1XNRO

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
molecule tags Ribosome
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xnrO00
4JI1O 4B3MO 2ZKOA 2VQFO 4AQYO 4DV1O 1IBLO 2UU9O 3T1HO 4LF5O 4GKKO 5IWAO 4A5UB 4DV7O 1AB3A 4B3TO 4NXMO 1HNXO 4DV6O 1HNWO 1KUQA 4KHPO 1FJGO 4YY3O 4JV5O 4DV0O 1FKAO 1XMOO 4DV3O 2LW7A 2Z0AA 2AGAA 4JI2O 4LF8O 5BY1A 3J81N 2N74A 4LFAO 4X65O 4OPHA 4OX9O 1XEQA 1A32A 5BR8O 4JI0O 1R6TA 4OPAA 4LF6O 4DUYO 5LMNO 4JI4O 4DR6O 1IBKO 1DK1A 1N36O 1YZBA 4K0KO 4JI3O 2DJVA 1I94O 5BXZA 1D2DA 5H5NA 4X64O 3R66A 4LFBO 4YHHO 2DOSA 1F7YA 4DR2O 3JAMN 5LL6Y 3SDLA 5FLXN 2UXCO 4X62O 3F5TA 4B3RO 1IBMO 1R1BA 1N32O 1N33O 2UUAO 1XMQO 1G1XB 5LMUO 4LF7O 4JI6O 4DR7O 4LFCO 1N34O 2UXDO 2F4VO 1X59A 1AILA 4DUZO 4LF4O 4B3SO 4NXNO 4DV2O 3O65A 4JI5O 4JYAO 4DR1O 2UUBO 3M8AA 3J7AU 4DR4O 4JI7O 4DV4O 1FYJA 2FKXA 3T1YO 1J5EO 3OTOO 1XNRO 1HR0O 5A2QN 4GKJO 4DR5O 2ZM6O 2UUCO 4JI8O 2HHHO 2VQEO 4DV5O 5IT9N 3RT3C 3J80N 4LF9O 4DR3O 1XNQO 1HNZO 1NS1A 2JRIA 4X66O 2E5LO 2UXBO
chains in the Genus database with same CATH superfamily
1XL4A 2IJHA 4WFFA 4MS2A 5CN0A 4KFMA 1IBLO 1Z5VA 1TA8A 4FZ1A 2EIKB 4AQYB 3L70H 3FAVB 3K5LA 1ZX3A 1S77D 4FLZA 2EIKC 1ORQC 3CXCU 1W59A 1K34A 2LW7A 2QR4A 2AGAA 1OHHG 4UXNA 5IY5B 4I0XB 4CC5A 2OYQA 2YS8A 3ZHVA 4O2AB 2AXTZ 1R6TA 2BSKA 1YJ9V 2V4DA 4O4IB 1N36O 4DR7B 2DJVA 2Y4TA 3JD2A 5FNVB 2IU3A 5B66Z 5JH7B 2IBZH 3SDLA 5DEDA 1R6NA 4G28B 1Q6IA 2EILB 2DYSC 4DO2A 5GW7A 3CCRV 3RYFA 1IBMO 1JMKC 4YJ2A 4DK0A 2RN9A 4MTOA 4AI8A 4UCOA 3A0BZ 4LF7O 2WAMA 2CTPA 1AVMA 1Q6UA 1RSOB 5D5PA 2ITCC 1V54B 2PI4A 3CRQA 3BEHA 5B3SC 1NTZH 2ILMA 4O4HB 1FYJA 2JJ1G 3E2EA 2QWQB 1WA8B 1PL4A 1NR7A 1UFIA 1BZKA 2ITDC 1EBOA 4KXRA 3K0GA 1B06A 4MW8A 4B3RB 3SJQC 4LBEC 4I4TA 2F95B 1YIJV 4P9PA 2A3QA 3OUFA 2P90A 4TV8A 3L71H 1FD9A 1QR8A 3T1HO 4IT5A 1AP5A 3WG7B 4DV7O 4L87A 2ZD9A 3AG1C 3HKBB 4NXMO 4H37A 1QLEB 3K59A 1OCOC 4RUEA 3G80A 1SESA 1WA8A 5E1AC 4DK1A 4JI1B 1NTKH 1OCOB 4J41A 3ZIAG 1NI8A 2XASA 1IBKB 3FB7C 1HW7A 4FFKA 2B9ZA 4JI0O 4WBNA 2ZT9B 1GN4A 4JI2B 4JZ2A 3E89A 3M99B 4F6RA 4FM0A 2IW5A 2Z3YA 3HKBA 1LUVA 1S72V 4DW1A 1T5EA 3LSQA 4YXWG 1JA8A 2BTQB 1Y6XA 2PTMA 2L35A 1YI2V 2V1DA 4B3RO 2XAQA 4GCZA 3UM7A 1ZLZA 5KHKA 3OW2U 4O4LB 1K5SA 1VIBA 4UCRA 3MHSC 1GMGA 1SRYA 2EZPA 4J7KA 5LHHA 3CJHA 4JI6B 1QNMA 1VQOV 3ETDA 2P06A 3FYEB 3ZHSA 4IL6Z 4G2KA 3SPJA 4LF7B 4X20A 1VQ9V 2GSMB 2VQEO 5D5QA 5CB4A 1TUBA 3LNNA 4DV5O 3T4DA 2LW1A 3G71V 2A06H 3HB3B 2IH1C 4E2LA 1KP3A 3CCSV 3OT7A 3FKSG 5L3CA 5H6RA 3HPLC 4IGGA 4H13B 4H44B 4TV9A 2ADQB 5IWAO 3FB6C 4UB6Z 4DUYB 3RYIA 2Y0PA 3N27A 5LGUA 1L0LH 2DN9A 3K06A 1F4MA 1FFXB 5EC1C 4IYIA 1KD1W 3JAWA 3IJ4A 3K9AA 4LFAO 3P32A 5J9PC 3THOA 1IZ3A 3VQVA 4NB5A 1MMMA 4KP4A 3GB7C 2QSAA 2B5UA 3K0DA 1WJZA 2DE0X 4K0KB 5H5NA 1DF4A 1OZ0A 4YHHO 3RYIB 2UXCO 2KG7A 4YHHB 4X62O 2QWOB 1H2NA 4FMTA 2JVDA 4R7CA 1P7BA 4MTFA 3CC2V 3OTFA 1NVPB 4MTGA 1K7DA 2JJ2G 1E1RG 4JF3A 2PYLA 2GTSA 1B3QA 4DUZO 3UT5B 3QNEA 4LC1A 4DV2O 2VWJA 1QVFU 4E4EA 4I55A 4JI5O 5JQGB 2ZIOA 3SPHA 1VQPV 4QPKA 2CUGA 4ZI7B 3LNMB 4WF9V 5FNVA 1XDCA 4UV9A 4TV8B 1YCIA 1D5NA 2UUCO 4NXMB 1VF7A 1XMOB 3Q4HA 1MSWD 1XQ8A 3QO8A 1ZL8B 3CWBH 4B7KA 1KKCA 1CEZA 3ABMC 3T2MA 2R9IA 1AR1B 1XMQB 1RPRA 3O9OA 2UU9O 1KECA 2Q8VA 4I9QA 3RWRD 1PKXA 4J80A 3B4SA 4GKKO 3QG5A 3UT5A 5JQGA 1MOFA 4DV6O 2VWKA 4X1IA 4LWSA 4N23A 2DQ3A 1N33B 2CK3G 1YF2A 1EN6A 5L3FA 1YJNV 4LH6A 1R3KC 4DV3B 1BT8A 4HZ3A 1K9MW 3BFRA 1SQFA 4LNUA 1F4NA 5L3BA 1GM9A 1WB8A 4LFBB 3CE2A 1V9PA 2PF4E 4OPAA 4LF6O 4DUYO 2G38A 1RM1B 4X1YA 3QO7A 3G67A 4JI3O 3FFQA 1Y67A 1HDJA 3CCEV 1NJIW 4O4JA 4K8XA 1MNGA 1VQMV 3CMAV 1AROP 4LFCB 4DR1B 1WLEA 1XBLA 1ZSPA 4NTWA 1YVWA 2ZDIA 1R1BA 1LNQA 2ETNA 1NVPD 2ZR3A 4U7OA 3GWOA 2CAZC 2XAJA 4P2ZA 1BSMA 2X0LA 2AZ0A 4NR1A 1TUBB 1JVMA 2D2CB 1L8DA 3FYIB 2A7WA 1IXBA 2PYJA 4JYAO 5B1OA 1BCCH 4YJ3A 4DW0A 5L3DA 1NH2D 3T1YB 1JJ2U 4EB6A 1IBLB 3H1KH 4CH5A 3OD4A 3TGUH 2PI5A 2WLHA 4MVRA 4JI8O 4HAMA 2HHHO 2WA3A 3ABLB 2DW4A 5K1XA 1YDXA 2F43G 2HLDG 4RQEA 1E1QG 4EFBA 2E3CA 4DR3B 3JCZA 5KUMA 4X88A 4LH7A 3U10A 4QGPA 5IJ0A 1SS3A 2EIJC 3CRRA 4NYKA 3SYAA 2HR3A 1M57B 3K3WA 5CA0B 3PJSK 1S5JA 3OM3B 3E8FA 5B1BC 4XBFA 1N4CA 3NXSA 4CH6A 2OCCB 4DYLA 4DV0O 1XMOO 3KG2A 3VOUA 4LF8O 5J2TA 3P30A 3RYHA 2WA4A 4MVZA 3ABKB 1A32A 5JJNB 2YICA 2BTQA 1Z5WA 1QHTA 1Y74A 1YZBA 1FFXA 1SQBH 3OFNG 2DOSA 4H0LB 3LSSA 3JASA 5JWPA 4GT1A 2H3OA 2WLMA 4J9YB 4TSFG 2W6JG 5LGNA 1YEWA 1M9NA 2JGUA 1GM8A 4JI3B 4RWUA 1N32O 4PA9A 3OAAG 1UPGA 3ZRWA 2XUMA 1EFRG 3FD9A 4WFHA 1Q81W 2AHYA 1N34O 3QTCA 1PL0A 4WBNB 4O4IA 1VQ7V 4JASA 3AEIA 1QQCA 1RPOA 1P4RA 3WU2Z 2Y0IA 5E79Z 4J11A 1ZUQA 3DGEA 3IC9A 1VEWA 3RN4A 2HVJC 1IURA 1L1FA 3ETGA 1GTOA 2DYRC 4RUFA 2ZM6B 1EZVH 4GKKB 4PA3A 3ZHRA 1BMFG 2Y4UA 3HKEB 2UXBO 1BE3H 1PD3A 3ZS8C 3IAYA 3SYQA 3AG4B 2DYSB 3N2KB 4YIOA 3FAVA 4B3TO 4UVAA 2ADPA 1FKAO 5IJ9B 1VQ6V 1K92A 4IIJA 5EIBD 3ETEA 4I50A 2JGDA 2ZDIC 1P84F 2N74A 1V54C 2Q0AA 2VS0A 2KKWA 1YTFD 3GVMA 2ZE7A 3IC7A 4JI4B 1KU9A 3UO2A 2JEXA 5CA3A 1MZFA 4X64O 3JAMN 5FLXN 1XOUA 1H2KA 3CSXA 1MSDA 5LOVB 5KA5A 2Q9LA 2EZOA 1HNWB 1N33O 4R6ZA 1N0NA 5LGTA 1G6UA 5LMUO 2C2AA 2Q6AA 4MTXA 5IYBO 3LDCA 2LO1A 3TETA 3TK1A 2BCCH 4FM1A 4B3SO 5IY5C 4QJFB 2A0LA 1MZEA 2HFEC 1H2MA 1YSCA 4X9QA 2WLJA 5HFMA 5H6QA 3OTOO 2QM4A 1HR0O 2UXNA 1V55C 4R50A 5EYPB 4YY3B 3IGAC 2E75B 3CS5A 3EXAA 3SPGA 5L3GA 3L72H 3E8BA 1WP8A 1DLBA 4DV2B 1V55B 3ICXA 3RT3C 4FLTA 4DV4B 4DRXA 3D8CA 4X1IB 2AZ2A 3SJCC 1HR0B 1XNQO 4BIZA 1NS1A 2PGGA 3AG3C 5L3EA 4BIOA 1DTOA 1J5EB 4CS2A 4LF5O 3TCUA 1FPOA 1Q43A 1VQ8V 1U96A 4GZRB 3OMNB 1MABG 1F51A 1KMIZ 1AB3A 2W0FC 3S3XA 2FTKA 2QWPB 3H01A 4PI2A 4X1YB 3E22B 3CEIA 3VBBA 5C8YB 2L6LA 2R9RB 5IJ0B 4DV3O 5EBWC 3OEHG 1KYOF 5BY1A 5EK0A 5BR8O 4NTYA 4MT8A 3JCUZ 3BAAA 4DV6B 1NR1A 3VQWA 4PHZA 3BA9A 1G8MA 2RNBA 4JAAA 3CYOA 4PJ0Z 1N34B 3JD3A 1D2DA 4ICGA 1GH6A 3R66A 3CRAA 1Y66A 3NR7A 1Y76B 4W4LA 1R3JC 2YIBD 3D36A 2HP8A 2QTSA 5LA6A 1Q86W 5KA6A 3AG1B 5JJJB 1NKDA 1Y74B 2CTRA 4Q20A 1N36B 4DR7O 1MA1A 3ZN0A 2FB5A 2YDEA 4LFCO 2O57A 4CBCA 3RYHB 1JOYA 2EULA 2ZXWB 1SQXH 1VQLV 3K03A 3LDDA 1W2BU 1BHAA 4HNAA 3ZHTA 2IM9A 4FLWA 1HNXB 1B04A 1GM7A 3D36C 4JI7O 4PV1B 1XNRO 2QM8A 1N0JA 1RM1C 3ABKC 3E83A 4GKJO 2ZM6O 2EX3A 1Q3EA 3UKMA 2KG7B 4RQFA 2QKAA 2ARHA 1S5HC 5DM6V 4ZHQA 3RYCA 4YJ2B 3DC5A 3CCJV 2VQFO 4DV1O 4TQFA 3MAQA 1WN7A 5DECA 2OTLV 1M56B 1FAFA 4O2BA 1F23A 3ABUA 3K9SA 4U3JA 3TXSA 4QPJA 1VQ4V 2EIMB 5K1PA 1QVGU 1M90W 2CGOA 1PNMA 4EB6B 1KKDA 3MHHC 4UCVA 2XTAA 4JTCB 2WLLB 3JASB 1EM1A 2ODMA 2P6JA 4I0XA 2F66C 2E76B 4PA7A 5C93A 4GX1A 2YEVA 4GYCB 3RYCB 5LMNO 2LQTA 3W7UA 1IBKO 1IVSA 3HKEA 1OCRC 1IDSA 2IJJA 1XHXA 5CA1A 4B3MB 4ZOLB 3VQYA 2BE3A 1GRJA 3ZRXA 1LR1A 3CHXA 3N2GA 2YI8A 2K1EA 3AG4C 3X2QB 3B40A 4U7NA 1ROPA 2R9AA 2Q69A 5IWAB 1QCEA 2QKSA 3E8HA 2UXDO 1TVKB 3EHBB 1NZ6A 3ASOC 1SF9A 3CD6V 4O2AA 3WFVA 3T1CA 4DR1O 1YXBA 4D6TH 4DV4O 4R8CA 2GHYA 3D3IA 4WCEV 3C3TA 4DR5O 3BCCH 1FS0G 2RMKB 3TXQA 5LP6B 3J80N 3QF7A 5B5EZ 4QE7A 1PNKA 5LBQA 2P22C 1OCZC 1OV9A 4X66B 4DR6B 3U11A 3RVZA 5EYPA 2FL4A 5JCOC 3ZMZA 3CCUV 1OCZB 3R65A 1TUEB 3HR0A 4KUMA 4TUYA 4LR3A 1HNXO 1HNZB 5CBGA 2XT9A 2QJ1A 1PNLA 1FJGO 4P9OA 1JFFB 2VQFB 1BL8A 1ZAUA 3K04A 4Z2WA 4UB8Z 4LNUB 1FXHA 4OX9O 4B3TB 4FLVA 2F1MA 1AJNA 1XILA 3HKDA 4TOIA 3G4SV 4QNHB 4JI4O 4BR6A 3K58A 1OJHA 1QU7A 2ZE5A 3ABMB 5IDJA 3ZHQA 2NR5A 1BHBA 5KX5A 4D7SA 2XOKG 4LF8B 5LXTB 3K5OA 3APOA 3FB5C 4HNAB 2E74B 1JFFA 3E22A 4FVMA 1QLNA 5LMUB 5EZYA 2Y69C 3SR2C 3ZRWB 1Q6HA 4J42A 2F4VB 2Q4PA 2YIDA 2Y69B 4WFAV 2F4VO 2A79B 2EJ7A 5LA6B 3VQXA 4JYBA 5JCOA 5EBLC 3BABA 2CGNA 4CZZA 3T1YO 3B8NA 2ATKC 5B3SB 2HHHB 1R73A 4F4LA 5AG2A 2LFSA 4FK5C 5BMVB 2UUCB 5GONA 5CBFA 5LHIA 4DV1B 3SJBC 4F6EA 3WG7C 2DMXA 2R72A 2HG5C 3F5WC 3RYFB 1TAEA 1WNSA 4ZI7A 5JJEB 4PD4F 3RW0A 1CPYA 2Z0AA 2EIMC 2IJIA 4ZIBA 4X65O 4ZOLA 5JVDA 4TUYB 5B1AC 1L0NH 4UFZA 2X7RB 1THZA 4X62B 4DR6O 2B1GA 5KMGA 4UCTA 4ASUG 4LFBO 1F7YA 2F23A 2WPDG 4JTDB 3SPIA 3RVYA 2W0XA 1J95A 1SC5B 3ZMTA 5BR8B 2HJDA 5IYZA 3OE7G 3UO3A 1CXZB 2LGQA 4HBNA 2ZIMA 1ENVA 1GO3F 2JS5A 1XMQO 1WB7A 5KHGA 3UCSC 2QEXV 3JD1A 3ABTA 1SQPH 5KX5B 2Q67A 2ZCEA 2IU0A 1OCCC 2YXHA 1CP9A 3K5MA 4IYHA 1Q5OA 3ZJZA 2VQEB 1UJWB 3JYCA 2UU9B 4LF5B 4NXNB 4K3AA 1S76D 2GV9A 3SYPA 4UVCA 5IYDO 2ZQMA 4GKJB 1COWG 4LCUC 5LOVA 4I4TB 1BQZA 1OCRB 2WSSG 3LUTB 4XDKA 3WB1A 5LYJB 5LHGA 4AQYO 3JSLA 1H2GA 3CC4V 2CDYA 4EEQA 3F7VC 1JPXA 5LP6A 3L9DA 1K73W 1SA0A 1HWYA 3HKDB 4KHPO 2ZINA 1SETA 4IHJB 3KZIZ 1I5YA 3W7TA 3I56V 4JV5O 3OR6C 4H33A 2Q7EA 4CS4A 3ASOB 3JAWB 3AK2A 2WLIB 5DN6G 4OPHA 2Q5ZA 4QE9A 3OGCC 4JAVA 1KQSU 1KC8W 4DV0B 1SZXA 3CX5F 3CJHB 3K57A 1H2LA 2VRZA 4PDMA 2F93B 2HEPA 3A8TA 2XAFA 3LSUA 5LP6C 2BTOA 2N04A 3ML0A 3ZRSA 2X6CA 3DXRB 1NTMH 1Q8IA 2Q7GA 2EINC 1GKFA 2YUAA 1K33A 3T4ZA 3ZN1A 3BY6A 5C8YA 4GLXA 2LGWA 2NN4A 2EINB 1VF6A 2UUAO 4N21A 3STZC 2KB1A 1Z2GA 4RAIA 4WFBV 1VP7A 2OIEA 2QE7G 2LFRA 3CXHF 4CH3A 5FPRA 1SQGA 2GUZB 4KHPB 1Q7YW 5A2QN 3H1IH 1TGOA 1RSOA 4OXSA 4DR4B 1DGSA 4BIUA 1AR4A 1Y76A 3JATB 4W4KA 4UVBA 3W7XA 3OR7C 2EBOA 4WFGA 4MW3A 2AW9A 2X6BA 3UQ8A 3APQA 3K79A 4B3MO 3DTUB 3FX7A 4FIPC 2V7QG 3BPZA 4LP8A 3BA8A 2D3OW 1VQNV 2QDOA 5GONB 3RBZA 1K8AW 1HNWO 3QVNA 4LWSB 1PV0A 4X8AA 1NT2B 4D7TA 1YJWV 5LYJA 4JAUA 4JI2O 1P49A 4JI0B 1SQVH 4CH4A 3SGIA 1EZJA 1WPBA 3H9VA 2M6YA 4FM2A 1ZWIC 4UUJC 4JPRA 3B2EE 4BW9A 4C7UA 1KB9F 4AILC 1AJPA 2XAHA 2H94A 3JALA 3AG3B 1I08A 2XHBA 1US6A 2WWWA 1DF5A 2JIZG 2Q0OC 4EKWA 5KMGB 2AHZA 4JI6O 1M56C 3ASNB 5KHIA 1QLEC 1FXKA 1M4UA 1JQ0A 2QTOA 1X59A 4X65B 3AG2B 5IE9A 1NBMG 3HKCA 4NXNO 4UV8A 1RFYA 3O65A 4ZBMA 2P5OA 4J10A 1N8RW 5LMNB 2RDCA 3EFFK 3FB8C 5B1AB 2PZSA 1I94B 3KCYA 2X6AA 5ITZB 2DWEC 2ZNIA 3G6BA 4JV5B 3AK1A 4UCSA 2CH7A 3ABLC 1IX9A 4LFAB 1B6QA 3P3NA 1K97A 1WPXA 3ZRVA 2OCCC 4U3JB 3ZBHA 3DC6A 3BHPA 1QBZA 4PDRA 5H9CA 1M1KW 4NTXA 4I50B 2YI9A 5J2TB 3B77A 1XEQA 3S3WA 5BMVA 2NNUA 3RFRA 2UXBB 4JI7B 3ZMUA 1FXKC 1DK1A 2UXCB 3C90A 5EBMC 3W7SA 5GTIZ 1W0KG 2JDIG 4O4HA 3ZHUA 5H2FZ 1ZL8A 3I5DA 5KUKA 4B3SB 1SERA 3N2GB 4LF6B 4LF4B 1SKVA 4FFBB 1S3JA 3A0HZ 5FL7G 3OMAB 2LP7A 2Q73A 3CP1A 5IJ9A 1M5IA 2YIBA 4DV7B 3OTOB 2XAGA 3JALB 1XHZA 2Z5UA 5CA0A 5JVDB 2FMLA 2Q68A 3JSNA 3JATA 1AILA 3EVKA 4OX9B 4PELA 2E5LB 3M8AA 4DR4O 4X64B 3STLC 1VMGA 1J5EO 1R6KA 2OT5A 1U97A 1IBMB 2IH3C 5J2UA 2Y48A 2IJKA 4XDLA 1LUWA 4PA4A 3CCMV 3DXRA 1VQKV 1KP2A 1SA0B 2QKCA 1Q90D 4Z1MG 2JRIA 4X66O 3AG7A 1JX9A 4ABMA 1RP3B 3ZMSA 5F2VO 1AP6A 4A5UB 3WB2A 4MVSA 2HKOA 3CRCA 1JCHA 1AI4A 4ZKIA 1KUQA 2YEVB 3JD0A 2UXXA 4YY3O 5J2UB 3OEEG 4Z1VA 1D5AA 3GWKC 2JGDB 1AI7A 2K9PA 1JR9A 4CS3A 3ZMVA 1I5XA 4ZHQB 3SJAC 4K0KO 4F6RB 1BQ0A 1XI1A 2PY5A 2MW2B 1PM9A 1GN3A 2DQ0A 2P67A 1SZTA 3X2QC 3K5NA 4TQDA 1VF5B 1H8HG 3C3SA 3MD0A 2BSKB 5A9GA 2WLKA 1NH2B 3HKCB 2FYUH 1O9HA 2P7TC 4DXWA 4I7ZB 3OGIB 3ETQA 2OWOA 3SPCA 1G1XB 1YITV 2YXLA 2YSUB 2OIGA 2P4KA 4X1KB 4XDJA 3N2KA 4Q6GA 2DWDC 3CCLV 4LF4O 3JARB 5ITZA 3CRMA 5KLVH 2ZR2A 3L73H 4I55B 2CH7B 1GN2A 1MG1A 1WAZA 4L8JA 4PI0A 4TT3G 3T1HB 2CTWA 5BZBA 5EC2C 5KHHA 5KHJA 3D3QA 1XNQB 4B7EA 4X89A 5IT9N 3Q4HB 4LF9O 4MVQA 1Q82W 4KL1A 4I9WA 4UCUA 4JTAB 4YIPA 5EIBC 2EILC 1VARA 4JI1O 1K5QA 2QGNA 3H1HH 3CCQV 2ZKOA 4NKGB 1BS3A 2ZE8A 3DSQA 1XUQA 1VF6C 2M7WA 2JS3A 4GX2A 4JZGA 4P30A 2YC0A 1K3EA 4FZ0A 4IHJA 3I55V 4O4LA 5B1BB 3KCXA 4J9ZB 4DR2B 2JEUA 5JH7A 4DUZB 1GN6A 1FJGB 4RO2A 3JD4A 2GBOA 2P4VA 2RQ6A 4TWKA 2OCHA 3RGBA 2BOBC 4MVMA 3ZEDA 5EZYB 2JK5C 3CMEV 2H8PC 4GUNA 1FXKB 2UXDB 3ZX6A 4JYCA 2A9HA 4GX0A 2HVKC 3ZCCA 2MK3A 3H1JH 3E35A 4JGSA 3F5TA 3K08A 1EN5A 2EIJB 2UUBB 5CMUA 5KAFZ 1I7FA 1KBHA 2CE4A 3B8MA 3WB0A 2WLIA 2KQXA 2ZXWC 1S5LZ 5CBHA 2OTJV 5HFLA 1SQQH 1XNRB 2HJFC 4JYAB 3CCVV 1W0JG 3A0RA 3L75H 4FFBA 3QO5A 1URFA 4OGQB 4BWAA 3JAKB 1K4CC 5CA1B 3M7MX 3CPWU 4FPPA 2UUAB 3G6EV 3E8GA 4AHCA 2EJRA 3PN1A 4PA6A 1R3IC 4X1KA 4DRXB 1XL6A 5FPOA 3MDSA 4MVOA 3U0ZA 4DR3O 1P7GA 1O9GA 3SYCA 4HYOA 1HNZO 1FFTB 2YIAA 4G27B 1YHQV 2DYRB 5BXZA 1Y4MA 1G4YB 1E79G 4JI8B 2WLNA 1GK9A 1M93A 2BOCC 4PDVA 3OMIB 4EFEA 1GAXA 1YTFB 5CB4B 3ASNC 4O4JB 2R70A 4J7JA 4BW5A 1I0HA 2NLJC 4WFEA 1WP7A 2RJZA 4K35A 2XNDG 3JAKA 3AG2C 1K4DC 1OCCB 3KKYA 2B1IA 4BAYA 2CTQA 1QR9A 3BVOA 3J81N 1XREA 4K8ZA 1R3LC 2WLLA 2QA4V 2QWNB 2ZNJA 1ZTEA 4GX5A 4I5SA 1BGYH 2QM7A 5KAIZ 1FXVA 1S0VA 2KSDA 2LJ2A 4IIJB 4PDLA 1I94O 4MSWC 4MVUA 3H1LH 1PPJH 1X4TA 4X20B 4U3FH 4J7ZA 3W7WA 5IYCO 4DV5B 1VQ5V 1AJQA 4B08A 4DR2O 4FLXA 5LL6Y 2PUSA 4FLYA 3JARA 1H8EG 4FJCC 5LXTA 3CB2A 2GDSA 4QIWF 1M57C 3TJTA 1H38A 2GTAA 2RCVA 1HP8A 5B1NA 4FLUA 1AI5A 4CC6A 2ZE6A 2W6IG 2N05A 1PP9H 3E86A 4TV9B 4JYYA 5TISZ 3CC7V 1EN4A 1TVKA 4O2BB 4JI5B 4YJ3B 2GUZA 2Q7HA 2UUBO 3L74H 4DR5B 3J7AU 1N32B 3AK3A 4LF9B 2FKXA 3BRCA 1IXMA 1NU1H 3F7YC 3SYOA 1H2SB 1AI6A 1NQTA 3LDEA 3P3PA 2QWRB 5GTHZ 3OUSA 3A2FA 2YXYA 3B09A 1AR5A 5IYZB 3IFXA 1JJOA 2E5LO 4NVPA
chains in the Genus database with same CATH topology
4JI1O 4B3MO 2ZKOA 2VQFO 4AQYO 4DV1O 1IBLO 2UU9O 3T1HO 4LF5O 4GKKO 5IWAO 4A5UB 4DV7O 1AB3A 4B3TO 4NXMO 1HNXO 4DV6O 1HNWO 1KUQA 4KHPO 1FJGO 4YY3O 4JV5O 4DV0O 1FKAO 1XMOO 4DV3O 2LW7A 2Z0AA 2AGAA 4JI2O 4LF8O 5BY1A 3J81N 2N74A 4LFAO 4X65O 4OPHA 4OX9O 1XEQA 1A32A 5BR8O 4JI0O 1R6TA 4OPAA 4LF6O 4DUYO 5LMNO 4JI4O 4DR6O 1IBKO 1DK1A 1N36O 1YZBA 4K0KO 4JI3O 2DJVA 1I94O 5BXZA 1D2DA 5H5NA 4X64O 3R66A 4LFBO 4YHHO 2DOSA 1F7YA 4DR2O 3JAMN 5LL6Y 3SDLA 5FLXN 2UXCO 4X62O 3F5TA 4B3RO 1IBMO 1R1BA 1N32O 1N33O 2UUAO 1XMQO 1G1XB 5LMUO 4LF7O 4JI6O 4DR7O 4LFCO 1N34O 2UXDO 2F4VO 1X59A 1AILA 4DUZO 4LF4O 4B3SO 4NXNO 4DV2O 3O65A 4JI5O 4JYAO 4DR1O 2UUBO 3M8AA 3J7AU 4DR4O 4JI7O 4DV4O 1FYJA 2FKXA 3T1YO 1J5EO 3OTOO 1XNRO 1HR0O 5A2QN 4GKJO 4DR5O 2ZM6O 2UUCO 4JI8O 2HHHO 2VQEO 4DV5O 5IT9N 3RT3C 3J80N 4LF9O 4DR3O 1XNQO 1HNZO 1NS1A 2JRIA 4X66O 2E5LO 2UXBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 O;  4B3M O;  2ZKO A;  2VQF O;  4AQY O;  4DV1 O;  1IBL O;  2UU9 O;  3T1H O;  4LF5 O;  4GKK O;  5IWA O;  4A5U B;  4DV7 O;  1AB3 A;  4B3T O;  4NXM O;  1HNX O;  4DV6 O;  1HNW O;  1KUQ A;  4KHP O;  1FJG O;  4YY3 O;  4JV5 O;  4DV0 O;  1FKA O;  1XMO O;  4DV3 O;  2LW7 A;  2Z0A A;  2AGA A;  4JI2 O;  4LF8 O;  5BY1 A;  3J81 N;  2N74 A;  4LFA O;  4X65 O;  4OPH A;  4OX9 O;  1XEQ A;  1A32 A;  5BR8 O;  4JI0 O;  1R6T A;  4OPA A;  4LF6 O;  4DUY O;  5LMN O;  4JI4 O;  4DR6 O;  1IBK O;  1DK1 A;  1N36 O;  1YZB A;  4K0K O;  4JI3 O;  2DJV A;  1I94 O;  5BXZ A;  1D2D A;  5H5N A;  4X64 O;  3R66 A;  4LFB O;  4YHH O;  2DOS A;  1F7Y A;  4DR2 O;  3JAM N;  5LL6 Y;  3SDL A;  5FLX N;  2UXC O;  4X62 O;  3F5T A;  4B3R O;  1IBM O;  1R1B A;  1N32 O;  1N33 O;  2UUA O;  1XMQ O;  1G1X B;  5LMU O;  4LF7 O;  4JI6 O;  4DR7 O;  4LFC O;  1N34 O;  2UXD O;  2F4V O;  1X59 A;  1AIL A;  4DUZ O;  4LF4 O;  4B3S O;  4NXN O;  4DV2 O;  3O65 A;  4JI5 O;  4JYA O;  4DR1 O;  2UUB O;  3M8A A;  3J7A U;  4DR4 O;  4JI7 O;  4DV4 O;  1FYJ A;  2FKX A;  3T1Y O;  1J5E O;  3OTO O;  1XNR O;  1HR0 O;  5A2Q N;  4GKJ O;  4DR5 O;  2ZM6 O;  2UUC O;  4JI8 O;  2HHH O;  2VQE O;  4DV5 O;  5IT9 N;  3RT3 C;  3J80 N;  4LF9 O;  4DR3 O;  1XNQ O;  1HNZ O;  1NS1 A;  2JRI A;  4X66 O;  2E5L O;  2UXB O; 
#chains in the Genus database with same CATH topology
 1XL4 A;  2IJH A;  4WFF A;  4MS2 A;  5CN0 A;  4KFM A;  1IBL O;  1Z5V A;  1TA8 A;  4FZ1 A;  2EIK B;  4AQY B;  3L70 H;  3FAV B;  3K5L A;  1ZX3 A;  1S77 D;  4FLZ A;  2EIK C;  1ORQ C;  3CXC U;  1W59 A;  1K34 A;  2LW7 A;  2QR4 A;  2AGA A;  1OHH G;  4UXN A;  5IY5 B;  4I0X B;  4CC5 A;  2OYQ A;  2YS8 A;  3ZHV A;  4O2A B;  2AXT Z;  1R6T A;  2BSK A;  1YJ9 V;  2V4D A;  4O4I B;  1N36 O;  4DR7 B;  2DJV A;  2Y4T A;  3JD2 A;  5FNV B;  2IU3 A;  5B66 Z;  5JH7 B;  2IBZ H;  3SDL A;  5DED A;  1R6N A;  4G28 B;  1Q6I A;  2EIL B;  2DYS C;  4DO2 A;  5GW7 A;  3CCR V;  3RYF A;  1IBM O;  1JMK C;  4YJ2 A;  4DK0 A;  2RN9 A;  4MTO A;  4AI8 A;  4UCO A;  3A0B Z;  4LF7 O;  2WAM A;  2CTP A;  1AVM A;  1Q6U A;  1RSO B;  5D5P A;  2ITC C;  1V54 B;  2PI4 A;  3CRQ A;  3BEH A;  5B3S C;  1NTZ H;  2ILM A;  4O4H B;  1FYJ A;  2JJ1 G;  3E2E A;  2QWQ B;  1WA8 B;  1PL4 A;  1NR7 A;  1UFI A;  1BZK A;  2ITD C;  1EBO A;  4KXR A;  3K0G A;  1B06 A;  4MW8 A;  4B3R B;  3SJQ C;  4LBE C;  4I4T A;  2F95 B;  1YIJ V;  4P9P A;  2A3Q A;  3OUF A;  2P90 A;  4TV8 A;  3L71 H;  1FD9 A;  1QR8 A;  3T1H O;  4IT5 A;  1AP5 A;  3WG7 B;  4DV7 O;  4L87 A;  2ZD9 A;  3AG1 C;  3HKB B;  4NXM O;  4H37 A;  1QLE B;  3K59 A;  1OCO C;  4RUE A;  3G80 A;  1SES A;  1WA8 A;  5E1A C;  4DK1 A;  4JI1 B;  1NTK H;  1OCO B;  4J41 A;  3ZIA G;  1NI8 A;  2XAS A;  1IBK B;  3FB7 C;  1HW7 A;  4FFK A;  2B9Z A;  4JI0 O;  4WBN A;  2ZT9 B;  1GN4 A;  4JI2 B;  4JZ2 A;  3E89 A;  3M99 B;  4F6R A;  4FM0 A;  2IW5 A;  2Z3Y A;  3HKB A;  1LUV A;  1S72 V;  4DW1 A;  1T5E A;  3LSQ A;  4YXW G;  1JA8 A;  2BTQ B;  1Y6X A;  2PTM A;  2L35 A;  1YI2 V;  2V1D A;  4B3R O;  2XAQ A;  4GCZ A;  3UM7 A;  1ZLZ A;  5KHK A;  3OW2 U;  4O4L B;  1K5S A;  1VIB A;  4UCR A;  3MHS C;  1GMG A;  1SRY A;  2EZP A;  4J7K A;  5LHH A;  3CJH A;  4JI6 B;  1QNM A;  1VQO V;  3ETD A;  2P06 A;  3FYE B;  3ZHS A;  4IL6 Z;  4G2K A;  3SPJ A;  4LF7 B;  4X20 A;  1VQ9 V;  2GSM B;  2VQE O;  5D5Q A;  5CB4 A;  1TUB A;  3LNN A;  4DV5 O;  3T4D A;  2LW1 A;  3G71 V;  2A06 H;  3HB3 B;  2IH1 C;  4E2L A;  1KP3 A;  3CCS V;  3OT7 A;  3FKS G;  5L3C A;  5H6R A;  3HPL C;  4IGG A;  4H13 B;  4H44 B;  4TV9 A;  2ADQ B;  5IWA O;  3FB6 C;  4UB6 Z;  4DUY B;  3RYI A;  2Y0P A;  3N27 A;  5LGU A;  1L0L H;  2DN9 A;  3K06 A;  1F4M A;  1FFX B;  5EC1 C;  4IYI A;  1KD1 W;  3JAW A;  3IJ4 A;  3K9A A;  4LFA O;  3P32 A;  5J9P C;  3THO A;  1IZ3 A;  3VQV A;  4NB5 A;  1MMM A;  4KP4 A;  3GB7 C;  2QSA A;  2B5U A;  3K0D A;  1WJZ A;  2DE0 X;  4K0K B;  5H5N A;  1DF4 A;  1OZ0 A;  4YHH O;  3RYI B;  2UXC O;  2KG7 A;  4YHH B;  4X62 O;  2QWO B;  1H2N A;  4FMT A;  2JVD A;  4R7C A;  1P7B A;  4MTF A;  3CC2 V;  3OTF A;  1NVP B;  4MTG A;  1K7D A;  2JJ2 G;  1E1R G;  4JF3 A;  2PYL A;  2GTS A;  1B3Q A;  4DUZ O;  3UT5 B;  3QNE A;  4LC1 A;  4DV2 O;  2VWJ A;  1QVF U;  4E4E A;  4I55 A;  4JI5 O;  5JQG B;  2ZIO A;  3SPH A;  1VQP V;  4QPK A;  2CUG A;  4ZI7 B;  3LNM B;  4WF9 V;  5FNV A;  1XDC A;  4UV9 A;  4TV8 B;  1YCI A;  1D5N A;  2UUC O;  4NXM B;  1VF7 A;  1XMO B;  3Q4H A;  1MSW D;  1XQ8 A;  3QO8 A;  1ZL8 B;  3CWB H;  4B7K A;  1KKC A;  1CEZ A;  3ABM C;  3T2M A;  2R9I A;  1AR1 B;  1XMQ B;  1RPR A;  3O9O A;  2UU9 O;  1KEC A;  2Q8V A;  4I9Q A;  3RWR D;  1PKX A;  4J80 A;  3B4S A;  4GKK O;  3QG5 A;  3UT5 A;  5JQG A;  1MOF A;  4DV6 O;  2VWK A;  4X1I A;  4LWS A;  4N23 A;  2DQ3 A;  1N33 B;  2CK3 G;  1YF2 A;  1EN6 A;  5L3F A;  1YJN V;  4LH6 A;  1R3K C;  4DV3 B;  1BT8 A;  4HZ3 A;  1K9M W;  3BFR A;  1SQF A;  4LNU A;  1F4N A;  5L3B A;  1GM9 A;  1WB8 A;  4LFB B;  3CE2 A;  1V9P A;  2PF4 E;  4OPA A;  4LF6 O;  4DUY O;  2G38 A;  1RM1 B;  4X1Y A;  3QO7 A;  3G67 A;  4JI3 O;  3FFQ A;  1Y67 A;  1HDJ A;  3CCE V;  1NJI W;  4O4J A;  4K8X A;  1MNG A;  1VQM V;  3CMA V;  1ARO P;  4LFC B;  4DR1 B;  1WLE A;  1XBL A;  1ZSP A;  4NTW A;  1YVW A;  2ZDI A;  1R1B A;  1LNQ A;  2ETN A;  1NVP D;  2ZR3 A;  4U7O A;  3GWO A;  2CAZ C;  2XAJ A;  4P2Z A;  1BSM A;  2X0L A;  2AZ0 A;  4NR1 A;  1TUB B;  1JVM A;  2D2C B;  1L8D A;  3FYI B;  2A7W A;  1IXB A;  2PYJ A;  4JYA O;  5B1O A;  1BCC H;  4YJ3 A;  4DW0 A;  5L3D A;  1NH2 D;  3T1Y B;  1JJ2 U;  4EB6 A;  1IBL B;  3H1K H;  4CH5 A;  3OD4 A;  3TGU H;  2PI5 A;  2WLH A;  4MVR A;  4JI8 O;  4HAM A;  2HHH O;  2WA3 A;  3ABL B;  2DW4 A;  5K1X A;  1YDX A;  2F43 G;  2HLD G;  4RQE A;  1E1Q G;  4EFB A;  2E3C A;  4DR3 B;  3JCZ A;  5KUM A;  4X88 A;  4LH7 A;  3U10 A;  4QGP A;  5IJ0 A;  1SS3 A;  2EIJ C;  3CRR A;  4NYK A;  3SYA A;  2HR3 A;  1M57 B;  3K3W A;  5CA0 B;  3PJS K;  1S5J A;  3OM3 B;  3E8F A;  5B1B C;  4XBF A;  1N4C A;  3NXS A;  4CH6 A;  2OCC B;  4DYL A;  4DV0 O;  1XMO O;  3KG2 A;  3VOU A;  4LF8 O;  5J2T A;  3P30 A;  3RYH A;  2WA4 A;  4MVZ A;  3ABK B;  1A32 A;  5JJN B;  2YIC A;  2BTQ A;  1Z5W A;  1QHT A;  1Y74 A;  1YZB A;  1FFX A;  1SQB H;  3OFN G;  2DOS A;  4H0L B;  3LSS A;  3JAS A;  5JWP A;  4GT1 A;  2H3O A;  2WLM A;  4J9Y B;  4TSF G;  2W6J G;  5LGN A;  1YEW A;  1M9N A;  2JGU A;  1GM8 A;  4JI3 B;  4RWU A;  1N32 O;  4PA9 A;  3OAA G;  1UPG A;  3ZRW A;  2XUM A;  1EFR G;  3FD9 A;  4WFH A;  1Q81 W;  2AHY A;  1N34 O;  3QTC A;  1PL0 A;  4WBN B;  4O4I A;  1VQ7 V;  4JAS A;  3AEI A;  1QQC A;  1RPO A;  1P4R A;  3WU2 Z;  2Y0I A;  5E79 Z;  4J11 A;  1ZUQ A;  3DGE A;  3IC9 A;  1VEW A;  3RN4 A;  2HVJ C;  1IUR A;  1L1F A;  3ETG A;  1GTO A;  2DYR C;  4RUF A;  2ZM6 B;  1EZV H;  4GKK B;  4PA3 A;  3ZHR A;  1BMF G;  2Y4U A;  3HKE B;  2UXB O;  1BE3 H;  1PD3 A;  3ZS8 C;  3IAY A;  3SYQ A;  3AG4 B;  2DYS B;  3N2K B;  4YIO A;  3FAV A;  4B3T O;  4UVA A;  2ADP A;  1FKA O;  5IJ9 B;  1VQ6 V;  1K92 A;  4IIJ A;  5EIB D;  3ETE A;  4I50 A;  2JGD A;  2ZDI C;  1P84 F;  2N74 A;  1V54 C;  2Q0A A;  2VS0 A;  2KKW A;  1YTF D;  3GVM A;  2ZE7 A;  3IC7 A;  4JI4 B;  1KU9 A;  3UO2 A;  2JEX A;  5CA3 A;  1MZF A;  4X64 O;  3JAM N;  5FLX N;  1XOU A;  1H2K A;  3CSX A;  1MSD A;  5LOV B;  5KA5 A;  2Q9L A;  2EZO A;  1HNW B;  1N33 O;  4R6Z A;  1N0N A;  5LGT A;  1G6U A;  5LMU O;  2C2A A;  2Q6A A;  4MTX A;  5IYB O;  3LDC A;  2LO1 A;  3TET A;  3TK1 A;  2BCC H;  4FM1 A;  4B3S O;  5IY5 C;  4QJF B;  2A0L A;  1MZE A;  2HFE C;  1H2M A;  1YSC A;  4X9Q A;  2WLJ A;  5HFM A;  5H6Q A;  3OTO O;  2QM4 A;  1HR0 O;  2UXN A;  1V55 C;  4R50 A;  5EYP B;  4YY3 B;  3IGA C;  2E75 B;  3CS5 A;  3EXA A;  3SPG A;  5L3G A;  3L72 H;  3E8B A;  1WP8 A;  1DLB A;  4DV2 B;  1V55 B;  3ICX A;  3RT3 C;  4FLT A;  4DV4 B;  4DRX A;  3D8C A;  4X1I B;  2AZ2 A;  3SJC C;  1HR0 B;  1XNQ O;  4BIZ A;  1NS1 A;  2PGG A;  3AG3 C;  5L3E A;  4BIO A;  1DTO A;  1J5E B;  4CS2 A;  4LF5 O;  3TCU A;  1FPO A;  1Q43 A;  1VQ8 V;  1U96 A;  4GZR B;  3OMN B;  1MAB G;  1F51 A;  1KMI Z;  1AB3 A;  2W0F C;  3S3X A;  2FTK A;  2QWP B;  3H01 A;  4PI2 A;  4X1Y B;  3E22 B;  3CEI A;  3VBB A;  5C8Y B;  2L6L A;  2R9R B;  5IJ0 B;  4DV3 O;  5EBW C;  3OEH G;  1KYO F;  5BY1 A;  5EK0 A;  5BR8 O;  4NTY A;  4MT8 A;  3JCU Z;  3BAA A;  4DV6 B;  1NR1 A;  3VQW A;  4PHZ A;  3BA9 A;  1G8M A;  2RNB A;  4JAA A;  3CYO A;  4PJ0 Z;  1N34 B;  3JD3 A;  1D2D A;  4ICG A;  1GH6 A;  3R66 A;  3CRA A;  1Y66 A;  3NR7 A;  1Y76 B;  4W4L A;  1R3J C;  2YIB D;  3D36 A;  2HP8 A;  2QTS A;  5LA6 A;  1Q86 W;  5KA6 A;  3AG1 B;  5JJJ B;  1NKD A;  1Y74 B;  2CTR A;  4Q20 A;  1N36 B;  4DR7 O;  1MA1 A;  3ZN0 A;  2FB5 A;  2YDE A;  4LFC O;  2O57 A;  4CBC A;  3RYH B;  1JOY A;  2EUL A;  2ZXW B;  1SQX H;  1VQL V;  3K03 A;  3LDD A;  1W2B U;  1BHA A;  4HNA A;  3ZHT A;  2IM9 A;  4FLW A;  1HNX B;  1B04 A;  1GM7 A;  3D36 C;  4JI7 O;  4PV1 B;  1XNR O;  2QM8 A;  1N0J A;  1RM1 C;  3ABK C;  3E83 A;  4GKJ O;  2ZM6 O;  2EX3 A;  1Q3E A;  3UKM A;  2KG7 B;  4RQF A;  2QKA A;  2ARH A;  1S5H C;  5DM6 V;  4ZHQ A;  3RYC A;  4YJ2 B;  3DC5 A;  3CCJ V;  2VQF O;  4DV1 O;  4TQF A;  3MAQ A;  1WN7 A;  5DEC A;  2OTL V;  1M56 B;  1FAF A;  4O2B A;  1F23 A;  3ABU A;  3K9S A;  4U3J A;  3TXS A;  4QPJ A;  1VQ4 V;  2EIM B;  5K1P A;  1QVG U;  1M90 W;  2CGO A;  1PNM A;  4EB6 B;  1KKD A;  3MHH C;  4UCV A;  2XTA A;  4JTC B;  2WLL B;  3JAS B;  1EM1 A;  2ODM A;  2P6J A;  4I0X A;  2F66 C;  2E76 B;  4PA7 A;  5C93 A;  4GX1 A;  2YEV A;  4GYC B;  3RYC B;  5LMN O;  2LQT A;  3W7U A;  1IBK O;  1IVS A;  3HKE A;  1OCR C;  1IDS A;  2IJJ A;  1XHX A;  5CA1 A;  4B3M B;  4ZOL B;  3VQY A;  2BE3 A;  1GRJ A;  3ZRX A;  1LR1 A;  3CHX A;  3N2G A;  2YI8 A;  2K1E A;  3AG4 C;  3X2Q B;  3B40 A;  4U7N A;  1ROP A;  2R9A A;  2Q69 A;  5IWA B;  1QCE A;  2QKS A;  3E8H A;  2UXD O;  1TVK B;  3EHB B;  1NZ6 A;  3ASO C;  1SF9 A;  3CD6 V;  4O2A A;  3WFV A;  3T1C A;  4DR1 O;  1YXB A;  4D6T H;  4DV4 O;  4R8C A;  2GHY A;  3D3I A;  4WCE V;  3C3T A;  4DR5 O;  3BCC H;  1FS0 G;  2RMK B;  3TXQ A;  5LP6 B;  3J80 N;  3QF7 A;  5B5E Z;  4QE7 A;  1PNK A;  5LBQ A;  2P22 C;  1OCZ C;  1OV9 A;  4X66 B;  4DR6 B;  3U11 A;  3RVZ A;  5EYP A;  2FL4 A;  5JCO C;  3ZMZ A;  3CCU V;  1OCZ B;  3R65 A;  1TUE B;  3HR0 A;  4KUM A;  4TUY A;  4LR3 A;  1HNX O;  1HNZ B;  5CBG A;  2XT9 A;  2QJ1 A;  1PNL A;  1FJG O;  4P9O A;  1JFF B;  2VQF B;  1BL8 A;  1ZAU A;  3K04 A;  4Z2W A;  4UB8 Z;  4LNU B;  1FXH A;  4OX9 O;  4B3T B;  4FLV A;  2F1M A;  1AJN A;  1XIL A;  3HKD A;  4TOI A;  3G4S V;  4QNH B;  4JI4 O;  4BR6 A;  3K58 A;  1OJH A;  1QU7 A;  2ZE5 A;  3ABM B;  5IDJ A;  3ZHQ A;  2NR5 A;  1BHB A;  5KX5 A;  4D7S A;  2XOK G;  4LF8 B;  5LXT B;  3K5O A;  3APO A;  3FB5 C;  4HNA B;  2E74 B;  1JFF A;  3E22 A;  4FVM A;  1QLN A;  5LMU B;  5EZY A;  2Y69 C;  3SR2 C;  3ZRW B;  1Q6H A;  4J42 A;  2F4V B;  2Q4P A;  2YID A;  2Y69 B;  4WFA V;  2F4V O;  2A79 B;  2EJ7 A;  5LA6 B;  3VQX A;  4JYB A;  5JCO A;  5EBL C;  3BAB A;  2CGN A;  4CZZ A;  3T1Y O;  3B8N A;  2ATK C;  5B3S B;  2HHH B;  1R73 A;  4F4L A;  5AG2 A;  2LFS A;  4FK5 C;  5BMV B;  2UUC B;  5GON A;  5CBF A;  5LHI A;  4DV1 B;  3SJB C;  4F6E A;  3WG7 C;  2DMX A;  2R72 A;  2HG5 C;  3F5W C;  3RYF B;  1TAE A;  1WNS A;  4ZI7 A;  5JJE B;  4PD4 F;  3RW0 A;  1CPY A;  2Z0A A;  2EIM C;  2IJI A;  4ZIB A;  4X65 O;  4ZOL A;  5JVD A;  4TUY B;  5B1A C;  1L0N H;  4UFZ A;  2X7R B;  1THZ A;  4X62 B;  4DR6 O;  2B1G A;  5KMG A;  4UCT A;  4ASU G;  4LFB O;  1F7Y A;  2F23 A;  2WPD G;  4JTD B;  3SPI A;  3RVY A;  2W0X A;  1J95 A;  1SC5 B;  3ZMT A;  5BR8 B;  2HJD A;  5IYZ A;  3OE7 G;  3UO3 A;  1CXZ B;  2LGQ A;  4HBN A;  2ZIM A;  1ENV A;  1GO3 F;  2JS5 A;  1XMQ O;  1WB7 A;  5KHG A;  3UCS C;  2QEX V;  3JD1 A;  3ABT A;  1SQP H;  5KX5 B;  2Q67 A;  2ZCE A;  2IU0 A;  1OCC C;  2YXH A;  1CP9 A;  3K5M A;  4IYH A;  1Q5O A;  3ZJZ A;  2VQE B;  1UJW B;  3JYC A;  2UU9 B;  4LF5 B;  4NXN B;  4K3A A;  1S76 D;  2GV9 A;  3SYP A;  4UVC A;  5IYD O;  2ZQM A;  4GKJ B;  1COW G;  4LCU C;  5LOV A;  4I4T B;  1BQZ A;  1OCR B;  2WSS G;  3LUT B;  4XDK A;  3WB1 A;  5LYJ B;  5LHG A;  4AQY O;  3JSL A;  1H2G A;  3CC4 V;  2CDY A;  4EEQ A;  3F7V C;  1JPX A;  5LP6 A;  3L9D A;  1K73 W;  1SA0 A;  1HWY A;  3HKD B;  4KHP O;  2ZIN A;  1SET A;  4IHJ B;  3KZI Z;  1I5Y A;  3W7T A;  3I56 V;  4JV5 O;  3OR6 C;  4H33 A;  2Q7E A;  4CS4 A;  3ASO B;  3JAW B;  3AK2 A;  2WLI B;  5DN6 G;  4OPH A;  2Q5Z A;  4QE9 A;  3OGC C;  4JAV A;  1KQS U;  1KC8 W;  4DV0 B;  1SZX A;  3CX5 F;  3CJH B;  3K57 A;  1H2L A;  2VRZ A;  4PDM A;  2F93 B;  2HEP A;  3A8T A;  2XAF A;  3LSU A;  5LP6 C;  2BTO A;  2N04 A;  3ML0 A;  3ZRS A;  2X6C A;  3DXR B;  1NTM H;  1Q8I A;  2Q7G A;  2EIN C;  1GKF A;  2YUA A;  1K33 A;  3T4Z A;  3ZN1 A;  3BY6 A;  5C8Y A;  4GLX A;  2LGW A;  2NN4 A;  2EIN B;  1VF6 A;  2UUA O;  4N21 A;  3STZ C;  2KB1 A;  1Z2G A;  4RAI A;  4WFB V;  1VP7 A;  2OIE A;  2QE7 G;  2LFR A;  3CXH F;  4CH3 A;  5FPR A;  1SQG A;  2GUZ B;  4KHP B;  1Q7Y W;  5A2Q N;  3H1I H;  1TGO A;  1RSO A;  4OXS A;  4DR4 B;  1DGS A;  4BIU A;  1AR4 A;  1Y76 A;  3JAT B;  4W4K A;  4UVB A;  3W7X A;  3OR7 C;  2EBO A;  4WFG A;  4MW3 A;  2AW9 A;  2X6B A;  3UQ8 A;  3APQ A;  3K79 A;  4B3M O;  3DTU B;  3FX7 A;  4FIP C;  2V7Q G;  3BPZ A;  4LP8 A;  3BA8 A;  2D3O W;  1VQN V;  2QDO A;  5GON B;  3RBZ A;  1K8A W;  1HNW O;  3QVN A;  4LWS B;  1PV0 A;  4X8A A;  1NT2 B;  4D7T A;  1YJW V;  5LYJ A;  4JAU A;  4JI2 O;  1P49 A;  4JI0 B;  1SQV H;  4CH4 A;  3SGI A;  1EZJ A;  1WPB A;  3H9V A;  2M6Y A;  4FM2 A;  1ZWI C;  4UUJ C;  4JPR A;  3B2E E;  4BW9 A;  4C7U A;  1KB9 F;  4AIL C;  1AJP A;  2XAH A;  2H94 A;  3JAL A;  3AG3 B;  1I08 A;  2XHB A;  1US6 A;  2WWW A;  1DF5 A;  2JIZ G;  2Q0O C;  4EKW A;  5KMG B;  2AHZ A;  4JI6 O;  1M56 C;  3ASN B;  5KHI A;  1QLE C;  1FXK A;  1M4U A;  1JQ0 A;  2QTO A;  1X59 A;  4X65 B;  3AG2 B;  5IE9 A;  1NBM G;  3HKC A;  4NXN O;  4UV8 A;  1RFY A;  3O65 A;  4ZBM A;  2P5O A;  4J10 A;  1N8R W;  5LMN B;  2RDC A;  3EFF K;  3FB8 C;  5B1A B;  2PZS A;  1I94 B;  3KCY A;  2X6A A;  5ITZ B;  2DWE C;  2ZNI A;  3G6B A;  4JV5 B;  3AK1 A;  4UCS A;  2CH7 A;  3ABL C;  1IX9 A;  4LFA B;  1B6Q A;  3P3N A;  1K97 A;  1WPX A;  3ZRV A;  2OCC C;  4U3J B;  3ZBH A;  3DC6 A;  3BHP A;  1QBZ A;  4PDR A;  5H9C A;  1M1K W;  4NTX A;  4I50 B;  2YI9 A;  5J2T B;  3B77 A;  1XEQ A;  3S3W A;  5BMV A;  2NNU A;  3RFR A;  2UXB B;  4JI7 B;  3ZMU A;  1FXK C;  1DK1 A;  2UXC B;  3C90 A;  5EBM C;  3W7S A;  5GTI Z;  1W0K G;  2JDI G;  4O4H A;  3ZHU A;  5H2F Z;  1ZL8 A;  3I5D A;  5KUK A;  4B3S B;  1SER A;  3N2G B;  4LF6 B;  4LF4 B;  1SKV A;  4FFB B;  1S3J A;  3A0H Z;  5FL7 G;  3OMA B;  2LP7 A;  2Q73 A;  3CP1 A;  5IJ9 A;  1M5I A;  2YIB A;  4DV7 B;  3OTO B;  2XAG A;  3JAL B;  1XHZ A;  2Z5U A;  5CA0 A;  5JVD B;  2FML A;  2Q68 A;  3JSN A;  3JAT A;  1AIL A;  3EVK A;  4OX9 B;  4PEL A;  2E5L B;  3M8A A;  4DR4 O;  4X64 B;  3STL C;  1VMG A;  1J5E O;  1R6K A;  2OT5 A;  1U97 A;  1IBM B;  2IH3 C;  5J2U A;  2Y48 A;  2IJK A;  4XDL A;  1LUW A;  4PA4 A;  3CCM V;  3DXR A;  1VQK V;  1KP2 A;  1SA0 B;  2QKC A;  1Q90 D;  4Z1M G;  2JRI A;  4X66 O;  3AG7 A;  1JX9 A;  4ABM A;  1RP3 B;  3ZMS A;  5F2V O;  1AP6 A;  4A5U B;  3WB2 A;  4MVS A;  2HKO A;  3CRC A;  1JCH A;  1AI4 A;  4ZKI A;  1KUQ A;  2YEV B;  3JD0 A;  2UXX A;  4YY3 O;  5J2U B;  3OEE G;  4Z1V A;  1D5A A;  3GWK C;  2JGD B;  1AI7 A;  2K9P A;  1JR9 A;  4CS3 A;  3ZMV A;  1I5X A;  4ZHQ B;  3SJA C;  4K0K O;  4F6R B;  1BQ0 A;  1XI1 A;  2PY5 A;  2MW2 B;  1PM9 A;  1GN3 A;  2DQ0 A;  2P67 A;  1SZT A;  3X2Q C;  3K5N A;  4TQD A;  1VF5 B;  1H8H G;  3C3S A;  3MD0 A;  2BSK B;  5A9G A;  2WLK A;  1NH2 B;  3HKC B;  2FYU H;  1O9H A;  2P7T C;  4DXW A;  4I7Z B;  3OGI B;  3ETQ A;  2OWO A;  3SPC A;  1G1X B;  1YIT V;  2YXL A;  2YSU B;  2OIG A;  2P4K A;  4X1K B;  4XDJ A;  3N2K A;  4Q6G A;  2DWD C;  3CCL V;  4LF4 O;  3JAR B;  5ITZ A;  3CRM A;  5KLV H;  2ZR2 A;  3L73 H;  4I55 B;  2CH7 B;  1GN2 A;  1MG1 A;  1WAZ A;  4L8J A;  4PI0 A;  4TT3 G;  3T1H B;  2CTW A;  5BZB A;  5EC2 C;  5KHH A;  5KHJ A;  3D3Q A;  1XNQ B;  4B7E A;  4X89 A;  5IT9 N;  3Q4H B;  4LF9 O;  4MVQ A;  1Q82 W;  4KL1 A;  4I9W A;  4UCU A;  4JTA B;  4YIP A;  5EIB C;  2EIL C;  1VAR A;  4JI1 O;  1K5Q A;  2QGN A;  3H1H H;  3CCQ V;  2ZKO A;  4NKG B;  1BS3 A;  2ZE8 A;  3DSQ A;  1XUQ A;  1VF6 C;  2M7W A;  2JS3 A;  4GX2 A;  4JZG A;  4P30 A;  2YC0 A;  1K3E A;  4FZ0 A;  4IHJ A;  3I55 V;  4O4L A;  5B1B B;  3KCX A;  4J9Z B;  4DR2 B;  2JEU A;  5JH7 A;  4DUZ B;  1GN6 A;  1FJG B;  4RO2 A;  3JD4 A;  2GBO A;  2P4V A;  2RQ6 A;  4TWK A;  2OCH A;  3RGB A;  2BOB C;  4MVM A;  3ZED A;  5EZY B;  2JK5 C;  3CME V;  2H8P C;  4GUN A;  1FXK B;  2UXD B;  3ZX6 A;  4JYC A;  2A9H A;  4GX0 A;  2HVK C;  3ZCC A;  2MK3 A;  3H1J H;  3E35 A;  4JGS A;  3F5T A;  3K08 A;  1EN5 A;  2EIJ B;  2UUB B;  5CMU A;  5KAF Z;  1I7F A;  1KBH A;  2CE4 A;  3B8M A;  3WB0 A;  2WLI A;  2KQX A;  2ZXW C;  1S5L Z;  5CBH A;  2OTJ V;  5HFL A;  1SQQ H;  1XNR B;  2HJF C;  4JYA B;  3CCV V;  1W0J G;  3A0R A;  3L75 H;  4FFB A;  3QO5 A;  1URF A;  4OGQ B;  4BWA A;  3JAK B;  1K4C C;  5CA1 B;  3M7M X;  3CPW U;  4FPP A;  2UUA B;  3G6E V;  3E8G A;  4AHC A;  2EJR A;  3PN1 A;  4PA6 A;  1R3I C;  4X1K A;  4DRX B;  1XL6 A;  5FPO A;  3MDS A;  4MVO A;  3U0Z A;  4DR3 O;  1P7G A;  1O9G A;  3SYC A;  4HYO A;  1HNZ O;  1FFT B;  2YIA A;  4G27 B;  1YHQ V;  2DYR B;  5BXZ A;  1Y4M A;  1G4Y B;  1E79 G;  4JI8 B;  2WLN A;  1GK9 A;  1M93 A;  2BOC C;  4PDV A;  3OMI B;  4EFE A;  1GAX A;  1YTF B;  5CB4 B;  3ASN C;  4O4J B;  2R70 A;  4J7J A;  4BW5 A;  1I0H A;  2NLJ C;  4WFE A;  1WP7 A;  2RJZ A;  4K35 A;  2XND G;  3JAK A;  3AG2 C;  1K4D C;  1OCC B;  3KKY A;  2B1I A;  4BAY A;  2CTQ A;  1QR9 A;  3BVO A;  3J81 N;  1XRE A;  4K8Z A;  1R3L C;  2WLL A;  2QA4 V;  2QWN B;  2ZNJ A;  1ZTE A;  4GX5 A;  4I5S A;  1BGY H;  2QM7 A;  5KAI Z;  1FXV A;  1S0V A;  2KSD A;  2LJ2 A;  4IIJ B;  4PDL A;  1I94 O;  4MSW C;  4MVU A;  3H1L H;  1PPJ H;  1X4T A;  4X20 B;  4U3F H;  4J7Z A;  3W7W A;  5IYC O;  4DV5 B;  1VQ5 V;  1AJQ A;  4B08 A;  4DR2 O;  4FLX A;  5LL6 Y;  2PUS A;  4FLY A;  3JAR A;  1H8E G;  4FJC C;  5LXT A;  3CB2 A;  2GDS A;  4QIW F;  1M57 C;  3TJT A;  1H38 A;  2GTA A;  2RCV A;  1HP8 A;  5B1N A;  4FLU A;  1AI5 A;  4CC6 A;  2ZE6 A;  2W6I G;  2N05 A;  1PP9 H;  3E86 A;  4TV9 B;  4JYY A;  5TIS Z;  3CC7 V;  1EN4 A;  1TVK A;  4O2B B;  4JI5 B;  4YJ3 B;  2GUZ A;  2Q7H A;  2UUB O;  3L74 H;  4DR5 B;  3J7A U;  1N32 B;  3AK3 A;  4LF9 B;  2FKX A;  3BRC A;  1IXM A;  1NU1 H;  3F7Y C;  3SYO A;  1H2S B;  1AI6 A;  1NQT A;  3LDE A;  3P3P A;  2QWR B;  5GTH Z;  3OUS A;  3A2F A;  2YXY A;  3B09 A;  1AR5 A;  5IYZ B;  3IFX A;  1JJO A;  2E5L O;  4NVP A; 
#chains in the Genus database with same CATH homology
 4JI1 O;  4B3M O;  2ZKO A;  2VQF O;  4AQY O;  4DV1 O;  1IBL O;  2UU9 O;  3T1H O;  4LF5 O;  4GKK O;  5IWA O;  4A5U B;  4DV7 O;  1AB3 A;  4B3T O;  4NXM O;  1HNX O;  4DV6 O;  1HNW O;  1KUQ A;  4KHP O;  1FJG O;  4YY3 O;  4JV5 O;  4DV0 O;  1FKA O;  1XMO O;  4DV3 O;  2LW7 A;  2Z0A A;  2AGA A;  4JI2 O;  4LF8 O;  5BY1 A;  3J81 N;  2N74 A;  4LFA O;  4X65 O;  4OPH A;  4OX9 O;  1XEQ A;  1A32 A;  5BR8 O;  4JI0 O;  1R6T A;  4OPA A;  4LF6 O;  4DUY O;  5LMN O;  4JI4 O;  4DR6 O;  1IBK O;  1DK1 A;  1N36 O;  1YZB A;  4K0K O;  4JI3 O;  2DJV A;  1I94 O;  5BXZ A;  1D2D A;  5H5N A;  4X64 O;  3R66 A;  4LFB O;  4YHH O;  2DOS A;  1F7Y A;  4DR2 O;  3JAM N;  5LL6 Y;  3SDL A;  5FLX N;  2UXC O;  4X62 O;  3F5T A;  4B3R O;  1IBM O;  1R1B A;  1N32 O;  1N33 O;  2UUA O;  1XMQ O;  1G1X B;  5LMU O;  4LF7 O;  4JI6 O;  4DR7 O;  4LFC O;  1N34 O;  2UXD O;  2F4V O;  1X59 A;  1AIL A;  4DUZ O;  4LF4 O;  4B3S O;  4NXN O;  4DV2 O;  3O65 A;  4JI5 O;  4JYA O;  4DR1 O;  2UUB O;  3M8A A;  3J7A U;  4DR4 O;  4JI7 O;  4DV4 O;  1FYJ A;  2FKX A;  3T1Y O;  1J5E O;  3OTO O;  1XNR O;  1HR0 O;  5A2Q N;  4GKJ O;  4DR5 O;  2ZM6 O;  2UUC O;  4JI8 O;  2HHH O;  2VQE O;  4DV5 O;  5IT9 N;  3RT3 C;  3J80 N;  4LF9 O;  4DR3 O;  1XNQ O;  1HNZ O;  1NS1 A;  2JRI A;  4X66 O;  2E5L O;  2UXB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...