4PHZA

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
388
structure length
388
Chain Sequence
b'HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 94
structure length 388
sequence length 388
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4phzA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4phzA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4phzA01
4PHZA 4PI0A 1YEWA 3RFRA 3RGBA 3CHXA 4PI2A 4O65A
chains in the Genus database with same CATH superfamily
2HHHB 4XQWA 3LDBB 3RIFF 3PF2A 3E5QA 4RS5A 1W0VA 1OLRA 3RGVD 2LTNA 3R0MA 4LOFA 5F9AC 3NGBC 3H1IH 2YZ4A 1FMD3 4IRJB 1XCTA 1A7RL 2BZ7A 3UTSD 1G7LA 4S1QH 5IEHA 4MSWA 1NZ6A 3G5YB 2QNKA 4RBPK 3HN1A 1YQ2A 5DS2A 2D6NA 1A6UL 1HNXO 2PCXA 1J88A 4FJ6A 4JTOA 3SJVA 3IN9A 1AXZA 2F19L 2HWF1 4U3SA 1BBT1 2BY3A 4PH8A 4QX7A 1JGUL 4IGOA 5DYOB 4L23A 4OIIH 1NFDE 4J1UB 4TUOA 3DGTA 5EHDA 5FGCB 4X1IA 2AXFB 2GBTA 4FP8H 4L8CA 2A6VA 1BM3H 4IS6B 1IC1A 3AJ7A 2ZX6A 4D94A 1SPPA 1SDAB 4G72B 2CLVA 4RQPB 2WM0A 4I2XB 4ALAC 4MADA 3BKCL 5CP3H 1I82A 1MCFA 5CBAB 1URXA 1JMXA 3WN5C 1UY3A 3I85A 3CQPA 1PIV3 3MREA 3M88A 2XN9E 1COBA 1QI4A 4LSVL 3D0SA 1YJNV 4P8QA 3IFXA 3W38A 4CDQC 2BOIA 2WQZC 2VR7A 1QRNB 1UD4A 4XN5A 4YAQA 3K3NA 4Y4RA 3RHWF 2BOLA 5KVGL 3NIGF 3F5WC 4IQPA 2YXLA 3GXNA 4J28A 3CVIH 5C0BD 4D2NA 1BXHA 1G9NH 4SBVA 5E1AB 1JFHA 3K2UL 4FF9A 2YAEA 4JHAH 3KF5A 4YQXH 3GMOA 4Q4Y2 3U46A 3ZSJA 2CMRH 2DIAA 4W6YB 1OGTA 1IS4A 2RFXB 3BGFB 4AGQA 4Y5YB 1EERB 5CXPA 1KCLA 3VJ6A 3VGFA 2FTKA 4IU3A 1UOVA 4CSSA 3C2SA 1AX2A 1J1PH 3QEQE 2QBWA 4K8RL 4YXHL 4E9SA 1ZT1A 3HRZA 4CCNA 2W65A 1Q43A 1D7CA 5K9QG 3IPVA 1KB3A 3HBPA 3LA7A 5J3UA 4YDVB 2Q8VA 4JFQB 2O6PA 5M95B 4KQ7A 4BZ2L 1OGAE 5D96C 3BFWA 3LPPA 4I5BA 4XOBA 5C0AB 3VFNA 3IWZA 4LA3A 4MNHB 4PJ7A 4AHXA 1R3IC 3HZMA 2X1QA 2EVJA 2C5DA 3HUJE 3SODB 2QDRA 3PL6A 1KUMA 2YAOA 5KX5A 3AMMA 1N59B 5L8JB 1MMMA 1CTMA 2FWLB 1CP9A 3SD5A 1COV3 3Q3GB 1XBDA 4FZ0A 4FFTA 5DHDA 3VD7A 5HBBA 3UAJA 1BVVA 4WVWA 3SE8H 4JZJC 2BVQA 4E8DA 1O3RA 3CQQA 2C8NA 1AQHA 4JPKL 3DN7A 3WHE0 4KU7A 1Q94B 4NRYA 4GQ7A 3FB7A 3UYRL 5DUML 3GIZL 2ZF8A 4WM8C 3VI4A 1LHWA 2GUZB 1CESA 4IIQC 4JDVA 3OD3A 1V05A 3VSVA 4PQQA 2AQTA 2B2XH 1DVUA 3FOMA 2Q73A 1QWHA 3T4AC 2QQMA 3CCUV 1HESA 5AVPA 4LF9O 3QFJB 2PYFA 3V8CA 1EO5A 3QUYD 5JQHC 3IJYB 4P2OC 4X8JA 4XCCL 4L4JA 5C6TL 1AD9A 5ISZE 1TTRA 1CT8B 1JGVL 1GAFL 3EH4B 4YHZL 1IS6A 2VQEO 4E4SA 4OCWL 3FUMA 4RZCB 5C9AB 4YEFA 5DT1L 4Y1AA 4XNYL 1Z9MA 1GGTA 2PTVA 3KWTA 1MWAB 4OZGF 3CNAA 5EEWA 4A2HA 1YFUA 1NCAH 3RVXC 1KDKA 3GPSA 3OVUB 4UU9A 5JLZB 5FY9A 5LY2A 1NBYB 3WN6A 2VQ1A 5FZ1A 4I0BA 4Y4FB 4TSCH 1IC0A 3CFBB 4MMYB 4CSZA 2BHFA 2IAAC 1MHEB 1APNA 1LJMA 3VWKC 5IESH 5AKRA 1KG0A 2WQ8A 1RMFH 1CZ8L 3D06A 3F00A 1UX7A 4LSQH 2VZQA 5B38B 4HSCX 3CN4A 4MGTA 1EZUA 3QIUC 4DGIL 2WS93 1UZGA 3LB6D 1R3KC 4GQPH 3AMQA 3U25A 4F33A 4NCC2 2HWZL 3VNYA 3QWOA 3L4ZA 1FPTL 5DTFA 1DJIA 3VGEA 2YIDA 1HB1A 4PTUB 4Y8DC 3QACA 4LKSA 2XNAA 2E3CA 4Z7VF 4Z76A 1DQ0A 4JHWH 5D7JC 2ZQKA 2XV0A 4H44C 5IFJA 5FZBA 3HT1A 3I2OA 1T1WA 4U1MA 1XNQO 1YEGL 2OPWA 3RVWD 3IXTA 3I3QA 5IMMA 3F58H 2VL5A 2OV0A 5CA6A 4QJ4B 1Y4WA 3ZDZF 4FHKA 3H3PL 3UBXG 2DLFL 4PJ5A 2D5HA 3D69B 3AWEA 2JDUA 2QCSB 5I9QB 4WFFE 4TT3G 2X7LB 1QJY3 1YPZF 4P5YA 3RI8A 4APQA 4AVAA 2BCCH 3VBHA 4NJ4A 1DQQA 1C5CL 5JXHA 1A5FL 4UTAH 2QQPA 3T2OA 4ODVH 4N90A 1GH7A 1Q38A 4GKJO 1DQJA 2OCJA 4P2OD 1X4TA 1FJGO 2E8YA 3S2CA 4D3CH 5ABZA 2RMKB 1LO3H 5ITFA 2UU8A 4BLJA 2WNVA 1MW2A 3KS0H 1EGJH 4XR8C 5GGSY 5KANG 3VB8A 4AUYA 4DN4L 1HDKA 4I88A 4QGNA 3IM0A 4UI2A 5JXAL 1I7ZB 3MTXA 4C47A 1WHPA 2Y38A 4N8VG 1JN6B 1JHKL 3DOSB 5T1LA 4YGVA 3KPLA 4P9IA 2YIAA 2WTPA 1IC5H 4N5ED 3WIFB 2Z1KA 1MA1A 5L0QC 1ND0B 4G7VL 1E9OA 5EZJB 4NBYB 5LMNB 1BD2D 5EWIL 1VKXA 1JE6A 3MYXA 4I48A 5A2AA 3V4LA 2ZX4A 4C1WA 1A6AA 5C0DB 1FWXA 1QSEE 3ABKB 4DO2A 3NMEA 4GQ9L 4Y2NA 2B8MA 5FUPA 3K58A 2Y0PA 2Z3YA 1L3NA 4AQ1C 1VFBA 3QIUD 1BGXL 1IM3B 3ZTNL 1T5WB 4MNGA 1AJQA 1PL0A 4MSVA 3ABUA 3GSRB 1XCQB 1I3VA 3G6JA 4K23L 1E8XA 2HX8A 5DZEA 4Z77A 1KTLB 4J6RH 4BKLB 5C8CC 5I76A 1YEIL 1ADQL 2GCYA 1EHLL 4ZTEA 3IFPA 4M02A 3BOVA 1WLCA 5GXBB 4X6RB 4AG4A 2JK5B 3WEXA 3RZCC 1YVLA 2UXDO 4PJ8C 4G5AA 3ZPDA 1JW6A 3M46A 5CBGA 1RUH3 4WM7C 5FUZL 2X4RB 4UT9H 4LFAB 4KMQA 1FMD2 2WAMA 1QU7A 4C4KO 1OLLA 3LKJA 4JKPH 1CX4A 1W2KT 1Y7VA 5F6IB 1FNYA 2DJ4A 5JPNC 5KG9A 4K3JH 1YRZA 5DABA 2G3XA 3WIAA 1POV0 3SYCA 4N0UA 1H3VA 5LDUA 5AVQB 1BZ7B 1RURH 3LS5H 3QWRD 3RPKA 4DEVA 1CC3A 2EDBA 3CFQA 4W6WB 5I1AB 4EB6A 4B5ZA 5JIPA 3MRNA 2K7PA 4YL4A 1GWMA 2HJKB 3AZYA 5KOMC 1AJKA 4GP8B 3BZEA 3U4EA 3EFOA 3ASNC 3AU1A 2B1AL 4LHSA 1GYUA 3OHXA 1EXGA 4RWYL 4PELA 1P1ZA 1T89A 3D4ZA 4HX1A 1TENA 4OZ4A 3WFCH 3JARB 4CU6A 2A4ZA 1YRKA 1DLHA 2B15A 4LF7B 1KCSL 3MBWA 5E1HB 4XBGB 1JNJA 3D08A 4NR1A 1HXMB 1RSYA 4LF8O 4UMGA 4Z3IA 5FGSA 3V0BA 1X5ZA 3ZMZA 4LXLA 3OGCB 1RUKL 3P3NA 2NCMA 3Q9QA 3SKUD 5DN2A 3MV7B 1VQLV 2BRQA 4LEEA 2VT0A 4PQXA 1PQZB 3BN3B 3G5YA 3MRIA 3VBOB 3NSDA 1VF5C 2VS0A 2CXKA 3RTQA 2C3GA 4OI8A 4RUEA 3EO1B 1NBCA 3ECUA 1HKLH 3POFA 4ODTH 5CLYA 2E47A 4HT1L 4KOCA 1FS0G 1S3RA 5DYOA 4YMPA 1WFMA 1DBML 2NLRA 4I3SL 5T8IA 1W8ZA 3OKEA 4WDIB 3WLWC 1KENL 4LPTA 5IYYA 4M9OA 4X8CA 4EKWA 5D7EA 1AO7E 3B5GA 1OAYL 1C8NA 4NUBA 3T3PF 1C5DB 2CXGA 4PGEB 3BA8A 2ATKB 1NGXB 5AAMA 2JG9A 3LQAL 5JOXA 1QNIA 1TPXC 1HKDA 5DZLA 5F5CA 1RP8A 4I2XA 5C08B 3OPZH 5DO2C 3RZCD 3C7FA 2OTWB 1PZ9A 5CBAA 4W9HC 4CCEA 5FLHA 2X38A 5CBHA 4CDWC 1P4LA 3H56A 5K33A 3ZVVA 3KEDA 3VQ1C 3Q9OA 1EA9C 3QDMB 3UQ8A 1R093 1QRNA 5LBCA 1OZUA 3MPCA 4Z7WF 3CZJA 2QVMA 5F0PB 2J20A 3NP4A 1ZVNA 4OLVL 3TT3H 2LROA 4DRXB 1QJX1 5CFCC 4GIQA 1A7RH 4M7JL 4ACTA 2DWYA 4DGWC 3TWYA 1VZHA 5IHBA 1ODNA 4OZHB 3U9WA 2ZWKA 3FRPB 3QPQC 2BWIA 3MLXH 1COV2 3ARBA 2F19H 4TOYH 4L3EA 3VBSA 1I1RA 3JQOB 1NCGA 1T66C 2VR9A 3HN8A 5IROA 1XMQB 2XWRA 4W6YA 3IF1B 4Y5YA 3WYRA 5C8YB 2IWGA 3L6FB 3LSOB 4C4BA 5JORB 1OFNA 1Z78A 4MAUH 4AAPA 5K69A 1LAJA 5L9RA 5E94B 1US6A 3MIBA 1AJNA 4KKCD 5E88A 3QJZA 5IW6A 3NFPB 2EXIA 4KHPB 1KN2H 2D2OA 1QTSA 5CZKA 4JFQA 2ZKHL 5D7KD 1UFIA 5EU6D 3RY6A 43CAB 4DJMA 2D40A 4AI0A 2A3XA 2UUCO 2B4CL 3I6KA 5C0AA 2AHYA 4UMSA 3WEAA 5EO1B 1IMHC 3LEVL 2EEFA 3CC1A 4NZRH 1R081 2WAHA 4NFDA 1GTOA 5BUGA 4HBCL 3FQYA 4ZFQA 3SSGA 3Q3GA 4HSJA 5HBAA 3V4VL 5KVGH 3LRSA 4KGGA 4ARYA 1I8IB 2VCBA 2NLJC 3WLWD 2NX5E 1OP3H 1XGPB 3BABA 1FIGL 2VLLA 5KSUA 4ZIBA 5DD3H 4Z0BL 5FYLD 3VXNB 2HR3A 3K2UH 5IDJA 3L1OL 4AQAA 4GB31 2AK4D 4M3CF 5TE6H 5FYYA 4BQWA 5DZOA 3LKRB 3W9EB 2GUZA 5L7OB 2ZUTA 2P4KA 1BOGA 4DPBX 2HUHA 4RMQA 5KVGE 3PUCA 3HZ3A 5D7LE 1KIUA 12E8H 3ETDA 4QCIB 3LAGA 3QR2A 4YLCA 2LRPA 1BZQK 2QM7A 1AKPA 5KYUB 1BP3B 1WQVT 3IJYA 5SV3A 2WS92 4HS3A 1IRAY 3RB5A 1BVP1 1CT8A 3PQYD 1I9RL 2VN4A 1VQOV 2X12A 4K8RH 3CLPA 4UNVA 3FFZA 4BWWA 4RZCA 3HKBB 1MIEL 1WBLA 5C9AA 2WW8A 4GT0A 2VNVA 5E8EB 1R5WB 2HMID 2XHKA 1TYEB 3FC0A 3FKSG 3VYPA 1URZA 1MWAA 4H8VA 1I8UA 1KWKA 5I1JL 4PGCB 3QPQD 3UX9B 2FBJH 1AIFB 2EC9U 3FTGB 4W93A 1T66D 4R4FL 1HRV1 4KROB 1EDHA 4NQDD 2XA3A 3BRFA 4IV1A 3T3ME 2NYKA 3VXMB 4XBPA 4DESA 1BG1A 4FQ4A 2ZCWA 4LSUL 3N42B 1OM3L 1GZCA 3NNLA 2WZAA 1HNYA 2YN3A 1F1DA 3UYRH 1GXEA 1AJPA 3GIZH 1QJY2 4N20A 1W2TA 1EV2E 2QFEA 2VC2L 4YSCA 1JZ7A 1AAJA 4IETA 4BCUA 1TCMA 2YOAA 4XP5L 4ZOLB 5C7XH 5LMUB 2VKWA 3IFNL 4JKMA 1OH3A 2IZWA 4X98A 2YBPA 1NFDB 5HDLA 5C6TH 1W2UA 1O5UA 3CIHA 4LF4O 1JGVH 3EJZC 1KUQA 3NA9L 4OHVA 2YSSB 4JM2F 2QR4A 2QWNB 1P84J 3G6DH 4OCWH 4CCCA 3K72B 4BGDA 1SLBA 2O6CA 4PLNA 2F7OA 4EN3C 5C9JA 5I0RA 1GKFA 3ZPOA 3LZNA 5FZIA 5CKGA 1HXYB 4M7LL 4EVNB 1B9ZA 4TRPL 3GBNL 4XPTL 2EXJA 4D6SA 4HFSA 2Y6JA 2X7LA 2CPUA 3DJTA 1MJ7L 3LKNB 4B9CA 2XXGA 4BJLA 2OFQA 1SQGA 1TFPA 2CGRH 4XMUA 2WXLA 4FXLA 3RPBA 4LHUB 3WJLC 5MEQB 3ZYJB 3MGAA 3AQXA 5FLIA 3FCSA 1OOAA 2J5WA 1FAKT 2FR4B 4QPWA 3GDCA 4QHMB 1GMEA 1GSKA 2QQVA 1FF5A 3NPSC 4LDOB 1ND3C 1QX1A 4LGRB 3INAA 3J81N 4B3MO 3DX1A 2D0FA 2HWZH 4R90L 4XC3L 5BJTB 1WBZB 4XMLL 1JN6A 5HD8D 2DYCA 2RS31 3BCFA 1MDAA 4OCRL 1WVZA 1A7QL 3UADA 2VDQH 4ERSL 3PMEA 1JGDA 4PUBL 2F9BT 3MLJA 5I5JA 5L2JB 1JJ2U 5EZJA 5JR2A 1USZA 1I6XA 1VLNA 1ZTXL 3B9AA 4LOTA 4PLJD 3GEFA 2ITCA 2B3RA 3QEQB 4XXDA 5C0DA 3VXOB 1I8MB 1MH5B 4NKOA 1P53A 4GG6E 4K5PA 2HKFH 4XFFA 4CCLA 4RUFA 2BNOA 3K06A 3H3PH 2P80A 1OVSA 3IVKB 1FNGB 2FQDA 5DZVA 1KGYE 1UXWB 1GZWA 1IM3A 1OGAB 1T5WA 1Y74A 4NQCD 3UPCA 3J4UH 4I09A 4JPWH 3KPSD 3T8VA 3C3VA 1XIWD 3AS1A 3KD4A 3HI1B 3CDCA 4LSRL 1TGOA 3BGMB 3R05A 1DJSA 2NY7H 1PKOA 2ARWA 3FFCD 1C5CH 2YUXA 1CN4A 1KTLA 4BKLA 3B4NA 3GIVA 4TUYA 1ASJ1 1T0OA 4BEIA 2VE1A 1K92A 5JHDE 2Y06L 1HIML 1RK0B 2JK5A 4N7UA 4UUJB 1AJ7L 5JXAH 2P22C 2CO7B 1DANT 1GIGL 3B2XA 3WE6B 4BH7A 1R1ZA 4EN3D 2FMDA 2X4RA 3DX8B 1U3ZA 5IT2L 4YVWC 5H9RA 2ZGRA 1UO9A 1A9EB 2HYKA 5I74C 4BFFA 5D6CA 2PCPB 3LPFA 3AYDA 3WXWH 1GRJA 4DIXA 1UWWA 3ETEA 2MPAL 4QQLA 1ZSHA 2EDMA 4LNRA 1JXJA 1O4ZA 5ISZB 3TBWB 3BYYA 3OD4A 4L4VD 4LBKA 1YSOA 1KC5L 2RR13 1P84F 5GRXG 3HG1A 3X3GL 5JSPA 4W6WA 5I1AA 4GQ9H 3B02A 2JTYA 2BNUB 1IILE 4GALA 3SKVA 4DZBB 3CDGB 4MSWC 4FPLA 1WWCA 3IXAA 4IJ3B 3ZTNH 1JSYA 5FX3A 1FFNB 1NQBA 1XPWA 3HS0B 1XB9A 4FULA 3KM1A 5L2KD 2V0AA 3QUGA 4OM0H 2IWEA 4WEBL 3I6LE 4IKIA 4MA7L 4BDVA 4ZX3A 4Y16C 1BF5A 3JARA 2FQPA 3AQYA 5ICYB 2ENRA 1XR9B 2ZTBA 5FAAA 2Q4SA 4JYBA 4RAVB 1ADQH 4HWBH 3MACH 4U2YA 1ULCA 4RA0A 4QXCA 5FZOA 3UXFA 4XACA 4YIOA 3V52L 5FUOL 4DV5O 5JO5A 2XG4A 3FKUS 1E27B 2ARJB 1BIIA 5IYBO 3MV7A 4Y1TA 4OX9O 2V4VA 2XZAH 3WS6A 2R0KL 2VCMA 1Z3GL 1MPXA 1WWAX 1R092 5FUZH 4U1GB 4WV1A 3CZKA 4LWSA 1IO4C 1S0GA 2X2JA 2CSPA 2A71A 4QTIL 5L3BA 3STLB 3P30H 4Q26A 4UWDA 3N06B 2GK0A 4F8QA 3MLTA 3CXDL 3B2VL 2X3AA 1PG7H 3N2KB 4H2CA 4M7ZB 3NKTA 1IBKB 1MZEA 1TME1 3DTDA 5F7WC 2H6PB 3BEHA 4OFGA 4HPOL 2UU9O 4H8UA 3N3HA 1C5DA 4A2LA 2OJ1A 4XNUL 2WDBA 4PGEA 5KR7A 2ATKA 5HJGA 4OCXH 4PRBB 2PUSA 1I1YA 1J9RA 3TN0C 3EXJA 4FHJA 1DVFB 1A6WH 3J7MA 5IFAL 3L5JA 4U4BA 2BOBB 2VN5A 4AIZA 1N6UA 3QDMA 4YJ3A 1D7BA 1JCHA 4ZX4A 4GUCA 2V7QG 2XWXA 4HMDA 4ZMZA 1W6LA 4A04A 2I24N 4K3EL 4HKOA 2DIEA 4AFBA 1RUKH 1WICA 3U1XA 2DI8A 1X82A 3E2HC 4PRAB 4LF5O 2R69L 4JUSA 4AMWA 5GGVL 2CBTA 2VLKB 2AABH 1M9SA 2AQ1A 4P9ML 5F9WC 4U6VL 5CAYB 2OX0A 3DIFA 2HRHA 2VE6B 1GTFA 4HT1H 5F89A 1EAJA 3BUTA 2C9PA 4XHJC 2FYVA 2JWPA 3JYCA 4WI5A 4JZGA 3SJVD 2ALAA 4I3SH 1W6QB 2ZINA 5BRZE 3ECBB 5BZWB 1KENH 4F5CE 2AXHA 3BP7B 4TXWA 1OAYH 1DUZB 1WE5A 3V5HA 5E94A 2W0FA 3J9SA 4PJFE 3S37X 4BOWA 4CW1B 4JFHD 1KXHA 2ZR2A 1A7NL 1P4UA 1PAMA 3S2AA 1JXNA 3QBTB 1KYFA 2FL4A 3P3PA 2WZPP 2IANA 3OJMB 43CAA 5E6YA 3WXVL 1J58A 1K5QA 1K3IA 1F56A 3NRPA 4NNPL 5TGBA 2HEVF 3TL5A 4P2RB 3PXHA 5EO1A 3SHRA 2A6JA 4X5WA 2V5DA 1KC8W 3DPBA 5DFTA 1ZNPA 3ZFGC 3QZMA 1M1SA 5GGQL 3A67L 2YSTA 4JI7O 1I8IA 2DYPB 4J3TA 3ZTJH 5FAXA 3MUJA 4LA2A 1C12A 5H6RA 1BAGA 4FXKC 4R7DB 1YZBA 4M5TA 2QVSB 3LKRA 1IGOA 5C0RL 4TUJB 3FRUB 3A0NA 1UENA 5L7OA 4NKMB 2XN2A 1OVPA 1FV1A 2OT5A 3OEHG 3F7LA 1BVLB 1KNOA 3OR6A 3KWVA 4TSAL 3V0WL 2OXBA 2R041 3OZ9H 4AK2A 5CZXC 1BLNB 2HFGH 3JAWA 4S2SA 4CN1A 1OTSD 5FDWA 3FT3B 4ZQKB 3KCXA 3V55A 5IB5A 1S2BA 1QQDB 2BIMA 1TMCB 2XWJB 4R6ZA 5MI0B 3HKBA 1FRGL 2BIIA 1ET8A 5HCAA 3B09A 3I2JA 3HMYA 2ZKHH 2B08A 5D21A 5LVEA 1H0DB 3T0VA 4RGGA 5DRZB 5K93A 5GRJL 4PGCA 1OBNA 2VNOA 4WJ5A 4GMP0 4EJ1C 1AZZC 4U1HA 3B9KA 2H6OA 4OCYL 5E2TH 1CS6A 3MMEA 4HBCH 4O2BB 4XHJD 1OA2A 1AVMA 3V4VH 5LGUA 3IKWA 3PL6D 3VXMA 4AYEC 5BNPC 4PJ9B 1FL3A 1UAIA 2CNYA 4Z0BH 4F2MB 2Y6SD 2ODHA 1MS3A 3UAJD 3U14A 5C09B 4JTDB 1RUML 3HRPA 1T21B 4DT2A 3S88H 4Z7UE 2X2HA 1N5AA 4XAKE 3S36L 1UCXA 5KYWB 4UDUA 3RDIA 3EGDB 5BW7A 3QDJE 3MLWH 2B20A 2VVEA 5C3SA 1T04A 3R4DB 1WWBX 1AZBA 4PJAF 1I9RH 3BIKB 2HG0A 3UZQA 3WSQH 1AO7B 2FQEA 3K77A 3NRFA 4FO9A 3K72A 1HCZA 3ARYA 1H5BA 4O4IA 3FSZA 4YDIL 1LENA 2WNVC 3EH1A 8PAZA 4XX5A 5F39A 4PB0H 1Q7YW 4DFIA 4RFOH 1HXYA 4Y1AD 1U3YA 1H2KA 1R6TA 5I1JH 2QZ5A 4H1LB 1EY2A 3CZSA 5IY5B 4DPAX 2CUMA 2JJ1G 1V00A 2BP5M 3LKNA 3CFTA 4WVMA 4MX3A 1YVWA 5TFSL 1R5IA 3MRHB 1LP9B 1U8HB 4BQ5A 4LSUH 4PBDA 4WTXA 2WCSA 1GZ9A 4MYWB 2QPFA 3HAEH 2HWD1 5GGTL 5FXVA 1VIBA 2Q1ZB 1U30A 1DJZA 1VPOL 5BJTA 3IFNH 1CFTB 3Q0HA 4XMKL 1H4GA 3SYQA 1DBAL 1JUHA 4KU1A 3DHJA 5EEZA 3S48A 3PHSA 1LECA 4L9BA 2IBZX 4JX0A 5DUBB 5E4OA 5CZRA 4TTGA 2DM2A 2V9QA 2D98A 2VLJB 1K34A 1YYCA 2AEQH 4X4YA 3SGJC 2ZYIA 1DVQA 5IB1B 1I8MA 2MNGA 1MH5A 1NFAA 2DN9A 5D2NE 1OCWH 2CUHA 5GIRA 3ULSA 5IUCA 2DCKA 3VZNA 2EVFA 2V6HA 1KXTB 3AM8A 1L0PA 3U0ZA 3C6LC 1N32B 1FNGA 1HINH 4TRPH 4XPTH 3NRUA 3Q8AA 4AEEA 4WCEV 1CF8H 2RR12 1EWHA 1GGUA 1V8HA 3MJ9L 1XO8A 4KJYB 2ESVA 1Z5LB 4PJ5D 1QDOA 5J48A 3MW4A 2ZOKA 2P06A 2BHZA 4FG2A 2BHUA 2EALA 4EAEA 1HQRA 1KECA 3MDJA 2BVYA 3QRLA 3NFSL 3MCKA 4APQD 1F9KA 2E5LB 1YEDB 1HSBB 2NX5B 4QT6A 4V2BA 1MJUL 4N90D 2D7MA 4PS7A 1A6CA 4N8MA 5FUCC 4A67A 4UUJA 4NC1C 4DERA 2O5XH 3L9YA 4FZ8H 2CO7A 4ZO7A 2HWE1 4KAQL 4PV8A 4R90H 4XC3H 2ZZJA 1AR83 2G75A 4OCRH 4QRQB 3ZE0F 1KLFB 4FLVA 1A7QH 3OHXC 4L8SC 5D7LB 5JXEC 5KS9B 1SHSA 5CUSL 5T1LD 4CADB 1XSIA 4YN3A 4YO0B 1D4M3 4OPHA 4R8CA 2VWEE 4MQTB 5AVSB 4IQHA 4Z6AT 3TBWA 2ARAA 2KG7A 4ZMTA 3P9MA 3FQWA 2NW3B 5KVDL 2E33A 2FHFA 4R6UA 5FQ0A 1UM4L 2BNUA 3P4NA 3LGRA 3CDGA 4XDPA 2JJSA 1IU1A 1HHIB 5EUOB 2G9HA 5ACA3 5EBWC 4WVZA 2W3JA 4MYEA 1UIKA 4LSRH 3UT5A 2XDHA 2WSVA 3STBA 3GZPA 2DBIA 3POGA 1KGWA 2CTQA 1JS4A 2F6AA 5ICXB 1DF0A 4BQXA 4PCYA 3MOAL 1LEKA 1A8ZA 1UB5B 2DVFA 2Y06H 2VLRE 2ADFH 4XMPL 4YBHA 1YJKA 2C9AA 2F5AH 1CVSC 2ARJA 3MRFB 4K6BA 5JI7A 2GBUA 1QVFU 2W38A 5AAMC 4NHLA 1ETZB 5JWPA 3QNEA 1ZSDB 1GIGH 4TV9B 3BI3A 3OC5A 3QNXA 5D1ZB 1S5IL 5IJVA 2APSA 5IT2H 2VO5A 1D4VB 1NA8A 2EIJB 4Z3GA 3KPRE 3IC9A 3VG9C 2FDFA 1Q90A 4Q2ZB 2P4EA 4TVPD 3ARTA 1MFAL 3N2KA 3VKNA 4FOQA 4A44A 1KEXA 2WSDA 2YMZA 1KC5H 4J3BA 4ETQA 3RYKA 1Y07A 4Q89A 3WFDL 3ZHNA 1JZFA 1MCJA 4ETYA 1Q6HA 2HX9A 4FC3E 4JQVA 4OI4A 4J6GA 3CC5B 5A3TA 5EBLA 3UJJH 2Z92B 2R063 2P5EE 1SLWA 1JPTL 4LFCB 1RPUA 1LU2A 3FB8B 4Q9QL 1DVFA 5GLUA 1VDGA 1DJYA 2OQJA 3VBSC 4CTEA 2J44A 1H2MA 1QA9A 2GTQA 1F4HA 3C9NB 1PAZA 2FDBP 2OXGA 3PU7A 4GW4A 4BQBA 3HZVB 3P9LA 1HDJA 3H7YA 4NQVA 5TK4A 3VGBA 2Z5UA 3RVZA 4TLUA 3ZSMA 1WA1X 3VFUA 1ORSB 5HP5A 4URTA 3V52H 2LE9A 3CNKA 4NNYA 4XPHH 5FUOH 1ZHBA 1NWOA 1ULFA 5IVCA 2XRAH 2R0KH 1KF9B 4PRAA 1Z3GH 5CINL 4Q4V3 3IJ8A 4ONFH 2Y7MA 3TWCL 3BFRA 3N1FC 2VLKA 3BEWB 5IF0A 5INCB 5I0DA 3WS3B 4B3RO 3CFEB 4Y1XA 1KJMA 1VB9A 3RTQD 2NPLX 2BOCB 1RUC2 1WMFA 2RQ8A 1ULDA 1NVPB 3MF6A 3ZN5A 3KH4A 3A2FA 3O4OC 5D1QC 5J36A 2DW5A 1EGJA 3QORA 3QK0A 5HHNB 1S76D 1ALYA 5C0NC 5HSFA 3MIEA 1S0EA 4LASH 2Y2TA 1FVDB 4XP9H 2QEXV 2BSEA 1QLEL 1PIFA 2IPKB 2KPNA 2VDQB 2AZ2A 1E6OL 3EYSL 4M48H 4DR4O 4W70A 4Y4HC 5IFAH 3EYOA 2QSCL 3M1CA 4WSGA 1NXD1 4LP5A 3WNXA 1CD1B 3S97C 1N18A 3L7EA 3JV4A 4P2RA 1B2WL 4LLMB 3H42H 4O4LB 4L0YA 2G4IA 2C1OB 4IBTA 1KTDA 5JHDB 1QRND 4RFNC 3QTCA 1MSWD 4LF6B 1GS6X 3WO4B 1JZ8A 3NQHA 3JATB 3B94A 4TUJA 4BZ1A 2XAGA 3UDWC 5IFHH 5E8DL 2AJVL 4KNTA 3VRLE 2P28B 4H0GA 2IGTA 3ARBD 1VQMV 4L3ED 1RVF3 3IMSA 4Y4KC 4FK5C 4FZ1A 1U6AH 1J0KA 1LO2H 4TVSa 1BLNA 3WF2A 2JI1A 1NR1A 3V6OC 5C07E 3JVGA 3FT3A 2OYMA 1QQDA 3ARGB 2JJUA 1P7BA 4LP8A 4IHJA 2F1AA 4XMWA 2BNQB 2OYLA 1T22A 1GQGA 2FBRA 3MUGB 4MCYB 5L8LB 2L9LA 2AGJL 3IJHB 1O3TA 4NYLA 5DRZA 3VBBA 2V2XB 4NNPH 3UTOA 5I19L 1NOFA 4D0DB 2OAAA 2ZX1A 2E53A 5I0TA 4E9TA 2EDXA 4JDMA 1LK2B 2WXOA 4MXQC 3L16A 5C0AD 3WNMA 4DP2X 4NRXB 4P9YA 4JFOB 4MZRA 5CGMA 2C9VA 1I8LC 5GGQH 1FGNL 1O7DE 1K8AW 2WMPB 2ZG1A 3T6XA 3UTQB 4ZUVB 5CLZA 1LGCA 2F4PA 1ECZA 4G6AC 5AZEL 4F2MA 4IERA 4CH6A 2YWYA 5I82A 5IB2B 1K12A 3AP6A 3PU3A 1ZVSB 4XF0A 5C0ND 5C09A 4OI7A 2C3XA 3APNA 5K1NA 2EDJA 1T21A 1EAPB 1IFRA 2W60B 5JHAA 2IH3A 4TSAH 4P5TC 1IFHL 1BXXA 2GIXA 2BCKB 2FX8H 2R2HB 3N44B 4U6HB 5I6NA 2MNUA 5KYWA 1U5XA 4UFKA 4G1EA 2NY5L 3P9WB 2EIKC 3RPQA 3R4DA 1S9YB 5FKPB 4B9ZA 1HL9A 1WC7B 2D7OA 5FR3A 3V0AC 2GMMA 5FBZA 1UA3A 2XOMA 1A21A 2VMCA 2WHVA 3KLAB 1TZHA 4GEJA 4NOBA 4HKWA 1QI3A 3RGBA 4J3WA 2CR6A 3V4UL 2HN7A 4RX4A 2LAAA 2A3TA 1HH9B 4GRWH 1KJVB 3PUIA 2QKSA 3IDGA 1MNGA 1S3KL 1LNQA 4H1LA 1OP3K 5FY1A 4N23A 1NLDL 3LS4L 3OTTA 4PBOA 5E16A 2WVVA 5MHSE 1SDDB 1TQBC 3TGXA 4FD0A 4JDNA 2ZA9A 5BYNA 2IQ9L 3GO1L 5BY1A 4HLZG 1WGVA 1LP9A 1U8HA 2BY2A 2YAQA 3LVEA 3MRHA 4O51A 3TTSA 3ZDXE 5B7MA 5I73B 4PRDB 5AKTA 4N21A 1AS6A 1JXKA 2NY1C 3P2DA 4GRWE 3WJMB 4XVTL 5BVPL 5ES4B 3GC3A 3O1VA 4JJOA 3AABA 1SBDA 3O2DA 4BCYA 4UBHA 4A2MA 5B1AB 1P1VA 1V54C 3Q5YA 5I8EA 2RMU1 2GKIA 3ENRA 2CM6A 3LOIA 2F66C 1JN2P 3BSHA 3Q2WA 5HYJB 2MTAA 1QJZA 4K40A 1AYM3 1JRHI 2AW9A 4Q8LA 4PJ6A 3A21A 5CU5A 4ZUWA 5DU7A 1YG9A 3QG7L 1JHLL 4MXQD 3TVMC 4L8DA 5KBFA 2AUYA 2F5BL 2VLJA 1EBPA 4FFWD 4YDIH 1AR82 5FYUA 1IQDC 4DV2B 4GIOA 3PG2A 4LLYB 4PJFB 1IBGL 2ZWYA 3PURA 1D4M2 4NRZB 5JIAA 1BK1A 4G6AD 2P8PB 3WFVA 1BT8A 4X4XB 1H8TB 4P2QB 1MLCB 4DO0A 3L3GB 1GJWA 4E5XG 1J05B 3HLAB 4H88H 2HLFC 4PJXE 4U3CA 3RIKA 3TEXA 2DFBA 2ZE5A 1IIIA 2CRZA 1NA1C 4C0HA 1E0OB 1Y6XA 3FH7A 5CLXA 5HJDA 5GGVY 2EUZA 4ZZ5A 1WA8B 4JJ5A 1YEDA 3VV1A 4QPEA 3L3HB 2Z42A 1G0XA 1QFUL 5E4IA 2DBLL 1IG0A 3ZT7A 3RUGE 5E4EB 4LU5L 2IPUG 3FWEA 4MQXC 1PPIA 3ZLIA 1CPUA 2OKMA 4C0BA 4QRQA 2UXXA 2MQCA 2AP2A 4NGHL 3DHPA 5IEKA 1RP3B 4F2FA 1RFYA 4HHGA 3RI5F 1RSOB 4YO0A 5IJ9B 5DRNB 4FLXA 1FZOB 2EYSB 2BQPA 3UO1L 5EPMA 4B95C 2Z8WC 4ZUSB 3UOAB 5D8JL 1KB5B 4GLRI 3V9CA 3EJJX 1CGWA 1MWOA 1DN0B 2WUCL 3WS6C 5L88L 3NV1A 4MJIA 1HHIA 2J3SA 5EUOA 5J11C 4KG0A 3MJ9H 5TH2B 1OPMA 1PVHA 2P80D 3U9UA 2VITA 1CFVL 1G6RL 4F83A 1NUKA 4KVNL 3JD2A 2ZUYA 3CVHL 1IM3D 1DU3D 1U12A 2X7RB 5I24A 1M05B 4Z3HA 4EBQL 3LKOB 2EX3A 1HCFX 2CQVA 2R062 5ICXA 1B6UA 3NFSH 3ZTCC 4MV2A 1MS5A 1UB5A 1CVNA 2DZEA 2QDWA 1VALA 4TWKA 1MJUH 1LWRA 1YDPA 3GS4A 4FTVA 3MRFA 4I77L 1MF2L 4IGBC 7FABH 4NHCL 1UXZA 2FTAA 1ETZA 3BE1L 1ZSDA 4I9WE 2QQWA 4FQZA 4S2DA 5I23A 2OTUB 4KK6D 2AJSL 4XIOA 3UG4A 5T54A 3W81A 4G8IA 2RD0A 3P0VH 5CCKL 4Z7UB 5CADA 1TO5A 1AR4A 1HNWO 3L54A 1XSKA 3A6CL 2Q7AA 1NMCB 2CTWA 5CUSH 3DVFA 4Q2ZA 5D2LB 1RUG3 4Q4V2 2HLFD 4H7VA 2WA4A 3PWVB 3RG1C 4UIKL 4U3FH 2QADB 3LDRA 4P9LA 3HMXL 1YJWV 3L1EA 4JCLA 4O5LH 3CC5A 4PRPE 4DEPC 3RMYA 4AEIL 3HG1D 2Z92A 2EABA 2K1MA 3F2LA 4OLEA 1J83A 3FB8A 1U5ZA 4ZHQA 2X4NA 2V17L 3BUBA 1KS5A 1V6IA 2R0FA 3Q1SH 3H1YA 4GLXA 4JASA 2Q2EB 3HZVA 4FFZA 4QHNB 1E4KC 2NMNA 4OZOA 1O9ZA 3CU7A 2VUKA 1F8TH 3HR5B 4FAAB 1LOFA 4I5SA 1ORSA 4XNXL 4DZ8B 2OZ4L 3T6WA 5MENA 2VNRA 5KBDA 2FGWL 2O57A 4S1SL 1YNTB 4DAGH 2J1EA 4Z7OF 3VXRE 5DM6V 1U95A 3ESMA 1NEZB 5CS7A 1MCHA 4MT8A 2PXYA 5FHAL 2AGAA 3C09C 5IBLC 1S5IH 5IR1B 3PWJA 1EN5A 3DVNB 3AADB 3WS3A 1J9TA 2YEQA 3W5NA 5HDBE 1MFAH 4JFEA 3WG7B 2JV6A 3C5ZB 3L8QA 4XP1H 2GC1A 2WFPA 5KHJA 5FK7A 4AL9A 3QZOA 2GHYA 1RM1B 2OQ7A 4K55A 1AGEB 3FFDB 5KS9E 2VW0A 1T4KA 3BAKA 5DJ8A 1PNLA 5HHNA 3UCQA 3FJTA 1DBBH 5D72H 4NTWA 1S9KC 4AL8L 4MG2A 1TG7A 5D2NB 1GANA 4ZFOL 2A6DA 1FVDA 1NQDA 1RVF2 1HXS1 1WJ3A 2ADDA 2NP0A 3LH2H 1JPTH 1J5CA 2IPKA 3JV0A 2ID4A 2EJRA 4J7JA 4O4YL 2D7FA 2TSBA 4M3CA 5IV2B 3VFGH 4N0CC 2DCZA 1D9KB 1QW9A 1CZVA 2MNJB 3OR6C 1W3VA 1R1CA 4OUEA 1QKZL 2E3VA 1OWRM 2CDOA 5AD0A 3ULUF 1AGCB 4M1DL 2FBOJ 2WKGA 2E7BA 1OKEA 4P3CL 5JW4N 5LUMA 4P9HC 2VMHA 2NTFB 2X6CA 4XTRC 4H8HA 2DVGA 3S4SG 5CINH 3OF1A 5LB1A 1R0AH 4TSBL 4NO5A 2R49A 4DW0A 3RWEA 3WP3A 3VA2C 3JATA 2ZNXA 3K5SA 2VMFA 1H4HA 2WZR2 4M8RA 3AITA 1KIQA 2E5EA 1JS9A 2IFRA 2W68A 1I1EA 2Y22A 1FX5A 1VQ9V 2H1XA 4MZUA 4XNBA 2ZUVA 3DK2A 4OLUL 4YVSA 2X6UA 4CEYA 1PL3A 3C2UA 2GAZB 3B9KC 3NEEA 2GDSA 1NDGB 3IDMB 5I0VA 4J3XA 1HB4A 3K4DA 3DO3A 3RU8L 5D6DC 5JH7B 2ZXDA 1K4DC 3FQUA 3ARGA 4X6CB 2DUOA 4G71B 3W7UA 4RDQG 3T2MA 1FYTA 3KYNB 1LE9B 4A6YA 1G5AA 2NY4B 4J3OC 2BNQA 2VR3A 1OT4A 3EYSH 2E7LC 4MCYA 1CG9B 3ZSSA 1JNNH 3IJHA 4EKJA 2KBGA 5F7DA 2V2XA 5IBLD 2OUHA 3FLRA 4LHKA 1X7TA 2IAND 5DMGC 4D0DA 1D2PA 5K8SA 5BW7C 3FD9A 1LK2A 3OUIA 1N19A 1I1CA 4IEPA 2GFBB 2B1HH 3ZYIA 4BQ6A 5A3UA 4AEMA 5BOPA 4LCWE 5DMJB 1A3RL 5T1MB 2VLRB 3UTQA 3WF0A 3PGDB 3E8GA 3M8OH 4QRRD 3T1FB 5F2FA 1SBFA 3QJFA 1KQRA 4FVMA 4CU8A 1TEIA 4LQRA 3BB6A 1NFDF 1E7VA 2J8UE 5EF0A 1S7XA 1XF2A 4GNKB 2V3FA 2XPYA 3TIDB 3ZMUA 1EAPA 3EOTL 5F1NA 2YV8A 3AYAA 1IGML 4IT5A 2BCKA 4U6HA 3Q44A 1DF5A 2LGNA 1SHWB 2Z4FA 4N0CD 3MV9A 4OGQC 1JBCA 1H1MA 1W9WA 1OARH 4UAOC 3U4SA 3WG3A 1RD6A 2GN7A 3WW2A 5FKPA 3MKGA 4S1DC 1C57A 3L08A 1WC7A 4JREC 3UZVA 1LILA 4LARL 2A6IB 2J6EL 3CVCA 3KLAA 2HKHH 2P7TB 4Q74A 2YI9A 1XMOB 3N50A 3UCSC 4KX7A 4UZGA 1F90H 3NNFA 4ZOEA 2JKLA 4JG0H 1FYHB 2P5EB 2LVEA 1HH9A 2YKLL 2X0LA 5EEVA 4ABQA 4LH7A 2LP7A 5CG9A 3SKMB 2R4SL 3KS7A 1SKVA 3FX3A 4GMSL 1CTOA 4FNQA 2R9AA 4W65A 1F1GA 3WEMA 2H6UA 3O6FA 1TZIB 1LULA 1MG2C 4JK0D 4JRYE 1FGNH 1OCRC 3B9KD 3WTXA 3WJMA 5AZEH 2RS12 3FLPA 1XE8A 2QDOA 2VSDA 2EH7H 3V5KA 1OLZA 4FXGC 3VXMD 1ND2A 2ZKXA 3GNEA 2DE0X 3T2NH 2QHLA 4J3OD 2IAMC 4GT7A 4MH0E 4HOWA 3H8OA 4OTXL 3DX9B 3LH9A 2LGWA 2NXYB 3K2KA 3BCWA 2NY5H 4PD4K 5HYJA 1RUQH 2E7HA 2YYOA 1K7DA 3TBYB 5C3PA 4CILA 3KLHC 4ZT1A 1K5NB 3ZYBA 1FSKC 2V8LA 1BFTA 3L75H 2Q8BH 4OZIA 3W20A 2IM9A 5J96B 2F4VO 4FKEA 4UV8A 1M7XA 4G6JL 4LCUB 2JKNA 2KYIA 1A2YB 2Y7QA 2OMTA 2UZYA 3HUJF 2ZGSA 2GG1A 2EUWA 4X4XA 1H8TA 1FLRL 4HPKB 1VGEH 4P2QA 4XFHA 3QEGL 1NLDH 3DOIA 2EIDA 4G7RB 1J05A 3HLAA 3E3QC 3LRGA 2IQ9H 3GO1H 1QG3A 4JZNA 2LGQA 3X12A 1KSRA 1OH4A 4MA1B 1RHI3 3PVOA 2VABA 4DS0A 1S55A 1WA8A 5FPOA 3L3HA 3O4LB 4TQFA 2J22A 2FATL 4BFRA 1DZQA 4Y22A 4CDXA 2WQRA 3DHMA 3KS0J 1XYPA 3H42B 5T50A 3TB0A 4LRIC 4LPVA 1VQ7V 2DQUL 3M3IA 3TOJA 1FZKB 3LZFL 1VRH2 1UJ3B 1WB8A 2CO3A 3VD9A 3OUJA 3OKKA 3A47A 5GQBA 1RSOA 1UHVA 3QG7H 1IARB 1JHLH 3EZJB 4H5SB 3MPPG 1FZOA 5C07B 3OBRA 2AJZA 3QEHB 4XCNA 4ZUSA 2Z0UA 2UXCO 3OUSA 1IBGH 2VL4A 3BH9B 1KB5A 5D93C 1HJFA 1RUG2 2RM23 3ZHKA 2X6AA 3JBG7 2UXVA 1W6PB 3T0DA 3WTVA 2EBOA 3GSWB 2KDYA 3OSKA 1KJLA 1CLZH 5AL8A 1KPUB 3O1SA 4YHHB 3C5SB 3KVDD 5TH2A 1I5XA 1ULGA 1HU8A 4AK1A 5C70A 1L8DA 2Y25A 3ICXA 4EOWH 1W0OA 1UT1A 1Z1WA 4D9LL 4MVUA 2ESVD 3LKOA 4DUVA 4G1MB 3ZT6A 3UTZB 4ENED 1RJ8A 2GNDA 5K1XA 4L4TA 4GAGL 2MEV1 4FA6A 2YAFA 4HKLA 3T0BA 1JHJA 4DR7O 2DBLH 4L99A 3JUZA 4X20A 1N0LA 4LU5H 1TQVA 1Y1DA 4X65B 2EE6A 2FX9H 2LAGB 2DVDA 4AFAA 2GU9A 3ME0B 3FU3A 4RMWA 2Z69A 5D2LA 5FPAA 3T0XA 2W1UA 1QNWA 1UATA 3T1HO 5E6IC 1D2DA 1WSST 4N3TA 3TNMB 3W11D 4F8NA 3CCSV 1SLVA 3BXNA 3PWVA 2D3PA 2CSGA 2WWNA 3VFVB 5D8JH 4RFEB 5GZCA 2Y23A 2GEEA 1Y6KR 4X62B 2ADIB 4DUYO 4NM4L 4CVXA 1Y18B 1AR5A 5DXDA 4ODSH 4Q4W3 2Q7YA 3PAYA 4R97C 1ROWA 4I7ZC 2RB8A 2P1YA 3VZLA 1RHFA 5B3SC 2ZAHA 3QUMA 4KVNH 3CVHH 5AYTA 1Q4NX 3V0DA 3E86A 1EVTC 5IIEA 2JQMA 3QXTA 2IGFL 1Q0YL 1B4LA 3VFPA 4QHNA 3R8QA 4X8XA 4EBQH 3EMRA 4XUPA 1CK0L 2BJML 4XOCA 3S3BB 1CE1H 4O2EB 1S78C 1P5UB 3F12A 3NJXA 1C1LA 4GRWB 1YNTA 4NHCH 2GMPA 1NEZA 2Y0OA 2AJSH 4UVAA 1MUJB 5IR1A 3P73B 4KRMB 1H6FA 2H8PC 2BJSA 3VL8A 3DVNA 3M17A 4PCRA 3A6CH 2DF3A 4PG2A 2HVJA 3C5ZA 1MN4A 3I7DA 1E8YA 1XNRB 5DSCB 5DD0H 4X64B 4UIKH 1VP7A 3FFDA 3QZWA 3HMXH 5A1LA 1YUHB 5T3ZL 3CFDB 2H7WA 1D2OA 1TCRB 4QXHA 5E23A 1YNLL 4JRXD 5EH1A 3CVDA 4HONA 2ZOTA 3BH4A 5IV2A 2DH3A 3KBEA 5SWSB 2YGPA 3CCLV 3EBHA 4NHUB 1Q9KB 4PJXB 3VG0H 4HULB 4CBCA 1DVFD 4Z3FA 1USQA 4Q56A 1EP0A 2R6QA 3IDYB 3CN1A 4RWHA 1AOZA 3DURB 2BVTA 4TSFG 1AGCA 3UL2A 1IAKB 1KEGL 2W0KA 3O8XC 3ZHUA 2ID5A 3LJ3A 4PJCA 4AQYB 2CH7A 2HT4D 5HCHA 5IT9N 3TNQA 2FWOA 5FHAH 4YVUA 5JCOA 3UAAA 4UV4L 1NGPH 1IEAB 3V4PL 5JMOA 1AY1L 1FQ9C 3CN2A 4KU8A 4ASLA 5IATA 5FECB 4K0OA 5L4IA 4LBLA 2VLKD 3L3KA 1IDSA 1IC7L 2QQLL 3Q6FB 4QRPA 5JW4M 3H3UA 3POYA 4G4FA 4KPHL 1BYHA 3QS3A 4X6DB 1ZDQA 3SYAA 2GAZA 4M62L 1DYOA 3IDMA 2WO2B 3MTRA 2E7AA 3GPEA 3M8AA 3CMOL 4X6CA 4ANVA 3QORD 4WI4A 2N4IA 4XJWA 3CCQV 1BFVL 2F0CA 4F58H 2Q4PA 2IOOA 3KJ4B 3M07A 3JBG1 4UW4A 2AEOA 5E1IA 1I94O 4GI6A 2ZEXA 1CG9A 5JVVA 1J1OH 3EGXB 2A6KB 5CNHA 2BSED 3OKDA 4KUCD 4AOFA 2AENA 3O11A 1G9MC 2MTPA 1QKZH 4I0PA 4ZAKA 3B93A 1LOGA 3N9LA 4UFLA 4XO8A 5IG7A 3LFMA 2GFBA 4P3CH 3ZHTA 1U58B 5EEUA 5D1IA 5E95B 4P2RD 1TTCA 1KPVB 1VB4A 4KI5M 5LBSH 1QI5A 4U49A 4AGRA 3SQOA 2ADJA 1IE5A 3FB5C 4PJAA 3SPVB 3B8NA 3IRPX 5AVTB 3KVQA 3MUZ1 2XY1A 1VIWB 4Z92B 5HI4D 5BV7L 4HMCA 2GC7C 1JYXA 3LIGA 2P45B 3VFRA 3PGCA 5ECJE 2GJ6E 4KKAC 3UC2A 4C8DA 1JYTA 1Z3RA 2NZ1A 4OLUH 4M1GH 3MX0A 5DVKA 4AYFA 3VDDA 4TLKA 4AQ2A 4HCIA 3RX8A 4GX2A 4DV1B 4L8QA 4M3JA 3ATGA 3FO9B 4F7ZA 1PO13 2J1SA 4MMXB 3WEBA 1FAIL 1TOXA 4PGBB 1RZJH 4AYID 2AJ3B 3AG2B 1LO5A 4G43B 4S2GA 1EXHA 4GMP1 2XJTA 1IIKA 3NABH 4EIGB 4I50B 1BZEA 3QIBC 3VVVA 5CSGA 2HRPH 4FI8A 1KB9K 1P49A 5HFMA 4K5MA 2KLRA 1QFWI 1E6JL 1G1YA 3BPOC 4QKTA 1I7RB 3RFZB 5K1VA 1S0IA 1OSPL 2CJSA 4WBNA 1A22B 1TZIA 2G5BB 3O6LL 2C7FA 3VQWA 1A3RH 2F95B 5HXMA 1UD6A 3MUY1 3T71A 4OF0A 1VMFA 3E6DA 3FHIB 2P5BA 1QAWA 2HXAA 3ET9F 4GPVA 2LUWA 1XHHA 3BPLC 1M4WA 1WAAE 1KY6A 3J07A 3V9EA 1A7PL 1K85A 4CH3A 3B5TA 4H26A 3IDXL 4TNEA 4JI4O 3UV9A 1TZOA 3EOTH 4E9QA 1ZWIA 4EDWL 1RHI2 1IGMH 5C09D 3BAEL 5HDBB 3DX9A 4DKAA 3R1GL 2AREA 3BSZA 4LK7A 3ZIAG 1JV5B 3VXQA 1ZLVH 4LARH 2QKCA 3D07A 3FQRB 2J6EH 1PCXA 4DK5A 3S8GB 3VW3H 4IEUA 3OGOE 3FCGA 4R84A 4MS8C 4FPGA 1V7ML 4LCUA 1S7RA 3MJ8B 5LBEA 3WP6A 1A2YA 1G7IB 3TCLB 2F2HA 4EO5A 5GS2H 2NY0C 4HPKA 2XAHA 3FO1B 1MXDA 4TUKL 3TH3T 4B3SO 3HKZA 4EFBA 3ETTA 4RX4D 3DTXB 5FZLA 3QNFA 1B3IA 3A8TA 2RM22 2OL3L 1OKQA 2CLRB 3JV6B 2JX9A 4OZFA 4JCWA 3OXRA 4JYAB 4JI2O 2CKBL 2EO1A 3GK8H 3O41A 4LK4A 2F68X 1V55C 1BEV1 1JK9A 2XBO3 1NCQC 1DZBA 2HH9A 3AWGA 1MVUA 1X5FA 3Q4HA 4GINA 1T2JA 3O4LA 2QQQA 4KXBA 2G2RB 2EAAA 4BQ3A 3OM3B 4P59L 1IX2A 4GYCB 2AQPA 1FOD1 4EN0A 4BQ4A 4NLAA 1QOOA 5M0TA 4A7TA 2A99A 2RS51 3IPFA 4MLOA 4JO2H 4PWJA 2VERN 2OCCC 1FZKA 2YC0A 2K9FB 1UJ3A 2WO4A 3BH8B 3FN9A 1ZSPA 1OHQA 3NESA 3OAWA 5D5ME 3ZK0A 3VXUD 1M6UA 5I6XB 4QD2A 1UF2C 2OR8A 4KRPB 4MDIA 5C07A 3AL5A 2L3BA 1SOXA 3X1BA 4QHLA 1WLEA 3DGGA 1VEOA 3UETA 4J41A 3UNPA 4H37A 2FEJA 1K2DA 2X1OA 3N9GL 2ZCEA 5DDHB 3NAPA 4N1EA 4WCYL 4IEWA 1FLRH 3GSWA 4IKJA 1I1AB 2E51A 2JE9A 1FL6B 1KPUA 3FT9A 3O6KL 3C5SA 3QEGH 4R26L 1EUUA 4XWOD 5DRWA 3T3MF 2Y69B 2F8IA 3FTWA 2C3VB 1H8HG 4HD5A 3H6JA 2JE8A 3U9PL 1IC4H 3T0AA 4Q4W2 4OAWB 1QNYA 3UTZA 4DYLA 1QW8A 1S5HB 4F8TA 1T6VN 4DV0O 3ZFEB 4YM1A 1EANA 4OGAD 4JHZA 2FECI 3L74H 5E6HA 2FATH 5T5NF 1DK1A 3FTYA 4NQEA 2J8UB 1HH6B 4PJEB 1KXGA 3LXBA 3BIWE 2XACC 4WVVA 2R72A 4L8JA 3JWNG 3OZLA 2DQUH 2NY0D 3OLIA 3VXSE 2IVFC 5J1XA 2I9LB 3DX6B 4KDWA 4H0LB 1WAPA 1D6EB 4YLZA 5EFUA 3S34H 2NW2A 4L9DA 5MP6H 3SIKA 1GZPA 3IK2A 2I26N 5B3JE 5HHVL 5J1SC 1OE1A 3JSNA 1OP4A 1QSFA 2W9DH 3DSNA 1LOFC 5FZCA 4YFZA 1E4WL 3FZUD 3OR7B 4M9PA 2R0LL 4X99B 2I9TB 4NWUL 3ZFFB 1ZZ6A 3CCJV 3NH7L 2WYIA 1QRKA 4PA6A 1MVQA 2P26A 1GL4B 3I9GL 3OC8A 4FOMA 3WKPA 1IQWL 2IJHA 2X4SB 4MJID 4PGZA 4XVUD 1RUE3 2ZHKA 1UOGA 4QKXB 4D9LH 3VKMA 5I6LA 4JPIA 4JRYB 4TF4A 4O2EA 1OLQA 5IWAO 4GAGH 1SLXA 1P5UA 3WOGA 1DQLL 1EEZB 4CN4A 1SXBA 1W9SA 2VLMD 3K2OA 4COZA 5FJKA 3QQ3B 5CEHA 3BWAB 3MNDA 3EKCA 1ZGLA 1QIQA 4FTVD 2VWJA 5IREA 1MUJA 1KBVA 3SPIA 3GTTA 3QSKB 1E9PA 2HVKA 3BP4B 4CS2A 2J2ZB 4DO6A 2G19A 2V09A 1M57C 1CJYA 4ZHNA 4Y5VC 4HH9A 5GS3A 4GG6F 1A14H 3CCHB 5DI8B 2VRQA 2G9FA 4IUGA 3PUHA 1GC1L 2IADA 2ZXEB 2XUWA 3BKML 3ITQA 1TCRA 4HIXL 3B9EA 4NM4H 3NK3A 4JG9A 1XZWA 5A7SA 1L5GB 1CFSB 2CK3G 2FMLA 1KEML 1TVHA 1ZJBA 1CAUB 1TMF1 3T4ZA 1JVOA 4CDUB 1BJ1H 3D5OA 5SWSA 3HPLB 4NIGA 2IGFH 1Q0YH 4NHUA 4IMKA 3L70H 4WEUD 4PIZA 5DG2A 1A34A 1LO0H 4L92A 3EXUA 4YVSC 4CEYC 2HA1A 2K3HA 4AZ8B 3DURA 4IEFA 4LPLA 3AEIA 2R9IA 4KI5E 3VVWA 1CBVL 2LOEA 2J8OA 1UCTA 2W1NA 3I84A 1MACA 1MCBA 4PFEA 4ZPTB 2EE9A 4YR6A 3BKYL 3V95A 3NOIA 5MEND 3IIAA 2EDWA 1IEAA 4HJUA 4JL1A 5JHLA 4N2KA 3SPCA 1HZHH 1ZA3A 2EVIA 4YY3B 1PD0A 1F5JA 1ZLWH 5FECA 2BNNA 2PXYD 2DUQA 4P4KB 1PPJH 3EO6A 1EBAA 3MLYL 4X6FA 5AOIA 2AEYA 2WKOA 1MS8A 4U1IB 5CCGE 3HKEB 3MHHC 3CU1A 1F4WL 3NZUA 4X6DA 4DK6A 1XCXA 1M5IA 3P2TA 4JFED 4XVSL 2ETWA 1NVPD 1TVKA 5T3ZH 3X1EA 1AMYA 5GPRA 3FQ2A 3W1ZA 3S3PA 3QHZL 4NOTA 4QE9A 4RIRB 4WWKA 1CR7A 1S9VB 3HFFA 4LHJB 1KGJA 4JM2C 4PREB 4W9KC 4DR6O 1TTGA 1MHPH 2XMLA 1W91A 3R4RA 1AZVA 1ZRFA 4C56E 3EGXA 2A6KA 2QEJA 1QQP3 4ZKTB 3MW2A 4K73A 5T3ZE 3FTSA 1KJRA 1PO12 3TV8A 3MF9A 4GXUN 3SO3B 3ARDA 3CSBA 2HKOA 3AROA 2Y3AA 1U58A 5GRUL 1KEGH 4Y24A 1FYJA 5IVZA 1P7GA 1FAYA 1KPVA 2COQA 4XP6H 5EC2A 2DYSC 4ADGA 1MCNA 3NFNB 1RUD1 3DC5A 1GPOH 2J1UA 4FFBB 4HS8L 1VIWA 3CDFA 5AKSA 1QHTA 1U3JA 4JFXB 2F74B 3WFEL 1AQ8A 1XH3B 1IVLA 5ADPL 1S4CA 1GGYA 1GNYA 2QQLH 4W4KA 1VQNV 1KYOK 4KPHH 5BOJA 4LULA 2MPFA 3G5XB 3QZLA 1W2AX 3O6FC 1EPZA 2R2EB 3CMOH 1QWNA 1LDSA 4FLQA 3BVCA 1YEJL 2GY5A 5DZPA 3DDGA 1W9XA 3FO9A 2QTSA 3LXAA 1BFVH 1RH8A 3U30B 1UZZA 4PGBA 2AHIA 2ZYSA 3ARGD 5JJEB 4G43A 4JDZA 4CMHB 1H9PA 3PIJA 3C6EA 1FYTD 3ILPB 4AI1A 4X9IA 3OFNG 4PD4J 3POJA 2BNQD 5CEZD 4IIJB 4PIBA 4JM4L 2YA0A 3POBA 4V1DA 1AG6A 5LBFA 1I7RA 3MHZA 3AVEA 1WAEA 4RMVA 2G5BA 3EAKA 2FO1A 4FOWA 3ETQA 1TJIL 1N36O 1P9MA 2WWMC 1VARA 3VHOA 2ZHMA 2ITDC 3COOA 5F7EL 5BV7H 1JVMA 5J3HC 3RPIA 4L8BB 1X5XA 2BDNL 3K1DA 3MI6A 1KV7A 3H0TB 1GN4A 4JM2D 3CJXA 3CHOA 3SKOB 1V3KA 4XXWA 1IG3A 3U7WH 5I5IA 2XBO2 3C3TA 1GV9A 3AREA 3VBUB 3L3OB 5D4HA 3AKQA 2P5WB 4FIPC 4NPRA 2V3EA 4QHZA 1DVYA 2A83B 5DEZA 2ZUXA 5JXGA 2YXWA 3LKQB 3TCTA 4DVBB 1G9FA 2JRIA 1JV5A 3MV9D 3RWFB 5JJNB 1GZHA 4RHV2 1EM1A 4CA9A 4QE7A 4Q0UA 5G05L 3LRLA 2VDRL 3KWWB 3QAZB 4NQTA 1UQXA 1T20B 3TNNA 1TSRA 1G7IA 1JJOA 1Y4MA 4TN7A 1QR4A 4CDXC 4LVNC 1TJGL 5H37G 2CNZA 3HHMA 3SE6A 1WCBA 3US1A 3D3IA 1NM9A 2I69A 3CDYA 1E6JH 2N01B 5BQ7B 4YOKA 2VD7A 3CPLA 4BSWB 4ICGA 2DQCH 2PGGA 3O6LH 4OLXH 1WN7A 3BISA 5EZOL 1MJ8L 3O6FD 1JRHL 3AUVA 4MO3M 4R9AA 4DUZO 4XPBH 4PWIA 1JU3A 1EJOH 4UNUA 3IDXH 1WBXB 1V9U3 3EO0A 4EDWH 4GSRA 1A4CA 3BAEH 2VAAB 1V70A 1JFQH 1BFOA 2Q69A 1V10A 3GSQA 2NR5A 1H9VA 3C8HA 1GGCL 3R1GH 5B39A 4PS4H 2JICA 1E40A 1U3NA 3BH8A 3ZKXB 1FN4A 4BISA 3ZN1A 2WLIB 1U8QA 1UFUA 2NY3B 2MOQA 2TRHA 3KBPA 3FB6B 1RUPL 1UMIA 5HYJD 3RZZA 1GAXA 1CAVA 3QLQA 3WFZA 2XLFA 2I60L 1HYSC 4HKJA 4KK9D 4XN4A 1V7MH 1OB1B 1PVC1 2D3OW 1PTZA 2DQFB 3EDFA 4N8VB 1MS0A 2WWMD 4HVOA 1RJZA 1ACYL 5GISL 5LNDA 1W80A 1XE7A 3DVIA 4TUKH 5ESAA 4KK8C 2L35A 2XLLA 1I1AA 4YH6A 4YSPA 1FL6A 3KYAA 3BOPA 4HZLB 3D8MA 4PD4F 3GXUB 3EYVA 3ZKMD 1KPRA 2EIGA 2HX7A 3HTLX 1ZM1A 3UKTA 1PZ5B 2OL3H 4PCKA 5DQ9A 3DXTA 2P3YA 3VRIB 4A7QA 3M1HA 2Q6AA 4AC4A 3ZYOA 1E4XH 3N5AA 3RYHB 4F15B 2BVPB 2VMIA 4OAWA 4AQEB 1AANA 4UOW1 1WCSA 1S5HA 1I3GL 5IJBC 3KCPA 4JE4B 1B9KA 2X5PA 1MW1A 4LFBB 4Z7UF 1FATA 1RUE2 2JDKA 4QDQA 5FZ4A 3NTCL 1XDTT 3U75A 1ROCA 4ZXBA 3LNMB 2NNAA 4JFDD 4PJEA 5CA0A 3ESOA 1WUVA 5GTIZ 3S6CA 2JD4A 3TPUA 2B39A 3NCEB 1AL21 4FI9A 1ZANL 3B9IA 4AE0A 1F35A 1D6EA 4JG1L 1RIUH 4HJGB 2F93B 5FLVA 3P6BA 3J26N 1OLME 3JD0A 2ARXA 1CDJA 4Z3JA 4ZBMA 1A1MB 3OR7A 4URKA 3GCXA 4AFDA 1U3HA 1MG1A 3O3EB 3R06B 1U8NA 4JFVA 4ZW7A 2J57A 4X7SL 3U7AA 4WCYH 2I9TA 2JIJA 3V5DB 1VE0A 1EHKB 2Z7WA 3O6KH 5BZBA 4MQSB 3Q01A 1CFNA 3F7YA 1GY2A 4PG2C 2CJUL 3PJSB 3AVRA 4COUA 1OALA 4KKBD 4ZPVB 3UEQA 4CC0A 3EFDL 5DFVC 3U9PH 2ZS6B 2YPKB 4AH2B 4FNSA 3A0HZ 1OAZL 1CDGA 1NPNA 1DZ0A 3ECWA 1LOAA 1EEZA 3FMGL 3UTTA 4UBGA 1M7IB 2E9JA 1HYSD 1GLHA 3QQ3A 1NI8A 3BWAA 3BUPA 3P11L 4L4TD 3MO1B 4M6OL 1OP5H 1UURA 5LGKA 2BIPA 4I3GA 4ZOAA 5DC9B 3TJPA 3NZSA 4KK8D 1RUJ1 3HW7A 1IGJA 4Q52A 1QVGU 2J2ZA 4MCNA 4NAQA 1N70A 5DRXB 2R32A 2ZHLA 3JQWA 4YGEA 1A32A 4XBQA 1EFRG 4PF1A 2DLTA 2VXTH 4D0BB 1FYUA 3D85A 1A6ZA 1SUHA 3IAYA 3LZRA 4UQBA 4DY5A 2FLBT 4EUPG 5FW8A 4NQXA 1YJDL 1HQWA 1E4WH 2E6JA 2VM9A 1GGBL 5FC9A 5CF3A 3A6BH 4Q14A 4X7TA 1T7VA 4QXVA 5T3XL 2Y7NA 5IVYA 5JCOC 3BA9A 2YUWA 3CX5J 2X53A 4H7LA 3MAQA 3GYRA 2G3MA 3I9GH 1T7XA 1QBBA 2YR3A 4YHNA 5C8JB 4CDUA 2C3HA 3ZL2A 1S72V 1PG7W 2A75A 3LDEA 5HHPA 4FHBD 4XPVA 2UUBO 3UERA 4AZ8A 1UH3A 3ZXFA 2XQXA 1FFOB 3TA3B 1QJFA 5J98B 2RH0A 3ZYGA 1DQLH 3KL3A 4JI0B 3B6SA 2WBKA 1QQP2 2NY2C 3LD8B 5A32B 4KZDL 4NO3A 3SCMA 3LCYA 3D9AL 4O2FB 3MV01 1MCOH 3ATEA 1TSHA 2BC4B 2BNMA 3OLGA 4UQCA 4XOGA 1SCSA 1F7YA 5D71L 5CJXA 3PN1A 3AG1C 4F7PB 3NV4A 5DUJA 1WCDJ 4DR3O 4WO4A 2Y6FA 5HI5D 3LNEA 3O0VA 4XFIA 1FFRA 2R0WL 4ZAKC 3RWGB 4AM0Q 3SJQC 1UM6H 5A16B 2G38A 1GC1H 4EWEA 5EOCH 3C5ZD 5DVLA 4BYHA 2P67A 1UACL 4PCSA 4QRTB 2C9QA 1OUSA 3BP5B 2VAUA 2IOIA 3ZX7A 1V6NA 3HI5L 3HVNA 2GP5A 3VGDA 4RIRA 2ET7A 3WP5A 3WDXA 2CU9A 1UW8A 5H8DA 4G27B 2BSCA 3H1MA 1BX2B 3MOBL 4X5RA 4BM8A 3LIZA 5L4JA 2X53S 4OVUA 3EGSB 2ZABA 5CB4B 3PP4L 3TK1A 4G5ZL 2ARBA 2MKWA 5I6PA 3VDDC 4NRMA 1GN3A 5IB4B 1DTUA 1IXBA 4MRBA 5T33L 1EFXB 1HDMB 2DCYA 3CFMA 3DEMA 4Q9RL 4KGLA 5BMVB 5IVBA 3CHRA 4M4PA 5AVZB 4FFBA 3CSTA 3H1HH 1NFIB 4PRIE 4FA8A 1MS4A 1OQDA 2DF7A 5PCYA 3DO7A 4P49A 5EF1A 3II1A 4GXUM 2CUGA 5CA3A 3H4FA 4ODUA 5HDWA 5D4QA 2WXKA 1S7TB 1XH3A 1MRCL 2I5YL 3QG6A 5DQJB 1C4RA 1RZPA 4H13C 4W68A 4EN7B 1QD0A 1EO8L 3GGWA 5JXIA 1YY8B 1F4WH 4OFDA 3GBEA 3B01A 4GX0A 3EH2A 3DBXB 4KO7A 2B59A 1BAFH 1D5XB 4QRPD 4XVSH 1R46A 4JGYA 1NJ9B 5KSAA 3DGEA 1Z9LA 4JANB 3QHZH 1DQML 2NY6B 1OF4A 5JCTA 1LE5B 3UKVA 3ASOB 4ZMXA 2NY2D 2TEPA 3WNLA 3HE7A 3CX5F 4I0CC 3ILPA 4PTTB 4CYDA 1MAML 1ZWIC 2NY4D 4IIJA 1CQYA 3LV3B 3KXFB 4BINA 2WNGA 3C08H 4RGNE 3BN9C 3QO0B 3SDYL 3FCTB 1AYN2 4Y26A 1K8DB 1RIHH 5D1XE 3JXAA 4I0PD 1R1A1 4ZAKD 5FYKD 3N4MA 5AKVA 3RX5A 3ZL4L 3KLDA 4L0PB 5I1EL 4OI1A 1UX6A 1ZEAL 4XUQA 1LWJA 1N4XL 1JYNA 2Q0OC 2EJ7A 1HHKB 2HTKD 2XTJC 4X0KB 3WFEH 5J1TC 1AZRA 4IDJL 1G7HB 4KRNA 3VZMA 5ADPH 2P34A 5FY0A 4WK2B 4ZYKA 2UWEB 4ODXB 3WCSA 4Q20A 2VW6A 5E0FA 4RGOL 5F32A 3LA3A 5ACLA 2P5WA 2DY2A 2A83A 3DX3A 5DEGA 1XQNA 2WANA 3LKQA 4DVBA 2WIIB 5IKCB 1V9U2 1LU1A 4GH4B 4GP4B 4M6NL 1YEJH 4HJSA 3RWFA 4UV9A 4CBZA 1BK0A 3B5LB 3BEVB 3GI9L 1AGBA 3VI3E 3I59B 4MAYB 3SCFA 1MCSA 2K8MA 3QIWC 3WY1A 4UTBA 4UI9L 3ME2A 2WNWA 5GS0C 5DEFA 1WIPA 3UTSE 2EEAA 4TMPA 5AVVB 2PMWB 2WYFA 4QKFA 4OQTH 3F7QA 4UFMA 5T5FA 4K71B 4ZI7A 3CG8A 4O7XA 5SX5H 3I9IA 3QH7A 3VD1A 4JI8O 5BQ7A 2PWHA 1CE6A 4F6RB 3TYFA 2Q7GA 2P2KA 4IRSA 1KWGA 5DK0B 4IRJC 2IC1A 3RYIA 4Z7NE 2L7JA 3HC0A 4HHAB 3UBXA 4DO4A 3ROUA 3PHMA 5F7EH 3WAJA 5C5UA 2EINB 2X4TA 2BDNH 2ZYRA 3FUIA 1T1YB 4J11A 1WBXA 3LSDA 2LTQC 3PJSK 2VAAA 2X3CA 2GVYA 2XXCB 3AT8A 4JGUA 4ZMNA 2D6KA 3H0OA 4L3AA 4NP4H 5LGHL 4XETA 4PJGE 5BCAA 5IQNA 3UYJA 2WLIA 3HMWH 1HI6B 4A38A 2Y60A 1QTPA 2NXYD 4HXAL 3AL6A 3L2NA 2JVDA 2Q3AA 2JD9A 5LEJA 2JQZA 4IBSA 4TNVK 3SJBC 2ZGLA 4PDWA 1XL4A 2VQFB 3BW9B 4N8VA 2DQFA 4B7IA 2VZRA 5FY5A 4BW5A 2OSLA 2P3JA 4DY3A 4HCRH 2PPCA 3NJJA 4BK4A 1AI1L 1XGRA 1PO21 2F6BA 5C0BE 2AW2A 4C56B 1CXFA 3GXUA 1QH6A 1PZ5A 1D3CA 3VRIA 1L7RA 4M01A 1CD0A 4MMZB 3IU4L 1RPQA 3SZKC 4YSUA 3KMDA 4AQEA 5DJCB 2CCLA 1VBB3 1MVYA 3W21A 1JRHH 1SLIA 4W9FC 3GHNA 1S77D 2R1XA 4WFBV 3ISYA 5D7SL 1D7FA 5E1AC 3IMNA 3JD71 5IVFA 4QHUB 1KIRA 2BIHA 3RKDD 3WI9A 2QTWB 2X4QA 4QLRA 1ZLVK 1H3XA 3O4LD 4G6FB 4WW2F 3B2MA 3CD4A 5DO8A 1RZKC 1ZA6B 1CGTA 2CJTA 3EO9L 3ZQ9A 3IJEB 5GS0D 1VF7A 3IRCA 1Q8VA 4Y5XA 3ZZ1A 4HJGA 2CO6A 1RUPH 4LOSA 2PO6B 4R3SB 4PWEA 3TESA 1W9YA 1UZ8A 1HW7A 4NN0A 2ZOLB 5T1KA 4B9GA 3QR0A 5BNOA 1PNDA 3LN9A 1M3IA 4ALAH 2RJLA 5GKAC 3R4UA 3R06A 3MRGA 1ACYH 3S96B 3WIHL 4LPCA 1RAMA 1SFHA 1SQVH 3V5DA 1DE4B 2YC1B 1ODAA 1R24A 2O6EA 4GS7C 3ZDXF 5B1KA 2NN8A 3ARVA 5K9OB 3D34A 2HVKC 1VQKV 4NENB 3DROB 4GRWF 4XZUA 3PJSA 4RH4A 3VDAA 4XPFL 4ZPVA 3BP6A 2EULA 3U83A 1DQ6A 3AJZA 1ZK5A 4XFCA 2YPKA 1XXFC 5FYJU 4JHUA 4QQOA 4COVA 1B6DA 1XZ0B 4ANWA 1I3GH 1RZ7H 4R0LB 1G86A 4EEQA 4GKKB 1UOKA 4UM8A 5E2WL 2YHJA 5CVRA 5F1RA 1VFAB 3NJGA 1FFXA 1RUAL 3O81A 5F70A 2H0JA 2OMYA 4QYAA 3L9RA 3M99B 4Z95H 3CDZB 1NCRC 4OD1L 5LP6B 3SHSA 4DCQB 4CVUA 4M5ZH 4GLRH 2BZCA 1RIVL 2NR6A 4NQED 2DWEC 2AI0L 4TL5A 3UJTL 1KFXL 2JDMA 3EYQD 4P5HA 3VDBA 2WWJA 3N41B 4JG1H 1IB5A 2X44D 1N6VA 2A1WH 1OOPA 4D0BA 2OW4A 4HOXA 4K20A 5L3EA 1XHZA 3TJTA 2G2PA 2K7QA 3U4BL 5BV7B 1Q0EA 3G08A 3VXPB 1B09A 4XJ8A 4XBEH 1PX8A 1RL1A 3DV4A 2JKSA 4L2YA 5J09A 2A0LA 1MIMH 1TFHA 1X5AA 4X7SH 5FW6A 3W9DB 1QSFD 4PJXF 5JHBA 1JHNA 3QBQA 2XTAA 1K73W 1HSAB 2LW3A 1M56B 5LAXB 4WBBA 2ZP8A 2XV3A 1O9HA 1R3IH 3ZX6A 1OF0A 1OY3B 1NXMA 4WAFA 2CHHA 5EC1B 2YDEA 5C8JA 4KQ4H 4DXTA 4JO1L 4ARXA 3ATAA 2XT1B 4AEDC 1CGPA 3K8MA 2KL6A 3EFDH 4LLWB 2LABA 5LCVH 2BTQB 4YHIB 5FLUA 5JOFB 1FFOA 3RUGF 4FJCC 1G9HA 3PXJA 1WBYB 3LD8A 5A32A 1RSFA 4WWKC 5FKBA 1F4XH 3FXIC 3MEPA 2YEZA 3TO2B 2AQRA 4FP2A 1MLBB 5K39B 1N1YA 2BDRA 4F7PA 2HLAB 1D5AA 1S9XA 2VISB 1KY7A 4LVHC 1U92A 5A3PA 4PQ9A 1YJDH 4Y8AA 2HJFC 3ZDWA 1GKOA 4HJTA 2H2PC 5TDNB 3DUSA 1BF8A 4FQJL 4CP0A 1BOYA 3MVSA 3REVA 4EIBA 1KBGL 2HT3C 3S0PA 3DPDA 5EBMB 1KYOJ 2ZAIA 4JRFA 1K3EA 5G5DB 5GZNA 4N53B 3RWDA 3L9JT 3S3XA 2G0LA 3O6MH 5CB4A 3E1ZA 4ZZ8A 4MGSA 3GNML 4KXCA 4M03A 5SWSD 1BG9A 1LQBC 3A24A 1O91A 2Y8KA 1JR9A 1EFXA 3ST7A 1HDMA 2KLSA 2YGOA 4CS3A 3BQUA 4XGZB 3D9AH 2VULA 1NFIA 2IXQB 1EPWA 2PWFA 4QRSB 5D71H 1INDH 3KWXA 3VTAA 2B9UA 1E50A 3LFIA 1S7TA 3GBLA 3SKNA 2XIIA 3D36C 4P57B 5DQJA 4Z3EA 4L3FA 3II2A 3O9WA 3L5WA 1XD1A 2CPCA 5DA4A 2ADEA 4N43B 1ZX3A 2R0WH 4J25A 4DO5A 3HN5A 3Q8BA 3RWGA 3HPNA 3DBXA 1D5XA 5C4WA 4XO9A 1NJ9A 4P4RB 5FREA 4O4HB 1FO0B 5AC91 1OFSA 1LMIA 1KXQA 1NEPA 1ZRIA 4DR2O 3K08A 1P9MC 4W9CC 3HBQA 3D4CA 4YIQA 1FG2A 4JQIL 1S7VB 1U8LB 5CGTA 3SITA 4WI3A 3JWOC 5LQBH 4JGJA 1MZYA 3HKFA 4WWKD 5IQMA 5GZEA 2D3SA 4PTTA 3TXAA 3H85A 3PWUB 4OJYA 3PP4H 3KXFA 4G42A 4G5ZH 3ZRWB 2BVOB 3GB7C 3AREC 3SH4A 4AFMA 2PWDA 4OLYH 5ISLA 4J6IA 4YJ2B 2BGPA 4HIJB 1QFHA 3QO0A 4K9EC 5AW3B 3RWCA 3NXSA 3NJNA 1K8DA 4YRDA 1RINA 4NT6A 1ZLWK 1AUYA 3ARDD 3A4FA 2D73A 1GZHC 3DYMA 1S7WB 3EIFA 3GSVA 3HIZA 4KTEL 1QWRA 4D7SA 2ZPXA 1NTDA 4POZC 4XAWH 2D44A 3OAUL 4XF4A 2H2PD 1VFUA 2X9XA 4H3WA 3OE7G 2WS91 5EIIG 5GRYA 4L37B 5A7EA 1MCLA 1G7HA 3F7VA 2I5YH 2DWTA 3GCWA 4RDQF 2UWEA 5FHBL 1EO8H 5KSBE 2UXBO 2JFCA 4FL4C 4HMEA 2MIZA 2R39A 3BYTA 5DZAA 5C0GB 1H3WM 1GOHA 2QGEA 3PUQA 4HOOA 1GP6A 2WIIA 3IAGC 3HQUA 4QYOB 2XIDA 5HVHB 2DFCA 4LE3A 1BXVA 1DQMH 3RYCA 2IDTA 3BEVA 1QFWL 4LO9A 1SLLA 1YSCA 4KJPD 3S5LB 3SE4A 3I59A 2GH8A 3N9QA 4PJBF 2UURA 4Q29A 1HL5A 1AHWB 4KUMA 4AGOA 3WGUB 4ELDA 5I1HH 4LO8A 3WKML 3IMBA 1YF2A 1U2YA 2FO4A 3G6AB 1MAMH 2Y7OA 2BSRB 4WUUB 4CVZB 3VKFC 1DQIA 2E31A 4IBVA 3U78A 2O5YL 3ABMC 9CGTA 4Q4X1 4WW1B 1XNQB 3MRCB 4GAFB 3E5UA 1Z5YD 3HHSB 1CGSL 2QSTA 1OSZB 3JTBA 1HAUA 4F6RA 3H7LA 3LN4B 4V1DD 4MDJA 3QT2A 4PV9A 3OGCC 5DK0A 4KJQD 1UZWA 5I1EH 1ZEAH 3P77A 1BM7A 1MEC3 1AI7A 4YSOA 5INDB 2YD4A 4YPJA 3ZE1E 4HK0B 1T1YA 1NSNH 4IDJH 3Q8FA 4OHZA 4EI5A 4X42A 4JO4H 4QPIA 1FV3A 5LA2A 4YHOL 2EDOA 4H8WH 4EMZA 1PNGA 3STZB 1W0NA 1PZ7A 1DHKB 2DURA 3L7FA 1HI6A 3ARED 4BZ2A 3VX0A 4GSDL 3EOYG 4M56A 4YHML 1N3NB 3RVUC 4YE0A 3WUWB 15C8L 5BRPA 3BW9A 4KXRA 4GKLA 5I8OH 4PJDB 3IBMA 5ANQA 3ULVL 2P8LA 4ZXBC 4POZD 4UDTA 2J6WA 4B6ZA 3SDXE 5KEZA 4L2NA 3CXHK 4Y2DA 3VUOA 3BPNB 4RFT0 4XT1C 4KTGA 1FAFA 4O9GA 1ORQC 2JDNA 1FZMB 4M61A 4MA8L 4HIHB 1XXNA 2QDVA 1JGEB 2W07B 1C5HA 4TPRL 1PZCA 1GVIA 3L1GA 4ZX5A 3IDNA 1G1OA 4ASUG 1Q0XL 1YNKL 4AI9A 3N7MA 2ZEYA 2BX5A 2CH8A 2VXUH 1U3HC 4J7ZA 2A3WA 4PRIB 3WTSA 5CA1B 1FORL 2D0GA 4QHUA 3HB3B 3WIIH 4GUOA 3BZ4A 4PVLA 4DW1A 2DM4A 4HVQA 1TETH 3T0EB 4JLRA 5EEXA 1J5DA 4MUVA 2RCVA 3BZDA 3OWEA 5LGHH 1YI2V 5EU6E 5D7KE 5FOBA 3F7YC 1OA4A 4WLCA 4GCZA 5T55A 5IYZB 5FYLH 2ZCLL 4HXAH 3I2GA 1W72L 3B1UA 4E4HA 5A6XA 2F43G 1S2EA 2VMEA 1ODUA 2QM8A 5F97E 5CIPH 3T8XB 5IQ9B 2UYAA 3QW9A 4YHPB 3GJEA 4AYMC 4H14A 3LOBA 4LH6A 2YC1A 3MFGB 3QNYB 4KTDL 2PCFB 2ZNWA 4OF5A 5FYLE 5I15L 1HE8A 4U0QB 2EA7A 2HHHO 2AK4E 2FECL 4NZFA 1CAWB 1T5XB 1I1AD 4NENA 1A78A 1XQ8A 4AI8A 1QFWM 3CRAA 2VUYA 3IU4H 5EUKA 3V2AR 4IYKA 2EXHA 5D1XB 3L3DB 1XQ4A 3VFMB 4R0LA 1KLUA 3FTXA 3I2CH 3U0WL 8FABA 4MVQA 5H5NA 3KNBA 3RYFB 3CH1B 4PY8J 3H9HB 4CBPA 3ULUC 4N0FA 5DR5L 2VC9A 3PQYE 1OT2A 1W2BU 2HTLD 2N0MA 4M43L 3RVUD 5EYYA 3SYPA 1AQDB 4FQIH 1DDHA 4ZTPL 3CDZA 4Z3TA 2FHRA 4HMZA 1QOKA 4NO0B 4LSTH 3TH4T 3MA9L 4DCQA 5BO0D 3EO9H 2BSTA 4ZXBD 5LO7A 1CAXB 2N05A 4M6MH 3M8LA 4KY1L 2Q7EA 2EXSA 1AQKL 5I5MA 1UY1A 4AW7A 1NGWA 1H9WA 1BBT3 4V2VA 3QJUB 3VXPA 3VACA 2ZIDA 4NQDE 5L36A 3RKPA 4IYHA 1KGIA 1YI9A 3VI3B 3WIHH 4F1ZA 4QWWC 4MD5B 4B7EA 3SCMC 3W9DA 3FQ4A 1W0WA 1Y76B 5LAXA 4OHWA 3K91A 3ZRFC 4WZ9A 1U3HD 1AL0G 1O9VA 3UTSB 2WN2A 1JPFB 4M7KH 3AG3B 1ENVA 2EIBA 4PM1A 1X5KA 5CJXC 2CK0L 3NCJL 3LNIA 4KGQA 5BNNA 2O61B 2OMUA 4RRPM 4LLWA 3QDGD 5HJ3B 1RZIB 3JZYA 3WD5L 4BFGA 3E8FA 2ZKLA 2BTQA 4Y20B 5FZKA 4NI6A 4OR1A 2UVEA 5JZGB 1SRDA 3PAZA 4Z7NB 4MGKE 1OCZC 4W50A 1EHNA 5FZ0A 2X70B 1DUYB 3WF4A 3ON7A 3KH3A 3UTTD 4P5SA 4QXWA 3UJTH 2FH8A 4NYKA 1MLBA 3DUHA 1HNFA 2AI0H 4ZQTA 2QE3A 5IFPA 2HLAA 4N9OB 3MROB 1JF6A 1TUBA 4PJGB 2XYBA 2CU5A 5IK3B 3BTYA 2CIKB 1OXCA 3C7EA 1OI6A 2XJSA 2ZZUT 4R2GC 3U4BH 4I0AA 3D39A 5BPPA 4A7KA 5IHUL 2FKXA 5EZYB 3UABA 1XWVA 4LLQB 2ISDA 3D85D 1R3HB 1TEFA 5ETUA 4XBFA 5TDNA 2JB5L 4HCFA 4WKZB 4MTFA 5HVFB 3EYPA 2GITA 2VDMH 2ZX3A 5AB2A 1PJWA 4R52A 1BQHG 2RACA 1OP9A 1H0BA 4F37K 2Z31A 1WP6A 3AAZB 3IDJA 4Y2OA 2FHCA 2YEVA 5T1DL 1QKQA 2VOXA 4NXNB 1SS3A 2BFUS 1WP7A 1U33A 5JW3L 5FDYA 1W0JG 2BVVA 4LCCB 2VOWA 1OP5K 1WUNT 1RZ8B 2P6CA 3QUZA 5AOZA 1AQMA 3WJJC 4AE1A 3OYWA 3SNMA 1G7MB 4NXKA 2XKNA 1UYXA 1EMTH 2FNBA 5GJSH 3VGGA 5GSRB 1OANA 5EULV 4XJ9A 1QACA