4PHZA

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
388
structure length
388
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
total genus 94
structure length 388
sequence length 388
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4phzA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4phzA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4phzA01
4PHZA 3CHXA 3RGBA 3RFRA 4PI0A 1YEWA 4PI2A 4O65A
chains in the Genus database with same CATH superfamily
2Y3AA 1MZ5A 4PP2B 5EU7E 1I1YB 3VMNA 4DRVA 2WWWA 1QHQA 2IFFH 2VITA 3CJJA 3QBTB 3OE7G 4GAGL 4YHMH 5IROA 2WNVC 1EM1A 4AHZA 5B5EZ 4BA6A 5FA4B 1OCCC 3F62A 4PEEA 5FFGA 3VFRB 1HXMB 1HRV3 2WNXA 2XWEA 4FN0A 3SN6N 4F58H 1RUOA 4N2MA 3O5SA 3UIYA 4LE3A 3ARQA 2Q8AH 2Z1PA 4JQXA 1TLKA 4B50A 1EAPB 1QHPA 4Y89A 3IGKA 1B4RA 1T89A 2JKWA 5F3EA 4JQIL 5CVRA 1C5HA 1NUGA 4DO5A 2TEPA 3IWVA 3PVOA 4K7JA 1BSMA 12E8L 2DJ4A 4Q4X1 3BVCA 4TV3A 3KLSA 4ISVB 1LHOA 3TEWA 2XJUA 4GG8A 4V2BA 3IT8A 3US9A 1QJY3 4LF3B 3TEZA 4PG2C 2NYZA 3JTBA 2HKFH 4XPTH 4DKDC 5I91A 1AY1H 3EJUA 3KT7A 1OW0C 1BWMA 3LDDA 3VQLA 1IGML 4MDIA 4UAOB 4NCC1 3DTDA 1OK0A 3JYBA 3TO4B 4R84A 1RUE2 5C0FA 2OP4L 3EH5B 4GG6B 4F5CA 4FA7B 4NIYE 1GPOL 5KHKA 3WIHA 2YD8A 2WZPD 5J98B 1LOGA 2O8QA 2IANA 3AY2A 3PWPB 1FD9A 4DK0A 1GAFL 3IDNB 1AUYA 3A6OA 3ZN4A 3HC2A 3UBXA 1R73A 5CN0A 4KNUA 3VXSE 3ZMEA 1APNA 3WFBH 4O4LB 3X3FL 2WZPP 1XZWA 4JZNB 1SQ4A 4O2EA 5CP3A 1T4KA 1NEZB 5T5NF 1A3RL 2OTWB 4P23B 3M46A 3SCFA 4BQ5A 1KJ3L 5BNQA 1O9HA 2IH9A 1NC2B 2W94A 3IVKA 4QE7A 2JIXD 5ENWA 4TXWA 1K92A 4OB5L 2OA2A 3WUCA 1DE4A 5F44A 1RU9H 1AJKA 5FZDA 4LASL 1UWWA 1WMXA 1UKTA 4IBZA 4JFEB 1TR7A 4G9FA 2HHHO 1NLDH 2BY0A 3DDFA 2EVFA 3CCSV 4XE9A 4LFAO 4NAJA 4YVNA 4JJHA 1HOCA 4JI8B 2QQMA 3JATB 4BUQA 4RQPB 1SZTA 2BPBA 4AY0A 1UXWA 4N9HA 1AR1B 1JGUL 3VZLA 1F97A 2QHLA 2IPKB 3NV1A 1BQHG 3U7AA 1O3TA 2QGDA 3FF8A 2R0KH 3ULVL 1W2UA 4MW3A 3GXIA 4YDNA 4DGYL 3GBDA 4QTIH 2H6CA 5HHPA 4NQVA 2YAFA 1MS0A 1RZJH 3RVZA 2VWJA 2C3XA 3I54A 1AR92 5KSVB 2J72A 3X1FA 2J8UF 1ZHKB 2BP8A 4F6RB 3FB8A 4XX1E 1COV3 3TBBA 3WHUA 3CQFA 5D1ZD 3K74B 1P6WA 3BZFA 3F7YA 3ST7A 1OD5A 4U3SB 2LQRA 5KAQF 1DUZA 5JPMA 3ZL1A 3HWJA 4CA9A 1XGYL 1OCZB 2QE7G 1CAWA 1XB3A 3LEVL 3DX7B 3DV8A 1OF3A 3T2OA 4LQFL 5B7MA 5IP4A 1W99A 2QBXA 4HK9A 4AQ8A 2FL5B 4MXWH 3R8BB 4JI4B 1WP8A 2OIEA 2P80D 2BH0A 3QUYA 5FV1L 4MLOA 4PIXA 3QXDA 4OI7A 3VE0B 1CPMA 4PH8A 3MXVL 5D1QE 2CTPA 1KBHA 5AL8A 4DY3A 1J05A 1G1XB 2AEQH 2UY8A 3IFLH 4I13B 3JD2A 3HR5B 5E6IA 3TNNA 1S9WA 3MGUA 3OF1A 2G2NA 5I8SA 1H8OA 2AEWA 3BOWA 1T6VN 2OJZH 1WFTA 1N34O 3RY6A 4KY1L 3GXUA 3OAZK 3MF6A 1D5BB 5DJ0A 3MODH 3P3NA 4I1NB 3RI5K 3JD4A 1EPZA 1FVDA 5FYJU 3TC9A 3V0WL 3QZLA 1JZGA 4F8QA 1TCRB 1AKJB 3H9HA 1XPWA 3PWJB 3JXSA 5LP6B 4NUQA 1IUZA 3L3HB 2W0FC 1T5WA 4K0OA 1A2YA 4CVWA 5CN3A 2J56A 4HOXA 1DVTA 4FTVD 2PFWA 3GSUB 2ORXA 1BQ0A 2ZGMA 2X7RB 3K2UL 2FZ3A 1RZKH 4MQTB 2X0LA 1TTFA 4NC2B 3ZKSD 1PLGH 5BZDA 4FXKA 5IK3A 2KR2A 1VQOV 4OIAA 4DEWA 4CDUA 4XX1G 2VITB 2BCKB 4Z8FL 2LVEA 4DP4X 3GSXB 1P7QD 3WDTA 1NCIA 1C8M1 3D34A 1NH2D 4Y4KC 3RP1A 2BWDA 4R52A 1L4IA 3FMGA 1ULPA 1QWRA 1ULOA 2CALA 4JFFE 5F7EL 3L48A 3NA4A 2QKIA 4MSWC 1SYVA 3AMQA 2JEUA 1VB4A 1OF2A 4FLOA 1IBHA 1YTFB 2W5FA 1PZSA 5DMJB 1EAH2 1FX5A 3I2CL 4EOWH 3GBWA 3N85H 3CEWA 1L0PA 4AGOA 4M6NL 5KBLA 1NGXB 4RD7A 1YVWA 2H3KA 3LNIA 4H0IA 4RWYH 3RHWF 3GMQB 4Y1XA 3JWDL 2FWUA 4H3WA 2VSCA 4RSUA 1JD9A 4NRYB 1J0KA 2J57A 4RIRA 5C0RH 4PJXE 4G82A 3AYDA 5I28A 5T3ZL 1A02N 3D3AA 1KJVA 1TJIH 3A3YB 5IWLA 4RRPM 5JDJA 4D94A 5IB4B 5C0FB 3GSOA 1CAXB 2FHCA 2VCCA 3DUUA 4FQ1H 2B59A 3O3BA 5FUPA 1PVC1 3QH6A 4TLUA 3QG5A 2ED8A 3K3QA 1SLLA 4JTOA 4JKPL 5BRPA 3GZQA 4KH9A 1Q6HA 1DBKL 2YAMA 1L3NA 2DCKA 1A7BA 1NFDE 2ZWZA 2VDQL 3T09A 2OUJA 1U8MA 5CILL 1RPQA 2PMZA 4O9HH 3LKQA 4O2EB 3S35X 1T4KB 2J1KA 1AZRA 1MS1A 1RSFA 5IHBA 4LFHG 4BMBA 1G7IA 2R69H 3D0VA 1U58A 1LHZA 3CC5A 1DN0A 4HPOH 4I77H 2PYEE 3E35A 1J9SA 4G5ZH 4PG9A 3U1QA 4XRCB 3IVKB 1EWHA 1NR1A 3B8YA 5ENWB 1XSRA 3GJFA 3ULUD 1WTLA 4QYOA 2R49A 2EZPA 3BA9A 4CC1A 1OAZL 1CWPA 2YWYA 4EI5A 4TQIA 2LW8A 4LVNC 3O9WA 4TWTA 5DFTA 1BDYA 4TQEH 3JARA 3WF2A 4UI9L 1O8PA 3I49A 1SRDA 1B6QA 1NMAL 4OY9A 4E41D 5E1AA 2Y69B 2HVJA 4NSKB 1XF3B 1H4HA 3SH3A 3H7BA 3L16A 2RCVA 5I66A 2HEPA 1UM6L 4R4FL 1A7RH 2O6FA 2ESVA 3JTTB 2ZF9A 4HIQA 1BJ1H 4XCEA 4JB9L 3QNYA 4D8MA 4ZI8A 1H3PL 2NQCA 3KPLA 4UF7C 5JOFA 2Y6SC 4KO5A 4OCNC 4G71B 1CD8A 1FC2D 5E4AA 3WJLC 1LE5A 3K8KA 3BZFB 3OB8A 3BDXA 1R3JC 3F7YB 1U8OA 5FO9B 2EUWA 1DUZB 3KB5A 4F7ZA 2JTDA 4O2AA 3UZQA 4Q4X3 5FZ3A 2WN2A 4ZD3H 1N5YL 4TLGA 1W8EA 5GW7A 4C56D 3JWNE 2EA7A 1RPKA 3RDIA 3D2UA 3IFPA 2P42B 3LZQA 4N9GA 2D3VA 3ROOA 2K9FB 2QDNA 3WFHB 2VPVA 4XVSL 3GSQB 3KXFD 5I8KH 4WW2C 3VBHC 4L8DA 3MRKB 2NY6D 3SQBA 2HKOA 3QA3A 3LWCA 1TTGA 2XJQA 5E6IB 1S9WB 1BD2B 3IN0A 4P9WA 3VXQB 3AU1B 3S96B 1QFUL 2XV3A 2VLRA 2ZYRA 3WR0A 3HA0A 1FKAO 1FL6A 2FBJL 4APQA 3BPCB 4KQ4H 4NZDA 5A2QN 1PIV1 3IWUA 4AUJA 3G6DH 4C90A 1FVDB 1HEJC 4Q29A 2O6DA 3GNMH 3GTNA 4FZ8H 4HAKA 3D3QA 3R18A 4N28A 3GK8H 4NN6B 4ZBJA 2FWLB 1NMCB 3ARGC 4TVPH 2P24A 1T5WB 2ZAGA 1A2YB 1GC1H 2QADC 5BVPL 4HWEH 2Y23A 1QRNA 3OYWB 5CG9A 1JV2A 2MNWA 3V10A 1D5AA 3WDXA 4XNAA 2LRPA 3VD9A 5BZDB 4JM2C 3V95A 3RDTD 1NL0H 3JD1A 1WF5A 2MTAA 2R7EA 5FTTC 1PO22 3IM0A 3R4SA 4CDUB 1H5BA 5E94A 4WKXA 5FMOL 1N7MH 3QZNA 4U1KA 1VMHA 4KAQH 2EILC 3WIHL 2NZ9D 1VFAA 2C8NA 4WI6A 4BW5A 1CR7A 5DAWA 3OAYK 4ONGH 1H8EG 2HT3D 1TXKA 1N18A 3LIZA 3LYRA 5F9OH 5K4LA 2H9GA 1VF6A 3JWNG 1DFBL 1OHZA 1MG1A 1Z9SB 4KP4A 2WO3A 5G5DA 3TNMA 1OF2B 1FOD3 1WBLA 4LU5H 3MYXA 2ZE5A 1T1ZA 3JCUZ 4JI0B 4NLAA 2CXGA 3O4LB 4X98A 4BE5A 4ZSOE 4E9WA 3VD3A 1IC1A 4JI3B 1VBA1 4H8PA 1QUNA 2Z1KA 1KXGA 4DIQA 5A16B 5C0ND 5FPLA 2LU7A 2X70B 3S0PA 3C3VA 2E6QA 3FL7A 1OB1A 2YEZA 3VCLB 5DEGA 1A7OH 2AAAA 5E6YA 3PTYA 4WKZB 3POYA 3PPSA 5FF6A 1XYOA 4WFBV 2VU9A 1XCTA 2W65B 1EVTC 4Q89A 3CZJA 5KVDL 3QNEA 3VQWA 4BQ3A 4HIXL 1G6RH 4TL5A 1AGFB 5GJTL 1GP6A 2QSAA 3DK2A 4O4YL 4LT7A 1GYVA 1MCHA 4V1DE 1E4WL 1JOJA 1QR4A 3DUUB 5J96B 1E7VA 2W9XA 3MD0A 3KS7A 3VB8A 1ES0A 2NY7H 5L3CA 3F3HA 4W81A 4F2MA 4N1CA 2DICA 3BWUF 3TWCL 3RGBA 4JKLA 4B7EA 3D05A 1A4KB 1UD4A 1T2JA 3DVGA 2HSIA 3DPRB 4Z82A 5IEKB 3FT4A 4GAGH 3V0DA 2FCBA 4F24A 4WTXA 2O93L 3LKQB 4CAGA 4I0WB 2WNUB 3QEQD 1DR9A 3FUHA 1LNSA 3V0JA 1OC1A 4YDMA 1G7IB 1WEJL 5JMRA 1YHFA 4LSQL 1U58B 2M6YA 2Q30A 3L2HA 3CC5B 1DN0B 2HJFA 4LIQL 4BFOA 1I4FA 2BP3A 3EBIA 3BN6A 3QDJE 3BSZA 1NFKA 4JQIH 3GJFB 2AJZA 1HIML 5DRXA 3DKQA 2WNVA 12E8H 5DJ2A 3WP4A 3SO3C 4NZFA 4IETA 4PGCA 2FD6L 2E0PA 2HA1A 3MDPA 3P9MA 2A9DA 3NFPB 3HTLX 4BZ4A 2F8VA 2IM9A 1AR72 3BVWA 1S5HC 3JARB 1S3RA 5KVEL 1DJHA 5CJBA 1AQHA 2F58H 2HVJB 3II1A 1L5GA 5ESVB 3SDXA 3FSWA 1IL1B 1IGMH 5EIIA 3IFNL 3H7BB 4FP3A 1IAIL 5JJJB 4HT1L 1KEML 3KPSB 1WZMA 4QIRA 1V3JA 3C3SA 4K5PA 4XMWA 1KGCE 1AZUA 1DBBL 2ZT9C 4JO1L 1A78A 1AS7A 4QRBA 4XB3A 3BALA 1GPOH 3KPLB 4TS6A 1K3EA 5JOFB 1LO5A 4Z7OE 1K85A 1R091 4GZ9A 4PG2A 1SJEA 3KPOA 1GAFH 1LM8V 2ZUYA 3MYZA 4KRNA 4P2OD 4POUB 3WNOA 2XBO3 3MNMA 4PCKA 1VPOL 5LN8A 1JRHL 1OW0A 1UC6A 2YUZA 4HX1A 2VWEC 2PF4E 3BLKA 4K5OA 4WHCA 3ZE1E 5E8NA 2ICWA 3X3FH 3CCHB 1ND2B 3WMQA 5FZHA 4P5MA 4XCNA 3B9KB 1SDWA 4H1LG 4YHIB 2XN9D 3IMBA 4TSBL 1A3RH 3VACA 4PJEF 4AFBA 5CFDC 5J09A 3ROOB 3QCWA 1KJ3H 2FAUA 2OMTA 4CU7A 1U8KB 1XMOO 2A4ZA 4NN7B 3IPFA 3FYEB 4G83A 5LCVL 4OB5H 4GKOA 5EDXA 3I74A 2Z4TA 2ZXEB 3AP9A 4LASH 4U6YA 1J0JA 2MNUA 3D69A 2A71A 1AG6A 3APOA 1ONQA 2VLRB 4MTMA 2BNQB 4APQB 2UWBA 3TH4T 4NI6A 3K7UA 2Q7AA 1E6JH 1YF2A 5D1ZC 2GEQA 4P9GA 1DQ1A 1JYVA 3A24A 1XYNA 1JGUH 1CZTA 3PREA 1LD9A 5G05L 1RUI2 3VL8A 4PRID 3ULVH 2Q87A 4J3SA 4IGBB 5BNNB 4DGYH 4J1UA 3BQVA 3U9WA 4OMCA 4I50A 2EYRB 3OJMB 2E9JA 2DQTL 1E0OB 1QW8A 3N1GC 2R15A 1MPAL 4NERA 5EEWA 1W05A 4AVSA 4JI7B 4QDGA 3UCSC 1LMKA 4ONFL 4OZGF 2ZUTA 5E24E 4X9YA 1H5BB 3L7FB 4MTXA 3BTXA 2GB2A 4WBNB 1QKZL 2EDEA 3QO1B 1P4RA 4Q14A 4XZPA 3O9OA 1RMFL 3WCSA 2J1ZA 1XGYH 5C0EA 3LEVH 4MWFA 4LQFH 3GRWL 1PGL2 1OK8A 1T2QL 4X6EB 5BO1L 2H9GB 5IMOA 1NCUA 4X5PA 4FJCC 3LNHA 2HX9A 4HOWA 3ZIWA 3T1YO 3MXVH 2P3IA 5KXEA 4HEPG 4Y5XB 2P43B 2UUCO 1PKXA 4Q20A 1F3JA 4JTNA 4E9SA 3S7EA 2VW4A 1PO11 1QUNB 1OD3A 4N2HA 4FNQA 1KGYA 1N8ZB 4K3JL 2ZDIC 1WYJA 1OB1B 2Q0AA 1IKNC 5DEGB 2H6OA 2XKSA 4KY1H 3DC6A 5FF6B 3KQ4B 4K8RD 4MXVF 4WY7L 1D2DA 4PCYA 2JS3A 1WFUA 3ETDA 3KLQA 3NPSB 3V0WH 2QV2A 2XLLA 4LCCC 4DCQA 3TU6A 3IDBB 3SZ6A 4P3WA 2Q7NA 3LRHA 2OAAA 2QPUA 1X5AA 1JL8A 2DD8L 4QXVA 3HB3B 2D0HA 1BFSA 4CBZA 3Q8AA 5MHSE 3U46A 1ES0B 2B77A 1MFDL 2QCSB 3K2UH 2B9ZA 4PGBA 4OJFH 3T1FA 1QRKA 3RTLA 3GIVB 4QD2E 3DVGB 5TE7L 1E3ZA 3GALA 4Z8FH 4M3HA 1TTUA 3CQQA 2NNFA 2B4CC 3AMPA 4KHXH 2WYHA 4JDMA 2D98A 4Y22B 2ZX0A 1OP5H 3L3DB 2AJYL 3B9EA 2W0FA 1YN7A 1B04A 4GLXA 1GKOA 1Z5LA 4UQCA 1RFYA 2BPA2 1X5IA 1Q0XL 2VAAA 3HC4L 5F7EH 1FYTD 3ITQA 1PM4A 5F6KA 1U93A 5LY1A 2HJFB 2ZYHA 3MRQA 4RN5A 4DR1B 1HB1A 2WAAA 4JTCB 1UJ3C 4BFIA 3U78A 3I2CH 2AJZB 5DRXB 4XMAA 2FSEB 1SXSA 3MHHC 1NI8A 2RALA 4EN2A 4M6NH 3CZKA 1EJFA 1S7UB 3OPTA 5IYZB 4PGCB 3CDGA 4J7ZA 1MDTA 2R0WL 4Y4KA 2XXFA 4NENA 5LXVA 3JWDH 1QSEE 3RGVD 5LHDA 4WUUA 4DV7O 3CUPA 4MSWA 2HPOA 2KQMA 2QQLL 3KCXA 1PK6B 4PJ9A 5T3ZH 3SDXB 4DV3O 2J8HA 4CEYC 1KC5H 2WXMA 2AQPA 2H0PA 2OXGA 5IR1A 1NQBA 2BIMA 3MRRA 3L9RA 3WBDA 5L2KD 1UYXA 5E8OB 5FL7G 4GQPH 1G7JA 3EMRA 1A0QL 4R7LA 3WHXA 4YZ4A 5AFEA 4TYUA 1J58A 1SJEB 3KPOB 1KG0A 4JKPH 1AROP 3UTTE 1DBKH 4A2LA 1OCRC 3LY6A 3ULUC 3FJSA 2EQDA 3EO6A 4N4YB 3OB0K 4Z1PA 7PCYA 4HX1B 4LBQD 1CGPA 1H2NA 3JQXA 5E8NB 1F4MA 2ICWB 2E3CA 1QSFA 4A2MA 2J1VA 4P5MB 2FQEA 5KJ4A 4PLMA 1HC1A 1A9EA 1OXCA 2W0LA 4NKOB 1B35C 1Y6KR 4MVUA 2OMTB 1BMV1 3GJEA 5DTFB 1MCOL 4Y2DD 4JGUA 1VB9A 5C3QA 7TAAA 1JH5A 3KD4A 2BP5M 1S7QA 3PV6A 1OAZH 3D69B 2WL1A 4Y19A 3N1PC 1ONQB 3L5HA 3MNVB 1U2HA 4FF9A 4WWKD 4X20A 5E1QA 3PG2A 5B8CC 4MA1B 1L3JA 4V1PA 2IO5A 4WGWB 3OG2A 3TJEL 1NMAH 3D25A 4CSSA 4PRHA 3DYOA 5IFJB 4H5SB 2BMKA 3QIWC 4ZUSA 4UFJA 1Y6NR 3QTCA 1UM6H 4J1UB 4R4FH 4EI6B 3HE7D 4I50B 2V5SA 2GMEA 4FKEA 4X6QB 4JB9H 4OI9A 2F4VB 1H3PH 5JMOC 4X42A 4RHV3 3NTCL 3MAQA 1HHHA 4MGTA 3EAKA 2OQJA 1BBT3 1KC8W 2DQ6A 3F7PC 3CF6E 5C0BB 3PIGA 5DEJA 1KB9K 2Y2YA 4QTHA 4G8GE 3MEPA 4UT6L 2CK2A 5HDBB 5F2VO 5C0EB 2CGOA 2LU3A 4MNGE 4N2CA 1N5YH 2D40A 2CY6A 1IAOA 5FAXA 4MWFB 2ET7A 4NPYA 4L4TA 4IRJD 3MAWA 5DJYA 5IMOB 4FG4A 3WTWA 4JFSA 3VZNA 1WD4A 3L3IA 1X9QA 1EBAA 3H55A 2OI9C 3PXLA 4XVSH 4M9PA 4UDUB 1IPSA 2P17A 3S57A 4OV6F 1F3JB 4P99A 3WJLA 4RH4A 2XPGB 4MVBD 1ACXA 3U1PA 4M8QA 1R3JA 2BVUA 2QEJA 3CDYA 3FO9A 1QFUH 4F37F 1MIML 3RQ3A 4HKZB 5LJYH 4JHAL 2FBJH 4J27A 1YEWA 3HPLC 2GTQA 3LH2L 3BSZL 1MJJA 4LNUB 3ECBB 4L11A 4FE9A 1DEEB 2ICEB 3HR9A 4GLRI 5B39A 1F1AA 3NCJL 3KJ6L 3I6KA 4N8VA 2BUKA 1ULVA 3LSUA 2NZ9C 2C24A 4WW2A 3IPBA 3VBHA 4K3GA 2LW1A 3OLGA 3TYJA 5BVPH 2JI2A 1QJX1 2HT3C 3WLBA 3SDAD 4ALAC 1CCZA 1VQ5V 4NZUL 3PDDA 4DGIL 4XIKA 4F80A 3UO2A 2HWB1 3FFDA 4HKJB 3D8CA 2D3NA 4HA1A 1MG3C 2C26A 2QZQA 5JH7A 3BD4A 3B8NA 2QQKL 5J3HD 5C0NC 2V3EA 4FM1A 2VE6A 1U5IA 2RJMA 4W9FC 3IN9A 4MB1A 1TPXB 3WIHH 4NT6A 1CESA 4G1EB 1YN7B 1Z5LB 2FX8L 1UZ8A 3H7LA 3O6LL 5HHXL 1JTTA 1JYNA 4FPKA 4Q4W2 1FL5A 2VAAB 1DFBH 2YFNA 5T8IA 1EZVX 1WPCA 2RGSA 1U93B 1VQNV 3MA9L 4W70A 4E42B 3MRQB 4JM2A 5M94B 3FSVA 3CHRA 3D3VE 4BFIB 4D2NA 3CJXA 5CFAA 4R9BA 4L9BA 3H3LA 5CP3H 3VFUB 4W6XA 3RTQD 2F7QA 1LK3L 2YMXL 5KG9B 4U6HA 3M1OA 4Q4Y2 1E4XI 4KXAA 4ZNEA 2RDSA 1K97A 2IDSA 3CDGB 4MZIA 1S0IA 4U05A 2WSKA 4QX1A 3ZFFC 2GPZA 1TLMA 3H42L 1E27A 1LB2A 4WUUB 5KVDH 1TT6A 1JTOA 4G6KL 3THDA 4XF1A 4AJYV 4HIXH 4PJ9B 4JW3A 1AANA 5DQ9A 1WFNA 5GJTH 3RMXA 2CGRL 1UJTA 4O4YH 4F33A 5F32A 2ZSVA 1E4WH 1XBFA 5B1NA 1EXUA 1KQRA 1EJOL 3SJVB 1G7JB 3RA7L 3UP6A 2XLGA 4D8PB 4JPIA 1FMD2 1BP3B 1XGTA 1OIOA 3RDJA 5D1QD 2ZX9A 3TWCH 1DZ0A 3F00A 4LF8B 4K7PY 2Q9OA 3ME0B 5LGHH 4ZOCA 4C55A 3N1MC 1H4GA 1SCSA 4SBVA 3HJEA 1J8SA 1EAH3 1ND0A 1QSFB 2E6PA 2EIDA 3BD3A 1N0JA 4GRMB 5BZWA 3FJTA 5KVMC 3WY2A 4R90L 5GZDA 1RVFL 1LHUA 1WEJH 3VNZA 4JGZC 2HRGA 4LSQH 3IN2A 2WQZC 2BQPA 2FCTA 1BOGA 4PBPA 2ZKOA 4HS6A 4BSWA 1YNKL 3RYMA 4DUWA 1FZMA 2IV8A 1HNWO 1U4EA 3FB6C 4RFEA 4UT9A 4EIBA 3OR6A 1HIMH 3C09C 1WFIA 4PJBE 4C4BA 5F2FA 4IBYA 3DGCR 1FPN3 2RJKA 4X66O 4NR1A 2FD6H 3SYOA 1D5XA 4X20B 2BW5A 1QPKA 1L9RA 1I08A 3M3EA 4P2OC 1ZCRA 3RKDD 5KVEH 4IQHA 3I59B 4JFDB 4MDJA 5CMUA 3D25B 2W8CA 4WSGA 2GHYA 4PRHB 2R70A 3IFNH 2Q8DA 2JLPA 2BS9A 4ZUSB 1IAIH 3ZHSA 1KEMH 4HT1H 3HW7A 5I1DA 4I18C 1WNSA 4P9JA 1INQA 2MWCA 1DBBH 1ETA1 2QVKA 4JO1H 4LFHD 4R8WL 4Q52A 4B97A 1H30A 1FHNA 4EN0A 4MAYD 4JFFD 2CHXA 4O51A 2WZPA 5DHXB 2OPKA 1ZHLB 3LQAL 3MGOA 4HMZA 3U37A 5BV7B 3KM1A 1S5HA 4HKLA 2EE2A 1Q9WA 3RJDA 3KVBA 2HTLD 2YBKA 5JZGB 1VPOH 1RIRA 5EFUA 4DR7B 3CL1A 4MQXD 3WJMB 1QASA 5E0QA 1XH3A 5H6RA 1IAOB 2WVTA 3OD4A 4AL8L 3L4TA 4YSQA 4NPYB 5F3BA 2R39A 5DJYB 1T5XB 2VQAA 4KQ7A 4TSBH 1LHNA 3L3IB 5FPIA 9CGTA 4Q5OA 2VC9A 2ZINA 4WWNA 1BYNA 5SX5K 2IH8A 4KTDL 2JIXA 1L9TA 4TQHA 4U3HA 4NHKA 1G5GA 1XHHA 3FMGH 2NMSA 4HMDA 5LCVH 2ZP9A 3X1NA 3IAGC 5A1LA 2Y3NA 5D93C 3S8WA 1RYYA 3IF1A 4R97C 4YHOL 5FM5M 4Y5VC 5EO9A 1XF2A 3GSNL 1GSLA 4AUUA 1SYSA 1QACA 3K4AA 1HXYB 1UY3A 1SHXA 2G5UA 1MJJB 4FEMA 1OT5A 2DUPA 3ZPOA 5CFDA 3FUNA 1OSYA 5HJDA 4U1JA 2WW8A 1JXNA 3ZTNH 3WELA 1RUF2 4YDZA 4OXSA 5IY5C 1M6OA 2JFCA 2EIGA 2V09A 5DGRA 2VQEB 1FO0L 2RD0A 2XVBA 2JI1A 2UWEF 2DQTH 3F12B 4DEUA 5I6KA 5J6HB 3RI8A 4YO0A 4HMEA 4GP4B 5HI5D 3WN6A 3AROA 3FFDB 4F1SA 4IEOA 3R06A 1J83A 5IMLA 2PYED 4KZEL 4K9EC 3KF3A 5D1ZA 4ONFH 3W7UA 4DESA 4LULA 4IRZA 4FPCA 4J3WA 1QKZH 4LBEC 1BREA 3O45B 1RMFH 2XA8L 4NT6B 2KHAA 1NOFA 2YA1A 3DX0A 4F92B 4UINL 2GJJA 2J1UA 1UZ8B 3GRWH 3ILDA 1T2QH 4K8RC 5BO1H 5L2JB 2PLV3 2P80A 2Z4FA 1FL5B 2VUOA 3LOWA 4MJHA 4PRBA 1HHKB 5BUVA 4K3AA 3HFML 2Y4TA 4NZJA 3DSNA 4R5TA 3DF0A 1D4M1 1RCYA 4XBNA 1DQTA 1NTKH 4W6XB 3GBNL 3HMWL 2F15A 1W0NA 1HCVA 1AZBA 1IFGA 3ALPA 4K3JH 1QLEB 2IFGA 3C7EA 4DP6X 2BINA 4M3JA 4N2KA 4X6DE 5HGBA 2E8ZA 3HBGA 3AC0A 4WY7H 1E27B 2ZM6B 2VXQL 4JAUA 2FGZA 3FCSA 1Q9OA 1XUQA 1DVQA 2VW0A 2DN7A 1HP8A 4CBCA 3HN8A 4N8PA 4D6RA 3PWUA 5AEAA 2DD8H 4IIJA 1FXKC 1LKNA 5FLIA 1Z5HA 4DP7X 2DCTA 4HISA 3VXTA 1EXUB 4FTVA 1IKNA 3UO8B 1MFDH 3PN1A 4J3OD 5I6NA 4YHHO 2AJXL 2LLNA 3IEAA 3ZDWA 3AZWA 4GWIA 3H53A 1TTCA 2ATPB 2CE4A 5TE7H 4AGGA 5I6MA 3MRNB 2VM3A 4K5MA 1P7QA 5E00A 3FS9A 3ISRA 4LCCA 4YEFA 4XFAA 1ND0B 1OL0A 3RWNA 2AJYH 2KPNA 3HOGA 4XP1L 5KLVH 4O61A 1FA4A 1LDPL 2B9AA 2FH6A 4HUUA 5BV7L 5LG6A 4LDCA 2O6EA 2QSTA 3VD1A 5FOBB 3L2NA 1Q0XH 4JGJA 1O7DE 3HC4H 1AMXA 1X5ZA 4GSDL 2XG5B 4WK2B 3LA2A 4PBVC 5CJ5A 1XE7A 4RQQA 5GIRA 4HS6B 5C7XL 3D18A 3QLQA 4D7TA 1OGSA 3O0XA 4LBNA 1QJX3 4LNRA 3OR6B 2YUVA 2KQNA 4TLKA 1GMEA 1IM9B 1ZRDA 1RPOA 4UW5A 2GFBA 4W9KC 4MVSA 5GRUL 2YFUA 2R0WH 4CYDA 5F7KC 1D5XB 4AQYB 1UADC 1I7ZA 1WLHA 1AYN1 4JDZA 3QDHA 2NY0B 1LEGA 2N59A 4TV9A 4MDJB 4NGHL 3EXJA 2VMJA 4E9XA 2CGZA 3SHRA 3MRPA 4FQCL 1UJ3A 3PNWA 1X5HA 3MCG1 5EZWA 2APBA 3MHSC 5JPNC 5I1DB 4FHBD 3ZDYE 4XB7A 5KA6A 1U42A 1INQB 4C57C 1HNFA 4YW4A 2BE3A 3HEIB 4O51B 3ARRA 1A0QH 4Y2DC 2B39A 4ZG1A 5E4EC 4KTYA 3DVNA 2J3SA 4UZUA 4WU7B 3A6CL 4WTZG 1VRSA 2WLZA 4KJWD 5F7DA 1I1FA 4UTBA 5E99L 1JHKL 4Y1YA 5GLUA 3TOJA 2HFGL 5K59F 2V1DA 2BSRA 1IZKA 3E8UL 3WHTA 4CEYA 2BSSA 5AB1A 5F3BB 3MJ7A 5CD5D 1Q9LB 2VKWA 5EU7C 1EVUA 4BWAA 4L3EE 3CCMV 4EDWL 2CIIA 4JANB 1XMEB 4NO2B 1MCOH 1XGZA 1CXLA 4ANVA 2XVLA 4JHBA 4XUNA 5LK5A 2F6AA 3QJSB 2Q3XA 2PWFA 3HE7C 3K5SA 4V1DD 3IF1B 4MVZA 5EO9B 4FA6A 1XF2B 5A7WB 3DDGA 1SYSB 1TNNA 4FOVA 5CBGA 4GCZA 2XETA 4A7SA 4XNYL 1LNQA 3L72H 3SCMD 3AVSA 5CFDB 1B35A 4RRPA 2ZGKA 3C2UA 2H8PC 4UCFA 4E41A 2J44A 1QLEL 5DZVA 4XAAA 3POWA 5E56A 4QAWA 2WLIA 4IRJC 4LCWE 1DBML 3G08A 4HIEA 1FE8L 3SEPA 5F7HA 3VD5A 1FT9A 4JRWA 1K5WA 3IWZA 3NT0A 2F53B 3QZWA 3NTCH 4R7NB 2ODMA 2Y06L 1VEPA 3PWVA 4MCYA 5B8CA 5IMLB 5DA4A 1HKDA 3CHXA 3WEXA 3WG7C 4MVBC 4L18A 5T5JA 3LF7A 5C70A 4GQ9L 3UL2A 4UT6H 4K94C 2WCPA 3VFTB 3J9SA 3WJJC 4L0YA 1KBVA 1W0PA 4C56A 2YD6A 2XHBA 3NCYS 1H2KA 2A77L 1FXVA 3K79A 3CK0L 4M5SA 4LESA 5JMOA 2HVKC 3DSNB 3KXFA 4WDIB 4GH4C 4YHNA 1SZNA 4MVMA 3C5ZD 4YHPB 2O5NA 1I75A 4WTWA 5KSAD 4LCUB 5FAAA 4XMTA 4UUJC 1F11A 2LFEA 3CFDA 4OZ4B 5SWZE 3SDAC 3ATGA 5HHVL 5JNYA 1KGCD 1MIMH 2Y25A 3JTSB 2A7AA 1NCAL 4JHAH 2BWAA 1TJXA 5T1MB 3LH2H 1OVSA 3BSZH 1U8NA 2W1QA 4UMSA 1T6GC 3AG1C 3BIBX 3GMNB 2GAZA 5TDNA 1LESA 4WFEE 5EK0A 3H50A 4ANUA 4RA3A 3OV6A 1KCRL 3KJ6H 3NCJH 3DHUA 4OFIA 4C91A 1BMWA 4XMZA 3QJUB 3AYEA 2HLFD 4FMTA 1DVUA 4GAZA 4F15C 4IIJB 1UOJA 4BPZA 4X7SL 4RWHA 5I5MA 3VXTB 4JI1O 3ZN5A 2JJ1G 1HWYA 3RZGA 4J3BA 4NZUH 3TXAA 3AG3B 3IGLA 5T50A 3RDTA 3OVUB 4DGIH 2HWF1 5KVGL 1QFWI 3O2VL 3ZT5A 3V0BB 4AYFA 4A7VA 3RTQC 2PYFB 4ZHNA 2QQKH 2EDKA 2NR5A 1P7QB 5E00B 2PTVA 2AVGA 4NO0D 3SKJL 4B96A 2LV4A 4FMKA 2NZ9A 2GDSA 1K4CC 4C1WA 2RBLA 4G6AD 4Z23A 4CP1A 5CA6A 1DZBA 2CIKB 5DVPA 3C60D 5HHXH 3O6LH 1Z9MA 2VG9A 3CVHB 4WI5A 5FJKA 3UGHA 3MA9H 1L9PA 2GTZA 5DVNA 2VOXA 4RQQB 4LBMA 2ZSWA 3D18B 1EHAA 4PYHA 2MQ3A 3LXUX 2EVGA 2A0LD 4G4FA 5E88A 2K2SA 4LNRB 1VDGA 1YRKA 4WM8B 1BXXA 1LK3H 2X4TB 2YMXH 1HOEA 1OMIA 3FQWA 3BZDA 4XAWL 1U8CB 5ANMB 2EF6A 2Y26A 2H45A 3KPPB 4EKWA 1BG9A 1UYPA 1N10A 4IUGA 1I8LC 3CC1A 5D1QC 1I7ZB 5SV5A 4TNEA 3H42H 4JDZB 2H1PL 4OFDA 4XE5B 4MNQE 4MKTA 1QH7A 4AEDA 4TV9B 3DPBA 4G6KH 4Q9CA 2FD8A 3N27A 4FPYA 3LZLA 4HAMA 1UJ3B 1QWUA 2CGRH 4I55B 15C8L 3MV9E 4AI9A 4ZIBA 3A47A 3TBDA 1OLLA 2LR4A 1EJOH 1R6VA 1SXCA 2VN5A 2YAEA 3JUZA 4ZUTA 5C07E 3MV7E 3RA7H 3UG4A 3TFKD 2XI9A 2EEAA 1C08B 1VFUA 1J0HA 3LNEA 4CJ0A 4XVOA 3ZFFA 4P2QB 4Y20A 3BO8A 4Z76A 1I1FB 1EPFA 1POV1 2X53S 4QI3A 5A33B 1MH5B 3OGGA 5FYMA 1W28A 3MGTA 2R071 4XEZA 3PJSB 3QEQA 4R90H 1RVFH 3RKDC 1SFYA 1TQUA 2YEVB 1LGBA 1R3HA 4CMMA 5D1XE 5EUOB 5AW1B 2R72A 3IYLW 3LPWA 2JDMA 1CLOL 1I7TA 4CA4A 1YNKH 2HLEA 2IMNA 1JFFB 4PIBA 1SRYA 2IH1C 2E5EA 3SBQA 1KYDA 4MMXC 1CBVH 3O6KH 5H37A 4IOFD 5K5YA 2QWPB 3NSTA 2OW4A 4PMEA 4MAYC 1YHQV 5MHSD 2GBUA 3NACL 3LIUA 2MJWA 3W39B 3DX6B 6PAZA 4P9LA 3K06A 5BV6A 1IPJA 4JDOA 2V9QA 4AENA 1B35B 1TIUA 2HTLC 4PBXA 4E41B 4QQLA 4MQXC 3CNAA 1BYOA 1NTZH 5CIPA 2LGNA 1Y6MR 4A2GA 2WNGA 4JPSA 3FB6A 4Z7QB 1AH1A 4HIHA 5CS7A 3G08B 2Y48A 1I8MA 1HKLL 4KG0A 1CFQB 4R8WH 3HI1B 4QKTA 5CBAB 3SCGA 4BISA 3THOA 1J18A 1LGNA 3FQ4A 4BQ8A 3S5QA 1Q90D 1IDSA 1MREL 3QZWB 4ACPA 4EIUA 1C8M2 2V4DA 3EG9A 2XDHA 3ELNA 4P2OA 1ULEA 1EUTA 4K2UL 1OM9A 3EO9H 2FB5A 3NCYP 3VXRB 3CCLV 4U1MA 1ULDA 5I18L 4A5UB 1E4KC 3KL5A 5J6SA 3JU9A 5FYKE 4UV7L 5I0ZA 4LRIC 4JK0D 2DLTA 2FDKA 4C56B 2E9BA 4J9YB 2XN9A 4I18A 4JY5L 4WSKA 3IDYC 5CEXB 3AMNA 3MOAL 3QEUB 1U91A 3QCUL 4QF1A 1QSED 2WO7A 2VCOA 1TEGA 3B5LB 1A6CA 1CJPA 1ZBA1 2A4CA 4KTDH 1YJKA 4H2CA 4R6UA 4DR4B 3VFPA 2NY6B 4MJ5A 1GNYA 4QWNA 4JC1A 1F11B 3N1FC 3SIKA 1J95A 2A74C 3CVHL 4GXVL 3RFZB 3VKLA 4ARYA 3RWCA 5JNYB 3GMLA 3X1GA 4YHOH 1XB6A 4Y1VA 1ZSDB 1R3KC 3KBHE 1CD9B 5HI5C 1GYKA 4HKWA 3J81N 1KY6A 1JGDB 5CXPA 1TME1 3ESUF 4XTMA 4ES9A 5JVDA 3KPRE 4B1MA 3UTTD 3L70H 5KBPA 4M3CB 4K40A 4A39A 4LR4A 4NB7A 2YKLL 4ODUA 5EF2A 4QDQA 3DVFA 1RHHA 4PRIA 5DHMC 1PVC2 2RS31 2Y24A 4A2HA 3OJDB 2ZOUA 4PLJC 1N4XL 1MNGA 1KECA 3CMOL 2PYTA 5KXCA 4Y5VA 1PNGA 1JWMA 3KAAA 3RDTB 4M02A 4P5YA 1XQNA 1F4XL 2HJKB 2E9IA 4NRPA 3AXHA 4AYFB 4KZEH 2G1MA 4AKQA 2DTYA 4N1EA 2IJHA 1QFOA 3EJZD 1ZRUA 5B3JE 5GQBA 4CDQA 4PJ5B 3ZXAC 2XA8H 4TVSa 1WD9A 2PHUA 3FFCE 3EJYD 1Z66A 1TQCC 4UINH 3F7RA 5HYIA 4ZI7A 1FVEA 5GONB 1DLHA 5GGRB 4HLTA 4HQQL 5CSGA 1JUHA 4NXMO 2CSPA 3T0AA 3VQ2C 5KHJA 3HFMH 3WIFA 3W0WE 1IE4A 4YR6A 2PMWB 3U9PL 3EB7A 2EE0A 1EXGA 1QR9A 2GABA 3GBNH 2AQRA 4N22A 5F21B 4E9RA 2BBAA 3JWNC 4MQ7A 4LBEA 2DIJA 4EN9B 3QWRD 3HPNA 4XOCA 2E27L 3FQWB 4JRYE 2NSXA 3UKVA 3C7GA 4ASLA 1X7TA 4GW4B 4GUOA 4ZMPA 3PABB 3AS1A 1U30A 3W37A 1PZCA 5JORA 5T5NG 1JK9A 2CUHA 5IF0B 4AEDB 2VXQH 3X13B 4PRAA 4EQ2A 5H35A 3ZKXC 4XHXA 5FWJA 2JGDA 1GN4A 4Z0XA 3X12A 2KYIA 2UXDO 4G8GD 3VYPA 5DRWA 1AJOA 1JBJA 4CC0A 1A9BA 4Z2AA 3O1RA 4OIIL 4ZFQA 3KGSA 5JW4N 1LOBA 1BVNT 2OIIA 3L4VA 3D09A 3T0XA 2DQFB 2YPVA 5MENE 2XJVA 3G5ZA 3CPLB 3D0LB 4Z7NB 3LQCA 4C0HA 4ZUTB 5BZZA 1X4TA 4MT8A 3SJCC 2BOBA 2AJXH 3LV3A 3ZFFB 3P73A 1GUIA 4K55A 4XVUD 4Y20B 4NKDB 2B1IA 5J56B 2EIJC 2BHUA 3BO8B 1ZA7A 1LU1A 4H8VA 4YW6A 4XP1H 3HKBA 2YQ2A 2IJKA 5E2TH 1AIFA 1XMWA 3I84A 1LDPH 2DQGL 5A2JH 1FXKA 5BV7H 1TVBA 4JGYC 1XNRO 1FYTA 1R3HB 3H8NA 4GSDH 4OZHF 1JGLL 1I7TB 1VFOA 3N44F 4UQDA 1SEQL 5AOMA 5C7XH 3LDRA 3SBWC 5LA9A 4A6YL 3VH8B 1TF4A 2XWBA 2W6IG 1MS8A 1E9OA 3TH3T 5IVYA 1KIUB 5LBSA 1PIV2 2NR6D 4U6XB 1QXRA 2MOQA 5GRUH 4DV6B 3I6GA 4HIIA 3AP5A 5D7IA 5E1GA 2OJ1A 2HAZA 3DECA 3KZIZ 5HGDB 4Y4HD 4Z77B 4XJ8A 4KJWC 5CISA 3BP7A 4NGHH 3IETA 4AQSA 3FQXA 5MEQA 2WA4A 2COVD 1OLMA 4FQCH 5CIPB 5EOCJ 1AL21 3FB6B 2PN5A 4YGVA 3RWKX 3PY9A 4HIHB 3U6XS 1I8MB 3C09B 5CD5C 1T5KA 3IXAB 5L2KA 1VEWA 4FMVA 4QXUL 1SS3A 4E2LA 3OKMB 1H3UA 3ZN1A 3U2JA 2H0JA 4HZ3A 1FH5L 2LVCA 2VISB 3P30L 4F8NA 1IPKA 1U12A 3EG9B 1NCDL 2Y0OA 3QCTL 2OZ6A 4DW1A 3D3VD 2V7QG 4OUEA 5C97A 3CLEL 2JKTM 3A6CH 4U1MB 4LZKA 4LBQA 1MFAL 3VFVA 5E99H 1JHKH 2HFGH 4IHJA 2CGYA 1R083 3E8UH 4H7LA 5JPNA 1ZS8A 3PHSA 4I18B 3KSCA 5E51A 5FGCE 3WS3A 2J43A 2DWDC 2WQXA 2Z6FA 1RJCA 2IC2A 1VBA2 4DUZB 4WQOA 2ADJA 1P7HL 4EDWH 4EQVA 4Y2DA 3S5ZA 4WM7C 3NW4A 1VMGA 1I8AA 3VFPB 5AVVB 4OGXL 3ENRA 2ITFA 3L4YA 3VWKD 1CU4L 5HVHC 4FOWA 4YVSC 4X5LA 2IZWA 5F8QC 4IE5A 1KCSL 4WWKA 5TDOA 4XIOA 1G1YA 4RMQA 5FCSH 4XNYH 3JD73 5JVDB 3IDIA 2Y22A 4GEIA 1P4UA 3GVMA 1P0SE 5CBFA 3GB7C 3C5SB 1QLEH 1BE3H 1HR0O 4P04A 4ODUB 3PDOB 3OTOB 4LGPB 1FN4A 1RHHB 4BLJA 3BAJA 5JCOC 5F3HA 3VGAC 1HDJA 1S7RB 1FJGB 2XWTB 1DBMH 1NA1C 5F9JA 3HE7A 2GBOA 2QTWB 1FE8H 1KYFA 2CJ3A 4WFGE 4HG6B 4PQ9A 1WN7A 4Y5VB 5EBLC 2VLKE 4N7UA 3RYIA 2JMRA 2Y06H 3C5ZC 4KRLB 5KSAC 3IXTA 2CBMA 1WA4A 3ZLIA 1AZCA 3MLKA 2EVHA 5E70A 3TPUB 3KWUA 4GQ9H 4CDQB 1AR4A 2VB5A 3H1ZA 1XGUA 4OLYL 4UNIA 1HE7A 2PI4A 3HRZC 5IY5B 3BU7A 5E16A 2XQ0A 3D8MA 1IS3A 2W81C 4IRJA 4ZI7B 4JO5A 3MX0B 1A65A 1DLHB 4PBWD 2A77H 4UW6A 3WSOA 1XMQB 4CC6A 3CK0H 5B38G 2JCCB 1U92B 2NY1C 2Z7WA 3LKOA 1BQHA 4GUCA 4HALA 3TNPB 1VLXA 1KT2A 1K6QL 2HLFC 2EXHA 3BW9B 1IGIL 4IQPA 3FLTA 1XDCA 4LBEB 5HHVH 1MRFL 4CCJA 3ZL2A 4GW5A 2CRIA 4GUPA 5I6PA 5J0BA 2PETA 1NCAH 1ERNA 2PCFA 3TO2A 2VQUA 5JORB 1JK9B 3G5XB 4LSVL 3EOAA 2Q0OC 4GMP3 3P2BA 4PRAB 5H35B 4OFVA 2HVKA 5DJ8A 1KCRH 1A6UL 2ZAIA 2XTSA 4UI2A 2O5XL 4Z0XB 4AJVA 1NWPA 3ELAT 4XHJD 5DRWB 3VBUC 1A9BB 3RL2A 2X9WA 2ZIOA 3SGIA 3C60C 3EGSA 3FQTA 4UUJA 1L8DA 1KZYA 3SDAA 4X7SH 1PMHX 3NNJA 3PNAA 3H1LH 2FWSA 3KPNB 3BGFC 3G5ZB 4B7KA 1AVBA 3O1PA 1A4CA 1AX0A 2W0PA 1I3VA 5L7XL 2BOBB 2A6ZA 5KVGH 2A0LC 3AXLB 3O2VH 3P73B 2XXZA 2EKJA 1W2NA 2Q2EB 3FB5C 3VLBB 4ZPTA 3WO3B 4AYEC 3DIFB 3SKJH 1J11A 2Q3AA 2B14A 5IATA 2YZ1A 3FW6A 5TD4A 3NJZA 5H5NA 3GLZA 3UGFA 1FYTB 1NCRC 2Y0SA 1U8PA 2AGJL 1KLUA 4FG2A 3VI4B 5GS1B 5I8CA 4N6RA 4BZ2L 4L29A 2R1BA 1M4UA 3I2HA 1KP3A 1XX9C 4RMSA 2UY9A 1ZRCA 3RTQA 1K5MA 1XD1A 1AQDA 1E5UI 3HIFA 4UOW1 3Q1SL 1NAMA 3HPJB 4XAWH 1K4CA 2HFTA 3I6GB 2XWXA 3QULB 3LEXB 4HIIB 5CUSL 2PPDA 5D7IB 3TFKC 3RGVB 3QOPA 3PL0A 4HCRA 5FYIA 1P5UB 3BSHA 3E2HC 1AI6A 2N7BA 1P4LA 3BP7B 3FCUB 5ISZE 1XL6A 2UZIL 1JXKA 3FQXB 4AEIL 5MEQB 2O6CA 2VUYA 5E08L 3FWEA 3AADB 3DKHA 4YGVB 3SR2C 1G1KA 2OIGA 15C8H 1NCTA 2ADFL 4DZGA 4UV9A 3Q3GB 4NNPL 5DLML 4XN1A 4TN7A 4KKCD 4P5TC 3ME2A 3FTGB 2FYYA 3I6LE 3PUUA 1OOPC 3RS6A 1I8LA 5D1QA 4F1ZA 2ET1A 4EUPG 1PEWA 3OKLA 1VIBA 1S6NA 1QHTA 1BFOB 1URLA 1C57A 2H3XC 2V2XA 2BOIA 4IOFC 4LBQB 3LDCA 1SN2A 4E9QA 4DR5O 3T3PF 3NSCA 4IHJB 5EJ1B 1LGVA 1ZS8B 1CXIA 4J6IA 1X7QA 3CX5F 3WS3B 2IH3B 4A2DA 2ETWA 4IRZH 2ZE7A 1PO12 4OFPA 1H6UA 1NUDA 5DECA 1CLOH 2Z65C 4Y2DB 3T71A 5AAPA 5CFHA 4N8MA 4QHOA 2XYCA 3MRIA 3W57A 2EAKA 2A73B 1SESA 2O5YL 5KYWA 4I48B 3SPCA 3NIFF 2R2EB 1A9VA 1U9KA 4FQXB 2F8XC 1L9NA 3NACH 1UZ6E 3BIKA 4WWKB 3POIA 3RWEB 4QX3A 3HMXL 2P5WE 2ZXGA 1N1SA 1YHPA 1H1MA 2J6EL 3MSPA 4FKHA 2WJ7A 1O4YA 4XPAL 3PHQA 1XV8A 4KKQA 1RUJ1 4XJAA 1G0YR 2JJVA 1FN4B 4JO4L 5GM0A 1OQ1A 5F3HB 2IH1A 1XNBA 4UFMA 1I5XA 4IERA 3S34L 5F9JB 1HKLH 1NM4A 3HE7B 1FJ1B 2Y6GA 1M2VA 1AI5A 3MV8B 4F6EA 4FNSA 4YZ1A 3SO5A 3BJ91 1ROWA 4JFFA 4MAYA 3AZZA 5J7MA 25C8L 3THML 3DBXA 2OXBA 4DFSA 5IAXA 4K2UH 2GUOB 5FA3A 4NBYB 4YBHA 2VZTA 5I18H 3OJVC 2P9RA 4UV7H 1NY71 1W8WA 2A6JA 2DVAA 5T54A 4WHYH 2ZE8A 4JY5H 1WC7A 4WW2F 4O4HA 4PJFB 1CL7I 1T22A 2DWTA 4JQRA 3LKOB 2J20A 1MEC1 4PJXA 2GIMA 4LBKA 2HTKD 2WBKA 4YEEA 2BFVL 2XAJA 4OF6A 1T21A 2NY5C 1ZTXL 3CVHH 1I1AD 4GXVH 1E4KA 3HRPA 2JS5A 3B09A 2WXNA 3C90A 4G9DA 1JV5A 1U33A 2MPAL 4GW5B 4JEGB 4LMQI 4LRIA 3MLTB 3W82A 3LSEA 2PCFB 1SJVA 4OVUA 3K91A 1PDKB 4AGQA 3U30C 2RS13 3AKTA 3AQZA 3N04A 4FYQA 3S3JA 4R8HA 4NNXB 1YEFL 4KU1A 4QTFA 3LXBA 5KBKA 3CIAA 4LK7A 3EJZC 1A8DA 5DS8A 4GQRA 1NZRA 4P57B 4KKZA 2YKLH 4F7PB 2Y0IA 5ALBL 4HWBL 5E5MA 1X9LA 4DP5X 1ETZB 1NFDA 3FQTB 4JM2F 4QRSB 4ZPVA 1T0OA 3L8QA 5FYYA 3ZMRA 5C2BL 2A74A 4WW1A 5BJTB 1N4XH 1DQIA 2BJMH 5HCFA 5C0GA 1UENA 3CMOH 4C8XA 1LO4H 1R3KA 1WAAE 3O4OC 1SOSA 1MCRA 4L3ED 3H9SE 5HVFB 1CGUA 2PYEA 1FAYA 3FOLB 4AVTA 4HJ0D 4ZPTB 5ACA3 3V0AC 2R4SL 3WXWL 4A7YA 3PU3A 4X1KA 5F6HI 2FJHB 4P5KA 5ACZA 1AXZA 2GC2A 3FU7A 5EZLA 2UY6A 4GUQA 3V5HA 5AFBA 3TLRA 1UO9A 1U95A 4OYUA 5FLJA 4MD5A 4ADJA 2UV3A 1PYWB 2I26N 4HQQH 3IJYA 4JFTA 5EU3A 3CH1A 1U8PB 5C0AB 4FPGA 5FZ6A 3JCZA 4N6RB 4ZW7A 3HMYA 4WV8A 1PQZA 3V5KA 4D9QE 2E26A 1S0EA 1K5MB 2BOLA 3Q7JA 4HT1T 5A7NA 4LCWD 4M4PA 2E27H 4WJKB 3E8VA 4OZFG 2VY0A 4LA2A 2EIKC 4GXLA 4I0AA 2KC0A 2ZXBA 5IQMA 3L6FA 2NCEA 3I2FA 1P4LB 2C9QA 1E5HA 4CCMA 1WRFA 1PPJH 1KTRL 1BXHA 2QQPA 4E9KA 5CKAA 1NGYA 3ZR6A 4HWNA 4E4ZA 4LPXA 4OIIH 2W6JG 1OB0A 4AV5A 4QE9A 3RBZA 3L4WA 5IYYA 3ASNC 3JUYA 2Q7YA 1I94O 1JBCA 1I7RA 3FXIC 4BZ1A 3FSZA 3K5RA 1S1AA 3OKLB 1GN6A 1CYXA 2VW1A 2OYKA 3H9VA 4JL1A 3EHBB 2WYFA 3PHMA 2FLBT 1JJUA 2QPSA 2X2UA 3IJSA 2NR6C 2WWKO 3NCMA 5SWZD 4YVWC 1BQLL 2FLRT 5HBBA 1DQDL 5FW8A 5FIXA 3MW2A 2DQGH 1GZCA 4LLYB 1F9KA 2G5BB 1EAQA 3MNZA 4WJ5A 3POJA 3VBRA 1UGNA 4N8CL 2HBTA 1X7NA 4QB2A 3VZKA 1JGLH 5CKQA 4WFED 2UYAA 4K20A 1SEQH 5H9PA 4IJ3C 3QPQD 1KIQB 4F3FA 3HLAA 5E9NA 5ELIA 1VFBA 2VECA 4D0QA 5LGNA 4IDZA 1J0IA 1R5VB 1CD1A 4WNQA 4DR2B 4XN4A 4N86A 3QDGE 3RX7A 5DMKB 1OAQL 3DHPA 3EBHA 1PM9A 3OLEA 5DZFA 5D7SL 4EZHA 4OF8A 1X4YA 4NQUA 1RAMA 4N5ED 4E4DX 5K9JL 3GHMA 1ZLVK 3SBWA 1GZQA 5AVXB 4GMP0 2GG1A 5FM5O 3NYKA 3QWOB 4R96A 2ZKYA 3WS6C 1DGRA 1M53A 4LPUA 4QXUH 3G7TA 1RP8A 4DN4L 4A55A 4JFFB 5C3OA 1KBPA 1WW7A 1FH5H 3P30H 2XZQL 4KROB 2VMIA 1TZHA 3WOGA 1E8WA 5TISZ 1NCDH 2FATL 3QCTH 4OKDA 4NZ8A 3EGDB 3ZE0E 3MLPA 2FHBA 3CLEH 4ZSOA 3VWKC 2A6WA 4G3YL 3FYIB 2JICA 3AYAA 4BZYA 1US2A 1MFAH 4HUMB 5F6HJ 2APFA 4A66A 2A6JB 2VT0A 2BGCA 1CFSA 2QBWA 4JQVC 4MMYA 4H0HB 4NFBA 2WZ8A 4CVXA 32C2A 1N8RW 2EDTA 4CS4A 3ZDSA 4XN8A 3CMAV 3ZN0A 5LHGA 4MNQD 3RRQA 3OCPA 3S88L 3VDAA 5IOPA 4FD0A 3OEBA 4L0ZA 2VZSA 3NK3A 3FT2B 2ZEZA 2PCXA 4OGXH 5EBWA 3VDDC 1SM3L 3L17A 1T21B 1Q9KB 1CU4H 1QNZL 1K8DA 3BH9A 3MV9D 4FQQA 4KV5F 4V1DA 5KHHA 1G9MC 2CDFB 2FQDA 4HU8A 1MG2C 1KCSH 5C07D 1MJ8L 3MV7D 3SCMA 1ENSA 2DWDA 4DH2A 4L8QA 1QD0A 4N7IA 3V0EA 5AB9A 2UUAO 1G6NA 1TZGL 3ECVA 5AW6B 4DVBA 5AUMB 1Q8SA 3DUSA 1UQXA 2DLIA 4WM7A 3DRQB 4JCMA 4H1LA 4NQTA 1N0NA 4YDKL 4B9PA 3GZTB 3OL2A 4YWAA 4WW1B 1YUHA 4XHBA 3RT3C 5C0GB 4XCCL 4U3FH 1H1IA 1W72B 2AHIA 1R3KB 2BVQA 3UT5A 2EEFA 5D1XD 2CH7B 2PYEB 3NZUA 4DSYA 1VCBC 1IILE 4B41A 3D0AA 1T66D 3GB7A 3JB8A 4ENZA 4PDVA 4ZX4A 1WUVA 4X1KB 1GS6X 4M1DL 4OLYH 3L1FA 4BK5C 5EF0A 3FU7B 5JCOA 5EZLB 1XBLA 3V5HB 2DJUA 2BWIA 3J8F3 4HFSA 1NA1A 1B0GA 5CEZL 3EHKA 3IJYB 5EU3B 3CH1B 1ZIBA 5EBLA 3UYPA 1TQSA 4P2RB 3LRMA 5EJ3A 3Q44A 3I9IA 3C5ZA 4XHJC 4HV8A 5KSAA 1IXBA 1K6QH 1QOKA 2VXSL 5B7EA 3KHBA 3CE1A 4OM0L 3BKML 4JF3A 3LKPA 4ZAKD 4E9TA 1SUJA 1IGIH 1PZ7A 3QYCA 4YFLI 5EZIL 4X65B 1U5ZA 1MRFH 4ZFFA 3FHIB 4I2XB 3ZYIA 1NIAA 4B3SB 2AQNA 2WO4A 3HRZA 2ZX2A 4M7ZC 1I8IB 4J80A 1M7IA 5IBUG 1BL8A 3JWOC 5BRQA 4LSVH 1X5KA 3FAVA 5GZOC 2F5AL 3DO7B 1OUSA 3DHMA 1CWVA 5F3CA 4AHCA 2HXAA 3O6ML 5FP4A 1A6UH 1D7FA 5JXAL 2O5XH 5T1JA 1UB5A 4DRRA 1ZIAA 1E4JA 3O41B 5FYKD 4UQ2A 5JUEL 2XASA 2Q69A 2ZIDA 3OKKA 1VZIA 3ZPDA 1CIWA 1MCKA 3BUDA 3E97A 1ZLEA 4YXKL 5A1FA 4X7CC 2Q7YB 5BMFL 3IKKA 3UGEA 4HEPA 4CGUB 2YD4A 5CIPH 3ZJZA 4W9LC 2LW7A 3OC5A 4DR3O 2OR8A 2WP3T 4LHUG 4AW4A 4EAEA 2M7WA 1DQJA 1ASJ1 2ZS6B 3H2QA 4MHHI 3ZKXB 3PUIA 1G7LB 4PSPA 1AXKA 4NO0A 3VBUA 3MLWL 3SC7X 1QO3B 3TT1L 2P3KA 3JV4B 2ZWLT 3C60A 5C08E 2KZBA 2ZXDA 1NBCA 2IBZX 3LDBC 2X3CA 4WJ5B 4ZX5A 3KV4A 2I9LA 1LNUA 2WQ8A 3EF7A 1C5CL 4KTEL 1WTGT 2AGJH 3H0TB 3KPRD 2VZUA 1AVMA 1K5QA 1SXBA 1H9VA 1HINL 4OQTL 4R2GD 4Z7VB 4XBLA 1QZNA 2XG4A 2A0LA 4DXZA 3IMSA 5J2UB 5DUPL 4Z7WE 4YDLC 1BVOA 3OUJA 1DO5A 3FB5A 3FOMA 5FNVB 1VFBB 3OSVA 4ZZFA 1KJLA 2X1XR 4JFHE 1KTJA 3D4ZA 3WFZA 3Q1SH 4KKCC 3EO0B 1CD1B 4EKXA 3J7NA 4E4EA 3WW3A 1YI2V 4XUPA 5CP7A 1G9HA 5CUSH 1ED3B 5E95B 4AW7A 2CLVB 1QLFB 5IJVB 2DBNA 1SEBB 3CKHA 3H3ZA 5I0SA 5JOEA 1RJZA 1QSVA 3PYCA 1AGDA 1BZOA 3P2TA 3QIBB 3TN0D 1PPIA 3IU3B 1OAKL 4GINA 5JIPA 4F83A 4X6CE 4PWFA 1WGOA 5E08H 4QM9A 3R0RA 2YIBA 2PTMA 2BVYA 2ADFH 3BIAX 3FFCD 5F7AA 1WHOA 2KDYA 2G9GA 4NNPH 5DLMH 4A7KA 1X4XA 3ULUF 1AI4A 5EIVA 4W4KA 5ICZA 2ZGSA 1N33B 4FFVC 1X9UA 1MS5A 5F37A 1TZHB 4NE9A 4QB1A 1BMFG 3CZUB 3QQNA 4LLMB 4YLBA 2JTYA 4ZSOB 3T3MF 1J88A 3W0WD 8CGTA 2IVIB 1JZ7A 4FFYA 5I1LA 1NJIW 1MQTB 3H9AA 1W72L 5GZFA 2YGPA 4YRDA 2FCVA 4QRUA 4JRYD 3TBWA 4Q6KA 3RB5A 1D4M2 4V2WA 2X6MA 2X4PA 3HAEG 4BW9A 4WI9A 2XFXB 1JXFA 1YQ6A 2ADIA 1RUD1 3E0GA 5IOPB 5GGSB 4QPKA 1OOPA 5F7LB 4NQCE 1A1NA 4EFBA 5EBWB 4V2VA 4AVCA 2O5YH 3BPOC 4GLRH 3BH9B 4V1DB 1ODAA 1QBZA 3LDKA 1A21A 5MEND 4NHMA 1O7DC 3B7MA 2D7OA 3TRSB 4JDNA 3HMXH 3SCMB 2L7UA 2GN3A 3LIHA 2J6EH 5FO2A 1JHTA 4EEQA 2EXWD 3QJHA 4FCAA 1GZHC 2NZ1A 4IRSD 4XPAH 2ADGA 4Q4V1 1QFWL 3CSFA 4JO4H 1EJ6A 1CDUA 3GRGA 2C9SA 4H1LB 1P1VA 4HHWA 4OAWA 1H15A 1DYKA 1RHI1 4Q6GA 3S34H 5IQLA 1GGYA 3F5TA 1JOYA 1BZEA 4LCYA 5D2AA 3RWIB 1Q90A 3UT5B 3ISWA 1MF2L 4RZCA 4JDVB 1KY7A 3TVMD 25C8H 1LO0L 5GHWL 5TPWL 2Z35A 3THMH 4EE2A 2HTKC 4LEOB 4Q2ZA 5KS9F 1UJWB 1DCEA 1VR3A 3CPUA 3DXAB 3HUJE 3ZW3A 3WTVA 5KJ7E 2PHWA 1I1AC 2Z92A 4QU1A 1PZ8A 1ZT7B 1R5WA 2A1WL 4MVRA 5J1AA 5IDJA 1ZLUH 1VRBA 1AYOA 1B0GB 1OTSD 4U1GC 3T6XA 3NFNB 4HDIA 1QSEA 2YLHA 2YKKA 4HCGA 5DHVA 2WC7A 2HLAA 2UX7A 2PLTA 5EBLB 1KS4A 3H01A 5JXIA 4ZHQA 3IKWA 5KSAB 1NXD1 2IGTA 2WTOA 1JOIA 3PAYA 2OSXA 4JHWL 5CAZA 3D48R 1H38A 2BFVH 3TA3D 5FY4A 2H2SD 2BBVA 1ZTXH 2ZONA 1OAXL 1AYN2 2BSDA 4J2XA 2NN4A 3VVVA 2VR8A 3HRZB 2MPAH 4KK9D 1TYRA 3Q2LA 1KD7A 3BCDA 4ZTPL 3JBG1 3VOUA 2H4EA 2NX5E 3WCRA 4O2BA 4Z7OB 2HWE1 3GBGA 1YEFH 3UTTA 4HJ0C 1YNTA 4H7VA 4BFGA 1IJ9A 3IDGA 1MACA 2AUYA 5ALBH 3ZE1B 4HWBH 2ZXWB 1UCXA 1KWKA 1K4DB 1DSYA 5HSFA 2JDPA 4YZFF 2VTFA 1WA1X 2CBOA 4HAFA 5C2BH 1W59A 1KJMA 3FBKA 5L3FA 5LGYA 5DC2A 3SKVA 3B2XA 3UJJL 2YC0A 2XTJB 1H8TB 2GT9A 1X6NA 5MERA 2B1GA 2AMGA 2AKRA 3VQ1C 2LLLA 1DQJB 1HL8A 4GAFB 4OTXH 1W0WA 1RSOB 1QVOA 1TQBC 2KL6A 2R4SH 3OAWA 4P3DB 3WXWH 5FP9A 1YECL 4AHYA 1F8VA 4XFBA 2WIIA 5FYJL 5A6IA 2WBJD 3C60B 4NJAL 1W6PB 3KYAA 4K3UA 2NTFA 1LNUB 3BGFB 4OLXL 2QGCA 4MJ6A 5GGTL 3RPIA 5C9JB 5CM1A 3RVVD 3TL5A 4XXPA 1IU1A 5JSPA 3F84A 1N26A 1ORQC 1G7HB 2NT1A 2VDRB 3MOBL 3QUMA 2OFQA 3FB5B 4QT5B 3VQMA 5IMMB 1S76D 5BUAA 3V0AA 2V0AA 3Q8BA 3QWRA 4AQOA 1N3OA 4R5VA 1VKXA 3HG2A 4MGZE 5KUKA 4WFGD 1UOLA 4XP5L 3VXUE 3OHXB 4AZ8A 4LNVA 2VLKD 1BT8A 2JK5C 4HK3J 4N6QA 3UTSB 4DN3L 2OX0A 2VDNB 2YFZA 4F2FA 2E4TA 1KDKA 2Z8RA 2X53A 5JOZA 4AK2A 2IXQA 4B9GA 4G8GA 3V6OE 2WFF1 4MNGA 5K0UB 3DRTB 1J8HE 2EUVA 1XWVA 1EIBA 1RSYA 2IXKA 3IPVA 1MW2A 2JEXA 3BP4B 2C9KA 2VOVA 3BUIA 5FP8A 3ES1A 1QYGL 2X4NA 3FPXA 1IGFL 1RITA 3E5XA 4UM9D 4EKJA 5DU7A 2FDHA 1NLQA 4CN1A 2JG8B 2IWEA 5DAXA 4MRCA 5KX5B 3J7AU 3QUZD 4MB4A 4BIUA 1DQDH 3WP3A 4OI0A 1T7ZA 1EV13 4X8AA 2Y1ZA 3EH3B 4OF0A 3TBWB 3VG9B 4BJLA 1H8VA 2XUWA 4LO6B 2AENA 2PQQA 5C8YB 2I45A 4N8CH 2ADIB 4LL9A 4N5EC 2EACA 3EYFB 5IWAB 3OAYH 1OOPB 4U2ZA 4LQ1A 4YK4C 2VL4A 2BRRL 2Q5TA 2CR0A 4M43L 5T33L 2NR6A 2GJ6B 4L8SC 1AHSA 1LJ7A 4YVWA 3LZPA 4BOWA 3FRPG 5J48A 3JBG7 5M0TA 5A6QA 2HG5C 1OAQH 2MSPA 1JPEA 1SXNA 5D7SH 3MRBB 4FFTA 3KYKL 3QJHB 2AEOA 3B00A 2KZKA 4YL4A 2ADGB 3D08A 1JI2A 4K94H 5F3FA 1SMDA 5AVZB 2GI7A 3ARDD 5H8DA 5K9JH 4PDRA 2BNUB 5F8RC 1BYHA 4ICGA 4B3RB 4OAWB 4B4RA 5L7OC 1F86A 4CDWC 2HWF2 1TUBB 3MUGA 3BRFA 2NY2D 4DN4H 2NXYD 5B1BB 1QOSA 4S2HA 2E9GA 1W16A 2ZGLA 4CCCA 4RZCB 4NHLA 2WQWA 4TSVA 2Z35B 5T55A 4JZGA 1JPTL 1N5AA 3OFNG 2FATH 2ZOWA 3D3VA 4AEFA 1ZANL 2PXYD 3X1BA 3HKEA 3POHA 4AMXA 1YJLA 4IE4A 3TNQA 3CRQA 2Z92B 4D6QA 2BIIA 3NQHA 1GVIA 1TVDA 3SH4A 1R5WB 1H1AA 2D2OA 5J1AB 3QRFM 2ZNIA 2DKSA 2AV1A 2I07A 3WS6A 5BOJA 1GW0A 2WBWB 3AT8A 4HDIB 1QSEB 5DHVB 4X4YA 3BEHA 1VBC3 2D93A 2HLAB 2AI0L 2R4RL 1EV2E 3KPMB 3S88H 5ISZD 2CU5A 2LGWA 1E8XA 4Z95L 5H2BB 3VWKA 1SM3H 4LMQE 4XPFL 4MGYE 4XF0A 3BKJL 4NQSB 1QNZH 5IREA 4RFRB 5LCWL 5K59E 3KLLA 2PW1A 4XP6L 1ST8A 1SBDA 3CN1A 4BELD 4JQVA 3D4CA 1WSST 4JFWA 1VRH3 5ANQA 3U14A 1MJ8H 4DPNA 4O2BB 3I6LD 5T1KD 1YQ8A 3ABTA 1L6PA 3UTTB 1SN0A 1T66C 4DJMA 1FV1A 3ILRA 1TZGH 3U36A 3SBRA 2JE9A 1JZEA 1MI5B 3IDGB 3U10A 1TZIA 4OCXL 4MYEA 4N0YL 3FUIA 3ZRFC 3B77A 1WLCA 4GJYA 4YDKH 3VDDA 5K39A 3QC6X 2PP8A 3SDDD 3GNEA 4KGQA 2XVKA 3MU3A 5CA1A 4XCCH 3GSWB 4X7TB 2D0GA 4F7MA 1G9DA 1WO2A 2EALA 4XVTL 2FL4A 5A3NA 2GT9B 1MCCA 2OMXA 4RGAA 3D85D 3VFWB 4QHBA 1RFDL 4ZAKC 4LLDA 2A7BA 2X2JA 1BF5A 4YDIL 1BGXL 3RYFB 1W0WB 3JXAA 1C16A 1R5IA 3GYRA 1R3IC 4M1DH 4OIFA 4PJBA 3B01A 3EH1A 1JMZA 4YM1A 2D9CA 4S2SA 4ZYKB 5JHLL 1VMJA 3MBWB 1GS7A 1KBGH 5CEZH 2NTFB 1ZAUA 5JW4R 3QFJB 2P5WD 4MJ6B 3IDXL 3ETPA 4YBLB 3O4OB 3H1HH 1IM3D 3I3EA 4BQWA 1PKQB 3CTTA 1EZVH 2DQDH 1RUH2 2VXSH 1RHI3 4CXWA 4OM0H 3BKMH 2YBSA 1S9VA 3B9VA 3IS0X 1ZWIB 4XZ4A 1FFXA 1DK1A 3BD5A 4LSTL 5EZIH 1PZ9A 4AL9A 3H9YA 1C8NA 3KVPA 1DYPA 2FR4A 4BK5A 2Q1EA 4PDLA 3ZYFA 3UAJD 5C0CE 2R0ZL 5KZCD 4QRRE 1K73W 4AIOA 4HAGA 5FUIA 3FH7A 3FQRA 2M2DA 4UV4L 2F5AH 5FBJA 1FFPA 1Z2GA 2O5ZL 4M7JL 2A6DB 4R5XA 1NCBL 5JXAH 4G8GB 4CU6A 1CONA 4UFKA 4PA7A 5JUEH 1X9TA 5ERWA 5DJ6A 4G42B 5DUBB 4A2FA 4FAGA 4MCMA 1HZLA 2R1WB 4YXKH 4XTRD 1A1OB 4QPIC 4BSVB 2Y4SA 1SETA 5BMFH 3PL6D 4R2GC 2DWYA 3H4FA 4IBTA 2EIKB 1F2NA 2YIAA 1DF4A 1L7QA 4HL0A 2CO6A 4Y16C 1ZT4A 4U7KA 4FXGC 1EZLA 1P84K 4MOAA 2NUPB 3TBTA 2WHVA 4QHKI 2QVMA 4Z7AA 5FKBA 1OKQA 3RJRA 3ZSEA 1MZFA 2EO7A 2R2HB 1PV0A 3MLWH 5J89A 1Z0NA 4NTYA 3TT1H 2C7FA 3E80A 4J2QA 1ZBA2 1CLVA 2PCYA 2XNAB 2P2KA 4TTDD 1B3QA 3ASNB 1M1KW 1VBB1 4KTEH 3TN0C 5EZJA 3DO4A 1C5CH 5GZND 5ITBL 2KA3A 3PXJA 1BZKA 1JCVA 1I3RA 1HINH 1OAUL 4OQTH 4WRLA 5DUPH 2GUZA 4NO3A 3L4ZA 5IJ9B 1TME2 3U6XA 4WEMB 3SXWA 2DYRC 4PA9A 4N3UA 1OP5K 1T1XA 1DN2A 4Z7UB 3BCCH 3UGGA 1PL0A 4JL2A 1OA2A 3LDBA 1O4TA 2RS32 1VADA 3H9SD 4Y4HB 1NCCL 3DV4A 4UF0A 5BZBA 3BPNC 4LSDA 1OAKH 2WLNA 1Q72L 2ZF8A 3MROB 4I0PB 4XXDB 2K7PA 1PGSA 1UYYA 1KOAA 3I02B 4COWA 1JPGA 3M6DA 3BVVA 3TGUH 1P5VA 2C4XA 3O6FB 4U6VL 4W9ZA 3UBHA 4UQ3A 5FZ1A 3IBEA 4OGQC 1WD8A 2Q8CA 2CUAA 3HS0C 3VFSB 3H8OA 2MEV1 1FL3B 4AI7A 1N5AB 1C5DB 4MYPA 5IHZA 2OZ4A 5IT9N 2EE9A 3HKEB 2P5EE 2QTEA 5D4HA 1U3JA 3OEHG 2PPEA 1W72H 2HFEB 2RR11 2E63A 3E8GA 1UD2A 5FZGA 4X6DA 2I07B 1SFPA 4MJIB 3WP5A 5CZXD 4X4YB 2EXWC 2NT0A 4IRSC 1J84A 2RHPA 4B9ZA 2UWCA 5FFOC 2W9DL 2NPLX 1VARA 1UA6L 1RXLA 3QH3B 3VGIA 1BFVH 1T1YA 2AFNA 3NCCB 2PW1B 5ICXA 1ZLWK 4IU2B 4GMSL 1NPNA 3TVMC 1SQBH 2M83A 1YPZE 2K9PA 2BOJA 4WTZA 3JUUA 1S7TB 5FQ0B 4MGKE 3D39E 4OX9O 1ZOXA 3U36B 3FDWA 1GJUA 1FG9C 3NRFA 5AG9A 1SLBA 3AMHA 1QFWH 1UIKA 5CKGA 5K39B 1MCDA 2H0EA 4LDOB 5IT2H 4QU2A 1UWFA 3NRQA 4LFCB 2MCAA 1JU3A 2VC2B 4DETA 1IURA 1MNUH 4COZA 4CU9A 3ZSTA 1K34A 2MIZA 5FEBA 1WK0A 1MF2H 3VQYA 5I6LA 1LO0H 2OMXB 5GHWH 5TPWH 3B37A 4KQ3L 1B0WA 2XN1A 4K71B 5LYJB 4N2LA 1Z5WA 2QKDA 3TA3C 4LLDB 3N7JA 1XCWA 2H2SC 4KDTC 4HSJA 1WA0X 1C16B 2E47A 2VR9A 3W5NA 3I2GA 4PJBB 4KK9C 2NY4D 2A1WH 2IDUA 4J3OH 4BB3A 2LU4A 2RM23 3J7MA 4KJPD 1JR9A 3AQXA 3QDGD 2DLGA 1MCLA 2HWC1 4RZKA 3T1LA 2YBPA 1V9U3 5DD0L 4WFFE 2FZ2A 1YY8A 3E6FA 1JDDA 2G60L 4BJ0A 3K6DA 5GXBB 3AUWB 5GRJL 1FRGL 2VRQA 3QISA 2J88H 2F1BA 1S9VB 3KLDA 4JHWH 5HHME 1Q8QA 1I1AA 3S36L 1EO8H 1VACA 3ECUA 4XF3A 3ZYPA 2L0DA 4N0FA 4PJAE 4K3DL 1BEV2 3WW2A 4DXWA 4KGLA 1QJU3 2WZAA 4P49A 4FPOB 3OR7C 3LE0A 3ASOC 4OLWL 4ZTPH 1XNAA 1AL22 2YC1B 4OHZA 4AYDC 1EN5A 2EJ7A 3SE6A 2W3JA 2W87A 3H3BC 1FSKC 3EGXB 1RPRA 3AREB 3NVCA 5FS5A 5I9QC 1LECA 1R0AH 2WBJC 5EZYA 1KP2A 2ETNA 4DYLA 1QTYT 4Z1MG 2R2CA 3LRSB 5DJ6B 3ZE2E 3VD7A 3UTQB 1C8PA 1LP9E 3KDPB 5BMVA 2JB4A 4H8WC 1VIWA 5FXXA 3VA6A 3RVVC 3UJJH 4TV8A 4HS3B 4L3EA 3GZPA 4NPJA 4CU8A 3SNMA 2CO6B 4X64O 2WLQA 2XVGA 4X6FB 1M56C 2AQ1A 3WW4A 1HCZA 1ZT4B 3H1JH 1CZVA 3E6DA 4LOSA 3RILA 3S4SG 3WY4A 1VALA 5AVAA 1MXGA 2V7HA 3N50A 3QC5X 2EDYA 4LARL 3OD0A 4UQAA 1YECH 5ECJE 1NFIA 3TBYB 5FYJH 3IC9A 1U5YA 3OBZA 3S30A 4NJAH 2HH9A 1P1ZA 2D6LX 2DM3A 3EYQD 2H0VA 5I0RA 2O26U 4OLXH 3QQDA 5EZJB 4HGWB 4XN9A 5GGTH 2A70A 4Z2WA 3AK1A 1UA3A 4GKJO 1U8IA 2TSAA 4DO6A 3I2JA 5JIUA 3MOBH 4JI5O 1HCFX 1A47A 3USUA 1R1A3 4LCWA 3TIDA 5CA3A 4BCYA 2VR6A 1IX2A 1T1XB 3D5OA 3M8LA 3IMTA 2EE3A 4XP5H 3M99B 4PIZA 1U8JB 3SE9L 2IADA 2JF1A 1E2WA 1VADB 4P05A 4RX4D 4FABL 2ODIA 3NNLA 4IV3B 5E03A 5DGQA 3QCVL 4DK1A 1XE0A 1JS9A 1MWAA 3QUZC 2AZ0A 4GULA 3SISA 3CCEV 1ORQA 1JPGB 2DQ3A 4BCZA 2V6HA 2QV4A 3LZNA 1GNHA 3O14A 3EH2A 4ACTA 1BVVA 4YC2C 3X11A 1QYGH 1WH0A 2JK5A 3L9BA 3ABLB 1XF5A 1K5NB 1JGEA 1IGFH 3LCYA 4H1LH 4PWGA 1WFOA 3BGAA 5C92A 5IHZB 3GWJA 1MLBA 2DDUA 2RG4A 2VC2L 3L5XL 5D7JD 5SWZA 2YAOA 1QFHA 4JV5O 3HIZA 1AC6A 2JQZA 4M5YL 4BIKA 4DP2X 3KGLA 2H2PD 4X6DB 1N0LB 4HFWA 3SKMA 3KPTA 4QQPA 4X8PA 1Y6XA 1F90L 4JPVL 2N0KA 3N40F 4OCWL 3T2TA 4D69A 5JQIB 4B08A 1N70A 4R9AA 4WFEA 2PXJA 3PUCA 4PDMA 2XZAL 3ARDC 3LB9A 3APBA 1GAXA 5K7PA 3U0WL 1O3QA 2LU5A 3FCBA 4ZO7A 2FBOJ 2OSYA 2BRRH 1AXTL 3IGUA 4YIOA 2NY2C 5T33H 3QJFB 2NXYC 4GA9A 5ICXB 1I0HA 3IDEA 5ESAA 2ZX6A 2R59A 4PWIA 4PJIB 5DS2A 5LNEA 4A1RA 1F35A 4AIZA 3AJYA 4DV1O 2PXYC 5DURB 4OZHE 1V0AA 5AYUL 3KYKH 4I5BA 4PHZA 3S97C 3VSUA 4A45A 3L4CA 1S7SA 2F74A 1RMU1 1WAZA 4BIZA 1W2OA 3UBGA 3VW3L 2UXVA 4Y1AB 4PJXF 3GHEL 3HKCA 1PW3A 5C08D 3RG0A 4RQEA 4L8SA 1CGXA 2KG7A 2RS11 3S5AA 2RB8A 4RNRB 1UKRA 2HG5A 1Y7BA 1QR1B 1ALYA 3OZKA 1JPTH 3I7DA 4MHUA 3RY4A 2C1FA 1WCBB 1KMIZ 1ZANH 3E1ZA 4HNAA 3CFJB 4NKGB 4G8IB 4JVWA 4K23L 4P9HC 4WLCA 4KKAD 4UTAL 4XFHA 5BNOC 2X4OA 2OXHA 4IHBA 2EXSA 3ATEA 1HQNA 1BQKA 4JFHD 5ITFA 5L7OA 4AMKH 1EA9C 2ZCKL 4JJOA 1PFCA 2QJ1A 3P4NA 4FCHA 1ZLSL 1NFDF 1LXMA 3UKNA 1TQTA 2AI0H 2R4RH 4MNQA 4ZXBB 2XQYG 4QHNA 2W0XA 2BS8A 1KBKA 4CSPA 4Z95H 2JKSA 2R9RB 1YJDC 5DZLA 3SDDC 3ZDYB 3JV6B 1I1AB 1T6WA 3BKJH 3RUGE 3MV9A 5JVVA 2NYYD 2XWCA 4N0FB 4G7VL 2CNAA 4LKSA 2AHYA 1EEYA 3S9DB 5C07A 4CUBA 1J9QA 5BUPA 4BMEA 4G80B 2P48B 1ZGLM 3DMMD 3DX9A 3MV7A 4U1GB 2VDRH 1A66A 1QQP3 3SGDH 4IGQA 4YLZA 2D9QB 3CXDL 5IB1A 3FKUS 4CC5A 2DVGA 4LSSL 4YIQA 2RR13 3LJ3A 4OCXH 3GXMA 3PHAA 2JD4A 5JXJA 4N0YH 5EZYB 3LKSB 5KYXA 1H19A 2F17A 1UY0A 2VDNH 1MFVA 3MIDA 1GQGA 2A9HA 5BMVB 1GGUA 1MHEA 1VIWB 2QFRA 5DK3A 4ELMA 1PF3A 1JHJA 4OI1A 4XVTH 4L3EB 5D1XA 4OJYA 2ZG3A 4K1ZA 3QI9B 4MVTA 5A7SA 4H37A 4TKWA 5D2LF 2GC4C 4MYWB 1RFDH 4QCIB 4NQCD 3EFDL 3WLUA 1R34A 1BGXH 4YDIH 5EHFA 3UROR 2B1HL 4QDSA 2N4IA 4Z3FA 1NFIB 1JIBA 1QQDB 5JHLH 1P1ZB 1HJCA 4X8NA 4KNCA 1Y76B 1JZDC 2AZUA 4JYAB 3SQOA 3N9OA 2ADDA 4UFHA 3QQDB 3TXQA 3IDXH 4UU9A 2VVFA 2D4FA 4UFIA 4P46D 1KTDB 1BJMA 3RWFA 4BFFA 5EPAA 4F93B 2YS8A 3OGCC 1XNTA 2CO3A 3WW1A 4ZAKA 3GHNA 3E7JA 1AHWC 4LCWB 4XTRC 4LSTH 5SX5H 4B0MB 1UWGL 1IGCL 1VBE1 1RUC1 3JALB 4FVMA 4FI6A 4Q6IC 3QACA 1CEZA 1OSZB 2R0ZH 2WXIA 2Z9TA 5GLVA 1IC0A 2IADB 1BJ1J 3FO2B 1W0VB 3AXEA 4JFQA 3VFMB 2EBOA 3N91A 3GO1L 1B9ZA 1P49A 3BSGA 4M7JH 2O5ZH 4AI8A 4UV4H 3H1WA 1IQAA 1MWAB 1NCBH 1NGQL 5KYYB 4L3AA 2UXNA 4FLVA 1ORQB 3KYMA 1RZPA 2OMZA 5J4MA 1SPPA 3LRLA 4YSTA 1GK9A 5GS0L 1HV1A 2O61B 4GO6B 4OLZL 4F9PC 1SC5B 5GZNC 4NB5A 3VFNA 4RR3B 1Q8PA 3B4SA 2DE0X 2VTXJ 1L9QA 1P7KA 1GY1A 3GJFK 5L19A 1GZWA 2WMPA 5FYLE 3PP3K 4GO9A 5GRWA 4DO2A 3DGGB 3P4MA 1MLBB 4X5XB 4XFCA 2VN4A 1PZUB 2SEBB 1ACZA 3DJ9A 1RZ8A 3MXWL 5DZOA 1XI1A 4ZMQA 5FB8A 1W39A 5FRAA 5AVRB 4LOUD 1AI1L 3E2EA 1GH6A 1MEC2 1WLWA 1TUEB 4HFWB 4OZIE 4O02B 2JVUA 4MMZC 5FUCE 1MVQA 4AF9A 4QPIA 5IJRA 3ESPA 3KPRA 4N9OB 5ITBH 4OI2A 4R9DA 3PAUA 4PRNA 3GF6A 1G9BA 2C1PA 1OAUH 2Z5UA 2WVVB 3D2TA 3FT1A 3I9AA 3DGDA 4JFPB 1GJIA 2WPGA 4PWKA 3ILPA 4Y16A 1K3IA 2YV8A 2VNGA 4FXGA 1WICA 1U3HD 5KANI 3DHJA 3C7FA 4MBOA 2DI9A 5DHVH 4CP0A 4C0BA 3QHFL 5LY2A 1R6TA 4CEWB 5HI3D 4IIQB 1C7SA 4ODTL 4ZUWB 3GUTA 1LK2A 1OE1A 1Q0YL 3VU1A 1DGWX 3CFEB 2Z79A 5BNOA 3TN0A 1NCCH 2FT8A 3P4LA 1QWHA 4FLTA 5CGYD 1Q72H 1DLCA 1S7SB 1AQMA 2F74B 3HCVB 5TGBB 1XF1A 4ANKA 4Q27A 4Z6AT 4KJYA 2AXHA 2VLJB 3A23A 3FFCA 3MN8A 5AYTA 5CZXC 4U6VH 2KG7B 2X5IC 3T1HO 5LXTB 2IQAA 2ED7A 2HG5B 2YBRB 3ZT7A 3W0WA 5HYJE