4JI6O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 34
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji6O00
4B3TO 4AQYO 4LFCO 2UXDO 4YHHO 1G1XB 2ZM6O 1HNXO 4LF8O 3T1YO 3SDLA 1IBMO 1N36O 4DV1O 5IT9N 1J5EO 4DUYO 1F7YA 4JV5O 1I94O 2ZKOA 1YZBA 3J81N 2UUAO 1IBKO 5LL6Y 4DR2O 1FKAO 4JI3O 5BY1A 2E5LO 4JI1O 4DR6O 3F5TA 1IBLO 4K0KO 4LF9O 2UXCO 5IWAO 4JI7O 2FKXA 1D2DA 4DV4O 4OPHA 1XMOO 4JYAO 4LF4O 1DK1A 4NXNO 4LF5O 3J7AU 1XNQO 1HR0O 2LW7A 4JI8O 1N33O 4GKJO 1XEQA 2UXBO 4DUZO 4LF7O 4NXMO 5A2QN 1R6TA 2HHHO 3O65A 4OPAA 4YY3O 1XMQO 1HNZO 1X59A 4DR5O 4B3SO 5H5NA 1AB3A 4X66O 5LMUO 5BXZA 3JAMN 5FLXN 4JI6O 2DJVA 3T1HO 2UUBO 2VQFO 2N74A 1FJGO 4JI0O 3J80N 4JI4O 2UUCO 2DOSA 3OTOO 2JRIA 1A32A 1AILA 4DR1O 4DR4O 4X65O 4DR7O 4B3MO 2F4VO 4LF6O 4X62O 1NS1A 4X64O 4JI2O 1R1BA 1N34O 3R66A 2Z0AA 4DV3O 4LFBO 1FYJA 4DV5O 2VQEO 4DV2O 4A5UB 5LMNO 1HNWO 4DV0O 1KUQA 4B3RO 4GKKO 4DV7O 3M8AA 1XNRO 3RT3C 2UU9O 4DR3O 4LFAO 4KHPO 4DV6O 4JI5O 1N32O 2AGAA 5BR8O 4OX9O
chains in the Genus database with same CATH superfamily
3OFNG 1EZVH 4AQYO 1U96A 2EINC 4W4KA 5LMNB 4LF8O 4LF5B 1QR9A 4GUNA 2XASA 4FVMA 3BA8A 3JD1A 3ZMUA 4PA6A 4QPJA 2D3OW 2GTSA 4RUFA 1DGSA 1P4RA 3K08A 3OTOB 2CTRA 1YI2V 3SYPA 3F5TA 1RP3B 1IBLO 4K0KO 2P67A 4JI7O 2PGGA 1XMOO 5IYZA 4CH5A 4NXNO 1VEWA 1OZ0A 1XEQA 5HFLA 1TUEB 1VQMV 3RYCB 4UB6Z 2YIAA 1ZX3A 1L1FA 4DR5O 4J7ZA 1VF6C 5LMUO 1HR0B 3LSQA 1H2MA 2WPDG 1ZAUA 1H8HG 2FMLA 5EYPA 2OYQA 2WWWA 5B1OA 1AI6A 4DW1A 4GX1A 3F5WC 3MHHC 5C8YA 4ZI7A 1SQBH 1WJZA 5B5EZ 3H1KH 3AK1A 3WB1A 1LUVA 2UUCB 3U0ZA 2ITCC 1PNLA 1NS1A 3JD0A 1GMGA 1PPJH 1OCOB 2XTAA 2LW1A 4DV3O 1FYJA 2OCCB 4QJFB 3G6EV 3D36C 1NU1H 2WA3A 5LMNO 3A2FA 3IC9A 5KHHA 1WNSA 2YS8A 4J9YB 1P49A 3RYHA 3LUTB 2ZXWB 4ZOLB 1E1RG 1AR5A 2DYRC 3SPGA 4DUZB 1VQKV 2YI8A 2OTLV 1G1XB 2W0FC 3C3SA 4MVMA 4IYIA 4NB5A 4WBNB 3RGBA 1RPOA 2VWJA 2RQ6A 3OMAB 3ABTA 3ICXA 3S3WA 3CRCA 4JZ2A 3FAVB 1Q43A 1IBKO 4B3TB 4DR2O 1NVPD 5EK0A 1WA8A 2OWOA 2YXYA 1EN5A 1SA0B 2FKXA 1OCCC 1GN3A 4MTFA 3QVNA 4JPRA 4DV5B 2FB5A 2VRZA 4X89A 4JI3B 2AXTZ 4I4TA 1THZA 1NR1A 4JI4B 1FS0G 4X66O 4HNAA 2PZSA 3STZC 3JAMN 2RCVA 1K34A 2XAFA 4JI0O 5EBLC 3H9VA 1H8EG 5EBMC 4NXMB 3FB5C 1DF4A 2UXDB 1Z5WA 4GLXA 2PY5A 4DV7B 1SRYA 2GSMB 5L3BA 4GX2A 3BAAA 2F4VO 4LF6O 4DUYB 5KHJA 4BAYA 1YF2A 4I7ZB 4UFZA 4CC5A 5JQGB 4WFHA 1KUQA 1YJ9V 2W6IG 3X2QB 3SYQA 1LR1A 4DR3O 4KHPO 3LDEA 4MVRA 2EX3A 5GW7A 1S5JA 1L0NH 2B5UA 2DMXA 5IY5C 2WAMA 3D3IA 1IBKB 3SPJA 2X6CA 4LFCO 1N33B 3DC5A 2A3QA 2PYJA 4O2AB 2YC0A 3T1YO 3ABLB 3OAAG 1N36O 5F2VO 1Y76B 1Q7YW 4MTGA 3I56V 4KL1A 3N2KA 2UUAO 2ARHA 4XBFA 2HJFC 4DYLA 3A0HZ 4DV2B 4JI3O 4P30A 4FM2A 2DQ3A 1SQFA 1H38A 1YTFB 3L74H 4H13B 1XQ8A 4K35A 4OPHA 2A7WA 2BSKA 2EIKC 3FYEB 4OGQB 1DK1A 4LF8B 1VQPV 4LF5O 3J7AU 4ZI7B 2Y69C 4GKJO 1LUWA 4NXMO 4TV8A 4OPAA 4UV8A 2BSKB 2LO1A 3CCLV 2IBZH 2CTWA 3UQ8A 4FLYA 2HEPA 2PUSA 3CXHF 2ZE5A 1NH2D 4LF4B 4PJ0Z 2QWNB 5EIBC 1YXBA 2ATKC 4J10A 2Q6AA 1K97A 2Q5ZA 1MSWD 1YJWV 3Q4HB 3ZHRA 1AI7A 3D36A 3K06A 3B8MA 4X1YB 3L9DA 4MVOA 4CH3A 1N34O 5LMUB 1XBLA 4MS2A 3E89A 2OIEA 5JVDB 3TETA 1GM9A 3N2KB 3ZRSA 1GO3F 2F1MA 2B1GA 4IYHA 3CYOA 4O2BB 3G80A 3RW0A 4FZ1A 4JI1B 4TT3G 3G67A 2O57A 4FFBB 1Q6UA 2UXNA 1FFTB 4IL6Z 3QF7A 1BL8A 2ZD9A 3G71V 2YDEA 3P3PA 3SJCC 4UCOA 1Q5OA 1R3IC 1BHAA 3CP1A 4CZZA 2JK5C 1TVKB 4CS3A 3WU2Z 4X20A 2JVDA 3TXQA 2WLKA 2EIKB 1Y76A 1HP8A 5IWAO 2XT9A 4DO2A 4FLWA 3ETGA 4PDVA 4LF4O 5IJ9B 4CC6A 2ZINA 3K9AA 2P4VA 2CH7B 2YIDA 3CPWU 1SETA 1ZL8B 3C90A 1KYOF 2P7TC 5LA6A 4H44B 4ZHQB 2VWKA 1QLNA 5EBWC 5KX5A 1G8MA 1Q90D 4BW9A 2GBOA 1FJGO 5CBHA 1HDJA 4PI2A 1T5EA 5L3FA 4L87A 3AG2B 1AP5A 1KKDA 4UCUA 2EILC 3K59A 4R8CA 1JR9A 1JVMA 3W7WA 3NR7A 4N23A 2Q8VA 4RQFA 1WLEA 4C7UA 1QLEC 1Y67A 1VF6A 2UXXA 3B2EE 1S72V 1K4DC 5CA0A 4DR2B 2A79B 2RN9A 5IJ0A 4B3RO 5EC1C 4IGGA 5K1PA 4H33A 1QVGU 3ETQA 4GCZA 3E8HA 5LXTA 3ZRVA 5BR8O 3OR6C 4TV9B 2JS5A 3AG7A 1JA8A 3E8GA 2ZNIA 3T2MA 1GH6A 4J42A 4O4JB 3SYAA 2Q67A 5ITZA 4O2BA 5LHIA 1OCZB 1PV0A 4K0KB 3K79A 1CPYA 1ZUQA 4JTDB 4X9QA 3U11A 5EYPB 2DE0X 3GVMA 3CJHB 2LFRA 3BRCA 4WBNA 3APOA 2XAGA 4DV4O 1K73W 2B1IA 3JD4A 4NKGB 1N4CA 1CEZA 3DC6A 5B1NA 1VF5B 4UCRA 1HR0O 3JAKA 4JI8O 4JGSA 1D5NA 1FPOA 3APQA 2KQXA 2YXHA 3RYIB 2Q68A 1VQOV 1JOYA 1VQ9V 1DF5A 5B66Z 3ZIAG 1IZ3A 1PP9H 3W7TA 4B08A 3RYFA 2A06H 3QO8A 5IE9A 1AI5A 3VQXA 2JGDB 5TISZ 3SR2C 3ZBHA 5LGNA 4F6RA 1N36B 5J9PC 1XI1A 3OM3B 5JJNB 1WB8A 1R1BA 5JJJB 3SYCA 4I5SA 2KSDA 4MVQA 4DV2O 3CCRV 3VOUA 1D5AA 1YDXA 4I50A 1AP6A 1R6KA 4MT8A 3K9SA 3EHBB 3SJBC 1JX9A 1URFA 5LGUA 1W2BU 2L35A 3A0RA 1JPXA 3JAKB 4EFBA 4I50B 4DK0A 1HNXO 4F6EA 3HKDB 1AJNA 1OCZC 4PHZA 4KFMA 4DRXA 3K5NA 3ABKC 2R72A 4I9QA 3I5DA 2EIMC 3IC7A 5CB4B 3UM7A 1P7BA 2ZKOA 3E8FA 4JYBA 2F66C 2XNDG 2IM9A 2LFSA 1YIJV 1K7DA 4RQEA 2MK3A 4JI1O 1SESA 3OUSA 3ZX6A 3CCUV 3MHSC 4IHJA 5L3DA 1L0LH 1N8RW 4DR1B 2DW4A 3A8TA 3TGUH 5H6QA 1AR1B 3SPHA 3K5OA 1YSCA 2MW2B 3ABMC 5IYBO 1GM7A 4FPPA 4RO2A 1HW7A 2YI9A 3ABUA 2OT5A 4H0LB 5EZYB 3CCJV 5KHKA 3AG2C 2AHYA 4PI0A 1BS3A 3U10A 3OMIB 4JI4O 3QG5A 5EC2C 2IJIA 3DXRB 4JASA 1JJOA 1O9GA 1SZTA 3EXAA 3ZMTA 3ML0A 5CBGA 4FLVA 2WLLB 4B3MO 5CN0A 3CEIA 1W59A 3E86A 2Q69A 1XMOB 4J11A 3LDCA 4D7SA 1K9MW 2CAZC 4CS2A 1M5IA 3SPCA 3QO5A 3B4SA 4LF6B 2QE7G 1OV9A 4QPKA 4DV0O 3M8AA 4I9WA 1F4MA 3TXSA 3ZMSA 2IU0A 5KUMA 5E1AC 2HG5C 5IWAB 1KU9A 4WFGA 1GN2A 1QBZA 4JYAB 1KBHA 4TQDA 3MAQA 5FL7G 4R50A 1VIBA 2NN4A 1RPRA 2XAHA 4ZKIA 1BHBA 2IJJA 5BMVB 1KKCA 3JATA 4LFCB 4X1KA 4LWSB 1F7YA 5C8YB 1SQGA 1YZBA 1FXKB 2HFEC 3E35A 3VQWA 2YXLA 5IYDO 1NH2B 2AZ0A 1V55B 3CC2V 5CBFA 4I0XB 3FKSG 1E1QG 3P30A 4RWUA 1UPGA 2Z3YA 1M9NA 3Q4HA 2HVKC 1MNGA 1JQ0A 3E22A 4YHHB 4DUZO 3OTFA 2OCHA 5CMUA 1EM1A 3ZHVA 4YY3O 1HNZO 2RJZA 3JSLA 4B3SO 3AG1B 3RYHB 4BIOA 4JI6O 3E22B 2PTMA 1X4TA 2IJHA 1RFYA 4JI5B 4MVSA 3OGIB 1NBMG 4IHJB 3RBZA 4AHCA 5DM6V 4HYOA 2W6JG 4DV0B 4GKKB 3IAYA 2QA4V 5KMGA 1ROPA 4R7CA 5ITZB 4QGPA 1WPBA 3PJSK 1Q81W 4PDLA 2ZDIA 4JV5B 2Z0AA 3AEIA 3B09A 3FB6C 3SYOA 3WB0A 5AG2A 4AI8A 2YUAA 4A5UB 4DRXB 2V4DA 1Y66A 4G28B 5H9CA 3BEHA 3E2EA 4YJ3B 3N2GA 1R73A 2IW5A 3G6BA 4DV1B 4DV6O 1AROP 1N32O 2E5LB 3ASOC 1SF9A 4O2AA 1BMFG 5DEDA 2UXDO 4EKWA 3AG4B 5GTIZ 5K1XA 1BGYH 2HKOA 2F43G 2JEUA 4IIJB 1ENVA 3AG1C 3IGAC 4KP4A 4QE9A 2F23A 4DUYO 1KP3A 1Z5VA 4U3JB 4UVBA 4U7NA 5KA5A 1W0KG 3VBBA 3CMEV 4ICGA 2JJ1G 3B8NA 4DR3B 1WA8B 3OE7G 4OXSA 1WB7A 3F7YC 2RMKB 4TUYA 1PL4A 1DLBA 2Q7HA 5FNVA 3AG3B 3RN4A 2BE3A 1N33O 2WLJA 3A0BZ 4W4LA 3HKCB 3UO2A 1XL6A 1XMQO 4TV8B 1IBMB 1R3JC 5L3CA 2WA4A 2ITDC 4HNAB 1G4YB 1I5YA 1GKFA 1I08A 4FLTA 2YIBA 2OIGA 2R9AA 4LFBB 4DR1O 4N21A 1KQSU 1M4UA 4MVZA 3FB8C 4ASUG 1VQ7V 4X1IA 4FLXA 4LF7B 1V55C 1Q6HA 1R6NA 4HZ3A 2E75B 4RAIA 1MSDA 4GYCB 1COWG 1NI8A 4IIJA 1K8AW 4J41A 3FAVA 4F4LA 4L8JA 2ZDIC 5KMGB 5DECA 5J2TB 3ZS8C 3FYIB 4YIPA 4LFAO 3CCSV 3OT7A 4WCEV 3ZJZA 2QR4A 1RSOA 2HP8A 3T1CA 2CUGA 3ZMVA 3CXCU 4EEQA 1IX9A 3QTCA 2YIBD 3JCUZ 2UXCB 2P06A 5D5QA 3BY6A 2K1EA 2EJRA 2WLMA 2Y69B 4TUYB 2QWPB 5BR8B 1SQXH 3TK1A 3OMNB 1S5LZ 2Z5UA 3RYFB 5LL6Y 2ZE6A 3CCQV 3JARB 3O9OA 2EIJC 2CTPA 4TSFG 1M57C 3ZHQA 3W7XA 3CD6V 1UFIA 1R3LC 4X1YA 2Q7EA 3AG3C 2BTQB 4KUMA 2GV9A 4EFEA 2ADPA 4G2KA 4DR4B 1SS3A 1PNKA 1F51A 1VMGA 4X62B 1R6TA 3HB3B 1Q86W 4I55A 3JD2A 4JAVA 4LH6A 2ILMA 1XNQB 2CDYA 2W0XA 5JCOA 5FNVB 2VQFO 5EIBD 2N74A 1S76D 1BCCH 4ZIBA 3K04A 1GN4A 1TA8A 2JDIG 3JALA 1H2GA 2DOSA 2ZQMA 3SPIA 1QNMA 1QQCA 1EBOA 3K03A 1S3JA 2F95B 3JASB 4LC1A 5LYJA 5BMVA 2EIJB 5KHIA 1B06A 3ZN1A 4LH7A 1NTMH 2LGQA 2IH1C 4D7TA 3OGCC 2VQEO 3QO7A 4GT1A 1RM1C 2XUMA 4X88A 2Y0PA 1WPXA 4I4TB 4UXNA 4DV7O 4KXRA 1WAZA 2QKAA 1SQVH 1W0JG 2UUBB 1GN6A 3ZCCA 3LDDA 1QLEB 3SGIA 3H01A 3L70H 2LQTA 4YHHO 4TV9A 1GAXA 4B7EA 1VQ5V 3JAWA 1H2NA 2G38A 1MZFA 3SDLA 2Y4UA 4YJ2B 2JS3A 1OCCB 1K5SA 3FD9A 1US6A 3M99B 2P5OA 1TUBB 1OJHA 1YEWA 1QVFU 5H2FZ 2P4KA 1AR4A 3NXSA 4MTOA 1XILA 2EULA 2E5LO 1K33A 3JATB 4JZGA 4LF9O 3UT5A 3ETDA 4P9PA 2NLJC 4X64B 3W7SA 2V7QG 1XDCA 1AVMA 4UUJC 4BWAA 1I7FA 3T4DA 4XDKA 3KKYA 2UXBO 2EZPA 4PDMA 2P6JA 3PN1A 4JTCB 5H6RA 4LCUC 2R9IA 3RVZA 5KUKA 1Z2GA 2WLHA 4MW8A 1F23A 4ZOLA 5LP6A 2YEVB 1B6QA 2CGOA 3CCVV 1JFFA 3LNMB 1A32A 2DWDC 3ABMB 3CRRA 4GX5A 1K4CC 2QM7A 1TAEA 3ASOB 1PM9A 4FIPC 3SJAC 4DV4B 1R3KC 3TCUA 4NTYA 3FB7C 1BQZA 5LHHA 4B3MB 1MABG 3C3TA 1AI4A 2D2CB 1SZXA 3STLC 1WP8A 2HJDA 3DSQA 2K9PA 4Z2WA 2UU9O 5IDJA 3W7UA 3BCCH 4CS4A 2IU3A 2QTOA 4B3TO 4YJ3A 3CX5F 3VQVA 2QM8A 3CMAV 3N27A 2JJ2G 4NVPA 2IJKA 1WN7A 1K5QA 3H1IH 3JARA 3KZIZ 3EFFK 4FK5C 1NZ6A 1IBMO 3EVKA 4JI8B 5B1AB 4K8XA 3F7VC 5DN6G 3J81N 1IURA 4FLUA 2ZIOA 5FPOA 3UO3A 2WLIB 5B1BC 3M7MX 5GONB 5JCOC 5KLVH 1QU7A 4FM0A 4MSWC 4P2ZA 4B7KA 2UXCO 4ZBMA 3K5MA 3RFRA 2KG7B 5CA1B 1FXKA 2ZE8A 1YCIA 3K3WA 1BSMA 4WFAV 1YITV 3H1LH 1BZKA 4WFBV 5B1BB 5A9GA 2F4VB 3GWKC 4JTAB 5LGTA 2EILB 4LFAB 3T1HO 3CRMA 3IJ4A 5B1AC 1HNZB 3J80N 4DXWA 2XOKG 1KECA 2BCCH 2HHHB 2BOCC 1FFXB 5L3GA 3AK2A 4NXNB 4DR4O 3GWOA 4OX9B 5LP6C 4DR7O 4UB8Z 4X62O 1IDSA 2WLLA 1Q82W 1P7GA 5JJEB 1HNXB 2ETNA 2ZNJA 1S0VA 2WLIA 1XUQA 4X1IB 4QE7A 2RNBA 3ZRXA 1MMMA 3RT3C 2CH7A 3KCXA 3CRQA 1NTZH 4EB6B 5J2TA 1XREA 3CC7V 1GTOA 4E2LA 5KAIZ 3AK3A 4GX0A 3B77A 1YHQV 1NVPB 1JMKC 2GUZB 3B40A 1SA0A 2E76B 3R65A 2EBOA 3K57A 4FFKA 3DXRA 1VQNV 1FXHA 3HKDA 3WFVA 2Q73A 5BY1A 4TQFA 3BABA 2Q7GA 1KP2A 1CP9A 4QNHB 4JYAO 3L75H 4PA3A 1XOUA 2DYRB 3BVOA 2PI4A 3SJQC 1FD9A 3P3NA 2HHHO 1EZJA 4J7KA 1M90W 2C2AA 1K92A 1Q6IA 5H5NA 2A0LA 3BPZA 5KX5B 3P32A 4FLZA 2UUBO 1ZTEA 4FMTA 3ZRWB 2QKSA 4UVCA 4U7OA 2M7WA 5KA6A 2JRIA 3OR7C 2GHYA 5KAFZ 2H94A 3THOA 2X6AA 1EN4A 4PA4A 1HWYA 2QWQB 5J2UB 4PD4F 1K3EA 2GUZA 1AJPA 3JALB 1KD1W 3TJTA 1PNMA 4LFBO 5KHGA 1KB9F 4X66B 2P90A 2ZIMA 3ABKB 3DTUB 4YY3B 1HNWO 2QJ1A 3FX7A 1N0JA 4JI0B 1Y74A 3KCYA 4X65B 2JEXA 4AQYB 4JI6B 4JYCA 1UJWB 4BW5A 2ZR2A 4JI5O 2IH3C 1ORQC 3JCZA 1KC8W 2F93B 2BTQA 1VARA 2EJ7A 5GTHZ 3CWBH 3BHPA 5LBQA 1IXMA 3WG7C 3FFQA 4F6RB 4I55B 4EB6A 2JGDA 4JV5O 1MG1A 1I94O 5L3EA 2WSSG 4B3SB 4JI7B 4CH4A 4U3JA 4JAAA 3UCSC 4NR1A 1I5XA 4O4HA 4TWKA 2LGWA 3CJHA 1D2DA 1MOFA 1FXVA 3X2QC 2Y4TA 1JCHA 1F4NA 5D5PA 1XNQO 3QNEA 1U97A 3ETEA 3RYIA 2KB1A 4UV9A 3WB2A 5IJ0B 1VP7A 4MTXA 1OCRC 5B3SB 1M1KW 2PYLA 4KHPB 2QTSA 5GONA 1Y4MA 4DR5B 3ZEDA 2UUCO 1M93A 4O4IB 2H8PC 1Y6XA 4CBCA 1AILA 1B3QA 2Q9LA 4DV3B 1JJ2U 1XNRB 3L73H 4X65O 4Z1VA 5IYZB 2VQEB 4P9OA 3OUFA 5LP6B 4JI2O 1BT8A 3JD3A 2XAQA 3D8CA 4UCTA 4BIUA 1V54C 4YJ2A 2OCCC 5LOVA 1CXZB 5J2UA 5CA3A 3WG7B 4WFFA 3OD4A 2QDOA 2E3CA 4NYKA 1H2KA 4FZ0A 4DR6B 1I94B 4OX9O 2ZXWC 3OEEG 3S3XA 3ZHTA 4LR3A 3IFXA 1SKVA 5EZYA 2E74B 3ABLC 4HAMA 3OW2U 2ZM6O 3HKBA 4R6ZA 2QEXV 2KKWA 1S5HC 1BQ0A 1J5EO 3CB2A 3ZN0A 5CB4A 1YVWA 2ZT9B 4J9ZB 2YEVA 1YTFD 3G4SV 2JGUA 3UKMA 3CCEV 1FKAO 4WF9V 3ZRWA 4RUEA 1Q8IA 1MA1A 1ZL8A 4BR6A 1N34B 3AG4C 1SQPH 2Q4PA 2HR3A 2LW7A 4LF9B 4FFBA 4U3FH 4MVUA 2DWEC 5IY5B 4LF7O 5A2QN 4ZHQA 2GTAA 1AB3A 2PI5A 3MDSA 3HKCA 4PV1B 1PKXA 2FTKA 1XHZA 3E83A 4BIZA 4JYYA 4O4LB 4JI2B 4J80A 2VS0A 2LP7A 3K5LA 1GRJA 2N05A 4GZRB 3OTOO 3JASA 5LYJB 1V54B 1PD3A 3HKEA 1ZSPA 4QIWF 2XHBA 1LNQA 3ZHSA 3K0DA 1OHHG 1ZWIC 1B04A 4UCSA 1FFXA 4XDLA 2QM4A 3K58A 2ZM6B 2R9RB 2FYUH 4GKKO 3CHXA 1FJGB 4X8AA 1E79G 4LNUB 1I0HA 1OCRB 5B3SC 5HFMA 2P22C 2V1DA 1NKDA 3BA9A 4Z1MG 4AILC 4UVAA 4O4HB 3VQYA 5LHGA 4JF3A 1SERA 1IXBA 1NR7A 2ZR3A 3ASNC 5CA1A 4YXWG 2Y0IA 1BE3H 1AJQA 1MZEA 1QCEA 3OEHG 5E79Z 2HLDG 1XHXA 4LP8A 4DV1O 1V9PA 5IT9N 1DTOA 1TGOA 3BFRA 4LBEC 1SC5B 4X1KB 3JYCA 1EFRG 2Q0AA 4X20B 3T1YB 2CK3G 2ZE7A 1QR8A 1FAFA 3LSUA 3HKEB 1QHTA 2M6YA 4I0XA 2WLNA 2JIZG 2YSUB 3GB7C 1M56C 4H37A 4JAUA 2R70A 2OTJV 2Q0OC 4E4EA 3H1JH 4XDJA 5LA6B 2DYSB 1HNWB 4O4JA 1X59A 1VF7A 3ZMZA 1WP7A 2N04A 3DGEA 1IVSA 2DJVA 4CH6A 2XAJA 2EZOA 3JSNA 2QGNA 4DR7B 2AW9A 3HR0A 2QWOB 2ADQB 1RM1B 2YICA 4DW0A 4NTWA 1OCOC 1XMQB 1VQLV 3CS5A 2QWRB 4UCVA 5JQGA 1EN6A 2NNUA 3E8BA 4HBNA 4X64O 3L71H 3HPLC 4LWSA 1VQ6V 1Q3EA 1TUBA 2LJ2A 4DV5O 2PF4E 4K3AA 1PL0A 3K0GA 2X7RB 2GDSA 2QKCA 4MW3A 4PDRA 3MD0A 5LXTB 2AGAA 1GM8A 1O9HA 1NQTA 1N0NA 2CE4A 3D3QA 2L6LA 1XNRO 4WFEA 3CCMV 1VQ4V 1XL4A 4J7JA 1P84F 2EINB 1GK9A 2UXBB 1M57B 4LNUA 2B9ZA 1NT2B 5JH7B 2DYSC 5IJ9A 1JFFB 2AHZA 1ZLZA 2DN9A 5JWPA 5C93A 4TOIA 3H1HH 3CRAA 5BZBA 4DK1A 4DR6O 4O4LA 1S77D 1NTKH 2CTQA 3ZHUA 3HKBB 4FM1A 1SQQH 1G6UA 1YJNV 5IYCO 3KG2A 3N2GB 2ZCEA 3CC4V 1L8DA 2AZ2A 3RVYA 3O65A 1FXKC 2RDCA 1IBLB 3UT5B 1KMIZ 5BXZA 2QSAA 5FLXN 1Y74B 2CGNA 4PA9A 4FJCC 3L72H 2X0LA 4Q6GA 1VQ8V 1H2SB 4ABMA 2EIMB 2Y48A 1TVKA 4NTXA 2UU9B 5CA0B 4PA7A 2NR5A 3RWRD 1H2LA 3LNNA 1NJIW 2X6BA 1J95A 4G27B 5JVDA 4PELA 3JAWB 3LSSA 4DV6B 1N32B 2VQFB 1J5EB 5JH7A 3R66A 4YIOA 2HVJC 4O4IA 4GKJB 2A9HA 2H3OA 2BTOA 2BOBC 5FPRA 2DQ0A 3RYCA 2FL4A 1M56B 3ASNB 4Q20A 2UUAB 3CSXA 2ODMA 3T1HB 3I55V 4K8ZA 4D6TH 2KG7A 3CE2A 5LOVB 4B3RB 1RSOB 3T4ZA 4IT5A
chains in the Genus database with same CATH topology
4B3TO 4AQYO 4LFCO 2UXDO 4YHHO 1G1XB 2ZM6O 1HNXO 4LF8O 3T1YO 3SDLA 1IBMO 1N36O 4DV1O 5IT9N 1J5EO 4DUYO 1F7YA 4JV5O 1I94O 2ZKOA 1YZBA 3J81N 2UUAO 1IBKO 5LL6Y 4DR2O 1FKAO 4JI3O 5BY1A 2E5LO 4JI1O 4DR6O 3F5TA 1IBLO 4K0KO 4LF9O 2UXCO 5IWAO 4JI7O 2FKXA 1D2DA 4DV4O 4OPHA 1XMOO 4JYAO 4LF4O 1DK1A 4NXNO 4LF5O 3J7AU 1XNQO 1HR0O 2LW7A 4JI8O 1N33O 4GKJO 1XEQA 2UXBO 4DUZO 4LF7O 4NXMO 5A2QN 1R6TA 2HHHO 3O65A 4OPAA 4YY3O 1XMQO 1HNZO 1X59A 4DR5O 4B3SO 5H5NA 1AB3A 4X66O 5LMUO 5BXZA 3JAMN 5FLXN 4JI6O 2DJVA 3T1HO 2UUBO 2VQFO 2N74A 1FJGO 4JI0O 3J80N 4JI4O 2UUCO 2DOSA 3OTOO 2JRIA 1A32A 1AILA 4DR1O 4DR4O 4X65O 4DR7O 4B3MO 2F4VO 4LF6O 4X62O 1NS1A 4X64O 4JI2O 1R1BA 1N34O 3R66A 2Z0AA 4DV3O 4LFBO 1FYJA 4DV5O 2VQEO 4DV2O 4A5UB 5LMNO 1HNWO 4DV0O 1KUQA 4B3RO 4GKKO 4DV7O 3M8AA 1XNRO 3RT3C 2UU9O 4DR3O 4LFAO 4KHPO 4DV6O 4JI5O 1N32O 2AGAA 5BR8O 4OX9O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T O;  4AQY O;  4LFC O;  2UXD O;  4YHH O;  1G1X B;  2ZM6 O;  1HNX O;  4LF8 O;  3T1Y O;  3SDL A;  1IBM O;  1N36 O;  4DV1 O;  5IT9 N;  1J5E O;  4DUY O;  1F7Y A;  4JV5 O;  1I94 O;  2ZKO A;  1YZB A;  3J81 N;  2UUA O;  1IBK O;  5LL6 Y;  4DR2 O;  1FKA O;  4JI3 O;  5BY1 A;  2E5L O;  4JI1 O;  4DR6 O;  3F5T A;  1IBL O;  4K0K O;  4LF9 O;  2UXC O;  5IWA O;  4JI7 O;  2FKX A;  1D2D A;  4DV4 O;  4OPH A;  1XMO O;  4JYA O;  4LF4 O;  1DK1 A;  4NXN O;  4LF5 O;  3J7A U;  1XNQ O;  1HR0 O;  2LW7 A;  4JI8 O;  1N33 O;  4GKJ O;  1XEQ A;  2UXB O;  4DUZ O;  4LF7 O;  4NXM O;  5A2Q N;  1R6T A;  2HHH O;  3O65 A;  4OPA A;  4YY3 O;  1XMQ O;  1HNZ O;  1X59 A;  4DR5 O;  4B3S O;  5H5N A;  1AB3 A;  4X66 O;  5LMU O;  5BXZ A;  3JAM N;  5FLX N;  4JI6 O;  2DJV A;  3T1H O;  2UUB O;  2VQF O;  2N74 A;  1FJG O;  4JI0 O;  3J80 N;  4JI4 O;  2UUC O;  2DOS A;  3OTO O;  2JRI A;  1A32 A;  1AIL A;  4DR1 O;  4DR4 O;  4X65 O;  4DR7 O;  4B3M O;  2F4V O;  4LF6 O;  4X62 O;  1NS1 A;  4X64 O;  4JI2 O;  1R1B A;  1N34 O;  3R66 A;  2Z0A A;  4DV3 O;  4LFB O;  1FYJ A;  4DV5 O;  2VQE O;  4DV2 O;  4A5U B;  5LMN O;  1HNW O;  4DV0 O;  1KUQ A;  4B3R O;  4GKK O;  4DV7 O;  3M8A A;  1XNR O;  3RT3 C;  2UU9 O;  4DR3 O;  4LFA O;  4KHP O;  4DV6 O;  4JI5 O;  1N32 O;  2AGA A;  5BR8 O;  4OX9 O; 
#chains in the Genus database with same CATH topology
 3OFN G;  1EZV H;  4AQY O;  1U96 A;  2EIN C;  4W4K A;  5LMN B;  4LF8 O;  4LF5 B;  1QR9 A;  4GUN A;  2XAS A;  4FVM A;  3BA8 A;  3JD1 A;  3ZMU A;  4PA6 A;  4QPJ A;  2D3O W;  2GTS A;  4RUF A;  1DGS A;  1P4R A;  3K08 A;  3OTO B;  2CTR A;  1YI2 V;  3SYP A;  3F5T A;  1RP3 B;  1IBL O;  4K0K O;  2P67 A;  4JI7 O;  2PGG A;  1XMO O;  5IYZ A;  4CH5 A;  4NXN O;  1VEW A;  1OZ0 A;  1XEQ A;  5HFL A;  1TUE B;  1VQM V;  3RYC B;  4UB6 Z;  2YIA A;  1ZX3 A;  1L1F A;  4DR5 O;  4J7Z A;  1VF6 C;  5LMU O;  1HR0 B;  3LSQ A;  1H2M A;  2WPD G;  1ZAU A;  1H8H G;  2FML A;  5EYP A;  2OYQ A;  2WWW A;  5B1O A;  1AI6 A;  4DW1 A;  4GX1 A;  3F5W C;  3MHH C;  5C8Y A;  4ZI7 A;  1SQB H;  1WJZ A;  5B5E Z;  3H1K H;  3AK1 A;  3WB1 A;  1LUV A;  2UUC B;  3U0Z A;  2ITC C;  1PNL A;  1NS1 A;  3JD0 A;  1GMG A;  1PPJ H;  1OCO B;  2XTA A;  2LW1 A;  4DV3 O;  1FYJ A;  2OCC B;  4QJF B;  3G6E V;  3D36 C;  1NU1 H;  2WA3 A;  5LMN O;  3A2F A;  3IC9 A;  5KHH A;  1WNS A;  2YS8 A;  4J9Y B;  1P49 A;  3RYH A;  3LUT B;  2ZXW B;  4ZOL B;  1E1R G;  1AR5 A;  2DYR C;  3SPG A;  4DUZ B;  1VQK V;  2YI8 A;  2OTL V;  1G1X B;  2W0F C;  3C3S A;  4MVM A;  4IYI A;  4NB5 A;  4WBN B;  3RGB A;  1RPO A;  2VWJ A;  2RQ6 A;  3OMA B;  3ABT A;  3ICX A;  3S3W A;  3CRC A;  4JZ2 A;  3FAV B;  1Q43 A;  1IBK O;  4B3T B;  4DR2 O;  1NVP D;  5EK0 A;  1WA8 A;  2OWO A;  2YXY A;  1EN5 A;  1SA0 B;  2FKX A;  1OCC C;  1GN3 A;  4MTF A;  3QVN A;  4JPR A;  4DV5 B;  2FB5 A;  2VRZ A;  4X89 A;  4JI3 B;  2AXT Z;  4I4T A;  1THZ A;  1NR1 A;  4JI4 B;  1FS0 G;  4X66 O;  4HNA A;  2PZS A;  3STZ C;  3JAM N;  2RCV A;  1K34 A;  2XAF A;  4JI0 O;  5EBL C;  3H9V A;  1H8E G;  5EBM C;  4NXM B;  3FB5 C;  1DF4 A;  2UXD B;  1Z5W A;  4GLX A;  2PY5 A;  4DV7 B;  1SRY A;  2GSM B;  5L3B A;  4GX2 A;  3BAA A;  2F4V O;  4LF6 O;  4DUY B;  5KHJ A;  4BAY A;  1YF2 A;  4I7Z B;  4UFZ A;  4CC5 A;  5JQG B;  4WFH A;  1KUQ A;  1YJ9 V;  2W6I G;  3X2Q B;  3SYQ A;  1LR1 A;  4DR3 O;  4KHP O;  3LDE A;  4MVR A;  2EX3 A;  5GW7 A;  1S5J A;  1L0N H;  2B5U A;  2DMX A;  5IY5 C;  2WAM A;  3D3I A;  1IBK B;  3SPJ A;  2X6C A;  4LFC O;  1N33 B;  3DC5 A;  2A3Q A;  2PYJ A;  4O2A B;  2YC0 A;  3T1Y O;  3ABL B;  3OAA G;  1N36 O;  5F2V O;  1Y76 B;  1Q7Y W;  4MTG A;  3I56 V;  4KL1 A;  3N2K A;  2UUA O;  2ARH A;  4XBF A;  2HJF C;  4DYL A;  3A0H Z;  4DV2 B;  4JI3 O;  4P30 A;  4FM2 A;  2DQ3 A;  1SQF A;  1H38 A;  1YTF B;  3L74 H;  4H13 B;  1XQ8 A;  4K35 A;  4OPH A;  2A7W A;  2BSK A;  2EIK C;  3FYE B;  4OGQ B;  1DK1 A;  4LF8 B;  1VQP V;  4LF5 O;  3J7A U;  4ZI7 B;  2Y69 C;  4GKJ O;  1LUW A;  4NXM O;  4TV8 A;  4OPA A;  4UV8 A;  2BSK B;  2LO1 A;  3CCL V;  2IBZ H;  2CTW A;  3UQ8 A;  4FLY A;  2HEP A;  2PUS A;  3CXH F;  2ZE5 A;  1NH2 D;  4LF4 B;  4PJ0 Z;  2QWN B;  5EIB C;  1YXB A;  2ATK C;  4J10 A;  2Q6A A;  1K97 A;  2Q5Z A;  1MSW D;  1YJW V;  3Q4H B;  3ZHR A;  1AI7 A;  3D36 A;  3K06 A;  3B8M A;  4X1Y B;  3L9D A;  4MVO A;  4CH3 A;  1N34 O;  5LMU B;  1XBL A;  4MS2 A;  3E89 A;  2OIE A;  5JVD B;  3TET A;  1GM9 A;  3N2K B;  3ZRS A;  1GO3 F;  2F1M A;  2B1G A;  4IYH A;  3CYO A;  4O2B B;  3G80 A;  3RW0 A;  4FZ1 A;  4JI1 B;  4TT3 G;  3G67 A;  2O57 A;  4FFB B;  1Q6U A;  2UXN A;  1FFT B;  4IL6 Z;  3QF7 A;  1BL8 A;  2ZD9 A;  3G71 V;  2YDE A;  3P3P A;  3SJC C;  4UCO A;  1Q5O A;  1R3I C;  1BHA A;  3CP1 A;  4CZZ A;  2JK5 C;  1TVK B;  4CS3 A;  3WU2 Z;  4X20 A;  2JVD A;  3TXQ A;  2WLK A;  2EIK B;  1Y76 A;  1HP8 A;  5IWA O;  2XT9 A;  4DO2 A;  4FLW A;  3ETG A;  4PDV A;  4LF4 O;  5IJ9 B;  4CC6 A;  2ZIN A;  3K9A A;  2P4V A;  2CH7 B;  2YID A;  3CPW U;  1SET A;  1ZL8 B;  3C90 A;  1KYO F;  2P7T C;  5LA6 A;  4H44 B;  4ZHQ B;  2VWK A;  1QLN A;  5EBW C;  5KX5 A;  1G8M A;  1Q90 D;  4BW9 A;  2GBO A;  1FJG O;  5CBH A;  1HDJ A;  4PI2 A;  1T5E A;  5L3F A;  4L87 A;  3AG2 B;  1AP5 A;  1KKD A;  4UCU A;  2EIL C;  3K59 A;  4R8C A;  1JR9 A;  1JVM A;  3W7W A;  3NR7 A;  4N23 A;  2Q8V A;  4RQF A;  1WLE A;  4C7U A;  1QLE C;  1Y67 A;  1VF6 A;  2UXX A;  3B2E E;  1S72 V;  1K4D C;  5CA0 A;  4DR2 B;  2A79 B;  2RN9 A;  5IJ0 A;  4B3R O;  5EC1 C;  4IGG A;  5K1P A;  4H33 A;  1QVG U;  3ETQ A;  4GCZ A;  3E8H A;  5LXT A;  3ZRV A;  5BR8 O;  3OR6 C;  4TV9 B;  2JS5 A;  3AG7 A;  1JA8 A;  3E8G A;  2ZNI A;  3T2M A;  1GH6 A;  4J42 A;  4O4J B;  3SYA A;  2Q67 A;  5ITZ A;  4O2B A;  5LHI A;  1OCZ B;  1PV0 A;  4K0K B;  3K79 A;  1CPY A;  1ZUQ A;  4JTD B;  4X9Q A;  3U11 A;  5EYP B;  2DE0 X;  3GVM A;  3CJH B;  2LFR A;  3BRC A;  4WBN A;  3APO A;  2XAG A;  4DV4 O;  1K73 W;  2B1I A;  3JD4 A;  4NKG B;  1N4C A;  1CEZ A;  3DC6 A;  5B1N A;  1VF5 B;  4UCR A;  1HR0 O;  3JAK A;  4JI8 O;  4JGS A;  1D5N A;  1FPO A;  3APQ A;  2KQX A;  2YXH A;  3RYI B;  2Q68 A;  1VQO V;  1JOY A;  1VQ9 V;  1DF5 A;  5B66 Z;  3ZIA G;  1IZ3 A;  1PP9 H;  3W7T A;  4B08 A;  3RYF A;  2A06 H;  3QO8 A;  5IE9 A;  1AI5 A;  3VQX A;  2JGD B;  5TIS Z;  3SR2 C;  3ZBH A;  5LGN A;  4F6R A;  1N36 B;  5J9P C;  1XI1 A;  3OM3 B;  5JJN B;  1WB8 A;  1R1B A;  5JJJ B;  3SYC A;  4I5S A;  2KSD A;  4MVQ A;  4DV2 O;  3CCR V;  3VOU A;  1D5A A;  1YDX A;  4I50 A;  1AP6 A;  1R6K A;  4MT8 A;  3K9S A;  3EHB B;  3SJB C;  1JX9 A;  1URF A;  5LGU A;  1W2B U;  2L35 A;  3A0R A;  1JPX A;  3JAK B;  4EFB A;  4I50 B;  4DK0 A;  1HNX O;  4F6E A;  3HKD B;  1AJN A;  1OCZ C;  4PHZ A;  4KFM A;  4DRX A;  3K5N A;  3ABK C;  2R72 A;  4I9Q A;  3I5D A;  2EIM C;  3IC7 A;  5CB4 B;  3UM7 A;  1P7B A;  2ZKO A;  3E8F A;  4JYB A;  2F66 C;  2XND G;  2IM9 A;  2LFS A;  1YIJ V;  1K7D A;  4RQE A;  2MK3 A;  4JI1 O;  1SES A;  3OUS A;  3ZX6 A;  3CCU V;  3MHS C;  4IHJ A;  5L3D A;  1L0L H;  1N8R W;  4DR1 B;  2DW4 A;  3A8T A;  3TGU H;  5H6Q A;  1AR1 B;  3SPH A;  3K5O A;  1YSC A;  2MW2 B;  3ABM C;  5IYB O;  1GM7 A;  4FPP A;  4RO2 A;  1HW7 A;  2YI9 A;  3ABU A;  2OT5 A;  4H0L B;  5EZY B;  3CCJ V;  5KHK A;  3AG2 C;  2AHY A;  4PI0 A;  1BS3 A;  3U10 A;  3OMI B;  4JI4 O;  3QG5 A;  5EC2 C;  2IJI A;  3DXR B;  4JAS A;  1JJO A;  1O9G A;  1SZT A;  3EXA A;  3ZMT A;  3ML0 A;  5CBG A;  4FLV A;  2WLL B;  4B3M O;  5CN0 A;  3CEI A;  1W59 A;  3E86 A;  2Q69 A;  1XMO B;  4J11 A;  3LDC A;  4D7S A;  1K9M W;  2CAZ C;  4CS2 A;  1M5I A;  3SPC A;  3QO5 A;  3B4S A;  4LF6 B;  2QE7 G;  1OV9 A;  4QPK A;  4DV0 O;  3M8A A;  4I9W A;  1F4M A;  3TXS A;  3ZMS A;  2IU0 A;  5KUM A;  5E1A C;  2HG5 C;  5IWA B;  1KU9 A;  4WFG A;  1GN2 A;  1QBZ A;  4JYA B;  1KBH A;  4TQD A;  3MAQ A;  5FL7 G;  4R50 A;  1VIB A;  2NN4 A;  1RPR A;  2XAH A;  4ZKI A;  1BHB A;  2IJJ A;  5BMV B;  1KKC A;  3JAT A;  4LFC B;  4X1K A;  4LWS B;  1F7Y A;  5C8Y B;  1SQG A;  1YZB A;  1FXK B;  2HFE C;  3E35 A;  3VQW A;  2YXL A;  5IYD O;  1NH2 B;  2AZ0 A;  1V55 B;  3CC2 V;  5CBF A;  4I0X B;  3FKS G;  1E1Q G;  3P30 A;  4RWU A;  1UPG A;  2Z3Y A;  1M9N A;  3Q4H A;  2HVK C;  1MNG A;  1JQ0 A;  3E22 A;  4YHH B;  4DUZ O;  3OTF A;  2OCH A;  5CMU A;  1EM1 A;  3ZHV A;  4YY3 O;  1HNZ O;  2RJZ A;  3JSL A;  4B3S O;  3AG1 B;  3RYH B;  4BIO A;  4JI6 O;  3E22 B;  2PTM A;  1X4T A;  2IJH A;  1RFY A;  4JI5 B;  4MVS A;  3OGI B;  1NBM G;  4IHJ B;  3RBZ A;  4AHC A;  5DM6 V;  4HYO A;  2W6J G;  4DV0 B;  4GKK B;  3IAY A;  2QA4 V;  5KMG A;  1ROP A;  4R7C A;  5ITZ B;  4QGP A;  1WPB A;  3PJS K;  1Q81 W;  4PDL A;  2ZDI A;  4JV5 B;  2Z0A A;  3AEI A;  3B09 A;  3FB6 C;  3SYO A;  3WB0 A;  5AG2 A;  4AI8 A;  2YUA A;  4A5U B;  4DRX B;  2V4D A;  1Y66 A;  4G28 B;  5H9C A;  3BEH A;  3E2E A;  4YJ3 B;  3N2G A;  1R73 A;  2IW5 A;  3G6B A;  4DV1 B;  4DV6 O;  1ARO P;  1N32 O;  2E5L B;  3ASO C;  1SF9 A;  4O2A A;  1BMF G;  5DED A;  2UXD O;  4EKW A;  3AG4 B;  5GTI Z;  5K1X A;  1BGY H;  2HKO A;  2F43 G;  2JEU A;  4IIJ B;  1ENV A;  3AG1 C;  3IGA C;  4KP4 A;  4QE9 A;  2F23 A;  4DUY O;  1KP3 A;  1Z5V A;  4U3J B;  4UVB A;  4U7N A;  5KA5 A;  1W0K G;  3VBB A;  3CME V;  4ICG A;  2JJ1 G;  3B8N A;  4DR3 B;  1WA8 B;  3OE7 G;  4OXS A;  1WB7 A;  3F7Y C;  2RMK B;  4TUY A;  1PL4 A;  1DLB A;  2Q7H A;  5FNV A;  3AG3 B;  3RN4 A;  2BE3 A;  1N33 O;  2WLJ A;  3A0B Z;  4W4L A;  3HKC B;  3UO2 A;  1XL6 A;  1XMQ O;  4TV8 B;  1IBM B;  1R3J C;  5L3C A;  2WA4 A;  2ITD C;  4HNA B;  1G4Y B;  1I5Y A;  1GKF A;  1I08 A;  4FLT A;  2YIB A;  2OIG A;  2R9A A;  4LFB B;  4DR1 O;  4N21 A;  1KQS U;  1M4U A;  4MVZ A;  3FB8 C;  4ASU G;  1VQ7 V;  4X1I A;  4FLX A;  4LF7 B;  1V55 C;  1Q6H A;  1R6N A;  4HZ3 A;  2E75 B;  4RAI A;  1MSD A;  4GYC B;  1COW G;  1NI8 A;  4IIJ A;  1K8A W;  4J41 A;  3FAV A;  4F4L A;  4L8J A;  2ZDI C;  5KMG B;  5DEC A;  5J2T B;  3ZS8 C;  3FYI B;  4YIP A;  4LFA O;  3CCS V;  3OT7 A;  4WCE V;  3ZJZ A;  2QR4 A;  1RSO A;  2HP8 A;  3T1C A;  2CUG A;  3ZMV A;  3CXC U;  4EEQ A;  1IX9 A;  3QTC A;  2YIB D;  3JCU Z;  2UXC B;  2P06 A;  5D5Q A;  3BY6 A;  2K1E A;  2EJR A;  2WLM A;  2Y69 B;  4TUY B;  2QWP B;  5BR8 B;  1SQX H;  3TK1 A;  3OMN B;  1S5L Z;  2Z5U A;  3RYF B;  5LL6 Y;  2ZE6 A;  3CCQ V;  3JAR B;  3O9O A;  2EIJ C;  2CTP A;  4TSF G;  1M57 C;  3ZHQ A;  3W7X A;  3CD6 V;  1UFI A;  1R3L C;  4X1Y A;  2Q7E A;  3AG3 C;  2BTQ B;  4KUM A;  2GV9 A;  4EFE A;  2ADP A;  4G2K A;  4DR4 B;  1SS3 A;  1PNK A;  1F51 A;  1VMG A;  4X62 B;  1R6T A;  3HB3 B;  1Q86 W;  4I55 A;  3JD2 A;  4JAV A;  4LH6 A;  2ILM A;  1XNQ B;  2CDY A;  2W0X A;  5JCO A;  5FNV B;  2VQF O;  5EIB D;  2N74 A;  1S76 D;  1BCC H;  4ZIB A;  3K04 A;  1GN4 A;  1TA8 A;  2JDI G;  3JAL A;  1H2G A;  2DOS A;  2ZQM A;  3SPI A;  1QNM A;  1QQC A;  1EBO A;  3K03 A;  1S3J A;  2F95 B;  3JAS B;  4LC1 A;  5LYJ A;  5BMV A;  2EIJ B;  5KHI A;  1B06 A;  3ZN1 A;  4LH7 A;  1NTM H;  2LGQ A;  2IH1 C;  4D7T A;  3OGC C;  2VQE O;  3QO7 A;  4GT1 A;  1RM1 C;  2XUM A;  4X88 A;  2Y0P A;  1WPX A;  4I4T B;  4UXN A;  4DV7 O;  4KXR A;  1WAZ A;  2QKA A;  1SQV H;  1W0J G;  2UUB B;  1GN6 A;  3ZCC A;  3LDD A;  1QLE B;  3SGI A;  3H01 A;  3L70 H;  2LQT A;  4YHH O;  4TV9 A;  1GAX A;  4B7E A;  1VQ5 V;  3JAW A;  1H2N A;  2G38 A;  1MZF A;  3SDL A;  2Y4U A;  4YJ2 B;  2JS3 A;  1OCC B;  1K5S A;  3FD9 A;  1US6 A;  3M99 B;  2P5O A;  1TUB B;  1OJH A;  1YEW A;  1QVF U;  5H2F Z;  2P4K A;  1AR4 A;  3NXS A;  4MTO A;  1XIL A;  2EUL A;  2E5L O;  1K33 A;  3JAT B;  4JZG A;  4LF9 O;  3UT5 A;  3ETD A;  4P9P A;  2NLJ C;  4X64 B;  3W7S A;  2V7Q G;  1XDC A;  1AVM A;  4UUJ C;  4BWA A;  1I7F A;  3T4D A;  4XDK A;  3KKY A;  2UXB O;  2EZP A;  4PDM A;  2P6J A;  3PN1 A;  4JTC B;  5H6R A;  4LCU C;  2R9I A;  3RVZ A;  5KUK A;  1Z2G A;  2WLH A;  4MW8 A;  1F23 A;  4ZOL A;  5LP6 A;  2YEV B;  1B6Q A;  2CGO A;  3CCV V;  1JFF A;  3LNM B;  1A32 A;  2DWD C;  3ABM B;  3CRR A;  4GX5 A;  1K4C C;  2QM7 A;  1TAE A;  3ASO B;  1PM9 A;  4FIP C;  3SJA C;  4DV4 B;  1R3K C;  3TCU A;  4NTY A;  3FB7 C;  1BQZ A;  5LHH A;  4B3M B;  1MAB G;  3C3T A;  1AI4 A;  2D2C B;  1SZX A;  3STL C;  1WP8 A;  2HJD A;  3DSQ A;  2K9P A;  4Z2W A;  2UU9 O;  5IDJ A;  3W7U A;  3BCC H;  4CS4 A;  2IU3 A;  2QTO A;  4B3T O;  4YJ3 A;  3CX5 F;  3VQV A;  2QM8 A;  3CMA V;  3N27 A;  2JJ2 G;  4NVP A;  2IJK A;  1WN7 A;  1K5Q A;  3H1I H;  3JAR A;  3KZI Z;  3EFF K;  4FK5 C;  1NZ6 A;  1IBM O;  3EVK A;  4JI8 B;  5B1A B;  4K8X A;  3F7V C;  5DN6 G;  3J81 N;  1IUR A;  4FLU A;  2ZIO A;  5FPO A;  3UO3 A;  2WLI B;  5B1B C;  3M7M X;  5GON B;  5JCO C;  5KLV H;  1QU7 A;  4FM0 A;  4MSW C;  4P2Z A;  4B7K A;  2UXC O;  4ZBM A;  3K5M A;  3RFR A;  2KG7 B;  5CA1 B;  1FXK A;  2ZE8 A;  1YCI A;  3K3W A;  1BSM A;  4WFA V;  1YIT V;  3H1L H;  1BZK A;  4WFB V;  5B1B B;  5A9G A;  2F4V B;  3GWK C;  4JTA B;  5LGT A;  2EIL B;  4LFA B;  3T1H O;  3CRM A;  3IJ4 A;  5B1A C;  1HNZ B;  3J80 N;  4DXW A;  2XOK G;  1KEC A;  2BCC H;  2HHH B;  2BOC C;  1FFX B;  5L3G A;  3AK2 A;  4NXN B;  4DR4 O;  3GWO A;  4OX9 B;  5LP6 C;  4DR7 O;  4UB8 Z;  4X62 O;  1IDS A;  2WLL A;  1Q82 W;  1P7G A;  5JJE B;  1HNX B;  2ETN A;  2ZNJ A;  1S0V A;  2WLI A;  1XUQ A;  4X1I B;  4QE7 A;  2RNB A;  3ZRX A;  1MMM A;  3RT3 C;  2CH7 A;  3KCX A;  3CRQ A;  1NTZ H;  4EB6 B;  5J2T A;  1XRE A;  3CC7 V;  1GTO A;  4E2L A;  5KAI Z;  3AK3 A;  4GX0 A;  3B77 A;  1YHQ V;  1NVP B;  1JMK C;  2GUZ B;  3B40 A;  1SA0 A;  2E76 B;  3R65 A;  2EBO A;  3K57 A;  4FFK A;  3DXR A;  1VQN V;  1FXH A;  3HKD A;  3WFV A;  2Q73 A;  5BY1 A;  4TQF A;  3BAB A;  2Q7G A;  1KP2 A;  1CP9 A;  4QNH B;  4JYA O;  3L75 H;  4PA3 A;  1XOU A;  2DYR B;  3BVO A;  2PI4 A;  3SJQ C;  1FD9 A;  3P3N A;  2HHH O;  1EZJ A;  4J7K A;  1M90 W;  2C2A A;  1K92 A;  1Q6I A;  5H5N A;  2A0L A;  3BPZ A;  5KX5 B;  3P32 A;  4FLZ A;  2UUB O;  1ZTE A;  4FMT A;  3ZRW B;  2QKS A;  4UVC A;  4U7O A;  2M7W A;  5KA6 A;  2JRI A;  3OR7 C;  2GHY A;  5KAF Z;  2H94 A;  3THO A;  2X6A A;  1EN4 A;  4PA4 A;  1HWY A;  2QWQ B;  5J2U B;  4PD4 F;  1K3E A;  2GUZ A;  1AJP A;  3JAL B;  1KD1 W;  3TJT A;  1PNM A;  4LFB O;  5KHG A;  1KB9 F;  4X66 B;  2P90 A;  2ZIM A;  3ABK B;  3DTU B;  4YY3 B;  1HNW O;  2QJ1 A;  3FX7 A;  1N0J A;  4JI0 B;  1Y74 A;  3KCY A;  4X65 B;  2JEX A;  4AQY B;  4JI6 B;  4JYC A;  1UJW B;  4BW5 A;  2ZR2 A;  4JI5 O;  2IH3 C;  1ORQ C;  3JCZ A;  1KC8 W;  2F93 B;  2BTQ A;  1VAR A;  2EJ7 A;  5GTH Z;  3CWB H;  3BHP A;  5LBQ A;  1IXM A;  3WG7 C;  3FFQ A;  4F6R B;  4I55 B;  4EB6 A;  2JGD A;  4JV5 O;  1MG1 A;  1I94 O;  5L3E A;  2WSS G;  4B3S B;  4JI7 B;  4CH4 A;  4U3J A;  4JAA A;  3UCS C;  4NR1 A;  1I5X A;  4O4H A;  4TWK A;  2LGW A;  3CJH A;  1D2D A;  1MOF A;  1FXV A;  3X2Q C;  2Y4T A;  1JCH A;  1F4N A;  5D5P A;  1XNQ O;  3QNE A;  1U97 A;  3ETE A;  3RYI A;  2KB1 A;  4UV9 A;  3WB2 A;  5IJ0 B;  1VP7 A;  4MTX A;  1OCR C;  5B3S B;  1M1K W;  2PYL A;  4KHP B;  2QTS A;  5GON A;  1Y4M A;  4DR5 B;  3ZED A;  2UUC O;  1M93 A;  4O4I B;  2H8P C;  1Y6X A;  4CBC A;  1AIL A;  1B3Q A;  2Q9L A;  4DV3 B;  1JJ2 U;  1XNR B;  3L73 H;  4X65 O;  4Z1V A;  5IYZ B;  2VQE B;  4P9O A;  3OUF A;  5LP6 B;  4JI2 O;  1BT8 A;  3JD3 A;  2XAQ A;  3D8C A;  4UCT A;  4BIU A;  1V54 C;  4YJ2 A;  2OCC C;  5LOV A;  1CXZ B;  5J2U A;  5CA3 A;  3WG7 B;  4WFF A;  3OD4 A;  2QDO A;  2E3C A;  4NYK A;  1H2K A;  4FZ0 A;  4DR6 B;  1I94 B;  4OX9 O;  2ZXW C;  3OEE G;  3S3X A;  3ZHT A;  4LR3 A;  3IFX A;  1SKV A;  5EZY A;  2E74 B;  3ABL C;  4HAM A;  3OW2 U;  2ZM6 O;  3HKB A;  4R6Z A;  2QEX V;  2KKW A;  1S5H C;  1BQ0 A;  1J5E O;  3CB2 A;  3ZN0 A;  5CB4 A;  1YVW A;  2ZT9 B;  4J9Z B;  2YEV A;  1YTF D;  3G4S V;  2JGU A;  3UKM A;  3CCE V;  1FKA O;  4WF9 V;  3ZRW A;  4RUE A;  1Q8I A;  1MA1 A;  1ZL8 A;  4BR6 A;  1N34 B;  3AG4 C;  1SQP H;  2Q4P A;  2HR3 A;  2LW7 A;  4LF9 B;  4FFB A;  4U3F H;  4MVU A;  2DWE C;  5IY5 B;  4LF7 O;  5A2Q N;  4ZHQ A;  2GTA A;  1AB3 A;  2PI5 A;  3MDS A;  3HKC A;  4PV1 B;  1PKX A;  2FTK A;  1XHZ A;  3E83 A;  4BIZ A;  4JYY A;  4O4L B;  4JI2 B;  4J80 A;  2VS0 A;  2LP7 A;  3K5L A;  1GRJ A;  2N05 A;  4GZR B;  3OTO O;  3JAS A;  5LYJ B;  1V54 B;  1PD3 A;  3HKE A;  1ZSP A;  4QIW F;  2XHB A;  1LNQ A;  3ZHS A;  3K0D A;  1OHH G;  1ZWI C;  1B04 A;  4UCS A;  1FFX A;  4XDL A;  2QM4 A;  3K58 A;  2ZM6 B;  2R9R B;  2FYU H;  4GKK O;  3CHX A;  1FJG B;  4X8A A;  1E79 G;  4LNU B;  1I0H A;  1OCR B;  5B3S C;  5HFM A;  2P22 C;  2V1D A;  1NKD A;  3BA9 A;  4Z1M G;  4AIL C;  4UVA A;  4O4H B;  3VQY A;  5LHG A;  4JF3 A;  1SER A;  1IXB A;  1NR7 A;  2ZR3 A;  3ASN C;  5CA1 A;  4YXW G;  2Y0I A;  1BE3 H;  1AJQ A;  1MZE A;  1QCE A;  3OEH G;  5E79 Z;  2HLD G;  1XHX A;  4LP8 A;  4DV1 O;  1V9P A;  5IT9 N;  1DTO A;  1TGO A;  3BFR A;  4LBE C;  1SC5 B;  4X1K B;  3JYC A;  1EFR G;  2Q0A A;  4X20 B;  3T1Y B;  2CK3 G;  2ZE7 A;  1QR8 A;  1FAF A;  3LSU A;  3HKE B;  1QHT A;  2M6Y A;  4I0X A;  2WLN A;  2JIZ G;  2YSU B;  3GB7 C;  1M56 C;  4H37 A;  4JAU A;  2R70 A;  2OTJ V;  2Q0O C;  4E4E A;  3H1J H;  4XDJ A;  5LA6 B;  2DYS B;  1HNW B;  4O4J A;  1X59 A;  1VF7 A;  3ZMZ A;  1WP7 A;  2N04 A;  3DGE A;  1IVS A;  2DJV A;  4CH6 A;  2XAJ A;  2EZO A;  3JSN A;  2QGN A;  4DR7 B;  2AW9 A;  3HR0 A;  2QWO B;  2ADQ B;  1RM1 B;  2YIC A;  4DW0 A;  4NTW A;  1OCO C;  1XMQ B;  1VQL V;  3CS5 A;  2QWR B;  4UCV A;  5JQG A;  1EN6 A;  2NNU A;  3E8B A;  4HBN A;  4X64 O;  3L71 H;  3HPL C;  4LWS A;  1VQ6 V;  1Q3E A;  1TUB A;  2LJ2 A;  4DV5 O;  2PF4 E;  4K3A A;  1PL0 A;  3K0G A;  2X7R B;  2GDS A;  2QKC A;  4MW3 A;  4PDR A;  3MD0 A;  5LXT B;  2AGA A;  1GM8 A;  1O9H A;  1NQT A;  1N0N A;  2CE4 A;  3D3Q A;  2L6L A;  1XNR O;  4WFE A;  3CCM V;  1VQ4 V;  1XL4 A;  4J7J A;  1P84 F;  2EIN B;  1GK9 A;  2UXB B;  1M57 B;  4LNU A;  2B9Z A;  1NT2 B;  5JH7 B;  2DYS C;  5IJ9 A;  1JFF B;  2AHZ A;  1ZLZ A;  2DN9 A;  5JWP A;  5C93 A;  4TOI A;  3H1H H;  3CRA A;  5BZB A;  4DK1 A;  4DR6 O;  4O4L A;  1S77 D;  1NTK H;  2CTQ A;  3ZHU A;  3HKB B;  4FM1 A;  1SQQ H;  1G6U A;  1YJN V;  5IYC O;  3KG2 A;  3N2G B;  2ZCE A;  3CC4 V;  1L8D A;  2AZ2 A;  3RVY A;  3O65 A;  1FXK C;  2RDC A;  1IBL B;  3UT5 B;  1KMI Z;  5BXZ A;  2QSA A;  5FLX N;  1Y74 B;  2CGN A;  4PA9 A;  4FJC C;  3L72 H;  2X0L A;  4Q6G A;  1VQ8 V;  1H2S B;  4ABM A;  2EIM B;  2Y48 A;  1TVK A;  4NTX A;  2UU9 B;  5CA0 B;  4PA7 A;  2NR5 A;  3RWR D;  1H2L A;  3LNN A;  1NJI W;  2X6B A;  1J95 A;  4G27 B;  5JVD A;  4PEL A;  3JAW B;  3LSS A;  4DV6 B;  1N32 B;  2VQF B;  1J5E B;  5JH7 A;  3R66 A;  4YIO A;  2HVJ C;  4O4I A;  4GKJ B;  2A9H A;  2H3O A;  2BTO A;  2BOB C;  5FPR A;  2DQ0 A;  3RYC A;  2FL4 A;  1M56 B;  3ASN B;  4Q20 A;  2UUA B;  3CSX A;  2ODM A;  3T1H B;  3I55 V;  4K8Z A;  4D6T H;  2KG7 A;  3CE2 A;  5LOV B;  4B3R B;  1RSO B;  3T4Z A;  4IT5 A; 
#chains in the Genus database with same CATH homology
 4B3T O;  4AQY O;  4LFC O;  2UXD O;  4YHH O;  1G1X B;  2ZM6 O;  1HNX O;  4LF8 O;  3T1Y O;  3SDL A;  1IBM O;  1N36 O;  4DV1 O;  5IT9 N;  1J5E O;  4DUY O;  1F7Y A;  4JV5 O;  1I94 O;  2ZKO A;  1YZB A;  3J81 N;  2UUA O;  1IBK O;  5LL6 Y;  4DR2 O;  1FKA O;  4JI3 O;  5BY1 A;  2E5L O;  4JI1 O;  4DR6 O;  3F5T A;  1IBL O;  4K0K O;  4LF9 O;  2UXC O;  5IWA O;  4JI7 O;  2FKX A;  1D2D A;  4DV4 O;  4OPH A;  1XMO O;  4JYA O;  4LF4 O;  1DK1 A;  4NXN O;  4LF5 O;  3J7A U;  1XNQ O;  1HR0 O;  2LW7 A;  4JI8 O;  1N33 O;  4GKJ O;  1XEQ A;  2UXB O;  4DUZ O;  4LF7 O;  4NXM O;  5A2Q N;  1R6T A;  2HHH O;  3O65 A;  4OPA A;  4YY3 O;  1XMQ O;  1HNZ O;  1X59 A;  4DR5 O;  4B3S O;  5H5N A;  1AB3 A;  4X66 O;  5LMU O;  5BXZ A;  3JAM N;  5FLX N;  4JI6 O;  2DJV A;  3T1H O;  2UUB O;  2VQF O;  2N74 A;  1FJG O;  4JI0 O;  3J80 N;  4JI4 O;  2UUC O;  2DOS A;  3OTO O;  2JRI A;  1A32 A;  1AIL A;  4DR1 O;  4DR4 O;  4X65 O;  4DR7 O;  4B3M O;  2F4V O;  4LF6 O;  4X62 O;  1NS1 A;  4X64 O;  4JI2 O;  1R1B A;  1N34 O;  3R66 A;  2Z0A A;  4DV3 O;  4LFB O;  1FYJ A;  4DV5 O;  2VQE O;  4DV2 O;  4A5U B;  5LMN O;  1HNW O;  4DV0 O;  1KUQ A;  4B3R O;  4GKK O;  4DV7 O;  3M8A A;  1XNR O;  3RT3 C;  2UU9 O;  4DR3 O;  4LFA O;  4KHP O;  4DV6 O;  4JI5 O;  1N32 O;  2AGA A;  5BR8 O;  4OX9 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...