4PHZA

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
388
structure length
388
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords unknown peptide
total genus 94
structure length 388
sequence length 388
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4phzA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4phzA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4phzA01
3RFRA 1YEWA 3RGBA 4PI0A 4PHZA 4PI2A 4O65A 3CHXA
chains in the Genus database with same CATH superfamily
1F58L 1VEOA 4FNQA 5IYZA 6PAZA 2UXBB 4G8FB 2A6JB 4IGBD 4DGVH 5C92A 3GIVA 3FU9A 5EF3A 1IM9D 4F9LC 5KXCA 1Q9WB 4R5VA 1UX7A 5E6SB 5IVZA 2FBOJ 2Y06L 3HE6D 4YDMA 2DYPB 5E7FA 2PTTB 3W2DH 4PGDB 2GJZB 1PZ2A 2P3YA 5DS2A 5FPBA 3L1OH 3CHOA 3L4XA 1DO5A 1MHCA 3C8DA 3DTXA 1SC5B 3ZKND 4BFOA 4BQ6A 3M7OA 4AL8L 1FYUA 3LEVH 3L72H 2BNRE 1DQDL 4D8PB 4WF9V 3MJ9H 3TXSA 3LX9A 5B7MA 2Q5BA 1WMDA 2Z65C 1NL0H 1S3RA 3BQUD 12E8L 25C8L 4X64O 1IBHA 1S4IA 2UY7A 2MCMA 2BFUS 1YPZB 3HQRA 3VXUB 1GKEA 4Q2ZB 1GKBA 4OZHE 4Z8BA 2DMHA 1SKVA 1VLNA 3C6EA 2BNRD 4Q8LA 1AYOA 1OP3K 4J3UA 3U7YH 3RL1A 1P5VB 2CRZA 5CADA 4WUKL 3STLC 1NIEA 5T1LD 3P77A 4PCKA 1GJUA 3WIAA 1HH9B 1X5MA 4U3JA 1EZVX 4LLQB 4ACPA 1S9XA 1CVRA 3CXHK 1S7TA 4HIIA 4K7PX 1A3QA 4R2GB 4Y33A 2FCUA 1AYN1 2CMRL 1P4RA 5E8PA 1TUBB 2PP7A 1OFNA 1UEYA 2AJYL 2QVTA 4PJDE 3IFOA 1UY2A 4JHTA 1BEV1 2QDOA 3FLPA 5F39A 4E41A 5CU9A 3FT4B 2LO1A 1LECA 5K9OA 2G1MA 3T8VA 5FO7A 4FTBA 3OKEB 5CLTA 5CCKH 2YEVA 1JZ3A 4K94H 4KK5D 5JJEB 1L5GB 3AJZA 3OJVC 5A43C 1AR73 1BD2E 1MSDA 1MCIA 1IAOB 4LFHD 5HDWA 4QXBA 3FFCA 5HJ3B 5CBGA 3GK8L 5CUSL 2R9RB 3RYHA 4GSQA 1RPOA 2GY7B 4ODSH 3S3DB 2VOKA 3BRCA 3HHMA 3QUGA 2BJSA 2D3OW 1SVCP 3N5AA 4AYFA 3ZMNA 3VJ6A 3SJCC 2NXZB 3ZN4A 1ZA6A 3O2VL 4MLIA 4KZCA 3CV5A 4Y22B 4I9WA 5ICZB 3UGFA 1F3DH 3NW4A 4MVBD 4MXVE 5BRQA 4MTXA 5EU3B 3QDMA 1ZLZA 4M61A 4ZD3L 3WENA 5J9PA 5L36A 4ZHNA 1SCSA 1RL3A 4PEEA 1OI6A 5LWBA 3WLWC 1MIEH 5J98B 1AHWC 4PS3A 1NCQB 2R062 1NIAA 2ARJB 1MKFA 2ZP9A 4FLTA 4LF6O 1KTDA 3A47A 3NN8B 1OVPA 2XJQA 3O0XA 4AQ2A 4QM8A 3VXPB 2PCPB 2YXHA 3VYOA 5JZ7C 1S8DB 3A21A 3TN0A 1XF3A 4MNHB 1MZYA 1AGCA 1LO2H 3LQZA 1ZLVH 4LRIA 3M45A 2H7WA 1WA8A 4Q8KA 5FBZA 2OKMA 1MHEB 2GC1A 3BEWA 1AZDA 1XNDA 4CVWA 4TM9A 4J7KA 5FLUA 3QIWB 5I9QB 4S2FA 4F9LA 3ARPA 1ZHBB 4L05A 3W39A 3HBQA 4XH2B 2H0BA 4XHQA 5FLVA 5F1OB 1DQMH 2Z79A 3IFLL 3G04B 4DO5A 4XHJD 1IVTA 1O3RA 2GC2A 2DWEC 3ILDA 3QUYC 3QDJB 5TJWK 1C8M3 1S55A 2FBJL 4P5KB 3GS7A 2Q3XA 4ZJ9A 3RBGA 5IR1A 2F4LA 3V0BB 4NP9A 1IM3B 1I9EA 1U92B 1VACA 2LHAA 4AGQA 2SLIA 1NEPA 3O11B 3V52L 1EO5A 1MJ7L 2Y23A 4Y2DA 1LGCA 3TBDA 3V4UH 3G08B 5E2TH 4BRVA 4F37K 5JLZB 2KLSA 3U07A 4W9JC 4QOKE 4GMTH 3JZYA 2DYSB 5DUBA 4DZBB 5DHYA 2J56A 1KMIZ 1RC6A 3LEKA 4OI9A 3OD3A 3U2SA 4EF3A 3QTCA 5AVTB 3CQFA 3CBNA 2CA4A 3LH9A 3G6JA 5EBMC 4YGEA 5LBQA 1M05B 4NOFA 3U0PA 2EXJA 1LO3H 5EOQL 1F4WL 4P23B 3OVUB 4XF9A 4G7SB 2ZX8A 4XNYH 5JSPA 1O0VA 3WLBA 4PI0A 4D3WA 3FTSA 5I0XA 4U3XA 5AZEL 3U37A 2Z0AA 5MI0B 1UOKA 2YSSB 4G9FE 5EEWA 3NL1A 1XTLA 5ADOH 4L8SC 1KULA 5B4MC 2CRMA 2P7TC 3PXHA 3C09C 1S9WB 3GMMA 5ALCL 3V0VA 3IGKA 4NSKA 4FA8A 1HDJA 2AMGA 3KVPA 3ROLA 1A1MB 5D7LA 2GUOA 3UTTD 3ECBA 3I2DA 4PGBB 1UPIA 3VD2A 4PG2A 2GC3A 4LLFA 1KY6A 4X66O 4GXUN 2LM3A 2Z8SA 1EDQA 2VCAA 4M5YH 4AK1A 3K5OA 1RIVL 3LZLA 3MNZB 3LOBA 4MFHA 3IDYC 4QTHB 1PP9H 2I07A 4I4TA 2G9KA 1IMHC 3MGOB 4BCYA 1IG0A 4NO4A 3WXPA 1MCPH 4XTRD 1BG1A 4PJBF 1MCNA 2DLGA 3HNYM 2EE9A 3LHPL 1KXGA 3NIDF 5FYKH 1P49A 5IMKB 3E8FA 4X6CF 4KZEL 1LXMA 2FSDA 2WUBH 3Q8AA 1C8M1 4JTCB 1EZLA 4OCSH 4YPGB 4WU7A 4MVZA 4LBAA 3H50A 4MJIA 2GB2A 4NRMA 2YA2A 4BIOA 4LKCB 1KPUA 5C0DB 2OCJA 3JWOH 5JW3L 1UWEL 1H4HA 3AQZA 4M3CB 4BPZA 1ET8A 5FPOA 3CCQV 3AWEA 3N9QA 1N8RW 1QSED 2ZZUT 2ZA9A 1OZUA 2VMJA 2ARWA 3KMDA 4IS6A 2QFEA 4I1PA 1MVYA 4WSKA 5DZEA 5GHWL 4CW1A 2X29A 4JRWA 1J86A 4XVOA 4F8OA 3TZVD 2FEJA 2QDNA 3L9DA 1JHLL 4PV9B 2CTPA 4XP1L 4LK4A 2IGLA 3S97C 4AMWA 3C5JB 3FSVA 3DVGA 3CN3A 4G6KL 2AXJA 1E3ZA 1PD1A 2X42A 3BPOB 1HZKA 4L29A 1MQKH 5EN2A 3LKQA 1X33A 1LULA 2R4RL 4DUZB 5CBLA 1E4WH 4MHHG 4UILH 5CMUA 1MF2L 4F2FA 2CGOA 4PJ9B 2VVEA 1XB3A 4QHOA 1KJ2H 5DK0B 1FS0G 4UTBA 2ICEA 4YJ3B 1NAKH 4TV9B 2H0JA 2NQDA 3QR2A 3L3OB 4L48A 4PRAB 5E95B 4OCYH 3BKJL 2G3ZA 4NQEE 4BHUI 4R83A 3NBNA 2OX0A 2YXSA 2X2YA 3HS0A 1GYUA 3PDGA 3R4SA 2BOBC 1TZHB 2FVNA 5EJ3A 1M9WA 4RA0A 4C55A 4JRXD 2VE1A 3ZN6B 3C60D 1JW6A 5A9GA 3JD3A 1J1PL 1P4UA 2DIAA 4TNWF 4HUWB 4BDVB 1C3HA 3B2UC 4X7SH 3RGVB 2ROYA 2CXGA 1VAVA 1I5XA 5L3FA 5IB2B 1H6TA 5T1MB 1Q7YW 1I7TA 1MELA 2XQBL 3E8UL 3W0WA 4HUVA 3UJJH 1DZRA 1UY3A 2HEPA 2XACC 3BEHA 1OD7A 2VC2B 5L88H 3MLJA 3HQXA 2XR4A 1PZ5A 1U8LB 2A9NH 4N43A 2GJ6A 1PY4A 1T21A 2GUZB 4WFFE 1A64A 3NCMA 5B3JF 3F01A 1SJVA 1ZSDA 3I50L 1HSAA 4B9IA 4A6OA 3ESMA 3OGGA 4NPRA 2VOTA 2J8UF 3LRSA 2J44A 4NNPL 1RZJL 4P99A 4UQCA 3DARA 1XGQA 4HJGA 2ZAIA 2IBZX 3B7SA 3MRRA 4GRWB 3LQAL 4MJIE 3FB5C 2BPBA 5I5IA 5KA5A 3UESA 2JIZG 3ZL2A 2R23A 2UY6A 3NJJA 4JRYB 1KTLB 4ZX3A 1CDCA 4PSRA 3FSWA 3SCGA 3SCMD 5I73C 1HHIA 4D9QE 3H3UA 5JDJA 4MJ5A 3D07A 3BEVB 5FLXN 1D9KC 2PWDA 3B9AA 5GRJL 5D72L 5KYXB 4Q1RA 4QY8B 3O3DB 3CVHA 4L3CA 1XGYH 1XZWA 2VLRD 1UWFA 4X6DA 5FHAH 5I6LA 2A1XA 3MFFA 5I8EB 3MRHB 2YJQA 4WBNB 4M7LT 2OL3H 4U6XB 3VCLA 3ZBMA 1J83A 5HXVA 3I3BA 2PUSA 4HT1L 4HP5A 4JRLA 4K94C 3TEUA 5C0JB 3OYWA 1DF0A 4YLZA 1R6NA 1QVGU 3EJZD 4FOQA 3V0AA 3GZOA 4XXCA 5FW6A 4ZFGH 1TEFA 3A67L 4JV5O 1U8JB 2JB5H 1UJTA 3MV11 2GBUA 4PJAB 4FP2A 1CC3A 2ED8A 3LMJH 4HOWA 4XBGA 1ZZBA 3AP6A 4X62B 2JGDB 4HUXA 2Y0IA 4ANVA 1CL7I 4W1TA 4YY3O 4H20L 3UYOD 2V9TA 3L16A 5JVVA 5CG8A 3KYKL 1BBDH 3O9WD 1U5YA 1MLCA 2DMKA 3EDFA 1W6QB 4Q4X3 4FZ1A 3N40P 4YNYB 5HYSG 5JHLA 4CUBA 4D69A 2BNOA 3QACA 2WFF1 1WSST 5CN1A 1NM4A 3P2BA 3B69A 1Z2GA 4DEUA 5SX5K 2V5DA 3AB0A 3NJVA 1BEYL 1CXKA 2BCKA 4M1CC 4GUQA 3CD4A 3EZ8A 1UWXK 5EU7E 4AL8H 2RQ6A 4LCWB 4Q97A 1W9FA 3GNMH 2FBEA 4OLLA 3T3YA 5JA9A 2VNVA 2X89D 3RVTD 3KE0A 2OYZA 1OK0A 3HAGA 1K8AW 2YWYA 4HBQA 4KROC 2WBJA 5JCOA 4KHPB 1WMFA 4HHGA 3QUHA 4JTAB 1MFCH 4HOMA 5BOPA 2XLLA 3ZTDC 4XFGA 1YI2V 1ND2A 2Q20A 5AYQA 1RVFH 4MSWA 1PTZA 3BAWA 3CNAA 5FPUA 4JAMB 5IZ7A 5IB4A 3IDUA 1KBHA 3ZKMD 2BSCA 1X5HA 2JJ6A 4QXGL 4RRPM 3H7LA 3P9WB 5DMIH 3IJ8A 3ZZQA 5J2TA 3TYJA 3SDAB 1UD2A 4D0BB 5GZEA 3GSWB 1GS6X 2QVKA 4Y4HB 1ZYBA 1TNMA 3WIHA 2UUAO 1RZKH 4IKJA 3WDIA 1TQCB 1HE8A 1JRHH 3AT0A 4WLCA 3VQMA 2VZ1A 3WEXB 2GNBA 3H1YA 2JKIS 1PD3A 3H8NA 3NACH 1AXSA 5JZ7D 3C6SB 1HB3A 4Q58C 4L99A 1S0FA 2Z4QA 4N2FA 2EH8L 3VXUD 4PF5A 2RS31 1DJIA 4PG9A 5IFAL 2LGWA 1DU3D 4NQDD 4OVUA 2CGZA 3UL2A 1S0EA 1SQPH 4P02B 2C3HA 3MRGB 3WY2A 3KMHA 1LWHA 1RU9H 2CKBH 4JFUA 3D0LB 3C8XA 3F12B 3BC9A 3D69B 4Z76B 4GKNA 1PZUB 2SBAA 5I1GL 3WDJA 2JIXD 4QD2A 4QE7A 2XIIA 1JPXA 5I1LA 2Y0SA 1ETA1 3HPLA 3L5IA 3MV7E 3KPOA 4H8WL 1T22A 3D1MC 3D6GA 2WXLA 2EXYD 3EYFB 3THCA 4QHLB 1X5JA 4HBCH 4IRZL 5KSBB 5I8KL 5D1QC 4HXBH 3SDXA 1VBA2 3I2CL 4KV5F 2ZSVA 3TYFB 5FPZA 2OMXB 1VEWA 1KBBA 3LQMA 2BVOA 1F4HA 4MQ7A 2GN7A 4UTAH 3QR1A 4L8QA 1J9CT 2ZXBA 3FJSA 2HLDG 4RGOH 5E2UL 1D5NA 1IT9H 5F7MC 3SBPA 5DPNA 1NX9A 3CZUA 1SDAB 1ASJ1 3DIFA 4KK8C 1LENA 2IXLA 2PNDA 1EMTH 2E4FA 2VXQA 2ZG1A 1DFXA 4FMKA 4TUKL 2WZPD 5JOPE 4MCZA 3K9SA 2GK0A 3IXAB 2A9NL 2ZGPA 2UV3A 3S8GB 4OI1A 3V0JA 1UAIA 2BTQB 4OB5L 5DEJA 1LU2A 1W0JG 2PGGA 5JHAA 2PETA 4KO5A 4WVWA 3RFRA 2X4QA 1JNHB 4XBEL 2PP8A 4YBQD 2CIKA 4GIAA 1KGUA 4P5RA 5CSZA 1GSLA 3FQXB 4CN6A 4NPJA 1Q82W 3MV01 3HNTH 5LRRA 3U2JA 3KKYA 5LASA 2HUHA 4LO7A 1W6WA 1S5HB 1HL4A 2A7WA 1MAKA 4OMDA 3QEQE 4BZ2A 1HHKA 2Y2WA 4UU9B 2ZWZA 4EUPB 4BWTA 4QRSB 1KN2H 3GRWL 1A3LL 5F8QC 3LEGA 3O14A 5C3SA 4FTVB 1SLCA 1UIJA 3LB6D 3B5HA 4IYHA 3TH3T 3LDCA 1CK0L 2ZEYA 3EO0B 5A3NA 1V5JA 4UT6A 3VH8A 3ZHDA 2W3JA 2R4SL 4QT5B 2R2BB 1B90A 2O8OA 2XHBA 1VHPA 2FSEB 1QP1A 2XOKG 2ITDA 2ALAA 3C5SA 3CWGA 4UTBH 2OPCA 3ILQD 1U8QB 5EO0B 3K74B 2IQAB 4GG6F 5DRZA 2KT6A 4QXTA 4KPHH 3OZ9H 5EU4A 3ES1A 2XKOA 1GGBL 4GJZA 1LDPL 4HEPA 3W81A 4Z23A 2I7OA 4K5OA 5E8DL 4E9RA 3HI6H 4IEZA 2ID5A 2DQDH 3FF7A 5ICYA 3S9DB 5FZ3A 4TQEH 5G5DA 5BS0A 5IW6B 4OT1H 4N1EA 4CNIB 1KLUB 3N3HA 1TMQA 1DCSA 3RTQB 3F7YC 4OZHF 4P8QA 2EULA 2VMIA 3T4AA 4QXKA 4OF6A 5CG9A 4P04A 1BOGA 1BBT3 1SOSA 1UMZA 1WK0A 4N0CD 5E00A 1AP5A 1UCXA 2A1WH 4JI1O 4U1KA 3MR9A 1B35C 4AW7A 4F93B 5J57B 5SX5H 5DSCA 3VTAA 2V8MA 1F86A 3JUYA 4JW3A 3B8NA 2CJSA 4HJTA 4K2UL 5BJTB 3UT5A 1JYTA 2RMNA 3GNML 2TUNA 2ENQA 3V64A 3U83A 4PJCB 4QNPE 1NZCA 1KD1W 5DJ0B 1Z7S2 4FZ8H 3QUXD 4FQIL 5MHSD 2R6QA 1NWPA 2XTLA 5CKGA 4NAOA 1OGAE 3EO9L 2HJDA 1IPKA 3FB8B 4AT6B 5DD3H 3ZKNC 2WNUA 2WS92 5FZKA 1IAII 4AVSA 1HQRB 3CQQA 4TWTA 3W3BA 3T4VA 2XJLA 5F6HI 3SQOA 4JG9A 5FYJE 3KVBA 2ILMA 1GC1C 2R15A 1GZCA 4HZ1A 1K34A 4QHNA 3NMEA 5I1CH 1BJQA 4JDTH 3CN4A 1LO3L 4XGZA 1LEGA 2VERA 5CAYB 1MRCH 3J8F3 3OSVA 1CIDA 4Z7OE 1RKRA 2ZOWA 4LF4B 5J4MA 3NQHA 5AB0A 2YIBA 4LWSB 1GW6A 4CRQA 4NM8H 1PIV3 4Y5YB 3POEA 3KCXA 4BQYA 2BIMA 5FZ1A 1SF3A 2BERA 4N8VB 1KYAA 1F13A 1WA6X 3PGFH 1RUOA 1COWG 3RAJH 4BFFA 1ZVFA 3PQYA 1UGNA 2PR4L 4KKBD 4P2QB 5IW3A 3VG0H 3WHE1 3GZPA 5FCUH 3EJUA 3U78A 2MEV3 4LHLA 1I3GH 4NQEA 2YIBD 1KS5A 4A7YA 5IAVA 4MMYB 3VBFC 5DTFB 1T7XA 3C2AL 2W47A 1VQ6V 3FB6A 1H3GA 1KEMH 4CL7A 2VDQL 2G9FA 3LA3A 3OY8B 4EV0A 4COUA 1BBT1 5A7OA 5H94B 1CAWA 1WA0X 3QDGB 2VRZA 4N9GA 4YWGL 4MHUA 4TVPH 2C4XA 1B4TA 1R24B 2K78A 5JOXA 4C47A 3KPPB 4GKSA 4IEFA 4YXHL 1BE3H 5C0IB 2MPAH 4U7OA 3HUJE 2B8OT 4CP0A 4P3DA 4OCXH 4Y89A 2VQ1A 1YDXA 1DSFL 4WFFA 2TNFA 3R7QA 3FBYA 1TNNA 2DVDA 2FL4A 3NSXA 4PWGA 3M7FB 1H2MA 4LFBB 1MUJA 3DSNB 3EOAA 3NZHL 4OZFB 4GQ9L 1MWAB 4F27A 3BZEA 2WFF3 2JKWA 2EIJC 1XIWC 3VMNA 4TUOA 5M0TA 1RZPA 2V0AA 2ZX7A 2ZKMX 2PYED 1RZ7L 3GIVB 1W99A 4OHWA 2AHYA 3MROB 4U3SA 4UW6A 3EJSA 3VBUC 4Z7NF 3U4SA 1PG7L 1NSNL 4AE2A 3S4SA 5GLUA 4QWWD 1WB8A 2LGQA 3HG2A 2ZJSL 1JUFB 1K4DB 4DW2H 4DCQA 1JZ2A 2JS3A 2WQRA 1MOFA 1F51A 3E86A 3MLWH 4I2XB 4A55A 1R082 2GALA 3CRRA 4QGLA 1DVUA 4M00A 2D8KA 5DT1L 1GC1L 2GCYB 4TRPL 4DXRA 1XEQA 4P5TC 1F8TH 1LK3H 3Q0HA 4D8PA 1JJ2U 2Y36L 4FYSA 1NCQC 1CCZA 2P5PA 3MRMB 2V5SA 4TQFA 2DBIA 1KJ2L 1T1ZB 3LJ3A 2PHUA 4Z2WA 5TQ2H 2YAOA 4XMKL 1RTVA 5J6GB 4ZUUB 1MG1A 1HAUA 3ZFGB 1UZ6F 4XRCA 1YPZA 5D2NB 5FW8A 3EYQD 4DN4H 4YVWC 4JPQA 5ANHA 2WCPA 1ACXA 1XNRO 3AADB 3BVOA 3LH2L 3U46A 2C9VA 5IHUL 3B2XA 1UKRA 4MCNA 3NV4A 3MZGB 3J4UH 3CVIL 3PP3K 4IU2A 4YW3A 4WW2A 3T9WA 4B9CA 4CCJA 1R73A 2YPLA 3FB7A 3E1F1 1A8JH 2BY1A 1N4CA 1NMAH 4IBLT 4XMLH 5CLZA 5DURB 5FKPA 5K39B 1I5PA 3TPUB 2J1ZA 1MZZA 2N7SA 3BFQG 5E6HA 1S7TB 4CXXA 4AWJC 3I6KA 4KAQL 3HPJB 4GUPB 4H1LG 1IXMA 3WF3A 1DZ0A 2CO7B 2DD8H 2EZ0C 3NCJH 4FFTA 5A2IH 2HH0H 3GRWA 5K1VA 1JYXA 4HF5H 5LXGL 3D6EA 3WS3A 3GXIA 3FFZA 1BD2A 4NT6B 4ZSOA 5LLIC 4E41B 4QU2A 3VU1A 3OKDB 4PRHA 3K0DA 3EO1B 5DK2A 4J6RL 4YZFE 4LLMA 2E5LO 5T1DL 1E6OL 1GP4A 5GM0A 5CB7A 1PX8A 1H8LA 2R0KH 4WV1C 1L5GA 1AQMA 3OF6A 2BHZA 2VXRA 4JN1L 4P9HL 4E2LA 3JASA 1NCJA 2XIBA 3VD0A 4GUOA 4C0HA 5DC2A 1XF5A 4JPIB 4OB5H 4UMGA 5DUPL 5JDBA 1GN3A 1WCDJ 2OR9L 1IGMH 1M57B 1W0KG 1YJWV 4G83A 5FIXA 3H7YA 3S3WA 2MOQA 3MXVH 2ZWSA 1U58A 1VFUA 4FXGB 5A3TA 2IWKA 1JS4A 3VMPA 5F6HJ 1WS8A 1FXKA 2CJUH 5ICZA 4R97C 2X4OA 1X5XA 2R9AA 1LR1A 1CICA 1NDMB 4B3SB 4C4UA 4QMEA 1K3EA 1NTKH 3O3EB 3QUXC 4RSUA 1K3ZA 4OCRL 4RR3A 3KWWA 3RPQA 3CHPA 4JHAL 1A2YA 1CE6B 4X4YA 3SE8H 4GG8A 1BMGA 5ANME 2NUTA 1CGUA 4DP8X 1VGKA 4Y16A 1A66A 1WHOA 1XNKA 5FMOS 4YZFF 5KYWB 1MS4A 3WINE 1DYPA 3MFAA 4LB8A 2IH1C 1JGVH 3T0XA 2ZYSA 4K71B 1OKQA 5JXJA 2F19H 2FEDD 4KHXL 5H2BB 5HHNB 5C71A 1L3WA 1PSKH 2VZTA 3LZOA 1J18A 4YIQB 4XJ9A 1OPGH 4XYXA 2VDQB 2CPUA 3EJTA 1QLRA 2NX5B 4TSAL 1MACA 1BREA 2IANA 4HK3N 3L3GA 3UMTA 3B2EE 1DDTA 3HD8B 5J06A 2G3NA 4N3UA 4ZS3A 1AR1D 4RGKA 1OLME 4NIDA 1NCTA 2MEJB 3ISWA 3W39B 4GB9A 5ALBL 3BAIA 4FGMA 1MREL 5IT2H 2WWMD 4X65B 2QQLL 5A6MA 2WV3A 4DZ8A 5KG9B 4WV1B 4K20A 2PMZA 2QADC 4HV8A 4F58L 5HHOB 5DJAB 2ZPXA 1HC1A 1LO4H 4WEMB 3D5OF 4AXWB 2HKXA 3BCDA 2RDNA 3AP7A 4HSLA 1G1CA 2NN8A 4XJAA 5T3NA 4AGNA 5IR1B 2WXMA 1UOJA 1ZOXA 1DANU 1QFWI 4FFWC 3ZDXF 4IBVA 3VDDB 3QE5A 5IHZB 1G4YB 3FWEA 4PWHA 3ZHVA 5EOTA 4I8DA 1ND0A 4HHAB 4P9HC 5E9AA 5GLTA 1AKJD 1VF6C 3QORB 3QZWB 4G9DB 5EC2C 1BGXH 1T0NB 5ILTH 3V65A 3POWA 2OXGB 5ABJB 4L37A 1NCDL 1MCRA 3ZBHA 4CH6A 3CF6E 3IEAA 4KVCL 1SHXA 1Z7JA 3CZEA 2Z2SB 4TUJA 3FK3A 2HEVF 2DDQL 1RIHH 1EHAA 5DQDH 3DLQR 4M48H 4Z5RB 2AZAA 1FV1B 3GZQA 5A7SA 1LUVA 2ATKC 1W72H 4XC1H 5E4IA 1M4WA 2C1FA 1QJEA 4UVCA 1HR0O 5F7EH 5EUOA 3LKOB 1CLVA 4YBQC 4DK3A 1MG2C 43CAB 2YAQA 3LDBA 2Y38A 3IMUA 3T2MA 2Y3NA 4V2CB 3PJNA 2CHNA 4N2IA 2BRQA 1DSWA 1Q90A 2ZEWA 1WWWX 3MJ6A 4O51A 5FHAL 1E8ZA 4CBPA 4MV2A 3N40F 1RXLA 4H13C 2V7QG 5CZKA 1PM7A 1EHXA 1J05B 2J1AA 4L11A 1QKZL 1VERA 3BP7A 4RX4D 5H5NA 3H9YA 4P9LA 4OTXL 3VBFA 3R1GL 3UO1H 3L6FB 4RAVA 3T0EC 1V3JA 4H1LA 4F37F 3E5QA 4OX9O 1SQ4A 1CZ8L 3L48A 3ILQC 4QTHA 4F80A 3FFCE 3WW1A 1TQTA 3S35X 5IV2B 2Q9OA 1S78D 3I2CH 4F15B 3HI5H 2BP5M 2IAMC 5EBWC 2JRIA 3DX6B 2A83B 3GMQB 3QJUB 3QQ3A 5TFSH 3LKNB 3PL6A 2HJIA 2VC9A 5EJ1B 2WUHA 4LCWD 2QNKA 3AKRA 1IC5H 1E5UI 1RZQA 4W9LC 4YHKL 1Y43B 2P8PB 4Q29A 2DE0X 3F6IA 4QXUH 4CU9A 1GLHA 3IU4L 3ATAA 3KLQA 2F54A 1LHUA 1HSBA 2IF7A 2P8MA 4HT1T 1EUUA 3WFBL 4EI6B 5BNQA 3OEAA 2CGPA 4JFOB 2JDMA 4ZNCD 3ZPYA 1G8WA 2CO4A 3ARTA 3BMVA 3FQWB 5A6ZA 3TJHC 4EE2A 2GSIA 1IBBA 3GALA 3H1WA 1KTBA 2WSDA 4JC1A 3K04A 1CXEA 4BZ1H 2E47A 3BSZL 4FLRA 3JD73 2QQKL 5SWSE 3WAJA 1F6FB 2G75A 3MRBA 5TK2A 4PJHB 1XSQA 3DVGB 1CIYA 3VE0B 1NLSA 2D31B 1ZNPA 1F6LL 2ET1A 2DQIH 3UX9B 1MFCL 1O9VA 4X4KA 1HKLH 5GGTH 2VRQA 2QR4A 4L1TA 3GXPA 3QG5A 1WH0A 3A6BH 1NBYB 2GITA 1ZTXE 5DK0A 3W7TA 3JU9A 4UT7L 4DR3B 1T6BX 3WX5A 3WEBA 2BIHA 2YPLE 3CE2A 2C7FA 1R64A 1VBB1 4P9YA 1Y7VA 4I0XA 5BV7L 5F9TA 3OPZL 1XDCA 1TZHA 2GH8A 2DVGA 4BSWA 4MVQA 1FL5A 3PWLB 1A32A 1O7FA 3T04D 5IJVA 4BXSV 1J5HA 4XP9H 1Y74A 2AKRB 4Z0XB 2WXFA 4MAYC 2DUQA 4HUVB 5T1MA 4TLKA 5F21B 3RWHA 1NPJA 1E42A 1F5FA 4M6NH 2XZAH 4AL9A 4O58L 2B0SH 2DM2A 3D18A 4DGVL 3O3AA 1U8LA 3WE1A 3HR5A 4KKAC 2AABH 4HGKC 5A3WA 1NH2B 3WJMA 2YD4A 2QGDA 3KCPB 1Z5VA 4J3WA 4PWJA 4ELMB 4NTXA 2D7OA 1HSAB 1SLLA 1BL8A 3TB0A 3TO4A 5KOMC 1PIV1 4XACA 3CLFL 5IJ0A 1JPEA 4EVNB 1I1RA 4Q0XH 4HS6B 4XNUL 1QLEB 3U79A 1UZ8A 1B4JH 4K7PY 4UQ2B 5EV7A 4PGCB 2C26A 5LN8A 3L1FA 1CPNA 1CZSA 3GHMA 5FYCA 2OA9A 2FJUB 4LKXA 2QPSA 1XFPA 2YD7A 4G6AD 4NCC1 2K3HA 2Q86B 3JZ7A 4QDGA 5D8AA 2BOBB 1YC8A 2P49B 4QB2A 3I6LE 1U96A 5D4HA 4NFCA 4OKVB 4FLVA 3MRJB 3CJHA 1VFAA 1SA0B 1GJWA 3CVHB 4L3CB 4N90E 1DSYA 2QKSA 2W1WA 1KUQA 4KBBA 3Q4HA 4F5CA 1QYGH 1WGPA 4IEQA 4ARYA 4LLVB 3DHUA 4AQ6A 3EBRA 4TNVF 5C33A 1BT8A 3MUHL 5E8NA 4XW3A 4JNXA 2XT9A 4X0NA 4XB8A 4Z3TA 3HLAA 3IDMB 3OAAG 1U8JA 1OF3A 4E27A 2AEWA 3O0RH 3EO6A 3VHRA 3IJYA 4LR3A 3KDMB 2G4EA 3ES6B 1QHTA 4UFJA 4X6RB 2FEEL 3K9AA 1N5AB 4AMKL 1QU0A 3Q2WA 4ZHQB 5D1XC 3K5NA 1JE6A 4DGUA 3USUA 4M01A 4DV3B 2GN3A 1U12A 1CGTA 1LO0H 1PQZB 2AZUA 4TMPA 1S0DA 3ETPA 2BPA2 3DSFH 3L4TA 4IDJH 4W6YB 4FA7B 4I09A 2D03L 2CIIA 3BP4B 5IM7B 3HEIB 4ODXA 1JWSA 3ZX1A 1R3KB 1AMXA 2P8LB 2OJZL 1A0QL 3CZLA 5C93A 5DUXA 2EE6A 2G4IA 3QBQA 2D9CA 2VITA 2YU1A 4PHXA 3AB0B 2WXOA 1KB5H 1DANT 1F3RB 1B9ZA 2FB4H 1DFBL 2BCKB 4KOCA 4CDUA 3P2TA 4N5EC 3O4OB 2WMPB 1L0LH 1KCSL 1P9MA 4MQTB 5FDWB 1NXMA 2A70A 1DQLH 1KYDA 2UYBA 5A3ID 4JZJC 4HIPA 2X4NB 2XWRA 1I5YA 3C08H 3UTTA 1C5DA 3L74H 1OAZH 2MMXA 4L0ZA 4IGGA 4OF7A 2CHDA 3BT0A 4A6YL 5J3HD 3M8AA 5LDSA 2A2QT 2YMOA 4DR1B 4DP9X 3S8WA 1Y18A 2RGSA 1ND2B 1VBA3 2IVJA 2CDGB 2LU5A 2JFCA 5FR3A 2PABA 4IIQC 1JI2A 3RHWK 2EVGA 4AEMA 3FUJA 2VN4A 3I9PA 4FQXA 3ZT5A 1EAPA 1FDLL 1XCTB 3GQFA 1GR3A 1HHHA 3SDAA 2VDRH 3OMAB 1QTYT 3EOTH 4FULA 4OFDA 3RX5A 5A7QA 2Z5UA 1F4NA 3LFMA 1MIEL 1BCCH 2GTAA 1QWUA 3L45A 2E7MA 4DT2A 3N7LA 5A3LA 3VFTB 2OCCB 1QRND 1RHHA 2CAKA 3MOAH 4AQ1C 4B3TB 4JI0B 1DHKA 4PG9B 4ALAC 2FLBT 2I69A 3C87A 3FO1B 4EZMA 1PZ7A 4EO5A 3PHAA 3KV9A 1GWLA 1V7ML 2XN9B 2YAPA 3IU3A 5E94A 3HRZB 1JIBA 3NJNA 1QI5A 4W4NA 2ZXWB 1G7JA 3WTXA 2VR9A 4CVZB 2JQAA 3L7FA 4U7SA 2IXKA 1SF5A 2Y36H 4YO0A 3ZEDA 4NQUA 7FABH 2XBTA 2X6VA 1MIML 2HYKA 1YIFA 4JZJB 4ZU7A 1HHJB 1KIUA 3MUGB 3I3EA 4XOGA 1FNGB 1XMOO 3SXWA 3Q6FB 2GFBB 3Q6GL 4NFBA 4HOZA 1MXDA 2UWBA 2ENJA 4H1LH 1PG7H 3CRAA 1NC2B 3CSYB 3F7YB 1VE0A 2IUWA 3IZOA 2XWTB 5AAPA 2ZCLL 2AK1L 2YFOA 1X6LA 2YN5A 5TQ0L 3V4VH 3W9EA 1IGYB 5J89A 3DIFB 3P4NB 3FN3A 3CC5B 3FTUA 2E9IA 2BUKA 4ETYA 4PJFF 2NY2B 3WL9A 1IKFL 2CNZA 1AR61 1HN0A 4MXWH 3DO4A 3RU8H 2G19A 2Q8DA 5CIPB 4G6MH 3RZCC 3TVMB 5BNXD 1CTOA 5EQUA 5FCUL 3KLHD 1W0NA 1MWAL 5I6XB 2CTRA 1TVKA 3EJKA 4NMIA 2Y25A 1FL6B 1L3NA 4G3YL 3WGUB 1RJZA 1RZIB 1ZX5A 3QIBC 1JNHA 1OQOA 3IKWA 4XVUC 5D7SH 1ZZ9A 3BO8A 5FZMA 1V54B 1EGJL 3B3IA 2J1VA 5B7FA 2Q6AA 4JN1H 4P9HH 4O4LA 4NHKA 1RUAL 1AR62 1STMA 3VFOB 5ISZD 4J10A 1A9EB 1UL9A 1JCHA 4WWKB 2ZXWC 5ERWB 1QBML 4MSWC 1HHKB 1GBGA 2R30A 2GC7C 4JJ5A 4NWUH 3RRDA 3QPQD 3PWUB 1H1MA 1R3HA 5EZJA 5LWYH 3ARDD 2DD8L 1ORQC 4E5XG 1RERA 3UACA 3EO0A 4PDMA 5SX4H 5IMMB 5HHPB 4INDA 4QT5A 1G7YA 5GLZA 1J8SA 1ITCA 1KCVH 4OZHA 1H3TA 1H8OA 3KGSA 2G9GA 5CKQA 4J6IA 5EO0A 1MVUA 3QQ9C 1UTDA 4JDEB 2IQAA 1IKNA 3O2DH 1G7IB 4WWNA 1D4M1 4QKNA 4XNZB 2E6JA 3ABLC 5KSVA 4HKZA 3SNMA 2LGNA 3RNKA 3MN8A 1NG0A 1NBQA 1YEEL 2ATFA 4P49A 2WGXA 4DW2L 4ES8A 1YG9A 2QZ5A 3APDA 3VRJA 4BIUA 5HV4A 5K0UB 1F11B 4QPIA 2IH3A 4HKXA 2MFNA 5C9JA 4COYA 4HPHA 5ADPH 1CX1A 4B9JA 4ACTA 1XGZA 3ZE2F 4PTTB 3ZN1A 5J13B 4D7YA 5FDBA 4PREA 4LHSA 5CSGA 3SGJA 5BQ7A 2ZNXA 4PQQA 4GKJB 4K3AA 5JXIA 2OZJA 3TCLB 1DJZA 1M9NA 2D4DA 2FHFA 3QIBB 1VEMA 4U1KB 1ZUQA 2RR12 3KAAA 2XG3A 3HKEB 3H3ZA 3RI9A 4JN2B 3KPSD 4DO6A 2HG5A 1H3PH 1JD9A 4HUKB 1A7NH 1BAFL 4D6TH 2QR0B 3CZSA 4KJQD 4LOUD 3DHPA 4EPSA 5MEOA 2OT5A 1DVSA 2MRYA 4W6WB 4YDKL 1PYWB 2R041 4L4VA 3ZOAA 3D4CA 4IMKA 1CE1H 1C5HA 4S1DC 3ETEA 5DJ0A 1F58H 1LD9A 4LCWE 4WI0B 3T2LA 3TJEL 5HYEA 4MXWB 2CGNA 3HNMA 1WFTA 3BH9A 3FCGA 4HKJB 5D1QE 2FYUH 5CIRA 5CISA 2FX8H 1MEXH 1DBJH 2W0FA 3EXAA 4FFZA 1TZ8A 3H2PA 3U4AA 1Z5WA 1ULDA 3MV8B 5LK5A 1ZT1B 3J07A 2XDHA 3S7IA 5FNVB 4LSQL 3UCSC 4LLAA 4OGAC 4Z7WA 5IGXH 1W8OA 1HQRA 2A5ZA 1H8HG 5GONA 2VXTL 2XT1B 1UFUA 4AKQA 4GX1A 1S9VB 3BN9D 3L3HB 4OZ4B 3P0YL 4HJJH 2Y6LA 2HKFL 2BDNH 5BMFL 1JGLH 4MGZE 3LN4B 1EN4A 4EBQH 2R0KL 2B77A 2PW2A 4TL5A 1NT2B 1WZ1L 3BSZH 3C3SA 5JPMA 3AZXA 4X5XA 5C1MB 1AFVL 4B3RB 3MRDB 4UB0L 3QEUA 5EUKB 5IHBA 5IQOA 1QEWA 5FV2A 2R49A 4EDXA 3UYPA 2F7QA 3VRIA 4GW5A 1OB1B 5JW4Q 3SY0B 3HG4A 4RHV3 1I1AA 4KDVA 2VJXA 3PQYB 4HAKA 2IALA 1M71B 4U33A 5TF1H 4JMXA 3SEPA 3T5WA 3FSOA 2YU2A 2ZACA 1UZGA 3FX3A 5EPMB 5AUMA 3SPJA 4FQPA 4MBRA 5IK3A 2Q0ZX 4BW5A 1WP8A 2IPUK 2CE4A 4NXNO 3BUYB 5FA3B 4EQVA 4LSRH 5IQ7H 1FXZA 1SYVB 1KXHA 2BNRA 4LZKA 4IBSA 5CZVL 4JFEA 2JK5C 1HQ4A 5LRSA 2V4VA 3L7EB 4XVTL 3E80A 5JXEC 1NJIW 1ASJ2 1R24A 2VQFO 2F61A 1LM8V 2WP3O 4TYUA 4JM2A 3K71A 2XUMA 3NPZB 1FAIH 5AVQB 1GGIL 3SH4A 2RHEA 1JZDC 1YCSA 1IS4A 4HXBL 5AFAA 4MYPA 3F62A 1A25A 3ARBC 3QZBA 4M0HA 1GN6A 3AQDA 4N0UB 4E9QA 1P5UB 2YQBA 4AE0A 2CBMA 2UUAB 3DMMD 4W93A 1E9OA 5CM1A 4MD5A 2RAMA 5ESVA 1QNYA 4JFXA 3DX4A 4M29A 1T5KA 3MA9H 4I9XA 4C59B 3MFCA 5DUML 4YVSA 5LMNO 5E8OA 4DV0B 1M9SA 1UM5L 1C28A 4OH2A 3WUWG 3BSHA 5H4ZA 3BH8A 4PJ8B 5I26A 1QOOA 3MROA 3MHZA 5K9QI 3IAYA 1BX2A 1SBDA 4APQC 1CYXA 4PELA 1W2NA 3OKLB 1N0LA 2DU0A 3VFGH 2IQ9H 4A2EA 4WI3A 5FIEA 2GW5A 4KJWC 5DHEA 1PIV2 4R97B 1KB9J 3N44B 4I7ZB 2CQVA 2BW4A 3LKPA 2HKOA 2E7DA 1FV2A 4YHYB 2LU4A 4MAUH 1CBVL 4HOOA 5FO9B 4LA2A 1S7QA 4XDKA 4EI5D 5DUUA 4Y5TA 2JF1A 3P4OA 2VXVH 4XABA 4ZPVB 4HWUA 1U8KB 4UIKH 5FA4B 1B35B 1GSMA 2R70A 4HGWA 4B3NA 1CB4A 5L7OB 1YF2A 2DQHL 4JZOA 4KVNL 3ZN5A 4TT3G 1GNYA 1A4JA 2B7DT 1QG3A 3UO8B 1IILE 5I76A 1MS9A 2A6JA 4OI4A 5GS1C 4HPOH 4PS4L 4HWBH 1N19A 3NIGB 3HZVB 4Y4KA 4I89A 3M99B 3W21A 5B2GB 3GHPA 3SE9H 4BW9A 4OUOA 3IJ9A 3ZK0A 2DYPA 5IMLB 2JDKA 5IK5A 4LAJH 1UKQA 2R83A 5F70A 2CV6A 2L9LA 1KCVL 3CFMA 3FB7B 3BW9B 3QJHB 1MHCB 4PD4J 3TOJA 5FKPB 1GIGH 5CN2A 5GS3A 1XF4A 2Y5TA 5A1AA 2TEPA 1UFIA 1RSFA 2KKWA 2ZX4A 3BVNA 2EE2A 2WVVA 3HPJA 3PDDA 4GUPA 2BVEA 4XI5D 5DMIL 1G84A 4P2ZA 4JV4A 4FLYA 1LEKB 1ZDQA 4XP1H 1EQWA 2A6YA 1FC2D 1QAWA 2BFGA 1F42A 4GO6B 4RGNC 3LHPH 1YNTB 4AIZB 5I0RA 2GY5A 5D72H 4XCFH 2W91A 5CJOL 1CF8H 1I75A 4LLMB 4Q2ZA 1RJCA 5FYJL 4A2DA 4Y4FD 4WFGA 4FFVD 4DQOH 4IQPA 1ZSPA 4TQHA 1FNEB 3DBSA 4GRWF 3LEYL 1RSYA 3L4ZA 3RG1C 1S72V 6TAAA 1CTNA 4XUTA 4AHZA 3HS9A 4YFDB 2H47C 4JPIA 4WFHA 1J9TA 1T6VN 1WZAA 3O6FD 4FVMA 5TF0A 5EPAA 3IMSA 1LTEA 4PA3A 1TEGA 3CVDA 4ZS7H 4DH2A 3CMEV 4FXGA 1R092 1B3JA 4ASKA 5AVZB 4UDUB 3RUGE 4BFJA 5CZXD 4ZW3A 1J5IA 1QBLH 2PYEE 1FXKB 1RUAH 4ZFGL 4ORFA 1NDMA 3AQYA 5CNHA 2PHFA 5E6ZA 3DJRA 1R5WA 1TVBB 4IV1A 4CTEA 2E3VA 2ORXA 2Z7WA 3TS8A 4Y5XB 3F05A 5EF0A 1CE6A 3KG5A 2X7LB 4OCWL 5B8CB 1CURA 4O4HB 1HL9A 5DG2A 4Y16B 4IW3A 2FRGP 2JJTA 2IGTA 1Z9LA 5KYWA 1LHVA 2YOCA 3N1MC 4UINH 3CPLA 4K23L 3ZE2B 2NNXA 4CCEA 1YMHB 1U8IA 1W8ZA 1Y66A 5HHMB 4V1DB 2W68A 3RYHB 5EWIL 5CWSA 3U1XA 1LEDA 4PDWA 1JZGA 1PD0A 3SGDI 2FX7H 2QSAA 5FGBA 1PVC2 2VNRA 3AKTA 3ZYFA 2FDGA 2VTFA 4ECNA 4G27B 1VRH2 4XZUG 1PNKA 2BP8B 5AZUA 5E1QA 3MW4A 1FF5A 2RMU1 2E59A 5F6KA 1UASA 3AG3B 3ECUA 4GSDL 2PPAA 3PMEA 1XAKA 5I8KH 4HWNA 2XVGA 3MTRA 2EZOA 2C9AA 5FYLH 4QJ5B 1HINL 5BRZB 4JPSA 4BXVA 5FMDA 4PRBB 2VDKB 3RJOA 5KVFL 3NN8A 4MCYB 4JZ2A 5B1NA 4ZQTA 3LA2A 4IV1C 4IRSC 4P4KC 4XMUA 3TBVA 3V0FA 3ZYGA 4Z7UB 1RVFL 1VPOL 4HVOA 2WLJA 3H9ZA 4PW9A 3ABZA 3VDDA 4QKTA 3CCHB 4U1LA 3HCVB 5E1AB 35C8L 1XCWA 5HVHC 1MHEA 5EOTB 4K3HA 4JYAO 4HFSA 2YD2A 1WLDA 2CLRB 3DDGA 1IFHL 3Q3GB 4FM2A 1NIFA 2VO5A 3HNSL 2IJJA 2WA3A 5EA0H 2W8CA 4L37B 5LQBL 1OSZB 3H3KA 4WUUA 3RDTB 3VFSB 4ABMA 1OXCA 4BIKA 2Q7HA 4I2XE 5LA9A 4X7DC 1LU1A 1TSRA 2CH7A 3NGBB 4UTBL 1IGFL 3NDZE 3JATA 5FZBA 5ADPL 2Y7SA 4R8WL 5AW6B 1NFDE 1E4WL 1ULVA 1NBVL 4UILL 3GGLA 1FV1A 4LDCA 3KVAA 5H9QA 3NCEB 3US9A 3LRHA 1RZJC 2EDKA 3FCTB 4EOWL 3V0BA 2PTMA 3WDYA 1GTNA 2YUXA 1OT4A 2Q1FA 4Y2DB 1R5IA 4N7UA 4Y19E 1XHZA 3G08A 4RISH 2DVBA 2ZEXA 1Y76B 4GYBA 5HD8D 5DUBB 3MXWH 4XNQB 4XF1A 1MCEA 2B15A 2DPKA 2VBBA 4ODHH 2Z31D 3KGUA 2OMTA 2XBO2 3OD4A 2YROA 2F54E 3TH4T 4LF6B 4BBWA 1A6CA 3DETC 3L6FA 3GSRA 4K35A 4RAVB 5AALA 5ANMB 5D7HA 5DWUL 1FLRH 2BK8A 4JDVA 2QLYA 4H8VA 4NWUL 4U6HA 2K9PA 4P23A 5D1ZC 4FLUA 4YLQT 4X6FA 5JW5B 3ESNA 4KJQC 4BB3A 4TLGA 4IRJC 5E1AC 4QCIA 3MO4A 4CDQC 1ZWIB 1KP3A 4HUUB 4PV8B 1PLAA 1QD0A 1H2NA 2ZTNA 4CEYC 2ICES 2V5TA 2ADPA 5ICXA 4EXKA 3WOGA 3H9HA 1HB2A 2Q2LA 4P2QE 3WIFB 1AGEA 4BH8A 2OP4H 3VD9A 5L19A 4OD3H 1EV13 1A1MA 5D7LB 2FHRA 3AK1A 3DPRC 4LHUB 3R65A 5MEPB 1LHZA 4LCUC 4WHCA 2ZOKA 2GC0A 3M1BA 4EI6A 1YUHB 4R7VA 3E8BA 4GEJA 4G6ML 4XWOC 5J3HC 3VFRA 5CCKL 2WQ4A 2HMIC 3PU8A 3L81A 4YW1A 2YMTA 2GSIB 3VDAA 1U8CB 1YRZA 4QHBA 4PJXA 3B77A 1D5ZA 5LBSH 2QJDA 3HE7D 4PJHA 4PA9A 3N4MA 3L5WA 1ZK9A 2D31A 3PHQB 4PJEF 4TULH 2O93L 1V6OA 3ZYOA 2OSLA 4XPBL 4XX5A 3ZMZA 1R4XA 5DVMA 1HZHH 1NBCA 3VXRE 3N2GA 1SERA 5DHVA 1RINA 4CMMB 1OT1A 3N42B 4LKCA 2G60H 5C0DA 1QRNA 4FM0A 2YGNA 3NH7L 3ZRXA 1F4YH 2A73A 2CWRA 1C08A 1WO2A 3RYCB 2OZNA 3DO3A 3JWNE 1D7CA 1FVDB 1RHI3 5BNNC 1G43A 4BSWB 3DIVA 1JZ7A 3QFJE 4W4OC 1IC0A 4OJCA 5CFDA 1AR92 1S7SA 3NA9H 4XC3L 5IJVB 2ZMNA 1XH3B 3DPRA 1X5FA 4CW1B 4GIQA 1SXAA 1LYQA 3HR0A 3L9YA 4WBBA 5EEVA 2JX9A 5D5ME 4RMRA 5KVFE 2VZQA 4UCFA 3LPFA 3T8XB 5IGXL 5LO7A 3X17A 2NZIA 1DE4A 2WNWA 3P9LB 3L4VA 5D4JA 4N2NA 3BDXA 4DKDC 4E9SA 2WWSA 2A06H 6CGTA 1DQDH 2N0KA 5DDHB 2D3SA 2VDKL 3UEZA 1F9KA 1KENL 4U1MA 2M8XA 4KFMA 5KSUA 2O6FA 2Z1PA 3TO4B 4CRPA 5C08A 5IJ0B 1GA2A 4AE1A 3UO2A 1QHPA 4HS6A 3HS0B 3VGGA 1SEBB 2DMBA 4UXNA 2CR3A 3HE7C 1RFDH 3ZTJH 2AS5M 1V6IA 3DUIA 1F8TL 3S88H 2HLFD 4MX7A 3PFQA 2LFEA 4BDVA 3ARUA 4KTEL 1GZ9A 1N18A 4QM9A 1P6FA 2Q86A 3VFMA 3W0WB 5FTTC 2HWF1 4FFBB 1OANA 3APQA 3SYCA 1FHGA 5JJJB 4KY1L 4H88H 1JYNA 3TEZA 3TA4D 1S9KC 1OKOA 1N0NA 4CUGA 2XU9A 4NIKB 2GJ6B 3BGAA 3MLSH 4NKMB 4L4TE 3QWQB 2GUZA 4N20A 3KHOA 4EAEA 1UXZA 3GIZL 5G05L 2QKIC 3T1WA 4OSUL 2NQCA 1QNZL 4RAHA 4B5EA 1ZA7A 3T1YO 2H5UA 2Z64C 5AOZA 3HLAB 3IDMA 1UG9A 3F7QA 1J1OL 2KDGA 4HJGB 4XPHH 3BOPA 5GIRA 3TN0D 1I9IL 2R23B 4AUYA 2JIXB 5F7AA 4H8PA 5KOVC 4TSCL 2QMJA 3QG7H 2YXFA 2TRHA 3OBTA 4FMTA 1MCFA 2X3BA 4YQXH 2P43B 1QFUH 1K5NB 1WISA 3FN9A 4TQ8A 1A6ZB 1O8PA 4OI2A 1JVKA 2IU0A 3GSNA 4QY8A 4R90H 2CIIB 3BP4A 3ATGA 1AJQA 4LARH 5FP8A 2DM3A 2DLHA 4WBNA 4TNGA 2P8LA 2GNMA 4YYOA 2RALA 4UV9A 1EV2E 4C56D 5C0JA 3NO8A 1VA9A 4K9SA 2VZ3A 2F53D 3H0TA 4JKNA 4YW4A 3D06A 5A16A 1A3KA 4DV1O 1OALA 4UCSA 1IAKA 5IQ9B 5K5YA 1R1A1 1EANA 1W72A 3LNFA 4FNLL 1SPPB 2FX7L 2Y6KA 2YGPA 4L8CA 2WNKA 1WCKA 2F4VB 3NV1A 4I3SL 1GRJA 2V4AA 1QLNA 5BUAA 2H6OA 2RV9A 4AEJA 4A4AA 1RMFL 3ZXDA 2G9HA 4N0FA 1JZ6A 1KJVB 3FU0A 4L97A 3E6FB 4G72B 1OVZA 1KIQA 5JIPA 3IRZA 3CZJA 3LVEA 3N41B 4YNYA 5HI4C 4BQXA 5A2KH 2DWTA 2BNQE 2Q0OC 1Z7S1 5BNOC 2QKIB 1MS3A 1FI8C 3MNWB 2BY2A 5D1XB 1X5AA 4M3JA 4IKKA 2IGFL 5ILTL 4FG6D 4XJUA 3QUMA 4OLWH 1ND3B 5GSVB 4ICGA 2JWYA 4I0PB 1FZKA 1KPVB 1YVLA 4MRBA 3LRGA 5J1TC 3TN93 1KB5A 4EWAA 4YSCA 4BUQA 3DRTB 1W06A 4F1ZA 1SBFA 4JGZC 1DP0A 1U3HA 2CRYA 3E6HA 3GJFH 1B4LA 3TT1L 4GKKB 4MT8A 1NCNA 4PJGA 2IXQA 1N7MH 4LQFL 3K3WA 3N1QC 4JE4B 2UZIL 5D9SB 1O5DT 3N04A 1TJIH 1R5VA 3V0WL 43C9B 1YNLH 2W1UA 1QPKA 3BAJA 4NJ4A 1W90A 3OGIB 4J4PA 3W5NA 5E2TL 3C8KB 3JSNA 2W95A 3QDHA 3RYIA 1L9MA 1G7JB 5IW1B 1IB5A 4O4IA 1UWGL 1GP5A 2OSYA 2V37A 1MDAA 1T4KA 4PWIA 5F3HA 1FE8L 5AWNH 4XNZC 5J2TB 5KSAD 3VXRB 2V2WB 4ZXBD 4XODA 3K5LA 3ARYA 4FADA 3GHNA 4WHYG 5JSRA 3HS8A 4JFDE 4D7TA 5SWSA 4QQOA 1J5CA 1CD0A 2OMWA 1HB4A 2F54D 1MW2A 1TNRA 4K07A 4L0PA 4RS5A 1MCDA 2VN7A 2Y24A 1R6VA 3WJJC 3ZE2E 3KZ4C 5FMOL 1GV9A 1E6JH 3PWPD 3RB5A 1YEDB 1S6NA 1REIA 2EC9T 1NKDA 2HKHL 2IPTH 3PS6A 4M5ZH 4OV5A 4LAQH 4DVRH 4EYUA 2XA8L 1JPST 1LP9A 4GAYA 3VRLF 3CFEA 3W9EB 3X1BA 3D05A 2KSDA 3QCWA 3LSOA 1RVF2 2JB4A 2LFSA 5D7LE 4QXHA 1NCBL 2WQZC 1AXZA 3AFKA 3H6AA 3VXMD 5H37G 5B4NA 5ALBH 1HKFA 2UZYA 2XFXA 2XWZA 4JFPB 4L5FL 4M6OH 3NIDB 3TVMA 5AENA 2OMVA 3LZPA 4FFWD 2IXCA 1XZ0A 2Z91A 3EYFA 4NQED 2Q2EB 1GM7A 1I8KB 3OJMB 4QHLA 3FTYA 1KJLA 3ABMC 4QQPA 1A4KA 3B5TA 4HJIA 5D7JA 4FMVA 4EN3A 1JHNA 1AS7A 3OJ2C 1LESA 4PVBA 2ZSVB 3WW3A 4H3WA 4GSUA 1OT5A 2HHHO 1I1FA 3NZHH 3PHOA 4NOBA 2IXHA 1G7MB 2C9UA 2XI9A 4LVEA 1H15A 1SMVA 1OARH 3IETB 4S1QL 1AF9A 3J26N 1KV7A 35C8H 4XPGL 1RJ8A 1NLBL 1PKQA 4RO2A 5LGNA 1FZMB 3LVTA 5LP6C 1BVZA 3MCG1 5CBAA 1NAEA 2Q8EA 1NTZH 5AW5B 3SGKA 3WY4A 5LCVH 3C9NA 2JB8A 5C0BE 3PV7A 5HHPA 4ES9A 2QJVA 2HFGH 5JJNB 2PXYB 3MJ8B 3QH3A 4M6AA 1F4WH 5SX4I 3VGIA 2VSMB 5IUCA 2A7AA 2LU3A 5L4FA 2HTKD 3BT2H 3GXNA 4JDEA 2CIKB 3RYMA 3RZCB 3JD2A 1SOXA 3TVMC 3ZRCC 4R0LB 4DSYA 1JZ8A 2ZUTA 1T3FB 4N90A 1J8HD 4ZMQA 2IFFH 5FY1A 3VG0L 4GRWE 3KPRD 4XWOD 1SVBA 3IFLH 3OCPA 1S5HA 5DN6G 2Z35B 4E9XA 2ZUQC 3VRJB 2HWB2 2BP6A 1COBA 3U0ZA 3V6OA 1ILUA 2FGWH 3NJXA 3P0VH 4J6RH 4JY4A 5D1QA 3CBKB 1G1OA 3ZX6A 1F2XK 4LGSB 4B7IA 4O9GA 4AH2A 3CVIH 2ZF9A 2HFEB 4QRFA 3VH8B 4BE5A 1G9MC 3K5MA 2AW2A 4WGVB 1W6NA 4WKXA 3ZYPA 1U5XA 2BIQA 2NTFB 3B9VA 4NAQA 1XXFC 3HKEA 1U8QA 3RA7H 4QXTB 4NZUL 2XKPA 4BM8A 1M56C 5A7BA 1HNZB 2NLRA 1X3DA 4QRPB 4YE4H 2Z5WA 3HIFA 4HLJA 3B7YA 4MD0A 4P2OD 1S46A 2RBLA 4DP2X 3DMMC 1E57A 4AI3A 4FFGA 5DFVC 3QRBA 1NCIA 1RZFL 1UB6B 4KTEH 3UC2A 1T89A 3K2KA 3KBEA 5DCCA 3VWKB 3KF3A 3QDJD 4L9LA 3VFMB 1UD6A 2DWDA 4OD3L 3MV8A 1P7BA 3SYAA 1NOLA 2XZAL 4X9GA 1OOPB 5FNVA 3B9IA 2ERFA 5L3CA 3GUFA 4W65A 4I18A 1A4AA 4MBOA 3MCYA 5FUZH 4G8GA 5E5MB 1BYOA 1NA1B 1GC1H 4UVAA 1RIUH 2E56A 1PNFA 2WKKA 4HAGA 3EYQC 5CO1A 2ODHA 2OV0A 1FUNA 4G70B 3WIHL 2BHUA 4HLEA 2D97A 4QX0A 1KF9B 5C6WH 4HCIA 1CFNA 3HAEB 5FYHA 1F5JA 4HS3B 5L7OC 3BA9A 1QJY3 5C07B 3Q8CA 3S88L 4L8BA 1R6TA 4PJCA 4QPEA 4YC2C 2ICWB 2P24B 4XZ4A 2BS9A 3FMGH 3ZMEA 2QQLH 2DCJA 4F7CA 4AYUA 1FO0L 4OLZL 5DA0B 3JQXA 5F3EA 3B1TA 1CDUA 2PTVA 3GO1H 4R4XA 3OKKA 3V7AG 2JMRA 1OHHG 2VT0A 3V7AE 4WW1A 5LNEA 2FO1A 5C6TH 4NM4H 4LE4A 3D9AH 1BHGA 4PRPA 4ODVH 1RVF1 4KHTH 4MJJA 1QABA 2A3WA 4TSAH 5A7NA 1OA3A 4OJDH 1SQQH 5B1KA 3RPBA 2EUVA 1QEXA 3FN0L 4HJSA 4K55A 2WTPA 2NZ9A 5AL0A 3ROOA 2A4CA 5T3XD 3OKMB 4J3OG 1RM1C 4PW4A 4ZQKB 4PB9L 3VI3E 3CKHA 7TAAA 2WLYA 2H6BA 5E9DA 4XBNA 1L0NH 4A6YB 2R0LL 2P5EB 3MV7A 4KTYA 2ESVD 3UC0H 4XC3H 1Z2KA 1Z5HA 4Y5YA 4UF0A 4OQ9A 1ZRCA 3P3PA 2J57A 3CU1A 1EEUA 4P9WA 2JQZA 3K72B 5CP7B 1JBCA 1DN0A 5I74B 4PJ0Z 1OF0A 3P0GB 2A3QA 1P5UA 4P2QA 4CKQA 5BO1H 5T33L 1AR1C 2HH9A 4MZUA 4CP9A 2FWOB 2W0LA 3QXTA 3FZUC 4QKXB 4G7VL 2DWRA 2K2SA 2CM5A 1VQMV 3LY6A 2FECL 2D98A 1KDJA 2C7UA 1K6QL 5DZLA 3Q5OA 5FK9A 4R7DB 5BR8B 5I82A 1BX2B 3FUFA 4HXAH 2CLZA 1UMIA 1NEUA 3ZMRA 4BKTC 3AT8A 1AKJA 3FQUB 4KTDL 3NIGE 1IKQA 5F1NB 2R27A 4GALA 5HHQA 4H0HB 4HGMA 3ZYHA 3IJ4A 5D7IE 4IHJA 2BOLA 3DHJA 4NQDE 3UERA 1FH5H 4DV5O 1H8SA 2X6AA 3QP3A 4ICXA 4LLYB 2B5UA 4LIQL 3U0WL 1TTUA 1J84A 1MS1A 2JDNA 2AZ0A 3APCA 5IWAB 2OIGA 2WLHA 1JAEA 2WPDG 2OW6A 3FZUD 4ZPVA 2OYQA 1POV0 3D30A 3I85A 5FA4A 2HJFA 3UG4A 2P06A 1Z7S3 3PURA 4BLJA 4F6RB 4JZOB 4FT8A 3TWCH 2ICCA 2V7NB 2HWD3 2VY0A 4HBCL 1UH3A 3IK2A 1U8PA 4GRMB 1P5UC 1WZLA 1QFOA 1XSOA 2ZE7A 4DV7O 1AD0A 2W81C 4ZOCA 3F7KA 3V6ZA 3QWNA 1R3IC 1MS0A 2VD7A 4WFEA 2O5NA 2DQFB 1JUFA 1K4DA 4KK9D 4KMLB 2WAOA 2J1SA 4WSJA 3OAYH 4L1SA 1E7UA 2QMKA 4EOWH 2CKBL 2H0PA 5FMBA 5FP9A 3SEEA 1NGYA 2VUJA 3ZFEC 4QX3A 5H35A 1B2WL 1YEIH 2QVMA 2YB7A 2VISB 4JQXA 4PDWC 2J5LC 3JARA 2WVVB 3KQ4B 5LEJA 5IFAH 1XH2A 2JCCA 4XHBA 5GALA 5D2NC 1SCRA 1W0PA 2ZINA 1C5CH 1PK6A 1K5SA 4ITCA 3LOWA 3QULB 4Y4KC 1H3VA 1E9PA 1UB5B 5C09A 2BC4B 3WELA 1DVFA 1KN4H 2YR3A 1H1IA 4WM7C 3VHOA 2VMFA 4NO2B 1SETA 5E4AA 4ZUVB 3ZE0B 5JMRA 5JMCA 1K2DB 3GWOA 2QTWB 4U7NA 1WT5C 4ZMAT 2CCVA 5C2UB 2WKOA 4D9RE 5IHWA 1JDDA 4RDQG 2ORBH 4N0CC 5F7DB 3A4AA 2BSTB 3BPCA 1YYML 2JE9A 2DQGL 3RZLA 3U4XA 1FNYA 1QLEL 1SM3L 2BNQD 5F7NC 3SMHA 5B1OA 5D93C 2CDOA 1CL7L 2NUPB 1DZTA 3IIAA 1VAHA 3NSFA 5IF0A 5GJSL 3VBOC 1ZRFA 1ZREA 2HJLA 1PAZA 3PWVB 1I3HA 1CK0H 2PYFA 5JUEL 3MIBA 4GBXD 3RX8A 5IQNA 1A1NB 2G5UA 4Q9BA 1EPFA 1S7WB 4PLNA 2XH6A 4UCOA 3FSZA 3QPKA 3EO1A 4MA3B 4UOJA 5KZCD 1NGPL 5IWAO 2HP8A 5KW9L 1PU0A 3RILA 1Q81W 4JZRA 4YJ2B 2DB8A 4P5TA 1J0HA 1JH5A 2XVLA 3K81A 1RZKC 2L8AA 4RGNB 5E9NA 2YIDA 3WYRA 1VP6A 4DXTA 4W6XB 4ET7A 3LNEA 2K6WA 5C3OA 5FUZL 3OD0A 2W65B 3E8VA 3HMYA 4R4FL 2H6CA 3TTYA 1XD1A 3FUEA 2W9EH 4NIIA 4UWDA 1U58B 1JJOA 3HZKB 3JUZA 2Y7QA 1YTFB 2VLLB 3MRIA 5LK7B 2VBPA 4ZMOA 3RYFB 4QRAA 4H20H 2W1QA 2DWYA 3FT2B 3HWJA 1MWAH 4NERA 4WFHE 4S1QH 5I8CA 5JHDB 1C9SA 4N22A 2EIBA 1ASOA 3ZYJA 3VB9A 4RR3B 4DPAX 4LC1A 5JIDA 2YC2A 4YVWA 4P59L 2Z92B 5JXED 2FGWL 4GKOA 2RG4A 2NUTB 4WAFA 3V4PH 1V6LA 3B2PA 2YKKA 4OGYH 2BTVC 3GNEA 4YZ4A 3AC0A 5IK4A 4R2GC 1LUWA 2LAGB 3Q1SL 4MCYA 5DO8A 5TGBB 5EEUA 3PUIA 3FU7B 5JR2A 4RGOL 5E2UH 4B41A 1YPZE 4W9GC 1XILA 5KAQG 5TH2B 3SD2A 4YIQA 5AB2A 4XC9A 3TM6A 1T5XB 4NNPH 3WU1A 1NCAL 4G71B 4BZ2H 2L4OA 4ZYKA 4YXKH 4KH9A 1H38A 1UA6H 1DLHA 1H3XA 2XTJB 3IPEA 1RMU3 2VH5L 3THDA 2JG9C 1YZBA 2K9FB 5DD3L 5EFIB 5C5TA 1UQSB 1A0QH 4EFBA 2YUVA 4WJ5B 5CR1A 3OTOO 4J23A 3UJOA 3BFWA 4WUUB 3RDTA 4CDWB 3KPQB 2QADB 3DPBB 4LPYA 3OGJA 1JTPA 2VDMB 1Y9MA 3DGGA 2FT8A 4IDJL 3WNJA 5KG9A 4WV1A 1FPN3 3AZVA 4PIYA 5DUWA 3LQAH 1DBMH 1H8VA 1SFNA 2N1KA 5FL7G 5DJAA 4J1UA 4NZRL 1HRI1 2MHFA 4AXWA 4D7BA 3G4SV 2R8SH 4QO1B 3B4SA 2KBGA 2NDGA 1HL8A 3K7UA 3VBHC 2VRKA 1MAMH 3SJVE 1XSIA 1JFQL 3WW4A 2YXYA 3MGAA 3GEFA 3H56A 4KRLB 3ZHNA 5I1DA 7FABL 2FNWA 1MXGA 3QORC 3BUIA 1LK3L 2ROXA 3BUPA 3EBIA 3FYIB 4JFZH 1M57C 2WWNA 3DRQA 4ORGA 4PB0H 4Y20A 3R4RA 3I2OA 5E9DE 2Q69A 2HT2C 2AK4D 3BAEL 5EK0A 2XV3A 3MLZH 2OMTB 4L9DA 3RWJA 1Y9QA 2WO3A 1OP3H 1T1YB 2AV7A 1CAUB 1Z5LB 1J3QA 1V8HA 3CVCA 4TUJB 4FPHA 3U6RB 3MX0A 3QFJD 1FFRA 5BUPA 3K2MC 3FKSG 2VXVL 5EC1B 5E6UB 1QTSA 2EDNA 3EG9B 2EC8A 4Z5RA 3USSA 3NACL 1QKQA 3FT0A 3AREA 5IYYA 2NYYD 2NY7H 3I75A 3LKOA 1ZWIA 4HUUA 5EUOB 5HI5C 3DKWA 4F8AA 4POYA 2VDRL 5JPNB 2UXDO 3TA3B 4HFUH 2X3AA 3J7NA 5B66Z 1EFXD 4R52A 3H9HB 2K4WA 3LA7A 1SGKA 1VRH1 3WIFA 1DGLA 1ES0B 2XN1A 5C0GA 1YLBB 3EH4B 3G5XB 4K8RD 1MZEA 2ZOEB 5AOLA 4LHUA 4LLUA 2MCAA 4DK0A 1KWGA 3MRQB 1F5WA 2CGYA 3OSKA 5IJKC 4G9SB 3ZMTA 1IVLA 1BMV1 2LVEA 3M4FA 4H1LB 5DI8A 4ORZC 1S1AA 3C7HA 2H45A 4UAHA 3WS6A 4HCRH 3D3QA 3S2CA 1VBE2 4ODWB 3PDOB 2WT1A 4NZUH 1VQNV 3DK2A 5LHIA 3FOLB 4BCXA 1KLGA 4U4IA 2PWHA 1J1XH 1INDH 1V7NH 1WFUA 3QQ3B 4MA1C 4NI6A 1YYLH 5D96C 2D43A 1UT2A 3I7DA 1J8HE 5LBBA 3VXSE 5F2SA 1KD7A 1VB2A 5DHVB 4FX5A 4KUCD 5J11B 3N3EA 2A73B 4TUKH 3L75H 2H2PD 3F7VA 3K48A 3HKZA 1KDKA 5ACLA 1YEEH 1GY1A 1AHKA 4WI7A 3V5DA 1KTCA 1AHWB 3JXSA 4CEWC 4TQPA 3T2NL 4BQ5A 2AF2A 2MPFA 1QFHA 5C0AD 1N7ML 4LQFH 2G75B 1SBSH 1G9BA 3VE0A 1DE4B 3P9LA 3RU8L 2ZGTA 1SUHA 1FPOA 3P54A 1CDHA 2Q6WB 1MIMH 5KTEL 1VIWB 2PELA 3D5OA 4U1MB 1DUZA 3EFOB 1BZ9B 1WIOA 2Y1VA 4WM8C 3IPBA 2Q8AH 4LRNL 2X1WL 5C08B 3O1TA 2DIBA 4M3HA 3QO0A 4KNSA 1NS1A 3KYNB 4UQ9A 4HMZA 2WBKA 4M1DH 3OGCA 1SEBA 4KX8A 4AG4H 3WEZA 4P57A 2IXJA 4IBYA 2WZ8A 1NXD1 4J3OD 4ISVB 3VXME 4KKQA 1UJ3B 2HFGL 2A75A 4NQDA 4GKKO 4WGWB 3UAEA 3VD3A 2Q7GA 1Y74B 3VNZA 5I8OL 4DKEH 1XGUB 3AKQA 2A71A 3BCWA 2OQJA 3GUTB 1D5BB 1QSZA 4FQ1H 1DLLA 4FFBA 4OZIE 3TZVC 2FO4B 4FKKA 4OVVA 1P2CB 2IPTL 3OR7A 1MFMA 3RVVD 1K4CB 2ZUXA 4NKMA 4LHQB 3WHXA 4AAXA 1ADQA 3FDWA 3NP3A 4E4ZA 2FIKB 4NHCH 3JAKA 4XP5H 4ZMZA 3MAQA 1ZA3A 1KEGL 1MFVA 4LQ1A 5K9JH 4FPYA 3G67A 5DYFA 1KXQA 4GPVA 1MQTB 3TRSB 1TJHL 1G0YR 1U2YA 4IMLB 3S5LA 2CAUA 4U1HB 1XGRA 4L3EE 3MOAL 1NDTA 1BPVA 3WJLC 1UZ8B 3IDNA 1CD9B 4U6YA 3NXSA 1BYPA 3G6BA 1ZY9A 3D34A 4YSUA 1HK6A 1MVQA 2J4WL 3BPLB 3IRPX 5D5MA 4QYAA 3T3MF 4E9VA 1IEHA 5TE7H 2DEYX 5CEZD 3QQDB 4LCCB 4AEDA 1NGZB 2AR6A 4GQQA 4X64B 2I9TA 1OCCC 4NRZB 2NY4B 3TONA 5HDQL 2BY0A 3VDCA 3VBSA 1AVAA 2XZCL 5BVPH 1GAXA 2ET7A 4LSVL 4R4NC 5ESQA 4EKJA 3PTRB 1WA1X 3MGTB 1IL1A 1O4ZA 4QYOA 4MTOA 1LP9E 3QBTB 3ZDYB 4P2AA 3ZYZA 1T0MB 2NPLX 3B1UA 3P69A 3QCUL 4M8QB 5FZIA 3RDIA 3E3QC 5EZOH 2AAAA 3MTXA 4IBZA 1BXAA 2WBXA 4PJDA 2K45A 3C60A 4Y9BA 3OJBA 4QXCA 3UPRB 1IAIH 1FMD1 1GAFH 4LE3A 4JFZL 5EDXA 3KDMA 2BMKA 5HI5D 3QCVL 3ETTA 1AH1A 5FZHA 3UROR 4WTZG 1GMEA 1HCFX 3F85A 3RIAK 3VXRD 4LQRA 4XXPA 5IYCO 3TZVB 3NMBA 2B3IA 5F1RA 4N0FB 2ZUUA 4CDXB 4QRRE 1PM9A 5AW4B 1I3GL 4W9DC 2B5HA 3NIDE 3ECQA 4M8RA 5H37A 2P3KA 3HEIA 2D6OX 1GZWA 3I9GL 1WLWA 4OV6F 4YM2A 2D40A 3LYRA 4E4HA 3RAJL 4BZYA 2R29A 3QUMB 3L3KB 5J12B 1S7VB 4Q4W2 1KXQE 1CLOL 2VN6A 4FE9A 4NIAA 4CDUB 4FNSA 5I73B 2C9PA 5EBLA 4E9KA 4W8JA 5DD1H 2AITA 1AR2A 2AQ3A 4HONA 1CZTA 3E6HB 1Y4WA 2E74C 3FTGB 3QF7A 2VC2H 3FUMA 1XNAA 2E32A 4MA8H 5GGSB 2HWB1 4OCNC 1UXXX 4NI3A 1N70A 5EBGA 8PAZA 4N53B 1FCCA 4XDPA 2ZUYA 1DQML 4CBZA 3A22A 1WFNA 1YJDC 3BGMA 1VP7A 2UXVA 3C8KA 2YG0A 2ZX1A 4RX4A 4JDZA 1DBKL 2VM3A 3LTVA 3PVEA 4Z1MG 1NZIA 4QNHB 2V8LA 1RUC1 1RURL 3N2JA 4FQXB 4O4IB 3SDYH 4FZ8L 1X59A 3GBMH 4CA4A 5CMAA 4NBZB 4Z7VE 3CN0A 3N1GC 2CO2A 4JGNA 1KCKA 3LIHA 3BDYL 1VZHA 4IE6A 4R4ND 5TPWH 1F41A 4KAQH 3WFHA 2V3FA 2VWEE 5SWSB 2YV8A 4OD1L 1P7GA 2ZIDA 1SUJA 4OBRA 3EFFB 5EEZA 3FF8A 4XN5A 5KWYC 4X98A 3VFTA 5K59E 1W0OA 2JIJA 3QK0A 1RHHB 4IE7A 4GOSA 1YEDA 1OV9A 4OFVA 4E8CA 2VR4A 1QFWL 5D7JD 3KJ6L 4EN3D 2LUWA 2EKJA 3CFEB 2XBDA 2X1QA 5BV7B 1OAXH 2CDEA 4U1NB 2D3PA 4PV1C 3WSQL 4EN7B 4MJ6A 4DN4L 1FIGH 3ES4A 4YRDA 4WNJA 4EJ1C 4OYUA 1YHPA 4V1DE 4CDUC 4OCLC 2VDPL 2UZYB 2XXGA 1A78A 1MREH 3AU1B 3M8OH 4PAZA 5HD8C 5DJ6A 3ZYIA 5IT2L 1M42A 1GTFA 3VXSA 1BCXA 2ZX3A 1MF2H 1V70A 1KZQA 2JXAA 1ZXKA 4Y7MA 1I8KA 4G82A 3ZDYF 2KXLA 3POSA 4IEOA 5ACMA 2A4ZA 4O2AA 1BLZA 3WG7C 3ABUA 3OMNB 1SMOA 4J80A 5LG6A 3SKMB 5T5FA 3H1JH 2X4TB 3CAFA 3V0AC 1R19A 4MDIA 2ZGQA 5IHUH 1NC2A 1SLAA 4FP3A 1V3KA 1LJ7A 1QOTA 5C7ZA 4D2NA 1LWJA 1PIFA 4I55B 3B2UD 5TE6L 3VSUA 2CBTA 1N8ZA 1UXWA 4F8QA 3QUMH 4QKFA 4JREB 3ZXEA 1GIGL 1PNDA 2ZUWA 3MBED 1PKQB 3ZPDA 5L8LB 5A3PA 2UUCO 2HX8A 1FZMA 1RUD3 2V7HA 5IROD 4NN5B 4QB1A 32C2B 1TPXB 2CMRH 2V17L 3K51A 3IDBB 4FLQA 1VRH3 4P06A 1YVWA 4GFTB 4UOW0 1PVC3 3I2HA 1WWBX 1YJDL 5CXPA 3NIFB 3RNSA 1QW8A 4I2OA 2Y9RT 1E2WA 4JFHE 1M3JA 5FFOA 4N8VG 2VDNB 4N8CL 1BMZA 4ZAKD 1IARB 1JP5A 4DRRA 2RS33 2P5WB 3UK9A 2YXLA 3EJJX 4HMCA 4DEPC 2C1OA 1HQWA 1SQ2N 3CK0L 1YJNV 1S9YB 3U48A 2R042 2UY9A 4FCAA 1J8RA 4KXCA 4Y9CA 2NW2B 5AC91 4IEYA 1G9EA 4WSGA 2BZ7A 2HVKC 2W52A 2Q7YB 1QSFB 3FS9A 3WTUA 4P9XA 2R0WL 1MRDH 2I60H 3LRMA 4FL4C 4Q6KA 4RFNC 4XP6H 3WKML 1E5RA 3KB5A 1F6AB 1TTFA 2YLKA 3STZB 4BKSC 1DYZA 3GB7C 2WSVA 2WIMA 3BUTA 3EJPA 2WNOA 3HVNA 4KI5E 2GJ6E 4AH2B 4A04A 3BODA 3IWZA 1NGXB 2YPKA 3TBTB 2JJSC 5H4YA 3EZJB 1OH4A 1PZCA 5A1LA 2YPVH 3E35A 1L7IH 1CZ8H 2C5DC 2FNBA 4GULA 1XR9A 4PJFA 1NANI 3HA0A 3IJSA 5F93C 5JQGA 2OQ6A 3LNNA 2G5RA 1TTBA 2FQPA 1HP8A 2Q0AA 3MLTA 1HRV1 4I9QA 3GSNL 2WO1A 3QNYB 4GX5A 3A0OA 2X9XA 4QRPA 3S4SG 4TZDA 1FH2A 1USZA 4BA8A 3ACHA 2R1BA 4KFZC 4PWFA 5IOPA 3DUHA 5B22A 4LMFA 4X1KA 1AZRA 2B4CH 1UZ6E 4ZO6A 2NR5A 5JWPA 4HIJA 4TUUA 3IU4H 4PDLA 2EDXA 2IVFC 2W9EL 3U36B 4ZX4A 2NY0C 3SH5A 4U1SA 3ZRVA 3H3BC 2H0EA 3A23A 3OLEA 4DOHB 1O91A 1OOPA 4PJEE 2UZPA 4PUBH 2E63A 4PT6A 1FG2A 3A24A 3EVKA 2WRAA 4HWEH 3E8GA 3FQYA 1IZKA 3I9GH 4GAJL 2R9HD 3AROA 2A6DA 4U1IA 2WXQA 2X87A 2DI9A 3QIBA 5DJDB 5EWIH 1DQ6A 2WINB 1C16A 3RVHA 5GGRB 4JN2A 4XP4L 3A2FA 3T4ZA 1QSFE 2R0ZH 4XMVA 1N47A 1JF6A 2VLJA 3QFJB 1IGCH 3NCXA 1PYWA 2GIYA 3QIUD 4JFEE 4HS3A 2GAZB 5F72S 3UYJA 5BRZE 4AR2A 5GZND 2WWUA 3AMKA 4C83A 1F35A 2MSPA 1SXNA 5DEGA 3N35A 4LK7A 2VNOA 3VVVA 4LHKA 1PG7W 3EJYD 3QWRD 4KKBC 1NA8A 4F7CB 2FLMA 3POYA 5IUQA 1JZJA 2CR6A 5JNYA 4WWKC 3H1HH 4YW5A 3APBA 1CL7H 5AVYB 4ODHL 1OZ0A 1TIUA 3NIFE 3OKKB 1FNSL 1ZT1A 5ISLA 5IDJA 1EV12 3NAPB 3VDBA 5CIPH 1D6VL 4DEQA 4GAGH 4JPRA 2IOMA 5J96B 4H0GA 4HDIB 3VWKC 5IEKB 4K8RL 3SIKA 1CQ9A 1OUXA 2DS4A 3CUPB 3BA8A 2AQ2A 2AW9A 4L1HA 3T1FA 5ITFA 3V5KB 2W87A 5CEHA 5IJDC 3HG1D 2DYPD 3KLAA 3NKGA 2VSDA 2G2PA 2H8PB 1L6XA 1E3FA 3C5ZB 3O8XC 3K2IA 3V6FB 1IG3A 3LCPA 3VI4B 4N23A 5FO8B 3AG1B 2BBAA 3NZUA 4C8XA 3FNKA 5BUGA 5JXHA 3VVWA 3J7AU 4UCVA 2J4WH 4YHNB 4Q4W3 4BJ0A 1HJCA 2F58L 1EZVH 4EDXB 3QSKB 5LGHH 3I84A 1CICD 2DTMH 2EYRA 4Y5VC 5FP4A 3FQRB 4HSCX 4CSZA 2ZX0A 3CCRV 2A9MH 2AEPL 3DYOA 2Q5TA 3O2VH 4FS0A 4FNTA 4FP8H 3MBXL 5K9KB 3MLZL 5IFJA 5CA6A 4G6JL 1HFUA 2EBOA 5DC9B 4NJAH 1V0AA 4AUUA 4CBCA 3US0A 2C7UB 2JK5B 4PGJA 1NFDA 4PRPD 4PJCE 4Z3HA 4I50A 3VGFA 5FPXA 4JHAH 2BNRB 1N36O 2CLZB 2EJRA 1TQWA 2HA1A 1IC5L 4JFEB 3ZKQD 3MLXH 3FQUA 4M3KB 4X5WA 1K5MB 1V6JA 4Q6GA 2BSBA 1CGSL 2RR13 3Q2NA 3HNSH 4H26B 4I3GA 2HR3A 3RT3C 1F4YL 4MQXC 1I0HA 3P73A 5J5EA 1W6OA 3HI5L 4BFIB 1X5LA 1UYWL 2B42B 1P1ZA 4AFMA 1IX2A 3EFDH 3BQUB 3REWA 2CHHA 2HT2D 5AC93 4LSPH 5EO1A 2YUAA 2LV4A 4P5MA 5CGYC 1DJHA 5BY1A 4PJEB 4X9HA 5HI3C 4OCWH 4N0UA 4RRPG 2H1PH 2ITDC 4GCZA 2OP4L 4XNXL 3AZUA 3QORD 4YVUA 2AJXL 3NTCH 4NN7C 4O2EB 4TVUA 3UTSD 5B39A 1GWMA 1QFWM 3CQOA 1W8HA 3PPSA 5C6CA 5E8OB 4JY6B 1M56B 1I1CA 2V7NA 5IFHL 3I9IA 3DGCR 4HKOA 1HOCA 2ALWA 2HWC3 3BLPX 5KBMA 1I94O 2OI9B 2EJ1A 4AEHL 4NRYA 2QVFB 1CONA 4YSTA 4NZRH 2BOCA 4PGDA 2K4AA 1IC7L 2QPEB 2VQTA 1TR7A 3L9JT 2NNAB 1UD3A 1BLNB 5HHXL 4OLXL 1H6FA 1KGCE 3BOWA 4UI2A 4ZX5A 4Q0VA 4Y9FA 2XJUA 4NKDB 3AXDA 4I13B 3UP1A 1AY1L 5BVJA 3P4OB 1N6QH 1JOJA 1QJY1 1U8KA 1UZYA 3W82A 4LF4O 1QO3A 4ERSH 3X1EA 1RHI2 1Q6IA 1SFDA 1W15A 3RY5A 3BLKA 2BC4A 2Y6GA 4XWGL 4ETQA 4ESKA 4UM9A 4YARA 4G1EA 2CDYA 4CE8A 2G3MA 1WW4A 4X8GA 3HZVA 4XFHA 3RJQB 5HI0A 2J2ZA 4PJDF 1NCWH 1AOZA 2X6UA 3BPNC 4LJHA 4XC1L 4BQ8A 2MKWA 4ZTPH 1DGRA 1A6UH 2GTQA 1FYTE 2XLAA 5AG9A 4WTZA 5KMGB 2VUAA 3UGHA 4AI0A 3JT2A 3P77B 4J3TA 5BXFA 1E28A 1N3OA 1XF4B 2Y5TB 2Y0OA 4LKDA 2NXYC 4DY3A 5BNPB 2PO6B 3UTZB 2JWPA 1Y67A 2DYCA 3DGDA 1ZTXL 3DKQA 1KC8W 5AB1A 4NOTA 1XTMA 1NU1H 1BIIA 4M8UA 3WP6A 1UEMA 1Z3RA 2HTLD 4N0UE 5JSOA 2NSMA 2J8UE 5E8EA 2YRLA 5DD0L 4V1PA 4ZUSA 4QHZA 1A1NA 3WFEL 5GTIZ 4LF7O 4PP2B 5K9OB 4WFGE 5BZXA 4ANUA 1FT9A 5SV3A 2WY3B 3OKEA 4XO5A 5T54A 2DW5A 2GYSA 3GZKA 5AYUH 3HE6B 3REVA 4CS2A 2A6IB 4OJYA 3QS3A 4JJOA 3THOA 1IM9B 2QVIA 5EJZB 4XN2A 1QI3A 2JDPA 4ODUB 4LO8A 4LOVA 5JHMA 2HLAB 4OJEH 3AS2A 3UZVB 3CCMV 1UATA 4ZFFB 1LHOA 3PP4L 3QXAB 1PL4A 1AROP 1L9QA 2WOBA 4GIOA 4Q4EA 4NQCB 1IGIH 1CVNA 1TXKA 4JFFB 3LXAA 1UD1A 2VXSL 3LZFL 1O3SA 4UDUA 4DVBA 3UAJC 1JHKL 1JPTH 1CD1A 2Y7QB 3W5MA 1DQ5A 1PZSA 3PXJA 1EEQA 3QUZA 3K6IA 4CC4C 4AJWA 1JCVA 4KC3B 3MRNA 3OGOE 1XNTA 5KJRL 5BXFB 4Y5XA 1D7PM 2Z92A 2X7LA 1VENA 3Q5YA 4JG5A 4O5LL 5B4XA 1D5MB 1BBJA 3GRBA 3WG3A 1KTDB 2IFRA 4ZMWA 2EVFA 2M6YA 2IMNA 3WNKA 4QJFB 4C57C 1FAIL 1VBE3 5JI9A 4Y2OA 3CB2A 1MHPL 1NM9A 1XF3B 2LLLA 4K8RH 4MNHA 2PUQT 3RZWA 4E5XA 1T5XA 2R061 4BQWA 3KHCA 3DN7A 2F4VO 2B20A 1Q43A 5LL6Y 1A7OH 1BZ7B 4YGAB 4MHRA 1DLHB 4OUUA 2NZ9D 2COQA 1I85C 2UXNA 2WWKO 4MXWL 2Z4FA 4OUEA 4M1GL 1BZEA 4N68A 5E99L 4N4YB 3VA6A 3QPQC 1BQKA 3KPQA 3U11A 2XDVA 3WQ1A 1AD9A 1F3JA 2K6YA 3EQEA 2RM23 4ZO8A 2B4CL 5BRZA 1HXS2 1CS6A 1KC5L 2AEYA 3IE4A 3DXAE 3NVCA 4FFHA 3KH3A 2X53A 4NKOA 5JQIB 1RUJ1 1MFDH 1OP9A 4YHHO 4NXKA 2H2SD 5GZOC 1GZHC 1JI6A 1MCSA 3LS4L