3R65A

Mthk channel pore e92q mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVQRLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crucial points within the pore as determinants of K+ channel conductance and gating
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Membrane protein
molecule keywords Calcium-gated potassium channel mthK
total genus 30
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3r65A00
1OCOC 4PDRA 3FB7C 3LDDA 3UM7A 1XL6A 1R3JC 4R8CA 4DXWA 2EIJC 2WLIB 3AG1C 3RVYA 2EINC 3F5WC 3SYCA 2IH3C 4CBCA 3E8GA 4R50A 3K0GA 2Q69A 2WLJA 4PA9A 5EBLC 2X6BA 2X6CA 2Y69C 1OCRC 3JYCA 4WFEA 3GB7C 5EC2C 3STLC 3X2QC 4MW3A 3F7YC 3E89A 4PA6A 4MVOA 3SYAA 2WLLA 4G27B 2HJFC 1G4YB 3ABKC 4GX2A 4PDMA 2HG5C 4I9WA 3ABLC 4QNHB 4JTDB 2WLMA 3ASNC 2ZXWC 4EKWA 3EFFK 4BW5A 1V54C 4JTCB 4G28B 5EBMC 2IH1C 5J9PC 3AG2C 1LNQA 5CBHA 1S5HC 2ZD9A 3E8BA 4MW8A 1ORQC 2JK5C 4P9OA 3ZRSA 3IGAC 4P9PA 4RUEA 1XL4A 3LDCA 1R3IC 4MVRA 1J95A 3FB6C 1M56C 3T1CA 4PA3A 4HYOA 3LDEA 3SYQA 3ABMC 2A9HA 4WFGA 5BZBA 4XDJA 2AHYA 3FB5C 4F4LA 2WLNA 3E8FA 3OUFA 1R3KC 2W0FC 3AG4C 3SPCA 4QE9A 4UUJC 3WG7C 3ZJZA 4J9YB 1JVMA 4JTAB 4P2ZA 4MTGA 2Q67A 2R9RB 3SPHA 3T2MA 4GX5A 2EIKC 2EILC 3IFXA 3LNMB 4H33A 2BOBC 5KUMA 4MS2A 1K4CC 3AG3C 3OR6C 2EIMC 2WLHA 3OR7C 4GX0A 4KFMA 4MVQA 4P30A 4X88A 3SYPA 1BL8A 3E83A 4MTFA 4MVMA 2X6AA 4X89A 5IY5C 4R6ZA 3ASOC 4MSWC 2Q6AA 2ATKC 2A0LA 2H8PC 2WLLB 3K08A 2DWDC 3RW0A 4PDLA 3BEHA 2BOCC 2AHZA 3FB8C 2QKSA 4LP8A 3TETA 3KG2A 4RAIA 5EK0A 4LBEC 3RBZA 2WLIA 1QLEC 2HVJC 2OCCC 4RUFA 4PDVA 3VOUA 2K1EA 2WLKA 5CBFA 1M57C 4XDKA 4XDLA 3PJSK 2YEVA 3SPJA 3K0DA 2ITCC 4LCUC 5B1BC 3SPIA 2NLJC 3SYOA 1OCZC 2DYRC 4TWKA 4WFHA 1V55C 5E1AC 5EC1C 3SPGA 4H37A 4MVUA 1R3LC 4RO2A 5CBGA 3K04A 1KKDA 2HFEC 4PA4A 3R65A 4GX1A 3UKMA 4WFFA 2HVKC 3T4ZA 3SJQC 4OXSA 4X8AA 3OUSA 2ITDC 2DWEC 3E8HA 2KB1A 3RVZA 4ZBMA 1P7BA 4HZ3A 2P7TC 2QTOA 1ZWIC 4QE7A 4MVZA 3E86A 2A79B 3F7VC 3K06A 5B1AC 3T4DA 5B3SC 3LUTB 4MTOA 2DYSC 4J9ZB 1K4DC 1OCCC 2Q68A 4MVSA 3HPLC 4PA7A 4R7CA 5EBWC 3TCUA 5KUKA 3STZC 3K03A 3OGCC
chains in the Genus database with same CATH superfamily
4DV6B 2X7RB 1TUEB 1WB7A 1QBZA 5HFMA 1IX9A 4U7NA 4LF8O 4FPPA 4KHPB 1FAFA 3OD4A 1O9HA 1PL4A 3LSQA 4AILC 1OV9A 5EC2C 3BA9A 3STLC 1JMKC 1B06A 1AJQA 3UCSC 5B66Z 1RM1B 4GCZA 3RWRD 1TA8A 2CTWA 4EKWA 1H2LA 1FXKA 2IH1C 3ETDA 4TSFG 2DQ0A 3B2EE 2N05A 3E8BA 1ORQC 3JD2A 5BMVB 1M9NA 4YY3O 1A32A 1VQPV 4B3RB 2C2AA 4DUZO 2PTMA 4JI4B 4LF7O 2ETNA 5BMVA 4JI2O 3T1CA 2D3OW 3OW2U 2ZNIA 5GONB 5BZBA 2ZIOA 1QHTA 3E8FA 3K3WA 1R3KC 2W0FC 1XNRO 5K1PA 1XOUA 1IDSA 4P2ZA 1HNZB 4FZ0A 4BAYA 1I08A 2Q67A 3P3PA 2EIKC 1MZEA 3EHBB 3QTCA 4MTFA 4ICGA 4HNAB 3AG7A 3QO5A 1I0HA 3W7TA 2H3OA 4OPHA 2QDOA 4E4EA 5KA6A 3K5NA 1IBLB 2L35A 3KG2A 1KUQA 2ZQMA 1FXVA 2V4DA 4RWUA 4O4JB 3SPJA 1M93A 5KLVH 4JYCA 5E1AC 2D2CB 3ABTA 2A7WA 1F23A 4OXSA 4JI6B 2DWEC 2ZINA 5E79Z 3N2GA 2FKXA 3ABUA 5K1XA 1E1QG 2OT5A 3E86A 1BQ0A 4I5SA 4CH3A 4MTOA 1V55B 1HWYA 3HKCA 2E5LO 3K03A 4K8XA 1I7FA 2F66C 3ABKB 2EINC 3F5WC 1XDCA 4TV9A 3K5LA 1XHZA 2WLJA 1R6TA 2F1MA 2Y69C 4QGPA 1GKFA 4B3SB 1HP8A 4JYAB 4G27B 2HJFC 1PM9A 1YJ9V 3CXHF 2YIBA 2Q4PA 4QNHB 1Q81W 1AR5A 1Q43A 3L73H 3ASNC 3OT7A 2UU9O 1ZSPA 1H2GA 5TISZ 1I5YA 5LHGA 1IXBA 3ETEA 5CBHA 1D5AA 3D36C 2GBOA 4O4HA 3N27A 3KCXA 3R66A 1P4RA 3K5MA 3MD0A 1Y6XA 4FLVA 4CC5A 2HHHB 2UUCB 1VQLV 5CA1A 2LW7A 2R9RB 1N0NA 3U0ZA 1K4CC 1JJ2U 3TETA 1SC5B 4KFMA 1SERA 4X1KA 4FZ1A 5KX5B 1NU1H 1QLNA 1WAZA 2AHZA 1U96A 3HKBA 1F4NA 1SZTA 4I0XB 3RYFA 2K1EA 1M57C 5ITZB 4LCUC 4DV5B 3RYHB 2EX3A 1R3LC 2IM9A 3NR7A 3ZHQA 3KKYA 1EBOA 3M99B 4X20B 4G2KA 4LWSA 4O4JA 1KECA 5FPRA 2P7TC 3ZRWB 4J10A 2DW4A 4B7KA 5J2UA 3CCEV 2DYSC 4GKJO 1Y74A 2ZXWB 3ZEDA 3ZHVA 1R1BA 1AILA 3Q4HA 1NS1A 5L3DA 1Q5OA 5IJ9B 3VQXA 5LA6B 3CMAV 2Y4TA 2Q0OC 3HKDA 4B08A 4WFBV 3ABKC 4GX2A 1JCHA 1ZAUA 2OCHA 3CD6V 4DR3B 3ZHRA 1Y76B 4EB6A 4P9OA 3ZRSA 4RUEA 1NTZH 3CRRA 1XMOB 3CC2V 2OTLV 4D7SA 5A9GA 1M4UA 5HFLA 5L3FA 2BE3A 4LF6O 3CCRV 5IWAO 5JVDB 1R6NA 4FJCC 3CS5A 3ZN0A 1SQFA 2BOBC 2Z0AA 3JATA 3QF7A 4NXNB 1NH2B 4GKKB 1XEQA 5LP6B 5BXZA 1IXMA 5LYJA 2QWOB 3MDSA 2A3QA 5BR8B 2VWJA 3QVNA 1MA1A 1UPGA 4J80A 3ZHSA 4CH5A 3RFRA 2ZE7A 2QR4A 2V7QG 4JI2B 1K34A 3TXQA 3A0BZ 3OTOO 5J2UB 3EVKA 2DN9A 1IBKO 2UXBB 1OZ0A 5CBGA 1FKAO 1K9MW 2UXDO 2PI4A 1VMGA 4LWSB 2P22C 1SF9A 3L72H 4X8AA 4DV1B 2XAFA 5F2VO 4O2AB 2WA4A 2OTJV 4X65B 4LF4B 5FNVB 1G8MA 3OGCC 2LGQA 4IHJA 4YJ3A 5LGTA 1K5QA 4R8CA 4MTXA 4U3JB 3JCZA 1UFIA 2WLIB 1GMGA 3SYCA 4LNUA 4CBCA 3SDLA 2ZM6B 1YCIA 4CC6A 4CS2A 2CDYA 3HKBB 3B4SA 2M6YA 3QG5A 2MW2B 2HG5C 2CTRA 5KX5A 2YS8A 3J7AU 4JTDB 4FM1A 3W7XA 1M5IA 1GO3F 3QO8A 4G28B 3AG2C 2HLDG 4ZHQA 4DR2B 3ICXA 3K58A 3IGAC 2Z3YA 4JAVA 4TV8B 1AJNA 2XAGA 5IT9N 1J95A 4IIJB 2K9PA 2NR5A 5IE9A 1OCCB 1D5NA 1S5LZ 3AG4C 4GYCB 4DK0A 1IBMO 3BFRA 5JWPA 1H2KA 2W6JG 5KUMA 2UUBO 1VF6C 3SJBC 4U7OA 4MVQA 3K79A 1XNQB 4X1IA 2Q5ZA 2W6IG 2DWDC 1AVMA 1BE3H 3BEHA 3HKDB 2L6LA 1ZL8B 4KP4A 1K73W 5IJ0B 3VQWA 4BR6A 1NTMH 1S76D 3DXRB 3DC5A 2CH7B 4X62B 4IL6Z 2QWNB 5LYJB 2M7WA 4JI8B 2UXCO 4FFKA 1MZFA 3R65A 4GX1A 1FXKB 4FLXA 2WPDG 1FXKC 1AROP 5EZYB 5B1AC 2YSUB 3BRCA 1HDJA 1Y4MA 4PV1B 4PA7A 1YEWA 2P6JA 2JJ2G 5CA3A 3FB7C 3ZX6A 4NTXA 4W4LA 3DSQA 1JPXA 4I0XA 3RYFB 3CCUV 4NXMO 2KKWA 2X6CA 1UJWB 2HKOA 3UO3A 1ENVA 1KU9A 1O9GA 4ASUG 3ASOB 2LP7A 4O4LB 4JF3A 4DV4O 1QU7A 1EN6A 2JEXA 5EBMC 5LMUB 1LNQA 3G67A 5B1NA 3D3IA 4QJFB 1SETA 3P32A 2OYQA 2Q0AA 2VRZA 5CN0A 2JIZG 2FMLA 2AZ2A 1SZXA 2CTPA 4MVRA 4F6EA 3T1YO 4IIJA 3UO2A 4D6TH 4X64O 4DR5O 1P84F 3CCMV 2ZE6A 1WN7A 3B09A 5LHIA 3GWKC 3RYHA 1VQ6V 2EILC 3A8TA 2HEPA 2UUAB 2YIBD 4YJ2A 4FLYA 4F6RB 3H1IH 1K8AW 2E5LB 3LSUA 2EIMB 2RN9A 1DF5A 2UUBB 2WLIA 5GTIZ 4YY3B 2RMKB 3PJSK 3CWBH 5FPOA 2ITCC 5IYDO 2ADQB 1WLEA 2PYLA 3ASNB 1PNMA 1GN4A 4MVUA 2UU9B 2ZIMA 1XI1A 1BT8A 3APOA 3P30A 1PNKA 5LGNA 2KB1A 4ZBMA 4HZ3A 2EINB 2XAJA 3JALA 2A79B 3E35A 1VQ7V 5FLXN 2P06A 2VQFO 4DV0O 4AQYO 3UM7A 3LDDA 4GUNA 3JAMN 4JZGA 4Z2WA 3ZMTA 3ZRXA 5EBLC 3BAAA 3T1HB 1YTFD 2B5UA 4QPJA 3X2QC 2EIKB 2QA4V 4DV7O 4BW9A 3FD9A 4JZ2A 3RYIB 1XMQO 3ABLC 2YIDA 1IBKB 2UXBO 4FMTA 2QSAA 4JI0O 1V54C 5DM6V 5BY1A 2GSMB 3U10A 1QR9A 2OIGA 1YIJV 4PD4F 3LDCA 1R3IC 2BTQA 3F5TA 1KKCA 1FXHA 2WAMA 5GONA 4IYIA 1VQ5V 1M90W 2P5OA 5CB4A 1MG1A 3WB2A 3ZJZA 1NVPB 4MTGA 1YZBA 3AG3C 1GM7A 1QVFU 4K35A 4H44B 1Z5WA 1I94O 1MSDA 2H8PC 3TJTA 4BIZA 3IAYA 3QNEA 1AI7A 3JAWB 1YTFB 4B3MO 3ABLB 1NBMG 4BWAA 4RUFA 5CBFA 2VS0A 4XDKA 1GRJA 4DW0A 3O65A 2Y69B 2RNBA 5LXTB 2FL4A 4I50B 1EN5A 3ZHTA 3CEIA 3CCVV 3CSXA 1NH2D 3CC4V 1SQBH 2KQXA 3OGIB 1P7BA 1ZWIC 4MVZA 5CMUA 3T4DA 4UV8A 5CB4B 5B3SC 3W7WA 2XTAA 3BY6A 1OCZB 4Q6GA 3STZC 1FJGO 4MT8A 1JOYA 5IDJA 1X4TA 1Y66A 2JGDB 3D8CA 5J2TB 2EBOA 4QIWF 3H1HH 3A0HZ 3IJ4A 4I9QA 3FAVA 3F7YC 3SYAA 4X62O 4JI3O 1G4YB 1S72V 3RYCB 4I9WA 1H2SB 5B1AB 3WB1A 5BR8O 4WFAV 1H2MA 3DXRA 5C8YB 1FPOA 4DV7B 2ZNJA 1AI5A 1N36O 2JDIG 2EZOA 3CCLV 1ZTEA 3JSLA 1ZUQA 3TK1A 4JAAA 3ABMB 2UXDB 2OCCB 3L70H 4DV1O 4Z1MG 2PGGA 4P30A 5A2QN 1HNXO 4X89A 2Y4UA 3U11A 1Q7YW 1VQ4V 2BSKB 4DR3O 1WJZA 3ML0A 3X2QB 4DR7B 3L9DA 4LBEC 1KBHA 3JD1A 1BHAA 4PDVA 4XDLA 5DEDA 2NNUA 3K57A 4DO2A 2ZR3A 1RPRA 3SYOA 2P4VA 3B40A 3CJHA 4B3MB 4X1KB 5H6RA 2UXNA 2QWPB 5L3CA 3WFVA 4J7KA 3JATB 4K3AA 4LF8B 4DR2O 1JR9A 4IYHA 4FFBB 3L71H 3VQYA 5JVDA 4J9ZB 3N2GB 2ODMA 3RGBA 1DTOA 4FK5C 1VQNV 1VF5B 2XOKG 3C90A 4O2AA 5LGUA 4GZRB 2KG7B 1VF6A 3H01A 1F51A 4I55A 1N34B 1BGYH 3WG7B 2F95B 4JTCB 3G71V 4DR4B 1NT2B 5IWAB 2Y0PA 1NZ6A 4DV3B 4IGGA 1TGOA 1PP9H 3ZMSA 1Q8IA 4LFCB 1URFA 2Q7EA 1EM1A 4DV4B 4LF4O 4DUYB 2CUGA 2DYRB 4GKKO 3ZS8C 1KB9F 4J9YB 5C93A 3QO7A 1PPJH 3JARB 2ZDIC 3AG1B 1OHHG 1Y67A 3A2FA 3LNMB 4H33A 4HBNA 4TQDA 4FM2A 4B3TO 3P3NA 3T1YB 4X88A 3E83A 4GT1A 1XMQB 2JJ1G 3ASOC 4B7EA 2LO1A 4GLXA 1SESA 4I4TB 4K8ZA 2BOCC 2QM8A 2QKSA 4X66B 2GUZB 1Q86W 4N21A 4KXRA 1EZJA 3K0DA 1ZL8A 4YIPA 2LW1A 2PF4E 1WPBA 2QJ1A 5IYCO 3OM3B 2N74A 4H37A 1KP2A 4X65O 1Q90D 1JQ0A 2NN4A 5KHGA 2BSKA 4TUYB 1YSCA 2VQEO 1W0KG 3K06A 4IT5A 1FFXB 1BHBA 5IYZA 2IJIA 3Q4HB 3SJAC 4R7CA 1PKXA 2BCCH 5GTHZ 1PNLA 4QPKA 3OEEG 2O57A 2JS5A 3WB0A 2IH3C 1FFTB 4FFBA 4LFAO 2Q69A 1N32B 1OCRC 4O4HB 1WP8A 4MW3A 3AG2B 1SQGA 1AB3A 5H6QA 3JD3A 1KQSU 3B8NA 4JI8O 2UXCB 1H2NA 5C8YA 3EFFK 3O9OA 1THZA 3E22A 2R70A 2JK5C 4FVMA 1N34O 3FB6C 1N4CA 3PN1A 2GTAA 1MMMA 1XNQO 5D5PA 4XDJA 2WLNA 4CS4A 1CPYA 2QM7A 3JCUZ 3H1LH 1QLEB 4E2LA 2LGWA 5AG2A 1K3EA 1GTOA 3SYPA 3K9AA 3N2KB 3JALB 4JASA 1DF4A 1SQPH 5LP6C 3K08A 2FYUH 2YXYA 3B8MA 2B1GA 4B3TB 5EK0A 2QKCA 3T1HO 3S3WA 1MABG 3TXSA 1H8HG 4Z1VA 5JJJB 1CXZB 2LQTA 3SPGA 2RQ6A 1P49A 1GM9A 1IVSA 2B9ZA 4UFZA 2XNDG 4JI1B 2PY5A 1KMIZ 2DJVA 3D36A 1WA8A 3SJQC 2R9AA 1BZKA 4UCSA 4LF9O 4O2BB 5JH7A 2UUAO 1NKDA 1ROPA 2BTOA 4U3JA 5LP6A 1TAEA 4RQEA 3TGUH 1W0JG 2EJRA 2YUAA 3L74H 3E22B 4ZIBA 1TVKB 1OCOC 1BSMA 3ZRVA 1YDXA 1XL6A 3ZMVA 1SKVA 2YIAA 1Z2GA 4CH4A 3CRAA 1NR1A 4PA9A 5EZYA 2X6BA 5CA0B 5LMUO 4X9QA 2WLLA 5DN6G 5ITZA 4OX9B 3FYIB 1TUBB 1AJPA 2DYSB 4ZI7B 2ZXWC 2XAHA 5LMNO 2XHBA 1PL0A 5LA6A 4UCRA 5JCOC 4BIOA 4O4IB 2LJ2A 2DMXA 5L3GA 2GTSA 1W59A 1YJWV 1NJIW 2A9HA 4PELA 4AQYB 1N0JA 4JAUA 1S5JA 2V1DA 3VQVA 5IYBO 1KYOF 5KMGB 4JTAB 4JI5O 3K9SA 3SPHA 4YIOA 5FL7G 1I5XA 4I4TA 1XHXA 3OR7C 2EIMC 2F23A 4UB6Z 1KP3A 4DR6O 2X6AA 3ZRWA 4PDLA 2IW5A 4LP8A 2EILB 5JCOA 4FLWA 1HW7A 2YEVA 2CK3G 2PUSA 4NYKA 3CXCU 4ZKIA 3CPWU 1RFYA 5H2FZ 5DECA 3JASB 4J41A 4NKGB 4DV0B 1VARA 4LH7A 4WFFA 5LXTA 4O2BA 4DRXB 1PV0A 1OJHA 3RVZA 4QE7A 4WF9V 1F7YA 1GN6A 1BQZA 5H9CA 1N36B 2P67A 1WPXA 4ZI7A 5CA1B 4DXWA 3FKSG 3K0GA 4CS3A 2Q8VA 4WFEA 5EIBC 1NQTA 2OWOA 4FLZA 4TV8A 4X1YA 1VEWA 1MOFA 1MNGA 1Q6UA 3OTFA 1Q82W 4BW5A 1L0NH 4PI2A 2DQ3A 2ZD9A 1B04A 4JYAO 4YHHB 1V54B 4O4LA 1NI8A 5L3BA 2EJ7A 3GWOA 5JH7B 1QQCA 1VQMV 4HYOA 1BMFG 3BA8A 2AGAA 4DR4O 1VQ8V 1JFFB 3CP1A 2QM4A 5B1OA 2WA3A 3ZCCA 1OCRB 2AXTZ 4UUJC 3BHPA 1QCEA 3MHHC 3RYIA 3S3XA 4KHPO 1KC8W 4YJ3B 4LFAB 3T2MA 1US6A 3VBBA 1L1FA 1K97A 1VQ9V 2RJZA 4BIUA 3OR6C 1K33A 4NTWA 4JI3B 2YEVB 3W7SA 1SQVH 2UXXA 2VQFB 5IY5B 2YICA 1E1RG 1AP6A 1YI2V 1SA0A 4DR1B 3GVMA 1AI6A 3VOUA 4DYLA 3RT3C 2CH7A 2ZT9B 3G6BA 1IZ3A 2DYRC 3FX7A 5L3EA 4RO2A 1XNRB 4RQFA 3D3QA 3UT5A 3K04A 1AR4A 4I50A 4WBNB 3G6EV 1KKDA 1FJGB 2HFEC 4PA4A 4JI0B 3KCYA 2MK3A 4Q20A 5B1BB 1JA8A 3OUSA 3CMEV 1YF2A 2QEXV 4LFBO 1HNWB 3OFNG 1YXBA 4O4IA 1WP7A 1RM1C 5KUKA 2CGOA 1G6UA 2JGUA 5CA0A 4UB8Z 4DR7O 5J2TA 1YITV 3AG1C 4ZOLB 3KZIZ 4R50A 2LFRA 2Q73A 2W0XA 3JYCA 1TVKA 2GUZA 1N33O 2F4VB 1FD9A 3CRMA 2CE4A 4PDMA 4TT3G 2WLMA 3JSNA 1QVGU 3OMIB 4DV2B 3H1KH 1WA8B 3AG3B 4JI6O 3IC9A 1M57B 4MW8A 2F43G 4UCUA 1XL4A 2PZSA 1U97A 2ILMA 3LDEA 3ABMC 4JPRA 3FB5C 2Q7GA 3JD0A 2F93B 1J5EO 2N04A 3OEHG 2EIJB 3APQA 4DUZB 4GX0A 3C3TA 3I56V 3ZMZA 3N2KA 4JV5O 5EIBD 1GH6A 3MHSC 2ATKC 5D5QA 2QTSA 3RW0A 1HNZO 3FB8C 1F4MA 3CB2A 1CP9A 4WCEV 1DLBA 1L0LH 4RAIA 3RBZA 2HVJC 2R9IA 1H8EG 5LBQA 3CHXA 3JAKA 2NLJC 3ZBHA 2HJDA 4D7TA 4TWKA 3CYOA 1M1KW 1V55C 2OIEA 2RDCA 2VWKA 5KAFZ 4U3FH 3CE2A 3UKMA 1LR1A 3T4ZA 3AK1A 2ITDC 3ZMUA 1D2DA 2QTOA 2QKAA 4JI4O 4LF7B 1JJOA 2YC0A 4PDRA 4LC1A 1R3JC 3IC7A 3E8GA 2AW9A 2X0LA 4X1YB 5JJEB 2E74B 1SRYA 2CAZC 2E3CA 3GB7C 1BCCH 2Q7HA 3OE7G 2IJKA 4LFCO 1HNXB 5KA5A 4FLUA 1FS0G 2CGNA 3G80A 2ADPA 1XUQA 4KL1A 1IBLO 3G4SV 3SJCC 4DW1A 2DE0X 4JI7B 4PA3A 4UCOA 1EN4A 5LMNB 2XASA 1ZLZA 4DV2O 3I5DA 4NVPA 3HKEA 2YI8A 2RCVA 3H1JH 4HNAA 4CZZA 1LUVA 3FAVB 4MS2A 4UCVA 2QGNA 4MSWC 2Q6AA 1P7GA 4AHCA 3BABA 4EFEA 3SGIA 5FNVA 3B77A 1YJNV 3DC6A 4ZOLA 2OCCC 1K7DA 2JVDA 4FM0A 2WLKA 1VIBA 4DR6B 1XMOO 1YVWA 1YHQV 2IU3A 4FLTA 4OPAA 2VQEB 1DK1A 5IYZB 5EC1C 5JQGB 1COWG 4H13B 4NR1A 4J7JA 4DV6O 1GM8A 4LH6A 2HVKC 1S3JA 4JYBA 1WB8A 4DV3O 4DV5O 3E8HA 4WBNA 5IJ9A 4NXNO 5KHKA 3F7VC 1RSOB 4JYYA 3EXAA 3AG4B 3HKEB 1K4DC 1OCCC 3HPLC 1E79G 3CCSV 5KAIZ 3UQ8A 2YDEA 1S77D 3RVYA 1XILA 1XREA 1TUBA 2IU0A 4EFBA 1Q3EA 1NR7A 4PHZA 1HR0O 3DTUB 4X20A 4UVAA 1X59A 4B3RO 4HAMA 1EZVH 2QWQB 2JGDA 1QNMA 2XT9A 1QR8A 3M7MX 5KHIA 2WWWA 2KSDA 4LF5B 4L8JA 4KUMA 3CJHB 3OAAG 5B5EZ 1GAXA 2YXHA 5H5NA 1VF7A 1H38A 5EYPB 4F4LA 2BTQB 2G38A 4QE9A 1AR1B 2XAQA 1JVMA 1VP7A 3A0RA 3SR2C 1CEZA 5KHJA 2F4VO 3HR0A 4JI7O 2WLHA 4X64B 1BL8A 3UT5B 4F6RA 2A0LA 2GHYA 2ARHA 1R73A 3ETGA 1Y74B 2KG7A 1SQXH 4UV9A 3NXSA 2ZE8A 4X1IB 3ETQA 1N32O 4AI8A 2E75B 1RP3B 2LFSA 3CRQA 4CH6A 3K59A 2R72A 2HHHO 3CCQV 1JX9A 1J5EB 3THOA 4JI5B 2Y0IA 2YXLA 2B1IA 2E76B 1DGSA 3M8AA 3JASA 3OTOB 3CC7V 3LUTB 4MVSA 2GDSA 2Q68A 3TCUA 5EBWC 4LF6B 3HKCB 4OX9O 1S0VA 4YXWG 4I7ZB 3CCJV 4LNUB 1XQ8A 4PJ0Z 4TV9B 1HNWO 4N23A 1VQKV 5EYPA 3JAKB 1NVPD 4PA6A 4MVOA 4A5UB 3J80N 3L75H 2HR3A 2DOSA 4K0KO 2AZ0A 3MAQA 4JGSA 4DUYO 2H94A 3J81N 3WU2Z 1M56B 5J9PC 1Z5VA 1S5HC 4PI0A 3W7UA 2HP8A 2ZCEA 3ZIAG 1HR0B 3OMAB 1W2BU 2XUMA 1RPOA 1Y76A 4TQFA 1OCOB 4EB6B 3SYQA 4GKJB 4WFGA 5JJNB 2AHYA 3OUFA 2ZKOA 4NB5A 3SPCA 3WG7C 5B3SB 3C3SA 5KMGA 1FYJA 1MSWD 4X66O 4H0LB 5IJ0A 3CRCA 4J7ZA 1G1XB 3AEIA 1K5SA 4UCTA 1EFRG 2PI5A 4MVMA 3RYCA 1B3QA 5KHHA 4W4KA 2WLLB 1IBMB 1AI4A 3JAWA 3LSSA 4J11A 3BPZA 5LL6Y 4LR3A 1QLEC 2ZM6O 2PYJA 4C7UA 5JQGA 1LUWA 4JV5B 2JEUA 5B1BC 4UXNA 1L8DA 3BCCH 1OCZC 2IJHA 2ZE5A 3ZN1A 4UVBA 3BVOA 2JRIA 3DGEA 4NTYA 4ZHQB 3OMNB 4OGQB 2Y48A 1FFXA 1GN2A 3JARA 4UVCA 2Z5UA 5GW7A 1JFFA 3ZHUA 2IBZH 4J42A 5LHHA 2CTQA 2UUCO 1RSOA 2EIJC 2P4KA 2A06H 1ZX3A 4DK1A 3E89A 1SS3A 2JS3A 3CX5F 4ABMA 1SA0B 1KD1W 5LOVB 1IURA 2IJJA 4NXMB 4L87A 5LOVA 4LFBB 3JD4A 1GK9A 4P9PA 4K0KB 3HB3B 3AK3A 4XBFA 1M56C 2YI9A 3RN4A 4GX5A 3FYEB 3IFXA 4DRXA 1GN3A 1PD3A 4DR1O 3E2EA 1XBLA 4YJ2B 3I55V 5IY5C 4R6ZA 2EULA 1WNSA 2ZR2A 2WSSG 3LNNA 2QE7G 4LF5O 4FIPC 1N8RW 2Q9LA 4JI1O 1BS3A 4I55B 2FB5A 2GV9A 4LF9B 1V9PA 4IHJB 1Q6IA 3SPIA 3H9VA 1B6QA 1R6KA 1AP5A 4WFHA 3FFQA 1NTKH 2QWRB 1K92A 2ZDIA 2EZPA 1T5EA 2P90A 1Q6HA 4YHHO 1VQOV 4EEQA 4TOIA 3K5OA 4B3SO 1I94B 3AK2A 1N33B 4TUYA 2FTKA 1SQQH 4DR5B
chains in the Genus database with same CATH topology
1PNLA 2P6JA 4PDRA 2JJ2G 2X7RB 1TUEB 3FB7C 5CA3A 4LC1A 4QPKA 3OEEG 1R3JC 1QBZA 5HFMA 4U7NA 4FPPA 1JPXA 2IH3C 3IC7A 1FFTB 3E8GA 3CCUV 2X0LA 2Q69A 1SRYA 2X6CA 3LSQA 1OCRC 1UJWB 3GB7C 2HKOA 5EC2C 1ENVA 3STLC 4MW3A 3AG2B 3OE7G 2IJKA 5H6QA 3JD3A 1AJQA 4ASUG 1RM1B 1KQSU 5KA5A 1FS0G 3B8NA 3ASOB 4GCZA 2LP7A 4JF3A 4EKWA 3EFFK 1FXKA 2JEXA 2IH1C 5EBMC 3ETDA 1LNQA 1THZA 4TSFG 2DQ0A 3E8BA 3JD2A 1ORQC 3D3IA 5B1NA 1SETA 1M9NA 2JK5C 3P32A 4QJFB 5CN0A 2JIZG 3G4SV 1VQPV 4MVRA 2C2AA 3FB6C 3T1CA 4PA3A 2D3OW 3OW2U 2XASA 5BZBA 4XDJA 2WLNA 3E8FA 3K3WA 1R3KC 2W0FC 1CPYA 2QM7A 3CCMV 4P2ZA 4CZZA 5LHIA 4BAYA 1QLEB 2Q67A 4E2LA 2EIKC 2EILC 1VQ6V 4MS2A 1K3EA 1GTOA 3SYPA 3EHBB 4MTFA 3K9AA 3QO5A 4JASA 1DF4A 4MSWC 2Q6AA 3K08A 3W7TA 1K8AW 3B77A 2EIMB 3B8MA 5KA6A 2B1GA 1YJNV 3KG2A 1DF5A 5EK0A 2ZQMA 2WLIA 2OCCC 1FXVA 1K7DA 2WLKA 3PJSK 1MABG 3SPJA 2ITCC 5IYDO 1YHQV 2IU3A 1H8HG 1WLEA 4JYCA 3ASNB 1PNMA 5E1AC 5EC1C 3SPGA 4MVUA 1COWG 1GM9A 2XNDG 3ABTA 1GM8A 1F23A 2HVKC 3D36A 1S3JA 4JYBA 4OXSA 3SJQC 2DWEC 1PNKA 3P30A 3E8HA 5LGNA 2KB1A 3ABUA 1NKDA 4ZBMA 1ROPA 4HZ3A 2EINB 2XAJA 1E1QG 2OT5A 2A79B 3E86A 3F7VC 3E35A 1VQ7V 4I5SA 4MTOA 3AG4B 4RQEA 1V55B 1K4DC 1OCCC 1HWYA 1W0JG 2EJRA 3HPLC 1E79G 3CCSV 3K03A 1OCOC 3UM7A 3LDDA 3ZRVA 1XL6A 3ZMVA 1S77D 3ABKB 3RVYA 2EINC 3F5WC 2IU0A 3ZMTA 3ZRXA 2WLJA 1NR1A 4PA9A 5EBLC 2X6BA 1YTFD 2Y69C 1GKFA 2B5UA 4QPJA 3X2QC 1NR7A 2EIKB 2QA4V 3DTUB 4UVAA 2WLLA 4G27B 5DN6G 2HJFC 1YJ9V 3FYIB 4HAMA 1AJPA 3ABLC 4QNHB 2DYSB 1Q81W 3ASNC 4FMTA 2ZXWC 1H2GA 2XAHA 1I5YA 1V54C 1QR8A 5DM6V 5LHGA 2WWWA 1PL0A 3ETEA 5CBHA 2GSMB 4KUMA 1QR9A 1YIJV 3LDCA 1R3IC 5L3GA 3OAAG 1YJWV 1FXHA 2WAMA 1P4RA 3MD0A 1VQ5V 1H38A 1M90W 1NJIW 2A9HA 4PELA 4F4LA 4JAUA 1MG1A 4QE9A 3ZJZA 2V1DA 1AR1B 1VQLV 5IYBO 1NVPB 2XAQA 1JVMA 4JTAB 3A0RA 4MTGA 2R9RB 3SPHA 1CEZA 5FL7G 1I5XA 1JJ2U 1K4CC 3AG3C 3OR7C 2EIMC 2WLHA 3TETA 1GM7A 4KFMA 1SERA 1QVFU 1BL8A 1KP3A 2X6AA 3ZRWA 2A0LA 2H8PC 2GHYA 4BIZA 1QLNA 4PDLA 3QNEA 1R73A 2IW5A 3ETGA 2AHZA 1AI7A 4LP8A 1YTFB 1F4NA 1NBMG 3ABLB 4UV9A 2EILB 1SZTA 3NXSA 4RUFA 5CBFA 2K1EA 1M57C 4XDKA 2YEVA 2CK3G 2Y69B 4LCUC 3CXCU 4ZKIA 2LFSA 3CPWU 3CCQV 1JX9A 1R3LC 3CCVV 1EBOA 3M99B 4G2KA 4WFFA 1NH2D 3CC4V 2B1IA 3RVZA 1KECA 1P7BA 2P7TC 4QE7A 1ZWIC 4MVZA 5CMUA 4WF9V 3T4DA 4UV8A 3ZRWB 3CC7V 2DW4A 5B3SC 3LUTB 3W7WA 3CCEV 2DYSC 5H9CA 4MVSA 2Q68A 3BY6A 3TCUA 5EBWC 2ZXWB 1OCZB 3STZC 2P67A 1S0VA 4MT8A 4YXWG 1JOYA 5IDJA 1WPXA 3CCJV 1Y66A 4DXWA 5L3DA 2EBOA 3FKSG 3K0GA 4N23A 4QIWF 4WFEA 1VQKV 1NQTA 3CMAV 3F7YC 4PA6A 3SYAA 4MVOA 1NVPD 1G4YB 2HR3A 3ABKC 4GX2A 4WFBV 1S72V 1JCHA 4I9WA 1MOFA 1Q82W 4JGSA 2H94A 5B1AB 4BW5A 3CD6V 1M56B 5J9PC 1S5HC 2DQ3A 3W7UA 2ZD9A 4WFAV 3ZIAG 4P9OA 3ZRSA 3OMAB 1V54B 4RUEA 5L3BA 1W2BU 3GWOA 2OTLV 3CC2V 1RPOA 1AI5A 5HFLA 2JDIG 5L3FA 1VQMV 4HYOA 2EZOA 1BMFG 1OCOB 3SYQA 3CCLV 4WFGA 2AHYA 3OUFA 3CCRV 1VQ8V 3CP1A 5B1OA 3SPCA 3TK1A 3WG7C 3ZCCA 1OCRB 4UUJC 1R6NA 5B3SB 4FJCC 1QCEA 3MHHC 1MSWD 3ABMB 1KC8W 3ZN0A 2OCCB 3T2MA 3VBBA 1L1FA 1K97A 2BOBC 1VQ9V 4Z1MG 4BIUA 3OR6C 4P30A 3AEIA 1K5SA 1K33A 1EFRG 2PI5A 3W7SA 2YEVB 4MVMA 1NH2B 4X89A 2UXXA 1IXMA 2WLLB 5IY5B 1Q7YW 1VQ4V 1E1RG 1AI4A 3LSSA 3ML0A 3X2QB 1YI2V 4LBEC 3JD1A 1QLEC 1BHAA 1AI6A 4PDVA 3VOUA 4XDLA 2NNUA 4DO2A 2JEUA 2V7QG 2ZR3A 5B1BC 1K34A 4UXNA 1RPRA 3SYOA 1OCZC 2IJHA 2DYRC 3ZN1A 5L3EA 4UVBA 4RO2A 1OZ0A 5CBGA 4RQFA 3K04A 5H6RA 3G6EV 1KKDA 2HFEC 4PA4A 2UXNA 1K9MW 5L3CA 3DGEA 2PI4A 2MK3A 4Q20A 5B1BB 4X8AA 3WFVA 3OUSA 3OMNB 3CMEV 2QEXV 2Y48A 3OFNG 2XAFA 4UVCA 2Z5UA 5GW7A 2OTJV 4J9ZB 1RM1C 5KUKA 1G8MA 3OGCC 1DTOA 4FK5C 5LGTA 5LHHA 1K5QA 4R8CA 3JCZA 4MTXA 1VQNV 2XOKG 2EIJC 2WLIB 1GMGA 3AG1C 3SYCA 1YITV 4CBCA 5LGUA 4R50A 2LFRA 3JYCA 3H01A 1F51A 3E89A 4PDMA 4TT3G 2HG5C 3WG7B 1KD1W 4JTDB 2WLMA 1QVGU 3W7XA 3OMIB 1GO3F 3QO8A 4JTCB 3G71V 4G28B 3AG3B 2IJJA 3AG2C 2HLDG 1M57B 4MW8A 4L87A 3IGAC 2F43G 3ZMSA 3JD4A 1GK9A 4P9PA 1XL4A 2Z3YA 4JAVA 1AJNA 2XAGA 1J95A 3HB3B 4XBFA 1M56C 3LDEA 3ABMC 4JPRA 2DYRB 3FB5C 1OCCB 3AG4C 4J9YB 5C93A 3QO7A 3JD0A 3OEHG 2ZDIC 2W6JG 2EIJB 1OHHG 3AG1B 4GX5A 5KUMA 3LNMB 3FYEB 3IFXA 4H33A 1PD3A 4GX0A 4MVQA 4U7OA 4X88A 3E2EA 3K79A 3E83A 3I56V 3ZMZA 3I55V 5IY5C 4GT1A 4R6ZA 2JJ1G 3ASOC 3MHSC 2ATKC 2ZR2A 1SESA 2W6IG 2DWDC 3RW0A 2WSSG 3BEHA 3FB8C 2BOCC 1F4MA 2QKSA 2QM8A 4KP4A 1CP9A 2QE7G 1K73W 4WCEV 1DLBA 4FIPC 1Q86W 4RAIA 1N8RW 3RBZA 2HVJC 4N21A 2R9IA 1H8EG 1S76D 1EZJA 3K0DA 5LBQA 3SPIA 2NLJC 1B6QA 1R6KA 3CYOA 4TWKA 1M1KW 4WFHA 1V55C 2M7WA 5IYCO 3OM3B 4H37A 1KP2A 1K92A 3R65A 4GX1A 1JQ0A 3UKMA 2ZDIA 1FXKB 3T4ZA 2WPDG 2EZPA 2ITDC 1FXKC 2P90A 3ZMUA 1YSCA 1VQOV 1AROP 1W0KG 2QTOA 3K06A 5B1AC 1BHBA 2YSUB 2IJIA 1Y4MA 4PA7A 4R7CA 2FTKA 1PKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO C;  4PDR A;  3FB7 C;  3LDD A;  3UM7 A;  1XL6 A;  1R3J C;  4R8C A;  4DXW A;  2EIJ C;  2WLI B;  3AG1 C;  3RVY A;  2EIN C;  3F5W C;  3SYC A;  2IH3 C;  4CBC A;  3E8G A;  4R50 A;  3K0G A;  2Q69 A;  2WLJ A;  4PA9 A;  5EBL C;  2X6B A;  2X6C A;  2Y69 C;  1OCR C;  3JYC A;  4WFE A;  3GB7 C;  5EC2 C;  3STL C;  3X2Q C;  4MW3 A;  3F7Y C;  3E89 A;  4PA6 A;  4MVO A;  3SYA A;  2WLL A;  4G27 B;  2HJF C;  1G4Y B;  3ABK C;  4GX2 A;  4PDM A;  2HG5 C;  4I9W A;  3ABL C;  4QNH B;  4JTD B;  2WLM A;  3ASN C;  2ZXW C;  4EKW A;  3EFF K;  4BW5 A;  1V54 C;  4JTC B;  4G28 B;  5EBM C;  2IH1 C;  5J9P C;  3AG2 C;  1LNQ A;  5CBH A;  1S5H C;  2ZD9 A;  3E8B A;  4MW8 A;  1ORQ C;  2JK5 C;  4P9O A;  3ZRS A;  3IGA C;  4P9P A;  4RUE A;  1XL4 A;  3LDC A;  1R3I C;  4MVR A;  1J95 A;  3FB6 C;  1M56 C;  3T1C A;  4PA3 A;  4HYO A;  3LDE A;  3SYQ A;  3ABM C;  2A9H A;  4WFG A;  5BZB A;  4XDJ A;  2AHY A;  3FB5 C;  4F4L A;  2WLN A;  3E8F A;  3OUF A;  1R3K C;  2W0F C;  3AG4 C;  3SPC A;  4QE9 A;  4UUJ C;  3WG7 C;  3ZJZ A;  4J9Y B;  1JVM A;  4JTA B;  4P2Z A;  4MTG A;  2Q67 A;  2R9R B;  3SPH A;  3T2M A;  4GX5 A;  2EIK C;  2EIL C;  3IFX A;  3LNM B;  4H33 A;  2BOB C;  5KUM A;  4MS2 A;  1K4C C;  3AG3 C;  3OR6 C;  2EIM C;  2WLH A;  3OR7 C;  4GX0 A;  4KFM A;  4MVQ A;  4P30 A;  4X88 A;  3SYP A;  1BL8 A;  3E83 A;  4MTF A;  4MVM A;  2X6A A;  4X89 A;  5IY5 C;  4R6Z A;  3ASO C;  4MSW C;  2Q6A A;  2ATK C;  2A0L A;  2H8P C;  2WLL B;  3K08 A;  2DWD C;  3RW0 A;  4PDL A;  3BEH A;  2BOC C;  2AHZ A;  3FB8 C;  2QKS A;  4LP8 A;  3TET A;  3KG2 A;  4RAI A;  5EK0 A;  4LBE C;  3RBZ A;  2WLI A;  1QLE C;  2HVJ C;  2OCC C;  4RUF A;  4PDV A;  3VOU A;  2K1E A;  2WLK A;  5CBF A;  1M57 C;  4XDK A;  4XDL A;  3PJS K;  2YEV A;  3SPJ A;  3K0D A;  2ITC C;  4LCU C;  5B1B C;  3SPI A;  2NLJ C;  3SYO A;  1OCZ C;  2DYR C;  4TWK A;  4WFH A;  1V55 C;  5E1A C;  5EC1 C;  3SPG A;  4H37 A;  4MVU A;  1R3L C;  4RO2 A;  5CBG A;  3K04 A;  1KKD A;  2HFE C;  4PA4 A;  3R65 A;  4GX1 A;  3UKM A;  4WFF A;  2HVK C;  3T4Z A;  3SJQ C;  4OXS A;  4X8A A;  3OUS A;  2ITD C;  2DWE C;  3E8H A;  2KB1 A;  3RVZ A;  4ZBM A;  1P7B A;  4HZ3 A;  2P7T C;  2QTO A;  1ZWI C;  4QE7 A;  4MVZ A;  3E86 A;  2A79 B;  3F7V C;  3K06 A;  5B1A C;  3T4D A;  5B3S C;  3LUT B;  4MTO A;  2DYS C;  4J9Z B;  1K4D C;  1OCC C;  2Q68 A;  4MVS A;  3HPL C;  4PA7 A;  4R7C A;  5EBW C;  3TCU A;  5KUK A;  3STZ C;  3K03 A;  3OGC C; 
#chains in the Genus database with same CATH topology
 4DV6 B;  2X7R B;  1TUE B;  1WB7 A;  1QBZ A;  5HFM A;  1IX9 A;  4U7N A;  4LF8 O;  4FPP A;  4KHP B;  1FAF A;  3OD4 A;  1O9H A;  1PL4 A;  3LSQ A;  4AIL C;  1OV9 A;  5EC2 C;  3BA9 A;  3STL C;  1JMK C;  1B06 A;  1AJQ A;  3UCS C;  5B66 Z;  1RM1 B;  4GCZ A;  3RWR D;  1TA8 A;  2CTW A;  4EKW A;  1H2L A;  1FXK A;  2IH1 C;  3ETD A;  4TSF G;  2DQ0 A;  3B2E E;  2N05 A;  3E8B A;  1ORQ C;  3JD2 A;  5BMV B;  1M9N A;  4YY3 O;  1A32 A;  1VQP V;  4B3R B;  2C2A A;  4DUZ O;  2PTM A;  4JI4 B;  4LF7 O;  2ETN A;  5BMV A;  4JI2 O;  3T1C A;  2D3O W;  3OW2 U;  2ZNI A;  5GON B;  5BZB A;  2ZIO A;  1QHT A;  3E8F A;  3K3W A;  1R3K C;  2W0F C;  1XNR O;  5K1P A;  1XOU A;  1IDS A;  4P2Z A;  1HNZ B;  4FZ0 A;  4BAY A;  1I08 A;  2Q67 A;  3P3P A;  2EIK C;  1MZE A;  3EHB B;  3QTC A;  4MTF A;  4ICG A;  4HNA B;  3AG7 A;  3QO5 A;  1I0H A;  3W7T A;  2H3O A;  4OPH A;  2QDO A;  4E4E A;  5KA6 A;  3K5N A;  1IBL B;  2L35 A;  3KG2 A;  1KUQ A;  2ZQM A;  1FXV A;  2V4D A;  4RWU A;  4O4J B;  3SPJ A;  1M93 A;  5KLV H;  4JYC A;  5E1A C;  2D2C B;  3ABT A;  2A7W A;  1F23 A;  4OXS A;  4JI6 B;  2DWE C;  2ZIN A;  5E79 Z;  3N2G A;  2FKX A;  3ABU A;  5K1X A;  1E1Q G;  2OT5 A;  3E86 A;  1BQ0 A;  4I5S A;  4CH3 A;  4MTO A;  1V55 B;  1HWY A;  3HKC A;  2E5L O;  3K03 A;  4K8X A;  1I7F A;  2F66 C;  3ABK B;  2EIN C;  3F5W C;  1XDC A;  4TV9 A;  3K5L A;  1XHZ A;  2WLJ A;  1R6T A;  2F1M A;  2Y69 C;  4QGP A;  1GKF A;  4B3S B;  1HP8 A;  4JYA B;  4G27 B;  2HJF C;  1PM9 A;  1YJ9 V;  3CXH F;  2YIB A;  2Q4P A;  4QNH B;  1Q81 W;  1AR5 A;  1Q43 A;  3L73 H;  3ASN C;  3OT7 A;  2UU9 O;  1ZSP A;  1H2G A;  5TIS Z;  1I5Y A;  5LHG A;  1IXB A;  3ETE A;  5CBH A;  1D5A A;  3D36 C;  2GBO A;  4O4H A;  3N27 A;  3KCX A;  3R66 A;  1P4R A;  3K5M A;  3MD0 A;  1Y6X A;  4FLV A;  4CC5 A;  2HHH B;  2UUC B;  1VQL V;  5CA1 A;  2LW7 A;  2R9R B;  1N0N A;  3U0Z A;  1K4C C;  1JJ2 U;  3TET A;  1SC5 B;  4KFM A;  1SER A;  4X1K A;  4FZ1 A;  5KX5 B;  1NU1 H;  1QLN A;  1WAZ A;  2AHZ A;  1U96 A;  3HKB A;  1F4N A;  1SZT A;  4I0X B;  3RYF A;  2K1E A;  1M57 C;  5ITZ B;  4LCU C;  4DV5 B;  3RYH B;  2EX3 A;  1R3L C;  2IM9 A;  3NR7 A;  3ZHQ A;  3KKY A;  1EBO A;  3M99 B;  4X20 B;  4G2K A;  4LWS A;  4O4J A;  1KEC A;  5FPR A;  2P7T C;  3ZRW B;  4J10 A;  2DW4 A;  4B7K A;  5J2U A;  3CCE V;  2DYS C;  4GKJ O;  1Y74 A;  2ZXW B;  3ZED A;  3ZHV A;  1R1B A;  1AIL A;  3Q4H A;  1NS1 A;  5L3D A;  1Q5O A;  5IJ9 B;  3VQX A;  5LA6 B;  3CMA V;  2Y4T A;  2Q0O C;  3HKD A;  4B08 A;  4WFB V;  3ABK C;  4GX2 A;  1JCH A;  1ZAU A;  2OCH A;  3CD6 V;  4DR3 B;  3ZHR A;  1Y76 B;  4EB6 A;  4P9O A;  3ZRS A;  4RUE A;  1NTZ H;  3CRR A;  1XMO B;  3CC2 V;  2OTL V;  4D7S A;  5A9G A;  1M4U A;  5HFL A;  5L3F A;  2BE3 A;  4LF6 O;  3CCR V;  5IWA O;  5JVD B;  1R6N A;  4FJC C;  3CS5 A;  3ZN0 A;  1SQF A;  2BOB C;  2Z0A A;  3JAT A;  3QF7 A;  4NXN B;  1NH2 B;  4GKK B;  1XEQ A;  5LP6 B;  5BXZ A;  1IXM A;  5LYJ A;  2QWO B;  3MDS A;  2A3Q A;  5BR8 B;  2VWJ A;  3QVN A;  1MA1 A;  1UPG A;  4J80 A;  3ZHS A;  4CH5 A;  3RFR A;  2ZE7 A;  2QR4 A;  2V7Q G;  4JI2 B;  1K34 A;  3TXQ A;  3A0B Z;  3OTO O;  5J2U B;  3EVK A;  2DN9 A;  1IBK O;  2UXB B;  1OZ0 A;  5CBG A;  1FKA O;  1K9M W;  2UXD O;  2PI4 A;  1VMG A;  4LWS B;  2P22 C;  1SF9 A;  3L72 H;  4X8A A;  4DV1 B;  2XAF A;  5F2V O;  4O2A B;  2WA4 A;  2OTJ V;  4X65 B;  4LF4 B;  5FNV B;  1G8M A;  3OGC C;  2LGQ A;  4IHJ A;  4YJ3 A;  5LGT A;  1K5Q A;  4R8C A;  4MTX A;  4U3J B;  3JCZ A;  1UFI A;  2WLI B;  1GMG A;  3SYC A;  4LNU A;  4CBC A;  3SDL A;  2ZM6 B;  1YCI A;  4CC6 A;  4CS2 A;  2CDY A;  3HKB B;  3B4S A;  2M6Y A;  3QG5 A;  2MW2 B;  2HG5 C;  2CTR A;  5KX5 A;  2YS8 A;  3J7A U;  4JTD B;  4FM1 A;  3W7X A;  1M5I A;  1GO3 F;  3QO8 A;  4G28 B;  3AG2 C;  2HLD G;  4ZHQ A;  4DR2 B;  3ICX A;  3K58 A;  3IGA C;  2Z3Y A;  4JAV A;  4TV8 B;  1AJN A;  2XAG A;  5IT9 N;  1J95 A;  4IIJ B;  2K9P A;  2NR5 A;  5IE9 A;  1OCC B;  1D5N A;  1S5L Z;  3AG4 C;  4GYC B;  4DK0 A;  1IBM O;  3BFR A;  5JWP A;  1H2K A;  2W6J G;  5KUM A;  2UUB O;  1VF6 C;  3SJB C;  4U7O A;  4MVQ A;  3K79 A;  1XNQ B;  4X1I A;  2Q5Z A;  2W6I G;  2DWD C;  1AVM A;  1BE3 H;  3BEH A;  3HKD B;  2L6L A;  1ZL8 B;  4KP4 A;  1K73 W;  5IJ0 B;  3VQW A;  4BR6 A;  1NTM H;  1S76 D;  3DXR B;  3DC5 A;  2CH7 B;  4X62 B;  4IL6 Z;  2QWN B;  5LYJ B;  2M7W A;  4JI8 B;  2UXC O;  4FFK A;  1MZF A;  3R65 A;  4GX1 A;  1FXK B;  4FLX A;  2WPD G;  1FXK C;  1ARO P;  5EZY B;  5B1A C;  2YSU B;  3BRC A;  1HDJ A;  1Y4M A;  4PV1 B;  4PA7 A;  1YEW A;  2P6J A;  2JJ2 G;  5CA3 A;  3FB7 C;  3ZX6 A;  4NTX A;  4W4L A;  3DSQ A;  1JPX A;  4I0X A;  3RYF B;  3CCU V;  4NXM O;  2KKW A;  2X6C A;  1UJW B;  2HKO A;  3UO3 A;  1ENV A;  1KU9 A;  1O9G A;  4ASU G;  3ASO B;  2LP7 A;  4O4L B;  4JF3 A;  4DV4 O;  1QU7 A;  1EN6 A;  2JEX A;  5EBM C;  5LMU B;  1LNQ A;  3G67 A;  5B1N A;  3D3I A;  4QJF B;  1SET A;  3P32 A;  2OYQ A;  2Q0A A;  2VRZ A;  5CN0 A;  2JIZ G;  2FML A;  2AZ2 A;  1SZX A;  2CTP A;  4MVR A;  4F6E A;  3T1Y O;  4IIJ A;  3UO2 A;  4D6T H;  4X64 O;  4DR5 O;  1P84 F;  3CCM V;  2ZE6 A;  1WN7 A;  3B09 A;  5LHI A;  3GWK C;  3RYH A;  1VQ6 V;  2EIL C;  3A8T A;  2HEP A;  2UUA B;  2YIB D;  4YJ2 A;  4FLY A;  4F6R B;  3H1I H;  1K8A W;  2E5L B;  3LSU A;  2EIM B;  2RN9 A;  1DF5 A;  2UUB B;  2WLI A;  5GTI Z;  4YY3 B;  2RMK B;  3PJS K;  3CWB H;  5FPO A;  2ITC C;  5IYD O;  2ADQ B;  1WLE A;  2PYL A;  3ASN B;  1PNM A;  1GN4 A;  4MVU A;  2UU9 B;  2ZIM A;  1XI1 A;  1BT8 A;  3APO A;  3P30 A;  1PNK A;  5LGN A;  2KB1 A;  4ZBM A;  4HZ3 A;  2EIN B;  2XAJ A;  3JAL A;  2A79 B;  3E35 A;  1VQ7 V;  5FLX N;  2P06 A;  2VQF O;  4DV0 O;  4AQY O;  3UM7 A;  3LDD A;  4GUN A;  3JAM N;  4JZG A;  4Z2W A;  3ZMT A;  3ZRX A;  5EBL C;  3BAA A;  3T1H B;  1YTF D;  2B5U A;  4QPJ A;  3X2Q C;  2EIK B;  2QA4 V;  4DV7 O;  4BW9 A;  3FD9 A;  4JZ2 A;  3RYI B;  1XMQ O;  3ABL C;  2YID A;  1IBK B;  2UXB O;  4FMT A;  2QSA A;  4JI0 O;  1V54 C;  5DM6 V;  5BY1 A;  2GSM B;  3U10 A;  1QR9 A;  2OIG A;  1YIJ V;  4PD4 F;  3LDC A;  1R3I C;  2BTQ A;  3F5T A;  1KKC A;  1FXH A;  2WAM A;  5GON A;  4IYI A;  1VQ5 V;  1M90 W;  2P5O A;  5CB4 A;  1MG1 A;  3WB2 A;  3ZJZ A;  1NVP B;  4MTG A;  1YZB A;  3AG3 C;  1GM7 A;  1QVF U;  4K35 A;  4H44 B;  1Z5W A;  1I94 O;  1MSD A;  2H8P C;  3TJT A;  4BIZ A;  3IAY A;  3QNE A;  1AI7 A;  3JAW B;  1YTF B;  4B3M O;  3ABL B;  1NBM G;  4BWA A;  4RUF A;  5CBF A;  2VS0 A;  4XDK A;  1GRJ A;  4DW0 A;  3O65 A;  2Y69 B;  2RNB A;  5LXT B;  2FL4 A;  4I50 B;  1EN5 A;  3ZHT A;  3CEI A;  3CCV V;  3CSX A;  1NH2 D;  3CC4 V;  1SQB H;  2KQX A;  3OGI B;  1P7B A;  1ZWI C;  4MVZ A;  5CMU A;  3T4D A;  4UV8 A;  5CB4 B;  5B3S C;  3W7W A;  2XTA A;  3BY6 A;  1OCZ B;  4Q6G A;  3STZ C;  1FJG O;  4MT8 A;  1JOY A;  5IDJ A;  1X4T A;  1Y66 A;  2JGD B;  3D8C A;  5J2T B;  2EBO A;  4QIW F;  3H1H H;  3A0H Z;  3IJ4 A;  4I9Q A;  3FAV A;  3F7Y C;  3SYA A;  4X62 O;  4JI3 O;  1G4Y B;  1S72 V;  3RYC B;  4I9W A;  1H2S B;  5B1A B;  3WB1 A;  5BR8 O;  4WFA V;  1H2M A;  3DXR A;  5C8Y B;  1FPO A;  4DV7 B;  2ZNJ A;  1AI5 A;  1N36 O;  2JDI G;  2EZO A;  3CCL V;  1ZTE A;  3JSL A;  1ZUQ A;  3TK1 A;  4JAA A;  3ABM B;  2UXD B;  2OCC B;  3L70 H;  4DV1 O;  4Z1M G;  2PGG A;  4P30 A;  5A2Q N;  1HNX O;  4X89 A;  2Y4U A;  3U11 A;  1Q7Y W;  1VQ4 V;  2BSK B;  4DR3 O;  1WJZ A;  3ML0 A;  3X2Q B;  4DR7 B;  3L9D A;  4LBE C;  1KBH A;  3JD1 A;  1BHA A;  4PDV A;  4XDL A;  5DED A;  2NNU A;  3K57 A;  4DO2 A;  2ZR3 A;  1RPR A;  3SYO A;  2P4V A;  3B40 A;  3CJH A;  4B3M B;  4X1K B;  5H6R A;  2UXN A;  2QWP B;  5L3C A;  3WFV A;  4J7K A;  3JAT B;  4K3A A;  4LF8 B;  4DR2 O;  1JR9 A;  4IYH A;  4FFB B;  3L71 H;  3VQY A;  5JVD A;  4J9Z B;  3N2G B;  2ODM A;  3RGB A;  1DTO A;  4FK5 C;  1VQN V;  1VF5 B;  2XOK G;  3C90 A;  4O2A A;  5LGU A;  4GZR B;  2KG7 B;  1VF6 A;  3H01 A;  1F51 A;  4I55 A;  1N34 B;  1BGY H;  3WG7 B;  2F95 B;  4JTC B;  3G71 V;  4DR4 B;  1NT2 B;  5IWA B;  2Y0P A;  1NZ6 A;  4DV3 B;  4IGG A;  1TGO A;  1PP9 H;  3ZMS A;  1Q8I A;  4LFC B;  1URF A;  2Q7E A;  1EM1 A;  4DV4 B;  4LF4 O;  4DUY B;  2CUG A;  2DYR B;  4GKK O;  3ZS8 C;  1KB9 F;  4J9Y B;  5C93 A;  3QO7 A;  1PPJ H;  3JAR B;  2ZDI C;  3AG1 B;  1OHH G;  1Y67 A;  3A2F A;  3LNM B;  4H33 A;  4HBN A;  4TQD A;  4FM2 A;  4B3T O;  3P3N A;  3T1Y B;  4X88 A;  3E83 A;  4GT1 A;  1XMQ B;  2JJ1 G;  3ASO C;  4B7E A;  2LO1 A;  4GLX A;  1SES A;  4I4T B;  4K8Z A;  2BOC C;  2QM8 A;  2QKS A;  4X66 B;  2GUZ B;  1Q86 W;  4N21 A;  4KXR A;  1EZJ A;  3K0D A;  1ZL8 A;  4YIP A;  2LW1 A;  2PF4 E;  1WPB A;  2QJ1 A;  5IYC O;  3OM3 B;  2N74 A;  4H37 A;  1KP2 A;  4X65 O;  1Q90 D;  1JQ0 A;  2NN4 A;  5KHG A;  2BSK A;  4TUY B;  1YSC A;  2VQE O;  1W0K G;  3K06 A;  4IT5 A;  1FFX B;  1BHB A;  5IYZ A;  2IJI A;  3Q4H B;  3SJA C;  4R7C A;  1PKX A;  2BCC H;  5GTH Z;  1PNL A;  4QPK A;  3OEE G;  2O57 A;  2JS5 A;  3WB0 A;  2IH3 C;  1FFT B;  4FFB A;  4LFA O;  2Q69 A;  1N32 B;  1OCR C;  4O4H B;  1WP8 A;  4MW3 A;  3AG2 B;  1SQG A;  1AB3 A;  5H6Q A;  3JD3 A;  1KQS U;  3B8N A;  4JI8 O;  2UXC B;  1H2N A;  5C8Y A;  3EFF K;  3O9O A;  1THZ A;  3E22 A;  2R70 A;  2JK5 C;  4FVM A;  1N34 O;  3FB6 C;  1N4C A;  3PN1 A;  2GTA A;  1MMM A;  1XNQ O;  5D5P A;  4XDJ A;  2WLN A;  4CS4 A;  1CPY A;  2QM7 A;  3JCU Z;  3H1L H;  1QLE B;  4E2L A;  2LGW A;  5AG2 A;  1K3E A;  1GTO A;  3SYP A;  3K9A A;  3N2K B;  3JAL B;  4JAS A;  1DF4 A;  1SQP H;  5LP6 C;  3K08 A;  2FYU H;  2YXY A;  3B8M A;  2B1G A;  4B3T B;  5EK0 A;  2QKC A;  3T1H O;  3S3W A;  1MAB G;  3TXS A;  1H8H G;  4Z1V A;  5JJJ B;  1CXZ B;  2LQT A;  3SPG A;  2RQ6 A;  1P49 A;  1GM9 A;  1IVS A;  2B9Z A;  4UFZ A;  2XND G;  4JI1 B;  2PY5 A;  1KMI Z;  2DJV A;  3D36 A;  1WA8 A;  3SJQ C;  2R9A A;  1BZK A;  4UCS A;  4LF9 O;  4O2B B;  5JH7 A;  2UUA O;  1NKD A;  1ROP A;  2BTO A;  4U3J A;  5LP6 A;  1TAE A;  4RQE A;  3TGU H;  1W0J G;  2EJR A;  2YUA A;  3L74 H;  3E22 B;  4ZIB A;  1TVK B;  1OCO C;  1BSM A;  3ZRV A;  1YDX A;  1XL6 A;  3ZMV A;  1SKV A;  2YIA A;  1Z2G A;  4CH4 A;  3CRA A;  1NR1 A;  4PA9 A;  5EZY A;  2X6B A;  5CA0 B;  5LMU O;  4X9Q A;  2WLL A;  5DN6 G;  5ITZ A;  4OX9 B;  3FYI B;  1TUB B;  1AJP A;  2DYS B;  4ZI7 B;  2ZXW C;  2XAH A;  5LMN O;  2XHB A;  1PL0 A;  5LA6 A;  4UCR A;  5JCO C;  4BIO A;  4O4I B;  2LJ2 A;  2DMX A;  5L3G A;  2GTS A;  1W59 A;  1YJW V;  1NJI W;  2A9H A;  4PEL A;  4AQY B;  1N0J A;  4JAU A;  1S5J A;  2V1D A;  3VQV A;  5IYB O;  1KYO F;  5KMG B;  4JTA B;  4JI5 O;  3K9S A;  3SPH A;  4YIO A;  5FL7 G;  1I5X A;  4I4T A;  1XHX A;  3OR7 C;  2EIM C;  2F23 A;  4UB6 Z;  1KP3 A;  4DR6 O;  2X6A A;  3ZRW A;  4PDL A;  2IW5 A;  4LP8 A;  2EIL B;  5JCO A;  4FLW A;  1HW7 A;  2YEV A;  2CK3 G;  2PUS A;  4NYK A;  3CXC U;  4ZKI A;  3CPW U;  1RFY A;  5H2F Z;  5DEC A;  3JAS B;  4J41 A;  4NKG B;  4DV0 B;  1VAR A;  4LH7 A;  4WFF A;  5LXT A;  4O2B A;  4DRX B;  1PV0 A;  1OJH A;  3RVZ A;  4QE7 A;  4WF9 V;  1F7Y A;  1GN6 A;  1BQZ A;  5H9C A;  1N36 B;  2P67 A;  1WPX A;  4ZI7 A;  5CA1 B;  4DXW A;  3FKS G;  3K0G A;  4CS3 A;  2Q8V A;  4WFE A;  5EIB C;  1NQT A;  2OWO A;  4FLZ A;  4TV8 A;  4X1Y A;  1VEW A;  1MOF A;  1MNG A;  1Q6U A;  3OTF A;  1Q82 W;  4BW5 A;  1L0N H;  4PI2 A;  2DQ3 A;  2ZD9 A;  1B04 A;  4JYA O;  4YHH B;  1V54 B;  4O4L A;  1NI8 A;  5L3B A;  2EJ7 A;  3GWO A;  5JH7 B;  1QQC A;  1VQM V;  4HYO A;  1BMF G;  3BA8 A;  2AGA A;  4DR4 O;  1VQ8 V;  1JFF B;  3CP1 A;  2QM4 A;  5B1O A;  2WA3 A;  3ZCC A;  1OCR B;  2AXT Z;  4UUJ C;  3BHP A;  1QCE A;  3MHH C;  3RYI A;  3S3X A;  4KHP O;  1KC8 W;  4YJ3 B;  4LFA B;  3T2M A;  1US6 A;  3VBB A;  1L1F A;  1K97 A;  1VQ9 V;  2RJZ A;  4BIU A;  3OR6 C;  1K33 A;  4NTW A;  4JI3 B;  2YEV B;  3W7S A;  1SQV H;  2UXX A;  2VQF B;  5IY5 B;  2YIC A;  1E1R G;  1AP6 A;  1YI2 V;  1SA0 A;  4DR1 B;  3GVM A;  1AI6 A;  3VOU A;  4DYL A;  3RT3 C;  2CH7 A;  2ZT9 B;  3G6B A;  1IZ3 A;  2DYR C;  3FX7 A;  5L3E A;  4RO2 A;  1XNR B;  4RQF A;  3D3Q A;  3UT5 A;  3K04 A;  1AR4 A;  4I50 A;  4WBN B;  3G6E V;  1KKD A;  1FJG B;  2HFE C;  4PA4 A;  4JI0 B;  3KCY A;  2MK3 A;  4Q20 A;  5B1B B;  1JA8 A;  3OUS A;  3CME V;  1YF2 A;  2QEX V;  4LFB O;  1HNW B;  3OFN G;  1YXB A;  4O4I A;  1WP7 A;  1RM1 C;  5KUK A;  2CGO A;  1G6U A;  2JGU A;  5CA0 A;  4UB8 Z;  4DR7 O;  5J2T A;  1YIT V;  3AG1 C;  4ZOL B;  3KZI Z;  4R50 A;  2LFR A;  2Q73 A;  2W0X A;  3JYC A;  1TVK A;  2GUZ A;  1N33 O;  2F4V B;  1FD9 A;  3CRM A;  2CE4 A;  4PDM A;  4TT3 G;  2WLM A;  3JSN A;  1QVG U;  3OMI B;  4DV2 B;  3H1K H;  1WA8 B;  3AG3 B;  4JI6 O;  3IC9 A;  1M57 B;  4MW8 A;  2F43 G;  4UCU A;  1XL4 A;  2PZS A;  1U97 A;  2ILM A;  3LDE A;  3ABM C;  4JPR A;  3FB5 C;  2Q7G A;  3JD0 A;  2F93 B;  1J5E O;  2N04 A;  3OEH G;  2EIJ B;  3APQ A;  4DUZ B;  4GX0 A;  3C3T A;  3I56 V;  3ZMZ A;  3N2K A;  4JV5 O;  5EIB D;  1GH6 A;  3MHS C;  2ATK C;  5D5Q A;  2QTS A;  3RW0 A;  1HNZ O;  3FB8 C;  1F4M A;  3CB2 A;  1CP9 A;  4WCE V;  1DLB A;  1L0L H;  4RAI A;  3RBZ A;  2HVJ C;  2R9I A;  1H8E G;  5LBQ A;  3CHX A;  3JAK A;  2NLJ C;  3ZBH A;  2HJD A;  4D7T A;  4TWK A;  3CYO A;  1M1K W;  1V55 C;  2OIE A;  2RDC A;  2VWK A;  5KAF Z;  4U3F H;  3CE2 A;  3UKM A;  1LR1 A;  3T4Z A;  3AK1 A;  2ITD C;  3ZMU A;  1D2D A;  2QTO A;  2QKA A;  4JI4 O;  4LF7 B;  1JJO A;  2YC0 A;  4PDR A;  4LC1 A;  1R3J C;  3IC7 A;  3E8G A;  2AW9 A;  2X0L A;  4X1Y B;  5JJE B;  2E74 B;  1SRY A;  2CAZ C;  2E3C A;  3GB7 C;  1BCC H;  2Q7H A;  3OE7 G;  2IJK A;  4LFC O;  1HNX B;  5KA5 A;  4FLU A;  1FS0 G;  2CGN A;  3G80 A;  2ADP A;  1XUQ A;  4KL1 A;  1IBL O;  3G4S V;  3SJC C;  4DW1 A;  2DE0 X;  4JI7 B;  4PA3 A;  4UCO A;  1EN4 A;  5LMN B;  2XAS A;  1ZLZ A;  4DV2 O;  3I5D A;  4NVP A;  3HKE A;  2YI8 A;  2RCV A;  3H1J H;  4HNA A;  4CZZ A;  1LUV A;  3FAV B;  4MS2 A;  4UCV A;  2QGN A;  4MSW C;  2Q6A A;  1P7G A;  4AHC A;  3BAB A;  4EFE A;  3SGI A;  5FNV A;  3B77 A;  1YJN V;  3DC6 A;  4ZOL A;  2OCC C;  1K7D A;  2JVD A;  4FM0 A;  2WLK A;  1VIB A;  4DR6 B;  1XMO O;  1YVW A;  1YHQ V;  2IU3 A;  4FLT A;  4OPA A;  2VQE B;  1DK1 A;  5IYZ B;  5EC1 C;  5JQG B;  1COW G;  4H13 B;  4NR1 A;  4J7J A;  4DV6 O;  1GM8 A;  4LH6 A;  2HVK C;  1S3J A;  4JYB A;  1WB8 A;  4DV3 O;  4DV5 O;  3E8H A;  4WBN A;  5IJ9 A;  4NXN O;  5KHK A;  3F7V C;  1RSO B;  4JYY A;  3EXA A;  3AG4 B;  3HKE B;  1K4D C;  1OCC C;  3HPL C;  1E79 G;  3CCS V;  5KAI Z;  3UQ8 A;  2YDE A;  1S77 D;  3RVY A;  1XIL A;  1XRE A;  1TUB A;  2IU0 A;  4EFB A;  1Q3E A;  1NR7 A;  4PHZ A;  1HR0 O;  3DTU B;  4X20 A;  4UVA A;  1X59 A;  4B3R O;  4HAM A;  1EZV H;  2QWQ B;  2JGD A;  1QNM A;  2XT9 A;  1QR8 A;  3M7M X;  5KHI A;  2WWW A;  2KSD A;  4LF5 B;  4L8J A;  4KUM A;  3CJH B;  3OAA G;  5B5E Z;  1GAX A;  2YXH A;  5H5N A;  1VF7 A;  1H38 A;  5EYP B;  4F4L A;  2BTQ B;  2G38 A;  4QE9 A;  1AR1 B;  2XAQ A;  1JVM A;  1VP7 A;  3A0R A;  3SR2 C;  1CEZ A;  5KHJ A;  2F4V O;  3HR0 A;  4JI7 O;  2WLH A;  4X64 B;  1BL8 A;  3UT5 B;  4F6R A;  2A0L A;  2GHY A;  2ARH A;  1R73 A;  3ETG A;  1Y74 B;  2KG7 A;  1SQX H;  4UV9 A;  3NXS A;  2ZE8 A;  4X1I B;  3ETQ A;  1N32 O;  4AI8 A;  2E75 B;  1RP3 B;  2LFS A;  3CRQ A;  4CH6 A;  3K59 A;  2R72 A;  2HHH O;  3CCQ V;  1JX9 A;  1J5E B;  3THO A;  4JI5 B;  2Y0I A;  2YXL A;  2B1I A;  2E76 B;  1DGS A;  3M8A A;  3JAS A;  3OTO B;  3CC7 V;  3LUT B;  4MVS A;  2GDS A;  2Q68 A;  3TCU A;  5EBW C;  4LF6 B;  3HKC B;  4OX9 O;  1S0V A;  4YXW G;  4I7Z B;  3CCJ V;  4LNU B;  1XQ8 A;  4PJ0 Z;  4TV9 B;  1HNW O;  4N23 A;  1VQK V;  5EYP A;  3JAK B;  1NVP D;  4PA6 A;  4MVO A;  4A5U B;  3J80 N;  3L75 H;  2HR3 A;  2DOS A;  4K0K O;  2AZ0 A;  3MAQ A;  4JGS A;  4DUY O;  2H94 A;  3J81 N;  3WU2 Z;  1M56 B;  5J9P C;  1Z5V A;  1S5H C;  4PI0 A;  3W7U A;  2HP8 A;  2ZCE A;  3ZIA G;  1HR0 B;  3OMA B;  1W2B U;  2XUM A;  1RPO A;  1Y76 A;  4TQF A;  1OCO B;  4EB6 B;  3SYQ A;  4GKJ B;  4WFG A;  5JJN B;  2AHY A;  3OUF A;  2ZKO A;  4NB5 A;  3SPC A;  3WG7 C;  5B3S B;  3C3S A;  5KMG A;  1FYJ A;  1MSW D;  4X66 O;  4H0L B;  5IJ0 A;  3CRC A;  4J7Z A;  1G1X B;  3AEI A;  1K5S A;  4UCT A;  1EFR G;  2PI5 A;  4MVM A;  3RYC A;  1B3Q A;  5KHH A;  4W4K A;  2WLL B;  1IBM B;  1AI4 A;  3JAW A;  3LSS A;  4J11 A;  3BPZ A;  5LL6 Y;  4LR3 A;  1QLE C;  2ZM6 O;  2PYJ A;  4C7U A;  5JQG A;  1LUW A;  4JV5 B;  2JEU A;  5B1B C;  4UXN A;  1L8D A;  3BCC H;  1OCZ C;  2IJH A;  2ZE5 A;  3ZN1 A;  4UVB A;  3BVO A;  2JRI A;  3DGE A;  4NTY A;  4ZHQ B;  3OMN B;  4OGQ B;  2Y48 A;  1FFX A;  1GN2 A;  3JAR A;  4UVC A;  2Z5U A;  5GW7 A;  1JFF A;  3ZHU A;  2IBZ H;  4J42 A;  5LHH A;  2CTQ A;  2UUC O;  1RSO A;  2EIJ C;  2P4K A;  2A06 H;  1ZX3 A;  4DK1 A;  3E89 A;  1SS3 A;  2JS3 A;  3CX5 F;  4ABM A;  1SA0 B;  1KD1 W;  5LOV B;  1IUR A;  2IJJ A;  4NXM B;  4L87 A;  5LOV A;  4LFB B;  3JD4 A;  1GK9 A;  4P9P A;  4K0K B;  3HB3 B;  3AK3 A;  4XBF A;  1M56 C;  2YI9 A;  3RN4 A;  4GX5 A;  3FYE B;  3IFX A;  4DRX A;  1GN3 A;  1PD3 A;  4DR1 O;  3E2E A;  1XBL A;  4YJ2 B;  3I55 V;  5IY5 C;  4R6Z A;  2EUL A;  1WNS A;  2ZR2 A;  2WSS G;  3LNN A;  2QE7 G;  4LF5 O;  4FIP C;  1N8R W;  2Q9L A;  4JI1 O;  1BS3 A;  4I55 B;  2FB5 A;  2GV9 A;  4LF9 B;  1V9P A;  4IHJ B;  1Q6I A;  3SPI A;  3H9V A;  1B6Q A;  1R6K A;  1AP5 A;  4WFH A;  3FFQ A;  1NTK H;  2QWR B;  1K92 A;  2ZDI A;  2EZP A;  1T5E A;  2P90 A;  1Q6H A;  4YHH O;  1VQO V;  4EEQ A;  4TOI A;  3K5O A;  4B3S O;  1I94 B;  3AK2 A;  1N33 B;  4TUY A;  2FTK A;  1SQQ H;  4DR5 B; 
#chains in the Genus database with same CATH homology
 1PNL A;  2P6J A;  4PDR A;  2JJ2 G;  2X7R B;  1TUE B;  3FB7 C;  5CA3 A;  4LC1 A;  4QPK A;  3OEE G;  1R3J C;  1QBZ A;  5HFM A;  4U7N A;  4FPP A;  1JPX A;  2IH3 C;  3IC7 A;  1FFT B;  3E8G A;  3CCU V;  2X0L A;  2Q69 A;  1SRY A;  2X6C A;  3LSQ A;  1OCR C;  1UJW B;  3GB7 C;  2HKO A;  5EC2 C;  1ENV A;  3STL C;  4MW3 A;  3AG2 B;  3OE7 G;  2IJK A;  5H6Q A;  3JD3 A;  1AJQ A;  4ASU G;  1RM1 B;  1KQS U;  5KA5 A;  1FS0 G;  3B8N A;  3ASO B;  4GCZ A;  2LP7 A;  4JF3 A;  4EKW A;  3EFF K;  1FXK A;  2JEX A;  2IH1 C;  5EBM C;  3ETD A;  1LNQ A;  1THZ A;  4TSF G;  2DQ0 A;  3E8B A;  3JD2 A;  1ORQ C;  3D3I A;  5B1N A;  1SET A;  1M9N A;  2JK5 C;  3P32 A;  4QJF B;  5CN0 A;  2JIZ G;  3G4S V;  1VQP V;  4MVR A;  2C2A A;  3FB6 C;  3T1C A;  4PA3 A;  2D3O W;  3OW2 U;  2XAS A;  5BZB A;  4XDJ A;  2WLN A;  3E8F A;  3K3W A;  1R3K C;  2W0F C;  1CPY A;  2QM7 A;  3CCM V;  4P2Z A;  4CZZ A;  5LHI A;  4BAY A;  1QLE B;  2Q67 A;  4E2L A;  2EIK C;  2EIL C;  1VQ6 V;  4MS2 A;  1K3E A;  1GTO A;  3SYP A;  3EHB B;  4MTF A;  3K9A A;  3QO5 A;  4JAS A;  1DF4 A;  4MSW C;  2Q6A A;  3K08 A;  3W7T A;  1K8A W;  3B77 A;  2EIM B;  3B8M A;  5KA6 A;  2B1G A;  1YJN V;  3KG2 A;  1DF5 A;  5EK0 A;  2ZQM A;  2WLI A;  2OCC C;  1FXV A;  1K7D A;  2WLK A;  3PJS K;  1MAB G;  3SPJ A;  2ITC C;  5IYD O;  1YHQ V;  2IU3 A;  1H8H G;  1WLE A;  4JYC A;  3ASN B;  1PNM A;  5E1A C;  5EC1 C;  3SPG A;  4MVU A;  1COW G;  1GM9 A;  2XND G;  3ABT A;  1GM8 A;  1F23 A;  2HVK C;  3D36 A;  1S3J A;  4JYB A;  4OXS A;  3SJQ C;  2DWE C;  1PNK A;  3P30 A;  3E8H A;  5LGN A;  2KB1 A;  3ABU A;  1NKD A;  4ZBM A;  1ROP A;  4HZ3 A;  2EIN B;  2XAJ A;  1E1Q G;  2OT5 A;  2A79 B;  3E86 A;  3F7V C;  3E35 A;  1VQ7 V;  4I5S A;  4MTO A;  3AG4 B;  4RQE A;  1V55 B;  1K4D C;  1OCC C;  1HWY A;  1W0J G;  2EJR A;  3HPL C;  1E79 G;  3CCS V;  3K03 A;  1OCO C;  3UM7 A;  3LDD A;  3ZRV A;  1XL6 A;  3ZMV A;  1S77 D;  3ABK B;  3RVY A;  2EIN C;  3F5W C;  2IU0 A;  3ZMT A;  3ZRX A;  2WLJ A;  1NR1 A;  4PA9 A;  5EBL C;  2X6B A;  1YTF D;  2Y69 C;  1GKF A;  2B5U A;  4QPJ A;  3X2Q C;  1NR7 A;  2EIK B;  2QA4 V;  3DTU B;  4UVA A;  2WLL A;  4G27 B;  5DN6 G;  2HJF C;  1YJ9 V;  3FYI B;  4HAM A;  1AJP A;  3ABL C;  4QNH B;  2DYS B;  1Q81 W;  3ASN C;  4FMT A;  2ZXW C;  1H2G A;  2XAH A;  1I5Y A;  1V54 C;  1QR8 A;  5DM6 V;  5LHG A;  2WWW A;  1PL0 A;  3ETE A;  5CBH A;  2GSM B;  4KUM A;  1QR9 A;  1YIJ V;  3LDC A;  1R3I C;  5L3G A;  3OAA G;  1YJW V;  1FXH A;  2WAM A;  1P4R A;  3MD0 A;  1VQ5 V;  1H38 A;  1M90 W;  1NJI W;  2A9H A;  4PEL A;  4F4L A;  4JAU A;  1MG1 A;  4QE9 A;  3ZJZ A;  2V1D A;  1AR1 B;  1VQL V;  5IYB O;  1NVP B;  2XAQ A;  1JVM A;  4JTA B;  3A0R A;  4MTG A;  2R9R B;  3SPH A;  1CEZ A;  5FL7 G;  1I5X A;  1JJ2 U;  1K4C C;  3AG3 C;  3OR7 C;  2EIM C;  2WLH A;  3TET A;  1GM7 A;  4KFM A;  1SER A;  1QVF U;  1BL8 A;  1KP3 A;  2X6A A;  3ZRW A;  2A0L A;  2H8P C;  2GHY A;  4BIZ A;  1QLN A;  4PDL A;  3QNE A;  1R73 A;  2IW5 A;  3ETG A;  2AHZ A;  1AI7 A;  4LP8 A;  1YTF B;  1F4N A;  1NBM G;  3ABL B;  4UV9 A;  2EIL B;  1SZT A;  3NXS A;  4RUF A;  5CBF A;  2K1E A;  1M57 C;  4XDK A;  2YEV A;  2CK3 G;  2Y69 B;  4LCU C;  3CXC U;  4ZKI A;  2LFS A;  3CPW U;  3CCQ V;  1JX9 A;  1R3L C;  3CCV V;  1EBO A;  3M99 B;  4G2K A;  4WFF A;  1NH2 D;  3CC4 V;  2B1I A;  3RVZ A;  1KEC A;  1P7B A;  2P7T C;  4QE7 A;  1ZWI C;  4MVZ A;  5CMU A;  4WF9 V;  3T4D A;  4UV8 A;  3ZRW B;  3CC7 V;  2DW4 A;  5B3S C;  3LUT B;  3W7W A;  3CCE V;  2DYS C;  5H9C A;  4MVS A;  2Q68 A;  3BY6 A;  3TCU A;  5EBW C;  2ZXW B;  1OCZ B;  3STZ C;  2P67 A;  1S0V A;  4MT8 A;  4YXW G;  1JOY A;  5IDJ A;  1WPX A;  3CCJ V;  1Y66 A;  4DXW A;  5L3D A;  2EBO A;  3FKS G;  3K0G A;  4N23 A;  4QIW F;  4WFE A;  1VQK V;  1NQT A;  3CMA V;  3F7Y C;  4PA6 A;  3SYA A;  4MVO A;  1NVP D;  1G4Y B;  2HR3 A;  3ABK C;  4GX2 A;  4WFB V;  1S72 V;  1JCH A;  4I9W A;  1MOF A;  1Q82 W;  4JGS A;  2H94 A;  5B1A B;  4BW5 A;  3CD6 V;  1M56 B;  5J9P C;  1S5H C;  2DQ3 A;  3W7U A;  2ZD9 A;  4WFA V;  3ZIA G;  4P9O A;  3ZRS A;  3OMA B;  1V54 B;  4RUE A;  5L3B A;  1W2B U;  3GWO A;  2OTL V;  3CC2 V;  1RPO A;  1AI5 A;  5HFL A;  2JDI G;  5L3F A;  1VQM V;  4HYO A;  2EZO A;  1BMF G;  1OCO B;  3SYQ A;  3CCL V;  4WFG A;  2AHY A;  3OUF A;  3CCR V;  1VQ8 V;  3CP1 A;  5B1O A;  3SPC A;  3TK1 A;  3WG7 C;  3ZCC A;  1OCR B;  4UUJ C;  1R6N A;  5B3S B;  4FJC C;  1QCE A;  3MHH C;  1MSW D;  3ABM B;  1KC8 W;  3ZN0 A;  2OCC B;  3T2M A;  3VBB A;  1L1F A;  1K97 A;  2BOB C;  1VQ9 V;  4Z1M G;  4BIU A;  3OR6 C;  4P30 A;  3AEI A;  1K5S A;  1K33 A;  1EFR G;  2PI5 A;  3W7S A;  2YEV B;  4MVM A;  1NH2 B;  4X89 A;  2UXX A;  1IXM A;  2WLL B;  5IY5 B;  1Q7Y W;  1VQ4 V;  1E1R G;  1AI4 A;  3LSS A;  3ML0 A;  3X2Q B;  1YI2 V;  4LBE C;  3JD1 A;  1QLE C;  1BHA A;  1AI6 A;  4PDV A;  3VOU A;  4XDL A;  2NNU A;  4DO2 A;  2JEU A;  2V7Q G;  2ZR3 A;  5B1B C;  1K34 A;  4UXN A;  1RPR A;  3SYO A;  1OCZ C;  2IJH A;  2DYR C;  3ZN1 A;  5L3E A;  4UVB A;  4RO2 A;  1OZ0 A;  5CBG A;  4RQF A;  3K04 A;  5H6R A;  3G6E V;  1KKD A;  2HFE C;  4PA4 A;  2UXN A;  1K9M W;  5L3C A;  3DGE A;  2PI4 A;  2MK3 A;  4Q20 A;  5B1B B;  4X8A A;  3WFV A;  3OUS A;  3OMN B;  3CME V;  2QEX V;  2Y48 A;  3OFN G;  2XAF A;  4UVC A;  2Z5U A;  5GW7 A;  2OTJ V;  4J9Z B;  1RM1 C;  5KUK A;  1G8M A;  3OGC C;  1DTO A;  4FK5 C;  5LGT A;  5LHH A;  1K5Q A;  4R8C A;  3JCZ A;  4MTX A;  1VQN V;  2XOK G;  2EIJ C;  2WLI B;  1GMG A;  3AG1 C;  3SYC A;  1YIT V;  4CBC A;  5LGU A;  4R50 A;  2LFR A;  3JYC A;  3H01 A;  1F51 A;  3E89 A;  4PDM A;  4TT3 G;  2HG5 C;  3WG7 B;  1KD1 W;  4JTD B;  2WLM A;  1QVG U;  3W7X A;  3OMI B;  1GO3 F;  3QO8 A;  4JTC B;  3G71 V;  4G28 B;  3AG3 B;  2IJJ A;  3AG2 C;  2HLD G;  1M57 B;  4MW8 A;  4L87 A;  3IGA C;  2F43 G;  3ZMS A;  3JD4 A;  1GK9 A;  4P9P A;  1XL4 A;  2Z3Y A;  4JAV A;  1AJN A;  2XAG A;  1J95 A;  3HB3 B;  4XBF A;  1M56 C;  3LDE A;  3ABM C;  4JPR A;  2DYR B;  3FB5 C;  1OCC B;  3AG4 C;  4J9Y B;  5C93 A;  3QO7 A;  3JD0 A;  3OEH G;  2ZDI C;  2W6J G;  2EIJ B;  1OHH G;  3AG1 B;  4GX5 A;  5KUM A;  3LNM B;  3FYE B;  3IFX A;  4H33 A;  1PD3 A;  4GX0 A;  4MVQ A;  4U7O A;  4X88 A;  3E2E A;  3K79 A;  3E83 A;  3I56 V;  3ZMZ A;  3I55 V;  5IY5 C;  4GT1 A;  4R6Z A;  2JJ1 G;  3ASO C;  3MHS C;  2ATK C;  2ZR2 A;  1SES A;  2W6I G;  2DWD C;  3RW0 A;  2WSS G;  3BEH A;  3FB8 C;  2BOC C;  1F4M A;  2QKS A;  2QM8 A;  4KP4 A;  1CP9 A;  2QE7 G;  1K73 W;  4WCE V;  1DLB A;  4FIP C;  1Q86 W;  4RAI A;  1N8R W;  3RBZ A;  2HVJ C;  4N21 A;  2R9I A;  1H8E G;  1S76 D;  1EZJ A;  3K0D A;  5LBQ A;  3SPI A;  2NLJ C;  1B6Q A;  1R6K A;  3CYO A;  4TWK A;  1M1K W;  4WFH A;  1V55 C;  2M7W A;  5IYC O;  3OM3 B;  4H37 A;  1KP2 A;  1K92 A;  3R65 A;  4GX1 A;  1JQ0 A;  3UKM A;  2ZDI A;  1FXK B;  3T4Z A;  2WPD G;  2EZP A;  2ITD C;  1FXK C;  2P90 A;  3ZMU A;  1YSC A;  1VQO V;  1ARO P;  1W0K G;  2QTO A;  3K06 A;  5B1A C;  1BHB A;  2YSU B;  2IJI A;  1Y4M A;  4PA7 A;  4R7C A;  2FTK A;  1PKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...