4PHZA

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
388
structure length
388
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 94
structure length 388
sequence length 388
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4phzA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4phzA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4phzA01
4O65A 3RFRA 3CHXA 4PI0A 4PHZA 3RGBA 4PI2A 1YEWA
chains in the Genus database with same CATH superfamily
4QQOA 3BAYA 4LBEC 1RZ8A 2YKLL 3FF8A 5J1XA 1NAEA 4HS8H 5IVYA 5AW4B 5JOEA 5IYCO 3V0BB 4EQ3A 1G7JB 4HHWA 1FRGL 2YBRB 4MUVA 4FXLA 1KBWA 4KJWD 3FZ3A 1O5DT 1C1LA 2BP3A 4GG8A 1RIVH 2FX7L 3GZOA 4M5TA 4MXQD 4NQEE 4PFEA 1I9RL 4LHJB 5DQ9A 1J3RA 3N9LA 5I1LB 2A1WL 4PREB 4N43A 4KHTH 3G6JE 4K8XA 2OMTB 4P2QE 4ANXA 3WIFB 4NCC1 1N34O 1S5IH 1G6NA 4PRIA 5J6GA 4BUQA 2QGCA 1U3HA 5CFDC 2PHXA 3HT1A 2NY4D 3RFRA 1FL3A 5EFIA 2G9FA 4QO1B 5AVUB 3HE6A 4U1JB 4M5ZH 1W6OA 3HOGA 1YHPA 2XVGA 1D5AA 3ULUH 2J5WA 5IJ9A 2VDQH 1NS1A 3O8XA 3CFUA 3RGBA 4XP5H 4EEEA 2OIIA 2A73A 3S35H 3HG3A 3JWOL 3U6XA 3HI5H 3KPRE 1OT5A 3TRSB 1CMOA 1VRH1 1OEZW 2DKMA 1K5JA 4U1GC 1RLBA 5FYJU 5J3HD 1OKOA 1F86A 2JDYA 1W6NA 4V1DB 5FYCA 1GYWA 4K3AA 4GRLC 2P5WA 4J41A 1QVGU 1PEZA 3SQBB 1KJ2B 2XZQL 1MW0A 1IFHH 3DO3A 3VUOA 3KYMB 3OXRB 5KAQG 2QWOB 1BMV1 3NFSH 4WUUB 4M0NA 1J12A 2WWMC 1AKJB 5FMDA 3VOUA 2JJ1G 2NR5A 1N6UA 2X4NA 1JHKL 2XZCL 2FNBA 4MHHG 5CSGA 1J8HB 4MQ7A 4OQTL 4Y16C 1NEUA 1ZLEA 1OUSA 2HKFH 4O2AB 2A83A 1T1YA 2BVYA 2QJDA 3WENA 1S9YB 4UCFA 3H8RA 1PKOA 4RS5C 4DH2A 3UZEC 1ULPA 4KP4A 1SMAA 2AJSL 2GCYB 5AW2B 4E5XA 4UT5A 3E2HB 2JQMA 2OTUB 3P11L 3V4LA 3VXPA 3JD73 4NSKA 3IBEA 2BTOA 4YGCA 3N2GB 2HP4A 2ZGNA 5AVTB 1FFOB 2J8HA 2OCCC 4DR6B 2VXQA 2XG5A 1Z0MA 3V65A 1ES0A 3H9AA 1C8QA 1PGW2 1T5XB 4MSWB 2ERJB 3E3QC 3D0AA 1CDBA 3GMPA 3U75A 2NSMA 3UTTA 2VDRB 5LGJB 2AC0A 4PA9A 3T1LA 4NT6A 1UXZA 4TOYH 2YDEA 3FULA 4X1KA 4KWLA 3RSJA 2D6NA 1NAKL 1UZ8A 3BYTA 3D0LB 3H55A 4JGUA 5E1RA 3IDIA 2J57A 3UAFA 1WKYA 5CAZA 2ZGQA 4WTWA 4GIOA 1UJWB 4UCRA 3KH3A 3AJZA 4U3SB 2WMPB 4L87A 3L3OB 2N0MA 1RVFL 4M6ML 4YVSC 1PZ8A 3SJBC 1SVBA 5AZ2L 1MCQA 4KZEL 2Y7LA 1LU1A 1JGDB 4DV3B 3WIIH 3BH8A 1OPMA 5DHVB 5B1JA 2J1UA 3AP6A 1KYUA 4IV3A 2XJPA 4Z7NB 1WB7A 3VXUE 1AGCA 2ENSA 4DV0B 1IGTB 3UP1A 5I15L 1JRHI 4W9KC 1QJZA 3INAA 3ZTJH 5GSVB 1FFXB 3VI3A 3GUFA 1OE2A 2EUZA 4YDIH 4MXWB 3MA7B 2OPWA 3UT0A 3NIGF 4N85A 3ZFEA 3BJLA 3TBTB 3GZUC 1OCRB 4QGPA 3JWDH 4J10A 3CF6E 2YD9A 2WK2A 3FRUA 4HS8L 2AV7A 3AKTA 1JNNH 4YIOA 5EIBD 2BVPB 1UADC 4XNMB 3FUNA 4HPYH 3VQXA 3A67H 4U4IA 5CIPA 5FWQA 3MRGA 3UKMA 1UUSA 2HN7B 3PWUA 3KGSA 1RIVL 2WNUA 1MF2H 4BMEA 3RWJA 3SDLA 3IT8D 1P4LB 4B1LA 3Q8EA 1HXKA 4KHTL 3SE3A 5CBAB 1UWYA 2Z93A 3MJGX 1HIMH 2EKSB 3HRZA 4LKCB 4FPOB 2A6JB 3FUMA 3NACH 3RGVA 4CP1A 1QEWB 1XIWA 1TUBB 4ZUVA 4KO9A 3ABZA 1RUPH 4G7VH 3KL3A 2X4RA 4K71C 3ZTJG 5SWSB 4G42A 5FMBA 1JGUH 3QUHA 4QHNA 4E4DX 2ZF8A 5I73B 3SKMB 5LO7A 2XLAA 4TUYA 2UZYA 3ULUL 3RWFA 4A6SA 2GIXA 2VDQL 1W9SA 3D39E 1UACL 4XP5L 2DYCA 4F15C 1CDYA 3S35L 3WQ0A 4AWDA 4ZPVA 5C7XH 3CC5A 2FHFA 1O9HA 3HBQA 3HI5L 3HPLA 3MRNB 3LFIA 2ZUYA 4DRRA 1NDGA 4LNUB 1T89C 3K0WA 4XDLA 4YFLI 4BDVA 3KT4A 5LHIA 1WWAX 1HB1A 3B00A 4CVXA 1NBZB 3E5QA 5B1BB 3ABUA 1QXPA 4BSJA 1CIUA 1IFHL 3VL9A 1PNFA 5SWZB 4N2MA 1MS5A 4Y1UA 5L9RA 4KFMA 4COZA 3BAEH 5FO2A 4PA6A 3LB6C 3HIFA 2N3JA 2Z0UA 2ZKNA 1A9EA 1K8DB 1Y9QA 2G38A 3FT4A 1B3JA 2HKFL 3FQXA 3GM8A 4WWNA 1OD5A 3LOWA 1J48A 4A7GF 3IMTA 4JYCA 2LRPA 4CH5A 4LK4A 3FCBA 2H1PH 3L5WA 3AREC 4Y2DA 3AS2A 2JD9A 4GH4A 3GSVB 2A6KB 1NGXA 1SJMA 2VZ1A 3FW6A 4CBPA 1O5LA 4KUMA 3TJHC 3MAQA 4D0DA 2FR4A 1A6UH 1TJIL 3GALA 3QCTH 1AR63 4ZU7A 1R6TA 1TMQA 2QADB 1D9KB 3BVNA 3UPCA 3PWVB 2AUYA 1SRYA 2DWDC 1OW0C 4ODXB 3ICXA 1FWXA 1IDSA 4KQ0A 1FZKA 1NFDB 4L2LA 4LLYA 3PUIA 1MJ7H 4TOYL 2A74A 1OAQL 3QE5A 2ZJCA 2HJKA 1BD2E 2XJKA 3QDMA 4MX7B 3O65A 1QW8A 2UUDH 3IGUA 2RDNA 3IETA 3LN5A 3OMZA 5ACMA 3HKDB 3HMXA 1AYM2 4UFLA 5I1DA 1WFOA 4AYUA 1UATA 1JBJA 5D7IB 3MV7B 3UC2A 4I3PA 1DBBL 3MRQB 1JERA 3ZFGB 1HXYA 2VR4A 2ZXBA 4ATTA 2F95B 1CGYA 5ES4B 3WB2A 4EQVA 3MW2A 5B8CB 2WHVA 1AHKA 2VL4A 1MLBA 3LKSA 3LQZA 3NJKA 3WIIL 3MBED 4ZMTA 3E22B 1BXHA 1DYKA 5AKSA 3ISWA 4X5QA 4DR4O 2DWSA 4AK1A 4RDBA 1LE5A 3MV9B 3O2DA 5C0IA 1SQFA 4PG9B 1XGZA 2WB1A 4K8RD 2AS5M 3IDCB 4XMKH 4YDIL 5IHBA 5E4EB 4J8RA 3VFMB 3IMNA 2ADIA 2PO6A 3JBG7 4J39A 4MOAA 3P3UA 4FLRA 2NW3A 4NDMA 2WNEA 3PL6D 1VACA 4QY8B 3RVTD 1UEMA 2XTLA 3TFKD 1XYPA 1D4M1 1OTTC 1JNNL 4U31A 1JZ3A 4F92B 1SCRA 1ASPA 4HPYL 3A67L 5F6HI 1VBD1 3R66A 1AGDB 2GITA 4NKOB 3LWCA 3L48A 2VTXA 2WWSA 4RIRB 4S2DA 1MF2L 3RY4A 3KPMB 3IJ8A 1TQCB 1E5SA 1IVLA 1B0GB 2W60B 4AEKA 5BMFH 3RX7A 3X1FA 4ONOA 2G1MA 1UZ6F 2Q1FA 4NXSA 4CA4A 3NACL 4KU8A 4XZUG 4PJXB 3U9PH 5L3FA 3I75A 3KJ6H 1LNUB 5CLTA 2ZGUA 4PIYA 4G7VL 1RUPL 3TVMA 3C2UA 1U93A 1JGUL 4BKLA 3W0WE 2BPA2 5FYLD 5D2LA 4UB6Z 3CCSV 1YWKA 2QTVA 3R8QA 5D8AB 4Q4X3 4F83A 3UADA 4DP5X 1NAMB 4UCSA 4EB6B 4TV9A 4U1KA 5EBWB 3ZGIA 1HS6A 5AW5B 1U8NA 2C5DA 4KKCD 3MRRB 3KG2A 1PG7W 4NGHH 5C7XL 2Z3FA 4G6JH 2F53D 1NEZG 2XWJA 3CG8A 4FEIA 4KXZH 3UBXB 3U9UA 2X44D 4QIRA 4ELDA 1HR0B 3E2HC 3CJIC 3I2KA 4X4YB 1XF5A 5BUAA 2PWGA 5CWSA 3LA3A 5CD3B 1WBFA 1QDCA 1OCZC 1KNOB 2NUPB 3U4EB 3EUDA 1FYTE 2XQYG 4LVHB 2ERJC 2IEPA 2CKBB 2R27A 1NCUA 2UZXA 3DX9B 2VMGA 4AM0Q 4WVMA 4JRAA 2LGNA 1I1AD 4AZZA 5A6LA 5CFAA 4OTXH 3AADB 1H3WM 4DP4X 2YIHA 4CILA 2JKLA 3QIUC 4XXAA 3S4SA 3ARPA 2WLLA 1IAMA 3H4FA 4OD3H 4H1LH 2VECA 1PAZA 3H1YA 3ZO0B 4IKKA 1TJXA 2H1PL 3QFJD 1AP6A 3PGFH 2XN2A 1XGPA 4H0LC 4JFWA 1AUYA 4YHHB 5F0PB 1J84A 3F12B 1WZXA 1N59B 3L16A 3C6SA 5HYJA 2DCZA 2BSRA 1QBLH 4YM2A 1I3HA 3VBRB 3ZFFB 2VMHA 2HFGH 1TZOA 4YOKA 1R1A1 4JFYB 2AJ3A 5BO1H 2RMKB 4QRPE 2C24A 3HN5A 4XETA 5F3IA 5FY1A 2UYLB 3RVZA 2ZWNA 3M17B 1MOFA 3RWDA 5I0DA 1EPFA 1MJ7L 4U1IB 2WIIB 2PELA 2W1QA 3HE6D 3HNSH 1RB8G 4AOCA 3PAZA 4XN7A 4JHUA 1EDQA 2WVVB 3JT2A 1OCRC 1S5LZ 4PW4A 5J57B 1TQUA 1DGWA 1A7QH 4UIKH 3OPTA 4JFTA 1QLEC 3WEAA 4P9IA 4O4JB 5IMOA 2E63A 2CIKA 5I8CA 4NQDA 2DLTA 2HJFB 3OPWA 1MUJA 1NGWA 2QQVA 3MIFA 3QH3A 1Z1WA 2X38A 4I5BA 4LFCO 3QR2A 3I9PA 2EP6A 3ZKMD 4YHYC 4LIQE 1H8SA 5IT2H 4OFQA 2YZ1A 1RUF3 3DX8A 3GHPA 4G8GE 5IJKC 3ZRXA 3B5TA 4NC2B 3JD4A 3LCPA 2VCOA 3ARFD 4CCKA 4I4WB 3OGCA 2IAAC 1FOD1 3W5NA 4PI2A 4NRZA 4RGND 3BPNB 4X20B 4QNHB 4Z2WA 4FFWC 2YRZA 1KECA 5ERLA 4XXWA 4B27A 4LHLA 4XGZA 1QVFU 1NQDA 2XNAA 4MYEA 2Y3AA 4V1PA 4OHZA 1GZHA 2NY7H 1PU0A 1RPQA 4NNXB 5C3SA 4JR9H 1FT9A 4H8HA 4WJG3 2LFEA 3QC6X 2UXBB 1GS7A 3CVHL 3IGLA 3MR9B 2H32H 1JI2A 4YNYA 1Q82W 5BMFL 1K5MB 1HJCA 1Q4NX 3BWAB 5JW3H 2XG4B 1IBKO 3SPIA 2AXTZ 2YAQA 2OZNA 8CGTA 4FVMA 3KJ6L 5TE6H 4JKWA 3J07A 3V5HA 4A6YH 4OZIB 2DCJA 4JZJB 2VBDA 3ES4A 4PY7B 1CIYA 2ARWA 5C0CA 3H53A 4BH8B 1BVP1 2XWTB 4HYOA 3RYIB 2COVD 1DGRN 5E8DL 3TNQA 4BXSV 4WBNB 4JGYB 1VFMA 4G6JL 3ZRWA 3KBEA 4ZFFA 1D5BA 5JR1H 1LE9B 1W72H 1UMHA 5GGQH 4RFNB 4UQCA 1Q8PA 3EKCA 3DVNB 3FCGA 5DJYB 2XL7A 2IH3A 4IRSB 3WB0A 2QADC 3EH4B 3HC0B 3OF6A 5KMGB 1XR8A 4H13C 5EIIB 4IETA 2YFUA 1MXGA 3HFMH 2J8UF 4QXKA 4N26A 3DGGB 4ODBD 1HL5A 4WI6A 3RX5A 4YW6A 1MFMA 1VEOA 5C92A 1OA3A 1L3WA 1RK0A 3SDXF 5FO8A 3LB9A 3D3VE 1O75A 4E2LA 2BSDA 2H2SC 2VQ0A 2XTSA 4QPJA 1UURA 4OD3L 2CKNA 4DV6B 1T5WB 1QOKA 5GPRA 3K71A 4A04A 1SFHA 1M9SA 1URFA 4NUPA 3OY8A 2P44B 4JL2A 4JKKA 4L05A 5DJ2B 4MHRA 2NLJC 1QBLL 3TBDA 4MW3A 3DIVA 3D4ZA 5EZLA 2HFGL 3LD8C 2R1YB 4NB7A 4EUPH 3RWIB 1NQJA 1QOOA 4QCIA 4PJBE 3B5LB 1TZHB 1RJ7A 3P69A 2WTOA 2WO2A 5BO1L 3RGVD 4JI4B 1BZ9A 2VRKA 1JR9A 2VSMB 5IMLB 2AAVA 3WS6A 1NLRA 3WP6A 4FLYA 5KSBE 5CB7A 3L3DB 4OFPA 3TWCH 2FUQA 4JGMA 1ZVFA 2ES3A 2VOWA 4LC1A 4EDXA 1ZWIA 3CC2V 3CFBB 1H1IA 1QJU3 4L92A 1NZCA 3VBUA 4HZ3A 3APBA 3VWJB 2VAAB 3D4YA 2H3NB 4HWUA 4Z7UA 1NGYB 1Z66A 4JPIB 4U7MA 1A7QL 4OLVL 4UIKL 5DD6A 3U4BL 1LOGA 3WL9B 2C9RA 1LGNA 1A3LH 1N32B 2JG9B 5ALCH 3BFWA 4QHKJ 2EF6A 4IIQC 2JICA 3BUIA 4F8PA 1UOFA 4I0CC 4DIQA 1TQCC 4HJJL 4EUPG 2E5LO 4R4FH 3T0EC 3V6FA 3K75B 3HAEA 4DO0A 1UPIA 1YC8A 2W6JG 1T7ZA 3I6GA 5IT2L 3BIAX 4CJ0A 3NKTA 1UXXX 2IALA 2ET7A 4XFCA 2X5IA 4AQ2A 3AP4A 4N22A 1N26A 4YZWA 4AVKA 1RITA 4V2BA 4RISH 1TSRA 2G2RA 1DZ0A 5C3LD 1W0PA 3KXFD 2CU5A 4IGBA 1I8IA 4XAAA 2QKDA 5EU6A 4HSLA 3EYPA 4DW1A 3UM7A 5EPMB 2I7OA 2LW3A 4DR1B 1A4CA 1U4FA 3BOVA 1DQQA 3BQVA 3L2MA 2NY7L 4LCVA 4CL7A 1BAWA 3QXWA 3ALWA 1J1LA 3W5MA 2OMZA 1G1CA 1HI6B 1OHZA 2ZOUA 3Q13A 3U36B 2R56H 2PF4E 2AREA 3VBOA 3JCUZ 5K9OB 4WZ9A 2APXA 2A75A 4HG4J 2SLIA 3AKQA 1FH5H 5JW3L 1OCWL 2NXZB 4MD4B 3CN1A 2BHFA 1TNNA 1G9EA 5F7HA 2X7LB 4BE5A 1JZ4A 2ZACA 1SERA 5K0UA 3S30A 3L8QA 4IKNA 5TE6L 1A02N 1ZRRA 2P52A 4KKLC 4XX1E 5EEUA 1NVPB 4OZFB 4A6YL 3ZDWA 2B8MA 3EJJX 4NO3B 1R0AH 4HS6A 1PNGA 4PJ9B 1DTOA 5DUWA 5SV3A 4POZC 3CFEA 4MLSA 1JFHA 2CH8A 2VLRE 5A6XA 4I7ZC 5FXVA 4MVSA 3AMMA 1JOYA 5AKRA 4EXPX 5JR1L 3EJYC 1W72L 4XPTH 4QXTA 5GGQL 5T33H 1S9WA 3RZCA 4J23A 1VALA 4CCDA 5CGYD 5JR2A 3WN5C 5HGDA 4QR7A 2JDKA 4Z7QE 4C59B 2W9XA 2GTZB 3OR6A 2FZ2A 4JZNA 2EDJA 2D0GA 3ESNA 3CFNA 3EYVB 4L4JA 1S3JA 3MGOA 3HFML 1W8WA 2HMID 5C4WC 2QTEA 2J44A 3PIGA 2NTFA 2WKGA 2TEPA 1E27A 2KPNA 2PO6D 2YUXA 4X50A 3S3XA 3E8GA 4F6RB 2FX9H 4HKZB 4I77H 1R3JB 1W8HA 4G71B 4M8UA 3LSDA 2VOTA 4JHBA 2XVBA 3MAWA 4G80A 3V4VH 1VMHA 5LBFA 3VBFC 2WXIA 1WA2X 5BNOC 5E6YA 2VW0A 2Z64C 1H8VA 4CP0A 4I3RH 4TPRH 5DECA 3Q48A 4PJDA 3WE1A 3D12B 1XXNA 4NKMA 1DVTA 2XTJC 3D52A 5A3MA 3FFCE 3LRMA 4WEBH 4JFHE 2Y3NA 1DZQA 5C0GB 1A1MA 2JDIG 1RP8A 2Y6SD 4HUXB 2HJFC 4JM2B 3EYUH 1XL6A 3WAKA 2HKXA 1M3JA 5CZVH 4JTNA 1DJSA 4H4NA 4O2CA 2UUBO 3QWRA 4WW2B 3UEQA 3T77B 5DA4A 1QXRA 3GBFA 5B3SB 4BZ1H 2FZ3A 4BA0A 3WW2A 5IBUG 4N6RB 3IKCA 2WUBH 1KFGA 1T0NB 4XDPA 4ZY9A 4DXSA 4L8QA 5FYSA 4XHJC 2CTPA 4ZOEA 3WHUA 3DPRA 5C7GA 3BPNC 3IPEA 4XMVA 2I74A 1I0HA 3W39B 2A7AA 3BAIA 4I1NB 3VTMA 3AP5A 4YZ2A 1FNGA 4GUCA 5F1OB 1RUC3 4MQSB 2XV3A 1A3LL 3IDXH 4S0TD 1FPN3 4C91A 2VIRA 1GAFH 5ALCL 2GH8A 5EJ3A 3M3QA 4JDVA 1N68A 4GW4B 3VBHC 5KC6A 1GNZA 3MNDA 4R4FL 3CU1A 1ZHBB 2GAZB 1C8PA 1VIWA 1BYHA 1AG0A 5CF3A 1K5MC 4HLTA 3EXUA 5KXDA 3FCUB 4G3YH 2XOTA 1M7UA 4R7XA 5TDPB 3SOBH 3NDYE 2YOCA 1X5XA 5C0JA 3TNMA 3BI9X 4BELD 3UK9A 1EAQA 4XTMA 3ZN5A 2Y36H 3HR9A 1YN6B 4GRWF 4KROB 4L3EA 4JZJC 5DABA 4K3UA 5CUSL 4QX0A 1JOJA 3F6LA 3EFFB 4UFIA 1SDYA 3B56A 4S2SB 1XB9A 3FU7A 4JRYD 4BWUA 1BG1A 1ZKAA 1QHQA 1J9CT 5IBLC 1QJX3 5HYJD 2ZEWA 1ZMYA 2Z1PA 2UVEA 2HWE2 3RJQB 1M4WA 2EXYD 4A5UB 5L2KD 3POGA 4QPGC 3WFCH 1REIA 1K7DA 1Z2GA 2R56L 2SEBB 2QQQA 3B2XA 2OJZH 3WDIA 1GZTA 4GALA 2O30A 3OXSB 3CJJA 1K5NB 4IRSC 1SXCA 4P5MA 4DR7B 1FH5L 2B9AA 4PWKA 1UYYA 1P5VB 2PXYB 3OGJA 3RI9A 1XMEB 4OF8A 3RPIB 3HB3B 3DXRB 4DPBX 2EH7L 1W04A 4ZO9A 3THOA 4JRXB 3KLKA 3QQDB 3MFAA 4BHPA 3HBKA 2BEOA 1H8NA 1XL4A 3L3IA 5DC0A 5E94B 3FTVA 4UVAA 4RQEA 1MFUA 1SHMA 5EZIH 1I7TA 1C16A 2NY3C 5PAZA 1E5UI 1X6NA 1QF3A 5EOQH 1W06A 5DAPA 5FMOL 3DDFA 4Y4KA 4Q9RH 4C1XA 3K3OA 4NQDD 5D7KE 3UTSE 2EEDA 3GSXA 4XPTL 2GJZA 3AMPA 5IYZB 1CTMA 5T33L 3E86A 3E6FA 3FBKA 4WI4A 1WMEA 3POFA 2BIQA 1QSEB 5IOPB 5BNPB 2Q0OC 2QLYA 2HTKC 2BDRA 3WUCA 4NQVB 3SGEH 3WJJA 1TITA 2DI7A 4GT1A 2IXKA 5DEDA 1TG8A 3FCTA 4X5LA 5DQ0A 4Z1PA 4AQ6A 5E88A 2DBNA 2FX9L 4I77L 1NCJA 4HCRL 2NT0A 3SZKC 4U2AA 5FRAA 2XRAH 5CJOH 3CTTA 8FABA 4C1WA 4X1IA 1E90A 2XXMB 4I3RL 4TPRL 5E6IA 3II3A 4A41A 1GMGA 4XIKA 4WEBL 1CXFA 2XACC 4Q4Y1 1CBJA 3QIWB 4J3OD 3EYUL 4ZXBC 4RN5A 5JIUA 1LK2A 5CZVL 5T5NG 3FT2B 5DHEA 4E2OA 2YXFA 4G5ZH 3COOA 3O4LA 2PTMA 2V2TB 4MTFA 2OQJB 3LZRA 5LMUB 1F4XH 4PJ5D 2GTAA 5HI4D 4BZ1L 1CS6A 3BZEB 1OGSA 4Q8KA 4PW9A 4MMXA 4AKQA 4OGZA 2VO8A 4H26B 4LTAA 1I94B 1R1CA 1OT1A 2Z69A 1JI1A 3S57A 4QOKB 3KW8A 2YC2A 3GLEA 1D4VB 4A37A 4ZJ9A 5JIIA 5GS1B 4TYSA 3IDXL 2WO7A 3AKSA 2V8MA 5FAAA 5JXIA 2P42B 1SS3A 3WG3A 2BFUS 2ZHNA 4DPAX 5K1JA 4NE9A 1ULEA 1S7XB 1LP9A 4M3JA 2PW2B 2GJ6E 3AMLA 3LTVA 1UO9A 2NXZC 1BF5A 4IL7A 4LO5B 4EROA 4G3YL 1MR5A 3SOBL 3L5IA 1MVEA 1NBQA 3ARBD 1CD3G 1PZCA 2XPYA 3D30A 5HI3C 5H9PA 1TGOA 2Y36L 1IAKB 2AKRA 1PS3A 3FT9A 2HWD3 2MHAA 4NPKA 1ZRIA 1BQKA 1KIQA 2PPFA 4FI8A 4ZG1A 4XXPA 4C0HA 5FV2A 1JNHB 4IQHA 3EDEA 4PRPD 1E67A 4FA8A 5A33A 2CUIA 4IIJA 3RYHB 1BQPA 1R5VB 4LH6A 1CL7H 2TAAA 2QMJA 3FJTA 5GJSH 3WFCL 4AIEA 5KBNC 2F4LA 2HWF3 3BUBA 1KACB 2EDQA 1ZIAA 2YD2A 1VBC2 2OJZL 1NFKA 4XF0A 1D6EB 3QIBD 4Z7VF 3VKLA 5ACA3 2R83A 1HESA 5L0QC 2LE9A 1EXGA 1QHOA 2JSFA 3WTXA 4O00A 2NPIA 4DEQA 3PTYA 1PX4A 3KYAA 2F66C 4NWTH 4A7TA 3R0NA 3EHBC 1MPAH 3THMH 4J9ZB 1MH5A 3PHOA 4LGRB 2CDFB 3A24A 4Z7NE 5CEXB 4LSPH 4GD4A 3N7LA 1V9U3 4N7IA 1A22B 1XMOO 3FO9B 2ROYA 4U1SA 5EZIL 1UY3A 2H1LM 2HG5B 4QXBA 2WQWA 1Q0XH 5EOQL 2BOIA 2YPVA 5J1TC 4Q9RL 1SQ2N 1I5ZA 4AILC 3DIFA 4QTFA 5BUPA 5KHJA 1BFVH 4YVWB 5TF0A 3CVIH 4L3CA 4LIQH 4GA9A 1NXD1 4U6HB 4JM2C 4IS6A 2OL3A 3I3DA 4X65B 2LLGA 2RM23 3NMBA 4B4PA 1ACXA 4NRMA 2M83A 5APAA 2OSLA 2YLKA 4K2UH 3FMGH 1CI3M 3ECQA 3GT6A 1E2WA 2R69L 3FTYA 1AYN1 2XHBA 4OGAD 4A2UA 3PJSB 4DR2B 5E9DB 1I8KA 3OT7A 5DRZB 4HVOA 4Y1AD 2YQBA 1ZVNA 4G28B 4IGBD 3AG3B 5EU6D 3P54A 4NTXA 4UTAH 2XRAL 5CJOL 1C5IA 1KYOK 1UN1A 1MS0A 1XVSA 3P0GB 4W4OC 5SWSE 2PHFA 4MGQA 5JUVA 5HGGS 1CDIA 3J27A 4IE0A 5IFAH 2KLSA 3L3JA 4KKBC 1OZ0A 1WLEA 5D1XB 1OGTA 4AL8H 1GZWA 5F6IC 1CPMA 1SFYA 1T66D 4JDEA 2DE0X 1YHQV 1ID5I 2YWYA 3FHIB 4NWVA 4N8VB 4Q26A 1W9XA 3LEVH 5LBGA 1PK6B 1BWMA 1R3HB 2X2HA 2FO4B 5BQDA 2Q8VA 1KIRA 1RERA 3NEEA 4G5ZL 4G11A 2AW9A 1FC2D 3LEXA 3NIFB 4PJCF 4PLOB 4TNWF 5FDWA 1S4CA 4WTZA 4XTRC 1F4XL 3WHE1 3DPBA 3SH3A 2JIZG 4GKNA 5L7OB 4QB2A 1S7VB 3VTTA 3QO5A 2ZE8A 1XSRA 3AITA 4YWAA 1U8CA 4AMKH 1EAH2 4M3CA 4KROC 4NXNB 2GAUA 2ZSWB 3NK4A 3LSOB 4FTSA 1SFPA 4NBYB 4B9YA 1E8XA 3PWLA 4LSDA 4PP2B 2GP5A 3UAEA 4YLBA 5FFOA 3UZQA 2G9KA 3TWYA 5A2FA 1QTPA 1UB6A 3IBOA 1J3QA 4CCEA 4DESA 3ATAA 4L9DA 2XXZA 3KLHD 3JASB 4BSWB 3GSNB 4UB0H 3SYCA 4ONGH 4ZUUA 2XV6B 3VFPA 4XNXH 3X12B 2NW2A 1J5CA 2BDNH 4W6WA 1RZ7L 3LGRA 1MCWM 2JLLA 2CLRA 5LAXB 4YJ3B 3WOGA 3LRHA 1JPGA 3UG5A 2Y4UA 4PRBB 5CJXC 3HB3C 1BZEA 1Z5WA 4PD4K 4CE8A 4FLTA 2BNQE 3ZXDA 3AYAA 1OQEA 5BXFA 4RWHA 4NFCA 1DBNA 4Z82A 1NBMG 4WSGA 4YSCA 1OGAE 2VQFO 3UFIA 4IRZA 4DEUA 5KWYC 3E1F1 4PJAE 1N34B 1XO8A 2UURA 1WZMA 2CR3A 1RK1B 2TSAA 1R4XA 2F23A 3TIDA 5JPNC 3F5WC 1M4KA 2J6EA 1E3ZA 5JZGA 1X7QB 4O2BA 4IESA 3F7QA 1CL7L 4OGXL 5D4IA 5EG6C 3RFZA 5GJSL 4WI0A 4YHIA 4Z6AT 3MNZA 3QWRD 5BNPC 3BUYB 4LRIA 2QR4A 4IUGA 1IEBA 3IRCA 3K4AA 2TRYA 2E3VA 4KI5C 1RUD3 2DDUA 1CE6A 1KJVB 2QQLH 2JJWA 1NCAH 2ZTBA 3A47A 4WIQA 4F2ME 3S8GB 2F6BA 2BSSB 1BEXA 3BIWE 4R2GC 1RULL 4JYBA 1GKOA 2WBWB 2NYYD 5DDJ3 4D6RA 5A7NA 1MPAL 1JZFA 1LUWA 2Y1AA 3THML 1Q9LA 1WAZA 3P4OB 4Y5VB 2V5DA 1AXYA 2X09A 4LSPL 1JA8A 3T0XA 1DN2A 3ZQWA 1RUH1 1NE4A 4JFXB 1VF6A 2DMHA 1PKQB 1AG6A 1Q0XL 4E9RA 2NY2D 1RMU2 2WSKA 2ZINA 2Y4SA 3JZ7A 1BFVL 4HGWB 3C09B 4UZGA 5EN2B 1JYXA 2QFEA 3KV9A 3CVIL 4LIQL 3UG4A 4BQBA 3JATB 5FUPA 1P8JA 4DUVA 3W9EA 1CFNA 2VM4A 3W9DB 2N7GA 3LCYA 4LLVA 3WO4C 4IOFD 3DX6A 4IEFA 4K2UL 3FMGL 5FKPB 3VMPA 4MA7H 2AK4A 3GJFA 3T0EE 1ETA1 4NX0A 3LRSA 5FB8A 3BA9A 2MMXA 1QOTA 5ELIA 2PWEA 4L3ED 1KIUA 4Y22A 1RAMA 4XBEH 1JHLH 5AKTA 3OR7C 3QAZB 1R34A 4LLUA 3CAFA 1P6WA 3C7HA 3S37L 1GIGL 1UVQB 2CM6A 5JH7A 4AZ8A 4UTAL 3F8UB 4QYAA 4A3XA 5GRYA 4ZW8A 1FFPA 2FGWH 3LDBB 4LLQB 1NKOA 2ZOKA 1PZUB 3N91A 5IFAL 3K80A 5F0JB 4P2OB 4NAQA 1D5NA 1ETB1 1YUHB 4JG9A 3KGLA 4AQ8C 3MGUA 4JJ5B 5H94B 2P47B 2J8OA 3ZSSA 4JZOB 1ZZ9A 3LEVL 3B93A 1FG9C 1IGMH 1KTDA 3ACFA 1W0WA 4FQJH 4NNPH 4UOW1 1GZPB 4HSJA 1FVEB 2OMUA 3VFSB 2VJ0A 5ADPH 5EC1C 3O6FB 1WUNT 1AZVA 3QUMA 1FNEB 1PQZA 3FO1A 4G6KH 2XKSA 5CM1A 5IAXA 3GIVB 4WEUD 5B7EA 4KK5D 5FP8A 4W6XB 3G7DA 4L4TE 2L7UA 3WS3B 4B53A 1IEHA 1L0PA 4AMKL 2B1IA 1WICA 5I9QB 4BQ2A 4BR6A 3GSWA 5EORH 4K7PH 3M1BB 3CJXA 5FL7G 4L11A 4Y4KD 3VXTB 4Z2AA 3HG1B 1LL1A 3O45B 4PJGF 2APWA 1DUZA 5IK4A 4OM0H 1HEJC 2K0GA 5DN2A 1SXAA 3ZHUA 1T1WA 4F1ZA 4UB0L 5IVZB 5JORA 4Q4W1 4QM8A 4ONGL 1G87A 2HVBA 4AK3A 4XNXL 1FKAO 3BH4A 2BDNL 2Z8WC 1GSMA 3I2GA 4XX1G 2I32A 1WB8A 4E36A 1RJCA 4MRBA 4RGAA 1Y76A 5LY2A 2VQTA 5HCAA 2H7WA 4G1MB 4PHXA 2DQEH 4P9PA 2QFPA 4KK9C 3TBBA 5JW4R 4HT1T 4KGGA 1CZTA 3QS2A 2QWNB 1KTLB 3NESA 5DHXB 2YEVA 1LOCA 4KXRA 4FHBD 2A6XA 3P4MB 2QA4V 1BLIA 3VNYA 4MB3A 1H9WA 1KGCE 5F8QC 3FX7A 4PIRF 1RZQA 1DEEA 4KTYA 1FXVA 3X2QB 4HIJA 1HNXO 1N36O 5FP9A 4LOVA 1D7BA 1L1FA 3G6EV 1GA2A 5D7EA 4NM8H 5GGRA 2W6IG 4P46C 4M3KB 3A21A 3BZ4A 1VQOV 1S1AA 1CPYA 1CD9B 3MHZA 3O4LD 2GNBA 2XTJE 4GRMB 1VADA 4YFLF 3U0TB 3RWGB 1VQLV 2QQLL 3D18B 1NCAL 4J4PD 4XVUD 4ZUWB 3ULVC 2R063 2MHFA 4CVWA 3RYCA 4JY4B 4MVTA 3GSUB 5IB4A 2D3VA 3LDCA 5AVQB 1TF4A 3IMVA 4MBOA 2HYMA 3O14A 1QPKA 2UWBA 1THAA 3OGVA 3AG3C 4F7EA 1RZJC 2X42A 2ZONA 4ZFZB 4UW3A 4GJZA 2Z35A 4GYCB 2QQKH 1QNZH 4O4HB 3AEIA 5IWAO 5IB3B 4R0LA 1KPRA 1UB5A 1WZKA 1XF3A 3W7TA 1JUFA 3ZBMA 1MS1A 5D1XC 3QBQA 4PQQA 2FL5B 3PXJA 4V11A 3VD2A 2HH9A 6TAAA 2WYSA 1A6ZA 1QASA 3QI9B 1UOJA 2I9LA 1OSZB 2DQTH 4UCTA 2FJGB 4BISA 1I8MA 1XSJA 2J1VA 3J4UH 4MA7L 2UUAO 2P8LB 3BPCA 3PURA 1T7VA 1YEJH 5EYPA 1SA0A 2JCCA 2MKWA 3JAKA 3P30H 4NZTL 3RTQB 4HOWA 1XC6A 1IS5A 3ZM8A 1PM9A 1TOXA 1JHLL 4XBEL 4A7UA 4PTTB 1PIV1 1RZKH 5FR3A 4HJUA 1UJ3A 3STLA 4TV3A 1ULGA 4DINB 1C7TA 1EUTA 3D50A 3FT0A 4OZIE 1UWGH 1WS7A 3QUXC 3FUDA 4GKZB 1WBXB 3KH4A 1WCUA 4X1YB 3TB0A 3U0PA 5J9PB 4KGJA 3CZFB 4M1GH 2ZHKA 1GK9A 2V2XB 3HN1A 1IBMB 2MCMA 1IGML 4YHLH 5D6DA 2Z4QB 5LGHH 3POHA 1VP6A 4C54A 1DGWX 4PDLA 2YEQA 1MFCH 5ADPL 5IEKB 3MRMA 2L8AA 5T1JA 4ODSH 4TUJB 4BXFA 4DFIA 3SY0B 3OTTA 2F43G 3H3PH 3B7YA 4G6KL 1BQUA 4KITB 4OXSA 1W39A 3B94A 2DN7A 2K78A 2OSXA 4K73A 2ARXA 1JYIA 1K4DB 2RMU1 3ES1A 1IGYB 1JL8A 4DR4B 2EZ0D 1Z9SA 4HBCH 5EORL 3NPSC 1OB1B 4K7PL 1HDMB 3FZUD 1VBA1 2GNTA 1OAKL 2A5UA 1MHEB 2QQNA 4LBJA 1KXVC 4JAMA 1S2BA 4XNBA 4K6BA 3PF2A 3SE6A 3T30A 5C6CA 4LASH 3F83A 4WFHA 4OM0L 3OHXB 2Y0OA 1ROPA 3QXAB 5FM8A 3UTPD 2X10A 1FJ1A 5C0BE 1CVSC 1T5EA 2EZPA 4OZGB 5ADOH 1QNMA 1BQHG 3NSXA 2O6PA 3DKHA 1EVTC 3V0EA 4Z77B 1IG3A 2JE7A 5C5TA 3CHXA 2DQEL 1AJQA 2FQGA 3RZJA 5IROC 1P2CA 3Q9PA 4UNVA 4AEMA 4GW5B 3GTVA 5CBGA 5A2BA 5C8YB 4YW1A 2HYKA 3WIHA 1I1FB 2EJ1A 2WBJB 3N43F 2FIRT 4JW3A 1F35A 2EABA 1QFUL 5FYJE 1S8DA 2JQZA 2ZWLT 1XF4A 3AMHA 5LATA 1OP4A 2YXSA 5H6QA 1M7DA 1F7YA 4NM8L 4TQFA 2V73A 3T1HO 3N3EA 4WW1B 4P4KD 1ND2C 5KBFA 3RVHA 2QT6A 2QSTA 2ZIDA 3NMEA 4LHUB 3ROOA 4EN2A 5IVXB 4LEBA 3POWA 3RUGF 4AIZA 3LXAA 4FPFA 3SE4C 3DKQA 1PO22 7TAAA 3LPWA 4PR5A 5F6LB 3SLIA 3F85A 3G71V 3S2CA 4JTCB 1S7RA 1YA5A 2ZUTA 2X6VA 1M05A 3FB7B 3HJEA 2FIKB 2XCMC 4X8XA 3VDAA 3OWRA 3IN0A 4AM0A 2H3XC 3NCYS 3QVNA 3QAZC 5I0ZA 1MCSA 4BIZA 1CXLA 4M3CF 2RTTA 5BZDB 4PYGA 4JVWA 2XI9A 2V3FA 2PTTA 4F8TA 4YVNA 3ULSB 5IFHH 1NYWA 3O3BA 2QQKL 2Z4TA 5GGUB 3SBRA 2OMXA 5T50A 3RZLA 3LDBC 4LBNA 3HUJA 3BP7B 2Q8OA 2OJEB 4Z5RA 2VISA 1RGSA 3I2CL 4BFRA 4X88A 3KHQA 3L1GA 3QQ4A 4R7DA 4PGDB 2ITDA 4WFGD 3ZMNA 4XFBA 2HEYF 4P57A 1LEIB 1M1XB 3VBSA 2NXYD 2DQTL 1H2KA 5KYXB 2P4EA 3I2DA 4QDRA 1WBZA 3BAJA 3L9JT 5IFPA 2YXLA 5DGRA 3ZO9A 4L99A 1VGKB 4ZXEA 2C9XA 5DPNA 1UY2A 1YEJL 1BOGA 1RSOB 3WLWC 3P30L 4BK8A 2NZ9A 2C4XA 4IMKC 1MVUB 1JGEA 2RQEA 1CF8H 4J3SA 3H6JA 1O6SB 1OOWA 5I9QC 4OF5A 1JNLH 3P73B 4MNQA 1MY5A 1PG7X 2VDLH 4LCWD 4DEPB 1LNQA 3NCFB 1ZLVK 4B5EA 2FDJA 1NMBH 1UT2A 5AVZB 4M1GL 1QKZH 3S0PA 3EO1A 3A6BH 3TCLB 5I28A 4X7FC 1HNWO 1H6UA 4YHLL 5LGHL 1JMUB 2HWC2 2EVIA 5JHDA 2FAUA 4G8EA 1S0JA 1S9VB 1MFCL 1TU2B 1TSHA 3CV5A 1KUQA 4LHQB 1QBMH 3APMA 2WXRA 4ODSL 4OVUA 5E95B 4WWKB 5IJDC 2CJTA 3H3PL 2H94A 1N0JA 5I8YA 1OTSD 3MRCA 4ODTL 1G9HA 3VU2A 1FHGA 3O11A 5BS0D 2VRAA 4X7TA 4MYWB 2M6YA 4WNSA 4Y19A 4LFCB 4NP4H 4CC4C 1VLNA 5EEZA 4XH2B 3G6DH 4HBCL 2N56A 3BP5A 2RACA 2EEXA 5J6HA 1R3KB 2GC4C 2OR7A 4JCKA 1JF1A 4J1UA 1QLEH 2DQCL 5GZGA 4H7VA 1M56B 1BVLB 1ZT4B 2GMMA 1XEUA 4LASL 3D5OA 3FFOA 1DJYA 5CN2A 5FJHA 3QUYB 4I0PB 1RHI1 1YQ2A 4X7DC 1IGJB 3NJNA 5FK9B 3VW3H 1JXFA 2KSDA 5LHGA 4JO3H 4OJDH 5C6PB 2H1XA 4WFFA 5LA6A 3OTFA 2AK4D 4G6AC 4ONHB 3V95A 2V7HB 4LULA 4FAHA 3S5LA 4BKTC 4GG6A 3CYOA 1QRNE 3D82A 4IEUA 4LSQH 4E2GA 4ZOCA 4XNZB 4YUEH 1Q86W 1H3PH 1Q7YW 2P8PB 2PAMA 2PUQT 4O5LH 2AXWA 4XN2A 2E4FA 5EUOB 2IWGA 1CLVA 4YBQD 1V0AA 1W9FA 1SXSA 1UJTA 2DKSA 1IBKB 3R18A 2GZWA 5LNGA 1QCEA 2YARA 2X40A 2CA3A 1W80A 4HJGB 1WGOA 4YSFA 5I1JH 1P84K 4JANA 3BPSA 3VXRD 5D2LF 5MERA 1E9QA 3T2MA 1HL9A 2DQHH 3ZDZB 2VLME 3MPBA 3TOPA 1HHKA 4PBDA 1MI5D 3NFNB 3L4CA 3AP9A 5T5PA 3DXTA 1A64A 4YW4A 5AUMA 1MCNA 3DJTA 4F7ZA 3KV4A 2FEEL 2W91A 5BOZG 2GK0A 4ISVB 3EOTH 5J7MA 2QGDA 2X4QA 3RTQC 4D9RD 1IC4H 5D7LB 3TYFB 1DFXA 2PTUA 4LGSB 4FRWA 5IKCB 2YA0A 1TYEB 3ZHSA 5IFHL 4AVAA 1HWHB 1JWSB 3EYQC 1YEDB 3L3KA 4MHHI 4NLAA 3RP1A 4ZO8A 1REEA 3W7WA 1Z5LA 1T04B 3KYNB 4JPVL 1HZHH 5D1QA 3X17A 1OT4A 2XB6C 3HI6H 2BNMA 2DFCA 4D7TA 1HV1A 3O0VA 1T21A 3GMLA 2YJLA 3SBPA 2FDBP 4B4QA 3AX4A 3O0RH 3WVJA 1XQ4A 2QR0A 3AT8A 4N43C 1RIUH 3BCCH 5K39B 2DU0A 1U5ZA 4NRXA 3AG4B 4LF5O 3GZQA 2JI2A 1U3HC 3VI4F 4ADIA 5AD0A 3BTXA 3MRDB 1HHJA 3MRIB 1BJ8A 1CAVB 2J1KA 2VMFA 2BX5A 1CF8L 3BIKB 1H1AA 1K4DC 3JTTA 3KPOB 5B1KA 4AGLA 4W4NA 1YYLL 2W07B 2IH1A 3L4XA 1JNLL 3O8XC 2WABA 2BVBA 2VDLL 3F7VA 2BCKB 2V9QA 3TN0A 5DRWB 3SCGA 2WSUA 3ZHDA 2AXFA 4LFBO 5T3XE 3PAYA 3IMWA 4GI8A 2R9IA 2EJ7A 1NMBL 5DVLA 1UXLA 3OHXC 1GWKA 2DVAA 5IW6A 2OPKA 2V09A 3A6BL 3JQWA 1I8AA 4Q8BA 1AO7A 5FXZA 5B39B 3SJAC 4M9OA 1UWFA 2WFF3 1KLUB 1QBML 3B4SA 5FHBH 1IE5A 2WSVA 3MI6A 4OD2A 4X98B 3ULAB 1QSEE 2FH6A 3TYGH 4MSVA 5CEZE 1DVFD 4FM0A 4KI5E 4CP9A 3O6LH 4UM9B 4FPKA 4TXWA 2E5LB 2E5EA 1YC61 4GSQA 3OBTA 5E1IA 4NP4L 2HUHA 3LNGA 1I1RA 1HQ4A 3IGFA 3G6DL 5C9AA 3WXWH 4BE6A 5C5UA 4NIDA 3IVKA 1AXSB 1UCTA 1ZT7B 1QA9A 1UD2A 4YLQT 3TEUA 2WUCH 4GXUN 3RI8A 1QLEL 3N9QA 3LY6A 4AI9A 1D5MA 1MHPH 4OM1H 2DQUL 1WMXA 3T2TA 2XJLA 5LN4A 3WV6A 2QCSB 5CS7A 4X6CE 1SZBA 4NUBA 3WJMA 4GIAA 2VQUA 4HJ0D 3IFOA 3PPSA 1UXMA 4JO3L 1GL4B 1ZTMA 4WLCA 3UIZA 4F7CA 4D94A 1W15A 2VR7A 1HYSC 3B8NA 2OYLA 1OAUH 3MLVL 4BPZA 2QL1A 3NJXA 4LSQL 3MZGB 3OJ2C 1YJDC 1URIA 1H3PL 2ZNWA 3I6SA 3II1A 4YUEL 3RYMA 4EKJA 4O5LL 2W5FA 1KGJA 5DQJA 3VD3A 4J3OF 3C7OA 3WT3A 3M46A 4FA7B 1CFBA 1NICA 2ZNIA 3WSOA 5CJBA 4K7PY 1COV1 5LG6A 1OLME 2ZPXA 5DC2A 3ALXA 5EU4A 5GSRB 1QSFA 4DV5O 2ALAA 3JBG1 4YGEA 1BYOA 5DTFB 5HVHC 3QQXA 4QOKE 1DF5A 1Z0NA 3LMJH 3ZTCC 1J1XL 5F1IA 5I1JL 1HZLA 1ZGLB 4FOMA 1VBE3 2GJJA 1VB2A 2RS11 2Y6HA 2DQHL 2QHRL 3K46A 4FSJA 1F6LL 2JB8A 1DVXA 3CVHA 5B1JC 1HW5A 3GIZH 5LW9A 1X6LA 2C3VA 2D3OW 4EI0A 4HNAB 3CZEA 2BU9A 3QUZA 4MGYE 2O6FA 3K57A 4P2RA 4PSPA 4X62O 4D8PB 3MHHC 5E1AA 2QV2A 4Z3JA 3D8MA 5I2IA 3B3IA 3EOTL 1SACA 3BVWA 5BVPH 4LPLA 3OHMB 4QKBA 3H3KA 4ZU4A 4GY4A 1PO11 3ZE1F 1IC4L 2IC1A 2VLLA 3KD4A 1NH2B 3ZFEC 1BM7A 1Q94A 4DVBA 1BFOB 1IGFH 4FPPA 3ILQD 1G9BA 1PVC3 2GC1A 1HZHL 4LVEA 4WFHD 5F7LB 1F8TH 4F93B 4WNJA 1ZGLP 2WNUC 3ATBA 3D06A 4P0DA 1U95A 2ZXDA 4XO5A 5TDOA 4LO6B 1TNRA 1E28B 1E7UA 4OQ8A 1COV2 2X6AA 1QNIA 2XN9A 3O0RL 1ULDA 1DGSA 2PW1A 2VR6A 3ARTA 3SE3C 4AGOA 3ZXLA 1RIUL 2HVKA 2VXTH 3ASNC 1NC2B 3KM1A 3HRZC 3KLLA 3UCRA 5IFJA 3ZDSA 5DVOA 3DMMB 4XUQA 3MUHL 1XIWC 4WWKC 1OIOA 3IDUA 1Q81W 2EC8A 1JV5B 4U1LA 2PAEA 5F39A 1BP3B 1UOBA 3AK1A 1CD1B 5TDNB 4YAQB 3GQFA 2UUBB 4J28A 3DX7A 3OZ9H 3WFEH 1NLSA 4L4VE 4N0UE 3T6ZA 1OO2A 1VP7A 3FO2B 3MKKA 4KNQA 3RYKA 3RWRD 4IOIA 5DJDB 1MVQA 4LWSB 1U8OA 2DYPB 3HPLC 3QHTC 3T0BA 1R3LA 5EU3B 2CHNA 3EOBB 1M56C 3IJYA 2VZRA 1KIPA 5F9DC 3SDCB 1MEC2 2PMZA 5FZAA 1YVLA 3QUYC 5FZFA 1O6VA 2MW2B 2F7QA 1P4BL 4UOQA 5I8EB 1NGPH 3B83A 2HKAA 3DARA 1RLWA 2PCPA 3OZKA 2PYFB 5FPRA 5FHBL 2O1QA 5DUVA 5FMCA 3TYGL 1EX0A 3R8BB 2UU8A 3MIHA 2EVXA 3PABB 4QHMB 4HWEH 4XNZC 1BEV1 4G7YH 3O6LL 5DHYB 3FQUA 3W56A 5FCSH 4MGKE 4NIIA 1NUKA 4AFDA 4QWWD 4PJ8A 5DFAA 1M9NA 2HHHO 2IGTA 3QNXB 4XMXA 2B8OT 3DHUA 3EW3B 4NYLB 3ULUD 1A4JB 3WAJA 4D0QA 2W0KA 3CMGA 5FW8A 1SQMA 5DFWH 4YDKH 5E9DE 5DK0A 4CBCA 2P24A 1BK0A 1CVNA 3PLYA 4Y2DC 3DO7B 4GH4C 2WUCL 4AV0A 5D70H 2YUZA 4FPYA 5FYMA 2EDKA 1MHPL 2FEJA 4OM1L 5E89A 1BZDA 3F7YB 4L2YA 1WJZA 4I55B 2Z7ZA 4G8AC 1VRH3 5EBMA 5CBEB 4G4FA 4X99A 4DGIH 4H5SA 1AX0A 1X4YA 1FNZA 1T6GC 2ZHMA 1FXKA 3TXQA 4HAGA 4X0NA 3C5SA 2MQCA 1OAUL 3ZIMA 5IR1B 5T55A 2VC9A 3NIGB 1Q9WB 2A74C 1JD7A 1DSFH 4UV8A 2Z92B 4KZ0A 1BBJA 1I4FA 5B21A 3TIEB 1C5HA 3H1WA 3EFOA 4M61A 1D5XB 1FFRA 1SLIA 4NROA 3DRTB 2B46X 4YDVB 4BQYA 3BPLB 5DN6G 1M2OA 3KE0A 5KZCB 2VMDA 5JXAH 1JYCA 1XRUA 1V00A 3LMJL 4MDIB 2EACA 1BJMA 3POYA 2JCWA 1CWPA 3BGAA 1DFBH 4LCIH 4X9BA 5JHDD 4PJ7B 3GNMH 3S2AA 1AR81 3GIZL 4DJMA 1S7QB 4P5TA 5F3BB 1EFQA 3MVSA 3UNPA 4RX4D 1SPDA 1RUE2 5B4XA 3LKOA 1A8DA 3LA7A 4LR4A 1N64H 3Q5TA 4QXGH 5C0AA 4DK0A 2ZYRA 5BVPL 1EXUB 2FWSA 3K3QA 2ICES 1L0QA 1F5JA 4Y19D 4CEWB 2X29A 3MPPG 4FFBB 1IAOB 2HPTA 5I1AA 2EIBA 3JSLA 1TLMA 3G3LA 4Z9KB 2XLLA 5EA0H 3RGHA 2QUOA 1H6EA 5DZFA 5A3UA 4JTDB 2LLLA 4UM8B 2ESVB 4DXZA 1IGFL 4XZUB 1NQTA 1MRDH 4X83A 4K3JH 5C09E 2QBXA 2VRZA 2R9RB 3QWOB 3T8MA 1RJ8A 2P5BA 2WW8A 1F8TL 3TV3H 3OTOO 3RIAF 3ZE2F 3QRFM 1CBVH 2GIYA 2TBVA 2WWJA 3UH8A 1WCBA 1A1NA 2F74B 4I9WE 2XQYK 5LBQA 4AFAA 4A7ZA 2DQ0A 2QDVA 3I02B 4KXZI 2OTWB 4DPRA 4H2AA 4AXWA 3K1KC 5EIIG 5CISA 2X4OB 1EFXB 4IHOB 1VAMA 3L3HA 1L9QA 1I8UA 4YPGB 3TVMC 4LF7B 1A4AA 2I07B 3R65A 2DL2A 2ZKHH 4OZHA 4U6TA 5DEJA 2C1OA 4R26H 2JS5A 4JCMA 4M7LH 2CO7B 5FYJH 3SJVD 3IN2A 3QDJB 3OZ9L 3WFEL 2AEYA 1RPUA 3U7WH 4APQD 1O5UA 2YGMA 3GRWH 4PVBA 2KUTA 2C5DC 2VN7A 3EH3B 1KDMA 2A3WA 3OGRA 3NQHA 4FNRA 2E7BA 4NQEA 4J6IA 3KF3A 2LTQC 2HRLA 2X3CA 4ELKB 2PA7A 4PJCE 5IB5B 4M0HA 4ZHQA 1MWAH 3C5XA 4Q0VA 4FE9A 1PKQE 2J71A 4QXCA 2QQJA 1SG3A 1ZL8B 1JNJA 1WP6A 5J2UB 1G84A 2QDWA 4BINA 3DVFA 1KCLA 1RHFA 2HR3A 3N44F 3CFCL 3QQ3A 1NGPL 5GGTH 1AJKA 3KZIZ 4JHWH 4PJ0Z 4QB6A 1HHGA 1SFNA 3FH5A 3NSFA 4MNGB 5FZEA 5BNNA 3E1ZA 3H2QA 4HWEL 4CCJA 4G7YL 1JUIA 2N04A 4UZSA 4N53A 5T5FA 5DRXB 2Y7MA 3EFDH 3V56A 1FL6A 5FYKU 3KPRA 3BFOA 3MLRH 1PD0A 4K7FA 4TKWA 1QAWA 1I7RB 5FOJB 5FLUA 3SCMD 1LHNA 2J1RA 2LO1A 4MTGA 1U92B 5D70L 4D0BA 1X9UA 1EA9C 2AZ0A 3V6OA 3L95A 1N33O 4HYTB 1MCKA 3BVCA 1ZCRA 2AJVH 2HX7A 2WV3A 3C3TA 2CHZA 4MD0B 4WKZB 3JB4C 3QD6A 4EN7B 3BISA 1GJIA 3FAWA 1OA4A 4AVTA 1LEKA 1KGYE 1R24B 1RZIB 4K3EH 4W1TA 4DGIL 3POSA 2ZOTA 2LVEA 3DGDA 4Y5XA 2CPCA 1HNGA 3IJSB 4QRSA 3JWNC 4CDQA 3GGLA 5FUNA 3VYNA 1DSFL 2EDLA 3PWPE 3VUAA 2DQFB 1H5BA 1UD3A 2HVJA 2J1YA 2FYYB 2MTAA 1RL1A 2X89D 3ZL4H 1RUG1 3U82B 4G9SB 4UW4A 4IU3A 3QBTB 1TYJA 1WT5A 4WU5B 5E5MB 2X9XA 1RXFA 3NO8A 3CRCA 4OCLC 3TN0D 4ASUG 4YDJB 3MV11 3QO8A 5EO1A 1UXWA 1ZSDB 3G5ZB 5JO5A 3B9KA 3CN3A 3LKJA 4H55A 4QX8A 3FU9A 3MYJA 1WW5A 1LO3H 1A8MA 3VKFC 3DRQB 3BODA 5JXAL 1CURA 1AHSA 2YI9A 3PY9A 4F8OA 3ZN6A 1IM9D 3ACGA 1DFBL 4LCIL 1LESA 1XMOB 4LCCB 3GNML 5JHLH 2DQJH 5INCA 3DCQA 2KC0A 3FHEA 1A66A 2EIMB 1KYOF 1SLLA 1RU9H 4JFDD 3WUWB 2O14A 4KTEH 1N64L 4QXGL 5ANMA 3EB7A 4LF3A 1IQDA 3OGCC 1BBDH 2Y06L 4JDZB 1KGWA 3VD4A 1Z78A 3MMEB 2CNAA 4NQUA 5LXTB 1J1PH 2JI1A 1UKQA 2YV8A 2MPAH 1XB3A 4DR3O 4XXWC 5BRZA 4A1RA 4IBWA 3B9IA 4J6RH 5FWEA 1MRDL 2R4RH 4K3JL 5HV0A 1BQSA 3QEGL 2YPLA 3SIKA 1B90A 3T8VA 4AJYV 1IKFH 2KH2B 4AJVA 3QO0A 5DUBB 4ORGA 3C60A 1YDPB 3F05A 5CMAA 3TV3L 2Z7YA 2Q7GA 3SDCC 3Q6FB 4W9EC 3S88L 3U0ZA 1RUJ2 2LGWA 2A6VA 4XBPA 1T3FB 3UPRA 5HI5D 2Q3AA 5F6KA 4PLKD 4GQQA 4CDXA 3P2TA 1JVMA 5D6CB 1QLFA 1IJNA 1B35B 4NO0B 4SBVA 1JDDA 3T3YA 3FONA 2P5ED 5KSVB 2ZKHL 3IWZA 3DTUB 4HPKA 4XJAA 2BNRB 2PCFA 4NXMO 2XWCA 2ZOLB 4IRJB 4R26L 1ULFA 4AR2A 4HIHB 5FYJL 3L5HA 2R2BB 2GEQA 1TJMA 2RJLA 2WLIB 4HCRA 4O51B 4FMKA 2DQIH 3U7WL 1TJHH 3DIDA 3GRWL 4LP4A 2MEV2 4HHAA 3DOSA 4X8GA 5E6ZA 2VY0A 3N7JA 1QSFD 4H20H 4U4BA 4WK2B 4M9PA 4FFVC 2ENRA 1OSEA 3CCHB 1D4M3 3E80A 1GM7A 3FRPA 3GMNA 1Y7BA 1F4AA 3AP7A 5MEOB 3NJFA 3F7YC 5IE9A 5IY5C 4PJFB 1VBD3 5FOBA 4PD4F 3T3PF 1NBVH 1IPSA 5E8PA 2IH3C 1SEQH 1WFNA 3IGAB 3WZ1A 4CXXA 3S3BB 3G9AB 3L54A 5HCHA 3QUZD 2WGNB 2VNVA 5GGTL 4GLRI 1O3TA 5HBBA 2D3LA 4JHWL 4BZ1A 2D93A 2J21A 3H0TA 1DJGA 3NJLA 1MCFA 1Q8MA 2PI5A 3B02A 1BHGA 3GB7B 3SKUD 5EOCJ 5DF0A 1BQZA 3EFDL 4I01A 3CD6V 1OCCB 3MLRL 5CP3A 2JJTC 2BVVA 3H2PA 4L8BA 1LGCA 2J55A 3AWEA 5JIQA 3FWEA 3I2HA 1B4TA 2YAFA 4QU2A 5JMOC 3C5JA 5FY7A 4UQ9A 4U33A 1YQ6A 2NX5D 2ZYIA 4CPBD 4PRAA 5KXBA 4B3NA 4DZBB 2AJVL 2CDEB 3BKJH 1A1OA 3UT5A 2NY1D 2VQFB 4UOJA 2J1SA 1G7QA 3IYLW 1ZIBA 1TME2 3RDTD 2RR11 4PWEA 4U1MA 1PZSA 5DEZA 3VFNA 4K3EL 3FB6A 4BGDA 1YNTF 5DCCA 3DXAB 1DGLA 3WS6C 4Y26A 2BERA 1IC7L 4N2BA 4PMFA 1NC4B 4OI9A 2GTSA 1JPEA 4GZRB 1OQDA 4XQWA 5KXCA 2GDSA 1XCQB 2OSWA 4CEWC 4CSSA 5FCUH 5FPIA 4HZLB 4PRIE 3ZL4L 4ZYKA 1HRV1 3B43A 5CHNA 4D0CB 3APQA 3HZYA 4HKXA 2I27N 5CLZA 5T3XH 5AAMC 3HC4H 3X11B 2VLJE 3VRIA 1M9WA 4CRQA 3D2UD 1PVHA 4XNUH 3H1IH 3MICA 1NIAA 5KYYA 3CXHF 4HUKB 2AR6A 2QZ5A 1LO3L 5SX4H 3GMRA 1GP6A 3P0YH 1CQKA 1CBVL 3TJEH 3FB5A 3NGBB 1FAIH 5CCJA 3D0VA 3MGTB 5CEZH 2DQJL 4NN5C 5A6IA 4G72B 5JHLL 1R1A3 2P5WE 4JM0A 1RU9L 1VHPA 1V6IA 1FORH 1PLCA 4KTEL 4P5YA 3CGTA 1BBDL 1ORQB 5DMGC 4DHLA 2BOJA 4GUPA 4OI7A 5F96H 4LRNH 5BMVB 1HV0A 3N4MA 4P05A 2AZ2A 5E0FA 3KPQB 4FQZA 3JV5A 1U5XA 3DUUA 3AYDA 2CH7A 5JOPD 2CDGB 4GKYA 2V4AA 1G6RA 3BPOB 3IJHA 2DW4A 3LAFA 1SJVA 2R4RL 4N8MA 4G1EB 3FSVA 2BOCB 1LHUA 5FLIA 3QDGD 1ASJ2 3LIZA 1IKFL 1HH9A 1O9GA 3CZSA 4X4MA 3O6KH 4X9YA 4ELMA 2GC0A 4JGSA 4JZ2A 4YK4B 1FMD1 2BVUA 2N05A 1LMKA 3NCXA 1AGFA 1GYKA 1VDGA 2J8UB 5ABJB 2FDIA 3DGEA 1Z5YD 2UZIH 3TGXA 3FTZA 5DMYA 2GBVA 2WOYA 1W6MA 1XNBA 4FQXB 4M7KH 3SDXB 3UACA 1V3LA 1K6QH 1UNBA 2R69A 4MVBD 4NZDA 3VA6A 3D4KA 4COYA 4UV4H 3UTTE 5FNVA 2HJDA 3GO1H 4EI6B 5IBTH 5EWIH 1NUFA 1FOD3 3GNEA 4GMSH 1TJHL 1T4KA 2GSGB 2V2WB 4YO0A 5HHMD 3TFBA 2IM9A 4H20L 3T4HB 3VKNA 3C7GA 2R23A 2VQ4A 5I30H 1JDAA 3P6BA 3UYRH 1MAKA 3QEQA 1VMFA 2W3JA 3RW0A 5SWQA 3RZCC 1WEJH 2EDTA 3CWGA 4LLWB 1JZGA 1ZHNA 2WWOA 4HFWB 4ODUA 4W9JC 2XBZA 5DJCB 1W2UA 3OR6C 1NBVL 4K07A 1KBPA 1SEQL 5F6HJ 4ARXA 4P5TD 3MZHA 1L6XA 2YGOA 3BFRA 3F6IA 5LXGH 4Z0XB 2ZG2A 3ZYFA 5TISZ 3GSQA 2OMWB 3WMPA 2A9NL 2IFGA 3W0WA 1T1ZB 3HOBA 4GBXB 1G7LA 3MRLA 5E70A 5E9NA 3H9SD 3WN6A 4YHOH 3W37A 3DN7A 5IVEA 4P9HC 1XEDA 3HZKB 4GFXA 2YSSB 4JO5A 4U3JA 3GJEA 1D7CA 3RKDD 3VI3E 4F7MA 5C07A 3JU9A 4Y3OA 2ZKWA 5HGBA 5I18L 2Q3XA 5DVMA 4MADA 3UV9A 4UU9B 2CDYA 1WPXA 5E2WH 1EEZA 3UTOA 3UOAB 3BKJL 4KDVA 3FCSB 2UWAA 1AFVH 1FYTA 4GAZA 3ZSJA 3JD3A 3GBLA 4XTPA 3WLBB 1TQ5A 4LCCC 1GH7A 2JKRM 1HNXB 5A7QA 1ET8A 4MA3B 1N36B 5AVPA 3WY1A 1QU0A 4FYQA 3O0XA 4GX1A 1UU4A 5E00A 3G5YB 3L71H 4NTYA 4BWTA 4O4IA 4WCEV 1SGKA 2IFFH 2DIJA 1AXIB 2WLJA 5E16A 3A5VA 3DPRC 4WWOA 5FCUL 1NXMA 5I1KH 1RMFH 4O02H 3I55V 4OFYD 5T3XL 4DZ8A 5B22A 4DMIA 5HYSB 1VQ8V 2YEZB 3HC4L 4I85A 5K8SA 4NQED 4CNIB 3CB2A 4M7JL 2VLKB 5ISZA 1HQRA 2D44A 1EBAA 5LDUA 3B77A 4OIBA 4P2QD 1OSGA 3C8KB 3P0YL 5IK3B 2WFPA 3TJEL 2G60H 4XJUA 5K9QG 1EHXA 1Q8QA 4E41B 3N7KA 1FAIL 2OZ4H 1LWHA 5CEZL 5IWAB 4OMDA 3RNKA 2FO1A 1Z0HA 4CADA 3AB0B 1XZ0A 3QZWB 4RQPB 4ACPA 1J10A 4EWAA 1DJHA 1FZMB 3VGEA 1JZ5A 5DJAB 2QTOA 5IMKB 4IRJC 3T4AB 1ZA4A 1D3CA 4TTDC 4LRNL 5F96L 1AJ7H 1RZJH 3KPRD 1IV8A 1I85A 3V9FA 1HJBC 4HUVA 3WDVA 4Y5Z0 3T2QA 4XWOD 2K8MA 1NU1H 1QO3B 2NY0B 3X13A 2I85A 2UUAB 6FABH 2XXGA 1GNHA 1XE0A 4CA9A 3CH1B 4PV9A 1WC7A 4W9IC 1WHPA 4ZO6A 5EUOE 2TNFA 2GV9A 3Q7JA 1Q38A 2WSDA 3QZPA 5D7JB 3O6KL 2DH2A 4MQXD 4G9FB 3K0GA 1VPOH 5CGTA 4F2FA 3WF1A 2E53A 1UWEH 2DLFH 4ABMA 3Q5OA 2QVTA 1CAUA 4P14A 4G8GA 3IGAC 4NRYB 4NQCB 2VL5A 4XXCC 1PLBA 3LNHA 4KC3B 3HC2A 4PJIF 2UZIL 3H56A 1TFPA 1BVVA 4UYPA 1JGLH 1JFFB 3H7BB 5FO7A 1ETJA 3BHBB 3IJEA 4FG0A 3JTSA 2HLDG 1K6QL 3BUQA 2F5AL 2GUOA 3MREB 1GZQA 4KK8D 2GNMA 1LEGB 3SGEI 3M1CA 4Y1YA 5GS2H 4KJPD 4UV4L 1W8ZA 1UWXH 3D2TA 3GXUA 3T1WA 3GO1L 4P9XA 4GAYB 1SY6H 1VIBA 5EWIL 4UILH 4GMSL 2FHBA 3RI5K 3A4AA 4LO4B 1ENXA 1N18A 2EO9A 3JXAA 3QDME 2V5MA 5IVOA 3GXMA 2K7QA 2XWXA 5I30L 1OI6A 1ZBA1 4EV0A 2TRHA 3FU5A 2R2HA 5GS0C 3FQRA 3P9LA 5CA1B 4HKBA 4TULH 2JKXA 2QE3A 4AVSA 3CCUV 2JKBA 2J1ZA 1A14H 5LXGL 5T1MB 4X5XB 1BLZA 2CHHA 5F2WA 2AK1H 2CY6A 3QO7A 3HE7A 3KCPA 1V9PA 3PGCA 3LQCA 5CLWA 3AABA 2EUVA 4YHOL 1J8SA 2VITA 4YZ1A 3FC8A 3IN9A 3L2NA 2M2DA 2CUHA 2QZQA 4Y5YC 2IXQB 3BO8A 5EXOA 3MOBH 2R1BA 2AJZB 2K46A 5DEGA 4AT6B 4URKA 1W8FA 3AZUA 3AKRA 2XPGB 4Y89A 3UTQB 1N0LA 3LS4H 4B3TO 1XT5A 7PCYA 3AAZA 4Y4HD 5FYZA 3NCJH 4YSDA 3BVDB 5E2WL 1DDTA 1ULOA 4W4LA 3BH9A 3D05A 3FHAA 5LG1A 5FO9B 2QVSB 2JVDA 2ZMLA 2VCCA 3F2LA 1AFVL 3QULA 4ZS6C 4F9LA 1DQ1A 3NGBC 1T6WA 2HRHA 1UTDA 4E8DA 5IB1B 2FQFA 1YHFA 4JO2H 4NQSB 3ACHA 3O1MA 3T1HB 4FXKB 4GRWB 4MJ6A 2IFFL 4MMXC 5G4NA 1POV1 2CTRA 1YN7A 1COBA 1ORQC 4Q6IA 2R16A 4B5ZA 3L9RA 2PYEE 1RMFL 3LEMA 3LZFH 4NKDB 4O02L 4C56A 2VWEC 4GXVL 4F8NA 4LBEA 4ZD3H 5K9KB 3NAPC 4EJRA 2GNDA 1E40A 4E8CA 1NJIW 2VYRE 4Q14A 5BZBA 4N0CD 2R30A 3RZZA 5AW8B 1MWOA 1HQNA 2J1TA 2G60L 2BINA 1FV1B 2OULB 4WO4D 3REWB 3WMSA 1ULCA 2UWCA 3V64A 3U4KA 2O61B 2OZ4L 1F00I 1Y67A 1ACCA 1KDIA 1MCJA 2E0PA 5IQ7H 1CL7I 3H8UA 5ABJC 5CFCC 1XSIA 5L2KB 3K77A 3ULVL 4LLMB 4EO5A 1ACYH 2VE6B 4LP8A 3NTCH 3OJDA 4FF9A 4FQXC 5CP7B 3F5TA 3VXMA 3GJBA 4ZS3A 5ITZB 1U58B 3D39D 4QRUB 3ZU8A 3S7EA 5L3BA 4XPVA 3MCKA 4KQ7A 3T2OA 4IERA 1K3ZA 4X0KA 1AJ7L 1RZJL 5EZYA 1WZLA 1MAMH 3V8CA 1BT8A 2DMKA 4OKVA 5DEFA 1A8ZA 1QH6A 2I60H 3MTXA 4ZX3A 2LJ2A 6FABL 4UFMA 1XQNA 4ZS2A 4N21A 1NL0H 4OV6F 2J4WH 4PELA 2JCCF 3IKKA 4YGBA 5E8EA 3LHAA 4U1NB 1I9IH 3DC6A 3PNWB 3PP3H 4HK8A 5D5QA 1NDMB 3IKWA 1UWEL 4HMDA 5GGSA 3P3RA 4GRLA 3WHXB 1CO1A 4P4RB 4FOWA 1I7UB 5EYXA 5DC9B 5LNEA 3V4PB 4JN1L 1DHKA 4NPYA 1PPJH 1JGLL 3U46B 4GJTB 2PR9A 4JFSA 1U8QA 4GBXC 3D33A 5DGQA 3V8OA 2ZSVB 1KULA 3BWUC 1HNWB 1FGNH 3E9UA 3FO0H 2FKXA 5A7SA 1W0KG 3VQ2C 4JN2B 3WNNA 4CC6A 3MUY1 3JWNE 1SY6L 4UFZA 3NG5A 4R5VA 4UILL 4Y16A 4XMLH 2KKQA 5FXCH 4HVRA 3H3BC 2D31A 1L9NA 1AH1A 4NKGB 4H8PA 3FQNA 3ROUA 4TV8B 3UZEA 3QEHA 4LSVH 5KWRA 1CAWA 3L9DA 2Z65C 4KKPA 4Y4FD 1O59A 3I9IA 5TJWK 1G7HA 1IAIH 4MZIA 2FB4H 4MJ2A 4TULL 3BRGC 3STZC 4WM8A 4YSAA 3D4CA 5IB2A 4W8JA 4C0BA 2E74C 1A14L 3MRHB 3GLZA 5I71C 5IYYA 3WOVA 1BD2D 4MGSA 2AK1L 4YNIA 2GBOA 5AOLA 1TZ8A 3I3EA 1AHWB 2JG8B 4URTA 2FDGA 3VN4A 1FN4A 1M42A 3SPHA 4K8RH 4CDUB 4PGCB 4BA8A 1A0QH 2E9GA 2QVFB 3CN4A 4AQEA 3GHEH 3DX1A 3IXAA 4WI2A 3I54A 1P84F 3MOBL 3D69B 3EYFB 1XSKA 3K48A 1UM5H 2CXGA 3OEEG 2VZ3A 3WKYA 4ZBMA 1SUJA 1HDKA 3UKNA 3LS4L 1FFNB 1M90W 3L74H 2AMUA 5GXBB 1SQBH 5KLVH 4MQTB 2BHYA 2R39A 4YVSA 3Q1SH 2IMNA 3BABA 2YA1A 2X7RB 2MCPL 3BRFA 1VFAB 3BQUB 1KPVA 3FUEA 3BDYH 4N25A 5EB9A 3Q44A 1G8MA 5C3TA 2BTQA 5ABZA 1YSCA 1ZANH 2R1WA 5IV2A 4JO2L 3VSUA 2YXVA 4DRXA 4KI5M 4MNHA 2EILB 5ITFA 4KRNA 4TLGA 1SZXA 2UX7A 1FL5A 2XXCB 4HD5A 3DECA 4Z3IA 4GULA 3T4AC 3BCFA 3TBVA 4ZD3L 5IHZA 1H3UA 5KOVC 4NN7B 3QB7C 5H35B 3FFCA 4APXB 3HHSB 3PQYB 3Q5YA 3UJIH 2MQ3A 3VV1A 5C0CE 3A4FA 1CQYA 2LU4A 4YSUA 1UM6H 4Z7VB 1B9ZA 3DEMA 2FYVA 1TQVA 1RUI1 4J25A 2OIGA 1JRHH 1WVZA 4KY2A 2J1EA 2OX5A 1N6VA 1J3PA 4Q4Y3 2VR5A 1T6VN 5IQ7L 2FJFA 4NI3A 5I23A 1RC6A 4GB32 1M2VB 2FB5A 2B39A 4GKSB 3W0WD 3ZE1E 4DOUA 1WF5A 1ACYL 3V7AE 3NTCL 1XJAA 35C8H 2QTSA 5T5LA 3BEVB 3O3DA 3PHAA 4B3RO 2VXRA 2EKJA 1LK3L 3J7LA 5EJ1B 1NMAH 3AU1B 3D1MC 2RS31 2Q8EA 3FTGA 4WM7A 1MAML 3ABLB 1VB4A 3GXFA 3MV8A 4FJYA 2UUCO 5EMYA 5LBVA 2IJKA 5GLVA 1TCRB 5AB1A 3AJYA 4K21A 4OPAA 4LF5B 4FNQA 2FT6A 5CA0B 4OLYH 1NL0L 3DV6B 4QJFB 1PNCA 3USUA 2J4WL 3IFNH 5IQ9B 3ERXA 4XXDB 1A6WL 1MW2A 4NUMA 3CSTA 4QTHB 1R75A 4QHLA 4RRPG 5J1SC 1PCXA 3WCSA 1FYTD 1OLZA 1I9IL 1DEDA 1T89A 4U1HA 5CO1A 5AFBA 4ECNA 1G7MB 5IWFA 4LRIC 1SOXA 1U97A 1SDDB 5ACZB 3WG7B 4L9LB 3RN4A 1V6OA 5AALA 2VAUA 3QZOA 3OLDA 2R072 2FX8H 4LFBB 5LWBA 4XW3A 1T1XB 3I9AA 4MVMA 3RVVD 1Z32X 4WNQB 1C8M2 4PJ7E 3ESUF 1N1YA 1H8HG 4YEEA 2KQMA 4LO7A 5BR8O 1FGNL 1XB6A 4BCXA 3FO0L 3E89A 3MJ7A 5I74C 1SYSA 4L29A 4WU7B 1DFQA 4OF7A 1LHVA 1Y74B 4R7NA 5F88A 4DF9A 5BW7A 4QD2E 3FLRA 1KXTB 3QRGH 4XMLL 1YCSA 5MEQA 5FA4A 1DANT 4UQ3A 3RVWD 4A7KA 2N74A 3CX2A 3SGJA 3FUIA 3MJ9A 4YDZA 1U3NA 1FBIL 4Z7UE 2C1PA 1P4UA 1VESA 1V6LA 1IAIL 2FB4L 1JWUB 3AYCA 1O7SA 3THTA 2IANE 1NGQH 4YDNA 3U1XA 1CCZA 2Y1YA 5ICYA 4NJAH 3I6KB 2D5FA 2RJ2A 2HRPH 1AR1C 5C0EB 3E6HB 3N50A 1MJJB 1O6TA 3HMWH 4LEJA 1A0QL 2O6CA 5DD3H 3WEZA 5I16B 4RUFA 3GHEL 3KCWA 4HA1A 1QUNB 2O5XH 2V5SA 4L8CA 1GZ9A 1UU5A 2E26A 2JWPA 5FECB 2UXCO 1UM5L 2B0SL 1GRJA 3PHQA 1HHIB 1RZPA 4LDOB 3QJXA 5ERWB 4K9SA 1EZJA 3JV0A 5IT6A 3V0BA 2AZAA 4QE9A 1G7JA 2NY6C 2YBRA 3KWWB 5EU6E 2VULA 3TZVB 2YMOA 1E6JH 3HZVB 1D5RA 5KUKA 3WY4A 4YYOA 3Q1SL 4ZX6A 1KYAA 4P5KB 2WKLA 3R6SA 2VXQH 4G8GD 4JFUA 1HVXA 1MCLA 3T3ME 5I1LA 3K6NA 1ZANL 3E38A 4DV5B 2OMTA 4NWUL 5ESAB 2BQPA 3WIFA 3HKEB 4QHZA 1YJDH 2ZR2A 1YPZB 1VMGA 1OKEA 1S0IA 5E56A 1E2ZA 3TEYA 4QRQB 1AYN3 2WS91 4IYKA 3OFNG 1S0FA 4QO1A 4U1JA 3MV01 4FTDA 3M7MX 4UCUA 4X62B 1ZA6B 4Q58C 4EI5D 2VMIA 4PRDB 4XCEB 1S72V 3VD1A 3ZPDA 3WF4A 2ZNXA 4KWUA 3EBRA 5JOZA 4E5XG 1VRSA 1UM6L 5F9AC 4AG4A 1W91A 5AG9A 3GLAA 4NQTA 2D43A 4V1DA 1JRHL 4JQIL 4MVZA 4R9DA 3GI9H 2X3AA 2A1XA 3SQBA 3A0KA 3TH4T 3M99B 1T4WA 4BRVA 1AZCA 3HE7D 3NIDB 5HDLA 1RY7B 1KJLA 3BU7A 1QJY3 3ZXJA 3KYMA 3OXRA 4FADA 1E5IA 4KBBA 35C8L 4ABVA 4GP4B 4WUUA 4EKXA 2K9UA 3TV8A 4GQ7A 5FM5M 3MBEB 1AKJA 1DG6A 1NMAL 4AGPA 3U4XA 4G7QB 4AFCA 4XO8A 4WHYH 4ERSH 3EO9H 3KQRA 2OW4A 1J8HA 1JK8B 3IE4A 3J8F7 3K6SB 3U7YH 3ZXAC 3NBNA 4O2AA 2EA7A 1HL8A 1XAUA 2HCZX 2QGEA 2B9ZA 5F3HB 3IFNL 4K3GA 4OH2A 5CIPH 1DCEA 2IV9A 5KBLA 4DXRA 4CH3A 5FY5A 1DK1A 3KR3H 2GCYA 3WY3A 5DHDA 3QARA 4GS7B 4H8QA 2OTUA 3EH2A 4PJDE 3N2GA 2BO0A 1TG7A 2JGUA 1DDHB 1FFOA 2OCJA 1SETA 1GJWA 1KTCA 3PXHA 3F84A 3D3VD 5FTTC 3MBXH 2FX8L 1T5XA 4MSWA 2BVTA 4Z7OE 2D73A 1AHWC 3C8HA 1P7KB 1Q0YH 3IWUA 2XYBA 4FKHA 4DSYA 5AAPA 5JYMA 5LGJA 3ECUA 2EXJA 4NHYA 3THCA 4CDUC 1O91A 1D2OA 4W6YB 2K45A 3F00A 1V6JA 1YO8A 3JQXA 4JVUA 3KVBA 4NPMA 4WHYG 3JAWB 2ZIOA 4IHJB 3D0LA 2NR6C 1KS5A 5DWUH 4UYBA 4UDUB 3QRGL 3KHBA 3W2DH 4R0LC 4ZX4A 3H8XA 2BNOA 3GI8H 5KN5B 3B01A 3P2BA 2BFGA 2WMPA 4U3SA 3UBHA 2JKTM 4FLZA 4N9GB 1DZBA 1F42A 2KMWA 4TNGA 5D96B 2HFFB 1AROP 3BQUC 1AI6A 4HWNA 1JGDA 2PHLA 4UBDC 2Q86B 4M7ZB 5EC2B 1JD9A 1J87A 5DHVA 2E75B 5GZOA 1B4JH 1F1AA 2F53B 5LGUA 4NJAL 3U6RB 1IGTA 2GBAA 1PAMA 1JZ6A 3RRQA 4OZ4B 3MXVL 1FFXA 5GSVA 3HMWL 3MN8A 4XOEA 4QF1A 3QS3A 3L17A 4OJYA 5DD3L 1BF8A 4MXWA 3MA7A 4BQ3A 1DLFH 2O5XL 3MRJB 3STLC 1VFOA 2BRQA 1YRZA 2W08A 5IK5A 3KHOA 3TBTA 3PAVA 3CHPA 2RHPA 1E3FA 2CUAA 1X9QA 1TEYA 3N36A 1RUH3 1I1AB 1QJFA 3UIYA 1DO5A 2BVPA 2IH9A 1WTLA 1I5XA 4XNMA 1E6JL 5EO0A 2HN7A 2WNKA 1BV8A 4YARA 3A2FA 2WXLA 3IF1B 1KB5B 2QEXV 4GRLD 1SRDA 2VXQL 4XP6L 4HSCX 5D6DC 1XYNA 2FCUA 1MCOL 1P0SE 1P4LA 2E9WA 3QFJB 5IG7B 1AF9A 1O4ZA 5M0TA 5CBAA 2AEOA 3MPCA 2EKSA 4LKCA 3EF4A 1T20B 2A6JA 1KYOJ 2WWMD 1LXMA 1NSNH 1VQMV 2YR3A 1QEWA 4RMQA 1TUBA 1YJDL 4X6DE 4YDLB 4HOZA 3NNFA 3V52H 5SWSA 5HJDA 3UZVB 4Y16D 5F70A 5FF6B 1KEGH 2ZG3A 2DRUA 4U2YA 3SKMA 3HMXH 5CBFA 4AYFA 5HGHB 3VQWA 2WXGA 5FK7A 1F4WH 2K9ZA 4BWOA 2WA3A 5DAVA 4X4ZA 5D5PA 2AFNA 5EFIB 4EE2A 3HE6B 3ZMTA 3QJFB 2CL2A 2OSYA 2K7PA 1T0MA 4LNUA 1E5BA 4QX3A 3GBGA 2W80C 2A73B 4ISQA 2ZEXA 2VUOA 5E51A 3GI9L 4YQXL 1I31A 4YE4L 2NY5C 5JR7B 3WG7C 4L9LC 3O2DH 5AOMA 3OTOB 3IXTB 5SWZA 1ZTEA 4TUOB 4FFZH 1YCIA 5CCGE 3ZYHA 2VLRD 4X42A 2YB7A 3BT2L 4M3CB 2FEEI 4ERSL 3EO9L 4ZONA 1KGXA 2BRRH 4ZMOA 1LOAA 1K8DA 2BP0B 1XCXA 2XVLA 4WI3A 4I18B 3MRKB 3U7YL 3TURA 3QPQC 1WAPA 1K45A 5DMKB 2APBA 2ZE5A 4PLNC 3ARFB 3BT0A 3KPPB 4ZQKB 1I9EA 2AXHA 1F3DJ 4RGNB 4HK9A 3GSVA 3L9BA 3VHRA 3KR3L 2A83B 3WE6B 1T1YB 2OV0A 2VWJA 1BZ7B 2YROA 4OF6A 3ZXGA 5I75B 3IAQA 4PD4J 1N3NB 1JOPA 4Q4W3 1UENA 4UQDA 5LGTA 3ETTA 1IAIM 1W6PB 1XOYA 3MBXL 2HSIA 3PWVA 2BGPA 5KBMA 3VSQA 2Y7QB 3DF0A 5A6YA 3OEHG 3EJSA 4X7CC 1Q0YL 2F8IA 3K2OA 2VQEO 2XG5B 4IE5A 3OKDB 4LESA 4PJAA 4DERA 3QORB 43C9B 2QQOA 1E8ZA 3D85D 4E42A 3PDQA 5D2AA 3E8HA 1DVYA 2BLFA 4ZMNA 4AIXA 3FFCD 4MX7A 4WF7A 2QELA 5DWUL 3UL2A 3BESR 1CPNA 1Q6IA 3HKDA 1N2RB 1MKFA 1NANH 3BN3B 2FE0A 3LN9A 3FQ4A 4YXHH 1AR2A 3GI8L 2YG0A 3MV7A 2VWEE 1E2VA 1UZ8B 4RMWA 2IG2L 5BV7C 5ID1B 3TZVC 25C8L 4FPGA 3MRQA 3EOAB 5F7UA 1DYPA 3CZKA 1JHNA 2ITDC 3P5BA 5B8CA 1VFBB 4IQPA 3W7SA 4OGQB 3E22A 2XPJA 1ZHLB 1SQGA 2G75B 1S2EA 3HJ0A 4U3HA 2VU9A 1B4JL 1EAOA 5HCBA 4QRTB 3K2UH 3ZDYB 3RYPA 1LP9E 1N33B 3MV9A 2JTYA 5MP6L 2XN0A 4I9XA 1FCGA 2D7PA 2NZ9C 4GFTB 4PG9A 2DJVA 1LEMA 3ZXKA 2VZUA 3VFMA 4G6FD 3KAAA 1DLFL 1SHXA 4NQXB 4PV8B 3D48R 4JMNA 2XAGA 4YMPA 4QTIH 4QY8A 4ODHH 4HKLA 5I0TA 1IXMA 2NQYA 5A32B 1QI3A 5ECJE 2CJ3A 4BFOA 5KA5A 3CXHJ 1N7MH 4HUUB 4LLOA 5EZOH 2H0VA 1AZNA 4NKOA 3KW7A 3GS0A 4DP0X 4RIRA 1TLKA 4OI2A 4KQ4H 3KPMA 5FEBA 5IEHB 1B0GA 2W60A 4JFOB 3EDDA 4A2FA 4EF3A 3T0EA 3MRGB 5BOJA 2IQAB 4ZSOB 2E6VA 3PWUB 1GGTA 1VJSA 32C2B 4MWFB 1NSNL 4PJXA 2JGDB 1K4CB 2J5LB 3LB6D 2X70B 1A7NH 4YSPA 5AVSB 1MZ6A 2XBO2 3H50A 3V52L 4HGKC 4PS7A 4OT1H 1UOLA 1KBGH 3I3QA 4Q29A 3N43B 1KEGL 2CNZA 3A6CH 3HMXL 4TVPE 1PIV3 1UZ0A 2PYTA 3CNAA 1F4WL 3CVCA 1L0LH 2X4RB 3PUQA 4G42B 3ARED 1NAMA 5EBWA 4EB6A 1RCYA 1ZLUH 4AYGA 2YN3A 3MRRA 3TJHD 1OLRA 4TUYB 2VQ1B 2GBUA 3ZTNH