3R65A

Mthk channel pore e92q mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
82
structure length
82
Chain Sequence
b'VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVQRLLEFLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
molecule tags Membrane protein
source organism Methanothermobacter thermautotrophicus str. delta h
publication title Crucial points within the pore as determinants of K+ channel conductance and gating
pubmed doi rcsb
total genus 30
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3r65A00
2ITCC 1OCZC 3AG1C 4PDMA 3E8GA 4QE7A 3SPHA 3ZRSA 4EKWA 1JVMA 2W0FC 2WLIB 4XDJA 4MW3A 1K4CC 2EINC 2Q69A 4CBCA 3LDCA 4PA3A 3K0GA 5KUMA 3SYQA 2A0LA 4QE9A 4LP8A 3AG3C 5EC1C 3FB6C 4OXSA 2DYSC 2KB1A 4G28B 4GX5A 3SYAA 2NLJC 4P9PA 1KKDA 3T4ZA 5EBMC 2ATKC 2IH3C 4JTAB 4WFHA 5B1AC 3GB7C 4MS2A 1J95A 4H37A 2WLNA 5EBWC 4JTDB 2YEVA 3SYPA 3JYCA 3T1CA 3K04A 3OR7C 3UKMA 4R7CA 3OUFA 3TCUA 1S5HC 4H33A 3LDDA 4WFGA 4PA4A 3K03A 2HVKC 3E83A 5BZBA 2EIMC 3ASOC 3E8BA 3WG7C 4LBEC 4MW8A 4QNHB 4GX2A 3E8HA 1R3IC 1ORQC 2X6CA 4X89A 4PDVA 3KG2A 5EC2C 5IY5C 3UM7A 1K4DC 3IGAC 2K1EA 3RVZA 3SPJA 2HJFC 4J9YB 3LDEA 3R65A 2Q68A 1V54C 4J9ZB 4KFMA 4X8AA 5B3SC 1XL4A 2WLJA 2QTOA 4X88A 2A9HA 3SYOA 3X2QC 3OR6C 4MVZA 2R9RB 3AG4C 2X6AA 4JTCB 2WLLA 4LCUC 2IH1C 4RAIA 3HPLC 4RUFA 3OUSA 1BL8A 3RW0A 4PA7A 5KUKA 4XDLA 3SPIA 2HFEC 4MVUA 3E89A 4HYOA 4I9WA 2H8PC 2WLMA 2QKSA 1OCOC 3F7YC 4WFEA 3K08A 2X6BA 3ZJZA 1G4YB 2Y69C 5J9PC 3BEHA 1V55C 1ZWIC 3ABLC 4R50A 2WLLB 2EIJC 4MTFA 4MVMA 4MVOA 2BOBC 2WLIA 3FB7C 4XDKA 2DWDC 2OCCC 3F5WC 3RVYA 4TWKA 4P9OA 3K06A 1P7BA 4DXWA 4GX0A 4MVQA 3STZC 4MSWC 2HVJC 1R3LC 4ZBMA 1OCCC 3SPCA 4R8CA 3SYCA 2EILC 1M57C 1QLEC 3ABMC 4PDLA 4RO2A 2A79B 4MTGA 4P2ZA 4R6ZA 3EFFK 3ASNC 5EK0A 2P7TC 3E8FA 2DYRC 2HG5C 4PDRA 2AHYA 2EIKC 4F4LA 4G27B 3SPGA 3T4DA 4MTOA 3TETA 3FB5C 5CBHA 2Q6AA 5E1AC 5CBGA 4BW5A 2Q67A 4MVRA 3SJQC 1R3KC 2JK5C 3VOUA 2WLKA 1M56C 1OCRC 1LNQA 4HZ3A 3AG2C 3ABKC 2WLHA 3T2MA 2ZD9A 5EBLC 2BOCC 2DWEC 3LUTB 3OGCC 2ITDC 3IFXA 3F7VC 3FB8C 3PJSK 4PA6A 3E86A 4GX1A 1XL6A 2ZXWC 3LNMB 4UUJC 4WFFA 5B1BC 3K0DA 4RUEA 5CBFA 1R3JC 3STLC 4PA9A 4MVSA 3RBZA 4P30A 2AHZA
chains in the Genus database with same CATH superfamily
1EN6A 1O9GA 4ZOLB 4BIUA 4X65B 4YXWG 2W0FC 3HKEA 2WLIB 1COWG 4UXNA 3RWRD 5J2TB 5BMVB 4DR5O 1URFA 1BZKA 5K1XA 3TGUH 1WPBA 1KKDA 3ZMZA 2B9ZA 2GUZA 1JPXA 2IU0A 2YUAA 5CA0B 1N32B 1Q8IA 3RGBA 5KMGA 1GN4A 2DYSB 2HJDA 1BT8A 1KC8W 1XHZA 4B3MO 4CH4A 1TAEA 4B08A 1F23A 3R65A 2YIBD 4NTYA 5IWAO 4BWAA 4EB6B 3K5LA 4A5UB 4YY3B 1P7GA 3VQYA 2P4KA 3F7YC 3LSQA 1V55C 3H1HH 4X20B 4DXWA 4N21A 5LYJA 4QPJA 2OTJV 2YXLA 1IX9A 3ABMC 3CPWU 4PDLA 4DR7B 1I5XA 3SGIA 3W7UA 5EIBD 1AROP 3E8FA 3OGIB 4TV9B 4RWUA 5IYDO 4U3FH 4YIOA 2JK5C 5IE9A 2R70A 2F66C 5B1AB 4O4LA 1N36B 1J5EO 2DWEC 3LUTB 2D3OW 5JJNB 3F7VC 2V4DA 4DK0A 1VIBA 3JASB 2HHHO 2AHZA 5C93A 5KX5A 4O2BA 3SPHA 5GONB 1JVMA 3TXSA 2WPDG 1AB3A 3SYQA 5LHGA 4PELA 4GX5A 2ZNIA 2F43G 4J42A 4H37A 5JWPA 4L87A 1UFIA 2UU9B 2YICA 1NZ6A 1VQ9V 4PA4A 1SS3A 2HKOA 4LF9O 1VARA 2ZM6O 2XNDG 5GTIZ 5KMGB 4IT5A 1ZL8A 2LP7A 4DV7O 3F5TA 1H2GA 4JI1B 4LF5O 2HJFC 4GKJB 4J9YB 4JZ2A 1CP9A 3T1YB 1IBKB 2CDYA 2QM4A 1K7DA 2WLLA 3CC4V 1VQ8V 3OFNG 1IDSA 3OUSA 4UCSA 2P5OA 1H8HG 1O9HA 4UVCA 4JAUA 1AI4A 4J80A 3B8NA 3B09A 3ETQA 1G4YB 1NBMG 4GYCB 4XDKA 2Q7GA 2ODMA 3OTOB 1S3JA 1OCRB 3NXSA 2DQ3A 4MVQA 2ZIMA 1M57C 4TQFA 1HWYA 4R6ZA 3L70H 3OAAG 5AG2A 2AHYA 4MTOA 4FM2A 1HNXB 4JI4B 2UXNA 3HKBA 1B6QA 3RYIB 3GVMA 2VS0A 3QVNA 5FL7G 3PJSK 4K35A 4UUJC 1FD9A 1Q43A 2P6JA 3Q4HB 4LF7O 2R9AA 3E8GA 4DR2B 3PN1A 4DW1A 1DLBA 4FLVA 3ZRSA 4QGPA 4JI6B 3ZHSA 5B3SB 3T1HB 2EINC 2Q7EA 2H3OA 1B3QA 3SDLA 2EZPA 1FXKC 1S77D 3DC5A 4X65O 1K73W 4OGQB 1GH6A 1M56B 4O4JA 1QR9A 3D36C 1YI2V 2Q0OC 2Y0IA 1QQCA 2XAGA 4JI3O 1Z2GA 3OEEG 4AILC 3CE2A 1NKDA 4DR1B 1Y66A 1HW7A 3ASOC 3E8BA 5IDJA 4MW8A 4X64B 3ZHVA 4E2LA 3QTCA 4PDVA 2BTOA 1FXHA 1XNRB 4JI7B 2QM7A 3SPJA 1PNMA 3H1IH 3E22A 3U0ZA 4DV5O 1WB8A 2WWWA 5HFMA 3KKYA 4WCEV 5F2VO 3ZHRA 3JAMN 5KA5A 2ZT9B 3G4SV 4B3TB 3CHXA 3FAVA 2QWOB 3K08A 1N8RW 3BEHA 2ZIOA 1FPOA 3ZMSA 2E5LO 4I0XA 2MK3A 4NXMB 1RPRA 1YJWV 1MOFA 4O2BB 3OE7G 5KLVH 4AQYB 4LFAO 4GX0A 2XAHA 2QWQB 4CS4A 2EILC 4FZ1A 2Z5UA 4FK5C 4JI7O 1Y74B 3ZHTA 4PI0A 5JQGB 4KL1A 4CC6A 4F4LA 3TETA 1N0JA 3JD0A 4ZI7B 1XMOB 1MMMA 1TUBB 4JI8B 3OGCC 1JX9A 1N32O 1US6A 3ABUA 5E79Z 5CBFA 4JAAA 2BTQB 5CA1B 1B04A 1FXKA 5IT9N 5KHIA 3BA8A 5BY1A 4DR7O 5LMUO 4O4IA 4JI2O 2A0LA 1Y76B 3T1HO 3FB6C 2OTLV 4G28B 5LP6B 3LSSA 4LNUB 2ZE8A 4Q6GA 1AR1B 3A0RA 3U11A 1S5HC 4L8JA 1Q81W 3W7WA 4JYAB 2HVKC 4ZHQB 1IBKO 4B7KA 1AJPA 2QE7G 1S72V 3K57A 2LO1A 2JVDA 5D5PA 3ZN1A 1ZSPA 1H2SB 2VWKA 3KG2A 5EC2C 4LF6O 1YJNV 3HR0A 2K1EA 1VQ7V 2XAJA 3JD2A 3E2EA 1Q7YW 3K9SA 2IJHA 5B3SC 3CXHF 3X2QC 2EINB 5LOVA 2JEUA 4UVAA 1WNSA 2GUZB 2EBOA 5EZYA 3OTOO 1XREA 2KG7B 3JALB 3HPLC 3N27A 4RUFA 3ZCCA 3FAVB 2QKSA 3LNNA 3AK1A 1R6NA 2JIZG 1BSMA 2BOBC 2WLIA 3MHHC 3F5WC 1ZUQA 2EJRA 3OTFA 4P9OA 2CAZC 4F6RB 3G67A 1F51A 3CRQA 3RYCA 2QWPB 4O4HB 3L9DA 1P4RA 4I55B 3RN4A 1FJGB 3SJQC 3CJHB 3JD4A 2VQFO 1M56C 4W4LA 2BE3A 3AEIA 3FB8C 1PP9H 3LNMB 4WFFA 4FJCC 4F6RA 1SQVH 4O4JB 1MZFA 1DK1A 4FLWA 5L3BA 1MA1A 5C8YA 4K0KB 4MW3A 5LMNB 2RCVA 2E3CA 1RM1C 4OPAA 1FFXB 4UV9A 2F93B 2QA4V 4WFHA 1FS0G 2JJ2G 3EXAA 1YTFD 3SYPA 4ABMA 3JYCA 3QNEA 1R1BA 3RYFA 3TCUA 1SETA 2Q4PA 4D7TA 4J10A 5BZBA 2HP8A 5IJ9A 2ETNA 4AHCA 4QNHB 5L3GA 3OEHG 4GX2A 4PV1B 3L73H 2DN9A 1H38A 2L35A 2LFSA 3ZMUA 3IAYA 5JVDA 3UM7A 2UUBB 1MSDA 3LDEA 1KECA 2Q68A 5KHGA 4J7KA 2X6AA 3FX7A 4D6TH 3M99B 1SQFA 3ZJZA 1RP3B 3UO3A 1EM1A 2DJVA 2NN4A 1IZ3A 4UB8Z 2GDSA 3CCRV 4P2ZA 4NTWA 2HG5C 2F4VB 2ZINA 2DW4A 2P90A 1SESA 1EN5A 3MDSA 2JJ1G 1AI5A 3MAQA 4I50A 1VF7A 2BOCC 4FM1A 3WB0A 1M90W 4UFZA 4N23A 4UV8A 1SKVA 2QSAA 5DN6G 1NR1A 1JFFB 1NS1A 4R50A 5IYBO 3AG1C 3AK2A 5JH7B 2QM8A 3CCLV 1Y67A 4LFBB 3G6EV 4PA3A 3K0GA 4QE9A 1XDCA 3ZMVA 1BHAA 3ABTA 3I56V 1KP2A 3RFRA 4GZRB 4ZOLA 5EBMC 5B1AC 5EYPB 1XNQB 1CEZA 4CS3A 4DR6B 4YIPA 4JTDB 5L3CA 1AR4A 2DQ0A 2W6IG 1ENVA 3WG7C 2UXCB 1Q86W 1KB9F 4I55A 1OHHG 3M8AA 1ZTEA 1S0VA 2ZR3A 2RN9A 3A0HZ 1QLNA 4LF6B 2QTSA 5IJ0A 4UB6Z 4GT1A 2ZCEA 3UCSC 2P22C 3W7SA 1VQLV 2DYRB 4U7NA 1BL8A 5K1PA 1KU9A 1M9NA 1GN2A 1VQ5V 4MVMA 4JYAO 1Z5WA 2JEXA 4NXMO 3CCVV 5LXTB 1M1KW 4MSWC 4NR1A 3RYIA 4J7JA 4BW9A 4H0LB 2QKCA 5IYCO 3APQA 1XMQB 5FNVA 4U3JB 2XHBA 4GUNA 2VQEO 5IYZB 1YCIA 5GTHZ 4JI0B 3JARA 2CGNA 5H5NA 1H2LA 2RDCA 1JQ0A 3VQXA 4U7OA 1HNXO 4PA6A 3KCYA 4DV6B 1R6TA 1AVMA 2YC0A 1Q90D 1K5QA 2XAQA 3CSXA 1KUQA 3BHPA 1I94O 4Z1VA 2AZ0A 1Y4MA 3BABA 3BAAA 2RJZA 2QGNA 4O4IB 4AQYO 1SF9A 2XASA 4JZGA 1WA8A 2YI9A 4JTAB 2F23A 4WFBV 1W0JG 3A0BZ 2P4VA 2EIMB 3K3WA 4LF4B 1WP7A 1H8EG 3T1CA 3OUFA 3D36A 4BIZA 1GN3A 1P49A 2EIMC 1PNKA 1SC5B 1TA8A 3C90A 2XT9A 1XI1A 1XNQO 1VQPV 3MD0A 3RVZA 4LH6A 2QEXV 2LGWA 4WF9V 2WLJA 5FPRA 2A9HA 4DV3B 3FD9A 2R9RB 3U10A 3ZMTA 4YJ2B 2WA4A 3OMIB 5GW7A 5B5EZ 1N34O 4B3RB 3K5MA 3ZBHA 1ZWIC 4ZIBA 1UJWB 1VF6A 3JASA 3RVYA 1GM9A 5KX5B 1FXKB 2ZNJA 3OMAB 5EIBC 2Q0AA 4MTGA 3ASNC 2ZE6A 2FB5A 4TSFG 4X1KA 1HNWB 2OYQA 3T4DA 2LQTA 1D5AA 3L75H 4ZKIA 1LNQA 1W59A 1PM9A 1GM7A 2Z3YA 1QNMA 4ICGA 1QHTA 1WB7A 4DV3O 1LUVA 1XL6A 4LNUA 1GMGA 2PGGA 1YTFB 2DMXA 1OCZC 4PDMA 1AR5A 1SZTA 1VEWA 4I0XB 2D2CB 1K4CC 2ILMA 3KZIZ 2RQ6A 3JCUZ 2ZR2A 1S5LZ 1I0HA 1OCCB 1BQZA 1SQXH 4P9PA 4DR6O 1MZEA 1XHXA 5CB4A 4H44B 5LGUA 2BSKA 2IJKA 5JVDB 1N0NA 4O2AB 3EHBB 4CH5A 4H33A 4TT3G 3K03A 3P3NA 4UCTA 1IURA 2Q7HA 2FYUH 3T1YO 4I5SA 3UQ8A 5TISZ 4LR3A 5B1OA 3ZIAG 2CTWA 2A06H 3ZRVA 1HDJA 2CTPA 3P30A 2WSSG 4IHJA 1AJNA 1NTMH 2FTKA 1WA8B 2UUBO 2YXHA 5J2TA 1WPXA 2K9PA 5B1NA 1U96A 1KD1W 3HKEB 4JPRA 2EIJC 2EZOA 3FB7C 1NTZH 3CXCU 4DUYO 4TWKA 2KG7A 3K06A 2Y4UA 2JS5A 2UXXA 5FPOA 4R8CA 4YY3O 3B40A 4LF8O 1W2BU 2ARHA 1VQMV 4LFCB 3AK3A 1BCCH 2JRIA 2UXBB 1M57B 2PI4A 1EN4A 3FKSG 1YJ9V 3SJAC 1P84F 1DGSA 1CXZB 4O2AA 1IXMA 4LFBO 4CZZA 3UO2A 4AI8A 4DV7B 4JGSA 4HAMA 4XDJA 5LP6A 3R66A 1PL4A 2OIGA 1EZJA 1Y76A 5C8YB 3FYEB 4X62B 2DYSC 2KB1A 4MT8A 4KHPO 4PHZA 5A9GA 1NH2B 4I4TB 1FFTB 2Q8VA 5CA1A 2M6YA 2QKAA 4DR5B 4J11A 3CX5F 2CGOA 3BCCH 2CUGA 5EBWC 3A2FA 4DK1A 5D5QA 5B1BB 2VWJA 1ZL8B 2OCHA 4ZI7A 4FFKA 1X4TA 1K3EA 3RYCB 2N74A 4LFCO 1X59A 1NT2B 1VP7A 4DO2A 1S5JA 5JJEB 1Y74A 3JSNA 1L8DA 4X88A 4D7SA 3HKCA 1GO3F 5EYPA 1QVGU 4JTCB 3APOA 3VBBA 4FLXA 4K0KO 4B3MB 2XOKG 3CYOA 4PA7A 1KQSU 4W4KA 1XQ8A 1FKAO 1VMGA 3OT7A 5JH7A 3UT5B 2PYLA 4YJ2A 2OCCC 1BQ0A 1GKFA 4IHJB 1F4NA 3A8TA 1EFRG 4Z1MG 2L6LA 1GTOA 4I50B 3C3TA 3FFQA 5H2FZ 3CMEV 5LGNA 2QDOA 2NR5A 5CBHA 1WN7A 3RYHB 3VOUA 1GK9A 4HZ3A 3WFVA 1N36O 1Q5OA 2Y48A 3TXQA 3QF7A 1YIJV 1JR9A 1YVWA 4FPPA 1QVFU 1SRYA 3E86A 2ZXWC 5CA0A 3K0DA 2Q9LA 2XUMA 1R3JC 1F4MA 1Q82W 4KXRA 2YIAA 2QJ1A 3CEIA 3G80A 4B7EA 4JYYA 4B3SO 3B77A 3LDCA 1IXBA 4B3SB 1E1QG 1YSCA 4G2KA 1AI6A 3J7AU 5EC1C 2Q73A 3DSQA 1H2NA 1HR0O 1PNLA 4JF3A 3HKCB 4DR3B 3E22B 5ITZA 1NQTA 1QCEA 3JAKA 1Y6XA 4UCUA 3W7XA 1JMKC 3D8CA 2FKXA 3MHSC 3E83A 1VF5B 4DV4B 3JARB 5L3FA 4JV5B 3P32A 2JGDA 4LC1A 4X89A 1NTKH 1G8MA 2FL4A 1Z5VA 3CMAV 3RYFB 4JASA 3CD6V 1KYOF 4NTXA 1AILA 5CA3A 4JYCA 2PF4E 4DUYB 1FXVA 2IH1C 5DEDA 4JI6O 4FLYA 1FFXA 4LF7B 3E89A 4HYOA 4B3RO 2YIBA 4DV6O 3QO8A 2W0XA 2X6BA 4BAYA 1GN6A 4EB6A 3LSUA 2Y4TA 4BR6A 2OWOA 2O57A 4YHHB 2ADPA 5LP6C 2UXBO 1NU1H 2V7QG 1HNWO 4NXNO 2P7TC 1G6UA 3CJHA 2DE0X 3TK1A 3X2QB 4GKKB 2Q6AA 1VF6C 2EJ7A 2HLDG 3AG2C 3ABKC 2WLHA 1AP6A 3I55V 2ZD9A 4DR2O 3IFXA 3SR2C 4JI2B 1ROPA 5B1BC 1SQPH 3I5DA 1GM8A 2EIKB 4DV2O 4X1IA 3S3WA 1D5NA 3SJCC 3K58A 1LUWA 4CBCA 1JA8A 5IY5B 1SQBH 3BRCA 3JD1A 3Q4HA 1M5IA 2P67A 4FLZA 5LOVB 3H1KH 1BMFG 2UUCO 1U97A 2MW2B 1J95A 4X64O 2QR4A 1SERA 2WLNA 4LFAB 1CPYA 4DR1O 4DV0B 3GWKC 3LDDA 1B06A 1SQQH 3BFRA 1DF5A 3ML0A 2RNBA 4F6EA 2JGUA 5KAIZ 4ZHQA 1IBLB 2XTAA 4GKKO 1ORQC 2X6CA 4TQDA 1XMQO 2F4VO 2JDIG 3ZN0A 4FLUA 2NNUA 4I7ZB 1QBZA 4DV5B 4J9ZB 3H01A 1KKCA 2QTOA 5DECA 4MVZA 1NVPD 5ITZB 4LF5B 1I94B 3JAWA 1T5EA 1TGOA 2HFEC 2H94A 2IJIA 4WFEA 2E75B 3G71V 4MTFA 1K8AW 1K34A 1PKXA 2BTQA 3JAWB 4JI3B 2UUAO 1XEQA 3STZC 1XUQA 4FIPC 2YS8A 3H1LH 3K5OA 3DGEA 2B1GA 2A79B 4RO2A 2E5LB 2W6JG 4WFAV 1XILA 5LHIA 3AG1B 3K59A 3RYHA 2FMLA 4ASUG 3IC9A 2QWNB 4IYIA 1OCRC 2F1MA 1YXBA 1PL0A 5L3EA 1H2MA 2ZDIA 4RUEA 1MSWD 4PA9A 5KHHA 3RBZA 4LBEC 5CBGA 2ADQB 2R72A 2VRZA 4UCRA 5BMVA 5LMNO 2LW1A 1IVSA 1PD3A 1MG1A 1HR0B 2IH3C 1ZX3A 3ETGA 4GCZA 2UXCO 1L1FA 3JSLA 4K3AA 4IYHA 2IM9A 2PI5A 3ICXA 3OM3B 5BR8B 4WFGA 3B2EE 3D3IA 2IBZH 1K9MW 1K33A 3ETDA 3RT3C 1R3IC 1Q6UA 3M7MX 3IGAC 2HHHB 2IW5A 3ZHUA 1V54C 4KFMA 1BE3H 2A3QA 1OZ0A 3CCMV 4I4TA 1VQ6V 5JJJB 4LCUC 4EFEA 4RAIA 2KKWA 4NB5A 4XDLA 1IBMB 2F95B 4JI5O 2WLMA 1OCOC 3DC6A 3W7TA 1GAXA 2Y0PA 3ZRWA 5BXZA 2XAFA 3IC7A 3JALA 2OIEA 3H9VA 3SPCA 1OCCC 3FYIB 3SYCA 1N33B 4WBNA 2GSMB 1RSOA 1VQKV 4LWSA 2B5UA 2DYRC 4KP4A 4G27B 5B66Z 3OW2U 4DUZO 1HP8A 3ZX6A 5IJ9B 4IIJA 5FNVB 4MTXA 1I08A 2Z0AA 2GHYA 1XBLA 2Y69B 3JATA 5LGTA 4I9QA 3ABLB 3G6BA 1N4CA 1RFYA 4GX1A 4DR4O 4UCOA 3HKDB 4DR4B 4JI1O 2ITCC 1OV9A 3L71H 5H6QA 1M4UA 1J5EB 4QE7A 1L0LH 5IWAB 3VQVA 2YI8A 2BCCH 3H1JH 3L74H 3NR7A 1DTOA 4GKJO 4OXSA 1R73A 4DV2B 1KP3A 2P06A 1NI8A 5IJ0B 3GB7C 1RM1B 1QR8A 4OX9O 2JS3A 2V1DA 3DXRA 3QO7A 3K04A 3OR7C 3UKMA 3CCJV 4JI8O 4CC5A 2EX3A 1Q3EA 3OD4A 4Z2WA 2OCCB 4E4EA 5LHHA 3DTUB 5KHJA 4JV5O 1YF2A 5JQGA 4TV8B 4DV4O 2QWRB 1E1RG 4RQFA 2YXYA 1NJIW 3ASOB 1BHBA 4C7UA 2CTRA 4YJ3B 4PI2A 4BIOA 4CH6A 1TVKB 2ZDIC 1FAFA 3K9AA 3KCXA 2UXDB 2OT5A 5LL6Y 2DWDC 5BR8O 4HNAB 2GBOA 4FLTA 1JFFA 1LR1A 1VQNV 5JCOA 1PPJH 1JJOA 1N33O 1XMOO 5LBQA 4X66B 4OX9B 4TV8A 3EFFK 3SPGA 1RPOA 2N04A 3O65A 5E1AC 3HB3B 5J2UB 4H13B 4X9QA 4JYBA 1SQGA 4X1YB 1FYJA 2ITDC 3J81N 3B8MA 2Q5ZA 2YEVB 1YHQV 4DRXA 1D2DA 1MABG 4MVSA 3WB2A 2GTAA 1E79G 5LYJB 1AP5A 4TUYA 4OPHA 3ZEDA 4X20A 2HR3A 3VQWA 4CS2A 5LMUB 2A7WA 1GRJA 2E74B 4QPKA 3WU2Z 3SYAA 2UXDO 3CRRA 3D3QA 2KQXA 2PY5A 4UCVA 2AGAA 3AG3B 4JI5B 1XOUA 1NVPB 4J41A 1TUBA 3J80N 5LA6B 3CCEV 1VQ4V 1S76D 5L3DA 1FJGO 1JOYA 4JI0O 3CRMA 1F7YA 2IU3A 3E8HA 4IIJB 1W0KG 1WP8A 3BA9A 1YITV 4QIWF 3WG7B 1SZXA 1K4DC 4LF8B 3DXRB 1IBLO 2HEPA 3L72H 1XL4A 5KHKA 3JCZA 3SYOA 4FM0A 3CC2V 1M93A 2CK3G 4DV1B 5KUKA 2YSUB 3SPIA 2AZ2A 4LF4O 4MVUA 2E76B 4I9WA 4YJ3A 2Y69C 5H6RA 3ABLC 4Q20A 4DYLA 3CB2A 3CP1A 4X62O 2ZXWB 3K5NA 1JJ2U 1MNGA 3CRCA 4NVPA 2R9IA 2PYJA 1ZAUA 1TUEB 2M7WA 1SA0A 3N2GA 5HFLA 2B1IA 5IYZA 4O4HA 3N2KB 1H2KA 1I5YA 1K97A 1HNZB 1YZBA 4PJ0Z 1WAZA 1R6KA 2N05A 3AG7A 3C3SA 3JD3A 4P30A 3CCUV 4EKWA 2Q69A 4NYKA 3WB1A 2AXTZ 5KAFZ 2UUAB 4LP8A 3P3PA 3QO5A 3B4SA 5EZYB 4FZ0A 1V54B 5GONA 3T4ZA 3CRAA 4MS2A 1IBMO 1OJHA 4DRXB 1PV0A 3ZHQA 2CTQA 2YEVA 3N2KA 4R7CA 2JGDB 2VQFB 3AG4B 1A32A 4X1YA 3ZRXA 2RMKB 2UU9O 4RQEA 2IJJA 2LGQA 5LA6A 2GV9A 4LH7A 4K8ZA 4X1KB 1AJQA 2ZKOA 3JAKB 5CMUA 5KA6A 2C2AA 2EIJB 4CH3A 2VQEB 1KMIZ 2AW9A 3OR6C 3OMNB 3BY6A 2GTSA 3AG4C 4J7ZA 3SJBC 3ZRWB 1HNZO 2PZSA 4EEQA 3BPZA 2YDEA 1TVKA 1NR7A 2CH7B 5J9PC 2WLLB 4FFBA 4NXNB 4DV0O 2LFRA 1P7BA 2PTMA 2G38A 1R3LC 2HVJC 1KBHA 1JCHA 4QJFB 5EK0A 3CCQV 2EIKC 5J2UA 4XBFA 4EFBA 1UPGA 4PD4F 4BW5A 3ASNB 1V9PA 1R3KC 1WLEA 3O9OA 1Q6IA 3THOA 2BSKB 2X0LA 3TJTA 4IL6Z 5CB4B 3STLC 4HNAA 3CWBH 4FFBB 4DV1O 2YIDA 2EULA 4TOIA 3UT5A 2CH7A 1VQOV 1YDXA 3E35A 4HBNA 1OCZB 5KUMA 1Q6HA 2WA3A 3BVOA 3AG3C 1WJZA 4TUYB 1THZA 2NLJC 2X7RB 4X1IB 1EBOA 2ATKC 3ABKB 2ZQMA 2ZE5A 2UUCB 2ZM6B 4YHHO 5H9CA 4IGGA 4DR3O 4O4LB 5JCOC 4K8XA 3CC7V 1I7FA 1AI7A 4JI4O 1EZVH 1K92A 3EVKA 4DW0A 4JAVA 3ABMB 4TV9A 4U3JA 4NKGB 3S3XA 5IY5C 4FVMA 2DOSA 1V55B 3IJ4A 1BGYH 1RSOB 2CE4A 4GLXA 4X8AA 1K5SA 3GWOA 5LXTA 1QLEB 3ZS8C 2EILB 3K79A 3RW0A 2KSDA 1BS3A 5FLXN 1N34B 2PUSA 2H8PC 3QG5A 2WAMA 4B3TO 4MVOA 3AG2B 3HKDA 2ZE7A 4FMTA 1YEWA 2LW7A 4X66O 3CCSV 5A2QN 5DM6V 3CS5A 5CN0A 4ZBMA 1QLEC 1QU7A 3JATB 2LJ2A 4DUZB 3ETEA 1XNRO 3HKBB 4PDRA 4KHPB 3FB5C 1ZLZA 1NH2D 2Q67A 4MVRA 4LF9B 1DF4A 2WLKA 1OCOB 4LWSB 3T2MA 5EBLC 1SA0B 3N2GB 4WBNB 1G1XB 1L0NH 4KUMA 4UVBA
chains in the Genus database with same CATH topology
2ITCC 4JGSA 5H6QA 4BIUA 5L3BA 4HAMA 4QE7A 4YXWG 2W0FC 2WLIB 1COWG 4XDJA 4UXNA 4MW3A 1EZJA 1DTOA 1RM1C 3FYEB 4OXSA 1R73A 2DYSC 1KP3A 2KB1A 4MT8A 4UV9A 1KKDA 3ZMZA 2QA4V 4WFHA 1NH2B 1FS0G 2JJ2G 1FFTB 3GB7C 1QR8A 1RM1B 1JPXA 2IU0A 2V1DA 3QO7A 1YTFD 5EBWC 3SYPA 3JYCA 3QNEA 3K04A 3OR7C 3UKMA 3CCJV 3TCUA 1SETA 5B1BB 5BZBA 4QNHB 5L3GA 2DYSB 3OEHG 4GX2A 2OCCB 1H38A 1K3EA 2LFSA 3ZMUA 1KC8W 5LHHA 3DTUB 3UM7A 1F23A 4DO2A 3LDEA 3R65A 1KECA 2Q68A 1E1RG 4X88A 4RQFA 1GO3F 1NJIW 2X6AA 4JTCB 3VBBA 1QVGU 3ASOB 2XOKG 1BHBA 3M99B 3CYOA 4PA7A 1KQSU 3F7YC 3ZJZA 2ZDIC 3LSQA 1V55C 3K9AA 2OT5A 2DWDC 2OCCC 1VQNV 1GKFA 4DXWA 1F4NA 4N21A 1EFRG 4Z1MG 4QPJA 5LBQA 2OTJV 3ABMC 1GTOA 4PDLA 3CPWU 3CCRV 1I5XA 4P2ZA 3EFFK 3W7UA 3CMEV 1AROP 3E8FA 2HG5C 5LGNA 5IYDO 3SPGA 1RPOA 2DW4A 5CBHA 2P90A 5E1AC 1SESA 3HB3B 2JJ1G 1AI5A 4JYBA 2JK5C 3VOUA 1GK9A 4HZ3A 3WFVA 2Y48A 5B1AB 2BOCC 2DWEC 3LUTB 2D3OW 2ITDC 1YIJV 3B8MA 3F7VC 4FPPA 1M90W 2YEVB 1QVFU 1SRYA 4N23A 3E86A 4UV8A 2ZXWC 5DN6G 1YHQV 1NR1A 3K0DA 1R3JC 1F4MA 1MABG 4MVSA 4R50A 5IYBO 2AHZA 1Q82W 1E79G 5C93A 3AG1C 2QM8A 3CCLV 2HR3A 3SPHA 1JVMA 2WPDG 3B77A 3G6EV 3LDCA 4PA3A 3K0GA 3SYQA 1E1QG 1YSCA 4G2KA 1AI6A 4QE9A 3ZMVA 5LHGA 4PELA 5EC1C 1BHAA 3ABTA 4GX5A 4QPKA 3I56V 3SYAA 1KP2A 1PNLA 4JF3A 5EBMC 5B1AC 2F43G 1NQTA 3AG3B 1QCEA 1CEZA 4H37A 4L87A 3W7XA 1NVPB 4JTDB 5L3CA 3CCEV 1VQ9V 4PA4A 2DQ0A 1VQ4V 1S76D 3MHSC 3E83A 2W6IG 1ENVA 2HKOA 5L3DA 1JOYA 3WG7C 2XNDG 1Q86W 5L3FA 2IU3A 3P32A 3E8HA 1OHHG 1W0KG 1S0VA 4LC1A 2ZR3A 4X89A 2LP7A 1G8MA 1YITV 4QIWF 1QLNA 1H2GA 3WG7B 1K4DC 3CMAV 4JASA 2HJFC 4J9YB 3CD6V 1CP9A 1XL4A 3JCZA 3SYOA 4GT1A 5CA3A 3W7SA 1VQLV 2DYRB 4JYCA 4U7NA 1K7DA 2WLLA 3CC4V 1FXVA 2IH1C 3CC2V 1VQ8V 2CK3G 3OFNG 3OUSA 1BL8A 5KUKA 1H8HG 2YSUB 3SPIA 1M9NA 4MVUA 3E89A 4HYOA 1AI4A 4I9WA 4JAUA 4UVCA 3B8NA 1VQ5V 3QO8A 2X6BA 1G4YB 2Y69C 4BAYA 5H6RA 1NBMG 3ABLC 4Q20A 4MVMA 3CP1A 2JEXA 4XDKA 2ZXWB 1JJ2U 3CCVV 1S3JA 1OCRB 3NXSA 2DQ3A 1M1KW 4MVQA 4MSWC 1M57C 1HWYA 2R9IA 2V7QG 4R6ZA 1TUEB 5IYCO 2M7WA 2P7TC 3OAAG 2AHYA 5HFLA 3TK1A 3X2QB 4MTOA 2B1IA 2Q6AA 2HLDG 3AG2C 2UXNA 3ABKC 1B6QA 1K97A 1I5YA 2WLHA 3I55V 2ZD9A 1JQ0A 4U7OA 3IFXA 5FL7G 1R6KA 3PJSK 4PA6A 1ROPA 4UUJC 3JD3A 5B1BC 4P30A 2P6JA 1GM8A 1K5QA 2EIKB 2XAQA 3CCUV 3E8GA 1DLBA 3ZRSA 4EKWA 5B3SB 2EINC 2Q69A 4CBCA 1Y4MA 5IY5B 2EZPA 1FXKC 4LP8A 3QO5A 1S77D 1K73W 2XASA 3JD1A 1V54B 2P67A 1M56B 3T4ZA 1QR9A 4JTAB 1BMFG 4WFBV 1YI2V 1W0JG 4MS2A 1J95A 2EIMB 3K3WA 1SERA 2WLNA 2XAGA 2YEVA 3OEEG 1H8EG 1CPYA 3T1CA 4R7CA 3OUFA 1NKDA 3D36A 3LDDA 4BIZA 3AG4B 1Y66A 1DF5A 2EIMC 3ASOC 3ML0A 1PNKA 3E8BA 5IDJA 3ZRXA 4MW8A 4E2LA 4RQEA 2IJJA 1ORQC 2X6CA 2JDIG 4PDVA 3ZN0A 1VQPV 1FXHA 2NNUA 1AJQA 3MD0A 2QM7A 3RVZA 3SPJA 1PNMA 2QEXV 1QBZA 5CMUA 5KA6A 2C2AA 2EIJB 4J9ZB 3H01A 4WF9V 2WLJA 2QTOA 2A9HA 2WWWA 5HFMA 3OR6C 3OMNB 4MVZA 3BY6A 4WCEV 1NVPD 2R9RB 3AG4C 3ZRWB 5KA5A 3G4SV 3ZMTA 3OMIB 5GW7A 2HFEC 2H94A 2IJIA 4WFEA 1NR7A 3K08A 1N8RW 5J9PC 3BEHA 1ZWIC 3G71V 1UJWB 2WLLB 4MTFA 3ZMSA 1K8AW 1K34A 2LFRA 1PKXA 2MK3A 3RVYA 1RPRA 1GM9A 1MOFA 1YJWV 3OE7G 1P7BA 4GX0A 1FXKB 2XAHA 3STZC 2HVJC 1R3LC 3OMAB 4FIPC 2EILC 1JCHA 2Z5UA 3DGEA 2B1GA 2A79B 4FK5C 4MTGA 4RO2A 4QJFB 3ASNC 5EK0A 2W6JG 4WFAV 4TSFG 3CCQV 5LHIA 3AG1B 2EIKC 4F4LA 4XBFA 3T4DA 3TETA 3JD0A 4ASUG 4BW5A 3ASNB 1R3KC 4ZKIA 1OCRC 1LNQA 1WLEA 1GM7A 2Z3YA 1PL0A 5L3EA 3OGCC 1JX9A 2X0LA 2ZDIA 1XL6A 3ABUA 5CBFA 4RUEA 1MSWD 1GMGA 3STLC 4PA9A 1YTFB 3RBZA 4LBEC 5CBGA 1FXKA 1OCZC 4PDMA 1SZTA 1VQOV 1K4CC 3E35A 1OCZB 5KUMA 2A0LA 2ZR2A 3AG3C 3FB6C 2OTLV 1OCCB 4G28B 3LSSA 1PD3A 1THZA 1MG1A 2NLJC 4P9PA 2X7RB 1EBOA 2ATKC 2IH3C 3ABKB 1AR1B 2ZQMA 3ETGA 3A0RA 4GCZA 5LGUA 1L1FA 2IJKA 5H9CA 2PI5A 3EHBB 3CC7V 3OM3B 1S5HC 4H33A 4TT3G 4WFGA 1AI7A 3K03A 3W7WA 1Q81W 1K92A 2HVKC 3D3IA 4JAVA 3ABMB 1AJPA 2QE7G 1S72V 4I5SA 1K9MW 1K33A 3ETDA 1R3IC 5B1OA 3ZN1A 3KG2A 5EC2C 3ZIAG 1YJNV 5IY5C 3IGAC 2K1EA 1V55B 3ZRVA 1VQ7V 2XAJA 3JD2A 3E2EA 1Q7YW 2IW5A 2IJHA 1V54C 3P30A 4KFMA 2WSSG 4X8AA 1AJNA 5B3SC 1K5SA 2EINB 1OZ0A 2JEUA 3X2QC 3CCMV 3GWOA 4UVAA 2FTKA 1VQ6V 2EBOA 4LCUC 1QLEB 4RAIA 2EILB 3K79A 3HPLC 4RUFA 3RW0A 4XDLA 3ZCCA 1WPXA 2H8PC 2WLMA 2QKSA 1OCOC 5B1NA 1KD1W 1R6NA 2JIZG 3W7TA 4JPRA 3ZRWA 2EIJC 2WAMA 2XAFA 4MVOA 2BOBC 2WLIA 2EZOA 3FB7C 3MHHC 3F5WC 3CXCU 2EJRA 3AG2B 3IC7A 4TWKA 4P9OA 4FMTA 3K06A 2UXXA 3CCSV 5CN0A 1OCCC 3FYIB 4R8CA 4ZBMA 3SPCA 3SYCA 5DM6V 1QLEC 1F51A 2GSMB 3ETEA 1VQKV 1W2BU 1VQMV 2B5UA 2DYRC 4KP4A 4PDRA 4G27B 3OW2U 1M57B 3FB5C 2PI4A 1P4RA 3FKSG 1NH2D 2Q67A 4MVRA 4MTXA 3SJQC 3JD4A 1DF4A 1M56C 2WLKA 1YJ9V 2GHYA 1OCOB 3T2MA 2Y69B 5EBLC 5LGTA 3ABLB 3AEIA 3FB8C 1IXMA 4GX1A 4CZZA 3LNMB 4WFFA 4FJCC 4KUMA 4UVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITC C;  1OCZ C;  3AG1 C;  4PDM A;  3E8G A;  4QE7 A;  3SPH A;  3ZRS A;  4EKW A;  1JVM A;  2W0F C;  2WLI B;  4XDJ A;  4MW3 A;  1K4C C;  2EIN C;  2Q69 A;  4CBC A;  3LDC A;  4PA3 A;  3K0G A;  5KUM A;  3SYQ A;  2A0L A;  4QE9 A;  4LP8 A;  3AG3 C;  5EC1 C;  3FB6 C;  4OXS A;  2DYS C;  2KB1 A;  4G28 B;  4GX5 A;  3SYA A;  2NLJ C;  4P9P A;  1KKD A;  3T4Z A;  5EBM C;  2ATK C;  2IH3 C;  4JTA B;  4WFH A;  5B1A C;  3GB7 C;  4MS2 A;  1J95 A;  4H37 A;  2WLN A;  5EBW C;  4JTD B;  2YEV A;  3SYP A;  3JYC A;  3T1C A;  3K04 A;  3OR7 C;  3UKM A;  4R7C A;  3OUF A;  3TCU A;  1S5H C;  4H33 A;  3LDD A;  4WFG A;  4PA4 A;  3K03 A;  2HVK C;  3E83 A;  5BZB A;  2EIM C;  3ASO C;  3E8B A;  3WG7 C;  4LBE C;  4MW8 A;  4QNH B;  4GX2 A;  3E8H A;  1R3I C;  1ORQ C;  2X6C A;  4X89 A;  4PDV A;  3KG2 A;  5EC2 C;  5IY5 C;  3UM7 A;  1K4D C;  3IGA C;  2K1E A;  3RVZ A;  3SPJ A;  2HJF C;  4J9Y B;  3LDE A;  3R65 A;  2Q68 A;  1V54 C;  4J9Z B;  4KFM A;  4X8A A;  5B3S C;  1XL4 A;  2WLJ A;  2QTO A;  4X88 A;  2A9H A;  3SYO A;  3X2Q C;  3OR6 C;  4MVZ A;  2R9R B;  3AG4 C;  2X6A A;  4JTC B;  2WLL A;  4LCU C;  2IH1 C;  4RAI A;  3HPL C;  4RUF A;  3OUS A;  1BL8 A;  3RW0 A;  4PA7 A;  5KUK A;  4XDL A;  3SPI A;  2HFE C;  4MVU A;  3E89 A;  4HYO A;  4I9W A;  2H8P C;  2WLM A;  2QKS A;  1OCO C;  3F7Y C;  4WFE A;  3K08 A;  2X6B A;  3ZJZ A;  1G4Y B;  2Y69 C;  5J9P C;  3BEH A;  1V55 C;  1ZWI C;  3ABL C;  4R50 A;  2WLL B;  2EIJ C;  4MTF A;  4MVM A;  4MVO A;  2BOB C;  2WLI A;  3FB7 C;  4XDK A;  2DWD C;  2OCC C;  3F5W C;  3RVY A;  4TWK A;  4P9O A;  3K06 A;  1P7B A;  4DXW A;  4GX0 A;  4MVQ A;  3STZ C;  4MSW C;  2HVJ C;  1R3L C;  4ZBM A;  1OCC C;  3SPC A;  4R8C A;  3SYC A;  2EIL C;  1M57 C;  1QLE C;  3ABM C;  4PDL A;  4RO2 A;  2A79 B;  4MTG A;  4P2Z A;  4R6Z A;  3EFF K;  3ASN C;  5EK0 A;  2P7T C;  3E8F A;  2DYR C;  2HG5 C;  4PDR A;  2AHY A;  2EIK C;  4F4L A;  4G27 B;  3SPG A;  3T4D A;  4MTO A;  3TET A;  3FB5 C;  5CBH A;  2Q6A A;  5E1A C;  5CBG A;  4BW5 A;  2Q67 A;  4MVR A;  3SJQ C;  1R3K C;  2JK5 C;  3VOU A;  2WLK A;  1M56 C;  1OCR C;  1LNQ A;  4HZ3 A;  3AG2 C;  3ABK C;  2WLH A;  3T2M A;  2ZD9 A;  5EBL C;  2BOC C;  2DWE C;  3LUT B;  3OGC C;  2ITD C;  3IFX A;  3F7V C;  3FB8 C;  3PJS K;  4PA6 A;  3E86 A;  4GX1 A;  1XL6 A;  2ZXW C;  3LNM B;  4UUJ C;  4WFF A;  5B1B C;  3K0D A;  4RUE A;  5CBF A;  1R3J C;  3STL C;  4PA9 A;  4MVS A;  3RBZ A;  4P30 A;  2AHZ A; 
#chains in the Genus database with same CATH topology
 1EN6 A;  1O9G A;  4ZOL B;  4BIU A;  4X65 B;  4YXW G;  2W0F C;  3HKE A;  2WLI B;  1COW G;  4UXN A;  3RWR D;  5J2T B;  5BMV B;  4DR5 O;  1URF A;  1BZK A;  5K1X A;  3TGU H;  1WPB A;  1KKD A;  3ZMZ A;  2B9Z A;  2GUZ A;  1JPX A;  2IU0 A;  2YUA A;  5CA0 B;  1N32 B;  1Q8I A;  3RGB A;  5KMG A;  1GN4 A;  2DYS B;  2HJD A;  1BT8 A;  1KC8 W;  1XHZ A;  4B3M O;  4CH4 A;  1TAE A;  4B08 A;  1F23 A;  3R65 A;  2YIB D;  4NTY A;  5IWA O;  4BWA A;  4EB6 B;  3K5L A;  4A5U B;  4YY3 B;  1P7G A;  3VQY A;  2P4K A;  3F7Y C;  3LSQ A;  1V55 C;  3H1H H;  4X20 B;  4DXW A;  4N21 A;  5LYJ A;  4QPJ A;  2OTJ V;  2YXL A;  1IX9 A;  3ABM C;  3CPW U;  4PDL A;  4DR7 B;  1I5X A;  3SGI A;  3W7U A;  5EIB D;  1ARO P;  3E8F A;  3OGI B;  4TV9 B;  4RWU A;  5IYD O;  4U3F H;  4YIO A;  2JK5 C;  5IE9 A;  2R70 A;  2F66 C;  5B1A B;  4O4L A;  1N36 B;  1J5E O;  2DWE C;  3LUT B;  2D3O W;  5JJN B;  3F7V C;  2V4D A;  4DK0 A;  1VIB A;  3JAS B;  2HHH O;  2AHZ A;  5C93 A;  5KX5 A;  4O2B A;  3SPH A;  5GON B;  1JVM A;  3TXS A;  2WPD G;  1AB3 A;  3SYQ A;  5LHG A;  4PEL A;  4GX5 A;  2ZNI A;  2F43 G;  4J42 A;  4H37 A;  5JWP A;  4L87 A;  1UFI A;  2UU9 B;  2YIC A;  1NZ6 A;  1VQ9 V;  4PA4 A;  1SS3 A;  2HKO A;  4LF9 O;  1VAR A;  2ZM6 O;  2XND G;  5GTI Z;  5KMG B;  4IT5 A;  1ZL8 A;  2LP7 A;  4DV7 O;  3F5T A;  1H2G A;  4JI1 B;  4LF5 O;  2HJF C;  4GKJ B;  4J9Y B;  4JZ2 A;  1CP9 A;  3T1Y B;  1IBK B;  2CDY A;  2QM4 A;  1K7D A;  2WLL A;  3CC4 V;  1VQ8 V;  3OFN G;  1IDS A;  3OUS A;  4UCS A;  2P5O A;  1H8H G;  1O9H A;  4UVC A;  4JAU A;  1AI4 A;  4J80 A;  3B8N A;  3B09 A;  3ETQ A;  1G4Y B;  1NBM G;  4GYC B;  4XDK A;  2Q7G A;  2ODM A;  3OTO B;  1S3J A;  1OCR B;  3NXS A;  2DQ3 A;  4MVQ A;  2ZIM A;  1M57 C;  4TQF A;  1HWY A;  4R6Z A;  3L70 H;  3OAA G;  5AG2 A;  2AHY A;  4MTO A;  4FM2 A;  1HNX B;  4JI4 B;  2UXN A;  3HKB A;  1B6Q A;  3RYI B;  3GVM A;  2VS0 A;  3QVN A;  5FL7 G;  3PJS K;  4K35 A;  4UUJ C;  1FD9 A;  1Q43 A;  2P6J A;  3Q4H B;  4LF7 O;  2R9A A;  3E8G A;  4DR2 B;  3PN1 A;  4DW1 A;  1DLB A;  4FLV A;  3ZRS A;  4QGP A;  4JI6 B;  3ZHS A;  5B3S B;  3T1H B;  2EIN C;  2Q7E A;  2H3O A;  1B3Q A;  3SDL A;  2EZP A;  1FXK C;  1S77 D;  3DC5 A;  4X65 O;  1K73 W;  4OGQ B;  1GH6 A;  1M56 B;  4O4J A;  1QR9 A;  3D36 C;  1YI2 V;  2Q0O C;  2Y0I A;  1QQC A;  2XAG A;  4JI3 O;  1Z2G A;  3OEE G;  4AIL C;  3CE2 A;  1NKD A;  4DR1 B;  1Y66 A;  1HW7 A;  3ASO C;  3E8B A;  5IDJ A;  4MW8 A;  4X64 B;  3ZHV A;  4E2L A;  3QTC A;  4PDV A;  2BTO A;  1FXH A;  1XNR B;  4JI7 B;  2QM7 A;  3SPJ A;  1PNM A;  3H1I H;  3E22 A;  3U0Z A;  4DV5 O;  1WB8 A;  2WWW A;  5HFM A;  3KKY A;  4WCE V;  5F2V O;  3ZHR A;  3JAM N;  5KA5 A;  2ZT9 B;  3G4S V;  4B3T B;  3CHX A;  3FAV A;  2QWO B;  3K08 A;  1N8R W;  3BEH A;  2ZIO A;  1FPO A;  3ZMS A;  2E5L O;  4I0X A;  2MK3 A;  4NXM B;  1RPR A;  1YJW V;  1MOF A;  4O2B B;  3OE7 G;  5KLV H;  4AQY B;  4LFA O;  4GX0 A;  2XAH A;  2QWQ B;  4CS4 A;  2EIL C;  4FZ1 A;  2Z5U A;  4FK5 C;  4JI7 O;  1Y74 B;  3ZHT A;  4PI0 A;  5JQG B;  4KL1 A;  4CC6 A;  4F4L A;  3TET A;  1N0J A;  3JD0 A;  4ZI7 B;  1XMO B;  1MMM A;  1TUB B;  4JI8 B;  3OGC C;  1JX9 A;  1N32 O;  1US6 A;  3ABU A;  5E79 Z;  5CBF A;  4JAA A;  2BTQ B;  5CA1 B;  1B04 A;  1FXK A;  5IT9 N;  5KHI A;  3BA8 A;  5BY1 A;  4DR7 O;  5LMU O;  4O4I A;  4JI2 O;  2A0L A;  1Y76 B;  3T1H O;  3FB6 C;  2OTL V;  4G28 B;  5LP6 B;  3LSS A;  4LNU B;  2ZE8 A;  4Q6G A;  1AR1 B;  3A0R A;  3U11 A;  1S5H C;  4L8J A;  1Q81 W;  3W7W A;  4JYA B;  2HVK C;  4ZHQ B;  1IBK O;  4B7K A;  1AJP A;  2QE7 G;  1S72 V;  3K57 A;  2LO1 A;  2JVD A;  5D5P A;  3ZN1 A;  1ZSP A;  1H2S B;  2VWK A;  3KG2 A;  5EC2 C;  4LF6 O;  1YJN V;  3HR0 A;  2K1E A;  1VQ7 V;  2XAJ A;  3JD2 A;  3E2E A;  1Q7Y W;  3K9S A;  2IJH A;  5B3S C;  3CXH F;  3X2Q C;  2EIN B;  5LOV A;  2JEU A;  4UVA A;  1WNS A;  2GUZ B;  2EBO A;  5EZY A;  3OTO O;  1XRE A;  2KG7 B;  3JAL B;  3HPL C;  3N27 A;  4RUF A;  3ZCC A;  3FAV B;  2QKS A;  3LNN A;  3AK1 A;  1R6N A;  2JIZ G;  1BSM A;  2BOB C;  2WLI A;  3MHH C;  3F5W C;  1ZUQ A;  2EJR A;  3OTF A;  4P9O A;  2CAZ C;  4F6R B;  3G67 A;  1F51 A;  3CRQ A;  3RYC A;  2QWP B;  4O4H B;  3L9D A;  1P4R A;  4I55 B;  3RN4 A;  1FJG B;  3SJQ C;  3CJH B;  3JD4 A;  2VQF O;  1M56 C;  4W4L A;  2BE3 A;  3AEI A;  3FB8 C;  1PP9 H;  3LNM B;  4WFF A;  4FJC C;  4F6R A;  1SQV H;  4O4J B;  1MZF A;  1DK1 A;  4FLW A;  5L3B A;  1MA1 A;  5C8Y A;  4K0K B;  4MW3 A;  5LMN B;  2RCV A;  2E3C A;  1RM1 C;  4OPA A;  1FFX B;  4UV9 A;  2F93 B;  2QA4 V;  4WFH A;  1FS0 G;  2JJ2 G;  3EXA A;  1YTF D;  3SYP A;  4ABM A;  3JYC A;  3QNE A;  1R1B A;  3RYF A;  3TCU A;  1SET A;  2Q4P A;  4D7T A;  4J10 A;  5BZB A;  2HP8 A;  5IJ9 A;  2ETN A;  4AHC A;  4QNH B;  5L3G A;  3OEH G;  4GX2 A;  4PV1 B;  3L73 H;  2DN9 A;  1H38 A;  2L35 A;  2LFS A;  3ZMU A;  3IAY A;  5JVD A;  3UM7 A;  2UUB B;  1MSD A;  3LDE A;  1KEC A;  2Q68 A;  5KHG A;  4J7K A;  2X6A A;  3FX7 A;  4D6T H;  3M99 B;  1SQF A;  3ZJZ A;  1RP3 B;  3UO3 A;  1EM1 A;  2DJV A;  2NN4 A;  1IZ3 A;  4UB8 Z;  2GDS A;  3CCR V;  4P2Z A;  4NTW A;  2HG5 C;  2F4V B;  2ZIN A;  2DW4 A;  2P90 A;  1SES A;  1EN5 A;  3MDS A;  2JJ1 G;  1AI5 A;  3MAQ A;  4I50 A;  1VF7 A;  2BOC C;  4FM1 A;  3WB0 A;  1M90 W;  4UFZ A;  4N23 A;  4UV8 A;  1SKV A;  2QSA A;  5DN6 G;  1NR1 A;  1JFF B;  1NS1 A;  4R50 A;  5IYB O;  3AG1 C;  3AK2 A;  5JH7 B;  2QM8 A;  3CCL V;  1Y67 A;  4LFB B;  3G6E V;  4PA3 A;  3K0G A;  4QE9 A;  1XDC A;  3ZMV A;  1BHA A;  3ABT A;  3I56 V;  1KP2 A;  3RFR A;  4GZR B;  4ZOL A;  5EBM C;  5B1A C;  5EYP B;  1XNQ B;  1CEZ A;  4CS3 A;  4DR6 B;  4YIP A;  4JTD B;  5L3C A;  1AR4 A;  2DQ0 A;  2W6I G;  1ENV A;  3WG7 C;  2UXC B;  1Q86 W;  1KB9 F;  4I55 A;  1OHH G;  3M8A A;  1ZTE A;  1S0V A;  2ZR3 A;  2RN9 A;  3A0H Z;  1QLN A;  4LF6 B;  2QTS A;  5IJ0 A;  4UB6 Z;  4GT1 A;  2ZCE A;  3UCS C;  2P22 C;  3W7S A;  1VQL V;  2DYR B;  4U7N A;  1BL8 A;  5K1P A;  1KU9 A;  1M9N A;  1GN2 A;  1VQ5 V;  4MVM A;  4JYA O;  1Z5W A;  2JEX A;  4NXM O;  3CCV V;  5LXT B;  1M1K W;  4MSW C;  4NR1 A;  3RYI A;  4J7J A;  4BW9 A;  4H0L B;  2QKC A;  5IYC O;  3APQ A;  1XMQ B;  5FNV A;  4U3J B;  2XHB A;  4GUN A;  2VQE O;  5IYZ B;  1YCI A;  5GTH Z;  4JI0 B;  3JAR A;  2CGN A;  5H5N A;  1H2L A;  2RDC A;  1JQ0 A;  3VQX A;  4U7O A;  1HNX O;  4PA6 A;  3KCY A;  4DV6 B;  1R6T A;  1AVM A;  2YC0 A;  1Q90 D;  1K5Q A;  2XAQ A;  3CSX A;  1KUQ A;  3BHP A;  1I94 O;  4Z1V A;  2AZ0 A;  1Y4M A;  3BAB A;  3BAA A;  2RJZ A;  2QGN A;  4O4I B;  4AQY O;  1SF9 A;  2XAS A;  4JZG A;  1WA8 A;  2YI9 A;  4JTA B;  2F23 A;  4WFB V;  1W0J G;  3A0B Z;  2P4V A;  2EIM B;  3K3W A;  4LF4 B;  1WP7 A;  1H8E G;  3T1C A;  3OUF A;  3D36 A;  4BIZ A;  1GN3 A;  1P49 A;  2EIM C;  1PNK A;  1SC5 B;  1TA8 A;  3C90 A;  2XT9 A;  1XI1 A;  1XNQ O;  1VQP V;  3MD0 A;  3RVZ A;  4LH6 A;  2QEX V;  2LGW A;  4WF9 V;  2WLJ A;  5FPR A;  2A9H A;  4DV3 B;  3FD9 A;  2R9R B;  3U10 A;  3ZMT A;  4YJ2 B;  2WA4 A;  3OMI B;  5GW7 A;  5B5E Z;  1N34 O;  4B3R B;  3K5M A;  3ZBH A;  1ZWI C;  4ZIB A;  1UJW B;  1VF6 A;  3JAS A;  3RVY A;  1GM9 A;  5KX5 B;  1FXK B;  2ZNJ A;  3OMA B;  5EIB C;  2Q0A A;  4MTG A;  3ASN C;  2ZE6 A;  2FB5 A;  4TSF G;  4X1K A;  1HNW B;  2OYQ A;  3T4D A;  2LQT A;  1D5A A;  3L75 H;  4ZKI A;  1LNQ A;  1W59 A;  1PM9 A;  1GM7 A;  2Z3Y A;  1QNM A;  4ICG A;  1QHT A;  1WB7 A;  4DV3 O;  1LUV A;  1XL6 A;  4LNU A;  1GMG A;  2PGG A;  1YTF B;  2DMX A;  1OCZ C;  4PDM A;  1AR5 A;  1SZT A;  1VEW A;  4I0X B;  2D2C B;  1K4C C;  2ILM A;  3KZI Z;  2RQ6 A;  3JCU Z;  2ZR2 A;  1S5L Z;  1I0H A;  1OCC B;  1BQZ A;  1SQX H;  4P9P A;  4DR6 O;  1MZE A;  1XHX A;  5CB4 A;  4H44 B;  5LGU A;  2BSK A;  2IJK A;  5JVD B;  1N0N A;  4O2A B;  3EHB B;  4CH5 A;  4H33 A;  4TT3 G;  3K03 A;  3P3N A;  4UCT A;  1IUR A;  2Q7H A;  2FYU H;  3T1Y O;  4I5S A;  3UQ8 A;  5TIS Z;  4LR3 A;  5B1O A;  3ZIA G;  2CTW A;  2A06 H;  3ZRV A;  1HDJ A;  2CTP A;  3P30 A;  2WSS G;  4IHJ A;  1AJN A;  1NTM H;  2FTK A;  1WA8 B;  2UUB O;  2YXH A;  5J2T A;  1WPX A;  2K9P A;  5B1N A;  1U96 A;  1KD1 W;  3HKE B;  4JPR A;  2EIJ C;  2EZO A;  3FB7 C;  1NTZ H;  3CXC U;  4DUY O;  4TWK A;  2KG7 A;  3K06 A;  2Y4U A;  2JS5 A;  2UXX A;  5FPO A;  4R8C A;  4YY3 O;  3B40 A;  4LF8 O;  1W2B U;  2ARH A;  1VQM V;  4LFC B;  3AK3 A;  1BCC H;  2JRI A;  2UXB B;  1M57 B;  2PI4 A;  1EN4 A;  3FKS G;  1YJ9 V;  3SJA C;  1P84 F;  1DGS A;  1CXZ B;  4O2A A;  1IXM A;  4LFB O;  4CZZ A;  3UO2 A;  4AI8 A;  4DV7 B;  4JGS A;  4HAM A;  4XDJ A;  5LP6 A;  3R66 A;  1PL4 A;  2OIG A;  1EZJ A;  1Y76 A;  5C8Y B;  3FYE B;  4X62 B;  2DYS C;  2KB1 A;  4MT8 A;  4KHP O;  4PHZ A;  5A9G A;  1NH2 B;  4I4T B;  1FFT B;  2Q8V A;  5CA1 A;  2M6Y A;  2QKA A;  4DR5 B;  4J11 A;  3CX5 F;  2CGO A;  3BCC H;  2CUG A;  5EBW C;  3A2F A;  4DK1 A;  5D5Q A;  5B1B B;  2VWJ A;  1ZL8 B;  2OCH A;  4ZI7 A;  4FFK A;  1X4T A;  1K3E A;  3RYC B;  2N74 A;  4LFC O;  1X59 A;  1NT2 B;  1VP7 A;  4DO2 A;  1S5J A;  5JJE B;  1Y74 A;  3JSN A;  1L8D A;  4X88 A;  4D7S A;  3HKC A;  1GO3 F;  5EYP A;  1QVG U;  4JTC B;  3APO A;  3VBB A;  4FLX A;  4K0K O;  4B3M B;  2XOK G;  3CYO A;  4PA7 A;  1KQS U;  4W4K A;  1XQ8 A;  1FKA O;  1VMG A;  3OT7 A;  5JH7 A;  3UT5 B;  2PYL A;  4YJ2 A;  2OCC C;  1BQ0 A;  1GKF A;  4IHJ B;  1F4N A;  3A8T A;  1EFR G;  4Z1M G;  2L6L A;  1GTO A;  4I50 B;  3C3T A;  3FFQ A;  5H2F Z;  3CME V;  5LGN A;  2QDO A;  2NR5 A;  5CBH A;  1WN7 A;  3RYH B;  3VOU A;  1GK9 A;  4HZ3 A;  3WFV A;  1N36 O;  1Q5O A;  2Y48 A;  3TXQ A;  3QF7 A;  1YIJ V;  1JR9 A;  1YVW A;  4FPP A;  1QVF U;  1SRY A;  3E86 A;  2ZXW C;  5CA0 A;  3K0D A;  2Q9L A;  2XUM A;  1R3J C;  1F4M A;  1Q82 W;  4KXR A;  2YIA A;  2QJ1 A;  3CEI A;  3G80 A;  4B7E A;  4JYY A;  4B3S O;  3B77 A;  3LDC A;  1IXB A;  4B3S B;  1E1Q G;  1YSC A;  4G2K A;  1AI6 A;  3J7A U;  5EC1 C;  2Q73 A;  3DSQ A;  1H2N A;  1HR0 O;  1PNL A;  4JF3 A;  3HKC B;  4DR3 B;  3E22 B;  5ITZ A;  1NQT A;  1QCE A;  3JAK A;  1Y6X A;  4UCU A;  3W7X A;  1JMK C;  3D8C A;  2FKX A;  3MHS C;  3E83 A;  1VF5 B;  4DV4 B;  3JAR B;  5L3F A;  4JV5 B;  3P32 A;  2JGD A;  4LC1 A;  4X89 A;  1NTK H;  1G8M A;  2FL4 A;  1Z5V A;  3CMA V;  3RYF B;  4JAS A;  3CD6 V;  1KYO F;  4NTX A;  1AIL A;  5CA3 A;  4JYC A;  2PF4 E;  4DUY B;  1FXV A;  2IH1 C;  5DED A;  4JI6 O;  4FLY A;  1FFX A;  4LF7 B;  3E89 A;  4HYO A;  4B3R O;  2YIB A;  4DV6 O;  3QO8 A;  2W0X A;  2X6B A;  4BAY A;  1GN6 A;  4EB6 A;  3LSU A;  2Y4T A;  4BR6 A;  2OWO A;  2O57 A;  4YHH B;  2ADP A;  5LP6 C;  2UXB O;  1NU1 H;  2V7Q G;  1HNW O;  4NXN O;  2P7T C;  1G6U A;  3CJH A;  2DE0 X;  3TK1 A;  3X2Q B;  4GKK B;  2Q6A A;  1VF6 C;  2EJ7 A;  2HLD G;  3AG2 C;  3ABK C;  2WLH A;  1AP6 A;  3I55 V;  2ZD9 A;  4DR2 O;  3IFX A;  3SR2 C;  4JI2 B;  1ROP A;  5B1B C;  1SQP H;  3I5D A;  1GM8 A;  2EIK B;  4DV2 O;  4X1I A;  3S3W A;  1D5N A;  3SJC C;  3K58 A;  1LUW A;  4CBC A;  1JA8 A;  5IY5 B;  1SQB H;  3BRC A;  3JD1 A;  3Q4H A;  1M5I A;  2P67 A;  4FLZ A;  5LOV B;  3H1K H;  1BMF G;  2UUC O;  1U97 A;  2MW2 B;  1J95 A;  4X64 O;  2QR4 A;  1SER A;  2WLN A;  4LFA B;  1CPY A;  4DR1 O;  4DV0 B;  3GWK C;  3LDD A;  1B06 A;  1SQQ H;  3BFR A;  1DF5 A;  3ML0 A;  2RNB A;  4F6E A;  2JGU A;  5KAI Z;  4ZHQ A;  1IBL B;  2XTA A;  4GKK O;  1ORQ C;  2X6C A;  4TQD A;  1XMQ O;  2F4V O;  2JDI G;  3ZN0 A;  4FLU A;  2NNU A;  4I7Z B;  1QBZ A;  4DV5 B;  4J9Z B;  3H01 A;  1KKC A;  2QTO A;  5DEC A;  4MVZ A;  1NVP D;  5ITZ B;  4LF5 B;  1I94 B;  3JAW A;  1T5E A;  1TGO A;  2HFE C;  2H94 A;  2IJI A;  4WFE A;  2E75 B;  3G71 V;  4MTF A;  1K8A W;  1K34 A;  1PKX A;  2BTQ A;  3JAW B;  4JI3 B;  2UUA O;  1XEQ A;  3STZ C;  1XUQ A;  4FIP C;  2YS8 A;  3H1L H;  3K5O A;  3DGE A;  2B1G A;  2A79 B;  4RO2 A;  2E5L B;  2W6J G;  4WFA V;  1XIL A;  5LHI A;  3AG1 B;  3K59 A;  3RYH A;  2FML A;  4ASU G;  3IC9 A;  2QWN B;  4IYI A;  1OCR C;  2F1M A;  1YXB A;  1PL0 A;  5L3E A;  1H2M A;  2ZDI A;  4RUE A;  1MSW D;  4PA9 A;  5KHH A;  3RBZ A;  4LBE C;  5CBG A;  2ADQ B;  2R72 A;  2VRZ A;  4UCR A;  5BMV A;  5LMN O;  2LW1 A;  1IVS A;  1PD3 A;  1MG1 A;  1HR0 B;  2IH3 C;  1ZX3 A;  3ETG A;  4GCZ A;  2UXC O;  1L1F A;  3JSL A;  4K3A A;  4IYH A;  2IM9 A;  2PI5 A;  3ICX A;  3OM3 B;  5BR8 B;  4WFG A;  3B2E E;  3D3I A;  2IBZ H;  1K9M W;  1K33 A;  3ETD A;  3RT3 C;  1R3I C;  1Q6U A;  3M7M X;  3IGA C;  2HHH B;  2IW5 A;  3ZHU A;  1V54 C;  4KFM A;  1BE3 H;  2A3Q A;  1OZ0 A;  3CCM V;  4I4T A;  1VQ6 V;  5JJJ B;  4LCU C;  4EFE A;  4RAI A;  2KKW A;  4NB5 A;  4XDL A;  1IBM B;  2F95 B;  4JI5 O;  2WLM A;  1OCO C;  3DC6 A;  3W7T A;  1GAX A;  2Y0P A;  3ZRW A;  5BXZ A;  2XAF A;  3IC7 A;  3JAL A;  2OIE A;  3H9V A;  3SPC A;  1OCC C;  3FYI B;  3SYC A;  1N33 B;  4WBN A;  2GSM B;  1RSO A;  1VQK V;  4LWS A;  2B5U A;  2DYR C;  4KP4 A;  4G27 B;  5B66 Z;  3OW2 U;  4DUZ O;  1HP8 A;  3ZX6 A;  5IJ9 B;  4IIJ A;  5FNV B;  4MTX A;  1I08 A;  2Z0A A;  2GHY A;  1XBL A;  2Y69 B;  3JAT A;  5LGT A;  4I9Q A;  3ABL B;  3G6B A;  1N4C A;  1RFY A;  4GX1 A;  4DR4 O;  4UCO A;  3HKD B;  4DR4 B;  4JI1 O;  2ITC C;  1OV9 A;  3L71 H;  5H6Q A;  1M4U A;  1J5E B;  4QE7 A;  1L0L H;  5IWA B;  3VQV A;  2YI8 A;  2BCC H;  3H1J H;  3L74 H;  3NR7 A;  1DTO A;  4GKJ O;  4OXS A;  1R73 A;  4DV2 B;  1KP3 A;  2P06 A;  1NI8 A;  5IJ0 B;  3GB7 C;  1RM1 B;  1QR8 A;  4OX9 O;  2JS3 A;  2V1D A;  3DXR A;  3QO7 A;  3K04 A;  3OR7 C;  3UKM A;  3CCJ V;  4JI8 O;  4CC5 A;  2EX3 A;  1Q3E A;  3OD4 A;  4Z2W A;  2OCC B;  4E4E A;  5LHH A;  3DTU B;  5KHJ A;  4JV5 O;  1YF2 A;  5JQG A;  4TV8 B;  4DV4 O;  2QWR B;  1E1R G;  4RQF A;  2YXY A;  1NJI W;  3ASO B;  1BHB A;  4C7U A;  2CTR A;  4YJ3 B;  4PI2 A;  4BIO A;  4CH6 A;  1TVK B;  2ZDI C;  1FAF A;  3K9A A;  3KCX A;  2UXD B;  2OT5 A;  5LL6 Y;  2DWD C;  5BR8 O;  4HNA B;  2GBO A;  4FLT A;  1JFF A;  1LR1 A;  1VQN V;  5JCO A;  1PPJ H;  1JJO A;  1N33 O;  1XMO O;  5LBQ A;  4X66 B;  4OX9 B;  4TV8 A;  3EFF K;  3SPG A;  1RPO A;  2N04 A;  3O65 A;  5E1A C;  3HB3 B;  5J2U B;  4H13 B;  4X9Q A;  4JYB A;  1SQG A;  4X1Y B;  1FYJ A;  2ITD C;  3J81 N;  3B8M A;  2Q5Z A;  2YEV B;  1YHQ V;  4DRX A;  1D2D A;  1MAB G;  4MVS A;  3WB2 A;  2GTA A;  1E79 G;  5LYJ B;  1AP5 A;  4TUY A;  4OPH A;  3ZED A;  4X20 A;  2HR3 A;  3VQW A;  4CS2 A;  5LMU B;  2A7W A;  1GRJ A;  2E74 B;  4QPK A;  3WU2 Z;  3SYA A;  2UXD O;  3CRR A;  3D3Q A;  2KQX A;  2PY5 A;  4UCV A;  2AGA A;  3AG3 B;  4JI5 B;  1XOU A;  1NVP B;  4J41 A;  1TUB A;  3J80 N;  5LA6 B;  3CCE V;  1VQ4 V;  1S76 D;  5L3D A;  1FJG O;  1JOY A;  4JI0 O;  3CRM A;  1F7Y A;  2IU3 A;  3E8H A;  4IIJ B;  1W0K G;  1WP8 A;  3BA9 A;  1YIT V;  4QIW F;  3WG7 B;  1SZX A;  1K4D C;  4LF8 B;  3DXR B;  1IBL O;  2HEP A;  3L72 H;  1XL4 A;  5KHK A;  3JCZ A;  3SYO A;  4FM0 A;  3CC2 V;  1M93 A;  2CK3 G;  4DV1 B;  5KUK A;  2YSU B;  3SPI A;  2AZ2 A;  4LF4 O;  4MVU A;  2E76 B;  4I9W A;  4YJ3 A;  2Y69 C;  5H6R A;  3ABL C;  4Q20 A;  4DYL A;  3CB2 A;  3CP1 A;  4X62 O;  2ZXW B;  3K5N A;  1JJ2 U;  1MNG A;  3CRC A;  4NVP A;  2R9I A;  2PYJ A;  1ZAU A;  1TUE B;  2M7W A;  1SA0 A;  3N2G A;  5HFL A;  2B1I A;  5IYZ A;  4O4H A;  3N2K B;  1H2K A;  1I5Y A;  1K97 A;  1HNZ B;  1YZB A;  4PJ0 Z;  1WAZ A;  1R6K A;  2N05 A;  3AG7 A;  3C3S A;  3JD3 A;  4P30 A;  3CCU V;  4EKW A;  2Q69 A;  4NYK A;  3WB1 A;  2AXT Z;  5KAF Z;  2UUA B;  4LP8 A;  3P3P A;  3QO5 A;  3B4S A;  5EZY B;  4FZ0 A;  1V54 B;  5GON A;  3T4Z A;  3CRA A;  4MS2 A;  1IBM O;  1OJH A;  4DRX B;  1PV0 A;  3ZHQ A;  2CTQ A;  2YEV A;  3N2K A;  4R7C A;  2JGD B;  2VQF B;  3AG4 B;  1A32 A;  4X1Y A;  3ZRX A;  2RMK B;  2UU9 O;  4RQE A;  2IJJ A;  2LGQ A;  5LA6 A;  2GV9 A;  4LH7 A;  4K8Z A;  4X1K B;  1AJQ A;  2ZKO A;  3JAK B;  5CMU A;  5KA6 A;  2C2A A;  2EIJ B;  4CH3 A;  2VQE B;  1KMI Z;  2AW9 A;  3OR6 C;  3OMN B;  3BY6 A;  2GTS A;  3AG4 C;  4J7Z A;  3SJB C;  3ZRW B;  1HNZ O;  2PZS A;  4EEQ A;  3BPZ A;  2YDE A;  1TVK A;  1NR7 A;  2CH7 B;  5J9P C;  2WLL B;  4FFB A;  4NXN B;  4DV0 O;  2LFR A;  1P7B A;  2PTM A;  2G38 A;  1R3L C;  2HVJ C;  1KBH A;  1JCH A;  4QJF B;  5EK0 A;  3CCQ V;  2EIK C;  5J2U A;  4XBF A;  4EFB A;  1UPG A;  4PD4 F;  4BW5 A;  3ASN B;  1V9P A;  1R3K C;  1WLE A;  3O9O A;  1Q6I A;  3THO A;  2BSK B;  2X0L A;  3TJT A;  4IL6 Z;  5CB4 B;  3STL C;  4HNA A;  3CWB H;  4FFB B;  4DV1 O;  2YID A;  2EUL A;  4TOI A;  3UT5 A;  2CH7 A;  1VQO V;  1YDX A;  3E35 A;  4HBN A;  1OCZ B;  5KUM A;  1Q6H A;  2WA3 A;  3BVO A;  3AG3 C;  1WJZ A;  4TUY B;  1THZ A;  2NLJ C;  2X7R B;  4X1I B;  1EBO A;  2ATK C;  3ABK B;  2ZQM A;  2ZE5 A;  2UUC B;  2ZM6 B;  4YHH O;  5H9C A;  4IGG A;  4DR3 O;  4O4L B;  5JCO C;  4K8X A;  3CC7 V;  1I7F A;  1AI7 A;  4JI4 O;  1EZV H;  1K92 A;  3EVK A;  4DW0 A;  4JAV A;  3ABM B;  4TV9 A;  4U3J A;  4NKG B;  3S3X A;  5IY5 C;  4FVM A;  2DOS A;  1V55 B;  3IJ4 A;  1BGY H;  1RSO B;  2CE4 A;  4GLX A;  4X8A A;  1K5S A;  3GWO A;  5LXT A;  1QLE B;  3ZS8 C;  2EIL B;  3K79 A;  3RW0 A;  2KSD A;  1BS3 A;  5FLX N;  1N34 B;  2PUS A;  2H8P C;  3QG5 A;  2WAM A;  4B3T O;  4MVO A;  3AG2 B;  3HKD A;  2ZE7 A;  4FMT A;  1YEW A;  2LW7 A;  4X66 O;  3CCS V;  5A2Q N;  5DM6 V;  3CS5 A;  5CN0 A;  4ZBM A;  1QLE C;  1QU7 A;  3JAT B;  2LJ2 A;  4DUZ B;  3ETE A;  1XNR O;  3HKB B;  4PDR A;  4KHP B;  3FB5 C;  1ZLZ A;  1NH2 D;  2Q67 A;  4MVR A;  4LF9 B;  1DF4 A;  2WLK A;  1OCO B;  4LWS B;  3T2M A;  5EBL C;  1SA0 B;  3N2G B;  4WBN B;  1G1X B;  1L0N H;  4KUM A;  4UVB A; 
#chains in the Genus database with same CATH homology
 2ITC C;  4JGS A;  5H6Q A;  4BIU A;  5L3B A;  4HAM A;  4QE7 A;  4YXW G;  2W0F C;  2WLI B;  1COW G;  4XDJ A;  4UXN A;  4MW3 A;  1EZJ A;  1DTO A;  1RM1 C;  3FYE B;  4OXS A;  1R73 A;  2DYS C;  1KP3 A;  2KB1 A;  4MT8 A;  4UV9 A;  1KKD A;  3ZMZ A;  2QA4 V;  4WFH A;  1NH2 B;  1FS0 G;  2JJ2 G;  1FFT B;  3GB7 C;  1QR8 A;  1RM1 B;  1JPX A;  2IU0 A;  2V1D A;  3QO7 A;  1YTF D;  5EBW C;  3SYP A;  3JYC A;  3QNE A;  3K04 A;  3OR7 C;  3UKM A;  3CCJ V;  3TCU A;  1SET A;  5B1B B;  5BZB A;  4QNH B;  5L3G A;  2DYS B;  3OEH G;  4GX2 A;  2OCC B;  1H38 A;  1K3E A;  2LFS A;  3ZMU A;  1KC8 W;  5LHH A;  3DTU B;  3UM7 A;  1F23 A;  4DO2 A;  3LDE A;  3R65 A;  1KEC A;  2Q68 A;  1E1R G;  4X88 A;  4RQF A;  1GO3 F;  1NJI W;  2X6A A;  4JTC B;  3VBB A;  1QVG U;  3ASO B;  2XOK G;  1BHB A;  3M99 B;  3CYO A;  4PA7 A;  1KQS U;  3F7Y C;  3ZJZ A;  2ZDI C;  3LSQ A;  1V55 C;  3K9A A;  2OT5 A;  2DWD C;  2OCC C;  1VQN V;  1GKF A;  4DXW A;  1F4N A;  4N21 A;  1EFR G;  4Z1M G;  4QPJ A;  5LBQ A;  2OTJ V;  3ABM C;  1GTO A;  4PDL A;  3CPW U;  3CCR V;  1I5X A;  4P2Z A;  3EFF K;  3W7U A;  3CME V;  1ARO P;  3E8F A;  2HG5 C;  5LGN A;  5IYD O;  3SPG A;  1RPO A;  2DW4 A;  5CBH A;  2P90 A;  5E1A C;  1SES A;  3HB3 B;  2JJ1 G;  1AI5 A;  4JYB A;  2JK5 C;  3VOU A;  1GK9 A;  4HZ3 A;  3WFV A;  2Y48 A;  5B1A B;  2BOC C;  2DWE C;  3LUT B;  2D3O W;  2ITD C;  1YIJ V;  3B8M A;  3F7V C;  4FPP A;  1M90 W;  2YEV B;  1QVF U;  1SRY A;  4N23 A;  3E86 A;  4UV8 A;  2ZXW C;  5DN6 G;  1YHQ V;  1NR1 A;  3K0D A;  1R3J C;  1F4M A;  1MAB G;  4MVS A;  4R50 A;  5IYB O;  2AHZ A;  1Q82 W;  1E79 G;  5C93 A;  3AG1 C;  2QM8 A;  3CCL V;  2HR3 A;  3SPH A;  1JVM A;  2WPD G;  3B77 A;  3G6E V;  3LDC A;  4PA3 A;  3K0G A;  3SYQ A;  1E1Q G;  1YSC A;  4G2K A;  1AI6 A;  4QE9 A;  3ZMV A;  5LHG A;  4PEL A;  5EC1 C;  1BHA A;  3ABT A;  4GX5 A;  4QPK A;  3I56 V;  3SYA A;  1KP2 A;  1PNL A;  4JF3 A;  5EBM C;  5B1A C;  2F43 G;  1NQT A;  3AG3 B;  1QCE A;  1CEZ A;  4H37 A;  4L87 A;  3W7X A;  1NVP B;  4JTD B;  5L3C A;  3CCE V;  1VQ9 V;  4PA4 A;  2DQ0 A;  1VQ4 V;  1S76 D;  3MHS C;  3E83 A;  2W6I G;  1ENV A;  2HKO A;  5L3D A;  1JOY A;  3WG7 C;  2XND G;  1Q86 W;  5L3F A;  2IU3 A;  3P32 A;  3E8H A;  1OHH G;  1W0K G;  1S0V A;  4LC1 A;  2ZR3 A;  4X89 A;  2LP7 A;  1G8M A;  1YIT V;  4QIW F;  1QLN A;  1H2G A;  3WG7 B;  1K4D C;  3CMA V;  4JAS A;  2HJF C;  4J9Y B;  3CD6 V;  1CP9 A;  1XL4 A;  3JCZ A;  3SYO A;  4GT1 A;  5CA3 A;  3W7S A;  1VQL V;  2DYR B;  4JYC A;  4U7N A;  1K7D A;  2WLL A;  3CC4 V;  1FXV A;  2IH1 C;  3CC2 V;  1VQ8 V;  2CK3 G;  3OFN G;  3OUS A;  1BL8 A;  5KUK A;  1H8H G;  2YSU B;  3SPI A;  1M9N A;  4MVU A;  3E89 A;  4HYO A;  1AI4 A;  4I9W A;  4JAU A;  4UVC A;  3B8N A;  1VQ5 V;  3QO8 A;  2X6B A;  1G4Y B;  2Y69 C;  4BAY A;  5H6R A;  1NBM G;  3ABL C;  4Q20 A;  4MVM A;  3CP1 A;  2JEX A;  4XDK A;  2ZXW B;  1JJ2 U;  3CCV V;  1S3J A;  1OCR B;  3NXS A;  2DQ3 A;  1M1K W;  4MVQ A;  4MSW C;  1M57 C;  1HWY A;  2R9I A;  2V7Q G;  4R6Z A;  1TUE B;  5IYC O;  2M7W A;  2P7T C;  3OAA G;  2AHY A;  5HFL A;  3TK1 A;  3X2Q B;  4MTO A;  2B1I A;  2Q6A A;  2HLD G;  3AG2 C;  2UXN A;  3ABK C;  1B6Q A;  1K97 A;  1I5Y A;  2WLH A;  3I55 V;  2ZD9 A;  1JQ0 A;  4U7O A;  3IFX A;  5FL7 G;  1R6K A;  3PJS K;  4PA6 A;  1ROP A;  4UUJ C;  3JD3 A;  5B1B C;  4P30 A;  2P6J A;  1GM8 A;  1K5Q A;  2EIK B;  2XAQ A;  3CCU V;  3E8G A;  1DLB A;  3ZRS A;  4EKW A;  5B3S B;  2EIN C;  2Q69 A;  4CBC A;  1Y4M A;  5IY5 B;  2EZP A;  1FXK C;  4LP8 A;  3QO5 A;  1S77 D;  1K73 W;  2XAS A;  3JD1 A;  1V54 B;  2P67 A;  1M56 B;  3T4Z A;  1QR9 A;  4JTA B;  1BMF G;  4WFB V;  1YI2 V;  1W0J G;  4MS2 A;  1J95 A;  2EIM B;  3K3W A;  1SER A;  2WLN A;  2XAG A;  2YEV A;  3OEE G;  1H8E G;  1CPY A;  3T1C A;  4R7C A;  3OUF A;  1NKD A;  3D36 A;  3LDD A;  4BIZ A;  3AG4 B;  1Y66 A;  1DF5 A;  2EIM C;  3ASO C;  3ML0 A;  1PNK A;  3E8B A;  5IDJ A;  3ZRX A;  4MW8 A;  4E2L A;  4RQE A;  2IJJ A;  1ORQ C;  2X6C A;  2JDI G;  4PDV A;  3ZN0 A;  1VQP V;  1FXH A;  2NNU A;  1AJQ A;  3MD0 A;  2QM7 A;  3RVZ A;  3SPJ A;  1PNM A;  2QEX V;  1QBZ A;  5CMU A;  5KA6 A;  2C2A A;  2EIJ B;  4J9Z B;  3H01 A;  4WF9 V;  2WLJ A;  2QTO A;  2A9H A;  2WWW A;  5HFM A;  3OR6 C;  3OMN B;  4MVZ A;  3BY6 A;  4WCE V;  1NVP D;  2R9R B;  3AG4 C;  3ZRW B;  5KA5 A;  3G4S V;  3ZMT A;  3OMI B;  5GW7 A;  2HFE C;  2H94 A;  2IJI A;  4WFE A;  1NR7 A;  3K08 A;  1N8R W;  5J9P C;  3BEH A;  1ZWI C;  3G71 V;  1UJW B;  2WLL B;  4MTF A;  3ZMS A;  1K8A W;  1K34 A;  2LFR A;  1PKX A;  2MK3 A;  3RVY A;  1RPR A;  1GM9 A;  1MOF A;  1YJW V;  3OE7 G;  1P7B A;  4GX0 A;  1FXK B;  2XAH A;  3STZ C;  2HVJ C;  1R3L C;  3OMA B;  4FIP C;  2EIL C;  1JCH A;  2Z5U A;  3DGE A;  2B1G A;  2A79 B;  4FK5 C;  4MTG A;  4RO2 A;  4QJF B;  3ASN C;  5EK0 A;  2W6J G;  4WFA V;  4TSF G;  3CCQ V;  5LHI A;  3AG1 B;  2EIK C;  4F4L A;  4XBF A;  3T4D A;  3TET A;  3JD0 A;  4ASU G;  4BW5 A;  3ASN B;  1R3K C;  4ZKI A;  1OCR C;  1LNQ A;  1WLE A;  1GM7 A;  2Z3Y A;  1PL0 A;  5L3E A;  3OGC C;  1JX9 A;  2X0L A;  2ZDI A;  1XL6 A;  3ABU A;  5CBF A;  4RUE A;  1MSW D;  1GMG A;  3STL C;  4PA9 A;  1YTF B;  3RBZ A;  4LBE C;  5CBG A;  1FXK A;  1OCZ C;  4PDM A;  1SZT A;  1VQO V;  1K4C C;  3E35 A;  1OCZ B;  5KUM A;  2A0L A;  2ZR2 A;  3AG3 C;  3FB6 C;  2OTL V;  1OCC B;  4G28 B;  3LSS A;  1PD3 A;  1THZ A;  1MG1 A;  2NLJ C;  4P9P A;  2X7R B;  1EBO A;  2ATK C;  2IH3 C;  3ABK B;  1AR1 B;  2ZQM A;  3ETG A;  3A0R A;  4GCZ A;  5LGU A;  1L1F A;  2IJK A;  5H9C A;  2PI5 A;  3EHB B;  3CC7 V;  3OM3 B;  1S5H C;  4H33 A;  4TT3 G;  4WFG A;  1AI7 A;  3K03 A;  3W7W A;  1Q81 W;  1K92 A;  2HVK C;  3D3I A;  4JAV A;  3ABM B;  1AJP A;  2QE7 G;  1S72 V;  4I5S A;  1K9M W;  1K33 A;  3ETD A;  1R3I C;  5B1O A;  3ZN1 A;  3KG2 A;  5EC2 C;  3ZIA G;  1YJN V;  5IY5 C;  3IGA C;  2K1E A;  1V55 B;  3ZRV A;  1VQ7 V;  2XAJ A;  3JD2 A;  3E2E A;  1Q7Y W;  2IW5 A;  2IJH A;  1V54 C;  3P30 A;  4KFM A;  2WSS G;  4X8A A;  1AJN A;  5B3S C;  1K5S A;  2EIN B;  1OZ0 A;  2JEU A;  3X2Q C;  3CCM V;  3GWO A;  4UVA A;  2FTK A;  1VQ6 V;  2EBO A;  4LCU C;  1QLE B;  4RAI A;  2EIL B;  3K79 A;  3HPL C;  4RUF A;  3RW0 A;  4XDL A;  3ZCC A;  1WPX A;  2H8P C;  2WLM A;  2QKS A;  1OCO C;  5B1N A;  1KD1 W;  1R6N A;  2JIZ G;  3W7T A;  4JPR A;  3ZRW A;  2EIJ C;  2WAM A;  2XAF A;  4MVO A;  2BOB C;  2WLI A;  2EZO A;  3FB7 C;  3MHH C;  3F5W C;  3CXC U;  2EJR A;  3AG2 B;  3IC7 A;  4TWK A;  4P9O A;  4FMT A;  3K06 A;  2UXX A;  3CCS V;  5CN0 A;  1OCC C;  3FYI B;  4R8C A;  4ZBM A;  3SPC A;  3SYC A;  5DM6 V;  1QLE C;  1F51 A;  2GSM B;  3ETE A;  1VQK V;  1W2B U;  1VQM V;  2B5U A;  2DYR C;  4KP4 A;  4PDR A;  4G27 B;  3OW2 U;  1M57 B;  3FB5 C;  2PI4 A;  1P4R A;  3FKS G;  1NH2 D;  2Q67 A;  4MVR A;  4MTX A;  3SJQ C;  3JD4 A;  1DF4 A;  1M56 C;  2WLK A;  1YJ9 V;  2GHY A;  1OCO B;  3T2M A;  2Y69 B;  5EBL C;  5LGT A;  3ABL B;  3AEI A;  3FB8 C;  1IXM A;  4GX1 A;  4CZZ A;  3LNM B;  4WFF A;  4FJC C;  4KUM A;  4UVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...