4JI6O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji6O00
4YHHO 4NXNO 1FKAO 1HR0O 4JV5O 5IWAO 1G1XB 1IBMO 2DOSA 4A5UB 4DV4O 4DUYO 1NS1A 1HNXO 3J80N 1XEQA 5IT9N 4JI0O 3M8AA 3OTOO 4OPHA 4JI8O 5LL6Y 4X64O 4LF9O 5A2QN 5LMNO 2E5LO 4GKKO 2UUBO 4DV3O 3O65A 4DUZO 4LFCO 1N32O 5BR8O 2ZM6O 4LF4O 4NXMO 1N33O 4JI2O 4JI6O 3SDLA 4LF6O 4K0KO 1R6TA 2FKXA 3JAMN 2LW7A 2JRIA 2UUAO 1FJGO 1HNZO 2HHHO 1XMQO 4DV2O 4JI5O 4DV5O 5H5NA 1F7YA 4GKJO 3J7AU 4JI4O 1N34O 1YZBA 4YY3O 1AB3A 3F5TA 4JI1O 4B3TO 4KHPO 1HNWO 3T1YO 1IBLO 1XMOO 3T1HO 1A32A 2VQEO 1XNRO 5BY1A 3J81N 4DV0O 4DR2O 1N36O 2ZKOA 4X65O 1DK1A 4B3RO 1X59A 3RT3C 4OX9O 4LF8O 1D2DA 2AGAA 2Z0AA 1KUQA 4DR6O 5LMUO 1AILA 2N74A 2F4VO 1J5EO 2UXDO 1FYJA 1I94O 4DV6O 4DR1O 4OPAA 1IBKO 1R1BA 2UXBO 4DV1O 4DV7O 4LFBO 1XNQO 4LF7O 4LFAO 4JYAO 2DJVA 4X66O 2UXCO 5FLXN 4B3MO 5BXZA 4DR5O 4X62O 3R66A 2UU9O 4B3SO 4DR3O 4LF5O 2UUCO 4JI7O 4DR4O 4DR7O 2VQFO 4AQYO 4JI3O
chains in the Genus database with same CATH superfamily
1IVSA 4BWAA 4GKJB 5IWAO 1WLEA 2HR3A 4DV4O 3OTFA 3G71V 4JI8O 4EB6B 4X9QA 5IDJA 2YS8A 3IC7A 3RWRD 3SYOA 3ZRWB 2HVKC 5L3BA 5LOVB 1Q81W 1LR1A 4JYYA 4FLZA 4L8JA 4TT3G 3ABTA 3K0DA 4YIPA 2VS0A 3CCRV 2Q6AA 4LF6O 2L35A 4DRXA 3EFFK 4DR1B 3JATA 4QPKA 1HNZO 2X6CA 3TK1A 2GSMB 2CH7A 4GX1A 2CGOA 3WG7C 4JI4O 1XL6A 2B1IA 1NZ6A 3IAYA 2P4VA 1OV9A 3KG2A 3RVZA 1I5XA 3J81N 3BHPA 4LF9B 3R65A 5E79Z 3A0BZ 1P84F 3RBZA 5LGNA 1WB8A 2RDCA 1YSCA 1NR7A 2FB5A 1KUQA 3F7VC 1AILA 5HFMA 4IL6Z 3CSXA 4LWSB 3ABLB 3ZBHA 2KB1A 2EINC 3SJAC 2BSKA 4D6TH 3BRCA 2BE3A 1GAXA 2BCCH 1OCOB 3FB8C 2DJVA 4O2AB 5KUMA 3K57A 1N34B 4PA6A 2XT9A 4DR5O 3TGUH 2LW1A 3R66A 1SS3A 4JASA 2YUAA 2UU9O 1K97A 4IYIA 1KYOF 4HYOA 3N2KA 2EIMB 4WFEA 1D5AA 3BAAA 1XHZA 4HNAB 4I4TB 3QG5A 4OPHA 5A2QN 3BVOA 3ZJZA 1Q90D 2ZE8A 3RYHA 5CA1A 3D36A 1OCCC 1VEWA 2XAJA 2GHYA 3OGIB 4TQFA 1WPXA 5IYZA 5L3DA 5D5QA 4DR7B 3UQ8A 1R6TA 3CC7V 2WLNA 2IJHA 1N4CA 1FAFA 2ZDIC 3FB6C 4JI3B 1M57B 4ZHQA 1AB3A 4YJ3B 4JF3A 3ASOC 1M4UA 4GX0A 2HP8A 5C93A 5EK0A 2W0XA 4UVCA 2MW2B 4GKKB 4Z2WA 3OD4A 3FFQA 2PYLA 3FD9A 5J2TB 2CAZC 3AG7A 3WFVA 1S77D 1YJNV 3E8HA 3W7XA 4PELA 2R9AA 1BHAA 4I0XA 4ZOLA 2V4DA 3JD4A 1S3JA 1BHBA 1H2LA 1HNXB 4I9QA 4CH3A 1S76D 1WB7A 2Q8VA 4J41A 4IHJA 2XAFA 2IW5A 1R3LC 3EXAA 4ZI7B 4JPRA 2PTMA 1WJZA 2JGDA 2OTLV 4I50A 4PI2A 4X65B 3UM7A 4B3RB 5FL7G 1Q5OA 3DC6A 5B3SC 4B7EA 3ZHUA 1NTZH 3SYCA 1VQPV 2X7RB 5EZYA 3VQVA 4HZ3A 1EZVH 4TWKA 2UXDB 3JASB 3JD0A 5B1OA 3TXSA 1RM1B 3AG1B 3KCYA 4NR1A 3J80N 4LF9O 3H01A 2Z3YA 3L73H 1X4TA 5J2UB 4QGPA 1KB9F 1V54B 2ITDC 1L0LH 1SQPH 4EB6A 1K4DC 3S3XA 3JAKA 3NR7A 3BPZA 4DV6B 1JR9A 3D8CA 5LGUA 3HR0A 1VP7A 3CEIA 1S72V 4NXNB 5DECA 3JARB 3P3PA 2AHZA 1N34O 1Y74B 2ZT9B 1NQTA 3RYCA 4W4KA 3ETEA 4ZKIA 2B1GA 1JA8A 1IXBA 2UUBB 3P3NA 2WA4A 2PZSA 1IX9A 4X1YA 2OT5A 4PJ0Z 2KKWA 2Z0AA 4NXMB 1CPYA 5CB4A 4H0LB 4OPAA 4UCRA 3UT5A 2N04A 3T4DA 1FJGB 2A3QA 1PL4A 1SESA 4JI5B 3STZC 3ABMC 3NXSA 2LP7A 4MTOA 3RFRA 1SQVH 2LO1A 1NH2B 3HKEA 1XOUA 5BXZA 1QCEA 1XMOB 4J10A 4DK1A 3SR2C 3CB2A 3CS5A 1K9MW 5EBLC 4U7NA 5CBHA 5LHGA 4DR7O 2M6YA 5CBFA 4JI3O 1XMQB 5LMUB 5LBQA 3ZRXA 2IJJA 4R50A 3EVKA 4FFBB 2W6IG 3U0ZA 1FXHA 1WA8B 1B3QA 1JPXA 4O4LA 3JSLA 4WFHA 4J7JA 1M56B 2XHBA 1FXKA 2EIKB 3AG3C 2QTSA 3DTUB 1XNRB 1XNQB 4TUYA 4LFAB 1QQCA 5H9CA 4GKKO 4LR3A 5IJ9B 2UXCB 1QR8A 4FZ0A 2A0LA 3HB3B 1U96A 4P9PA 4L87A 1AI7A 5L3EA 1XHXA 1TGOA 4B7KA 3CCUV 1GN6A 3FAVB 2HVJC 3KCXA 5B5EZ 1VQ9V 1K8AW 3K9AA 2ZNJA 3CCMV 5CN0A 2WLKA 5AG2A 4RAIA 3ZRSA 1I08A 3OR7C 1FFXA 1QBZA 3L71H 1DGSA 3VQWA 4DUYB 1OCCB 4CC5A 2ZKOA 4X65O 4X64B 2N05A 3L75H 3SGIA 4LF5B 4NYKA 4B3RO 3RT3C 3QF7A 4YJ3A 5DN6G 1BMFG 3BA9A 1IDSA 3E83A 1CXZB 4MW8A 1H8HG 3AG2B 5BR8B 4X89A 4F6RB 1Z5VA 2UXXA 3RYIA 2UXDO 4JYBA 4TV9B 2AZ2A 3S3WA 3SPIA 5J2TA 3G6EV 4UCTA 4MTGA 4BW9A 3E22B 4JI8B 3ZMTA 4YY3B 1K34A 5FPRA 3ZX6A 2Q5ZA 3W7UA 2H3OA 3MHHC 3OM3B 5IYCO 1LNQA 3GWKC 2ZXWB 1P7BA 2QTOA 1QR9A 4MVUA 1K4CC 1WP8A 4ZI7A 1T5EA 2XASA 4GLXA 2XTAA 1YVWA 3DGEA 3IFXA 1K3EA 3VOUA 4NXNO 5GTIZ 2JS3A 5CBGA 3X2QC 4JI4B 5E1AC 1US6A 1OCZC 2NR5A 2VWJA 1WP7A 1Q6UA 1M9NA 4F6EA 1S5LZ 5JJEB 3JASA 1ZAUA 2WPDG 1NI8A 5KUKA 1FFTB 2UUBO 3VQXA 4R8CA 3APQA 2MK3A 2O57A 3N2GB 4NXMO 2DWDC 4WFGA 1UFIA 4JI2O 3SDLA 3TCUA 3LSSA 1AJQA 1FJGO 2JJ2G 4X20B 1QVGU 4JI5O 4DK0A 1PM9A 3SPHA 1RFYA 5JQGB 4I9WA 2Y0PA 4NTWA 2OTJV 1JVMA 1IBLO 1XMOO 3IGAC 4EEQA 3I56V 3B4SA 4DR2O 1IURA 1F4NA 2YIDA 2Y0IA 3JARA 2UU9B 1P4RA 2Z5UA 2K1EA 3CX5F 2EILB 4O4IB 3ZHRA 1V55C 2ADQB 3EHBB 2QWQB 2Q0AA 5LMUO 1Q3EA 3C90A 1B04A 5LYJB 3E8FA 5KHIA 2PGGA 4TV8A 4K8ZA 1BZKA 5GW7A 4GT1A 1XNQO 5B1NA 1TUBA 4LFAO 3CE2A 2QM7A 4JI1B 4B3TB 2UXCO 1AVMA 3CRQA 3SJCC 5JVDB 3L74H 1G6UA 1OHHG 5FPOA 3HKDB 5D5PA 3T2MA 1Q82W 5C8YA 2H8PC 4P9OA 2H94A 2OCCC 2X0LA 1SQQH 3OUFA 2F43G 1VQLV 3ABMB 2HJFC 1I7FA 5KX5B 2ZR2A 4DUYO 1MSDA 1OZ0A 2YXHA 4D7TA 4X64O 2L6LA 5B1AC 4LF7B 4CH4A 2KG7B 3GWOA 1WA8A 3O65A 4BAYA 5BR8O 3QO7A 1S5JA 4UV8A 2JGUA 3P32A 4DR3B 4W4LA 3CP1A 1QLNA 3ZMUA 5KMGB 2UUAO 1N8RW 2NLJC 1GO3F 2FYUH 3MD0A 4TQDA 5H5NA 1R6NA 1F51A 4JV5B 3FAVA 4YY3O 3K59A 5A9GA 2RCVA 1GM9A 3DXRA 4JI0B 2YI8A 3HKCB 3ETQA 1K7DA 4QE7A 4DO2A 2RQ6A 1JJOA 3K04A 3LNMB 2XAHA 4X88A 3L70H 1KU9A 1ZTEA 2JEUA 1H2SB 2GUZB 5DM6V 5JH7B 1TAEA 3THOA 2JJ1G 1GN3A 1K33A 3SPCA 2CTRA 2WLIA 1R73A 2EIJC 4MVQA 4KUMA 1I0HA 3LDEA 2XNDG 1YITV 1HW7A 3SYAA 4FMTA 1OJHA 1YI2V 4B3MO 2P7TC 3UO2A 5JCOA 2F1MA 4YXWG 4K8XA 4X1KB 1SZTA 5LP6C 5EC1C 3BEHA 4YJ2B 5LXTA 1BL8A 3H1KH 2YICA 1NH2D 4CS4A 3H9VA 3CXCU 1EM1A 3WB1A 2CUGA 2CTPA 4FZ1A 4LFBB 3FB7C 1DF4A 4N23A 2HLDG 1B06A 1F23A 5EBMC 1JQ0A 4FFKA 1SQXH 4LP8A 1EBOA 2Y69C 1SA0B 1NTMH 2WLHA 1R6KA 4CS2A 1GM7A 2BTOA 4GCZA 2E74B 2DN9A 2Q68A 4YHHB 3K5MA 3E86A 2QM4A 2QSAA 2D2CB 4FLUA 3F5TA 4JI1O 4B3TO 3ZCCA 1A32A 4GUNA 4X20A 4OXSA 4FM2A 1XBLA 2EZPA 3ASNC 4RQEA 4WFAV 3CMAV 3JAWB 2YDEA 2YXLA 1EN4A 1FS0G 2IM9A 4ICGA 1SQGA 1R1BA 2PF4E 3HPLC 4GX5A 1GK9A 2UXBO 2HG5C 4MT8A 5GONB 4LF7O 2WWWA 2R9RB 3VBBA 5LYJA 4KHPB 1DLBA 5FLXN 1AP5A 4MVMA 1N36B 2IU3A 5BMVA 3DC5A 3AK2A 4DR3O 4J9YB 3HKBA 1VF5B 3WU2Z 4WFFA 5EIBD 1GKFA 5JVDA 3BA8A 2RN9A 4X8AA 2C2AA 5CA0A 4JAAA 4EKWA 1Y76A 1NU1H 1I94B 1YJ9V 4JV5O 2IJKA 5EBWC 4LBEC 2G38A 4LH6A 4A5UB 2Q73A 3TJTA 1OCRB 1XEQA 4JI0O 4DW1A 1JCHA 4UVAA 3L72H 5LA6A 3OT7A 2DYSC 3OAAG 3M99B 2OCCB 1TUEB 5JWPA 2Y48A 3A0RA 1Y4MA 3CCEV 3AG4B 4WBNB 4JTAB 2KQXA 2P5OA 1XDCA 2R72A 4Q6GA 1MNGA 4R7CA 4RUFA 4AQYB 2JS5A 2LGQA 3J7AU 1MSWD 2X6AA 4CH5A 3ZS8C 1ZX3A 3RW0A 5KMGA 1TA8A 2WAMA 3LSQA 1KP2A 3PJSK 4PA3A 4LNUB 3WB2A 2A79B 2HKOA 1ZWIC 2XAQA 3D36C 4JTDB 3ZRWA 4DV3B 4DUZB 5LOVA 3JALB 1EZJA 2B9ZA 5FNVB 2HEPA 3K5OA 1FYJA 4FIPC 4CZZA 5IE9A 2YIAA 1H2KA 5EYPB 3CRCA 2GUZA 1XL4A 4P30A 4EFEA 5B1BC 4LFBO 3W7WA 3ZHTA 3ZHVA 2P06A 4FJCC 1MABG 3T1HB 1NJIW 3ETGA 4FPPA 4Z1MG 2JIZG 4JI2B 3WG7B 3QO8A 1VF6A 3OMAB 2EIJB 1W0KG 1RPRA 4WF9V 3DSQA 2IH3C 2CGNA 4YHHO 1G4YB 2V7QG 4UB6Z 3H1LH 4O4JB 1P49A 5LGTA 2F4VB 4X1KA 4LWSA 1L0NH 1PL0A 2LFSA 2QJ1A 4LCUC 1IBLB 1D5NA 5B66Z 4DR2B 1S5HC 4FLXA 5LL6Y 1Z2GA 4X66B 4O2AA 3ZN1A 1EN6A 5LP6B 2HJDA 1RPOA 2YIBD 2EINB 2JEXA 2YEVB 1MA1A 3QTCA 4XDJA 1ZLZA 3E8GA 4RUEA 3E89A 4JI7B 1SETA 3CRRA 2VQFB 1BSMA 1WNSA 2ZE7A 4FLVA 4X1IB 1VQ6V 1VQMV 1LUWA 2ITCC 1VQOV 2XOKG 2P4KA 3B8MA 5LHHA 4KHPO 4HNAA 2F93B 3BABA 4I4TA 3K5NA 2HFEC 3AEIA 5KHKA 1N36O 1H2MA 1E1QG 2P67A 3LSUA 4EFBA 4MVOA 5KLVH 5JJJB 4MW3A 1BQ0A 4WCEV 3ZRVA 2BTQB 2DWEC 2Q67A 2ZM6B 4LF8O 3CCSV 4DR6O 5IJ0B 3GVMA 3RYFB 1J5EO 1I94O 2IBZH 1AI6A 3FYEB 1F4MA 3OEHG 1JJ2U 1KMIZ 3SPGA 1GTOA 1EFRG 2NN4A 1SKVA 3G4SV 3B8NA 1SF9A 4IGGA 3QO5A 4PDLA 3T1CA 1PPJH 1HNWB 2OIGA 4I7ZB 4XBFA 1XREA 3T4ZA 3LNNA 2QDOA 4GYCB 3JATB 4E4EA 3ASOB 4J11A 1O9GA 2UUAB 4AQYO 1AP6A 2JDIG 2CE4A 4NKGB 1AJNA 1IBMO 1SC5B 1NS1A 3ABLC 4UVBA 2PYJA 1BQZA 2QEXV 1AR4A 4J7ZA 4DV3O 4IYHA 4DUZO 2ILMA 1Q8IA 2YXYA 3ZHQA 1OCOC 1NBMG 3CD6V 3CRAA 2NNUA 3C3TA 2Q9LA 4UCVA 1YXBA 2BSKB 2R70A 3P30A 3K3WA 4UUJC 1VIBA 3OR6C 3OEEG 1KECA 1SRYA 2DQ3A 4PA7A 1FXKC 2EIMC 4B3MB 3T1HO 4B08A 2W0FC 1DF5A 5B3SB 2YC0A 4PHZA 1MOFA 4NTYA 5LMNB 2E5LB 4I5SA 5J2UA 1AR5A 4UV9A 2Q7GA 1ZL8B 1K73W 2W6JG 4LF4B 4LNUA 2JVDA 2F4VO 2BOCC 3OMIB 4K0KB 4D7SA 3JALA 2RMKB 4DV7O 1BCCH 2IH1C 4E2LA 4X66O 2YSUB 4JYCA 1MMMA 4N21A 1Y74A 5EYPA 4MTXA 1M57C 4DV0B 3A2FA 3Q4HB 1H8EG 4P2ZA 2XUMA 5IYZB 2ZINA 1JOYA 3C3SA 3PN1A 3K9SA 4JI7O 1VMGA 4AI8A 3CYOA 2VQFO 4O2BB 4WFBV 3BFRA 1G8MA 4BR6A 3RVYA 4LH7A 2OWOA 4I55B 4DV1B 2FTKA 1XILA 4O4JA 5L3GA 4JYAB 1ENVA 2LGWA 1IZ3A 4YIOA 1QU7A 3CCLV 2ZD9A 3SJBC 5L3CA 4X62B 2ZM6O 4UB8Z 3CHXA 4ZOLB 3LDDA 2AW9A 3JCZA 3I55V 2LJ2A 1THZA 1VQKV 2A06H 2UXBB 3CMEV 4HAMA 5L3FA 4IIJB 1HR0B 3N27A 4NB5A 1Q6HA 2GTSA 4FFBA 4J9ZB 1B6QA 1HNWO 2ZQMA 3CC2V 2JGDB 2ZIMA 3T1YO 1XUQA 3ZHSA 5KHGA 3OTOB 4KFMA 1DK1A 4ASUG 3VQYA 3AG1C 5IJ9A 1YTFB 1QNMA 1N32B 2QKAA 4ABMA 3B2EE 4LC1A 5EZYB 2EJ7A 1QHTA 3K06A 4CBCA 3AG3B 2QKSA 1M5IA 2AHYA 3UKMA 1V54C 4CC6A 1WPBA 2PY5A 2BTQA 4H33A 1SQBH 1KD1W 2QKCA 2QWPB 3ML0A 1O9HA 5IJ0A 2QE7G 3ZN0A 2Q0OC 2Y4TA 3RYFA 2WLMA 2F23A 2ZIOA 1SERA 2ATKC 2E76B 1V9PA 4JZ2A 4U3FH 3JAKB 4OX9B 3FKSG 2UXNA 3WB0A 4UFZA 5ITZB 3MAQA 2ZDIA 4F6RA 2CTWA 2K9PA 1MZFA 4XDKA 4TV9A 2PI5A 4GZRB 3RYCB 1E79G 4BIUA 3E22A 3UCSC 1FD9A 4UCSA 4U7OA 5LMNO 2E5LO 4FLTA 3K03A 2V1DA 2EX3A 3CCJV 4X1YB 3CCQV 1Y66A 1ZUQA 2DE0X 3K79A 4FLWA 4LF4O 4B3SB 4UCUA 1GN2A 5CB4B 3OW2U 5H2FZ 4DR4B 4K0KO 3UT5B 3CC4V 2JRIA 3AK1A 1PD3A 2ETNA 2FL4A 1QLEC 2RJZA 1VQ4V 4XDLA 2JK5C 2P90A 3HKEB 4Z1VA 1YHQV 4DV0O 1J95A 2OCHA 3JD1A 3GB7C 5KA6A 3K58A 3UO3A 1M56C 2LQTA 2EIKC 3X2QB 4QE9A 2AGAA 3N2GA 1KKCA 1OCZB 2N74A 3STLC 3TXQA 1N33B 4G2KA 2GV9A 4O4LB 1FXKB 3I5DA 4K35A 1ZL8A 4DV1O 2HHHB 3ZMZA 5CMUA 3G67A 4DV2B 1AR1B 4TUYB 1GM8A 3E2EA 4JYAO 3ICXA 2F66C 3G80A 3E35A 4GX2A 5JQGA 5KA5A 1TVKB 1VQNV 2VQEB 1NTKH 4X62O 1ZSPA 1NVPD 4QNHB 1KC8W 1RSOB 4MSWC 4C7UA 1GRJA 1YF2A 4DYLA 4O4IA 3D3IA 4DXWA 3ABKC 3Q4HA 4CS3A 2CK3G 1YDXA 1HR0O 2Y4UA 3QNEA 1FFXB 3BCCH 4PV1B 3AG2C 2B5UA 2R9IA 3H1JH 2BOBC 4O2BA 2DOSA 2VWKA 3U11A 5IT9N 2KSDA 3OTOO 1V55B 4RO2A 5EIBC 4ZIBA 2PI4A 4LFCO 1N32O 5IY5C 5JJNB 5LHIA 4I55A 3K08A 5JCOC 2AZ0A 1VARA 4LF8B 4MS2A 3RYIB 4QPJA 4DR6B 2EZOA 1QVFU 1HWYA 3OMNB 4UCOA 1J5EB 3HKDA 5KHJA 2FKXA 1AI4A 2YIBA 2ZXWC 2QWRB 3B09A 4MTFA 1CP9A 2ODMA 4PD4F 4GKJO 4PI0A 1YZBA 3CXHF 3FYIB 5K1PA 2E75B 4QJFB 5KX5A 2QR4A 1R3JC 4J42A 2A9HA 5TISZ 4IIJA 2KG7A 4DW0A 4RWUA 4OX9O 1AROP 3JYCA 3K5LA 5H6RA 1WN7A 3G6BA 4PA4A 1DTOA 5EC2C 1HDJA 2EBOA 2QGNA 1YIJV 3L9DA 5IYDO 5B1AB 3F5WC 2IJIA 4DR1O 4JAUA 2WLLB 1IBMB 2CDYA 2EULA 3E8BA 2OIEA 1W2BU 4AILC 3ABUA 5KAFZ 3CRMA 1K92A 1AI5A 2DYRC 2WLJA 1PNLA 2WA3A 2M7WA 4B3SO 1NKDA 3HKCA 4DR4O 3SJQC 1Q43A 3D3QA 5JH7A 4K3AA 1PNKA 2QM8A 1UPGA 2EILC 5J9PC 4G27B 1UJWB 1IBKB 5ITZA 1ORQC 4O4HB 3CJHB 1N0JA 3LDCA 1VQ5V 3H1HH 4RQFA 2D3OW 1JFFB 1H2NA 4JTCB 4CH6A 1I5YA 1M90W 2ZE5A 1N33O 1Y6XA 5CA3A 2UUCB 1NT2B 1NR1A 4UXNA 4TV8B 4U3JB 4YJ2A 2HHHO 4FLYA 4DV2O 4DV7B 1TUBB 1F7YA 2CTQA 3LUTB 4MVSA 1URFA 3ETDA 2VQEO 3TETA 2AXTZ 2ZR3A 4KL1A 2F95B 5C8YB 3AK3A 2GTAA 2DQ0A 1SA0A 2Q7EA 2X6BA 4JI6B 1QLEB 2QA4V 4J7KA 1W0JG 1BT8A 4Q20A 2VRZA 3W7SA 3OE7G 4DV5B 1EN5A 4TSFG 2Y69B 4G28B 1YTFD 4FM1A 1MZEA 1NVPB 4FVMA 5GTHZ 3CCVV 1M1KW 1TVKA 4BIZA 3JAWA 1GH6A 4NTXA 5F2VO 2GDSA 1RSOA 1R3KC 4JAVA 5H6QA 2DMXA 4H44B 3T1YB 3DXRB 3ASNB 1PV0A 1HNXO 3M8AA 1BS3A 2PUSA 5GONA 4IT5A 1M93A 2P6JA 2QWNB 4MVZA 2E3CA 4DRXB 3RN4A 2FMLA 2EJRA 2Q69A 1N0NA 1Q6IA 4KP4A 4J80A 3ABKB 2CH7B 1KBHA 4OGQB 1VF6C 2WLIB 3JAMN 2LW7A 4TOIA 3SYPA 3U10A 1H2GA 1JX9A 1L8DA 5IWAB 3SYQA 4PDRA 4DV4B 5IY5B 2IU0A 4R6ZA 2QWOB 1Q7YW 3OGCC 1H38A 3MHSC 5LXTB 1D2DA 1SQFA 1VQ8V 4DV6O 2A7WA 5HFLA 4LF6B 1IBKO 4WBNA 1HNZB 1ROPA 3OFNG 2DYSB 2YI9A 3KZIZ 3ZIAG 4F4LA 2WLLA 3MDSA 4PA9A 3N2KB 2GBOA 1LUVA 4PDMA 4QIWF 2P22C 1BGYH 4BIOA 2UUCO 4H13B 1U97A 4AHCA 1CEZA 5DEDA 1FKAO 5FNVA 1FPOA 1HP8A 2WSSG 1KP3A 1PP9H 4FK5C 4FM0A 1IXMA 1KQSU 3RYHB 5CA1B 1G1XB 4ZBMA 3QVNA 2Q7HA 1PKXA 1KKDA 3SPJA 1Z5WA 2DYRB 2ADPA 2XAGA 5IYBO 2ZNIA 2DW4A 1Y67A 3M7MX 5K1XA 4DR5B 4O4HA 1AJPA 3CJHA 1XI1A 5KHHA 3FB5C 1PNMA 5B1BB 2ZCEA 1SZXA 4ZHQB 3CPWU 4JI6O 1JFFA 1L1FA 3JD2A 3OUSA 1JMKC 4JGSA 1S0VA 1YJWV 1XMQO 1XQ8A 4DV5O 2RNBA 1COWG 2LFRA 1MG1A 3CWBH 3B40A 2ZE6A 4U3JA 5BY1A 1XNRO 1K5SA 3H1IH 5BMVB 2Q4PA 1Q86W 3F7YC 3JSNA 3HKBB 3RGBA 3ZEDA 1YCIA 1X59A 4I0XB 1K5QA 1YEWA 1OCRC 3IC9A 1WAZA 5LP6A 5KAIZ 3O9OA 5BZBA 3JD3A 4HBNA 4MVRA 2YEVA 5CA0B 1Y76B 3BY6A 3APOA 4IHJB 1BE3H 4H37A 3B77A 1VQ7V 3IJ4A 1RP3B 3KKYA 4I50B 4X1IA 3JCUZ 1FXVA 3ZMVA 1RM1C 3ZMSA 3AG4C 5LA6B 1VF7A 4LFCB 3A8TA 4KXRA 1GN4A 1R3IC 3K0GA 4LF5O 4BW5A 2ARHA 3W7TA 1W59A 2OYQA 4JZGA 3FX7A 1P7GA 4PDVA 4NVPA 3A0HZ 1GMGA 1E1RG
chains in the Genus database with same CATH topology
4YHHO 4NXNO 1FKAO 1HR0O 4JV5O 5IWAO 1G1XB 1IBMO 2DOSA 4A5UB 4DV4O 4DUYO 1NS1A 1HNXO 3J80N 1XEQA 5IT9N 4JI0O 3M8AA 3OTOO 4OPHA 4JI8O 5LL6Y 4X64O 4LF9O 5A2QN 5LMNO 2E5LO 4GKKO 2UUBO 4DV3O 3O65A 4DUZO 4LFCO 1N32O 5BR8O 2ZM6O 4LF4O 4NXMO 1N33O 4JI2O 4JI6O 3SDLA 4LF6O 4K0KO 1R6TA 2FKXA 3JAMN 2LW7A 2JRIA 2UUAO 1FJGO 1HNZO 2HHHO 1XMQO 4DV2O 4JI5O 4DV5O 5H5NA 1F7YA 4GKJO 3J7AU 4JI4O 1N34O 1YZBA 4YY3O 1AB3A 3F5TA 4JI1O 4B3TO 4KHPO 1HNWO 3T1YO 1IBLO 1XMOO 3T1HO 1A32A 2VQEO 1XNRO 5BY1A 3J81N 4DV0O 4DR2O 1N36O 2ZKOA 4X65O 1DK1A 4B3RO 1X59A 3RT3C 4OX9O 4LF8O 1D2DA 2AGAA 2Z0AA 1KUQA 4DR6O 5LMUO 1AILA 2N74A 2F4VO 1J5EO 2UXDO 1FYJA 1I94O 4DV6O 4DR1O 4OPAA 1IBKO 1R1BA 2UXBO 4DV1O 4DV7O 4LFBO 1XNQO 4LF7O 4LFAO 4JYAO 2DJVA 4X66O 2UXCO 5FLXN 4B3MO 5BXZA 4DR5O 4X62O 3R66A 2UU9O 4B3SO 4DR3O 4LF5O 2UUCO 4JI7O 4DR4O 4DR7O 2VQFO 4AQYO 4JI3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH O;  4NXN O;  1FKA O;  1HR0 O;  4JV5 O;  5IWA O;  1G1X B;  1IBM O;  2DOS A;  4A5U B;  4DV4 O;  4DUY O;  1NS1 A;  1HNX O;  3J80 N;  1XEQ A;  5IT9 N;  4JI0 O;  3M8A A;  3OTO O;  4OPH A;  4JI8 O;  5LL6 Y;  4X64 O;  4LF9 O;  5A2Q N;  5LMN O;  2E5L O;  4GKK O;  2UUB O;  4DV3 O;  3O65 A;  4DUZ O;  4LFC O;  1N32 O;  5BR8 O;  2ZM6 O;  4LF4 O;  4NXM O;  1N33 O;  4JI2 O;  4JI6 O;  3SDL A;  4LF6 O;  4K0K O;  1R6T A;  2FKX A;  3JAM N;  2LW7 A;  2JRI A;  2UUA O;  1FJG O;  1HNZ O;  2HHH O;  1XMQ O;  4DV2 O;  4JI5 O;  4DV5 O;  5H5N A;  1F7Y A;  4GKJ O;  3J7A U;  4JI4 O;  1N34 O;  1YZB A;  4YY3 O;  1AB3 A;  3F5T A;  4JI1 O;  4B3T O;  4KHP O;  1HNW O;  3T1Y O;  1IBL O;  1XMO O;  3T1H O;  1A32 A;  2VQE O;  1XNR O;  5BY1 A;  3J81 N;  4DV0 O;  4DR2 O;  1N36 O;  2ZKO A;  4X65 O;  1DK1 A;  4B3R O;  1X59 A;  3RT3 C;  4OX9 O;  4LF8 O;  1D2D A;  2AGA A;  2Z0A A;  1KUQ A;  4DR6 O;  5LMU O;  1AIL A;  2N74 A;  2F4V O;  1J5E O;  2UXD O;  1FYJ A;  1I94 O;  4DV6 O;  4DR1 O;  4OPA A;  1IBK O;  1R1B A;  2UXB O;  4DV1 O;  4DV7 O;  4LFB O;  1XNQ O;  4LF7 O;  4LFA O;  4JYA O;  2DJV A;  4X66 O;  2UXC O;  5FLX N;  4B3M O;  5BXZ A;  4DR5 O;  4X62 O;  3R66 A;  2UU9 O;  4B3S O;  4DR3 O;  4LF5 O;  2UUC O;  4JI7 O;  4DR4 O;  4DR7 O;  2VQF O;  4AQY O;  4JI3 O; 
#chains in the Genus database with same CATH topology
 1IVS A;  4BWA A;  4GKJ B;  5IWA O;  1WLE A;  2HR3 A;  4DV4 O;  3OTF A;  3G71 V;  4JI8 O;  4EB6 B;  4X9Q A;  5IDJ A;  2YS8 A;  3IC7 A;  3RWR D;  3SYO A;  3ZRW B;  2HVK C;  5L3B A;  5LOV B;  1Q81 W;  1LR1 A;  4JYY A;  4FLZ A;  4L8J A;  4TT3 G;  3ABT A;  3K0D A;  4YIP A;  2VS0 A;  3CCR V;  2Q6A A;  4LF6 O;  2L35 A;  4DRX A;  3EFF K;  4DR1 B;  3JAT A;  4QPK A;  1HNZ O;  2X6C A;  3TK1 A;  2GSM B;  2CH7 A;  4GX1 A;  2CGO A;  3WG7 C;  4JI4 O;  1XL6 A;  2B1I A;  1NZ6 A;  3IAY A;  2P4V A;  1OV9 A;  3KG2 A;  3RVZ A;  1I5X A;  3J81 N;  3BHP A;  4LF9 B;  3R65 A;  5E79 Z;  3A0B Z;  1P84 F;  3RBZ A;  5LGN A;  1WB8 A;  2RDC A;  1YSC A;  1NR7 A;  2FB5 A;  1KUQ A;  3F7V C;  1AIL A;  5HFM A;  4IL6 Z;  3CSX A;  4LWS B;  3ABL B;  3ZBH A;  2KB1 A;  2EIN C;  3SJA C;  2BSK A;  4D6T H;  3BRC A;  2BE3 A;  1GAX A;  2BCC H;  1OCO B;  3FB8 C;  2DJV A;  4O2A B;  5KUM A;  3K57 A;  1N34 B;  4PA6 A;  2XT9 A;  4DR5 O;  3TGU H;  2LW1 A;  3R66 A;  1SS3 A;  4JAS A;  2YUA A;  2UU9 O;  1K97 A;  4IYI A;  1KYO F;  4HYO A;  3N2K A;  2EIM B;  4WFE A;  1D5A A;  3BAA A;  1XHZ A;  4HNA B;  4I4T B;  3QG5 A;  4OPH A;  5A2Q N;  3BVO A;  3ZJZ A;  1Q90 D;  2ZE8 A;  3RYH A;  5CA1 A;  3D36 A;  1OCC C;  1VEW A;  2XAJ A;  2GHY A;  3OGI B;  4TQF A;  1WPX A;  5IYZ A;  5L3D A;  5D5Q A;  4DR7 B;  3UQ8 A;  1R6T A;  3CC7 V;  2WLN A;  2IJH A;  1N4C A;  1FAF A;  2ZDI C;  3FB6 C;  4JI3 B;  1M57 B;  4ZHQ A;  1AB3 A;  4YJ3 B;  4JF3 A;  3ASO C;  1M4U A;  4GX0 A;  2HP8 A;  5C93 A;  5EK0 A;  2W0X A;  4UVC A;  2MW2 B;  4GKK B;  4Z2W A;  3OD4 A;  3FFQ A;  2PYL A;  3FD9 A;  5J2T B;  2CAZ C;  3AG7 A;  3WFV A;  1S77 D;  1YJN V;  3E8H A;  3W7X A;  4PEL A;  2R9A A;  1BHA A;  4I0X A;  4ZOL A;  2V4D A;  3JD4 A;  1S3J A;  1BHB A;  1H2L A;  1HNX B;  4I9Q A;  4CH3 A;  1S76 D;  1WB7 A;  2Q8V A;  4J41 A;  4IHJ A;  2XAF A;  2IW5 A;  1R3L C;  3EXA A;  4ZI7 B;  4JPR A;  2PTM A;  1WJZ A;  2JGD A;  2OTL V;  4I50 A;  4PI2 A;  4X65 B;  3UM7 A;  4B3R B;  5FL7 G;  1Q5O A;  3DC6 A;  5B3S C;  4B7E A;  3ZHU A;  1NTZ H;  3SYC A;  1VQP V;  2X7R B;  5EZY A;  3VQV A;  4HZ3 A;  1EZV H;  4TWK A;  2UXD B;  3JAS B;  3JD0 A;  5B1O A;  3TXS A;  1RM1 B;  3AG1 B;  3KCY A;  4NR1 A;  3J80 N;  4LF9 O;  3H01 A;  2Z3Y A;  3L73 H;  1X4T A;  5J2U B;  4QGP A;  1KB9 F;  1V54 B;  2ITD C;  1L0L H;  1SQP H;  4EB6 A;  1K4D C;  3S3X A;  3JAK A;  3NR7 A;  3BPZ A;  4DV6 B;  1JR9 A;  3D8C A;  5LGU A;  3HR0 A;  1VP7 A;  3CEI A;  1S72 V;  4NXN B;  5DEC A;  3JAR B;  3P3P A;  2AHZ A;  1N34 O;  1Y74 B;  2ZT9 B;  1NQT A;  3RYC A;  4W4K A;  3ETE A;  4ZKI A;  2B1G A;  1JA8 A;  1IXB A;  2UUB B;  3P3N A;  2WA4 A;  2PZS A;  1IX9 A;  4X1Y A;  2OT5 A;  4PJ0 Z;  2KKW A;  2Z0A A;  4NXM B;  1CPY A;  5CB4 A;  4H0L B;  4OPA A;  4UCR A;  3UT5 A;  2N04 A;  3T4D A;  1FJG B;  2A3Q A;  1PL4 A;  1SES A;  4JI5 B;  3STZ C;  3ABM C;  3NXS A;  2LP7 A;  4MTO A;  3RFR A;  1SQV H;  2LO1 A;  1NH2 B;  3HKE A;  1XOU A;  5BXZ A;  1QCE A;  1XMO B;  4J10 A;  4DK1 A;  3SR2 C;  3CB2 A;  3CS5 A;  1K9M W;  5EBL C;  4U7N A;  5CBH A;  5LHG A;  4DR7 O;  2M6Y A;  5CBF A;  4JI3 O;  1XMQ B;  5LMU B;  5LBQ A;  3ZRX A;  2IJJ A;  4R50 A;  3EVK A;  4FFB B;  2W6I G;  3U0Z A;  1FXH A;  1WA8 B;  1B3Q A;  1JPX A;  4O4L A;  3JSL A;  4WFH A;  4J7J A;  1M56 B;  2XHB A;  1FXK A;  2EIK B;  3AG3 C;  2QTS A;  3DTU B;  1XNR B;  1XNQ B;  4TUY A;  4LFA B;  1QQC A;  5H9C A;  4GKK O;  4LR3 A;  5IJ9 B;  2UXC B;  1QR8 A;  4FZ0 A;  2A0L A;  3HB3 B;  1U96 A;  4P9P A;  4L87 A;  1AI7 A;  5L3E A;  1XHX A;  1TGO A;  4B7K A;  3CCU V;  1GN6 A;  3FAV B;  2HVJ C;  3KCX A;  5B5E Z;  1VQ9 V;  1K8A W;  3K9A A;  2ZNJ A;  3CCM V;  5CN0 A;  2WLK A;  5AG2 A;  4RAI A;  3ZRS A;  1I08 A;  3OR7 C;  1FFX A;  1QBZ A;  3L71 H;  1DGS A;  3VQW A;  4DUY B;  1OCC B;  4CC5 A;  2ZKO A;  4X65 O;  4X64 B;  2N05 A;  3L75 H;  3SGI A;  4LF5 B;  4NYK A;  4B3R O;  3RT3 C;  3QF7 A;  4YJ3 A;  5DN6 G;  1BMF G;  3BA9 A;  1IDS A;  3E83 A;  1CXZ B;  4MW8 A;  1H8H G;  3AG2 B;  5BR8 B;  4X89 A;  4F6R B;  1Z5V A;  2UXX A;  3RYI A;  2UXD O;  4JYB A;  4TV9 B;  2AZ2 A;  3S3W A;  3SPI A;  5J2T A;  3G6E V;  4UCT A;  4MTG A;  4BW9 A;  3E22 B;  4JI8 B;  3ZMT A;  4YY3 B;  1K34 A;  5FPR A;  3ZX6 A;  2Q5Z A;  3W7U A;  2H3O A;  3MHH C;  3OM3 B;  5IYC O;  1LNQ A;  3GWK C;  2ZXW B;  1P7B A;  2QTO A;  1QR9 A;  4MVU A;  1K4C C;  1WP8 A;  4ZI7 A;  1T5E A;  2XAS A;  4GLX A;  2XTA A;  1YVW A;  3DGE A;  3IFX A;  1K3E A;  3VOU A;  4NXN O;  5GTI Z;  2JS3 A;  5CBG A;  3X2Q C;  4JI4 B;  5E1A C;  1US6 A;  1OCZ C;  2NR5 A;  2VWJ A;  1WP7 A;  1Q6U A;  1M9N A;  4F6E A;  1S5L Z;  5JJE B;  3JAS A;  1ZAU A;  2WPD G;  1NI8 A;  5KUK A;  1FFT B;  2UUB O;  3VQX A;  4R8C A;  3APQ A;  2MK3 A;  2O57 A;  3N2G B;  4NXM O;  2DWD C;  4WFG A;  1UFI A;  4JI2 O;  3SDL A;  3TCU A;  3LSS A;  1AJQ A;  1FJG O;  2JJ2 G;  4X20 B;  1QVG U;  4JI5 O;  4DK0 A;  1PM9 A;  3SPH A;  1RFY A;  5JQG B;  4I9W A;  2Y0P A;  4NTW A;  2OTJ V;  1JVM A;  1IBL O;  1XMO O;  3IGA C;  4EEQ A;  3I56 V;  3B4S A;  4DR2 O;  1IUR A;  1F4N A;  2YID A;  2Y0I A;  3JAR A;  2UU9 B;  1P4R A;  2Z5U A;  2K1E A;  3CX5 F;  2EIL B;  4O4I B;  3ZHR A;  1V55 C;  2ADQ B;  3EHB B;  2QWQ B;  2Q0A A;  5LMU O;  1Q3E A;  3C90 A;  1B04 A;  5LYJ B;  3E8F A;  5KHI A;  2PGG A;  4TV8 A;  4K8Z A;  1BZK A;  5GW7 A;  4GT1 A;  1XNQ O;  5B1N A;  1TUB A;  4LFA O;  3CE2 A;  2QM7 A;  4JI1 B;  4B3T B;  2UXC O;  1AVM A;  3CRQ A;  3SJC C;  5JVD B;  3L74 H;  1G6U A;  1OHH G;  5FPO A;  3HKD B;  5D5P A;  3T2M A;  1Q82 W;  5C8Y A;  2H8P C;  4P9O A;  2H94 A;  2OCC C;  2X0L A;  1SQQ H;  3OUF A;  2F43 G;  1VQL V;  3ABM B;  2HJF C;  1I7F A;  5KX5 B;  2ZR2 A;  4DUY O;  1MSD A;  1OZ0 A;  2YXH A;  4D7T A;  4X64 O;  2L6L A;  5B1A C;  4LF7 B;  4CH4 A;  2KG7 B;  3GWO A;  1WA8 A;  3O65 A;  4BAY A;  5BR8 O;  3QO7 A;  1S5J A;  4UV8 A;  2JGU A;  3P32 A;  4DR3 B;  4W4L A;  3CP1 A;  1QLN A;  3ZMU A;  5KMG B;  2UUA O;  1N8R W;  2NLJ C;  1GO3 F;  2FYU H;  3MD0 A;  4TQD A;  5H5N A;  1R6N A;  1F51 A;  4JV5 B;  3FAV A;  4YY3 O;  3K59 A;  5A9G A;  2RCV A;  1GM9 A;  3DXR A;  4JI0 B;  2YI8 A;  3HKC B;  3ETQ A;  1K7D A;  4QE7 A;  4DO2 A;  2RQ6 A;  1JJO A;  3K04 A;  3LNM B;  2XAH A;  4X88 A;  3L70 H;  1KU9 A;  1ZTE A;  2JEU A;  1H2S B;  2GUZ B;  5DM6 V;  5JH7 B;  1TAE A;  3THO A;  2JJ1 G;  1GN3 A;  1K33 A;  3SPC A;  2CTR A;  2WLI A;  1R73 A;  2EIJ C;  4MVQ A;  4KUM A;  1I0H A;  3LDE A;  2XND G;  1YIT V;  1HW7 A;  3SYA A;  4FMT A;  1OJH A;  1YI2 V;  4B3M O;  2P7T C;  3UO2 A;  5JCO A;  2F1M A;  4YXW G;  4K8X A;  4X1K B;  1SZT A;  5LP6 C;  5EC1 C;  3BEH A;  4YJ2 B;  5LXT A;  1BL8 A;  3H1K H;  2YIC A;  1NH2 D;  4CS4 A;  3H9V A;  3CXC U;  1EM1 A;  3WB1 A;  2CUG A;  2CTP A;  4FZ1 A;  4LFB B;  3FB7 C;  1DF4 A;  4N23 A;  2HLD G;  1B06 A;  1F23 A;  5EBM C;  1JQ0 A;  4FFK A;  1SQX H;  4LP8 A;  1EBO A;  2Y69 C;  1SA0 B;  1NTM H;  2WLH A;  1R6K A;  4CS2 A;  1GM7 A;  2BTO A;  4GCZ A;  2E74 B;  2DN9 A;  2Q68 A;  4YHH B;  3K5M A;  3E86 A;  2QM4 A;  2QSA A;  2D2C B;  4FLU A;  3F5T A;  4JI1 O;  4B3T O;  3ZCC A;  1A32 A;  4GUN A;  4X20 A;  4OXS A;  4FM2 A;  1XBL A;  2EZP A;  3ASN C;  4RQE A;  4WFA V;  3CMA V;  3JAW B;  2YDE A;  2YXL A;  1EN4 A;  1FS0 G;  2IM9 A;  4ICG A;  1SQG A;  1R1B A;  2PF4 E;  3HPL C;  4GX5 A;  1GK9 A;  2UXB O;  2HG5 C;  4MT8 A;  5GON B;  4LF7 O;  2WWW A;  2R9R B;  3VBB A;  5LYJ A;  4KHP B;  1DLB A;  5FLX N;  1AP5 A;  4MVM A;  1N36 B;  2IU3 A;  5BMV A;  3DC5 A;  3AK2 A;  4DR3 O;  4J9Y B;  3HKB A;  1VF5 B;  3WU2 Z;  4WFF A;  5EIB D;  1GKF A;  5JVD A;  3BA8 A;  2RN9 A;  4X8A A;  2C2A A;  5CA0 A;  4JAA A;  4EKW A;  1Y76 A;  1NU1 H;  1I94 B;  1YJ9 V;  4JV5 O;  2IJK A;  5EBW C;  4LBE C;  2G38 A;  4LH6 A;  4A5U B;  2Q73 A;  3TJT A;  1OCR B;  1XEQ A;  4JI0 O;  4DW1 A;  1JCH A;  4UVA A;  3L72 H;  5LA6 A;  3OT7 A;  2DYS C;  3OAA G;  3M99 B;  2OCC B;  1TUE B;  5JWP A;  2Y48 A;  3A0R A;  1Y4M A;  3CCE V;  3AG4 B;  4WBN B;  4JTA B;  2KQX A;  2P5O A;  1XDC A;  2R72 A;  4Q6G A;  1MNG A;  4R7C A;  4RUF A;  4AQY B;  2JS5 A;  2LGQ A;  3J7A U;  1MSW D;  2X6A A;  4CH5 A;  3ZS8 C;  1ZX3 A;  3RW0 A;  5KMG A;  1TA8 A;  2WAM A;  3LSQ A;  1KP2 A;  3PJS K;  4PA3 A;  4LNU B;  3WB2 A;  2A79 B;  2HKO A;  1ZWI C;  2XAQ A;  3D36 C;  4JTD B;  3ZRW A;  4DV3 B;  4DUZ B;  5LOV A;  3JAL B;  1EZJ A;  2B9Z A;  5FNV B;  2HEP A;  3K5O A;  1FYJ A;  4FIP C;  4CZZ A;  5IE9 A;  2YIA A;  1H2K A;  5EYP B;  3CRC A;  2GUZ A;  1XL4 A;  4P30 A;  4EFE A;  5B1B C;  4LFB O;  3W7W A;  3ZHT A;  3ZHV A;  2P06 A;  4FJC C;  1MAB G;  3T1H B;  1NJI W;  3ETG A;  4FPP A;  4Z1M G;  2JIZ G;  4JI2 B;  3WG7 B;  3QO8 A;  1VF6 A;  3OMA B;  2EIJ B;  1W0K G;  1RPR A;  4WF9 V;  3DSQ A;  2IH3 C;  2CGN A;  4YHH O;  1G4Y B;  2V7Q G;  4UB6 Z;  3H1L H;  4O4J B;  1P49 A;  5LGT A;  2F4V B;  4X1K A;  4LWS A;  1L0N H;  1PL0 A;  2LFS A;  2QJ1 A;  4LCU C;  1IBL B;  1D5N A;  5B66 Z;  4DR2 B;  1S5H C;  4FLX A;  5LL6 Y;  1Z2G A;  4X66 B;  4O2A A;  3ZN1 A;  1EN6 A;  5LP6 B;  2HJD A;  1RPO A;  2YIB D;  2EIN B;  2JEX A;  2YEV B;  1MA1 A;  3QTC A;  4XDJ A;  1ZLZ A;  3E8G A;  4RUE A;  3E89 A;  4JI7 B;  1SET A;  3CRR A;  2VQF B;  1BSM A;  1WNS A;  2ZE7 A;  4FLV A;  4X1I B;  1VQ6 V;  1VQM V;  1LUW A;  2ITC C;  1VQO V;  2XOK G;  2P4K A;  3B8M A;  5LHH A;  4KHP O;  4HNA A;  2F93 B;  3BAB A;  4I4T A;  3K5N A;  2HFE C;  3AEI A;  5KHK A;  1N36 O;  1H2M A;  1E1Q G;  2P67 A;  3LSU A;  4EFB A;  4MVO A;  5KLV H;  5JJJ B;  4MW3 A;  1BQ0 A;  4WCE V;  3ZRV A;  2BTQ B;  2DWE C;  2Q67 A;  2ZM6 B;  4LF8 O;  3CCS V;  4DR6 O;  5IJ0 B;  3GVM A;  3RYF B;  1J5E O;  1I94 O;  2IBZ H;  1AI6 A;  3FYE B;  1F4M A;  3OEH G;  1JJ2 U;  1KMI Z;  3SPG A;  1GTO A;  1EFR G;  2NN4 A;  1SKV A;  3G4S V;  3B8N A;  1SF9 A;  4IGG A;  3QO5 A;  4PDL A;  3T1C A;  1PPJ H;  1HNW B;  2OIG A;  4I7Z B;  4XBF A;  1XRE A;  3T4Z A;  3LNN A;  2QDO A;  4GYC B;  3JAT B;  4E4E A;  3ASO B;  4J11 A;  1O9G A;  2UUA B;  4AQY O;  1AP6 A;  2JDI G;  2CE4 A;  4NKG B;  1AJN A;  1IBM O;  1SC5 B;  1NS1 A;  3ABL C;  4UVB A;  2PYJ A;  1BQZ A;  2QEX V;  1AR4 A;  4J7Z A;  4DV3 O;  4IYH A;  4DUZ O;  2ILM A;  1Q8I A;  2YXY A;  3ZHQ A;  1OCO C;  1NBM G;  3CD6 V;  3CRA A;  2NNU A;  3C3T A;  2Q9L A;  4UCV A;  1YXB A;  2BSK B;  2R70 A;  3P30 A;  3K3W A;  4UUJ C;  1VIB A;  3OR6 C;  3OEE G;  1KEC A;  1SRY A;  2DQ3 A;  4PA7 A;  1FXK C;  2EIM C;  4B3M B;  3T1H O;  4B08 A;  2W0F C;  1DF5 A;  5B3S B;  2YC0 A;  4PHZ A;  1MOF A;  4NTY A;  5LMN B;  2E5L B;  4I5S A;  5J2U A;  1AR5 A;  4UV9 A;  2Q7G A;  1ZL8 B;  1K73 W;  2W6J G;  4LF4 B;  4LNU A;  2JVD A;  2F4V O;  2BOC C;  3OMI B;  4K0K B;  4D7S A;  3JAL A;  2RMK B;  4DV7 O;  1BCC H;  2IH1 C;  4E2L A;  4X66 O;  2YSU B;  4JYC A;  1MMM A;  4N21 A;  1Y74 A;  5EYP A;  4MTX A;  1M57 C;  4DV0 B;  3A2F A;  3Q4H B;  1H8E G;  4P2Z A;  2XUM A;  5IYZ B;  2ZIN A;  1JOY A;  3C3S A;  3PN1 A;  3K9S A;  4JI7 O;  1VMG A;  4AI8 A;  3CYO A;  2VQF O;  4O2B B;  4WFB V;  3BFR A;  1G8M A;  4BR6 A;  3RVY A;  4LH7 A;  2OWO A;  4I55 B;  4DV1 B;  2FTK A;  1XIL A;  4O4J A;  5L3G A;  4JYA B;  1ENV A;  2LGW A;  1IZ3 A;  4YIO A;  1QU7 A;  3CCL V;  2ZD9 A;  3SJB C;  5L3C A;  4X62 B;  2ZM6 O;  4UB8 Z;  3CHX A;  4ZOL B;  3LDD A;  2AW9 A;  3JCZ A;  3I55 V;  2LJ2 A;  1THZ A;  1VQK V;  2A06 H;  2UXB B;  3CME V;  4HAM A;  5L3F A;  4IIJ B;  1HR0 B;  3N27 A;  4NB5 A;  1Q6H A;  2GTS A;  4FFB A;  4J9Z B;  1B6Q A;  1HNW O;  2ZQM A;  3CC2 V;  2JGD B;  2ZIM A;  3T1Y O;  1XUQ A;  3ZHS A;  5KHG A;  3OTO B;  4KFM A;  1DK1 A;  4ASU G;  3VQY A;  3AG1 C;  5IJ9 A;  1YTF B;  1QNM A;  1N32 B;  2QKA A;  4ABM A;  3B2E E;  4LC1 A;  5EZY B;  2EJ7 A;  1QHT A;  3K06 A;  4CBC A;  3AG3 B;  2QKS A;  1M5I A;  2AHY A;  3UKM A;  1V54 C;  4CC6 A;  1WPB A;  2PY5 A;  2BTQ A;  4H33 A;  1SQB H;  1KD1 W;  2QKC A;  2QWP B;  3ML0 A;  1O9H A;  5IJ0 A;  2QE7 G;  3ZN0 A;  2Q0O C;  2Y4T A;  3RYF A;  2WLM A;  2F23 A;  2ZIO A;  1SER A;  2ATK C;  2E76 B;  1V9P A;  4JZ2 A;  4U3F H;  3JAK B;  4OX9 B;  3FKS G;  2UXN A;  3WB0 A;  4UFZ A;  5ITZ B;  3MAQ A;  2ZDI A;  4F6R A;  2CTW A;  2K9P A;  1MZF A;  4XDK A;  4TV9 A;  2PI5 A;  4GZR B;  3RYC B;  1E79 G;  4BIU A;  3E22 A;  3UCS C;  1FD9 A;  4UCS A;  4U7O A;  5LMN O;  2E5L O;  4FLT A;  3K03 A;  2V1D A;  2EX3 A;  3CCJ V;  4X1Y B;  3CCQ V;  1Y66 A;  1ZUQ A;  2DE0 X;  3K79 A;  4FLW A;  4LF4 O;  4B3S B;  4UCU A;  1GN2 A;  5CB4 B;  3OW2 U;  5H2F Z;  4DR4 B;  4K0K O;  3UT5 B;  3CC4 V;  2JRI A;  3AK1 A;  1PD3 A;  2ETN A;  2FL4 A;  1QLE C;  2RJZ A;  1VQ4 V;  4XDL A;  2JK5 C;  2P90 A;  3HKE B;  4Z1V A;  1YHQ V;  4DV0 O;  1J95 A;  2OCH A;  3JD1 A;  3GB7 C;  5KA6 A;  3K58 A;  3UO3 A;  1M56 C;  2LQT A;  2EIK C;  3X2Q B;  4QE9 A;  2AGA A;  3N2G A;  1KKC A;  1OCZ B;  2N74 A;  3STL C;  3TXQ A;  1N33 B;  4G2K A;  2GV9 A;  4O4L B;  1FXK B;  3I5D A;  4K35 A;  1ZL8 A;  4DV1 O;  2HHH B;  3ZMZ A;  5CMU A;  3G67 A;  4DV2 B;  1AR1 B;  4TUY B;  1GM8 A;  3E2E A;  4JYA O;  3ICX A;  2F66 C;  3G80 A;  3E35 A;  4GX2 A;  5JQG A;  5KA5 A;  1TVK B;  1VQN V;  2VQE B;  1NTK H;  4X62 O;  1ZSP A;  1NVP D;  4QNH B;  1KC8 W;  1RSO B;  4MSW C;  4C7U A;  1GRJ A;  1YF2 A;  4DYL A;  4O4I A;  3D3I A;  4DXW A;  3ABK C;  3Q4H A;  4CS3 A;  2CK3 G;  1YDX A;  1HR0 O;  2Y4U A;  3QNE A;  1FFX B;  3BCC H;  4PV1 B;  3AG2 C;  2B5U A;  2R9I A;  3H1J H;  2BOB C;  4O2B A;  2DOS A;  2VWK A;  3U11 A;  5IT9 N;  2KSD A;  3OTO O;  1V55 B;  4RO2 A;  5EIB C;  4ZIB A;  2PI4 A;  4LFC O;  1N32 O;  5IY5 C;  5JJN B;  5LHI A;  4I55 A;  3K08 A;  5JCO C;  2AZ0 A;  1VAR A;  4LF8 B;  4MS2 A;  3RYI B;  4QPJ A;  4DR6 B;  2EZO A;  1QVF U;  1HWY A;  3OMN B;  4UCO A;  1J5E B;  3HKD A;  5KHJ A;  2FKX A;  1AI4 A;  2YIB A;  2ZXW C;  2QWR B;  3B09 A;  4MTF A;  1CP9 A;  2ODM A;  4PD4 F;  4GKJ O;  4PI0 A;  1YZB A;  3CXH F;  3FYI B;  5K1P A;  2E75 B;  4QJF B;  5KX5 A;  2QR4 A;  1R3J C;  4J42 A;  2A9H A;  5TIS Z;  4IIJ A;  2KG7 A;  4DW0 A;  4RWU A;  4OX9 O;  1ARO P;  3JYC A;  3K5L A;  5H6R A;  1WN7 A;  3G6B A;  4PA4 A;  1DTO A;  5EC2 C;  1HDJ A;  2EBO A;  2QGN A;  1YIJ V;  3L9D A;  5IYD O;  5B1A B;  3F5W C;  2IJI A;  4DR1 O;  4JAU A;  2WLL B;  1IBM B;  2CDY A;  2EUL A;  3E8B A;  2OIE A;  1W2B U;  4AIL C;  3ABU A;  5KAF Z;  3CRM A;  1K92 A;  1AI5 A;  2DYR C;  2WLJ A;  1PNL A;  2WA3 A;  2M7W A;  4B3S O;  1NKD A;  3HKC A;  4DR4 O;  3SJQ C;  1Q43 A;  3D3Q A;  5JH7 A;  4K3A A;  1PNK A;  2QM8 A;  1UPG A;  2EIL C;  5J9P C;  4G27 B;  1UJW B;  1IBK B;  5ITZ A;  1ORQ C;  4O4H B;  3CJH B;  1N0J A;  3LDC A;  1VQ5 V;  3H1H H;  4RQF A;  2D3O W;  1JFF B;  1H2N A;  4JTC B;  4CH6 A;  1I5Y A;  1M90 W;  2ZE5 A;  1N33 O;  1Y6X A;  5CA3 A;  2UUC B;  1NT2 B;  1NR1 A;  4UXN A;  4TV8 B;  4U3J B;  4YJ2 A;  2HHH O;  4FLY A;  4DV2 O;  4DV7 B;  1TUB B;  1F7Y A;  2CTQ A;  3LUT B;  4MVS A;  1URF A;  3ETD A;  2VQE O;  3TET A;  2AXT Z;  2ZR3 A;  4KL1 A;  2F95 B;  5C8Y B;  3AK3 A;  2GTA A;  2DQ0 A;  1SA0 A;  2Q7E A;  2X6B A;  4JI6 B;  1QLE B;  2QA4 V;  4J7K A;  1W0J G;  1BT8 A;  4Q20 A;  2VRZ A;  3W7S A;  3OE7 G;  4DV5 B;  1EN5 A;  4TSF G;  2Y69 B;  4G28 B;  1YTF D;  4FM1 A;  1MZE A;  1NVP B;  4FVM A;  5GTH Z;  3CCV V;  1M1K W;  1TVK A;  4BIZ A;  3JAW A;  1GH6 A;  4NTX A;  5F2V O;  2GDS A;  1RSO A;  1R3K C;  4JAV A;  5H6Q A;  2DMX A;  4H44 B;  3T1Y B;  3DXR B;  3ASN B;  1PV0 A;  1HNX O;  3M8A A;  1BS3 A;  2PUS A;  5GON A;  4IT5 A;  1M93 A;  2P6J A;  2QWN B;  4MVZ A;  2E3C A;  4DRX B;  3RN4 A;  2FML A;  2EJR A;  2Q69 A;  1N0N A;  1Q6I A;  4KP4 A;  4J80 A;  3ABK B;  2CH7 B;  1KBH A;  4OGQ B;  1VF6 C;  2WLI B;  3JAM N;  2LW7 A;  4TOI A;  3SYP A;  3U10 A;  1H2G A;  1JX9 A;  1L8D A;  5IWA B;  3SYQ A;  4PDR A;  4DV4 B;  5IY5 B;  2IU0 A;  4R6Z A;  2QWO B;  1Q7Y W;  3OGC C;  1H38 A;  3MHS C;  5LXT B;  1D2D A;  1SQF A;  1VQ8 V;  4DV6 O;  2A7W A;  5HFL A;  4LF6 B;  1IBK O;  4WBN A;  1HNZ B;  1ROP A;  3OFN G;  2DYS B;  2YI9 A;  3KZI Z;  3ZIA G;  4F4L A;  2WLL A;  3MDS A;  4PA9 A;  3N2K B;  2GBO A;  1LUV A;  4PDM A;  4QIW F;  2P22 C;  1BGY H;  4BIO A;  2UUC O;  4H13 B;  1U97 A;  4AHC A;  1CEZ A;  5DED A;  1FKA O;  5FNV A;  1FPO A;  1HP8 A;  2WSS G;  1KP3 A;  1PP9 H;  4FK5 C;  4FM0 A;  1IXM A;  1KQS U;  3RYH B;  5CA1 B;  1G1X B;  4ZBM A;  3QVN A;  2Q7H A;  1PKX A;  1KKD A;  3SPJ A;  1Z5W A;  2DYR B;  2ADP A;  2XAG A;  5IYB O;  2ZNI A;  2DW4 A;  1Y67 A;  3M7M X;  5K1X A;  4DR5 B;  4O4H A;  1AJP A;  3CJH A;  1XI1 A;  5KHH A;  3FB5 C;  1PNM A;  5B1B B;  2ZCE A;  1SZX A;  4ZHQ B;  3CPW U;  4JI6 O;  1JFF A;  1L1F A;  3JD2 A;  3OUS A;  1JMK C;  4JGS A;  1S0V A;  1YJW V;  1XMQ O;  1XQ8 A;  4DV5 O;  2RNB A;  1COW G;  2LFR A;  1MG1 A;  3CWB H;  3B40 A;  2ZE6 A;  4U3J A;  5BY1 A;  1XNR O;  1K5S A;  3H1I H;  5BMV B;  2Q4P A;  1Q86 W;  3F7Y C;  3JSN A;  3HKB B;  3RGB A;  3ZED A;  1YCI A;  1X59 A;  4I0X B;  1K5Q A;  1YEW A;  1OCR C;  3IC9 A;  1WAZ A;  5LP6 A;  5KAI Z;  3O9O A;  5BZB A;  3JD3 A;  4HBN A;  4MVR A;  2YEV A;  5CA0 B;  1Y76 B;  3BY6 A;  3APO A;  4IHJ B;  1BE3 H;  4H37 A;  3B77 A;  1VQ7 V;  3IJ4 A;  1RP3 B;  3KKY A;  4I50 B;  4X1I A;  3JCU Z;  1FXV A;  3ZMV A;  1RM1 C;  3ZMS A;  3AG4 C;  5LA6 B;  1VF7 A;  4LFC B;  3A8T A;  4KXR A;  1GN4 A;  1R3I C;  3K0G A;  4LF5 O;  4BW5 A;  2ARH A;  3W7T A;  1W59 A;  2OYQ A;  4JZG A;  3FX7 A;  1P7G A;  4PDV A;  4NVP A;  3A0H Z;  1GMG A;  1E1R G; 
#chains in the Genus database with same CATH homology
 4YHH O;  4NXN O;  1FKA O;  1HR0 O;  4JV5 O;  5IWA O;  1G1X B;  1IBM O;  2DOS A;  4A5U B;  4DV4 O;  4DUY O;  1NS1 A;  1HNX O;  3J80 N;  1XEQ A;  5IT9 N;  4JI0 O;  3M8A A;  3OTO O;  4OPH A;  4JI8 O;  5LL6 Y;  4X64 O;  4LF9 O;  5A2Q N;  5LMN O;  2E5L O;  4GKK O;  2UUB O;  4DV3 O;  3O65 A;  4DUZ O;  4LFC O;  1N32 O;  5BR8 O;  2ZM6 O;  4LF4 O;  4NXM O;  1N33 O;  4JI2 O;  4JI6 O;  3SDL A;  4LF6 O;  4K0K O;  1R6T A;  2FKX A;  3JAM N;  2LW7 A;  2JRI A;  2UUA O;  1FJG O;  1HNZ O;  2HHH O;  1XMQ O;  4DV2 O;  4JI5 O;  4DV5 O;  5H5N A;  1F7Y A;  4GKJ O;  3J7A U;  4JI4 O;  1N34 O;  1YZB A;  4YY3 O;  1AB3 A;  3F5T A;  4JI1 O;  4B3T O;  4KHP O;  1HNW O;  3T1Y O;  1IBL O;  1XMO O;  3T1H O;  1A32 A;  2VQE O;  1XNR O;  5BY1 A;  3J81 N;  4DV0 O;  4DR2 O;  1N36 O;  2ZKO A;  4X65 O;  1DK1 A;  4B3R O;  1X59 A;  3RT3 C;  4OX9 O;  4LF8 O;  1D2D A;  2AGA A;  2Z0A A;  1KUQ A;  4DR6 O;  5LMU O;  1AIL A;  2N74 A;  2F4V O;  1J5E O;  2UXD O;  1FYJ A;  1I94 O;  4DV6 O;  4DR1 O;  4OPA A;  1IBK O;  1R1B A;  2UXB O;  4DV1 O;  4DV7 O;  4LFB O;  1XNQ O;  4LF7 O;  4LFA O;  4JYA O;  2DJV A;  4X66 O;  2UXC O;  5FLX N;  4B3M O;  5BXZ A;  4DR5 O;  4X62 O;  3R66 A;  2UU9 O;  4B3S O;  4DR3 O;  4LF5 O;  2UUC O;  4JI7 O;  4DR4 O;  4DR7 O;  2VQF O;  4AQY O;  4JI3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...