4PHZA

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
388
structure length
388
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords unknown peptide
total genus 94
structure length 388
sequence length 388
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4phzA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4phzA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4phzA01
4O65A 3RGBA 4PI0A 4PI2A 1YEWA 4PHZA 3CHXA 3RFRA
chains in the Genus database with same CATH superfamily
2Y7NA 1N3NA 2F4VO 3P0VH 4IRSD 1DZBA 3VA6A 5MENE 4UFLA 4NFCA 5ANMA 1F4YL 2LLNA 3WO3B 4W9LC 2X6CA 1R091 2V3DA 1GBGA 2QCSB 3EADA 3AS1A 1J5DA 4FLYA 4P2AA 5FYJL 3S5LA 3U1XA 3DROB 2K45A 4DEPB 1W6WA 3UBGA 1KTDB 2J8OA 3MOAL 1HKFA 3VQMA 2BNMA 4Y22A 2HLDG 3L3OC 1QZ1A 1HQWA 5FR3A 4ZO7A 1X9TA 1TNMA 2WFPA 4EEQA 1CT8B 1HDMA 2YZ1A 4V11A 3AAZA 3SPJA 2ZYSA 3MRIB 3MO1A 1LU2A 1JV2B 2DQCL 1FL3B 3HKCA 4GKZA 3D4CA 1MN4A 4R9HA 2P44B 1YFXA 3BP6A 5CGBA 4G5AA 5IVEA 1Q94A 2GDSA 4LNRB 1QG3A 1PZUB 4U6VL 2FMLA 2CGOA 4Y33A 3TP4A 4ZI8A 3T0EC 1MFVA 3CZJA 4LZKA 4WU5A 1U58B 5IHWA 5JXAH 1WCUA 2XA3A 2A6YA 2GI7A 3LA7A 1RH8A 1ONQA 3FO2B 4M7ZB 5DEFB 5FO7B 4M48L 2WZ0A 1EA9C 1EAPB 3AXLA 1CFBA 1M2OA 2IH9A 3C09B 4YGVB 3F7LA 3Q9OA 3PV7A 4FNQA 1V5JA 3LEXB 2V7QG 1N36O 1NC2D 4I48A 2CGRH 3FT1A 1JPSH 5ABJA 4LFCO 2ZXWC 3RZKA 4LIQH 3CC5A 4QHNA 1L1FA 5GZNA 3TBSA 4X9FA 7FABL 3TVMD 3WFDL 4ZAKD 3QRGL 4YVWA 5HHXH 1O91A 3X2QC 4LLFA 2Z0BA 2D0GA 4IGGA 4DV0B 3QC5X 3L6FB 1NDTA 5FYKD 2IBBA 1J1PH 3RWHB 4YHHB 2VIRA 3U7WL 2P17A 4ISRA 4AQSA 1D5RA 5I5RA 5EIIG 4GQ7A 5HFMA 1VADB 5H9SA 5LA0A 4TQEH 2ZCKL 2FWOB 4KX9A 3VWKC 2RS53 3P32A 2HFEB 2LOEA 3MLWL 1NCCH 3VM7A 1ZV5A 3GT6A 1A3ZA 1GMMA 2ZKMX 4YNIA 3KZIZ 4DPRA 4ZX6A 4B3TO 5FY9A 5EZOH 4DUYO 3DX1A 3NNMA 1RQ5A 3EJYD 4FF9A 4CDXC 5DUMH 4UB6Z 3ARDC 5E5UB 5I6XB 1VBA1 3O41A 5H6RA 1TTCA 4U6XA 2JK5C 1V27A 3W39A 5GGVY 2NW2B 5D7IB 3GS7A 2BVOB 1IMHC 5FFLA 1HZKA 2WLQA 3KPPA 5DUBA 2B1AL 4HPOH 1FVEB 4PJBE 3TONA 1NCRA 5LG1A 4YVNA 4JI8B 1LR1A 5B2GB 4JCKA 4IKJA 2JKNA 3L95A 1HB1A 2EUVA 2PXYC 4BQ8A 4LFBB 4P59H 2BBVA 5JLZA 4RD7A 4EUPA 4MNGB 2XBO2 4MJ2A 2ATPB 2EA7A 5GZEA 4BFFA 4H13B 3IPEA 1OA4A 4U6VH 5B8CC 1PG7W 1OAUH 1PVC1 2E9GA 1VF6A 2I07B 1CGSH 2O61B 3WDVA 1ZEAL 2Z79A 2VQFO 2WXKA 4NJAH 1XCXA 5F7YC 2HYKA 2AJXL 5IY5B 3DKWA 3SEEA 2XPJA 4YXHL 3RWKX 5DMYA 3HMXH 4PJAA 4KHXL 3QPQC 2ZGLA 1GGIH 4APXA 5AEAA 2XIDA 4FXKC 4NHUB 1U8HA 1AO7B 1KB9J 1FGNL 2ZAHA 4TQHA 1FX5A 4OD1H 1BMFG 1Q4NX 2IQ9L 3THPA 1JMXA 4S10A 3W0WA 4N0UB 3UV9A 3IKWA 3JSSA 1OP3H 2JJTA 2OJEB 3BGFB 4PRIE 3DCQA 1A7QL 3H2QA 2GNDA 4LARH 1DLLA 4X65O 4WV1A 4OZOA 4Q52A 4D9RD 4KI5F 3TBTA 3G7DA 3TS8A 3HVDA 1MCIA 3IXTB 1WC7B 3IDBB 4NRMA 3OKDA 1AD0B 4UV4H 1HNXB 2ERJB 4INDA 2I9LB 4Y4RA 4AI8A 2VO5A 1BQLH 3CVHB 3DUUA 3O3DA 2G4IA 1RZFH 4ODXB 4AQOA 5DZ9A 5I16B 4NN7C 4NQEB 2BNQE 1NFDB 4G7VL 3VFMB 3B5TA 4LK4A 4AZ8B 1KCKA 5B3JE 3RFZA 2BFVH 2NY7H 2A3QA 3AVSA 2J4WH 3D07A 1JWUA 5EDSA 2HSIA 3OW2U 3MRRA 2OS2A 4FULA 4LBJA 4U1LB 1U8JB 4MXWH 3C87A 5HXMA 3OR7C 1QBAA 3N41F 4JG0H 1GAXA 4YVSB 1LO2L 4Z7OB 3VXSB 2PXJA 4JRAA 3K9SA 4L18A 5IVXE 4YEFA 5HYSA 1UXLA 5FPLA 3ZE1F 2ZOKB 3Q6FB 1RK1A 1AJ7L 1KGCE 3A3YB 4R7NB 2HB0A 4XCNB 4XCNA 3RIFF 4P4RB 4BLJA 3RG1C 4K8RD 1K4DC 1QTSA 1FF5A 5I17A 1KELH 3M7FB 2Q9LA 3QFJA 2XTJD 2JJ1G 3PXJA 2Y23A 4HDIA 1EJOH 3V0GA 4AUJA 1NIFA 1OB1B 4MB5A 4YHNB 5HYQA 2GEQA 1MWAA 3CVIH 4DQAA 4DXZA 3OUIA 4YHZL 3UPRA 3GBWA 5JIMA 1R093 3P73A 1G5AA 4MAYD 4C8XA 5LNDA 3ROUA 1FZJB 2IM9A 4XPHL 2R27A 1FFOA 4K3EH 4LPVA 4OI9A 4JI1B 3IMMA 5TD4A 4XMPL 3NZHH 2QVSB 4FM1A 2G0LA 4HIEA 3RS6A 1AD9B 3VFTB 2VQTA 1MWAL 1FNZA 3APCA 3FLTA 3FYEB 1QR4A 4FPFA 4XQWA 2VLKD 2K1MA 5ID1B 4BWOA 2J5LB 1SQMA 1FPN3 1ORSA 4L3FA 5CBAB 1VMFA 1TPXB 3DSQA 4Q56A 1UQXA 1AQMA 2GK0B 4QGPA 4HNAA 2L6LA 1HH6B 3K4AA 4G9FB 5CSZB 4A67A 4C55A 4LPCA 2P3YA 5LXGL 4AVVA 1QJX2 2I69A 2ES3A 1BLNB 3AUWB 2EC8A 4GFXA 4QXTB 5IQNA 1NZ6A 1R6TA 1RUKH 4MVSA 3IDXH 4X7EC 1AB3A 2YN3A 1XSOA 1NAKH 3WEXA 3GMLA 3DOIA 2XASA 2ZABA 1AHWB 2PWHA 4X5WB 3CU7A 4DR1O 5DK2B 2O61A 4RNRA 3ULVC 3BPLB 7CGTA 2UXBO 1S9XB 2OJZL 2OZNA 4QGYA 2DN9A 1QBLH 2DYPB 3L3DA 4YHLH 3TT3H 3V0JA 3LZRA 3SZKC 2Y7MA 5E6RB 1LGNA 3AZWA 4JTOA 5JYLA 3ZSMA 4TNEA 2L7QA 4AI1A 4WM8C 2UZXB 2BSTB 1ZGLB 3OZ9H 2J1XA 1K3EA 2BZCA 4I0PB 3KMDA 2VXRA 5DVKA 4W9JC 2BP3A 4BUQA 2J56A 2P6CA 1CU4L 4A55A 3NW4A 3BSHA 3CVHL 3R19A 1AJPA 1KULA 1HDJA 4M3CA 2FIKB 1OSEA 3DC5A 3B3IA 4H40A 3VFOB 1AG0A 4CS3A 3EG9A 2H8PA 1K9TA 1IEAA 1MRFH 2MIZA 4FPOB 1FV3A 3HKDA 5JVVA 3L1GA 3QE5A 5FF6A 3DMMD 3LF7A 4XCYA 4CCEA 1URFA 1U8IB 4MA7L 3ZQ9A 4ELMA 1YQ5A 3FZ3A 4ZMZA 1SMDA 5HI5D 1S72V 5CBHA 3ULUC 4G6KH 2DJSA 4IGBA 1XJAA 3DGGA 3OZKA 1GKEA 3FSOA 5IKCA 1QR8A 2APTA 2W07B 1BWWA 1ZDSA 3ACGA 4YG6A 4RQPC 3EYQD 4YXKH 3US0A 2G5BA 3ZMEA 5ISZB 1IBZA 2AJVH 2BW5A 2APBA 2QLYA 1XH2A 2X6VA 4XQDA 5IBLD 2VT0A 1P4UA 4BQ6A 4ZW5A 1WA4A 1AO7A 1F9KA 5IMKB 3C7HA 2VRKA 3UX9B 3ZHNA 2YPLD 3VXNB 2VVFA 3ES6B 2FGZA 3FCSB 3F62A 3VMPA 4KC3B 5EBMA 4R9DA 2GMEA 4L5FH 5DAQA 3RBZA 2ICWA 4P9YA 1QP1A 2DIBA 2K6ZA 5F1OB 2Q7EA 3AZXA 5A80A 1J95A 1KCWA 1OWWA 2OMTA 1AE6L 4MD0B 3HBPA 1U8KA 4PW9A 2NN8A 3GMOA 4ZMXA 1AVAA 2OMUA 3N91A 3C8HA 2CQVA 2JKSA 3ORJA 3QWQB 3O14A 2ADGA 1Q90D 5EU6D 4U7NA 4UW4A 3NL1A 3RIKA 4IRJD 2NXYB 2OBGA 1S7RB 4HWNA 4X6EA 3S8GB 1M7XA 2ADEA 1S7WA 4JYAB 1A4BA 1FRGH 1UFUA 1Q43A 3E80A 1IC0A 3N6YA 2I85A 3IKCA 1XGPB 3PWPA 4Q8BA 4F7MA 4ZMLA 4G6JH 3HMWL 3EXLA 3QJZA 4AKQA 1N33O 2WIMA 5DJCA 5HSFA 4FLUA 1AY1H 1SEBB 5BRZE 2WSVA 3NV1A 4AEMA 5T1LB 1F90L 1HIMH 1XHHA 2NW2A 3L3GB 3PLYA 2RVAA 1NR1A 4KP4A 2R2EB 4FXLA 4EFBA 3LS4H 1UCBL 5KXBA 2VO8A 1QLRA 4U0RC 3RAJL 1S9YA 2RV9A 2AQQA 1FL5B 3VWJA 2JDZA 2QEJA 3QEHB 3IJEA 4RZCA 3NABL 2EH8H 2ITFA 1R33A 1I94B 4OLZH 1QNWA 2WXLA 3LCYA 4OV6F 5C6TH 1KC5H 1E67A 2A6JA 4AF9A 5DAXA 1S6NA 1X3DA 3MVSA 4PJEE 3RFZC 1ZANL 4XBGB 5KJ4A 4I1RA 5D71H 2Y34A 3EZJB 3VXPA 1RHHB 1WH0A 4DFIA 2ZCLL 4BLIA 2QKIB 4AI2A 2D7PA 4XZPA 3VXME 4RGKA 1GNHA 5K7PA 1AHKA 3RWDB 4YMPA 5EPMA 2FMDA 4ZXBD 2VZVA 4KBPA 1QY4A 1H3VA 3ELNA 4U1MB 4KRLB 3PDGA 1YY8B 4Z1PA 5BOPA 1OCCB 1YJDL 2CRZA 1AR71 1PK6C 1BF5A 4D3WA 2EXIA 1M1KW 5A3IC 2ZIOA 2R9RB 4YZWA 3TCLB 3V5DA 3B2MA 1LOFC 5JOYA 1FN4B 3MYZA 2EQDA 4QQHA 2VWEC 1WFIA 3JWOC 2EO7A 1WP6A 1KIQB 1YMME 2Z91A 4MCZA 4GQZA 4M6AA 3FUFA 4RFOH 3TX4A 3DV6A 4UAHA 3ULSB 1IBYA 4F33B 1GS7A 1MCKA 1Q94B 4JREB 3I59B 3AT0A 3OZLA 4M3HA 2CUMA 3EGSA 3TO2B 3RZCA 2R1BA 4D6SA 3ETSA 3FT2B 1ZSDA 1J3RA 2XNAB 4DV0O 5DO8A 3NFPB 1EBOA 8FABA 3LUTB 5J2UB 3QO1B 1CDBA 3GJAA 1W28A 4AHZA 4CH5A 1NGPL 2WP3T 2DLGA 4H88L 2IALB 3C60A 4LKCA 4PJGB 5KSBE 1IU1A 1RMU2 1J1OL 3HA0A 4I89A 3FT4A 4KWJA 2AFNA 3LVEA 4TRPH 1HRV3 3B9CA 1J87A 5FYKU 3MKGA 4L4JA 3OC5A 5F5QA 4XB7A 4DUYB 1CJDA 2ORZA 3IJSA 1H5BC 2V6HA 3LKQB 3H42H 3VBHC 1Q0YH 3KL5A 4RDBA 5HGDA 4C57C 5DYFA 1AKJD 2UZIL 1NX9A 1RJYB 1TO5A 5SV4A 1L0LH 3DIVA 4H44B 4L8SC 2H0VA 3VZLA 2VOXA 3ZDYE 2ODIA 1Y9GA 4XACA 4NHCH 5IOPA 3L16A 2CIKA 3OY8A 4FQXC 1UU4A 4DV1B 5BY1A 3L3IB 5D7LB 1IS5A 4TQ8A 3PWJB 4BKSC 4LSSH 4A7GA 1LL1A 2B8MA 4DR4O 5SX4H 4K5NA 4JGJA 2KR2A 3M4FA 3UGHA 3D3AA 2H6OA 4D69A 1LECA 4LLAA 1N0XH 3DGEA 4JKPL 2QZ3A 4LFBO 1QNIA 1J5OH 1U30A 3LGRA 1AYRA 3O6ML 4NNXB 2YR3A 4FABL 3FHAA 3GXUB 5C7GA 1B2WL 4KX7A 3GWKC 1L0PA 2J73A 4K2UH 2XV2A 3GSUB 3I97A 4J1XA 1JPSL 3K72A 4H8HA 4KMQA 1AMYA 3FUMA 3MRCB 2XBTA 1ILUA 2AZAA 4FQ1H 5C0ND 2ZWZA 3QRGH 3TA3C 2ETEA 1UW8A 3NP4A 4UFJA 4QJ5B 3WFEH 1U36A 4P04A 2IV8A 2ICWJ 4G5ZH 3LQCA 2F8XC 4M4PA 3U2SA 5E4OA 1OAKL 1LRHA 5FPUA 1UHVA 3A0BZ 5IGXL 3ZDSA 1A7OH 4HS8H 3I7DA 4JS7A 3K6SB 1ML0A 3H3PH 4ABUA 5KVEE 5EZLA 1EMTH 1BVZA 2WXRA 4YSCA 2UVFA 4M3CE 4BW9A 1DEEA 2EC9T 4MYPA 4XJWA 4JFOA 3O1UA 5IOKA 1PZ3A 4BEIA 1EYBA 2XJQA 1U3YA 4CC4A 3KAAA 2FGWL 1ACYL 2DH3A 4TVPD 3V0HA 1VDGA 1NQTA 1YIJV 2G2PA 4N21A 2VLLA 5H37A 2JKBA 2PA7A 5DJAA 3OJMB 2IW5A 4JM4L 4AZUA 2O6CA 5IBTH 3PNRB 2XAJA 4TV8A 2GZWA 1QSEE 5IYCO 3MHSC 5LK7B 2P5WA 4YY3B 3IBOA 3E8GA 3MGTA 3H01A 2ORBH 3QI9C 1NT0A 2TEPA 1OOWA 2DQFA 4RZKA 5KHKA 3NN8A 1DN0A 1NIAA 3EBHA 3H3KA 3RQ0A 3OD4A 3EBIA 1WA8A 1HV0A 3HE7B 5E5LA 1CLOH 4AY0A 2PLTA 4J3OD 1ETZB 2A9CA 3CZLA 4MAYC 4WHTA 4LRIC 3UABA 1IQDC 1WMEA 4OJEH 1OAXL 2FEEL 1FLTX 2V5TA 3I50L 4M7LH 3OR6B 1JPFA 2DBJA 4N85A 3WY4A 1JWSA 3VFNA 4IIQA 2C9AA 4UB8Z 2F74A 2YHGA 3AK0A 3G6DL 4QU1A 3OMIB 4UTAH 2Y6LA 4KNUA 1E4WL 1P8JA 4DJMA 1MCFA 5E8DL 1ZHLB 3LKRA 4LCIL 2R0ZH 3JUYA 1R19A 3HCVB 4UTCA 4XAKE 4PCTA 4F8QA 5E9NA 4F3JA 3ESPA 4J3OH 4M5SA 2D0FA 1HHGA 1LB2A 1GV9A 4KZDL 2QFRA 5EDXA 4OD1L 4PJIE 1RHI1 2BE3A 2BC4B 5ALBH 1V54C 5ES4B 5F0PB 2HX9A 1JF1A 1NAMH 1AP6A 2NX5E 4F1ZA 2QSTA 3SBWA 1Q3EA 2CHHA 4G5ZL 3ZTNL 5DJDB 5FO8A 5D8AC 4LF6B 4G2AA 1HNFA 3AMHA 5CBEA 4LF7O 1FXKA 2Q67A 4LH7A 1BZ7B 1DZ0A 1Q9WA 2G2RA 4M8VA 4XNUL 3N3HA 1RMFL 4JDNA 1ND2B 4DTGH 4C1WA 5A3LA 2VDLB 1WAAE 4HBCL 2HPOA 2YWYA 5E2JA 3V9FA 1CL7L 1RPUA 2XKNA 4U1GB 3WW1A 1DQVA 3G04B 1VA9A 3ILEA 4OKVB 4XCYB 3BN6A 2G38A 3ZDVA 3RDTB 4ESKA 1F2XK 1GJIA 3G6DH 1IBGL 1O5DT 1OSPH 1T1XB 1E43A 1Y1UA 5EU3B 2DFCA 4AAXA 4XCEB 3WDHA 2BNRA 4AUYA 5E2WL 2NXZD 5IBTL 43CAA 1SESA 5I76B 3KCWA 1NTZH 3ZHSA 4GY4A 4NO0D 1MS9A 3ZVXA 4N87A 1SEFA 4EFEA 5TQ2H 1GLHA 1KGJA 4BWAA 4TF4A 5C9AB 2UZXA 5DJXB 4G9FE 1S3RA 1X50A 3NCCB 2AABH 4P48A 4Y5XA 1JMUB 4YVWC 2WC7A 4NTXA 4KJYB 2A3XA 4AKOA 1CG9B 5EU7E 1AX2A 2EXHA 2Z93A 1B88A 4L8QA 3TNPB 3SB3A 1PL0A 3HG1A 5AVTB 4AXWA 1DE4A 3ULVF 2HEPA 2JJ2G 1SFPA 1P5VA 3RZCC 5BNXD 1NYWA 4S2GA 3V9CA 4FLWA 2Z0UA 4PCYA 3FOMA 4KKLC 1NZRA 1A6WH 1RUPL 2R49A 5K39B 3FQYA 1ASQA 1ZRIA 2K0RA 3NQIA 4LF5O 2P42B 5EUOE 2X4PB 3FONA 2CAVA 3ALXA 2XWCA 4X6FA 1PD0A 4G8GA 4N9GA 1F13A 1Z0MA 3PGDA 1OLME 4OVVA 5ECJE 5J11C 2HWF1 4CBPA 3JD72 4KKCC 1F3RB 4KRMB 4AKPA 1WCDJ 2PHLA 2JVUA 3AQDA 1KRIA 3PJSB 1D5AA 4N3UA 3ME0B 1XNRO 1XHZA 2R042 3ZYHA 5E7FA 4J3OC 1ORSB 4WO4A 4FCAA 4ZMQA 1Y66A 4BA0A 1G6RB 3HZYB 2VDKB 4PJ9C 5B3NA 5HVHC 2B1HL 3BKML 1RUI2 4M43H 3MAWA 3ZW3A 3QAZC 1K5QA 1IBMO 5K9QG 4Y9BA 4F37K 3PMEA 2MEV2 4YHIB 2YD6A 3D25A 1NZCA 4GI8A 3ZMRA 1X8MA 3SCMB 2F53A 3NR7A 1VQ5V 4SLIA 4XUNA 2KQNA 2EXSA 4QM9A 3DIDA 4V1DB 2UY9A 3LS5L 4O4IA 4KL1A 4XVSH 1P1ZA 1M6OB 1PKXA 3RBSA 2QQWA 3LZQA 4XO4A 3O0WA 4LO8A 5JLVA 2OSLA 2J2ZB 2LS6A 4GULA 2R0HA 4U1SA 1R64A 4DP5X 1TFHA 4GI9A 1OOPA 4NKGB 3TOPA 3TWIA 4EN8B 1SY6L 2R9IA 1VQMV 1AIZA 2WLZA 4PRPE 1KB9K 5D7JB 5DGRA 3O8XA 4IV1A 4CDWC 2RR13 2Q76A 5TFSL 1F3DJ 2RMNA 3B09A 5IW0A 1RJZB 3LZOA 4HKJB 1FJGB 2A73A 2XN0A 3QXTA 5CEYA 1I9RA 3N43B 4X99B 4TMPA 3WCYA 4DMIA 1ZVSA 1CK0L 3ZE0B 1JOYA 3KPQA 3ULUD 3FUIA 3LH9A 1WV7T 4HIXL 1HEZA 1RUOA 5T5NF 4NMIA 3WF3A 2WXMA 3BISA 3MREA 4ZDHB 3PUQA 4HPKA 4GCZA 1COV1 2E56A 3KSCA 2CLVA 3G71V 1KPRA 1QACA 2XQYA 3DX7A 4ZD3H 2A74C 3MUHL 5I8KH 3MRGB 5B21A 5IQMA 3LSEA 4ZW7A 1XGTB 3EYFB 3KPRB 4MMYA 1RMU1 1IM9D 1XCTB 2YIBA 4AT6A 1BZ9B 3NV4A 4RQFA 3DETC 3QDJE 4AIZA 2DEYX 3B3BA 5HD8D 3NJMA 4U6YB 3SE9L 3AADB 1QI3A 1RK0B 3ARSA 1M93A 2VG9A 2YPJA 3CC7V 2QKCA 3QXDB 1BL8A 3PHOA 2NY1B 4Z5RA 3KYOB 4MXQC 3NSJA 2BO0A 3DARA 2E76B 5IWLC 4LVEA 1AXTH 3RLSA 1NINA 3LZFL 1FMD3 1S0GA 5GGSY 2Q4SA 1FAYA 2Q1ZB 1KYOK 1S5HA 3J7LA 4Q20A 1RZGB 2OP4H 1K4CB 4GUCA 1UA3A 2VDOH 3M46A 1OTTD 4Y4HD 2A9AA 3RZLA 3BPOB 3SDLA 1NOLA 4XJAA 4AFMA 4HG6B 3TN0D 2XXFA 5A7QA 4XN4A 5A2CA 3BODA 5GGRY 1R5WB 4I1NB 5GPRA 3FUOA 5FV2A 2NPLX 2QPFA 3ZZLA 3VTAA 3QH3A 4LO5B 1FRGL 5BW7A 5A7SA 3CH1A 4PRBA 5DQDH 1E5CA 4IMKA 3HS9A 1ES0B 2CBOA 3GZKA 4CP9A 1I8MB 2KERA 2V5YA 3H7BA 5MENA 3EH4B 4H8PA 5LQBL 5T3XE 2X6UA 2JGUA 4MTOA 5I6LA 1RIUH 3BTXA 3PHOB 1G1KA 1U95B 2KA3A 3CN4A 5HCBA 3LZFH 5MHSE 3VE0A 4UCSA 5H35B 3I8TA 1IM3A 1ODUA 2HJKB 3BUDA 1BW8A 3HN8A 1TYEB 2X9XA 2DM4A 5DURB 2ZOUA 4HKWA 2P5BA 5IYDO 1U8IA 1YWKA 4OI7A 2VNGA 1Z3GH 3UO2A 4I3SL 4UM8A 3GMMB 5I8KL 5DJ2A 3SJCC 3MDPA 3BVUA 4RGNB 1UXXX 4KK9D 1OF2B 3HQXA 3WNKA 2DLEA 2B8OT 2WWKT 3ZVVA 2EO1A 2FT6A 2R6QA 3VGIA 2ZCHH 2WV3A 5ELIA 2BSKA 2XBO3 1Q1JL 2NQ3A 4HZLA 2BSSA 3N2KB 4YPGB 5D7KE 3QQ3B 1J1PL 1RUF1 3E8HA 1ZLWK 4LSQH 3PJSA 1U8MB 2FSDA 3H6AA 2OJ1A 3U4AA 1KB9F 3MYXA 3AG1C 2VTXJ 3O8XB 5FXWA 2F19H 1FVDA 1PZ5A 4KTYA 1D5XA 3KG2A 1TVGA 4HUMB 4Z7UF 4ZOBA 3CE2A 1IZJA 5DZJA 4F7PB 1V6KA 3FD9A 3A6CH 4ZUVA 2ZXGA 4PJFE 4YHPA 1CFVL 1R3JB 2VL5B 4DR3O 1K8DB 1D7CA 4AL8C 3BIKA 1N3OA 3N1QC 1HT6A 3FFDB 3O0XA 1BAWA 1HHKA 1HHKB 3IETB 3BKYL 3L70H 2F43G 3HC0A 4PEEA 15C8H 4XXPA 1BAFL 4TZDA 2Q73A 3L71H 2ZSVB 1NUDA 2UU9O 3SKUD 4RMUA 3ZT7A 1QATA 4F15C 2Q8BH 4AUUA 1PIFA 5CGMA 4WCYL 4WNJA 2Y69C 2J8UA 4D8OA 4TSCH 5JQ6H 4NZTL 4PGDB 5DDJ1 1WWWX 1RFDL 3MBEB 4XWOC 5JO5B 1EPZA 5G4MA 2BVYA 5FKCA 3LKNA 4MSWA 4UMGA 1KN2H 4XXAA 4X6CB 1FAFA 1WBFA 4LCUC 2B5IB 3R4RA 4FXKB 3FBKA 4QMEA 1C16A 2HXAA 3OHXB 2OT7A 2J88H 3KL3A 1KSRA 3QIBA 2BCCH 2FD6L 3WD5A 4BQ4A 4NPJA 2HT2C 3S0PA 2EAEA 2R2HB 2QQKL 2K7PA 1JBCA 4FFYL 1H1MA 2QSCL 2VL5A 3KXFE 4ACTA 1NUKA 3I9GH 1YJKA 2J1TA 3HNSL 2XWRA 2HWC1 2NT1A 4KZCA 2NCMA 4CKQA 2QQMA 4EV0A 1ND2A 1JZDC 3TBTB 4P08A 3TU6A 4ZTOH 2C24A 3MLYH 1HI6A 1RPKA 5K0UA 3AP6A 3H2PA 3LNGA 3U11A 3EH5B 2IF7A 5CA3A 4G42B 3V6OA 2OYZA 5IYYA 2C1OA 4I87A 3ZHRA 3VRIB 1ST8A 3MHHC 1NWPA 3S3PA 5MEPB 4B4RA 4HMCA 5ABAA 2NX5B 3NUKA 4FA7B 1UT2A 5JQGA 2EEXA 2ZE7A 3AK2A 1PIV3 5EN2A 1VRH2 2D6NA 3ZHVA 4OULA 4Q4X1 4QU2A 4R8CA 2QA4V 4TSBL 2V0AA 5T1MB 3VXSA 3I2CL 5E94A 1N2RB 5KS9B 2XLFA 2W81C 1HKLL 1OLQA 4AQTA 1BFTA 3WZ1A 4WUKL 4QJFB 3ARFA 1V10A 4XIKA 1PD6A 4PJCE 4GKSA 5BZWA 2DCJA 2MMXA 4PCKA 1FXKC 2E7CA 4Z7VE 4OFKA 3FB5B 4UMSA 3E6HA 4GRLB 1PZBA 4BHUA 4MNGA 5F5IA 3UAFA 2DQMA 2VMCA 1YEWA 1YYML 3A4AA 2HYXA 3E89A 1UWXK 1T66D 4Z18A 3CXDH 3DX6B 2VAUA 3RX7A 5FYSA 5CA6A 4YBQC 4NCDA 4P2QB 2D3OW 3BZ5A 5MEOA 2IJKA 2UYAA 2GJJA 4NZTH 1E4KC 1NPNA 4QDRA 1MJ7L 2QPUA 1VQ6V 3BEWA 1DQ6A 1VF5B 3QXDA 1QPPA 4UZGA 3E8UH 4LBAA 4Z5RB 3LNMB 2FJGA 4KK9C 3MNVA 3N7MA 3BSGA 1S0EA 2MOGA 2P43B 4KAQH 1ZREA 1TPXC 2H3KA 1M42A 1KXTA 2FB4H 3B5HA 4Q0SA 3BGMA 1L7QA 3AZYA 4LBLA 4RR3B 3DDFA 1DK1A 2XBDA 5B22A 3ZT5A 3CXHJ 5D1XC 2PTUA 3GO1H 5FA4B 1MQ8A 4Z2WA 1F1DA 1I9RH 1J3PA 4J9ZB 3SQRA 2XAFA 3V4PL 3SDDA 1YJDC 3PWLA 3CAFA 3SE3A 3HRZC 4LLQB 1UJTA 3EJTA 3OJ2C 4HGMA 4IS6A 4UIKH 5LO7A 3WAJA 4R3SB 5I1KH 4PLKD 4CDXB 1KV7A 5CINH 1UYYA 5K9YA 4MVQA 4JFQB 4ZO6A 4IEUA 5IHZA 5E8DH 5T3XD 4PAZA 3Q6GH 4RL7A 4L4VB 1JNJA 4OUMA 3LDEA 1M4KA 5CKGA 3QJFB 1BGYH 4DO4A 1GTOA 5DFWH 4ATEA 4UV8A 1BX2B 1F4AA 2LW3A 4MVRA 1RMFH 4TQEL 4QE7A 2ZE5A 5C6PB 3LMJH 4XE9A 1VALA 2YK1L 4KI1A 3PJQA 2YV8A 5FZIA 5H6QA 5FZFA 2BWQA 2ZYRA 4RGMC 4TQDA 2ZUYA 3WNPA 3ZTNH 4NZDA 4ZK8A 5K59F 3L17A 3FO0L 2VDQH 2PNDA 3VMNA 3OAAG 1KB3A 4D7PA 3IWUA 2V8MA 4CC1A 4K3EL 4N6RB 5HHOE 1H8VA 4XF0A 2FTAA 3WW3A 5I91A 5EJZB 1X6LA 1ZWIA 2UYLB 4AYFB 4ICXA 4JJ5A 1TQWA 2ZGUA 5IOPB 2XKSA 3AAZB 3MRIA 4YL4A 2HT2D 4CADA 3UT5A 1SC5B 1FORH 2BTQA 3QG6A 5FCCA 3DN7A 5EYPB 2DBLH 1A64A 1AYM2 4IOFC 5DTFB 1DUYB 3VB9A 1ZHBB 4EZLA 2HWE2 2IVIB 5JXAL 1TZ8A 4BIZA 3TN93 4R8WL 5LBQA 1YNKL 2R4RL 2GVYA 2FWUA 2WBJB 1MLCB 1NTMH 4BD4A 3KM5A 1QDOA 4Y24A 2ET1A 4JB9L 2X9YA 4OZIB 1Z66A 1AR61 3HMXA 3T1CA 1HNYA 2JKXA 1SBEA 2GU9A 2EDNA 4E4DX 4M0HA 3LEXA 2Y72A 3BP5B 3HZMA 4NGHL 1PQZA 2DQUL 1S4IA 3I2HA 2W9XA 1DSWA 1KJ2H 1Q72H 3RJRA 1QBBA 4TUUA 3D25B 1T66C 3HVNA 3A0OA 1N1TA 3II1A 3OD3A 2HWD3 1NMCC 3C5ZB 2OCJA 4K3DH 1CWPA 1UWEH 2XGXA 1EEQA 2GALA 3ARED 5BUPA 3QUGA 2R0WH 4G8FB 2AJVL 4YM0A 2W92A 2CTQA 4M1GH 4H14A 4CSWA 3IGFA 1NCCL 3Q9PA 4FQHB 1IAOA 2ICES 2B1OA 5IYZB 1OCRB 3HKCB 4GFTB 5CZVL 4HUVA 1OZ0A 2WKKA 3ENRA 5DDJ2 1H2NA 3ERXA 2RMU2 3ZRCC 3SOBH 2YZ8A 3BP7B 3MTXA 1USZA 1CGXA 1YNKH 2BHFA 1MCOL 1IKNC 2R4RH 4KY1H 3X1EA 5SWQB 1N7MH 4LRNL 5KBDA 3T4ZA 2DEXX 5T5FH 3ZKYA 4MXQD 1YFYA 2W94A 4YBQD 4GKLA 4FQ4A 1YY8A 3A7QA 4XUOA 4JM2A 5I9QC 1UACL 2Q7GA 3S5YA 1QTPA 4MDIB 3UBFA 2AXGB 5AVVB 4ELMF 2HR3A 3ABTA 3QEUA 5ESAB 2BOIA 2VAAA 4BFGA 1G9EA 3O0LA 3D0SA 4X7CC 2P6JA 4GKKO 3LY6A 4HSAC 2VC2H 2Y7OA 1I8LC 2JKIS 5D7IE 4HVBA 4IW4C 2JIXB 2WIIB 4PHZA 5ITFB 3BY6A 1N3QA 1RTVA 4E9RA 4CADB 1LGBA 2YMXH 4NN0A 5FYYA 3O3EB 1RXGA 2Z35A 1AR82 4JO1H 3MLJA 3ZDZE 1FYTB 4H0LC 3AKPA 3KZ4C 4MNQE 2XY1A 3BYYA 3KPMA 4LLYB 4MS8D 4YDNA 3KWTA 4APQA 1GZCA 1QJEA 1QSFD 3EFDH 4Z8BA 3U7AA 2CJTA 3KD4A 3B6SB 5C8YB 4DR7O 1C12B 2F53D 4G6FD 5EO1B 5J8OA 3HZ3A 5EIQA 3N36A 2LW8A 4HXBL 1PZCA 3B2XA 4JGMA 4ACPA 2NY6B 3C09C 5F1KC 2J55A 2MCAA 5L9RA 2YEVB 1ROCA 3N85H 5JI7A 2NNUA 1UUNA 2A5UA 2VR7A 4PD4J 3ZKMC 2DQIL 4FYQA 4I2XE 4LSVL 4IU2B 5LGUA 1LJ7A 3FQXB 3JWNG 1RUG2 1J88A 4WHDA 5L2KD 4BA6A 4Z7QF 3MMEA 2D2OA 4DUWA 3VD5A 2UXNA 1WG3A 5GTIZ 1Z7JA 4GMTL 2YC1A 1UZ6F 3T3PB 2OMUB 4IYIA 4OJYA 1O4YA 1A78A 4LLQA 2OR9H 4JREC 4MNGE 4LP4A 1HRV1 2DW4A 1YUDA 3OGJA 3QD6A 1ODNA 4R7CA 3VBFC 5FQ0A 4TT3G 1F6FB 1AQDA 1C08A 4GP4B 1AYM1 3NMBA 1JVMA 5A3OA 5BNPB 4QY8A 4CUAA 2DWTA 2E8ZA 1FG9C 5CA1B 4PGZA 1RUQH 4HHAB 3GSWA 4KKLD 1SBBA 4BRVA 3O3AA 3ARDB 4HS3B 3QA3A 4P5SA 3L1FA 4Y9EA 5C6TL 1AS6A 5I6XC 3TXQA 1I8KA 1NAKL 3FKSG 5HGGS 4AYID 4CE8A 1TYJA 5I8EA 5JSOA 5HFLA 3UTOA 3C2AH 1JTTA 4NDMA 1OQDA 2J42A 4FPGA 1J86A 3RT3C 2NMNA 4XNBA 1EZVH 4X5LA 4JQVC 4Y5VB 3ET9F 4MGYE 2EYRB 1H5BB 1VLNA 3RJDA 3I6KB 3Q1SH 4R97B 5C07D 3SDDC 3GRWL 2GH8A 4FVMA 3TN0C 5HVGB 2E9JA 4BCZA 2W0LA 1AR1B 4FJZA 1NCRC 2DKUA 3RWCB 1DJYA 3IFLH 1NC2B 4JFYA 5IREA 2NYYA 1AFVH 1L7LA 1M57B 4JG1L 4DZGA 3QXUA 3JD4A 5FHAL 4IKNA 3VI3F 5JIKA 5C71A 3E35A 4PGCA 4H1LG 2PWEA 1A32A 3VTTA 1J11A 5DHDA 4HJEA 4AV5A 1RJ7A 1XQNA 3ARGC 2LTNA 2VW1A 3VFRB 3UCQA 1GGBL 1O9GA 2BCMA 4NQUA 4HCIA 4O02L 4I2OA 5BO0D 2UUCB 1VF6C 2F9BT 5I19L 5AOJA 1DQ5A 1BD2D 4P9JA 3W7TA 1YXBA 2QTWB 4I0WB 1F3DH 5EN2B 2GBTA 3GNMH 3EVKA 3QDME 3QWOA 4IRZA 1BG1A 4PRNB 2J8UE 5I0DA 5IFJA 1MACA 1BYPA 4ZO9A 1BXVA 3E6DA 2Y48A 3MOBH 3WKMH 2VISA 1K5MC 4OZFG 3VDCA 1X8EA 1OCOB 4X20B 2NY2C 3ELQA 3NJFA 3MZTA 3G5WA 2XPGB 4HKOA 5KS9E 3ZKND 1ETB1 3SCFA 2YUVA 3RHWF 5E6IC 1G9ML 1RY7B 5JHDE 2QVKA 2AJ3A 2IGTA 3BRGC 1PNCA 3FRPB 3O6KH 4J3OF 5C8CA 5LGHH 4Z7VB 5SWZD 3QDJA 5C5UA 1SLTA 3C6LB 3B6SA 5IK7A 1CXEA 1MFAH 4O4HA 3BOWA 1UYWH 1OAYH 5FUCE 4ODUA 4ZXKA 5ADPH 1TAEA 4M7LT 1OOPC 1UOBA 3S37H 4TVPE 4NRPA 2X9ZA 1A1NB 1AYN2 1W3XA 3EHKA 5IVCA 1ULPA 4OSUL 5GISH 1EZVX 2XVKA 3EYOA 5SV3A 1X7TA 1JHKH 1B09A 5DWPA 3QI9B 1CU4H 4AHYA 4NO0A 4CL7A 2QSAA 4GQ9H 4MX7A 3HG3A 2B9AA 3W56A 2CSPA 4H5SB 1H4HA 5F9TA 3IFXA 1TUPA 4P4KA 1R3IH 4ZMTA 1ZRFA 1O59A 2ZBJA 1TTBA 4F9PC 5JOPE 5FZ3A 3MBWA 1I9IH 4Y16B 3AB0B 1IQDB 3ZKMD 2WJSA 4DOHB 1OB1A 2DMXA 1TQSA 1YJNV 1KKDA 2RCSH 1EV12 1MVQA 1FXZA 4H7LA 2AQPA 5AVZB 5A7WA 3CJIB 1DBML 4D7BA 5GRXG 3LD8B 2ZXCA 2FATL 2XN9D 1OLMA 1RZKL 3GI8H 5GZFA 5JUVA 3IJ9A 2OR7A 1TGOA 5I0ZA 4NLHA 4GP8B 4QAMB 4YW1A 4V33A 3AQYA 3CDZA 4UZUA 2WJ5A 1TITA 3RKPA 2A6VA 2GAZA 3H3PL 2A0LA 2K6WA 3SJVD 3VCLA 3WCSA 5FPIA 3S57A 5KHJA 3B8SA 3WNNA 2OQ7A 5E9DE 1S7SA 1LTXA 2FH6A 4H55A 4N4YB 1E4XH 1A6AA 2DRUA 3HB3B 2GI0A 5HDWA 4JVWA 4GQRA 4ZNEA 2F7IA 3Q2CA 3CMGA 3P9LB 1OOAA 1BYNA 1QKZL 4LO6B 1CP9A 1S5HC 1YECL 4Y4FC 3WQ7A 1YPZB 1JUHA 5SWZB 4WI7A 3GMPA 1AILA 2UUBO 1QFOA 3AG4C 2ZP8A 3NIDB 3OPZL 3RUGF 1TJIL 1LNUA 1ZT4A 2YGQA 1ND2C 4FGMA 2IFFL 3NCXA 1AD0A 4BE3A 4U1GC 4XO5A 5BS0B 1ET5A 1G4RA 3MV9D 4OYUA 4RH4A 5HHOB 5F97E 3VD0A 4BYHA 3M99B 3ZE2E 3QUML 5A7NA 4JAMA 2VVEA 4DUZB 1B0WA 4HWBL 4JFSA 4R7XA 5DTFA 3Q8FA 2R56L 5ESVA 4J8RB 3EFFK 4C56D 2D7MA 5L3EA 5GJSL 3PAVA 4L0YA 1QU0A 3AABA 2EVFA 1PGSA 1RK7A 2DMBA 1MCHA 3DVGA 1NQJA 4BBWA 2WZR1 3TASA 4WM8B 5DJCB 1EWHA 1JGVH 4R90H 4I0PC 3I3BA 2ZX0A 2VW6A 2WS92 5C9AC 5L9DH 1CUOA 4UWDA 1TUBA 4XAEA 1W8NA 1OPGH 3I6KA 2B3IA 1ACCA 2I7SA 4WRLA 3S48A 4Q4W1 2AV7A 2BRTA 2MRYA 1AZUA 1A4JA 5C8JB 1ZV2A 4ZJ9A 2CBMA 2ZUSA 1PYWB 2EDXA 1Q9KB 2CGYA 2WQ8A 3WIIL 1J0KA 4N53A 1RUJ1 1EY2A 2P5ED 5JLZB 5FY5A 4AQAB 4M61A 4M48H 3OAUH 4KK5D 3W5MA 3C5XA 5J13B 1R3KA 1MQKL 1DCEA 1OH3A 4DGIH 2PHXA 3HG1D 3ATAA 1YNTB 3D85B 2OYKA 5J1XA 1DBKH 3M8AA 5ACLA 3U9UA 2BSKB 4K0KO 1KGYA 3E9UA 2ENJA 1PSKH 5F5AA 1BDYA 4Q0XH 3PURA 1YMHA 5IVBA 1DJGA 3WUWA 1F6AA 1R4XA 2EDQA 1KOAA 3KVQA 2Q0OC 1VRSA 1ZIBA 4MD5A 3LIZH 4K23L 4Z1VA 3WF0A 3WY1A 3CQOA 4D94A 4IGPA 1FGNH 1VB2A 2YIDA 1A3LL 1G6RH 3G6JB 2Q87A 2BRRH 4X4XB 4PLKC 4JBSA 2WXQA 3B9AA 1ZHNB 3JT0A 3VE0B 1WT5A 2A9NH 2OS7A 2P4AB 2Q2LA 3LX9A 2W39A 2H32H 5IQ7L 1TZOA 3HKDB 1EEZB 1KLGA 3NH7L 2A38A 1SGKA 3ZHUA 1YCIA 2XWEA 3FTUA 3GGWB 2MCPL 1LD9B 1Q8QA 2OYQA 4U3CA 4CP2A 5IAXA 2J20A 2OZ4A 4OI8A 1X6NA 2GC3A 3VYNA 3U46B 1FFRA 1OSZA 1T4KB 3AQZA 3TLRA 1KEXA 3L3JB 4PVMA 3DX4A 3L2MA 5DHXB 1NY72 5I5JA 3TYFA 5L4FA 2DVBA 1CGYA 3QJXA 3IJ4A 2H0EA 4JPQA 3UZVA 4N22A 2PPDA 4TRPL 2QVIA 2Y22A 2HUHA 4NM8H 2LLLA 5D7IA 1S0BA 4LA2A 4NPRA 5GS3A 3D5OF 3VI3A 5KSBB 1LO2H 4FLHA 2VDQL 3H0TB 2HJFA 2BXZA 5A6QA 1CD8A 3IDYC 3LKQA 4L2LA 5E6HA 4AIEA 35C8L 5BS0D 4IEFA 1NLQA 4LHUB 2UZYB 3QCVH 1GZPA 3EDDA 2PY5A 2DQDH 5LCWL 5FY1A 2HZHA 3UBXA 5BV7B 5EFIA 4HIHA 1HNGA 1N34B 1HDMB 2AP2A 5JORB 5EIYB 4LF9O 5LBFA 5D7SH 2VCCA 2O6EA 4YWGL 1JAEA 2GTZA 2YYOA 4G42A 2DQHL 5LKNA 3LRSA 3QEGL 3CC2V 4NBZB 3UGXA 1IBDA 2K1EA 1Q81W 1A9BA 4XXCC 4YH6A 4DP0X 2VC9A 4LBKA 3CEWA 2RR3A 2BP5M 2YD3A 4F2MA 3QXAA 5LBEA 4OPAA 2FLMA 1WFNA 4C4BA 2XYCA 2YIHA 3VI4F 1QI5A 4PYHA 4LF3B 3QRFM 5IW1A 4DV4B 2OMXB 5IWLA 5I23A 4TTGA 4KFMA 1HWWA 4LT7A 1XQ4A 2QQLL 5GW7A 3UMNA 4QX2A 4NIIA 3O6LL 2YC2A 5E4EC 4IU3B 5GJ6A 3OVUB 4Q9CA 5M0TA 3CK0L 2KPWA 2AAAA 3WY3A 4QPGA 2EXKA 2EXYD 3ATGA 4UCUA 1HNWB 4X9IA 3S5LG 3WE6B 1SQ4A 4AK3A 1TQCB 1YJWV 1HFUA 3IFNH 5E1IA 4J4PD 3FRPG 4NCC2 3VRLE 4DV3O 1WCKA 5JXEA 3ZMOA 4ZMVA 1FWXA 5FUCC 3N9NA 4X0KB 2EEBA 3T1YO 1Y9QA 4HQQH 1P6AB 1E5YA 2KMWA 4J7ZA 2NR6A 5HJDA 3SSGA 1NS1A 5ESVB 1W9WA 2VPVA 3JQXA 4R2GC 1ZLDA 2IANB 2OQJA 3I9IA 3B7MA 4JAMB 3VKLA 3WP5A 3U83A 2AW9A 5E9AA 2R7EA 5TK2A 1IBHA 3UZEC 4U1HA 4HIQA 2CHZA 1BD2A 3CCMV 2CUGA 2WBJD 4ZUVB 4OUOA 4TVPL 3O81A 4DEPC 1EX0A 1WBXB 2CA4A 4AH2A 1KMIZ 1UJ3A 3W11D 3WJLC 5CIRA 2F5AH 1HOCB 3KWWA 5LA6B 1T04A 2DJMA 1D5IH 4FQJL 1O3QA 4ZFFA 2X87A 5CP7B 1Y1DA 3MI8A 2AK1L 2AEYA 2G5UA 4P9PA 2AQNA 1Z0NA 3VDAA 1WLEA 1FSKB 1RJLB 5CJXA 4RGGA 5H94B 4Q1RA 3G5YA 4MJID 1OSZB 3EKCA 3WELA 4QTIL 2WUCL 3CN1A 3CDZB 1W6MB 5DJ2B 2O6DA 2WNVC 2EO9A 1ZVFA 1YN7B 3HLAB 5E4IA 5LEKA 5MHSD 1KN4L 2AR6A 4X6DF 3HZKB 3IDXL 4PREB 1Q8VA 2F1MA 2N0KA 1UEMA 1HK6A 4G6FB 4AVTA 2OV0A 3MV8D 5CB4A 2DAVA 4M62H 3OPUA 3Q5TA 2BPA2 5C08E 1DE4B 4POZC 1W8TA 1VQKV 5DQDL 5F32A 3H1IH 4I0BA 4J3VA 1EFXB 4QXWA 5GS1A 4B9KC 1S5IL 4EJ1C 5B39G 1WEJH 1S55A 4G8EB 4H1LB 1XXFC 1QFWH 1I9JH 4M8QB 1WWBX 2AYHA 1ZS8A 5LBBA 4IK7A 4LUMA 3D0VB 1E8ZA 3CH1B 1FYJA 4JCWA 3U46A 1RPOA 3DGGB 1HAWA 4YZFF 4BRJA 4GEJA 1NOAA 1TME3 3F7YA 1MRCH 3L2LA 4NC1C 1HR0O 1FPTH 4AQYB 2I07A 2QQUA 3W58A 2XZCL 2EZ0C 4UCRA 3P4MA 4MB4A 4D0DB 3QDMB 1LAJA 3LS5H 3NEOA 12E8L 3B8YA 4M62L 4KHPB 1NI8A 3GMNA 4FFVC 3PDOB 4DYLA 2BSEA 1QLEL 1KLUB 2LHAA 4MXVE 3VXUE 4O9GA 3H50A 5J48A 5CLZA 4OAWB 2C3VA 1J0YA 1X5KA 1AP2B 4JFDB 4D0CB 4OMCA 3IGAA 5EC2A 1ULOA 1MXDA 5IVXF 1MCRA 3ZSSA 2AK1H 1T7WA 2JB5H 1WD8A 2WM0A 4O5LL 2ISDA 1Y9MA 1KP3A 3DYOA 3NO8A 4AENB 3SMHA 5FYJD 3BGAA 2J2ZA 3RVVC 4FI8A 1S3JA 1FP5A 3I74A 5D1QE 5A2LH 4F9LC 2ZGRA 3RSJA 5JIAA 4A45A 3ULUE 3UCSC 1ZHLA 2A75A 5LMUB 1JZFA 5BO1H 2WZ6A 1XBRA 6PCYA 1FCCA 1M1XB 1AGDA 3LRKA 3WFCH 3L5IA 3JWDC 3GXUA 1OVSA 2YPLB 1OQOA 1TVHA 1RZIA 3CFIC 3K2UH 4PSPA 1V54B 2ESVA 3ASWA 3WL9B 5FRAA 3NSFA 1JZJA 3LIGA 1P9MC 5JPNA 2OXBA 1JNNH 3MA9H 1A0QH 5FY8A 2YQBA 3S88H 1UWFA 1L0YA 3ZK0A 5F72S 1APNA 1E90A 1DFBH 3QORD 2DKSA 5AG8A 5F1SA 5EBWB 5T33L 1IAIH 4DV1O 4XVHA 4ZFFB 5GLTA 1CJYA 4LBOA 3U4XA 5KYUA 3S37L 2BCKA 1DDTA 1F23A 4GLRH 4H33A 1MW1A 4L1DA 5LXTB 2IXCA 2FX8H 4U2AA 3DECA 4DEQA 3AM8C 3VOUA 1A6CA 3B2VH 1TG7A 2V4DA 1G9MC 3IT8A 1H3GA 1UOVA 1ZTEA 3Q5YA 4HV8B 3RGVB 5I1EL 4S2DA 4GS7B 5ERWA 2V17L 3MLUH 2EDYA 2OSLB 5JW4R 3E0GA 1JFFB 5BZXA 1KGCD 1SN5A 1P4RA 2GTQA 3JTSB 2G1MA 5ANMB 1LEMA 4RFRB 4J1WA 2XRAH 2HJLB 5LHIA 3D4ZA 3CSYB 2CDGB 3HC4L 2JDNA 1QJY1 3K5OA 5FPVA 1CQ9A 2B2XH 4WJ5B 5DVPA 4JZ2A 4N2KA 3BKCH 3M3CA 3UKNA 4N8UA 2VDRL 1DR9A 1RZ8B 2UXDB 2YXYA 4D0BA 5J3HD 3LRMA 1JFQL 3UTZB 4YXLH 1OFNA 1VARA 1A02N 3WINE 3B93A 3DOHA 4P8QA 4UWQB 1TMF3 2BP8A 5ADOH 2GY7B 2WXJA 1M9SA 3US9A 3RYKA 2J1WA 2X2YA 5LLIC 4RRPA 4RAIA 2Q2EB 3JWDL 4MRCA 3M70A 2CGRL 4FI9A 3FONB 1T1XA 4YM2A 4AZ8A 1XZ0B 1X36A 4NR1A 3C6LA 2DKMA 4NZRH 2ZAAA 4JGZC 1LJMA 4JL2A 5C2BH 1JGUH 3MRPB 4FG0A 3CWGA 5DG2A 2FYUH 4I02A 3CCRV 3VXRA 2N1KA 3WU1A 2IFWA 3AKRA 3S97C 1CONA 5BRZA 1JH5A 4RQQB 4JI0O 4X7TB 4N86A 2AKRB 3II3A 3A23A 5JVDA 1GAFL 4A2MA 2CK0H 4C90A 4X1KA 1T83A 1DHKB 5FM5M 3KPSD 3DOSA 1VBA2 2B1AH 2HFFB 3BH8B 4HPOL 2CGZA 1ZTMA 2F66C 4R7DB 4Y5XB 1UZVA 4Y5Z0 1RJYA 1OD5A 3VZMA 1YI2V 2Z93B 3W1ZA 5DYOA 2L35A 1P7KA 5EZJA 4AEHH 3OMAB 4TOIA 3Q8EA 4QCIB 4JFEA 3LSQA 1SHSA 4XN2A 1VF7A 3CDGA 2E32A 5MERA 1CXZB 3CCHA 2GAUA 4K8RH 4FO9A 3CFBA 1DANT 1SDDB 1R17A 5B38G 5KSUB 1J84A 1OTUC 3T0EA 3ARGA 2VBDA 4KVCH 1NFIB 3S3JA 2RM21 1KKCA 5GJSH 2OX5B 2BQPA 2BK8A 2BNRB 3AW5A 5L9BA 3ASOB 4JPSA 3PLQA 2HH9A 1HNZO 2BVBA 5EC1A 4NEHB 4E4ZA 3DO4A 4KFZC 2JLLA 2J6EL 3ESUF 3SGEI 4CEWC 4L1BA 2CH8A 3B8NA 2I74A 4OFVA 1EBAA 3UO1L 5DJDA 2F17A 3O1MA 3V9EA 2CBQA 3PYCA 1FVEA 2CHXA 4C0HA 2YGMA 5FWEA 2FDJA 1R0AL 1JR9A 1RM1B 2D7TL 4JDVB 1X59A 3BSZA 4JKPH 4UQEA 3U0WL 2W9EL 2WCSA 1ZY9A 3FZUC 1U8NA 2AJXH 3DK2A 1LO5A 1G7JA 3X3FH 5J7CC 3AGVA 3CEIA 1QUNB 4HVRA 3RYPA 4UT7H 3TFBA 2WXGA 5AVAA 3UBHA 4OB5L 3WD5L 3ZL4H 4MBRA 3PTYA 3NCJH 2IPUK 5F44A 5FHBH 1KXVC 5BR8B 3GTVA 1KGXA 3I6SA 3P9WB 5CA1A 4H8WL 3BWUC 4EN6B 1SLWA 4E42B 2LRPA 3BYTA 3ZFEB 3LKRB 1J3QA 4G1EB 4J23A 4GRMA 4YAQA 3DIFA 2N4IA 3AWGA 1HXYA 2EXJA 4XVTL 2A9NL 1QA9A 2BSBA 1JODA 1RUG1 1F6AB 3QIBD 2DBNA 5GGQH 2BFUS 2BOBC 2NY1C 3VFPB 2ZX3A 3QWOB 1R73A 3KB5A 5A2JH 5IQ9B 1F2QA 5FTTC 5I1HL 3ZHTA 3OUFA 1RKRA 2Z7WA 1JBJA 1SN2A 4SBVA 3CWBH 5JW3H 3BPNC 3FAWA 3U4SA 4BYYA 1FLRL 2DQFB 5C09E 2PXYA 2WHVA 3RL1A 1DTOA 3NFNA 3MZGB 4XDPA 4MS8C 2VJXA 4GG8B 1JHJA 5D1QD 1CFTA 5T1DL 2AEPH 3BLKA 4MHUA 4EN7B 5FOBB 5FOBA 5KBPA 2BVQA 2IOOA 3FBYA 1TVKA 2VM4A 1AACA 5KUKA 3MRLB 1FMD1 5C8YA 1QJY3 1VBD3 5CLWA 3G9VA 3VBBA 2I5YH 3OAYH 3KS7A 2HKAA 2LU4A 4ZFOL 3L73H 5A7OA 2Y36L 2ZNJA 3K80A 4L8DA 4HBCH 5EC1B 5HGHA 1HZLA 3SITA 4HWBA 3UTTB 2R0WL 2AJUL 4AV0A 3EYVB 3ZN6B 3KYKH 1ILSA 3I49A 3VFPA 3T1YB 1UATA 2FD6H 4LUKA 1IBMB 2KZKA 4J3TA 2WVSA 1AGCB 5TE4L 5MEND 4GX1A 5FM5O 3WXWL 3O1PA 1TQ5A 1RB8G 1UXWA 3S5LB 4Y1YA 4KROD 2X29A 3T6QC 4PF5A 4XFIA 4LDCA 3C7FA 4LIVA 4KXZI 1GSLA 1K92A 5DRXA 3BWUF 5C0JA 4IRZL 5CCKL 3VUAA 2YIBD 1ZT4B 5F3IA 2N0MA 2WLMA 2P2KA 2CLRB 5IVNA 2ZKWA 1RAMA 4I30A 4KXCA 1DQLH 1E4JA 2YSSA 5CJXC 5DD6A 2XOKG 1OXYA 5I30H 2VN5A 3EIFA 1WE5A 5SWQA 3FTGB 5I2IB 3ROOB 1G8WA 4B9IA 1ULFA 1EO8L 3ESVF 1EN5A 3ZDYF 1S46A 4ZY9A 3KH4A 3QUZD 2MWCA 2X4SB 3T2NL 5GSVB 3U14A 1IZKA 5IKCB 3VL9A 1O7FA 3ETBJ 2NM1A 3IE4A 2BNUA 4MZRA 4N2HA 4OCMC 1DJIA 4JGUA 4DTGL 1NBVL 1GS6X 4IBSA 5AB1A 5G04L 4J3UA 3VXRB 5JHAA 1ITCA 3M1OA 1JX9A 3D34A 4HWUA 2B39A 5F3BB 3HUJB 1A3QA 2Q30A 3F5WB 3QG5A 4I7ZC 2RS51 2D7FA 1WNSA 1CF8L 2G9HB 5DS8A 5EHDA 5HDBB 1TLKA 1V3KA 1Z9MA 5ETUB 3TN0B 1WFJA 1Z9LA 4UQ3A 4Y1UA 4FEMA 5T5NG 4FFVD 3WDYA 5JMRA 3IDNB 5H2BA 3AJYA 3CX2A 1BF8A 1GIGH 4G43B 2EULA 4NKDA 4HK3J 4W9DC 2E7MA 5TQ2L 1AYN3 4P2RB 3VBOB 4HC1L 3CDGB 4XCEA 1P7BA 1JPGA 5DHYB 1KUQA 3V0AB 5ANNA 4YHOH 1Y7VA 1LMKA 2YA0A 1PKQE 3ALPA 3LEGA 3MW4A 3NQHA 2GHYA 2YS4A 5DZOA 4ZKIA 3FUHA 5FYLD 5JW5A 5I8YA 3U0TB 4LE3A 2R72A 5I0WA 1MCNA 1GP4A 2HJLA 3OLIA 4MHHI 5CG9A 2EADA 1DHKA 1KV3A 2O26U 3BZFA 1VEWA 2JI2A 1G9NH 2NTFB 2WP3O 5IMMA 2FB4L 1YAIA 4A2LA 3NNLA 2HHHO 3R0RA 3FLRA 4W65A 1R3HA 2LFRA 1HQRA 2XONA 2EZPA 2NXZB 4LT5A 3CLPA 2DL2A 3HJEA 5FO8B 2WO2A 3WLWD 1SLLA 1NBCA 1W2AX 3J9SA 4EN3B 2X6AA 2HWB2 2FH8A 4Z82A 1ZBE1 4EN2A 1I5ZA 4GW5B 2B9ZA 1AXSA 2IXHA 3JVFC 1JZHA 1XB8A 4HCFA 2ZHLA 1NL0L 3SYPA 5D2AA 1RI8A 5F3CA 5GTHZ 3KQRA 3VHPA 3E83A 1CTOA 4PS4L 3GUFA 4P2QE 1Z9NA 4QTIH 5A1AA 2NUTB 3E97A 4FMKA 1S7RA 1ZHBA 4YHOL 1J9RA 2DN7A 1DLFL 2Q6WB 3T4AB 1X9LA 3QCWA 2RIKA 1EP0A 1VHPA 3K8LA 1H1AA 2DWSA 1SQQH 3QJSB 5IFAL 5KVEL 5F3HB 4YAQB 4FFZL 4OUUA 4Y20A 4HUXA 4R4XA 4ZUSA 2IMNA 3EYVA 4QHBA 2ADJA 4CEWA 1RU9H 3HZMB 1J0IA 1SXAA 4ZSOB 1I1FB 4C56A 1U97A 1BSMA 2ZXQA 1DQ2A 3LQAL 4JJOA 5J2TB 3X14A 2H2SC 3LQAC 4AW4A 2H3XC 3FCSA 3T30A 1YHFA 1P4IL 3BGFC 4JO5A 4YHKL 1LO5B 3CYOA 1H38A 3COOA 3GBML 1F4HA 1QXPA 5ADPL 1QMJA 3LFIA 4WKZB 3SDYH 2W1QA 1UFGA 1IQWL 1CL7I 3U4BH 4BCYA 5F7UA 2HLFD 4GG6A 4OZHF 1JS4A 5HHPB 5IB2A 1LODA 3LD8C 4NN7B 4QOKA 2CZNA 5KYUB 2J1EA 4YOKA 4UDTA 5I66A 1I94O 2XTJC 5DVLA 2E59A 3U37A 3LNDA 2DBIA 3ZIYA 3BD5A 3NPSC 3QS3A 2EIKB 1OQEA 4JPWL 4NP9A 3MROA 4X6BB 4BQ9A 5ESQB 1Y07A 1I82A 1JPTH 4U6XB 2YKLH 1G7MB 4I0AA 4CC6A 2P45B 2TRYA 3N1PC 4NKMA 1TVHB 1Z2KA 3T2QA 3GBNH 3P4NB 4S1QL 1I7ZB 2YD5A 4LA3A 2ROYA 5HJBA 4LO7A 1KJMB 1ZLEA 4XWOD 5AFBA 2FIKA 4ALAL 2OL3H 1HC1A 3ARFB 4MVBD 1KB5B 1TEIA 1XSJA 1XCQA 2WQVA 3B43A 3MUJA 2XYBA 4Y4FB 4Z2AA 1NEZB 1O8SA 4UCTA 1IFHL 4I85A 1UOWA 5DUJA 5KSAA 1NG0A 1KBKA 5AWNL 1ZTXH 1W2OA 3A22A 1OZTG 1YMMB 1TCMA 2LTQB 3OKLB 2E51A 5FP9A 2F2HA 2VQUA 4APQC 5K4LA 5EOTB 2DQIH 4XPVA 4LSSL 2RR12 1QPXA 4B1MA 1MG1A 1KTKE 4JQIL 2LGQA 4PJ8A 4AE2A 4IV3A 2R1XA 4P23D 4H88H 4ZRGA 3G67A 1GANA 5CNAA 3VAEA 1HN0A 3HZKA 1GKBA 1KDKA 4PG2A 5CXPA 5L8KB 1V00A 4GSDL 3F7VA 2BOLA 5FO7A 3AMQA 4JO3L 3FRUB 5AOKA 1TZHB 1BV8A 2CGPA 3H9SD 4JE4B 3SQBA 5CAYB 1AX0A 2VC2L 1QBLL 2EYTA 4EZMA 4YHLL 3KVAA 1QJU2 3VFOA 3FE5A 3CDCA 2WY3B 1CFVH 5CA0A 4CSPA 3CCJV 3CVCA 4Z7NB 1QO3A 1ZA4A 4PJDA 3EOBA 3SKOA 1YO4A 4OM0H 2JQMA 2YBRA 3OF1A 4PA7A 5FMBA 2Y4UA 3F00A 4MJ4A 3DPBB 4NQDE 3K06A 1RUC3 3LEKA 2F4PA 4K8ZA 1I8IB 3U4EA 4AEIH 1X5XA 3V0FA 5KR7A 2OMYA 3RRQA 4Y7OC 1W2TA 3OGCA 2YFZA 3QO1A 4K94C 8FABB 1KF9B 5KVDE 4ZFOB 3ZHKA 1FNEB 1UKTA 2R32A 2WNXA 1Z2GA 3O9WC 1UYZA 3VBUC 3BJLA 3ST7A 3AP5A 5JVDB 2H2SD 2YMOA 4PMFA 5GLUA 4Y9GA 1MHEA 4RQQA 4X7TA 3TH4T 2VDNB 3NIFE 1NXMA 4XMZA 5HHMB 5IB1B 3X1GA 4KU7A 3LAFA 1QJU1 1C5IA 2K3TA 4U3JB 2ALWA 1AR93 2J88L 4N2GA 2VWKA 3T71A 2VIRB 1FN4A 3ESOA 4L8JA 2ZYHA 2VXVL 4XH2A 1D5XB 5EQUA 5KAFZ 4B3RO 1I7RB 5EU6B 4YW3A 1PZDA 1UKSA 4Q6IB 4RFEA 4G8FA 4N9OB 4XP4L 4D9QD 4PUBL 5C0IA 1UGKA 3SKJL 1GGUA 1PL3A 3OG4B 3ZYZA 4HMZA 5A6YA 4TSVA 4GXVL 1OKOA 2AANA 1UWWA 3S0MA 3CFKA 3NK4A 4NT6B 3U36A 3V4PB 5C2BL 4EAEA 2R30A 3FUQA 5GLVA 2FBOJ 2Z4FA 4M7KH 3QZPA 2WABA 2IGFH 5JW4M 4TYSA 1VACA 1JUFB 2LR4A 5I1LB 1C8QA 1N3PA 1W6QA 4FN0A 2VU9A 4TL4A 1JI1A 2XETA 4IETA 1QAWA 1MHEB 5IQ7H 3VKNA 2O72A 1V55C 4G82A 5I8TA 4PN6A 5E8EA 4DKAA 4B5ZA 1KXHA 3GJFB 2EVIA 1SEQH 4F5CE 2A3WA 3FTXA 4X6CA 3U10A 4JZJC 1R5VB 3LH2L 3Q1SL 5KVFE 5A6ZA 4DZBA 3EXJA 3M17A 3DHPA 2O5XL 4YHIA 5GRUL 4L3EB 2RCVA 3LTVA 2P34A 3AMKA 2GUZA 2C3VB 4P4RA 2VQEO 5FYKE 4D0CA 3RTQA 4HKXA 5C09D 4UUJB 4JRXB 3BAIA 4OCRL 4A6YB 4AYFA 2TBVA 4UNTA 3JBG3 2FZ3A 3KLLA 1NCDL 2H2PD 4OFIA 4PW4A 5CU1A 4AGNA 2Y6HA 5C8CC 1JOJA 4I18B 2P1BA 4YX2L 1MG2C 4JNXA 3FOLA 1V6NA 1E4WH 2PR9A 1OL0A 4LO4B 1KT2B 5TDOA 3O3BA 4MB1A 3ZFFC 2HP4A 2VMGA 4P9ML 1GS8A 3LNIA 1W0YT 5E8PA 1BBT1 4G2KA 2IPKA 2JV6A 3SYQA 1SG3A 3JCIA 5FFOA 3GEFA 4JY6B 5F37A 5L2JA 2BSCA 4HZ1A 4S2SA 7PAZA 5J4MA 4BPZA 1SOXA 1CESA 3VQWA 1F86A 1KY7A 4LIQL 4F3FA 5A7BA 4DS0A 3GMRB 1LOAA 4M4RB 3KS0H 1TJXA 1KYFA 1RUJ2 3HS8A 2V5DA 1Q6IA 4A63A 3DJZA 4OHWA 3CHXA 3RYFA 4YFWA 1PGL2 5T3ZE 2WD0A 1NXD1 1EV2E 1BVNP 2JE8A 2WVVB 4NO4A 4KAQL 1BGXH 4KGLA 3E8VA 5FO2A 1R1CA 5EEZA 4YM3A 4AJWA 1JYWA 2LO1A 3AM8A 4FQCH 3L5XH 4G8IA 4HEMA 4HSQA 5D72L 4ZW3A 1IX9A 1PMJX 2ZCZA 2Y26A 1VIWB 4HVOA 2ZOLA 1MNNA 1IBGH 1XGTA 1YY9D 3EYFA 4MMYB 1FCGA 2UYBA 2YAEA 4R2GB 3O1TA 2RQEA 4MD4A 3UJJH 4J4PA 1WN7A 4JZNB 3CRMA 1UXSB 3HBQA 3PGCA 2NMSA 3MIDA 3WKYA 4YIOA 4N2CA 3TTSA 4P5TA 1WIUA 2MOQA 3B56A 2QWNB 2NY5L 3DRQB 2PWGA 3IM1A 1R3IL 1W91A 5D1ZA 4B4PA 1EGJH 5B39A 4OCTA 3IEAA 5KOMC 2VZPA 3KEDA 4JQVA 3AYEA 1VZHA 4Y1AE 3RE0A 1CDHA 2VDRB 4HKXB 2F1EA 3KWWB 1NCRB 5EIBD 1J1OH 4AH2B 4KUZH 1EK3A 1XYPA 3M8LA 2CKNA 3M07A 1WPCA 3D6GA 1CPNA 3ACIA 5E03A 4OQ9A 2C9KA 3KPSE 1RURL 3PRZA 3ACFA 3QBQA 2XTAA 5F6LB 3O1SA 3HUJF 1YC7A 3MLRL 4ZOAA 3H3BC 4DPCX 4UM9B 3LHPH 2O5YL 4GIQA 2NYYD 5GS2H 2WNVB 2A9BA 5FWRA 3NTCL 4MB3A 4D2NA 1I9RL 2Y6TE 1O9WA 3D51A 3CZNA 3P30H 1XNDA 1S7UA 3C8XA 4WM8A 4E8DA 4K7FA 3UFIA 5B7MA 5A3NA 4BXSV 1Y76B 1UD5A 4N7UA 4TUKL 1HHIA 1JNHB 1A9VA 2HKXA 1CAUB 4WSGA 3C12A 1OCWH 4JR9L 5FXZA 4DSYA 1HH6A 4G9FA 2VD7A 3HE7A 4F57L 2XL7A 4WNQA 3T65A 5JA8B 5I82A 1LESA 5LVEA 1A7QH 3IFPB 4GAYB 5AW7B 4UT9H 2MQCA 1GC1L 2VNRA 4KV5E 1GMEA 4GIOA 4QEGA 1S2BA 5C0NC 1E8YA 1KB5L 4FMVA 3J80N 2CHWA 4CMHB 1YPZE 3ILQD 1DDHB 5HYEA 4HPKB 1GCYA 3E6FA 1V9U1 1OAZH 2RJMA 4WFFE 4Q4EA 2ITEA 1F35A 1CIUA 3U36B 5FZOA 2A2QT 2X4PA 3POGA 2P90A 1AC6A 1WCBB 3BKMH 3TV8A 1WJZA 1Z3RA 3FQUB 5I1CH 2V72A 5CKQA 1XGRB 5BJTA 5LB6A 3CLFH 4N2OA 1NU1H 1WEJL 1IM9B 1H2SB 3CRCA 4X4ME 2BINA 1YEKH 4JE0A 2BP0A 1ASJ3 1J1XL 1JNHA 1HHIB 1DQKA 1KTDA 3ARYA 3ENEA 4MGTA 3OB0H 5DHVH 3B9KC 4HWZA 2I27N 4S1RL 2ZOKA 3UL4A 2UXCO 1L7IH 3VA2C 2RG4A 3PUIA 5DUXA 5LJYH 1A9EA 1JD7A 2IAMB 2X6BA 4LARL 3K59A 2YB7A 3LEMA 3AB0C 1IKOP 3ML8A 1IARB 5SX4I 2FIRT 3ASIA 4UIMA 5C0CB 4TNWF 4QKTA 5DR5L 1J9SA 3SGDI 2C7FA 3VFUB 1DGRA 3FU9A 5FZ9A 4V1DA 5FP3A 2IIJA 1MW2A 3VWKB 1NBZB 2BNQA 1CGTA 3UTSB 4ZFOA 5K9OB 2KB1A 5EU3A 1C9SA 1UIKA 1WLDA 4WEBL 2VOVA 4RMTA 4N8MA 4F4LA 1CLOL 1GJUA 1BCIA 4XPHH 2W08A 1EVUA 2X38A 1SFYA 5KC6A 5KVDH 5H8DA 4MTGA 5FYHA 1KPUB 2R2BA 2XZAL 4PJ9D 5FDBA 4QHKI 1SJMA 3DV4B 3CXCU 3VBSC 3T8XA 2ZQKA 2DWRA 3OE7G 1VMGA 5C8WA 1G6VK 2BSRB 5DMJB 4NQDD 4CGUB 1AYM3 2JELL 3OBAA 4N0UA 1BYHA 1IAMA 1YQ8A 3TN92 2ZONA 5C6WH 4FLVA 3BT2L 1SPDA 1XCQB 4HAGA 5GQBA 5BZDB 1NC4A 4EZHA 1D5NA 4YLQT 1XSKA 4LQFL 2Z2SB 4O2AB 4DR6B 3CJIA 3POSA 5A7WB 4JFED 2NZ1A 2CDEB 3QEQB 3WTTA 3QZLA 3KCCA 4NUPA 4N43A 5CEHA 1MEXL 1N10A 3G5VA 1G0XA 1WLTA 2DUPA 3NZSA 6TAAA 4DXRA 3K5LA 4GS7C 4I0PD 4B3NA 3S96B 2WB1A 2D73A 1TEGA 4QRPE 5AOIA 1KLFA 1OY3B 1S7VB 3MV9A 1F4XL 1ZL8B 4JO8A 4X6BA 2Q7YB 2XX0A 5T33H 1RUH3 2PLV2 4DQOL 3UTTA 1UYPA 3QJUB 3IF1A 5IBUB 4WVMA 4E4HA 1W6NB 3EYOB 1RPRA 1BBJB 3OJVC 4LL1A 2VE6B 1VENA 1AKPA 1QHDA 1UB5B 3ZMTA 35C8H 3GK8H 3RQ3A 4OD3H 2BJSA 4L1LA 3QI9D 4NWTH 1IGIL 3VGGA 3SY6A 5BXXA 4GKJB 1VQ7V 1MZZA 4F9PA 4U33A 4XPAH 4KKRA 3MHZA 5AKTA 5AVWB 2HRLA 4GAJL 2C1FA 2X4QB 3FRPA 5T1KA 3ZIWA 2BS71 5CEZD 5IT9N 1GYAA 3TYGL 1Z3GL 4I3SH 2OPCA 3USSA 1A22B 4OCSL 3VXQA 5ACA2 3QEGH 3AG2C 3IU4L 4R5TA 5I66B 4LJHA 1CFNA 3WTVA 3L3KB 2BDRA 2W68A 4YJ3B 2GT9A 3ARBB 4RAVA 5LEJA 4DEWA 1DBAL 5BUVA 1JPTL 5EU4A 2OYLA 2VXSH 3N43F 5E51A 4Z7UB 4XN1A 4RMRA 3OR7B 4XBLA 3BIEA 3KEHA 4L23A 3DPRB 2BZDA 3ARDA 2GJRA 4PRNA 2XJSA 4DKFH 1U8LB 4LC1A 4XVJL 4NUGH 4YLZA 3I2JA 4NKQB 4TQFA 1NANH 3PP4L 3J4UH 1FL6B 2WMPA 1FL6A 5F7WC 3QHZL 4YVWB 2UU8A 5I6OA 1RUD2 1XBLA 3QEHA 4RZCB 2HWZL 4XNZC 5C6CA 43C9B 4FFGA 2QTEA 3HR0A 1MFDL 4PWIA 3QZWG 2BIOA 4RWHA 4YSAA 5D5QA 4RX4D 1DF4A 1MI5A 3NACH 3REVA 1QTYT 5IEKB 2HKHL 4PRHD 4AFAA 2RJ2A 3FU7B 5ACZA 1GNZA 4OCSH 4AYGA 2BIHA 2DYSC 4IYHA 1QRNE 4B3RB 1SLVA 2G3ZA 3QQXA 2Q6WA 3X17A 4J2XA 1W0WA 1W99A 4Q4X2 4WBBA 3GS4A 3S35H 1I85C 2X5IB 2MFNA 1UWYA 3IDCB 4X6EB 5CP3A 1MFEL 1S5IH 2NQCA 2VXSL 2WNKA 3PL6C 1AO7E 5FK9A 4MJHA 3L4WA 3MV8A 5IUSA 5GZOD 4URTB 2E47A 3RPBA 4BISA 4XPBL 3DI2B 3NFSH 2IANE 3QIWB 3TC9A 4B9GA 2BEOA 2Y4SA 4BU2A 4OZ4B 1KY6A 5G2NA 1A2YB 2W88A 4NJ4A 1PVC3 1DJSA 4XNYL 1K7DA 4XN7A 3FSVA 2YA1A 3QHZH 2H1PH 1JIBA 4I4TA 1JYNA 1H6TA 5JPNC 2EDTA 3GF6A 4BQWA 1FG2A 4KVCL 4NBYB 1C5DA 2EDHA 3UJTH 1A6TB 4HIJA 3PAUA 1MCDA 2YWZA 1RUG3 2YC0A 1CZTA 5IJ0B 4TUYB 4YXWG 1W8EA 1F11A 3F7KA 3JV4B 2LLGA 3TK1A 2WTRB 2H3NA 5C3IA 3B5LB 4AGQA 3OM3B 4DO2A 1ZANH 1SNRA 3ESNA 4CRPA 3U4EB 5K0UC 4MA8H 1HH9B 3VXMA 3KG5A 4R4ZA 1XFPA 4PJAF 5IIEA 3HG0A 4HPYL 4JANA 3U6RA 2W07A 2W5FA 4XFFA 4HIXH 3EF4A 4J7KA 4EZKA 4Y4KB 4ODSH 3LSSA 3MRDA 3SPHA 4LLVB 4A6SA 3KPRD 3VCLB 2ZX7A 2ZD9A 3GIVA 2VCOA 5E1AA 1I3HA 5EULV 5D5PA 3GSUA 5TH2A 4Z3FA 5TH2B 3FRUA 4ZS7L 5I0SA 3AK1A 1A6VL 2BS9A 1H9PA 3D3VA 4NPYA 1K42A 3FB6A 4MGKE 3DYPA 1SJHB 4HFWB 4N0UE 2EH8L 4NQCD 1FZMB 4BB3A 3IMNA 2OA2A 1SQVH 4LRIA 3H8XA 4JDTL 1AL22 5I26A 5LRRA 5AOZA 2LW1A 5C33A 2IJJA 1IPSA 4MZIA 2E7AA 3QZWB 2ROXA 4B3TB 1C5CH 3O3EA 4RRPG 4CU8A 3K9AA 1LENA 2BMKB 5CN2A 1WKYA 2E7QA 3GI9H 1N1YA 4FC3E 2B59A 2WBKA 2XNAA 2VOKA 5DJZB 4UVCA 3VFGH 4LASH 1GZ9A 1DYZA 1LE5B 4R83A 3RVVD 5KZCB 1JXGA 4U1IB 1QKQA 2VLRE 5EC1C 3GWJA 1D2QA 2P24B 1Z7S1 4QX0A 2OCCC 3NSXA 3QEUB 5DLMH 1CD1A 4G9SB 1YJDH 2BFGA 4BSVB 1HJBC 4ABVA 4X8JB 2ZM6B 2GIYA 4HUWA 1X5FA 3IDJA 4I4TB 2E76C 5D7LD 1S9YB 1OPGL 3TBYA 1FIGH 3VD3A 4PDWB 5A6LA 1AGEA 1F5WA 3MV11 5JI9A 3RGBA 1CBJA 4W6XA 5KHHA 2QSQA 4QHZA 4OXSA 1U4EA 3UGFA 5IK5A 1ZWIB 2UYLA 3AS2A 1KPVA 1BECA 3KR3H 3KYKL 4PTUA 4QRRD 3HBZA 2EVGA 2VN3A 1GCFA 1DQ1A 1N1SA 4QOKB 3VD4A 3MIFA 4AQ1A 1H8OA 1L9MA 3NIGF 3ROOA 3DRTB 3CGTA 4Q9QL 2FCTA 2GNTA 2XQRA 3ZYJB 2FYYB 2E9QA 4DOUA 1NGWA 4XXCA 4J7JA 1WZ1L 2E0PA 3QUMB 5EEYA 3H7JA 1QEXA 4QR7A 4MLSA 5FZGA 2B14A 5D2LB 5DJ6B 2J5WA 1M1XA 1SFNA 4WU7B 1J83A 2F0CA 2F7OA 2AEPL 4UIKL 1UY4A 4NN5C 1FNYA 3BEHA 5FYBA 2JVDA 5C93A 1PAMA 1JNNL 2D03L 1TFPA 3F58L 4ZS2A 2UXVA 1OHHG 3K03A 3VGAC 4DAGL 3DMMC 3DPRA 1M5IA 3LXUX 4LSUL 3O12A 4U6HA 5D7KD 3E1ZA 2GK2A 5HP5A 1MF2L 1AVMA 4QO1A 3O4LD 3MYJB 3FAVB 1YNLH 5AL8A 2EILC 5IHBA 4QPGC 1ETZA 3IGAB 2VSKB 3RX8A 4FFFA 1EMTL 3EYQC 2EIGA 3K6IA 3VBOC 4JPKH 2I2SA 5B1AC 5F7DA 5I1JH 4YJ3A 1KG0B 1TETL 1TG8A 1U9KA 3SDXA 4A7SA 1YDXA 3BESR 2JGDB 3BRDA 5ACZB 3INAA 2FGWH 1L6XA 5DRWB 5CG8A 3L7EB 1EZSA 1F02I 3MN8A 3RPQA 1ZHKA 2ARJA 1I3GL 5HJ3A 5HJ3B 1I8KB 2FJGB 2Y38A 4DNLA 5BQ7A 4K2UL 4ARYA 4TN7A 2VDPH 4JASA 3IDJB 3V7AG 3TTYA 1T5WB 2QKSA 2CM5A 4RVBA 3DXUA 3MRHA 4Y1AA 1YEFH 2ZAGA 2BXYA 4UYQA 4B7LA 3OJBA 4JTAB 4N8VG 1HNWO 3BIAX 2HWC2 1S0VA 4NM8L 1WCSA 5C3OA 3NJLA 4OGQC 5JOZA 2I7OA 1F56A 5DHYA 3T6ZA 5FLHA 1K45A 3V0AA 2DDQL 4U4IA 1NGXB 3CFJB 4GKOA 1Z0HA 1J5CA 2F8IA 5KXEA 3BMWA 1S9XA 3LDBB 5EIIB 2OCHA 4UB0L 5L9VA 3ARGB 2ZEXA 2HVJC 2IBZH 2X0WA 3G5VB 3TCTA 2QUOA 2NNFA 4IBWA 5FZCA 4YGAB 5BNOC 1TMCB 5D5MB 4P9GA 1RVF3 4WI5A 5EP9A 3WY2A 3ARGD 4PJXB 3RBGA 5IV2B 2C9PA 5DWUL 2YXSA 4I9WE 4HKLA 3L3HB 5IMKA 4YR6A 4F8AA 3QZBA 2Z7YA 4HXAH 4CDWA 2ZUUA 4WFHE 1N59A 4TS6A 3T8XB 4GRWF 4GAGH 2X7LB 3W9DB 2ZCEA 5I0XA 4E41E 2WLHA 1JHTA 4CMMA 1XH0A 2X2JA 4S0HA 2VY0A 4HZ3A 3VBHB 5C97A 2JECA 2P5OA 4D9RE 4KJQD 5FW7A 3TNMA 2OWOA 1T5KA 4O2CA 4YLCA 5T5FL 4H44C 1WD3A 2DQGL 4NPMA 1NAEA 4NRZA 3ZTEA 1HZHL 3I2CH 1W8ZA 1F5JA 4TLTA 4B4QA 1UACH 4DR1B 2JI1A 1KGUA 3K71A 4G80B 3U2JA 1QBZA 4CCJA 4JRYA 4P5YA 1NY71 4HZFA 3D39E 5BVJA 2YMZA 4QYOA 3WHE0 1IAKA 2GSGB 5F7KC 2W59A 3BDYH 3LN4B 5FKPB 5E23A 1XSIA 4OVEA 1S8DA 4DV7O 1J0HA 3SDYL 4M56A 4A42A 4XHBA 3K8KA 4R2GD 2WGNB 1EN4A 3AREC 2PPAA 4UF0B 2D4DA 3ZSTA 1MS8A 1O3RA 2TAAA 1D7BA 1QASA 4Z7WE 3SO5A 3DOSB 1VFMA 4OTXH 2UY7B 3GPSA 4BUHA 1FOD3 3U0WH 4TVPH 3EXUA 4JDMA 3GCWA 1ULEA 5A9GA 1OARH 4HXBH 4NQSB 4QI3A 5EBWA 4NYLB 4B9PA 3J7NA 2AJUH 2NQYA 4F33A 4K8RB 5E2UH 3ZSJA 1RU9L 4WSKA 3RYIA 5E8NB 3K6FA 2NX5D 1AS8A 4WW2A 3BVOA 4NB5A 5ITZB 1EBPA 2BVQB 3IKKA 4P23C 5AZ2H 4MGQA 3PIQA 4W6YA 2PQSA 1GOFA 3ULVL 5KSAD 4HV8A 3RGVA 4NN6B 4PJ7B 3ZPYA 1YJLA 3MNZB 1VZGA 2F5AL 3WB1A 4N7IA 1JGLL 3PUCA 3QJFA 3DXRB 3AJ7A 3ZGIA 4EBQL 2H0FA 3ARUA 1PL4A 1WO2A 1SZBA 1NBMG 2YG0A 2QTVA 3ZIMA 4Q0QA 5CJQH 2OR9L 4L48A 3Q5OA 4G1MA 5IT2L 4I3PA 3VBRA 4PDLA 3H0OA 5IQ9A 4XMKH 3GSNL 4ZUUB 2P06A 2P22C 3V7MA 1RJ8A 2KZBA 1JUIA 3Q6FA 5CBGA 4PBWD 5DXDA 2CA3A 2C1PA 2ZPKH 4KMTL 4NP4L 4OTXL 5D5MF 1W3VA 4X1IA 1RUF3 3CJXA 3HR9A 1GPOH 3MCKA 1VQLV 1U8PA 2GSMB 4HIHB 4G3YC 4QWWC 1YZZA 2JCCE 4F24A 4F58H 3LMJL 3P73B 2D93A 1YI9A 4YVSA 1MHHA 1F90H 1NCTA 4JDZB 4N0FB 1W8UA 4FSJA 1MZEA 4XOCA 3UNPA 4PWHA 4XBEH 5BVJB 2ZJSH 1U3JA 5L0QB 5LGHL 3WTUA 1XNCA 1I1CA 3MV01 2PMWB 4JL1A 3VFMA 3FTYA 3VFSB 1GZQA 4D3CL 4JFVA 2VDPB 2Y6JA 3N35A 1N33B 3SDAD 4BWWA 4F7EA 4E2QA 3QNYA 4WW1A 2QHLA 4PJIF 1HL8A 4NQVB 5J09A 1OQ1A 5T1LA 4MMZB 4X9HA 2NXYD 3Q06A 5A7EA 3WLBA 4DV5O 5CISA 3QUZA 3FFOA 4ODBD 3TYFB 3PUAA 4QPKA 2IXQA 2PHDA 3R6SA 4CU9A 3BEVA 3PCYA 2Q8VA 5TE4H 5ENWA 3H9HA 4XO8A 5B39B 4CDHA 3UGEA 3O1VA 4R0LB 3QISA 1OARL 3TF4A 3V4UL 4E0RA 2PP9A 3SJBC 5DT1H 5IWFA 4JVPA 2G3MA 1MHPH 1UXMA 3BHPA 2Z65C 3BE1H 1ZBA1 1OBNA 1W72H 3USUB 3OGOE 5AZ2L 3SKNA 1XTMA 2I9LA 2QHRH 3O3UN 5KSUA 3NJZA 3GB7A 2Y7SA 4Z6AT 1EO8H 4HHWA 3WBDA 4UM9A 5KBMA 2GH2A 2JB6A 2AQ2A 1RUAL 2QZQA 3NZHL 2EE0A 3GRBA 1FV2A 4FZ8H 1GWKA 1CXIA 1Z9OA 1YN6B 3B4NA 5JMCA 4DK5A 4FLRA 4NUMA 2IV9A 3G5XA 5EBGA 2HPTA 5IFHL 3W37A 1BFVH 4LCUA 2WWOA 4TM9A 2OAAA 1IBLO 4JPVH 2QR0B 5L73A 1KZYA 4S2SB 4WQOA 3CPLA 3PP4H 1E6OH 3K2UL 3R4DA 4CAGA 1S0FA 4XEZA 4HCRL 2X4NB 5EEXA 1X9UA 4XE0A 1RGSA 5IHLB 4AV4A 3TN91 5BO1L 5I1GH 1VBD2 2GDFA 4W9EC 3UIYA 2FDHA 1JN2P 1PMYA 4PJBF 3OD0A 5IROA 1YTFD 1GGTA 1CLCA 2YDEA 1MLBA 3GBDA 4QHLB 2XUWA 3AYAA 3GRWA 5I6PA