1XNRO

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xnrO00
1R6TA 4DV1O 5H5NA 4NXNO 4B3TO 3RT3C 4LF9O 4OPHA 1J5EO 2ZM6O 3J7AU 4X66O 3SDLA 4DR7O 1FJGO 1XMQO 4X62O 2DJVA 4AQYO 2Z0AA 3M8AA 3JAMN 3O65A 4JI7O 4DR2O 2ZKOA 1IBLO 1D2DA 1XEQA 4DR4O 4B3RO 2AGAA 4DUYO 4GKJO 4LFBO 1HR0O 1NS1A 2UUBO 1F7YA 3J81N 4DV6O 1HNZO 4JI4O 4DV4O 5IT9N 1FKAO 4B3MO 4DR6O 4YHHO 5BR8O 1N36O 4NXMO 4DV2O 1R1BA 4X64O 2JRIA 4X65O 3T1YO 1N33O 3OTOO 4DV3O 4JI8O 5BXZA 4JI3O 4LF8O 2HHHO 4LF6O 2VQFO 2UXCO 1X59A 1HNXO 1A32A 2DOSA 1IBKO 2UXBO 1XNQO 4B3SO 4JYAO 2VQEO 5LMNO 4LF5O 4GKKO 4JI1O 2N74A 5BY1A 4DR1O 1AB3A 3T1HO 4LFCO 4JI5O 5FLXN 4DR5O 1YZBA 3J80N 4DV5O 4K0KO 1IBMO 4DV0O 2E5LO 1HNWO 4LF7O 2UUCO 4JV5O 5LL6Y 3R66A 1I94O 4JI2O 4LFAO 2LW7A 3F5TA 4DUZO 1AILA 1FYJA 4OX9O 4KHPO 1XNRO 5LMUO 2FKXA 4YY3O 4JI6O 1N34O 4DR3O 5IWAO 1DK1A 2UXDO 4OPAA 1KUQA 4DV7O 5A2QN 1N32O 2UUAO 2UU9O 2F4VO 1XMOO 1G1XB 4LF4O 4A5UB 4JI0O
chains in the Genus database with same CATH superfamily
2Y4UA 1NBMG 3CRAA 3U11A 4DYLA 2BSKA 3E8GA 5LP6B 3RYIA 1XI1A 1J5EO 2KKWA 1WLEA 1BS3A 1TUEB 4LF8B 2P4VA 3FAVA 5H9CA 1WA8B 1YIJV 3JD1A 4U7NA 5LGUA 4D6TH 1EBOA 4HBNA 3GVMA 3M7MX 4J7ZA 1JQ0A 5KHGA 1NI8A 2CGNA 4FZ0A 4JTCB 4CC6A 2CUGA 4CH4A 5B1AB 3DTUB 1GH6A 5BMVB 1H8EG 4I9QA 4FLWA 4O4LB 2VQFB 3TK1A 4B7EA 3SJCC 4MTOA 3OTOO 3ZX6A 2ZXWB 4I4TA 3OGCC 2QJ1A 2AZ0A 5IY5B 1X59A 3ZCCA 1BT8A 4B08A 2W0FC 3I56V 4PDLA 2IH1C 3IC9A 3K9AA 4PA6A 3CRCA 1NR1A 4LC1A 3P3PA 4Q20A 3J80N 2XNDG 2BTQB 1AVMA 3IAYA 1HNWO 3H01A 1Q43A 2CH7A 2HJDA 2IU0A 3CC2V 3CS5A 5LL6Y 4O2AB 2X0LA 5LHGA 3CWBH 1VF6C 4TQFA 2EIJB 1M93A 2UXDB 4IYHA 2A3QA 4HYOA 1S5JA 4JI6O 4AHCA 2UU9B 1V55B 1DK1A 2D3OW 1R3IC 2YIBA 2XHBA 2QA4V 5KX5A 1XHXA 5HFMA 1VQ9V 4J10A 4BIUA 4MVZA 1COWG 5JQGB 2JS5A 1NZ6A 1FAFA 4X62B 4PDMA 1PNKA 1YJNV 4DR2B 3SJBC 1OCRB 2Y0PA 3OTFA 1H2KA 1M57B 1SA0B 1Q6HA 1IBLO 2EIKC 1XEQA 3ZHTA 1OZ0A 2GHYA 1W59A 3AG4B 1D5NA 3CXCU 4DK0A 5LOVB 3CD6V 2DWEC 5L3CA 1AI7A 4JI4O 2BSKB 1SRYA 3RYIB 2R9AA 2JEUA 4DR6O 3SPGA 1N36O 4DW1A 3CRRA 1R1BA 2F43G 3FAVB 3T1YO 1N33O 1RPOA 3CSXA 2QKSA 5KAFZ 2H3OA 4CC5A 1SETA 4NKGB 3RVYA 2N04A 3JARA 4B3SO 4WBNA 3OMNB 4N21A 1K73W 1Q6UA 4DV0B 2E5LB 1JX9A 4ZOLB 3PJSK 1Y4MA 3ASNC 4JI5O 3RBZA 1GN2A 4N23A 3EHBB 2Q69A 2PY5A 2EIJC 1GAXA 2UUCO 4PI0A 3AG1B 3D3QA 4LWSA 4RAIA 1EFRG 3HKDA 4OX9O 4I4TB 1M56B 1PNLA 2YXLA 4X1IB 3JD3A 3KCYA 2GSMB 3MHSC 4B3RB 5KLVH 3UT5A 5B66Z 1Y76B 1GM8A 3NXSA 5KHJA 3CCSV 1LNQA 5KA6A 2CH7B 3K3WA 4A5UB 4DV4B 2QE7G 5D5QA 1M57C 3D8CA 4MTXA 2ETNA 2QM4A 3AG4C 1S5LZ 1AI5A 1KMIZ 4PJ0Z 5KUMA 2OT5A 3E8BA 3K59A 2BOBC 1MSDA 1W2BU 2AGAA 2CTWA 5KX5B 1MA1A 3T1HB 3K57A 3WG7B 3OGIB 5IDJA 2R9RB 1Z5WA 3EFFK 2XAJA 3FB6C 3VQYA 3JD0A 1DLBA 1BSMA 2DYRB 2ZT9B 1AJQA 5LA6A 1V54B 2P6JA 2ZIMA 1AR1B 1PPJH 4J11A 1UPGA 3K04A 3SYPA 1GN4A 1NVPB 1JOYA 5IYDO 4LF8O 1HDJA 3UKMA 1SQBH 5GONA 3OFNG 4CH5A 3AG1C 4B7KA 2WA4A 1KYOF 5EIBD 2JJ1G 5EIBC 2JJ2G 1H8HG 3CCLV 2YSUB 3FB7C 1M56C 2XOKG 2ODMA 4QIWF 3TCUA 2QTSA 1URFA 2A0LA 1IXBA 3ZMVA 3ZHQA 2DE0X 3CMEV 1PNMA 2HR3A 4CH3A 3SJQC 2IH3C 1BL8A 1OCZC 3JARB 4WBNB 3HKBA 3SYCA 1XMOB 1H2LA 4QJFB 2P7TC 1AI4A 1XQ8A 3U0ZA 4UV9A 5GW7A 1P84F 4JI0O 1YF2A 4LWSB 1GMGA 4H0LB 2YIBD 1P7GA 5H5NA 3HKDB 4GZRB 1FPOA 3D36A 3BABA 4JASA 3RT3C 2HP8A 3W7TA 4BIOA 1JJ2U 2FYUH 2ZM6O 4BWAA 3E8HA 3CP1A 4ZI7A 4HNAA 5EBMC 2AW9A 3UT5B 2W6IG 1K34A 3HKEA 4NR1A 3SPJA 4DK1A 2Q7EA 5L3DA 3VBBA 5IYCO 1NVPD 1F7YA 2X6BA 1JJOA 1GO3F 1SF9A 5IT9N 3IGAC 2KB1A 3TXQA 1V9PA 3OTOB 4JI2B 1SQXH 2LQTA 1OCOB 3JYCA 1K4CC 5E1AC 2Q0OC 1CP9A 1S3JA 1I0HA 1YJ9V 2VWJA 1FFTB 3AG3B 4ABMA 4CS3A 1THZA 1FS0G 2AXTZ 2HJFC 5ITZA 2ATKC 2PYLA 5LA6B 1VQKV 3H1LH 4EB6A 1XREA 1YEWA 4MTGA 4JI6B 2LFSA 2FKXA 3MDSA 3RW0A 5L3EA 4JGSA 1QR8A 5GONB 1N8RW 1EZJA 3A2FA 2EINB 4D7SA 2P06A 1UFIA 4JTAB 5K1XA 2WLKA 3OMAB 1QLNA 3CCJV 2C2AA 5B3SB 2Q68A 4UCTA 3P30A 1SQVH 3DGEA 1R6TA 2ZD9A 4NXNO 2GDSA 4Q6GA 1DF5A 1K5SA 1KB9F 3M8AA 3HR0A 5JJJB 3HKBB 1D2DA 1DTOA 4B3RO 2HFEC 3RVZA 1WPBA 4KP4A 4GKKB 2DYSB 3E83A 1JPXA 3TETA 5LHHA 2XT9A 4JI4B 2L35A 4GX0A 3FD9A 3LNNA 2LFRA 4DR6B 1N36B 1IBMB 3F7YC 1CXZB 4J7KA 3CB2A 2EJ7A 3SPCA 4DV4O 4OXSA 3T1YB 4NXMO 1RPRA 5B1OA 1NH2B 3AG3C 4X64O 3N2KA 2EZOA 3K06A 4ZI7B 1BGYH 4HNAB 4JI8O 1G6UA 2XTAA 2YICA 4B3SB 3QO8A 5JVDA 2OCCB 2RJZA 2OIGA 3HKEB 3LSSA 3KG2A 3JAKA 3B8NA 4IIJA 4ICGA 2N05A 1GTOA 1AB3A 3T1HO 2UUCB 2D2CB 3APQA 2JS3A 4D7TA 3A8TA 1BE3H 3ASOC 2RCVA 3U10A 5L3BA 3AK2A 2P67A 3H1IH 4UB8Z 3ZN0A 2EINC 1HWYA 3OMIB 4DUZO 1M5IA 1FXHA 4MT8A 5KHKA 3ZMTA 4I55B 1KU9A 3CCRV 2XAGA 1L8DA 1I5XA 3LSUA 5ITZB 3UCSC 1I08A 3BRCA 3CHXA 2UUBB 1K97A 2P4KA 2NNUA 4YIPA 4EB6B 4FLXA 1SQGA 4FLTA 2QWPB 2WLHA 4O4HA 4PA4A 4FLUA 4FJCC 5LGTA 1L0NH 2W0XA 4FMTA 4YIOA 1J95A 1O9HA 3CE2A 4LH6A 2KQXA 5FNVA 1B06A 4JPRA 4GT1A 5BZBA 3E8FA 1HNXB 1SQFA 1GKFA 3I55V 3WB0A 4TV8A 2Q6AA 1R6KA 1NH2D 1DGSA 1SZXA 4UUJC 2CTQA 1ROPA 5CA1A 1VQ7V 2OWOA 2OCCC 3R65A 3LDEA 3B8MA 1XL4A 1VQ6V 4Z1VA 4X65O 4ZKIA 5BXZA 4G28B 1ZLZA 3AK3A 2YUAA 3L70H 4O2BA 5FPRA 2GTAA 4ZOLA 2EIKB 3K5NA 1NR7A 4PD4F 1W0JG 1N4CA 2CK3G 2ZR2A 4GX2A 4MS2A 4FLZA 2BE3A 3STLC 3UO3A 3N2KB 3E35A 2FTKA 4JI2O 3ZBHA 3AEIA 3IC7A 1H38A 3RYFA 3AG7A 2QWNB 4X1IA 2ZIOA 1RSOA 5JVDB 4F6EA 4XDLA 4BW5A 5JH7A 2W6JG 3FB8C 2LO1A 2B1GA 3E22A 3JAKB 1CPYA 2HEPA 4FIPC 1KD1W 4IIJB 3T4DA 1Y76A 1IURA 1MZFA 2HG5C 4WFBV 4JI0B 2IM9A 5A2QN 3DC6A 4H37A 1PD3A 2Q9LA 2F4VO 5GTIZ 4KUMA 3ZRSA 4C7UA 3ASNB 3N2GA 4NTXA 5LBQA 2ZM6B 1MABG 1PP9H 4P30A 4X20A 4K8XA 4ZIBA 2ARHA 2ZE6A 3SDLA 2IJHA 3RWRD 1QHTA 3ABUA 1QR9A 3FKSG 1NU1H 1VF5B 2VQEB 3DXRA 2EILC 1UJWB 4JI1B 3I5DA 5J2TA 2QSAA 4TUYA 4LFBO 1MNGA 4MVQA 5KAIZ 4Z1MG 1EZVH 4O4HB 2F95B 3GWKC 4YHHO 4FK5C 1CEZA 4Z2WA 5FNVB 1BQ0A 5F2VO 3BPZA 2IJJA 3OEEG 4EFBA 5KHHA 3ZHVA 5L3FA 3CYOA 4LF6O 2V7QG 1AP5A 4JAVA 4RUEA 2YIAA 4TV8B 2UXBO 4X1YA 3P3NA 4FPPA 3K58A 4LF5O 4GKKO 4WFEA 5LYJA 3SYAA 5CA1B 1PL0A 3ZRWB 2UUAB 3G6EV 5FLXN 4X9QA 2E74B 2V1DA 3W7WA 2ZCEA 1IBMO 4R8CA 4NTWA 2QM7A 1XOUA 2LW7A 2H8PC 1IDSA 1FYJA 1YSCA 2EIMB 3OR7C 3EVKA 2WLLA 2LGQA 2PUSA 1X4TA 4FVMA 1PV0A 3QF7A 4O2BB 3QVNA 4YY3O 4WFAV 1Y74A 3UO2A 3JATA 1HR0B 3ZMZA 1N32O 3QG5A 3L71H 3BA9A 4KFMA 3SYOA 4NXNB 2K9PA 1U96A 2F66C 1KP3A 4L8JA 3RYFB 2HVKC 2R72A 1RFYA 2OTJV 1RSOB 3T4ZA 5JH7B 2RQ6A 4BAYA 1B6QA 4LP8A 1SKVA 2RNBA 3T1CA 3E22B 3JAMN 1XBLA 1Q3EA 4JYAB 1OCZB 4BR6A 4F6RA 3UQ8A 5DM6V 2CTRA 3ZRXA 4O4IB 4UCUA 2UUBO 4NXMB 3N2GB 4NTYA 4X64B 3J81N 2P5OA 1FXKC 1JA8A 4X20B 4JI8B 2Y48A 5EK0A 1YVWA 1KECA 4MW3A 3STZC 1WNSA 4TV9A 2IW5A 4KHPB 1SC5B 2A06H 4R7CA 4UVBA 5LMUB 2QWQB 4BW9A 3DXRB 1HNXO 2DOSA 5J2TB 1IBKO 4TUYB 1GM9A 4FLVA 2WAMA 1NTKH 1S5HC 3C3TA 2RMKB 2PTMA 1K5QA 2ILMA 4L87A 1FXVA 2EIMC 4LF7O 4DUZB 1VMGA 4NYKA 3G4SV 1PKXA 1P49A 2DMXA 4QGPA 3F5TA 2WPDG 1H2GA 3GWOA 4JI7B 3FYIB 1AP6A 4X1YB 5LYJB 5EBLC 1H2MA 1US6A 2WLNA 5LGNA 4GLXA 4JAAA 1YJWV 2WWWA 3WB1A 3K9SA 1L0LH 2YEVA 5EZYA 2GV9A 2DWDC 3SYQA 2WLLB 2LGWA 4JYCA 3JAWA 1FJGO 1PM9A 2ZKOA 1Y74B 1S72V 1JFFA 3B40A 5LMNB 3JATB 3AG2C 4JYBA 4DUYO 3L72H 1S77D 1ENVA 4K0KB 3ML0A 1LUWA 4JV5B 2KG7A 4X65B 3L73H 1M1KW 5C93A 1YTFB 4U3JA 1YXBA 4GCZA 3A0BZ 1AR5A 5IJ9A 2CE4A 3ABKB 1A32A 4F6RB 1Q6IA 1HW7A 4JYYA 3K5MA 3BEHA 2VQEO 3ABLB 4JI1O 1P7BA 3CRQA 3B2EE 4E4EA 1ZTEA 2EULA 4DV5O 3OUFA 2Y69B 5LXTA 3K79A 2QTOA 4TV9B 4B3TB 1R3KC 4R6ZA 2Y0IA 4X66B 3L74H 3SR2C 4PHZA 1XMQB 2ZNIA 2OTLV 2IBZH 4AQYB 4I55A 5H6QA 3CCEV 2X6CA 2F4VB 2M6YA 4AI8A 4CBCA 1TA8A 3DSQA 3VQWA 2UUAO 2EX3A 2F23A 3ZS8C 3ZHRA 1VQ4V 2QEXV 3B4SA 2XAFA 1Q90D 4MSWC 4WCEV 4TT3G 1TUBA 2DQ3A 1RP3B 3CMAV 2ITCC 3ASOB 4OPHA 3JALA 1WP8A 4HZ3A 4IT5A 4JI3B 3KCXA 4I9WA 4LFBB 3CCUV 4PI2A 1BQZA 4RQFA 1VQNV 3CCVV 5AG2A 3K5LA 4KL1A 2FL4A 5EC2C 1HR0O 4LFCB 4JF3A 3EXAA 4YHHB 1IVSA 2OIEA 4DV6O 2YEVB 3C90A 5EZYB 1SS3A 2ZQMA 2LW1A 3ABKC 5BR8O 3H1HH 3W7SA 3JAWB 4LF6B 3ABLC 3G6BA 5EYPA 1Q8IA 2UXBB 5KUKA 3RFRA 4LF5B 2QKCA 1JFFB 2XUMA 2UXCO 2VRZA 5FPOA 3B77A 2E76B 2Y69C 4JYAO 2NN4A 2MK3A 1T5EA 3SJAC 3K08A 2ZDIC 4MVMA 5A9GA 1VQ8V 2LJ2A 2CDYA 2KG7B 5J2UA 3ICXA 2Z3YA 2OCHA 2RDCA 4U3JB 3ZHSA 3TJTA 4DV1B 1Q81W 4U3FH 3R66A 4UCOA 5EBWC 2O57A 5IJ9B 4YY3B 2ZR3A 4KHPO 5LMUO 2DN9A 4I0XB 3O9OA 4OGQB 1N32B 4DR3O 2CAZC 2BOCC 1PL4A 2WLIA 2XAQA 3LUTB 4J80A 2ZE7A 5JCOA 4DO2A 3CRMA 3UM7A 3MAQA 3JCZA 5LXTB 2K1EA 3CPWU 4B3MB 4P9PA 1QLEC 1Q82W 1N0JA 1ZUQA 2MW2B 4FM0A 3JASA 1XL6A 4DR7O 4FZ1A 1KKDA 1KP2A 1NTZH 4JI7O 1IZ3A 4GUNA 1QBZA 4EKWA 2EZPA 2VWKA 2ZINA 3SPIA 2HLDG 1DF4A 4U7OA 1QU7A 2NR5A 2G38A 5CN0A 3X2QC 3CEIA 1E1QG 1AROP 5B1NA 2EBOA 1TUBB 4XDKA 3JALB 4YJ2A 1Q5OA 3F7VC 2QKAA 1LR1A 2JRIA 1FXKA 2PYJA 1IBKB 2X6AA 4J41A 4IGGA 3HB3B 1XNQO 4WFFA 5LMNO 4ZBMA 1BZKA 1E1RG 3ZIAG 4G2KA 3ZRWA 4DR1O 4LF7B 1K9MW 2EILB 1FD9A 4K0KO 1F23A 1Z2GA 3WFVA 4JV5O 1ZWIC 3JD2A 2Q5ZA 4X1KA 4RO2A 5EYPB 1B3QA 1WB8A 4XDJA 1SESA 4EFEA 1GRJA 5DEDA 3ABMC 3LSQA 2CGOA 4WFHA 1FFXA 3QTCA 4DR4B 2ADPA 4OPAA 4GX5A 2BTOA 4J9YB 5J2UB 2JEXA 1AI6A 4LF4O 1TAEA 2DW4A 1NQTA 2XASA 1FJGB 3ZMSA 1AJNA 1RM1C 4B3TO 4TWKA 4HAMA 3J7AU 1MSWD 3TXSA 4X66O 5KA5A 2GBOA 1XMQO 3OT7A 2DJVA 3IJ4A 4AQYO 1TGOA 4DUYB 1AJPA 3G67A 4FFBA 2Q8VA 2WLIB 1IXMA 3N27A 4F4LA 1S76D 1M9NA 4O4IA 2BCCH 1N0NA 4XBFA 4GKJO 1NS1A 1ZSPA 3L9DA 4K35A 3DC5A 3ZMUA 3THOA 1MMMA 2Q7GA 3JASB 4PV1B 3K0GA 4QPJA 1KC8W 1XDCA 5CBFA 5B1BC 4JI3O 2YXHA 5DECA 1QQCA 4PA3A 4MVSA 2YS8A 4QPKA 1QVGU 4PA9A 1WAZA 1WP7A 4DV5B 2WLMA 3ZEDA 4DV7B 4UVAA 2NLJC 4LFCO 1H2NA 1K7DA 2JDIG 3T2MA 3CCMV 5LP6C 4YJ2B 1GN3A 2Q73A 1I94O 4J9ZB 1SZTA 3OEHG 4LF9B 1FXKB 2FB5A 4JTDB 3F5WC 1VQMV 1EM1A 2IU3A 3G71V 3ABTA 4H33A 3RYCA 1JR9A 2P22C 3JD4A 3ZN1A 1N34O 3H1KH 3JSLA 5IWAO 2PGGA 2GTSA 5IJ0A 1S0VA 4KXRA 3S3WA 1NT2B 3A0RA 5B1AC 4PA7A 3L75H 1G1XB 4YJ3A 4UCRA 2RN9A 4X8AA 1HNZB 4X1KB 1L1FA 4RUFA 3MD0A 4FM1A 4DV1O 4O4JA 2YXYA 4RWUA 2ZXWC 5JCOC 5IY5C 1VF7A 3CXHF 2HHHB 3IFXA 1MZEA 2Z0AA 1OHHG 1GM7A 5JWPA 1H2SB 1FFXB 4K8ZA 4FM2A 2JGDA 1AR4A 4PDRA 2X7RB 1NTMH 3E89A 3AK1A 4I5SA 3P32A 4DV6B 2ADQB 3BFRA 3OUSA 3LDDA 4DR5B 5BR8B 4LCUC 2F93B 5J9PC 3RN4A 1G4YB 4B3MO 3WU2Z 5CB4A 5KMGA 4PDVA 3RGBA 1U97A 4DV2O 3NR7A 4FFKA 2M7WA 4H13B 2UXCB 2QDOA 3JSNA 1KQSU 4DV3O 1XILA 3CCQV 1Q7YW 3SGIA 4FFBB 1Y66A 1V55C 1Z5VA 1BCCH 4CH6A 3LDCA 4X89A 2WA3A 4UCVA 2UXXA 4EEQA 5H6RA 4DRXA 1K4DC 1K8AW 1JMKC 3BAAA 3AG2B 1EN4A 3G80A 4ZHQA 1GN6A 2ZDIA 1OCRC 4GX1A 4J42A 5E79Z 1Q86W 1K33A 3QO5A 1OV9A 3TGUH 1HP8A 1XNRO 5KHIA 2H94A 3VOUA 4DR3B 4I50A 5IYZA 3OE7G 4W4LA 5JJNB 2HKOA 2B1IA 1G8MA 2GUZA 4YXWG 2VS0A 3HPLC 1VQPV 1Y67A 5L3GA 4UFZA 2AHZA 3KZIZ 4DR7B 3H1JH 5C8YA 2Q7HA 1BHAA 4RQEA 5D5PA 2Q4PA 3ETEA 5JJEB 1R3JC 1WPXA 4TQDA 4FLYA 3RYCB 1O9GA 1BMFG 5IJ0B 4CS4A 4DR4O 4IHJA 1VP7A 2R9IA 4CZZA 4YJ3B 4QNHB 2YI8A 3RYHA 2CTPA 1SQQH 2QR4A 4P2ZA 4O4JB 5FL7G 1LUVA 1SQPH 4LFAB 1KBHA 4MVOA 4IL6Z 1ORQC 4LBEC 1XNQB 1EN5A 3PN1A 2JGDB 2VQFO 3B09A 3Q4HA 2PI5A 1R73A 1ZL8A 4DR1B 1YDXA 1OJHA 3H9VA 1MOFA 1YI2V 1E79G 3ZRVA 1M90W 2ZNJA 3OAAG 3KKYA 3K0DA 5H2FZ 3M99B 2PZSA 1I7FA 2A79B 4CS2A 5CB4B 5KMGB 3APOA 2P90A 1JCHA 5CBGA 1J5EB 2UXNA 2IJKA 1WJZA 4NVPA 5EC1C 4I0XA 1XHZA 1VQ5V 4DRXB 2YC0A 3WG7C 4LF4B 2UXDO 1EN6A 3S3XA 5K1PA 1VEWA 1KUQA 2L6LA 3A0HZ 4DV7O 2DYRC 2EJRA 1F4MA 4ZHQB 1QCEA 2UU9O 4UXNA 5CA3A 4GYCB 4AILC 1R6NA 5TISZ 1V54C 2DQ0A 4LR3A 4P9OA 1MG1A 2FMLA 2WLJA 4QE7A 4LF9O 3C3SA 3K5OA 4I50B 2YIDA 4W4KA 2HVJC 4X62O 4MVUA 4DR2O 5IYZB 1OCCB 5IYBO 2V4DA 4GKJB 3K03A 2GUZB 1Y6XA 4NB5A 3D3IA 4LNUA 4UV8A 4LH7A 3FB5C 5C8YB 1BHBA 1HNWB 1HNZO 1F4NA 1QNMA 2JIZG 5HFLA 5IE9A 5GTHZ 2QM8A 4TOIA 3GB7C 5CA0A 3CC4V 4E2LA 1QLEB 1WB7A 3CJHA 2HHHO 5CMUA 1YTFD 4IHJB 2OYQA 2YDEA 3LNMB 4UB6Z 2PI4A 1YHQV 1VQLV 1YCIA 3RYHB 3ZJZA 2ZE8A 4X88A 1W0KG 1TVKA 1VF6A 1VARA 4UVCA 4DR5O 1I94B 1YZBA 2JVDA 1B04A 2AHYA 4DV0O 2E5LO 2IJIA 3X2QB 2WSSG 3HKCA 3BCCH 3FX7A 4QE9A 3CX5F 5LP6A 4JZ2A 1I5YA 2YI9A 4ASUG 5LHIA 1N34B 3Q4HB 5IWAB 1ZL8B 3BHPA 2QWRB 1XUQA 1IBLB 4G27B 2A9HA 2XAHA 1WA8A 3JCUZ 3BA8A 4TSFG 4IYIA 2ZE5A 2E3CA 3MHHC 4J7JA 1NKDA 2B9ZA 1OCOC 3VQVA 4WF9V 5B5EZ 1QVFU 1OCCC 3W7UA 5BMVA 4R50A 1KKCA 2AZ2A 3OW2U 1WN7A 4BIZA 1N33B 2JK5C 4O4LA 4MVRA 4JAUA 4PELA 3O65A 3W7XA 2Y4TA 3OR6C 5DN6G 3ABMB 2A7WA 2E75B 1YITV 3ETGA 4JI5B 3FYEB 3ZHUA 4DXWA 1P4RA 4DV2B 3WB2A 4UCSA 3SPHA 2B5UA 1D5AA 2QWOB 4MW8A 2BTQA 1FKAO 3OD4A 3E86A 4DV3B 2PF4E 3VQXA 3ETQA 4JZGA 3QO7A 1JVMA 4OX9B 1IX9A 2KSDA 4O2AA 3CC7V 4K3AA 1RM1B 3QNEA 1M4UA 2ITDC 2JGUA 4WFGA 1R3LC 1GK9A 2Q0AA 3ETDA 5CBHA 3BVOA 1K92A 4LNUB 5B3SC 2N74A 4I7ZB 5BY1A 3OM3B 3E2EA 3FFQA 5CA0B 2Z5UA 1XNRB 4LFAO 3CJHB 5JQGA 4MTFA 3BY6A 1AILA 4H44B 1ZX3A 1F51A 2LP7A 1VQOV 2DYSC 4DW0A 2R70A 5B1BB 1NJIW 2Q67A 1SA0A 2F1MA 1SERA 1ZAUA 1VIBA 1TVKB 2QGNA 1K3EA 3D36C 1XMOO 5LOVA 3HKCB
chains in the Genus database with same CATH topology
1R6TA 4DV1O 5H5NA 4NXNO 4B3TO 3RT3C 4LF9O 4OPHA 1J5EO 2ZM6O 3J7AU 4X66O 3SDLA 4DR7O 1FJGO 1XMQO 4X62O 2DJVA 4AQYO 2Z0AA 3M8AA 3JAMN 3O65A 4JI7O 4DR2O 2ZKOA 1IBLO 1D2DA 1XEQA 4DR4O 4B3RO 2AGAA 4DUYO 4GKJO 4LFBO 1HR0O 1NS1A 2UUBO 1F7YA 3J81N 4DV6O 1HNZO 4JI4O 4DV4O 5IT9N 1FKAO 4B3MO 4DR6O 4YHHO 5BR8O 1N36O 4NXMO 4DV2O 1R1BA 4X64O 2JRIA 4X65O 3T1YO 1N33O 3OTOO 4DV3O 4JI8O 5BXZA 4JI3O 4LF8O 2HHHO 4LF6O 2VQFO 2UXCO 1X59A 1HNXO 1A32A 2DOSA 1IBKO 2UXBO 1XNQO 4B3SO 4JYAO 2VQEO 5LMNO 4LF5O 4GKKO 4JI1O 2N74A 5BY1A 4DR1O 1AB3A 3T1HO 4LFCO 4JI5O 5FLXN 4DR5O 1YZBA 3J80N 4DV5O 4K0KO 1IBMO 4DV0O 2E5LO 1HNWO 4LF7O 2UUCO 4JV5O 5LL6Y 3R66A 1I94O 4JI2O 4LFAO 2LW7A 3F5TA 4DUZO 1AILA 1FYJA 4OX9O 4KHPO 1XNRO 5LMUO 2FKXA 4YY3O 4JI6O 1N34O 4DR3O 5IWAO 1DK1A 2UXDO 4OPAA 1KUQA 4DV7O 5A2QN 1N32O 2UUAO 2UU9O 2F4VO 1XMOO 1G1XB 4LF4O 4A5UB 4JI0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6T A;  4DV1 O;  5H5N A;  4NXN O;  4B3T O;  3RT3 C;  4LF9 O;  4OPH A;  1J5E O;  2ZM6 O;  3J7A U;  4X66 O;  3SDL A;  4DR7 O;  1FJG O;  1XMQ O;  4X62 O;  2DJV A;  4AQY O;  2Z0A A;  3M8A A;  3JAM N;  3O65 A;  4JI7 O;  4DR2 O;  2ZKO A;  1IBL O;  1D2D A;  1XEQ A;  4DR4 O;  4B3R O;  2AGA A;  4DUY O;  4GKJ O;  4LFB O;  1HR0 O;  1NS1 A;  2UUB O;  1F7Y A;  3J81 N;  4DV6 O;  1HNZ O;  4JI4 O;  4DV4 O;  5IT9 N;  1FKA O;  4B3M O;  4DR6 O;  4YHH O;  5BR8 O;  1N36 O;  4NXM O;  4DV2 O;  1R1B A;  4X64 O;  2JRI A;  4X65 O;  3T1Y O;  1N33 O;  3OTO O;  4DV3 O;  4JI8 O;  5BXZ A;  4JI3 O;  4LF8 O;  2HHH O;  4LF6 O;  2VQF O;  2UXC O;  1X59 A;  1HNX O;  1A32 A;  2DOS A;  1IBK O;  2UXB O;  1XNQ O;  4B3S O;  4JYA O;  2VQE O;  5LMN O;  4LF5 O;  4GKK O;  4JI1 O;  2N74 A;  5BY1 A;  4DR1 O;  1AB3 A;  3T1H O;  4LFC O;  4JI5 O;  5FLX N;  4DR5 O;  1YZB A;  3J80 N;  4DV5 O;  4K0K O;  1IBM O;  4DV0 O;  2E5L O;  1HNW O;  4LF7 O;  2UUC O;  4JV5 O;  5LL6 Y;  3R66 A;  1I94 O;  4JI2 O;  4LFA O;  2LW7 A;  3F5T A;  4DUZ O;  1AIL A;  1FYJ A;  4OX9 O;  4KHP O;  1XNR O;  5LMU O;  2FKX A;  4YY3 O;  4JI6 O;  1N34 O;  4DR3 O;  5IWA O;  1DK1 A;  2UXD O;  4OPA A;  1KUQ A;  4DV7 O;  5A2Q N;  1N32 O;  2UUA O;  2UU9 O;  2F4V O;  1XMO O;  1G1X B;  4LF4 O;  4A5U B;  4JI0 O; 
#chains in the Genus database with same CATH topology
 2Y4U A;  1NBM G;  3CRA A;  3U11 A;  4DYL A;  2BSK A;  3E8G A;  5LP6 B;  3RYI A;  1XI1 A;  1J5E O;  2KKW A;  1WLE A;  1BS3 A;  1TUE B;  4LF8 B;  2P4V A;  3FAV A;  5H9C A;  1WA8 B;  1YIJ V;  3JD1 A;  4U7N A;  5LGU A;  4D6T H;  1EBO A;  4HBN A;  3GVM A;  3M7M X;  4J7Z A;  1JQ0 A;  5KHG A;  1NI8 A;  2CGN A;  4FZ0 A;  4JTC B;  4CC6 A;  2CUG A;  4CH4 A;  5B1A B;  3DTU B;  1GH6 A;  5BMV B;  1H8E G;  4I9Q A;  4FLW A;  4O4L B;  2VQF B;  3TK1 A;  4B7E A;  3SJC C;  4MTO A;  3OTO O;  3ZX6 A;  2ZXW B;  4I4T A;  3OGC C;  2QJ1 A;  2AZ0 A;  5IY5 B;  1X59 A;  3ZCC A;  1BT8 A;  4B08 A;  2W0F C;  3I56 V;  4PDL A;  2IH1 C;  3IC9 A;  3K9A A;  4PA6 A;  3CRC A;  1NR1 A;  4LC1 A;  3P3P A;  4Q20 A;  3J80 N;  2XND G;  2BTQ B;  1AVM A;  3IAY A;  1HNW O;  3H01 A;  1Q43 A;  2CH7 A;  2HJD A;  2IU0 A;  3CC2 V;  3CS5 A;  5LL6 Y;  4O2A B;  2X0L A;  5LHG A;  3CWB H;  1VF6 C;  4TQF A;  2EIJ B;  1M93 A;  2UXD B;  4IYH A;  2A3Q A;  4HYO A;  1S5J A;  4JI6 O;  4AHC A;  2UU9 B;  1V55 B;  1DK1 A;  2D3O W;  1R3I C;  2YIB A;  2XHB A;  2QA4 V;  5KX5 A;  1XHX A;  5HFM A;  1VQ9 V;  4J10 A;  4BIU A;  4MVZ A;  1COW G;  5JQG B;  2JS5 A;  1NZ6 A;  1FAF A;  4X62 B;  4PDM A;  1PNK A;  1YJN V;  4DR2 B;  3SJB C;  1OCR B;  2Y0P A;  3OTF A;  1H2K A;  1M57 B;  1SA0 B;  1Q6H A;  1IBL O;  2EIK C;  1XEQ A;  3ZHT A;  1OZ0 A;  2GHY A;  1W59 A;  3AG4 B;  1D5N A;  3CXC U;  4DK0 A;  5LOV B;  3CD6 V;  2DWE C;  5L3C A;  1AI7 A;  4JI4 O;  2BSK B;  1SRY A;  3RYI B;  2R9A A;  2JEU A;  4DR6 O;  3SPG A;  1N36 O;  4DW1 A;  3CRR A;  1R1B A;  2F43 G;  3FAV B;  3T1Y O;  1N33 O;  1RPO A;  3CSX A;  2QKS A;  5KAF Z;  2H3O A;  4CC5 A;  1SET A;  4NKG B;  3RVY A;  2N04 A;  3JAR A;  4B3S O;  4WBN A;  3OMN B;  4N21 A;  1K73 W;  1Q6U A;  4DV0 B;  2E5L B;  1JX9 A;  4ZOL B;  3PJS K;  1Y4M A;  3ASN C;  4JI5 O;  3RBZ A;  1GN2 A;  4N23 A;  3EHB B;  2Q69 A;  2PY5 A;  2EIJ C;  1GAX A;  2UUC O;  4PI0 A;  3AG1 B;  3D3Q A;  4LWS A;  4RAI A;  1EFR G;  3HKD A;  4OX9 O;  4I4T B;  1M56 B;  1PNL A;  2YXL A;  4X1I B;  3JD3 A;  3KCY A;  2GSM B;  3MHS C;  4B3R B;  5KLV H;  3UT5 A;  5B66 Z;  1Y76 B;  1GM8 A;  3NXS A;  5KHJ A;  3CCS V;  1LNQ A;  5KA6 A;  2CH7 B;  3K3W A;  4A5U B;  4DV4 B;  2QE7 G;  5D5Q A;  1M57 C;  3D8C A;  4MTX A;  2ETN A;  2QM4 A;  3AG4 C;  1S5L Z;  1AI5 A;  1KMI Z;  4PJ0 Z;  5KUM A;  2OT5 A;  3E8B A;  3K59 A;  2BOB C;  1MSD A;  1W2B U;  2AGA A;  2CTW A;  5KX5 B;  1MA1 A;  3T1H B;  3K57 A;  3WG7 B;  3OGI B;  5IDJ A;  2R9R B;  1Z5W A;  3EFF K;  2XAJ A;  3FB6 C;  3VQY A;  3JD0 A;  1DLB A;  1BSM A;  2DYR B;  2ZT9 B;  1AJQ A;  5LA6 A;  1V54 B;  2P6J A;  2ZIM A;  1AR1 B;  1PPJ H;  4J11 A;  1UPG A;  3K04 A;  3SYP A;  1GN4 A;  1NVP B;  1JOY A;  5IYD O;  4LF8 O;  1HDJ A;  3UKM A;  1SQB H;  5GON A;  3OFN G;  4CH5 A;  3AG1 C;  4B7K A;  2WA4 A;  1KYO F;  5EIB D;  2JJ1 G;  5EIB C;  2JJ2 G;  1H8H G;  3CCL V;  2YSU B;  3FB7 C;  1M56 C;  2XOK G;  2ODM A;  4QIW F;  3TCU A;  2QTS A;  1URF A;  2A0L A;  1IXB A;  3ZMV A;  3ZHQ A;  2DE0 X;  3CME V;  1PNM A;  2HR3 A;  4CH3 A;  3SJQ C;  2IH3 C;  1BL8 A;  1OCZ C;  3JAR B;  4WBN B;  3HKB A;  3SYC A;  1XMO B;  1H2L A;  4QJF B;  2P7T C;  1AI4 A;  1XQ8 A;  3U0Z A;  4UV9 A;  5GW7 A;  1P84 F;  4JI0 O;  1YF2 A;  4LWS B;  1GMG A;  4H0L B;  2YIB D;  1P7G A;  5H5N A;  3HKD B;  4GZR B;  1FPO A;  3D36 A;  3BAB A;  4JAS A;  3RT3 C;  2HP8 A;  3W7T A;  4BIO A;  1JJ2 U;  2FYU H;  2ZM6 O;  4BWA A;  3E8H A;  3CP1 A;  4ZI7 A;  4HNA A;  5EBM C;  2AW9 A;  3UT5 B;  2W6I G;  1K34 A;  3HKE A;  4NR1 A;  3SPJ A;  4DK1 A;  2Q7E A;  5L3D A;  3VBB A;  5IYC O;  1NVP D;  1F7Y A;  2X6B A;  1JJO A;  1GO3 F;  1SF9 A;  5IT9 N;  3IGA C;  2KB1 A;  3TXQ A;  1V9P A;  3OTO B;  4JI2 B;  1SQX H;  2LQT A;  1OCO B;  3JYC A;  1K4C C;  5E1A C;  2Q0O C;  1CP9 A;  1S3J A;  1I0H A;  1YJ9 V;  2VWJ A;  1FFT B;  3AG3 B;  4ABM A;  4CS3 A;  1THZ A;  1FS0 G;  2AXT Z;  2HJF C;  5ITZ A;  2ATK C;  2PYL A;  5LA6 B;  1VQK V;  3H1L H;  4EB6 A;  1XRE A;  1YEW A;  4MTG A;  4JI6 B;  2LFS A;  2FKX A;  3MDS A;  3RW0 A;  5L3E A;  4JGS A;  1QR8 A;  5GON B;  1N8R W;  1EZJ A;  3A2F A;  2EIN B;  4D7S A;  2P06 A;  1UFI A;  4JTA B;  5K1X A;  2WLK A;  3OMA B;  1QLN A;  3CCJ V;  2C2A A;  5B3S B;  2Q68 A;  4UCT A;  3P30 A;  1SQV H;  3DGE A;  1R6T A;  2ZD9 A;  4NXN O;  2GDS A;  4Q6G A;  1DF5 A;  1K5S A;  1KB9 F;  3M8A A;  3HR0 A;  5JJJ B;  3HKB B;  1D2D A;  1DTO A;  4B3R O;  2HFE C;  3RVZ A;  1WPB A;  4KP4 A;  4GKK B;  2DYS B;  3E83 A;  1JPX A;  3TET A;  5LHH A;  2XT9 A;  4JI4 B;  2L35 A;  4GX0 A;  3FD9 A;  3LNN A;  2LFR A;  4DR6 B;  1N36 B;  1IBM B;  3F7Y C;  1CXZ B;  4J7K A;  3CB2 A;  2EJ7 A;  3SPC A;  4DV4 O;  4OXS A;  3T1Y B;  4NXM O;  1RPR A;  5B1O A;  1NH2 B;  3AG3 C;  4X64 O;  3N2K A;  2EZO A;  3K06 A;  4ZI7 B;  1BGY H;  4HNA B;  4JI8 O;  1G6U A;  2XTA A;  2YIC A;  4B3S B;  3QO8 A;  5JVD A;  2OCC B;  2RJZ A;  2OIG A;  3HKE B;  3LSS A;  3KG2 A;  3JAK A;  3B8N A;  4IIJ A;  4ICG A;  2N05 A;  1GTO A;  1AB3 A;  3T1H O;  2UUC B;  2D2C B;  3APQ A;  2JS3 A;  4D7T A;  3A8T A;  1BE3 H;  3ASO C;  2RCV A;  3U10 A;  5L3B A;  3AK2 A;  2P67 A;  3H1I H;  4UB8 Z;  3ZN0 A;  2EIN C;  1HWY A;  3OMI B;  4DUZ O;  1M5I A;  1FXH A;  4MT8 A;  5KHK A;  3ZMT A;  4I55 B;  1KU9 A;  3CCR V;  2XAG A;  1L8D A;  1I5X A;  3LSU A;  5ITZ B;  3UCS C;  1I08 A;  3BRC A;  3CHX A;  2UUB B;  1K97 A;  2P4K A;  2NNU A;  4YIP A;  4EB6 B;  4FLX A;  1SQG A;  4FLT A;  2QWP B;  2WLH A;  4O4H A;  4PA4 A;  4FLU A;  4FJC C;  5LGT A;  1L0N H;  2W0X A;  4FMT A;  4YIO A;  1J95 A;  1O9H A;  3CE2 A;  4LH6 A;  2KQX A;  5FNV A;  1B06 A;  4JPR A;  4GT1 A;  5BZB A;  3E8F A;  1HNX B;  1SQF A;  1GKF A;  3I55 V;  3WB0 A;  4TV8 A;  2Q6A A;  1R6K A;  1NH2 D;  1DGS A;  1SZX A;  4UUJ C;  2CTQ A;  1ROP A;  5CA1 A;  1VQ7 V;  2OWO A;  2OCC C;  3R65 A;  3LDE A;  3B8M A;  1XL4 A;  1VQ6 V;  4Z1V A;  4X65 O;  4ZKI A;  5BXZ A;  4G28 B;  1ZLZ A;  3AK3 A;  2YUA A;  3L70 H;  4O2B A;  5FPR A;  2GTA A;  4ZOL A;  2EIK B;  3K5N A;  1NR7 A;  4PD4 F;  1W0J G;  1N4C A;  2CK3 G;  2ZR2 A;  4GX2 A;  4MS2 A;  4FLZ A;  2BE3 A;  3STL C;  3UO3 A;  3N2K B;  3E35 A;  2FTK A;  4JI2 O;  3ZBH A;  3AEI A;  3IC7 A;  1H38 A;  3RYF A;  3AG7 A;  2QWN B;  4X1I A;  2ZIO A;  1RSO A;  5JVD B;  4F6E A;  4XDL A;  4BW5 A;  5JH7 A;  2W6J G;  3FB8 C;  2LO1 A;  2B1G A;  3E22 A;  3JAK B;  1CPY A;  2HEP A;  4FIP C;  1KD1 W;  4IIJ B;  3T4D A;  1Y76 A;  1IUR A;  1MZF A;  2HG5 C;  4WFB V;  4JI0 B;  2IM9 A;  5A2Q N;  3DC6 A;  4H37 A;  1PD3 A;  2Q9L A;  2F4V O;  5GTI Z;  4KUM A;  3ZRS A;  4C7U A;  3ASN B;  3N2G A;  4NTX A;  5LBQ A;  2ZM6 B;  1MAB G;  1PP9 H;  4P30 A;  4X20 A;  4K8X A;  4ZIB A;  2ARH A;  2ZE6 A;  3SDL A;  2IJH A;  3RWR D;  1QHT A;  3ABU A;  1QR9 A;  3FKS G;  1NU1 H;  1VF5 B;  2VQE B;  3DXR A;  2EIL C;  1UJW B;  4JI1 B;  3I5D A;  5J2T A;  2QSA A;  4TUY A;  4LFB O;  1MNG A;  4MVQ A;  5KAI Z;  4Z1M G;  1EZV H;  4O4H B;  2F95 B;  3GWK C;  4YHH O;  4FK5 C;  1CEZ A;  4Z2W A;  5FNV B;  1BQ0 A;  5F2V O;  3BPZ A;  2IJJ A;  3OEE G;  4EFB A;  5KHH A;  3ZHV A;  5L3F A;  3CYO A;  4LF6 O;  2V7Q G;  1AP5 A;  4JAV A;  4RUE A;  2YIA A;  4TV8 B;  2UXB O;  4X1Y A;  3P3N A;  4FPP A;  3K58 A;  4LF5 O;  4GKK O;  4WFE A;  5LYJ A;  3SYA A;  5CA1 B;  1PL0 A;  3ZRW B;  2UUA B;  3G6E V;  5FLX N;  4X9Q A;  2E74 B;  2V1D A;  3W7W A;  2ZCE A;  1IBM O;  4R8C A;  4NTW A;  2QM7 A;  1XOU A;  2LW7 A;  2H8P C;  1IDS A;  1FYJ A;  1YSC A;  2EIM B;  3OR7 C;  3EVK A;  2WLL A;  2LGQ A;  2PUS A;  1X4T A;  4FVM A;  1PV0 A;  3QF7 A;  4O2B B;  3QVN A;  4YY3 O;  4WFA V;  1Y74 A;  3UO2 A;  3JAT A;  1HR0 B;  3ZMZ A;  1N32 O;  3QG5 A;  3L71 H;  3BA9 A;  4KFM A;  3SYO A;  4NXN B;  2K9P A;  1U96 A;  2F66 C;  1KP3 A;  4L8J A;  3RYF B;  2HVK C;  2R72 A;  1RFY A;  2OTJ V;  1RSO B;  3T4Z A;  5JH7 B;  2RQ6 A;  4BAY A;  1B6Q A;  4LP8 A;  1SKV A;  2RNB A;  3T1C A;  3E22 B;  3JAM N;  1XBL A;  1Q3E A;  4JYA B;  1OCZ B;  4BR6 A;  4F6R A;  3UQ8 A;  5DM6 V;  2CTR A;  3ZRX A;  4O4I B;  4UCU A;  2UUB O;  4NXM B;  3N2G B;  4NTY A;  4X64 B;  3J81 N;  2P5O A;  1FXK C;  1JA8 A;  4X20 B;  4JI8 B;  2Y48 A;  5EK0 A;  1YVW A;  1KEC A;  4MW3 A;  3STZ C;  1WNS A;  4TV9 A;  2IW5 A;  4KHP B;  1SC5 B;  2A06 H;  4R7C A;  4UVB A;  5LMU B;  2QWQ B;  4BW9 A;  3DXR B;  1HNX O;  2DOS A;  5J2T B;  1IBK O;  4TUY B;  1GM9 A;  4FLV A;  2WAM A;  1NTK H;  1S5H C;  3C3T A;  2RMK B;  2PTM A;  1K5Q A;  2ILM A;  4L87 A;  1FXV A;  2EIM C;  4LF7 O;  4DUZ B;  1VMG A;  4NYK A;  3G4S V;  1PKX A;  1P49 A;  2DMX A;  4QGP A;  3F5T A;  2WPD G;  1H2G A;  3GWO A;  4JI7 B;  3FYI B;  1AP6 A;  4X1Y B;  5LYJ B;  5EBL C;  1H2M A;  1US6 A;  2WLN A;  5LGN A;  4GLX A;  4JAA A;  1YJW V;  2WWW A;  3WB1 A;  3K9S A;  1L0L H;  2YEV A;  5EZY A;  2GV9 A;  2DWD C;  3SYQ A;  2WLL B;  2LGW A;  4JYC A;  3JAW A;  1FJG O;  1PM9 A;  2ZKO A;  1Y74 B;  1S72 V;  1JFF A;  3B40 A;  5LMN B;  3JAT B;  3AG2 C;  4JYB A;  4DUY O;  3L72 H;  1S77 D;  1ENV A;  4K0K B;  3ML0 A;  1LUW A;  4JV5 B;  2KG7 A;  4X65 B;  3L73 H;  1M1K W;  5C93 A;  1YTF B;  4U3J A;  1YXB A;  4GCZ A;  3A0B Z;  1AR5 A;  5IJ9 A;  2CE4 A;  3ABK B;  1A32 A;  4F6R B;  1Q6I A;  1HW7 A;  4JYY A;  3K5M A;  3BEH A;  2VQE O;  3ABL B;  4JI1 O;  1P7B A;  3CRQ A;  3B2E E;  4E4E A;  1ZTE A;  2EUL A;  4DV5 O;  3OUF A;  2Y69 B;  5LXT A;  3K79 A;  2QTO A;  4TV9 B;  4B3T B;  1R3K C;  4R6Z A;  2Y0I A;  4X66 B;  3L74 H;  3SR2 C;  4PHZ A;  1XMQ B;  2ZNI A;  2OTL V;  2IBZ H;  4AQY B;  4I55 A;  5H6Q A;  3CCE V;  2X6C A;  2F4V B;  2M6Y A;  4AI8 A;  4CBC A;  1TA8 A;  3DSQ A;  3VQW A;  2UUA O;  2EX3 A;  2F23 A;  3ZS8 C;  3ZHR A;  1VQ4 V;  2QEX V;  3B4S A;  2XAF A;  1Q90 D;  4MSW C;  4WCE V;  4TT3 G;  1TUB A;  2DQ3 A;  1RP3 B;  3CMA V;  2ITC C;  3ASO B;  4OPH A;  3JAL A;  1WP8 A;  4HZ3 A;  4IT5 A;  4JI3 B;  3KCX A;  4I9W A;  4LFB B;  3CCU V;  4PI2 A;  1BQZ A;  4RQF A;  1VQN V;  3CCV V;  5AG2 A;  3K5L A;  4KL1 A;  2FL4 A;  5EC2 C;  1HR0 O;  4LFC B;  4JF3 A;  3EXA A;  4YHH B;  1IVS A;  2OIE A;  4DV6 O;  2YEV B;  3C90 A;  5EZY B;  1SS3 A;  2ZQM A;  2LW1 A;  3ABK C;  5BR8 O;  3H1H H;  3W7S A;  3JAW B;  4LF6 B;  3ABL C;  3G6B A;  5EYP A;  1Q8I A;  2UXB B;  5KUK A;  3RFR A;  4LF5 B;  2QKC A;  1JFF B;  2XUM A;  2UXC O;  2VRZ A;  5FPO A;  3B77 A;  2E76 B;  2Y69 C;  4JYA O;  2NN4 A;  2MK3 A;  1T5E A;  3SJA C;  3K08 A;  2ZDI C;  4MVM A;  5A9G A;  1VQ8 V;  2LJ2 A;  2CDY A;  2KG7 B;  5J2U A;  3ICX A;  2Z3Y A;  2OCH A;  2RDC A;  4U3J B;  3ZHS A;  3TJT A;  4DV1 B;  1Q81 W;  4U3F H;  3R66 A;  4UCO A;  5EBW C;  2O57 A;  5IJ9 B;  4YY3 B;  2ZR3 A;  4KHP O;  5LMU O;  2DN9 A;  4I0X B;  3O9O A;  4OGQ B;  1N32 B;  4DR3 O;  2CAZ C;  2BOC C;  1PL4 A;  2WLI A;  2XAQ A;  3LUT B;  4J80 A;  2ZE7 A;  5JCO A;  4DO2 A;  3CRM A;  3UM7 A;  3MAQ A;  3JCZ A;  5LXT B;  2K1E A;  3CPW U;  4B3M B;  4P9P A;  1QLE C;  1Q82 W;  1N0J A;  1ZUQ A;  2MW2 B;  4FM0 A;  3JAS A;  1XL6 A;  4DR7 O;  4FZ1 A;  1KKD A;  1KP2 A;  1NTZ H;  4JI7 O;  1IZ3 A;  4GUN A;  1QBZ A;  4EKW A;  2EZP A;  2VWK A;  2ZIN A;  3SPI A;  2HLD G;  1DF4 A;  4U7O A;  1QU7 A;  2NR5 A;  2G38 A;  5CN0 A;  3X2Q C;  3CEI A;  1E1Q G;  1ARO P;  5B1N A;  2EBO A;  1TUB B;  4XDK A;  3JAL B;  4YJ2 A;  1Q5O A;  3F7V C;  2QKA A;  1LR1 A;  2JRI A;  1FXK A;  2PYJ A;  1IBK B;  2X6A A;  4J41 A;  4IGG A;  3HB3 B;  1XNQ O;  4WFF A;  5LMN O;  4ZBM A;  1BZK A;  1E1R G;  3ZIA G;  4G2K A;  3ZRW A;  4DR1 O;  4LF7 B;  1K9M W;  2EIL B;  1FD9 A;  4K0K O;  1F23 A;  1Z2G A;  3WFV A;  4JV5 O;  1ZWI C;  3JD2 A;  2Q5Z A;  4X1K A;  4RO2 A;  5EYP B;  1B3Q A;  1WB8 A;  4XDJ A;  1SES A;  4EFE A;  1GRJ A;  5DED A;  3ABM C;  3LSQ A;  2CGO A;  4WFH A;  1FFX A;  3QTC A;  4DR4 B;  2ADP A;  4OPA A;  4GX5 A;  2BTO A;  4J9Y B;  5J2U B;  2JEX A;  1AI6 A;  4LF4 O;  1TAE A;  2DW4 A;  1NQT A;  2XAS A;  1FJG B;  3ZMS A;  1AJN A;  1RM1 C;  4B3T O;  4TWK A;  4HAM A;  3J7A U;  1MSW D;  3TXS A;  4X66 O;  5KA5 A;  2GBO A;  1XMQ O;  3OT7 A;  2DJV A;  3IJ4 A;  4AQY O;  1TGO A;  4DUY B;  1AJP A;  3G67 A;  4FFB A;  2Q8V A;  2WLI B;  1IXM A;  3N27 A;  4F4L A;  1S76 D;  1M9N A;  4O4I A;  2BCC H;  1N0N A;  4XBF A;  4GKJ O;  1NS1 A;  1ZSP A;  3L9D A;  4K35 A;  3DC5 A;  3ZMU A;  3THO A;  1MMM A;  2Q7G A;  3JAS B;  4PV1 B;  3K0G A;  4QPJ A;  1KC8 W;  1XDC A;  5CBF A;  5B1B C;  4JI3 O;  2YXH A;  5DEC A;  1QQC A;  4PA3 A;  4MVS A;  2YS8 A;  4QPK A;  1QVG U;  4PA9 A;  1WAZ A;  1WP7 A;  4DV5 B;  2WLM A;  3ZED A;  4DV7 B;  4UVA A;  2NLJ C;  4LFC O;  1H2N A;  1K7D A;  2JDI G;  3T2M A;  3CCM V;  5LP6 C;  4YJ2 B;  1GN3 A;  2Q73 A;  1I94 O;  4J9Z B;  1SZT A;  3OEH G;  4LF9 B;  1FXK B;  2FB5 A;  4JTD B;  3F5W C;  1VQM V;  1EM1 A;  2IU3 A;  3G71 V;  3ABT A;  4H33 A;  3RYC A;  1JR9 A;  2P22 C;  3JD4 A;  3ZN1 A;  1N34 O;  3H1K H;  3JSL A;  5IWA O;  2PGG A;  2GTS A;  5IJ0 A;  1S0V A;  4KXR A;  3S3W A;  1NT2 B;  3A0R A;  5B1A C;  4PA7 A;  3L75 H;  1G1X B;  4YJ3 A;  4UCR A;  2RN9 A;  4X8A A;  1HNZ B;  4X1K B;  1L1F A;  4RUF A;  3MD0 A;  4FM1 A;  4DV1 O;  4O4J A;  2YXY A;  4RWU A;  2ZXW C;  5JCO C;  5IY5 C;  1VF7 A;  3CXH F;  2HHH B;  3IFX A;  1MZE A;  2Z0A A;  1OHH G;  1GM7 A;  5JWP A;  1H2S B;  1FFX B;  4K8Z A;  4FM2 A;  2JGD A;  1AR4 A;  4PDR A;  2X7R B;  1NTM H;  3E89 A;  3AK1 A;  4I5S A;  3P32 A;  4DV6 B;  2ADQ B;  3BFR A;  3OUS A;  3LDD A;  4DR5 B;  5BR8 B;  4LCU C;  2F93 B;  5J9P C;  3RN4 A;  1G4Y B;  4B3M O;  3WU2 Z;  5CB4 A;  5KMG A;  4PDV A;  3RGB A;  1U97 A;  4DV2 O;  3NR7 A;  4FFK A;  2M7W A;  4H13 B;  2UXC B;  2QDO A;  3JSN A;  1KQS U;  4DV3 O;  1XIL A;  3CCQ V;  1Q7Y W;  3SGI A;  4FFB B;  1Y66 A;  1V55 C;  1Z5V A;  1BCC H;  4CH6 A;  3LDC A;  4X89 A;  2WA3 A;  4UCV A;  2UXX A;  4EEQ A;  5H6R A;  4DRX A;  1K4D C;  1K8A W;  1JMK C;  3BAA A;  3AG2 B;  1EN4 A;  3G80 A;  4ZHQ A;  1GN6 A;  2ZDI A;  1OCR C;  4GX1 A;  4J42 A;  5E79 Z;  1Q86 W;  1K33 A;  3QO5 A;  1OV9 A;  3TGU H;  1HP8 A;  1XNR O;  5KHI A;  2H94 A;  3VOU A;  4DR3 B;  4I50 A;  5IYZ A;  3OE7 G;  4W4L A;  5JJN B;  2HKO A;  2B1I A;  1G8M A;  2GUZ A;  4YXW G;  2VS0 A;  3HPL C;  1VQP V;  1Y67 A;  5L3G A;  4UFZ A;  2AHZ A;  3KZI Z;  4DR7 B;  3H1J H;  5C8Y A;  2Q7H A;  1BHA A;  4RQE A;  5D5P A;  2Q4P A;  3ETE A;  5JJE B;  1R3J C;  1WPX A;  4TQD A;  4FLY A;  3RYC B;  1O9G A;  1BMF G;  5IJ0 B;  4CS4 A;  4DR4 O;  4IHJ A;  1VP7 A;  2R9I A;  4CZZ A;  4YJ3 B;  4QNH B;  2YI8 A;  3RYH A;  2CTP A;  1SQQ H;  2QR4 A;  4P2Z A;  4O4J B;  5FL7 G;  1LUV A;  1SQP H;  4LFA B;  1KBH A;  4MVO A;  4IL6 Z;  1ORQ C;  4LBE C;  1XNQ B;  1EN5 A;  3PN1 A;  2JGD B;  2VQF O;  3B09 A;  3Q4H A;  2PI5 A;  1R73 A;  1ZL8 A;  4DR1 B;  1YDX A;  1OJH A;  3H9V A;  1MOF A;  1YI2 V;  1E79 G;  3ZRV A;  1M90 W;  2ZNJ A;  3OAA G;  3KKY A;  3K0D A;  5H2F Z;  3M99 B;  2PZS A;  1I7F A;  2A79 B;  4CS2 A;  5CB4 B;  5KMG B;  3APO A;  2P90 A;  1JCH A;  5CBG A;  1J5E B;  2UXN A;  2IJK A;  1WJZ A;  4NVP A;  5EC1 C;  4I0X A;  1XHZ A;  1VQ5 V;  4DRX B;  2YC0 A;  3WG7 C;  4LF4 B;  2UXD O;  1EN6 A;  3S3X A;  5K1P A;  1VEW A;  1KUQ A;  2L6L A;  3A0H Z;  4DV7 O;  2DYR C;  2EJR A;  1F4M A;  4ZHQ B;  1QCE A;  2UU9 O;  4UXN A;  5CA3 A;  4GYC B;  4AIL C;  1R6N A;  5TIS Z;  1V54 C;  2DQ0 A;  4LR3 A;  4P9O A;  1MG1 A;  2FML A;  2WLJ A;  4QE7 A;  4LF9 O;  3C3S A;  3K5O A;  4I50 B;  2YID A;  4W4K A;  2HVJ C;  4X62 O;  4MVU A;  4DR2 O;  5IYZ B;  1OCC B;  5IYB O;  2V4D A;  4GKJ B;  3K03 A;  2GUZ B;  1Y6X A;  4NB5 A;  3D3I A;  4LNU A;  4UV8 A;  4LH7 A;  3FB5 C;  5C8Y B;  1BHB A;  1HNW B;  1HNZ O;  1F4N A;  1QNM A;  2JIZ G;  5HFL A;  5IE9 A;  5GTH Z;  2QM8 A;  4TOI A;  3GB7 C;  5CA0 A;  3CC4 V;  4E2L A;  1QLE B;  1WB7 A;  3CJH A;  2HHH O;  5CMU A;  1YTF D;  4IHJ B;  2OYQ A;  2YDE A;  3LNM B;  4UB6 Z;  2PI4 A;  1YHQ V;  1VQL V;  1YCI A;  3RYH B;  3ZJZ A;  2ZE8 A;  4X88 A;  1W0K G;  1TVK A;  1VF6 A;  1VAR A;  4UVC A;  4DR5 O;  1I94 B;  1YZB A;  2JVD A;  1B04 A;  2AHY A;  4DV0 O;  2E5L O;  2IJI A;  3X2Q B;  2WSS G;  3HKC A;  3BCC H;  3FX7 A;  4QE9 A;  3CX5 F;  5LP6 A;  4JZ2 A;  1I5Y A;  2YI9 A;  4ASU G;  5LHI A;  1N34 B;  3Q4H B;  5IWA B;  1ZL8 B;  3BHP A;  2QWR B;  1XUQ A;  1IBL B;  4G27 B;  2A9H A;  2XAH A;  1WA8 A;  3JCU Z;  3BA8 A;  4TSF G;  4IYI A;  2ZE5 A;  2E3C A;  3MHH C;  4J7J A;  1NKD A;  2B9Z A;  1OCO C;  3VQV A;  4WF9 V;  5B5E Z;  1QVF U;  1OCC C;  3W7U A;  5BMV A;  4R50 A;  1KKC A;  2AZ2 A;  3OW2 U;  1WN7 A;  4BIZ A;  1N33 B;  2JK5 C;  4O4L A;  4MVR A;  4JAU A;  4PEL A;  3O65 A;  3W7X A;  2Y4T A;  3OR6 C;  5DN6 G;  3ABM B;  2A7W A;  2E75 B;  1YIT V;  3ETG A;  4JI5 B;  3FYE B;  3ZHU A;  4DXW A;  1P4R A;  4DV2 B;  3WB2 A;  4UCS A;  3SPH A;  2B5U A;  1D5A A;  2QWO B;  4MW8 A;  2BTQ A;  1FKA O;  3OD4 A;  3E86 A;  4DV3 B;  2PF4 E;  3VQX A;  3ETQ A;  4JZG A;  3QO7 A;  1JVM A;  4OX9 B;  1IX9 A;  2KSD A;  4O2A A;  3CC7 V;  4K3A A;  1RM1 B;  3QNE A;  1M4U A;  2ITD C;  2JGU A;  4WFG A;  1R3L C;  1GK9 A;  2Q0A A;  3ETD A;  5CBH A;  3BVO A;  1K92 A;  4LNU B;  5B3S C;  2N74 A;  4I7Z B;  5BY1 A;  3OM3 B;  3E2E A;  3FFQ A;  5CA0 B;  2Z5U A;  1XNR B;  4LFA O;  3CJH B;  5JQG A;  4MTF A;  3BY6 A;  1AIL A;  4H44 B;  1ZX3 A;  1F51 A;  2LP7 A;  1VQO V;  2DYS C;  4DW0 A;  2R70 A;  5B1B B;  1NJI W;  2Q67 A;  1SA0 A;  2F1M A;  1SER A;  1ZAU A;  1VIB A;  1TVK B;  2QGN A;  1K3E A;  3D36 C;  1XMO O;  5LOV A;  3HKC B; 
#chains in the Genus database with same CATH homology
 1R6T A;  4DV1 O;  5H5N A;  4NXN O;  4B3T O;  3RT3 C;  4LF9 O;  4OPH A;  1J5E O;  2ZM6 O;  3J7A U;  4X66 O;  3SDL A;  4DR7 O;  1FJG O;  1XMQ O;  4X62 O;  2DJV A;  4AQY O;  2Z0A A;  3M8A A;  3JAM N;  3O65 A;  4JI7 O;  4DR2 O;  2ZKO A;  1IBL O;  1D2D A;  1XEQ A;  4DR4 O;  4B3R O;  2AGA A;  4DUY O;  4GKJ O;  4LFB O;  1HR0 O;  1NS1 A;  2UUB O;  1F7Y A;  3J81 N;  4DV6 O;  1HNZ O;  4JI4 O;  4DV4 O;  5IT9 N;  1FKA O;  4B3M O;  4DR6 O;  4YHH O;  5BR8 O;  1N36 O;  4NXM O;  4DV2 O;  1R1B A;  4X64 O;  2JRI A;  4X65 O;  3T1Y O;  1N33 O;  3OTO O;  4DV3 O;  4JI8 O;  5BXZ A;  4JI3 O;  4LF8 O;  2HHH O;  4LF6 O;  2VQF O;  2UXC O;  1X59 A;  1HNX O;  1A32 A;  2DOS A;  1IBK O;  2UXB O;  1XNQ O;  4B3S O;  4JYA O;  2VQE O;  5LMN O;  4LF5 O;  4GKK O;  4JI1 O;  2N74 A;  5BY1 A;  4DR1 O;  1AB3 A;  3T1H O;  4LFC O;  4JI5 O;  5FLX N;  4DR5 O;  1YZB A;  3J80 N;  4DV5 O;  4K0K O;  1IBM O;  4DV0 O;  2E5L O;  1HNW O;  4LF7 O;  2UUC O;  4JV5 O;  5LL6 Y;  3R66 A;  1I94 O;  4JI2 O;  4LFA O;  2LW7 A;  3F5T A;  4DUZ O;  1AIL A;  1FYJ A;  4OX9 O;  4KHP O;  1XNR O;  5LMU O;  2FKX A;  4YY3 O;  4JI6 O;  1N34 O;  4DR3 O;  5IWA O;  1DK1 A;  2UXD O;  4OPA A;  1KUQ A;  4DV7 O;  5A2Q N;  1N32 O;  2UUA O;  2UU9 O;  2F4V O;  1XMO O;  1G1X B;  4LF4 O;  4A5U B;  4JI0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...