4PHZA

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
388
structure length
388
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 94
structure length 388
sequence length 388
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4phzA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4phzA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4phzA01
3CHXA 4PI2A 1YEWA 4PI0A 4PHZA 3RGBA 3RFRA 4O65A
chains in the Genus database with same CATH superfamily
4GRWF 4XVOA 1GP6A 3ETBF 5IBLD 4HJGB 1RK1A 5DJ6A 1RSOA 1W2TA 3T4AC 4XX1E 3EYUH 3LRHA 4A7VA 5ITBH 2WZR3 4BV1A 3BA9A 1RMFL 1FH5L 3LNHA 3MBXH 4BZ2A 1R1A2 4H14A 5EOTB 2PGGA 4MJHA 1TZIB 1ORQB 1T0PB 5LBGA 1A8MA 2JKWA 5KS9E 3BVOA 1YYML 1W0PA 5J6SA 4TUKL 3MNMA 3QIBB 5AAPA 4Z8FL 1P8JA 1UF2C 2V1DA 4F37K 4NT6A 3U07A 1F6LL 4MHHI 4ZFGH 2YBRA 5E0QA 1NDGA 1HI6B 4XPBH 1OP3H 2ZTNA 3RG0A 1N8RW 5FYLE 2EIZA 4POZC 4APXB 3BU0A 1YEHH 2X1QA 1S3KH 1NTMH 2CO7A 1KIQB 2VN5A 2XJLA 4JJOA 4GXFA 3HVDA 3HRZB 3ACIA 3OSVA 2LFSA 1LILA 3QRBA 4LLMA 3I2FA 4OLLA 2FATH 1J1LA 4QCIB 1AJ7H 3C6SA 1OAJA 3LXCA 4LBAA 1VBC2 4EWEA 1L0YA 5J48A 2WQUA 4V2CB 4MQSB 2W0FB 3GXNA 3QDJA 5A3ID 4D0CB 2FR4A 5HDWA 3BFWA 3NXSA 3QUZA 4Q74A 3ZPYA 2EC9T 5F3BB 4TVPD 3AKPA 1IC1A 2DQUL 2VM9A 4MJ6B 1ES0A 1IFRA 5HYSB 3BFRA 1BBT1 1UZ0A 1XNQB 3MAWA 1QJU3 3MRHB 2PAMA 2BRRL 4Q6IC 4DINB 3ZSSA 1P84J 3VBOA 5I1HH 1D9KA 1CDUA 2KZ1B 1T2QH 4GQ9H 1P49A 4ODSL 2IAMD 4IV3B 2D31A 5JQ6H 1B90A 5I71C 4F57H 4XNUL 4FTVA 5HHPA 1J95A 2FKXA 1AXTL 1J8HD 4NZJA 2OJ1A 3TZVC 3UCRA 2V5RA 1UZZA 1OCCC 1KIRB 3MIGA 3I9IA 3CDCA 3G04B 4Q6YA 3TN0B 5K69A 4OZIE 2ZA9A 1AKJB 1WLDA 5DD3L 3KG5A 4L8BA 3K1DA 3NCJH 5EOQH 4FLUA 4JFDA 4OZGF 5ICXA 5AAMA 5TTRA 2D6MA 4IJ3C 1OJHA 2ADYA 2A4EA 3K57A 2DI8A 5HHOB 3AC0A 3KZ8A 1H8EG 3TCUA 4N2IA 4WF7A 3ABUA 3JQXA 2IBBA 4N2KA 1RJLB 2XAHA 2PI5A 1DVTA 3SPVA 1S2EA 1CAWA 1SVZA 2OL3B 4KJPC 4ZOAA 4IRZL 3FQXB 1G7IA 4Y2DC 4TN9A 4MQXD 4QNPE 4HOMA 2F6BA 1N4XH 3QIWC 1JHNA 3CDGB 1YNAA 2HG0A 1WC7B 3TPUB 3QJHA 1S9WB 3AB0C 2VN6A 2WNXA 3FB5B 3MLSH 4AJWA 4U2AA 3BTYA 2XXGA 3T1HO 1DVZA 3H3PH 1JZGA 5I9QC 1RZIA 2PFWA 1XGTB 2IBGA 3SQOL 3BT0A 2PW2B 3EH2A 4QWWD 3HKZA 3JCZA 4G9FD 1AR73 1TMF3 4F7ZA 1Q8SA 3F64A 1G9ML 2RR3A 2BHFA 3IAGC 2FJUB 3AKRA 4G8AC 5APAA 4LVOC 1P0SE 2BOBA 5IBUG 1ZXQA 4I3GA 3ZE1E 5IHZB 2ZWNA 5LGTA 4PEEA 1WE5A 1MH5B 4M7JL 4Y16D 5I66B 4YSEA 4NCC1 2WQ8A 3V52L 2N7AA 1XIWB 5GS1B 4J80A 3HUJB 1DLHA 3HS8A 3B01A 4AGPA 5C0FB 4NKQB 4CC6A 4ELMA 2OT7A 5E5UB 1DQMH 1BYHA 2DQFB 2L4OA 5AVSB 4JW3A 4OFYA 4CCJA 3OZKA 1MCHA 4GG8A 2Y3AA 4OB5L 3VNYA 3BB6A 4HUXA 1QZNA 4MXWA 3FZUC 2R2EB 2IPUK 1SM3H 1Z32X 2COVD 5T5OA 5D6DA 1KCWA 4MYEA 3EO1B 4I55A 3ULSA 4RGMC 4TTGA 2F8XC 3QH3A 1S9XB 3CU7A 4PIXA 1UD3A 5AZUA 2CJSA 2W94A 2GJRA 3K81A 3HQXA 5B8CC 4BFBD 5H4ZA 5C0BE 1IQWH 3GXFA 4HIPA 5AG9A 4FQLL 1H6XA 4V33A 3IDAA 5KAFZ 1F1GA 1N1TA 1J11A 2EBOA 3O3DA 6PAZA 3VTAA 2JELL 4CCCA 2RQ8A 2UY7B 5AW7B 3FB6C 3UTQB 3DPRA 3CFNA 2YLKA 3RVYA 1XH3A 3U0TB 1JUIA 1IGCL 3NAAL 1E8XA 3DETC 5B21A 3O0WA 1U8NA 4K7FA 4HKBB 4PJ8D 3IPFA 4U1JA 2JK5A 3SE3A 5IV2A 1RUD2 1AS7A 1BIHA 3LKJA 3L6FB 4K23L 1JZJA 4KTEL 3MJ7A 2B42B 5CB7A 1W72H 2BP3A 4R2GC 3K04A 1RZJH 2BC4A 2ZX8A 3H55A 3NCYP 4HS8L 4JRYD 5F7EH 2R041 3POIA 1E6JL 4Z3TA 4X8PA 3KLHD 4NZRH 2R29H 5E51A 3ZYRA 3P2BA 4RISL 2B3RA 4FQIL 1FNGA 3RSJA 1G9NL 2MIZA 4IMKC 1KGCE 3HC4H 3U6RA 3SITA 4BW9A 2Z35A 3AYDA 1FNSL 2XVBA 4ES9A 1KENH 4JEGB 4CH5A 5JHLH 4Q4Y1 2YZ1A 4DVRH 4BXFA 1HE7A 1MCJA 5HGGS 3O4OB 4D9QD 1LOAA 5LP6B 4N0YH 4XP5H 3HNBM 5CEYA 3BPCB 1CG9B 1IC7L 1QFWI 3X3GH 2ZGRA 5DRNB 3SNMA 2VMCA 5C0RH 4JY4A 5I8CA 5CKQA 3SEEA 5EZLB 3NSCA 5T8IA 1AR61 4H44B 5JI9A 2OTUA 3EIFA 4B3TB 2GT9A 4G70B 4GJTB 5IFJA 1KXQE 1A6TB 4BHPA 4X0NA 2XQXA 3IDYB 4OUUA 4JI0B 4AG4L 1CAUA 4QQLA 4Z7OB 4YVSB 4GW5B 3KZ4C 5EWSA 2JG8B 1FS0G 1SDDB 2OXGA 3IFPB 3VD7A 3MICA 5EIBD 4Z23A 1TUEB 3HC3L 4H26B 2YZ8A 1O75A 5EBGA 3IGFA 2H6BA 2NTFB 4AGNA 2XWCA 3UESA 2WYHA 3BTAA 3MLKA 1CF8H 3VSUA 4HMZA 3GYDA 3GRWA 3QUXB 4U7SA 1XBDA 2FJFA 2MFNA 1R33A 1VBB1 4UU9B 4N2AA 2EE0A 2NUPB 4F9LC 1LU1A 4L05A 1R5WA 5JOXA 1NFDA 5EFIA 1T7XA 2F74B 3ULUC 2IDTA 4BM7A 5E4IA 1NH2B 1MCCA 1XWVA 4YEEA 3WW1A 4PJEE 1N19A 4KJQC 4L9LC 4P5TC 4OFIA 4RFNB 2R4RH 4FXKB 3WIHA 5HI5C 3CJIB 3O4LA 4UUJB 5EN2B 1RK0A 2DDQH 2WBJB 4FHKA 3ARGB 4ZFZB 3GZKA 1DP0A 4HHAB 4I9WD 1YEFH 2Q8AH 3JYBA 2H6CA 5IJRA 1DLBA 3CSFA 2NY3B 2WXRA 4OVUA 2DI7A 3P4MB 2WLZA 3BVXA 5AUMA 3SH4A 4NERA 3Q4HA 2VUKA 3MI6A 3ZFEC 3F7QA 4BWTA 2XASA 1DYZA 1H8SA 1MF2H 1ZKAA 4GBXB 5LLIC 4JGSA 3NAPC 2V2XB 2YA2A 3DDGA 4JZJC 2N04A 1NAMA 1UXSB 2I07B 4CC4C 4X0KB 1E90A 5IOKA 2CTVA 4E27A 4NJAH 4NXNB 4OLVL 3A0BZ 4C58B 2XRAH 5CSZB 1SF3A 5A7OA 4G42A 4BU2A 5HV4A 2QDNA 3K74B 3FLRA 3RTQB 3T77A 3CQOA 3GZQA 4UV7H 5KAIZ 4P2YA 4TZDA 3SE4A 3GHEL 2P43B 1FL5A 3DPDA 3NIFF 2KDYA 5TF1H 3KXFA 4UILL 1V3KA 1ZK5A 1NBCA 1FYTD 4JM2F 1FE8L 4QX0A 1ZS2A 4MSWB 2R0LL 3VFWB 2B2XH 4FFHA 4GW1B 3PGCA 5KVEE 3D3VA 4TRPL 3SQBA 4YDLB 3CLEH 2QVFB 4W6XB 5HDOA 4R4ND 4L87A 1WFOA 4WGWB 2E7LC 2MOQA 5MENE 15C8H 5BW7A 5EUKB 2Q87A 4CCDA 5E6RB 4CMHB 1BREA 3NCXA 3OGCA 4K20A 1S7UA 4FFWD 3ZXJA 6CGTA 3ILRA 1SJHB 1TJGL 4XURA 5HYIA 3G6AA 3AG2C 5B39A 3LEGA 4DRXB 4MVRA 3WDIA 4AX3A 4XMIA 4IOSA 4KKLC 3SYCA 2C3VB 5IROC 3V7AE 4RWYH 4QRRA 5M94B 1W6NB 4IJTA 1SQBH 4O4JB 1IEAB 5GGTA 1BBT3 2W9DH 1HKLH 5AW9B 3A0NA 2ZCEA 1J0IA 3AUWB 2ESVA 3LSQA 3VG0H 1GM8A 1YI7A 1YECH 2G60L 2SEBB 5IMOB 3OY8B 2MQ3A 4P14A 1Y6NR 2FL5A 1WB7A 4NPMA 1AE6L 1T2JA 5FLVA 3DGEA 2YXLA 1JMXA 3FT4B 4IV1C 3WLUA 4KUZL 3EOAB 4P05A 2DU1A 2QGBA 3MV8A 1SRDA 4AEDB 1A0QL 5DURD 3C6LA 2XZAL 8FABA 5C3RA 4M61B 3D9AH 3X2QC 3O1PA 3JWDL 3CNKA 4G2AA 3V4VH 5IYYA 4NO0B 1K4DA 3VVVA 3JQWA 1NS1A 1KPUB 4LARH 1ZS8A 3N1GC 3ZIAG 2ENYA 1AI5A 2Q76B 1H5BA 4NRZA 4AVHA 3V9EA 3RY5A 2A9ML 4KMLB 1Z5VA 2XIIA 5EF2A 3H3LA 2GIXA 1FYUA 3AADB 1HHJA 4MGXA 2XACC 5CG8A 5LEKA 1OHZA 1ZHLA 4XWOC 3VXPA 1OVSA 5K0UB 3L81A 3FO0L 1G1YA 1VP7A 4IHBA 2K3TA 2C5DC 2HHHO 3V6OA 5HHQA 3POJA 3C5SA 4QHNA 4HSQA 4HJ0C 2NR5A 2WVVB 4QRPD 4PR5A 1KULA 1H6UA 1BE3H 1YQ6A 3QPKA 5KXDA 2ZYSA 2GEEA 5C0EB 1S7SA 3TL5A 3GYRA 1FWXA 1CQKA 5I0VA 1RJ7A 3ZXLA 4M5ZH 4HXBH 2JCCF 3VFVA 3QIUC 4YWGH 5KSBB 3JAKA 1N1YA 1JPGB 2R063 1T1YB 4MAZA 4XXAA 5JIKA 4HEMA 4PJ9D 4C55A 4EZKA 1PPJH 5I8OH 5GLUA 3A4UA 3GJFK 4PA4A 1ENSA 3LD8C 4MAUL 4LBKA 3DA0A 4DUYO 1XGPA 4M5YL 4NYLB 4IEFB 2X7LA 4K5MA 4EI6B 1C1LA 2Q8BL 1GFF2 1G7MA 3QS2A 2W46A 2NPIA 2CCLA 5FM5O 2QSAA 5FYLL 4QRTA 3VU1A 5J1SC 3LDRA 2QPSA 4NP4H 4YK4B 5JYMA 2XHKA 1MRDH 5FK9A 4X64O 4Q6IB 4I48B 4OHVA 3ZBMA 5ADOL 4DP0X 5B5EZ 4PVLA 3VMOA 3D3AA 1A1MB 4CEWC 5T3ZE 3CMOL 5FYKD 2QWRB 1Y7BA 3ULUE 2IFGA 1M7DA 3VGDA 3OEHG 5I71B 2JDAA 5J37A 43C9B 2JB6A 1XGQA 2JKNA 2BIQA 4YBQD 3TZVB 2N7GA 4E9KA 2FCBA 1C08A 4A2DA 1E27B 4B7KA 1IZJA 2EKSB 3VDDB 2ZGKA 2AABL 3E8GA 1ZLDA 4MB4A 1RIRA 1T7YA 3DSQA 1IBMB 1KIPB 1S5LZ 4PDLA 2UYAA 1C1EH 1MFCH 2AYHA 4PWKA 3IEAA 2Z7YA 2N7BA 5EC1A 1ZLSH 3I3BA 4DO4A 1QR8A 3OR6B 3HPLB 1HKDA 3ROOB 3FYEB 5IESL 5C8CA 4O2EA 3EGDB 1K42A 1N0LA 1P53A 4XVJH 4IEZA 4ZMWA 4AQEA 2WKLA 4K3DH 4X8JA 1VADB 4M6OH 1OUXA 1IS6A 1ITCA 3E9UA 4PLJD 4OQTH 4JC1A 5EO9A 4IIJB 1S9YB 5FHBL 5IR1B 1A4KA 2G9FA 1PW3A 4JGUA 2VMHA 4N7UA 4KRMB 4IEYA 3PNWA 2LW3A 1RJYB 2XQ0A 2HLAB 2LTQC 3GT6A 3QEHA 4YDKL 2Z31C 2J8UE 5GISH 3SDXE 1ZHKB 1YLLA 2HXAA 4BZ1A 4GRLD 1UWWA 1YEIL 3MOBL 4J11A 2NY7H 5FZKA 3T4HB 3LN9A 4LVOB 1FUNA 2XV3A 4NI6A 4UCFA 5TE4H 2JQAA 3CCLV 2NY6C 2PP7A 2X10A 2ZPKL 3FRUB 1DVFD 4BSVB 5FPVA 3GIZL 4FXTA 4LLVB 4P4RB 4PBVC 1WFJA 3HI6L 2B0SL 1UYXA 3F6LA 3A4DA 3ARZA 4XCCH 2D6OX 4OLZL 3ZHVA 3I3DA 4O58H 4K8RH 1TPXC 5D8AB 4KDVA 1FLRL 1BFVL 2Q8EA 5TD4A 4GRWE 1KCUH 2J56A 3L2MA 4OV5A 3PMSA 5FCUL 4QX3A 1J5OH 5EYPB 1GZHA 1TT6A 1FVEA 1YY9C 1NLBH 2QADC 1UOVA 4L3CB 4N26A 3RZKA 1CC3A 2IJJA 3T1YO 1QW8A 2HFFA 4P23B 3U7AA 1QKZH 3BSHA 4IK7A 3X3FH 1ID2A 3HN8A 3KPLA 5BOPA 5C4WA 4S2FA 1PLAA 4PA9A 4KOBA 2D9CA 4RGMB 2EH8L 4V11A 2X09A 2H2SD 1TETL 2EVHA 2AEQH 3FBKA 3QEGH 4GSRA 3TJHD 4X7FC 2YD1A 3QRGH 4NB5A 1F86A 2CL2A 1EN6A 3UP6A 1MHPL 2V9UA 3CZUB 1DBMH 4TQEL 5KVFE 3V0AC 4OYUA 4AFCA 4BA8A 3WN6A 2PYFA 1I8IA 4U0QB 3VDCA 1IT9L 1AI1L 2ICEA 3GZAA 4XDJA 2G3XA 3KLAB 1RFDL 4QTHA 3H3BC 1NXMA 4QPGB 4WZ9A 4HL0A 4FMVA 1RHFA 5IOPB 2V5TA 5E24E 1UUNA 2GEQA 1FO0A 4PA7A 2MK3A 2LE9A 1DQ6A 4FC3E 4P5KB 3S6PA 4YARA 5C9AC 1H3VA 5AKSA 3FZ3A 2WQSA 4KI5M 5B1BC 1BBDH 2ERJC 2ZYRA 2L04A 1RP3B 4Z9KB 4MXQC 4J4PC 5E9DA 5TQ2H 4EN3D 1VPHA 4DNLA 1U96A 3I2HA 1OB1A 1EEYA 1SEBB 4HAMA 2OYMA 4H8PA 1O7DC 2VGLM 1Q8VA 5FGBC 2YD7A 4NGHH 1LB2A 1YEDB 4JFYB 2V4DA 3BWZA 1W9YA 2B59B 3KCCA 1A34A 2X4SA 4YUEH 5HVHB 4JAMA 2WSUA 2GW5A 4OW6A 4AQ1C 4UIMA 4DP6X 2HN7A 1DDHA 5CAYB 3BH9B 2J6WA 4G3YL 4LCVA 4YXHL 5IB4A 3LIHA 5CFDB 3JT0A 2BYVE 1UA3A 1IL1B 2NT0A 4OZFA 5H4YA 1ZVSB 3FT0A 1KN4H 4M3KB 4MZIA 5HYJA 4KKBD 4QHMA 5FY5A 2MCAA 3T2QA 4LPWA 1AYRA 1OARL 4JFED 4NQTA 3NJNA 1UOWA 5EZOH 1UA7A 1AH1A 3MIHA 1BGXL 5D1QB 5E56A 5DUJA 1A6ZB 4PJDA 5ADPH 5IFAL 3LS4L 1RZKH 2WC7A 5EYYA 4MJ5A 4OZGE 5ACA2 2ATKB 4H37A 1TTAA 4KO5A 2WUBH 3IVKB 3U2SB 1CURA 1BJ1H 4MA8L 5ACZB 3BP7B 3IU4H 1QSEB 1HXKA 1KB9J 1P7QB 2E86A 3DOHA 4I0PA 1MKFA 4L1SA 4PW9A 4QJ4B 1O4ZA 5DC9B 1RPKA 4Y4YA 4MQ7B 1LHUA 2FEDD 4N6QA 4HF5H 3T2TA 2Z9TA 4H25B 3W2DH 4LHSA 4XXDB 4GKSA 4AI2A 1JPSL 1LEKB 3GMPA 1RFYA 3L3OA 4U33A 1PKQB 4O2CA 4YBLB 4XI5C 5I6LA 4ZO7A 2YBPA 4YW2A 4GQQA 4DR4O 1OURA 2QQKA 2DY2A 1DK1A 4FQXB 3V9FA 3WEXB 2EINC 4W6WB 2ADEA 3ZXFA 1PYWA 4MVBC 1HCYA 4ANVA 4KUCF 2FDJA 2APSA 1GM7A 3V6ZB 4YHOH 5C0IA 1KB5H 1Q9KB 3E89A 1CDJA 3GBFA 2NNAA 4WU5A 4QXKA 4NNYA 1WCBB 4K55A 2P90A 5BJTA 1JW6A 3APBA 2Q9LA 4KU1A 4N2HA 4QAWA 3EFFB 5HD8D 5DMIL 5EIIA 1DQQB 2OUJA 4CDXC 1B0GB 4FG2A 4X6DF 5E6IA 1EXHA 4RGKA 3SDYL 4AMXA 4PIYA 4WUUE 3UG3A 3VJ6B 2Y23A 2E3VA 5E4EB 1YEGL 1YQ5A 3ZFEB 4FFBB 2P28B 4NKDB 5MEOB 4PJGA 2FWOB 5D5QA 2VW2A 1FP5A 2VQFB 2F54B 1XEDA 4JZJB 3V8CA 1MNNA 4JGYB 1IFHL 4HCGA 2YPLE 1L7TL 4BKTC 3B5LB 4UCTA 4XMLL 2XWEA 5BMFL 3RYIB 3RWGB 4JAUA 3IXAB 5F21B 2LU3A 4HCRA 3O1SA 1XQNA 2VR8A 4H3WA 3OKDA 1D6VL 3JD2A 2VSCA 1VAVA 1U4EA 4OV6F 4EBQL 1UKQA 2P3IA 3P3PA 4YNYB 1NCAH 5C09D 1UY2A 2A5ZA 1M05A 5HYSG 1SMAA 2G0KA 4LDOB 3BKZA 4QAMB 1J05A 1F4WH 1KBGH 3ECVA 3WF0A 1AR81 5EBMA 1FA4A 2I9LA 3FMGL 3SKUD 5JHDD 3Q48A 4PJAB 5L88L 1QR9A 2YAMA 2JIXB 3FT3B 3O2WL 4L29A 3ZT5A 2ZX4A 4A6YA 1EVTC 1SQ2N 4QHKI 5KYUB 2HFEA 2JSFA 3IDXL 2Z64C 3OTTA 5C08D 3AP4A 2E9QA 3A7QA 3UK9A 5G55A 2G30A 1HCFX 2GSIA 5KVDH 5EIQA 4DW2L 4NNXA 4LLDA 4ONOA 3RWNA 2RDRA 2PW1B 4JPKH 3J81N 1S55A 2QL1A 2JDNA 3WG2A 3VQ1C 5JJNB 1YMHA 2YPJA 4BWWA 3E97A 5EZIH 3ZYJB 2DTYA 2QQLH 2PO6A 4XTPA 3RFRA 4OGQC 4WZCA 2ICWJ 1N6QH 1K9TA 1FJ1B 1QG3A 3KDPB 4JFQB 3U2IA 4IE7A 5GJSH 2XBO2 3O9WD 1DBAH 3QUKA 4JHUA 4QF1B 4BCZA 5I8EA 4EQ3A 3QO1B 4IV1B 3FBYA 5CR8A 2H0EA 4MJ4A 2W1NA 2GJJA 3PP4H 2NY1D 2C7FA 2X0LA 4QPKA 1T3FA 2DV6A 3H6AA 4NQDA 4E9SA 4BQCA 1VJ2A 1G1OA 4NKIL 1GYCA 1ENXA 2VRQA 1NU1H 1U93B 4Z0BH 4AK1A 2ZR2A 4Q4Y2 1T1ZA 4R9CA 4Y5VC 3LNDA 1YC61 2GUZB 1PD3A 1J1OL 1SLTA 5ABAA 4QT6A 4O61A 3AL6A 4QQPA 3GSWB 4IRSC 1QR1A 3S3BB 4DFHA 1HTYA 3IJSB 3CVIL 2QNKA 4POYA 4LSRH 1SBSH 1LWRA 3WOVA 4M7ZC 3IFOB 3KSCA 3LB6C 4I01A 4UBGA 3KNBA 4K73A 2F53D 2ZX0A 2LAGB 5IEHA 1O7DE 3M6DA 3D36C 1S5IL 4I3SH 2A9BA 3CFMA 1IXBA 1G4MA 3HKFA 3ZJZA 4RIRA 1FX5A 3CTTA 1MS5A 3QG5A 3TTYA 5E23A 1QO3B 2VC9A 4M1GH 3RIFF 5HHMD 4AYID 1IAMA 1T6GC 2LALA 1KLFB 3PL6D 4FZEH 2HT3D 3BZDA 2CXGA 3CFCH 3RJOA 1BF8A 2QZ3A 4JVWA 4XBGB 1I0HA 5CJXC 2Y6HA 4G27B 3CN1A 4MASA 1UU6A 4XO4A 3T0DA 1MREL 1I5XA 1CESA 1FH2A 1B2YA 2VABB 5A9GA 3O0LA 3T1WA 1GZWB 3WR0A 1MAMH 3VFTB 4C8DA 4JY5L 4CEYC 4UI9L 2HRPH 1Q8PA 4LP8A 3EJZC 4TQHA 3VFPB 5LGNA 2WP3T 5HPMA 1QSVA 4AHWA 2W65A 3FQNA 3MA9H 2IMMA 4FPEA 4QLRA 1ND3A 2OX5B 1DFXA 1S7QB 4MXVF 3NEOA 4OMDA 5FY1A 1UGNA 4KMTL 2HJIA 3U30C 1I8UA 2Z8SA 3ZDSA 4DIXA 3QNYA 3K06A 2VXQA 4A6OA 4GH4A 1EHLH 2V2WA 2LTNA 2F8OA 1RH8A 2AEPL 4XCYB 1F1DA 1XO8A 3VBFA 4AH2B 4OPAA 2A83A 1GRWA 5DHVB 5IATA 1W6WA 3AXIA 3NIFE 2WKGA 3BGMB 3SJBC 2WXPA 2WTOA 3PGDA 4GMTH 3AM8A 3DUHA 3RKDD 4QGYA 1BLIA 4NBYB 2UXTA 5TDPB 4BR6A 1DQLH 2EEAA 5GRUL 1T0OA 3MUJA 1H2MA 2ZSVA 5L4IA 5CSGA 4UAPA 4QHZA 4YJ2A 3GMLA 4ZXBB 4AVBA 4JTOA 2YO3A 2FMYA 5L9RA 5ELIA 3U1SH 3BE1L 3NW4A 2QVKA 1AR1D 3FN0L 4ODHH 5T3ZL 3HZKB 1KBKA 5FGCB 4E9QA 2Y38A 1VAMA 3TN92 1MFAL 1RD6A 2RALA 4AYGA 3ULUL 1YYLL 5DJDB 5CYYA 1RZGA 2K1MA 3P32A 4P2AA 4L11A 4YZ1A 3SKOA 2FB4H 3F7YC 1BD2E 3RA7L 1V7MH 2BE3A 1R5IB 1NTZH 3BZ4A 5AWNL 5J6HB 2Z6FA 4ZX5A 3S3WA 1G1XB 1JXDA 5C0DB 1YJDC 1U3NA 4Q0PA 4ET7A 3CLWA 2DCJA 4XN1A 4X8AA 4IRJA 3POEA 5KZCD 1OE2A 4ABUA 4P2RD 2V2TA 5GS3A 4FIPC 5L7OC 1AI6A 1HH9B 3NGBB 4TSCL 5F6IB 3W20A 2VLLB 2P46B 2Z31B 1UD1A 1ZL8B 5LA6A 5IYZB 3MJ8A 4WFFE 4XO8A 1R3JC 4XP6L 1BXHA 4ZKTB 5I16B 1PIGA 3B7MA 2EH7L 1S6NA 1HSAB 4KZDL 3GPEA 5JMOC 1IQDB 5JW4N 5BQ7A 3UJIL 3Q06A 1GWLA 3EXUA 1JS4A 1O5LA 1U8HA 2BINA 1LGCA 3OAAG 4DO6A 3Q2WA 1TPXB 1SYSB 2EECA 4R0LB 3VWKA 3VKFC 2VXVH 1E5HA 3IAQA 5TFSH 2NY4C 3DMMB 4OF8A 1CF1A 2OPCA 4KBZA 4TNVF 4YGBA 3ET9F 2LGNA 3MZTA 3TNMA 1L0LH 3S2AA 3GCXA 4PRIE 1YEEL 4KI5C 4RBPK 3T2MA 4JHAL 1X36A 3ZK0A 3AVSA 1MDAA 2QADB 3Q8FA 4DV0O 5FHAL 1MCOL 1RIHH 4Z5RA 5I1IH 1US3A 1NOAA 1ALYA 2XJPA 3N36A 5A7PA 1D5XB 1GOFA 5IY5B 2IH9A 3ESVF 5GZGA 1UJ3A 1YXBA 1SMOA 1JWSA 2AF2A 3RI9A 5KHJA 4Y4KC 2F4PA 1R6NA 3CFQA 3S7IA 4EWAA 3V0AB 1OAYH 4CS4A 1SZNA 1VFAA 1Q4NX 3BVNA 5CJBA 1OM3H 3VL9A 2VQEB 2WJ7A 5C9KA 4YC2C 1IPKA 1ZANL 4LBMA 4IRZA 4RAVB 3K0GA 3NL1A 4K8RD 4EEEA 2P06A 1PK6A 5GTIZ 4NBXB 1H2GA 2JCCE 3HR6A 5LA1A 4FG6D 3SGIA 2J1YA 3D08A 3FOLB 4WF9V 4LVHC 3VFMA 1BHAA 3QCTL 5AZEL 4DKFH 4HGKC 5IQ7L 5C9AB 1A7BA 1NCNA 5I1JH 3IMWA 1ZWIC 5B1BB 2ERJB 4V1DD 3SQOA 2UY6A 5GRVL 1CBVH 1ESOA 2R1BA 1LK2A 3SBRA 4LA3A 4MGTA 1TIUA 1UWEH 4ALAL 4GA9A 2R56H 3CC5A 1U9KA 3JTTB 3MLYH 4QRUA 3F12B 3AMNA 1U92A 3M07A 1IM3A 4DR5B 2HCZX 4KXDA 5CIPA 4J9ZB 3QEQD 1ZGLB 1GQHA 1UO9A 2CAUA 2XJSA 3GLEA 2A6KA 4EFEA 5LQBL 1PGSA 2WVUA 4JZNA 1SLLA 3LA3A 4AQ1B 1Z5WA 1YUKB 4TV9A 2W59A 4WO4B 5EOCH 2HTLC 1C4RA 4GLXA 1KFXL 4HXCA 4Y26A 4BFGA 3DKQA 3CH1A 3BQUD 2VR6A 1NGYB 2G4GA 4TTDC 2NXYD 3F7VC 1OV8A 3I02B 4P9WA 5ABJC 3TK1A 3G5XA 2OXHB 2EYRB 2WOYA 5F97E 2D7TH 4AEHH 1JZ6A 3UTTA 3UXFA 2FO1A 1AR83 4NM8H 2K70A 1X7QA 2XN2A 3IKCB 3W3BA 5HI0A 5L2KB 2XXFA 4A3ZA 4LHJB 3VRJA 4LHUB 4U4IA 1BX2A 1QBLH 4L9DA 3QUYB 1QXPA 4PDWA 2OX0A 3LKOA 1H3UA 4PJFF 4U1KB 1KB9F 3ZQ9A 5C3LD 1QLEH 4IDLA 4OLUH 1F90H 2BPBA 3K6OA 3UKMA 1WZLA 4KY1H 2F7RA 4I89A 2QVSB 4EWDA 1YO8A 4G8GD 5LBFA 4L4TE 4BFNA 4AHZA 5FP3A 3MLRH 2MNWA 4U1NB 3QVNA 1DBBH 2WGNB 5FRAA 4AWDA 3PUAA 2P42B 5C5UA 3MRDB 2EE6A 4DGUA 3BDYH 2WK2A 2VR9A 3KB5A 2C3XA 3RWDB 1P4RA 5CU5A 2CO1A 2JKXA 2KBGA 2OMNA 2PHLA 1X9RA 2BNRB 1RU9L 3Q5OA 3KS0J 3S5ZA 3VXRE 3WY4A 1BLNA 4OIFA 3LSUA 5F6HI 5I1LA 3OR7B 2JDMA 2Y07H 1M4WA 4WNSA 1T03L 4B3RO 3UNPA 2WXHA 3ARTA 3IYLW 1NIEA 3E6HB 5E00A 3WXVH 2ZJSL 5CD3B 2NLJA 1BL8A 5G5DB 4N8MA 3IBOA 3MCYA 2HVJC 5TDNA 1OUSA 3DHUA 4ZW8A 1F8TL 2W5PA 3MRKA 3EOTH 3SD2A 2D44A 5F3EA 4ZZFA 3O3UN 5KANG 4D0DB 3WD5L 3N42B 2WXLA 4PYGA 5KVMC 4J41A 2R071 3D18A 1N3NA 2B1HL 2ALWA 1ZZCA 1GW6A 4DJMA 2QCSB 1L3NA 4HA1A 5CGYD 3WI9A 1P5UB 3QHFH 2WS91 1P4UA 3QIBD 3SISA 4R7NA 3EYFB 3TBVA 3LZZA 1JNNH 4MVSA 4HUUB 4XFFA 2ZUVA 2EDOA 3RIAK 1J8RA 2OQJB 4N7IA 5CB4A 1N8OE 4AG4A 5ANHA 3MW3A 5ESAA 5C07E 4ZMNA 4QRAA 2CV6A 2NCEA 1EZVH 5KYWA 5FBZA 2K4WA 1FYHB 3CX5J 4DEPC 1VBB2 1FD9A 2UXFA 4CKQA 3HMWL 4Z7WF 2W5FA 3AG3B 1RUMH 3JCUZ 4O4HB 4L1LA 1JHTB 3EJYC 1AR4A 4CDUA 3IDGB 3A6CH 2PLV3 1AY1H 2AJSH 2ZSWB 3FB8A 3HT1A 3BUYA 4XFBA 5CA1B 2PYEB 2RCSH 2WP3O 3JD72 1M3JA 3M7OA 3WE6A 1UB5B 2WLIA 2X6MA 2H7WA 2D3PA 4MGZE 3SHRA 3P0YH 2X9XA 4LFHG 2MPVA 3FSOA 5D4IA 5HPOA 5I75C 4JI7O 4NWVA 1U58B 1QQP1 1OP5H 1IAIM 2UXXA 1JZIA 1DE4A 4DUWA 3MRIA 1REFA 2XLAA 3QQDB 3HR0A 1DFQA 4ASKA 3KT7A 1UWXK 2YUZA 3C8KB 1AZUA 3DX2A 5DK3A 3OZ9L 3P40A 1TNRA 3TBCA 1B35A 4NQCA 1F51A 3CXHK 4HAFA 4GQRA 4E9YA 1AKJD 2UUCO 2JXMB 1NUKA 5AALA 3SCMC 2OJZL 1XCQB 3BAYA 3IDJB 3ESOA 4JHVA 5K39A 1EAH3 4LF9B 3ROLA 4DIQA 1W0WA 2VR3A 4BQXA 1XNTA 4HPKB 2UZXA 1UGKA 3DV4A 3GZOA 5HHXL 3WNMA 5K59F 4P00B 1BQHB 4Q4EA 4B9JA 3B3BA 4Z7QF 2IDUA 1AP6A 4HG6B 4DP8X 2BVOB 5EUOB 4AAXA 3MUY1 4UNUA 2WTPA 2ZEZA 4Q4X3 3BH8B 5J6GB 3U4SA 5K9YA 4Y5VB 3ATBA 1NWPA 4D7TA 3GSUB 1C7SA 2LQTA 4O4IB 3GHMA 3AZZA 3QOPA 2DUPA 1XB3A 5F9TA 3R65A 4H8HA 1O8SA 2AKRA 2YEVB 1IE4A 4DUXA 3EDJA 2OP4H 1I9JL 2P4KA 1I9IH 1KN2L 2EDFA 3BVDB 3KPTA 3BKYH 5T1LA 1HZLA 1ULEA 1WKYA 3GFUA 2KZBA 4XHXA 4B5EA 4ETQB 1CMOA 4CW1A 1GIGL 3AFLA 4D8MA 4XVUD 2WJ5A 3EGSB 3M17A 4UT9L 2LR4A 5AEAA 2D3NA 4ZXEA 3RZZA 1ZA4A 4B3EA 3AT0A 1KLGA 3M86A 4HKZA 1Q0YH 1Y67A 3VW3L 4JO4L 3EO6A 1P7KA 5C0ND 1ET5A 1N0XL 3GXTA 3MV9A 5L4FA 3K8MA 4COVA 1L7IH 2FCUA 1XIWD 1NOLA 3FTXA 1ASPA 4NMIA 3UIZA 1UM6L 2X1PA 1AXSB 3WHXA 1RUE2 2YJQA 3SJVA 5IHLB 1G8WA 5LHGA 2GPZA 4AQOA 3NJLA 4J2QA 2GMEA 3OEAA 2MSPA 2O6CA 1JG9A 3IMSA 5FO7A 5F9DC 3V5KA 2C6SA 4W6YA 4Z8BA 5J1XA 1I1CA 4XUTA 1HN1A 3NIGB 4UTCA 2VDQL 4QJ5B 4X6DE 1UKTA 5ISZE 1JV5A 3THMH 3FLTA 5CBFA 1N68A 4DPCX 1H6FA 4DR1O 1ACYL 3HKCB 4PJIB 4JQTA 5FJKA 5JORA 1JTPA 4MJID 5DJAA 3ZDXB 3GBMH 1XR8A 1H6TA 3VWJA 4J1XA 2P67A 1SXNA 2FO4A 2Y9RT 4AIZA 4EIUA 2QKIC 3MV7A 4MXWH 2RM22 4Z7UA 3JVFC 1COV1 4X6EA 5LJYH 4GIQA 2D03H 3ECBA 5GGVL 1XNRO 4P9HH 3TYGH 2PMZA 4F7PB 1N4CA 2OQ6A 4OHYA 4X80L 5F7FA 4LBQB 2AXJA 2P5EE 2IZWA 3T3PB 3VD1A 4CUAA 4BQ3A 5FP8A 2Y2TA 4JKMA 1WA8A 1E9QA 2YGPA 3EBIA 4GEJA 2NP0A 2GUOB 4M9PA 2HEVF 2JJ2G 4RMVA 3FFDB 4OGXL 5HGHB 5FX3A 4ORGA 4H7LA 1OQDA 1YVWA 1KJVB 1IBGL 2GTZA 4PP2A 4JF3A 1CDIA 3KPRA 5BVPH 2DYCA 4G7YL 4R7VA 1OY3B 4UV9A 5E1AA 2AQNA 3QWQB 4FQJL 4JMXA 1NQDA 4HWEL 4GSDL 3M1CA 3WO3B 1CIDA 3GWKC 3LCYA 2VXUL 4D9RE 2PHWA 4ZNEE 4ZS3A 5F6HJ 1VR3A 4W9IC 2WVSA 2W6IG 1F0LA 4D8PA 1OLRA 2HFTA 5IWLC 1WCDJ 4X4XA 3F7YB 5DMGC 5T5JA 3OX8A 4XNQB 1NFIA 5DAWA 4AVVA 2F2HA 1I7UB 3GHBH 3SDDA 3J7LA 2P26A 4MCMA 4PJ7B 4HZ3A 3EDKA 1MS9A 2OYKA 4GFXA 4JMNA 5AOMA 1JGIA 1NAEA 1QKQA 1IX2A 2VXTL 2Y0SA 4Y5Z0 5E5MA 5LB6A 4RYDA 2BOCB 2WFF1 3P11H 2WYFA 3RE0A 2BVBA 2DLFL 3TRSB 5L6YL 3MCLH 1P84K 3PWLB 2PXYA 3POCA 2VUDA 4GWIA 3PAUA 4KRPB 1CFSA 1WH0A 3FU7B 4XWGL 5DEZA 1AZCA 2XVKA 4H5SB 1JODA 4ZU5A 3TS8A 4DW1A 4GAGL 4FM1A 2DWEC 4AW7A 5ANMA 5GXBB 1DQTA 3MNWA 3QUXD 4ZQTA 5AC93 4QYOB 5D5PA 5ID1B 4RGAA 2VRZA 5DTFB 4N53A 4ZAKA 2QE3A 2YPKA 1YXWA 2Y6JA 3NSXA 4XEZA 2YQ3A 3ZJAA 4APQC 4CU8A 5FFOA 1GGIL 1RHI1 5JOFA 4XF0A 4R83A 3VE0B 4OJAA 1GAFH 5J2UA 1OCZB 5D1XC 1DBJL 4PBWD 3MRPB 4K4KA 2YI8A 1S76D 3GRWH 3U4BH 4WNQA 5FZHA 2OA9A 2EVFA 1LD9B 4LCCA 5IT6A 2TNFA 3QJFB 4P9IA 3WHTA 3TIEA 4HKLA 2WBJD 5ESVA 1NCQB 5F39A 3ARGD 3OB0H 3QZWA 3RAJL 1R19A 1AZDA 1GTNA 2EXYC 2XTSA 3D3IA 3DRTA 4EYUA 4O2AB 1FRGH 5LKNA 2NY3D 5JIDA 4PRDA 4RFOH 3TFBA 3CZKA 5JNYB 3M3OA 3WIHH 3OGSA 5LBBA 2JDPA 4MTXA 3FCSA 4JKPL 3L54A 5D2NA 5BRZA 4F58L 2ZMLA 1G94A 1T5KA 3FUDA 4GBXD 3HE7D 2NY0D 1ZWIB 3LDBB 3WKMH 4IKLA 4JS7A 2ROXA 2PF6A 2B15A 5B38A 1Z5HA 2MHAB 1E2ZA 3LRSA 1KS5A 1YPZB 2IGFL 1MNUH 1N8ZB 4GSQA 5E1QA 5IMMA 4ACTA 1O7VA 3RTQD 4YSFA 3K3WA 1JWMB 5D9SA 4MXVE 5FAAA 1YNTF 4K6BA 3FN3A 3WSQL 1WW5A 4OVVA 4JFPB 4RMTA 1VQOV 1Z0NA 1LOFC 3H1YA 1MFDL 2VDKB 2PP8A 1NA8A 2EYTB 3BUTA 3GMNB 1CAXA 4EVNA 4M0HA 2CBPA 2IJ0C 3QRLA 4BHUA 3NFSL 1GGYA 4LBJA 3GJEA 1YN7B 3WMQA 1U3HD 2D4DA 3FAWA 2PTMA 4WCYL 4NQEB 1XOYA 3BP5B 2PAKA 3VKLA 3ZLIA 3T0EA 2APTA 2VS0A 1W03A 2E74B 2E46A 1EPFA 1P4BL 1KUMA 2Z65C 5D72H 3UDWC 3TXQA 4E8CA 4O4YH 5CINL 1N2RA 1MWAL 4RR3B 1DUZB 2IALB 1KBPA 4KZCA 4R8WL 1OXCA 2K2SA 1EP0A 1U30A 2E6PA 1T0MA 1DQDH 1WD4A 2UUAB 4DUZO 3DOSA 3QULA 1N33B 4RQQB 1NCTA 4Z76B 5KSUB 3RL2A 1FPN2 4Q29A 3IDCB 5KANI 5HV0A 5D2LB 2PWGA 5HY9B 2UXBB 2FUQA 1A7PL 1MS0A 5GGTH 2WZPA 4TV8A 1O6UA 1H19A 1P4IL 2K7PA 3FS9A 4AVAA 4DFSA 3ZXEA 1ZAUA 4HIEB 1CR9L 2R8SL 3WEOA 3IF1B 1GSKA 3GSQB 4NRXB 5C0BA 1KLUB 4WSJA 5I0XA 3KM5A 1NBVH 3LOIA 4LKEA 3BEHA 3IU3B 5GGSY 4G6JL 3T4YA 4URKA 4NO0D 1NA1A 5I17B 5LGJB 1FFXA 2LFRA 4IM8A 4F7MB 4P59H 3L9JT 1M57C 4RUEA 5DJZA 3QEUA 3K4DA 4NWTH 3ARDB 1CK0H 2PPAA 1CL7H 5F71A 2HVJB 2V7NB 3AS2A 3UACA 5KEZA 1F13A 1OCWH 2Q86A 4X89A 2IBZY 2X4RA 3KL0A 5T5NG 4DESA 2GN3A 1ZBE3 3IJYA 3PPSA 1UKRA 5D7LE 1ET7A 4JR9H 4N0CC 1EO8L 4X50A 1W6OB 1KTLA 1RVFL 2VUYA 3PXLA 3QORD 3AY2A 2CIIA 3QXVA 5GLVA 4XP1L 3NVCA 2PCFB 1PM9A 3SOBH 5KSAC 4ZOBA 4AYFB 4NHUB 1DQJA 3LA7A 4GO6B 1MJ8L 1CTMA 3OGOE 4XTRD 5HJGA 3T4AA 4YHYB 4YJ3B 2EXJA 1NMCB 3OKMA 4B3MB 4NIGA 1YSOA 2DQTH 3GC3A 4G8EA 1HV1A 3KPMA 3H9SE 3CX5F 2BNQE 3NH7L 4P9MH 1GP4A 3K48A 4IE5A 3WP5A 1ZZ8A 4D3CL 3KV9A 4QGNA 1AGFB 1WFMA 2AV7B 4K0KO 4F2FA 4WZFA 5C3QA 3FF7A 5DEJA 4J1UA 2YXHA 4FNLL 4DEPB 2JRIA 1U3YA 1G6RB 4IEOA 3AP7A 2GHWB 1HZHL 1XYOA 1A4JB 2W07A 4QDGA 5HCFA 5CA3A 4IE4A 4QKTA 4ATTA 4P4KC 2ZWYA 2PABA 1JYVA 3CVHB 4LEXH 3UP1A 3MUHL 5J8OA 2IH1C 1MW0A 4U1MA 5KVGE 1SFYA 4HK0A 2BO0A 5T33L 2JEMA 3ZYFA 3IN2A 3LIZL 5IQMA 2WWNA 3DSFL 2BSDA 4B6ZA 5K5YA 3QJQB 3RJ2X 3WFDL 3H9VA 1WIUA 1QVGU 2NDGA 2X05A 4ZDHA 4GI9A 4J8RA 3PS6A 2VY0A 4XBEH 3LEVH 3F7LA 3MGOB 1S7RB 1Y76A 2FJHA 1IHMA 3G5VA 3SDCB 2QELA 3HG0A 4LFHD 4E68A 1YYNA 5DM6V 5DDJ1 1UB6A 3A0HZ 5JQGB 4RQEA 2AV1A 2QFRA 3L5JA 4HQQL 3SGEI 2QGNA 5JVDB 2PCPA 3N2KA 1TVHB 2F5BH 2QPFA 4PJEA 3U6XS 2ZOLA 1FFQA 1FZKB 1VP6A 1Z6JT 1CJPA 4LFAB 1AQKL 1GA2A 5EV7A 5FPLA 1QATA 2OKMA 4YQXL 3WLBB 1E5BA 1SHXA 3P73B 1ZLVK 3V4LA 4XNZB 1OE1A 3HJEA 5J7MA 1TJHH 2OMBA 1QYGH 4IS6A 3K5LA 1O6SB 3BH4A 3DURA 1ZSPA 2WUHA 2O5YH 1WLEA 3QDJD 5JA8B 5DD6B 2FNWA 4JJHA 3QUZD 4PJFE 5F9WB 1HJFA 4Y19E 5ALCH 3VFOA 5K9JH 1L9OA 4GXUM 1W8WA 1AZBA 3BVWA 5F96H 5TGBB 3S34H 2EDKA 3H2QA 4OI8A 1PVC3 1KIUA 3WD5A 3BRGC 1BK1A 1FXZA 1INEL 3WF1A 2EXTA 3X29B 1N0NA 2VULA 4MNQB 4URTA 3OPUA 1I8AA 1KDKA 4H0GA 1BM3L 1JPTL 1ZUQA 2R2BB 4M48H 4Y2DA 3VD9A 3QIWA 2V5DA 4FPYA 4YDVB 1LK3L 4HK3J 3FMGA 3L1OH 4BSWB 4LFBB 1CIUA 2IANE 3OHMB 5I2IB 1W9FA 3AB0A 5HVWA 1JHLH 3K6NA 2OWOA 4JL2A 4OF3A 2WXQA 2JKBA 3O6FB 5M7QA 3F58L 3RFZC 2ZDIC 3S8GB 1VRBA 1JYNA 1SLVA 4QOKA 4ZPVB 2Q6WB 5IWAB 3B3IA 2HX7A 4UTAL 2BHYA 3CSXA 5IMLB 2XDHA 3QJUB 1JGEA 2KHAA 3S5YA 1JHKL 5MENA 4EZHA 4E4DX 2HJLB 1IAOB 4XMPH 4P23D 3LQAH 1G86A 2ENRA 4N24A 3RPQA 1GGCH 1KC5H 3LKRA 2FIKB 2E6VA 1ETB1 4G5ZH 5FZBA 3WY6A 1RZFL 1J8SA 5FYKU 3L3IB 4NKOB 1AX1A 1W0YT 1FPOA 5IVZA 4LQFL 1EQWA 1ZT7B 3AS0A 1GH7A 4RRPG 3ZZLA 2JB5H 5GLZA 3UTZB 2FQGA 3LN4A 2OMWB 2QKIB 2B7DT 3IZOA 5JUVA 1VQKV 3IN9A 2WNOA 4F7KA 4V2VA 1MCRA 1U8KB 3T5WA 2OR9H 1MCWM 2V3DA 3FLPA 1J1PH 4LO7A 1JOYA 1AD0A 5ERLA 5E1RA 4NSKA 1H6EA 3RBZA 3ILPA 1OOWA 1VBA3 5B8CA 5HYQB 5EF3A 1BQLH 1UM4H 1YMMB 4Z7WE 3NRUA 1Y6KR 4PI2A 3LPFA 4MW3A 3UL4A 1N32B 3VDAA 1GKOA 3DRQA 4K9EH 2CBMA 4LCWB 1OQ1A 3TWCL 4Q1PA 3VXME 3KEHA 3FB6A 3ROUA 1O3SA 2KG7A 4EKXA 3ZDYF 2L6LA 3TYFB 2OTLV 4N0UB 2AJVH 1H8TC 4QNHB 1PMJX 1GZ9A 3HZ3A 4R9HA 2DTWA 1ECYA 1JXFA 2UWAA 1GO3F 2FBJL 5ACLA 2PYLA 4RWHA 5LXTB 2DUQA 3BDBA 2VD7A 2RMU2 3MNVB 4HGWA 5DZEA 4Y5XC 4I5SA 2DEWX 3LKSA 4LHUG 2VL5B 1Q6HA 5IM7B 2XGXA 1QWUA 2CO3A 3HNVL 4AMKH 5CBLA 1P2CA 1O3TA 2Z4QA 1DU3D 1JOJA 3CFEA 1P7GA 5HJBA 2ITCC 4KUMA 1AQ8A 2XLLA 4WHYH 4AQYB 5H5NA 1VESA 1AYN2 3AMMA 1E9PB 4LR4A 3FX7A 3HKEA 2HT4D 3Q8CA 4JLRA 3FKUS 5D1QD 4ZS2A 1AYM2 2DBIA 4E9LA 2DPKA 4LPCA 4PIRF 4DKEL 4M1CC 4ZONA 2W95A 5IB3A 5K59E 1XB6A 3C3VA 3N27A 4GB31 2X1XR 3FTGB 5E8EA 4Z7QE 2A3XA 4XIKA 4ISVB 4PY7B 5FWQA 3PAYA 1OPGL 3KVBA 2ZIOA 1TO4A 1RUF1 1ROWA 2XYBA 4AFDA 3ZEDA 5IJ0A 1E6OL 5JMRA 4Q4V3 2Q8CA 2DQHH 4I2OA 5E2WL 1FJGO 3GBEA 1KWKA 1CLOH 3M1BA 3BZFB 1OQEA 5AVYB 4L8DA 4XRCB 5CA0A 1AHWB 2Z93A 5AKRA 4M4PA 2OCCC 2AJZA 4K15A 4U6HA 5SX5K 2P3YA 3RX5A 1UAIA 2WO1A 3H4FA 2IXLA 1PJWA 2XWZA 5JXAL 2TAAA 3G5WA 4FQXD 3UC0L 3VD0A 2XIBA 4OBSA 5FXVA 5DECA 4JN1H 1OQOA 3ZN6A 1AGBA 3CHPA 2H8PC 4X6FA 4P2QA 4O2FA 4JQRA 4AW4A 2CDPA 5A6YA 1B4JH 1XMEB 4F9LA 1OF4A 1SS3A 1T5XB 3H9HA 5KW9H 1US6A 5KS9B 5GLTA 2GITA 4X5WA 1H9WA 5LW9A 2QQKH 1PU0A 4N3UA 2YKKA 4CU7A 3I75B 4JUSA 2UWBA 1TZGH 2WZ5A 3CU1A 2Z92B 4L9LA 3DJRA 2WQXA 4P5TA 4XN8A 4DK0A 2JH2A 4XXPA 1TQCC 1M4UA 4R26L 5JMCA 5CGTA 2EIMB 1AAJA 4JPIB 4WM7C 1I4FB 4YO0B 4PRHE 4MCYB 3EJTA 1UCTA 3ABGA 4LT7A 2LQRA 3GTVA 4Y5YC 2C1FA 1X5GA 2ZUQC 4WV1C 2VISB 3GXUB 4IETA 3W21A 2VDRL 1PG7X 2Y36H 3LKPB 5T1KA 4YDNA 1W0KG 4LE3A 1X5KA 2DLTA 4PF5A 4XDQA 3NAPA 4Z1VA 2J57A 2EZ0C 3GSRA 2NY5H 3P0GB 4KVNL 4S1QL 4W68A 3B2UD 3FRPB 3X13B 4CC4A 4YHHB 2Y5TB 2RG4A 4OUOA 2I7SA 1ZA3B 3O4LD 2ZXWC 2K1EA 4PHZA 1TZOA 3JATB 4ATWA 2QMKA 3EO9L 4DFIA 4AEMA 1MJUL 5T3NA 4NQVA 4FX5A 3SDXA 2OA2A 3IMNA 4ZFFB 1E7VA 2JIGA 1RM1C 3THCA 2VH5H 5JHMA 1IJNA 2IWGA 2C26A 4FXGB 1A22B 1D5IH 3VXSE 4OZIB 2K8MA 3Q2NA 1SFHA 1IGIL 3JTSB 5DYOB 3U6XA 2QV2A 5K9QG 2G9HA 3QQ3A 4WEBL 4DY5A 2VRAA 3VQVA 3OD3A 4GZRB 2MQ0A 2E7LA 1KGXA 1FDLH 1I08A 2RH0A 2AHYA 5H35A 3ETQA 5EH1A 5IB2B 1BQHG 1UX6A 1OCRB 3SXWA 1AS8A 4XOBA 4A6YH 5KYYB 2E3CA 4CBZA 2BCCH 3L73H 4IHJB 3F7PC 1HSBA 4R7DA 5CBAA 1IBDA 1FXKB 4N9HA 1IC5H 1A6WL 3ZHTA 5JH7B 2K45A 2KS0A 2JJUA 4AUUA 5K9KB 4Y88A 3EOBA 2DE0X 2HRLA 1O5PA 2ZKWA 2IU0A 3KXFD 4FG0A 4EE2A 1LO3H 4P5YA 1CT8B 3P6BA 1NM9A 3MIFA 4V1PA 1NR7A 1ZTXH 4LBEC 4HIXL 4HS3A 4AE1A 1NZIA 4L92A 3OF6D 3NPSB 1HINH 4ZYKA 4RGGA 1T7VA 4DHLA 2CGOA 3N2GB 1IX9A 1XNQO 1ERNA 1STMA 4Y22A 3DKWA 3MLXL 4UIKH 1MS8A 5CD5C 2ED7A 2H1XA 3GJFB 3I2CH 3TM6A 1XT5A 4BISA 2L7EA 3L8QA 1AF9A 4OAWA 3SHSA 1J5EB 1BQKA 3CJJA 4EB6B 5IDJA 3TO4B 2WGXA 4AI7A 4KTDL 4AXWB 4JHTA 2KQNA 2FT8A 3NR7A 3Q2LA 3C08L 2VQ4A 4U1IB 1T20A 5DK0B 1JXNA 3ZKYA 2IH3A 2ZYIA 5BV7H 2F19H 5F89B 5I1DB 5IIEA 3VG9C 5FYYA 1HHKA 4KRLB 2XTJE 1KB9K 4M3CF 1XSJA 4X9GA 4I4TB 2O14A 5GGRY 3DJZA 3FHEA 3HEIB 5EO1B 3GS7A 1HL8A 4FQCH 3MV8D 4JO1L 3T0BA 2C5DA 1NR1A 2PQQA 3FJSA 4CBCA 2Z1KA 5ITFA 3C6LD 5IQNA 3U1PA 3OVUB 4X65B 4JJ5B 4AQ8C 1KT2A 1M1XA 5LO7A 2HWZL 1T1WB 3FC8A 2JKTM 1V6KA 2DDUA 3MR9A 3EAKA 5KYXB 4C1XA 3WINE 4P4KB 3ZYIA 1FOD1 1RVF2 1N7MH 4E9WA 1SQMA 1PG7H 3QIUA 4OZGA 5EU5A 2D6LX 4QE7A 4P57B 4OI7A 1UIJA 2O1QA 1RXLA 4P49A 3IFXA 2WLJA 3FSWA 2IWKA 5TE6L 5EEWA 3M3QA 4JI5B 2JJ1G 2UZIH 1DYPA 2FCVA 2CRMA 2F4LA 4H20H 2ZKNA 4KHPB 1HFUA 4HIJB 2GJZA 3LD8A 1JPST 2D3LA 4RGOL 5AZ2L 3U0WL 2IXHA 1HL9A 1VFMA 1ZOXA 1F3JA 2WXKA 4XB3A 1GBGA 2MW2B 3ZDZF 4AJ0A 5DJ8B 1BBJB 4LF3B 3VD2A 1ZE3C 3CDZB 2XZCL 2Q0ZX 1OF2A 7PAZA 2VXQH 2VW6A 3GUTA 2WS92 1VACA 4AZUA 1XF3B 4QTFA 4DR2B 2FQEA 3L3KA 4MJJA 5DO2C 1MI5E 1ST8A 3KHOA 3LZQA 1DTUA 4N25A 3QXDA 5FPIA 4XAKD 2KLSA 5I15L 4JGZC 4B5ZA 4X9IA 4ZXBD 2O93L 2YC1B 4AL8C 2GNBA 5SV8A 3QVAA 1RUC1 4CEWA 3PIQB 3FUIA 1XHZA 1DFBL 4JDEB 5DZPA 1UZ6F 3L3HA 4J6GA 1W59A 4YHML 2NRDA 4GKNA 2QKAA 3NJKA 3VZMA 1G7QB 5IG7A 4MZUA 4BPZA 4IIQC 1B4LA 1ADQH 1DN2A 1PNGA 1DQ0A 3NV2A 1VPOH 4JDTH 5IK7A 1J3RA 4ICGA 4TUKH 4Z8FH 1QU0A 3KD4A 2Q5ZA 4C8XA 2H6OA 1AZZC 4WUUA 4E9RA 1XE8A 4Q4W1 3C2UA 5D2AA 5IW6A 1PX3A 5B1JC 5I0ZA 2QWPB 4RMSA 4YDJA 3WL9B 4JHBA 3LDKA 4YVWB 4QXUL 1HK6A 4ZS6D 35C8L 4M8VA 5C6TL 3G08B 2Z42A 3ZL1A 4P9LA 5E8AA 4F7TA 4MS8D 5AW0B 2GY5A 2JVUA 2CMRL 1K5MA 2D0HA 3M88A 1BZ9B 3HZYA 4EUPH 5INDA 4TUOB 4ZK8A 5F7LB 3FO1A 5EYXA 4U6XA 2VOTA 1AJ7L 5I1AA 2BWDA 1WFIA 4KK5C 3ZTEA 1A7NH 4YXLH 3HKDA 3B2VL 3DMMD 5JI7A 2P52A 5BZDB 3PDOB 2R1YB 2WQRA 3HHRB 2Z1PA 2WQWA 2YGVA 2HWE3 1F58L 1G7HB 4YHIB 1Q90A 3DC6A 3O6KL 4QXTB 4ODSH 4W70A 2MEJB 4PQXA 1SEFA 3II2A 5I1HL 4XNUH 2OCJA 1R5VA 1T2QL 3C3TA 1A1OB 1AXTH 1L9NA 2ZOOA 5SWZB 1AHMA 2Q7AA 4QDSA 3D0AA 3TBWB 4N4YB 4IBVA 1E3XA 1WGOA 5DRZB 4F57L 2AFNA 4P2OC 3TEWA 1TYEB 5DD3H 2DMCA 4I88A 5AOJA 1G5AA 3VHOA 5HXMA 1NPNA 1J5HA 2GJPA 4IGBC 4UBHA 5AVQB 2BSSB 3SIKA 3MRGA 5EOQL 3ZHRA 3N44B 5BNOC 1VIWB 1FVDB 3QBTB 3IDBB 4B3VA 4ECNA 4I09A 4NAOA 1S9VA 4PGDA 3TGXA 2R9RB 3MFFB 2A9HA 1BVNP 1ZHBB 3ZYHA 5FUZL 3F6JA 5AOZA 4IRZH 4UT9A 1QDOA 1WA2X 1JP5A 2QTWB 1NQTA 5ES4B 1QTYT 3MIDA 1IBZA 2D3VA 3V0BA 5BV6A 1XYPA 5KWYC 1N4XL 3KYAA 4N21A 4B96A 3L4TA 5AG8A 1KUQA 1JN6A 4WTZA 3UZEC 1PZ5A 4LSPL 4O02B 1V0AA 5JR1L 1RUJ1 3MLSL 1POV3 3WP3A 3FPXA 4WO4D 2D98A 1S78D 1M71B 2YSSB 4J4PA 5ERWA 3EGXB 3HNTL 2KXLA 4Z77B 1G9MH 1Z9SB 1U5IA 4N87A 4IW3A 2HMID 2YXFA 3N1FC 2IXQB 3OJ2C 5K1XA 5CIPH 5DS8A 3S96A 3T1FB 1YHFA 5FGBA 4XHQA 4WHTA 5EZPA 5J9PB 4M7JH 1A3KA 3W0WA 4JI3B 4U3JA 1MEC2 1QJY1 2UY8A 4L8QA 5L2KD 2VMGA 4XBLA 2KPWA 5FLJA 1A3LH 1VBE2 4LHUD 5IVVA 1COV2 2Z69A 4OZHF 3QUYD 4NXNO 4LIQL 1MHCB 2OMVA 1XRUA 4OHXA 1H0DB 1SLAA 4OB5H 5CBEA 1W9SA 2JEXA 3MLLA 1IEBA 3N40F 3TESA 5EC2B 5E9DD 5E8OB 2F18A 4C4KT 1RL3A 3FUEA 5DDHA 1MEXL 3F3HA 3JALA 5ITZB 1SM3L 1WDAA 1MY7A 2K0GA 1QHQA 1WK0A 5AVWB 5B4XA 3OAWA 5EU3A 3JV6A 5BZZA 1ODMA 1G1KA 3VXUE 2OCCB 2ZKXA 5D1ZC 4AI3A 1QA9A 2A6DB 1IQWL 2NX5B 1SA0B 1S46A 1P9MC 3FB7A 3LKQB 3MYXA 4AT6B 1CXKA 4W9LC 1UT2A 1FFPB 2E7MA 5AVVB 2GC1A 3UYJA 1IGCH 3NAAH 3HFML 1PVHA 3HI5L 4XMZA 1LEGB 1Q1PA 2C3HA 5ICZB 4M03A 4DK6A 1BZDA 4DQOL 4BGLA 1PZ8A 2JDUA 3WHUA 3IMMA 4X7TA 2WLYA 4K23H 4KTEH 2M1KA 2AK4B 1Z5LB 1WF5A 1TZHA 4HS8H 2C9SA 4M4RB 3JWNH 3UAJD 2WT1A 4QB6A 2Z4FA 1E6JH 1GZQA 3GUFA 3QWRA 1ZRDA 1W72L 1KEGL 4L9BA 4FQIH 1J8KA 4DEVA 3BP6B 4B9FA 1AUYA 1G9NH 1M7IA 1KY6A 3DO7B 1Q38A 2GABA 4HU2A 4W4LA 2WKKA 4NZRL 3T65B 1FNSH 4IGPA 2WFF2 2OCFD 3VQYA 2UU8A 5A7WB 1ACZA 4XN9A 4MX7A 1QJU2 2RE9A 2VLRB 2ZT9C 3ETDA 1BZ7A 2NMOA 1KENL 4MLSA 1VAKA 5BOZG 1FGVL 2EXIA 1PFOA 1JIBA 1LTXA 5DUWA 4Y5YB 4CDXA 4WV1B 4JI1O 2P5OA 3AU1A 2VLKA 2P5WB 1LR1A 4OGZA 2NNUA 4KNSA 3X3GL 5K9QI 2MCG1 1BD2A 1ZDSA 4LHLA 4R96B 3GQFA 4LL1A 1RHI2 3QJOA 4FYTA 3S5QA 3HB3C 4DP9X 4HUVB 4AG4H 3A6OA 4LT5A 4DV5O 3OKOB 5EU6B 2VAUA 4UTBH 4GXVL 3T8XA 4X1KA 2VLMD 4QGTA 1EGJL 3R66A 1VLXA 2ZTBA 1PKOA 4AGLA 2VMFA 3IXTB 3ZM8A 3HTLX 4C0BA 2GITB 1EFXA 4ZO6A 3MU3A 1ND0A 3PDGA 3VTMA 4LNUA 1HC1A 1VGKA 1EXUB 1VCBC 4FNSA 1F11A 3EYVA 4XNBA 2DBLL 5DFAA 1J3QA 4RETB 4I1RA 1EYBA 4YHZL 3KPPB 1WN7A 3IDIB 3FO2B 3ZDYE 3I9GL 4NC2B 3D85A 4OLXH 2EDTA 2NY2C 3CH8A 4M29A 5IBTL 3DARA 3REWA 1AR72 3MRMB 3B8SA 4PRIA 4E2OA 1OO2A 4LPTA 3N35A 1PLCA 4I8DA 2R4RL 3ALWA 1E2VA 3L2LA 3H1KH 2DWTA 4F5CA 1Z3GL 2IPUG 2JENA 3CZEA 4CC1A 3GI8H 3TA3C 2JE7A 3HNYM 1QUNA 1K4CB 1YEFL 1DSFL 2GQHA 3FULA 4PJ5A 3K72A 5D4QA 2Q8AL 3VFUA 4PI0A 3WBDA 2RQEA 4YIQA 4GKYA 3ARWA 4H33A 2J8UB 3CFDA 2BVVA 1IV8A 1QX1A 4WKXA 1QXJA 2EXWC 5GS0C 1F4MA 2IGTA 4PJYA 1TDQA 2JJ6A 3MI8A 2LU5A 5E95B 5JOPE 1KPVB 1NY72 4ZMXA 4YZ5A 4Z3EA 3HC0B 4FS0A 1AC6A 3GHPA 5DQ9A 3C5JB 3U79A 2XRAL 3I9AA 3ECUA 1NANI 4FPPA 2JE8A 4DR3B 3GHEH 4HWZA 4IRSA 4PBDA 4UM9B 1QHDA 1GKEA 2PO6D 4P5HA 4Y33A 4UV7L 3LOBA 3VXTA 3I6LD 1FE8H 3FNKA 4WLCA 3I84A 3VG9B 4I5BB 2OL3H 3O41B 5KVDE 1KTDB 1EK3A 4UQAA 1G7YA 4OLYL 2R69H 4IEXA 1MWAA 1L8DA 1H8NA 2IMNA 4PLMA 2X38A 4X5PA 3D36A 5L0QC 4XAAA 1VF6C 1N36O 1R3KB 2YMXH 4RNRA 3LY6A 1D5AA 3RYCA 5FMOL 3ZT7A 1AR2A 4DXZA 2X2JA 1M4KA 5JDBA 1TJGH 1ZV9A 3MOAL 4GRMB 2X4QA 1RULL 3RWJB 3U4AA 5KBFA 4RDBA 3FJTA 3L16A 1DZ0A 4NOFA 3KE0A 5KSVB 4G8FB 2FB5A 4TUJB 1XCXA 3NN8A 3WN5C 4C83A 5EDSA 3HAEA 5LAXB 1QOSA 4NR1A 1WLTA 3W57A 5CJXA 1HAWA 2QHLA 1ZREA 5INCB 4GKJB 5C0AB 2G60H 1WSST 2HKAA 3STZC 2ENJA 2W9DL 2X4OB 4Y9GA 1H30A 5CEHA 4JM4L 4LVNC 1AE6H 3C09C 5IW1B 1YECL 4CEYA 3CWBH 4UINH 5J09A 1TGOA 4L4VE 1X9QA 4K8XA 4AYBA 2MNJB 4KUZH 2EC9U 2J20A 4L4TA 5HI3D 1PKXA 3QNFA 4UOZA 2WO2B 1A0QH 3UAAA 5JIIA 4N2CA 3MZHA 2CA3A 3ULVF 3ZZ1A 3VFNA 1OP4A 3RWFA 5DHEA 2X5IC 2HYXA 3QFJA 1CFNB 5IQ9A 3D9AL 3S9DB 1IB5A 2I24N 4FP8H 4JHZA 5TH2B 2Q1FA 3V4VL 4JCKA 4QX8A 3RQ0A 3ZRFC 4UT7H 3N43B 4FQHB 2YEZB 3K9SA 2ZONA 2W0PA 4LARL 1E28A 2Z2SB 4HJEA 1PMHX 3CX5K 1PNKA 1BMV1 1QFWM 3RMYA 2HPTA 4CZZA 1NGXA 3QWOA 4R90L 3FO0H 4N43C 3VBUB 2CJTA 3LVEA 1AX0A 1R3HA 1BIIB 9CGTA 1JWUA 1T6BX 2MCMA 4AZ8A 1W91A 1IMHC 1LHOA 3DTDA 1PLGH 5F1NB 5J0BA 4KJYA 3BC9A 2WABA 4B1LA 1MCIA 1RZ7L 1X7SA 5E8DL 3TIDA 2GALA 4QDQA 2EIKC 2VSKB 1OVZA 2KZKA 5MEQA 3ARFA 3I3MA 2OS7A 1TU2A 2IDQA 4COWA 4EKJA 5JZGC 3LIZA 2HKOA 1K3IA 4KI1A 4KRPD 3HJ0A 4O4LB 1AL23 3ZHDA 3THTA 2MNGA 2XC8A 4IL7A 2R7EB 2WUCL 4HV8B 3ZR5A 4CP0A 5I8OL 5L7OA 5DDJ2 2JDYA 3S0MA 2DLEA 3VD5A 4JRLA 4C56A 5BXFA 5FYLH 1UOKA 4GKLA 3DX4A 3L9RA 1PJ9A 4ZFOB 1R3JA 4MRCA 5H94A 1F56A 5DUMH 1ZLUH 5F7HA 5ACMA 1ZLZA 5JMOA 1MCWW 1GANA 1LAJA 3RW0A 5DG1A 3UT5A 5JO5A 1O9HA 1CICB 1MRDL 1ROPA 5J12C 32C2B 4LKCA 2VCMA 4L48A 5DAPA 3RRDA 3WSOA 4KKRA 4RGNC 3CMOH 4IYKA 3AG7A 3FUFA 4J3OH 1GJIA 3FUOA 5E1IA 3LNMB 3TGUH 1DJXA 4UQ3A 3CFJA 4IKKA 3NZHL 4IRJD 3VV1A 3EBRA 4ZS7L 4P2OB 2DQEL 4M3HA 3NJXA 1CZ8L 5TDOB 4R7XA 2AABH 2YPLB 2LAAA 3CE1A 4PTTA 3V5DA 4IGBB 2ARAA 4O9GA 1WZKA 3FONA 3MYJA 5LY2A 5JCOC 1OTTD 4K0OA 5DA4A 3TBYB 3FQWB 4A2GA 5HP5A 5BNOB 1KFAL 3ZHKA 1UVQA 1ZAGA 4NOTA 3PWPA 4FMTA 2ZE8A 3QZLA 3FUJA 3I55V 1JSYA 3MMEA 3PQYE 4JB9L 3P77B 4Y4KA 2HG5B 5IBLC 5IESH 3V0VA 1MQTC 5K33A 3KWWA 3LMJH 1FXVA 4PJCA 3FRPG 4QYAA 2QBWA 3SGJC 3KDMA 4B9CA 1QWHA 4LCYA 4NC1C 4XVJL 1YCSA 5KR7A 3WYRA 1PVXA 1ONQB 3G9VA 3ML8A 4Y2OB 2QJVA 4K3DL 5FHBH 4KXZI 3U0PA 4M6OL 2I9TB 1W6PA 5DHXB 2H1PL 2ORBL 2WWOA 4OQTL 2R59A 5FYBA 5FPXA 2HLFD 3OBZA 4YDKH 4XC1H 3H7JA 2HWF1 1HILA 3DHMA 3DV6A 4UTAA 4DEWA 4B3SO 1C5BH 1DUYA 3FSVA 4JFXA 3FQTA 3X11B 1WD3A 2IADA 4J25A 1AD9A 2X4PB 3T1MA 1OAKL 3DXAA 4QY8A 5GISL 1WMDA 3QHZL 4H13C 5T3XL 3ZDZE 3UKVA 1JJ2U 2Q9OA 2VR7A 4NQED 3S6CA 2ZPKH 4BEIA 1Z9PA 3ME0A 2NY7L 1YFUA 2HWC1 1FVCB 1WEJL 5TE4L 3ARBB 1V27A 4NENA 4OLZH 4XNMA 2UWEA 2JKJA 3MROA 4DQAA 4YDMA 4NDMB 4L1HA 2YYOA 2FEEI 2ZNWA 4DOHE 2RQ6A 2VLJE 3C60B 3QXAA 5A3IC 1Y6XA 4O58L 1USZA 2KDGA 4BRJA 3F7VA 2CE4A 1CYXA 4OD3L 3SKNB 1B04A 4DH2A 5DJ2B 3K6SB 3IT8A 4JTNA 4ONFL 5ABJA 4LRIC 1UZ6E 3C2SA 3IJEB 3RURA 4R7LA 4B60A 3ARUA 1TME1 2J1TA 4HYOA 1NZRA 5FY0A 4R6UA 1TR7A 1TETH 3WENA 1L9QA 4XP9L 3RDIA 4X6DA 2YOAA 3OLGA 5ISZA 3TVMB 1E1QG 4YPGB 2IAMC 3G67A 3RVUD 3OPZL 3NNMA 1P6WA 5KN5A 2YQBA 1IT9H 1AI1H 2FHFA 1IBLB 5D1ZB 4HK9A 1VKXA 1AP5A 1EJ8A 2PCXA 1RFDH 1YIPA 4XXCC 4H8WC 4HZLA 5LGYA 2QR0B 3HR9A 2HRHA 5A2KH 1WW7A 4QJFB 3B2MA 1UU4A 5BRQA 3A22A 1QFPA 3GKWL 2B4CC 4BKLB 1MHEB 4ZZ8A 1Y0LB 2DMHA 3FE5A 3RZJA 4YGVA 2P5EA 3UTTD 2RS53 4S10A 3A23A 3ZL4L 3HW7A 2R49A 5IHHA 5CFCB 3IRZA 1GICA 3LAFA 1DZQA 2FECL 4MQXC 4NE9A 1QSFB 2X0VA 4HEPG 5HI4D 1XYNA 5IW0A 2XAJA 2K6YA 5CJOL 2DS4A 2ZT9B 1NAKL 1LGVA 1WJZA 1ZT4B 4IDJL 5DFVD 4GB32 1NEUA 4YUEL 3MBWA 3VBHB 4YXHH 1OZ0A 3N41F 2JD4A 1DQKA 2PR9A 4DO2A 1JGLL 1BT8A 5HHNB 1RUF2 1KP2A 1KGWA 1RQ5A 3DYMA 3MCG1 3MLZL 1UD6A 4QWWC 5FYZA 4MAYB 4ZNEA 2JJVA 5E8PB 3M7MX 1OARH 2EADA 3GSNB 3QFDA 1NG0A 2Q0AA 4BUGA 4EN0A 4NN6C 4AKOA 1NE4A 3IJHB 1AGDA 1WYJA 4UAHA 1FV1A 4Y89A 3KWUA 3RWCB 1XB9A 4Y16C 3I2DA 3CFKB 4XF4A 3DN7A 4AXOA 1EFQA 4L3EE 3GWJA 5EULV 4MA8H 1RZKL 1VF5C 3UYRL 4A7SA 2YGLA 2WTRA 3C2AL 4LEOB 2WUBL 4NAQA 1I1YA 3DX7A 4MNGE 2FBOJ 4KVPA 1TFPA 2KA3A 1XU2A 2XY1A 3EH1A 3LF7A 3IMUA 4JM2B 4NUMA 4AF9A 5F37A 5CU9A 1XBFA 2CLRA 3T8MA 3L7EA 3UPAA 3AJYA 4AHYA 5HFLA 3IIAA 1HQ4A 3I85A 1QZ1A 1LHVA 3VXNA 5ABZA 1JYCA 4CGUB 2UUBB 2N1KA 3JWOC 1KS4A 4NUBA 2P8MA 5E03A 4HH9A 4UDTA 4HWBH 4JFOB 4PV9A 3WS6C 2EDLA 4I2XB 4WM8A 1EZVY 4G9DB 4JFHD 3VD4A 4Y8AA 4ELDA 3U9UA 4XAWL 1CX4A 4DNYA 3UTPD 4DGIL 4PJ8C 3LPOA 2YBKA 3Q9QA 1HJGA 5DMIH 5DRWB 3PWNA 1F1AA 4KWUA 4P3DB 4B7EA 1Y18A 2X4NA 3EFDH 3GSOA 3MREB 4YAQB 3WNPA 5E70A 4AY0A 4PRPE 4OZHE 3SCMA 1ACXA 1UN1A 2Q5TA 4MGKE 3RWKX 5IF0A 3ZO0B 2E9IA 2RR13 3AT8A 4QPIA 1PS3A 5IZ7A 4AV5A 2N01B 1IFHH 5FXXA 2F15A 1L7TH 4PYHA 2XJKA 3G7TA 2VN3A 4IERA 1YJLA 3ZXGA 3UJTL 4NC1E 1OOPA 3E6FB 2J43A 2QHRL 3DC0A 2DMGA 4N5ED 3N9OA 1KC8W 1V6IA 1W15A 3H0TB 2AAVA 4EBQH 1LQBC 2Q30A 5I91A 4NQCD 4MXVA 5LEJA 3LX9A 2BMKA 4GI8A 4KH9A 3O6FD 1IBBA 2CLZA 2EDBA 5JIPA 3ULVC 4BK8A 1JUFB 3VBRB 2R4SH 1FNLA 1KXTB 5L0QB 3AM2A 1F4WL 1KBGL 2DH2A 3FMGH 4HFWA 3KT4A 5L88H 5A3WA 4LF5O 3O2WH 3ZMNA 4K7PY 1MZYA 5EIBC 2JGDB 1QUNB 1JFFA 1CUOA 3FU5A 1K5QA 3IDXH 1OXYA 3LQMA 3FTWA 3ARPA 3T6ZA 2WRAA 3TONA 3H42B 1T89C 4W9GC 4YMPA 5CZKA 4DW2H 3W7UA 3QB7C 1JZ3A 1N59B 3B7RL 2JCCB 5KVDL 2GSMB 4FTVE 2X12A 4JPKL 1U8QA 3CB2A 5T1LD 1A6PA 3STZB 4HZ1A 4LNRA 3JZYA 5DZVA 1OSGA 1UZ8A 5EZIL 3PWUB 1TYRA 2QQLL 4JFDE 4ONUA 2EIBA 3AWFA 3C09B 1HQRB 4UWDA 2DTML 4MVQA 1N6QL 5CBGA 2DLGA 2VR5A 2R16A 3I4IA 4GUPA 1M90W 5GJSL 3BGFC 1DBAL 4B1MA 1XMOB 1E30A 3IE4A 3KBHE 4OU3A 5E4AA 4A2EA 4PGEA 4R5VA 3ZTJG 3B6SA 4PJXA 4NKIH 1YMMD 3MV9D 1Q72H 1NCRC 4GXUN 3BZEA 4NCDA 4WKZA 1W04A 4UQ2A 4W4KA 2BCKA 3CD6V 1J1OH 2H47C 1GZPB 1T4KA 5FKPB 2IXJA 4K40A 4FNPA 5CBHA 3INAA 3FU9A 4LCWD 3SJVD 5PCYA 3TO2A 4A2HA 2Z7ZA 4X6CF 4XCEB 1H9DA 5JW5A 4PJBA 3EBGA 1W99A 5C8YA 4X8NA 2CU9A 4OD1L 4ZSOB 1TQVA 4PD4F 5EZJB 1HHGB 3N40P 1V05A 3EYOB 4R9DA 5BY5A 1EUTA 5EEUA 2BSEA 2CUGA 2YUVA 4LSRL 1LP9B 1XTLA 1BSMA 5B3JF 1S5IH 1MFBH 2VQEO 1WWCA 1XZWA 4FFVC 4BIFA 1YY8B 5C0CB 1JVMA 1JS9A 4YSTA 1FN4A 2DYPB 4HONA 3VI3F 3S48A 2X41A 4RMWA 4DO0A 3MV7D 3WFHB 4YE0A 3CFBA 3FFCB 1AB3A 1LO0H 1TKWB 4Y1AE 1XBRA 2OSYA 4H55A 4G80B 3BRCA 4DP1X 4EFBA 3LNFA 2VB5A 3IDMA 4M1GL 3RILA 1C8M1 1W0JG 3IPEA 3R4DB 4P9JA 3IPVA 2AVGA 3QRFM 2GAZB 4R4NC 5IWLA 4FZEL 3BP4A 3H9SA 4PJGF 1MREH 2NDFA 3CFCL 5D71H 4CN4A 3RRQA 5H9SA 2ARJA 3ZFFB 3U4EB 2BSRA 2B08A 3K8KA 3KHQA 1U8LA 1S7TA 1NEZA 4GKOA 3RJQB 4ELKB 5F5QA 4GP5B 3ZMOA 4KTGA 4Y20A 1MAML 2RS31 2P7TA 4BM8A 4Y8DC 2HRPL 4LKXB 3VXRB 4BFRA 3IMVA 4ORZC 4OMCA 1CLZL 2ID4A 1W9XA 4UCUA 4JYBA 2EEFA 4UF0B 3MA9L 4CC0A 3MO1A 4KMTH 2X6AA 2QTEA 1IVLA 2EDXA 5AVRB 1TXKA 1AQMA 5FKAA 4PGBA 2DWEA 1CTNA 2H32A 1BHBA 4UT6H 3EHBB 2OPWA 4D94A 3V0WL 2HKXA 1PEZA 3K79A 3H8RA 1H1MA 3NABH 5AFAA 3HE6A 1BMWA 3OAYH 1QQDB 2ZUTA 3FQ2A 3SDDD 4CP9B 1XDTT 4APQA 4PSRA 2QQPA 2BRQA 2Y2WA 4LLAA 1AR91 5FMCA 4GMTL 1KD1W 3E1F1 1FNZA 1IIIA 4YFEA 1AIFB 5D1XA 1YUDA 3IAYA 1DQLL 4RWUA 4IBWA 4BCUA 1QEWA 1I5ZA 5C07B 3ERXA 4EI5B 2BP0A 3BE1H 4GG6B 4C91A 2EYSA 4R9BA 3FN0H 4FFKA 3JV4B 5KX5B 1PZ3A 4XPTH 4DGYH 2F7IA 3NT0A 3UPRA 1R6TA 1MELA 2DBJA 3K71B 1QBBA 5IKCB 1EMTL 2XX0A 3L3GB 5F88B 1BXXA 1KP3A 2DW5A 2JKLA 3QDGE 2JIZG 2X70B 4B7LA 4YSUA 3I6GB 1VRH3 2F17A 4Q27A 4PGCA 3RA7H 4TUYB 5AWNH 3ARQA 3T3MF 5HGDB 5C2BL 2J1RA 1EZLA 3JQOB 1Y1UA 2FB4L 1A7RL 4GY4A 4PJFA 1KCLA 5CEXA 5A1FA 1NBQA 4UOW0 4Y19A 1QMUA 3RL1B 3WIFB 4EZ4A 1J86A 1SOKA 4WW2C 2C1OA 2ZOTA 4L8SC 4NUJA 4TSCH 3IMBA 1OF3A 2ZHLA 1FFOB 3ACGA 2D97A 1D4M1 4BHUI 4PV1B 4D0QA 3SC7X 4LO9A 3UKTA 2EH7H 4YLZA 5KJ4A 4KZDH 3UJIH 4U3HA 5GS0L 2XH6A 2CE6A 1AVBA 3ULVE 4S2DA 1LO2L 1DBKH 3B56A 1LOFA 2IANA 2P9RA 3MCKB 4G8IA 4N90D 5ENWB 5IK3A 3D30A 4OGAD 5CF3A 2BGCA 2GNDA 1YI2V 1J7VR 5DXWA 4ONGL 5F5CA 1CI3M 5BRZD 4PJHA 2CM5A 3QJVB 3KBPA 5FP7A 5IB1A 3WQ1A 4PRAA 3G5YA 1CQYA 1PL0A 2VXVL 3AZUA 4G6KL 4N5UA 5TFSL 1R9FA 4Q7DA 1KYOF 5KUMA 1FNEB 1ZHNA 2BW8A 3VZOA 1HL5A 2DL2A 3LRKA 1MCOH 3P0VH 1OKQA 2HT2D 3RI5K 3U1XA 1WBYB 1VENA 4F4LA 3KJ4C 3Q13A 4FLXA 3TX4A 3UDWA 2ZAAA 5BXXA 3JASA 3ZOAA 2FHBA 2XZQH 4ZOLA 2X6CA 1U8PB 3P3SA 1G7PA 3UGEA 4HIHA 1JU3A 2ZGNA 4PLNC 2B9ZA 3QJTB 1K7DA 5JLZA 1CFQB 1IAII 5LG1A 5JDSB 2PHDA 2Q8OA 1ZANH 1J8HB 3BFOA 3DX6B 4YBQC 4HKOA 1JMUB 3E8FA 3QNZA 2WANA 5IHUH 2R39A 3P02A 3QAZB 3CQPA 4HBCL 1RUJ2 4LIVA 3THPA 4I0CC 4ZUTB 3BPNC 1V6JA 3QCTH 4QO1A 5AZEH 1RMU3 4EIGB 3BYWA 2XXCB 1FSKC 3R19A 4DKFL 5E4OA 4MA3A 3V5HA 1A6CA 3ES6A 3QNEA 4B97A 5IVJA 3QUHA 2RJMA 3CP1A 1JNHB 3TO4D 1QJY2 3SYPA 3IB3A 4PRBA 5GSVA 2OJEB 2B45X 2I32A 4F7EB 5CHNB 1JVLA 2JICA 1CGTA 3L5HA 4E41A 3SY0A 4PLJC 1MPXA 4LF9O 3BALA 2YRLA 3KMDA 3OPTA 2QE7G 4YW3A 4WEUD 4N8VA 4H8UA 4OCMC 1ASJ1 1W0VA 2VVEA 5EU4A 1NMAL 3WO4B 5EBWB 4LOSA 4M0NA 3P5BA 5GIRB 2DW4A 2Y1YA 4LE8A 4LBLA 1QNMA 4BQ4A 1OAUL 2L7QA 2WZPD 2A74C 2H0VA 1OBNA 2KMWA 2AGJL 1PBYA 4G6FD 4GRLC 4MADA 1K72A 5AOKA 4ENEC 5C0BD 3D4CA 2VNOA 5KSAA 1W2AX 2VAAB 4Y1YA 1V55B 5FNVB 1DVFC 2F93B 5FYHA 5LRRA 4Y16B 5EJ1B 4QRRE 5LYJA 3LE0A 3MGUA 4IUGA 4Q0SA 1GKFA 1RI8A 3MDSA 3QP3A 2IDFA 1G6UA 4CNIA 2MTPA 3KF3A 4MMXA 5DQJB 1A9BA 1JPFA 1OP5K 3ILFA 3P2TA 4LE4A 5IB5B 5I8TA 3ZHNA 1S4IA 1E1RG 4NQSA 1FGNL 1QLEL 1WBXA 4G59C 3K77A 1BQ0A 2HJKB 3F5WC 1OLLA 5BCAA 4DERA 2ZGOA 1ENRA 3CPLB 1H1IA 2CGNA 1L0XA 4KY1L 2A6IA 4XO9A 3SEPA 5CCKL 4S0HA 2PXJA 3JU9A 4NWWA 1R093 5JR2A 2Y72A 1VMHA 5D1IA 2OTWA 3LPPA 2GBAA 2HJDA 4X1YA 1T22A 3ABKC 3MLRL 4RLDA 2IOMA 5DEFB 1DBBL 3TJHC 5M0TA 2IH1A 1AL0G 1KGCD 5FZCA 2EILB 4NPYB 1E42A 3K2OA 3BDYL 1W8EA 4UQEA 1RU9H 5K1JA 4CGTA 5IVXB 5LDSA 1CZSA 1QOOA 1Z7S1 2WFPA 5DO8A 4CCKA 1L1FA 1W72A 3SKJH 2AJXH 1U42A 1E4JA 2WMPA 3KPSE 4MWFB 1T03H 5FZDA 4FOMA 4N28A 1UQSB 4S1SL 5LASA 1AZVA 5IYBO 1KNOB 4FEIA 4F8PA 1NXD1 4RHV1 3MVSA 5FW8A 2VDOB 4JDZA 1BG1A 3MRNA 1F8TH 1KG0A 3QJSB 1QRNB 5DEGB 3WXVL 3KCPA 3OHXC 4Z3FA 2CNAA 3WD5H 4CYDA 4RAUB 2BIPA 2Q3XA 4NYKA 3QDAA 4EN3C 2B1HH 5FZAA 4JRYB 1SQGA 3SDLA 5JHBA 2PMWB 4L0YA 4UW3A 2DQDL 1HOEA 2XJUA 3LKNB 2A1XA 1L5GB 1KPRA 3T0AA 3UTSE 4J5VA 4YGAB 5F7DA 2EUWA 3QUML 1VQPV 5IYCO 1JNNL 5F5AA 3E8HA 4J3VA 2ZWZA 1U8JA 3D25A 4MMYA 3HI1A 2C8NA 5HDQH 3VXMB 2QM8A 1EGJA