4JI6O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji6O00
5BXZA 2ZKOA 1HR0O 3JAMN 4JYAO 1AILA 4X62O 3T1YO 5LL6Y 4JI8O 2DJVA 4JI6O 4JI3O 2AGAA 1IBMO 1R1BA 4DR4O 3J7AU 4B3TO 4LF6O 2FKXA 1AB3A 2ZM6O 5IT9N 1F7YA 2F4VO 4K0KO 4DR6O 1N36O 1DK1A 1N34O 1NS1A 5FLXN 3T1HO 3J80N 4DUYO 1X59A 4AQYO 4LF5O 1A32A 2UU9O 4B3MO 4DV1O 4JI4O 5LMNO 4JI1O 4LF7O 4DV6O 1FJGO 4OPHA 3RT3C 4LFAO 4DR2O 4DV3O 2UXDO 4LFBO 4YY3O 2Z0AA 2VQFO 2DOSA 4NXMO 1XNQO 1XNRO 2UUAO 4JI0O 4DV2O 1N33O 1HNZO 4X64O 4B3RO 4JV5O 2UUCO 2UXBO 4DV4O 3J81N 4LF8O 5IWAO 2UUBO 4LFCO 4B3SO 4YHHO 1N32O 5BY1A 2VQEO 3OTOO 3M8AA 4DR1O 2JRIA 2LW7A 3R66A 4DR5O 2UXCO 4KHPO 2N74A 3F5TA 4OX9O 4LF4O 5H5NA 3O65A 4JI5O 1XMQO 3SDLA 4X65O 1G1XB 1D2DA 1I94O 2E5LO 4DV5O 1HNWO 1YZBA 1HNXO 4OPAA 4JI7O 4DUZO 1R6TA 1XEQA 5A2QN 1IBLO 4DV7O 1J5EO 4DR7O 5BR8O 4NXNO 4GKJO 1FKAO 4JI2O 2HHHO 4A5UB 4GKKO 4LF9O 4X66O 4DR3O 5LMUO 1XMOO 4DV0O 1KUQA 1IBKO 1FYJA
chains in the Genus database with same CATH superfamily
4LH6A 1KBHA 1S77D 1SZXA 1CP9A 1AVMA 1FPOA 4P9OA 2F4VB 4JAVA 1GO3F 2IH1C 1TUBA 3JSNA 3FB8C 2XAHA 1QNMA 3STZC 3STLC 3ABLC 2CH7B 1BL8A 3TK1A 3JD4A 1VQMV 2VWJA 1NVPD 1B3QA 1NS1A 4HAMA 4PELA 1YI2V 1U96A 4LR3A 3EFFK 1GN6A 4BR6A 4LF7O 4QNHB 2IJKA 2V4DA 1XQ8A 1N33B 2BE3A 4B3MB 3JYCA 5JCOC 2UXDO 1XNQO 2CH7A 3W7WA 3MAQA 2XT9A 4UXNA 1AROP 4IT5A 4MTFA 2R9IA 2UXBO 2CTQA 2ZE6A 2G38A 3TGUH 5A9GA 4LFCO 3RYCB 2PZSA 5HFLA 4YHHO 1HNWB 1M93A 3K5LA 1PV0A 5DECA 2A79B 4NTYA 4LF8B 5H5NA 4KP4A 2OCCC 4TT3G 1YZBA 3CS5A 1VF7A 5JWPA 3K06A 3RW0A 1MSDA 3D36A 5BMVB 5KA6A 4WFEA 3FKSG 3T1CA 2A06H 3RYCA 1SKVA 1K73W 1VEWA 1IBLB 3RN4A 4GCZA 2ATKC 2EIJB 4AHCA 1NT2B 3JAMN 4HNAA 1Y66A 4JI8O 1VIBA 4OGQB 3FFQA 4DR6B 4DR4O 1U97A 1XHZA 5B3SC 1JPXA 3K5NA 2WLNA 3K57A 3VQYA 1Q90D 1K34A 3ABKB 5JQGB 2CTPA 3ZRVA 5CN0A 3CCMV 3ABMC 4N21A 5LMNB 1N34O 1R73A 3Q4HA 3OR7C 4PDLA 2ZINA 4B3MO 3E8FA 4JZGA 3LDDA 2AZ0A 1PNMA 1D5NA 4FLVA 2F1MA 3R65A 3O9OA 3CCEV 3CCSV 1J95A 3CCRV 1PKXA 3CCUV 2PI4A 2UUCB 2Y69C 2F95B 3E2EA 5J2TB 5JQGA 3RVZA 1MZEA 1MNGA 2P4VA 2VQEB 4LH7A 5IDJA 1O9GA 1K3EA 3T2MA 3APQA 4LF8O 4FFBB 1SF9A 3CC7V 4JZ2A 3BEHA 4YIPA 4X1IB 2L35A 3ZX6A 4JTAB 1AR5A 2C2AA 4I9QA 1H2LA 3AG3B 2YC0A 3F5TA 3LSSA 5KHGA 1LR1A 4X9QA 4NXNB 2FL4A 3QVNA 5GW7A 1BGYH 3ZRXA 4I0XB 5J2TA 1B06A 1OJHA 2GTAA 1XEQA 1IBLO 4X66B 1Q8IA 3AK3A 2ZXWB 4GX5A 1XMOB 4U3JA 4FFKA 1K9MW 1HR0B 5CA1B 4FFBA 4A5UB 2IJHA 2JEXA 2YEVB 1AJPA 3RYIB 4J42A 3ML0A 3OR6C 4GKKO 5C93A 1NH2D 1WLEA 2F23A 4J7ZA 2WLKA 2DYRB 2Q5ZA 1P7BA 4R7CA 1H2SB 4WFAV 1TUEB 4EFEA 1OCZC 2HVJC 4NTXA 1SQPH 2XAGA 2WLIB 2F93B 3H9VA 4I0XA 4ZIBA 5BZBA 1IBKB 5KLVH 1YTFB 4W4KA 2YXYA 5IY5B 1RM1C 4LCUC 3JASA 2QKAA 3BFRA 3RYIA 1OCOC 1LNQA 3K9SA 2LQTA 5TISZ 1ZL8A 4DV3B 3D36C 2E76B 3AG2B 2XAJA 3T1HB 3IJ4A 5IYCO 1ZTEA 2VWKA 1URFA 1IX9A 5HFMA 3TCUA 3W7XA 3PJSK 1BT8A 5H9CA 1M5IA 1XOUA 1VQ6V 4J7JA 1HNZO 3RWRD 3D3QA 4JV5O 4DXWA 4PA3A 4LF4B 4JAUA 1YIJV 1K92A 3OEEG 2YIBA 3SJAC 4ZBMA 3T4DA 4F6RA 4PD4F 1UPGA 1XMQO 2EIJC 4O4HB 2YXLA 3C3SA 2IM9A 2JJ1G 4LF9B 1SRYA 4FZ1A 3RYFA 4DR7O 4NVPA 4UVCA 1FFXB 1VQ8V 2LGQA 4PI0A 2CGNA 3CPWU 1VARA 1Q6UA 3ABKC 1R6NA 3SYOA 4O2AB 4XDJA 3SPJA 5LMUO 4DV7B 1IBKO 2P90A 3SPGA 4R50A 5KHKA 1Q43A 5EYPB 3HKCB 2E75B 3FX7A 2EILC 4LF6O 2WLLA 2FKXA 2ZE5A 2D3OW 1IBMB 2KKWA 1TVKB 5KUKA 3UM7A 1KKCA 3T1HO 4O2AA 5B1BC 2Q69A 3ZBHA 1JX9A 5L3CA 1XREA 2B5UA 4LP8A 1GN2A 4JI0B 1H8EG 3HKCA 1E1RG 1EN4A 3K58A 3B40A 3AG3C 4MTGA 2XASA 1US6A 2XNDG 2DOSA 4TV8B 1WP8A 1TVKA 1EN6A 3ASOB 3G80A 1ZSPA 1UJWB 3IC9A 2EZOA 3X2QB 4XBFA 2ZXWC 5EBMC 4UVAA 3T4ZA 4MW3A 1PD3A 4TSFG 2L6LA 2LP7A 4KHPO 3ZRWB 1J5EB 5KHJA 1R3IC 3WB0A 5KUMA 3H1KH 4TV8A 5A2QN 2WWWA 1S5LZ 4DV7O 3AK1A 3RFRA 2PI5A 4I55A 4LBEC 5EC1C 3A0HZ 2ZR3A 3VOUA 4WFHA 1YDXA 2QWOB 1VQPV 1RPOA 3CRRA 3MHSC 1P84F 5IY5C 4H37A 4JI7B 3ZCCA 4ZHQA 1V55B 3ZRWA 3K0GA 2HG5C 4JYCA 2DJVA 2MK3A 4K0KB 4JTCB 1IBMO 3QO8A 1MG1A 1SC5B 4MT8A 5KA5A 4RQFA 2CE4A 1S3JA 1JQ0A 4TOIA 4PDMA 2EIKC 2D2CB 1FJGB 4AQYO 2Q7GA 5H6RA 4Z1VA 3G4SV 4E2LA 1Q6HA 1PNKA 3DXRA 1IDSA 3WU2Z 3B8NA 3SYCA 4DR2O 5LHGA 2YUAA 3A0RA 1H38A 4IYIA 1JFFB 1KP3A 1I5XA 4DO2A 3GWOA 4UCUA 1WA8B 1NR1A 5JJNB 2JVDA 3G67A 5IWAO 4NXMB 4GYCB 2ODMA 3LNNA 2B9ZA 5BY1A 4P9PA 3SYAA 1HNXB 4CH5A 4DUZB 2UXCO 4X64B 3LDCA 2H94A 3ASNB 3W7UA 2M7WA 2AXTZ 1EN5A 3N2GB 2H8PC 5EBWC 4JI7O 4GZRB 1JFFA 2OIGA 4DR3B 4YJ3B 1WA8A 5JH7B 5BR8O 1MA1A 2PF4E 4JI2O 3LDEA 1YTFD 2QA4V 3CJHB 1VF6A 2GHYA 1AP6A 1E1QG 1RPRA 1YJNV 4GUNA 2VRZA 4LNUB 2QGNA 3WFVA 2QWPB 4DV0O 2CDYA 1I08A 4O4JB 2ZKOA 4YIOA 1NBMG 3C90A 5LL6Y 3L9DA 2AGAA 4F6EA 1GN3A 1QCEA 4KXRA 4NYKA 2YIBD 2JGDB 2V1DA 4YJ3A 2BSKB 3OEHG 3BPZA 1H2NA 2IU3A 5LHHA 4LNUA 5K1PA 3ASOC 1SQBH 1NI8A 4O4JA 5KAFZ 4YY3B 2Q0OC 2HVKC 4QIWF 5CA0B 1AI6A 2UUAB 3RT3C 2EZPA 4MVSA 1WN7A 2CK3G 4DV1B 1COWG 3TETA 2P22C 2W6IG 2Z0AA 2VQFO 4NXMO 4GX2A 5ITZB 3G6BA 1K33A 1AR4A 2BSKA 1SZTA 2E3CA 2QTSA 4R8CA 1NKDA 2OIEA 4X64O 4DR5B 4FM2A 1JVMA 2HJFC 2QJ1A 3WG7B 5DN6G 2DWDC 5IJ9B 1B04A 4DV5B 1AI4A 4O4LB 1N8RW 3A2FA 1FD9A 1KKDA 4X89A 4ABMA 2X0LA 2WLHA 4KUMA 3SDLA 4X65O 1G1XB 1V55C 2RCVA 1KMIZ 5LHIA 3MHHC 3ZJZA 5J2UB 3BA9A 2XTAA 2GUZB 1AI5A 4X62B 1IVSA 3AG1C 4I4TB 5CB4B 4TQDA 4FZ0A 1FXKB 4B3TB 1JJOA 1SQFA 4O4LA 3C3TA 2PYLA 3OE7G 2NNUA 1E79G 2LGWA 3GVMA 4MVZA 2RNBA 3NR7A 3IAYA 3P3PA 4CS2A 2CTRA 1H2KA 3T1YB 2DMXA 1F7YA 2F4VO 3F5WC 3SYQA 2GV9A 2BTQB 2GUZA 4MVQA 1YF2A 1BHAA 1V54B 5CB4A 2YXHA 1FXKA 1FXVA 4DV1O 5KHIA 3K79A 2ZD9A 2DQ3A 5LA6B 3GWKC 4LFBB 4MTXA 5FPRA 1SESA 1UFIA 3L74H 1VF6C 3M7MX 2QE7G 4WFBV 1ROPA 1BS3A 1NTZH 2YS8A 4PDVA 5BMVA 3N27A 2GDSA 2Y48A 3E22B 3OUFA 4EB6B 4ASUG 1F4NA 3DGEA 4PA9A 1JJ2U 3E8GA 1N33O 1NJIW 4Q20A 1YVWA 2YI9A 3AG7A 1Q3EA 4U3FH 2QDOA 2KG7B 3E35A 5FNVB 3E8HA 4CZZA 1Q82W 5H6QA 1QR8A 1I0HA 4QE7A 2F66C 4UCRA 1GTOA 1HNWO 1SETA 3E22A 1CPYA 1YEWA 4K8ZA 3RGBA 4NR1A 5L3EA 1PP9H 1QU7A 2WPDG 3HPLC 3JAWB 4NKGB 3ZHVA 2KG7A 5FNVA 2DWEC 4JASA 2ZIMA 3IFXA 2ITCC 1JOYA 3T1YO 1KB9F 2OYQA 1FS0G 3HKBB 5L3BA 5K1XA 1Y74B 2Q8VA 3JAKB 4J7KA 2ADQB 2WLMA 4HYOA 5F2VO 4GX1A 4DR6O 3BAAA 3JAWA 4X1IA 3OMNB 4IGGA 4UFZA 2JS5A 3H1JH 1IURA 4RO2A 5IJ0B 1M57B 4L87A 4MVOA 3OMAB 1ZLZA 3SYPA 4TQFA 3QF7A 5LMNO 4RQEA 1M4UA 3WG7C 4DV2B 1Q6IA 1Y74A 3DSQA 4J9ZB 1BQ0A 1QQCA 3JAKA 1W2BU 3CHXA 1AI7A 4KL1A 5CA1A 2YEVA 3JATB 1KU9A 3ETGA 3JARB 3ZHRA 3JCUZ 3CP1A 3OTOB 2PYJA 2UUCO 4H44B 2Q73A 3U10A 4KFMA 1R3JC 4JI5B 1W59A 3RBZA 2P06A 4GX0A 5E1AC 2VQEO 2WLIA 3FB7C 1QBZA 4G27B 4J11A 4F4LA 2ZE7A 3OGCC 1FXKC 3B77A 4B7EA 1EZJA 2UUBB 3CC4V 1N4CA 1BE3H 3CEIA 1VQKV 2W0XA 1N32B 4YXWG 3JATA 1F4MA 3JARA 4FMTA 4NXNO 1OCCB 1GRJA 1SQQH 2AZ2A 4JI6B 4FLWA 4MVRA 2YIDA 1Z2GA 2IW5A 2HP8A 1YHQV 4X66O 2QSAA 2QM8A 1XMOO 1KUQA 3K03A 4G2KA 2UXNA 1HR0O 2ZCEA 4UVBA 1BZKA 5KMGB 2BCCH 2JDIG 2ZQMA 1HP8A 4FLUA 1NTMH 1RFYA 5EZYB 2JGUA 5H2FZ 2X7RB 1R3LC 2R70A 1DTOA 2P6JA 4PA6A 3A8TA 4JI1B 5FLXN 4DV6B 2IJIA 2DW4A 4X1YB 4Q6GA 2LO1A 2PTMA 4FK5C 1ZX3A 4BIUA 4FLZA 3AG4B 4O4HA 2EINB 1XNRB 4JYYA 2WA3A 4OPHA 4LF5B 5C8YB 3UT5B 5IE9A 4UCVA 4DV3O 3E89A 1FFXA 4DK0A 2YI8A 1FXHA 5KHHA 1SQXH 5IYDO 1BSMA 2AHYA 2M6YA 1Q81W 4X1YA 2ITDC 2XAFA 2PGGA 3CRAA 2UUBO 3CE2A 5EYPA 1I94B 1N32O 3WB2A 2LFRA 3ZEDA 2X6BA 3K08A 1S72V 4BIOA 4DV4B 5C8YA 4LF4O 1K4CC 2UXXA 3MD0A 3SPCA 4B3SB 1K4DC 3FYEB 4DR1B 3E8BA 1ZUQA 4PA7A 1LUWA 4XDLA 5GTIZ 1MZFA 2W6JG 1SQVH 4JI3B 1XL6A 3JALB 5E79Z 4LF9O 4K8XA 3AK2A 3CCVV 2X6CA 2LFSA 5CA3A 2DYRC 2ZT9B 1PL0A 1Y4MA 4PHZA 1ORQC 1M57C 1QVFU 3L71H 3N2KB 3J7AU 4DUYB 4CC6A 4JI4B 2GTSA 3BY6A 2V7QG 4JGSA 1YJWV 3U0ZA 2YSUB 1HWYA 3JALA 4Z1MG 4LF5O 3OAAG 4U7NA 3B09A 4DW1A 3H1HH 1H2MA 1YXBA 4RWUA 2LW1A 5L3FA 2QWRB 5GONB 1VP7A 2Q7EA 2IBZH 1P7GA 2XUMA 3AG2C 3N2KA 4H33A 4D6TH 1KECA 3SJBC 4IHJB 3K5OA 3K04A 4D7SA 3W7TA 4H13B 5CBHA 4JI0O 1S76D 3CB2A 3K0DA 4DV4O 1VQNV 4OX9B 3KZIZ 2BOCC 3ICXA 4G28B 4B3SO 1OCCC 3QO7A 4BIZA 1X4TA 1AR1B 1XILA 1N0JA 3M8AA 4DR1O 2LW7A 4WBNB 3OFNG 1AJNA 3AEIA 3JD2A 4LWSB 4J10A 5GONA 1XL4A 2K9PA 2A9HA 2IJJA 3L72H 4IHJA 1SA0B 2BTOA 1FAFA 1L8DA 1T5EA 1P49A 3BRCA 4H0LB 4CH6A 3RYHB 1J5EO 2Q7HA 1M90W 2CAZC 2YIAA 3CX5F 1R6KA 2VS0A 1IZ3A 1IXBA 4JAAA 3UO2A 3ZN0A 3RVYA 5AG2A 1I7FA 3EVKA 1YSCA 1VQ7V 5IYZB 4AI8A 1G8MA 4LWSA 1KQSU 4O4IB 4RUEA 2A3QA 4UB8Z 3VQVA 2Y0IA 3CCQV 1FFTB 4JYAB 3RYHA 4K0KO 4PV1B 2JS3A 5LYJB 4LF7B 5LGTA 1DGSA 4X1KB 1X59A 3IC7A 1GK9A 2ZM6B 1VQ4V 2JK5C 3ZMZA 1KP2A 2HKOA 2UXDB 1N36B 1BCCH 1XNQB 3N2GA 1W0KG 4O4IA 1VQ5V 1FJGO 1SQGA 5JJJB 2QM7A 2DN9A 3SJCC 2FMLA 2Y69B 1NTKH 2P5OA 1XUQA 2UXBB 5JH7A 3G71V 3CJHA 1M9NA 2Y4TA 1TUBB 1W0JG 2NLJC 4I50B 4YHHB 1OV9A 2HLDG 4P30A 4ZOLB 4JYBA 2OTLV 3TXQA 1RSOB 1G4YB 3ZMTA 2EBOA 4DW0A 2WLJA 4UCTA 2A7WA 4QPJA 3X2QC 2KB1A 5JJEB 4EFBA 4J80A 3QG5A 1OCRB 2ZNJA 3I5DA 4TV9B 2N74A 3QNEA 5B1NA 1XI1A 2JGDA 3K5MA 1Q7YW 4FPPA 3DC6A 1BQZA 1HNXO 4DUZO 1EBOA 1PNLA 4I50A 1Z5VA 1P4RA 4ZOLA 1RSOA 5LP6B 3JD3A 1QVGU 4JI8B 3ZHUA 3VQXA 4DR4B 5CA0A 4MVMA 4DR3O 2O57A 1QLEB 2FYUH 1FYJA 2B1GA 5JVDB 4GKJB 4JYAO 4TV9A 1OCZB 4WFFA 3CCLV 1WNSA 1THZA 1RP3B 1XHXA 5ITZA 1R1BA 4IYHA 1N34B 4LC1A 5J9PC 3BABA 4BWAA 5LXTB 4MSWC 1AB3A 1RM1B 1KYOF 2ZM6O 5IT9N 3KG2A 3UO3A 5LP6A 1N36O 4FJCC 3EXAA 1OCOB 5IJ9A 3CRMA 1PL4A 1H8HG 5JVDA 1PPJH 4P2ZA 1L1FA 2YICA 2ZDIA 1WP7A 1NU1H 3ZIAG 5J2UA 1DLBA 2ZE8A 3CYOA 4HNAB 3TXSA 5LXTA 1TGOA 1JCHA 4I5SA 3OTFA 4YY3O 5EBLC 2IH3C 4I4TA 2UUAO 5EC2C 3D8CA 4FLTA 2QEXV 4CBCA 4CC5A 4GLXA 2HJDA 3ZHQA 4I9WA 4C7UA 3Q4HB 2P4KA 1ZAUA 3CD6V 5FPOA 3L73H 2H3OA 1L0NH 2ZIOA 3E86A 3ABTA 4DR5O 1ENVA 3QTCA 2N04A 1MABG 3ASNC 2BTQA 3LSQA 1D2DA 4DV5O 1TAEA 4GKKB 4IIJB 4B7KA 2QWQB 2KSDA 3CSXA 3GB7C 4GKJO 1LUVA 4MS2A 5LA6A 1XBLA 2E5LB 4ZI7B 3U11A 4FIPC 1S5HC 5D5PA 3CXHF 2Y0PA 2EIMB 5FL7G 4X62O 2BOBC 4L8JA 1K7DA 1K97A 2EILB 1JA8A 2RJZA 4EB6A 3CWBH 2XHBA 4IL6Z 4B3TO 3CMEV 2NN4A 3OW2U 4IIJA 1M56B 1MMMA 3HKDB 2WA4A 5B5EZ 1VQ9V 2CGOA 4QJFB 3G6EV 1I5YA 5B1BB 2NR5A 3OM3B 4ZI7A 3J80N 3L75H 4E4EA 4U3JB 1EM1A 5LGNA 2A0LA 3H1LH 4DRXB 1NZ6A 3LUTB 1SS3A 2JJ2G 1HDJA 2QTOA 1Q86W 1HNZB 1K5SA 2MW2B 2DYSB 3ZHSA 4JV5B 1VF5B 1WB7A 1OCRC 4LFBO 2R72A 2CUGA 3HKDA 1CXZB 3NXSA 4GT1A 1BMFG 2EJ7A 3KKYA 1M1KW 5LGUA 1BHBA 3J81N 1GM9A 2EJRA 4X20B 3JSLA 1XMQB 2X6AA 3HKBA 4JPRA 2Y4UA 5LP6C 4D7TA 3JASB 2JEUA 5IYBO 4DRXA 4EEQA 2QR4A 4B3RB 4UUJC 3K3WA 1ZL8B 4DR7B 1QLEC 2Q4PA 4HBNA 4WF9V 2E5LO 3SPIA 2N05A 2ZDIC 4OPAA 4AILC 3OD4A 3UQ8A 5LMUB 5IJ0A 4O2BB 1FKAO 3I55V 2QM4A 4X20A 1V9PA 4CS4A 2OCHA 4LF6B 4FLXA 3HB3B 3E83A 1G6UA 1DF5A 1AILA 3FD9A 4PI2A 4BAYA 2HHHB 2OWOA 3UKMA 2RQ6A 5D5QA 2EIKB 4F6RB 2Q67A 3TJTA 3CC2V 4O2BA 4RAIA 2QKCA 2P7TC 5B1OA 2QWNB 5DM6V 1GKFA 1Q5OA 2AHZA 2P67A 1V54C 3F7YC 3RYFB 5GTHZ 5B66Z 4CH3A 2R9AA 2HR3A 4RUFA 1K8AW 4ZKIA 3JD1A 1GM8A 4WFGA 3FB5C 3VBBA 4MTOA 4WCEV 1NVPB 1NR7A 4HZ3A 3HR0A 5EIBC 3BCCH 3CXCU 1AP5A 5B1AB 4DV2O 1QR9A 2WLLB 1F23A 4B3RO 5KX5B 1S5JA 4LFAB 1QLNA 4KHPB 5LOVB 5KMGA 3B2EE 4J41A 2K1EA 3L70H 4K35A 4W4LA 4FM0A 4QGPA 3OTOO 3R66A 5EZYA 2E74B 2JIZG 3O65A 1MSWD 4JI5O 2GSMB 4UB6Z 2EIMC 1IXMA 3W7SA 1EFRG 3H01A 3K9AA 1WPXA 3DC5A 4BW5A 3ETEA 1R3KC 5KX5A 1XDCA 3D3IA 3ZMSA 2HHHO 4MVUA 1M56C 5LOVA 5CMUA 3ETQA 3S3WA 3ZS8C 3SGIA 3F7VC 2LJ2A 4BW9A 4EKWA 2F43G 2PUSA 5BXZA 3UT5A 5CBGA 4JI6O 5KAIZ 4OXSA 2W0FC 4QPKA 1H2GA 3B8MA 4AQYB 1JR9A 4U7OA 4R6ZA 1WJZA 2DYSC 1WAZA 3BA8A 1A32A 4I55B 4MW8A 2EULA 3OT7A 4PJ0Z 5CBFA 2ETNA 4DR2B 2HEPA 1HW7A 3OUSA 5DEDA 4JF3A 4JI1O 4DV6O 1GH6A 5LBQA 3A0BZ 3ABLB 3KCXA 3JCZA 4ZHQB 2UU9B 4LFAO 5EIBD 5IWAB 4X8AA 1WPBA 1OZ0A 1L0LH 1XNRO 3WB1A 3K59A 1N0NA 5EK0A 3I56V 3BHPA 2UXCB 4FVMA 3PN1A 1K5QA 3QO5A 2Q6AA 3THOA 3MDSA 4UCSA 2HFEC 1S0VA 2ADPA 2KQXA 3SPHA 3JD0A 3CCJV 3OGIB 1Y76B 1MOFA 1WB8A 2GBOA 2PY5A 4UV9A 3ZRSA 2ZR2A 2DQ0A 3ZMVA 5BR8B 3ABUA 1YCIA 4JI2B 3DXRB 4CS3A 1I94O 1GAXA 4FLYA 4Z2WA 1GN4A 1YJ9V 3FYIB 1B6QA 1R6TA 3OMIB 4DV0B 4FM1A 4X88A 3AG1B 4J9YB 4DYLA 1Y67A 2RMKB 3DTUB 3FAVB 1JMKC 2AW9A 2YDEA 2FTKA 2B1IA 3LNMB 2Q0AA 5JCOA 2OCCB 2Z5UA 1Y76A 3HKEB 2ZNIA 4JI3O 3ZN1A 4CH4A 2WSSG 3CRCA 3FB6C 2Z3YA 1D5AA 3ETDA 4N23A 1Z5WA 1VQLV 3IGAC 5L3DA 1ZWIC 4PDRA 4NB5A 4DK1A 1NH2B 3BVOA 4ICGA 1DK1A 4JTDB 3APOA 2WAMA 1AJQA 1NQTA 4UV8A 3FAVA 3ZHTA 1QHTA 4TUYB 5B1AC 4WBNA 4DUYO 1SERA 2UU9O 3VQWA 3SJQC 2DE0X 3B4SA 1CEZA 4JI4O 3H1IH 5B3SB 5L3GA 1SA0A 2VQFB 3HKEA 4B08A 3M99B 3S3XA 2Q68A 2ILMA 3AG4C 2EINC 3P3NA 3SR2C 1EZVH 1GM7A 1Y6XA 2RN9A 2XOKG 3ABMB 1OHHG 4TWKA 2OT5A 1O9HA 3CRQA 3EHBB 3UCSC 3P30A 3CMAV 2CTWA 1F51A 1DF4A 2XAQA 4YJ2B 4TUYA 5IYZA 2OTJV 1TA8A 2QKSA 4UCOA 4X65B 2EX3A 2JRIA 4I7ZB 4PA4A 4OX9O 2IU0A 4NTWA 1YITV 2RDCA 4K3AA 4LFCB 4XDKA 1KC8W 2ARHA 1PM9A 1KD1W 5LYJA 3KCYA 4X1KA 3ZMUA 1GMGA 4YJ2A 4QE9A 2Q9LA 2FB5A 3LSUA 1VQOV 2R9RB 1VMGA 3P32A
chains in the Genus database with same CATH topology
5BXZA 2ZKOA 1HR0O 3JAMN 4JYAO 1AILA 4X62O 3T1YO 5LL6Y 4JI8O 2DJVA 4JI6O 4JI3O 2AGAA 1IBMO 1R1BA 4DR4O 3J7AU 4B3TO 4LF6O 2FKXA 1AB3A 2ZM6O 5IT9N 1F7YA 2F4VO 4K0KO 4DR6O 1N36O 1DK1A 1N34O 1NS1A 5FLXN 3T1HO 3J80N 4DUYO 1X59A 4AQYO 4LF5O 1A32A 2UU9O 4B3MO 4DV1O 4JI4O 5LMNO 4JI1O 4LF7O 4DV6O 1FJGO 4OPHA 3RT3C 4LFAO 4DR2O 4DV3O 2UXDO 4LFBO 4YY3O 2Z0AA 2VQFO 2DOSA 4NXMO 1XNQO 1XNRO 2UUAO 4JI0O 4DV2O 1N33O 1HNZO 4X64O 4B3RO 4JV5O 2UUCO 2UXBO 4DV4O 3J81N 4LF8O 5IWAO 2UUBO 4LFCO 4B3SO 4YHHO 1N32O 5BY1A 2VQEO 3OTOO 3M8AA 4DR1O 2JRIA 2LW7A 3R66A 4DR5O 2UXCO 4KHPO 2N74A 3F5TA 4OX9O 4LF4O 5H5NA 3O65A 4JI5O 1XMQO 3SDLA 4X65O 1G1XB 1D2DA 1I94O 2E5LO 4DV5O 1HNWO 1YZBA 1HNXO 4OPAA 4JI7O 4DUZO 1R6TA 1XEQA 5A2QN 1IBLO 4DV7O 1J5EO 4DR7O 5BR8O 4NXNO 4GKJO 1FKAO 4JI2O 2HHHO 4A5UB 4GKKO 4LF9O 4X66O 4DR3O 5LMUO 1XMOO 4DV0O 1KUQA 1IBKO 1FYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXZ A;  2ZKO A;  1HR0 O;  3JAM N;  4JYA O;  1AIL A;  4X62 O;  3T1Y O;  5LL6 Y;  4JI8 O;  2DJV A;  4JI6 O;  4JI3 O;  2AGA A;  1IBM O;  1R1B A;  4DR4 O;  3J7A U;  4B3T O;  4LF6 O;  2FKX A;  1AB3 A;  2ZM6 O;  5IT9 N;  1F7Y A;  2F4V O;  4K0K O;  4DR6 O;  1N36 O;  1DK1 A;  1N34 O;  1NS1 A;  5FLX N;  3T1H O;  3J80 N;  4DUY O;  1X59 A;  4AQY O;  4LF5 O;  1A32 A;  2UU9 O;  4B3M O;  4DV1 O;  4JI4 O;  5LMN O;  4JI1 O;  4LF7 O;  4DV6 O;  1FJG O;  4OPH A;  3RT3 C;  4LFA O;  4DR2 O;  4DV3 O;  2UXD O;  4LFB O;  4YY3 O;  2Z0A A;  2VQF O;  2DOS A;  4NXM O;  1XNQ O;  1XNR O;  2UUA O;  4JI0 O;  4DV2 O;  1N33 O;  1HNZ O;  4X64 O;  4B3R O;  4JV5 O;  2UUC O;  2UXB O;  4DV4 O;  3J81 N;  4LF8 O;  5IWA O;  2UUB O;  4LFC O;  4B3S O;  4YHH O;  1N32 O;  5BY1 A;  2VQE O;  3OTO O;  3M8A A;  4DR1 O;  2JRI A;  2LW7 A;  3R66 A;  4DR5 O;  2UXC O;  4KHP O;  2N74 A;  3F5T A;  4OX9 O;  4LF4 O;  5H5N A;  3O65 A;  4JI5 O;  1XMQ O;  3SDL A;  4X65 O;  1G1X B;  1D2D A;  1I94 O;  2E5L O;  4DV5 O;  1HNW O;  1YZB A;  1HNX O;  4OPA A;  4JI7 O;  4DUZ O;  1R6T A;  1XEQ A;  5A2Q N;  1IBL O;  4DV7 O;  1J5E O;  4DR7 O;  5BR8 O;  4NXN O;  4GKJ O;  1FKA O;  4JI2 O;  2HHH O;  4A5U B;  4GKK O;  4LF9 O;  4X66 O;  4DR3 O;  5LMU O;  1XMO O;  4DV0 O;  1KUQ A;  1IBK O;  1FYJ A; 
#chains in the Genus database with same CATH topology
 4LH6 A;  1KBH A;  1S77 D;  1SZX A;  1CP9 A;  1AVM A;  1FPO A;  4P9O A;  2F4V B;  4JAV A;  1GO3 F;  2IH1 C;  1TUB A;  3JSN A;  3FB8 C;  2XAH A;  1QNM A;  3STZ C;  3STL C;  3ABL C;  2CH7 B;  1BL8 A;  3TK1 A;  3JD4 A;  1VQM V;  2VWJ A;  1NVP D;  1B3Q A;  1NS1 A;  4HAM A;  4PEL A;  1YI2 V;  1U96 A;  4LR3 A;  3EFF K;  1GN6 A;  4BR6 A;  4LF7 O;  4QNH B;  2IJK A;  2V4D A;  1XQ8 A;  1N33 B;  2BE3 A;  4B3M B;  3JYC A;  5JCO C;  2UXD O;  1XNQ O;  2CH7 A;  3W7W A;  3MAQ A;  2XT9 A;  4UXN A;  1ARO P;  4IT5 A;  4MTF A;  2R9I A;  2UXB O;  2CTQ A;  2ZE6 A;  2G38 A;  3TGU H;  5A9G A;  4LFC O;  3RYC B;  2PZS A;  5HFL A;  4YHH O;  1HNW B;  1M93 A;  3K5L A;  1PV0 A;  5DEC A;  2A79 B;  4NTY A;  4LF8 B;  5H5N A;  4KP4 A;  2OCC C;  4TT3 G;  1YZB A;  3CS5 A;  1VF7 A;  5JWP A;  3K06 A;  3RW0 A;  1MSD A;  3D36 A;  5BMV B;  5KA6 A;  4WFE A;  3FKS G;  3T1C A;  2A06 H;  3RYC A;  1SKV A;  1K73 W;  1VEW A;  1IBL B;  3RN4 A;  4GCZ A;  2ATK C;  2EIJ B;  4AHC A;  1NT2 B;  3JAM N;  4HNA A;  1Y66 A;  4JI8 O;  1VIB A;  4OGQ B;  3FFQ A;  4DR6 B;  4DR4 O;  1U97 A;  1XHZ A;  5B3S C;  1JPX A;  3K5N A;  2WLN A;  3K57 A;  3VQY A;  1Q90 D;  1K34 A;  3ABK B;  5JQG B;  2CTP A;  3ZRV A;  5CN0 A;  3CCM V;  3ABM C;  4N21 A;  5LMN B;  1N34 O;  1R73 A;  3Q4H A;  3OR7 C;  4PDL A;  2ZIN A;  4B3M O;  3E8F A;  4JZG A;  3LDD A;  2AZ0 A;  1PNM A;  1D5N A;  4FLV A;  2F1M A;  3R65 A;  3O9O A;  3CCE V;  3CCS V;  1J95 A;  3CCR V;  1PKX A;  3CCU V;  2PI4 A;  2UUC B;  2Y69 C;  2F95 B;  3E2E A;  5J2T B;  5JQG A;  3RVZ A;  1MZE A;  1MNG A;  2P4V A;  2VQE B;  4LH7 A;  5IDJ A;  1O9G A;  1K3E A;  3T2M A;  3APQ A;  4LF8 O;  4FFB B;  1SF9 A;  3CC7 V;  4JZ2 A;  3BEH A;  4YIP A;  4X1I B;  2L35 A;  3ZX6 A;  4JTA B;  1AR5 A;  2C2A A;  4I9Q A;  1H2L A;  3AG3 B;  2YC0 A;  3F5T A;  3LSS A;  5KHG A;  1LR1 A;  4X9Q A;  4NXN B;  2FL4 A;  3QVN A;  5GW7 A;  1BGY H;  3ZRX A;  4I0X B;  5J2T A;  1B06 A;  1OJH A;  2GTA A;  1XEQ A;  1IBL O;  4X66 B;  1Q8I A;  3AK3 A;  2ZXW B;  4GX5 A;  1XMO B;  4U3J A;  4FFK A;  1K9M W;  1HR0 B;  5CA1 B;  4FFB A;  4A5U B;  2IJH A;  2JEX A;  2YEV B;  1AJP A;  3RYI B;  4J42 A;  3ML0 A;  3OR6 C;  4GKK O;  5C93 A;  1NH2 D;  1WLE A;  2F23 A;  4J7Z A;  2WLK A;  2DYR B;  2Q5Z A;  1P7B A;  4R7C A;  1H2S B;  4WFA V;  1TUE B;  4EFE A;  1OCZ C;  2HVJ C;  4NTX A;  1SQP H;  2XAG A;  2WLI B;  2F93 B;  3H9V A;  4I0X A;  4ZIB A;  5BZB A;  1IBK B;  5KLV H;  1YTF B;  4W4K A;  2YXY A;  5IY5 B;  1RM1 C;  4LCU C;  3JAS A;  2QKA A;  3BFR A;  3RYI A;  1OCO C;  1LNQ A;  3K9S A;  2LQT A;  5TIS Z;  1ZL8 A;  4DV3 B;  3D36 C;  2E76 B;  3AG2 B;  2XAJ A;  3T1H B;  3IJ4 A;  5IYC O;  1ZTE A;  2VWK A;  1URF A;  1IX9 A;  5HFM A;  3TCU A;  3W7X A;  3PJS K;  1BT8 A;  5H9C A;  1M5I A;  1XOU A;  1VQ6 V;  4J7J A;  1HNZ O;  3RWR D;  3D3Q A;  4JV5 O;  4DXW A;  4PA3 A;  4LF4 B;  4JAU A;  1YIJ V;  1K92 A;  3OEE G;  2YIB A;  3SJA C;  4ZBM A;  3T4D A;  4F6R A;  4PD4 F;  1UPG A;  1XMQ O;  2EIJ C;  4O4H B;  2YXL A;  3C3S A;  2IM9 A;  2JJ1 G;  4LF9 B;  1SRY A;  4FZ1 A;  3RYF A;  4DR7 O;  4NVP A;  4UVC A;  1FFX B;  1VQ8 V;  2LGQ A;  4PI0 A;  2CGN A;  3CPW U;  1VAR A;  1Q6U A;  3ABK C;  1R6N A;  3SYO A;  4O2A B;  4XDJ A;  3SPJ A;  5LMU O;  4DV7 B;  1IBK O;  2P90 A;  3SPG A;  4R50 A;  5KHK A;  1Q43 A;  5EYP B;  3HKC B;  2E75 B;  3FX7 A;  2EIL C;  4LF6 O;  2WLL A;  2FKX A;  2ZE5 A;  2D3O W;  1IBM B;  2KKW A;  1TVK B;  5KUK A;  3UM7 A;  1KKC A;  3T1H O;  4O2A A;  5B1B C;  2Q69 A;  3ZBH A;  1JX9 A;  5L3C A;  1XRE A;  2B5U A;  4LP8 A;  1GN2 A;  4JI0 B;  1H8E G;  3HKC A;  1E1R G;  1EN4 A;  3K58 A;  3B40 A;  3AG3 C;  4MTG A;  2XAS A;  1US6 A;  2XND G;  2DOS A;  4TV8 B;  1WP8 A;  1TVK A;  1EN6 A;  3ASO B;  3G80 A;  1ZSP A;  1UJW B;  3IC9 A;  2EZO A;  3X2Q B;  4XBF A;  2ZXW C;  5EBM C;  4UVA A;  3T4Z A;  4MW3 A;  1PD3 A;  4TSF G;  2L6L A;  2LP7 A;  4KHP O;  3ZRW B;  1J5E B;  5KHJ A;  1R3I C;  3WB0 A;  5KUM A;  3H1K H;  4TV8 A;  5A2Q N;  2WWW A;  1S5L Z;  4DV7 O;  3AK1 A;  3RFR A;  2PI5 A;  4I55 A;  4LBE C;  5EC1 C;  3A0H Z;  2ZR3 A;  3VOU A;  4WFH A;  1YDX A;  2QWO B;  1VQP V;  1RPO A;  3CRR A;  3MHS C;  1P84 F;  5IY5 C;  4H37 A;  4JI7 B;  3ZCC A;  4ZHQ A;  1V55 B;  3ZRW A;  3K0G A;  2HG5 C;  4JYC A;  2DJV A;  2MK3 A;  4K0K B;  4JTC B;  1IBM O;  3QO8 A;  1MG1 A;  1SC5 B;  4MT8 A;  5KA5 A;  4RQF A;  2CE4 A;  1S3J A;  1JQ0 A;  4TOI A;  4PDM A;  2EIK C;  2D2C B;  1FJG B;  4AQY O;  2Q7G A;  5H6R A;  4Z1V A;  3G4S V;  4E2L A;  1Q6H A;  1PNK A;  3DXR A;  1IDS A;  3WU2 Z;  3B8N A;  3SYC A;  4DR2 O;  5LHG A;  2YUA A;  3A0R A;  1H38 A;  4IYI A;  1JFF B;  1KP3 A;  1I5X A;  4DO2 A;  3GWO A;  4UCU A;  1WA8 B;  1NR1 A;  5JJN B;  2JVD A;  3G67 A;  5IWA O;  4NXM B;  4GYC B;  2ODM A;  3LNN A;  2B9Z A;  5BY1 A;  4P9P A;  3SYA A;  1HNX B;  4CH5 A;  4DUZ B;  2UXC O;  4X64 B;  3LDC A;  2H94 A;  3ASN B;  3W7U A;  2M7W A;  2AXT Z;  1EN5 A;  3N2G B;  2H8P C;  5EBW C;  4JI7 O;  4GZR B;  1JFF A;  2OIG A;  4DR3 B;  4YJ3 B;  1WA8 A;  5JH7 B;  5BR8 O;  1MA1 A;  2PF4 E;  4JI2 O;  3LDE A;  1YTF D;  2QA4 V;  3CJH B;  1VF6 A;  2GHY A;  1AP6 A;  1E1Q G;  1RPR A;  1YJN V;  4GUN A;  2VRZ A;  4LNU B;  2QGN A;  3WFV A;  2QWP B;  4DV0 O;  2CDY A;  1I08 A;  4O4J B;  2ZKO A;  4YIO A;  1NBM G;  3C90 A;  5LL6 Y;  3L9D A;  2AGA A;  4F6E A;  1GN3 A;  1QCE A;  4KXR A;  4NYK A;  2YIB D;  2JGD B;  2V1D A;  4YJ3 A;  2BSK B;  3OEH G;  3BPZ A;  1H2N A;  2IU3 A;  5LHH A;  4LNU A;  5K1P A;  3ASO C;  1SQB H;  1NI8 A;  4O4J A;  5KAF Z;  4YY3 B;  2Q0O C;  2HVK C;  4QIW F;  5CA0 B;  1AI6 A;  2UUA B;  3RT3 C;  2EZP A;  4MVS A;  1WN7 A;  2CK3 G;  4DV1 B;  1COW G;  3TET A;  2P22 C;  2W6I G;  2Z0A A;  2VQF O;  4NXM O;  4GX2 A;  5ITZ B;  3G6B A;  1K33 A;  1AR4 A;  2BSK A;  1SZT A;  2E3C A;  2QTS A;  4R8C A;  1NKD A;  2OIE A;  4X64 O;  4DR5 B;  4FM2 A;  1JVM A;  2HJF C;  2QJ1 A;  3WG7 B;  5DN6 G;  2DWD C;  5IJ9 B;  1B04 A;  4DV5 B;  1AI4 A;  4O4L B;  1N8R W;  3A2F A;  1FD9 A;  1KKD A;  4X89 A;  4ABM A;  2X0L A;  2WLH A;  4KUM A;  3SDL A;  4X65 O;  1G1X B;  1V55 C;  2RCV A;  1KMI Z;  5LHI A;  3MHH C;  3ZJZ A;  5J2U B;  3BA9 A;  2XTA A;  2GUZ B;  1AI5 A;  4X62 B;  1IVS A;  3AG1 C;  4I4T B;  5CB4 B;  4TQD A;  4FZ0 A;  1FXK B;  4B3T B;  1JJO A;  1SQF A;  4O4L A;  3C3T A;  2PYL A;  3OE7 G;  2NNU A;  1E79 G;  2LGW A;  3GVM A;  4MVZ A;  2RNB A;  3NR7 A;  3IAY A;  3P3P A;  4CS2 A;  2CTR A;  1H2K A;  3T1Y B;  2DMX A;  1F7Y A;  2F4V O;  3F5W C;  3SYQ A;  2GV9 A;  2BTQ B;  2GUZ A;  4MVQ A;  1YF2 A;  1BHA A;  1V54 B;  5CB4 A;  2YXH A;  1FXK A;  1FXV A;  4DV1 O;  5KHI A;  3K79 A;  2ZD9 A;  2DQ3 A;  5LA6 B;  3GWK C;  4LFB B;  4MTX A;  5FPR A;  1SES A;  1UFI A;  3L74 H;  1VF6 C;  3M7M X;  2QE7 G;  4WFB V;  1ROP A;  1BS3 A;  1NTZ H;  2YS8 A;  4PDV A;  5BMV A;  3N27 A;  2GDS A;  2Y48 A;  3E22 B;  3OUF A;  4EB6 B;  4ASU G;  1F4N A;  3DGE A;  4PA9 A;  1JJ2 U;  3E8G A;  1N33 O;  1NJI W;  4Q20 A;  1YVW A;  2YI9 A;  3AG7 A;  1Q3E A;  4U3F H;  2QDO A;  2KG7 B;  3E35 A;  5FNV B;  3E8H A;  4CZZ A;  1Q82 W;  5H6Q A;  1QR8 A;  1I0H A;  4QE7 A;  2F66 C;  4UCR A;  1GTO A;  1HNW O;  1SET A;  3E22 A;  1CPY A;  1YEW A;  4K8Z A;  3RGB A;  4NR1 A;  5L3E A;  1PP9 H;  1QU7 A;  2WPD G;  3HPL C;  3JAW B;  4NKG B;  3ZHV A;  2KG7 A;  5FNV A;  2DWE C;  4JAS A;  2ZIM A;  3IFX A;  2ITC C;  1JOY A;  3T1Y O;  1KB9 F;  2OYQ A;  1FS0 G;  3HKB B;  5L3B A;  5K1X A;  1Y74 B;  2Q8V A;  3JAK B;  4J7K A;  2ADQ B;  2WLM A;  4HYO A;  5F2V O;  4GX1 A;  4DR6 O;  3BAA A;  3JAW A;  4X1I A;  3OMN B;  4IGG A;  4UFZ A;  2JS5 A;  3H1J H;  1IUR A;  4RO2 A;  5IJ0 B;  1M57 B;  4L87 A;  4MVO A;  3OMA B;  1ZLZ A;  3SYP A;  4TQF A;  3QF7 A;  5LMN O;  4RQE A;  1M4U A;  3WG7 C;  4DV2 B;  1Q6I A;  1Y74 A;  3DSQ A;  4J9Z B;  1BQ0 A;  1QQC A;  3JAK A;  1W2B U;  3CHX A;  1AI7 A;  4KL1 A;  5CA1 A;  2YEV A;  3JAT B;  1KU9 A;  3ETG A;  3JAR B;  3ZHR A;  3JCU Z;  3CP1 A;  3OTO B;  2PYJ A;  2UUC O;  4H44 B;  2Q73 A;  3U10 A;  4KFM A;  1R3J C;  4JI5 B;  1W59 A;  3RBZ A;  2P06 A;  4GX0 A;  5E1A C;  2VQE O;  2WLI A;  3FB7 C;  1QBZ A;  4G27 B;  4J11 A;  4F4L A;  2ZE7 A;  3OGC C;  1FXK C;  3B77 A;  4B7E A;  1EZJ A;  2UUB B;  3CC4 V;  1N4C A;  1BE3 H;  3CEI A;  1VQK V;  2W0X A;  1N32 B;  4YXW G;  3JAT A;  1F4M A;  3JAR A;  4FMT A;  4NXN O;  1OCC B;  1GRJ A;  1SQQ H;  2AZ2 A;  4JI6 B;  4FLW A;  4MVR A;  2YID A;  1Z2G A;  2IW5 A;  2HP8 A;  1YHQ V;  4X66 O;  2QSA A;  2QM8 A;  1XMO O;  1KUQ A;  3K03 A;  4G2K A;  2UXN A;  1HR0 O;  2ZCE A;  4UVB A;  1BZK A;  5KMG B;  2BCC H;  2JDI G;  2ZQM A;  1HP8 A;  4FLU A;  1NTM H;  1RFY A;  5EZY B;  2JGU A;  5H2F Z;  2X7R B;  1R3L C;  2R70 A;  1DTO A;  2P6J A;  4PA6 A;  3A8T A;  4JI1 B;  5FLX N;  4DV6 B;  2IJI A;  2DW4 A;  4X1Y B;  4Q6G A;  2LO1 A;  2PTM A;  4FK5 C;  1ZX3 A;  4BIU A;  4FLZ A;  3AG4 B;  4O4H A;  2EIN B;  1XNR B;  4JYY A;  2WA3 A;  4OPH A;  4LF5 B;  5C8Y B;  3UT5 B;  5IE9 A;  4UCV A;  4DV3 O;  3E89 A;  1FFX A;  4DK0 A;  2YI8 A;  1FXH A;  5KHH A;  1SQX H;  5IYD O;  1BSM A;  2AHY A;  2M6Y A;  1Q81 W;  4X1Y A;  2ITD C;  2XAF A;  2PGG A;  3CRA A;  2UUB O;  3CE2 A;  5EYP A;  1I94 B;  1N32 O;  3WB2 A;  2LFR A;  3ZED A;  2X6B A;  3K08 A;  1S72 V;  4BIO A;  4DV4 B;  5C8Y A;  4LF4 O;  1K4C C;  2UXX A;  3MD0 A;  3SPC A;  4B3S B;  1K4D C;  3FYE B;  4DR1 B;  3E8B A;  1ZUQ A;  4PA7 A;  1LUW A;  4XDL A;  5GTI Z;  1MZF A;  2W6J G;  1SQV H;  4JI3 B;  1XL6 A;  3JAL B;  5E79 Z;  4LF9 O;  4K8X A;  3AK2 A;  3CCV V;  2X6C A;  2LFS A;  5CA3 A;  2DYR C;  2ZT9 B;  1PL0 A;  1Y4M A;  4PHZ A;  1ORQ C;  1M57 C;  1QVF U;  3L71 H;  3N2K B;  3J7A U;  4DUY B;  4CC6 A;  4JI4 B;  2GTS A;  3BY6 A;  2V7Q G;  4JGS A;  1YJW V;  3U0Z A;  2YSU B;  1HWY A;  3JAL A;  4Z1M G;  4LF5 O;  3OAA G;  4U7N A;  3B09 A;  4DW1 A;  3H1H H;  1H2M A;  1YXB A;  4RWU A;  2LW1 A;  5L3F A;  2QWR B;  5GON B;  1VP7 A;  2Q7E A;  2IBZ H;  1P7G A;  2XUM A;  3AG2 C;  3N2K A;  4H33 A;  4D6T H;  1KEC A;  3SJB C;  4IHJ B;  3K5O A;  3K04 A;  4D7S A;  3W7T A;  4H13 B;  5CBH A;  4JI0 O;  1S76 D;  3CB2 A;  3K0D A;  4DV4 O;  1VQN V;  4OX9 B;  3KZI Z;  2BOC C;  3ICX A;  4G28 B;  4B3S O;  1OCC C;  3QO7 A;  4BIZ A;  1X4T A;  1AR1 B;  1XIL A;  1N0J A;  3M8A A;  4DR1 O;  2LW7 A;  4WBN B;  3OFN G;  1AJN A;  3AEI A;  3JD2 A;  4LWS B;  4J10 A;  5GON A;  1XL4 A;  2K9P A;  2A9H A;  2IJJ A;  3L72 H;  4IHJ A;  1SA0 B;  2BTO A;  1FAF A;  1L8D A;  1T5E A;  1P49 A;  3BRC A;  4H0L B;  4CH6 A;  3RYH B;  1J5E O;  2Q7H A;  1M90 W;  2CAZ C;  2YIA A;  3CX5 F;  1R6K A;  2VS0 A;  1IZ3 A;  1IXB A;  4JAA A;  3UO2 A;  3ZN0 A;  3RVY A;  5AG2 A;  1I7F A;  3EVK A;  1YSC A;  1VQ7 V;  5IYZ B;  4AI8 A;  1G8M A;  4LWS A;  1KQS U;  4O4I B;  4RUE A;  2A3Q A;  4UB8 Z;  3VQV A;  2Y0I A;  3CCQ V;  1FFT B;  4JYA B;  3RYH A;  4K0K O;  4PV1 B;  2JS3 A;  5LYJ B;  4LF7 B;  5LGT A;  1DGS A;  4X1K B;  1X59 A;  3IC7 A;  1GK9 A;  2ZM6 B;  1VQ4 V;  2JK5 C;  3ZMZ A;  1KP2 A;  2HKO A;  2UXD B;  1N36 B;  1BCC H;  1XNQ B;  3N2G A;  1W0K G;  4O4I A;  1VQ5 V;  1FJG O;  1SQG A;  5JJJ B;  2QM7 A;  2DN9 A;  3SJC C;  2FML A;  2Y69 B;  1NTK H;  2P5O A;  1XUQ A;  2UXB B;  5JH7 A;  3G71 V;  3CJH A;  1M9N A;  2Y4T A;  1TUB B;  1W0J G;  2NLJ C;  4I50 B;  4YHH B;  1OV9 A;  2HLD G;  4P30 A;  4ZOL B;  4JYB A;  2OTL V;  3TXQ A;  1RSO B;  1G4Y B;  3ZMT A;  2EBO A;  4DW0 A;  2WLJ A;  4UCT A;  2A7W A;  4QPJ A;  3X2Q C;  2KB1 A;  5JJE B;  4EFB A;  4J80 A;  3QG5 A;  1OCR B;  2ZNJ A;  3I5D A;  4TV9 B;  2N74 A;  3QNE A;  5B1N A;  1XI1 A;  2JGD A;  3K5M A;  1Q7Y W;  4FPP A;  3DC6 A;  1BQZ A;  1HNX O;  4DUZ O;  1EBO A;  1PNL A;  4I50 A;  1Z5V A;  1P4R A;  4ZOL A;  1RSO A;  5LP6 B;  3JD3 A;  1QVG U;  4JI8 B;  3ZHU A;  3VQX A;  4DR4 B;  5CA0 A;  4MVM A;  4DR3 O;  2O57 A;  1QLE B;  2FYU H;  1FYJ A;  2B1G A;  5JVD B;  4GKJ B;  4JYA O;  4TV9 A;  1OCZ B;  4WFF A;  3CCL V;  1WNS A;  1THZ A;  1RP3 B;  1XHX A;  5ITZ A;  1R1B A;  4IYH A;  1N34 B;  4LC1 A;  5J9P C;  3BAB A;  4BWA A;  5LXT B;  4MSW C;  1AB3 A;  1RM1 B;  1KYO F;  2ZM6 O;  5IT9 N;  3KG2 A;  3UO3 A;  5LP6 A;  1N36 O;  4FJC C;  3EXA A;  1OCO B;  5IJ9 A;  3CRM A;  1PL4 A;  1H8H G;  5JVD A;  1PPJ H;  4P2Z A;  1L1F A;  2YIC A;  2ZDI A;  1WP7 A;  1NU1 H;  3ZIA G;  5J2U A;  1DLB A;  2ZE8 A;  3CYO A;  4HNA B;  3TXS A;  5LXT A;  1TGO A;  1JCH A;  4I5S A;  3OTF A;  4YY3 O;  5EBL C;  2IH3 C;  4I4T A;  2UUA O;  5EC2 C;  3D8C A;  4FLT A;  2QEX V;  4CBC A;  4CC5 A;  4GLX A;  2HJD A;  3ZHQ A;  4I9W A;  4C7U A;  3Q4H B;  2P4K A;  1ZAU A;  3CD6 V;  5FPO A;  3L73 H;  2H3O A;  1L0N H;  2ZIO A;  3E86 A;  3ABT A;  4DR5 O;  1ENV A;  3QTC A;  2N04 A;  1MAB G;  3ASN C;  2BTQ A;  3LSQ A;  1D2D A;  4DV5 O;  1TAE A;  4GKK B;  4IIJ B;  4B7K A;  2QWQ B;  2KSD A;  3CSX A;  3GB7 C;  4GKJ O;  1LUV A;  4MS2 A;  5LA6 A;  1XBL A;  2E5L B;  4ZI7 B;  3U11 A;  4FIP C;  1S5H C;  5D5P A;  3CXH F;  2Y0P A;  2EIM B;  5FL7 G;  4X62 O;  2BOB C;  4L8J A;  1K7D A;  1K97 A;  2EIL B;  1JA8 A;  2RJZ A;  4EB6 A;  3CWB H;  2XHB A;  4IL6 Z;  4B3T O;  3CME V;  2NN4 A;  3OW2 U;  4IIJ A;  1M56 B;  1MMM A;  3HKD B;  2WA4 A;  5B5E Z;  1VQ9 V;  2CGO A;  4QJF B;  3G6E V;  1I5Y A;  5B1B B;  2NR5 A;  3OM3 B;  4ZI7 A;  3J80 N;  3L75 H;  4E4E A;  4U3J B;  1EM1 A;  5LGN A;  2A0L A;  3H1L H;  4DRX B;  1NZ6 A;  3LUT B;  1SS3 A;  2JJ2 G;  1HDJ A;  2QTO A;  1Q86 W;  1HNZ B;  1K5S A;  2MW2 B;  2DYS B;  3ZHS A;  4JV5 B;  1VF5 B;  1WB7 A;  1OCR C;  4LFB O;  2R72 A;  2CUG A;  3HKD A;  1CXZ B;  3NXS A;  4GT1 A;  1BMF G;  2EJ7 A;  3KKY A;  1M1K W;  5LGU A;  1BHB A;  3J81 N;  1GM9 A;  2EJR A;  4X20 B;  3JSL A;  1XMQ B;  2X6A A;  3HKB A;  4JPR A;  2Y4U A;  5LP6 C;  4D7T A;  3JAS B;  2JEU A;  5IYB O;  4DRX A;  4EEQ A;  2QR4 A;  4B3R B;  4UUJ C;  3K3W A;  1ZL8 B;  4DR7 B;  1QLE C;  2Q4P A;  4HBN A;  4WF9 V;  2E5L O;  3SPI A;  2N05 A;  2ZDI C;  4OPA A;  4AIL C;  3OD4 A;  3UQ8 A;  5LMU B;  5IJ0 A;  4O2B B;  1FKA O;  3I55 V;  2QM4 A;  4X20 A;  1V9P A;  4CS4 A;  2OCH A;  4LF6 B;  4FLX A;  3HB3 B;  3E83 A;  1G6U A;  1DF5 A;  1AIL A;  3FD9 A;  4PI2 A;  4BAY A;  2HHH B;  2OWO A;  3UKM A;  2RQ6 A;  5D5Q A;  2EIK B;  4F6R B;  2Q67 A;  3TJT A;  3CC2 V;  4O2B A;  4RAI A;  2QKC A;  2P7T C;  5B1O A;  2QWN B;  5DM6 V;  1GKF A;  1Q5O A;  2AHZ A;  2P67 A;  1V54 C;  3F7Y C;  3RYF B;  5GTH Z;  5B66 Z;  4CH3 A;  2R9A A;  2HR3 A;  4RUF A;  1K8A W;  4ZKI A;  3JD1 A;  1GM8 A;  4WFG A;  3FB5 C;  3VBB A;  4MTO A;  4WCE V;  1NVP B;  1NR7 A;  4HZ3 A;  3HR0 A;  5EIB C;  3BCC H;  3CXC U;  1AP5 A;  5B1A B;  4DV2 O;  1QR9 A;  2WLL B;  1F23 A;  4B3R O;  5KX5 B;  1S5J A;  4LFA B;  1QLN A;  4KHP B;  5LOV B;  5KMG A;  3B2E E;  4J41 A;  2K1E A;  3L70 H;  4K35 A;  4W4L A;  4FM0 A;  4QGP A;  3OTO O;  3R66 A;  5EZY A;  2E74 B;  2JIZ G;  3O65 A;  1MSW D;  4JI5 O;  2GSM B;  4UB6 Z;  2EIM C;  1IXM A;  3W7S A;  1EFR G;  3H01 A;  3K9A A;  1WPX A;  3DC5 A;  4BW5 A;  3ETE A;  1R3K C;  5KX5 A;  1XDC A;  3D3I A;  3ZMS A;  2HHH O;  4MVU A;  1M56 C;  5LOV A;  5CMU A;  3ETQ A;  3S3W A;  3ZS8 C;  3SGI A;  3F7V C;  2LJ2 A;  4BW9 A;  4EKW A;  2F43 G;  2PUS A;  5BXZ A;  3UT5 A;  5CBG A;  4JI6 O;  5KAI Z;  4OXS A;  2W0F C;  4QPK A;  1H2G A;  3B8M A;  4AQY B;  1JR9 A;  4U7O A;  4R6Z A;  1WJZ A;  2DYS C;  1WAZ A;  3BA8 A;  1A32 A;  4I55 B;  4MW8 A;  2EUL A;  3OT7 A;  4PJ0 Z;  5CBF A;  2ETN A;  4DR2 B;  2HEP A;  1HW7 A;  3OUS A;  5DED A;  4JF3 A;  4JI1 O;  4DV6 O;  1GH6 A;  5LBQ A;  3A0B Z;  3ABL B;  3KCX A;  3JCZ A;  4ZHQ B;  2UU9 B;  4LFA O;  5EIB D;  5IWA B;  4X8A A;  1WPB A;  1OZ0 A;  1L0L H;  1XNR O;  3WB1 A;  3K59 A;  1N0N A;  5EK0 A;  3I56 V;  3BHP A;  2UXC B;  4FVM A;  3PN1 A;  1K5Q A;  3QO5 A;  2Q6A A;  3THO A;  3MDS A;  4UCS A;  2HFE C;  1S0V A;  2ADP A;  2KQX A;  3SPH A;  3JD0 A;  3CCJ V;  3OGI B;  1Y76 B;  1MOF A;  1WB8 A;  2GBO A;  2PY5 A;  4UV9 A;  3ZRS A;  2ZR2 A;  2DQ0 A;  3ZMV A;  5BR8 B;  3ABU A;  1YCI A;  4JI2 B;  3DXR B;  4CS3 A;  1I94 O;  1GAX A;  4FLY A;  4Z2W A;  1GN4 A;  1YJ9 V;  3FYI B;  1B6Q A;  1R6T A;  3OMI B;  4DV0 B;  4FM1 A;  4X88 A;  3AG1 B;  4J9Y B;  4DYL A;  1Y67 A;  2RMK B;  3DTU B;  3FAV B;  1JMK C;  2AW9 A;  2YDE A;  2FTK A;  2B1I A;  3LNM B;  2Q0A A;  5JCO A;  2OCC B;  2Z5U A;  1Y76 A;  3HKE B;  2ZNI A;  4JI3 O;  3ZN1 A;  4CH4 A;  2WSS G;  3CRC A;  3FB6 C;  2Z3Y A;  1D5A A;  3ETD A;  4N23 A;  1Z5W A;  1VQL V;  3IGA C;  5L3D A;  1ZWI C;  4PDR A;  4NB5 A;  4DK1 A;  1NH2 B;  3BVO A;  4ICG A;  1DK1 A;  4JTD B;  3APO A;  2WAM A;  1AJQ A;  1NQT A;  4UV8 A;  3FAV A;  3ZHT A;  1QHT A;  4TUY B;  5B1A C;  4WBN A;  4DUY O;  1SER A;  2UU9 O;  3VQW A;  3SJQ C;  2DE0 X;  3B4S A;  1CEZ A;  4JI4 O;  3H1I H;  5B3S B;  5L3G A;  1SA0 A;  2VQF B;  3HKE A;  4B08 A;  3M99 B;  3S3X A;  2Q68 A;  2ILM A;  3AG4 C;  2EIN C;  3P3N A;  3SR2 C;  1EZV H;  1GM7 A;  1Y6X A;  2RN9 A;  2XOK G;  3ABM B;  1OHH G;  4TWK A;  2OT5 A;  1O9H A;  3CRQ A;  3EHB B;  3UCS C;  3P30 A;  3CMA V;  2CTW A;  1F51 A;  1DF4 A;  2XAQ A;  4YJ2 B;  4TUY A;  5IYZ A;  2OTJ V;  1TA8 A;  2QKS A;  4UCO A;  4X65 B;  2EX3 A;  2JRI A;  4I7Z B;  4PA4 A;  4OX9 O;  2IU0 A;  4NTW A;  1YIT V;  2RDC A;  4K3A A;  4LFC B;  4XDK A;  1KC8 W;  2ARH A;  1PM9 A;  1KD1 W;  5LYJ A;  3KCY A;  4X1K A;  3ZMU A;  1GMG A;  4YJ2 A;  4QE9 A;  2Q9L A;  2FB5 A;  3LSU A;  1VQO V;  2R9R B;  1VMG A;  3P32 A; 
#chains in the Genus database with same CATH homology
 5BXZ A;  2ZKO A;  1HR0 O;  3JAM N;  4JYA O;  1AIL A;  4X62 O;  3T1Y O;  5LL6 Y;  4JI8 O;  2DJV A;  4JI6 O;  4JI3 O;  2AGA A;  1IBM O;  1R1B A;  4DR4 O;  3J7A U;  4B3T O;  4LF6 O;  2FKX A;  1AB3 A;  2ZM6 O;  5IT9 N;  1F7Y A;  2F4V O;  4K0K O;  4DR6 O;  1N36 O;  1DK1 A;  1N34 O;  1NS1 A;  5FLX N;  3T1H O;  3J80 N;  4DUY O;  1X59 A;  4AQY O;  4LF5 O;  1A32 A;  2UU9 O;  4B3M O;  4DV1 O;  4JI4 O;  5LMN O;  4JI1 O;  4LF7 O;  4DV6 O;  1FJG O;  4OPH A;  3RT3 C;  4LFA O;  4DR2 O;  4DV3 O;  2UXD O;  4LFB O;  4YY3 O;  2Z0A A;  2VQF O;  2DOS A;  4NXM O;  1XNQ O;  1XNR O;  2UUA O;  4JI0 O;  4DV2 O;  1N33 O;  1HNZ O;  4X64 O;  4B3R O;  4JV5 O;  2UUC O;  2UXB O;  4DV4 O;  3J81 N;  4LF8 O;  5IWA O;  2UUB O;  4LFC O;  4B3S O;  4YHH O;  1N32 O;  5BY1 A;  2VQE O;  3OTO O;  3M8A A;  4DR1 O;  2JRI A;  2LW7 A;  3R66 A;  4DR5 O;  2UXC O;  4KHP O;  2N74 A;  3F5T A;  4OX9 O;  4LF4 O;  5H5N A;  3O65 A;  4JI5 O;  1XMQ O;  3SDL A;  4X65 O;  1G1X B;  1D2D A;  1I94 O;  2E5L O;  4DV5 O;  1HNW O;  1YZB A;  1HNX O;  4OPA A;  4JI7 O;  4DUZ O;  1R6T A;  1XEQ A;  5A2Q N;  1IBL O;  4DV7 O;  1J5E O;  4DR7 O;  5BR8 O;  4NXN O;  4GKJ O;  1FKA O;  4JI2 O;  2HHH O;  4A5U B;  4GKK O;  4LF9 O;  4X66 O;  4DR3 O;  5LMU O;  1XMO O;  4DV0 O;  1KUQ A;  1IBK O;  1FYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...