3R65A

Mthk channel pore e92q mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVQRLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Calcium-gated potassium channel mthK
publication title Crucial points within the pore as determinants of K+ channel conductance and gating
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 30
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3r65A00
3JYCA 3X2QC 1R3KC 1OCRC 2W0FC 4GX1A 4MTOA 3OR7C 2EINC 4G28B 3T4ZA 4P9OA 3ASNC 2HFEC 3LDDA 3RVZA 1S5HC 2Q69A 4QNHB 2K1EA 1QLEC 2AHYA 4PDLA 4J9ZB 4JTCB 3FB8C 5E1AC 4P30A 3E8HA 4GX2A 1OCZC 3WG7C 3ABKC 4RAIA 4XDKA 3SPHA 3STZC 4R7CA 4GX0A 4J9YB 3TETA 4I9WA 3TCUA 3E89A 3F7VC 2WLJA 2BOBC 3ZJZA 2HVJC 4UUJC 4EKWA 5EBMC 2ITCC 1KKDA 4LBEC 3SYAA 3SYCA 2WLNA 1V54C 5J9PC 2ZD9A 4XDLA 4PDMA 2OCCC 1V55C 4MTGA 1OCOC 4H37A 3LDEA 4PA6A 5CBHA 4TWKA 2Q68A 4WFEA 3ZRSA 5EC2C 3SYQA 4MVQA 4PA7A 2QKSA 4KFMA 2X6AA 4QE9A 3FB7C 2DWEC 4CBCA 2X6BA 3SYPA 4MW8A 2JK5C 2X6CA 2ZXWC 3E86A 2HG5C 2DYRC 3PJSK 4X8AA 4MVUA 5CBFA 4GX5A 5B1BC 2BOCC 4R50A 3SYOA 1J95A 3FB6C 3KG2A 4MVMA 4PDRA 4MVSA 3IGAC 4LCUC 1R3JC 2DWDC 2WLIB 3ASOC 2Q67A 2A0LA 3UM7A 2WLIA 2NLJC 3T2MA 2EIJC 3E8FA 4JTDB 2YEVA 3SPIA 5BZBA 4RUFA 1XL6A 3OR6C 4MW3A 4PA9A 5EBWC 1K4CC 4G27B 3K0DA 2Q6AA 2WLMA 3AG2C 4PDVA 3T4DA 1P7BA 3AG3C 4OXSA 4PA4A 4PA3A 4R6ZA 4RUEA 3VOUA 3K06A 4MSWC 4MTFA 4X88A 2WLHA 5B1AC 3LDCA 3RBZA 1G4YB 3AG4C 2HVKC 3FB5C 3SPGA 3R65A 1XL4A 2WLLB 4LP8A 4XDJA 1R3LC 4P2ZA 4RO2A 4ZBMA 3RVYA 3F7YC 2WLLA 3EFFK 3K03A 4MVRA 3BEHA 2A79B 3IFXA 4F4LA 1M57C 2IH1C 2ITDC 4DXWA 4WFGA 2IH3C 3UKMA 3ABLC 4MS2A 2EIKC 3T1CA 3SJQC 4H33A 3LUTB 4HYOA 1ZWIC 2R9RB 1ORQC 4QE7A 5EBLC 5KUMA 5CBGA 2ATKC 5KUKA 2AHZA 2EILC 2QTOA 1M56C 3OGCC 5IY5C 2Y69C 3OUSA 2KB1A 2DYSC 4HZ3A 3E8BA 2HJFC 3LNMB 4BW5A 3OUFA 1R3IC 4R8CA 3RW0A 4MVOA 3E83A 3F5WC 3GB7C 1LNQA 5EK0A 3AG1C 4P9PA 3ABMC 4JTAB 4MVZA 2A9HA 2EIMC 2P7TC 4WFFA 1BL8A 4WFHA 1K4DC 5B3SC 5EC1C 3K08A 3E8GA 4X89A 3STLC 1JVMA 2H8PC 2WLKA 3K0GA 3SPCA 3SPJA 3HPLC 3K04A 1OCCC
chains in the Genus database with same CATH superfamily
1YXBA 5LMUB 2OIEA 3CMAV 2XNDG 2XTAA 4WF9V 4J9ZB 5E1AC 4JI2O 2PYJA 4DV1B 1VQ7V 3FX7A 4L87A 3ZJZA 5H9CA 1V54C 5J9PC 4UB6Z 2F43G 4XDLA 1AI5A 2Q68A 5KHGA 5KA5A 2CH7B 2GDSA 4PA7A 1AILA 4JZGA 2Q4PA 1EZJA 1H38A 4HBNA 3E35A 4DR4B 1XILA 3RFRA 3N2KB 4FZ1A 5KLVH 1MNGA 1OCCB 2QM4A 3HKBB 4NTYA 2UU9O 4TQDA 1D5NA 1OV9A 2UUCB 2XAHA 4X88A 3RBZA 5BMVA 1G4YB 3FB5C 1KYOF 2Y4UA 1CP9A 3EFFK 4MVRA 1GMGA 4HNAA 4JI8B 1JOYA 3A2FA 2KB1A 4JI6B 3OUFA 4CS2A 4MVOA 4TV9B 4B3MB 1VQ9V 3K08A 3WB1A 4J7KA 2BTQB 1FFTB 1JVMA 2R70A 4NXMB 1QLNA 3KG2A 4DO2A 2YSUB 3JYCA 1X59A 1ZL8A 3JSNA 4DV0B 3RVZA 2Q69A 1RM1B 4X65O 4FLUA 3ZHVA 2QSAA 3ABKC 4RAIA 1XMOB 3CJHA 4X66O 3TGUH 1Q3EA 5L3EA 3FKSG 1PM9A 3OMIB 3HKCA 2HVJC 1BMFG 5GONA 4PI0A 2KQXA 1NI8A 3A8TA 3E22B 5KAIZ 2EILB 5H2FZ 2QKSA 3AG7A 3UO3A 1SS3A 5CA0A 2LO1A 1AROP 4NXNO 2DMXA 2EZPA 1M1KW 4MVUA 1IX9A 5LP6A 2ZNIA 2V4DA 2DWDC 3ZN0A 5EYPB 5IWAB 1DGSA 3E8FA 4CH5A 4RUFA 3OR6C 2B1IA 1IBLB 4DV2B 1EN6A 3RYHA 4EFBA 5LBQA 4PA4A 5BMVB 1N32B 4LNUA 1Q86W 1EM1A 2ZE7A 1Q6UA 2XAGA 3CP1A 1IXMA 5J2TA 4QPJA 3CPWU 4HYOA 2VQEO 4N23A 5LMUO 3H1LH 5IJ9A 1IZ3A 3DC6A 4IL6Z 4BW5A 1OCOB 4Z1MG 1VARA 1BSMA 4DV1O 2M7WA 1AVMA 4X64B 1RPRA 4TQFA 2C2AA 1X4TA 5KMGB 2HLDG 3A0RA 1OCCC 1ZL8B 5LYJB 2FKXA 3CRAA 3JARA 3M8AA 4IIJA 1YJWV 3JATB 2K1EA 3KCYA 3UCSC 3VQXA 2PGGA 2F23A 4ZI7A 1W0JG 1YCIA 4E2LA 5JH7A 3WFVA 5CA1A 1YVWA 3CJHB 1CXZB 2LW1A 5IYDO 2D2CB 5JVDA 4YJ2A 2PZSA 1QBZA 4JV5B 3HKCB 2HP8A 1B06A 1YHQV 3SJAC 2BSKB 5GONB 3BHPA 1KKDA 1OHHG 1Q81W 3RYCB 4I0XA 3K58A 4HAMA 4TWKA 5EC2C 3KKYA 4ZOLA 1BQ0A 1NT2B 4B08A 5CA0B 4O4IA 2UUCO 5IJ0A 4G2KA 1Z2GA 2JGUA 5LP6B 5FLXN 3L9DA 4R50A 4QJFB 1XNRB 1YJ9V 5B3SB 4JI8O 2E5LB 5J2UA 1RM1C 1THZA 2FYUH 1NU1H 3ML0A 3RYHB 3TXSA 2WLMA 2H94A 2F1MA 4J41A 4OXSA 3I56V 2R9AA 3VOUA 2YXYA 3Q4HA 4LNUB 1HNZB 3LDCA 4LF7B 4B3MO 1XL4A 2ZDIC 5J2TB 4WFBV 1SETA 3UKMA 4NXMO 3A0HZ 4JGSA 4JYBA 5IJ9B 3ZEDA 2EILC 3WB0A 5KHHA 1QHTA 4Z2WA 4HZ3A 2OCHA 1AR4A 2LW7A 1SC5B 1XMOO 2ZE8A 2Z5UA 4FMTA 4KUMA 3SPJA 2DJVA 5BZBA 2K9PA 4E4EA 1AJNA 2W0FC 4IIJB 2Q8VA 4Q20A 2VWKA 3JARB 3OR7C 1PL0A 3SDLA 3T1HB 3SJCC 4ZI7B 4X1YB 4PDLA 4FFKA 3QG5A 3JD1A 4JI7B 1DTOA 2QWQB 3RGBA 1NR7A 4FLVA 3GVMA 4YJ2B 5JVDB 4LF9B 4R7CA 4DV5O 4GCZA 3U0ZA 1VQ4V 3E89A 1GN2A 4JI1B 1EBOA 1HWYA 5C93A 3OEEG 1IXBA 4I0XB 5IWAO 4TUYA 1J5EB 5IDJA 1YITV 1OCOC 3FYIB 2EZOA 1IBLO 4DV2O 3JSLA 4O4IB 5IJ0B 1A32A 4DR1B 1Y76A 1N32O 2JK5C 1HR0B 1ZTEA 1QCEA 5LOVB 3CX5F 5IYCO 3I55V 5J2UB 3WU2Z 1JMKC 1EZVH 3CXHF 4JYCA 4UV9A 3CRMA 5H6QA 3SGIA 2CTRA 2CGOA 5KX5A 3K5OA 1YIJV 3Q4HB 1WPXA 4R6ZA 2VQFB 3B77A 5L3DA 2L35A 2Q5ZA 3KCXA 4I50A 2G38A 4FM0A 1YJNV 5BXZA 2HVKC 2QWRB 3P3NA 5E79Z 4X64O 3CCEV 4FLZA 4NYKA 1QR8A 1MABG 2R9RB 2PY5A 3LSUA 1NH2D 1B3QA 4UVAA 5JCOC 2RQ6A 2Y69C 1YSCA 5LHHA 3E8BA 3ZIAG 4LC1A 2JGDA 1SRYA 5LP6C 4YY3B 3GWKC 4BIZA 3ETDA 5L3CA 1M93A 5B3SC 1GM7A 4JV5O 4X89A 3QVNA 2WLKA 2PF4E 3L70H 2PI4A 4DV4B 4PDVA 4GYCB 1JX9A 3OW2U 1SZXA 2UXCB 4NR1A 2HFEC 5GW7A 1R6KA 2EIJB 4WBNA 1S0VA 2PYLA 4LFBB 1AP6A 2FL4A 2ZM6B 1PPJH 3FAVA 1YDXA 4OPHA 3CC7V 1E79G 2ZINA 2ITCC 4O2AA 1Y74B 4LBEC 3UT5B 4TUYB 2E5LO 1NQTA 1K92A 5CB4A 4DW0A 1LUVA 1Y6XA 1NVPD 4D7SA 1Y76B 1HNZO 1GK9A 4LF7O 3J80N 3PJSK 1N8RW 4GX5A 4MVMA 2EIMB 2NLJC 3JAKA 2QEXV 2KG7A 4B3TB 2YUAA 2X0LA 5KX5B 3W7WA 1AR5A 4I50B 4NB5A 1JA8A 4NTXA 3HKEB 4XDJA 1WLEA 3RVYA 3DXRA 1VIBA 3ZMTA 2XASA 1JR9A 3IFXA 2Y4TA 1XHXA 1XUQA 3K5LA 2W6JG 5KUMA 3D36A 4DV6B 3T1HO 1BS3A 1Q7YW 2EJRA 3K59A 4JI7O 2JGDB 1K5SA 1KBHA 2EJ7A 3F5WC 3OMAB 5LL6Y 3CXCU 2QE7G 3AG1C 2UXDB 4LF9O 2P7TC 1ENVA 4U7OA 1SA0A 3K79A 4FM2A 4JI1O 1V9PA 3K04A 1SQQH 3L73H 3UO2A 1J5EO 5KAFZ 4WBNB 3BPZA 4PHZA 5IYBO 4JAAA 1FFXA 4TT3G 2BCCH 4DW1A 4JYYA 1E1QG 1S77D 4ZKIA 1WNSA 4K8XA 3K3WA 4DR1O 2W6IG 3RT3C 5LA6A 1HR0O 1M9NA 1R6TA 4O2AB 3QNEA 2DQ3A 2YIAA 1O9HA 1JJ2U 4PI2A 4DRXA 3FFQA 1TA8A 1YTFB 1D2DA 3FB7C 2VQFO 4MW8A 2CTQA 1S72V 4B3RB 5EIBD 1PNLA 2Y48A 5TISZ 5BR8O 3CS5A 4LCUC 1M5IA 4CC5A 3JD0A 2WAMA 2EIJC 2KG7B 3ABTA 1WAZA 2YI8A 2YEVA 2ILMA 2A7WA 2UXNA 3O65A 1B6QA 3X2QB 4U3JA 1U96A 3OTFA 4LFAB 3CC2V 4YY3O 3DXRB 3PN1A 3VQWA 2YXLA 2A06H 5FNVB 3H1KH 4DXWA 2HJDA 4EEQA 3SJQC 5K1XA 4DV4O 3ASOB 2F95B 2WA3A 2UXCO 2AZ2A 4TOIA 2AZ0A 4K8ZA 4TV8B 3TK1A 2ODMA 4YJ3A 1WB7A 3G71V 4LFBO 1FS0G 3L71H 1JJOA 3BRCA 4IHJA 2ZM6O 4ICGA 2EIMC 2PTMA 5DN6G 5C8YB 1VQPV 3ETGA 3CCMV 4K0KB 2P90A 5EZYA 2OWOA 3JD4A 1AR1B 4O4LB 1FFXB 4Q6GA 1F23A 3B09A 2YS8A 4O4HA 4NTWA 2Q73A 1WJZA 5BY1A 1MSDA 4AILC 4EKWA 1I94B 2Z0AA 2XAJA 1WP8A 1XBLA 3L72H 2ZIOA 5LMNO 4B3TO 4GT1A 4UV8A 1T5EA 2XOKG 1WA8A 3D3QA 1URFA 3D8CA 1H2MA 2JRIA 2HG5C 2LGQA 4DR2B 4MVSA 1R3JC 2YEVB 2KKWA 1VQLV 5FPRA 4U3JB 4DV6O 1SERA 1Q43A 1PKXA 3ZMSA 1P49A 1P7BA 1W2BU 3OFNG 2UXDO 3OAAG 1R3LC 1K3EA 4DV7O 3APOA 2LJ2A 4UCSA 1NTKH 5CBGA 1VQ5V 2RMKB 1HNWB 1RP3B 4YJ3B 3BABA 4UCVA 2B5UA 1I08A 2ADQB 3LSSA 1F51A 3OM3B 2A9HA 1SQFA 1EFRG 3P3PA 2OYQA 5IYZA 2HEPA 3CE2A 3ZRXA 1H2NA 4HNAB 3B40A 1Z5WA 3X2QC 4YHHB 4GZRB 2XAFA 4B7EA 2VS0A 3IJ4A 3ICXA 5AG2A 1P84F 2VRZA 2RJZA 4B3RO 2LGWA 4GUNA 3AG4B 3WB2A 4YXWG 1PP9H 2Q0AA 3CCVV 2LFSA 2WLNA 4MTXA 1VF6C 3SYQA 4MVQA 1PV0A 4I55A 4KFMA 3JASA 3JCZA 4ABMA 5F2VO 2DYSB 1W0KG 2X6BA 4ZIBA 4LFAO 4NKGB 3E86A 5IT9N 3G67A 1Q6IA 5B1OA 1J95A 3FB6C 3JD3A 1G8MA 3IGAC 2QWOB 2Q67A 4W4LA 2E74B 4LH7A 1XHZA 3VBBA 4DR4O 4MW3A 4AQYB 1KD1W 3K0DA 2H3OA 2Q6AA 1FXKA 3JALA 4JI4B 1FJGB 1K33A 2UXXA 2QR4A 1SQGA 3F7YC 2WLLA 4CH4A 4DR7B 4IYIA 2ZT9B 4EFEA 4FM1A 4K0KO 3CRQA 1I7FA 5GTHZ 3H1IH 3HKDA 3OUSA 4BR6A 3G4SV 1Q8IA 4TSFG 1FKAO 4JI6O 1YF2A 4P9PA 2F93B 5LXTA 5IYZB 3T1YB 4WFHA 3P30A 1ROPA 2NR5A 2QGNA 4FFBA 1F4NA 1M90W 1BT8A 4BW9A 3OT7A 5LHGA 4JI5B 2YIBD 4DV0O 1XREA 2RN9A 2Q0OC 3CD6V 3THOA 4GX0A 4J9YB 3TETA 4GKKB 1Y4MA 4DR2O 4DUYB 2GV9A 2E76B 1FD9A 1SQVH 3ABLB 3BVOA 2UXBB 2QM8A 2Y0IA 3OGIB 4I55B 5JH7B 1YI2V 1M56B 1VF5B 5KHJA 4QE9A 5CA1B 1VQOV 1NBMG 3FD9A 1VEWA 5CBFA 3ABMB 2Q7HA 3RYFA 4KHPB 1G1XB 5L3FA 4X1IA 2FMLA 4NVPA 5EBWC 1P7GA 1HNWO 3CMEV 1FXKB 3JALB 4ZOLB 1Q82W 1TVKA 1MOFA 2ADPA 4U3FH 1WB8A 1E1RG 5ITZA 1RSOA 3H01A 1JQ0A 2HKOA 2QKCA 3AG4C 3H9VA 2WLLB 4UB8Z 1K9MW 3WG7B 1FAFA 2YICA 2ITDC 2IH1C 4DR5B 4WFGA 1QR9A 3T1CA 2DQ0A 1H2KA 5CA3A 4UVCA 1HP8A 1VF7A 3HKDB 4DR3B 1B04A 4YHHO 4OPAA 2DYSC 2LFRA 1H8HG 1GM9A 3GB7C 3G80A 1F7YA 4I9QA 4UCRA 1K4DC 1WP7A 3E8GA 4O4JA 1HDJA 2JS3A 4FLXA 1NH2B 3O9OA 1S5LZ 4L8JA 3LDDA 4JYAB 4J7ZA 4J10A 2AHYA 3CCJV 2P06A 4P30A 3B4SA 1NTZH 5A9GA 4XDKA 3STZC 1FXHA 3U10A 2P4VA 2ZCEA 1I0HA 2WLJA 1VQKV 4I4TA 1XNQB 3CCUV 1M57B 1QQCA 2EIKB 2E75B 3IC7A 2OT5A 3IC9A 3LDEA 4AQYO 3C90A 4FLWA 4PD4F 4JI4O 1FJGO 2QTSA 3K9SA 5DM6V 1K34A 3K5NA 2QJ1A 1CPYA 2WSSG 3RYFB 1XNRO 4DR7O 3CRRA 1JFFA 2IBZH 2AGAA 3BAAA 3ZHSA 3JD2A 4PV1B 1TVKB 1NVPB 1RFYA 3ASNB 3B8MA 4RUEA 5ITZB 1RSOB 3RN4A 2WLHA 4JI0B 2P4KA 4ZBMA 1MMMA 2CTPA 3T1YO 3K03A 2A79B 1VP7A 3TXQA 3ABLC 4MS2A 1DF4A 2HHHB 3LUTB 2F66C 4QE7A 2ATKC 1WPBA 1M56C 4JI5O 1ZLZA 5JQGA 2OCCB 3ZN1A 3G6BA 4R8CA 1AJPA 4LF5B 2CK3G 1PNMA 4UXNA 4UVBA 3ABMC 4MVZA 3JAMN 2N05A 4UCTA 2KSDA 4GKKO 2ZXWB 3UQ8A 4J11A 2YI9A 3J81N 4DUYO 1SQBH 1SZTA 1K73W 1GTOA 2IJKA 2W0XA 4GX1A 4FLYA 5FL7G 4G28B 1TUEB 3H1JH 3APQA 2CH7A 1O9GA 3WG7C 4X66B 3IAYA 1LR1A 1UFIA 4I9WA 2QWNB 1F4MA 1UJWB 2DOSA 4I4TB 2UUBB 4LFCB 5EBMC 2A3QA 2YXHA 5KHIA 2ZD9A 3W7XA 1P4RA 3C3SA 5CBHA 2FTKA 3HKBA 3AK1A 4WFEA 1R6NA 3ZRSA 1PNKA 1Y67A 1ZAUA 1H2LA 5IY5B 4N21A 3SYPA 2X6CA 3FAVB 2ETNA 4F6RA 4DK0A 2L6LA 1DK1A 1S5JA 4DR5O 1JFFB 2GUZA 3CWBH 3EVKA 3ZRWA 1BHAA 2JIZG 1XL6A 2XHBA 5CB4B 1N0JA 1N33B 1K4CC 2IU0A 2AXTZ 1FYJA 4MTFA 1GAXA 1MZEA 4DUZB 3R65A 4CS4A 4QGPA 3W7TA 3K5MA 1OCZB 4RO2A 4BIOA 4FLTA 1IURA 5GTIZ 1AP5A 4QPKA 1M57C 1GM8A 2BTQA 1EN5A 2EIKC 5KHKA 3JAKB 1MG1A 2JEXA 1ORQC 3ZX6A 5EBLC 1LUWA 3OD4A 4CH6A 4JYAO 5JQGB 4ZHQA 2HJFC 3ZRVA 1NKDA 1SQXH 1YTFD 2QWPB 2WWWA 5EK0A 3KZIZ 2LQTA 2GHYA 1JPXA 1QU7A 1VMGA 2DYRB 2IM9A 3K0GA 1L1FA 1KECA 2ZDIA 4KXRA 1K7DA 1XNQO 4X20A 3OE7G 3BCCH 4FJCC 2ZQMA 3ASNC 2P5OA 3E22A 5KA6A 4H44B 3W7SA 3ABUA 2M6YA 3SPHA 3JAWA 1G6UA 1SA0B 1Q6HA 2BOBC 3M99B 3QO7A 3SYCA 5EYPA 4FZ0A 5JJEB 4J7JA 4PDMA 2OCCC 3CYOA 2JEUA 4IT5A 1N34B 1FXVA 2V7QG 4OGQB 1NZ6A 4CBCA 1WN7A 4KP4A 1M4UA 1K97A 5LGTA 2ZXWC 2O57A 5LA6B 4JI0O 4F6RB 4EB6A 3LSQA 5K1PA 2BOCC 4K35A 1SQPH 4FPPA 3L74H 4J80A 2VWJA 2UUAB 2WLIA 4LH6A 2HHHO 2GUZB 3ZRWB 1IBMB 1QVGU 1GN4A 2ZIMA 5H5NA 4DRXB 1OCRB 2EINB 3GWOA 1I5YA 4JI3B 3T4DA 4LF5O 1QLEB 1OJHA 4LP8A 2IJHA 1GN3A 1YEWA 5KMGA 2MW2B 1ZWIC 3QF7A 1N0NA 4LF4B 2WA4A 5LYJA 5IY5C 3D3IA 1XQ8A 4ZHQB 3JATA 3RWRD 4X62B 4BAYA 1V55B 4JZ2A 4F6EA 3RW0A 1US6A 2BE3A 1BQZA 4JTAB 5JJNB 4OX9B 1I5XA 4I5SA 2R9IA 1BL8A 1SF9A 4Z1VA 4I7ZB 2UUBO 2BSKA 4LFCO 1GKFA 4X20B 2DE0X 3RYCA 2ZR3A 4DR6B 3LNNA 2DW4A 5B1NA 1IBKB 1S5HC 2JJ1G 1MSWD 1XDCA 4JTCB 5EIBC 5JCOA 4PELA 1OCZC 4W4KA 4DV5B 4IHJB 3OTOB 1H8EG 3JAWB 1KP2A 3QO5A 1ZUQA 2RCVA 1NTMH 3BFRA 3EXAA 3BA9A 3OMNB 5B1AB 4LF8B 4JAUA 2ZR2A 1OZ0A 1CEZA 1BZKA 1YZBA 4UUJC 3CEIA 5EZYB 4U7NA 2OTJV 1PD3A 3ZHTA 3B2EE 4PA6A 1QVFU 2YIBA 1N33O 1VQMV 3BA8A 2IW5A 4O4HB 4EB6B 1S3JA 2DYRC 4DUZO 1BHBA 1Q90D 3SYOA 3MHHC 2DN9A 2F4VB 4B3SB 3DC5A 3ZHRA 2WLIB 3ASOC 3D36C 3ZCCA 1DLBA 3CHXA 4DV3B 4PA9A 5DECA 5B5EZ 4ASUG 1WA8B 4AHCA 4C7UA 1Z5VA 4XBFA 1GO3F 1MA1A 5LHIA 1XEQA 5B66Z 3QO8A 2IH3C 4AI8A 2CUGA 1JCHA 2GTSA 1L8DA 2AHZA 3S3WA 2CE4A 2P6JA 4X1YA 3CRCA 3CC4V 1W59A 3ZHQA 2D3OW 4X9QA 4BWAA 4DK1A 4MT8A 1COWG 4GKJB 5H6RA 3STLC 3A0BZ 5B1BB 4YIOA 4X1KA 5HFLA 1AI6A 1R3KC 1OCRC 2EINC 3T4ZA 1VQNV 3H1HH 3ZMUA 1QLEC 1N34O 5D5QA 2Y69B 3FB8C 1BGYH 4RWUA 1RPOA 1Q5OA 3N27A 3I5DA 2CDYA 4BIUA 5LOVA 4CZZA 2P67A 3MD0A 3SYAA 2UUAO 1Y66A 1I94O 3MHSC 1TUBA 4H13B 1AI7A 3NR7A 1IBMO 1GH6A 1V55C 3U11A 4H37A 1KU9A 2B1GA 4D7TA 3SR2C 4D6TH 2ZKOA 4LWSA 4JI3O 2DWEC 3ETEA 2YC0A 4KL1A 4X8AA 1HNXB 4RQFA 3C3TA 4JAVA 1XMQB 1KMIZ 2E3CA 2XAQA 4JPRA 2JVDA 2QA4V 2N74A 3EHBB 2A0LA 5LGUA 3T2MA 5LGNA 5L3GA 3SPIA 4GLXA 1XI1A 4FVMA 1HW7A 4LF4O 3MAQA 3VQYA 1BCCH 4X62O 4YIPA 2P22C 3JASB 2MK3A 4PA3A 2Z3YA 5JJJB 3JCUZ 5B1AC 3SPGA 2CGNA 4PJ0Z 4OX9O 2QM7A 2ZE5A 1H2GA 3BEHA 1N36B 3DTUB 1QNMA 4H33A 4DR6O 1IBKO 1ZX3A 2EULA 4LR3A 3DSQA 1PL4A 2QDOA 3ETQA 3OTOO 1K8AW 3QTCA 2GTAA 5EC1C 3CCLV 4LF8O 2H8PC 4X1KB 3RYIA 1Y74A 3UT5A 1H2SB 2RNBA 4CH3A 2IJJA 1FPOA 2CAZC 1IDSA 4QNHB 4WCEV 1KUQA 3L75H 1KQSU 4GX2A 2IU3A 2ARHA 3AG2B 5LXTB 3SJBC 1NJIW 4LF6B 3AG3B 3AG1B 2XUMA 3CCRV 3F7VC 2ZE6A 2F4VO 4B3SO 1GRJA 4FK5C 4FFBB 5JWPA 1AJQA 1TUBB 1MZFA 4DV3O 1BE3H 2YDEA 4MTGA 2OTLV 2NN4A 4LWSB 4JI2B 4O2BA 3P32A 4H0LB 2XT9A 1AB3A 4UCUA 3HKEA 5FPOA 5BR8B 3HR0A 5B1BC 2QKAA 4PDRA 2Q9LA 3UM7A 3W7UA 2N04A 4J42A 4IYHA 3E2EA 3TJTA 1EN4A 1UPGA 4DYLA 4MSWC 4K3AA 2JDIG 2YIDA 5CN0A 2PI5A 3CCSV 4GKJO 1D5AA 3ZMVA 2FB5A 4WFAV 4JASA 4X1IB 3CCQV 5KUKA 2CTWA 1KKCA 2QTOA 3OGCC 2UU9B 1V54B 3LNMB 1K5QA 1L0NH 1R3IC 3N2GA 1N4CA 5DEDA 2Y0PA 2ZNJA 1L0LH 2X7RB 2RDCA 3K57A 3RYIB 3FYEB 3HPLC 2R72A 3AK2A 2LP7A 4MTOA 2AW9A 3K9AA 1AI4A 4P9OA 5HFMA 4UCOA 3F5TA 2GBOA 2GSMB 2WPDG 1VQ6V 3E8HA 1XOUA 5A2QN 2Q7EA 4CS3A 1SESA 4RQEA 1NS1A 3G6EV 1GN6A 5CMUA 1HNXO 3TCUA 2V1DA 1XMQO 4O4JB 4IGGA 1KP3A 2JS5A 4A5UB 3ZHUA 3MDSA 5LMNB 1FXKC 4JF3A 4X65B 2UXBO 4O2BB 2B9ZA 2JJ2G 2X6AA 2NNUA 1IVSA 1NR1A 3NXSA 1S76D 2EBOA 2HR3A 2BTOA 3R66A 3ZS8C 3ZMZA 5FNVA 4B7KA 4QIWF 1N36O 1KC8W 3CB2A 3J7AU 2IJIA 3OEHG 4JTDB 1U97A 4FIPC 4KHPO 2Q7GA 3N2KA 3CSXA 2OIGA 5L3BA 2PUSA 4TV8A 4G27B 3AG2C 1VF6A 3AG3C 1SKVA 3K06A 4NXNB 4CC6A 1KB9F 1DF5A 4P2ZA 3VQVA 3ABKB 4DV7B 4F4LA 5D5PA 3AEIA 5C8YA 3S3XA 1VQ8V 3BY6A 3M7MX 5IE9A 3DGEA 4O4LA 3AK3A 4DR3O 3ZBHA 1TAEA 3N2GB 3E83A 1LNQA 3HB3B 4TV9A 4LF6O 1R1BA 4WFFA 1R73A 1TGOA 2EX3A 3SPCA 4UFZA 1ZSPA 2VQEB 3B8NA
chains in the Genus database with same CATH topology
1JX9A 2ZR3A 3OW2U 2DW4A 5LHGA 2HFEC 5B1NA 5GW7A 3CMAV 1R6KA 1S5HC 2EIJB 2XNDG 2JJ1G 1MSWD 4WF9V 1S0VA 4J9ZB 4JTCB 5E1AC 4PELA 1OCZC 3CD6V 1VQ7V 1H8EG 1KP2A 3QO5A 4GX0A 4J9YB 3TETA 3OMNB 5B1AB 3CC7V 1Y4MA 4L87A 3ZJZA 4JAUA 2ZR2A 1OZ0A 1CEZA 1E79G 4UUJC 2ITCC 5H9CA 4LBEC 4U7NA 2OTJV 1V54C 1NQTA 1PD3A 5J9PC 3ABLB 4XDLA 2F43G 4PA6A 1QVFU 1AI5A 1K92A 2Q68A 2QM8A 1VQMV 1NVPD 5KA5A 1YI2V 1M56B 4PA7A 4QE9A 2IW5A 1VQOV 1NBMG 1GK9A 1S3JA 2DYRC 1EZJA 3PJSK 1N8RW 1BHBA 1H38A 5CBFA 4GX5A 3SYOA 3MHHC 3ABMB 4MVMA 2EIMB 2WLIB 3ASOC 3E35A 3ZCCA 2NLJC 1DLBA 2QEXV 5L3FA 4PA9A 1OCCB 5EBWC 4ASUG 3CMEV 2X0LA 1FXKB 3W7WA 1Q82W 1MOFA 4XBFA 2XAHA 4X88A 1E1RG 1GO3F 3H01A 3RBZA 1G4YB 1JQ0A 2HKOA 3AG4C 3FB5C 5LHIA 2WLLB 4XDJA 1CP9A 1WLEA 3RVYA 3WG7B 1K9MW 3ZMTA 3EFFK 2XASA 4MVRA 3IFXA 2ITDC 2IH1C 3QO8A 4WFGA 2IH3C 1GMGA 1QR9A 3T1CA 2DQ0A 5CA3A 2W6JG 1JOYA 1JCHA 4UVCA 5KUMA 3D36A 2AHZA 2KB1A 2DYSC 1Q7YW 2LFRA 2EJRA 2P6JA 1H8HG 3OUFA 1K5SA 4MVOA 3CC4V 1GM9A 3OMAB 3F5WC 3GB7C 3CXCU 2QE7G 3AG1C 2D3OW 2P7TC 1ENVA 1K4DC 1VQ9V 4MT8A 1COWG 4U7OA 5H6RA 3K08A 3E8GA 3K79A 3STLC 1FFTB 1JVMA 1QLNA 3KG2A 5B1BB 3K04A 4DO2A 2YSUB 5HFLA 3JYCA 1AI6A 1R3KC 1OCRC 1NH2B 2EINC 3T4ZA 3LDDA 3RVZA 2Q69A 1VQNV 5IYBO 3ZMUA 1QLEC 2AHYA 1RM1B 3CCJV 2Y69B 3FB8C 4P30A 4TT3G 1S77D 1E1QG 4ZKIA 3ABKC 3K3WA 4RAIA 4XDKA 3STZC 2W6IG 1FXHA 1RPOA 5L3EA 3FKSG 1M9NA 2WLJA 1VQKV 4BIUA 3OMIB 2HVJC 4CZZA 1BMFG 2P67A 3MD0A 3QNEA 3SYAA 2DQ3A 3CCUV 1M57B 1Y66A 3MHSC 1AI7A 2EIKB 3IC7A 1V55C 4H37A 2OT5A 3LDEA 2B1GA 1JJ2U 2EILB 2QKSA 1YTFB 3FB7C 2DWEC 1AROP 4MW8A 5DM6V 3ETEA 1K34A 1S72V 2EZPA 4X8AA 1M1KW 4MVUA 4RQFA 1PNLA 2Y48A 1CPYA 4JAVA 2WSSG 4JPRA 2XAQA 2QA4V 4LCUC 2DWDC 3EHBB 2A0LA 5LGUA 3JD0A 2WAMA 3ZN0A 3T2MA 5LGNA 2EIJC 3ABTA 3E8FA 5L3GA 2YEVA 3SPIA 4RUFA 3JD2A 3OR6C 2UXNA 2B1IA 1B6QA 3X2QB 1NVPB 3ASNB 3B8MA 2MK3A 4RUEA 5LBQA 4PA4A 4PA3A 2Z3YA 3CC2V 2WLHA 5B1AC 1Q86W 3SPGA 4ZBMA 2QM7A 2XAGA 3K03A 3BEHA 1H2GA 2A79B 1IXMA 3CP1A 3DTUB 4DXWA 4QPJA 3CPWU 3ABLC 4MS2A 1DF4A 3SJQC 4H33A 3LUTB 4HYOA 3ASOB 4QE7A 4N23A 2ATKC 1M56C 3TK1A 2OCCB 3ZN1A 4BW5A 1OCOB 4R8CA 1AJPA 4Z1MG 3G71V 2CK3G 1FS0G 1PNMA 4UXNA 4UVBA 3ABMC 4MVZA 1K8AW 2M7WA 2EIMC 5DN6G 5EC1C 1RPRA 2ZXWB 3CCLV 1VQPV 2C2AA 3ETGA 2H8PC 3CCMV 2P90A 2HLDG 1SZTA 3A0RA 1OCCC 1GTOA 1K73W 2IJKA 4GX1A 2IJJA 5FL7G 4G28B 3JD4A 1AR1B 1TUEB 4QNHB 1YJWV 4WCEV 2K1EA 1F23A 1W0JG 4E2LA 1KQSU 3WFVA 4GX2A 2IU3A 3WG7C 5IYDO 3AG2B 1NJIW 3AG3B 1QBZA 3AG1B 4I9WA 3CCRV 3F7VC 1F4MA 1UJWB 1YHQV 4FK5C 4EKWA 5EBMC 1KKDA 1AJQA 1OHHG 1Q81W 2XAJA 2ZD9A 3W7XA 1P4RA 4MTGA 4GT1A 5CBHA 2FTKA 4HAMA 4TWKA 4UV8A 1R6NA 4WFEA 5EC2C 2XOKG 3ZRSA 2OTLV 1PNKA 5IY5B 3P32A 4N21A 3SYPA 4G2KA 2X6CA 2HG5C 5B1BC 4R50A 4QJFB 4PDRA 4MVSA 1YJ9V 1R3JC 3UM7A 3W7UA 5B3SB 2YEVB 3ZRWA 1RM1C 1BHAA 2JIZG 1VQLV 1XL6A 1THZA 3E2EA 3ML0A 1K4CC 1SERA 2WLMA 2H94A 2IU0A 1PKXA 3ZMSA 1P7BA 4OXSA 3I56V 3VOUA 4MSWC 4MTFA 2JDIG 1W2BU 3LDCA 3OFNG 3R65A 3W7TA 1XL4A 3OAAG 5CN0A 3CCSV 1OCZB 2PI5A 1R3LC 4RO2A 2ZDIC 4QPKA 4WFBV 3ZMVA 1M57C 1GM8A 1K3EA 1SETA 3UKMA 2EIKC 1MG1A 4JGSA 4JYBA 4WFAV 2JEXA 1ORQC 4JASA 3CCQV 5EBLC 5CBGA 1VQ5V 5KUKA 2EILC 2QTOA 3OGCC 1V54B 4HZ3A 3LNMB 1K5QA 2HJFC 3ZRVA 2B5UA 1NKDA 1R3IC 1YTFD 3LSSA 2WWWA 5EK0A 1F51A 3OM3B 2A9HA 2X7RB 1EFRG 2GHYA 1JPXA 3ZRXA 2Z5UA 4FMTA 4KUMA 2DYRB 3K0GA 3SPJA 1L1FA 3FYEB 3HPLC 5BZBA 1KECA 2ZDIA 1AJNA 1K7DA 3X2QC 2W0FC 2LP7A 3OE7G 3OR7C 4MTOA 4Q20A 1PL0A 1AI4A 2ZQMA 3K9AA 3ASNC 4FJCC 4P9OA 5HFMA 2XAFA 4PDLA 2GSMB 3JD1A 1DTOA 5KA6A 2WPDG 1NR7A 1VQ6V 3E8HA 3W7SA 3ABUA 3SPHA 1SESA 4RQEA 4R7CA 3G6EV 4GCZA 5CMUA 1VQ4V 3TCUA 3E89A 2V1DA 3AG4B 2BOBC 1KP3A 1EBOA 4YXWG 3CCVV 1HWYA 3M99B 5C93A 3QO7A 2LFSA 3OEEG 3SYCA 2WLNA 5IDJA 1FXKC 1YITV 4PDMA 4MTXA 2OCCC 3CYOA 2JEUA 1OCOC 3FYIB 2EZOA 4JF3A 1FXVA 2V7QG 3SYQA 4MVQA 2JJ2G 3JCZA 4KFMA 2X6AA 2NNUA 4CBCA 2DYSB 1W0KG 2X6BA 4KP4A 1K97A 2JK5C 3E86A 2ZXWC 1NR1A 5LGTA 3NXSA 5B1OA 3LSQA 2EBOA 2HR3A 1S76D 3ZMZA 2BOCC 1J95A 4FPPA 1QCEA 3FB6C 4QIWF 3JD3A 1G8MA 3IGAC 2Q67A 5IYCO 3I55V 1KC8W 2WLIA 2IJIA 3VBBA 3OEHG 3ZRWB 4JTDB 4FIPC 4JYCA 1QVGU 4UV9A 4MW3A 1KD1W 5H6QA 5L3BA 1OCRB 4G27B 2EINB 3K0DA 2Q6AA 3GWOA 1FXKA 3AG2C 1YIJV 1I5YA 3T4DA 1K33A 1WPXA 2UXXA 3AG3C 4R6ZA 3B77A 1QLEB 3K06A 5L3DA 1YJNV 2HVKC 4LP8A 1DF5A 4P2ZA 3ABKB 3F7YC 2WLLA 3CCEV 4F4LA 3AEIA 2IJHA 1VQ8V 3BY6A 1QR8A 1MABG 1ZWIC 2R9RB 3DGEA 1NH2D 4UVAA 5IY5C 2Y69C 3D3IA 1YSCA 3OUSA 5LHHA 4BAYA 3E8BA 3G4SV 1V55B 4TSFG 3RW0A 3ZIAG 4LC1A 3E83A 1SRYA 1LNQA 3HB3B 4P9PA 4JTAB 1I5XA 4BIZA 4I5SA 4WFFA 2R9IA 1BL8A 4WFHA 3ETDA 5L3CA 5B3SC 1GM7A 3P30A 1R73A 4X89A 1ROPA 2WLKA 3SPCA 1F4NA 2PI4A 1GKFA 1M90W 4PDVA 3B8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYC A;  3X2Q C;  1R3K C;  1OCR C;  2W0F C;  4GX1 A;  4MTO A;  3OR7 C;  2EIN C;  4G28 B;  3T4Z A;  4P9O A;  3ASN C;  2HFE C;  3LDD A;  3RVZ A;  1S5H C;  2Q69 A;  4QNH B;  2K1E A;  1QLE C;  2AHY A;  4PDL A;  4J9Z B;  4JTC B;  3FB8 C;  5E1A C;  4P30 A;  3E8H A;  4GX2 A;  1OCZ C;  3WG7 C;  3ABK C;  4RAI A;  4XDK A;  3SPH A;  3STZ C;  4R7C A;  4GX0 A;  4J9Y B;  3TET A;  4I9W A;  3TCU A;  3E89 A;  3F7V C;  2WLJ A;  2BOB C;  3ZJZ A;  2HVJ C;  4UUJ C;  4EKW A;  5EBM C;  2ITC C;  1KKD A;  4LBE C;  3SYA A;  3SYC A;  2WLN A;  1V54 C;  5J9P C;  2ZD9 A;  4XDL A;  4PDM A;  2OCC C;  1V55 C;  4MTG A;  1OCO C;  4H37 A;  3LDE A;  4PA6 A;  5CBH A;  4TWK A;  2Q68 A;  4WFE A;  3ZRS A;  5EC2 C;  3SYQ A;  4MVQ A;  4PA7 A;  2QKS A;  4KFM A;  2X6A A;  4QE9 A;  3FB7 C;  2DWE C;  4CBC A;  2X6B A;  3SYP A;  4MW8 A;  2JK5 C;  2X6C A;  2ZXW C;  3E86 A;  2HG5 C;  2DYR C;  3PJS K;  4X8A A;  4MVU A;  5CBF A;  4GX5 A;  5B1B C;  2BOC C;  4R50 A;  3SYO A;  1J95 A;  3FB6 C;  3KG2 A;  4MVM A;  4PDR A;  4MVS A;  3IGA C;  4LCU C;  1R3J C;  2DWD C;  2WLI B;  3ASO C;  2Q67 A;  2A0L A;  3UM7 A;  2WLI A;  2NLJ C;  3T2M A;  2EIJ C;  3E8F A;  4JTD B;  2YEV A;  3SPI A;  5BZB A;  4RUF A;  1XL6 A;  3OR6 C;  4MW3 A;  4PA9 A;  5EBW C;  1K4C C;  4G27 B;  3K0D A;  2Q6A A;  2WLM A;  3AG2 C;  4PDV A;  3T4D A;  1P7B A;  3AG3 C;  4OXS A;  4PA4 A;  4PA3 A;  4R6Z A;  4RUE A;  3VOU A;  3K06 A;  4MSW C;  4MTF A;  4X88 A;  2WLH A;  5B1A C;  3LDC A;  3RBZ A;  1G4Y B;  3AG4 C;  2HVK C;  3FB5 C;  3SPG A;  3R65 A;  1XL4 A;  2WLL B;  4LP8 A;  4XDJ A;  1R3L C;  4P2Z A;  4RO2 A;  4ZBM A;  3RVY A;  3F7Y C;  2WLL A;  3EFF K;  3K03 A;  4MVR A;  3BEH A;  2A79 B;  3IFX A;  4F4L A;  1M57 C;  2IH1 C;  2ITD C;  4DXW A;  4WFG A;  2IH3 C;  3UKM A;  3ABL C;  4MS2 A;  2EIK C;  3T1C A;  3SJQ C;  4H33 A;  3LUT B;  4HYO A;  1ZWI C;  2R9R B;  1ORQ C;  4QE7 A;  5EBL C;  5KUM A;  5CBG A;  2ATK C;  5KUK A;  2AHZ A;  2EIL C;  2QTO A;  1M56 C;  3OGC C;  5IY5 C;  2Y69 C;  3OUS A;  2KB1 A;  2DYS C;  4HZ3 A;  3E8B A;  2HJF C;  3LNM B;  4BW5 A;  3OUF A;  1R3I C;  4R8C A;  3RW0 A;  4MVO A;  3E83 A;  3F5W C;  3GB7 C;  1LNQ A;  5EK0 A;  3AG1 C;  4P9P A;  3ABM C;  4JTA B;  4MVZ A;  2A9H A;  2EIM C;  2P7T C;  4WFF A;  1BL8 A;  4WFH A;  1K4D C;  5B3S C;  5EC1 C;  3K08 A;  3E8G A;  4X89 A;  3STL C;  1JVM A;  2H8P C;  2WLK A;  3K0G A;  3SPC A;  3SPJ A;  3HPL C;  3K04 A;  1OCC C; 
#chains in the Genus database with same CATH topology
 1YXB A;  5LMU B;  2OIE A;  3CMA V;  2XND G;  2XTA A;  4WF9 V;  4J9Z B;  5E1A C;  4JI2 O;  2PYJ A;  4DV1 B;  1VQ7 V;  3FX7 A;  4L87 A;  3ZJZ A;  5H9C A;  1V54 C;  5J9P C;  4UB6 Z;  2F43 G;  4XDL A;  1AI5 A;  2Q68 A;  5KHG A;  5KA5 A;  2CH7 B;  2GDS A;  4PA7 A;  1AIL A;  4JZG A;  2Q4P A;  1EZJ A;  1H38 A;  4HBN A;  3E35 A;  4DR4 B;  1XIL A;  3RFR A;  3N2K B;  4FZ1 A;  5KLV H;  1MNG A;  1OCC B;  2QM4 A;  3HKB B;  4NTY A;  2UU9 O;  4TQD A;  1D5N A;  1OV9 A;  2UUC B;  2XAH A;  4X88 A;  3RBZ A;  5BMV A;  1G4Y B;  3FB5 C;  1KYO F;  2Y4U A;  1CP9 A;  3EFF K;  4MVR A;  1GMG A;  4HNA A;  4JI8 B;  1JOY A;  3A2F A;  2KB1 A;  4JI6 B;  3OUF A;  4CS2 A;  4MVO A;  4TV9 B;  4B3M B;  1VQ9 V;  3K08 A;  3WB1 A;  4J7K A;  2BTQ B;  1FFT B;  1JVM A;  2R70 A;  4NXM B;  1QLN A;  3KG2 A;  4DO2 A;  2YSU B;  3JYC A;  1X59 A;  1ZL8 A;  3JSN A;  4DV0 B;  3RVZ A;  2Q69 A;  1RM1 B;  4X65 O;  4FLU A;  3ZHV A;  2QSA A;  3ABK C;  4RAI A;  1XMO B;  3CJH A;  4X66 O;  3TGU H;  1Q3E A;  5L3E A;  3FKS G;  1PM9 A;  3OMI B;  3HKC A;  2HVJ C;  1BMF G;  5GON A;  4PI0 A;  2KQX A;  1NI8 A;  3A8T A;  3E22 B;  5KAI Z;  2EIL B;  5H2F Z;  2QKS A;  3AG7 A;  3UO3 A;  1SS3 A;  5CA0 A;  2LO1 A;  1ARO P;  4NXN O;  2DMX A;  2EZP A;  1M1K W;  4MVU A;  1IX9 A;  5LP6 A;  2ZNI A;  2V4D A;  2DWD C;  3ZN0 A;  5EYP B;  5IWA B;  1DGS A;  3E8F A;  4CH5 A;  4RUF A;  3OR6 C;  2B1I A;  1IBL B;  4DV2 B;  1EN6 A;  3RYH A;  4EFB A;  5LBQ A;  4PA4 A;  5BMV B;  1N32 B;  4LNU A;  1Q86 W;  1EM1 A;  2ZE7 A;  1Q6U A;  2XAG A;  3CP1 A;  1IXM A;  5J2T A;  4QPJ A;  3CPW U;  4HYO A;  2VQE O;  4N23 A;  5LMU O;  3H1L H;  5IJ9 A;  1IZ3 A;  3DC6 A;  4IL6 Z;  4BW5 A;  1OCO B;  4Z1M G;  1VAR A;  1BSM A;  4DV1 O;  2M7W A;  1AVM A;  4X64 B;  1RPR A;  4TQF A;  2C2A A;  1X4T A;  5KMG B;  2HLD G;  3A0R A;  1OCC C;  1ZL8 B;  5LYJ B;  2FKX A;  3CRA A;  3JAR A;  3M8A A;  4IIJ A;  1YJW V;  3JAT B;  2K1E A;  3KCY A;  3UCS C;  3VQX A;  2PGG A;  2F23 A;  4ZI7 A;  1W0J G;  1YCI A;  4E2L A;  5JH7 A;  3WFV A;  5CA1 A;  1YVW A;  3CJH B;  1CXZ B;  2LW1 A;  5IYD O;  2D2C B;  5JVD A;  4YJ2 A;  2PZS A;  1QBZ A;  4JV5 B;  3HKC B;  2HP8 A;  1B06 A;  1YHQ V;  3SJA C;  2BSK B;  5GON B;  3BHP A;  1KKD A;  1OHH G;  1Q81 W;  3RYC B;  4I0X A;  3K58 A;  4HAM A;  4TWK A;  5EC2 C;  3KKY A;  4ZOL A;  1BQ0 A;  1NT2 B;  4B08 A;  5CA0 B;  4O4I A;  2UUC O;  5IJ0 A;  4G2K A;  1Z2G A;  2JGU A;  5LP6 B;  5FLX N;  3L9D A;  4R50 A;  4QJF B;  1XNR B;  1YJ9 V;  5B3S B;  4JI8 O;  2E5L B;  5J2U A;  1RM1 C;  1THZ A;  2FYU H;  1NU1 H;  3ML0 A;  3RYH B;  3TXS A;  2WLM A;  2H94 A;  2F1M A;  4J41 A;  4OXS A;  3I56 V;  2R9A A;  3VOU A;  2YXY A;  3Q4H A;  4LNU B;  1HNZ B;  3LDC A;  4LF7 B;  4B3M O;  1XL4 A;  2ZDI C;  5J2T B;  4WFB V;  1SET A;  3UKM A;  4NXM O;  3A0H Z;  4JGS A;  4JYB A;  5IJ9 B;  3ZED A;  2EIL C;  3WB0 A;  5KHH A;  1QHT A;  4Z2W A;  4HZ3 A;  2OCH A;  1AR4 A;  2LW7 A;  1SC5 B;  1XMO O;  2ZE8 A;  2Z5U A;  4FMT A;  4KUM A;  3SPJ A;  2DJV A;  5BZB A;  2K9P A;  4E4E A;  1AJN A;  2W0F C;  4IIJ B;  2Q8V A;  4Q20 A;  2VWK A;  3JAR B;  3OR7 C;  1PL0 A;  3SDL A;  3T1H B;  3SJC C;  4ZI7 B;  4X1Y B;  4PDL A;  4FFK A;  3QG5 A;  3JD1 A;  4JI7 B;  1DTO A;  2QWQ B;  3RGB A;  1NR7 A;  4FLV A;  3GVM A;  4YJ2 B;  5JVD B;  4LF9 B;  4R7C A;  4DV5 O;  4GCZ A;  3U0Z A;  1VQ4 V;  3E89 A;  1GN2 A;  4JI1 B;  1EBO A;  1HWY A;  5C93 A;  3OEE G;  1IXB A;  4I0X B;  5IWA O;  4TUY A;  1J5E B;  5IDJ A;  1YIT V;  1OCO C;  3FYI B;  2EZO A;  1IBL O;  4DV2 O;  3JSL A;  4O4I B;  5IJ0 B;  1A32 A;  4DR1 B;  1Y76 A;  1N32 O;  2JK5 C;  1HR0 B;  1ZTE A;  1QCE A;  5LOV B;  3CX5 F;  5IYC O;  3I55 V;  5J2U B;  3WU2 Z;  1JMK C;  1EZV H;  3CXH F;  4JYC A;  4UV9 A;  3CRM A;  5H6Q A;  3SGI A;  2CTR A;  2CGO A;  5KX5 A;  3K5O A;  1YIJ V;  3Q4H B;  1WPX A;  4R6Z A;  2VQF B;  3B77 A;  5L3D A;  2L35 A;  2Q5Z A;  3KCX A;  4I50 A;  2G38 A;  4FM0 A;  1YJN V;  5BXZ A;  2HVK C;  2QWR B;  3P3N A;  5E79 Z;  4X64 O;  3CCE V;  4FLZ A;  4NYK A;  1QR8 A;  1MAB G;  2R9R B;  2PY5 A;  3LSU A;  1NH2 D;  1B3Q A;  4UVA A;  5JCO C;  2RQ6 A;  2Y69 C;  1YSC A;  5LHH A;  3E8B A;  3ZIA G;  4LC1 A;  2JGD A;  1SRY A;  5LP6 C;  4YY3 B;  3GWK C;  4BIZ A;  3ETD A;  5L3C A;  1M93 A;  5B3S C;  1GM7 A;  4JV5 O;  4X89 A;  3QVN A;  2WLK A;  2PF4 E;  3L70 H;  2PI4 A;  4DV4 B;  4PDV A;  4GYC B;  1JX9 A;  3OW2 U;  1SZX A;  2UXC B;  4NR1 A;  2HFE C;  5GW7 A;  1R6K A;  2EIJ B;  4WBN A;  1S0V A;  2PYL A;  4LFB B;  1AP6 A;  2FL4 A;  2ZM6 B;  1PPJ H;  3FAV A;  1YDX A;  4OPH A;  3CC7 V;  1E79 G;  2ZIN A;  2ITC C;  4O2A A;  1Y74 B;  4LBE C;  3UT5 B;  4TUY B;  2E5L O;  1NQT A;  1K92 A;  5CB4 A;  4DW0 A;  1LUV A;  1Y6X A;  1NVP D;  4D7S A;  1Y76 B;  1HNZ O;  1GK9 A;  4LF7 O;  3J80 N;  3PJS K;  1N8R W;  4GX5 A;  4MVM A;  2EIM B;  2NLJ C;  3JAK A;  2QEX V;  2KG7 A;  4B3T B;  2YUA A;  2X0L A;  5KX5 B;  3W7W A;  1AR5 A;  4I50 B;  4NB5 A;  1JA8 A;  4NTX A;  3HKE B;  4XDJ A;  1WLE A;  3RVY A;  3DXR A;  1VIB A;  3ZMT A;  2XAS A;  1JR9 A;  3IFX A;  2Y4T A;  1XHX A;  1XUQ A;  3K5L A;  2W6J G;  5KUM A;  3D36 A;  4DV6 B;  3T1H O;  1BS3 A;  1Q7Y W;  2EJR A;  3K59 A;  4JI7 O;  2JGD B;  1K5S A;  1KBH A;  2EJ7 A;  3F5W C;  3OMA B;  5LL6 Y;  3CXC U;  2QE7 G;  3AG1 C;  2UXD B;  4LF9 O;  2P7T C;  1ENV A;  4U7O A;  1SA0 A;  3K79 A;  4FM2 A;  4JI1 O;  1V9P A;  3K04 A;  1SQQ H;  3L73 H;  3UO2 A;  1J5E O;  5KAF Z;  4WBN B;  3BPZ A;  4PHZ A;  5IYB O;  4JAA A;  1FFX A;  4TT3 G;  2BCC H;  4DW1 A;  4JYY A;  1E1Q G;  1S77 D;  4ZKI A;  1WNS A;  4K8X A;  3K3W A;  4DR1 O;  2W6I G;  3RT3 C;  5LA6 A;  1HR0 O;  1M9N A;  1R6T A;  4O2A B;  3QNE A;  2DQ3 A;  2YIA A;  1O9H A;  1JJ2 U;  4PI2 A;  4DRX A;  3FFQ A;  1TA8 A;  1YTF B;  1D2D A;  3FB7 C;  2VQF O;  4MW8 A;  2CTQ A;  1S72 V;  4B3R B;  5EIB D;  1PNL A;  2Y48 A;  5TIS Z;  5BR8 O;  3CS5 A;  4LCU C;  1M5I A;  4CC5 A;  3JD0 A;  2WAM A;  2EIJ C;  2KG7 B;  3ABT A;  1WAZ A;  2YI8 A;  2YEV A;  2ILM A;  2A7W A;  2UXN A;  3O65 A;  1B6Q A;  3X2Q B;  4U3J A;  1U96 A;  3OTF A;  4LFA B;  3CC2 V;  4YY3 O;  3DXR B;  3PN1 A;  3VQW A;  2YXL A;  2A06 H;  5FNV B;  3H1K H;  4DXW A;  2HJD A;  4EEQ A;  3SJQ C;  5K1X A;  4DV4 O;  3ASO B;  2F95 B;  2WA3 A;  2UXC O;  2AZ2 A;  4TOI A;  2AZ0 A;  4K8Z A;  4TV8 B;  3TK1 A;  2ODM A;  4YJ3 A;  1WB7 A;  3G71 V;  4LFB O;  1FS0 G;  3L71 H;  1JJO A;  3BRC A;  4IHJ A;  2ZM6 O;  4ICG A;  2EIM C;  2PTM A;  5DN6 G;  5C8Y B;  1VQP V;  3ETG A;  3CCM V;  4K0K B;  2P90 A;  5EZY A;  2OWO A;  3JD4 A;  1AR1 B;  4O4L B;  1FFX B;  4Q6G A;  1F23 A;  3B09 A;  2YS8 A;  4O4H A;  4NTW A;  2Q73 A;  1WJZ A;  5BY1 A;  1MSD A;  4AIL C;  4EKW A;  1I94 B;  2Z0A A;  2XAJ A;  1WP8 A;  1XBL A;  3L72 H;  2ZIO A;  5LMN O;  4B3T O;  4GT1 A;  4UV8 A;  1T5E A;  2XOK G;  1WA8 A;  3D3Q A;  1URF A;  3D8C A;  1H2M A;  2JRI A;  2HG5 C;  2LGQ A;  4DR2 B;  4MVS A;  1R3J C;  2YEV B;  2KKW A;  1VQL V;  5FPR A;  4U3J B;  4DV6 O;  1SER A;  1Q43 A;  1PKX A;  3ZMS A;  1P49 A;  1P7B A;  1W2B U;  3OFN G;  2UXD O;  3OAA G;  1R3L C;  1K3E A;  4DV7 O;  3APO A;  2LJ2 A;  4UCS A;  1NTK H;  5CBG A;  1VQ5 V;  2RMK B;  1HNW B;  1RP3 B;  4YJ3 B;  3BAB A;  4UCV A;  2B5U A;  1I08 A;  2ADQ B;  3LSS A;  1F51 A;  3OM3 B;  2A9H A;  1SQF A;  1EFR G;  3P3P A;  2OYQ A;  5IYZ A;  2HEP A;  3CE2 A;  3ZRX A;  1H2N A;  4HNA B;  3B40 A;  1Z5W A;  3X2Q C;  4YHH B;  4GZR B;  2XAF A;  4B7E A;  2VS0 A;  3IJ4 A;  3ICX A;  5AG2 A;  1P84 F;  2VRZ A;  2RJZ A;  4B3R O;  2LGW A;  4GUN A;  3AG4 B;  3WB2 A;  4YXW G;  1PP9 H;  2Q0A A;  3CCV V;  2LFS A;  2WLN A;  4MTX A;  1VF6 C;  3SYQ A;  4MVQ A;  1PV0 A;  4I55 A;  4KFM A;  3JAS A;  3JCZ A;  4ABM A;  5F2V O;  2DYS B;  1W0K G;  2X6B A;  4ZIB A;  4LFA O;  4NKG B;  3E86 A;  5IT9 N;  3G67 A;  1Q6I A;  5B1O A;  1J95 A;  3FB6 C;  3JD3 A;  1G8M A;  3IGA C;  2QWO B;  2Q67 A;  4W4L A;  2E74 B;  4LH7 A;  1XHZ A;  3VBB A;  4DR4 O;  4MW3 A;  4AQY B;  1KD1 W;  3K0D A;  2H3O A;  2Q6A A;  1FXK A;  3JAL A;  4JI4 B;  1FJG B;  1K33 A;  2UXX A;  2QR4 A;  1SQG A;  3F7Y C;  2WLL A;  4CH4 A;  4DR7 B;  4IYI A;  2ZT9 B;  4EFE A;  4FM1 A;  4K0K O;  3CRQ A;  1I7F A;  5GTH Z;  3H1I H;  3HKD A;  3OUS A;  4BR6 A;  3G4S V;  1Q8I A;  4TSF G;  1FKA O;  4JI6 O;  1YF2 A;  4P9P A;  2F93 B;  5LXT A;  5IYZ B;  3T1Y B;  4WFH A;  3P30 A;  1ROP A;  2NR5 A;  2QGN A;  4FFB A;  1F4N A;  1M90 W;  1BT8 A;  4BW9 A;  3OT7 A;  5LHG A;  4JI5 B;  2YIB D;  4DV0 O;  1XRE A;  2RN9 A;  2Q0O C;  3CD6 V;  3THO A;  4GX0 A;  4J9Y B;  3TET A;  4GKK B;  1Y4M A;  4DR2 O;  4DUY B;  2GV9 A;  2E76 B;  1FD9 A;  1SQV H;  3ABL B;  3BVO A;  2UXB B;  2QM8 A;  2Y0I A;  3OGI B;  4I55 B;  5JH7 B;  1YI2 V;  1M56 B;  1VF5 B;  5KHJ A;  4QE9 A;  5CA1 B;  1VQO V;  1NBM G;  3FD9 A;  1VEW A;  5CBF A;  3ABM B;  2Q7H A;  3RYF A;  4KHP B;  1G1X B;  5L3F A;  4X1I A;  2FML A;  4NVP A;  5EBW C;  1P7G A;  1HNW O;  3CME V;  1FXK B;  3JAL B;  4ZOL B;  1Q82 W;  1TVK A;  1MOF A;  2ADP A;  4U3F H;  1WB8 A;  1E1R G;  5ITZ A;  1RSO A;  3H01 A;  1JQ0 A;  2HKO A;  2QKC A;  3AG4 C;  3H9V A;  2WLL B;  4UB8 Z;  1K9M W;  3WG7 B;  1FAF A;  2YIC A;  2ITD C;  2IH1 C;  4DR5 B;  4WFG A;  1QR9 A;  3T1C A;  2DQ0 A;  1H2K A;  5CA3 A;  4UVC A;  1HP8 A;  1VF7 A;  3HKD B;  4DR3 B;  1B04 A;  4YHH O;  4OPA A;  2DYS C;  2LFR A;  1H8H G;  1GM9 A;  3GB7 C;  3G80 A;  1F7Y A;  4I9Q A;  4UCR A;  1K4D C;  1WP7 A;  3E8G A;  4O4J A;  1HDJ A;  2JS3 A;  4FLX A;  1NH2 B;  3O9O A;  1S5L Z;  4L8J A;  3LDD A;  4JYA B;  4J7Z A;  4J10 A;  2AHY A;  3CCJ V;  2P06 A;  4P30 A;  3B4S A;  1NTZ H;  5A9G A;  4XDK A;  3STZ C;  1FXH A;  3U10 A;  2P4V A;  2ZCE A;  1I0H A;  2WLJ A;  1VQK V;  4I4T A;  1XNQ B;  3CCU V;  1M57 B;  1QQC A;  2EIK B;  2E75 B;  3IC7 A;  2OT5 A;  3IC9 A;  3LDE A;  4AQY O;  3C90 A;  4FLW A;  4PD4 F;  4JI4 O;  1FJG O;  2QTS A;  3K9S A;  5DM6 V;  1K34 A;  3K5N A;  2QJ1 A;  1CPY A;  2WSS G;  3RYF B;  1XNR O;  4DR7 O;  3CRR A;  1JFF A;  2IBZ H;  2AGA A;  3BAA A;  3ZHS A;  3JD2 A;  4PV1 B;  1TVK B;  1NVP B;  1RFY A;  3ASN B;  3B8M A;  4RUE A;  5ITZ B;  1RSO B;  3RN4 A;  2WLH A;  4JI0 B;  2P4K A;  4ZBM A;  1MMM A;  2CTP A;  3T1Y O;  3K03 A;  2A79 B;  1VP7 A;  3TXQ A;  3ABL C;  4MS2 A;  1DF4 A;  2HHH B;  3LUT B;  2F66 C;  4QE7 A;  2ATK C;  1WPB A;  1M56 C;  4JI5 O;  1ZLZ A;  5JQG A;  2OCC B;  3ZN1 A;  3G6B A;  4R8C A;  1AJP A;  4LF5 B;  2CK3 G;  1PNM A;  4UXN A;  4UVB A;  3ABM C;  4MVZ A;  3JAM N;  2N05 A;  4UCT A;  2KSD A;  4GKK O;  2ZXW B;  3UQ8 A;  4J11 A;  2YI9 A;  3J81 N;  4DUY O;  1SQB H;  1SZT A;  1K73 W;  1GTO A;  2IJK A;  2W0X A;  4GX1 A;  4FLY A;  5FL7 G;  4G28 B;  1TUE B;  3H1J H;  3APQ A;  2CH7 A;  1O9G A;  3WG7 C;  4X66 B;  3IAY A;  1LR1 A;  1UFI A;  4I9W A;  2QWN B;  1F4M A;  1UJW B;  2DOS A;  4I4T B;  2UUB B;  4LFC B;  5EBM C;  2A3Q A;  2YXH A;  5KHI A;  2ZD9 A;  3W7X A;  1P4R A;  3C3S A;  5CBH A;  2FTK A;  3HKB A;  3AK1 A;  4WFE A;  1R6N A;  3ZRS A;  1PNK A;  1Y67 A;  1ZAU A;  1H2L A;  5IY5 B;  4N21 A;  3SYP A;  2X6C A;  3FAV B;  2ETN A;  4F6R A;  4DK0 A;  2L6L A;  1DK1 A;  1S5J A;  4DR5 O;  1JFF B;  2GUZ A;  3CWB H;  3EVK A;  3ZRW A;  1BHA A;  2JIZ G;  1XL6 A;  2XHB A;  5CB4 B;  1N0J A;  1N33 B;  1K4C C;  2IU0 A;  2AXT Z;  1FYJ A;  4MTF A;  1GAX A;  1MZE A;  4DUZ B;  3R65 A;  4CS4 A;  4QGP A;  3W7T A;  3K5M A;  1OCZ B;  4RO2 A;  4BIO A;  4FLT A;  1IUR A;  5GTI Z;  1AP5 A;  4QPK A;  1M57 C;  1GM8 A;  2BTQ A;  1EN5 A;  2EIK C;  5KHK A;  3JAK B;  1MG1 A;  2JEX A;  1ORQ C;  3ZX6 A;  5EBL C;  1LUW A;  3OD4 A;  4CH6 A;  4JYA O;  5JQG B;  4ZHQ A;  2HJF C;  3ZRV A;  1NKD A;  1SQX H;  1YTF D;  2QWP B;  2WWW A;  5EK0 A;  3KZI Z;  2LQT A;  2GHY A;  1JPX A;  1QU7 A;  1VMG A;  2DYR B;  2IM9 A;  3K0G A;  1L1F A;  1KEC A;  2ZDI A;  4KXR A;  1K7D A;  1XNQ O;  4X20 A;  3OE7 G;  3BCC H;  4FJC C;  2ZQM A;  3ASN C;  2P5O A;  3E22 A;  5KA6 A;  4H44 B;  3W7S A;  3ABU A;  2M6Y A;  3SPH A;  3JAW A;  1G6U A;  1SA0 B;  1Q6H A;  2BOB C;  3M99 B;  3QO7 A;  3SYC A;  5EYP A;  4FZ0 A;  5JJE B;  4J7J A;  4PDM A;  2OCC C;  3CYO A;  2JEU A;  4IT5 A;  1N34 B;  1FXV A;  2V7Q G;  4OGQ B;  1NZ6 A;  4CBC A;  1WN7 A;  4KP4 A;  1M4U A;  1K97 A;  5LGT A;  2ZXW C;  2O57 A;  5LA6 B;  4JI0 O;  4F6R B;  4EB6 A;  3LSQ A;  5K1P A;  2BOC C;  4K35 A;  1SQP H;  4FPP A;  3L74 H;  4J80 A;  2VWJ A;  2UUA B;  2WLI A;  4LH6 A;  2HHH O;  2GUZ B;  3ZRW B;  1IBM B;  1QVG U;  1GN4 A;  2ZIM A;  5H5N A;  4DRX B;  1OCR B;  2EIN B;  3GWO A;  1I5Y A;  4JI3 B;  3T4D A;  4LF5 O;  1QLE B;  1OJH A;  4LP8 A;  2IJH A;  1GN3 A;  1YEW A;  5KMG A;  2MW2 B;  1ZWI C;  3QF7 A;  1N0N A;  4LF4 B;  2WA4 A;  5LYJ A;  5IY5 C;  3D3I A;  1XQ8 A;  4ZHQ B;  3JAT A;  3RWR D;  4X62 B;  4BAY A;  1V55 B;  4JZ2 A;  4F6E A;  3RW0 A;  1US6 A;  2BE3 A;  1BQZ A;  4JTA B;  5JJN B;  4OX9 B;  1I5X A;  4I5S A;  2R9I A;  1BL8 A;  1SF9 A;  4Z1V A;  4I7Z B;  2UUB O;  2BSK A;  4LFC O;  1GKF A;  4X20 B;  2DE0 X;  3RYC A;  2ZR3 A;  4DR6 B;  3LNN A;  2DW4 A;  5B1N A;  1IBK B;  1S5H C;  2JJ1 G;  1MSW D;  1XDC A;  4JTC B;  5EIB C;  5JCO A;  4PEL A;  1OCZ C;  4W4K A;  4DV5 B;  4IHJ B;  3OTO B;  1H8E G;  3JAW B;  1KP2 A;  3QO5 A;  1ZUQ A;  2RCV A;  1NTM H;  3BFR A;  3EXA A;  3BA9 A;  3OMN B;  5B1A B;  4LF8 B;  4JAU A;  2ZR2 A;  1OZ0 A;  1CEZ A;  1BZK A;  1YZB A;  4UUJ C;  3CEI A;  5EZY B;  4U7N A;  2OTJ V;  1PD3 A;  3ZHT A;  3B2E E;  4PA6 A;  1QVF U;  2YIB A;  1N33 O;  1VQM V;  3BA8 A;  2IW5 A;  4O4H B;  4EB6 B;  1S3J A;  2DYR C;  4DUZ O;  1BHB A;  1Q90 D;  3SYO A;  3MHH C;  2DN9 A;  2F4V B;  4B3S B;  3DC5 A;  3ZHR A;  2WLI B;  3ASO C;  3D36 C;  3ZCC A;  1DLB A;  3CHX A;  4DV3 B;  4PA9 A;  5DEC A;  5B5E Z;  4ASU G;  1WA8 B;  4AHC A;  4C7U A;  1Z5V A;  4XBF A;  1GO3 F;  1MA1 A;  5LHI A;  1XEQ A;  5B66 Z;  3QO8 A;  2IH3 C;  4AI8 A;  2CUG A;  1JCH A;  2GTS A;  1L8D A;  2AHZ A;  3S3W A;  2CE4 A;  2P6J A;  4X1Y A;  3CRC A;  3CC4 V;  1W59 A;  3ZHQ A;  2D3O W;  4X9Q A;  4BWA A;  4DK1 A;  4MT8 A;  1COW G;  4GKJ B;  5H6R A;  3STL C;  3A0B Z;  5B1B B;  4YIO A;  4X1K A;  5HFL A;  1AI6 A;  1R3K C;  1OCR C;  2EIN C;  3T4Z A;  1VQN V;  3H1H H;  3ZMU A;  1QLE C;  1N34 O;  5D5Q A;  2Y69 B;  3FB8 C;  1BGY H;  4RWU A;  1RPO A;  1Q5O A;  3N27 A;  3I5D A;  2CDY A;  4BIU A;  5LOV A;  4CZZ A;  2P67 A;  3MD0 A;  3SYA A;  2UUA O;  1Y66 A;  1I94 O;  3MHS C;  1TUB A;  4H13 B;  1AI7 A;  3NR7 A;  1IBM O;  1GH6 A;  1V55 C;  3U11 A;  4H37 A;  1KU9 A;  2B1G A;  4D7T A;  3SR2 C;  4D6T H;  2ZKO A;  4LWS A;  4JI3 O;  2DWE C;  3ETE A;  2YC0 A;  4KL1 A;  4X8A A;  1HNX B;  4RQF A;  3C3T A;  4JAV A;  1XMQ B;  1KMI Z;  2E3C A;  2XAQ A;  4JPR A;  2JVD A;  2QA4 V;  2N74 A;  3EHB B;  2A0L A;  5LGU A;  3T2M A;  5LGN A;  5L3G A;  3SPI A;  4GLX A;  1XI1 A;  4FVM A;  1HW7 A;  4LF4 O;  3MAQ A;  3VQY A;  1BCC H;  4X62 O;  4YIP A;  2P22 C;  3JAS B;  2MK3 A;  4PA3 A;  2Z3Y A;  5JJJ B;  3JCU Z;  5B1A C;  3SPG A;  2CGN A;  4PJ0 Z;  4OX9 O;  2QM7 A;  2ZE5 A;  1H2G A;  3BEH A;  1N36 B;  3DTU B;  1QNM A;  4H33 A;  4DR6 O;  1IBK O;  1ZX3 A;  2EUL A;  4LR3 A;  3DSQ A;  1PL4 A;  2QDO A;  3ETQ A;  3OTO O;  1K8A W;  3QTC A;  2GTA A;  5EC1 C;  3CCL V;  4LF8 O;  2H8P C;  4X1K B;  3RYI A;  1Y74 A;  3UT5 A;  1H2S B;  2RNB A;  4CH3 A;  2IJJ A;  1FPO A;  2CAZ C;  1IDS A;  4QNH B;  4WCE V;  1KUQ A;  3L75 H;  1KQS U;  4GX2 A;  2IU3 A;  2ARH A;  3AG2 B;  5LXT B;  3SJB C;  1NJI W;  4LF6 B;  3AG3 B;  3AG1 B;  2XUM A;  3CCR V;  3F7V C;  2ZE6 A;  2F4V O;  4B3S O;  1GRJ A;  4FK5 C;  4FFB B;  5JWP A;  1AJQ A;  1TUB B;  1MZF A;  4DV3 O;  1BE3 H;  2YDE A;  4MTG A;  2OTL V;  2NN4 A;  4LWS B;  4JI2 B;  4O2B A;  3P32 A;  4H0L B;  2XT9 A;  1AB3 A;  4UCU A;  3HKE A;  5FPO A;  5BR8 B;  3HR0 A;  5B1B C;  2QKA A;  4PDR A;  2Q9L A;  3UM7 A;  3W7U A;  2N04 A;  4J42 A;  4IYH A;  3E2E A;  3TJT A;  1EN4 A;  1UPG A;  4DYL A;  4MSW C;  4K3A A;  2JDI G;  2YID A;  5CN0 A;  2PI5 A;  3CCS V;  4GKJ O;  1D5A A;  3ZMV A;  2FB5 A;  4WFA V;  4JAS A;  4X1I B;  3CCQ V;  5KUK A;  2CTW A;  1KKC A;  2QTO A;  3OGC C;  2UU9 B;  1V54 B;  3LNM B;  1K5Q A;  1L0N H;  1R3I C;  3N2G A;  1N4C A;  5DED A;  2Y0P A;  2ZNJ A;  1L0L H;  2X7R B;  2RDC A;  3K57 A;  3RYI B;  3FYE B;  3HPL C;  2R72 A;  3AK2 A;  2LP7 A;  4MTO A;  2AW9 A;  3K9A A;  1AI4 A;  4P9O A;  5HFM A;  4UCO A;  3F5T A;  2GBO A;  2GSM B;  2WPD G;  1VQ6 V;  3E8H A;  1XOU A;  5A2Q N;  2Q7E A;  4CS3 A;  1SES A;  4RQE A;  1NS1 A;  3G6E V;  1GN6 A;  5CMU A;  1HNX O;  3TCU A;  2V1D A;  1XMQ O;  4O4J B;  4IGG A;  1KP3 A;  2JS5 A;  4A5U B;  3ZHU A;  3MDS A;  5LMN B;  1FXK C;  4JF3 A;  4X65 B;  2UXB O;  4O2B B;  2B9Z A;  2JJ2 G;  2X6A A;  2NNU A;  1IVS A;  1NR1 A;  3NXS A;  1S76 D;  2EBO A;  2HR3 A;  2BTO A;  3R66 A;  3ZS8 C;  3ZMZ A;  5FNV A;  4B7K A;  4QIW F;  1N36 O;  1KC8 W;  3CB2 A;  3J7A U;  2IJI A;  3OEH G;  4JTD B;  1U97 A;  4FIP C;  4KHP O;  2Q7G A;  3N2K A;  3CSX A;  2OIG A;  5L3B A;  2PUS A;  4TV8 A;  4G27 B;  3AG2 C;  1VF6 A;  3AG3 C;  1SKV A;  3K06 A;  4NXN B;  4CC6 A;  1KB9 F;  1DF5 A;  4P2Z A;  3VQV A;  3ABK B;  4DV7 B;  4F4L A;  5D5P A;  3AEI A;  5C8Y A;  3S3X A;  1VQ8 V;  3BY6 A;  3M7M X;  5IE9 A;  3DGE A;  4O4L A;  3AK3 A;  4DR3 O;  3ZBH A;  1TAE A;  3N2G B;  3E83 A;  1LNQ A;  3HB3 B;  4TV9 A;  4LF6 O;  1R1B A;  4WFF A;  1R73 A;  1TGO A;  2EX3 A;  3SPC A;  4UFZ A;  1ZSP A;  2VQE B;  3B8N A; 
#chains in the Genus database with same CATH homology
 1JX9 A;  2ZR3 A;  3OW2 U;  2DW4 A;  5LHG A;  2HFE C;  5B1N A;  5GW7 A;  3CMA V;  1R6K A;  1S5H C;  2EIJ B;  2XND G;  2JJ1 G;  1MSW D;  4WF9 V;  1S0V A;  4J9Z B;  4JTC B;  5E1A C;  4PEL A;  1OCZ C;  3CD6 V;  1VQ7 V;  1H8E G;  1KP2 A;  3QO5 A;  4GX0 A;  4J9Y B;  3TET A;  3OMN B;  5B1A B;  3CC7 V;  1Y4M A;  4L87 A;  3ZJZ A;  4JAU A;  2ZR2 A;  1OZ0 A;  1CEZ A;  1E79 G;  4UUJ C;  2ITC C;  5H9C A;  4LBE C;  4U7N A;  2OTJ V;  1V54 C;  1NQT A;  1PD3 A;  5J9P C;  3ABL B;  4XDL A;  2F43 G;  4PA6 A;  1QVF U;  1AI5 A;  1K92 A;  2Q68 A;  2QM8 A;  1VQM V;  1NVP D;  5KA5 A;  1YI2 V;  1M56 B;  4PA7 A;  4QE9 A;  2IW5 A;  1VQO V;  1NBM G;  1GK9 A;  1S3J A;  2DYR C;  1EZJ A;  3PJS K;  1N8R W;  1BHB A;  1H38 A;  5CBF A;  4GX5 A;  3SYO A;  3MHH C;  3ABM B;  4MVM A;  2EIM B;  2WLI B;  3ASO C;  3E35 A;  3ZCC A;  2NLJ C;  1DLB A;  2QEX V;  5L3F A;  4PA9 A;  1OCC B;  5EBW C;  4ASU G;  3CME V;  2X0L A;  1FXK B;  3W7W A;  1Q82 W;  1MOF A;  4XBF A;  2XAH A;  4X88 A;  1E1R G;  1GO3 F;  3H01 A;  3RBZ A;  1G4Y B;  1JQ0 A;  2HKO A;  3AG4 C;  3FB5 C;  5LHI A;  2WLL B;  4XDJ A;  1CP9 A;  1WLE A;  3RVY A;  3WG7 B;  1K9M W;  3ZMT A;  3EFF K;  2XAS A;  4MVR A;  3IFX A;  2ITD C;  2IH1 C;  3QO8 A;  4WFG A;  2IH3 C;  1GMG A;  1QR9 A;  3T1C A;  2DQ0 A;  5CA3 A;  2W6J G;  1JOY A;  1JCH A;  4UVC A;  5KUM A;  3D36 A;  2AHZ A;  2KB1 A;  2DYS C;  1Q7Y W;  2LFR A;  2EJR A;  2P6J A;  1H8H G;  3OUF A;  1K5S A;  4MVO A;  3CC4 V;  1GM9 A;  3OMA B;  3F5W C;  3GB7 C;  3CXC U;  2QE7 G;  3AG1 C;  2D3O W;  2P7T C;  1ENV A;  1K4D C;  1VQ9 V;  4MT8 A;  1COW G;  4U7O A;  5H6R A;  3K08 A;  3E8G A;  3K79 A;  3STL C;  1FFT B;  1JVM A;  1QLN A;  3KG2 A;  5B1B B;  3K04 A;  4DO2 A;  2YSU B;  5HFL A;  3JYC A;  1AI6 A;  1R3K C;  1OCR C;  1NH2 B;  2EIN C;  3T4Z A;  3LDD A;  3RVZ A;  2Q69 A;  1VQN V;  5IYB O;  3ZMU A;  1QLE C;  2AHY A;  1RM1 B;  3CCJ V;  2Y69 B;  3FB8 C;  4P30 A;  4TT3 G;  1S77 D;  1E1Q G;  4ZKI A;  3ABK C;  3K3W A;  4RAI A;  4XDK A;  3STZ C;  2W6I G;  1FXH A;  1RPO A;  5L3E A;  3FKS G;  1M9N A;  2WLJ A;  1VQK V;  4BIU A;  3OMI B;  2HVJ C;  4CZZ A;  1BMF G;  2P67 A;  3MD0 A;  3QNE A;  3SYA A;  2DQ3 A;  3CCU V;  1M57 B;  1Y66 A;  3MHS C;  1AI7 A;  2EIK B;  3IC7 A;  1V55 C;  4H37 A;  2OT5 A;  3LDE A;  2B1G A;  1JJ2 U;  2EIL B;  2QKS A;  1YTF B;  3FB7 C;  2DWE C;  1ARO P;  4MW8 A;  5DM6 V;  3ETE A;  1K34 A;  1S72 V;  2EZP A;  4X8A A;  1M1K W;  4MVU A;  4RQF A;  1PNL A;  2Y48 A;  1CPY A;  4JAV A;  2WSS G;  4JPR A;  2XAQ A;  2QA4 V;  4LCU C;  2DWD C;  3EHB B;  2A0L A;  5LGU A;  3JD0 A;  2WAM A;  3ZN0 A;  3T2M A;  5LGN A;  2EIJ C;  3ABT A;  3E8F A;  5L3G A;  2YEV A;  3SPI A;  4RUF A;  3JD2 A;  3OR6 C;  2UXN A;  2B1I A;  1B6Q A;  3X2Q B;  1NVP B;  3ASN B;  3B8M A;  2MK3 A;  4RUE A;  5LBQ A;  4PA4 A;  4PA3 A;  2Z3Y A;  3CC2 V;  2WLH A;  5B1A C;  1Q86 W;  3SPG A;  4ZBM A;  2QM7 A;  2XAG A;  3K03 A;  3BEH A;  1H2G A;  2A79 B;  1IXM A;  3CP1 A;  3DTU B;  4DXW A;  4QPJ A;  3CPW U;  3ABL C;  4MS2 A;  1DF4 A;  3SJQ C;  4H33 A;  3LUT B;  4HYO A;  3ASO B;  4QE7 A;  4N23 A;  2ATK C;  1M56 C;  3TK1 A;  2OCC B;  3ZN1 A;  4BW5 A;  1OCO B;  4R8C A;  1AJP A;  4Z1M G;  3G71 V;  2CK3 G;  1FS0 G;  1PNM A;  4UXN A;  4UVB A;  3ABM C;  4MVZ A;  1K8A W;  2M7W A;  2EIM C;  5DN6 G;  5EC1 C;  1RPR A;  2ZXW B;  3CCL V;  1VQP V;  2C2A A;  3ETG A;  2H8P C;  3CCM V;  2P90 A;  2HLD G;  1SZT A;  3A0R A;  1OCC C;  1GTO A;  1K73 W;  2IJK A;  4GX1 A;  2IJJ A;  5FL7 G;  4G28 B;  3JD4 A;  1AR1 B;  1TUE B;  4QNH B;  1YJW V;  4WCE V;  2K1E A;  1F23 A;  1W0J G;  4E2L A;  1KQS U;  3WFV A;  4GX2 A;  2IU3 A;  3WG7 C;  5IYD O;  3AG2 B;  1NJI W;  3AG3 B;  1QBZ A;  3AG1 B;  4I9W A;  3CCR V;  3F7V C;  1F4M A;  1UJW B;  1YHQ V;  4FK5 C;  4EKW A;  5EBM C;  1KKD A;  1AJQ A;  1OHH G;  1Q81 W;  2XAJ A;  2ZD9 A;  3W7X A;  1P4R A;  4MTG A;  4GT1 A;  5CBH A;  2FTK A;  4HAM A;  4TWK A;  4UV8 A;  1R6N A;  4WFE A;  5EC2 C;  2XOK G;  3ZRS A;  2OTL V;  1PNK A;  5IY5 B;  3P32 A;  4N21 A;  3SYP A;  4G2K A;  2X6C A;  2HG5 C;  5B1B C;  4R50 A;  4QJF B;  4PDR A;  4MVS A;  1YJ9 V;  1R3J C;  3UM7 A;  3W7U A;  5B3S B;  2YEV B;  3ZRW A;  1RM1 C;  1BHA A;  2JIZ G;  1VQL V;  1XL6 A;  1THZ A;  3E2E A;  3ML0 A;  1K4C C;  1SER A;  2WLM A;  2H94 A;  2IU0 A;  1PKX A;  3ZMS A;  1P7B A;  4OXS A;  3I56 V;  3VOU A;  4MSW C;  4MTF A;  2JDI G;  1W2B U;  3LDC A;  3OFN G;  3R65 A;  3W7T A;  1XL4 A;  3OAA G;  5CN0 A;  3CCS V;  1OCZ B;  2PI5 A;  1R3L C;  4RO2 A;  2ZDI C;  4QPK A;  4WFB V;  3ZMV A;  1M57 C;  1GM8 A;  1K3E A;  1SET A;  3UKM A;  2EIK C;  1MG1 A;  4JGS A;  4JYB A;  4WFA V;  2JEX A;  1ORQ C;  4JAS A;  3CCQ V;  5EBL C;  5CBG A;  1VQ5 V;  5KUK A;  2EIL C;  2QTO A;  3OGC C;  1V54 B;  4HZ3 A;  3LNM B;  1K5Q A;  2HJF C;  3ZRV A;  2B5U A;  1NKD A;  1R3I C;  1YTF D;  3LSS A;  2WWW A;  5EK0 A;  1F51 A;  3OM3 B;  2A9H A;  2X7R B;  1EFR G;  2GHY A;  1JPX A;  3ZRX A;  2Z5U A;  4FMT A;  4KUM A;  2DYR B;  3K0G A;  3SPJ A;  1L1F A;  3FYE B;  3HPL C;  5BZB A;  1KEC A;  2ZDI A;  1AJN A;  1K7D A;  3X2Q C;  2W0F C;  2LP7 A;  3OE7 G;  3OR7 C;  4MTO A;  4Q20 A;  1PL0 A;  1AI4 A;  2ZQM A;  3K9A A;  3ASN C;  4FJC C;  4P9O A;  5HFM A;  2XAF A;  4PDL A;  2GSM B;  3JD1 A;  1DTO A;  5KA6 A;  2WPD G;  1NR7 A;  1VQ6 V;  3E8H A;  3W7S A;  3ABU A;  3SPH A;  1SES A;  4RQE A;  4R7C A;  3G6E V;  4GCZ A;  5CMU A;  1VQ4 V;  3TCU A;  3E89 A;  2V1D A;  3AG4 B;  2BOB C;  1KP3 A;  1EBO A;  4YXW G;  3CCV V;  1HWY A;  3M99 B;  5C93 A;  3QO7 A;  2LFS A;  3OEE G;  3SYC A;  2WLN A;  5IDJ A;  1FXK C;  1YIT V;  4PDM A;  4MTX A;  2OCC C;  3CYO A;  2JEU A;  1OCO C;  3FYI B;  2EZO A;  4JF3 A;  1FXV A;  2V7Q G;  3SYQ A;  4MVQ A;  2JJ2 G;  3JCZ A;  4KFM A;  2X6A A;  2NNU A;  4CBC A;  2DYS B;  1W0K G;  2X6B A;  4KP4 A;  1K97 A;  2JK5 C;  3E86 A;  2ZXW C;  1NR1 A;  5LGT A;  3NXS A;  5B1O A;  3LSQ A;  2EBO A;  2HR3 A;  1S76 D;  3ZMZ A;  2BOC C;  1J95 A;  4FPP A;  1QCE A;  3FB6 C;  4QIW F;  3JD3 A;  1G8M A;  3IGA C;  2Q67 A;  5IYC O;  3I55 V;  1KC8 W;  2WLI A;  2IJI A;  3VBB A;  3OEH G;  3ZRW B;  4JTD B;  4FIP C;  4JYC A;  1QVG U;  4UV9 A;  4MW3 A;  1KD1 W;  5H6Q A;  5L3B A;  1OCR B;  4G27 B;  2EIN B;  3K0D A;  2Q6A A;  3GWO A;  1FXK A;  3AG2 C;  1YIJ V;  1I5Y A;  3T4D A;  1K33 A;  1WPX A;  2UXX A;  3AG3 C;  4R6Z A;  3B77 A;  1QLE B;  3K06 A;  5L3D A;  1YJN V;  2HVK C;  4LP8 A;  1DF5 A;  4P2Z A;  3ABK B;  3F7Y C;  2WLL A;  3CCE V;  4F4L A;  3AEI A;  2IJH A;  1VQ8 V;  3BY6 A;  1QR8 A;  1MAB G;  1ZWI C;  2R9R B;  3DGE A;  1NH2 D;  4UVA A;  5IY5 C;  2Y69 C;  3D3I A;  1YSC A;  3OUS A;  5LHH A;  4BAY A;  3E8B A;  3G4S V;  1V55 B;  4TSF G;  3RW0 A;  3ZIA G;  4LC1 A;  3E83 A;  1SRY A;  1LNQ A;  3HB3 B;  4P9P A;  4JTA B;  1I5X A;  4BIZ A;  4I5S A;  4WFF A;  2R9I A;  1BL8 A;  4WFH A;  3ETD A;  5L3C A;  5B3S C;  1GM7 A;  3P30 A;  1R73 A;  4X89 A;  1ROP A;  2WLK A;  3SPC A;  1F4N A;  2PI4 A;  1GKF A;  1M90 W;  4PDV A;  3B8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...