3R65A

Mthk channel pore e92q mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVQRLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crucial points within the pore as determinants of K+ channel conductance and gating
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Membrane protein
molecule keywords Calcium-gated potassium channel mthK
total genus 30
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3r65A00
4MVUA 2BOCC 3RBZA 5EC1C 3ZJZA 1V55C 4RAIA 5KUKA 2QKSA 4GX1A 2IH3C 4PDVA 4CBCA 4WFGA 3K03A 3SJQC 4EKWA 4PDRA 4PDLA 2A0LA 3K0GA 4F4LA 1R3LC 3RVYA 4I9WA 2KB1A 2YEVA 1V54C 2JK5C 3RVZA 3R65A 5CBHA 2HVJC 1G4YB 2Q69A 2X6CA 3T1CA 3OR6C 3F7YC 3SYCA 2HFEC 4MS2A 3JYCA 3OGCC 2EILC 2W0FC 4MVMA 2WLJA 1K4DC 3HPLC 4MVOA 3UM7A 3E8FA 3SPJA 5E1AC 1LNQA 3KG2A 4MW3A 2A79B 2A9HA 4UUJC 5KUMA 3LNMB 3E89A 1OCRC 4MVZA 1R3IC 4P9PA 1XL4A 3AG1C 2BOBC 3AG2C 2WLKA 3SPHA 4P2ZA 4PA3A 3T2MA 4MW8A 4GX0A 4WFFA 3ABKC 4P9OA 4WFEA 4OXSA 3PJSK 2ITCC 5B3SC 4HYOA 4HZ3A 3ASOC 1R3KC 4LCUC 4RUFA 3ABMC 4PA7A 4RO2A 3FB7C 5B1BC 3OUFA 5EC2C 1R3JC 4MSWC 2K1EA 3F7VC 3IGAC 4MTGA 4PA9A 3SPIA 4ZBMA 3X2QC 5EBLC 2X6AA 3TCUA 3BEHA 3FB6C 3WG7C 2WLLA 2WLHA 3SYOA 2DWEC 2ATKC 4MVQA 2EIKC 4PA4A 4J9YB 5EK0A 3E8BA 2Q6AA 3K04A 4QE9A 4R8CA 1OCOC 3EFFK 2Q67A 2R9RB 3OUSA 5J9PC 1P7BA 1M56C 3GB7C 4GX5A 3UKMA 4G28B 1ZWIC 3VOUA 5CBFA 2HJFC 2NLJC 4R50A 1QLEC 2ITDC 4QNHB 5CBGA 4XDJA 4KFMA 3F5WC 3FB5C 4WFHA 2H8PC 3AG3C 3ZRSA 2HVKC 4GX2A 4H33A 5B1AC 4LBEC 2ZD9A 4QE7A 3TETA 2IH1C 1S5HC 2ZXWC 3AG4C 3LUTB 4LP8A 2WLLB 5BZBA 4X8AA 4BW5A 4MVRA 3STZC 3FB8C 4P30A 5IY5C 1KKDA 4MTOA 3ABLC 3IFXA 2DYRC 3LDCA 2QTOA 4JTCB 2WLNA 1ORQC 4PA6A 3SPCA 4JTAB 4TWKA 3K06A 5EBMC 1J95A 3K0DA 3RW0A 2DWDC 2HG5C 2AHZA 3E83A 4X89A 5EBWC 4H37A 3K08A 3LDDA 2EIMC 3T4ZA 4MTFA 1JVMA 1OCZC 4MVSA 3E8HA 1M57C 3SYPA 4G27B 1XL6A 4R7CA 4XDKA 3E8GA 4RUEA 4JTDB 2EINC 4J9ZB 4X88A 3SYAA 2Q68A 2AHYA 2EIJC 2Y69C 4DXWA 3STLC 2WLIA 3LDEA 4XDLA 1BL8A 2P7TC 3SYQA 3T4DA 2WLIB 2WLMA 2X6BA 3ASNC 3E86A 4PDMA 1K4CC 4R6ZA 3SPGA 1OCCC 2DYSC 3OR7C 2OCCC
chains in the Genus database with same CATH superfamily
4MVUA 3RBZA 3UO3A 4EFBA 4GX1A 4FIPC 2CAZC 4TUYB 1SZTA 4UB6Z 2IJIA 3CS5A 1AI7A 4D6TH 3CWBH 3MDSA 1SQVH 4E4EA 2Q69A 1QCEA 3ETEA 4DV2O 4YJ3B 1F7YA 3GVMA 2B1IA 1N0JA 4DR6B 2JGDB 2JIZG 5FPOA 3PN1A 4Z1VA 4DW1A 5JJNB 1A32A 4LC1A 3T2MA 4YXWG 1VIBA 3AG3B 1GRJA 3JSNA 3ASOC 2ZE5A 4IHJA 1BGYH 3C3TA 3F7VC 1BSMA 5GONB 3FB6C 1NH2B 2ATKC 1M56B 2XUMA 3UO2A 3A2FA 1NVPB 5J9PC 1SQQH 1M56C 3WFVA 5IYCO 3EXAA 5KHIA 4FLXA 3VQXA 1SC5B 1UFIA 3R66A 1VQ7V 4JI1O 4KFMA 5LOVA 3TK1A 4H33A 4LNUA 4NTXA 5A2QN 4DW0A 3ZCCA 5IY5C 1AILA 4E2LA 4JF3A 1KBHA 1SETA 4I7ZB 3BCCH 3ZMUA 3K57A 3NR7A 4ZI7A 4NXNB 2CTPA 2KG7B 2VQEO 1AI4A 1NS1A 2JEXA 1YXBA 3I55V 1VQ4V 1N32B 4LF4O 1XNQB 5E79Z 4DK1A 1DGSA 5FNVA 2VQEB 3SPGA 1YJ9V 3D8CA 4DR7B 4PI2A 4PDVA 4X1YB 4OPAA 1W0JG 3K0GA 4X65O 5DN6G 4DR6O 2EULA 4GZRB 1PV0A 1VQ6V 5AG2A 5CBHA 1W0KG 2HVJC 1M1KW 1XMQO 2EILC 2W0FC 1ZL8B 4JAAA 1GK9A 3HPLC 1YSCA 2ZXWB 3SJBC 4DV6O 2YI8A 2LP7A 2R72A 3TGUH 4KL1A 3FFQA 1XMOO 1RP3B 4X1YA 1FS0G 1F4MA 1JMKC 4X1KB 3QO7A 2YSUB 3FB7C 3DXRA 4MTGA 1NZ6A 4PJ0Z 3SPIA 1H38A 2HP8A 4TV9B 2P6JA 4JYYA 4JI5O 2V7QG 1OCRB 3E22B 4UCSA 1I5YA 3UT5B 2IJKA 3GB7C 3QG5A 3ZHSA 3L72H 3HKEB 4I0XA 3CRCA 2DJVA 1AR1B 4RQEA 2XAHA 3GWOA 1IBKO 3BY6A 1O9HA 2OCCB 2UXDO 4AILC 1PNLA 3HKDB 1XUQA 4BW5A 1LUWA 3BRCA 3JAKB 3W7UA 1P84F 4O4JB 2H94A 3ZRWB 1K5SA 3I56V 4FVMA 1N32O 1M57B 2UXDB 4JI5B 3HKEA 4ZHQA 1SZXA 2EIJB 4LWSB 2Q73A 5KA6A 1JA8A 2PYJA 4I55A 2EIJC 4LNUB 2QR4A 3ASNC 3H1LH 1AB3A 5KUKA 4NVPA 1K92A 2UXXA 1H2LA 1TUBB 4LF7B 3SJQC 4F4LA 1FKAO 1Q86W 1K33A 5B1AB 1IZ3A 2KB1A 4BIUA 4O4HA 2QWQB 3OR6C 3F7YC 1NKDA 4FPPA 1US6A 4HNAA 5L3CA 1AP6A 5KUMA 1OCRC 4P9PA 4U3JB 3M7MX 4FLWA 3CCLV 2Q0OC 2UUCB 5L3EA 1MMMA 4J7ZA 3JCUZ 5EC2C 5LXTA 2YI9A 4HAMA 3IGAC 4ZBMA 2QSAA 3AG2B 5EYPB 2PI5A 3K58A 1H2NA 2EZPA 1WJZA 3P32A 1YTFD 2E3CA 1Y76A 1N33O 1L1FA 1QQCA 2QE7G 4JI8B 1KQSU 4F6EA 2E5LO 1HP8A 4BW9A 3LSQA 1BMFG 2L35A 3AG3C 1TVKA 1Y74B 3CC4V 2R9IA 1XHZA 5BXZA 4LP8A 2ZQMA 4DV0B 3IFXA 4JI4B 5EBWC 2EIMC 1GKFA 1AI5A 4MTFA 4DUZO 1AJQA 5KHHA 3ZBHA 4L8JA 4B3SO 3E2EA 2EINC 4QPJA 4J9ZB 1Q90D 1WN7A 2AGAA 2E74B 3B77A 2E5LB 3HKBA 1QNMA 2NN4A 1GN4A 1SQBH 3ZX6A 2WA4A 1YJWV 1P7GA 3BVOA 4PDLA 2G38A 5LHHA 5H2FZ 3DGEA 1P4RA 2CGOA 2JEUA 2EBOA 5J2TA 1J5EO 3QO8A 3SYCA 2EIKB 5IT9N 3JYCA 5IJ0A 1FD9A 1XDCA 5LGTA 1EN6A 3CX5F 1KP3A 3IC9A 2LFRA 4LF8B 3RYHA 2N74A 5L3GA 4NTYA 5LYJB 3AG1C 1M9NA 4WFFA 3VQYA 1BQ0A 4WFEA 2GBOA 2AZ2A 2ZE6A 1RPRA 4H0LB 4J7KA 1PPJH 1H2SB 2DQ0A 2WLLA 1JCHA 4YY3B 3JAMN 1TAEA 3CXCU 4WFBV 2Q67A 3D36C 1KYOF 5IY5B 5JWPA 5IDJA 3I5DA 1IBMB 5H6RA 1TUEB 1UPGA 4QE7A 1YF2A 3ETQA 4DR2O 2WLLB 3STZC 4O4LA 3FB8C 2IU0A 4EB6A 4K0KO 3ABLC 4LR3A 4IGGA 2ZM6O 2RQ6A 4TWKA 4K8XA 1SKVA 2DWDC 2HG5C 3W7TA 2LFSA 4JYBA 4FFBA 3THOA 5CMUA 1HNXB 5CA0A 4PHZA 3RGBA 2E76B 4X88A 1X59A 2F4VO 2WLIB 5H6QA 4HNAB 1M93A 3B4SA 4R6ZA 1CEZA 3FAVB 3G4SV 5BMVA 1WPXA 3CCMV 1YTFB 1S5LZ 4CZZA 2Y4TA 3R65A 1Y6XA 3CD6V 2BSKA 1N0NA 4CC6A 3BHPA 2R70A 4X62B 1OCZB 5CA3A 1K4DC 3CRQA 4IIJA 4YJ2B 2Q8VA 2ILMA 1MZFA 1I0HA 4WCEV 4UUJC 3L75H 4J41A 1IBLO 2F4VB 5ITZA 4BWAA 4BAYA 4D7TA 5EYPA 1R3KC 2YXHA 1Y66A 3APQA 5EBLC 2A7WA 2CH7A 5A9GA 5LHGA 2DWEC 2Q7EA 3CRRA 1R73A 3MAQA 1NR1A 4JI2B 1VQMV 4JAVA 4N23A 2R9RB 3SR2C 3SJCC 3VOUA 2XAFA 1GM8A 5FL7G 2YEVB 3MHHC 4J11A 1PL0A 1MABG 5CBGA 4B3TO 3RYIA 3OTOO 3QNEA 4FM0A 4JV5O 2P22C 4LF9O 3C90A 5EIBD 2X0LA 5CA1A 3Q4HB 1B04A 4JTCB 4JTAB 4TV8B 1I94B 1VF6C 3OD4A 5KHKA 2M7WA 3T4ZA 4B7EA 1W2BU 4W4LA 2WA3A 4RUEA 5J2UA 1B6QA 2AHYA 3N2GA 5KA5A 2Z3YA 4KXRA 1JFFA 3U10A 1KC8W 2UXBO 5IYZA 2W6IG 2HR3A 3G6BA 4H13B 1YJNV 5LGNA 2FYUH 1GN3A 4PDRA 5LYJA 4DRXA 1HW7A 2Q5ZA 3FYIB 3H01A 2W6JG 4DV1B 2Y0IA 1KU9A 1FJGO 5LP6B 2LW1A 5B3SB 3UM7A 3DC5A 2RN9A 4CS4A 1SERA 3CCQV 5IJ9A 5JQGA 3FAVA 2VWJA 1IXBA 2YICA 4MVZA 2BTOA 4NXNO 1VF5B 1WB7A 4NKGB 4O2BB 4PD4F 1XEQA 3M8AA 4OPHA 3QVNA 4JI1B 2KKWA 1EN4A 1PL4A 4LCUC 3JARA 5B1BB 4PA7A 4W4KA 1TUBA 1K34A 4IT5A 1JR9A 4MSWC 4OGQB 3TCUA 1WP7A 4ASUG 2XAGA 1H2GA 2CE4A 5BY1A 3ZRXA 4PA4A 1BZKA 3D36A 3SDLA 1CP9A 4QE9A 1HNZO 4R8CA 2GHYA 1EN5A 5FLXN 4G2KA 3EFFK 5TISZ 3OTOB 4GLXA 3BAAA 1QVFU 1GN6A 4WFAV 2UUAO 2HKOA 3ZEDA 1S76D 1Z5WA 4DR4B 1F51A 3RWRD 2YIBA 4JYAB 3WU2Z 2YIDA 3OMAB 4Q20A 2DYRC 1V55B 3DXRB 3SPCA 4LF8O 1YDXA 1EZVH 4X64B 5HFLA 3K0DA 2EX3A 3E83A 4H37A 3RYFA 3SYPA 1R6TA 4U3FH 2Q0AA 4XDKA 3CCEV 1PKXA 4UXNA 1GH6A 3ETGA 5KMGB 2OT5A 3ABMB 3STLC 4DK0A 3RN4A 3A0RA 1RFYA 2WLMA 3E86A 2AXTZ 1BHBA 4AQYB 1BE3H 3ZIAG 1FJGB 2QKSA 2CTRA 3ABLB 4WFGA 3K03A 5ITZB 2NNUA 1R3LC 4GT1A 4B3RO 1Q81W 3B8MA 4YJ2A 3UQ8A 3CC2V 5FPRA 1NTZH 4UV9A 1WB8A 1ZL8A 1NT2B 2Q4PA 3SPJA 5KX5A 4IHJB 3ZN1A 3A0HZ 2A79B 2UXCO 1XL4A 2PF4E 4L87A 4JGSA 4AQYO 3PJSK 1URFA 1RM1C 1SA0A 3X2QC 4TV9A 4LF6O 1VF6A 3WG7B 5J2TB 3CJHB 1FXKC 2PYLA 1XILA 2FTKA 3ICXA 4LFBB 1NI8A 4FZ0A 2A06H 5L3BA 2HJFC 1XI1A 1K8AW 4X66B 4I50B 2F43G 4TV8A 1S72V 4LFAO 3VQWA 1S77D 2WAMA 3AG4C 3LUTB 1Z2GA 4RQFA 3LNNA 3RT3C 1FFXA 5LXTB 2WLNA 2P90A 1ENVA 4F6RB 1PD3A 4WBNB 4DRXB 1K7DA 4DR3O 2JGUA 1QU7A 4LH7A 4RWUA 4AHCA 1MSWD 3CB2A 4DV3B 4K8ZA 3H1KH 1XQ8A 2UXNA 3AK1A 1L8DA 2DYSC 2OCCC 4DV0O 1YIJV 2ZDIC 1FXKA 1QVGU 4FZ1A 3GWKC 4KHPO 3AG7A 2OWOA 4O4LB 3TJTA 2PI4A 3H1HH 4DR5O 3TXSA 3FD9A 4B3TB 3G80A 2QA4V 4WF9V 1HNWB 3JATA 4UVBA 3JARB 3ZMZA 1DK1A 4FLTA 4CH5A 5IWAB 2QGNA 3K5LA 2BTQB 1B3QA 2KG7A 2B1GA 1XNRB 1NBMG 1YEWA 4H44B 4DV5O 2EINB 1SQGA 3OFNG 5LHIA 2FKXA 1Q5OA 1K3EA 4C7UA 5KX5B 2EILB 5DEDA 2UU9B 4YJ3A 1NH2D 3HKDA 5D5QA 1COWG 1SRYA 2UU9O 4UCTA 1VQLV 4LF5O 3OTFA 3OMNB 3OEHG 1AI6A 2QM8A 3JD0A 4DYLA 1TGOA 1TVKB 1Y74A 1RPOA 2ADPA 1H2KA 3CCSV 3K5MA 3JD1A 5EZYB 3N27A 5EBMC 1J95A 3B09A 3CSXA 3W7XA 1DF5A 2ZIMA 1N4CA 4DV4B 4LF4B 1F23A 2AW9A 2OIEA 1J5EB 4I4TA 4JZGA 4UVAA 3SYAA 3CCRV 2VRZA 4XDLA 2XOKG 1FFXB 5IYDO 4DR5B 2GDSA 5BR8B 2LO1A 3UT5A 2P67A 1NVPD 4O2BA 1H8EG 1UJWB 3CRMA 1JJ2U 3L71H 2X7RB 5B1OA 4JI0O 4O2AB 1KB9F 1WP8A 5LMNB 2EIMB 4GCZA 5GTHZ 3E8FA 3ZRWA 4DUYB 3LNMB 5LMNO 2WLKA 2YIBD 2EJRA 2UUBO 2P5OA 4HZ3A 3RYCA 4RUFA 4RO2A 4DUYO 1AROP 5C8YA 1E1RG 4DR2B 4K3AA 4Z1MG 1R6NA 3O65A 4JI6O 5CB4B 3B8NA 4LF5B 1ZSPA 2UXBB 1WAZA 4CS2A 3A0BZ 1XNQO 3ZRVA 4EEQA 5LMUO 1EZJA 4BR6A 2JJ2G 4X8AA 5LGUA 1KKDA 1IX9A 1H2MA 4JI2O 4UFZA 4UB8Z 3KKYA 2DN9A 5LBQA 3HKCA 2DOSA 1XL6A 3E22A 4R7CA 3E8GA 2YDEA 1FXKB 1Y4MA 1S3JA 4UCOA 1ZUQA 2R9AA 5DECA 4X62O 5CA0B 2RJZA 1VMGA 4CH3A 4JYAO 3LDEA 4LF9B 3ZHTA 5KAFZ 2QDOA 4QJFB 4TOIA 4QGPA 3J81N 5B66Z 1EM1A 1I94O 1NJIW 2BTQA 2A0LA 2Y0PA 3JAKA 1Q8IA 2NR5A 1GAXA 5LA6B 3RVZA 1G4YB 2JS5A 1FAFA 2IU3A 2ZE8A 1D2DA 2MK3A 4MVMA 1IXMA 4AI8A 2RCVA 3CCUV 2Z0AA 5JVDB 3QTCA 2UUCO 2E75B 1M90W 2XTAA 2ADQB 1E1QG 3AG2C 3DSQA 3CC7V 3AG1B 4UV8A 1VARA 4GKKO 3ZHVA 3OUFA 4DR4O 3ASOB 4ZIBA 3BEHA 3WG7C 3KCXA 2EIKC 3CPWU 2P4KA 3P3NA 5L3DA 3ETDA 2QKCA 1OCOC 5EIBC 4X20A 5HFMA 4DV6B 1WNSA 5CA1B 2GUZB 4XDJA 5B1AC 1JQ0A 1IDSA 1KMIZ 3S3WA 4DR1B 1Q43A 1G6UA 5LL6Y 3AK3A 2UXCB 2ZE7A 4GKJO 1Q6HA 2JGDA 3LSSA 4A5UB 3CJHA 2WSSG 1FYJA 1XNRO 1RSOB 4J7JA 1KUQA 4DXWA 3TXQA 1K5QA 1GN2A 2OYQA 2F95B 1JFFB 4RAIA 2QTSA 3C3SA 2IH3C 3UCSC 3JATB 3EHBB 3CRAA 4I9WA 3G71V 2UUAB 2V4DA 1PNMA 1Q7YW 2DMXA 4KP4A 3HR0A 3T1CA 3IJ4A 4JI3O 2PZSA 3RFRA 2EJ7A 5KAIZ 4D7SA 4LF6B 4FLUA 2DE0X 3IAYA 2WWWA 3KG2A 5IYBO 2F23A 3K5NA 2XHBA 3CMAV 4JAUA 4U3JA 1GM9A 4MW8A 3WB1A 1WA8B 2ITCC 4DV4O 5C93A 2ETNA 1R3JC 1DTOA 2QM4A 3J80N 1P49A 3D3QA 2Z5UA 1SQFA 3JSLA 3QF7A 1LUVA 4PI0A 5L3FA 5FNVB 2Q7GA 2P4VA 4JASA 4LWSA 3P30A 3AEIA 3OW2U 4IL6Z 2GSMB 2HEPA 1GTOA 5BMVB 5CBFA 4KHPB 4IIJB 4DV1O 1VQPV 3CCJV 1SQXH 2YUAA 4CH6A 1VQOV 1YHQV 4FLVA 3FB5C 2IH1C 3WB0A 4P30A 3L70H 5KLVH 2DYSB 3N2GB 1V54B 1I7FA 1M57C 1KP2A 4G27B 3JALB 2ZM6B 3E35A 1ZAUA 2HHHO 1G8MA 3DTUB 4NXMO 2P7TC 3M99B 2CH7B 1Z5VA 3T1HO 1OCCC 3VBBA 4NTWA 4ICGA 3CMEV 3ZJZA 1AVMA 3W7WA 5IWAO 4OX9O 2N05A 2P06A 1VQ5V 4Z2WA 3APOA 1I08A 3OGIB 3RVYA 3S3XA 1I5XA 1W59A 1CPYA 5JQGB 1BS3A 4TT3G 3X2QB 4YY3O 2HFEC 3NXSA 1Y76B 2PUSA 4DV7B 4JI7B 1N34O 1S5JA 3JAWB 4MW3A 2HHHB 2EZOA 2ARHA 3E89A 3O9OA 3FYEB 1JOYA 1SS3A 4X9QA 4GX0A 4YIOA 3ABKC 4UCRA 1ROPA 1SESA 2DW4A 4LH6A 2K1EA 2VS0A 2IBZH 2X6AA 1D5AA 2WLHA 3SYOA 1KD1W 4B7KA 1YCIA 1L0NH 1THZA 2YS8A 5IYZB 3B40A 4K35A 4CH4A 3OUSA 1VQKV 5D5PA 4GX5A 1QR9A 3UKMA 4U7OA 1WA8A 2VQFO 3K79A 2RDCA 2GV9A 4QNHB 1QLNA 1DF4A 2LGQA 3HKBB 2CTWA 3F5WC 2ZNJA 4X1IB 4UVCA 4JI8O 4JZ2A 1S5HC 4IYIA 4EB6B 1FFTB 3N2KB 4JI6B 1BHAA 3DC6A 2ZKOA 2QKAA 1M5IA 3ZMSA 2CK3G 3RW0A 3ZHQA 4NXMB 4X89A 4ZI7B 1WLEA 3QO5A 4WBNA 5LA6A 5CB4A 1OCOB 4JTDB 1E79G 2GTSA 3A8TA 4B08A 3ML0A 4DO2A 2WLIA 3T4DA 1BL8A 2XAQA 3ASNB 3D3IA 3T1YB 3JCZA 4PDMA 5GTIZ 4XBFA 3L9DA 1V55C 1VEWA 5K1PA 2QJ1A 4TQDA 4EKWA 4DV7O 2HLDG 3L74H 3OAAG 2ODMA 4CC5A 1T5EA 4DV5B 2JK5C 1NU1H 2X6CA 1XBLA 1PNKA 4MS2A 4NB5A 4ZOLB 4FJCC 4LFCO 2XASA 1HNXO 1G1XB 2D2CB 3W7SA 4FM1A 1R3IC 2OCHA 5F2VO 3OM3B 3RYFB 1IVSA 2JS3A 4GKJB 1N8RW 2IW5A 1YI2V 4FM2A 2FL4A 3H9VA 3K3WA 4PV1B 2B5UA 4J80A 2CUGA 2ZT9B 4PA9A 3CHXA 5KHJA 1X4TA 2YIAA 3JAWA 1ZTEA 4DR7O 5H5NA 1IBMO 2QWNB 2LQTA 1GO3F 4G28B 1F4NA 4X65B 1Q3EA 4K0KB 1QBZA 1QLEC 2ITDC 3JD3A 1BQZA 2A3QA 3JD4A 4F6RA 3K9SA 4PELA 1N36B 4TUYA 3ZRSA 2HVKC 2JJ1G 1FXHA 3U0ZA 1AR4A 2ZXWC 5JH7A 5JJJB 4MVRA 1MSDA 3JALA 1RSOA 3LDCA 1OJHA 4O4IB 5BR8O 5EZYA 1FPOA 1OV9A 1M4UA 1K73W 1XMOB 1K97A 1OZ0A 3LDDA 2OIGA 1JVMA 3SJAC 4MVSA 4FLYA 2Y69B 1VP7A 1U97A 4ZKIA 4I55B 3RYHB 3MHSC 2Y69C 2K9PA 2OTJV 4X20B 2D3OW 1BCCH 2X6BA 4ZHQB 1KKCA 1NQTA 3KCYA 4I50A 1VQ8V 2BOCC 4X1KA 3ABUA 4CBCA 2ZR3A 2FB5A 1CXZB 4YHHB 1Q82W 3MD0A 4LFCB 2Y48A 1V54C 4GKKB 1HDJA 1LR1A 2O57A 1VQNV 3OGCC 5LP6A 1L0LH 1NTMH 5DM6V 3AK2A 1WPBA 2PY5A 4B3RB 2ZCEA 5E1AC 3CXHF 3CYOA 2JVDA 5IJ9B 1MNGA 1SQPH 3OMIB 4LF7O 3ABTA 1FXVA 4FFBB 5IJ0B 4P9OA 2YXLA 3BA8A 4QIWF 4HYOA 2XAJA 1IBKB 1RM1B 1VQ9V 4I9QA 4Q6GA 2LW7A 4FMTA 1HWYA 2WPDG 4MVQA 4J9YB 3ZS8C 3E8BA 4UCUA 2RNBA 4OX9B 1ZWIC 3G67A 2NLJC 1ZLZA 4R50A 4FLZA 1V9PA 3CP1A 4I5SA 1HNZB 4JI0B 1D5NA 1XMQB 2XT9A 4DV2B 2Q9LA 4JI3B 4GX2A 1JJOA 3JASA 2KSDA 2ZD9A 3ABKB 3HKCB 5JCOC 5BZBA 1PP9H 2ZIOA 4O4HB 3K06A 1O9GA 5CN0A 3K08A 4IYHA 5B1NA 1Q6UA 2IJHA 4YIPA 4X64O 2Q68A 5B5EZ 1NTKH 3JASB 3CCVV 3SYQA 2GUZA 3OR7C 3CEIA 2YXYA 4KUMA 4O2AA 4NYKA 5EC1C 4ABMA 2F1MA 2Y4UA 2CGNA 2VQFB 5LMUB 2LJ2A 2YEVA 3CE2A 2QEXV 4QPKA 3IC7A 2QM7A 3RYIB 3OEEG 1JX9A 2Q7HA 2KQXA 1YZBA 2WLJA 3F5TA 1QHTA 1S0VA 4J42A 3BFRA 3EVKA 4I4TB 1VF7A 5C8YB 3WB2A 1N33B 4GYCB 1U96A 2BOBC 3SPHA 2CTQA 4P2ZA 1R6KA 3SGIA 4OXSA 2BCCH 3HB3B 5B3SC 4DUZB 3ZHUA 3ABMC 5B1BC 2L6LA 4B3SB 1EBOA 1TA8A 1AR5A 2FMLA 3G6EV 3B2EE 2CDYA 5JH7B 2H3OA 4DR1O 5GW7A 4B3MB 4N21A 2M6YA 5EK0A 3K04A 4O4IA 4X1IA 4JPRA 2PTMA 4GUNA 1GM7A 4NR1A 4UCVA 5J2UB 1QR8A 1BT8A 4B3MO 3N2KA 3LSUA 2YC0A 2N04A 2RMKB 3OT7A 4LFBO 3K5OA 2ZR2A 3TETA 2JRIA 2QWOB 1PM9A 4FFKA 1ZX3A 4X66O 4PA6A 2V1DA 1OCCB 2AHZA 2W0XA 1OCZC 2HJDA 3E8HA 3BA9A 1SF9A 5K1XA 4O4JA 3RYCB 4TQFA 2DYRB 1MOFA 2F93B 3U11A 5IE9A 3P3PA 1QLEB 5JJEB 1XREA 1JPXA 3JD2A 4HBNA 2F66C 2AZ0A 1MG1A 2B9ZA 1SA0B 4ZOLA 3VQVA 1IURA 1H8HG 3H1IH 5JVDA 2BSKB 3ZHRA 3H1JH 5LP6C 2ZDIA 3OE7G 5GONA 1MA1A 1B06A 4MVOA 4TSFG 3T1YO 3AG4B 1HR0B 1EFRG 1LNQA 2A9HA 4MT8A 4U7NA 1HNWO 4PA3A 4MTXA 2DQ3A 2JDIG 2IJJA 5JCOA 1AP5A 3ZMVA 5LOVB 3BPZA 1R1BA 3K59A 4J10A 4BIOA 4JYCA 2UUBB 1MZEA 2OTLV 2ZINA 1AJNA 2Q6AA 4LFAB 4JI4O 1YITV 1OHHG 3ZN0A 5KMGA 1KECA 1P7BA 4EFEA 3FX7A 1XOUA 1AJPA 3K9AA 1HR0O 3FKSG 4YHHO 2QWPB 1XHXA 4WFHA 1Q6IA 2H8PC 2LGWA 1YVWA 4LBEC 4FK5C 3L73H 4DR3B 3T1HB 5H9CA 4BIZA 4MTOA 4CS3A 2QTOA 1ORQC 2MW2B 4DV3O 2ZNIA 2C2AA 1IBLB 5KHGA 4I0XB 1NR7A 1Y67A 3ZMTA 1GMGA 3Q4HA 2XNDG 2VWKA 3BABA 3J7AU 4JI7O 1K9MW 3KZIZ 1N36O 1DLBA 2GTAA 2QWRB 2IM9A 4JV5B 1N34B 2PGGA 2BE3A 1K4CC
chains in the Genus database with same CATH topology
4MVUA 1CEZA 4XBFA 3RBZA 1V55C 4GX1A 4FIPC 3G4SV 1SZTA 4EKWA 2IJIA 2HLDG 1WPXA 1AI7A 2P67A 1NVPD 3OAAG 3CCMV 1H8EG 1YTFB 1UJWB 4CZZA 1JJ2U 2JK5C 2X7RB 3R65A 2Q69A 5B1OA 3CD6V 1QCEA 2X6CA 3ETEA 1PNKA 4MS2A 1OCZB 5CA3A 2B1IA 2EIMB 4GCZA 4FJCC 1K4DC 3E8FA 2XASA 2JIZG 4WCEV 3ZRWA 4UUJC 3LNMB 3W7SA 1R3IC 4LC1A 2WLKA 3T2MA 4BAYA 3OM3B 2EJRA 4YXWG 3AG3B 1N8RW 2IW5A 4HZ3A 3ASOC 1R3KC 1YI2V 4RUFA 4RO2A 3K3WA 1AROP 1Y66A 2B5UA 3F7VC 4PA9A 1E1RG 5EBLC 3FB6C 4Z1MG 1R6NA 1NH2B 5LHGA 2DWEC 2ATKC 1M56B 1R73A 3B8NA 1NR1A 1VQMV 4JAVA 4N23A 2R9RB 1NVPB 5J9PC 1M56C 1GO3F 4G28B 1F4NA 3WFVA 3VOUA 5IYCO 2XAFA 1GM8A 5FL7G 2YEVB 1QBZA 1QLEC 3MHHC 2ITDC 3ZRVA 1PL0A 1MABG 3JD3A 5CBGA 1VQ7V 3JD4A 4KFMA 4PELA 3ZRSA 1EZJA 2HVKC 2JJ1G 1FXHA 4H33A 3TK1A 3QNEA 2JJ2G 2ZXWC 4X8AA 3ZCCA 4MVRA 5LGUA 1KKDA 5IY5C 4E2LA 2X0LA 4JF3A 3LDCA 4JTCB 1SETA 4JTAB 3ZMUA 1K73W 1K97A 1OZ0A 3LDDA 5LBQA 2M7WA 3T4ZA 1JVMA 4MVSA 2Y69B 1W2BU 1XL6A 1AI4A 4R7CA 3E8GA 4RUEA 1FXKB 1Y4MA 4ZKIA 1S3JA 2JEXA 3I55V 3MHSC 1B6QA 2AHYA 2Y69C 2OTJV 1VQ4V 5KA5A 2D3OW 3LDEA 2Z3YA 2X6BA 1NQTA 3SPGA 1YJ9V 1KC8W 4QJFB 1VQ8V 2BOCC 3ABUA 2W6IG 4PDVA 2HR3A 4CBCA 2ZR3A 1YJNV 5LGNA 1NJIW 4PDRA 1W0JG 2A0LA 3K0GA 5DN6G 1Q82W 3MD0A 1VQ6V 3FYIB 2Y48A 1V54C 2W6JG 3H01A 3RVZA 5CBHA 1W0KG 2HVJC 1G4YB 1M1KW 1VQNV 2IU3A 3OGCC 2EILC 2W0FC 5DM6V 2MK3A 4MVMA 5B3SB 1IXMA 1GK9A 3HPLC 3UM7A 3CCUV 1YSCA 2ZXWB 1SERA 3CCQV 5E1AC 2LP7A 3CYOA 1M90W 3OMIB 4MVZA 1E1QG 3AG2C 3ABTA 1FXVA 1FS0G 3CC7V 4P9OA 3AG1B 1F4MA 4QIWF 4HYOA 2XAJA 4UV8A 3QO7A 4LCUC 2YSUB 5B1BB 4PA7A 1RM1B 3FB7C 3OUFA 1K34A 1VQ9V 3ASOB 4MSWC 4MTGA 3SPIA 4FMTA 1H38A 3TCUA 4ASUG 3BEHA 3WG7C 2P6JA 2XAGA 1H2GA 1HWYA 2WPDG 4MVQA 2EIKC 3ZRXA 2V7QG 1OCRB 4PA4A 3CPWU 3D36A 4J9YB 5L3DA 3ETDA 1CP9A 3E8BA 4QE9A 4R8CA 2GHYA 4G2KA 1OCOC 3EFFK 1I5YA 2IJKA 3GB7C 1ZWIC 1QVFU 5HFMA 2NLJC 4R50A 4WFAV 1AR1B 3CP1A 2XAHA 4RQEA 4I5SA 3GWOA 2HKOA 3BY6A 4XDJA 1S76D 1F51A 4GX2A 5B1AC 2ZD9A 3ABKB 2OCCB 1PNLA 1JQ0A 5BZBA 4BW5A 3W7UA 3OMAB 4Q20A 2DYRC 1V55B 3SPCA 2H94A 3K06A 5HFLA 3ZRWB 1K5SA 3K0DA 3I56V 3E83A 1M57B 5CN0A 4H37A 3K08A 3SYPA 2EIJB 3LSSA 4XDKA 3CCEV 2WSSG 5B1NA 1PKXA 5KA6A 4UXNA 2IJHA 3ETGA 2OT5A 2Q68A 3ABMB 2EIJC 4DXWA 3STLC 1K5QA 3CCVV 3SYQA 3A0RA 2WLMA 3E86A 3ASNC 1BHBA 3OR7C 5KUKA 3ZIAG 4KUMA 1K92A 5EC1C 2UXXA 4RAIA 2QKSA 2IH3C 3ABLB 4WFGA 3K03A 3SJQC 4F4LA 2NNUA 1R3LC 1Q86W 3EHBB 1K33A 4GT1A 4I9WA 5B1AB 1Q81W 2KB1A 4BIUA 2YEVA 3B8MA 3G71V 2QEXV 4QPKA 3IC7A 1PNMA 1Q7YW 3CC2V 2QM7A 4KP4A 3OEEG 3T1CA 3OR6C 3F7YC 1JX9A 1NKDA 4FPPA 4UV9A 2WLJA 5L3CA 3SPJA 2WWWA 3ZN1A 1S0VA 3KG2A 5IYBO 2A79B 3CMAV 5KUMA 1OCRC 4P9PA 4JAUA 1XL4A 2BOBC 3SPHA 4P2ZA 1GM9A 4MW8A 1R6KA 4JGSA 4L87A 4OXSA 3PJSK 2ITCC 3HB3B 5B3SC 3CCLV 5C93A 5L3EA 3ABMC 5B1BC 1RM1C 5EC2C 1R3JC 1DTOA 1EBOA 4HAMA 3IGAC 3G6EV 4ZBMA 2Z5UA 3X2QC 3AG2B 5GW7A 5L3FA 2PI5A 3WG7B 4N21A 5EK0A 4JASA 3K04A 2EZPA 1FXKC 3P30A 3AEIA 1GM7A 4JPRA 3P32A 1YTFD 2FTKA 3OW2U 2GSMB 1L1FA 1GTOA 2QE7G 5CBFA 1KQSU 5L3BA 2HJFC 1QR8A 1K8AW 1VQPV 3CCJV 3LSQA 2F43G 1VQOV 1BMFG 1YHQV 1S72V 3FB5C 3AG3C 3CC4V 2ZR2A 3TETA 2R9IA 2IH1C 1S77D 2WAMA 3AG4C 3LUTB 4LP8A 2ZQMA 4RQFA 4P30A 3IFXA 2WLNA 4PA6A 2V1DA 2P90A 1ENVA 2DYSB 1OCCB 1PD3A 2AHZA 5EBWC 1V54B 2EIMC 1GKFA 1K7DA 1AI5A 4MTFA 1OCZC 3E8HA 1M57C 1KP2A 4G27B 1AJQA 1MSWD 3E2EA 2EINC 2DYRB 3E35A 4J9ZB 4QPJA 1MOFA 1G8MA 3DTUB 2UXNA 1QLEB 2P7TC 3M99B 3B77A 1JPXA 1OCCC 2DYSC 2OCCC 3JD2A 3VBBA 1YIJV 3CMEV 2ZDIC 1FXKA 3ZJZA 1QVGU 1YJWV 3W7WA 1MG1A 4PDLA 5LHHA 1VQ5V 3RVYA 1I5XA 3DGEA 1CPYA 1P4RA 1H8HG 2JEUA 2EBOA 4TT3G 3X2QB 2PI4A 2ZDIA 3QO8A 3SYCA 3OE7G 2EIKB 2HFEC 3NXSA 2QA4V 3JYCA 4WF9V 5LGTA 4MVOA 4TSFG 1KP3A 4UVBA 3AG4B 2LFRA 3ZMZA 1EFRG 1LNQA 4MW3A 2A9HA 2EZOA 4MT8A 3E89A 5L3GA 3FYEB 4U7NA 1JOYA 3AG1C 1M9NA 4PA3A 4GX0A 4WFFA 3ABKC 4MTXA 4WFEA 2B1GA 2DQ3A 2JDIG 2IJJA 1ROPA 1NBMG 1SESA 1RPRA 2DW4A 3ZMVA 2EINB 2K1EA 3OFNG 5LHIA 2DQ0A 2X6AA 2WLLA 1JCHA 2WLHA 3SYOA 1KD1W 1K3EA 4JYCA 2OTLV 2EILB 1THZA 1AJNA 2Q6AA 3CXCU 4WFBV 2Q67A 1YITV 3OUSA 1OHHG 3ZN0A 1VQKV 1KECA 1P7BA 4GX5A 1QR9A 3UKMA 1NH2D 4U7OA 1COWG 1AJPA 5IY5B 3K9AA 3K79A 3FKSG 5IDJA 4QNHB 1QLNA 1DF4A 1SRYA 1VQLV 5H6RA 3F5WC 3OMNB 1TUEB 3OEHG 4WFHA 1AI6A 2H8PC 2QM8A 3JD0A 4UVCA 4LBEC 4QE7A 1S5HC 4FK5C 1RPOA 2WLLB 5H9CA 4BIZA 3STZC 1FFTB 3FB8C 3JD1A 2IU0A 3CCSV 4MTOA 3ABLC 1BHAA 2QTOA 1ORQC 4TWKA 3ZMSA 5EBMC 1J95A 2C2AA 2CK3G 3RW0A 2DWDC 2HG5C 4X89A 3W7XA 1DF5A 3W7TA 2LFSA 1WLEA 3QO5A 4JYBA 1F23A 1NR7A 1OCOB 3ZMTA 1GMGA 5CMUA 2XNDG 4JTDB 1E79G 4UVAA 4X88A 3SYAA 3CCRV 1K9MW 3ML0A 1DLBA 4DO2A 2WLIA 2XOKG 4XDLA 1BL8A 3T4DA 2XAQA 3ASNB 2WLIB 3D3IA 3JCZA 4R6ZA 5H6QA 4PDMA 1K4CC 5IYDO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVU A;  2BOC C;  3RBZ A;  5EC1 C;  3ZJZ A;  1V55 C;  4RAI A;  5KUK A;  2QKS A;  4GX1 A;  2IH3 C;  4PDV A;  4CBC A;  4WFG A;  3K03 A;  3SJQ C;  4EKW A;  4PDR A;  4PDL A;  2A0L A;  3K0G A;  4F4L A;  1R3L C;  3RVY A;  4I9W A;  2KB1 A;  2YEV A;  1V54 C;  2JK5 C;  3RVZ A;  3R65 A;  5CBH A;  2HVJ C;  1G4Y B;  2Q69 A;  2X6C A;  3T1C A;  3OR6 C;  3F7Y C;  3SYC A;  2HFE C;  4MS2 A;  3JYC A;  3OGC C;  2EIL C;  2W0F C;  4MVM A;  2WLJ A;  1K4D C;  3HPL C;  4MVO A;  3UM7 A;  3E8F A;  3SPJ A;  5E1A C;  1LNQ A;  3KG2 A;  4MW3 A;  2A79 B;  2A9H A;  4UUJ C;  5KUM A;  3LNM B;  3E89 A;  1OCR C;  4MVZ A;  1R3I C;  4P9P A;  1XL4 A;  3AG1 C;  2BOB C;  3AG2 C;  2WLK A;  3SPH A;  4P2Z A;  4PA3 A;  3T2M A;  4MW8 A;  4GX0 A;  4WFF A;  3ABK C;  4P9O A;  4WFE A;  4OXS A;  3PJS K;  2ITC C;  5B3S C;  4HYO A;  4HZ3 A;  3ASO C;  1R3K C;  4LCU C;  4RUF A;  3ABM C;  4PA7 A;  4RO2 A;  3FB7 C;  5B1B C;  3OUF A;  5EC2 C;  1R3J C;  4MSW C;  2K1E A;  3F7V C;  3IGA C;  4MTG A;  4PA9 A;  3SPI A;  4ZBM A;  3X2Q C;  5EBL C;  2X6A A;  3TCU A;  3BEH A;  3FB6 C;  3WG7 C;  2WLL A;  2WLH A;  3SYO A;  2DWE C;  2ATK C;  4MVQ A;  2EIK C;  4PA4 A;  4J9Y B;  5EK0 A;  3E8B A;  2Q6A A;  3K04 A;  4QE9 A;  4R8C A;  1OCO C;  3EFF K;  2Q67 A;  2R9R B;  3OUS A;  5J9P C;  1P7B A;  1M56 C;  3GB7 C;  4GX5 A;  3UKM A;  4G28 B;  1ZWI C;  3VOU A;  5CBF A;  2HJF C;  2NLJ C;  4R50 A;  1QLE C;  2ITD C;  4QNH B;  5CBG A;  4XDJ A;  4KFM A;  3F5W C;  3FB5 C;  4WFH A;  2H8P C;  3AG3 C;  3ZRS A;  2HVK C;  4GX2 A;  4H33 A;  5B1A C;  4LBE C;  2ZD9 A;  4QE7 A;  3TET A;  2IH1 C;  1S5H C;  2ZXW C;  3AG4 C;  3LUT B;  4LP8 A;  2WLL B;  5BZB A;  4X8A A;  4BW5 A;  4MVR A;  3STZ C;  3FB8 C;  4P30 A;  5IY5 C;  1KKD A;  4MTO A;  3ABL C;  3IFX A;  2DYR C;  3LDC A;  2QTO A;  4JTC B;  2WLN A;  1ORQ C;  4PA6 A;  3SPC A;  4JTA B;  4TWK A;  3K06 A;  5EBM C;  1J95 A;  3K0D A;  3RW0 A;  2DWD C;  2HG5 C;  2AHZ A;  3E83 A;  4X89 A;  5EBW C;  4H37 A;  3K08 A;  3LDD A;  2EIM C;  3T4Z A;  4MTF A;  1JVM A;  1OCZ C;  4MVS A;  3E8H A;  1M57 C;  3SYP A;  4G27 B;  1XL6 A;  4R7C A;  4XDK A;  3E8G A;  4RUE A;  4JTD B;  2EIN C;  4J9Z B;  4X88 A;  3SYA A;  2Q68 A;  2AHY A;  2EIJ C;  2Y69 C;  4DXW A;  3STL C;  2WLI A;  3LDE A;  4XDL A;  1BL8 A;  2P7T C;  3SYQ A;  3T4D A;  2WLI B;  2WLM A;  2X6B A;  3ASN C;  3E86 A;  4PDM A;  1K4C C;  4R6Z A;  3SPG A;  1OCC C;  2DYS C;  3OR7 C;  2OCC C; 
#chains in the Genus database with same CATH topology
 4MVU A;  3RBZ A;  3UO3 A;  4EFB A;  4GX1 A;  4FIP C;  2CAZ C;  4TUY B;  1SZT A;  4UB6 Z;  2IJI A;  3CS5 A;  1AI7 A;  4D6T H;  3CWB H;  3MDS A;  1SQV H;  4E4E A;  2Q69 A;  1QCE A;  3ETE A;  4DV2 O;  4YJ3 B;  1F7Y A;  3GVM A;  2B1I A;  1N0J A;  4DR6 B;  2JGD B;  2JIZ G;  5FPO A;  3PN1 A;  4Z1V A;  4DW1 A;  5JJN B;  1A32 A;  4LC1 A;  3T2M A;  4YXW G;  1VIB A;  3AG3 B;  1GRJ A;  3JSN A;  3ASO C;  2ZE5 A;  4IHJ A;  1BGY H;  3C3T A;  3F7V C;  1BSM A;  5GON B;  3FB6 C;  1NH2 B;  2ATK C;  1M56 B;  2XUM A;  3UO2 A;  3A2F A;  1NVP B;  5J9P C;  1SQQ H;  1M56 C;  3WFV A;  5IYC O;  3EXA A;  5KHI A;  4FLX A;  3VQX A;  1SC5 B;  1UFI A;  3R66 A;  1VQ7 V;  4JI1 O;  4KFM A;  5LOV A;  3TK1 A;  4H33 A;  4LNU A;  4NTX A;  5A2Q N;  4DW0 A;  3ZCC A;  5IY5 C;  1AIL A;  4E2L A;  4JF3 A;  1KBH A;  1SET A;  4I7Z B;  3BCC H;  3ZMU A;  3K57 A;  3NR7 A;  4ZI7 A;  4NXN B;  2CTP A;  2KG7 B;  2VQE O;  1AI4 A;  1NS1 A;  2JEX A;  1YXB A;  3I55 V;  1VQ4 V;  1N32 B;  4LF4 O;  1XNQ B;  5E79 Z;  4DK1 A;  1DGS A;  5FNV A;  2VQE B;  3SPG A;  1YJ9 V;  3D8C A;  4DR7 B;  4PI2 A;  4PDV A;  4X1Y B;  4OPA A;  1W0J G;  3K0G A;  4X65 O;  5DN6 G;  4DR6 O;  2EUL A;  4GZR B;  1PV0 A;  1VQ6 V;  5AG2 A;  5CBH A;  1W0K G;  2HVJ C;  1M1K W;  1XMQ O;  2EIL C;  2W0F C;  1ZL8 B;  4JAA A;  1GK9 A;  3HPL C;  1YSC A;  2ZXW B;  3SJB C;  4DV6 O;  2YI8 A;  2LP7 A;  2R72 A;  3TGU H;  4KL1 A;  3FFQ A;  1XMO O;  1RP3 B;  4X1Y A;  1FS0 G;  1F4M A;  1JMK C;  4X1K B;  3QO7 A;  2YSU B;  3FB7 C;  3DXR A;  4MTG A;  1NZ6 A;  4PJ0 Z;  3SPI A;  1H38 A;  2HP8 A;  4TV9 B;  2P6J A;  4JYY A;  4JI5 O;  2V7Q G;  1OCR B;  3E22 B;  4UCS A;  1I5Y A;  3UT5 B;  2IJK A;  3GB7 C;  3QG5 A;  3ZHS A;  3L72 H;  3HKE B;  4I0X A;  3CRC A;  2DJV A;  1AR1 B;  4RQE A;  2XAH A;  3GWO A;  1IBK O;  3BY6 A;  1O9H A;  2OCC B;  2UXD O;  4AIL C;  1PNL A;  3HKD B;  1XUQ A;  4BW5 A;  1LUW A;  3BRC A;  3JAK B;  3W7U A;  1P84 F;  4O4J B;  2H94 A;  3ZRW B;  1K5S A;  3I56 V;  4FVM A;  1N32 O;  1M57 B;  2UXD B;  4JI5 B;  3HKE A;  4ZHQ A;  1SZX A;  2EIJ B;  4LWS B;  2Q73 A;  5KA6 A;  1JA8 A;  2PYJ A;  4I55 A;  2EIJ C;  4LNU B;  2QR4 A;  3ASN C;  3H1L H;  1AB3 A;  5KUK A;  4NVP A;  1K92 A;  2UXX A;  1H2L A;  1TUB B;  4LF7 B;  3SJQ C;  4F4L A;  1FKA O;  1Q86 W;  1K33 A;  5B1A B;  1IZ3 A;  2KB1 A;  4BIU A;  4O4H A;  2QWQ B;  3OR6 C;  3F7Y C;  1NKD A;  4FPP A;  1US6 A;  4HNA A;  5L3C A;  1AP6 A;  5KUM A;  1OCR C;  4P9P A;  4U3J B;  3M7M X;  4FLW A;  3CCL V;  2Q0O C;  2UUC B;  5L3E A;  1MMM A;  4J7Z A;  3JCU Z;  5EC2 C;  5LXT A;  2YI9 A;  4HAM A;  3IGA C;  4ZBM A;  2QSA A;  3AG2 B;  5EYP B;  2PI5 A;  3K58 A;  1H2N A;  2EZP A;  1WJZ A;  3P32 A;  1YTF D;  2E3C A;  1Y76 A;  1N33 O;  1L1F A;  1QQC A;  2QE7 G;  4JI8 B;  1KQS U;  4F6E A;  2E5L O;  1HP8 A;  4BW9 A;  3LSQ A;  1BMF G;  2L35 A;  3AG3 C;  1TVK A;  1Y74 B;  3CC4 V;  2R9I A;  1XHZ A;  5BXZ A;  4LP8 A;  2ZQM A;  4DV0 B;  3IFX A;  4JI4 B;  5EBW C;  2EIM C;  1GKF A;  1AI5 A;  4MTF A;  4DUZ O;  1AJQ A;  5KHH A;  3ZBH A;  4L8J A;  4B3S O;  3E2E A;  2EIN C;  4QPJ A;  4J9Z B;  1Q90 D;  1WN7 A;  2AGA A;  2E74 B;  3B77 A;  2E5L B;  3HKB A;  1QNM A;  2NN4 A;  1GN4 A;  1SQB H;  3ZX6 A;  2WA4 A;  1YJW V;  1P7G A;  3BVO A;  4PDL A;  2G38 A;  5LHH A;  5H2F Z;  3DGE A;  1P4R A;  2CGO A;  2JEU A;  2EBO A;  5J2T A;  1J5E O;  3QO8 A;  3SYC A;  2EIK B;  5IT9 N;  3JYC A;  5IJ0 A;  1FD9 A;  1XDC A;  5LGT A;  1EN6 A;  3CX5 F;  1KP3 A;  3IC9 A;  2LFR A;  4LF8 B;  3RYH A;  2N74 A;  5L3G A;  4NTY A;  5LYJ B;  3AG1 C;  1M9N A;  4WFF A;  3VQY A;  1BQ0 A;  4WFE A;  2GBO A;  2AZ2 A;  2ZE6 A;  1RPR A;  4H0L B;  4J7K A;  1PPJ H;  1H2S B;  2DQ0 A;  2WLL A;  1JCH A;  4YY3 B;  3JAM N;  1TAE A;  3CXC U;  4WFB V;  2Q67 A;  3D36 C;  1KYO F;  5IY5 B;  5JWP A;  5IDJ A;  3I5D A;  1IBM B;  5H6R A;  1TUE B;  1UPG A;  4QE7 A;  1YF2 A;  3ETQ A;  4DR2 O;  2WLL B;  3STZ C;  4O4L A;  3FB8 C;  2IU0 A;  4EB6 A;  4K0K O;  3ABL C;  4LR3 A;  4IGG A;  2ZM6 O;  2RQ6 A;  4TWK A;  4K8X A;  1SKV A;  2DWD C;  2HG5 C;  3W7T A;  2LFS A;  4JYB A;  4FFB A;  3THO A;  5CMU A;  1HNX B;  5CA0 A;  4PHZ A;  3RGB A;  2E76 B;  4X88 A;  1X59 A;  2F4V O;  2WLI B;  5H6Q A;  4HNA B;  1M93 A;  3B4S A;  4R6Z A;  1CEZ A;  3FAV B;  3G4S V;  5BMV A;  1WPX A;  3CCM V;  1YTF B;  1S5L Z;  4CZZ A;  2Y4T A;  3R65 A;  1Y6X A;  3CD6 V;  2BSK A;  1N0N A;  4CC6 A;  3BHP A;  2R70 A;  4X62 B;  1OCZ B;  5CA3 A;  1K4D C;  3CRQ A;  4IIJ A;  4YJ2 B;  2Q8V A;  2ILM A;  1MZF A;  1I0H A;  4WCE V;  4UUJ C;  3L75 H;  4J41 A;  1IBL O;  2F4V B;  5ITZ A;  4BWA A;  4BAY A;  4D7T A;  5EYP A;  1R3K C;  2YXH A;  1Y66 A;  3APQ A;  5EBL C;  2A7W A;  2CH7 A;  5A9G A;  5LHG A;  2DWE C;  2Q7E A;  3CRR A;  1R73 A;  3MAQ A;  1NR1 A;  4JI2 B;  1VQM V;  4JAV A;  4N23 A;  2R9R B;  3SR2 C;  3SJC C;  3VOU A;  2XAF A;  1GM8 A;  5FL7 G;  2YEV B;  3MHH C;  4J11 A;  1PL0 A;  1MAB G;  5CBG A;  4B3T O;  3RYI A;  3OTO O;  3QNE A;  4FM0 A;  4JV5 O;  2P22 C;  4LF9 O;  3C90 A;  5EIB D;  2X0L A;  5CA1 A;  3Q4H B;  1B04 A;  4JTC B;  4JTA B;  4TV8 B;  1I94 B;  1VF6 C;  3OD4 A;  5KHK A;  2M7W A;  3T4Z A;  4B7E A;  1W2B U;  4W4L A;  2WA3 A;  4RUE A;  5J2U A;  1B6Q A;  2AHY A;  3N2G A;  5KA5 A;  2Z3Y A;  4KXR A;  1JFF A;  3U10 A;  1KC8 W;  2UXB O;  5IYZ A;  2W6I G;  2HR3 A;  3G6B A;  4H13 B;  1YJN V;  5LGN A;  2FYU H;  1GN3 A;  4PDR A;  5LYJ A;  4DRX A;  1HW7 A;  2Q5Z A;  3FYI B;  3H01 A;  2W6J G;  4DV1 B;  2Y0I A;  1KU9 A;  1FJG O;  5LP6 B;  2LW1 A;  5B3S B;  3UM7 A;  3DC5 A;  2RN9 A;  4CS4 A;  1SER A;  3CCQ V;  5IJ9 A;  5JQG A;  3FAV A;  2VWJ A;  1IXB A;  2YIC A;  4MVZ A;  2BTO A;  4NXN O;  1VF5 B;  1WB7 A;  4NKG B;  4O2B B;  4PD4 F;  1XEQ A;  3M8A A;  4OPH A;  3QVN A;  4JI1 B;  2KKW A;  1EN4 A;  1PL4 A;  4LCU C;  3JAR A;  5B1B B;  4PA7 A;  4W4K A;  1TUB A;  1K34 A;  4IT5 A;  1JR9 A;  4MSW C;  4OGQ B;  3TCU A;  1WP7 A;  4ASU G;  2XAG A;  1H2G A;  2CE4 A;  5BY1 A;  3ZRX A;  4PA4 A;  1BZK A;  3D36 A;  3SDL A;  1CP9 A;  4QE9 A;  1HNZ O;  4R8C A;  2GHY A;  1EN5 A;  5FLX N;  4G2K A;  3EFF K;  5TIS Z;  3OTO B;  4GLX A;  3BAA A;  1QVF U;  1GN6 A;  4WFA V;  2UUA O;  2HKO A;  3ZED A;  1S76 D;  1Z5W A;  4DR4 B;  1F51 A;  3RWR D;  2YIB A;  4JYA B;  3WU2 Z;  2YID A;  3OMA B;  4Q20 A;  2DYR C;  1V55 B;  3DXR B;  3SPC A;  4LF8 O;  1YDX A;  1EZV H;  4X64 B;  5HFL A;  3K0D A;  2EX3 A;  3E83 A;  4H37 A;  3RYF A;  3SYP A;  1R6T A;  4U3F H;  2Q0A A;  4XDK A;  3CCE V;  1PKX A;  4UXN A;  1GH6 A;  3ETG A;  5KMG B;  2OT5 A;  3ABM B;  3STL C;  4DK0 A;  3RN4 A;  3A0R A;  1RFY A;  2WLM A;  3E86 A;  2AXT Z;  1BHB A;  4AQY B;  1BE3 H;  3ZIA G;  1FJG B;  2QKS A;  2CTR A;  3ABL B;  4WFG A;  3K03 A;  5ITZ B;  2NNU A;  1R3L C;  4GT1 A;  4B3R O;  1Q81 W;  3B8M A;  4YJ2 A;  3UQ8 A;  3CC2 V;  5FPR A;  1NTZ H;  4UV9 A;  1WB8 A;  1ZL8 A;  1NT2 B;  2Q4P A;  3SPJ A;  5KX5 A;  4IHJ B;  3ZN1 A;  3A0H Z;  2A79 B;  2UXC O;  1XL4 A;  2PF4 E;  4L87 A;  4JGS A;  4AQY O;  3PJS K;  1URF A;  1RM1 C;  1SA0 A;  3X2Q C;  4TV9 A;  4LF6 O;  1VF6 A;  3WG7 B;  5J2T B;  3CJH B;  1FXK C;  2PYL A;  1XIL A;  2FTK A;  3ICX A;  4LFB B;  1NI8 A;  4FZ0 A;  2A06 H;  5L3B A;  2HJF C;  1XI1 A;  1K8A W;  4X66 B;  4I50 B;  2F43 G;  4TV8 A;  1S72 V;  4LFA O;  3VQW A;  1S77 D;  2WAM A;  3AG4 C;  3LUT B;  1Z2G A;  4RQF A;  3LNN A;  3RT3 C;  1FFX A;  5LXT B;  2WLN A;  2P90 A;  1ENV A;  4F6R B;  1PD3 A;  4WBN B;  4DRX B;  1K7D A;  4DR3 O;  2JGU A;  1QU7 A;  4LH7 A;  4RWU A;  4AHC A;  1MSW D;  3CB2 A;  4DV3 B;  4K8Z A;  3H1K H;  1XQ8 A;  2UXN A;  3AK1 A;  1L8D A;  2DYS C;  2OCC C;  4DV0 O;  1YIJ V;  2ZDI C;  1FXK A;  1QVG U;  4FZ1 A;  3GWK C;  4KHP O;  3AG7 A;  2OWO A;  4O4L B;  3TJT A;  2PI4 A;  3H1H H;  4DR5 O;  3TXS A;  3FD9 A;  4B3T B;  3G80 A;  2QA4 V;  4WF9 V;  1HNW B;  3JAT A;  4UVB A;  3JAR B;  3ZMZ A;  1DK1 A;  4FLT A;  4CH5 A;  5IWA B;  2QGN A;  3K5L A;  2BTQ B;  1B3Q A;  2KG7 A;  2B1G A;  1XNR B;  1NBM G;  1YEW A;  4H44 B;  4DV5 O;  2EIN B;  1SQG A;  3OFN G;  5LHI A;  2FKX A;  1Q5O A;  1K3E A;  4C7U A;  5KX5 B;  2EIL B;  5DED A;  2UU9 B;  4YJ3 A;  1NH2 D;  3HKD A;  5D5Q A;  1COW G;  1SRY A;  2UU9 O;  4UCT A;  1VQL V;  4LF5 O;  3OTF A;  3OMN B;  3OEH G;  1AI6 A;  2QM8 A;  3JD0 A;  4DYL A;  1TGO A;  1TVK B;  1Y74 A;  1RPO A;  2ADP A;  1H2K A;  3CCS V;  3K5M A;  3JD1 A;  5EZY B;  3N27 A;  5EBM C;  1J95 A;  3B09 A;  3CSX A;  3W7X A;  1DF5 A;  2ZIM A;  1N4C A;  4DV4 B;  4LF4 B;  1F23 A;  2AW9 A;  2OIE A;  1J5E B;  4I4T A;  4JZG A;  4UVA A;  3SYA A;  3CCR V;  2VRZ A;  4XDL A;  2XOK G;  1FFX B;  5IYD O;  4DR5 B;  2GDS A;  5BR8 B;  2LO1 A;  3UT5 A;  2P67 A;  1NVP D;  4O2B A;  1H8E G;  1UJW B;  3CRM A;  1JJ2 U;  3L71 H;  2X7R B;  5B1O A;  4JI0 O;  4O2A B;  1KB9 F;  1WP8 A;  5LMN B;  2EIM B;  4GCZ A;  5GTH Z;  3E8F A;  3ZRW A;  4DUY B;  3LNM B;  5LMN O;  2WLK A;  2YIB D;  2EJR A;  2UUB O;  2P5O A;  4HZ3 A;  3RYC A;  4RUF A;  4RO2 A;  4DUY O;  1ARO P;  5C8Y A;  1E1R G;  4DR2 B;  4K3A A;  4Z1M G;  1R6N A;  3O65 A;  4JI6 O;  5CB4 B;  3B8N A;  4LF5 B;  1ZSP A;  2UXB B;  1WAZ A;  4CS2 A;  3A0B Z;  1XNQ O;  3ZRV A;  4EEQ A;  5LMU O;  1EZJ A;  4BR6 A;  2JJ2 G;  4X8A A;  5LGU A;  1KKD A;  1IX9 A;  1H2M A;  4JI2 O;  4UFZ A;  4UB8 Z;  3KKY A;  2DN9 A;  5LBQ A;  3HKC A;  2DOS A;  1XL6 A;  3E22 A;  4R7C A;  3E8G A;  2YDE A;  1FXK B;  1Y4M A;  1S3J A;  4UCO A;  1ZUQ A;  2R9A A;  5DEC A;  4X62 O;  5CA0 B;  2RJZ A;  1VMG A;  4CH3 A;  4JYA O;  3LDE A;  4LF9 B;  3ZHT A;  5KAF Z;  2QDO A;  4QJF B;  4TOI A;  4QGP A;  3J81 N;  5B66 Z;  1EM1 A;  1I94 O;  1NJI W;  2BTQ A;  2A0L A;  2Y0P A;  3JAK A;  1Q8I A;  2NR5 A;  1GAX A;  5LA6 B;  3RVZ A;  1G4Y B;  2JS5 A;  1FAF A;  2IU3 A;  2ZE8 A;  1D2D A;  2MK3 A;  4MVM A;  1IXM A;  4AI8 A;  2RCV A;  3CCU V;  2Z0A A;  5JVD B;  3QTC A;  2UUC O;  2E75 B;  1M90 W;  2XTA A;  2ADQ B;  1E1Q G;  3AG2 C;  3DSQ A;  3CC7 V;  3AG1 B;  4UV8 A;  1VAR A;  4GKK O;  3ZHV A;  3OUF A;  4DR4 O;  3ASO B;  4ZIB A;  3BEH A;  3WG7 C;  3KCX A;  2EIK C;  3CPW U;  2P4K A;  3P3N A;  5L3D A;  3ETD A;  2QKC A;  1OCO C;  5EIB C;  4X20 A;  5HFM A;  4DV6 B;  1WNS A;  5CA1 B;  2GUZ B;  4XDJ A;  5B1A C;  1JQ0 A;  1IDS A;  1KMI Z;  3S3W A;  4DR1 B;  1Q43 A;  1G6U A;  5LL6 Y;  3AK3 A;  2UXC B;  2ZE7 A;  4GKJ O;  1Q6H A;  2JGD A;  3LSS A;  4A5U B;  3CJH A;  2WSS G;  1FYJ A;  1XNR O;  1RSO B;  4J7J A;  1KUQ A;  4DXW A;  3TXQ A;  1K5Q A;  1GN2 A;  2OYQ A;  2F95 B;  1JFF B;  4RAI A;  2QTS A;  3C3S A;  2IH3 C;  3UCS C;  3JAT B;  3EHB B;  3CRA A;  4I9W A;  3G71 V;  2UUA B;  2V4D A;  1PNM A;  1Q7Y W;  2DMX A;  4KP4 A;  3HR0 A;  3T1C A;  3IJ4 A;  4JI3 O;  2PZS A;  3RFR A;  2EJ7 A;  5KAI Z;  4D7S A;  4LF6 B;  4FLU A;  2DE0 X;  3IAY A;  2WWW A;  3KG2 A;  5IYB O;  2F23 A;  3K5N A;  2XHB A;  3CMA V;  4JAU A;  4U3J A;  1GM9 A;  4MW8 A;  3WB1 A;  1WA8 B;  2ITC C;  4DV4 O;  5C93 A;  2ETN A;  1R3J C;  1DTO A;  2QM4 A;  3J80 N;  1P49 A;  3D3Q A;  2Z5U A;  1SQF A;  3JSL A;  3QF7 A;  1LUV A;  4PI0 A;  5L3F A;  5FNV B;  2Q7G A;  2P4V A;  4JAS A;  4LWS A;  3P30 A;  3AEI A;  3OW2 U;  4IL6 Z;  2GSM B;  2HEP A;  1GTO A;  5BMV B;  5CBF A;  4KHP B;  4IIJ B;  4DV1 O;  1VQP V;  3CCJ V;  1SQX H;  2YUA A;  4CH6 A;  1VQO V;  1YHQ V;  4FLV A;  3FB5 C;  2IH1 C;  3WB0 A;  4P30 A;  3L70 H;  5KLV H;  2DYS B;  3N2G B;  1V54 B;  1I7F A;  1M57 C;  1KP2 A;  4G27 B;  3JAL B;  2ZM6 B;  3E35 A;  1ZAU A;  2HHH O;  1G8M A;  3DTU B;  4NXM O;  2P7T C;  3M99 B;  2CH7 B;  1Z5V A;  3T1H O;  1OCC C;  3VBB A;  4NTW A;  4ICG A;  3CME V;  3ZJZ A;  1AVM A;  3W7W A;  5IWA O;  4OX9 O;  2N05 A;  2P06 A;  1VQ5 V;  4Z2W A;  3APO A;  1I08 A;  3OGI B;  3RVY A;  3S3X A;  1I5X A;  1W59 A;  1CPY A;  5JQG B;  1BS3 A;  4TT3 G;  3X2Q B;  4YY3 O;  2HFE C;  3NXS A;  1Y76 B;  2PUS A;  4DV7 B;  4JI7 B;  1N34 O;  1S5J A;  3JAW B;  4MW3 A;  2HHH B;  2EZO A;  2ARH A;  3E89 A;  3O9O A;  3FYE B;  1JOY A;  1SS3 A;  4X9Q A;  4GX0 A;  4YIO A;  3ABK C;  4UCR A;  1ROP A;  1SES A;  2DW4 A;  4LH6 A;  2K1E A;  2VS0 A;  2IBZ H;  2X6A A;  1D5A A;  2WLH A;  3SYO A;  1KD1 W;  4B7K A;  1YCI A;  1L0N H;  1THZ A;  2YS8 A;  5IYZ B;  3B40 A;  4K35 A;  4CH4 A;  3OUS A;  1VQK V;  5D5P A;  4GX5 A;  1QR9 A;  3UKM A;  4U7O A;  1WA8 A;  2VQF O;  3K79 A;  2RDC A;  2GV9 A;  4QNH B;  1QLN A;  1DF4 A;  2LGQ A;  3HKB B;  2CTW A;  3F5W C;  2ZNJ A;  4X1I B;  4UVC A;  4JI8 O;  4JZ2 A;  1S5H C;  4IYI A;  4EB6 B;  1FFT B;  3N2K B;  4JI6 B;  1BHA A;  3DC6 A;  2ZKO A;  2QKA A;  1M5I A;  3ZMS A;  2CK3 G;  3RW0 A;  3ZHQ A;  4NXM B;  4X89 A;  4ZI7 B;  1WLE A;  3QO5 A;  4WBN A;  5LA6 A;  5CB4 A;  1OCO B;  4JTD B;  1E79 G;  2GTS A;  3A8T A;  4B08 A;  3ML0 A;  4DO2 A;  2WLI A;  3T4D A;  1BL8 A;  2XAQ A;  3ASN B;  3D3I A;  3T1Y B;  3JCZ A;  4PDM A;  5GTI Z;  4XBF A;  3L9D A;  1V55 C;  1VEW A;  5K1P A;  2QJ1 A;  4TQD A;  4EKW A;  4DV7 O;  2HLD G;  3L74 H;  3OAA G;  2ODM A;  4CC5 A;  1T5E A;  4DV5 B;  2JK5 C;  1NU1 H;  2X6C A;  1XBL A;  1PNK A;  4MS2 A;  4NB5 A;  4ZOL B;  4FJC C;  4LFC O;  2XAS A;  1HNX O;  1G1X B;  2D2C B;  3W7S A;  4FM1 A;  1R3I C;  2OCH A;  5F2V O;  3OM3 B;  3RYF B;  1IVS A;  2JS3 A;  4GKJ B;  1N8R W;  2IW5 A;  1YI2 V;  4FM2 A;  2FL4 A;  3H9V A;  3K3W A;  4PV1 B;  2B5U A;  4J80 A;  2CUG A;  2ZT9 B;  4PA9 A;  3CHX A;  5KHJ A;  1X4T A;  2YIA A;  3JAW A;  1ZTE A;  4DR7 O;  5H5N A;  1IBM O;  2QWN B;  2LQT A;  1GO3 F;  4G28 B;  1F4N A;  4X65 B;  1Q3E A;  4K0K B;  1QBZ A;  1QLE C;  2ITD C;  3JD3 A;  1BQZ A;  2A3Q A;  3JD4 A;  4F6R A;  3K9S A;  4PEL A;  1N36 B;  4TUY A;  3ZRS A;  2HVK C;  2JJ1 G;  1FXH A;  3U0Z A;  1AR4 A;  2ZXW C;  5JH7 A;  5JJJ B;  4MVR A;  1MSD A;  3JAL A;  1RSO A;  3LDC A;  1OJH A;  4O4I B;  5BR8 O;  5EZY A;  1FPO A;  1OV9 A;  1M4U A;  1K73 W;  1XMO B;  1K97 A;  1OZ0 A;  3LDD A;  2OIG A;  1JVM A;  3SJA C;  4MVS A;  4FLY A;  2Y69 B;  1VP7 A;  1U97 A;  4ZKI A;  4I55 B;  3RYH B;  3MHS C;  2Y69 C;  2K9P A;  2OTJ V;  4X20 B;  2D3O W;  1BCC H;  2X6B A;  4ZHQ B;  1KKC A;  1NQT A;  3KCY A;  4I50 A;  1VQ8 V;  2BOC C;  4X1K A;  3ABU A;  4CBC A;  2ZR3 A;  2FB5 A;  1CXZ B;  4YHH B;  1Q82 W;  3MD0 A;  4LFC B;  2Y48 A;  1V54 C;  4GKK B;  1HDJ A;  1LR1 A;  2O57 A;  1VQN V;  3OGC C;  5LP6 A;  1L0L H;  1NTM H;  5DM6 V;  3AK2 A;  1WPB A;  2PY5 A;  4B3R B;  2ZCE A;  5E1A C;  3CXH F;  3CYO A;  2JVD A;  5IJ9 B;  1MNG A;  1SQP H;  3OMI B;  4LF7 O;  3ABT A;  1FXV A;  4FFB B;  5IJ0 B;  4P9O A;  2YXL A;  3BA8 A;  4QIW F;  4HYO A;  2XAJ A;  1IBK B;  1RM1 B;  1VQ9 V;  4I9Q A;  4Q6G A;  2LW7 A;  4FMT A;  1HWY A;  2WPD G;  4MVQ A;  4J9Y B;  3ZS8 C;  3E8B A;  4UCU A;  2RNB A;  4OX9 B;  1ZWI C;  3G67 A;  2NLJ C;  1ZLZ A;  4R50 A;  4FLZ A;  1V9P A;  3CP1 A;  4I5S A;  1HNZ B;  4JI0 B;  1D5N A;  1XMQ B;  2XT9 A;  4DV2 B;  2Q9L A;  4JI3 B;  4GX2 A;  1JJO A;  3JAS A;  2KSD A;  2ZD9 A;  3ABK B;  3HKC B;  5JCO C;  5BZB A;  1PP9 H;  2ZIO A;  4O4H B;  3K06 A;  1O9G A;  5CN0 A;  3K08 A;  4IYH A;  5B1N A;  1Q6U A;  2IJH A;  4YIP A;  4X64 O;  2Q68 A;  5B5E Z;  1NTK H;  3JAS B;  3CCV V;  3SYQ A;  2GUZ A;  3OR7 C;  3CEI A;  2YXY A;  4KUM A;  4O2A A;  4NYK A;  5EC1 C;  4ABM A;  2F1M A;  2Y4U A;  2CGN A;  2VQF B;  5LMU B;  2LJ2 A;  2YEV A;  3CE2 A;  2QEX V;  4QPK A;  3IC7 A;  2QM7 A;  3RYI B;  3OEE G;  1JX9 A;  2Q7H A;  2KQX A;  1YZB A;  2WLJ A;  3F5T A;  1QHT A;  1S0V A;  4J42 A;  3BFR A;  3EVK A;  4I4T B;  1VF7 A;  5C8Y B;  3WB2 A;  1N33 B;  4GYC B;  1U96 A;  2BOB C;  3SPH A;  2CTQ A;  4P2Z A;  1R6K A;  3SGI A;  4OXS A;  2BCC H;  3HB3 B;  5B3S C;  4DUZ B;  3ZHU A;  3ABM C;  5B1B C;  2L6L A;  4B3S B;  1EBO A;  1TA8 A;  1AR5 A;  2FML A;  3G6E V;  3B2E E;  2CDY A;  5JH7 B;  2H3O A;  4DR1 O;  5GW7 A;  4B3M B;  4N21 A;  2M6Y A;  5EK0 A;  3K04 A;  4O4I A;  4X1I A;  4JPR A;  2PTM A;  4GUN A;  1GM7 A;  4NR1 A;  4UCV A;  5J2U B;  1QR8 A;  1BT8 A;  4B3M O;  3N2K A;  3LSU A;  2YC0 A;  2N04 A;  2RMK B;  3OT7 A;  4LFB O;  3K5O A;  2ZR2 A;  3TET A;  2JRI A;  2QWO B;  1PM9 A;  4FFK A;  1ZX3 A;  4X66 O;  4PA6 A;  2V1D A;  1OCC B;  2AHZ A;  2W0X A;  1OCZ C;  2HJD A;  3E8H A;  3BA9 A;  1SF9 A;  5K1X A;  4O4J A;  3RYC B;  4TQF A;  2DYR B;  1MOF A;  2F93 B;  3U11 A;  5IE9 A;  3P3P A;  1QLE B;  5JJE B;  1XRE A;  1JPX A;  3JD2 A;  4HBN A;  2F66 C;  2AZ0 A;  1MG1 A;  2B9Z A;  1SA0 B;  4ZOL A;  3VQV A;  1IUR A;  1H8H G;  3H1I H;  5JVD A;  2BSK B;  3ZHR A;  3H1J H;  5LP6 C;  2ZDI A;  3OE7 G;  5GON A;  1MA1 A;  1B06 A;  4MVO A;  4TSF G;  3T1Y O;  3AG4 B;  1HR0 B;  1EFR G;  1LNQ A;  2A9H A;  4MT8 A;  4U7N A;  1HNW O;  4PA3 A;  4MTX A;  2DQ3 A;  2JDI G;  2IJJ A;  5JCO A;  1AP5 A;  3ZMV A;  5LOV B;  3BPZ A;  1R1B A;  3K59 A;  4J10 A;  4BIO A;  4JYC A;  2UUB B;  1MZE A;  2OTL V;  2ZIN A;  1AJN A;  2Q6A A;  4LFA B;  4JI4 O;  1YIT V;  1OHH G;  3ZN0 A;  5KMG A;  1KEC A;  1P7B A;  4EFE A;  3FX7 A;  1XOU A;  1AJP A;  3K9A A;  1HR0 O;  3FKS G;  4YHH O;  2QWP B;  1XHX A;  4WFH A;  1Q6I A;  2H8P C;  2LGW A;  1YVW A;  4LBE C;  4FK5 C;  3L73 H;  4DR3 B;  3T1H B;  5H9C A;  4BIZ A;  4MTO A;  4CS3 A;  2QTO A;  1ORQ C;  2MW2 B;  4DV3 O;  2ZNI A;  2C2A A;  1IBL B;  5KHG A;  4I0X B;  1NR7 A;  1Y67 A;  3ZMT A;  1GMG A;  3Q4H A;  2XND G;  2VWK A;  3BAB A;  3J7A U;  4JI7 O;  1K9M W;  3KZI Z;  1N36 O;  1DLB A;  2GTA A;  2QWR B;  2IM9 A;  4JV5 B;  1N34 B;  2PGG A;  2BE3 A;  1K4C C; 
#chains in the Genus database with same CATH homology
 4MVU A;  1CEZ A;  4XBF A;  3RBZ A;  1V55 C;  4GX1 A;  4FIP C;  3G4S V;  1SZT A;  4EKW A;  2IJI A;  2HLD G;  1WPX A;  1AI7 A;  2P67 A;  1NVP D;  3OAA G;  3CCM V;  1H8E G;  1YTF B;  1UJW B;  4CZZ A;  1JJ2 U;  2JK5 C;  2X7R B;  3R65 A;  2Q69 A;  5B1O A;  3CD6 V;  1QCE A;  2X6C A;  3ETE A;  1PNK A;  4MS2 A;  1OCZ B;  5CA3 A;  2B1I A;  2EIM B;  4GCZ A;  4FJC C;  1K4D C;  3E8F A;  2XAS A;  2JIZ G;  4WCE V;  3ZRW A;  4UUJ C;  3LNM B;  3W7S A;  1R3I C;  4LC1 A;  2WLK A;  3T2M A;  4BAY A;  3OM3 B;  2EJR A;  4YXW G;  3AG3 B;  1N8R W;  2IW5 A;  4HZ3 A;  3ASO C;  1R3K C;  1YI2 V;  4RUF A;  4RO2 A;  3K3W A;  1ARO P;  1Y66 A;  2B5U A;  3F7V C;  4PA9 A;  1E1R G;  5EBL C;  3FB6 C;  4Z1M G;  1R6N A;  1NH2 B;  5LHG A;  2DWE C;  2ATK C;  1M56 B;  1R73 A;  3B8N A;  1NR1 A;  1VQM V;  4JAV A;  4N23 A;  2R9R B;  1NVP B;  5J9P C;  1M56 C;  1GO3 F;  4G28 B;  1F4N A;  3WFV A;  3VOU A;  5IYC O;  2XAF A;  1GM8 A;  5FL7 G;  2YEV B;  1QBZ A;  1QLE C;  3MHH C;  2ITD C;  3ZRV A;  1PL0 A;  1MAB G;  3JD3 A;  5CBG A;  1VQ7 V;  3JD4 A;  4KFM A;  4PEL A;  3ZRS A;  1EZJ A;  2HVK C;  2JJ1 G;  1FXH A;  4H33 A;  3TK1 A;  3QNE A;  2JJ2 G;  2ZXW C;  4X8A A;  3ZCC A;  4MVR A;  5LGU A;  1KKD A;  5IY5 C;  4E2L A;  2X0L A;  4JF3 A;  3LDC A;  4JTC B;  1SET A;  4JTA B;  3ZMU A;  1K73 W;  1K97 A;  1OZ0 A;  3LDD A;  5LBQ A;  2M7W A;  3T4Z A;  1JVM A;  4MVS A;  2Y69 B;  1W2B U;  1XL6 A;  1AI4 A;  4R7C A;  3E8G A;  4RUE A;  1FXK B;  1Y4M A;  4ZKI A;  1S3J A;  2JEX A;  3I55 V;  3MHS C;  1B6Q A;  2AHY A;  2Y69 C;  2OTJ V;  1VQ4 V;  5KA5 A;  2D3O W;  3LDE A;  2Z3Y A;  2X6B A;  1NQT A;  3SPG A;  1YJ9 V;  1KC8 W;  4QJF B;  1VQ8 V;  2BOC C;  3ABU A;  2W6I G;  4PDV A;  2HR3 A;  4CBC A;  2ZR3 A;  1YJN V;  5LGN A;  1NJI W;  4PDR A;  1W0J G;  2A0L A;  3K0G A;  5DN6 G;  1Q82 W;  3MD0 A;  1VQ6 V;  3FYI B;  2Y48 A;  1V54 C;  2W6J G;  3H01 A;  3RVZ A;  5CBH A;  1W0K G;  2HVJ C;  1G4Y B;  1M1K W;  1VQN V;  2IU3 A;  3OGC C;  2EIL C;  2W0F C;  5DM6 V;  2MK3 A;  4MVM A;  5B3S B;  1IXM A;  1GK9 A;  3HPL C;  3UM7 A;  3CCU V;  1YSC A;  2ZXW B;  1SER A;  3CCQ V;  5E1A C;  2LP7 A;  3CYO A;  1M90 W;  3OMI B;  4MVZ A;  1E1Q G;  3AG2 C;  3ABT A;  1FXV A;  1FS0 G;  3CC7 V;  4P9O A;  3AG1 B;  1F4M A;  4QIW F;  4HYO A;  2XAJ A;  4UV8 A;  3QO7 A;  4LCU C;  2YSU B;  5B1B B;  4PA7 A;  1RM1 B;  3FB7 C;  3OUF A;  1K34 A;  1VQ9 V;  3ASO B;  4MSW C;  4MTG A;  3SPI A;  4FMT A;  1H38 A;  3TCU A;  4ASU G;  3BEH A;  3WG7 C;  2P6J A;  2XAG A;  1H2G A;  1HWY A;  2WPD G;  4MVQ A;  2EIK C;  3ZRX A;  2V7Q G;  1OCR B;  4PA4 A;  3CPW U;  3D36 A;  4J9Y B;  5L3D A;  3ETD A;  1CP9 A;  3E8B A;  4QE9 A;  4R8C A;  2GHY A;  4G2K A;  1OCO C;  3EFF K;  1I5Y A;  2IJK A;  3GB7 C;  1ZWI C;  1QVF U;  5HFM A;  2NLJ C;  4R50 A;  4WFA V;  1AR1 B;  3CP1 A;  2XAH A;  4RQE A;  4I5S A;  3GWO A;  2HKO A;  3BY6 A;  4XDJ A;  1S76 D;  1F51 A;  4GX2 A;  5B1A C;  2ZD9 A;  3ABK B;  2OCC B;  1PNL A;  1JQ0 A;  5BZB A;  4BW5 A;  3W7U A;  3OMA B;  4Q20 A;  2DYR C;  1V55 B;  3SPC A;  2H94 A;  3K06 A;  5HFL A;  3ZRW B;  1K5S A;  3K0D A;  3I56 V;  3E83 A;  1M57 B;  5CN0 A;  4H37 A;  3K08 A;  3SYP A;  2EIJ B;  3LSS A;  4XDK A;  3CCE V;  2WSS G;  5B1N A;  1PKX A;  5KA6 A;  4UXN A;  2IJH A;  3ETG A;  2OT5 A;  2Q68 A;  3ABM B;  2EIJ C;  4DXW A;  3STL C;  1K5Q A;  3CCV V;  3SYQ A;  3A0R A;  2WLM A;  3E86 A;  3ASN C;  1BHB A;  3OR7 C;  5KUK A;  3ZIA G;  4KUM A;  1K92 A;  5EC1 C;  2UXX A;  4RAI A;  2QKS A;  2IH3 C;  3ABL B;  4WFG A;  3K03 A;  3SJQ C;  4F4L A;  2NNU A;  1R3L C;  1Q86 W;  3EHB B;  1K33 A;  4GT1 A;  4I9W A;  5B1A B;  1Q81 W;  2KB1 A;  4BIU A;  2YEV A;  3B8M A;  3G71 V;  2QEX V;  4QPK A;  3IC7 A;  1PNM A;  1Q7Y W;  3CC2 V;  2QM7 A;  4KP4 A;  3OEE G;  3T1C A;  3OR6 C;  3F7Y C;  1JX9 A;  1NKD A;  4FPP A;  4UV9 A;  2WLJ A;  5L3C A;  3SPJ A;  2WWW A;  3ZN1 A;  1S0V A;  3KG2 A;  5IYB O;  2A79 B;  3CMA V;  5KUM A;  1OCR C;  4P9P A;  4JAU A;  1XL4 A;  2BOB C;  3SPH A;  4P2Z A;  1GM9 A;  4MW8 A;  1R6K A;  4JGS A;  4L87 A;  4OXS A;  3PJS K;  2ITC C;  3HB3 B;  5B3S C;  3CCL V;  5C93 A;  5L3E A;  3ABM C;  5B1B C;  1RM1 C;  5EC2 C;  1R3J C;  1DTO A;  1EBO A;  4HAM A;  3IGA C;  3G6E V;  4ZBM A;  2Z5U A;  3X2Q C;  3AG2 B;  5GW7 A;  5L3F A;  2PI5 A;  3WG7 B;  4N21 A;  5EK0 A;  4JAS A;  3K04 A;  2EZP A;  1FXK C;  3P30 A;  3AEI A;  1GM7 A;  4JPR A;  3P32 A;  1YTF D;  2FTK A;  3OW2 U;  2GSM B;  1L1F A;  1GTO A;  2QE7 G;  5CBF A;  1KQS U;  5L3B A;  2HJF C;  1QR8 A;  1K8A W;  1VQP V;  3CCJ V;  3LSQ A;  2F43 G;  1VQO V;  1BMF G;  1YHQ V;  1S72 V;  3FB5 C;  3AG3 C;  3CC4 V;  2ZR2 A;  3TET A;  2R9I A;  2IH1 C;  1S77 D;  2WAM A;  3AG4 C;  3LUT B;  4LP8 A;  2ZQM A;  4RQF A;  4P30 A;  3IFX A;  2WLN A;  4PA6 A;  2V1D A;  2P90 A;  1ENV A;  2DYS B;  1OCC B;  1PD3 A;  2AHZ A;  5EBW C;  1V54 B;  2EIM C;  1GKF A;  1K7D A;  1AI5 A;  4MTF A;  1OCZ C;  3E8H A;  1M57 C;  1KP2 A;  4G27 B;  1AJQ A;  1MSW D;  3E2E A;  2EIN C;  2DYR B;  3E35 A;  4J9Z B;  4QPJ A;  1MOF A;  1G8M A;  3DTU B;  2UXN A;  1QLE B;  2P7T C;  3M99 B;  3B77 A;  1JPX A;  1OCC C;  2DYS C;  2OCC C;  3JD2 A;  3VBB A;  1YIJ V;  3CME V;  2ZDI C;  1FXK A;  3ZJZ A;  1QVG U;  1YJW V;  3W7W A;  1MG1 A;  4PDL A;  5LHH A;  1VQ5 V;  3RVY A;  1I5X A;  3DGE A;  1CPY A;  1P4R A;  1H8H G;  2JEU A;  2EBO A;  4TT3 G;  3X2Q B;  2PI4 A;  2ZDI A;  3QO8 A;  3SYC A;  3OE7 G;  2EIK B;  2HFE C;  3NXS A;  2QA4 V;  3JYC A;  4WF9 V;  5LGT A;  4MVO A;  4TSF G;  1KP3 A;  4UVB A;  3AG4 B;  2LFR A;  3ZMZ A;  1EFR G;  1LNQ A;  4MW3 A;  2A9H A;  2EZO A;  4MT8 A;  3E89 A;  5L3G A;  3FYE B;  4U7N A;  1JOY A;  3AG1 C;  1M9N A;  4PA3 A;  4GX0 A;  4WFF A;  3ABK C;  4MTX A;  4WFE A;  2B1G A;  2DQ3 A;  2JDI G;  2IJJ A;  1ROP A;  1NBM G;  1SES A;  1RPR A;  2DW4 A;  3ZMV A;  2EIN B;  2K1E A;  3OFN G;  5LHI A;  2DQ0 A;  2X6A A;  2WLL A;  1JCH A;  2WLH A;  3SYO A;  1KD1 W;  1K3E A;  4JYC A;  2OTL V;  2EIL B;  1THZ A;  1AJN A;  2Q6A A;  3CXC U;  4WFB V;  2Q67 A;  1YIT V;  3OUS A;  1OHH G;  3ZN0 A;  1VQK V;  1KEC A;  1P7B A;  4GX5 A;  1QR9 A;  3UKM A;  1NH2 D;  4U7O A;  1COW G;  1AJP A;  5IY5 B;  3K9A A;  3K79 A;  3FKS G;  5IDJ A;  4QNH B;  1QLN A;  1DF4 A;  1SRY A;  1VQL V;  5H6R A;  3F5W C;  3OMN B;  1TUE B;  3OEH G;  4WFH A;  1AI6 A;  2H8P C;  2QM8 A;  3JD0 A;  4UVC A;  4LBE C;  4QE7 A;  1S5H C;  4FK5 C;  1RPO A;  2WLL B;  5H9C A;  4BIZ A;  3STZ C;  1FFT B;  3FB8 C;  3JD1 A;  2IU0 A;  3CCS V;  4MTO A;  3ABL C;  1BHA A;  2QTO A;  1ORQ C;  4TWK A;  3ZMS A;  5EBM C;  1J95 A;  2C2A A;  2CK3 G;  3RW0 A;  2DWD C;  2HG5 C;  4X89 A;  3W7X A;  1DF5 A;  3W7T A;  2LFS A;  1WLE A;  3QO5 A;  4JYB A;  1F23 A;  1NR7 A;  1OCO B;  3ZMT A;  1GMG A;  5CMU A;  2XND G;  4JTD B;  1E79 G;  4UVA A;  4X88 A;  3SYA A;  3CCR V;  1K9M W;  3ML0 A;  1DLB A;  4DO2 A;  2WLI A;  2XOK G;  4XDL A;  1BL8 A;  3T4D A;  2XAQ A;  3ASN B;  2WLI B;  3D3I A;  3JCZ A;  4R6Z A;  5H6Q A;  4PDM A;  1K4C C;  5IYD O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...