1XNRO

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xnrO00
2ZKOA 2F4VO 5A2QN 4JYAO 2AGAA 4JI7O 1HNWO 1N33O 4AQYO 4JI5O 4OPHA 1KUQA 3T1HO 4X65O 5IT9N 1IBMO 4DR3O 4DUYO 4K0KO 5BR8O 4JI6O 5IWAO 3SDLA 4YHHO 4DR6O 1X59A 1R1BA 2JRIA 4DV5O 1HR0O 2UUCO 4LF6O 4YY3O 4DV0O 1XNQO 2UXBO 1J5EO 2DOSA 4LF8O 2UU9O 4DR1O 4JI3O 4DV4O 2LW7A 1XEQA 4X62O 2UXDO 1N32O 5FLXN 1HNZO 1F7YA 4B3TO 1FJGO 4DV7O 1XNRO 1G1XB 3JAMN 5H5NA 5BY1A 4B3MO 4B3RO 3O65A 1I94O 2FKXA 3M8AA 4DV1O 1DK1A 1A32A 1R6TA 4X66O 2N74A 4LF9O 4GKJO 4NXNO 5LL6Y 4JI1O 1FYJA 4A5UB 4X64O 2DJVA 3J80N 4B3SO 1IBKO 5LMNO 3J7AU 1NS1A 4DV6O 2UUBO 3RT3C 4OPAA 4LFCO 4JI2O 4NXMO 4LFAO 2E5LO 3R66A 4DR4O 4DV3O 4OX9O 2UXCO 2ZM6O 3T1YO 4JV5O 4DR7O 2UUAO 4JI8O 1HNXO 1XMQO 1XMOO 4JI0O 4LFBO 4DV2O 4LF7O 2VQFO 4KHPO 5LMUO 4LF4O 3F5TA 4DR5O 5BXZA 1FKAO 1AB3A 1D2DA 1YZBA 3OTOO 4DR2O 4DUZO 2HHHO 4JI4O 2VQEO 4LF5O 4GKKO 1AILA 1IBLO 3J81N 1N34O 2Z0AA 1N36O
chains in the Genus database with same CATH superfamily
2EIKC 1NR1A 3SYAA 1BHBA 3CXHF 3AG1C 2YIBD 5HFLA 4X65O 2PI5A 4P9OA 5IT9N 3CD6V 1YJWV 4DUYO 4FLZA 3UO2A 4YHHO 5J2TB 1THZA 1M1KW 4YJ2A 2EZOA 3CWBH 1QLEB 3AEIA 2XAHA 5KA6A 1NH2D 3FAVA 4MT8A 4RWUA 3STZC 1ZX3A 5J9PC 5LMNB 1H8HG 3BFRA 5EBWC 3W7SA 3H1IH 3RYCA 2QKCA 4LFCB 1SA0A 1XQ8A 1EBOA 3B8MA 1IVSA 4CBCA 2WWWA 2EIMB 3M8AA 3CCLV 1R6TA 2CTRA 2UUAB 3L75H 4H33A 1JVMA 1D5NA 5LMNO 3VQWA 5IY5C 4LFCO 3OTFA 3ABKC 4LNUA 4FPPA 4F4LA 3JAWB 3OMAB 1ZTEA 5JVDA 3RGBA 4P30A 4PELA 1K4CC 1CP9A 2BSKB 3LSQA 2RMKB 3RYHA 2UUAO 3ABMB 1XMQO 2AW9A 3QVNA 4LCUC 3HKCA 4XDKA 1QQCA 2BTQA 1JX9A 3K5LA 3H1KH 3LUTB 4PHZA 2VRZA 4TV9A 3OFNG 5CB4B 1Y76A 2KG7A 5FPOA 4I50B 3ASOB 5TISZ 3MDSA 4DXWA 2UXXA 1I7FA 3B4SA 1AI6A 5KUMA 2WLKA 4JYAO 5IYDO 5B3SC 3RFRA 1TUBA 3JASA 5ITZB 3T1HO 2LFRA 5B1OA 2IJJA 4EFEA 4FM2A 1PL4A 3WG7B 1NBMG 5LXTB 3A0BZ 4J80A 1IURA 3TETA 1MABG 1WA8A 4GT1A 4MVZA 3B77A 1AP5A 3CE2A 2DOSA 5LHGA 1XEQA 5KHHA 2ZE7A 2OCCC 1KYOF 4PD4F 3ZHTA 2PYJA 2X6AA 2XHBA 1VQ8V 2NLJC 2EJRA 2MW2B 3AK2A 1A32A 5B1BC 4WFEA 4YJ3A 4DV1B 3ZRWA 5EIBD 2W6IG 4J10A 3MHSC 2PI4A 1H2GA 3MAQA 4NVPA 3ETQA 3B8NA 4GX5A 3P30A 3JD3A 1YJNV 1GMGA 3QF7A 1GK9A 3F7YC 1QBZA 4UB6Z 1AR4A 3L70H 4PA7A 4QPJA 4LFBO 3L73H 2JEUA 3K04A 3EVKA 3JARB 4CS4A 1RPRA 1OCCC 4DRXA 4DR5O 3BA8A 1D2DA 4DR2O 1U96A 1R6NA 3JD4A 3RW0A 5L3EA 3ETGA 2EIJB 2DW4A 1YDXA 5KAIZ 4Z2WA 3STLC 1M4UA 3CJHB 4FJCC 3FB8C 5C8YA 1HP8A 4ICGA 4JI6O 1TVKA 3JD2A 1S5JA 3VQVA 4K0KB 2YICA 4TV8A 4DV0O 1ZL8B 3ZJZA 3VQYA 2B5UA 5L3CA 2UU9O 3IAYA 1EN6A 1JR9A 2W0XA 5LA6A 4FM0A 2W0FC 3GB7C 2ZCEA 1K73W 4O2AB 1VQOV 2P6JA 2F23A 3THOA 2LFSA 4B3MB 1FS0G 3T4DA 4XDJA 3FB7C 3OR7C 5LGNA 4JI1O 1VQNV 3CRAA 4TQDA 2Q73A 4WFAV 4U7OA 3D3IA 3RT3C 1Q3EA 3FFQA 4JI2O 2GUZA 1Z2GA 3GWOA 2ZINA 4ABMA 2ITCC 3T1CA 5IYZB 3HKEA 2A3QA 1GN2A 1KKCA 3UT5B 2DYRC 1XMOO 4WBNB 1PV0A 5CA0B 1LUVA 1HNWB 4RO2A 3C90A 2VQFO 3KCXA 1KQSU 4XBFA 1LUWA 3AK3A 4D7TA 4UCRA 2VQEB 1JJOA 4X1KA 3OT7A 1HNWO 3AG3B 4JI5O 3OW2U 4E4EA 4J9YB 3SYPA 3RBZA 5JJJB 5LHHA 2XAJA 5LYJB 3ZHUA 4IIJB 5BR8O 1XL6A 4I55B 5IJ0B 4O4HB 3LDEA 2YEVA 1KB9F 1MZFA 5BZBA 1NH2B 2DQ3A 1WLEA 1Y74B 1KU9A 3CMAV 1R3KC 4LWSA 5JQGB 4JI3B 1N32O 4DV6B 3W7WA 1H2MA 4PI2A 1BQ0A 1CPYA 1G1XB 1BE3H 1TUEB 1FJGB 2E74B 4PA3A 3ICXA 3QTCA 2LGWA 5F2VO 1I94B 2ETNA 3TXSA 3VBBA 3ZEDA 1VQ4V 3CXCU 1TAEA 1YITV 1V55B 4BWAA 1FAFA 5E1AC 2D2CB 2DJVA 3K0DA 3E89A 1VQ9V 1IBKO 1SRYA 4H44B 3AG4B 4DV6O 1QLEC 4YJ2B 3BY6A 3K06A 1RP3B 1VQ7V 2XAFA 5JCOA 3FAVB 2BOCC 3D3QA 1N0JA 2UXCO 5EBMC 1QCEA 3OTOB 3JAKA 3IFXA 4UV8A 3N27A 3OUSA 3RYCB 4AILC 1SA0B 2Q7EA 1YEWA 5L3FA 1SQXH 4RQEA 2JGDA 2QKSA 2EIMC 3HB3B 1PL0A 4L8JA 1P84F 4QJFB 2R9AA 3OTOO 4GKKO 2PTMA 4JI4B 4MVUA 3K03A 1IBLB 4LNUB 2QWRB 1Q86W 2F4VO 5JVDB 4UCVA 3IC9A 2Q7HA 1VARA 5EZYA 3ABMC 3RYHB 5CA1A 3A0RA 3AG7A 3HKCB 1IBMB 3SDLA 2BTQB 5FNVA 2HEPA 1KP2A 4UFZA 5EBLC 3SJAC 4TV9B 5KHKA 3RWRD 1Y76B 2KG7B 2XOKG 4I0XA 3WFVA 1QLNA 3T4ZA 5EYPA 1WAZA 2RN9A 1OCRC 1F7YA 1PKXA 4JTCB 3TJTA 1XNRO 2E5LB 1TUBB 3JASB 1FFXB 1VF6A 5DEDA 4X66O 1M56B 3LNMB 3WG7C 1B3QA 5LL6Y 3F7VC 4PDMA 5H9CA 1NS1A 1QU7A 2HR3A 1WA8B 3QO7A 1S5HC 2ZIMA 2P4KA 2FYUH 2F1MA 4FZ0A 2E5LO 4WBNA 4DV3O 1Y67A 2HHHB 4TT3G 4MS2A 3T1YB 4NR1A 4J41A 1PD3A 1NZ6A 4QPKA 2B9ZA 1VF7A 3ZBHA 1K34A 1RPOA 3CCRV 2JS3A 3OMNB 4E2LA 4KHPO 1GAXA 4LF4O 3SJQC 3S3XA 1QR8A 4YJ3B 3ZRWB 3JD0A 1TA8A 2HHHO 1FD9A 2KQXA 3W7UA 1B04A 5L3DA 2ARHA 3O9OA 1N36O 2ZDIC 2WLLA 4HAMA 4LP8A 1FFTB 1V54B 4PJ0Z 1WB7A 5IE9A 2DYSB 1J5EB 2YDEA 4U3JA 4F6RA 1OHHG 4CH3A 3DTUB 5IJ0A 1Q90D 5K1PA 4RAIA 2EBOA 4X65B 4RQFA 2GDSA 4YXWG 2QGNA 4DUYB 1R1BA 4K3AA 4FM1A 4YY3O 1H8EG 4DRXB 1WP7A 4J11A 1J5EO 3GWKC 5DN6G 4EEQA 1NT2B 1K7DA 4O2BA 1YCIA 1O9GA 2AHYA 3A2FA 2EIJC 5JJNB 1DF4A 2YS8A 3ZMZA 2IW5A 4XDLA 3JD1A 5C8YB 4J9ZB 3N2GA 3HKDA 1TVKB 1FYJA 3EHBB 3OM3B 4D7SA 1G8MA 4TV8B 4I5SA 4UCTA 4MTGA 5KLVH 1Q43A 1SF9A 1P7BA 4GX1A 2Y4UA 1AR1B 4DR4O 4QGPA 1H2LA 2FL4A 3G71V 5LA6B 3WB1A 2AZ0A 4UCUA 1XMQB 3ZRXA 2Q9LA 4P2ZA 4BIZA 5H6QA 4DV2O 1M5IA 1AP6A 2KB1A 1K9MW 4LF7O 4AQYB 2CH7B 3F5TA 4HBNA 4NYKA 1YIJV 3CCUV 5LP6A 3ABUA 3AK1A 1VQKV 2YIAA 4DV5B 5B66Z 1KBHA 3DC5A 3H1HH 1MA1A 2GUZB 2ZKOA 1VP7A 3CRRA 4AHCA 3HKEB 1VEWA 3SPGA 3BEHA 4AQYO 5KHJA 4JYAB 2WAMA 1SESA 2XAGA 3FD9A 5IDJA 4N23A 1SQPH 1KECA 1K8AW 1EN5A 4DW1A 3T1HB 3APQA 2P5OA 1US6A 1X59A 3SYOA 4DV5O 2UUCO 1PM9A 1V9PA 5IYBO 1GM7A 3BHPA 2Q4PA 1AJQA 3D36C 4DW0A 2LP7A 2WLHA 1M93A 3BAAA 1SC5B 4X1KB 1FFXA 4JAUA 2MK3A 3W7XA 3BPZA 3AG3C 4B08A 1DGSA 4J7ZA 3C3TA 2Q67A 1I0HA 3ZMSA 1GKFA 1VQ5V 2WLMA 2LO1A 4FFBA 2HFEC 4PI0A 1PP9H 2YEVB 5GTHZ 2JGUA 1AJPA 1XBLA 5B1NA 5EK0A 4OX9O 2ZM6O 4LWSB 3OMIB 1JFFA 1LR1A 2XASA 1FXKA 4EKWA 4W4LA 1YHQV 1SS3A 4LFBB 1N33B 1UJWB 2GTSA 1WP8A 1M9NA 3HKBA 1V55C 2QWOB 5HFMA 5LBQA 2V7QG 1J95A 2EINB 5GONB 5JH7A 2ILMA 2RJZA 3AG4C 4DR5B 2IU3A 3CB2A 4IGGA 2Z0AA 4DR2B 1AI4A 1HR0B 2R9IA 2WA4A 2CE4A 1GN6A 2LW1A 1N33O 1JPXA 2DWDC 3OE7G 3QG5A 2HVKC 3JAKB 1NTKH 3A8TA 4DV4B 3E8FA 5FL7G 2HP8A 1ZSPA 2JGDB 3UM7A 1EZVH 1AVMA 1IXBA 1SERA 1NTMH 4HNAA 4X1IA 5CA3A 2HKOA 1SQBH 4LH7A 2JRIA 4JI6B 1HR0O 1JQ0A 4TUYA 2YUAA 2IH1C 2PY5A 2QM4A 3K5NA 1XI1A 3P3PA 4DV0B 2VS0A 4GX2A 2QTOA 4DV4O 1I08A 2UU9B 5A9GA 4X62O 1KP3A 4X89A 3ZMVA 3UO3A 2V4DA 2EIKB 1S5LZ 4IHJA 5BY1A 5EZYB 4G28B 5CA1B 3FB5C 4NXNO 2P90A 1EZJA 3CMEV 3U11A 5FNVB 4B3SO 1R6KA 4JI1B 2DMXA 2PZSA 3H01A 1L0NH 4MVRA 1NI8A 4NXMO 2BE3A 3K3WA 4I0XB 2ZR2A 4JI2B 4JV5O 3S3WA 4IYHA 4O4IA 5EYPB 3FYIB 1H2NA 2CH7A 2X7RB 1XMOB 5K1XA 1M56C 1E1RG 5EIBC 4CC5A 2OIGA 4CH6A 4KFMA 1I5YA 2R9RB 3ZCCA 4BR6A 2VQFB 2CTPA 3SJCC 1OCZB 4EB6A 1Q6IA 1AILA 4D6TH 1UFIA 4FLUA 3J81N 3L74H 2RQ6A 1I5XA 4GX0A 1Z5VA 2B1IA 3H1LH 2IM9A 3I56V 3PJSK 2O57A 3TGUH 4TSFG 2KKWA 1K97A 1Q8IA 4JI5B 2DQ0A 3DGEA 4PDLA 2P67A 4WF9V 3Q4HA 2QM8A 1T5EA 5CMUA 3CC4V 5BR8B 2OIEA 1K5SA 5KMGA 2XT9A 4JAAA 2GBOA 3G4SV 2EILB 2OYQA 1Z5WA 4F6EA 4K8ZA 4MTFA 1V54C 2WLLB 2UXDO 3WB0A 1N32B 3IC7A 1K3EA 4JPRA 2P4VA 4DV7O 1MSDA 4U3JB 5H5NA 3RN4A 4F6RB 4FLTA 1S77D 3SPHA 3OD4A 3CCMV 2BTOA 4PV1B 2Y69B 4A5UB 3K58A 2CDYA 2VWKA 5D5PA 1QVGU 1IBKB 3ZX6A 3C3SA 1KD1W 4O2BB 1G6UA 2UXCB 1XOUA 1Q6HA 3HPLC 2ZE8A 1MG1A 2WLJA 1R73A 1ZLZA 5H6RA 5GONA 3CEIA 1B6QA 1JOYA 2ZE6A 4ZHQA 1FXVA 2N04A 3N2GB 2UXNA 3HKDB 1GM8A 4BW9A 2LJ2A 1PNLA 5LOVA 4LF5O 2IJIA 2ZE5A 1NVPB 2AHZA 1MMMA 4TOIA 5D5QA 1D5AA 4GKKB 5IYCO 2YI8A 4UXNA 2CGNA 2L35A 2AGAA 1F23A 2F43G 3SJBC 1BMFG 4LF8B 2F4VB 4HZ3A 2GSMB 4MVMA 1E79G 2QM7A 3B2EE 2KSDA 4G27B 1YJ9V 1ORQC 3N2KA 4P9PA 2QA4V 2ADQB 3ZRSA 4Z1MG 1BHAA 4C7UA 1COWG 4FLXA 2UXBO 2F93B 3R65A 4LF8O 4IYIA 4UVBA 5LP6B 2CUGA 3SYQA 4UVAA 1WN7A 3EXAA 1GRJA 2JJ2G 4NB5A 2QDOA 2CTQA 1NJIW 3CCSV 1DF5A 3CS5A 2LGQA 1XNRB 2ADPA 1VQPV 1JA8A 1W59A 1Y66A 2ZNJA 5EC2C 3K57A 4LH6A 2Y0IA 2FMLA 4X66B 1K33A 5GW7A 1WPBA 4RUEA 3ASOC 3J80N 2PF4E 2X6BA 1K92A 2XUMA 3NXSA 3FB6C 2UUBO 4UB8Z 3LDDA 3G6BA 2P7TC 1RM1B 3AG2B 3BCCH 2A06H 3JCZA 3K5OA 3ABLB 2IU0A 4DV3B 5KHIA 1N34B 3G67A 1HNXO 4JYYA 3OEEG 4J42A 2EZPA 3H9VA 4CS2A 1EN4A 3G6EV 3K0GA 3SPIA 1Q7YW 3SPJA 1U97A 5BXZA 1FKAO 1P7GA 4KHPB 1KC8W 4LF4B 4FFBB 1YZBA 3SPCA 2RDCA 3K79A 1N34O 4DR6B 1HWYA 4QE9A 3WB2A 1N36B 1XNQB 3CPWU 4J7KA 1W2BU 3E8BA 2CK3G 2WPDG 1QVFU 2RNBA 3DSQA 3OGCC 4I4TA 5IJ9B 1OCOB 3ETDA 4UUJC 2D3OW 1JFFB 3P3NA 2OTLV 1FXKB 1BCCH 4JASA 2HG5C 4OXSA 1NTZH 4B3TB 3ZN0A 4DR6O 4B3RB 3HKBB 5C93A 2EINC 2FB5A 1XNQO 2M7WA 4X1YA 4YY3B 1GN3A 5JH7B 4K8XA 4X64B 3LDCA 2OT5A 1XHZA 5JCOC 4N21A 1SZTA 4B3TO 2Q6AA 1G4YB 3G80A 2X6CA 2YIBA 3TXQA 4B3RO 2Q0AA 2JDIG 2YI9A 3A0HZ 2OWOA 1WB8A 1RSOA 3JSNA 4MSWC 4NTXA 4HNAB 3E22A 4X1IB 5BMVA 2HLDG 4X64O 1XUQA 4TUYB 2Q8VA 1N0NA 1RFYA 2DN9A 2PUSA 4DR4B 4JI8O 2H94A 4JI0O 3SGIA 1VQ6V 2QJ1A 4IHJB 1UPGA 2QSAA 3DXRA 5KX5B 2P06A 4JTDB 4DV2B 4W4KA 4LF7B 1QR9A 4R50A 1XILA 4JYBA 2JJ1G 4O4JA 5EC1C 4FLWA 3ASNB 4X9QA 4LF6B 2C2AA 1VIBA 2A79B 1YI2V 3CRQA 2PGGA 4IL6Z 2ODMA 3F5WC 1M57B 4LBEC 3RVYA 1CXZB 2Q0OC 4O4IB 3K08A 1BSMA 4KL1A 5CBGA 3GVMA 4FLYA 1YF2A 4DK0A 2H8PC 4GYCB 1HNZB 4WCEV 4PDVA 1VF6C 4ZI7A 5GTIZ 1NKDA 2ZXWB 2Y4TA 1H2KA 4LF6O 1NVPD 3SR2C 1OCZC 2QWQB 4WFFA 2UUCB 2VWJA 3E8HA 4EB6B 4UCOA 3RYIB 2Y0PA 4FMTA 3ML0A 4MVSA 1NR7A 2LW7A 4JAVA 3HR0A 1YTFB 3RVZA 2WLIA 2RCVA 4WFGA 1HNZO 3CSXA 2A9HA 4LFAB 3JALA 2IBZH 3MD0A 5CBFA 4AI8A 3VOUA 4JZGA 3K59A 4X20A 3L72H 3Q4HB 1BZKA 4CH5A 4H0LB 3PN1A 4NTWA 5KMGB 2ZIOA 4OPAA 2EILC 1W0JG 1WPXA 3CX5F 5LMUB 5B5EZ 4LFAO 4BIOA 3E35A 2ZT9B 4YIPA 2WSSG 1XREA 3TK1A 2G38A 4OX9B 1SZXA 5KHGA 2ZM6B 5AG2A 2FTKA 4L87A 1OCRB 3ZS8C 3D8CA 4X88A 4I9QA 1YSCA 3ABTA 2PYLA 5LMUO 1YVWA 2Y69C 2A0LA 5JWPA 2K1EA 4DR3B 4FK5C 3CCEV 5IJ9A 3KG2A 4MTOA 1SQQH 2W6JG 4FIPC 4GZRB 1GM9A 2R72A 5A2QN 2OTJV 1KMIZ 4JZ2A 2P22C 2IH3C 3RYFA 5J2UA 1K4DC 4OPHA 1NQTA 1S72V 2E76B 3X2QB 4B7KA 4FLVA 2ZNIA 4FVMA 2R70A 2LQTA 1Q81W 4LR3A 2JVDA 4DR3O 3CP1A 1WNSA 1PNKA 4LC1A 4OGQB 4ZHQB 3L9DA 2M6YA 3LSSA 1XL4A 4LF9B 3FYEB 1LNQA 2EX3A 5LOVB 4DO2A 5LHIA 1AI7A 3UQ8A 1XHXA 4X62B 3CHXA 5DM6V 2HJFC 5JJEB 1B06A 2Q69A 2DE0X 3WU2Z 5B1AB 4JYCA 4KUMA 2WLNA 1BT8A 2AZ2A 4DV1O 1SQGA 4LF9O 3I5DA 3ZHQA 4ZOLA 3N2KB 1BL8A 4NXNB 4O4LA 4B3SB 3OUFA 4U7NA 1GN4A 5LP6C 2ZR3A 3U10A 1E1QG 1MNGA 4MVOA 4NXMB 1IZ3A 5L3BA 3AG1B 2EULA 5KX5A 4JV5B 3OR6C 2NR5A 1VQLV 3VQXA 2CGOA 5J2TA 2YXHA 1DTOA 3CYOA 3T2MA 4ZKIA 3NR7A 1AB3A 2AXTZ 2BOBC 1CEZA 4HYOA 1R3LC 1RM1C 1JMKC 3AG2C 1Q82W 3ABLC 3CCJV 2IJHA 4J7JA 4JGSA 3BRCA 5LGUA 1AJNA 4K0KO 3M99B 3RYIA 4Q6GA 3ZRVA 3FKSG 1S76D 4CS3A 5DECA 1BS3A 4BIUA 4QIWF 5IY5B 3JATB 4PA6A 3ABKB 3JAWA 3ZHRA 2Q5ZA 1R3JC 5CBHA 4JF3A 1Q5OA 2QTSA 2BSKA 3JCUZ 1EFRG 1ZWIC 5FLXN 4CC6A 3K5MA 4RUFA 2QEXV 2UXDB 1OCOC 4G2KA 2CAZC 3ETEA 4I4TB 5L3GA 1GH6A 4B3MO 3JYCA 3O65A 4DV7B 3W7TA 1P4RA 3E86A 4DR7B 1FXKC 1VF5B 3B09A 4Z1VA 3CC2V 1L1FA 5CB4A 3P32A 1IX9A 3LSUA 4I50A 3BABA 2B1GA 3LNNA 4X1YB 1YTFD 2CTWA 2QKAA 4H13B 1F51A 1PPJH 2DYSC 4DUZB 4MTXA 3K9SA 1F4MA 4DYLA 5B3SB 3E83A 4DR7O 5ITZA 3UKMA 1Q6UA 3QO5A 2JK5C 4EFBA 4GCZA 4JI7B 3OAAG 2Q7GA 5LXTA 1RSOB 3CCQV 2JS5A 4FFKA 4U3FH 3E22B 5BMVB 2Y48A 3I55V 4DUZO 4UVCA 2VQEO 4JTAB 5IWAB 4LF5B 2QR4A 5FPRA 4I9WA 1VMGA 2OCCB 3OGIB 3U0ZA 3K9AA 4JI7O 3ZIAG 4NTYA 4R6ZA 2K9PA 1S0VA 4DR1B 4X8AA 1OV9A 3KZIZ 1KUQA 1ENVA 1R3IC 5B1BB 2HVJC 3DXRB 5IWAO 1VQMV 1ZUQA 1DLBA 2GV9A 3QNEA 2NN4A 2DWEC 2F95B 1HDJA 1MZEA 4GKJB 2ZDIA 2H3OA 3ASNC 4GUNA 1O9HA 4O4JB 2UXBB 1Y6XA 4DR1O 2BCCH 4JI3O 3BA9A 3EFFK 1MOFA 2HJDA 2ATKC 4UCSA 1M57C 3APOA 2WA3A 1FJGO 3B40A 4MW3A 4DK1A 1FPOA 4R7CA 2YXYA 1WJZA 1I94O 2FKXA 4R8CA 3JARA 1L0LH 1NU1H 4GKJO 3FX7A 2X0LA 3E8GA 2ZXWC 2XTAA 4KP4A 1OCCB 4ZI7B 3JSLA 4WFHA 1IXMA 1BGYH 2XAQA 4QNHB 4IT5A 4CZZA 1XDCA 2UUBB 1AI5A 3H1JH 2QWPB 1AR5A 2JIZG 4PDRA 3KCYA 2YC0A 3CRMA 2WLIB 3CJHA 3L71H 3M7MX 4YIOA 1HNXB 3ZMTA 3JALB 2ZQMA 1OZ0A 1Y4MA 1EM1A 4UV9A 3UCSC 2N05A 2XNDG 1MSWD 4X20B 3CC7V 4PA4A 1SQFA 1ZL8A 1QNMA 1M90W 4JI4O 3BVOA 1IBLO 1IDSA 4TQFA 2E3CA 3SYCA 1ROPA 1SKVA 2E75B 1SETA 1OJHA 3CCVV 1FXHA 5KUKA 3DC6A 4O2AA 4MVQA 5LGTA 4H37A 2EJ7A 3E2EA 1QHTA 1IBMO 3CRCA 3JATA 1GTOA 1JJ2U 1TGOA 3QO8A 3ZHVA 1URFA 1JCHA 3ZMUA 2GTAA 4TWKA 4KXRA 3IJ4A 2Z3YA 5IYZA 2JEXA 1H2SB 3UT5A 4CH4A 5CN0A 2DYRB 5E79Z 1F4NA 2QWNB 3ZN1A 2Q68A 3JAMN 3RYFB 2YIDA 2ZD9A 3MHHC 5J2UB 5CA0A 3X2QC 1KKDA 1S3JA 4FZ1A 1DK1A 2N74A 4ZIBA 4QE7A 4PA9A 4Q20A 3OEHG 2A7WA 3KKYA 5H2FZ 3TCUA 2YXLA 3J7AU 1X4TA 1H38A 3D36A 4ZBMA 1P49A 1SQVH 1YXBA 4WFBV 5KA5A 1N8RW 2IJKA 3R66A 4GLXA 4B7EA 1HW7A 3T1YO 4MW8A 5KAFZ 1PNMA 2NNUA 1W0KG 2OCHA 4NKGB 3IGAC 5LYJA 4JI8B 5B1AC 2L6LA 1BQZA 1ZAUA 2ITDC 4IIJA 3ZHSA 2YSUB 4I7ZB 4BW5A 4JI0B 4I55A 4O4HA 1N4CA 1K5QA 4ZOLB 2V1DA 2QE7G 2Z5UA 4ASUG 4BAYA 4O4LB 1Y74A 2F66C 1AROP 4YHHB 5JQGA 1GO3F 4K35A 1L8DA 2GHYA
chains in the Genus database with same CATH topology
2ZKOA 2F4VO 5A2QN 4JYAO 2AGAA 4JI7O 1HNWO 1N33O 4AQYO 4JI5O 4OPHA 1KUQA 3T1HO 4X65O 5IT9N 1IBMO 4DR3O 4DUYO 4K0KO 5BR8O 4JI6O 5IWAO 3SDLA 4YHHO 4DR6O 1X59A 1R1BA 2JRIA 4DV5O 1HR0O 2UUCO 4LF6O 4YY3O 4DV0O 1XNQO 2UXBO 1J5EO 2DOSA 4LF8O 2UU9O 4DR1O 4JI3O 4DV4O 2LW7A 1XEQA 4X62O 2UXDO 1N32O 5FLXN 1HNZO 1F7YA 4B3TO 1FJGO 4DV7O 1XNRO 1G1XB 3JAMN 5H5NA 5BY1A 4B3MO 4B3RO 3O65A 1I94O 2FKXA 3M8AA 4DV1O 1DK1A 1A32A 1R6TA 4X66O 2N74A 4LF9O 4GKJO 4NXNO 5LL6Y 4JI1O 1FYJA 4A5UB 4X64O 2DJVA 3J80N 4B3SO 1IBKO 5LMNO 3J7AU 1NS1A 4DV6O 2UUBO 3RT3C 4OPAA 4LFCO 4JI2O 4NXMO 4LFAO 2E5LO 3R66A 4DR4O 4DV3O 4OX9O 2UXCO 2ZM6O 3T1YO 4JV5O 4DR7O 2UUAO 4JI8O 1HNXO 1XMQO 1XMOO 4JI0O 4LFBO 4DV2O 4LF7O 2VQFO 4KHPO 5LMUO 4LF4O 3F5TA 4DR5O 5BXZA 1FKAO 1AB3A 1D2DA 1YZBA 3OTOO 4DR2O 4DUZO 2HHHO 4JI4O 2VQEO 4LF5O 4GKKO 1AILA 1IBLO 3J81N 1N34O 2Z0AA 1N36O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZKO A;  2F4V O;  5A2Q N;  4JYA O;  2AGA A;  4JI7 O;  1HNW O;  1N33 O;  4AQY O;  4JI5 O;  4OPH A;  1KUQ A;  3T1H O;  4X65 O;  5IT9 N;  1IBM O;  4DR3 O;  4DUY O;  4K0K O;  5BR8 O;  4JI6 O;  5IWA O;  3SDL A;  4YHH O;  4DR6 O;  1X59 A;  1R1B A;  2JRI A;  4DV5 O;  1HR0 O;  2UUC O;  4LF6 O;  4YY3 O;  4DV0 O;  1XNQ O;  2UXB O;  1J5E O;  2DOS A;  4LF8 O;  2UU9 O;  4DR1 O;  4JI3 O;  4DV4 O;  2LW7 A;  1XEQ A;  4X62 O;  2UXD O;  1N32 O;  5FLX N;  1HNZ O;  1F7Y A;  4B3T O;  1FJG O;  4DV7 O;  1XNR O;  1G1X B;  3JAM N;  5H5N A;  5BY1 A;  4B3M O;  4B3R O;  3O65 A;  1I94 O;  2FKX A;  3M8A A;  4DV1 O;  1DK1 A;  1A32 A;  1R6T A;  4X66 O;  2N74 A;  4LF9 O;  4GKJ O;  4NXN O;  5LL6 Y;  4JI1 O;  1FYJ A;  4A5U B;  4X64 O;  2DJV A;  3J80 N;  4B3S O;  1IBK O;  5LMN O;  3J7A U;  1NS1 A;  4DV6 O;  2UUB O;  3RT3 C;  4OPA A;  4LFC O;  4JI2 O;  4NXM O;  4LFA O;  2E5L O;  3R66 A;  4DR4 O;  4DV3 O;  4OX9 O;  2UXC O;  2ZM6 O;  3T1Y O;  4JV5 O;  4DR7 O;  2UUA O;  4JI8 O;  1HNX O;  1XMQ O;  1XMO O;  4JI0 O;  4LFB O;  4DV2 O;  4LF7 O;  2VQF O;  4KHP O;  5LMU O;  4LF4 O;  3F5T A;  4DR5 O;  5BXZ A;  1FKA O;  1AB3 A;  1D2D A;  1YZB A;  3OTO O;  4DR2 O;  4DUZ O;  2HHH O;  4JI4 O;  2VQE O;  4LF5 O;  4GKK O;  1AIL A;  1IBL O;  3J81 N;  1N34 O;  2Z0A A;  1N36 O; 
#chains in the Genus database with same CATH topology
 2EIK C;  1NR1 A;  3SYA A;  1BHB A;  3CXH F;  3AG1 C;  2YIB D;  5HFL A;  4X65 O;  2PI5 A;  4P9O A;  5IT9 N;  3CD6 V;  1YJW V;  4DUY O;  4FLZ A;  3UO2 A;  4YHH O;  5J2T B;  1THZ A;  1M1K W;  4YJ2 A;  2EZO A;  3CWB H;  1QLE B;  3AEI A;  2XAH A;  5KA6 A;  1NH2 D;  3FAV A;  4MT8 A;  4RWU A;  3STZ C;  1ZX3 A;  5J9P C;  5LMN B;  1H8H G;  3BFR A;  5EBW C;  3W7S A;  3H1I H;  3RYC A;  2QKC A;  4LFC B;  1SA0 A;  1XQ8 A;  1EBO A;  3B8M A;  1IVS A;  4CBC A;  2WWW A;  2EIM B;  3M8A A;  3CCL V;  1R6T A;  2CTR A;  2UUA B;  3L75 H;  4H33 A;  1JVM A;  1D5N A;  5LMN O;  3VQW A;  5IY5 C;  4LFC O;  3OTF A;  3ABK C;  4LNU A;  4FPP A;  4F4L A;  3JAW B;  3OMA B;  1ZTE A;  5JVD A;  3RGB A;  4P30 A;  4PEL A;  1K4C C;  1CP9 A;  2BSK B;  3LSQ A;  2RMK B;  3RYH A;  2UUA O;  3ABM B;  1XMQ O;  2AW9 A;  3QVN A;  4LCU C;  3HKC A;  4XDK A;  1QQC A;  2BTQ A;  1JX9 A;  3K5L A;  3H1K H;  3LUT B;  4PHZ A;  2VRZ A;  4TV9 A;  3OFN G;  5CB4 B;  1Y76 A;  2KG7 A;  5FPO A;  4I50 B;  3ASO B;  5TIS Z;  3MDS A;  4DXW A;  2UXX A;  1I7F A;  3B4S A;  1AI6 A;  5KUM A;  2WLK A;  4JYA O;  5IYD O;  5B3S C;  3RFR A;  1TUB A;  3JAS A;  5ITZ B;  3T1H O;  2LFR A;  5B1O A;  2IJJ A;  4EFE A;  4FM2 A;  1PL4 A;  3WG7 B;  1NBM G;  5LXT B;  3A0B Z;  4J80 A;  1IUR A;  3TET A;  1MAB G;  1WA8 A;  4GT1 A;  4MVZ A;  3B77 A;  1AP5 A;  3CE2 A;  2DOS A;  5LHG A;  1XEQ A;  5KHH A;  2ZE7 A;  2OCC C;  1KYO F;  4PD4 F;  3ZHT A;  2PYJ A;  2X6A A;  2XHB A;  1VQ8 V;  2NLJ C;  2EJR A;  2MW2 B;  3AK2 A;  1A32 A;  5B1B C;  4WFE A;  4YJ3 A;  4DV1 B;  3ZRW A;  5EIB D;  2W6I G;  4J10 A;  3MHS C;  2PI4 A;  1H2G A;  3MAQ A;  4NVP A;  3ETQ A;  3B8N A;  4GX5 A;  3P30 A;  3JD3 A;  1YJN V;  1GMG A;  3QF7 A;  1GK9 A;  3F7Y C;  1QBZ A;  4UB6 Z;  1AR4 A;  3L70 H;  4PA7 A;  4QPJ A;  4LFB O;  3L73 H;  2JEU A;  3K04 A;  3EVK A;  3JAR B;  4CS4 A;  1RPR A;  1OCC C;  4DRX A;  4DR5 O;  3BA8 A;  1D2D A;  4DR2 O;  1U96 A;  1R6N A;  3JD4 A;  3RW0 A;  5L3E A;  3ETG A;  2EIJ B;  2DW4 A;  1YDX A;  5KAI Z;  4Z2W A;  3STL C;  1M4U A;  3CJH B;  4FJC C;  3FB8 C;  5C8Y A;  1HP8 A;  4ICG A;  4JI6 O;  1TVK A;  3JD2 A;  1S5J A;  3VQV A;  4K0K B;  2YIC A;  4TV8 A;  4DV0 O;  1ZL8 B;  3ZJZ A;  3VQY A;  2B5U A;  5L3C A;  2UU9 O;  3IAY A;  1EN6 A;  1JR9 A;  2W0X A;  5LA6 A;  4FM0 A;  2W0F C;  3GB7 C;  2ZCE A;  1K73 W;  4O2A B;  1VQO V;  2P6J A;  2F23 A;  3THO A;  2LFS A;  4B3M B;  1FS0 G;  3T4D A;  4XDJ A;  3FB7 C;  3OR7 C;  5LGN A;  4JI1 O;  1VQN V;  3CRA A;  4TQD A;  2Q73 A;  4WFA V;  4U7O A;  3D3I A;  3RT3 C;  1Q3E A;  3FFQ A;  4JI2 O;  2GUZ A;  1Z2G A;  3GWO A;  2ZIN A;  4ABM A;  2ITC C;  3T1C A;  5IYZ B;  3HKE A;  2A3Q A;  1GN2 A;  1KKC A;  3UT5 B;  2DYR C;  1XMO O;  4WBN B;  1PV0 A;  5CA0 B;  1LUV A;  1HNW B;  4RO2 A;  3C90 A;  2VQF O;  3KCX A;  1KQS U;  4XBF A;  1LUW A;  3AK3 A;  4D7T A;  4UCR A;  2VQE B;  1JJO A;  4X1K A;  3OT7 A;  1HNW O;  3AG3 B;  4JI5 O;  3OW2 U;  4E4E A;  4J9Y B;  3SYP A;  3RBZ A;  5JJJ B;  5LHH A;  2XAJ A;  5LYJ B;  3ZHU A;  4IIJ B;  5BR8 O;  1XL6 A;  4I55 B;  5IJ0 B;  4O4H B;  3LDE A;  2YEV A;  1KB9 F;  1MZF A;  5BZB A;  1NH2 B;  2DQ3 A;  1WLE A;  1Y74 B;  1KU9 A;  3CMA V;  1R3K C;  4LWS A;  5JQG B;  4JI3 B;  1N32 O;  4DV6 B;  3W7W A;  1H2M A;  4PI2 A;  1BQ0 A;  1CPY A;  1G1X B;  1BE3 H;  1TUE B;  1FJG B;  2E74 B;  4PA3 A;  3ICX A;  3QTC A;  2LGW A;  5F2V O;  1I94 B;  2ETN A;  3TXS A;  3VBB A;  3ZED A;  1VQ4 V;  3CXC U;  1TAE A;  1YIT V;  1V55 B;  4BWA A;  1FAF A;  5E1A C;  2D2C B;  2DJV A;  3K0D A;  3E89 A;  1VQ9 V;  1IBK O;  1SRY A;  4H44 B;  3AG4 B;  4DV6 O;  1QLE C;  4YJ2 B;  3BY6 A;  3K06 A;  1RP3 B;  1VQ7 V;  2XAF A;  5JCO A;  3FAV B;  2BOC C;  3D3Q A;  1N0J A;  2UXC O;  5EBM C;  1QCE A;  3OTO B;  3JAK A;  3IFX A;  4UV8 A;  3N27 A;  3OUS A;  3RYC B;  4AIL C;  1SA0 B;  2Q7E A;  1YEW A;  5L3F A;  1SQX H;  4RQE A;  2JGD A;  2QKS A;  2EIM C;  3HB3 B;  1PL0 A;  4L8J A;  1P84 F;  4QJF B;  2R9A A;  3OTO O;  4GKK O;  2PTM A;  4JI4 B;  4MVU A;  3K03 A;  1IBL B;  4LNU B;  2QWR B;  1Q86 W;  2F4V O;  5JVD B;  4UCV A;  3IC9 A;  2Q7H A;  1VAR A;  5EZY A;  3ABM C;  3RYH B;  5CA1 A;  3A0R A;  3AG7 A;  3HKC B;  1IBM B;  3SDL A;  2BTQ B;  5FNV A;  2HEP A;  1KP2 A;  4UFZ A;  5EBL C;  3SJA C;  4TV9 B;  5KHK A;  3RWR D;  1Y76 B;  2KG7 B;  2XOK G;  4I0X A;  3WFV A;  1QLN A;  3T4Z A;  5EYP A;  1WAZ A;  2RN9 A;  1OCR C;  1F7Y A;  1PKX A;  4JTC B;  3TJT A;  1XNR O;  2E5L B;  1TUB B;  3JAS B;  1FFX B;  1VF6 A;  5DED A;  4X66 O;  1M56 B;  3LNM B;  3WG7 C;  1B3Q A;  5LL6 Y;  3F7V C;  4PDM A;  5H9C A;  1NS1 A;  1QU7 A;  2HR3 A;  1WA8 B;  3QO7 A;  1S5H C;  2ZIM A;  2P4K A;  2FYU H;  2F1M A;  4FZ0 A;  2E5L O;  4WBN A;  4DV3 O;  1Y67 A;  2HHH B;  4TT3 G;  4MS2 A;  3T1Y B;  4NR1 A;  4J41 A;  1PD3 A;  1NZ6 A;  4QPK A;  2B9Z A;  1VF7 A;  3ZBH A;  1K34 A;  1RPO A;  3CCR V;  2JS3 A;  3OMN B;  4E2L A;  4KHP O;  1GAX A;  4LF4 O;  3SJQ C;  3S3X A;  1QR8 A;  4YJ3 B;  3ZRW B;  3JD0 A;  1TA8 A;  2HHH O;  1FD9 A;  2KQX A;  3W7U A;  1B04 A;  5L3D A;  2ARH A;  3O9O A;  1N36 O;  2ZDI C;  2WLL A;  4HAM A;  4LP8 A;  1FFT B;  1V54 B;  4PJ0 Z;  1WB7 A;  5IE9 A;  2DYS B;  1J5E B;  2YDE A;  4U3J A;  4F6R A;  1OHH G;  4CH3 A;  3DTU B;  5IJ0 A;  1Q90 D;  5K1P A;  4RAI A;  2EBO A;  4X65 B;  4RQF A;  2GDS A;  4YXW G;  2QGN A;  4DUY B;  1R1B A;  4K3A A;  4FM1 A;  4YY3 O;  1H8E G;  4DRX B;  1WP7 A;  4J11 A;  1J5E O;  3GWK C;  5DN6 G;  4EEQ A;  1NT2 B;  1K7D A;  4O2B A;  1YCI A;  1O9G A;  2AHY A;  3A2F A;  2EIJ C;  5JJN B;  1DF4 A;  2YS8 A;  3ZMZ A;  2IW5 A;  4XDL A;  3JD1 A;  5C8Y B;  4J9Z B;  3N2G A;  3HKD A;  1TVK B;  1FYJ A;  3EHB B;  3OM3 B;  4D7S A;  1G8M A;  4TV8 B;  4I5S A;  4UCT A;  4MTG A;  5KLV H;  1Q43 A;  1SF9 A;  1P7B A;  4GX1 A;  2Y4U A;  1AR1 B;  4DR4 O;  4QGP A;  1H2L A;  2FL4 A;  3G71 V;  5LA6 B;  3WB1 A;  2AZ0 A;  4UCU A;  1XMQ B;  3ZRX A;  2Q9L A;  4P2Z A;  4BIZ A;  5H6Q A;  4DV2 O;  1M5I A;  1AP6 A;  2KB1 A;  1K9M W;  4LF7 O;  4AQY B;  2CH7 B;  3F5T A;  4HBN A;  4NYK A;  1YIJ V;  3CCU V;  5LP6 A;  3ABU A;  3AK1 A;  1VQK V;  2YIA A;  4DV5 B;  5B66 Z;  1KBH A;  3DC5 A;  3H1H H;  1MA1 A;  2GUZ B;  2ZKO A;  1VP7 A;  3CRR A;  4AHC A;  3HKE B;  1VEW A;  3SPG A;  3BEH A;  4AQY O;  5KHJ A;  4JYA B;  2WAM A;  1SES A;  2XAG A;  3FD9 A;  5IDJ A;  4N23 A;  1SQP H;  1KEC A;  1K8A W;  1EN5 A;  4DW1 A;  3T1H B;  3APQ A;  2P5O A;  1US6 A;  1X59 A;  3SYO A;  4DV5 O;  2UUC O;  1PM9 A;  1V9P A;  5IYB O;  1GM7 A;  3BHP A;  2Q4P A;  1AJQ A;  3D36 C;  4DW0 A;  2LP7 A;  2WLH A;  1M93 A;  3BAA A;  1SC5 B;  4X1K B;  1FFX A;  4JAU A;  2MK3 A;  3W7X A;  3BPZ A;  3AG3 C;  4B08 A;  1DGS A;  4J7Z A;  3C3T A;  2Q67 A;  1I0H A;  3ZMS A;  1GKF A;  1VQ5 V;  2WLM A;  2LO1 A;  4FFB A;  2HFE C;  4PI0 A;  1PP9 H;  2YEV B;  5GTH Z;  2JGU A;  1AJP A;  1XBL A;  5B1N A;  5EK0 A;  4OX9 O;  2ZM6 O;  4LWS B;  3OMI B;  1JFF A;  1LR1 A;  2XAS A;  1FXK A;  4EKW A;  4W4L A;  1YHQ V;  1SS3 A;  4LFB B;  1N33 B;  1UJW B;  2GTS A;  1WP8 A;  1M9N A;  3HKB A;  1V55 C;  2QWO B;  5HFM A;  5LBQ A;  2V7Q G;  1J95 A;  2EIN B;  5GON B;  5JH7 A;  2ILM A;  2RJZ A;  3AG4 C;  4DR5 B;  2IU3 A;  3CB2 A;  4IGG A;  2Z0A A;  4DR2 B;  1AI4 A;  1HR0 B;  2R9I A;  2WA4 A;  2CE4 A;  1GN6 A;  2LW1 A;  1N33 O;  1JPX A;  2DWD C;  3OE7 G;  3QG5 A;  2HVK C;  3JAK B;  1NTK H;  3A8T A;  4DV4 B;  3E8F A;  5FL7 G;  2HP8 A;  1ZSP A;  2JGD B;  3UM7 A;  1EZV H;  1AVM A;  1IXB A;  1SER A;  1NTM H;  4HNA A;  4X1I A;  5CA3 A;  2HKO A;  1SQB H;  4LH7 A;  2JRI A;  4JI6 B;  1HR0 O;  1JQ0 A;  4TUY A;  2YUA A;  2IH1 C;  2PY5 A;  2QM4 A;  3K5N A;  1XI1 A;  3P3P A;  4DV0 B;  2VS0 A;  4GX2 A;  2QTO A;  4DV4 O;  1I08 A;  2UU9 B;  5A9G A;  4X62 O;  1KP3 A;  4X89 A;  3ZMV A;  3UO3 A;  2V4D A;  2EIK B;  1S5L Z;  4IHJ A;  5BY1 A;  5EZY B;  4G28 B;  5CA1 B;  3FB5 C;  4NXN O;  2P90 A;  1EZJ A;  3CME V;  3U11 A;  5FNV B;  4B3S O;  1R6K A;  4JI1 B;  2DMX A;  2PZS A;  3H01 A;  1L0N H;  4MVR A;  1NI8 A;  4NXM O;  2BE3 A;  3K3W A;  4I0X B;  2ZR2 A;  4JI2 B;  4JV5 O;  3S3W A;  4IYH A;  4O4I A;  5EYP B;  3FYI B;  1H2N A;  2CH7 A;  2X7R B;  1XMO B;  5K1X A;  1M56 C;  1E1R G;  5EIB C;  4CC5 A;  2OIG A;  4CH6 A;  4KFM A;  1I5Y A;  2R9R B;  3ZCC A;  4BR6 A;  2VQF B;  2CTP A;  3SJC C;  1OCZ B;  4EB6 A;  1Q6I A;  1AIL A;  4D6T H;  1UFI A;  4FLU A;  3J81 N;  3L74 H;  2RQ6 A;  1I5X A;  4GX0 A;  1Z5V A;  2B1I A;  3H1L H;  2IM9 A;  3I56 V;  3PJS K;  2O57 A;  3TGU H;  4TSF G;  2KKW A;  1K97 A;  1Q8I A;  4JI5 B;  2DQ0 A;  3DGE A;  4PDL A;  2P67 A;  4WF9 V;  3Q4H A;  2QM8 A;  1T5E A;  5CMU A;  3CC4 V;  5BR8 B;  2OIE A;  1K5S A;  5KMG A;  2XT9 A;  4JAA A;  2GBO A;  3G4S V;  2EIL B;  2OYQ A;  1Z5W A;  4F6E A;  4K8Z A;  4MTF A;  1V54 C;  2WLL B;  2UXD O;  3WB0 A;  1N32 B;  3IC7 A;  1K3E A;  4JPR A;  2P4V A;  4DV7 O;  1MSD A;  4U3J B;  5H5N A;  3RN4 A;  4F6R B;  4FLT A;  1S77 D;  3SPH A;  3OD4 A;  3CCM V;  2BTO A;  4PV1 B;  2Y69 B;  4A5U B;  3K58 A;  2CDY A;  2VWK A;  5D5P A;  1QVG U;  1IBK B;  3ZX6 A;  3C3S A;  1KD1 W;  4O2B B;  1G6U A;  2UXC B;  1XOU A;  1Q6H A;  3HPL C;  2ZE8 A;  1MG1 A;  2WLJ A;  1R73 A;  1ZLZ A;  5H6R A;  5GON A;  3CEI A;  1B6Q A;  1JOY A;  2ZE6 A;  4ZHQ A;  1FXV A;  2N04 A;  3N2G B;  2UXN A;  3HKD B;  1GM8 A;  4BW9 A;  2LJ2 A;  1PNL A;  5LOV A;  4LF5 O;  2IJI A;  2ZE5 A;  1NVP B;  2AHZ A;  1MMM A;  4TOI A;  5D5Q A;  1D5A A;  4GKK B;  5IYC O;  2YI8 A;  4UXN A;  2CGN A;  2L35 A;  2AGA A;  1F23 A;  2F43 G;  3SJB C;  1BMF G;  4LF8 B;  2F4V B;  4HZ3 A;  2GSM B;  4MVM A;  1E79 G;  2QM7 A;  3B2E E;  2KSD A;  4G27 B;  1YJ9 V;  1ORQ C;  3N2K A;  4P9P A;  2QA4 V;  2ADQ B;  3ZRS A;  4Z1M G;  1BHA A;  4C7U A;  1COW G;  4FLX A;  2UXB O;  2F93 B;  3R65 A;  4LF8 O;  4IYI A;  4UVB A;  5LP6 B;  2CUG A;  3SYQ A;  4UVA A;  1WN7 A;  3EXA A;  1GRJ A;  2JJ2 G;  4NB5 A;  2QDO A;  2CTQ A;  1NJI W;  3CCS V;  1DF5 A;  3CS5 A;  2LGQ A;  1XNR B;  2ADP A;  1VQP V;  1JA8 A;  1W59 A;  1Y66 A;  2ZNJ A;  5EC2 C;  3K57 A;  4LH6 A;  2Y0I A;  2FML A;  4X66 B;  1K33 A;  5GW7 A;  1WPB A;  4RUE A;  3ASO C;  3J80 N;  2PF4 E;  2X6B A;  1K92 A;  2XUM A;  3NXS A;  3FB6 C;  2UUB O;  4UB8 Z;  3LDD A;  3G6B A;  2P7T C;  1RM1 B;  3AG2 B;  3BCC H;  2A06 H;  3JCZ A;  3K5O A;  3ABL B;  2IU0 A;  4DV3 B;  5KHI A;  1N34 B;  3G67 A;  1HNX O;  4JYY A;  3OEE G;  4J42 A;  2EZP A;  3H9V A;  4CS2 A;  1EN4 A;  3G6E V;  3K0G A;  3SPI A;  1Q7Y W;  3SPJ A;  1U97 A;  5BXZ A;  1FKA O;  1P7G A;  4KHP B;  1KC8 W;  4LF4 B;  4FFB B;  1YZB A;  3SPC A;  2RDC A;  3K79 A;  1N34 O;  4DR6 B;  1HWY A;  4QE9 A;  3WB2 A;  1N36 B;  1XNQ B;  3CPW U;  4J7K A;  1W2B U;  3E8B A;  2CK3 G;  2WPD G;  1QVF U;  2RNB A;  3DSQ A;  3OGC C;  4I4T A;  5IJ9 B;  1OCO B;  3ETD A;  4UUJ C;  2D3O W;  1JFF B;  3P3N A;  2OTL V;  1FXK B;  1BCC H;  4JAS A;  2HG5 C;  4OXS A;  1NTZ H;  4B3T B;  3ZN0 A;  4DR6 O;  4B3R B;  3HKB B;  5C93 A;  2EIN C;  2FB5 A;  1XNQ O;  2M7W A;  4X1Y A;  4YY3 B;  1GN3 A;  5JH7 B;  4K8X A;  4X64 B;  3LDC A;  2OT5 A;  1XHZ A;  5JCO C;  4N21 A;  1SZT A;  4B3T O;  2Q6A A;  1G4Y B;  3G80 A;  2X6C A;  2YIB A;  3TXQ A;  4B3R O;  2Q0A A;  2JDI G;  2YI9 A;  3A0H Z;  2OWO A;  1WB8 A;  1RSO A;  3JSN A;  4MSW C;  4NTX A;  4HNA B;  3E22 A;  4X1I B;  5BMV A;  2HLD G;  4X64 O;  1XUQ A;  4TUY B;  2Q8V A;  1N0N A;  1RFY A;  2DN9 A;  2PUS A;  4DR4 B;  4JI8 O;  2H94 A;  4JI0 O;  3SGI A;  1VQ6 V;  2QJ1 A;  4IHJ B;  1UPG A;  2QSA A;  3DXR A;  5KX5 B;  2P06 A;  4JTD B;  4DV2 B;  4W4K A;  4LF7 B;  1QR9 A;  4R50 A;  1XIL A;  4JYB A;  2JJ1 G;  4O4J A;  5EC1 C;  4FLW A;  3ASN B;  4X9Q A;  4LF6 B;  2C2A A;  1VIB A;  2A79 B;  1YI2 V;  3CRQ A;  2PGG A;  4IL6 Z;  2ODM A;  3F5W C;  1M57 B;  4LBE C;  3RVY A;  1CXZ B;  2Q0O C;  4O4I B;  3K08 A;  1BSM A;  4KL1 A;  5CBG A;  3GVM A;  4FLY A;  1YF2 A;  4DK0 A;  2H8P C;  4GYC B;  1HNZ B;  4WCE V;  4PDV A;  1VF6 C;  4ZI7 A;  5GTI Z;  1NKD A;  2ZXW B;  2Y4T A;  1H2K A;  4LF6 O;  1NVP D;  3SR2 C;  1OCZ C;  2QWQ B;  4WFF A;  2UUC B;  2VWJ A;  3E8H A;  4EB6 B;  4UCO A;  3RYI B;  2Y0P A;  4FMT A;  3ML0 A;  4MVS A;  1NR7 A;  2LW7 A;  4JAV A;  3HR0 A;  1YTF B;  3RVZ A;  2WLI A;  2RCV A;  4WFG A;  1HNZ O;  3CSX A;  2A9H A;  4LFA B;  3JAL A;  2IBZ H;  3MD0 A;  5CBF A;  4AI8 A;  3VOU A;  4JZG A;  3K59 A;  4X20 A;  3L72 H;  3Q4H B;  1BZK A;  4CH5 A;  4H0L B;  3PN1 A;  4NTW A;  5KMG B;  2ZIO A;  4OPA A;  2EIL C;  1W0J G;  1WPX A;  3CX5 F;  5LMU B;  5B5E Z;  4LFA O;  4BIO A;  3E35 A;  2ZT9 B;  4YIP A;  2WSS G;  1XRE A;  3TK1 A;  2G38 A;  4OX9 B;  1SZX A;  5KHG A;  2ZM6 B;  5AG2 A;  2FTK A;  4L87 A;  1OCR B;  3ZS8 C;  3D8C A;  4X88 A;  4I9Q A;  1YSC A;  3ABT A;  2PYL A;  5LMU O;  1YVW A;  2Y69 C;  2A0L A;  5JWP A;  2K1E A;  4DR3 B;  4FK5 C;  3CCE V;  5IJ9 A;  3KG2 A;  4MTO A;  1SQQ H;  2W6J G;  4FIP C;  4GZR B;  1GM9 A;  2R72 A;  5A2Q N;  2OTJ V;  1KMI Z;  4JZ2 A;  2P22 C;  2IH3 C;  3RYF A;  5J2U A;  1K4D C;  4OPH A;  1NQT A;  1S72 V;  2E76 B;  3X2Q B;  4B7K A;  4FLV A;  2ZNI A;  4FVM A;  2R70 A;  2LQT A;  1Q81 W;  4LR3 A;  2JVD A;  4DR3 O;  3CP1 A;  1WNS A;  1PNK A;  4LC1 A;  4OGQ B;  4ZHQ B;  3L9D A;  2M6Y A;  3LSS A;  1XL4 A;  4LF9 B;  3FYE B;  1LNQ A;  2EX3 A;  5LOV B;  4DO2 A;  5LHI A;  1AI7 A;  3UQ8 A;  1XHX A;  4X62 B;  3CHX A;  5DM6 V;  2HJF C;  5JJE B;  1B06 A;  2Q69 A;  2DE0 X;  3WU2 Z;  5B1A B;  4JYC A;  4KUM A;  2WLN A;  1BT8 A;  2AZ2 A;  4DV1 O;  1SQG A;  4LF9 O;  3I5D A;  3ZHQ A;  4ZOL A;  3N2K B;  1BL8 A;  4NXN B;  4O4L A;  4B3S B;  3OUF A;  4U7N A;  1GN4 A;  5LP6 C;  2ZR3 A;  3U10 A;  1E1Q G;  1MNG A;  4MVO A;  4NXM B;  1IZ3 A;  5L3B A;  3AG1 B;  2EUL A;  5KX5 A;  4JV5 B;  3OR6 C;  2NR5 A;  1VQL V;  3VQX A;  2CGO A;  5J2T A;  2YXH A;  1DTO A;  3CYO A;  3T2M A;  4ZKI A;  3NR7 A;  1AB3 A;  2AXT Z;  2BOB C;  1CEZ A;  4HYO A;  1R3L C;  1RM1 C;  1JMK C;  3AG2 C;  1Q82 W;  3ABL C;  3CCJ V;  2IJH A;  4J7J A;  4JGS A;  3BRC A;  5LGU A;  1AJN A;  4K0K O;  3M99 B;  3RYI A;  4Q6G A;  3ZRV A;  3FKS G;  1S76 D;  4CS3 A;  5DEC A;  1BS3 A;  4BIU A;  4QIW F;  5IY5 B;  3JAT B;  4PA6 A;  3ABK B;  3JAW A;  3ZHR A;  2Q5Z A;  1R3J C;  5CBH A;  4JF3 A;  1Q5O A;  2QTS A;  2BSK A;  3JCU Z;  1EFR G;  1ZWI C;  5FLX N;  4CC6 A;  3K5M A;  4RUF A;  2QEX V;  2UXD B;  1OCO C;  4G2K A;  2CAZ C;  3ETE A;  4I4T B;  5L3G A;  1GH6 A;  4B3M O;  3JYC A;  3O65 A;  4DV7 B;  3W7T A;  1P4R A;  3E86 A;  4DR7 B;  1FXK C;  1VF5 B;  3B09 A;  4Z1V A;  3CC2 V;  1L1F A;  5CB4 A;  3P32 A;  1IX9 A;  3LSU A;  4I50 A;  3BAB A;  2B1G A;  3LNN A;  4X1Y B;  1YTF D;  2CTW A;  2QKA A;  4H13 B;  1F51 A;  1PPJ H;  2DYS C;  4DUZ B;  4MTX A;  3K9S A;  1F4M A;  4DYL A;  5B3S B;  3E83 A;  4DR7 O;  5ITZ A;  3UKM A;  1Q6U A;  3QO5 A;  2JK5 C;  4EFB A;  4GCZ A;  4JI7 B;  3OAA G;  2Q7G A;  5LXT A;  1RSO B;  3CCQ V;  2JS5 A;  4FFK A;  4U3F H;  3E22 B;  5BMV B;  2Y48 A;  3I55 V;  4DUZ O;  4UVC A;  2VQE O;  4JTA B;  5IWA B;  4LF5 B;  2QR4 A;  5FPR A;  4I9W A;  1VMG A;  2OCC B;  3OGI B;  3U0Z A;  3K9A A;  4JI7 O;  3ZIA G;  4NTY A;  4R6Z A;  2K9P A;  1S0V A;  4DR1 B;  4X8A A;  1OV9 A;  3KZI Z;  1KUQ A;  1ENV A;  1R3I C;  5B1B B;  2HVJ C;  3DXR B;  5IWA O;  1VQM V;  1ZUQ A;  1DLB A;  2GV9 A;  3QNE A;  2NN4 A;  2DWE C;  2F95 B;  1HDJ A;  1MZE A;  4GKJ B;  2ZDI A;  2H3O A;  3ASN C;  4GUN A;  1O9H A;  4O4J B;  2UXB B;  1Y6X A;  4DR1 O;  2BCC H;  4JI3 O;  3BA9 A;  3EFF K;  1MOF A;  2HJD A;  2ATK C;  4UCS A;  1M57 C;  3APO A;  2WA3 A;  1FJG O;  3B40 A;  4MW3 A;  4DK1 A;  1FPO A;  4R7C A;  2YXY A;  1WJZ A;  1I94 O;  2FKX A;  4R8C A;  3JAR A;  1L0L H;  1NU1 H;  4GKJ O;  3FX7 A;  2X0L A;  3E8G A;  2ZXW C;  2XTA A;  4KP4 A;  1OCC B;  4ZI7 B;  3JSL A;  4WFH A;  1IXM A;  1BGY H;  2XAQ A;  4QNH B;  4IT5 A;  4CZZ A;  1XDC A;  2UUB B;  1AI5 A;  3H1J H;  2QWP B;  1AR5 A;  2JIZ G;  4PDR A;  3KCY A;  2YC0 A;  3CRM A;  2WLI B;  3CJH A;  3L71 H;  3M7M X;  4YIO A;  1HNX B;  3ZMT A;  3JAL B;  2ZQM A;  1OZ0 A;  1Y4M A;  1EM1 A;  4UV9 A;  3UCS C;  2N05 A;  2XND G;  1MSW D;  4X20 B;  3CC7 V;  4PA4 A;  1SQF A;  1ZL8 A;  1QNM A;  1M90 W;  4JI4 O;  3BVO A;  1IBL O;  1IDS A;  4TQF A;  2E3C A;  3SYC A;  1ROP A;  1SKV A;  2E75 B;  1SET A;  1OJH A;  3CCV V;  1FXH A;  5KUK A;  3DC6 A;  4O2A A;  4MVQ A;  5LGT A;  4H37 A;  2EJ7 A;  3E2E A;  1QHT A;  1IBM O;  3CRC A;  3JAT A;  1GTO A;  1JJ2 U;  1TGO A;  3QO8 A;  3ZHV A;  1URF A;  1JCH A;  3ZMU A;  2GTA A;  4TWK A;  4KXR A;  3IJ4 A;  2Z3Y A;  5IYZ A;  2JEX A;  1H2S B;  3UT5 A;  4CH4 A;  5CN0 A;  2DYR B;  5E79 Z;  1F4N A;  2QWN B;  3ZN1 A;  2Q68 A;  3JAM N;  3RYF B;  2YID A;  2ZD9 A;  3MHH C;  5J2U B;  5CA0 A;  3X2Q C;  1KKD A;  1S3J A;  4FZ1 A;  1DK1 A;  2N74 A;  4ZIB A;  4QE7 A;  4PA9 A;  4Q20 A;  3OEH G;  2A7W A;  3KKY A;  5H2F Z;  3TCU A;  2YXL A;  3J7A U;  1X4T A;  1H38 A;  3D36 A;  4ZBM A;  1P49 A;  1SQV H;  1YXB A;  4WFB V;  5KA5 A;  1N8R W;  2IJK A;  3R66 A;  4GLX A;  4B7E A;  1HW7 A;  3T1Y O;  4MW8 A;  5KAF Z;  1PNM A;  2NNU A;  1W0K G;  2OCH A;  4NKG B;  3IGA C;  5LYJ A;  4JI8 B;  5B1A C;  2L6L A;  1BQZ A;  1ZAU A;  2ITD C;  4IIJ A;  3ZHS A;  2YSU B;  4I7Z B;  4BW5 A;  4JI0 B;  4I55 A;  4O4H A;  1N4C A;  1K5Q A;  4ZOL B;  2V1D A;  2QE7 G;  2Z5U A;  4ASU G;  4BAY A;  4O4L B;  1Y74 A;  2F66 C;  1ARO P;  4YHH B;  5JQG A;  1GO3 F;  4K35 A;  1L8D A;  2GHY A; 
#chains in the Genus database with same CATH homology
 2ZKO A;  2F4V O;  5A2Q N;  4JYA O;  2AGA A;  4JI7 O;  1HNW O;  1N33 O;  4AQY O;  4JI5 O;  4OPH A;  1KUQ A;  3T1H O;  4X65 O;  5IT9 N;  1IBM O;  4DR3 O;  4DUY O;  4K0K O;  5BR8 O;  4JI6 O;  5IWA O;  3SDL A;  4YHH O;  4DR6 O;  1X59 A;  1R1B A;  2JRI A;  4DV5 O;  1HR0 O;  2UUC O;  4LF6 O;  4YY3 O;  4DV0 O;  1XNQ O;  2UXB O;  1J5E O;  2DOS A;  4LF8 O;  2UU9 O;  4DR1 O;  4JI3 O;  4DV4 O;  2LW7 A;  1XEQ A;  4X62 O;  2UXD O;  1N32 O;  5FLX N;  1HNZ O;  1F7Y A;  4B3T O;  1FJG O;  4DV7 O;  1XNR O;  1G1X B;  3JAM N;  5H5N A;  5BY1 A;  4B3M O;  4B3R O;  3O65 A;  1I94 O;  2FKX A;  3M8A A;  4DV1 O;  1DK1 A;  1A32 A;  1R6T A;  4X66 O;  2N74 A;  4LF9 O;  4GKJ O;  4NXN O;  5LL6 Y;  4JI1 O;  1FYJ A;  4A5U B;  4X64 O;  2DJV A;  3J80 N;  4B3S O;  1IBK O;  5LMN O;  3J7A U;  1NS1 A;  4DV6 O;  2UUB O;  3RT3 C;  4OPA A;  4LFC O;  4JI2 O;  4NXM O;  4LFA O;  2E5L O;  3R66 A;  4DR4 O;  4DV3 O;  4OX9 O;  2UXC O;  2ZM6 O;  3T1Y O;  4JV5 O;  4DR7 O;  2UUA O;  4JI8 O;  1HNX O;  1XMQ O;  1XMO O;  4JI0 O;  4LFB O;  4DV2 O;  4LF7 O;  2VQF O;  4KHP O;  5LMU O;  4LF4 O;  3F5T A;  4DR5 O;  5BXZ A;  1FKA O;  1AB3 A;  1D2D A;  1YZB A;  3OTO O;  4DR2 O;  4DUZ O;  2HHH O;  4JI4 O;  2VQE O;  4LF5 O;  4GKK O;  1AIL A;  1IBL O;  3J81 N;  1N34 O;  2Z0A A;  1N36 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...