4JI6O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 34
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji6O00
2ZM6O 2UUCO 4YY3O 1N32O 1DK1A 1I94O 4DV2O 4JI6O 2HHHO 4LFBO 5FLXN 2UUBO 4OX9O 4DR3O 4DUYO 3J80N 4X65O 1HNXO 4DV7O 3RT3C 4LF7O 3F5TA 2UXDO 4LF9O 2LW7A 4JYAO 2JRIA 4DR1O 4JI2O 2VQEO 1XMQO 1HR0O 3J7AU 5LMUO 4DV5O 4LF5O 3M8AA 3JAMN 1FJGO 4DV1O 4DR6O 5BY1A 2N74A 1XNQO 4GKJO 1XMOO 2VQFO 1X59A 5LMNO 4B3RO 2AGAA 4JI7O 5BXZA 5IWAO 4OPHA 4X64O 4DV3O 1A32A 4OPAA 4YHHO 4DV4O 2UU9O 4LF6O 1FYJA 1F7YA 4DV6O 4NXNO 2F4VO 4LFCO 4DR2O 1N36O 4LFAO 4DR5O 1G1XB 2DJVA 3R66A 4LF8O 4JI3O 4B3TO 4JI8O 1KUQA 1IBLO 1R1BA 4K0KO 1AB3A 1N33O 1J5EO 1XEQA 1YZBA 4A5UB 5H5NA 2UXBO 4DUZO 4B3SO 1FKAO 3SDLA 1AILA 2DOSA 4LF4O 5BR8O 3T1YO 3J81N 2E5LO 1IBKO 4X62O 5IT9N 2Z0AA 4JV5O 1HNZO 1HNWO 5LL6Y 4B3MO 4DR4O 1NS1A 4KHPO 4DR7O 4AQYO 1XNRO 2UXCO 1N34O 3OTOO 3T1HO 4JI0O 5A2QN 1R6TA 3O65A 4JI4O 4NXMO 2UUAO 4JI5O 4X66O 4DV0O 4GKKO 2ZKOA 2FKXA 4JI1O 1D2DA 1IBMO
chains in the Genus database with same CATH superfamily
2FMLA 1L8DA 5JCOC 4JI6O 4WFFA 5KHIA 1MA1A 3OEEG 3JAKB 2UUBO 4OX9O 1D5NA 2NLJC 1YIJV 2D2CB 3CEIA 5E1AC 2KQXA 5LHHA 4JYAO 3F7VC 1EFRG 4FMTA 4DR6B 3OR6C 3T1CA 4JYBA 2JJ2G 4MVMA 4J10A 5KA5A 2XOKG 4BW5A 5IJ0B 2P67A 3SYQA 5GONB 3L75H 5KMGA 5J2TB 3ETQA 1XNQO 4DRXB 2P90A 2AGAA 4ZOLB 5BXZA 3JAKA 5JVDB 1BHBA 1F4MA 4CS4A 3O9OA 3CXHF 2V7QG 2HKOA 2DYRC 2Q0OC 2XT9A 5JQGA 4J9ZB 5IJ9A 4HNAB 2OTLV 1WPXA 4X64B 2BOCC 4Z1VA 4E4EA 4PDLA 4XDJA 2DWEC 4C7UA 3BABA 2IU3A 5DECA 4WFEA 2P7TC 5K1XA 3K08A 5IY5C 3LSSA 1VF7A 3EHBB 3FAVA 3K9AA 4JYCA 4XDKA 4IHJA 3L9DA 4U3FH 4UVBA 4JASA 4MVRA 2N04A 1MSDA 4X1IB 3I5DA 4LFCB 1OV9A 4O2BB 3RVZA 4FVMA 5LBQA 1TUBB 2IW5A 3FYEB 2YIBA 1N8RW 4X62B 5BMVA 4AQYO 1THZA 1COWG 1HNZB 3CCJV 4U7OA 2QWRB 4J7KA 2A7WA 2IBZH 3RFRA 2FKXA 4JI1O 3G6BA 2XUMA 1N32O 4KFMA 1B3QA 1H38A 4R6ZA 4LC1A 5IJ9B 2KG7B 3CMAV 1SQQH 4RQEA 2YXLA 5L3GA 2Q7GA 4DV7O 2GV9A 3F5TA 4PA6A 4P30A 4B7KA 4FZ0A 1HR0O 5CBFA 2GUZA 2YSUB 4J80A 4UVCA 1I0HA 1KD1W 3OMNB 3B40A 1GMGA 1CP9A 1FJGO 4PDMA 4X66B 4RAIA 5A9GA 5JJJB 4X20B 5LMNO 1BQZA 1OCOC 2XHBA 4YHHO 1W2BU 2KSDA 4IIJB 1G4YB 1NBMG 3LSUA 3ABMC 2F43G 4AHCA 4ICGA 1TVKA 3ZMVA 3IC7A 1AR4A 4B3SB 5KA6A 2QM7A 2DYSC 2EULA 5JWPA 4DV2B 4GZRB 3RGBA 4DO2A 4DV5B 3K5LA 5CBGA 1G8MA 4MTFA 3ASNB 4JPRA 3SJAC 2EBOA 2Y0IA 3ZRVA 2P5OA 2WAMA 1NVPB 1BZKA 3AK2A 4F4LA 4KHPO 3W7TA 1HR0B 4ABMA 4MVUA 3ZJZA 1KC8W 3AG2C 1M90W 4LF9B 1H2GA 3X2QC 4X66O 3BFRA 2PY5A 1OCCB 4DV7B 3E35A 2UUCO 2JK5C 3ZS8C 1QCEA 4MTXA 1Q90D 2R72A 1Q8IA 4PD4F 3AK1A 3J80N 1T5EA 4TOIA 5EC1C 1WAZA 1LUVA 2EILC 1M4UA 4DV1B 3RYFA 1SQBH 3J7AU 4OX9B 5LHIA 4N21A 5LGTA 3JAMN 3ZHUA 1GM8A 3TXQA 2ZT9B 2Q67A 4ZKIA 5FNVB 1X59A 3WB0A 1BSMA 2P6JA 2WLMA 1KP3A 3CD6V 4DV3O 4DR3B 2B1GA 2AZ0A 2G38A 3AG3C 2Q7EA 3DXRA 5IYZB 4QE7A 1BHAA 2RDCA 1JOYA 4DK1A 5CB4B 5CA0A 5CMUA 1AROP 3SPIA 4F6RB 4PA7A 4AI8A 1XL6A 2PZSA 4O4LB 2X6CA 3ZHSA 1BL8A 1GTOA 1Z5WA 2Y4TA 3F7YC 3AG1B 1FXKB 2AZ2A 1KB9F 2RCVA 5KHGA 1XNQB 1IXMA 1YHQV 2BTQA 2DYRB 4TUYB 3I55V 4B3MO 4CC6A 3M7MX 1Z2GA 1TUBA 2QTOA 3ZHQA 5E79Z 4JI0O 5A2QN 2HFEC 4I0XB 4CS2A 1ZTEA 3ZHTA 4JYAB 3BVOA 1M93A 1ZAUA 4LFBB 1WNSA 3B4SA 2ZM6O 3QTCA 5IYDO 1K3EA 3JD0A 3B09A 4UCRA 1MSWD 4TWKA 3CRCA 2UXDO 4TV8A 1SESA 5LOVA 3N2KA 2LQTA 2XTAA 2IH1C 1JMKC 4LF8B 4JI2O 1QHTA 4DR2B 1TGOA 2AXTZ 1XMQO 1AVMA 4W4KA 4GX5A 5J2UA 4PI2A 1DTOA 3BEHA 1OCCC 3SR2C 3C3SA 1FFXB 2E74B 1ZL8B 3QVNA 3OD4A 1Q6UA 2HG5C 4TSFG 5GONA 1XMQB 5ITZA 5EZYA 3WB2A 3JSNA 3R66A 1BCCH 2BTOA 4GCZA 4JI3O 3JCUZ 1IBLO 1NR1A 3OW2U 4O4HB 4DW1A 2YUAA 3OEHG 5EBLC 4DR1B 2VS0A 3HKDA 1Y66A 2YIDA 2M6YA 3ZHRA 1EZJA 3JARA 1DGSA 3LUTB 4JI2B 5C8YA 3E22B 1AI4A 2OYQA 1OCZC 4PV1B 4DW0A 3FFQA 4ZIBA 5F2VO 1ORQC 3VQWA 3G67A 2HVJC 1XNRO 3ABKC 3UO3A 4FLTA 4J9YB 3O65A 3PN1A 3K0DA 3ABLC 1YXBA 4O2AA 3L70H 4WFGA 4O2BA 4DV2O 5DM6V 4KHPB 4FFBB 1TUEB 1W0KG 1ZUQA 4O4JA 2R9AA 2LGWA 3OMIB 3K3WA 1R6NA 2W6JG 2JRIA 2R9IA 1GM9A 3OTFA 2DQ0A 3RYFB 5L3EA 1MOFA 5IYZA 4LF5B 1VIBA 2VRZA 4GX1A 5IDJA 4QGPA 3L72H 3STLC 1NU1H 1K5SA 1YEWA 2CK3G 5IWAO 1R73A 4NXNB 1QVGU 4OPHA 1JCHA 1Q6HA 4K0KB 5JVDA 2ITDC 1K5QA 3ZHVA 3CHXA 2ZCEA 1ZLZA 1N36O 3BHPA 2EINC 3E22A 3BY6A 3B2EE 2QR4A 4X65B 1P84F 2JS3A 4CBCA 4B3TO 4J7ZA 4I5SA 4NKGB 1FS0G 2CGOA 4A5UB 4F6EA 2NR5A 2HLDG 1B04A 1IZ3A 1N0JA 2ZE8A 3P32A 1PL0A 3LDEA 3PJSK 3DTUB 2LW1A 5BR8O 1IBKO 1SQVH 5D5QA 5IT9N 1M57B 1WLEA 2WLIB 1DF5A 1BQ0A 4DRXA 1W59A 1YF2A 3S3XA 2ADPA 1LUWA 3ETDA 1WB8A 2UUAB 4PA4A 1HNWB 2RN9A 4NXMO 2EIMC 4B7EA 4JI5O 4GLXA 3LDDA 2ZKOA 3ZMTA 3H1JH 4YIPA 1IBMO 2OTJV 1Q5OA 1P49A 1V54B 1O9HA 1YVWA 4JZ2A 1VQ4V 4MW8A 2L35A 5KUMA 1AP5A 1HNXO 1V9PA 3P30A 3FX7A 5EBWC 1L1FA 3T4ZA 4W4LA 4DR7B 3LNMB 1XHZA 4X1IA 3GWOA 2H8PC 2GTSA 3OGCC 1DF4A 4FLYA 1Q43A 4JI0B 1N0NA 4X64O 4EFEA 3RYCA 1FXKC 2F23A 3FB8C 4X1YB 1RM1B 4NR1A 3L73H 1HNXB 2X0LA 2UU9O 3CCUV 3EXAA 1FYJA 2QDOA 2EIKC 4L8JA 1EN4A 4JTAB 2Y69C 2EILB 5LXTA 1VQLV 1Q86W 4PJ0Z 5LP6B 2UXXA 1SC5B 2KG7A 2ZE7A 4BIOA 4JI8O 1SETA 2QA4V 3E8BA 5B1AC 1M1KW 4J41A 1XEQA 1HWYA 2P06A 5KHJA 3VQVA 4U7NA 1NR7A 2QGNA 2OCCC 3CYOA 4FLWA 2WPDG 3STZC 5LL6Y 4OGQB 4GX2A 3A0HZ 4AQYB 2GBOA 2VWKA 4KUMA 4PA9A 1CPYA 3ZEDA 5LA6B 4MVQA 5K1PA 4I0XA 2E5LB 2X7RB 4B08A 4FLXA 3SJQC 2PI5A 3EVKA 2OIEA 2ZXWB 2ZIOA 2JS5A 3ZRXA 4QJFB 1PKXA 2BTQB 1R3JC 3ZX6A 3K04A 3RYHA 4ZOLA 2W0XA 1QR8A 4G2KA 4DR3O 3QNEA 4DUYO 1QLEC 3TJTA 4NXMB 4U3JB 4I9QA 1QLNA 4YJ3A 1ZL8A 5LP6A 1SS3A 5CBHA 1OCRC 4BWAA 2QWOB 1GN2A 4ZI7B 4ASUG 2QM8A 2W0FC 4IYIA 3SYPA 2ZR2A 1VQMV 4FZ1A 3F5WC 4WFHA 3IJ4A 1OCRB 1YCIA 2N74A 5B66Z 5C93A 4LF4B 2DMXA 1SKVA 2CH7B 3H01A 2IU0A 4H13B 3SYAA 1NVPD 2JGDB 3OGIB 2HR3A 3GVMA 4NXNO 4JAAA 5FNVA 3ZIAG 4JI8B 1S5LZ 3SJCC 4PA3A 3ZN1A 4LF7B 1Y76A 1KECA 3APQA 1FAFA 3AG4C 4K0KO 1Y74A 3DSQA 4FIPC 1YZBA 2RMKB 1AJQA 5H5NA 2UXBO 4J7JA 5LA6A 1N33B 4DUZO 3OFNG 4MSWC 1ZWIC 2GUZB 1SQPH 4LNUA 1K4CC 4JI7B 1IBLB 2Y0PA 1RSOB 1VF5B 3T1YO 4LBEC 3U0ZA 1FXVA 1SA0B 4HBNA 2V1DA 4I4TB 2P4VA 2QKSA 1XBLA 2LJ2A 1GAXA 3KKYA 4YXWG 4JI6B 4F6RA 1WJZA 2XNDG 3C3TA 1VF6C 5LP6C 2A3QA 4IIJA 2MK3A 1S5HC 4UV9A 4FFBA 1KKCA 1LR1A 3N2GB 2JGDA 5CA1B 1BGYH 5KMGB 4O2AB 2ZDIA 3ZN0A 4JGSA 1RM1C 1YJNV 3MAQA 1VQPV 1H2KA 4D6TH 3U10A 2VQFB 3H1HH 4MVZA 4DR1O 3Q4HB 4HAMA 4WCEV 2JJ1G 3AEIA 3ZRWA 4O4IB 3JAWB 5LMUO 2YXYA 4KXRA 2WLHA 3BA8A 5LMUB 3QF7A 1KKDA 3ETGA 4LF6B 2DYSB 3QO8A 4UCOA 1RPOA 4DR5B 5B1NA 4B3RO 4Z1MG 3MD0A 2Z3YA 3SPGA 3JASA 3FB7C 2IJHA 2JIZG 4NVPA 1S77D 1F7YA 4B3MB 4X8AA 3RYCB 3ZMSA 3K9SA 1N36B 2YEVB 1VQ5V 1R3LC 3CJHA 2KB1A 4B3SO 5JCOA 3T1YB 1FKAO 1XILA 3AK3A 3S3WA 1K97A 3BA9A 2Q69A 5EBMC 3RBZA 2QM4A 5KHKA 1AI6A 2Q6AA 3OTOB 1NH2B 5J2UB 4LFAB 2XAQA 1ZX3A 4TQFA 5KAIZ 2KKWA 5FPOA 1JFFA 2HJFC 4UCVA 1N34O 1SERA 1AP6A 1SQFA 4NYKA 4PDVA 4CZZA 3A8TA 1P4RA 5L3BA 5JH7B 4IYHA 2ZNJA 3ASOB 1PV0A 2YI8A 4DYLA 1Q81W 3LSQA 3FB6C 5HFLA 2OT5A 1X4TA 2BCCH 1IBMB 1NJIW 4KP4A 5EK0A 3K58A 2PGGA 2FYUH 1G6UA 1V55B 1LNQA 1RP3B 2E76B 4I50B 5H9CA 3CCRV 3E2EA 3ICXA 1JJ2U 3CXCU 2GHYA 2IJKA 5GTHZ 5IYCO 4R7CA 1B6QA 2P22C 2WLLA 2VQFO 5B1BC 5B1OA 3JYCA 4JTCB 3UCSC 1QNMA 4DV4O 3TK1A 4LFCO 1HW7A 4X9QA 2QTSA 4OXSA 3DC5A 2IM9A 3R65A 4TV9A 1H8HG 5LYJA 1MABG 1WA8B 3RWRD 3CC7V 3AG1C 2YI9A 3VOUA 3TXSA 2Y4UA 5DN6G 3RYIA 4JTDB 2ZQMA 3U11A 4MVSA 1AJNA 1KP2A 2E75B 4CC5A 2B1IA 4JYYA 3K5NA 3J81N 3EFFK 1XMOB 1NTZH 3ZRSA 1AI7A 3KZIZ 3OE7G 4H0LB 5EIBD 1N34B 4TV8B 4CH3A 1TAEA 1YJ9V 2EJRA 3ZBHA 1KYOF 4DK0A 4QPJA 1R6KA 1NI8A 4PDRA 4P9PA 1PL4A 1I7FA 2QWQB 2UXDB 1M56C 2R70A 1DK1A 1I94O 2EX3A 1EBOA 1S0VA 3A2FA 1WB7A 4GT1A 1I94B 3K0GA 4BAYA 3HKDB 3AG4B 4RUEA 3ZMZA 2LW7A 1M9NA 3N2GA 2LGQA 3CE2A 4B3RB 1UPGA 3GB7C 2QWNB 3HKBB 3BAAA 1H2LA 3ZRWB 5J2TA 1WP8A 3M8AA 2CTPA 5LGUA 1NZ6A 4FFKA 1SRYA 1RPRA 4JAUA 2LO1A 3WB1A 4UB8Z 1ROPA 2Q4PA 3APOA 1XMOO 2YDEA 1CXZB 4CH5A 3IAYA 1TA8A 4O4IA 1FXHA 2YS8A 3X2QB 2Y69B 2L6LA 1JJOA 2N05A 2Z5UA 4GYCB 2CTRA 3JD3A 1Y4MA 4YHHB 1J95A 5IJ0A 2HVKC 5GW7A 4MT8A 1IXBA 4UFZA 1SA0A 4I7ZB 3OM3B 1R1BA 2HJDA 2PI4A 2GTAA 4GX0A 1KMIZ 1QU7A 3JALA 4DV3B 2ZIMA 5B1BB 2Q9LA 2DWDC 3QO5A 1VP7A 3SDLA 3H1LH 4CH4A 4FJCC 4RQFA 1GM7A 1IVSA 2XAFA 2HEPA 5LXTB 3HKBA 3SYCA 5KX5A 4JI1B 2Q5ZA 3ABTA 2ZNIA 4JAVA 2OCCB 1PPJH 1S72V 3N2KB 1JFFB 3A0RA 4JI4O 5CA3A 3CPWU 2EIMB 1BT8A 5B5EZ 4AILC 4D7TA 5JJNB 3T1HB 3HPLC 3JALB 4QNHB 1K8AW 4I4TA 4D7SA 1U97A 1SZTA 5B1AB 4R8CA 4K35A 1ENVA 2ODMA 1MZEA 5LOVB 5EC2C 1XL4A 1YITV 2F93B 3D8CA 4HYOA 4X65O 3RT3C 3E8GA 1GN6A 1GH6A 4PELA 4RO2A 3I56V 3B8NA 3B77A 4N23A 1NH2D 3SPCA 1US6A 2ZE5A 3W7SA 3CSXA 4WBNB 3HR0A 3RN4A 1A32A 2YEVA 2HHHB 3JD2A 2OCHA 1I5XA 2ADQB 1OZ0A 1WA8A 4O4LA 3JAWA 1XQ8A 3OUFA 4X1KA 4YIOA 1NQTA 1EZVH 3G80A 1MZFA 5DEDA 1F4NA 1GK9A 4NTWA 3BPZA 3HB3B 3K03A 1KUQA 1GKFA 1JQ0A 4FK5C 4BIUA 3CJHB 4ZBMA 1PM9A 2ATKC 3SPHA 1H2SB 1K34A 1VF6A 5CN0A 3G4SV 4XDLA 2HP8A 2QWPB 3CCVV 4XBFA 3HKEA 1VQ9V 1SQXH 1RSOA 4Z2WA 1BE3H 2WA3A 1HNWO 3LNNA 1R3KC 1OHHG 5BR8B 3E8HA 4MTGA 3JD4A 4X1YA 3UO2A 4GKJB 4LWSB 3CRQA 1XDCA 4DV6B 4LR3A 4FLVA 2Y48A 1YSCA 1V54C 2R9RB 4WBNA 2F66C 4WFBV 1VEWA 4LF9O 4BW9A 1EN6A 2ZD9A 2JGUA 2PYJA 4YJ2A 2BOBC 3THOA 3BCCH 4DV5O 2GDSA 5EYPA 2LP7A 3HKEB 2BSKB 1WN7A 5BY1A 3ZMUA 4PHZA 2XAJA 1H8EG 3SGIA 3CCEV 3H9VA 4JI7O 4QE9A 3TCUA 1Y67A 2JEUA 2GSMB 2ZXWC 2AHYA 4GUNA 2NN4A 4P9OA 4UB6Z 1VQNV 1MNGA 1EN5A 3E89A 4LCUC 4DR2O 4YJ2B 1KQSU 4CH6A 4YJ3B 3P3PA 3G6EV 1O9GA 1XNRB 4UV8A 3JD1A 1E1RG 2V4DA 2UU9B 2WLIA 1N33O 2DW4A 2ZM6B 5BMVB 1JX9A 1NTMH 2M7WA 4LWSA 2DE0X 3ABKB 4JI5B 5EIBC 2Q8VA 3NR7A 2ILMA 1QVFU 4E2LA 4UCSA 1FPOA 1NS1A 4I55B 5AG2A 4JI3B 3WG7C 3T1HO 3P3NA 2A9HA 4R50A 1R3IC 3CC2V 3A0BZ 4GKKO 4P2ZA 3CB2A 4FM0A 3T4DA 3IC9A 4MVOA 5L3CA 1D2DA 1OJHA 3H1KH 2Q68A 2UUBB 2X6AA 3AG3B 3E83A 5FLXN 4TT3G 3W7XA 1S3JA 3E8FA 3CRMA 1PP9H 5H6RA 4JZGA 2ZINA 4UCTA 1YDXA 2IJJA 1VQ8V 4X1KB 3D3QA 1YI2V 3K5OA 1FXKA 3D36C 4LF5O 3VQXA 1VMGA 4UVAA 2ARHA 1M56B 4H44B 2VQEB 1XREA 4DV1O 3LDCA 4MTOA 1DLBA 4LP8A 3CCLV 1IURA 3SYOA 1OCOB 4IT5A 4FM1A 4DV0B 5B3SB 4NTXA 4QIWF 2A79B 3FAVB 4LFAO 1L0NH 1UJWB 1HP8A 5CA1A 1G1XB 1JVMA 3AG2B 1NTKH 5KUKA 2B5UA 4K8XA 5LYJB 3KCXA 3T2MA 1Q82W 1AR5A 1JA8A 4O4HA 5C8YB 2PUSA 2CGNA 2PTMA 5L3DA 2JDIG 4NB5A 3UT5B 3ASNC 2XASA 3B8MA 4LF4O 4X88A 1Q3EA 1XOUA 3FD9A 5FPRA 3JATB 1VQKV 2Z0AA 2EJ7A 4YY3B 1KBHA 4EKWA 3JCZA 4DR7O 2IJIA 1RFYA 4NTYA 2WLLB 1P7GA 1JPXA 1H2MA 4JI4B 5LHGA 2RNBA 2A06H 1GRJA 1QQCA 3D36A 4L87A 4WF9V 5ITZB 1F23A 2K9PA 5KX5B 3CRAA 4Q20A 3JASB 1VQOV 2EIJC 4UCUA 2X6BA 2VQEO 4DR4B 5EYPB 5JH7A 4TQDA 1Y74B 2ZDIC 1QLEB 2LFSA 1S5JA 1SF9A 1E79G 3H1IH 5J9PC 4X20A 4UXNA 3UT5A 3ML0A 3ABMB 1VQ7V 1TVKB 4ZHQA 4BR6A 3K59A 3QG5A 1GN4A 4DV6O 5BZBA 2F4VO 1B06A 1FFTB 1BS3A 4DR5O 2P4KA 3K5MA 4K8ZA 1CEZA 4UUJC 4I55A 4LF8O 2CE4A 2WLJA 1SQGA 3SPJA 3RVYA 5B3SC 4TUYA 3WFVA 1Z5VA 3ASOC 1N32B 2YICA 5IE9A 4FPPA 3UM7A 3CP1A 2C2AA 3VQYA 4EEQA 5KLVH 2DN9A 5JJEB 3TGUH 4FLUA 1PD3A 1W0JG 1PNKA 3Q4HA 3DGEA 1K33A 2FTKA 2F1MA 3GWKC 2YXHA 4DR4O 1VARA 2E3CA 3DC6A 4I50A 2Q0AA 2VWJA 2FL4A 4Q6GA 3K57A 2IH3C 3OTOO 4PI0A 5IWAB 5CA0B 2W6IG 3MHSC 1XUQA 4DV0O 4X89A 1UFIA 1WP7A 4J42A 5EZYB 4YY3O 3MHHC 1E1QG 3RYIB 3ABLB 2HHHO 4H37A 2EZOA 4LFBO 3G71V 3FB5C 2FB5A 2XAGA 4LH6A 1AR1B 3DXRB 3MDSA 3SJBC 3OMAB 1QBZA 3NXSA 4ZHQB 1FJGB 3WU2Z 2YIBD 3L74H 3QO7A 1OCZB 1I5YA 5KHHA 4H33A 4J11A 4QPKA 1P7BA 4JF3A 4DR6O 1IBKB 4GKJO 2H94A 5H2FZ 1N4CA 2YC0A 3KG2A 1YTFD 3CCMV 4EB6B 4GKKB 5H6QA 2UXNA 1S76D 4OPAA 3N27A 3HKCA 4LF6O 2F4VB 1K7DA 3L71H 2QKCA 2D3OW 5JQGB 4DV4B 3CC4V 1M57C 2BSKA 2CAZC 2CH7A 2ETNA 1XHXA 2YIAA 2ZR3A 3CCQV 1L0LH 2CDYA 2EZPA 1AI5A 4BIZA 2BE3A 4RUFA 4FLZA 1PNLA 1GO3F 2JEXA 4EB6A 4B3TB 5L3FA 3FYIB 2H3OA 2UUCB 4LH7A 2QJ1A 1FFXA 3W7UA 3HKCB 3K79A 1AILA 3IGAC 2WLKA 2WWWA 1K9MW 5LGNA 4X62O 2PF4E 2K1EA 4JV5O 3W7WA 2EINB 3OAAG 1HNZO 1K4DC 2JVDA 1XI1A 1FD9A 2XAHA 3OUSA 2PYLA 1QR9A 4WFAV 2UXCO 1Q6IA 1MMMA 3JATA 3C90A 5FL7G 3ZCCA 1JR9A 4HZ3A 3KCYA 3RYHB 5D5PA 3BRCA 5IY5B 4CS3A 1PNMA 2F95B 1J5EB 4EFBA 4KL1A 4DUZB 4U3JA 1KU9A 2Q73A 5IYBO 1MG1A 2A0LA 2AHZA 5GTIZ 4LF7O 2B9ZA 3CWBH 2QSAA 5LMNB 1K73W 1YJWV 2LFRA 2O57A 2CTQA 3VBBA 3E86A 1U96A 4ZI7A 3TETA 2UXBB 5HFMA 5CB4A 1BMFG 5KAFZ 1F51A 3OR7C 1SZXA 2EIJB 2CUGA 2Q7HA 3AG7A 3ABUA 3CRRA 3JSLA 4MS2A 3UQ8A 4G27B 3FKSG 1D5AA 4FM2A 3WG7B 2NNUA 4O4JB 4I9WA 1URFA 1Y76B 2ZE6A 1V55C 2RQ6A 2QKAA 2DJVA 1WPBA 1K92A 3CS5A 1IDSA 3JARB 3OT7A 5TISZ 1M5IA 4TV9B 1AB3A 1J5EO 2QEXV 1ZSPA 4K3AA 4DUYB 1IX9A 1NT2B 1EM1A 1VQ6V 2ITCC 4JV5B 4IGGA 4MW3A 3RW0A 1GN3A 4HNAA 3UKMA 3CX5F 2WA4A 2DQ3A 1NKDA 2DOSA 2WLNA 2E5LO 2UXCB 3IFXA 2OIGA 2WSSG 4G28B 4RWUA 3CCSV 2EIKB 4IL6Z 1Y6XA 3K06A 1H2NA 4IHJB 2MW2B 3CMEV 2QE7G 1R6TA 2AW9A 3M99B 3D3IA 2OWOA 1I08A 3ETEA 2UUAO 1YTFB 1HDJA 1AJPA 4LNUB 1Q7YW 2CTWA 2RJZA 4DXWA
chains in the Genus database with same CATH topology
2ZM6O 2UUCO 4YY3O 1N32O 1DK1A 1I94O 4DV2O 4JI6O 2HHHO 4LFBO 5FLXN 2UUBO 4OX9O 4DR3O 4DUYO 3J80N 4X65O 1HNXO 4DV7O 3RT3C 4LF7O 3F5TA 2UXDO 4LF9O 2LW7A 4JYAO 2JRIA 4DR1O 4JI2O 2VQEO 1XMQO 1HR0O 3J7AU 5LMUO 4DV5O 4LF5O 3M8AA 3JAMN 1FJGO 4DV1O 4DR6O 5BY1A 2N74A 1XNQO 4GKJO 1XMOO 2VQFO 1X59A 5LMNO 4B3RO 2AGAA 4JI7O 5BXZA 5IWAO 4OPHA 4X64O 4DV3O 1A32A 4OPAA 4YHHO 4DV4O 2UU9O 4LF6O 1FYJA 1F7YA 4DV6O 4NXNO 2F4VO 4LFCO 4DR2O 1N36O 4LFAO 4DR5O 1G1XB 2DJVA 3R66A 4LF8O 4JI3O 4B3TO 4JI8O 1KUQA 1IBLO 1R1BA 4K0KO 1AB3A 1N33O 1J5EO 1XEQA 1YZBA 4A5UB 5H5NA 2UXBO 4DUZO 4B3SO 1FKAO 3SDLA 1AILA 2DOSA 4LF4O 5BR8O 3T1YO 3J81N 2E5LO 1IBKO 4X62O 5IT9N 2Z0AA 4JV5O 1HNZO 1HNWO 5LL6Y 4B3MO 4DR4O 1NS1A 4KHPO 4DR7O 4AQYO 1XNRO 2UXCO 1N34O 3OTOO 3T1HO 4JI0O 5A2QN 1R6TA 3O65A 4JI4O 4NXMO 2UUAO 4JI5O 4X66O 4DV0O 4GKKO 2ZKOA 2FKXA 4JI1O 1D2DA 1IBMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 O;  2UUC O;  4YY3 O;  1N32 O;  1DK1 A;  1I94 O;  4DV2 O;  4JI6 O;  2HHH O;  4LFB O;  5FLX N;  2UUB O;  4OX9 O;  4DR3 O;  4DUY O;  3J80 N;  4X65 O;  1HNX O;  4DV7 O;  3RT3 C;  4LF7 O;  3F5T A;  2UXD O;  4LF9 O;  2LW7 A;  4JYA O;  2JRI A;  4DR1 O;  4JI2 O;  2VQE O;  1XMQ O;  1HR0 O;  3J7A U;  5LMU O;  4DV5 O;  4LF5 O;  3M8A A;  3JAM N;  1FJG O;  4DV1 O;  4DR6 O;  5BY1 A;  2N74 A;  1XNQ O;  4GKJ O;  1XMO O;  2VQF O;  1X59 A;  5LMN O;  4B3R O;  2AGA A;  4JI7 O;  5BXZ A;  5IWA O;  4OPH A;  4X64 O;  4DV3 O;  1A32 A;  4OPA A;  4YHH O;  4DV4 O;  2UU9 O;  4LF6 O;  1FYJ A;  1F7Y A;  4DV6 O;  4NXN O;  2F4V O;  4LFC O;  4DR2 O;  1N36 O;  4LFA O;  4DR5 O;  1G1X B;  2DJV A;  3R66 A;  4LF8 O;  4JI3 O;  4B3T O;  4JI8 O;  1KUQ A;  1IBL O;  1R1B A;  4K0K O;  1AB3 A;  1N33 O;  1J5E O;  1XEQ A;  1YZB A;  4A5U B;  5H5N A;  2UXB O;  4DUZ O;  4B3S O;  1FKA O;  3SDL A;  1AIL A;  2DOS A;  4LF4 O;  5BR8 O;  3T1Y O;  3J81 N;  2E5L O;  1IBK O;  4X62 O;  5IT9 N;  2Z0A A;  4JV5 O;  1HNZ O;  1HNW O;  5LL6 Y;  4B3M O;  4DR4 O;  1NS1 A;  4KHP O;  4DR7 O;  4AQY O;  1XNR O;  2UXC O;  1N34 O;  3OTO O;  3T1H O;  4JI0 O;  5A2Q N;  1R6T A;  3O65 A;  4JI4 O;  4NXM O;  2UUA O;  4JI5 O;  4X66 O;  4DV0 O;  4GKK O;  2ZKO A;  2FKX A;  4JI1 O;  1D2D A;  1IBM O; 
#chains in the Genus database with same CATH topology
 2FML A;  1L8D A;  5JCO C;  4JI6 O;  4WFF A;  5KHI A;  1MA1 A;  3OEE G;  3JAK B;  2UUB O;  4OX9 O;  1D5N A;  2NLJ C;  1YIJ V;  2D2C B;  3CEI A;  5E1A C;  2KQX A;  5LHH A;  4JYA O;  3F7V C;  1EFR G;  4FMT A;  4DR6 B;  3OR6 C;  3T1C A;  4JYB A;  2JJ2 G;  4MVM A;  4J10 A;  5KA5 A;  2XOK G;  4BW5 A;  5IJ0 B;  2P67 A;  3SYQ A;  5GON B;  3L75 H;  5KMG A;  5J2T B;  3ETQ A;  1XNQ O;  4DRX B;  2P90 A;  2AGA A;  4ZOL B;  5BXZ A;  3JAK A;  5JVD B;  1BHB A;  1F4M A;  4CS4 A;  3O9O A;  3CXH F;  2V7Q G;  2HKO A;  2DYR C;  2Q0O C;  2XT9 A;  5JQG A;  4J9Z B;  5IJ9 A;  4HNA B;  2OTL V;  1WPX A;  4X64 B;  2BOC C;  4Z1V A;  4E4E A;  4PDL A;  4XDJ A;  2DWE C;  4C7U A;  3BAB A;  2IU3 A;  5DEC A;  4WFE A;  2P7T C;  5K1X A;  3K08 A;  5IY5 C;  3LSS A;  1VF7 A;  3EHB B;  3FAV A;  3K9A A;  4JYC A;  4XDK A;  4IHJ A;  3L9D A;  4U3F H;  4UVB A;  4JAS A;  4MVR A;  2N04 A;  1MSD A;  4X1I B;  3I5D A;  4LFC B;  1OV9 A;  4O2B B;  3RVZ A;  4FVM A;  5LBQ A;  1TUB B;  2IW5 A;  3FYE B;  2YIB A;  1N8R W;  4X62 B;  5BMV A;  4AQY O;  1THZ A;  1COW G;  1HNZ B;  3CCJ V;  4U7O A;  2QWR B;  4J7K A;  2A7W A;  2IBZ H;  3RFR A;  2FKX A;  4JI1 O;  3G6B A;  2XUM A;  1N32 O;  4KFM A;  1B3Q A;  1H38 A;  4R6Z A;  4LC1 A;  5IJ9 B;  2KG7 B;  3CMA V;  1SQQ H;  4RQE A;  2YXL A;  5L3G A;  2Q7G A;  4DV7 O;  2GV9 A;  3F5T A;  4PA6 A;  4P30 A;  4B7K A;  4FZ0 A;  1HR0 O;  5CBF A;  2GUZ A;  2YSU B;  4J80 A;  4UVC A;  1I0H A;  1KD1 W;  3OMN B;  3B40 A;  1GMG A;  1CP9 A;  1FJG O;  4PDM A;  4X66 B;  4RAI A;  5A9G A;  5JJJ B;  4X20 B;  5LMN O;  1BQZ A;  1OCO C;  2XHB A;  4YHH O;  1W2B U;  2KSD A;  4IIJ B;  1G4Y B;  1NBM G;  3LSU A;  3ABM C;  2F43 G;  4AHC A;  4ICG A;  1TVK A;  3ZMV A;  3IC7 A;  1AR4 A;  4B3S B;  5KA6 A;  2QM7 A;  2DYS C;  2EUL A;  5JWP A;  4DV2 B;  4GZR B;  3RGB A;  4DO2 A;  4DV5 B;  3K5L A;  5CBG A;  1G8M A;  4MTF A;  3ASN B;  4JPR A;  3SJA C;  2EBO A;  2Y0I A;  3ZRV A;  2P5O A;  2WAM A;  1NVP B;  1BZK A;  3AK2 A;  4F4L A;  4KHP O;  3W7T A;  1HR0 B;  4ABM A;  4MVU A;  3ZJZ A;  1KC8 W;  3AG2 C;  1M90 W;  4LF9 B;  1H2G A;  3X2Q C;  4X66 O;  3BFR A;  2PY5 A;  1OCC B;  4DV7 B;  3E35 A;  2UUC O;  2JK5 C;  3ZS8 C;  1QCE A;  4MTX A;  1Q90 D;  2R72 A;  1Q8I A;  4PD4 F;  3AK1 A;  3J80 N;  1T5E A;  4TOI A;  5EC1 C;  1WAZ A;  1LUV A;  2EIL C;  1M4U A;  4DV1 B;  3RYF A;  1SQB H;  3J7A U;  4OX9 B;  5LHI A;  4N21 A;  5LGT A;  3JAM N;  3ZHU A;  1GM8 A;  3TXQ A;  2ZT9 B;  2Q67 A;  4ZKI A;  5FNV B;  1X59 A;  3WB0 A;  1BSM A;  2P6J A;  2WLM A;  1KP3 A;  3CD6 V;  4DV3 O;  4DR3 B;  2B1G A;  2AZ0 A;  2G38 A;  3AG3 C;  2Q7E A;  3DXR A;  5IYZ B;  4QE7 A;  1BHA A;  2RDC A;  1JOY A;  4DK1 A;  5CB4 B;  5CA0 A;  5CMU A;  1ARO P;  3SPI A;  4F6R B;  4PA7 A;  4AI8 A;  1XL6 A;  2PZS A;  4O4L B;  2X6C A;  3ZHS A;  1BL8 A;  1GTO A;  1Z5W A;  2Y4T A;  3F7Y C;  3AG1 B;  1FXK B;  2AZ2 A;  1KB9 F;  2RCV A;  5KHG A;  1XNQ B;  1IXM A;  1YHQ V;  2BTQ A;  2DYR B;  4TUY B;  3I55 V;  4B3M O;  4CC6 A;  3M7M X;  1Z2G A;  1TUB A;  2QTO A;  3ZHQ A;  5E79 Z;  4JI0 O;  5A2Q N;  2HFE C;  4I0X B;  4CS2 A;  1ZTE A;  3ZHT A;  4JYA B;  3BVO A;  1M93 A;  1ZAU A;  4LFB B;  1WNS A;  3B4S A;  2ZM6 O;  3QTC A;  5IYD O;  1K3E A;  3JD0 A;  3B09 A;  4UCR A;  1MSW D;  4TWK A;  3CRC A;  2UXD O;  4TV8 A;  1SES A;  5LOV A;  3N2K A;  2LQT A;  2XTA A;  2IH1 C;  1JMK C;  4LF8 B;  4JI2 O;  1QHT A;  4DR2 B;  1TGO A;  2AXT Z;  1XMQ O;  1AVM A;  4W4K A;  4GX5 A;  5J2U A;  4PI2 A;  1DTO A;  3BEH A;  1OCC C;  3SR2 C;  3C3S A;  1FFX B;  2E74 B;  1ZL8 B;  3QVN A;  3OD4 A;  1Q6U A;  2HG5 C;  4TSF G;  5GON A;  1XMQ B;  5ITZ A;  5EZY A;  3WB2 A;  3JSN A;  3R66 A;  1BCC H;  2BTO A;  4GCZ A;  4JI3 O;  3JCU Z;  1IBL O;  1NR1 A;  3OW2 U;  4O4H B;  4DW1 A;  2YUA A;  3OEH G;  5EBL C;  4DR1 B;  2VS0 A;  3HKD A;  1Y66 A;  2YID A;  2M6Y A;  3ZHR A;  1EZJ A;  3JAR A;  1DGS A;  3LUT B;  4JI2 B;  5C8Y A;  3E22 B;  1AI4 A;  2OYQ A;  1OCZ C;  4PV1 B;  4DW0 A;  3FFQ A;  4ZIB A;  5F2V O;  1ORQ C;  3VQW A;  3G67 A;  2HVJ C;  1XNR O;  3ABK C;  3UO3 A;  4FLT A;  4J9Y B;  3O65 A;  3PN1 A;  3K0D A;  3ABL C;  1YXB A;  4O2A A;  3L70 H;  4WFG A;  4O2B A;  4DV2 O;  5DM6 V;  4KHP B;  4FFB B;  1TUE B;  1W0K G;  1ZUQ A;  4O4J A;  2R9A A;  2LGW A;  3OMI B;  3K3W A;  1R6N A;  2W6J G;  2JRI A;  2R9I A;  1GM9 A;  3OTF A;  2DQ0 A;  3RYF B;  5L3E A;  1MOF A;  5IYZ A;  4LF5 B;  1VIB A;  2VRZ A;  4GX1 A;  5IDJ A;  4QGP A;  3L72 H;  3STL C;  1NU1 H;  1K5S A;  1YEW A;  2CK3 G;  5IWA O;  1R73 A;  4NXN B;  1QVG U;  4OPH A;  1JCH A;  1Q6H A;  4K0K B;  5JVD A;  2ITD C;  1K5Q A;  3ZHV A;  3CHX A;  2ZCE A;  1ZLZ A;  1N36 O;  3BHP A;  2EIN C;  3E22 A;  3BY6 A;  3B2E E;  2QR4 A;  4X65 B;  1P84 F;  2JS3 A;  4CBC A;  4B3T O;  4J7Z A;  4I5S A;  4NKG B;  1FS0 G;  2CGO A;  4A5U B;  4F6E A;  2NR5 A;  2HLD G;  1B04 A;  1IZ3 A;  1N0J A;  2ZE8 A;  3P32 A;  1PL0 A;  3LDE A;  3PJS K;  3DTU B;  2LW1 A;  5BR8 O;  1IBK O;  1SQV H;  5D5Q A;  5IT9 N;  1M57 B;  1WLE A;  2WLI B;  1DF5 A;  1BQ0 A;  4DRX A;  1W59 A;  1YF2 A;  3S3X A;  2ADP A;  1LUW A;  3ETD A;  1WB8 A;  2UUA B;  4PA4 A;  1HNW B;  2RN9 A;  4NXM O;  2EIM C;  4B7E A;  4JI5 O;  4GLX A;  3LDD A;  2ZKO A;  3ZMT A;  3H1J H;  4YIP A;  1IBM O;  2OTJ V;  1Q5O A;  1P49 A;  1V54 B;  1O9H A;  1YVW A;  4JZ2 A;  1VQ4 V;  4MW8 A;  2L35 A;  5KUM A;  1AP5 A;  1HNX O;  1V9P A;  3P30 A;  3FX7 A;  5EBW C;  1L1F A;  3T4Z A;  4W4L A;  4DR7 B;  3LNM B;  1XHZ A;  4X1I A;  3GWO A;  2H8P C;  2GTS A;  3OGC C;  1DF4 A;  4FLY A;  1Q43 A;  4JI0 B;  1N0N A;  4X64 O;  4EFE A;  3RYC A;  1FXK C;  2F23 A;  3FB8 C;  4X1Y B;  1RM1 B;  4NR1 A;  3L73 H;  1HNX B;  2X0L A;  2UU9 O;  3CCU V;  3EXA A;  1FYJ A;  2QDO A;  2EIK C;  4L8J A;  1EN4 A;  4JTA B;  2Y69 C;  2EIL B;  5LXT A;  1VQL V;  1Q86 W;  4PJ0 Z;  5LP6 B;  2UXX A;  1SC5 B;  2KG7 A;  2ZE7 A;  4BIO A;  4JI8 O;  1SET A;  2QA4 V;  3E8B A;  5B1A C;  1M1K W;  4J41 A;  1XEQ A;  1HWY A;  2P06 A;  5KHJ A;  3VQV A;  4U7N A;  1NR7 A;  2QGN A;  2OCC C;  3CYO A;  4FLW A;  2WPD G;  3STZ C;  5LL6 Y;  4OGQ B;  4GX2 A;  3A0H Z;  4AQY B;  2GBO A;  2VWK A;  4KUM A;  4PA9 A;  1CPY A;  3ZED A;  5LA6 B;  4MVQ A;  5K1P A;  4I0X A;  2E5L B;  2X7R B;  4B08 A;  4FLX A;  3SJQ C;  2PI5 A;  3EVK A;  2OIE A;  2ZXW B;  2ZIO A;  2JS5 A;  3ZRX A;  4QJF B;  1PKX A;  2BTQ B;  1R3J C;  3ZX6 A;  3K04 A;  3RYH A;  4ZOL A;  2W0X A;  1QR8 A;  4G2K A;  4DR3 O;  3QNE A;  4DUY O;  1QLE C;  3TJT A;  4NXM B;  4U3J B;  4I9Q A;  1QLN A;  4YJ3 A;  1ZL8 A;  5LP6 A;  1SS3 A;  5CBH A;  1OCR C;  4BWA A;  2QWO B;  1GN2 A;  4ZI7 B;  4ASU G;  2QM8 A;  2W0F C;  4IYI A;  3SYP A;  2ZR2 A;  1VQM V;  4FZ1 A;  3F5W C;  4WFH A;  3IJ4 A;  1OCR B;  1YCI A;  2N74 A;  5B66 Z;  5C93 A;  4LF4 B;  2DMX A;  1SKV A;  2CH7 B;  3H01 A;  2IU0 A;  4H13 B;  3SYA A;  1NVP D;  2JGD B;  3OGI B;  2HR3 A;  3GVM A;  4NXN O;  4JAA A;  5FNV A;  3ZIA G;  4JI8 B;  1S5L Z;  3SJC C;  4PA3 A;  3ZN1 A;  4LF7 B;  1Y76 A;  1KEC A;  3APQ A;  1FAF A;  3AG4 C;  4K0K O;  1Y74 A;  3DSQ A;  4FIP C;  1YZB A;  2RMK B;  1AJQ A;  5H5N A;  2UXB O;  4J7J A;  5LA6 A;  1N33 B;  4DUZ O;  3OFN G;  4MSW C;  1ZWI C;  2GUZ B;  1SQP H;  4LNU A;  1K4C C;  4JI7 B;  1IBL B;  2Y0P A;  1RSO B;  1VF5 B;  3T1Y O;  4LBE C;  3U0Z A;  1FXV A;  1SA0 B;  4HBN A;  2V1D A;  4I4T B;  2P4V A;  2QKS A;  1XBL A;  2LJ2 A;  1GAX A;  3KKY A;  4YXW G;  4JI6 B;  4F6R A;  1WJZ A;  2XND G;  3C3T A;  1VF6 C;  5LP6 C;  2A3Q A;  4IIJ A;  2MK3 A;  1S5H C;  4UV9 A;  4FFB A;  1KKC A;  1LR1 A;  3N2G B;  2JGD A;  5CA1 B;  1BGY H;  5KMG B;  4O2A B;  2ZDI A;  3ZN0 A;  4JGS A;  1RM1 C;  1YJN V;  3MAQ A;  1VQP V;  1H2K A;  4D6T H;  3U10 A;  2VQF B;  3H1H H;  4MVZ A;  4DR1 O;  3Q4H B;  4HAM A;  4WCE V;  2JJ1 G;  3AEI A;  3ZRW A;  4O4I B;  3JAW B;  5LMU O;  2YXY A;  4KXR A;  2WLH A;  3BA8 A;  5LMU B;  3QF7 A;  1KKD A;  3ETG A;  4LF6 B;  2DYS B;  3QO8 A;  4UCO A;  1RPO A;  4DR5 B;  5B1N A;  4B3R O;  4Z1M G;  3MD0 A;  2Z3Y A;  3SPG A;  3JAS A;  3FB7 C;  2IJH A;  2JIZ G;  4NVP A;  1S77 D;  1F7Y A;  4B3M B;  4X8A A;  3RYC B;  3ZMS A;  3K9S A;  1N36 B;  2YEV B;  1VQ5 V;  1R3L C;  3CJH A;  2KB1 A;  4B3S O;  5JCO A;  3T1Y B;  1FKA O;  1XIL A;  3AK3 A;  3S3W A;  1K97 A;  3BA9 A;  2Q69 A;  5EBM C;  3RBZ A;  2QM4 A;  5KHK A;  1AI6 A;  2Q6A A;  3OTO B;  1NH2 B;  5J2U B;  4LFA B;  2XAQ A;  1ZX3 A;  4TQF A;  5KAI Z;  2KKW A;  5FPO A;  1JFF A;  2HJF C;  4UCV A;  1N34 O;  1SER A;  1AP6 A;  1SQF A;  4NYK A;  4PDV A;  4CZZ A;  3A8T A;  1P4R A;  5L3B A;  5JH7 B;  4IYH A;  2ZNJ A;  3ASO B;  1PV0 A;  2YI8 A;  4DYL A;  1Q81 W;  3LSQ A;  3FB6 C;  5HFL A;  2OT5 A;  1X4T A;  2BCC H;  1IBM B;  1NJI W;  4KP4 A;  5EK0 A;  3K58 A;  2PGG A;  2FYU H;  1G6U A;  1V55 B;  1LNQ A;  1RP3 B;  2E76 B;  4I50 B;  5H9C A;  3CCR V;  3E2E A;  3ICX A;  1JJ2 U;  3CXC U;  2GHY A;  2IJK A;  5GTH Z;  5IYC O;  4R7C A;  1B6Q A;  2P22 C;  2WLL A;  2VQF O;  5B1B C;  5B1O A;  3JYC A;  4JTC B;  3UCS C;  1QNM A;  4DV4 O;  3TK1 A;  4LFC O;  1HW7 A;  4X9Q A;  2QTS A;  4OXS A;  3DC5 A;  2IM9 A;  3R65 A;  4TV9 A;  1H8H G;  5LYJ A;  1MAB G;  1WA8 B;  3RWR D;  3CC7 V;  3AG1 C;  2YI9 A;  3VOU A;  3TXS A;  2Y4U A;  5DN6 G;  3RYI A;  4JTD B;  2ZQM A;  3U11 A;  4MVS A;  1AJN A;  1KP2 A;  2E75 B;  4CC5 A;  2B1I A;  4JYY A;  3K5N A;  3J81 N;  3EFF K;  1XMO B;  1NTZ H;  3ZRS A;  1AI7 A;  3KZI Z;  3OE7 G;  4H0L B;  5EIB D;  1N34 B;  4TV8 B;  4CH3 A;  1TAE A;  1YJ9 V;  2EJR A;  3ZBH A;  1KYO F;  4DK0 A;  4QPJ A;  1R6K A;  1NI8 A;  4PDR A;  4P9P A;  1PL4 A;  1I7F A;  2QWQ B;  2UXD B;  1M56 C;  2R70 A;  1DK1 A;  1I94 O;  2EX3 A;  1EBO A;  1S0V A;  3A2F A;  1WB7 A;  4GT1 A;  1I94 B;  3K0G A;  4BAY A;  3HKD B;  3AG4 B;  4RUE A;  3ZMZ A;  2LW7 A;  1M9N A;  3N2G A;  2LGQ A;  3CE2 A;  4B3R B;  1UPG A;  3GB7 C;  2QWN B;  3HKB B;  3BAA A;  1H2L A;  3ZRW B;  5J2T A;  1WP8 A;  3M8A A;  2CTP A;  5LGU A;  1NZ6 A;  4FFK A;  1SRY A;  1RPR A;  4JAU A;  2LO1 A;  3WB1 A;  4UB8 Z;  1ROP A;  2Q4P A;  3APO A;  1XMO O;  2YDE A;  1CXZ B;  4CH5 A;  3IAY A;  1TA8 A;  4O4I A;  1FXH A;  2YS8 A;  3X2Q B;  2Y69 B;  2L6L A;  1JJO A;  2N05 A;  2Z5U A;  4GYC B;  2CTR A;  3JD3 A;  1Y4M A;  4YHH B;  1J95 A;  5IJ0 A;  2HVK C;  5GW7 A;  4MT8 A;  1IXB A;  4UFZ A;  1SA0 A;  4I7Z B;  3OM3 B;  1R1B A;  2HJD A;  2PI4 A;  2GTA A;  4GX0 A;  1KMI Z;  1QU7 A;  3JAL A;  4DV3 B;  2ZIM A;  5B1B B;  2Q9L A;  2DWD C;  3QO5 A;  1VP7 A;  3SDL A;  3H1L H;  4CH4 A;  4FJC C;  4RQF A;  1GM7 A;  1IVS A;  2XAF A;  2HEP A;  5LXT B;  3HKB A;  3SYC A;  5KX5 A;  4JI1 B;  2Q5Z A;  3ABT A;  2ZNI A;  4JAV A;  2OCC B;  1PPJ H;  1S72 V;  3N2K B;  1JFF B;  3A0R A;  4JI4 O;  5CA3 A;  3CPW U;  2EIM B;  1BT8 A;  5B5E Z;  4AIL C;  4D7T A;  5JJN B;  3T1H B;  3HPL C;  3JAL B;  4QNH B;  1K8A W;  4I4T A;  4D7S A;  1U97 A;  1SZT A;  5B1A B;  4R8C A;  4K35 A;  1ENV A;  2ODM A;  1MZE A;  5LOV B;  5EC2 C;  1XL4 A;  1YIT V;  2F93 B;  3D8C A;  4HYO A;  4X65 O;  3RT3 C;  3E8G A;  1GN6 A;  1GH6 A;  4PEL A;  4RO2 A;  3I56 V;  3B8N A;  3B77 A;  4N23 A;  1NH2 D;  3SPC A;  1US6 A;  2ZE5 A;  3W7S A;  3CSX A;  4WBN B;  3HR0 A;  3RN4 A;  1A32 A;  2YEV A;  2HHH B;  3JD2 A;  2OCH A;  1I5X A;  2ADQ B;  1OZ0 A;  1WA8 A;  4O4L A;  3JAW A;  1XQ8 A;  3OUF A;  4X1K A;  4YIO A;  1NQT A;  1EZV H;  3G80 A;  1MZF A;  5DED A;  1F4N A;  1GK9 A;  4NTW A;  3BPZ A;  3HB3 B;  3K03 A;  1KUQ A;  1GKF A;  1JQ0 A;  4FK5 C;  4BIU A;  3CJH B;  4ZBM A;  1PM9 A;  2ATK C;  3SPH A;  1H2S B;  1K34 A;  1VF6 A;  5CN0 A;  3G4S V;  4XDL A;  2HP8 A;  2QWP B;  3CCV V;  4XBF A;  3HKE A;  1VQ9 V;  1SQX H;  1RSO A;  4Z2W A;  1BE3 H;  2WA3 A;  1HNW O;  3LNN A;  1R3K C;  1OHH G;  5BR8 B;  3E8H A;  4MTG A;  3JD4 A;  4X1Y A;  3UO2 A;  4GKJ B;  4LWS B;  3CRQ A;  1XDC A;  4DV6 B;  4LR3 A;  4FLV A;  2Y48 A;  1YSC A;  1V54 C;  2R9R B;  4WBN A;  2F66 C;  4WFB V;  1VEW A;  4LF9 O;  4BW9 A;  1EN6 A;  2ZD9 A;  2JGU A;  2PYJ A;  4YJ2 A;  2BOB C;  3THO A;  3BCC H;  4DV5 O;  2GDS A;  5EYP A;  2LP7 A;  3HKE B;  2BSK B;  1WN7 A;  5BY1 A;  3ZMU A;  4PHZ A;  2XAJ A;  1H8E G;  3SGI A;  3CCE V;  3H9V A;  4JI7 O;  4QE9 A;  3TCU A;  1Y67 A;  2JEU A;  2GSM B;  2ZXW C;  2AHY A;  4GUN A;  2NN4 A;  4P9O A;  4UB6 Z;  1VQN V;  1MNG A;  1EN5 A;  3E89 A;  4LCU C;  4DR2 O;  4YJ2 B;  1KQS U;  4CH6 A;  4YJ3 B;  3P3P A;  3G6E V;  1O9G A;  1XNR B;  4UV8 A;  3JD1 A;  1E1R G;  2V4D A;  2UU9 B;  2WLI A;  1N33 O;  2DW4 A;  2ZM6 B;  5BMV B;  1JX9 A;  1NTM H;  2M7W A;  4LWS A;  2DE0 X;  3ABK B;  4JI5 B;  5EIB C;  2Q8V A;  3NR7 A;  2ILM A;  1QVF U;  4E2L A;  4UCS A;  1FPO A;  1NS1 A;  4I55 B;  5AG2 A;  4JI3 B;  3WG7 C;  3T1H O;  3P3N A;  2A9H A;  4R50 A;  1R3I C;  3CC2 V;  3A0B Z;  4GKK O;  4P2Z A;  3CB2 A;  4FM0 A;  3T4D A;  3IC9 A;  4MVO A;  5L3C A;  1D2D A;  1OJH A;  3H1K H;  2Q68 A;  2UUB B;  2X6A A;  3AG3 B;  3E83 A;  5FLX N;  4TT3 G;  3W7X A;  1S3J A;  3E8F A;  3CRM A;  1PP9 H;  5H6R A;  4JZG A;  2ZIN A;  4UCT A;  1YDX A;  2IJJ A;  1VQ8 V;  4X1K B;  3D3Q A;  1YI2 V;  3K5O A;  1FXK A;  3D36 C;  4LF5 O;  3VQX A;  1VMG A;  4UVA A;  2ARH A;  1M56 B;  4H44 B;  2VQE B;  1XRE A;  4DV1 O;  3LDC A;  4MTO A;  1DLB A;  4LP8 A;  3CCL V;  1IUR A;  3SYO A;  1OCO B;  4IT5 A;  4FM1 A;  4DV0 B;  5B3S B;  4NTX A;  4QIW F;  2A79 B;  3FAV B;  4LFA O;  1L0N H;  1UJW B;  1HP8 A;  5CA1 A;  1G1X B;  1JVM A;  3AG2 B;  1NTK H;  5KUK A;  2B5U A;  4K8X A;  5LYJ B;  3KCX A;  3T2M A;  1Q82 W;  1AR5 A;  1JA8 A;  4O4H A;  5C8Y B;  2PUS A;  2CGN A;  2PTM A;  5L3D A;  2JDI G;  4NB5 A;  3UT5 B;  3ASN C;  2XAS A;  3B8M A;  4LF4 O;  4X88 A;  1Q3E A;  1XOU A;  3FD9 A;  5FPR A;  3JAT B;  1VQK V;  2Z0A A;  2EJ7 A;  4YY3 B;  1KBH A;  4EKW A;  3JCZ A;  4DR7 O;  2IJI A;  1RFY A;  4NTY A;  2WLL B;  1P7G A;  1JPX A;  1H2M A;  4JI4 B;  5LHG A;  2RNB A;  2A06 H;  1GRJ A;  1QQC A;  3D36 A;  4L87 A;  4WF9 V;  5ITZ B;  1F23 A;  2K9P A;  5KX5 B;  3CRA A;  4Q20 A;  3JAS B;  1VQO V;  2EIJ C;  4UCU A;  2X6B A;  2VQE O;  4DR4 B;  5EYP B;  5JH7 A;  4TQD A;  1Y74 B;  2ZDI C;  1QLE B;  2LFS A;  1S5J A;  1SF9 A;  1E79 G;  3H1I H;  5J9P C;  4X20 A;  4UXN A;  3UT5 A;  3ML0 A;  3ABM B;  1VQ7 V;  1TVK B;  4ZHQ A;  4BR6 A;  3K59 A;  3QG5 A;  1GN4 A;  4DV6 O;  5BZB A;  2F4V O;  1B06 A;  1FFT B;  1BS3 A;  4DR5 O;  2P4K A;  3K5M A;  4K8Z A;  1CEZ A;  4UUJ C;  4I55 A;  4LF8 O;  2CE4 A;  2WLJ A;  1SQG A;  3SPJ A;  3RVY A;  5B3S C;  4TUY A;  3WFV A;  1Z5V A;  3ASO C;  1N32 B;  2YIC A;  5IE9 A;  4FPP A;  3UM7 A;  3CP1 A;  2C2A A;  3VQY A;  4EEQ A;  5KLV H;  2DN9 A;  5JJE B;  3TGU H;  4FLU A;  1PD3 A;  1W0J G;  1PNK A;  3Q4H A;  3DGE A;  1K33 A;  2FTK A;  2F1M A;  3GWK C;  2YXH A;  4DR4 O;  1VAR A;  2E3C A;  3DC6 A;  4I50 A;  2Q0A A;  2VWJ A;  2FL4 A;  4Q6G A;  3K57 A;  2IH3 C;  3OTO O;  4PI0 A;  5IWA B;  5CA0 B;  2W6I G;  3MHS C;  1XUQ A;  4DV0 O;  4X89 A;  1UFI A;  1WP7 A;  4J42 A;  5EZY B;  4YY3 O;  3MHH C;  1E1Q G;  3RYI B;  3ABL B;  2HHH O;  4H37 A;  2EZO A;  4LFB O;  3G71 V;  3FB5 C;  2FB5 A;  2XAG A;  4LH6 A;  1AR1 B;  3DXR B;  3MDS A;  3SJB C;  3OMA B;  1QBZ A;  3NXS A;  4ZHQ B;  1FJG B;  3WU2 Z;  2YIB D;  3L74 H;  3QO7 A;  1OCZ B;  1I5Y A;  5KHH A;  4H33 A;  4J11 A;  4QPK A;  1P7B A;  4JF3 A;  4DR6 O;  1IBK B;  4GKJ O;  2H94 A;  5H2F Z;  1N4C A;  2YC0 A;  3KG2 A;  1YTF D;  3CCM V;  4EB6 B;  4GKK B;  5H6Q A;  2UXN A;  1S76 D;  4OPA A;  3N27 A;  3HKC A;  4LF6 O;  2F4V B;  1K7D A;  3L71 H;  2QKC A;  2D3O W;  5JQG B;  4DV4 B;  3CC4 V;  1M57 C;  2BSK A;  2CAZ C;  2CH7 A;  2ETN A;  1XHX A;  2YIA A;  2ZR3 A;  3CCQ V;  1L0L H;  2CDY A;  2EZP A;  1AI5 A;  4BIZ A;  2BE3 A;  4RUF A;  4FLZ A;  1PNL A;  1GO3 F;  2JEX A;  4EB6 A;  4B3T B;  5L3F A;  3FYI B;  2H3O A;  2UUC B;  4LH7 A;  2QJ1 A;  1FFX A;  3W7U A;  3HKC B;  3K79 A;  1AIL A;  3IGA C;  2WLK A;  2WWW A;  1K9M W;  5LGN A;  4X62 O;  2PF4 E;  2K1E A;  4JV5 O;  3W7W A;  2EIN B;  3OAA G;  1HNZ O;  1K4D C;  2JVD A;  1XI1 A;  1FD9 A;  2XAH A;  3OUS A;  2PYL A;  1QR9 A;  4WFA V;  2UXC O;  1Q6I A;  1MMM A;  3JAT A;  3C90 A;  5FL7 G;  3ZCC A;  1JR9 A;  4HZ3 A;  3KCY A;  3RYH B;  5D5P A;  3BRC A;  5IY5 B;  4CS3 A;  1PNM A;  2F95 B;  1J5E B;  4EFB A;  4KL1 A;  4DUZ B;  4U3J A;  1KU9 A;  2Q73 A;  5IYB O;  1MG1 A;  2A0L A;  2AHZ A;  5GTI Z;  4LF7 O;  2B9Z A;  3CWB H;  2QSA A;  5LMN B;  1K73 W;  1YJW V;  2LFR A;  2O57 A;  2CTQ A;  3VBB A;  3E86 A;  1U96 A;  4ZI7 A;  3TET A;  2UXB B;  5HFM A;  5CB4 A;  1BMF G;  5KAF Z;  1F51 A;  3OR7 C;  1SZX A;  2EIJ B;  2CUG A;  2Q7H A;  3AG7 A;  3ABU A;  3CRR A;  3JSL A;  4MS2 A;  3UQ8 A;  4G27 B;  3FKS G;  1D5A A;  4FM2 A;  3WG7 B;  2NNU A;  4O4J B;  4I9W A;  1URF A;  1Y76 B;  2ZE6 A;  1V55 C;  2RQ6 A;  2QKA A;  2DJV A;  1WPB A;  1K92 A;  3CS5 A;  1IDS A;  3JAR B;  3OT7 A;  5TIS Z;  1M5I A;  4TV9 B;  1AB3 A;  1J5E O;  2QEX V;  1ZSP A;  4K3A A;  4DUY B;  1IX9 A;  1NT2 B;  1EM1 A;  1VQ6 V;  2ITC C;  4JV5 B;  4IGG A;  4MW3 A;  3RW0 A;  1GN3 A;  4HNA A;  3UKM A;  3CX5 F;  2WA4 A;  2DQ3 A;  1NKD A;  2DOS A;  2WLN A;  2E5L O;  2UXC B;  3IFX A;  2OIG A;  2WSS G;  4G28 B;  4RWU A;  3CCS V;  2EIK B;  4IL6 Z;  1Y6X A;  3K06 A;  1H2N A;  4IHJ B;  2MW2 B;  3CME V;  2QE7 G;  1R6T A;  2AW9 A;  3M99 B;  3D3I A;  2OWO A;  1I08 A;  3ETE A;  2UUA O;  1YTF B;  1HDJ A;  1AJP A;  4LNU B;  1Q7Y W;  2CTW A;  2RJZ A;  4DXW A; 
#chains in the Genus database with same CATH homology
 2ZM6 O;  2UUC O;  4YY3 O;  1N32 O;  1DK1 A;  1I94 O;  4DV2 O;  4JI6 O;  2HHH O;  4LFB O;  5FLX N;  2UUB O;  4OX9 O;  4DR3 O;  4DUY O;  3J80 N;  4X65 O;  1HNX O;  4DV7 O;  3RT3 C;  4LF7 O;  3F5T A;  2UXD O;  4LF9 O;  2LW7 A;  4JYA O;  2JRI A;  4DR1 O;  4JI2 O;  2VQE O;  1XMQ O;  1HR0 O;  3J7A U;  5LMU O;  4DV5 O;  4LF5 O;  3M8A A;  3JAM N;  1FJG O;  4DV1 O;  4DR6 O;  5BY1 A;  2N74 A;  1XNQ O;  4GKJ O;  1XMO O;  2VQF O;  1X59 A;  5LMN O;  4B3R O;  2AGA A;  4JI7 O;  5BXZ A;  5IWA O;  4OPH A;  4X64 O;  4DV3 O;  1A32 A;  4OPA A;  4YHH O;  4DV4 O;  2UU9 O;  4LF6 O;  1FYJ A;  1F7Y A;  4DV6 O;  4NXN O;  2F4V O;  4LFC O;  4DR2 O;  1N36 O;  4LFA O;  4DR5 O;  1G1X B;  2DJV A;  3R66 A;  4LF8 O;  4JI3 O;  4B3T O;  4JI8 O;  1KUQ A;  1IBL O;  1R1B A;  4K0K O;  1AB3 A;  1N33 O;  1J5E O;  1XEQ A;  1YZB A;  4A5U B;  5H5N A;  2UXB O;  4DUZ O;  4B3S O;  1FKA O;  3SDL A;  1AIL A;  2DOS A;  4LF4 O;  5BR8 O;  3T1Y O;  3J81 N;  2E5L O;  1IBK O;  4X62 O;  5IT9 N;  2Z0A A;  4JV5 O;  1HNZ O;  1HNW O;  5LL6 Y;  4B3M O;  4DR4 O;  1NS1 A;  4KHP O;  4DR7 O;  4AQY O;  1XNR O;  2UXC O;  1N34 O;  3OTO O;  3T1H O;  4JI0 O;  5A2Q N;  1R6T A;  3O65 A;  4JI4 O;  4NXM O;  2UUA O;  4JI5 O;  4X66 O;  4DV0 O;  4GKK O;  2ZKO A;  2FKX A;  4JI1 O;  1D2D A;  1IBM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...