3R65A

Mthk channel pore e92q mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
82
structure length
82
Chain Sequence
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVQRLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title Crucial points within the pore as determinants of K+ channel conductance and gating
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Membrane protein
total genus 30
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3r65A00
3ASOC 3SPHA 1K4CC 1M57C 2AHYA 2ATKC 4MVQA 4PA6A 4MVOA 4RUEA 4XDJA 3SYAA 4J9ZB 3ZRSA 4MSWC 1ZWIC 4DXWA 4GX0A 3LDDA 3FB7C 3ABKC 1LNQA 2WLIA 2WLIB 3STZC 4J9YB 2KB1A 3LDEA 1V55C 2WLJA 4MS2A 1S5HC 3F7VC 1OCRC 4HYOA 3RVZA 3E8BA 4PA9A 1G4YB 4PDMA 5IY5C 4H37A 4UUJC 4CBCA 3ASNC 3LUTB 4PDVA 5E1AC 5CBHA 3AG1C 4MVSA 2BOCC 2HVKC 3FB8C 4MVRA 5KUKA 5EK0A 2P7TC 3HPLC 4P2ZA 4MVUA 4MW8A 4PDLA 2HVJC 4ZBMA 3R65A 3E8FA 3LDCA 4JTAB 3OR7C 3SPJA 3E8HA 3FB6C 3SYQA 3TCUA 5J9PC 4GX5A 4HZ3A 4LP8A 4BW5A 2R9RB 4R6ZA 5EBWC 2Q6AA 5CBFA 4RUFA 5BZBA 4WFEA 2Q67A 3UM7A 2WLNA 2ZXWC 3K08A 1R3IC 3K0GA 3TETA 2IH3C 2DYRC 1OCZC 2WLMA 4WFHA 3T2MA 3T1CA 2K1EA 4QE9A 2Y69C 4G27B 3SYPA 1ORQC 3E83A 2H8PC 3BEHA 3OGCC 2NLJC 5EC2C 3RW0A 5EBMC 4MTOA 2BOBC 4WFGA 5B1AC 4EKWA 2A0LA 3T4DA 5B3SC 2WLLA 4G28B 2WLLB 2EIKC 2EIJC 2ITDC 4PA7A 3STLC 2HJFC 1R3LC 4JTCB 5EC1C 5CBGA 4MW3A 1OCCC 4MTGA 4TWKA 2EIMC 2YEVA 4RO2A 3AG4C 2QTOA 1BL8A 2DWEC 1M56C 3KG2A 3OR6C 3ABMC 3PJSK 3AG2C 4PA3A 3AG3C 4X8AA 4X89A 3UKMA 2X6CA 4QNHB 3K03A 2Q69A 3LNMB 4PDRA 1K4DC 2QKSA 2EINC 3ZJZA 4OXSA 2AHZA 4MTFA 4P30A 3SPCA 4JTDB 3SYCA 4F4LA 1QLEC 2WLKA 3X2QC 3RVYA 4XDLA 3F7YC 3OUFA 4KFMA 3VOUA 4R7CA 2X6BA 2DWDC 1XL6A 2HG5C 3GB7C 3JYCA 2OCCC 3F5WC 3OUSA 4P9OA 2WLHA 2A9HA 2IH1C 4LBEC 4PA4A 4WFFA 1R3JC 2ITCC 2EILC 5KUMA 3E8GA 2JK5C 5EBLC 5B1BC 3E86A 2A79B 3SJQC 4LCUC 4MVZA 1J95A 2DYSC 2X6AA 4H33A 3IGAC 3RBZA 3E89A 2Q68A 3FB5C 3ABLC 3SPGA 3K0DA 1V54C 4RAIA 1XL4A 3EFFK 4GX1A 1OCOC 2ZD9A 3SPIA 3T4ZA 4X88A 3SYOA 3WG7C 1R3KC 1KKDA 4I9WA 4QE7A 2HFEC 3K04A 3K06A 4GX2A 4P9PA 1JVMA 3IFXA 4R8CA 4MVMA 4XDKA 1P7BA 2W0FC 4R50A
chains in the Genus database with same CATH superfamily
1PL0A 2GUZA 1LUWA 3ZIAG 1RPOA 2WLIB 4HNAB 2LFSA 5E1AC 3ZHTA 1XNRB 3HPLC 3OMIB 2UUBB 2LJ2A 3GWOA 3LDCA 3RYFA 2UXBB 5KAIZ 3B09A 1XREA 1WB8A 2AW9A 3EVKA 4TV8A 4DR7B 1HNXB 4LC1A 1DGSA 2IU3A 3OW2U 4TV9B 3H1IH 2A3QA 3BA9A 3RW0A 5LXTA 4FM1A 2MW2B 2WLLA 3K58A 1AB3A 2QE7G 1K8AW 1Q81W 1VQ8V 1M1KW 4YXWG 1KQSU 3E22A 1Y66A 1K97A 3CCMV 4DV5B 4K0KO 1BSMA 4RO2A 3KZIZ 4O4LA 3Q4HB 3SDLA 3HKDA 1NS1A 1FFTB 1AR5A 5KA5A 5LMUO 1J5EB 3ZMSA 4EFBA 3K9AA 4F4LA 1O9GA 1QLEC 2QA4V 1YVWA 3GB7C 3OUSA 3FX7A 4I4TB 3UT5A 3CCUV 1QR8A 5LBQA 4DR4B 2ADPA 2V4DA 3P3NA 3OTOB 4JI4B 2A79B 1J95A 4H33A 1X59A 1EN4A 3G67A 2XT9A 1XOUA 4LFCO 3JD0A 2IJHA 3QO5A 5KHIA 3DXRA 2YSUB 1VQOV 1KB9F 1S5JA 4O2BA 3HKEB 1KKDA 4UVAA 4QE7A 1K92A 1VQPV 3ABTA 3OTOO 4JI4O 1R73A 4I7ZB 2AHYA 4NTWA 4MVQA 1I5XA 4XDJA 4J9ZB 3E2EA 4DXWA 3ZRWB 3D8CA 3CXHF 5KLVH 2WLIA 3STZC 5JCOC 3CWBH 4HNAA 4HYOA 1W2BU 4K8XA 3E8BA 3K79A 4JAVA 3FB8C 3HB3B 2Y0IA 1GMGA 3MD0A 2RCVA 5KHJA 3E8FA 1SRYA 2H3OA 2Q73A 2EILB 2PF4E 4IIJB 1QQCA 2HEPA 2IH3C 4X65O 3LSSA 4WBNB 3ZMUA 1M4UA 5CB4B 1AJNA 4TV9A 1VQKV 1QR9A 5EC2C 2YI8A 5EBMC 4WFGA 5B3SC 1VQ4V 3UO2A 4MTGA 4LF8B 3Q4HA 2KG7B 1M56C 1VQ5V 1MNGA 2F95B 2UXDO 3K9SA 4PDRA 1B6QA 5IY5B 1UFIA 4L87A 3SYCA 3P30A 3K3WA 3AEIA 3U11A 1H2KA 2P06A 3THOA 4I4TA 2K9PA 1Q86W 2ITCC 4CS4A 3VQYA 1BMFG 1PNLA 1NVPB 3L72H 3JCZA 3CS5A 3BY6A 3AG7A 1GN4A 4K35A 5L3CA 1K5QA 2R9IA 4FPPA 3HKEA 4CS2A 4X9QA 1FKAO 2M6YA 1HNWB 4GKJO 1P7BA 2EJRA 2QM4A 1PV0A 3L70H 1SZTA 1GM8A 1FPOA 3CMEV 5EIBD 2NNUA 3ZRWA 3T1HB 4DV1B 4I5SA 1R6KA 1H2GA 4ZI7B 4N21A 3RVZA 3TJTA 1G4YB 3BCCH 1JPXA 1SQXH 5L3DA 4JI3O 2QTSA 2ADQB 3ZHVA 4P2ZA 3L73H 4DUYB 1DLBA 3LSQA 3OD4A 1N0NA 5H5NA 1IVSA 2ZCEA 1IBMO 2EX3A 1IBKO 4IIJA 2IW5A 4ABMA 4DV1O 3JSNA 4D7SA 2CTQA 4WBNA 5IYCO 1ZAUA 1QLNA 3T1CA 5CB4A 1QVGU 3E83A 4LF7B 4FVMA 1EN5A 3MHHC 3M99B 3J81N 4JASA 2XAJA 4LF6B 4CH5A 2IU0A 3ASOB 1VARA 4CZZA 4GUNA 3RWRD 2KG7A 4FLVA 4PD4F 3UKMA 2YC0A 1SQBH 3QVNA 4LF7O 1KU9A 1K4DC 2EZOA 4UVBA 1H38A 2P6JA 3N2GB 2F1MA 4LF6O 4JI6B 4DUZO 3IC7A 1MABG 4UCRA 3I56V 3CMAV 1R1BA 1JMKC 3FYEB 4JYAB 3SJQC 4GCZA 1VQ9V 3E89A 3KCXA 4UCSA 2RNBA 5D5QA 1H2LA 2Y0PA 4NVPA 4FZ0A 2EIJB 2Q0OC 4ASUG 1BS3A 1JVMA 1IXBA 4F6EA 3T1YB 4Z2WA 2ATKC 1DK1A 2Q7EA 2F4VO 1L8DA 2GTSA 4CH3A 2KB1A 4ZI7A 2DE0X 1GM9A 2FTKA 4J11A 2QR4A 5CBHA 2UUCB 3A8TA 2HVKC 3NXSA 5CMUA 1ZX3A 3JD2A 5LL6Y 4GKKO 2PYLA 4B7EA 4FFKA 1QU7A 3OR7C 1BQ0A 1FXKB 5FPRA 2YDEA 3VQWA 2EZPA 2OTLV 5B1BB 1HR0O 3ZN1A 4B3TO 1NQTA 4JI8O 1WAZA 2Z0AA 4FK5C 5LOVB 1N33O 1PPJH 1VQLV 4B3MO 2NR5A 2QWOB 1N36O 4CC6A 3O9OA 1AJPA 4NXNB 1Q8IA 1E1RG 1KMIZ 1NZ6A 4X64B 2F43G 3D36A 3BAAA 2YXHA 4RWUA 2ZKOA 1QVFU 5ITZB 4O4IB 2BE3A 2W6IG 4OXSA 1SQVH 2AHZA 4MTFA 1URFA 3DC5A 5FLXN 4X64O 3RYCB 1I0HA 1NKDA 4DV4O 2KSDA 1FXVA 4PA4A 3OFNG 3SGIA 2WAMA 5EBLC 4FZ1A 5CA3A 3VBBA 3BRCA 2L35A 2PY5A 4G2KA 1OCZB 3M7MX 3B4SA 5IE9A 1Z2GA 4BIUA 3CXCU 2DQ0A 1JR9A 4GX1A 4X66O 1M93A 1PKXA 2ZE7A 4GX2A 3IFXA 3CJHB 4EFEA 3RGBA 2JEXA 2VQFB 2PUSA 5IT9N 1U96A 4NB5A 1ZWIC 1VQMV 1YSCA 3ABMB 2DQ3A 1AJQA 5KAFZ 5BR8B 2LW7A 4PDMA 4H37A 4CBCA 3H9VA 3S3XA 4O4HB 4ZOLB 2BOCC 4B7KA 1WP7A 4GZRB 3TK1A 3KCYA 4JZGA 4ZBMA 1LUVA 3JAMN 2VQFO 5JQGB 3FFQA 3SPJA 1FXKA 2HHHO 4FLTA 3ZEDA 4DO2A 5GW7A 2D3OW 3MDSA 2WLNA 3K08A 3N27A 2UUAO 2N04A 2HP8A 4O2AB 5H6RA 5LOVA 5FL7G 4AHCA 2GHYA 2XAFA 1AI7A 3HKBA 4LFBO 5HFMA 3ZX6A 2F93B 2ITDC 1NH2D 4JI1B 1KP2A 2YIAA 2BTQB 1Q6UA 4YHHO 1SETA 4YIOA 2C2AA 4UB8Z 1VP7A 4XBFA 3JD1A 1Q5OA 4O4IA 5ITZA 5IJ0B 4MT8A 3ZBHA 5LGNA 2FL4A 1KD1W 4AQYB 2UXNA 1KKCA 3RYCA 5LMNO 3ZMZA 1BQZA 2EILC 3CCJV 3JSLA 3E8GA 2JK5C 1U97A 2CDYA 2CH7B 2CUGA 2WSSG 4DV0B 3QNEA 2VQEB 3G80A 5F2VO 4RAIA 1YDXA 1MA1A 3T4ZA 1OV9A 2ZNJA 3H1HH 2HFEC 4DR2O 3CRQA 3CJHA 4R50A 1K4CC 2UU9O 1YTFD 1L0NH 1RFYA 2VQEO 1THZA 1TVKB 3ZMVA 4DR5B 3LDDA 5IJ9B 2JIZG 1N32O 2WLJA 1EN6A 1ZL8B 4J7ZA 5IY5C 4PA9A 1HW7A 4YY3B 4O4HA 1H2MA 4ZOLA 1XMQB 3L71H 1H2SB 2FMLA 5LHIA 2ZR3A 3J80N 5JQGA 2OCCB 3TCUA 1CXZB 5IWAB 4DW0A 3L75H 3P32A 3NR7A 1GN3A 1PNMA 3CRAA 3D3IA 1NTMH 4QE9A 2CTWA 4G27B 3SYPA 4QPJA 3ZCCA 1F7YA 1OCOB 1UJWB 4OPHA 2R72A 4MTOA 1QHTA 4LF9B 1AI4A 4G28B 4FMTA 2ZNIA 4JTCB 1SERA 2BTQA 4FLUA 1K33A 1TGOA 4F6RB 4OPAA 4PA3A 4OX9B 2X6CA 5IJ0A 3W7UA 1XNRO 2UUBO 1AR4A 5BXZA 2WLKA 2UXBO 1JJ2U 3CEIA 3OEHG 4CH6A 4DR7O 1SS3A 1HNXO 5LYJB 2RDCA 3JAWB 2ZINA 2Q5ZA 2ZIOA 3ZS8C 2CH7A 2X6AA 1MZFA 2Q0AA 1OZ0A 1MSWD 1YJNV 2DYRB 2Y69B 1PM9A 4X1IA 3QTCA 1Q43A 1XNQB 2QSAA 3SYOA 1NU1H 2BSKB 4KHPB 5BMVB 4DV5O 4UFZA 1UPGA 4XDKA 4NYKA 3ASOC 3B2EE 3DGEA 3IAYA 1HWYA 5JH7B 2QKAA 3D36C 4TT3G 1J5EO 3CP1A 1TVKA 1P84F 5IJ9A 1WA8B 3OT7A 1XNQO 1ROPA 1ZL8A 1K3EA 1PL4A 4PI0A 2E3CA 3X2QB 5DECA 4JPRA 3LSUA 4DR4O 2HVJC 3SR2C 4LF4B 4RUFA 1WN7A 4JF3A 2JGDB 4PELA 3P3PA 3ZRXA 4QIWF 5B5EZ 4UCTA 2ZM6B 3B40A 3W7XA 2XAGA 2EIJC 4EB6B 3A0HZ 3IJ4A 1HNZB 4FFBB 1I08A 1MSDA 4UVCA 2DWEC 4F6RA 1QNMA 1BGYH 2QKSA 2DJVA 5LP6B 2PGGA 4JTDB 3K5NA 3DC6A 1PNKA 1B06A 3FYIB 1OJHA 1S3JA 1SKVA 3F5WC 1FXKC 2R9AA 4LBEC 3TXSA 5LYJA 3JAWA 4LH7A 3M8AA 5B1BC 1Q90D 1GH6A 4BR6A 1W59A 4U7OA 5GTIZ 2ZD9A 4B3RB 2BSKA 5B1AB 3CCVV 2Q9LA 5BMVA 2EIKB 4LF8O 4P9PA 2ODMA 4JI5B 2FB5A 4MVMA 1O9HA 4FLZA 5JH7A 3SYAA 2CAZC 1LNQA 1WA8A 3CCLV 1FYJA 4MS2A 2Y48A 3F7VC 1ZTEA 3FD9A 4BAYA 2E76B 1XQ8A 3ML0A 3E8HA 3PN1A 2JGDA 2QKCA 3J7AU 2ARHA 1RM1B 1OCZC 2UXXA 4OGQB 1HNWO 1HP8A 2VWKA 2QWRB 5CBGA 4KL1A 4EB6A 5EC1C 2WWWA 5CA0B 2F66C 4FFBA 4MW3A 5KMGB 1M57B 4O4JB 3T1HO 4NTYA 2PI4A 1BL8A 3CD6V 1XDCA 3ABMC 3PJSK 2YUAA 4CC5A 1XI1A 2Q7HA 1V55B 3ABUA 3CB2A 1EZVH 1AP6A 4MTXA 3ZJZA 5LP6A 4DV2B 1K34A 1WLEA 3UCSC 3JATB 4DUYO 3KKYA 4DV7B 1ZLZA 3BVOA 1I94B 3RVYA 2DN9A 1XL6A 2EJ7A 4JGSA 4ZHQB 3CRRA 4DR6B 2ZXWB 3JCUZ 4DV2O 3K5OA 2W6JG 3A2FA 5KHKA 2EBOA 1RSOB 2O57A 5E79Z 5JJJB 1K7DA 4I9WA 1DTOA 4DV6B 2P4VA 3F5TA 4DR6O 1A32A 1FXHA 4DV3B 2WPDG 2P5OA 1KC8W 4DR3B 3CE2A 1M90W 3AG3B 3OMAB 1TA8A 1JCHA 4J7KA 1Z5VA 4JI6O 2YXYA 1MG1A 5EK0A 1NJIW 3CPWU 2XNDG 1G8MA 4PDLA 3OMNB 3R65A 4LH6A 4DR3O 4AILC 3B77A 4JYAO 4JYBA 1FJGB 4HZ3A 4JAAA 4R6ZA 5JJNB 2IJJA 4JV5B 4LNUB 1W0JG 2Q8VA 1F4NA 5KHGA 1JJOA 2X0LA 2UXCB 3G71V 3T1YO 3T4DA 1N4CA 5GTHZ 1VF6A 4IGGA 5CA1B 1NBMG 5CA0A 4YJ2B 1NTKH 1XHZA 4O4JA 2EIMC 4DYLA 1AROP 4KUMA 3WFVA 2JVDA 4X8AA 2UUCO 2OCHA 3LNMB 4WF9V 1S77D 1EM1A 3B8NA 3JATA 1IX9A 3JARB 4N23A 3OAAG 1NH2B 1EZJA 3JYCA 2OCCC 4WCEV 3N2KB 4WFFA 1SQGA 4ZHQA 3E86A 3E35A 3GVMA 1H2NA 2LFRA 3O65A 1RSOA 1Q7YW 2QEXV 4JYYA 5KA6A 1GN2A 1OCOC 3N2GA 3SPIA 4CH4A 3CC7V 4NXNO 3S3WA 1D5AA 3K04A 1NTZH 4I0XB 5JWPA 2ZE8A 2VWJA 4JI2B 1GO3F 4PA6A 5IYDO 1RP3B 1M5IA 4UCVA 4UB6Z 3L74H 4TQDA 3ZHQA 2OTJV 2YICA 1BHAA 5L3BA 4ICGA 5KUKA 4IL6Z 1EFRG 4UCUA 4KXRA 4WFAV 4FLWA 2OIEA 1S72V 1YTFB 5LHHA 1COWG 2JJ2G 2Q67A 2DYSB 3K0GA 1N34B 4LNUA 3WB1A 2DYRC 2WLMA 3MHSC 4DRXB 2OYQA 1LR1A 2Y69C 4CS3A 3ABLB 3CYOA 3GWKC 3RFRA 4QJFB 2JRIA 5CA1A 1KYOF 4YJ2A 4TSFG 3K59A 3UQ8A 1WP8A 4FLXA 1RPRA 2P67A 3ZHUA 5BR8O 3OR6C 2ZIMA 1AI6A 3ABKB 2CGOA 1CEZA 1NR7A 2B1IA 3ASNB 3AG1B 1KUQA 3X2QC 1L0LH 3ZHRA 3R66A 3OUFA 2H94A 2X6BA 2HG5C 5KX5B 2P4KA 3N2KA 2IJIA 5AG2A 4X62B 3C90A 4GYCB 5EIBC 1R6NA 4JI7B 4NXMB 4E2LA 2Q68A 3QG5A 3FB5C 3AK3A 2XAQA 5L3GA 4JI1O 4X88A 4UV8A 2DMXA 1XMOB 2YI9A 4I0XA 1Q3EA 5IYZB 4DR1B 4RUEA 4MVOA 1SA0B 2BCCH 3AG4B 2LGWA 4LF5B 1HDJA 4J80A 1S5LZ 3FB7C 3C3TA 3APQA 4J9YB 2QM8A 4AQYO 2EINB 1WNSA 4BIZA 5LP6C 1XMOO 3H1LH 2R70A 4PDVA 4MVSA 1SQQH 4B3SB 3JASB 1K9MW 3WB0A 3ETDA 2CTPA 2QWPB 4MW8A 2W0XA 2IBZH 4I50B 2JDIG 4GX5A 1I5YA 1MMMA 4W4LA 5BZBA 2JGUA 4DV0O 2XAHA 4X1KB 2RN9A 3DTUB 3K57A 4B3SO 4DRXA 5IDJA 2QDOA 2QWNB 3G6EV 2GSMB 4EKWA 2BOBC 5B1AC 1E1QG 2YIBD 2A0LA 2XASA 2XUMA 2EIKC 1JFFB 1KECA 4HBNA 2Y4TA 4DR5O 2PI5A 1F51A 3B8MA 4YY3O 1Y76B 3K03A 1XMQO 1M9NA 1OCRB 3ICXA 4O2AA 5JVDB 4J42A 1GRJA 2OT5A 2CTRA 3D3QA 2RJZA 4I55B 5KX5A 5IWAO 2ZE6A 2EULA 2N05A 4PV1B 5KUMA 1H8EG 2IM9A 3IGAC 1RM1C 4LF9O 3H1KH 3I55V 4TQFA 2HKOA 3WB2A 2E75B 1QCEA 1Y4MA 2PTMA 4J10A 2GDSA 1VF6C 3K06A 4NKGB 5IYZA 1GTOA 3SPHA 1M57C 2AZ2A 5B1OA 3QF7A 1SA0A 2LGQA 4OX9O 4K3AA 2DW4A 4MSWC 3U0ZA 4K0KB 3AG2B 1YHQV 4E4EA 1V55C 1S5HC 3OE7G 3RYHB 5LMUB 4UUJC 1SC5B 5JJEB 5BY1A 3JASA 3ZN0A 2ETNA 4I9QA 2PYJA 5L3FA 3AK2A 4I50A 2B1GA 1CP9A 3TGUH 1FAFA 2ZXWC 3K5LA 4X1KA 5J2UB 5FNVB 1NI8A 4DW1A 4J7JA 4B08A 3CSXA 2KQXA 3H1JH 4A5UB 5H2FZ 1SQFA 1XUQA 4KHPO 4QPKA 1SZXA 1G6UA 2H8PC 5D5PA 4LFCB 2FYUH 5LGUA 1IDSA 3CC4V 1JFFA 2Q4PA 2N74A 2DOSA 1AP5A 4J41A 4TWKA 4IT5A 2YEVB 1AILA 4IYIA 3JAKB 1JOYA 3SJBC 3AG3C 2Q7GA 1Y76A 4QNHB 3ETQA 4FIPC 5JVDA 4P30A 1YCIA 3H01A 2YS8A 4LF4O 4KFMA 3VOUA 4R7CA 4I55A 3MAQA 3I5DA 3BFRA 1SQPH 2Z5UA 5CN0A 5DM6V 5C93A 2RMKB 2FKXA 4MVZA 2L6LA 3CHXA 2JS3A 5GONB 4IHJB 1BCCH 1JX9A 1P49A 4X65B 2ZM6O 3CX5F 1T5EA 2OIGA 1FS0G 1HNZO 3QO8A 4R8CA 4FJCC 1OCCB 4U3JB 2AXTZ 3OM3B 1SF9A 4YJ3B 4YIPA 4QGPA 1E79G 3RYHA 1AR1B 5IYBO 2BTOA 3U10A 3VQXA 2UXDB 2AGAA 1DF4A 3W7TA 5HFLA 2XHBA 1YJWV 3C3SA 4BW5A 2F23A 1PP9H 2Q6AA 2ZR2A 4WFEA 2M7WA 4BW9A 3OGIB 3UM7A 3W7SA 5J2UA 5FNVA 2JEUA 3TXQA 3TETA 5A2QN 4X20B 4B3RO 1K73W 1DF5A 1V54B 3RT3C 4GLXA 4U3FH 3WU2Z 4JI5O 3WG7B 3STLC 4WFBV 1YXBA 1JQ0A 4JAUA 1D5NA 4GKJB 2YEVA 2QTOA 1Q6IA 3JAKA 3QO7A 4KP4A 1N0JA 4PJ0Z 3VQVA 5J2TB 1TUEB 4D7TA 4IYHA 1VQNV 4TUYB 1XBLA 1VQ7V 2HR3A 1D2DA 2YIDA 1EBOA 3CC2V 4JI3B 4P9OA 2WLHA 4BWAA 3CCSV 2VS0A 5H6QA 1G1XB 2DYSC 5A9GA 1NT2B 1IBMB 1IBKB 5GONA 4IHJA 4LFAB 3EHBB 1VF7A 3SJAC 1W0KG 5L3EA 3ABLC 4Q6GA 3EFFK 2OWOA 3FAVB 1N8RW 1AVMA 2WA4A 1VF5B 4JYCA 3IC9A 4U3JA 1I7FA 4LFAO 1XILA 4BIOA 4YJ3A 3ZRSA 2GBOA 4GX0A 3ABKC 4LWSB 2D2CB 2LQTA 4DV7O 1I94O 3ASNC 3LUTB 5LA6B 3AG1C 4H44B 1QLEB 1PD3A 2P90A 4MVUA 4JTAB 4DUZB 1IBLB 4JZ2A 1QBZA 2R9RB 2JS5A 2ZDIA 3LNNA 1MOFA 1WPBA 4PI2A 1F4MA 3HKCB 4X20A 2GV9A 3DSQA 4DV6O 2WA3A 3CCEV 4HAMA 3BEHA 2NLJC 1IBLO 1ZSPA 3JALB 4DV3O 2HJFC 1JA8A 4ZIBA 5K1XA 5C8YB 4L8JA 1P4RA 3AG4C 5H9CA 3KG2A 1NVPD 1WB7A 5J2TA 3JD3A 4GT1A 2HJDA 2EINC 4RQEA 2F4VB 1CPYA 4TUYA 1OHHG 2A06H 3G4SV 4H13B 1FJGO 4GKKB 1ZUQA 1VIBA 2IH1C 2QGNA 4UCOA 4AI8A 5KMGA 4JV5O 2LO1A 5FPOA 3RBZA 1FFXB 2UXCO 3RYIB 2B9ZA 3UO3A 1YIJV 1HR0B 3ETEA 3SPGA 3K5MA 4B3TB 4JI8B 1Y6XA 3FAVA 1R3KC 1N33B 5EYPB 5B3SB 4B3MB 4FM0A 2W0FC 1N36B 1S76D 2CK3G 4H0LB 1S0VA 1VEWA 1ENVA 1M56B 1X4TA 4U7NA 3LDEA 4LWSA 5DEDA 3JD4A 2HLDG 1KP3A 1OCRC 2A7WA 5LHGA 1TAEA 5LA6A 3HKBB 1IXMA 4Z1VA 2ZE5A 4JI0B 4FLYA 3FB6C 5J9PC 4NTXA 4LP8A 4DV4B 3ZHSA 5CBFA 5LGTA 1R3IC 1IZ3A 2Y4UA 2VRZA 3HKCA 2RQ6A 4WFHA 3CCRV 3FKSG 1B3QA 1ORQC 4TOIA 4JI0O 3OEEG 2V1DA 3OGCC 1BHBA 5EZYB 3JALA 1Q82W 1YZBA 4PA7A 4JI2O 2MK3A 3ETGA 4Q20A 1MZEA 1R3LC 4X66B 3APOA 1TUBB 5DN6G 5C8YA 4NR1A 3RN4A 3BHPA 2NN4A 3AG2C 5JCOA 3OTFA 4X89A 1BE3H 2G38A 3A0RA 2E5LB 1GN6A 1VQ6V 1VMGA 1AI5A 1YEWA 1Z5WA 2V7QG 1P7GA 3F7YC 3W7WA 4C7UA 2DWDC 1F23A 2A9HA 1Y74B 4D6TH 1R3JC 1N34O 1H8HG 3AK1A 4FM2A 4LCUC 1XEQA 2E5LO 2HHHB 4K8ZA 4W4KA 1FFXA 3RYIA 2LP7A 1WJZA 4X1YB 2UUAB 1US6A 1WPXA 1Q6HA 3SJCC 2QJ1A 2YXLA 3JARA 5EYPA 5TISZ 4PHZA 4RQFA 2QM7A 1GK9A 4LFBB 1NR1A 4UV9A 2CGNA 3CCQV 1K5SA 3BA8A 1YF2A 2GUZB 4YHHB 2ILMA 1FD9A 1BT8A 5KHHA 3BPZA 3ZMTA 3CRCA 1IURA 3EXAA 3HR0A 1GAXA 1R6TA 4MVRA 2P7TC 1YITV 4X62O 1B04A 3RYFB 3SYQA 5LMNB 1Y67A 4JI7O 5EBWC 4NXMO 4TV8B 2XOKG 2ZQMA 3T2MA 2LW1A 1YJ9V 2K1EA 2JJ1G 2XTAA 1BZKA 5LXTB 5EZYA 2WLLB 4LR3A 4DR1O 5B1NA 1GM7A 4LF5O 1TUBA 1OCCC 2CE4A 1V9PA 3E22B 4DR2B 4Z1MG 2Z3YA 3G6BA 1YI2V 4O4LB 3HKDB 2UU9B 5B66Z 2Q69A 3L9DA 4DK1A 2ZT9B 2AZ0A 2PZSA 1SESA 4UXNA 3SPCA 1N32B 3BABA 4X1IB 2YIBA 2GTAA 5K1PA 1XHXA 4XDLA 3CRMA 3UT5B 1Y74A 2EIMB 2ZDIC 2IJKA 3A0BZ 1GKFA 4DK0A 2B5UA 4ZKIA 2E74B 2P22C 2QWQB 1KBHA 4X1YA 3ZRVA 3K0DA 1V54C 1XL4A 2X7RB 2KKWA 3DXRB 4EEQA 3WG7C 4O2BB 1L1FA
chains in the Genus database with same CATH topology
1FXHA 2WPDG 1PL0A 2JEXA 3OM3B 1KC8W 3ZIAG 1RPOA 1ZWIC 1YSCA 1VQMV 1M90W 3ABMB 2WLIB 3AG3B 1E79G 3OMAB 2DQ3A 1AJQA 1JCHA 1AR1B 2LFSA 4PDMA 4H37A 5IYBO 4CBCA 5E1AC 2BOCC 1MG1A 5EK0A 1NJIW 3CPWU 3TK1A 2XNDG 3HPLC 3OMIB 1DF4A 3W7TA 1G8MA 4PDLA 3OMNB 3R65A 4ZBMA 3GWOA 5HFLA 3LDCA 1YJWV 3B77A 3SPJA 1FXKA 4JYBA 4HZ3A 4BW5A 4R6ZA 2Q6AA 2ZR2A 4DO2A 5GW7A 4WFEA 2D3OW 2M7WA 3UM7A 2WLNA 3K08A 3W7SA 4LC1A 2IJJA 2JEUA 3TETA 1W0JG 1F4NA 1K73W 5H6RA 2IU3A 2X0LA 3OW2U 1DF5A 5FL7G 2GHYA 3G71V 1V54B 2XAFA 3RW0A 1AI7A 5HFMA 3WG7B 3T4DA 2WLLA 2ITDC 3STLC 4WFBV 1NBMG 1NH2D 2QE7G 1KP2A 1K8AW 1Q81W 1JQ0A 1VQ8V 1M1KW 4YXWG 4JAUA 1KQSU 1SETA 1Y66A 1K97A 2C2AA 2EIMC 2YEVA 3CCMV 4RO2A 1AROP 2QTOA 4XBFA 3QO7A 4KP4A 1FFTB 4KUMA 3WFVA 5KA5A 4X8AA 3JD1A 3LNMB 4WF9V 1S77D 1TUEB 4MT8A 1VQNV 5LGNA 3ZMSA 1KD1W 1VQ7V 3B8NA 3K9AA 2UXNA 2HR3A 4F4LA 1QLEC 2QA4V 4N23A 3OAAG 1EBOA 1EZJA 3ZMZA 3GB7C 3JYCA 1NH2B 3CC2V 2OCCC 3OUSA 4P9OA 2WLHA 4WCEV 3CCUV 1QR8A 5LBQA 4WFFA 2EILC 3CCJV 3CCSV 5H6QA 3E8GA 2JK5C 3E86A 2A79B 1J95A 2DYSC 4H33A 3E35A 2WSSG 3EHBB 3QNEA 2LFRA 1W0KG 1Q7YW 5L3EA 2QEXV 3JD0A 3ABLC 2IJHA 5KA6A 4RAIA 3QO5A 3EFFK 1OCOC 3SPIA 3T4ZA 3CC7V 2YSUB 1VQOV 1KKDA 4UVAA 1N8RW 4QE7A 1K92A 2HFEC 3K04A 1VQPV 3ABTA 4JYCA 1R73A 4R50A 1K4CC 1GO3F 2AHYA 4PA6A 4MVQA 5IYDO 1YTFD 1I5XA 4XDJA 1THZA 4J9ZB 3ZRSA 3E2EA 3ZMVA 4GX0A 4DXWA 3LDDA 3ZRWB 3ABKC 2JIZG 2WLIA 3STZC 2WLJA 2OTJV 1W2BU 4HYOA 1BHAA 3E8BA 4PA9A 3K79A 5IY5C 5L3BA 3ASNC 3LUTB 3AG1C 4JAVA 3FB8C 3HB3B 1QLEB 5KUKA 1PD3A 2P90A 1GMGA 3MD0A 2ZR3A 4MVUA 1EFRG 5LHIA 4WFAV 3E8FA 4JTAB 2OCCB 1SRYA 3TCUA 1S72V 1YTFB 5LHHA 1QBZA 2EILB 2R9RB 1COWG 2JJ2G 2Q67A 2ZDIA 2DYSB 3K0GA 3P32A 1MOFA 2IH3C 3LSSA 2DYRC 1F4MA 2WLMA 1PNMA 3MHSC 3ZMUA 3D3IA 4QE9A 1AJNA 2Y69C 4G27B 3SYPA 1VQKV 3ABLB 4QPJA 1QR9A 3CYOA 3ZCCA 3CCEV 4HAMA 5EC2C 3BEHA 1OCOB 2NLJC 1UJWB 5EBMC 4MTOA 4WFGA 1AI4A 4QJFB 5B3SC 4G28B 4FMTA 2HJFC 4JTCB 1VQ4V 4TSFG 1SERA 1K33A 4MTGA 1RPRA 2P67A 1P4RA 3AG4C 5H9CA 1M56C 3KG2A 3OR6C 1NVPD 1VQ5V 1AI6A 3ABKB 4PA3A 2X6CA 1CEZA 1NR7A 4PDRA 3JD3A 4GT1A 3W7UA 1B6QA 2EINC 4RQEA 1CPYA 5IY5B 4L87A 2B1IA 3ASNB 1OHHG 3AG1B 3SYCA 3P30A 2WLKA 3X2QC 3G4SV 3K3WA 1JJ2U 3AEIA 3OUFA 2H94A 2X6BA 2HG5C 3OEHG 2IJIA 2IH1C 1Q86W 2ITCC 1BMFG 1PNLA 1NVPB 1R6NA 2X6AA 1OZ0A 1MSWD 3RBZA 1YJNV 3JCZA 4E2LA 2DYRB 2Q68A 3BY6A 1YIJV 5L3CA 2Y69B 3ETEA 3FB5C 1K5QA 3SPGA 2R9IA 2XAQA 5L3GA 4FPPA 4X88A 3SYOA 1R3KC 4UV8A 5B3SB 4XDKA 1P7BA 2W0FC 2EJRA 3ASOC 3DGEA 1SZTA 1GM8A 1S76D 1HWYA 4MVOA 4RUEA 2CK3G 3AG4B 4TT3G 3CMEV 3CP1A 1S0VA 1ENVA 1M56B 2NNUA 3ZRWA 3FB7C 4U7NA 4I5SA 1R6KA 4J9YB 2QM8A 3LDEA 1H2GA 3JD4A 1ROPA 2HLDG 1K3EA 1KP3A 1OCRC 4N21A 3RVZA 2EINB 5LHGA 4BIZA 1G4YB 4PDVA 1JPXA 4MVSA 5L3DA 3X2QB 1K9MW 1IXMA 4P2ZA 3ETDA 4JPRA 4MW8A 2HVJC 1DLBA 2JDIG 3LSQA 3FB6C 5J9PC 4GX5A 4LP8A 1I5YA 2IW5A 5CBFA 5LGTA 4RUFA 5BZBA 4JF3A 2XAHA 1R3IC 3DTUB 5IYCO 4WFHA 4PELA 5IDJA 3CCRV 1QLNA 3T1CA 1QVGU 3ZRXA 3FKSG 3G6EV 1ORQC 2GSMB 3OEEG 3E83A 4QIWF 2V1DA 3OGCC 1BHBA 4EKWA 2BOBC 1E1QG 5B1AC 1Q82W 2A0LA 3MHHC 2XASA 3W7XA 4PA7A 2MK3A 2EIKC 2EIJC 2XAGA 3ETGA 3M99B 4Q20A 1KECA 1R3LC 4JASA 2XAJA 2IU0A 3ASOB 5DN6G 4CZZA 2PI5A 1F51A 3B8MA 4UVCA 2DWEC 3UKMA 3AG2C 4X89A 3K03A 3A0RA 1K4DC 1M9NA 2EZOA 2QKSA 1OCRB 4UVBA 1H38A 1VQ6V 2P6JA 1AI5A 4JTDB 2V7QG 2OT5A 3IC7A 3F7YC 3W7WA 1PNKA 1MABG 2DWDC 3FYIB 1S3JA 3F5WC 1F23A 3I56V 2A9HA 1FXKC 4LBEC 1R3JC 3CMAV 3FYEB 1H8HG 5KUMA 5B1BC 1H8EG 3SJQC 4LCUC 4GCZA 1VQ9V 3IGAC 2LP7A 3E89A 1RM1C 1WPXA 4U7OA 3I55V 2ZD9A 2HKOA 1QCEA 5B1AB 3CCVV 1Y4MA 2EIKB 2EIJB 3K06A 4P9PA 2QM7A 1GK9A 1JVMA 4ASUG 4RQFA 4MVMA 1GTOA 1NR1A 4UV9A 3SPHA 1M57C 2ATKC 5B1OA 3CCQV 1K5SA 2DW4A 3SYAA 4MSWC 1LNQA 3AG2B 1YHQV 2KB1A 3CCLV 1V55C 4MS2A 2Y48A 1S5HC 3F7VC 3OE7G 1GM9A 2FTKA 3ZMTA 4UUJC 5CBHA 2HVKC 3NXSA 5CMUA 4MVRA 3JD2A 3ZN0A 2P7TC 4BAYA 1YITV 5L3FA 3ML0A 3OR7C 2B1GA 3E8HA 3SYQA 1FXKB 1CP9A 5EBWC 2EZPA 2OTLV 5B1BB 2ZXWC 2XOKG 2ZQMA 3ZN1A 1RM1B 1OCZC 3T2MA 2UXXA 1NQTA 1YJ9V 2K1EA 2JJ1G 4FK5C 4QPKA 2H8PC 1VQLV 5CBGA 5LGUA 3CC4V 2WLLB 1AJPA 5EC1C 2WWWA 5B1NA 1GM7A 4MW3A 1OCCC 1E1RG 4TWKA 2F43G 1M57B 2YEVB 3D36A 2Z3YA 4Z1MG 1YI2V 2PI4A 1BL8A 3CD6V 1JOYA 3ABMC 3PJSK 3AG3C 1QVFU 4QNHB 1V55B 2Q69A 3ABUA 4MTXA 3ZJZA 2W6IG 4FIPC 4OXSA 1K34A 2AHZA 4MTFA 1SESA 4P30A 4UXNA 1WLEA 3SPCA 3H01A 3RVYA 4XDLA 4KFMA 3VOUA 4R7CA 1NKDA 1XL6A 1FXVA 4JGSA 4PA4A 2EIMB 2Z5UA 3OFNG 5CN0A 5DM6V 5C93A 2WAMA 5EBLC 2ZDIC 4MVZA 2ZXWB 5CA3A 3VBBA 2IJKA 1GKFA 2W6JG 4G2KA 2B5UA 1OCZB 2EBOA 4ZKIA 1JX9A 3ZRVA 3K0DA 1V54C 4BIUA 1FS0G 1XL4A 2DQ0A 4GX1A 3CXCU 2X7RB 1PKXA 3WG7C 3QO8A 1K7DA 4I9WA 1DTOA 1L1FA 4GX2A 3IFXA 4R8CA 4FJCC 1OCCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASO C;  3SPH A;  1K4C C;  1M57 C;  2AHY A;  2ATK C;  4MVQ A;  4PA6 A;  4MVO A;  4RUE A;  4XDJ A;  3SYA A;  4J9Z B;  3ZRS A;  4MSW C;  1ZWI C;  4DXW A;  4GX0 A;  3LDD A;  3FB7 C;  3ABK C;  1LNQ A;  2WLI A;  2WLI B;  3STZ C;  4J9Y B;  2KB1 A;  3LDE A;  1V55 C;  2WLJ A;  4MS2 A;  1S5H C;  3F7V C;  1OCR C;  4HYO A;  3RVZ A;  3E8B A;  4PA9 A;  1G4Y B;  4PDM A;  5IY5 C;  4H37 A;  4UUJ C;  4CBC A;  3ASN C;  3LUT B;  4PDV A;  5E1A C;  5CBH A;  3AG1 C;  4MVS A;  2BOC C;  2HVK C;  3FB8 C;  4MVR A;  5KUK A;  5EK0 A;  2P7T C;  3HPL C;  4P2Z A;  4MVU A;  4MW8 A;  4PDL A;  2HVJ C;  4ZBM A;  3R65 A;  3E8F A;  3LDC A;  4JTA B;  3OR7 C;  3SPJ A;  3E8H A;  3FB6 C;  3SYQ A;  3TCU A;  5J9P C;  4GX5 A;  4HZ3 A;  4LP8 A;  4BW5 A;  2R9R B;  4R6Z A;  5EBW C;  2Q6A A;  5CBF A;  4RUF A;  5BZB A;  4WFE A;  2Q67 A;  3UM7 A;  2WLN A;  2ZXW C;  3K08 A;  1R3I C;  3K0G A;  3TET A;  2IH3 C;  2DYR C;  1OCZ C;  2WLM A;  4WFH A;  3T2M A;  3T1C A;  2K1E A;  4QE9 A;  2Y69 C;  4G27 B;  3SYP A;  1ORQ C;  3E83 A;  2H8P C;  3BEH A;  3OGC C;  2NLJ C;  5EC2 C;  3RW0 A;  5EBM C;  4MTO A;  2BOB C;  4WFG A;  5B1A C;  4EKW A;  2A0L A;  3T4D A;  5B3S C;  2WLL A;  4G28 B;  2WLL B;  2EIK C;  2EIJ C;  2ITD C;  4PA7 A;  3STL C;  2HJF C;  1R3L C;  4JTC B;  5EC1 C;  5CBG A;  4MW3 A;  1OCC C;  4MTG A;  4TWK A;  2EIM C;  2YEV A;  4RO2 A;  3AG4 C;  2QTO A;  1BL8 A;  2DWE C;  1M56 C;  3KG2 A;  3OR6 C;  3ABM C;  3PJS K;  3AG2 C;  4PA3 A;  3AG3 C;  4X8A A;  4X89 A;  3UKM A;  2X6C A;  4QNH B;  3K03 A;  2Q69 A;  3LNM B;  4PDR A;  1K4D C;  2QKS A;  2EIN C;  3ZJZ A;  4OXS A;  2AHZ A;  4MTF A;  4P30 A;  3SPC A;  4JTD B;  3SYC A;  4F4L A;  1QLE C;  2WLK A;  3X2Q C;  3RVY A;  4XDL A;  3F7Y C;  3OUF A;  4KFM A;  3VOU A;  4R7C A;  2X6B A;  2DWD C;  1XL6 A;  2HG5 C;  3GB7 C;  3JYC A;  2OCC C;  3F5W C;  3OUS A;  4P9O A;  2WLH A;  2A9H A;  2IH1 C;  4LBE C;  4PA4 A;  4WFF A;  1R3J C;  2ITC C;  2EIL C;  5KUM A;  3E8G A;  2JK5 C;  5EBL C;  5B1B C;  3E86 A;  2A79 B;  3SJQ C;  4LCU C;  4MVZ A;  1J95 A;  2DYS C;  2X6A A;  4H33 A;  3IGA C;  3RBZ A;  3E89 A;  2Q68 A;  3FB5 C;  3ABL C;  3SPG A;  3K0D A;  1V54 C;  4RAI A;  1XL4 A;  3EFF K;  4GX1 A;  1OCO C;  2ZD9 A;  3SPI A;  3T4Z A;  4X88 A;  3SYO A;  3WG7 C;  1R3K C;  1KKD A;  4I9W A;  4QE7 A;  2HFE C;  3K04 A;  3K06 A;  4GX2 A;  4P9P A;  1JVM A;  3IFX A;  4R8C A;  4MVM A;  4XDK A;  1P7B A;  2W0F C;  4R50 A; 
#chains in the Genus database with same CATH topology
 1PL0 A;  2GUZ A;  1LUW A;  3ZIA G;  1RPO A;  2WLI B;  4HNA B;  2LFS A;  5E1A C;  3ZHT A;  1XNR B;  3HPL C;  3OMI B;  2UUB B;  2LJ2 A;  3GWO A;  3LDC A;  3RYF A;  2UXB B;  5KAI Z;  3B09 A;  1XRE A;  1WB8 A;  2AW9 A;  3EVK A;  4TV8 A;  4DR7 B;  1HNX B;  4LC1 A;  1DGS A;  2IU3 A;  3OW2 U;  4TV9 B;  3H1I H;  2A3Q A;  3BA9 A;  3RW0 A;  5LXT A;  4FM1 A;  2MW2 B;  2WLL A;  3K58 A;  1AB3 A;  2QE7 G;  1K8A W;  1Q81 W;  1VQ8 V;  1M1K W;  4YXW G;  1KQS U;  3E22 A;  1Y66 A;  1K97 A;  3CCM V;  4DV5 B;  4K0K O;  1BSM A;  4RO2 A;  3KZI Z;  4O4L A;  3Q4H B;  3SDL A;  3HKD A;  1NS1 A;  1FFT B;  1AR5 A;  5KA5 A;  5LMU O;  1J5E B;  3ZMS A;  4EFB A;  3K9A A;  4F4L A;  1O9G A;  1QLE C;  2QA4 V;  1YVW A;  3GB7 C;  3OUS A;  3FX7 A;  4I4T B;  3UT5 A;  3CCU V;  1QR8 A;  5LBQ A;  4DR4 B;  2ADP A;  2V4D A;  3P3N A;  3OTO B;  4JI4 B;  2A79 B;  1J95 A;  4H33 A;  1X59 A;  1EN4 A;  3G67 A;  2XT9 A;  1XOU A;  4LFC O;  3JD0 A;  2IJH A;  3QO5 A;  5KHI A;  3DXR A;  2YSU B;  1VQO V;  1KB9 F;  1S5J A;  4O2B A;  3HKE B;  1KKD A;  4UVA A;  4QE7 A;  1K92 A;  1VQP V;  3ABT A;  3OTO O;  4JI4 O;  1R73 A;  4I7Z B;  2AHY A;  4NTW A;  4MVQ A;  1I5X A;  4XDJ A;  4J9Z B;  3E2E A;  4DXW A;  3ZRW B;  3D8C A;  3CXH F;  5KLV H;  2WLI A;  3STZ C;  5JCO C;  3CWB H;  4HNA A;  4HYO A;  1W2B U;  4K8X A;  3E8B A;  3K79 A;  4JAV A;  3FB8 C;  3HB3 B;  2Y0I A;  1GMG A;  3MD0 A;  2RCV A;  5KHJ A;  3E8F A;  1SRY A;  2H3O A;  2Q73 A;  2EIL B;  2PF4 E;  4IIJ B;  1QQC A;  2HEP A;  2IH3 C;  4X65 O;  3LSS A;  4WBN B;  3ZMU A;  1M4U A;  5CB4 B;  1AJN A;  4TV9 A;  1VQK V;  1QR9 A;  5EC2 C;  2YI8 A;  5EBM C;  4WFG A;  5B3S C;  1VQ4 V;  3UO2 A;  4MTG A;  4LF8 B;  3Q4H A;  2KG7 B;  1M56 C;  1VQ5 V;  1MNG A;  2F95 B;  2UXD O;  3K9S A;  4PDR A;  1B6Q A;  5IY5 B;  1UFI A;  4L87 A;  3SYC A;  3P30 A;  3K3W A;  3AEI A;  3U11 A;  1H2K A;  2P06 A;  3THO A;  4I4T A;  2K9P A;  1Q86 W;  2ITC C;  4CS4 A;  3VQY A;  1BMF G;  1PNL A;  1NVP B;  3L72 H;  3JCZ A;  3CS5 A;  3BY6 A;  3AG7 A;  1GN4 A;  4K35 A;  5L3C A;  1K5Q A;  2R9I A;  4FPP A;  3HKE A;  4CS2 A;  4X9Q A;  1FKA O;  2M6Y A;  1HNW B;  4GKJ O;  1P7B A;  2EJR A;  2QM4 A;  1PV0 A;  3L70 H;  1SZT A;  1GM8 A;  1FPO A;  3CME V;  5EIB D;  2NNU A;  3ZRW A;  3T1H B;  4DV1 B;  4I5S A;  1R6K A;  1H2G A;  4ZI7 B;  4N21 A;  3RVZ A;  3TJT A;  1G4Y B;  3BCC H;  1JPX A;  1SQX H;  5L3D A;  4JI3 O;  2QTS A;  2ADQ B;  3ZHV A;  4P2Z A;  3L73 H;  4DUY B;  1DLB A;  3LSQ A;  3OD4 A;  1N0N A;  5H5N A;  1IVS A;  2ZCE A;  1IBM O;  2EX3 A;  1IBK O;  4IIJ A;  2IW5 A;  4ABM A;  4DV1 O;  3JSN A;  4D7S A;  2CTQ A;  4WBN A;  5IYC O;  1ZAU A;  1QLN A;  3T1C A;  5CB4 A;  1QVG U;  3E83 A;  4LF7 B;  4FVM A;  1EN5 A;  3MHH C;  3M99 B;  3J81 N;  4JAS A;  2XAJ A;  4LF6 B;  4CH5 A;  2IU0 A;  3ASO B;  1VAR A;  4CZZ A;  4GUN A;  3RWR D;  2KG7 A;  4FLV A;  4PD4 F;  3UKM A;  2YC0 A;  1SQB H;  3QVN A;  4LF7 O;  1KU9 A;  1K4D C;  2EZO A;  4UVB A;  1H38 A;  2P6J A;  3N2G B;  2F1M A;  4LF6 O;  4JI6 B;  4DUZ O;  3IC7 A;  1MAB G;  4UCR A;  3I56 V;  3CMA V;  1R1B A;  1JMK C;  3FYE B;  4JYA B;  3SJQ C;  4GCZ A;  1VQ9 V;  3E89 A;  3KCX A;  4UCS A;  2RNB A;  5D5Q A;  1H2L A;  2Y0P A;  4NVP A;  4FZ0 A;  2EIJ B;  2Q0O C;  4ASU G;  1BS3 A;  1JVM A;  1IXB A;  4F6E A;  3T1Y B;  4Z2W A;  2ATK C;  1DK1 A;  2Q7E A;  2F4V O;  1L8D A;  2GTS A;  4CH3 A;  2KB1 A;  4ZI7 A;  2DE0 X;  1GM9 A;  2FTK A;  4J11 A;  2QR4 A;  5CBH A;  2UUC B;  3A8T A;  2HVK C;  3NXS A;  5CMU A;  1ZX3 A;  3JD2 A;  5LL6 Y;  4GKK O;  2PYL A;  4B7E A;  4FFK A;  1QU7 A;  3OR7 C;  1BQ0 A;  1FXK B;  5FPR A;  2YDE A;  3VQW A;  2EZP A;  2OTL V;  5B1B B;  1HR0 O;  3ZN1 A;  4B3T O;  1NQT A;  4JI8 O;  1WAZ A;  2Z0A A;  4FK5 C;  5LOV B;  1N33 O;  1PPJ H;  1VQL V;  4B3M O;  2NR5 A;  2QWO B;  1N36 O;  4CC6 A;  3O9O A;  1AJP A;  4NXN B;  1Q8I A;  1E1R G;  1KMI Z;  1NZ6 A;  4X64 B;  2F43 G;  3D36 A;  3BAA A;  2YXH A;  4RWU A;  2ZKO A;  1QVF U;  5ITZ B;  4O4I B;  2BE3 A;  2W6I G;  4OXS A;  1SQV H;  2AHZ A;  4MTF A;  1URF A;  3DC5 A;  5FLX N;  4X64 O;  3RYC B;  1I0H A;  1NKD A;  4DV4 O;  2KSD A;  1FXV A;  4PA4 A;  3OFN G;  3SGI A;  2WAM A;  5EBL C;  4FZ1 A;  5CA3 A;  3VBB A;  3BRC A;  2L35 A;  2PY5 A;  4G2K A;  1OCZ B;  3M7M X;  3B4S A;  5IE9 A;  1Z2G A;  4BIU A;  3CXC U;  2DQ0 A;  1JR9 A;  4GX1 A;  4X66 O;  1M93 A;  1PKX A;  2ZE7 A;  4GX2 A;  3IFX A;  3CJH B;  4EFE A;  3RGB A;  2JEX A;  2VQF B;  2PUS A;  5IT9 N;  1U96 A;  4NB5 A;  1ZWI C;  1VQM V;  1YSC A;  3ABM B;  2DQ3 A;  1AJQ A;  5KAF Z;  5BR8 B;  2LW7 A;  4PDM A;  4H37 A;  4CBC A;  3H9V A;  3S3X A;  4O4H B;  4ZOL B;  2BOC C;  4B7K A;  1WP7 A;  4GZR B;  3TK1 A;  3KCY A;  4JZG A;  4ZBM A;  1LUV A;  3JAM N;  2VQF O;  5JQG B;  3FFQ A;  3SPJ A;  1FXK A;  2HHH O;  4FLT A;  3ZED A;  4DO2 A;  5GW7 A;  2D3O W;  3MDS A;  2WLN A;  3K08 A;  3N27 A;  2UUA O;  2N04 A;  2HP8 A;  4O2A B;  5H6R A;  5LOV A;  5FL7 G;  4AHC A;  2GHY A;  2XAF A;  1AI7 A;  3HKB A;  4LFB O;  5HFM A;  3ZX6 A;  2F93 B;  2ITD C;  1NH2 D;  4JI1 B;  1KP2 A;  2YIA A;  2BTQ B;  1Q6U A;  4YHH O;  1SET A;  4YIO A;  2C2A A;  4UB8 Z;  1VP7 A;  4XBF A;  3JD1 A;  1Q5O A;  4O4I A;  5ITZ A;  5IJ0 B;  4MT8 A;  3ZBH A;  5LGN A;  2FL4 A;  1KD1 W;  4AQY B;  2UXN A;  1KKC A;  3RYC A;  5LMN O;  3ZMZ A;  1BQZ A;  2EIL C;  3CCJ V;  3JSL A;  3E8G A;  2JK5 C;  1U97 A;  2CDY A;  2CH7 B;  2CUG A;  2WSS G;  4DV0 B;  3QNE A;  2VQE B;  3G80 A;  5F2V O;  4RAI A;  1YDX A;  1MA1 A;  3T4Z A;  1OV9 A;  2ZNJ A;  3H1H H;  2HFE C;  4DR2 O;  3CRQ A;  3CJH A;  4R50 A;  1K4C C;  2UU9 O;  1YTF D;  1L0N H;  1RFY A;  2VQE O;  1THZ A;  1TVK B;  3ZMV A;  4DR5 B;  3LDD A;  5IJ9 B;  2JIZ G;  1N32 O;  2WLJ A;  1EN6 A;  1ZL8 B;  4J7Z A;  5IY5 C;  4PA9 A;  1HW7 A;  4YY3 B;  4O4H A;  1H2M A;  4ZOL A;  1XMQ B;  3L71 H;  1H2S B;  2FML A;  5LHI A;  2ZR3 A;  3J80 N;  5JQG A;  2OCC B;  3TCU A;  1CXZ B;  5IWA B;  4DW0 A;  3L75 H;  3P32 A;  3NR7 A;  1GN3 A;  1PNM A;  3CRA A;  3D3I A;  1NTM H;  4QE9 A;  2CTW A;  4G27 B;  3SYP A;  4QPJ A;  3ZCC A;  1F7Y A;  1OCO B;  1UJW B;  4OPH A;  2R72 A;  4MTO A;  1QHT A;  4LF9 B;  1AI4 A;  4G28 B;  4FMT A;  2ZNI A;  4JTC B;  1SER A;  2BTQ A;  4FLU A;  1K33 A;  1TGO A;  4F6R B;  4OPA A;  4PA3 A;  4OX9 B;  2X6C A;  5IJ0 A;  3W7U A;  1XNR O;  2UUB O;  1AR4 A;  5BXZ A;  2WLK A;  2UXB O;  1JJ2 U;  3CEI A;  3OEH G;  4CH6 A;  4DR7 O;  1SS3 A;  1HNX O;  5LYJ B;  2RDC A;  3JAW B;  2ZIN A;  2Q5Z A;  2ZIO A;  3ZS8 C;  2CH7 A;  2X6A A;  1MZF A;  2Q0A A;  1OZ0 A;  1MSW D;  1YJN V;  2DYR B;  2Y69 B;  1PM9 A;  4X1I A;  3QTC A;  1Q43 A;  1XNQ B;  2QSA A;  3SYO A;  1NU1 H;  2BSK B;  4KHP B;  5BMV B;  4DV5 O;  4UFZ A;  1UPG A;  4XDK A;  4NYK A;  3ASO C;  3B2E E;  3DGE A;  3IAY A;  1HWY A;  5JH7 B;  2QKA A;  3D36 C;  4TT3 G;  1J5E O;  3CP1 A;  1TVK A;  1P84 F;  5IJ9 A;  1WA8 B;  3OT7 A;  1XNQ O;  1ROP A;  1ZL8 A;  1K3E A;  1PL4 A;  4PI0 A;  2E3C A;  3X2Q B;  5DEC A;  4JPR A;  3LSU A;  4DR4 O;  2HVJ C;  3SR2 C;  4LF4 B;  4RUF A;  1WN7 A;  4JF3 A;  2JGD B;  4PEL A;  3P3P A;  3ZRX A;  4QIW F;  5B5E Z;  4UCT A;  2ZM6 B;  3B40 A;  3W7X A;  2XAG A;  2EIJ C;  4EB6 B;  3A0H Z;  3IJ4 A;  1HNZ B;  4FFB B;  1I08 A;  1MSD A;  4UVC A;  2DWE C;  4F6R A;  1QNM A;  1BGY H;  2QKS A;  2DJV A;  5LP6 B;  2PGG A;  4JTD B;  3K5N A;  3DC6 A;  1PNK A;  1B06 A;  3FYI B;  1OJH A;  1S3J A;  1SKV A;  3F5W C;  1FXK C;  2R9A A;  4LBE C;  3TXS A;  5LYJ A;  3JAW A;  4LH7 A;  3M8A A;  5B1B C;  1Q90 D;  1GH6 A;  4BR6 A;  1W59 A;  4U7O A;  5GTI Z;  2ZD9 A;  4B3R B;  2BSK A;  5B1A B;  3CCV V;  2Q9L A;  5BMV A;  2EIK B;  4LF8 O;  4P9P A;  2ODM A;  4JI5 B;  2FB5 A;  4MVM A;  1O9H A;  4FLZ A;  5JH7 A;  3SYA A;  2CAZ C;  1LNQ A;  1WA8 A;  3CCL V;  1FYJ A;  4MS2 A;  2Y48 A;  3F7V C;  1ZTE A;  3FD9 A;  4BAY A;  2E76 B;  1XQ8 A;  3ML0 A;  3E8H A;  3PN1 A;  2JGD A;  2QKC A;  3J7A U;  2ARH A;  1RM1 B;  1OCZ C;  2UXX A;  4OGQ B;  1HNW O;  1HP8 A;  2VWK A;  2QWR B;  5CBG A;  4KL1 A;  4EB6 A;  5EC1 C;  2WWW A;  5CA0 B;  2F66 C;  4FFB A;  4MW3 A;  5KMG B;  1M57 B;  4O4J B;  3T1H O;  4NTY A;  2PI4 A;  1BL8 A;  3CD6 V;  1XDC A;  3ABM C;  3PJS K;  2YUA A;  4CC5 A;  1XI1 A;  2Q7H A;  1V55 B;  3ABU A;  3CB2 A;  1EZV H;  1AP6 A;  4MTX A;  3ZJZ A;  5LP6 A;  4DV2 B;  1K34 A;  1WLE A;  3UCS C;  3JAT B;  4DUY O;  3KKY A;  4DV7 B;  1ZLZ A;  3BVO A;  1I94 B;  3RVY A;  2DN9 A;  1XL6 A;  2EJ7 A;  4JGS A;  4ZHQ B;  3CRR A;  4DR6 B;  2ZXW B;  3JCU Z;  4DV2 O;  3K5O A;  2W6J G;  3A2F A;  5KHK A;  2EBO A;  1RSO B;  2O57 A;  5E79 Z;  5JJJ B;  1K7D A;  4I9W A;  1DTO A;  4DV6 B;  2P4V A;  3F5T A;  4DR6 O;  1A32 A;  1FXH A;  4DV3 B;  2WPD G;  2P5O A;  1KC8 W;  4DR3 B;  3CE2 A;  1M90 W;  3AG3 B;  3OMA B;  1TA8 A;  1JCH A;  4J7K A;  1Z5V A;  4JI6 O;  2YXY A;  1MG1 A;  5EK0 A;  1NJI W;  3CPW U;  2XND G;  1G8M A;  4PDL A;  3OMN B;  3R65 A;  4LH6 A;  4DR3 O;  4AIL C;  3B77 A;  4JYA O;  4JYB A;  1FJG B;  4HZ3 A;  4JAA A;  4R6Z A;  5JJN B;  2IJJ A;  4JV5 B;  4LNU B;  1W0J G;  2Q8V A;  1F4N A;  5KHG A;  1JJO A;  2X0L A;  2UXC B;  3G71 V;  3T1Y O;  3T4D A;  1N4C A;  5GTH Z;  1VF6 A;  4IGG A;  5CA1 B;  1NBM G;  5CA0 A;  4YJ2 B;  1NTK H;  1XHZ A;  4O4J A;  2EIM C;  4DYL A;  1ARO P;  4KUM A;  3WFV A;  2JVD A;  4X8A A;  2UUC O;  2OCH A;  3LNM B;  4WF9 V;  1S77 D;  1EM1 A;  3B8N A;  3JAT A;  1IX9 A;  3JAR B;  4N23 A;  3OAA G;  1NH2 B;  1EZJ A;  3JYC A;  2OCC C;  4WCE V;  3N2K B;  4WFF A;  1SQG A;  4ZHQ A;  3E86 A;  3E35 A;  3GVM A;  1H2N A;  2LFR A;  3O65 A;  1RSO A;  1Q7Y W;  2QEX V;  4JYY A;  5KA6 A;  1GN2 A;  1OCO C;  3N2G A;  3SPI A;  4CH4 A;  3CC7 V;  4NXN O;  3S3W A;  1D5A A;  3K04 A;  1NTZ H;  4I0X B;  5JWP A;  2ZE8 A;  2VWJ A;  4JI2 B;  1GO3 F;  4PA6 A;  5IYD O;  1RP3 B;  1M5I A;  4UCV A;  4UB6 Z;  3L74 H;  4TQD A;  3ZHQ A;  2OTJ V;  2YIC A;  1BHA A;  5L3B A;  4ICG A;  5KUK A;  4IL6 Z;  1EFR G;  4UCU A;  4KXR A;  4WFA V;  4FLW A;  2OIE A;  1S72 V;  1YTF B;  5LHH A;  1COW G;  2JJ2 G;  2Q67 A;  2DYS B;  3K0G A;  1N34 B;  4LNU A;  3WB1 A;  2DYR C;  2WLM A;  3MHS C;  4DRX B;  2OYQ A;  1LR1 A;  2Y69 C;  4CS3 A;  3ABL B;  3CYO A;  3GWK C;  3RFR A;  4QJF B;  2JRI A;  5CA1 A;  1KYO F;  4YJ2 A;  4TSF G;  3K59 A;  3UQ8 A;  1WP8 A;  4FLX A;  1RPR A;  2P67 A;  3ZHU A;  5BR8 O;  3OR6 C;  2ZIM A;  1AI6 A;  3ABK B;  2CGO A;  1CEZ A;  1NR7 A;  2B1I A;  3ASN B;  3AG1 B;  1KUQ A;  3X2Q C;  1L0L H;  3ZHR A;  3R66 A;  3OUF A;  2H94 A;  2X6B A;  2HG5 C;  5KX5 B;  2P4K A;  3N2K A;  2IJI A;  5AG2 A;  4X62 B;  3C90 A;  4GYC B;  5EIB C;  1R6N A;  4JI7 B;  4NXM B;  4E2L A;  2Q68 A;  3QG5 A;  3FB5 C;  3AK3 A;  2XAQ A;  5L3G A;  4JI1 O;  4X88 A;  4UV8 A;  2DMX A;  1XMO B;  2YI9 A;  4I0X A;  1Q3E A;  5IYZ B;  4DR1 B;  4RUE A;  4MVO A;  1SA0 B;  2BCC H;  3AG4 B;  2LGW A;  4LF5 B;  1HDJ A;  4J80 A;  1S5L Z;  3FB7 C;  3C3T A;  3APQ A;  4J9Y B;  2QM8 A;  4AQY O;  2EIN B;  1WNS A;  4BIZ A;  5LP6 C;  1XMO O;  3H1L H;  2R70 A;  4PDV A;  4MVS A;  1SQQ H;  4B3S B;  3JAS B;  1K9M W;  3WB0 A;  3ETD A;  2CTP A;  2QWP B;  4MW8 A;  2W0X A;  2IBZ H;  4I50 B;  2JDI G;  4GX5 A;  1I5Y A;  1MMM A;  4W4L A;  5BZB A;  2JGU A;  4DV0 O;  2XAH A;  4X1K B;  2RN9 A;  3DTU B;  3K57 A;  4B3S O;  4DRX A;  5IDJ A;  2QDO A;  2QWN B;  3G6E V;  2GSM B;  4EKW A;  2BOB C;  5B1A C;  1E1Q G;  2YIB D;  2A0L A;  2XAS A;  2XUM A;  2EIK C;  1JFF B;  1KEC A;  4HBN A;  2Y4T A;  4DR5 O;  2PI5 A;  1F51 A;  3B8M A;  4YY3 O;  1Y76 B;  3K03 A;  1XMQ O;  1M9N A;  1OCR B;  3ICX A;  4O2A A;  5JVD B;  4J42 A;  1GRJ A;  2OT5 A;  2CTR A;  3D3Q A;  2RJZ A;  4I55 B;  5KX5 A;  5IWA O;  2ZE6 A;  2EUL A;  2N05 A;  4PV1 B;  5KUM A;  1H8E G;  2IM9 A;  3IGA C;  1RM1 C;  4LF9 O;  3H1K H;  3I55 V;  4TQF A;  2HKO A;  3WB2 A;  2E75 B;  1QCE A;  1Y4M A;  2PTM A;  4J10 A;  2GDS A;  1VF6 C;  3K06 A;  4NKG B;  5IYZ A;  1GTO A;  3SPH A;  1M57 C;  2AZ2 A;  5B1O A;  3QF7 A;  1SA0 A;  2LGQ A;  4OX9 O;  4K3A A;  2DW4 A;  4MSW C;  3U0Z A;  4K0K B;  3AG2 B;  1YHQ V;  4E4E A;  1V55 C;  1S5H C;  3OE7 G;  3RYH B;  5LMU B;  4UUJ C;  1SC5 B;  5JJE B;  5BY1 A;  3JAS A;  3ZN0 A;  2ETN A;  4I9Q A;  2PYJ A;  5L3F A;  3AK2 A;  4I50 A;  2B1G A;  1CP9 A;  3TGU H;  1FAF A;  2ZXW C;  3K5L A;  4X1K A;  5J2U B;  5FNV B;  1NI8 A;  4DW1 A;  4J7J A;  4B08 A;  3CSX A;  2KQX A;  3H1J H;  4A5U B;  5H2F Z;  1SQF A;  1XUQ A;  4KHP O;  4QPK A;  1SZX A;  1G6U A;  2H8P C;  5D5P A;  4LFC B;  2FYU H;  5LGU A;  1IDS A;  3CC4 V;  1JFF A;  2Q4P A;  2N74 A;  2DOS A;  1AP5 A;  4J41 A;  4TWK A;  4IT5 A;  2YEV B;  1AIL A;  4IYI A;  3JAK B;  1JOY A;  3SJB C;  3AG3 C;  2Q7G A;  1Y76 A;  4QNH B;  3ETQ A;  4FIP C;  5JVD A;  4P30 A;  1YCI A;  3H01 A;  2YS8 A;  4LF4 O;  4KFM A;  3VOU A;  4R7C A;  4I55 A;  3MAQ A;  3I5D A;  3BFR A;  1SQP H;  2Z5U A;  5CN0 A;  5DM6 V;  5C93 A;  2RMK B;  2FKX A;  4MVZ A;  2L6L A;  3CHX A;  2JS3 A;  5GON B;  4IHJ B;  1BCC H;  1JX9 A;  1P49 A;  4X65 B;  2ZM6 O;  3CX5 F;  1T5E A;  2OIG A;  1FS0 G;  1HNZ O;  3QO8 A;  4R8C A;  4FJC C;  1OCC B;  4U3J B;  2AXT Z;  3OM3 B;  1SF9 A;  4YJ3 B;  4YIP A;  4QGP A;  1E79 G;  3RYH A;  1AR1 B;  5IYB O;  2BTO A;  3U10 A;  3VQX A;  2UXD B;  2AGA A;  1DF4 A;  3W7T A;  5HFL A;  2XHB A;  1YJW V;  3C3S A;  4BW5 A;  2F23 A;  1PP9 H;  2Q6A A;  2ZR2 A;  4WFE A;  2M7W A;  4BW9 A;  3OGI B;  3UM7 A;  3W7S A;  5J2U A;  5FNV A;  2JEU A;  3TXQ A;  3TET A;  5A2Q N;  4X20 B;  4B3R O;  1K73 W;  1DF5 A;  1V54 B;  3RT3 C;  4GLX A;  4U3F H;  3WU2 Z;  4JI5 O;  3WG7 B;  3STL C;  4WFB V;  1YXB A;  1JQ0 A;  4JAU A;  1D5N A;  4GKJ B;  2YEV A;  2QTO A;  1Q6I A;  3JAK A;  3QO7 A;  4KP4 A;  1N0J A;  4PJ0 Z;  3VQV A;  5J2T B;  1TUE B;  4D7T A;  4IYH A;  1VQN V;  4TUY B;  1XBL A;  1VQ7 V;  2HR3 A;  1D2D A;  2YID A;  1EBO A;  3CC2 V;  4JI3 B;  4P9O A;  2WLH A;  4BWA A;  3CCS V;  2VS0 A;  5H6Q A;  1G1X B;  2DYS C;  5A9G A;  1NT2 B;  1IBM B;  1IBK B;  5GON A;  4IHJ A;  4LFA B;  3EHB B;  1VF7 A;  3SJA C;  1W0K G;  5L3E A;  3ABL C;  4Q6G A;  3EFF K;  2OWO A;  3FAV B;  1N8R W;  1AVM A;  2WA4 A;  1VF5 B;  4JYC A;  3IC9 A;  4U3J A;  1I7F A;  4LFA O;  1XIL A;  4BIO A;  4YJ3 A;  3ZRS A;  2GBO A;  4GX0 A;  3ABK C;  4LWS B;  2D2C B;  2LQT A;  4DV7 O;  1I94 O;  3ASN C;  3LUT B;  5LA6 B;  3AG1 C;  4H44 B;  1QLE B;  1PD3 A;  2P90 A;  4MVU A;  4JTA B;  4DUZ B;  1IBL B;  4JZ2 A;  1QBZ A;  2R9R B;  2JS5 A;  2ZDI A;  3LNN A;  1MOF A;  1WPB A;  4PI2 A;  1F4M A;  3HKC B;  4X20 A;  2GV9 A;  3DSQ A;  4DV6 O;  2WA3 A;  3CCE V;  4HAM A;  3BEH A;  2NLJ C;  1IBL O;  1ZSP A;  3JAL B;  4DV3 O;  2HJF C;  1JA8 A;  4ZIB A;  5K1X A;  5C8Y B;  4L8J A;  1P4R A;  3AG4 C;  5H9C A;  3KG2 A;  1NVP D;  1WB7 A;  5J2T A;  3JD3 A;  4GT1 A;  2HJD A;  2EIN C;  4RQE A;  2F4V B;  1CPY A;  4TUY A;  1OHH G;  2A06 H;  3G4S V;  4H13 B;  1FJG O;  4GKK B;  1ZUQ A;  1VIB A;  2IH1 C;  2QGN A;  4UCO A;  4AI8 A;  5KMG A;  4JV5 O;  2LO1 A;  5FPO A;  3RBZ A;  1FFX B;  2UXC O;  3RYI B;  2B9Z A;  3UO3 A;  1YIJ V;  1HR0 B;  3ETE A;  3SPG A;  3K5M A;  4B3T B;  4JI8 B;  1Y6X A;  3FAV A;  1R3K C;  1N33 B;  5EYP B;  5B3S B;  4B3M B;  4FM0 A;  2W0F C;  1N36 B;  1S76 D;  2CK3 G;  4H0L B;  1S0V A;  1VEW A;  1ENV A;  1M56 B;  1X4T A;  4U7N A;  3LDE A;  4LWS A;  5DED A;  3JD4 A;  2HLD G;  1KP3 A;  1OCR C;  2A7W A;  5LHG A;  1TAE A;  5LA6 A;  3HKB B;  1IXM A;  4Z1V A;  2ZE5 A;  4JI0 B;  4FLY A;  3FB6 C;  5J9P C;  4NTX A;  4LP8 A;  4DV4 B;  3ZHS A;  5CBF A;  5LGT A;  1R3I C;  1IZ3 A;  2Y4U A;  2VRZ A;  3HKC A;  2RQ6 A;  4WFH A;  3CCR V;  3FKS G;  1B3Q A;  1ORQ C;  4TOI A;  4JI0 O;  3OEE G;  2V1D A;  3OGC C;  1BHB A;  5EZY B;  3JAL A;  1Q82 W;  1YZB A;  4PA7 A;  4JI2 O;  2MK3 A;  3ETG A;  4Q20 A;  1MZE A;  1R3L C;  4X66 B;  3APO A;  1TUB B;  5DN6 G;  5C8Y A;  4NR1 A;  3RN4 A;  3BHP A;  2NN4 A;  3AG2 C;  5JCO A;  3OTF A;  4X89 A;  1BE3 H;  2G38 A;  3A0R A;  2E5L B;  1GN6 A;  1VQ6 V;  1VMG A;  1AI5 A;  1YEW A;  1Z5W A;  2V7Q G;  1P7G A;  3F7Y C;  3W7W A;  4C7U A;  2DWD C;  1F23 A;  2A9H A;  1Y74 B;  4D6T H;  1R3J C;  1N34 O;  1H8H G;  3AK1 A;  4FM2 A;  4LCU C;  1XEQ A;  2E5L O;  2HHH B;  4K8Z A;  4W4K A;  1FFX A;  3RYI A;  2LP7 A;  1WJZ A;  4X1Y B;  2UUA B;  1US6 A;  1WPX A;  1Q6H A;  3SJC C;  2QJ1 A;  2YXL A;  3JAR A;  5EYP A;  5TIS Z;  4PHZ A;  4RQF A;  2QM7 A;  1GK9 A;  4LFB B;  1NR1 A;  4UV9 A;  2CGN A;  3CCQ V;  1K5S A;  3BA8 A;  1YF2 A;  2GUZ B;  4YHH B;  2ILM A;  1FD9 A;  1BT8 A;  5KHH A;  3BPZ A;  3ZMT A;  3CRC A;  1IUR A;  3EXA A;  3HR0 A;  1GAX A;  1R6T A;  4MVR A;  2P7T C;  1YIT V;  4X62 O;  1B04 A;  3RYF B;  3SYQ A;  5LMN B;  1Y67 A;  4JI7 O;  5EBW C;  4NXM O;  4TV8 B;  2XOK G;  2ZQM A;  3T2M A;  2LW1 A;  1YJ9 V;  2K1E A;  2JJ1 G;  2XTA A;  1BZK A;  5LXT B;  5EZY A;  2WLL B;  4LR3 A;  4DR1 O;  5B1N A;  1GM7 A;  4LF5 O;  1TUB A;  1OCC C;  2CE4 A;  1V9P A;  3E22 B;  4DR2 B;  4Z1M G;  2Z3Y A;  3G6B A;  1YI2 V;  4O4L B;  3HKD B;  2UU9 B;  5B66 Z;  2Q69 A;  3L9D A;  4DK1 A;  2ZT9 B;  2AZ0 A;  2PZS A;  1SES A;  4UXN A;  3SPC A;  1N32 B;  3BAB A;  4X1I B;  2YIB A;  2GTA A;  5K1P A;  1XHX A;  4XDL A;  3CRM A;  3UT5 B;  1Y74 A;  2EIM B;  2ZDI C;  2IJK A;  3A0B Z;  1GKF A;  4DK0 A;  2B5U A;  4ZKI A;  2E74 B;  2P22 C;  2QWQ B;  1KBH A;  4X1Y A;  3ZRV A;  3K0D A;  1V54 C;  1XL4 A;  2X7R B;  2KKW A;  3DXR B;  4EEQ A;  3WG7 C;  4O2B B;  1L1F A; 
#chains in the Genus database with same CATH homology
 1FXH A;  2WPD G;  1PL0 A;  2JEX A;  3OM3 B;  1KC8 W;  3ZIA G;  1RPO A;  1ZWI C;  1YSC A;  1VQM V;  1M90 W;  3ABM B;  2WLI B;  3AG3 B;  1E79 G;  3OMA B;  2DQ3 A;  1AJQ A;  1JCH A;  1AR1 B;  2LFS A;  4PDM A;  4H37 A;  5IYB O;  4CBC A;  5E1A C;  2BOC C;  1MG1 A;  5EK0 A;  1NJI W;  3CPW U;  3TK1 A;  2XND G;  3HPL C;  3OMI B;  1DF4 A;  3W7T A;  1G8M A;  4PDL A;  3OMN B;  3R65 A;  4ZBM A;  3GWO A;  5HFL A;  3LDC A;  1YJW V;  3B77 A;  3SPJ A;  1FXK A;  4JYB A;  4HZ3 A;  4BW5 A;  4R6Z A;  2Q6A A;  2ZR2 A;  4DO2 A;  5GW7 A;  4WFE A;  2D3O W;  2M7W A;  3UM7 A;  2WLN A;  3K08 A;  3W7S A;  4LC1 A;  2IJJ A;  2JEU A;  3TET A;  1W0J G;  1F4N A;  1K73 W;  5H6R A;  2IU3 A;  2X0L A;  3OW2 U;  1DF5 A;  5FL7 G;  2GHY A;  3G71 V;  1V54 B;  2XAF A;  3RW0 A;  1AI7 A;  5HFM A;  3WG7 B;  3T4D A;  2WLL A;  2ITD C;  3STL C;  4WFB V;  1NBM G;  1NH2 D;  2QE7 G;  1KP2 A;  1K8A W;  1Q81 W;  1JQ0 A;  1VQ8 V;  1M1K W;  4YXW G;  4JAU A;  1KQS U;  1SET A;  1Y66 A;  1K97 A;  2C2A A;  2EIM C;  2YEV A;  3CCM V;  4RO2 A;  1ARO P;  2QTO A;  4XBF A;  3QO7 A;  4KP4 A;  1FFT B;  4KUM A;  3WFV A;  5KA5 A;  4X8A A;  3JD1 A;  3LNM B;  4WF9 V;  1S77 D;  1TUE B;  4MT8 A;  1VQN V;  5LGN A;  3ZMS A;  1KD1 W;  1VQ7 V;  3B8N A;  3K9A A;  2UXN A;  2HR3 A;  4F4L A;  1QLE C;  2QA4 V;  4N23 A;  3OAA G;  1EBO A;  1EZJ A;  3ZMZ A;  3GB7 C;  3JYC A;  1NH2 B;  3CC2 V;  2OCC C;  3OUS A;  4P9O A;  2WLH A;  4WCE V;  3CCU V;  1QR8 A;  5LBQ A;  4WFF A;  2EIL C;  3CCJ V;  3CCS V;  5H6Q A;  3E8G A;  2JK5 C;  3E86 A;  2A79 B;  1J95 A;  2DYS C;  4H33 A;  3E35 A;  2WSS G;  3EHB B;  3QNE A;  2LFR A;  1W0K G;  1Q7Y W;  5L3E A;  2QEX V;  3JD0 A;  3ABL C;  2IJH A;  5KA6 A;  4RAI A;  3QO5 A;  3EFF K;  1OCO C;  3SPI A;  3T4Z A;  3CC7 V;  2YSU B;  1VQO V;  1KKD A;  4UVA A;  1N8R W;  4QE7 A;  1K92 A;  2HFE C;  3K04 A;  1VQP V;  3ABT A;  4JYC A;  1R73 A;  4R50 A;  1K4C C;  1GO3 F;  2AHY A;  4PA6 A;  4MVQ A;  5IYD O;  1YTF D;  1I5X A;  4XDJ A;  1THZ A;  4J9Z B;  3ZRS A;  3E2E A;  3ZMV A;  4GX0 A;  4DXW A;  3LDD A;  3ZRW B;  3ABK C;  2JIZ G;  2WLI A;  3STZ C;  2WLJ A;  2OTJ V;  1W2B U;  4HYO A;  1BHA A;  3E8B A;  4PA9 A;  3K79 A;  5IY5 C;  5L3B A;  3ASN C;  3LUT B;  3AG1 C;  4JAV A;  3FB8 C;  3HB3 B;  1QLE B;  5KUK A;  1PD3 A;  2P90 A;  1GMG A;  3MD0 A;  2ZR3 A;  4MVU A;  1EFR G;  5LHI A;  4WFA V;  3E8F A;  4JTA B;  2OCC B;  1SRY A;  3TCU A;  1S72 V;  1YTF B;  5LHH A;  1QBZ A;  2EIL B;  2R9R B;  1COW G;  2JJ2 G;  2Q67 A;  2ZDI A;  2DYS B;  3K0G A;  3P32 A;  1MOF A;  2IH3 C;  3LSS A;  2DYR C;  1F4M A;  2WLM A;  1PNM A;  3MHS C;  3ZMU A;  3D3I A;  4QE9 A;  1AJN A;  2Y69 C;  4G27 B;  3SYP A;  1VQK V;  3ABL B;  4QPJ A;  1QR9 A;  3CYO A;  3ZCC A;  3CCE V;  4HAM A;  5EC2 C;  3BEH A;  1OCO B;  2NLJ C;  1UJW B;  5EBM C;  4MTO A;  4WFG A;  1AI4 A;  4QJF B;  5B3S C;  4G28 B;  4FMT A;  2HJF C;  4JTC B;  1VQ4 V;  4TSF G;  1SER A;  1K33 A;  4MTG A;  1RPR A;  2P67 A;  1P4R A;  3AG4 C;  5H9C A;  1M56 C;  3KG2 A;  3OR6 C;  1NVP D;  1VQ5 V;  1AI6 A;  3ABK B;  4PA3 A;  2X6C A;  1CEZ A;  1NR7 A;  4PDR A;  3JD3 A;  4GT1 A;  3W7U A;  1B6Q A;  2EIN C;  4RQE A;  1CPY A;  5IY5 B;  4L87 A;  2B1I A;  3ASN B;  1OHH G;  3AG1 B;  3SYC A;  3P30 A;  2WLK A;  3X2Q C;  3G4S V;  3K3W A;  1JJ2 U;  3AEI A;  3OUF A;  2H94 A;  2X6B A;  2HG5 C;  3OEH G;  2IJI A;  2IH1 C;  1Q86 W;  2ITC C;  1BMF G;  1PNL A;  1NVP B;  1R6N A;  2X6A A;  1OZ0 A;  1MSW D;  3RBZ A;  1YJN V;  3JCZ A;  4E2L A;  2DYR B;  2Q68 A;  3BY6 A;  1YIJ V;  5L3C A;  2Y69 B;  3ETE A;  3FB5 C;  1K5Q A;  3SPG A;  2R9I A;  2XAQ A;  5L3G A;  4FPP A;  4X88 A;  3SYO A;  1R3K C;  4UV8 A;  5B3S B;  4XDK A;  1P7B A;  2W0F C;  2EJR A;  3ASO C;  3DGE A;  1SZT A;  1GM8 A;  1S76 D;  1HWY A;  4MVO A;  4RUE A;  2CK3 G;  3AG4 B;  4TT3 G;  3CME V;  3CP1 A;  1S0V A;  1ENV A;  1M56 B;  2NNU A;  3ZRW A;  3FB7 C;  4U7N A;  4I5S A;  1R6K A;  4J9Y B;  2QM8 A;  3LDE A;  1H2G A;  3JD4 A;  1ROP A;  2HLD G;  1K3E A;  1KP3 A;  1OCR C;  4N21 A;  3RVZ A;  2EIN B;  5LHG A;  4BIZ A;  1G4Y B;  4PDV A;  1JPX A;  4MVS A;  5L3D A;  3X2Q B;  1K9M W;  1IXM A;  4P2Z A;  3ETD A;  4JPR A;  4MW8 A;  2HVJ C;  1DLB A;  2JDI G;  3LSQ A;  3FB6 C;  5J9P C;  4GX5 A;  4LP8 A;  1I5Y A;  2IW5 A;  5CBF A;  5LGT A;  4RUF A;  5BZB A;  4JF3 A;  2XAH A;  1R3I C;  3DTU B;  5IYC O;  4WFH A;  4PEL A;  5IDJ A;  3CCR V;  1QLN A;  3T1C A;  1QVG U;  3ZRX A;  3FKS G;  3G6E V;  1ORQ C;  2GSM B;  3OEE G;  3E83 A;  4QIW F;  2V1D A;  3OGC C;  1BHB A;  4EKW A;  2BOB C;  1E1Q G;  5B1A C;  1Q82 W;  2A0L A;  3MHH C;  2XAS A;  3W7X A;  4PA7 A;  2MK3 A;  2EIK C;  2EIJ C;  2XAG A;  3ETG A;  3M99 B;  4Q20 A;  1KEC A;  1R3L C;  4JAS A;  2XAJ A;  2IU0 A;  3ASO B;  5DN6 G;  4CZZ A;  2PI5 A;  1F51 A;  3B8M A;  4UVC A;  2DWE C;  3UKM A;  3AG2 C;  4X89 A;  3K03 A;  3A0R A;  1K4D C;  1M9N A;  2EZO A;  2QKS A;  1OCR B;  4UVB A;  1H38 A;  1VQ6 V;  2P6J A;  1AI5 A;  4JTD B;  2V7Q G;  2OT5 A;  3IC7 A;  3F7Y C;  3W7W A;  1PNK A;  1MAB G;  2DWD C;  3FYI B;  1S3J A;  3F5W C;  1F23 A;  3I56 V;  2A9H A;  1FXK C;  4LBE C;  1R3J C;  3CMA V;  3FYE B;  1H8H G;  5KUM A;  5B1B C;  1H8E G;  3SJQ C;  4LCU C;  4GCZ A;  1VQ9 V;  3IGA C;  2LP7 A;  3E89 A;  1RM1 C;  1WPX A;  4U7O A;  3I55 V;  2ZD9 A;  2HKO A;  1QCE A;  5B1A B;  3CCV V;  1Y4M A;  2EIK B;  2EIJ B;  3K06 A;  4P9P A;  2QM7 A;  1GK9 A;  1JVM A;  4ASU G;  4RQF A;  4MVM A;  1GTO A;  1NR1 A;  4UV9 A;  3SPH A;  1M57 C;  2ATK C;  5B1O A;  3CCQ V;  1K5S A;  2DW4 A;  3SYA A;  4MSW C;  1LNQ A;  3AG2 B;  1YHQ V;  2KB1 A;  3CCL V;  1V55 C;  4MS2 A;  2Y48 A;  1S5H C;  3F7V C;  3OE7 G;  1GM9 A;  2FTK A;  3ZMT A;  4UUJ C;  5CBH A;  2HVK C;  3NXS A;  5CMU A;  4MVR A;  3JD2 A;  3ZN0 A;  2P7T C;  4BAY A;  1YIT V;  5L3F A;  3ML0 A;  3OR7 C;  2B1G A;  3E8H A;  3SYQ A;  1FXK B;  1CP9 A;  5EBW C;  2EZP A;  2OTL V;  5B1B B;  2ZXW C;  2XOK G;  2ZQM A;  3ZN1 A;  1RM1 B;  1OCZ C;  3T2M A;  2UXX A;  1NQT A;  1YJ9 V;  2K1E A;  2JJ1 G;  4FK5 C;  4QPK A;  2H8P C;  1VQL V;  5CBG A;  5LGU A;  3CC4 V;  2WLL B;  1AJP A;  5EC1 C;  2WWW A;  5B1N A;  1GM7 A;  4MW3 A;  1OCC C;  1E1R G;  4TWK A;  2F43 G;  1M57 B;  2YEV B;  3D36 A;  2Z3Y A;  4Z1M G;  1YI2 V;  2PI4 A;  1BL8 A;  3CD6 V;  1JOY A;  3ABM C;  3PJS K;  3AG3 C;  1QVF U;  4QNH B;  1V55 B;  2Q69 A;  3ABU A;  4MTX A;  3ZJZ A;  2W6I G;  4FIP C;  4OXS A;  1K34 A;  2AHZ A;  4MTF A;  1SES A;  4P30 A;  4UXN A;  1WLE A;  3SPC A;  3H01 A;  3RVY A;  4XDL A;  4KFM A;  3VOU A;  4R7C A;  1NKD A;  1XL6 A;  1FXV A;  4JGS A;  4PA4 A;  2EIM B;  2Z5U A;  3OFN G;  5CN0 A;  5DM6 V;  5C93 A;  2WAM A;  5EBL C;  2ZDI C;  4MVZ A;  2ZXW B;  5CA3 A;  3VBB A;  2IJK A;  1GKF A;  2W6J G;  4G2K A;  2B5U A;  1OCZ B;  2EBO A;  4ZKI A;  1JX9 A;  3ZRV A;  3K0D A;  1V54 C;  4BIU A;  1FS0 G;  1XL4 A;  2DQ0 A;  4GX1 A;  3CXC U;  2X7R B;  1PKX A;  3WG7 C;  3QO8 A;  1K7D A;  4I9W A;  1DTO A;  1L1F A;  4GX2 A;  3IFX A;  4R8C A;  4FJC C;  1OCC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...