RQEA 4ICGA 3FB7C 1PL0A 5A9GA 4MW8A 1M93A 3F7VC 3WB0A 4FLTA 1B6QA 1J95A 1AI5A 1V9PA 4FJCC 3CE2A 4CC5A 1K33A 1H2GA 2QWRB 5BXZA 4JI4O 4DUYO 3F5TA 4FLXA 1KP2A 4JF3A 1BL8A 3QO5A 4JI1B 1HNXB 2VQEB 3C3TA 1AR4A 3AG3B 1Y76A 5KA5A 1VF7A 5L3FA 2ZQMA 2A7WA 4JYCA 3L70H 3IAYA 4XDJA 2WSSG 1VEWA 2ITDC 3SPJA 1GH6A 4XBFA 5KAFZ 2N74A 4DV2O 2AGAA 4H44B 2JJ1G 2BOCC 4ZKIA 3CX5F 3SPCA 5IYZB 4YIPA 3LSQA 4FVMA 2XTAA 1V54C 5BY1A 1FAFA 3ABKC 3ZRXA 3SYPA 1TA8A 4WFGA 5IJ0A 4O4JB 1H2NA 3G6EV 2DQ0A 3B40A 2F95B 4JAUA 1FJGB 1Y74A 1BGYH 1ORQC 1YVWA 3HKEB 2B5UA 1W59A 3OD4A 3I5DA 3K5OA 4X9QA 2LO1A 4PA7A 1WB7A 4IGGA 2PYLA 2W6JG 3HKBB 3K59A 3T1YB 5GW7A 4DV7O 2UXDB 1Q90D 4LF8O 5J2TB 2MK3A 1SA0A 1KD1W 2OWOA 2EIMC 1MG1A 1HR0B 5DECA 2Z5UA 4PA9A 1H2KA 2QJ1A 4PV1B 3SPHA 1N4CA 2XASA 2NN4A 4CBCA 4IIJB 1MMMA 1QCEA 1QR9A 1NR7A 2P22C 3QO7A 3K3WA 1ROPA 3O9OA 3F7YC 1S76D 1ZUQA 3LSSA 1VF6A 5B1NA 4JYYA 4DV5O 4X62B 2P4VA 1ZLZA 4FFKA 4QE7A 4UCTA 3RYCB 4PA6A 5IWAB 1OZ0A 2JK5C 4LF7B 1CEZA 4X66O 5IYZA 5IYCO 4O2BB 3CC4V 1OCOC 1R6TA 3BCCH 1PNLA 3W7TA 5E1AC 1VQ7V 2QM7A 4O4JA 3E8HA 2ATKC 4GUNA 4X1IB 4LFAO 3D8CA 3SGIA 2EILC 2UUBO 1XL4A 1Z5WA 3DSQA 3K0DA 2F1MA 1K9MW 2AZ0A 3OMIB 2CUGA 2AHZA 4I5SA 1GM9A 3RYFB 4DR4B 1ZSPA 1K4DC 4B7KA 4JGSA 1SQGA 3ZMUA 1Q6HA 2LGWA 3HKBA 5FPOA 2ZR2A 2A79B 2DYSC 2LQTA 4IHJB 2F93B 4MVRA 4DR2B 5J2TA 4NTXA 1EN5A 5A2QN 1XNQB 5LGTA 3L75H 1GMGA 2N04A 2RMKB 4MVSA 1PP9H 1XMQO 4G28B 4I9QA 1JCHA 4DV4B 1E1QG 1AP6A 4PA4A 1M9NA 4GYCB 4JI6O 1R6KA 3CXCU 2GV9A 4K3AA 4FZ1A 1DK1A 3QG5A 3H01A 3JD1A 3ZHVA 3TXQA 3RYCA 5IT9N 3J7AU 3ZHTA 4W4LA 3CRAA 4I50B 1BT8A 3SDLA 3JD0A 4DV0B 4FMTA 4MTFA 3B8NA 4YXWG 4PHZA 3SYCA 2WPDG 2KB1A 2CK3G 3FD9A 5B1OA 2CAZC 2OTLV 1EN6A 2Z3YA 5IYDO 1V55C 1SS3A 2WAMA 1BMFG 3H1IH 5GTIZ 1W0KG 4X1IA 3ZBHA 2RDCA 1Q3EA 2OCHA 2CDYA 1JPXA 2WLIB 4UXNA 4B3SB 3BY6A 1MSDA 3JAWB 2EILB 5LHHA 1VF5B 1N0NA 3J81N 4PI0A 1DLBA 1H2MA 4DV1O 5FPRA 1R1BA 4IHJA 1N32B 1JR9A 4DO2A 2EIKB 2DYRC 4J41A 3OEHG 2QE7G 3K06A 1AROP 1VMGA 4JI0B 2Z0AA 4AQYO 1NQTA 4BR6A 1IXMA 2ZE5A 2CTRA 2F4VO 3CHXA 1DF5A 1I7FA 2UU9O 4UCOA 3EFFK 4GX2A 1M57C 3O65A 2QM4A 4NYKA 1URFA 4NB5A 1R6NA 4LF6B 3KZIZ 2Y4TA 1YITV 5KMGB 3Q4HB 2XAGA 3ABMC 1MZFA 2QTSA 4J42A 4OX9B 1LR1A 3HKCA 1NR1A 5CMUA 3CD6V 2YXYA 2YXHA 1OCRB 1YTFD 1XMOO 4PJ0Z 1NH2D 1RFYA 4WF9V 3W7SA 1FFXB 4JYBA 4QIWF 3VQYA 4JPRA 5L3CA 3E83A 1IBKB 2PYJA 4PD4F 1WNSA 4IL6Z 4DR7O 2QWPB 3B09A 2XHBA 2ADPA 1SETA 3K0GA 4ABMA 1S72V 3GWKC 4JI5O 5JCOC 1WPBA 1XILA 5TISZ 5F2VO 2E5LB 2YS8A 4CH3A 2E76B 3ABUA 2WLIA 1XEQA 2WLNA 3N2GB 1V55B 4TOIA 4DV3B 2WA4A 1AI6A 1RSOA 2HHHB 1CXZB 1Q6UA 1KBHA 2P4KA 3CPWU 3JAWA 1H2SB 2Q7GA 4P2ZA 2A06H 2HJFC 2E3CA 2JS3A 4X89A 1R73A 3D3QA 2VQFO 5J9PC 2UXXA 5L3GA 1OCZC 1YJNV 3T1HB 4NXNO 1IBLB 3LDEA 3H1KH 4GKKO 2PI4A 3N27A 3OR6C 1K8AW 2DYRB 3JD2A 4E4EA 2P90A 4H33A 4N23A 5KMGA 3Q4HA 2AHYA 2F66C 5EZYB 4K0KO 1L0LH 1VQLV 2XT9A 3K03A 3ABTA 3ABMB 1FFXA 5KA6A 3CWBH 2DWEC 4G27B 3QVNA 4DR1B 2Q5ZA 5D5QA 4DUZB 3JASB 1IBMB 4AHCA 4K35A 3KKYA 3EXAA 1RPOA 4O4HB 1NJIW 2RN9A 2ZNIA 3SPIA 3N2GA 3PN1A 4LFCO 4TQFA 4H37A 4Q6GA 1HP8A 2JGDB 3MAQA 3R66A 4JI3B 4BIUA 3CJHB 2VWJA 4R7CA 1OCCC 3E35A 1L8DA 5CB4B 4HYOA 4FZ0A 2UXBO 1VQMV 2V7QG 3U11A 2W0XA 1GRJA 5CBHA 1OCZB 5LMNO 4X64O 3HR0A 4OXSA 3RN4A 1AR5A 4B3RB 2K9PA 1BS3A 4MT8A 4I55B 3K57A 5EZYA 4JI7O 4P30A 1J5EB 1AJPA 1TGOA 2CTWA 2MW2B 4PDVA 4YY3O 1I0HA 4U3FH 4JI2B 3E8GA 1E1RG 4DR6B 3JASA 2UUCO 3W7UA 1R3JC 4O4HA 4H0LB 1N36O 4PI2A 3AG4C 1Z5VA 2IBZH 1K73W 4Z1VA 1D5NA 5CA0B 3B2EE 3CCJV 4JZGA 5JCOA 3LUTB 4FM1A 1NZ6A 2YIDA 2Q69A 4B3TB 2JGDA 3K08A 4X65B 3CJHA 5KX5B 4YHHO 5IJ0B 2KSDA 2DOSA 2XAJA 4QE9A 1HDJA 1VQOV 5CB4A 1HNWO 1HNZB 3FB6C 5B3SC 5DN6G 3RBZA 3CEIA 1OCCB 3ZS8C 3NXSA 4IYHA 1N33O 4I0XA 3ZN1A 2ZE6A 3D36C 3ZN0A 4BWAA 2R9RB 4DR5O 3RYHB 4D7TA 3M7MX 3AG1C 2IJJA 4P9OA 4NXMB 4I55A 4FK5C 5FNVA 1SA0B 1ZWIC 3CP1A 1SQXH 4X1YB 4DR3B 1HWYA 4UCUA 1A32A 2BE3A 4HNAB 3ZMTA 3CCSV 1NI8A 2LFSA 5C8YB 4UCRA 3LNNA 4I7ZB 4JI1O 1YTFB 2OIEA 3SYQA 3G67A 1NH2B 1T5EA 1WP7A 5LHGA 4DUYB 2P06A 4KXRA 1K97A 4U7NA 4J9ZB 5CA0A 1FXVA 1W0JG 3JSLA 1I94O 5LOVB 3CRMA 2QKCA 2QKAA 3QNEA 2FKXA 5K1PA 1YHQV 4B3MO 1YEWA 3H1LH 4DK1A 3AG4B 1Y4MA 1AILA 2HEPA 1L1FA 1GM8A 1XHZA 2QM8A 1YIJV 2LFRA 3C3SA 2XOKG 3VBBA 5KX5A 4TV8B 4DXWA 1N34O 2DQ3A 1Z2GA 4MS2A 1UJWB 1ENVA 4CS3A 5KHHA 4DV2B 5IE9A 1KB9F 4EEQA 4WFAV 1TUEB 2HVJC 1S5LZ 2CH7B 3G4SV 1FJGO 3B8MA 3ETEA 2Q68A 1FPOA 2N05A 5B3SB 4FLVA 4RWUA 5J2UB 1WAZA 4D6TH 2IH3C 3LSUA 1AJNA 3ZMZA 1JJ2U 2F43G 3RYHA 1PD3A 1Y67A 1YF2A 3ZCCA 1EM1A 1YCIA 3IC9A 1YJ9V 2UXDO 2QA4V 3CB2A 1X4TA 3C90A 4UVCA 4FM0A 4LF5O 4X1YA 3AG1B 2PZSA 1I08A 4QNHB 4MVZA 3IGAC 5HFLA 4HNAA 2IW5A 4DV7B 4CZZA 3GWOA 2RQ6A 4LF4O 1FXHA 1CPYA 1BCCH 1COWG 5C8YA 4I9WA 5JVDB 4UB6Z 3QO8A 2V4DA 3L72H 1KP3A 4MTGA 1XUQA 2HVKC 4C7UA 3LNMB 2HP8A 1G6UA 5LOVA 3IJ4A 1I5XA 3A0BZ 3T4DA 1P49A 3RW0A 5IWAO 4LF7O 2ETNA 3RGBA 4JI8B 5BZBA 1M1KW 1LNQA 3CMAV 2R70A 1VQ9V 2R72A 2XAHA 4EKWA 3HKDA 1G8MA 3SYOA 4TV8A 2UUAB 2CTQA 3GB7C 2AW9A 4UB8Z 2YIBD 4E2LA 3HPLC 4MW3A 5KAIZ 3OTOO 3GVMA 4OGQB 4X66B 4RAIA 2CH7A 1TUBB 4HZ3A 4PELA 3ZRVA 1SESA 3OMNB 3BVOA 1AP5A 1RM1B 2EIKC 5J2UA 3NR7A 4JASA 5JJJB 2QTOA 2QSAA 3JSNA 1TVKB 1KKCA 1SERA 2HJDA 2UUBB 3ASNC 2P5OA 3D36A 5B5EZ 1XHXA 1BHBA 2JRIA 3ZHUA 4R8CA 1XNQO 5H9CA 2QDOA 3OFNG 4UV8A 1M90W 1RP3B 2ZE8A 3ZHRA 2G38A 3OGCC 4A5UB 4AILC 1OCRC 5DEDA 5JVDA 4CS2A 3OEEG 2Y4UA 2BOBC 3HKCB 5JWPA 1XMQB 4F6RA 1P7GA 3ETGA 2VS0A 2WLMA 1JFFB 4MVMA 1QHTA 4DV0O 2QWOB 4J7JA 1FKAO 5BR8B 3BFRA 4BIZA 1K4CC 3WB1A 2QWQB 1BHAA 1WJZA 3ETQA 4RUFA 1EZJA 2JVDA 2EZPA 5FLXN 1FD9A 4FM2A 2ZDIC 4X1KA 3DGEA 1B06A 1TUBA 2A9HA 3RT3C 3JAMN 1P7BA 1RSOB 3RVZA 4LH6A 2WLLA 4J80A 1RPRA 4GCZA 1OV9A 4AI8A 1K7DA 5JJEB 4JTCB 4L87A 1TVKA 1L0NH 1S3JA 3T4ZA 3ABLC 4CH5A 3KG2A 3JD4A 3BA8A 1H38A 2DJVA 1TAEA 4G2KA 1S5JA 4RUEA 2ZD9A 3KCXA 4JTAB 4J7ZA 4UFZA 4JI0O 3ASNB 3S3XA 3APOA 3CCEV 1WP8A 1MZEA 2DWDC 1HW7A 5AG2A 4FLUA 1FS0G 4GT1A 2EBOA 3VQXA 3DC6A 3AG2C 1DGSA 2UXNA 4QGPA 3CCUV 3UCSC 4TT3G 4AQYB 4LF6O 4JYAO 3K9AA 3SR2C 2F4VB 4JTDB 1R3LC 4OX9O 3UQ8A 4EFEA 1NVPD 3K58A 2KQXA 1JFFA 2ZXWC 3ICXA 2Y0IA 4NR1A 5CA3A 2D2CB 2ZCEA 4QPJA 2X7RB 4TUYA 4UCVA 4CH6A 4FIPC 1I5YA 4UVAA 3ZHSA 5LYJB 1XBLA 2PF4E 1XMOB 4CH4A 3K9SA 3AK3A 4Q20A 4DV6O 1SQPH 3SPGA 3KCYA 1ZX3A 4MTXA 3STLC 1WB8A 1AVMA 4DR7B 2YEVB 1VQ6V 2LJ2A 5LXTB 3X2QC 4DV3O 1VQPV 1VQNV 2HHHO 1AI7A 2E74B 2YIAA 4JI5B 5IJ9B 1GN2A 3A0RA 4PA3A 3ZRWB 4GKJO 2L35A 1XREA 5CBGA 3E2EA 1IBLO 1D5AA 3ABLB 2RJZA 4ZHQA 3P32A 1O9GA 1Q5OA 4U7OA 2OYQA 2HG5C 3JATB 4KHPB 3F5WC 4LH7A 1WLEA 5BMVB 3TK1A 4NXNB 3W7XA 4TV9B 2PUSA 4GKKB 4F6EA 1SRYA 3CRCA 4DYLA 4CS4A 2LP7A 3AG2B 4MVQA 1NTMH 1VQ8V 4EFBA 3U10A 3P3NA 1F4NA 1K5SA 1VQ4V 1X59A 2EIJC 4LNUA 1IXBA 4B7EA 3OGIB 4DR1O 4K0KB 2ZXWB 5LYJA 1XNRO 4DUZO 1IBMO 2DW4A 1KYOF 3JARB 1UFIA 2F23A 4PDMA 5L3DA 1JX9A 3L73H 4O2AA 5H2FZ 2Q67A 2QGNA 2ZM6O 3TXSA 2YEVA 3OTFA 1K92A 5LXTA 1FYJA 2ZDIA 1BQ0A 4HAMA 1Y66A 3JCZA 4LFBO 3BAAA 4FFBA 4ZOLB 5IJ9A 2JJ2G 3FYIB 1WA8B 5JQGB 3X2QB 4JI3O 3MHHC 1M56B 3ZRWA 3E89A 1VQ5V 2ARHA 1LUWA 2OIGA 3JD3A 1EZVH 3CRRA 2B9ZA 1GN6A 1S5HC 4I0XB 4J9YB 4WFEA 3JATA 3K79A 1WPXA 1JOYA 3ZRSA 2ZNJA 5BMVA 4KFMA 2CE4A 3M99B 4TV9A 2Y48A 5EYPA 3EHBB 3K5LA 1QLNA 3WG7B 5HFMA 4GLXA 3AK1A 5FNVB 5LMNB 4YIOA 1G1XB 4B08A 3CRQA 2CTPA 4DW0A 1SQVH 3DC5A 3ZX6A 4GX5A 2JEUA 1YSCA 3TETA 4LBEC 3AEIA 3FAVB 1O9HA 3A8TA 4JI7B 4DR6O 1IDSA 2EIJB 5JJNB 3JARA 5KHIA 3TGUH 3K5NA 3G80A 3CXHF 1S0VA 1XQ8A 1UPGA 2M6YA 2EINC 3CS5A 2YI9A 3UO3A 4LF9O 5LMUB 3CC7V 5K1XA 4ZOLA 3VOUA 2YIBA 1N36B 2YUAA 1Q81W 4W4KA 3WU2Z 1WA8A 5JQGA 2WLJA 1D2DA 2KKWA 5EIBD 2KG7B 5KHJA 3QTCA 3ASOC 1XL6A 3BRCA 3OUSA 4JV5O 4X8AA 1U97A 3CC2V 1HNZO 5C93A 4NTWA 1NTKH 3P3PA 1S77D 2UXCO 2Q7HA 5IY5C 2WWWA 3FFQA 3J80N 2ZIOA 1GN4A 1XI1A 1BSMA 1SQQH 1KQSU 4HBNA 1SZTA 2Q7EA 1DF4A 1XDCA 2OT5A 3D3IA 1N33B 2IJIA 1QLEC 4FLWA 4J10A 4DR3O 2FL4A 1N0JA 3PJSK 4DR5B 1PPJH 2BSKB 1GAXA 1F7YA 1SZXA 3FAVA 1PKXA 4GZRB 1HNXO 4WFBV 3OAAG 2VQEO 1NVPB 1NBMG 2RCVA 4YJ3B 4IT5A
chains in the Genus database with same CATH topology
5H5NA 4JI8O 1XMOO 4JI0O 4JI6O 4B3RO 3T1HO 2UUAO 4B3SO 1FJGO 4DR6O 5LL6Y 4DR7O 2JRIA 4YHHO 1DK1A 2DOSA 1XNQO 1HNWO 1X59A 5IT9N 2LW7A 4LF6O 4JYAO 3J7AU 4LFCO 4KHPO 1J5EO 4OX9O 1N32O 3SDLA 4JI5O 4DR1O 4OPAA 1XNRO 3R66A 4DUZO 1AB3A 2UXDO 4DR4O 1IBMO 5BXZA 4JI4O 4DUYO 4A5UB 1N33O 4LF9O 1XEQA 4DV5O 3F5TA 4LF5O 4JI2O 2UXBO 4OPHA 4DR5O 1D2DA 4DR2O 2ZM6O 4JV5O 4LF4O 4X66O 1FYJA 5LMNO 1HNZO 2VQFO 4LFBO 4DV6O 4X64O 1R6TA 3T1YO 4NXNO 4DV0O 4DV4O 1FKAO 4GKKO 1A32A 4JI3O 4DV2O 2N74A 2AGAA 3J81N 2UXCO 4LFAO 5LMUO 4DV1O 4DV3O 3J80N 4JI7O 1NS1A 2HHHO 1HR0O 4B3TO 1IBKO 2UUBO 1R1BA 4X65O 4JI1O 5BY1A 3M8AA 5FLXN 4YY3O 5IWAO 4LF7O 4AQYO 2Z0AA 3RT3C 3JAMN 4GKJO 2F4VO 2UU9O 1I94O 4K0KO 4DR3O 1IBLO 3O65A 2UUCO 2FKXA 4B3MO 2E5LO 5BR8O 3OTOO 5A2QN 1F7YA 2ZKOA 4X62O 1AILA 1N36O 1HNXO 1XMQO 1G1XB 1KUQA 2DJVA 1N34O 2VQEO 1YZBA 4DV7O 4NXMO 4LF8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H5N A;  4JI8 O;  1XMO O;  4JI0 O;  4JI6 O;  4B3R O;  3T1H O;  2UUA O;  4B3S O;  1FJG O;  4DR6 O;  5LL6 Y;  4DR7 O;  2JRI A;  4YHH O;  1DK1 A;  2DOS A;  1XNQ O;  1HNW O;  1X59 A;  5IT9 N;  2LW7 A;  4LF6 O;  4JYA O;  3J7A U;  4LFC O;  4KHP O;  1J5E O;  4OX9 O;  1N32 O;  3SDL A;  4JI5 O;  4DR1 O;  4OPA A;  1XNR O;  3R66 A;  4DUZ O;  1AB3 A;  2UXD O;  4DR4 O;  1IBM O;  5BXZ A;  4JI4 O;  4DUY O;  4A5U B;  1N33 O;  4LF9 O;  1XEQ A;  4DV5 O;  3F5T A;  4LF5 O;  4JI2 O;  2UXB O;  4OPH A;  4DR5 O;  1D2D A;  4DR2 O;  2ZM6 O;  4JV5 O;  4LF4 O;  4X66 O;  1FYJ A;  5LMN O;  1HNZ O;  2VQF O;  4LFB O;  4DV6 O;  4X64 O;  1R6T A;  3T1Y O;  4NXN O;  4DV0 O;  4DV4 O;  1FKA O;  4GKK O;  1A32 A;  4JI3 O;  4DV2 O;  2N74 A;  2AGA A;  3J81 N;  2UXC O;  4LFA O;  5LMU O;  4DV1 O;  4DV3 O;  3J80 N;  4JI7 O;  1NS1 A;  2HHH O;  1HR0 O;  4B3T O;  1IBK O;  2UUB O;  1R1B A;  4X65 O;  4JI1 O;  5BY1 A;  3M8A A;  5FLX N;  4YY3 O;  5IWA O;  4LF7 O;  4AQY O;  2Z0A A;  3RT3 C;  3JAM N;  4GKJ O;  2F4V O;  2UU9 O;  1I94 O;  4K0K O;  4DR3 O;  1IBL O;  3O65 A;  2UUC O;  2FKX A;  4B3M O;  2E5L O;  5BR8 O;  3OTO O;  5A2Q N;  1F7Y A;  2ZKO A;  4X62 O;  1AIL A;  1N36 O;  1HNX O;  1XMQ O;  1G1X B;  1KUQ A;  2DJV A;  1N34 O;  2VQE O;  1YZB A;  4DV7 O;  4NXM O;  4LF8 O; 
#chains in the Genus database with same CATH topology
 4JI4 B;  5H5N A;  3CCR V;  2IJH A;  2JS5 A;  1SKV A;  3L9D A;  3ML0 A;  3OE7 G;  5KUK A;  3K5M A;  3CSX A;  1QVF U;  1US6 A;  1ZTE A;  2YI8 A;  5GON A;  3T1C A;  1W2B U;  2EIN B;  2YDE A;  1U96 A;  3HKD B;  2PY5 A;  2Y0P A;  2KG7 A;  4FLY A;  1I94 B;  2ZT9 B;  2YSU B;  3BEH A;  3VQW A;  1LUV A;  1NU1 H;  4B3M B;  3STZ C;  1H2L A;  1FXK C;  4YJ2 B;  3B77 A;  1RM1 C;  4J11 A;  5KHK A;  3ASO B;  4TSF G;  1KC8 W;  5LP6 C;  1N34 B;  2ZR3 A;  2PI5 A;  1IZ3 A;  4IYI A;  1NTZ H;  2GUZ B;  2FML A;  3JYC A;  5EC1 C;  1IX9 A;  3APQ A;  2WA3 A;  3T1Y O;  1H8H G;  1PNK A;  5IY5 B;  4BAY A;  2EJ7 A;  1Q86 W;  2JDI G;  1JMK C;  3W7W A;  1XOU A;  4KL1 A;  4WCE V;  2YC0 A;  4LWS B;  2EUL A;  2JGU A;  2A3Q A;  4D7S A;  1HR0 O;  3UO2 A;  2BSK A;  4LF8 B;  1QLE B;  5D5P A;  3THO A;  1FFT B;  4K8X A;  3SYA A;  3L71 H;  1AR1 B;  3WB2 A;  1THZ A;  2B1G A;  4LF5 B;  4GX1 A;  1H8E G;  2BTQ B;  2FB5 A;  4X20 B;  5LA6 B;  3S3W A;  4YJ3 A;  1YJW V;  4ZIB A;  4F6R B;  4QJF B;  4KUM A;  4QPK A;  5LHI A;  1E79 G;  2E75 B;  4LF4 B;  4X62 O;  3AG7 A;  4ZI7 B;  2GTS A;  2XND G;  1EBO A;  3N2K B;  4JI8 O;  1Q7Y W;  4DV5 B;  1QNM A;  2ITC C;  4K8Z A;  2GHY A;  1IUR A;  1YDX A;  1VAR A;  2UUA O;  3E22 B;  4UVB A;  1GN3 A;  5LL6 Y;  3ZIA G;  3T2M A;  4X1K B;  2W6I G;  5EIB C;  4YJ2 A;  5JH7 B;  2EJR A;  1F4M A;  1MA1 A;  4P9P A;  1P4R A;  2WLL B;  2QKS A;  1FXK B;  4LP8 A;  4TQD A;  4DR4 O;  2GUZ A;  5KUM A;  3OTO B;  4LFA B;  2WLK A;  4WBN B;  1K34 A;  5LP6 B;  5DM6 V;  1V54 B;  2FTK A;  3ABK B;  3ZJZ A;  3RYI B;  3HKE A;  1B3Q A;  4LCU C;  4DR2 O;  2XAQ A;  1IVS A;  3A0H Z;  5L3E A;  2A0L A;  5EC2 C;  4LWS A;  4R50 A;  3UM7 A;  2DN9 A;  4JAA A;  3A2F A;  2EX3 A;  4DV4 O;  2L6L A;  1Q8I A;  2BTQ A;  1M5I A;  2VRZ A;  4X20 A;  5LA6 A;  5EBM C;  1NS1 A;  1Y6X A;  4FLZ A;  1VQK V;  1N8R W;  2IJK A;  4NVP A;  2XUM A;  1DTO A;  3BA9 A;  1M4U A;  3FYE B;  4ZI7 A;  2D3O W;  4IIJ A;  2EIM B;  1Q43 A;  2DMX A;  4JI6 B;  2GTA A;  3L74 H;  4TUY B;  4CC6 A;  2Q8V A;  5LBQ A;  3HB3 B;  4DW1 A;  3N2K A;  2OCC C;  1AJQ A;  2K1E A;  5BR8 O;  2YIC A;  3OMA B;  2IM9 A;  3SJQ C;  3RVY A;  3E22 A;  4ASU G;  1BQZ A;  1KUQ A;  3UKM A;  2R9I A;  2CGN A;  3BAB A;  3IFX A;  4BIO A;  5JH7 A;  2GSM B;  4U3J B;  2C2A A;  4O2B A;  2NR5 A;  2B1I A;  1BE3 H;  1FXK A;  2M7W A;  4B3S O;  3IC7 A;  1MNG A;  2HR3 A;  4XDL A;  1NKD A;  4WBN A;  1K3E A;  1QVG U;  3ZHQ A;  5LP6 A;  2Q9L A;  1OCO B;  4LC1 A;  4MVU A;  3RYI A;  3UT5 B;  3OT7 A;  1N32 O;  3G71 V;  2H94 A;  3BPZ A;  1AB3 A;  1GO3 F;  3SJB C;  4ZHQ B;  3RYF A;  1KU9 A;  5ITZ B;  3OM3 B;  4DV1 B;  2FYU H;  3U0Z A;  4OPH A;  2H3O A;  3SJC C;  4WFH A;  4UV9 A;  3B4S A;  3CME V;  2GDS A;  4XDK A;  2DYS B;  2UU9 B;  4UCS A;  3JCU Z;  1R3I C;  1VP7 A;  3FX7 A;  5EBL C;  4BW9 A;  1OHH G;  5FL7 G;  1SF9 A;  1K5Q A;  2HFE C;  2X6A A;  4LNU B;  4ZBM A;  4PDR A;  2Q0O C;  4JYA B;  4TWK A;  1F51 A;  1IBK O;  2ILM A;  3I56 V;  4I4T B;  2O57 A;  3M8A A;  4MTO A;  2Y69 C;  2ADQ B;  4DRX B;  3JAL B;  4N21 A;  4RQF A;  1JQ0 A;  3G6B A;  4H13 B;  4I50 A;  2OCC B;  4O2A B;  2PGG A;  2AXT Z;  4X88 A;  4U3J A;  2E5L O;  3BHP A;  1QR8 A;  3LDD A;  2WLH A;  2ZKO A;  1M56 C;  4DV6 B;  4FFB B;  4F4L A;  5EK0 A;  2XAF A;  1OJH A;  2HLD G;  3UT5 A;  1AI4 A;  3TJT A;  1GKF A;  3T1H O;  4WFF A;  4Z2W A;  3JAK B;  2NLJ C;  5ITZ A;  3WG7 C;  2ZIM A;  2OTJ V;  2LW7 A;  3H1H H;  2VQF B;  4KHP O;  4GKJ B;  4BW5 A;  5EYP B;  1Q6I A;  4OPA A;  2W0F C;  2LGQ A;  5E79 Z;  3FB5 C;  3CCL V;  1QBZ A;  3SJA C;  3ZMV A;  1KKD A;  2AZ2 A;  4LR3 A;  5B66 Z;  2QR4 A;  1BZK A;  3R65 A;  4O4L B;  1MSW D;  5B1A C;  1EN4 A;  1GK9 A;  2JEX A;  4I4T A;  1M57 B;  4GX0 A;  3K04 A;  3DXR B;  3OW2 U;  4DRX A;  5B1B C;  3JAL A;  3FB8 C;  3E8B A;  1NT2 B;  5EBW C;  2P67 A;  2Y69 B;  5CA1 B;  1YI2 V;  4NKG B;  3EVK A;  3ZMS A;  2VWK A;  1JVM A;  1XNR B;  4Z1M G;  3CCM V;  1SC5 B;  2P7T C;  3OUF A;  4NTY A;  2V1D A;  2Q4P A;  4UUJ C;  1JA8 A;  2Q6A A;  2IH1 C;  1ZL8 B;  4MSW C;  1ZAU A;  5IYB O;  3MDS A;  2ZM6 B;  1KEC A;  3FKS G;  5CN0 A;  2H8P C;  4LFC B;  2ZIN A;  3E86 A;  4LFB B;  3JAK A;  4L8J A;  4O4I B;  1QQC A;  3H1J H;  3DTU B;  4MVO A;  1F23 A;  5KLV H;  5LGU A;  2BTO A;  1Q82 W;  2R9A A;  3I55 V;  2UXB B;  4R6Z A;  4B3R O;  4EB6 B;  3RFR A;  3H9V A;  2ZE7 A;  3E8F A;  4RO2 A;  1GM7 A;  2X0L A;  2IU0 A;  5H6R A;  2HKO A;  5GTH Z;  1SQF A;  1KMI Z;  1VIB A;  4KP4 A;  4X64 B;  1J5E O;  3MD0 A;  4O4L A;  2QEX V;  3LDC A;  2JIZ G;  4PDL A;  1EFR G;  4JZ2 A;  4JI2 O;  1P84 F;  3DXR A;  5B1A B;  2ODM A;  3OR7 C;  1G4Y B;  4YY3 B;  2QWN B;  1QU7 A;  2RNB A;  3RWR D;  1PV0 A;  1PNM A;  3CCQ V;  3P30 A;  3AG3 C;  5CA1 A;  3AK2 A;  3WFV A;  4DK0 A;  2LW1 A;  1VF6 C;  2NNU A;  5B1B B;  1GTO A;  3VQV A;  1PL4 A;  2UUC B;  5GON B;  2Q0A A;  1Y76 B;  5LMU O;  5LGN A;  4B3T O;  1ZL8 A;  4X65 O;  1WN7 A;  2X6C A;  1MAB G;  1YXB A;  1B04 A;  5CBF A;  2CGO A;  4JAV A;  3QF7 A;  4LF9 B;  2P6J A;  3CYO A;  4O4I A;  1CP9 A;  2X6B A;  1PM9 A;  2EZO A;  4YHH B;  1JJO A;  4JV5 B;  4FPP A;  3TCU A;  1HNW B;  5IDJ A;  4J7K A;  4EB6 A;  5L3B A;  3ZED A;  3MHS C;  2Q73 A;  1YZB A;  3ETD A;  1Y74 B;  2IU3 A;  2PTM A;  2GBO A;  4NXM O;  1MOF A;  2DE0 X;  2YXL A;  1R3K C;  5H6Q A;  2UXC B;  5KHG A;  2BCC H;  1SQB H;  3CCV V;  4RQE A;  4ICG A;  3FB7 C;  1PL0 A;  5A9G A;  4MW8 A;  1M93 A;  3F7V C;  3WB0 A;  4FLT A;  1B6Q A;  1J95 A;  1AI5 A;  1V9P A;  4FJC C;  3CE2 A;  4CC5 A;  1K33 A;  1H2G A;  2QWR B;  5BXZ A;  4JI4 O;  4DUY O;  3F5T A;  4FLX A;  1KP2 A;  4JF3 A;  1BL8 A;  3QO5 A;  4JI1 B;  1HNX B;  2VQE B;  3C3T A;  1AR4 A;  3AG3 B;  1Y76 A;  5KA5 A;  1VF7 A;  5L3F A;  2ZQM A;  2A7W A;  4JYC A;  3L70 H;  3IAY A;  4XDJ A;  2WSS G;  1VEW A;  2ITD C;  3SPJ A;  1GH6 A;  4XBF A;  5KAF Z;  2N74 A;  4DV2 O;  2AGA A;  4H44 B;  2JJ1 G;  2BOC C;  4ZKI A;  3CX5 F;  3SPC A;  5IYZ B;  4YIP A;  3LSQ A;  4FVM A;  2XTA A;  1V54 C;  5BY1 A;  1FAF A;  3ABK C;  3ZRX A;  3SYP A;  1TA8 A;  4WFG A;  5IJ0 A;  4O4J B;  1H2N A;  3G6E V;  2DQ0 A;  3B40 A;  2F95 B;  4JAU A;  1FJG B;  1Y74 A;  1BGY H;  1ORQ C;  1YVW A;  3HKE B;  2B5U A;  1W59 A;  3OD4 A;  3I5D A;  3K5O A;  4X9Q A;  2LO1 A;  4PA7 A;  1WB7 A;  4IGG A;  2PYL A;  2W6J G;  3HKB B;  3K59 A;  3T1Y B;  5GW7 A;  4DV7 O;  2UXD B;  1Q90 D;  4LF8 O;  5J2T B;  2MK3 A;  1SA0 A;  1KD1 W;  2OWO A;  2EIM C;  1MG1 A;  1HR0 B;  5DEC A;  2Z5U A;  4PA9 A;  1H2K A;  2QJ1 A;  4PV1 B;  3SPH A;  1N4C A;  2XAS A;  2NN4 A;  4CBC A;  4IIJ B;  1MMM A;  1QCE A;  1QR9 A;  1NR7 A;  2P22 C;  3QO7 A;  3K3W A;  1ROP A;  3O9O A;  3F7Y C;  1S76 D;  1ZUQ A;  3LSS A;  1VF6 A;  5B1N A;  4JYY A;  4DV5 O;  4X62 B;  2P4V A;  1ZLZ A;  4FFK A;  4QE7 A;  4UCT A;  3RYC B;  4PA6 A;  5IWA B;  1OZ0 A;  2JK5 C;  4LF7 B;  1CEZ A;  4X66 O;  5IYZ A;  5IYC O;  4O2B B;  3CC4 V;  1OCO C;  1R6T A;  3BCC H;  1PNL A;  3W7T A;  5E1A C;  1VQ7 V;  2QM7 A;  4O4J A;  3E8H A;  2ATK C;  4GUN A;  4X1I B;  4LFA O;  3D8C A;  3SGI A;  2EIL C;  2UUB O;  1XL4 A;  1Z5W A;  3DSQ A;  3K0D A;  2F1M A;  1K9M W;  2AZ0 A;  3OMI B;  2CUG A;  2AHZ A;  4I5S A;  1GM9 A;  3RYF B;  4DR4 B;  1ZSP A;  1K4D C;  4B7K A;  4JGS A;  1SQG A;  3ZMU A;  1Q6H A;  2LGW A;  3HKB A;  5FPO A;  2ZR2 A;  2A79 B;  2DYS C;  2LQT A;  4IHJ B;  2F93 B;  4MVR A;  4DR2 B;  5J2T A;  4NTX A;  1EN5 A;  5A2Q N;  1XNQ B;  5LGT A;  3L75 H;  1GMG A;  2N04 A;  2RMK B;  4MVS A;  1PP9 H;  1XMQ O;  4G28 B;  4I9Q A;  1JCH A;  4DV4 B;  1E1Q G;  1AP6 A;  4PA4 A;  1M9N A;  4GYC B;  4JI6 O;  1R6K A;  3CXC U;  2GV9 A;  4K3A A;  4FZ1 A;  1DK1 A;  3QG5 A;  3H01 A;  3JD1 A;  3ZHV A;  3TXQ A;  3RYC A;  5IT9 N;  3J7A U;  3ZHT A;  4W4L A;  3CRA A;  4I50 B;  1BT8 A;  3SDL A;  3JD0 A;  4DV0 B;  4FMT A;  4MTF A;  3B8N A;  4YXW G;  4PHZ A;  3SYC A;  2WPD G;  2KB1 A;  2CK3 G;  3FD9 A;  5B1O A;  2CAZ C;  2OTL V;  1EN6 A;  2Z3Y A;  5IYD O;  1V55 C;  1SS3 A;  2WAM A;  1BMF G;  3H1I H;  5GTI Z;  1W0K G;  4X1I A;  3ZBH A;  2RDC A;  1Q3E A;  2OCH A;  2CDY A;  1JPX A;  2WLI B;  4UXN A;  4B3S B;  3BY6 A;  1MSD A;  3JAW B;  2EIL B;  5LHH A;  1VF5 B;  1N0N A;  3J81 N;  4PI0 A;  1DLB A;  1H2M A;  4DV1 O;  5FPR A;  1R1B A;  4IHJ A;  1N32 B;  1JR9 A;  4DO2 A;  2EIK B;  2DYR C;  4J41 A;  3OEH G;  2QE7 G;  3K06 A;  1ARO P;  1VMG A;  4JI0 B;  2Z0A A;  4AQY O;  1NQT A;  4BR6 A;  1IXM A;  2ZE5 A;  2CTR A;  2F4V O;  3CHX A;  1DF5 A;  1I7F A;  2UU9 O;  4UCO A;  3EFF K;  4GX2 A;  1M57 C;  3O65 A;  2QM4 A;  4NYK A;  1URF A;  4NB5 A;  1R6N A;  4LF6 B;  3KZI Z;  2Y4T A;  1YIT V;  5KMG B;  3Q4H B;  2XAG A;  3ABM C;  1MZF A;  2QTS A;  4J42 A;  4OX9 B;  1LR1 A;  3HKC A;  1NR1 A;  5CMU A;  3CD6 V;  2YXY A;  2YXH A;  1OCR B;  1YTF D;  1XMO O;  4PJ0 Z;  1NH2 D;  1RFY A;  4WF9 V;  3W7S A;  1FFX B;  4JYB A;  4QIW F;  3VQY A;  4JPR A;  5L3C A;  3E83 A;  1IBK B;  2PYJ A;  4PD4 F;  1WNS A;  4IL6 Z;  4DR7 O;  2QWP B;  3B09 A;  2XHB A;  2ADP A;  1SET A;  3K0G A;  4ABM A;  1S72 V;  3GWK C;  4JI5 O;  5JCO C;  1WPB A;  1XIL A;  5TIS Z;  5F2V O;  2E5L B;  2YS8 A;  4CH3 A;  2E76 B;  3ABU A;  2WLI A;  1XEQ A;  2WLN A;  3N2G B;  1V55 B;  4TOI A;  4DV3 B;  2WA4 A;  1AI6 A;  1RSO A;  2HHH B;  1CXZ B;  1Q6U A;  1KBH A;  2P4K A;  3CPW U;  3JAW A;  1H2S B;  2Q7G A;  4P2Z A;  2A06 H;  2HJF C;  2E3C A;  2JS3 A;  4X89 A;  1R73 A;  3D3Q A;  2VQF O;  5J9P C;  2UXX A;  5L3G A;  1OCZ C;  1YJN V;  3T1H B;  4NXN O;  1IBL B;  3LDE A;  3H1K H;  4GKK O;  2PI4 A;  3N27 A;  3OR6 C;  1K8A W;  2DYR B;  3JD2 A;  4E4E A;  2P90 A;  4H33 A;  4N23 A;  5KMG A;  3Q4H A;  2AHY A;  2F66 C;  5EZY B;  4K0K O;  1L0L H;  1VQL V;  2XT9 A;  3K03 A;  3ABT A;  3ABM B;  1FFX A;  5KA6 A;  3CWB H;  2DWE C;  4G27 B;  3QVN A;  4DR1 B;  2Q5Z A;  5D5Q A;  4DUZ B;  3JAS B;  1IBM B;  4AHC A;  4K35 A;  3KKY A;  3EXA A;  1RPO A;  4O4H B;  1NJI W;  2RN9 A;  2ZNI A;  3SPI A;  3N2G A;  3PN1 A;  4LFC O;  4TQF A;  4H37 A;  4Q6G A;  1HP8 A;  2JGD B;  3MAQ A;  3R66 A;  4JI3 B;  4BIU A;  3CJH B;  2VWJ A;  4R7C A;  1OCC C;  3E35 A;  1L8D A;  5CB4 B;  4HYO A;  4FZ0 A;  2UXB O;  1VQM V;  2V7Q G;  3U11 A;  2W0X A;  1GRJ A;  5CBH A;  1OCZ B;  5LMN O;  4X64 O;  3HR0 A;  4OXS A;  3RN4 A;  1AR5 A;  4B3R B;  2K9P A;  1BS3 A;  4MT8 A;  4I55 B;  3K57 A;  5EZY A;  4JI7 O;  4P30 A;  1J5E B;  1AJP A;  1TGO A;  2CTW A;  2MW2 B;  4PDV A;  4YY3 O;  1I0H A;  4U3F H;  4JI2 B;  3E8G A;  1E1R G;  4DR6 B;  3JAS A;  2UUC O;  3W7U A;  1R3J C;  4O4H A;  4H0L B;  1N36 O;  4PI2 A;  3AG4 C;  1Z5V A;  2IBZ H;  1K73 W;  4Z1V A;  1D5N A;  5CA0 B;  3B2E E;  3CCJ V;  4JZG A;  5JCO A;  3LUT B;  4FM1 A;  1NZ6 A;  2YID A;  2Q69 A;  4B3T B;  2JGD A;  3K08 A;  4X65 B;  3CJH A;  5KX5 B;  4YHH O;  5IJ0 B;  2KSD A;  2DOS A;  2XAJ A;  4QE9 A;  1HDJ A;  1VQO V;  5CB4 A;  1HNW O;  1HNZ B;  3FB6 C;  5B3S C;  5DN6 G;  3RBZ A;  3CEI A;  1OCC B;  3ZS8 C;  3NXS A;  4IYH A;  1N33 O;  4I0X A;  3ZN1 A;  2ZE6 A;  3D36 C;  3ZN0 A;  4BWA A;  2R9R B;  4DR5 O;  3RYH B;  4D7T A;  3M7M X;  3AG1 C;  2IJJ A;  4P9O A;  4NXM B;  4I55 A;  4FK5 C;  5FNV A;  1SA0 B;  1ZWI C;  3CP1 A;  1SQX H;  4X1Y B;  4DR3 B;  1HWY A;  4UCU A;  1A32 A;  2BE3 A;  4HNA B;  3ZMT A;  3CCS V;  1NI8 A;  2LFS A;  5C8Y B;  4UCR A;  3LNN A;  4I7Z B;  4JI1 O;  1YTF B;  2OIE A;  3SYQ A;  3G67 A;  1NH2 B;  1T5E A;  1WP7 A;  5LHG A;  4DUY B;  2P06 A;  4KXR A;  1K97 A;  4U7N A;  4J9Z B;  5CA0 A;  1FXV A;  1W0J G;  3JSL A;  1I94 O;  5LOV B;  3CRM A;  2QKC A;  2QKA A;  3QNE A;  2FKX A;  5K1P A;  1YHQ V;  4B3M O;  1YEW A;  3H1L H;  4DK1 A;  3AG4 B;  1Y4M A;  1AIL A;  2HEP A;  1L1F A;  1GM8 A;  1XHZ A;  2QM8 A;  1YIJ V;  2LFR A;  3C3S A;  2XOK G;  3VBB A;  5KX5 A;  4TV8 B;  4DXW A;  1N34 O;  2DQ3 A;  1Z2G A;  4MS2 A;  1UJW B;  1ENV A;  4CS3 A;  5KHH A;  4DV2 B;  5IE9 A;  1KB9 F;  4EEQ A;  4WFA V;  1TUE B;  2HVJ C;  1S5L Z;  2CH7 B;  3G4S V;  1FJG O;  3B8M A;  3ETE A;  2Q68 A;  1FPO A;  2N05 A;  5B3S B;  4FLV A;  4RWU A;  5J2U B;  1WAZ A;  4D6T H;  2IH3 C;  3LSU A;  1AJN A;  3ZMZ A;  1JJ2 U;  2F43 G;  3RYH A;  1PD3 A;  1Y67 A;  1YF2 A;  3ZCC A;  1EM1 A;  1YCI A;  3IC9 A;  1YJ9 V;  2UXD O;  2QA4 V;  3CB2 A;  1X4T A;  3C90 A;  4UVC A;  4FM0 A;  4LF5 O;  4X1Y A;  3AG1 B;  2PZS A;  1I08 A;  4QNH B;  4MVZ A;  3IGA C;  5HFL A;  4HNA A;  2IW5 A;  4DV7 B;  4CZZ A;  3GWO A;  2RQ6 A;  4LF4 O;  1FXH A;  1CPY A;  1BCC H;  1COW G;  5C8Y A;  4I9W A;  5JVD B;  4UB6 Z;  3QO8 A;  2V4D A;  3L72 H;  1KP3 A;  4MTG A;  1XUQ A;  2HVK C;  4C7U A;  3LNM B;  2HP8 A;  1G6U A;  5LOV A;  3IJ4 A;  1I5X A;  3A0B Z;  3T4D A;  1P49 A;  3RW0 A;  5IWA O;  4LF7 O;  2ETN A;  3RGB A;  4JI8 B;  5BZB A;  1M1K W;  1LNQ A;  3CMA V;  2R70 A;  1VQ9 V;  2R72 A;  2XAH A;  4EKW A;  3HKD A;  1G8M A;  3SYO A;  4TV8 A;  2UUA B;  2CTQ A;  3GB7 C;  2AW9 A;  4UB8 Z;  2YIB D;  4E2L A;  3HPL C;  4MW3 A;  5KAI Z;  3OTO O;  3GVM A;  4OGQ B;  4X66 B;  4RAI A;  2CH7 A;  1TUB B;  4HZ3 A;  4PEL A;  3ZRV A;  1SES A;  3OMN B;  3BVO A;  1AP5 A;  1RM1 B;  2EIK C;  5J2U A;  3NR7 A;  4JAS A;  5JJJ B;  2QTO A;  2QSA A;  3JSN A;  1TVK B;  1KKC A;  1SER A;  2HJD A;  2UUB B;  3ASN C;  2P5O A;  3D36 A;  5B5E Z;  1XHX A;  1BHB A;  2JRI A;  3ZHU A;  4R8C A;  1XNQ O;  5H9C A;  2QDO A;  3OFN G;  4UV8 A;  1M90 W;  1RP3 B;  2ZE8 A;  3ZHR A;  2G38 A;  3OGC C;  4A5U B;  4AIL C;  1OCR C;  5DED A;  5JVD A;  4CS2 A;  3OEE G;  2Y4U A;  2BOB C;  3HKC B;  5JWP A;  1XMQ B;  4F6R A;  1P7G A;  3ETG A;  2VS0 A;  2WLM A;  1JFF B;  4MVM A;  1QHT A;  4DV0 O;  2QWO B;  4J7J A;  1FKA O;  5BR8 B;  3BFR A;  4BIZ A;  1K4C C;  3WB1 A;  2QWQ B;  1BHA A;  1WJZ A;  3ETQ A;  4RUF A;  1EZJ A;  2JVD A;  2EZP A;  5FLX N;  1FD9 A;  4FM2 A;  2ZDI C;  4X1K A;  3DGE A;  1B06 A;  1TUB A;  2A9H A;  3RT3 C;  3JAM N;  1P7B A;  1RSO B;  3RVZ A;  4LH6 A;  2WLL A;  4J80 A;  1RPR A;  4GCZ A;  1OV9 A;  4AI8 A;  1K7D A;  5JJE B;  4JTC B;  4L87 A;  1TVK A;  1L0N H;  1S3J A;  3T4Z A;  3ABL C;  4CH5 A;  3KG2 A;  3JD4 A;  3BA8 A;  1H38 A;  2DJV A;  1TAE A;  4G2K A;  1S5J A;  4RUE A;  2ZD9 A;  3KCX A;  4JTA B;  4J7Z A;  4UFZ A;  4JI0 O;  3ASN B;  3S3X A;  3APO A;  3CCE V;  1WP8 A;  1MZE A;  2DWD C;  1HW7 A;  5AG2 A;  4FLU A;  1FS0 G;  4GT1 A;  2EBO A;  3VQX A;  3DC6 A;  3AG2 C;  1DGS A;  2UXN A;  4QGP A;  3CCU V;  3UCS C;  4TT3 G;  4AQY B;  4LF6 O;  4JYA O;  3K9A A;  3SR2 C;  2F4V B;  4JTD B;  1R3L C;  4OX9 O;  3UQ8 A;  4EFE A;  1NVP D;  3K58 A;  2KQX A;  1JFF A;  2ZXW C;  3ICX A;  2Y0I A;  4NR1 A;  5CA3 A;  2D2C B;  2ZCE A;  4QPJ A;  2X7R B;  4TUY A;  4UCV A;  4CH6 A;  4FIP C;  1I5Y A;  4UVA A;  3ZHS A;  5LYJ B;  1XBL A;  2PF4 E;  1XMO B;  4CH4 A;  3K9S A;  3AK3 A;  4Q20 A;  4DV6 O;  1SQP H;  3SPG A;  3KCY A;  1ZX3 A;  4MTX A;  3STL C;  1WB8 A;  1AVM A;  4DR7 B;  2YEV B;  1VQ6 V;  2LJ2 A;  5LXT B;  3X2Q C;  4DV3 O;  1VQP V;  1VQN V;  2HHH O;  1AI7 A;  2E74 B;  2YIA A;  4JI5 B;  5IJ9 B;  1GN2 A;  3A0R A;  4PA3 A;  3ZRW B;  4GKJ O;  2L35 A;  1XRE A;  5CBG A;  3E2E A;  1IBL O;  1D5A A;  3ABL B;  2RJZ A;  4ZHQ A;  3P32 A;  1O9G A;  1Q5O A;  4U7O A;  2OYQ A;  2HG5 C;  3JAT B;  4KHP B;  3F5W C;  4LH7 A;  1WLE A;  5BMV B;  3TK1 A;  4NXN B;  3W7X A;  4TV9 B;  2PUS A;  4GKK B;  4F6E A;  1SRY A;  3CRC A;  4DYL A;  4CS4 A;  2LP7 A;  3AG2 B;  4MVQ A;  1NTM H;  1VQ8 V;  4EFB A;  3U10 A;  3P3N A;  1F4N A;  1K5S A;  1VQ4 V;  1X59 A;  2EIJ C;  4LNU A;  1IXB A;  4B7E A;  3OGI B;  4DR1 O;  4K0K B;  2ZXW B;  5LYJ A;  1XNR O;  4DUZ O;  1IBM O;  2DW4 A;  1KYO F;  3JAR B;  1UFI A;  2F23 A;  4PDM A;  5L3D A;  1JX9 A;  3L73 H;  4O2A A;  5H2F Z;  2Q67 A;  2QGN A;  2ZM6 O;  3TXS A;  2YEV A;  3OTF A;  1K92 A;  5LXT A;  1FYJ A;  2ZDI A;  1BQ0 A;  4HAM A;  1Y66 A;  3JCZ A;  4LFB O;  3BAA A;  4FFB A;  4ZOL B;  5IJ9 A;  2JJ2 G;  3FYI B;  1WA8 B;  5JQG B;  3X2Q B;  4JI3 O;  3MHH C;  1M56 B;  3ZRW A;  3E89 A;  1VQ5 V;  2ARH A;  1LUW A;  2OIG A;  3JD3 A;  1EZV H;  3CRR A;  2B9Z A;  1GN6 A;  1S5H C;  4I0X B;  4J9Y B;  4WFE A;  3JAT A;  3K79 A;  1WPX A;  1JOY A;  3ZRS A;  2ZNJ A;  5BMV A;  4KFM A;  2CE4 A;  3M99 B;  4TV9 A;  2Y48 A;  5EYP A;  3EHB B;  3K5L A;  1QLN A;  3WG7 B;  5HFM A;  4GLX A;  3AK1 A;  5FNV B;  5LMN B;  4YIO A;  1G1X B;  4B08 A;  3CRQ A;  2CTP A;  4DW0 A;  1SQV H;  3DC5 A;  3ZX6 A;  4GX5 A;  2JEU A;  1YSC A;  3TET A;  4LBE C;  3AEI A;  3FAV B;  1O9H A;  3A8T A;  4JI7 B;  4DR6 O;  1IDS A;  2EIJ B;  5JJN B;  3JAR A;  5KHI A;  3TGU H;  3K5N A;  3G80 A;  3CXH F;  1S0V A;  1XQ8 A;  1UPG A;  2M6Y A;  2EIN C;  3CS5 A;  2YI9 A;  3UO3 A;  4LF9 O;  5LMU B;  3CC7 V;  5K1X A;  4ZOL A;  3VOU A;  2YIB A;  1N36 B;  2YUA A;  1Q81 W;  4W4K A;  3WU2 Z;  1WA8 A;  5JQG A;  2WLJ A;  1D2D A;  2KKW A;  5EIB D;  2KG7 B;  5KHJ A;  3QTC A;  3ASO C;  1XL6 A;  3BRC A;  3OUS A;  4JV5 O;  4X8A A;  1U97 A;  3CC2 V;  1HNZ O;  5C93 A;  4NTW A;  1NTK H;  3P3P A;  1S77 D;  2UXC O;  2Q7H A;  5IY5 C;  2WWW A;  3FFQ A;  3J80 N;  2ZIO A;  1GN4 A;  1XI1 A;  1BSM A;  1SQQ H;  1KQS U;  4HBN A;  1SZT A;  2Q7E A;  1DF4 A;  1XDC A;  2OT5 A;  3D3I A;  1N33 B;  2IJI A;  1QLE C;  4FLW A;  4J10 A;  4DR3 O;  2FL4 A;  1N0J A;  3PJS K;  4DR5 B;  1PPJ H;  2BSK B;  1GAX A;  1F7Y A;  1SZX A;  3FAV A;  1PKX A;  4GZR B;  1HNX O;  4WFB V;  3OAA G;  2VQE O;  1NVP B;  1NBM G;  2RCV A;  4YJ3 B;  4IT5 A; 
#chains in the Genus database with same CATH homology
 5H5N A;  4JI8 O;  1XMO O;  4JI0 O;  4JI6 O;  4B3R O;  3T1H O;  2UUA O;  4B3S O;  1FJG O;  4DR6 O;  5LL6 Y;  4DR7 O;  2JRI A;  4YHH O;  1DK1 A;  2DOS A;  1XNQ O;  1HNW O;  1X59 A;  5IT9 N;  2LW7 A;  4LF6 O;  4JYA O;  3J7A U;  4LFC O;  4KHP O;  1J5E O;  4OX9 O;  1N32 O;  3SDL A;  4JI5 O;  4DR1 O;  4OPA A;  1XNR O;  3R66 A;  4DUZ O;  1AB3 A;  2UXD O;  4DR4 O;  1IBM O;  5BXZ A;  4JI4 O;  4DUY O;  4A5U B;  1N33 O;  4LF9 O;  1XEQ A;  4DV5 O;  3F5T A;  4LF5 O;  4JI2 O;  2UXB O;  4OPH A;  4DR5 O;  1D2D A;  4DR2 O;  2ZM6 O;  4JV5 O;  4LF4 O;  4X66 O;  1FYJ A;  5LMN O;  1HNZ O;  2VQF O;  4LFB O;  4DV6 O;  4X64 O;  1R6T A;  3T1Y O;  4NXN O;  4DV0 O;  4DV4 O;  1FKA O;  4GKK O;  1A32 A;  4JI3 O;  4DV2 O;  2N74 A;  2AGA A;  3J81 N;  2UXC O;  4LFA O;  5LMU O;  4DV1 O;  4DV3 O;  3J80 N;  4JI7 O;  1NS1 A;  2HHH O;  1HR0 O;  4B3T O;  1IBK O;  2UUB O;  1R1B A;  4X65 O;  4JI1 O;  5BY1 A;  3M8A A;  5FLX N;  4YY3 O;  5IWA O;  4LF7 O;  4AQY O;  2Z0A A;  3RT3 C;  3JAM N;  4GKJ O;  2F4V O;  2UU9 O;  1I94 O;  4K0K O;  4DR3 O;  1IBL O;  3O65 A;  2UUC O;  2FKX A;  4B3M O;  2E5L O;  5BR8 O;  3OTO O;  5A2Q N;  1F7Y A;  2ZKO A;  4X62 O;  1AIL A;  1N36 O;  1HNX O;  1XMQ O;  1G1X B;  1KUQ A;  2DJV A;  1N34 O;  2VQE O;  1YZB A;  4DV7 O;  4NXM O;  4LF8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...