1XNRO

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xnrO00
3F5TA 2VQFO 1XNRO 5IT9N 2UXCO 1IBLO 4OPAA 4DR5O 3RT3C 5IWAO 5H5NA 3JAMN 4A5UB 1IBMO 5FLXN 4B3SO 4LFAO 5BY1A 4DUZO 4LFCO 1FKAO 4JI5O 4DUYO 5BXZA 3J81N 4GKKO 4K0KO 4GKJO 4DR4O 4DV6O 1XMOO 4DR3O 4OX9O 4DR2O 2ZKOA 4JV5O 4X64O 4AQYO 1KUQA 2UUBO 3J80N 1FYJA 2LW7A 2N74A 4JI2O 1J5EO 2JRIA 4DV7O 3O65A 1D2DA 5LMNO 4KHPO 1XEQA 2DJVA 1YZBA 1G1XB 2UXBO 3R66A 4B3MO 4JYAO 4DV5O 1FJGO 4DR1O 4JI8O 1XMQO 2DOSA 4LF6O 4LF5O 5BR8O 2HHHO 4X65O 4JI6O 4OPHA 1IBKO 4JI4O 4DV4O 4JI7O 4DV2O 1X59A 4LF9O 1AILA 1HNWO 1A32A 1DK1A 4DR7O 1N33O 4YY3O 4LFBO 3SDLA 4NXNO 4DV0O 1N34O 4LF4O 1I94O 4B3TO 2UUCO 2F4VO 1N32O 2VQEO 4X66O 2UU9O 1HNZO 4B3RO 4X62O 4JI3O 5LMUO 1NS1A 2UUAO 2E5LO 4DR6O 2FKXA 4YHHO 2UXDO 3OTOO 5LL6Y 1R6TA 4DV1O 1HNXO 2Z0AA 2ZM6O 1N36O 4LF8O 1F7YA 4DV3O 4LF7O 1AB3A 5A2QN 3J7AU 4NXMO 1R1BA 3M8AA 3T1HO 2AGAA 1XNQO 3T1YO 4JI0O 1HR0O 4JI1O
chains in the Genus database with same CATH superfamily
3K08A 3E35A 2CGOA 2JJ2G 2JVDA 3ZEDA 4G2KA 3P32A 4FM1A 2HFEC 1B3QA 3RYIA 2Q0AA 3JAMN 5FLXN 1HR0B 3ABMB 4AI8A 3G80A 4MTGA 3CSXA 2AZ2A 4DR3O 3CJHB 4UCSA 5LOVB 1R3JC 1S5HC 4EFBA 2EULA 3UT5B 1AR1B 4MVRA 4JI3B 3WB1A 2X6CA 1RFYA 1XEQA 3ABUA 4LNUA 3ABKC 3JSNA 2ZNIA 1Z5WA 2YS8A 1TUBB 2OIEA 1UPGA 1P7GA 4B3MO 2ZIMA 4FIPC 1LNQA 1ZAUA 4RQFA 2GSMB 4DR2B 4HNAA 4TSFG 4DRXA 3K03A 3SYQA 4LF9O 4WBNA 1VQPV 2P4VA 3AG2C 1YXBA 3RBZA 1ZUQA 1OCCB 1ORQC 1VARA 4JYBA 3ZMTA 3T1YB 3UT5A 3CS5A 4FLTA 2QSAA 2K1EA 4RO2A 4X1IA 4X66O 4X62O 2JIZG 4JYCA 2ARHA 1FXHA 5KAFZ 3CC2V 4LBEC 1NTKH 1HNXO 2EZOA 1NU1H 4Z2WA 1X4TA 5EZYB 4CS4A 1WLEA 3W7SA 5CB4A 2X6BA 4O4LB 3T1HO 3ETEA 4LFBB 4LF7B 1ZWIC 4CH3A 3FYIB 4HAMA 4U3FH 1V54B 1WA8B 2A79B 1Y67A 5IYBO 2ETNA 4UFZA 3UCSC 1QR8A 3UO2A 1XHZA 3BA9A 1KBHA 5H5NA 1IBMO 3FKSG 4R7CA 1HWYA 4BR6A 1U97A 4IYHA 4J10A 3W7TA 2P67A 5J2UA 1JVMA 2K9PA 2ZCEA 4BAYA 2N74A 1J5EO 2DW4A 3KKYA 4FLVA 2BE3A 4KHPO 2F43G 3H1LH 4DYLA 1NVPD 2F93B 3THOA 4PDRA 3RYFA 4R8CA 5LHIA 3JCUZ 3CD6V 4CBCA 3QG5A 2G38A 2QGNA 3K9AA 1BHAA 4DV4O 3ZRVA 3RW0A 4J41A 1YTFD 2BCCH 2YXHA 3CP1A 3TXSA 3ZJZA 3G67A 5LYJA 1N33O 3G6EV 4O4IA 2HJDA 1WB7A 1AI4A 3B2EE 3JD3A 4NXNO 2Z5UA 2IH3C 4JF3A 3RFRA 1GN2A 2OCCC 2YXYA 4PELA 4CS2A 3CRRA 2FKXA 1NH2B 2HHHB 5LL6Y 4L8JA 5KX5B 1GN6A 3OMNB 4IIJA 3T2MA 5JVDA 4GZRB 1KYOF 3CCLV 2PZSA 4F6RA 4QJFB 1XHXA 4LF4B 4I50A 1OZ0A 1PV0A 5IWAB 3IAYA 1BQZA 3JALB 1CP9A 2BOBC 1FS0G 2QM4A 4MW8A 4LP8A 3C3TA 4LH6A 4OPAA 4FLWA 3QO8A 2MW2B 4ZKIA 4UVBA 4DV3B 4DUZO 2O57A 3OW2U 4JI5O 5DN6G 1PNKA 4GKKO 4TV8B 4GKJO 4UB8Z 3SR2C 4O2AA 1O9GA 1ZSPA 1GTOA 2CTWA 1KP2A 2WSSG 3BHPA 1KUQA 4IYIA 4L87A 4ZI7A 1SERA 3MDSA 4YJ3B 1N0NA 3ICXA 2QJ1A 4IL6Z 1XDCA 5B1OA 2EIMB 1VQ8V 1H2LA 1TAEA 2HEPA 4NTWA 4N21A 2Y0PA 3H1JH 4N23A 1QLEC 1JJ2U 3OR6C 2YICA 3SYPA 2HG5C 1NKDA 3X2QB 3ZRSA 5CA0A 1XOUA 1N36B 3CC4V 4ZOLB 4X64B 3K5OA 4JI6O 1TA8A 3CRCA 1L1FA 2GHYA 2UUCB 1HNWO 2EIMC 1K33A 3HR0A 1AI5A 1R6KA 3ZMSA 2Q7EA 1H2SB 2EX3A 4LFBO 5ITZA 4NR1A 4E4EA 1KKCA 3RYCB 1JR9A 5LHHA 4B3TO 2RQ6A 2UXCB 1Q6UA 3SPGA 5LMUO 3RYHB 4H0LB 4JI7B 2RMKB 3NR7A 1Q5OA 2Z3YA 2LFSA 4JAAA 4PJ0Z 1DLBA 2ZM6O 3CMAV 2JGUA 3SJBC 4O2AB 4DV0B 2CDYA 3FD9A 4WFFA 1UJWB 5KHJA 2FB5A 3ZHSA 5LA6B 4DV7B 1Z2GA 4OX9B 3H01A 1TVKB 2EIKB 1BCCH 2VRZA 1Q90D 5IWAO 1E79G 5EK0A 1QVGU 2ZR3A 3IJ4A 2JDIG 1P49A 2WLIB 2DMXA 3F5WC 1V55B 4DW0A 2WLMA 3VQXA 1VF7A 4HZ3A 2X0LA 1MOFA 1DTOA 4PDMA 4QPJA 2LGWA 3L74H 2ZNJA 1HDJA 2IJIA 1Q6IA 3K5MA 2WLKA 4GX2A 3E89A 4Q6GA 1MG1A 4P30A 4GKKB 2RNBA 3JARB 4DK1A 5B3SC 4X1KA 2E76B 2ZE8A 3AG3C 1PKXA 5B1NA 3DTUB 4O4IB 3BPZA 5IY5B 5L3BA 3OUFA 5DEDA 3GB7C 3T4DA 2FL4A 4UV9A 1J95A 3APOA 3HKEB 3OT7A 1N4CA 1DF4A 4DV1B 1GM8A 3EHBB 4P9PA 2UUCO 2LGQA 3LSQA 3L75H 5B5EZ 2YDEA 2XOKG 2WPDG 2UUAO 3CPWU 4B3RB 1WP8A 2UXDO 3ZRWB 4X65B 1YIJV 2ZXWB 4K8ZA 1F7YA 2OCHA 1AB3A 3UQ8A 2DYSB 2GDSA 2X6AA 3G71V 3P3NA 2LP7A 1QHTA 1OJHA 3A0BZ 4WCEV 1M56B 3F5TA 2VQFO 5IDJA 1K97A 1S5LZ 4O4HA 2WLLA 4B3MB 3PN1A 4BW9A 4K8XA 2VS0A 4Z1MG 3RT3C 3UO3A 3K3WA 2OYQA 1HNZB 4B3SO 4X1YA 1NVPB 1R3LC 1HNXB 1KU9A 3FB7C 2HVKC 2H94A 1F4NA 5KHGA 1XILA 3RYCA 1F51A 1OCZB 5KUKA 4IGGA 3W7WA 5K1XA 3AG2B 3JD0A 5EIBD 5J2UB 4JAUA 2DQ3A 1QCEA 4YXWG 4JAVA 4X1IB 1WJZA 2CH7A 3ZS8C 3ABTA 4QE9A 4MVQA 1AP5A 3JASA 1VF6C 3AK2A 4DR6B 4W4LA 2B9ZA 2ZD9A 4LF6O 3A8TA 3FAVB 4JPRA 2QA4V 2AHYA 2M6YA 3ZHRA 4FM2A 1CEZA 4I9QA 4DV6B 1FD9A 3D36A 3FX7A 3K0DA 2LJ2A 1RSOB 4DRXB 4NXMB 3OR7C 4JI0B 1P84F 4YY3O 4I9WA 3L73H 1T5EA 1VF6A 4DR7B 2Q69A 1M9NA 4BIZA 4O4JB 5L3GA 3I55V 5IJ9B 1S72V 4QPKA 1IDSA 4H33A 4WF9V 3ABMC 4G28B 3K5LA 3MD0A 4J42A 2ITDC 2ITCC 4DV1O 4DUYB 1GH6A 4EB6B 4PDLA 2PI5A 3CJHA 4X66B 5EYPA 1RM1B 1VQ4V 3TGUH 1YVWA 2OTLV 4LFAB 5A2QN 2P7TC 2GV9A 5KA5A 1PPJH 3BCCH 2EILB 3BVOA 4FM0A 2QDOA 4JGSA 2RN9A 3OMIB 4IHJB 4DR3B 4EKWA 2L35A 2YSUB 2UXCO 1BSMA 1YDXA 2LO1A 2QTSA 1JOYA 1AJNA 1K92A 2UUAB 5KAIZ 3JATB 3LNMB 2KG7A 4A5UB 4O2BB 5EBLC 1H2NA 2IU0A 5B1AB 2W6JG 3I5DA 1I5YA 3STLC 1NJIW 1K4CC 5IYZA 4GX0A 4RUEA 2YI9A 2YI8A 2JS3A 3DGEA 3J80N 4GT1A 1VP7A 1EN5A 1Z5VA 2P5OA 2EIJB 1BGYH 3AG1B 1I94B 1EFRG 1VQKV 3K06A 2JS5A 5L3CA 1JPXA 3U11A 1HW7A 3E86A 1FJGO 2HJFC 4DR1O 3WFVA 2GBOA 1PP9H 4KFMA 1W0KG 1IX9A 2YIBA 1QR9A 4JI4O 1VQ6V 2R9IA 3RVYA 3B77A 1SESA 5L3DA 3FB8C 3ABLC 1OCOB 3H1IH 1EN6A 4UCRA 1JCHA 3WG7B 5IY5C 3K9SA 5B1BB 4P2ZA 4TUYA 2GTSA 1UFIA 1MNGA 2H8PC 1FFTB 1M5IA 2QM8A 1BMFG 3CXHF 3ZRXA 5H9CA 3ZHVA 5JQGA 2AZ0A 3N2GB 3ZN0A 2Z0AA 4DV5B 1GM9A 4JI8B 1WB8A 3OGCC 4NXMO 1XI1A 3OAAG 3QVNA 1XNQO 5HFLA 4XDKA 2KB1A 2ZINA 4UVCA 3X2QC 3APQA 4NB5A 4UCVA 1SQQH 5CA1A 3OEHG 1ZLZA 4YHHB 4ASUG 2E3CA 2JEUA 3K59A 1QLNA 2IBZH 4O4LA 2Q6AA 4IT5A 1S76D 4G27B 3U10A 2WLLB 2IH1C 3CRQA 2JGDB 2X7RB 2XAJA 1PM9A 1SA0B 5E79Z 1XNRB 2IM9A 2ADPA 5CBGA 1D2DA 3JAWA 5LP6B 1JMKC 2UXBO 1XL4A 3CMEV 4MVUA 4U7OA 1IBKB 5FPRA 2Q4PA 1XMQO 3L71H 1NT2B 3ETDA 5BR8O 4MTFA 4AHCA 1MSDA 1Y4MA 4DV2O 2VQEB 1K4DC 2B5UA 2IJKA 5LXTB 2CTQA 4ICGA 4CC6A 1GN3A 1FFXB 2GUZB 3SDLA 3HKDA 5KHHA 1TGOA 5EYPB 5C8YB 4JYYA 3F7YC 2QTOA 2IJJA 3LDEA 1Q86W 3AG7A 4TQDA 2UU9B 1NR1A 4FK5C 4X8AA 2JEXA 1FXKC 4FFKA 4I4TB 4YJ2B 1R6TA 3T4ZA 4LF8O 1K3EA 1IXBA 3A0RA 1YJNV 3RYIB 4DXWA 3SJAC 5H2FZ 4CH6A 4JI0O 4TV9B 4YIPA 3OE7G 3U0ZA 1JX9A 4FLYA 1AJQA 4K3AA 4LR3A 1SQPH 4LWSB 4DR5O 1MSWD 1XNQB 1VQMV 1M93A 2EZPA 3AEIA 4MVOA 3ML0A 3ZBHA 4I55B 1TVKA 2P90A 1ZTEA 2Q5ZA 4EEQA 1QU7A 3ZN1A 1EM1A 1VF5B 2Q8VA 1K9MW 1XMOO 2BTQA 4X64O 1P7BA 4O2BA 5CBHA 4PA7A 2F95B 1IBLB 1FYJA 1WAZA 1NH2D 3ZMUA 4MVMA 4PA3A 2UXXA 3W7UA 1GKFA 4H37A 1N33B 1SZTA 1H38A 4J11A 3CCUV 4B3SB 4PA9A 1KD1W 1PD3A 2CGNA 2P22C 4LF5O 2BTOA 3A2FA 1Y76B 2QKSA 2XASA 3HB3B 4B7EA 5ITZB 3ABKB 1ZX3A 2ZQMA 1YTFB 4JI7O 3BFRA 1LR1A 4I7ZB 3G6BA 1NR7A 3BY6A 5CMUA 2YC0A 4FFBB 4KHPB 4LF4O 3Q4HA 4WFGA 2CUGA 3ASOC 3OEEG 3KCYA 1IBMB 4X1KB 4NTXA 3OGIB 4MS2A 1OV9A 1VMGA 1KP3A 1Q8IA 1L8DA 3KCXA 2ZR2A 3ABLB 1OCZC 4LF7O 4YJ3A 1WA8A 4ZI7B 2YIBD 2AGAA 4MVSA 4I5SA 1DGSA 4JI1O 2E5LB 2QWPB 1XNRO 5IT9N 4WFEA 1G8MA 3AG1C 3FB6C 5FPOA 1L0NH 1PNMA 1LUWA 1SA0A 1W2BU 3S3WA 3ZHQA 3FB5C 4ZHQB 1R73A 4RUFA 4LFCO 3SPJA 5LMNB 1N0JA 4J7ZA 5BXZA 3J81N 4DUZB 4K0KO 5J2TA 4DR4O 1Y76A 1M90W 1I08A 3UKMA 2QKAA 1YHQV 4I50B 5AG2A 3T1CA 2ZXWC 4O4HB 3FYEB 5KX5A 2LQTA 4WFHA 2Q7GA 3TCUA 2BSKB 3GWOA 2R9RB 2RJZA 5FL7G 2CK3G 3LSUA 5KLVH 2EINC 2JJ1G 3S3XA 3TK1A 1L0LH 3WB0A 1XMOB 1K5QA 1RP3B 3C3SA 1E1RG 3ZIAG 3VBBA 2FTKA 1URFA 1A32A 1BT8A 2WAMA 3O9OA 3K5NA 2YXLA 2DQ0A 2XAHA 3B8MA 5LHGA 1WPXA 3L9DA 4BW5A 3E8BA 1YCIA 1XUQA 2EIJC 1ENVA 1AP6A 3R65A 4GKJB 2F1MA 5CB4B 1OHHG 3E2EA 1Y6XA 5J9PC 3CXCU 2Q68A 2P06A 3LDDA 1MZEA 4TWKA 1OCRB 1M4UA 2CTRA 1SRYA 2AHZA 5FNVA 5JH7A 2E74B 2PY5A 1FFXA 4PA6A 3P3PA 4XDJA 4Z1VA 3TJTA 1VEWA 3MHHC 2YIAA 1IVSA 3H9VA 2A06H 4LH7A 1E1QG 4LWSA 4ZBMA 5D5PA 1HNWB 2ATKC 2OTJV 4PD4F 3E22A 3A0HZ 4DR2O 2OWOA 4JV5O 4LF6B 4LCUC 1VQ5V 2UUBO 3PJSK 3SYAA 3Q4HB 2FYUH 3IFXA 4XDLA 5IE9A 5JH7B 2JRIA 4DV7O 4XBFA 4K0KB 4NYKA 3JSLA 1G1XB 3HKCB 1ROPA 4PDVA 1QBZA 2C2AA 3ASOB 2ZM6B 5LOVA 2DYSC 3CWBH 2DWEC 1EBOA 5GTHZ 3OUSA 1N32B 2HVJC 1ZL8A 1VQ7V 3ETGA 3CCRV 1DF5A 1XL6A 3VQVA 4JTAB 3RYHA 2Y69B 3WB2A 5LXTA 1SZXA 2W0XA 3JALA 1FJGB 4UUJC 1NBMG 3DSQA 3RYFB 3TETA 5CA1B 4KP4A 4JI3O 1R6NA 4JZGA 4JI6B 3RN4A 5EBWC 1VQLV 2F66C 4DR6O 3H1HH 4J9ZB 3BEHA 3AK1A 3ASNB 3WU2Z 2RDCA 1SQBH 1YEWA 5FNVB 2IJHA 2VWKA 5D5QA 3ZHTA 1SQXH 2IU3A 4DW1A 4GLXA 1MMMA 1US6A 3JD2A 1XBLA 2BSKA 2PI4A 2ZDIC 4H13B 4TUYB 4PHZA 1KECA 5LGTA 2VQFB 3K0GA 4B7KA 1Y66A 2QR4A 5JJNB 3LUTB 4OGQB 1SC5B 4TT3G 4GX1A 2AXTZ 3QO7A 4PI2A 4DUYO 4ZIBA 2W6IG 2H3OA 1M1KW 2P6JA 3D8CA 5CBFA 4MT8A 1WPBA 5L3FA 2HKOA 4KL1A 2BOCC 4Q20A 1QNMA 3O65A 2NN4A 2KQXA 4JTCB 2OCCB 3SYOA 2ZE6A 1SETA 2QEXV 1GO3F 2DOSA 3OM3B 2WLHA 3OTOB 2A0LA 4J80A 1GM7A 3KZIZ 5BZBA 5EC1C 5KA6A 4FLUA 1DK1A 1R3KC 3CCVV 3DXRB 3JAWB 2PGGA 5LP6A 1FPOA 3JATA 3FFQA 4DV0O 1I94O 1Q7YW 1N32O 4JI2B 3CE2A 2VQEO 2LW1A 4B3RO 1PNLA 1HNZO 4D7TA 5J2TB 3WG7C 4LNUB 1NS1A 5LGUA 4MW3A 2QWRB 1BZKA 2PUSA 1Y74B 1THZA 3LSSA 2WWWA 3N27A 5EBMC 5GTIZ 4DV3O 3W7XA 4X20A 3GVMA 3M8AA 3RWRD 4AILC 3HKCA 2VWJA 4DK0A 1WP7A 4J9YB 2Q9LA 1QVFU 5GW7A 4X89A 1VQNV 2CTPA 2Q73A 2WA4A 1RM1C 1NI8A 1Q82W 1EZJA 1H2KA 1EN4A 2HLDG 3E22B 5BY1A 3BABA 1BL8A 1H8EG 3KG2A 5DM6V 3N2GA 3ZMZA 3E8HA 1TUBA 1YF2A 5JCOA 1AROP 4MTXA 1MZFA 1S0VA 3D3QA 4NTYA 1MABG 5BR8B 3AG4B 5GONB 5L3EA 5LA6A 1Q43A 1O9HA 1F4MA 1RPRA 4I0XB 1M57B 1YZBA 2ZIOA 5KMGB 2R72A 3IC9A 1S3JA 3SJQC 5CN0A 5IJ9A 1WN7A 1GK9A 4O4JA 3SGIA 1YITV 3CCEV 3VOUA 1G6UA 5BMVA 2R70A 2F4VB 2Q0OC 1OCOC 1AILA 5DECA 4AQYB 3EFFK 1S5JA 4JI1B 3T1HB 4ABMA 1RSOA 2AW9A 2ZT9B 4K35A 1FXKA 3CHXA 4EFEA 5IYCO 1GAXA 3JD1A 1YJ9V 4FVMA 4UCTA 4BIOA 1N34O 1B04A 1P4RA 2WLNA 2UXNA 1W59A 2KKWA 3AG3B 5JJEB 1U96A 3OFNG 3QTCA 1QLEB 4LF9B 3B4SA 3SPHA 4MVZA 1NZ6A 3OTOO 2ZDIA 3MHSC 1AJPA 1S77D 2HR3A 2ADQB 1N36O 4UVAA 4PA4A 4NXNB 1SQFA 1GMGA 4H44B 4U3JA 1M56C 5E1AC 1HR0O 1H2MA 1JJOA 3SPIA 3BAAA 3UM7A 2L6LA 3LNNA 5B1AC 1XREA 2PTMA 3ZCCA 4J7KA 1CXZB 1IXMA 3CC7V 2DWDC 3QNEA 2F23A 3ZHUA 4LFAO 3AK3A 1IURA 1LUVA 1H2GA 3HKBB 3SYCA 1I0HA 4DV4B 4F6EA 2EILC 2PYLA 2ZE5A 3E8GA 5H6RA 5LBQA 3ASNC 4CS3A 1AR5A 5KHIA 1AI6A 3CRMA 5LMNO 1NTMH 2DJVA 4B3TB 3ZRWA 1I5XA 4YY3B 1AI7A 1OCRC 2XUMA 3C90A 2PYJA 4JYAO 4DV5O 4JI8O 1BQ0A 2Y0IA 1WNSA 3ZMVA 3F7VC 3DC5A 1YSCA 3JASB 1IBKO 1JFFA 2R9AA 1XMQB 4BIUA 1KKDA 1GN4A 1B6QA 3HKEA 3TXQA 3MAQA 4J7JA 2QM7A 3B8NA 1K5SA 4BWAA 4JTDB 3AG4C 4UCUA 3EXAA 3JYCA 3L72H 3CRAA 2F4VO 1Q3EA 5LYJB 1V55C 1VQ9V 5KUMA 2ILMA 1N34B 2A9HA 4JI5B 3CX5F 3JARA 4X1YB 2EIKC 1SKVA 3BA8A 3CCQV 4LF8B 1EZVH 5K1PA 5IJ0B 4P9OA 4JASA 1MA1A 2YEVB 5LMUB 3BRCA 4ZHQA 1N8RW 1Q6HA 2W0FC 1VIBA 2HP8A 1QQCA 4GCZA 4GUNA 2BTQB 4R50A 1K34A 4NKGB 1V54C 1KC8W 3CB2A 1K8AW 2N05A 1JA8A 5JQGB 5LGNA 4YIOA 1FKAO 5EC2C 2M7WA 2V1DA 2XAFA 4GYCB 2UXDB 1JFFB 3K04A 4B08A 4KUMA 5IJ0A 4AQYO 2EJ7A 2NLJC 2LFRA 3D3IA 4C7UA 1PL0A 4IHJA 2CAZC 1W0JG 4E2LA 3N2KA 4WFAV 5B66Z 5BMVB 3R66A 1COWG 4FJCC 3CCMV 4UV8A 5EZYA 1FAFA 3P30A 1V9PA 4OPHA 4I4TA 3K57A 1NTZH 4HYOA 5KMGA 2Y69C 1F23A 4U7NA 4JYAB 4X88A 3RVZA 5JWPA 3OMAB 5GONA 4MSWC 3SPCA 2ODMA 2UU9O 4D7SA 3N2KB 2Y4TA 1NQTA 4GX5A 3OD4A 2V4DA 3EVKA 1M57C 3L70H 3LDCA 2DE0X 4WBNB 4OXSA 2YIDA 5B3SB 2Q7HA 2YUAA 3IGAC 2WLIA 5LP6C 4FZ1A 1AVMA 5JVDB 3FAVA 2V7QG 4FMTA 4IIJB 2FMLA 5EIBC 2D3OW 2OIGA 2CE4A 1R1BA 4CZZA 2B1GA 2CH7B 3RGBA 4D6TH 1VQOV 3K58A 4F4LA 4DR5B 3VQWA 4FLZA 1BE3H 4X20B 4LF5B 3I56V 1FXKB 3K79A 4TOIA 5F2VO 1Y74A 4CH4A 3HPLC 3QF7A 1PL4A 4QGPA 4OX9O 1KQSU 4DR4B 3H1KH 2LW7A 4JI2O 3DXRA 3CEIA 2XT9A 4UCOA 2XAQA 1SQGA 5JCOC 5C8YA 1K73W 4I55A 5KHKA 2HHHO 4ZOLA 4X65O 5B1BC 3E83A 2DYRC 2XAGA 1B06A 1X59A 1I7FA 1OCCC 4FZ0A 3M7MX 2D2CB 3G4SV 4DR7O 2YEVA 1SF9A 2OT5A 1Q81W 5A9GA 2EJRA 1SQVH 4TV9A 1K7DA 2DN9A 3B40A 2Y4UA 2NNUA 4PV1B 1FXVA 3SJCC 2A7WA 4WFBV 3CCJV 4FPPA 1YI2V 2XTAA 4YJ2A 4TV8A 2WLJA 2NR5A 3M99B 4YHHO 1AR4A 2ZE7A 1D5NA 2Y48A 4DR1B 4QE7A 1SS3A 4W4KA 4RQEA 2B1IA 1CPYA 2IW5A 2JGDA 3HKDB 3HKBA 2EBOA 4UXNA 1H8HG 4KXRA 5C93A 2GUZA 3T1YO 1KMIZ 2GTAA 3JCZA 2JK5C 1IZ3A 1J5EB 2XNDG 4X62B 4R6ZA 1IBLO 2UUBB 4F6RB 3ETQA 5JJJB 4JZ2A 1YJWV 4TQFA 3ZX6A 1JQ0A 2QKCA 4DV6O 4HNAB 2KG7B 2ZKOA 3DC6A 1XQ8A 1HP8A 4QIWF 5HFMA 3B09A 4RWUA 4FFBA 3GWKC 3JD4A 2Q67A 2QWQB 4NVPA 2MK3A 2QWOB 2XHBA 3D36C 3CCSV 1ZL8B 1D5AA 4RAIA 1RPOA 3VQYA 4JI4B 5H6QA 4EB6A 1TUEB 4FLXA 4LC1A 4MTOA 2P4KA 2QE7G 4UB6Z 4JV5B 2DYRB 3NXSA 5CA3A 1GRJA 4X9QA 4CH5A 4U3JB 2N04A 1KB9F 2WA3A 3IC7A 4I0XA 1BS3A 4CC5A 4PI0A 3JAKB 3E8FA 3OTFA 2E5LO 4QNHB 1G4YB 2RCVA 3QO5A 2UXBB 4DO2A 2PF4E 1BHBA 2A3QA 3CYOA 5IYDO 1R3IC 5IYZB 3J7AU 4LFCB 5CA0B 4HBNA 3STZC 2QWNB 2EINB 5TISZ 2E75B 4DV2B 3JAKA 2KSDA
chains in the Genus database with same CATH topology
3F5TA 2VQFO 1XNRO 5IT9N 2UXCO 1IBLO 4OPAA 4DR5O 3RT3C 5IWAO 5H5NA 3JAMN 4A5UB 1IBMO 5FLXN 4B3SO 4LFAO 5BY1A 4DUZO 4LFCO 1FKAO 4JI5O 4DUYO 5BXZA 3J81N 4GKKO 4K0KO 4GKJO 4DR4O 4DV6O 1XMOO 4DR3O 4OX9O 4DR2O 2ZKOA 4JV5O 4X64O 4AQYO 1KUQA 2UUBO 3J80N 1FYJA 2LW7A 2N74A 4JI2O 1J5EO 2JRIA 4DV7O 3O65A 1D2DA 5LMNO 4KHPO 1XEQA 2DJVA 1YZBA 1G1XB 2UXBO 3R66A 4B3MO 4JYAO 4DV5O 1FJGO 4DR1O 4JI8O 1XMQO 2DOSA 4LF6O 4LF5O 5BR8O 2HHHO 4X65O 4JI6O 4OPHA 1IBKO 4JI4O 4DV4O 4JI7O 4DV2O 1X59A 4LF9O 1AILA 1HNWO 1A32A 1DK1A 4DR7O 1N33O 4YY3O 4LFBO 3SDLA 4NXNO 4DV0O 1N34O 4LF4O 1I94O 4B3TO 2UUCO 2F4VO 1N32O 2VQEO 4X66O 2UU9O 1HNZO 4B3RO 4X62O 4JI3O 5LMUO 1NS1A 2UUAO 2E5LO 4DR6O 2FKXA 4YHHO 2UXDO 3OTOO 5LL6Y 1R6TA 4DV1O 1HNXO 2Z0AA 2ZM6O 1N36O 4LF8O 1F7YA 4DV3O 4LF7O 1AB3A 5A2QN 3J7AU 4NXMO 1R1BA 3M8AA 3T1HO 2AGAA 1XNQO 3T1YO 4JI0O 1HR0O 4JI1O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5T A;  2VQF O;  1XNR O;  5IT9 N;  2UXC O;  1IBL O;  4OPA A;  4DR5 O;  3RT3 C;  5IWA O;  5H5N A;  3JAM N;  4A5U B;  1IBM O;  5FLX N;  4B3S O;  4LFA O;  5BY1 A;  4DUZ O;  4LFC O;  1FKA O;  4JI5 O;  4DUY O;  5BXZ A;  3J81 N;  4GKK O;  4K0K O;  4GKJ O;  4DR4 O;  4DV6 O;  1XMO O;  4DR3 O;  4OX9 O;  4DR2 O;  2ZKO A;  4JV5 O;  4X64 O;  4AQY O;  1KUQ A;  2UUB O;  3J80 N;  1FYJ A;  2LW7 A;  2N74 A;  4JI2 O;  1J5E O;  2JRI A;  4DV7 O;  3O65 A;  1D2D A;  5LMN O;  4KHP O;  1XEQ A;  2DJV A;  1YZB A;  1G1X B;  2UXB O;  3R66 A;  4B3M O;  4JYA O;  4DV5 O;  1FJG O;  4DR1 O;  4JI8 O;  1XMQ O;  2DOS A;  4LF6 O;  4LF5 O;  5BR8 O;  2HHH O;  4X65 O;  4JI6 O;  4OPH A;  1IBK O;  4JI4 O;  4DV4 O;  4JI7 O;  4DV2 O;  1X59 A;  4LF9 O;  1AIL A;  1HNW O;  1A32 A;  1DK1 A;  4DR7 O;  1N33 O;  4YY3 O;  4LFB O;  3SDL A;  4NXN O;  4DV0 O;  1N34 O;  4LF4 O;  1I94 O;  4B3T O;  2UUC O;  2F4V O;  1N32 O;  2VQE O;  4X66 O;  2UU9 O;  1HNZ O;  4B3R O;  4X62 O;  4JI3 O;  5LMU O;  1NS1 A;  2UUA O;  2E5L O;  4DR6 O;  2FKX A;  4YHH O;  2UXD O;  3OTO O;  5LL6 Y;  1R6T A;  4DV1 O;  1HNX O;  2Z0A A;  2ZM6 O;  1N36 O;  4LF8 O;  1F7Y A;  4DV3 O;  4LF7 O;  1AB3 A;  5A2Q N;  3J7A U;  4NXM O;  1R1B A;  3M8A A;  3T1H O;  2AGA A;  1XNQ O;  3T1Y O;  4JI0 O;  1HR0 O;  4JI1 O; 
#chains in the Genus database with same CATH topology
 3K08 A;  3E35 A;  2CGO A;  2JJ2 G;  2JVD A;  3ZED A;  4G2K A;  3P32 A;  4FM1 A;  2HFE C;  1B3Q A;  3RYI A;  2Q0A A;  3JAM N;  5FLX N;  1HR0 B;  3ABM B;  4AI8 A;  3G80 A;  4MTG A;  3CSX A;  2AZ2 A;  4DR3 O;  3CJH B;  4UCS A;  5LOV B;  1R3J C;  1S5H C;  4EFB A;  2EUL A;  3UT5 B;  1AR1 B;  4MVR A;  4JI3 B;  3WB1 A;  2X6C A;  1RFY A;  1XEQ A;  3ABU A;  4LNU A;  3ABK C;  3JSN A;  2ZNI A;  1Z5W A;  2YS8 A;  1TUB B;  2OIE A;  1UPG A;  1P7G A;  4B3M O;  2ZIM A;  4FIP C;  1LNQ A;  1ZAU A;  4RQF A;  2GSM B;  4DR2 B;  4HNA A;  4TSF G;  4DRX A;  3K03 A;  3SYQ A;  4LF9 O;  4WBN A;  1VQP V;  2P4V A;  3AG2 C;  1YXB A;  3RBZ A;  1ZUQ A;  1OCC B;  1ORQ C;  1VAR A;  4JYB A;  3ZMT A;  3T1Y B;  3UT5 A;  3CS5 A;  4FLT A;  2QSA A;  2K1E A;  4RO2 A;  4X1I A;  4X66 O;  4X62 O;  2JIZ G;  4JYC A;  2ARH A;  1FXH A;  5KAF Z;  3CC2 V;  4LBE C;  1NTK H;  1HNX O;  2EZO A;  1NU1 H;  4Z2W A;  1X4T A;  5EZY B;  4CS4 A;  1WLE A;  3W7S A;  5CB4 A;  2X6B A;  4O4L B;  3T1H O;  3ETE A;  4LFB B;  4LF7 B;  1ZWI C;  4CH3 A;  3FYI B;  4HAM A;  4U3F H;  1V54 B;  1WA8 B;  2A79 B;  1Y67 A;  5IYB O;  2ETN A;  4UFZ A;  3UCS C;  1QR8 A;  3UO2 A;  1XHZ A;  3BA9 A;  1KBH A;  5H5N A;  1IBM O;  3FKS G;  4R7C A;  1HWY A;  4BR6 A;  1U97 A;  4IYH A;  4J10 A;  3W7T A;  2P67 A;  5J2U A;  1JVM A;  2K9P A;  2ZCE A;  4BAY A;  2N74 A;  1J5E O;  2DW4 A;  3KKY A;  4FLV A;  2BE3 A;  4KHP O;  2F43 G;  3H1L H;  4DYL A;  1NVP D;  2F93 B;  3THO A;  4PDR A;  3RYF A;  4R8C A;  5LHI A;  3JCU Z;  3CD6 V;  4CBC A;  3QG5 A;  2G38 A;  2QGN A;  3K9A A;  1BHA A;  4DV4 O;  3ZRV A;  3RW0 A;  4J41 A;  1YTF D;  2BCC H;  2YXH A;  3CP1 A;  3TXS A;  3ZJZ A;  3G67 A;  5LYJ A;  1N33 O;  3G6E V;  4O4I A;  2HJD A;  1WB7 A;  1AI4 A;  3B2E E;  3JD3 A;  4NXN O;  2Z5U A;  2IH3 C;  4JF3 A;  3RFR A;  1GN2 A;  2OCC C;  2YXY A;  4PEL A;  4CS2 A;  3CRR A;  2FKX A;  1NH2 B;  2HHH B;  5LL6 Y;  4L8J A;  5KX5 B;  1GN6 A;  3OMN B;  4IIJ A;  3T2M A;  5JVD A;  4GZR B;  1KYO F;  3CCL V;  2PZS A;  4F6R A;  4QJF B;  1XHX A;  4LF4 B;  4I50 A;  1OZ0 A;  1PV0 A;  5IWA B;  3IAY A;  1BQZ A;  3JAL B;  1CP9 A;  2BOB C;  1FS0 G;  2QM4 A;  4MW8 A;  4LP8 A;  3C3T A;  4LH6 A;  4OPA A;  4FLW A;  3QO8 A;  2MW2 B;  4ZKI A;  4UVB A;  4DV3 B;  4DUZ O;  2O57 A;  3OW2 U;  4JI5 O;  5DN6 G;  1PNK A;  4GKK O;  4TV8 B;  4GKJ O;  4UB8 Z;  3SR2 C;  4O2A A;  1O9G A;  1ZSP A;  1GTO A;  2CTW A;  1KP2 A;  2WSS G;  3BHP A;  1KUQ A;  4IYI A;  4L87 A;  4ZI7 A;  1SER A;  3MDS A;  4YJ3 B;  1N0N A;  3ICX A;  2QJ1 A;  4IL6 Z;  1XDC A;  5B1O A;  2EIM B;  1VQ8 V;  1H2L A;  1TAE A;  2HEP A;  4NTW A;  4N21 A;  2Y0P A;  3H1J H;  4N23 A;  1QLE C;  1JJ2 U;  3OR6 C;  2YIC A;  3SYP A;  2HG5 C;  1NKD A;  3X2Q B;  3ZRS A;  5CA0 A;  1XOU A;  1N36 B;  3CC4 V;  4ZOL B;  4X64 B;  3K5O A;  4JI6 O;  1TA8 A;  3CRC A;  1L1F A;  2GHY A;  2UUC B;  1HNW O;  2EIM C;  1K33 A;  3HR0 A;  1AI5 A;  1R6K A;  3ZMS A;  2Q7E A;  1H2S B;  2EX3 A;  4LFB O;  5ITZ A;  4NR1 A;  4E4E A;  1KKC A;  3RYC B;  1JR9 A;  5LHH A;  4B3T O;  2RQ6 A;  2UXC B;  1Q6U A;  3SPG A;  5LMU O;  3RYH B;  4H0L B;  4JI7 B;  2RMK B;  3NR7 A;  1Q5O A;  2Z3Y A;  2LFS A;  4JAA A;  4PJ0 Z;  1DLB A;  2ZM6 O;  3CMA V;  2JGU A;  3SJB C;  4O2A B;  4DV0 B;  2CDY A;  3FD9 A;  4WFF A;  1UJW B;  5KHJ A;  2FB5 A;  3ZHS A;  5LA6 B;  4DV7 B;  1Z2G A;  4OX9 B;  3H01 A;  1TVK B;  2EIK B;  1BCC H;  2VRZ A;  1Q90 D;  5IWA O;  1E79 G;  5EK0 A;  1QVG U;  2ZR3 A;  3IJ4 A;  2JDI G;  1P49 A;  2WLI B;  2DMX A;  3F5W C;  1V55 B;  4DW0 A;  2WLM A;  3VQX A;  1VF7 A;  4HZ3 A;  2X0L A;  1MOF A;  1DTO A;  4PDM A;  4QPJ A;  2LGW A;  3L74 H;  2ZNJ A;  1HDJ A;  2IJI A;  1Q6I A;  3K5M A;  2WLK A;  4GX2 A;  3E89 A;  4Q6G A;  1MG1 A;  4P30 A;  4GKK B;  2RNB A;  3JAR B;  4DK1 A;  5B3S C;  4X1K A;  2E76 B;  2ZE8 A;  3AG3 C;  1PKX A;  5B1N A;  3DTU B;  4O4I B;  3BPZ A;  5IY5 B;  5L3B A;  3OUF A;  5DED A;  3GB7 C;  3T4D A;  2FL4 A;  4UV9 A;  1J95 A;  3APO A;  3HKE B;  3OT7 A;  1N4C A;  1DF4 A;  4DV1 B;  1GM8 A;  3EHB B;  4P9P A;  2UUC O;  2LGQ A;  3LSQ A;  3L75 H;  5B5E Z;  2YDE A;  2XOK G;  2WPD G;  2UUA O;  3CPW U;  4B3R B;  1WP8 A;  2UXD O;  3ZRW B;  4X65 B;  1YIJ V;  2ZXW B;  4K8Z A;  1F7Y A;  2OCH A;  1AB3 A;  3UQ8 A;  2DYS B;  2GDS A;  2X6A A;  3G71 V;  3P3N A;  2LP7 A;  1QHT A;  1OJH A;  3A0B Z;  4WCE V;  1M56 B;  3F5T A;  2VQF O;  5IDJ A;  1K97 A;  1S5L Z;  4O4H A;  2WLL A;  4B3M B;  3PN1 A;  4BW9 A;  4K8X A;  2VS0 A;  4Z1M G;  3RT3 C;  3UO3 A;  3K3W A;  2OYQ A;  1HNZ B;  4B3S O;  4X1Y A;  1NVP B;  1R3L C;  1HNX B;  1KU9 A;  3FB7 C;  2HVK C;  2H94 A;  1F4N A;  5KHG A;  1XIL A;  3RYC A;  1F51 A;  1OCZ B;  5KUK A;  4IGG A;  3W7W A;  5K1X A;  3AG2 B;  3JD0 A;  5EIB D;  5J2U B;  4JAU A;  2DQ3 A;  1QCE A;  4YXW G;  4JAV A;  4X1I B;  1WJZ A;  2CH7 A;  3ZS8 C;  3ABT A;  4QE9 A;  4MVQ A;  1AP5 A;  3JAS A;  1VF6 C;  3AK2 A;  4DR6 B;  4W4L A;  2B9Z A;  2ZD9 A;  4LF6 O;  3A8T A;  3FAV B;  4JPR A;  2QA4 V;  2AHY A;  2M6Y A;  3ZHR A;  4FM2 A;  1CEZ A;  4I9Q A;  4DV6 B;  1FD9 A;  3D36 A;  3FX7 A;  3K0D A;  2LJ2 A;  1RSO B;  4DRX B;  4NXM B;  3OR7 C;  4JI0 B;  1P84 F;  4YY3 O;  4I9W A;  3L73 H;  1T5E A;  1VF6 A;  4DR7 B;  2Q69 A;  1M9N A;  4BIZ A;  4O4J B;  5L3G A;  3I55 V;  5IJ9 B;  1S72 V;  4QPK A;  1IDS A;  4H33 A;  4WF9 V;  3ABM C;  4G28 B;  3K5L A;  3MD0 A;  4J42 A;  2ITD C;  2ITC C;  4DV1 O;  4DUY B;  1GH6 A;  4EB6 B;  4PDL A;  2PI5 A;  3CJH A;  4X66 B;  5EYP A;  1RM1 B;  1VQ4 V;  3TGU H;  1YVW A;  2OTL V;  4LFA B;  5A2Q N;  2P7T C;  2GV9 A;  5KA5 A;  1PPJ H;  3BCC H;  2EIL B;  3BVO A;  4FM0 A;  2QDO A;  4JGS A;  2RN9 A;  3OMI B;  4IHJ B;  4DR3 B;  4EKW A;  2L35 A;  2YSU B;  2UXC O;  1BSM A;  1YDX A;  2LO1 A;  2QTS A;  1JOY A;  1AJN A;  1K92 A;  2UUA B;  5KAI Z;  3JAT B;  3LNM B;  2KG7 A;  4A5U B;  4O2B B;  5EBL C;  1H2N A;  2IU0 A;  5B1A B;  2W6J G;  3I5D A;  1I5Y A;  3STL C;  1NJI W;  1K4C C;  5IYZ A;  4GX0 A;  4RUE A;  2YI9 A;  2YI8 A;  2JS3 A;  3DGE A;  3J80 N;  4GT1 A;  1VP7 A;  1EN5 A;  1Z5V A;  2P5O A;  2EIJ B;  1BGY H;  3AG1 B;  1I94 B;  1EFR G;  1VQK V;  3K06 A;  2JS5 A;  5L3C A;  1JPX A;  3U11 A;  1HW7 A;  3E86 A;  1FJG O;  2HJF C;  4DR1 O;  3WFV A;  2GBO A;  1PP9 H;  4KFM A;  1W0K G;  1IX9 A;  2YIB A;  1QR9 A;  4JI4 O;  1VQ6 V;  2R9I A;  3RVY A;  3B77 A;  1SES A;  5L3D A;  3FB8 C;  3ABL C;  1OCO B;  3H1I H;  1EN6 A;  4UCR A;  1JCH A;  3WG7 B;  5IY5 C;  3K9S A;  5B1B B;  4P2Z A;  4TUY A;  2GTS A;  1UFI A;  1MNG A;  2H8P C;  1FFT B;  1M5I A;  2QM8 A;  1BMF G;  3CXH F;  3ZRX A;  5H9C A;  3ZHV A;  5JQG A;  2AZ0 A;  3N2G B;  3ZN0 A;  2Z0A A;  4DV5 B;  1GM9 A;  4JI8 B;  1WB8 A;  3OGC C;  4NXM O;  1XI1 A;  3OAA G;  3QVN A;  1XNQ O;  5HFL A;  4XDK A;  2KB1 A;  2ZIN A;  4UVC A;  3X2Q C;  3APQ A;  4NB5 A;  4UCV A;  1SQQ H;  5CA1 A;  3OEH G;  1ZLZ A;  4YHH B;  4ASU G;  2E3C A;  2JEU A;  3K59 A;  1QLN A;  2IBZ H;  4O4L A;  2Q6A A;  4IT5 A;  1S76 D;  4G27 B;  3U10 A;  2WLL B;  2IH1 C;  3CRQ A;  2JGD B;  2X7R B;  2XAJ A;  1PM9 A;  1SA0 B;  5E79 Z;  1XNR B;  2IM9 A;  2ADP A;  5CBG A;  1D2D A;  3JAW A;  5LP6 B;  1JMK C;  2UXB O;  1XL4 A;  3CME V;  4MVU A;  4U7O A;  1IBK B;  5FPR A;  2Q4P A;  1XMQ O;  3L71 H;  1NT2 B;  3ETD A;  5BR8 O;  4MTF A;  4AHC A;  1MSD A;  1Y4M A;  4DV2 O;  2VQE B;  1K4D C;  2B5U A;  2IJK A;  5LXT B;  2CTQ A;  4ICG A;  4CC6 A;  1GN3 A;  1FFX B;  2GUZ B;  3SDL A;  3HKD A;  5KHH A;  1TGO A;  5EYP B;  5C8Y B;  4JYY A;  3F7Y C;  2QTO A;  2IJJ A;  3LDE A;  1Q86 W;  3AG7 A;  4TQD A;  2UU9 B;  1NR1 A;  4FK5 C;  4X8A A;  2JEX A;  1FXK C;  4FFK A;  4I4T B;  4YJ2 B;  1R6T A;  3T4Z A;  4LF8 O;  1K3E A;  1IXB A;  3A0R A;  1YJN V;  3RYI B;  4DXW A;  3SJA C;  5H2F Z;  4CH6 A;  4JI0 O;  4TV9 B;  4YIP A;  3OE7 G;  3U0Z A;  1JX9 A;  4FLY A;  1AJQ A;  4K3A A;  4LR3 A;  1SQP H;  4LWS B;  4DR5 O;  1MSW D;  1XNQ B;  1VQM V;  1M93 A;  2EZP A;  3AEI A;  4MVO A;  3ML0 A;  3ZBH A;  4I55 B;  1TVK A;  2P90 A;  1ZTE A;  2Q5Z A;  4EEQ A;  1QU7 A;  3ZN1 A;  1EM1 A;  1VF5 B;  2Q8V A;  1K9M W;  1XMO O;  2BTQ A;  4X64 O;  1P7B A;  4O2B A;  5CBH A;  4PA7 A;  2F95 B;  1IBL B;  1FYJ A;  1WAZ A;  1NH2 D;  3ZMU A;  4MVM A;  4PA3 A;  2UXX A;  3W7U A;  1GKF A;  4H37 A;  1N33 B;  1SZT A;  1H38 A;  4J11 A;  3CCU V;  4B3S B;  4PA9 A;  1KD1 W;  1PD3 A;  2CGN A;  2P22 C;  4LF5 O;  2BTO A;  3A2F A;  1Y76 B;  2QKS A;  2XAS A;  3HB3 B;  4B7E A;  5ITZ B;  3ABK B;  1ZX3 A;  2ZQM A;  1YTF B;  4JI7 O;  3BFR A;  1LR1 A;  4I7Z B;  3G6B A;  1NR7 A;  3BY6 A;  5CMU A;  2YC0 A;  4FFB B;  4KHP B;  4LF4 O;  3Q4H A;  4WFG A;  2CUG A;  3ASO C;  3OEE G;  3KCY A;  1IBM B;  4X1K B;  4NTX A;  3OGI B;  4MS2 A;  1OV9 A;  1VMG A;  1KP3 A;  1Q8I A;  1L8D A;  3KCX A;  2ZR2 A;  3ABL B;  1OCZ C;  4LF7 O;  4YJ3 A;  1WA8 A;  4ZI7 B;  2YIB D;  2AGA A;  4MVS A;  4I5S A;  1DGS A;  4JI1 O;  2E5L B;  2QWP B;  1XNR O;  5IT9 N;  4WFE A;  1G8M A;  3AG1 C;  3FB6 C;  5FPO A;  1L0N H;  1PNM A;  1LUW A;  1SA0 A;  1W2B U;  3S3W A;  3ZHQ A;  3FB5 C;  4ZHQ B;  1R73 A;  4RUF A;  4LFC O;  3SPJ A;  5LMN B;  1N0J A;  4J7Z A;  5BXZ A;  3J81 N;  4DUZ B;  4K0K O;  5J2T A;  4DR4 O;  1Y76 A;  1M90 W;  1I08 A;  3UKM A;  2QKA A;  1YHQ V;  4I50 B;  5AG2 A;  3T1C A;  2ZXW C;  4O4H B;  3FYE B;  5KX5 A;  2LQT A;  4WFH A;  2Q7G A;  3TCU A;  2BSK B;  3GWO A;  2R9R B;  2RJZ A;  5FL7 G;  2CK3 G;  3LSU A;  5KLV H;  2EIN C;  2JJ1 G;  3S3X A;  3TK1 A;  1L0L H;  3WB0 A;  1XMO B;  1K5Q A;  1RP3 B;  3C3S A;  1E1R G;  3ZIA G;  3VBB A;  2FTK A;  1URF A;  1A32 A;  1BT8 A;  2WAM A;  3O9O A;  3K5N A;  2YXL A;  2DQ0 A;  2XAH A;  3B8M A;  5LHG A;  1WPX A;  3L9D A;  4BW5 A;  3E8B A;  1YCI A;  1XUQ A;  2EIJ C;  1ENV A;  1AP6 A;  3R65 A;  4GKJ B;  2F1M A;  5CB4 B;  1OHH G;  3E2E A;  1Y6X A;  5J9P C;  3CXC U;  2Q68 A;  2P06 A;  3LDD A;  1MZE A;  4TWK A;  1OCR B;  1M4U A;  2CTR A;  1SRY A;  2AHZ A;  5FNV A;  5JH7 A;  2E74 B;  2PY5 A;  1FFX A;  4PA6 A;  3P3P A;  4XDJ A;  4Z1V A;  3TJT A;  1VEW A;  3MHH C;  2YIA A;  1IVS A;  3H9V A;  2A06 H;  4LH7 A;  1E1Q G;  4LWS A;  4ZBM A;  5D5P A;  1HNW B;  2ATK C;  2OTJ V;  4PD4 F;  3E22 A;  3A0H Z;  4DR2 O;  2OWO A;  4JV5 O;  4LF6 B;  4LCU C;  1VQ5 V;  2UUB O;  3PJS K;  3SYA A;  3Q4H B;  2FYU H;  3IFX A;  4XDL A;  5IE9 A;  5JH7 B;  2JRI A;  4DV7 O;  4XBF A;  4K0K B;  4NYK A;  3JSL A;  1G1X B;  3HKC B;  1ROP A;  4PDV A;  1QBZ A;  2C2A A;  3ASO B;  2ZM6 B;  5LOV A;  2DYS C;  3CWB H;  2DWE C;  1EBO A;  5GTH Z;  3OUS A;  1N32 B;  2HVJ C;  1ZL8 A;  1VQ7 V;  3ETG A;  3CCR V;  1DF5 A;  1XL6 A;  3VQV A;  4JTA B;  3RYH A;  2Y69 B;  3WB2 A;  5LXT A;  1SZX A;  2W0X A;  3JAL A;  1FJG B;  4UUJ C;  1NBM G;  3DSQ A;  3RYF B;  3TET A;  5CA1 B;  4KP4 A;  4JI3 O;  1R6N A;  4JZG A;  4JI6 B;  3RN4 A;  5EBW C;  1VQL V;  2F66 C;  4DR6 O;  3H1H H;  4J9Z B;  3BEH A;  3AK1 A;  3ASN B;  3WU2 Z;  2RDC A;  1SQB H;  1YEW A;  5FNV B;  2IJH A;  2VWK A;  5D5Q A;  3ZHT A;  1SQX H;  2IU3 A;  4DW1 A;  4GLX A;  1MMM A;  1US6 A;  3JD2 A;  1XBL A;  2BSK A;  2PI4 A;  2ZDI C;  4H13 B;  4TUY B;  4PHZ A;  1KEC A;  5LGT A;  2VQF B;  3K0G A;  4B7K A;  1Y66 A;  2QR4 A;  5JJN B;  3LUT B;  4OGQ B;  1SC5 B;  4TT3 G;  4GX1 A;  2AXT Z;  3QO7 A;  4PI2 A;  4DUY O;  4ZIB A;  2W6I G;  2H3O A;  1M1K W;  2P6J A;  3D8C A;  5CBF A;  4MT8 A;  1WPB A;  5L3F A;  2HKO A;  4KL1 A;  2BOC C;  4Q20 A;  1QNM A;  3O65 A;  2NN4 A;  2KQX A;  4JTC B;  2OCC B;  3SYO A;  2ZE6 A;  1SET A;  2QEX V;  1GO3 F;  2DOS A;  3OM3 B;  2WLH A;  3OTO B;  2A0L A;  4J80 A;  1GM7 A;  3KZI Z;  5BZB A;  5EC1 C;  5KA6 A;  4FLU A;  1DK1 A;  1R3K C;  3CCV V;  3DXR B;  3JAW B;  2PGG A;  5LP6 A;  1FPO A;  3JAT A;  3FFQ A;  4DV0 O;  1I94 O;  1Q7Y W;  1N32 O;  4JI2 B;  3CE2 A;  2VQE O;  2LW1 A;  4B3R O;  1PNL A;  1HNZ O;  4D7T A;  5J2T B;  3WG7 C;  4LNU B;  1NS1 A;  5LGU A;  4MW3 A;  2QWR B;  1BZK A;  2PUS A;  1Y74 B;  1THZ A;  3LSS A;  2WWW A;  3N27 A;  5EBM C;  5GTI Z;  4DV3 O;  3W7X A;  4X20 A;  3GVM A;  3M8A A;  3RWR D;  4AIL C;  3HKC A;  2VWJ A;  4DK0 A;  1WP7 A;  4J9Y B;  2Q9L A;  1QVF U;  5GW7 A;  4X89 A;  1VQN V;  2CTP A;  2Q73 A;  2WA4 A;  1RM1 C;  1NI8 A;  1Q82 W;  1EZJ A;  1H2K A;  1EN4 A;  2HLD G;  3E22 B;  5BY1 A;  3BAB A;  1BL8 A;  1H8E G;  3KG2 A;  5DM6 V;  3N2G A;  3ZMZ A;  3E8H A;  1TUB A;  1YF2 A;  5JCO A;  1ARO P;  4MTX A;  1MZF A;  1S0V A;  3D3Q A;  4NTY A;  1MAB G;  5BR8 B;  3AG4 B;  5GON B;  5L3E A;  5LA6 A;  1Q43 A;  1O9H A;  1F4M A;  1RPR A;  4I0X B;  1M57 B;  1YZB A;  2ZIO A;  5KMG B;  2R72 A;  3IC9 A;  1S3J A;  3SJQ C;  5CN0 A;  5IJ9 A;  1WN7 A;  1GK9 A;  4O4J A;  3SGI A;  1YIT V;  3CCE V;  3VOU A;  1G6U A;  5BMV A;  2R70 A;  2F4V B;  2Q0O C;  1OCO C;  1AIL A;  5DEC A;  4AQY B;  3EFF K;  1S5J A;  4JI1 B;  3T1H B;  4ABM A;  1RSO A;  2AW9 A;  2ZT9 B;  4K35 A;  1FXK A;  3CHX A;  4EFE A;  5IYC O;  1GAX A;  3JD1 A;  1YJ9 V;  4FVM A;  4UCT A;  4BIO A;  1N34 O;  1B04 A;  1P4R A;  2WLN A;  2UXN A;  1W59 A;  2KKW A;  3AG3 B;  5JJE B;  1U96 A;  3OFN G;  3QTC A;  1QLE B;  4LF9 B;  3B4S A;  3SPH A;  4MVZ A;  1NZ6 A;  3OTO O;  2ZDI A;  3MHS C;  1AJP A;  1S77 D;  2HR3 A;  2ADQ B;  1N36 O;  4UVA A;  4PA4 A;  4NXN B;  1SQF A;  1GMG A;  4H44 B;  4U3J A;  1M56 C;  5E1A C;  1HR0 O;  1H2M A;  1JJO A;  3SPI A;  3BAA A;  3UM7 A;  2L6L A;  3LNN A;  5B1A C;  1XRE A;  2PTM A;  3ZCC A;  4J7K A;  1CXZ B;  1IXM A;  3CC7 V;  2DWD C;  3QNE A;  2F23 A;  3ZHU A;  4LFA O;  3AK3 A;  1IUR A;  1LUV A;  1H2G A;  3HKB B;  3SYC A;  1I0H A;  4DV4 B;  4F6E A;  2EIL C;  2PYL A;  2ZE5 A;  3E8G A;  5H6R A;  5LBQ A;  3ASN C;  4CS3 A;  1AR5 A;  5KHI A;  1AI6 A;  3CRM A;  5LMN O;  1NTM H;  2DJV A;  4B3T B;  3ZRW A;  1I5X A;  4YY3 B;  1AI7 A;  1OCR C;  2XUM A;  3C90 A;  2PYJ A;  4JYA O;  4DV5 O;  4JI8 O;  1BQ0 A;  2Y0I A;  1WNS A;  3ZMV A;  3F7V C;  3DC5 A;  1YSC A;  3JAS B;  1IBK O;  1JFF A;  2R9A A;  1XMQ B;  4BIU A;  1KKD A;  1GN4 A;  1B6Q A;  3HKE A;  3TXQ A;  3MAQ A;  4J7J A;  2QM7 A;  3B8N A;  1K5S A;  4BWA A;  4JTD B;  3AG4 C;  4UCU A;  3EXA A;  3JYC A;  3L72 H;  3CRA A;  2F4V O;  1Q3E A;  5LYJ B;  1V55 C;  1VQ9 V;  5KUM A;  2ILM A;  1N34 B;  2A9H A;  4JI5 B;  3CX5 F;  3JAR A;  4X1Y B;  2EIK C;  1SKV A;  3BA8 A;  3CCQ V;  4LF8 B;  1EZV H;  5K1P A;  5IJ0 B;  4P9O A;  4JAS A;  1MA1 A;  2YEV B;  5LMU B;  3BRC A;  4ZHQ A;  1N8R W;  1Q6H A;  2W0F C;  1VIB A;  2HP8 A;  1QQC A;  4GCZ A;  4GUN A;  2BTQ B;  4R50 A;  1K34 A;  4NKG B;  1V54 C;  1KC8 W;  3CB2 A;  1K8A W;  2N05 A;  1JA8 A;  5JQG B;  5LGN A;  4YIO A;  1FKA O;  5EC2 C;  2M7W A;  2V1D A;  2XAF A;  4GYC B;  2UXD B;  1JFF B;  3K04 A;  4B08 A;  4KUM A;  5IJ0 A;  4AQY O;  2EJ7 A;  2NLJ C;  2LFR A;  3D3I A;  4C7U A;  1PL0 A;  4IHJ A;  2CAZ C;  1W0J G;  4E2L A;  3N2K A;  4WFA V;  5B66 Z;  5BMV B;  3R66 A;  1COW G;  4FJC C;  3CCM V;  4UV8 A;  5EZY A;  1FAF A;  3P30 A;  1V9P A;  4OPH A;  4I4T A;  3K57 A;  1NTZ H;  4HYO A;  5KMG A;  2Y69 C;  1F23 A;  4U7N A;  4JYA B;  4X88 A;  3RVZ A;  5JWP A;  3OMA B;  5GON A;  4MSW C;  3SPC A;  2ODM A;  2UU9 O;  4D7S A;  3N2K B;  2Y4T A;  1NQT A;  4GX5 A;  3OD4 A;  2V4D A;  3EVK A;  1M57 C;  3L70 H;  3LDC A;  2DE0 X;  4WBN B;  4OXS A;  2YID A;  5B3S B;  2Q7H A;  2YUA A;  3IGA C;  2WLI A;  5LP6 C;  4FZ1 A;  1AVM A;  5JVD B;  3FAV A;  2V7Q G;  4FMT A;  4IIJ B;  2FML A;  5EIB C;  2D3O W;  2OIG A;  2CE4 A;  1R1B A;  4CZZ A;  2B1G A;  2CH7 B;  3RGB A;  4D6T H;  1VQO V;  3K58 A;  4F4L A;  4DR5 B;  3VQW A;  4FLZ A;  1BE3 H;  4X20 B;  4LF5 B;  3I56 V;  1FXK B;  3K79 A;  4TOI A;  5F2V O;  1Y74 A;  4CH4 A;  3HPL C;  3QF7 A;  1PL4 A;  4QGP A;  4OX9 O;  1KQS U;  4DR4 B;  3H1K H;  2LW7 A;  4JI2 O;  3DXR A;  3CEI A;  2XT9 A;  4UCO A;  2XAQ A;  1SQG A;  5JCO C;  5C8Y A;  1K73 W;  4I55 A;  5KHK A;  2HHH O;  4ZOL A;  4X65 O;  5B1B C;  3E83 A;  2DYR C;  2XAG A;  1B06 A;  1X59 A;  1I7F A;  1OCC C;  4FZ0 A;  3M7M X;  2D2C B;  3G4S V;  4DR7 O;  2YEV A;  1SF9 A;  2OT5 A;  1Q81 W;  5A9G A;  2EJR A;  1SQV H;  4TV9 A;  1K7D A;  2DN9 A;  3B40 A;  2Y4U A;  2NNU A;  4PV1 B;  1FXV A;  3SJC C;  2A7W A;  4WFB V;  3CCJ V;  4FPP A;  1YI2 V;  2XTA A;  4YJ2 A;  4TV8 A;  2WLJ A;  2NR5 A;  3M99 B;  4YHH O;  1AR4 A;  2ZE7 A;  1D5N A;  2Y48 A;  4DR1 B;  4QE7 A;  1SS3 A;  4W4K A;  4RQE A;  2B1I A;  1CPY A;  2IW5 A;  2JGD A;  3HKD B;  3HKB A;  2EBO A;  4UXN A;  1H8H G;  4KXR A;  5C93 A;  2GUZ A;  3T1Y O;  1KMI Z;  2GTA A;  3JCZ A;  2JK5 C;  1IZ3 A;  1J5E B;  2XND G;  4X62 B;  4R6Z A;  1IBL O;  2UUB B;  4F6R B;  3ETQ A;  5JJJ B;  4JZ2 A;  1YJW V;  4TQF A;  3ZX6 A;  1JQ0 A;  2QKC A;  4DV6 O;  4HNA B;  2KG7 B;  2ZKO A;  3DC6 A;  1XQ8 A;  1HP8 A;  4QIW F;  5HFM A;  3B09 A;  4RWU A;  4FFB A;  3GWK C;  3JD4 A;  2Q67 A;  2QWQ B;  4NVP A;  2MK3 A;  2QWO B;  2XHB A;  3D36 C;  3CCS V;  1ZL8 B;  1D5A A;  4RAI A;  1RPO A;  3VQY A;  4JI4 B;  5H6Q A;  4EB6 A;  1TUE B;  4FLX A;  4LC1 A;  4MTO A;  2P4K A;  2QE7 G;  4UB6 Z;  4JV5 B;  2DYR B;  3NXS A;  5CA3 A;  1GRJ A;  4X9Q A;  4CH5 A;  4U3J B;  2N04 A;  1KB9 F;  2WA3 A;  3IC7 A;  4I0X A;  1BS3 A;  4CC5 A;  4PI0 A;  3JAK B;  3E8F A;  3OTF A;  2E5L O;  4QNH B;  1G4Y B;  2RCV A;  3QO5 A;  2UXB B;  4DO2 A;  2PF4 E;  1BHB A;  2A3Q A;  3CYO A;  5IYD O;  1R3I C;  5IYZ B;  3J7A U;  4LFC B;  5CA0 B;  4HBN A;  3STZ C;  2QWN B;  2EIN B;  5TIS Z;  2E75 B;  4DV2 B;  3JAK A;  2KSD A; 
#chains in the Genus database with same CATH homology
 3F5T A;  2VQF O;  1XNR O;  5IT9 N;  2UXC O;  1IBL O;  4OPA A;  4DR5 O;  3RT3 C;  5IWA O;  5H5N A;  3JAM N;  4A5U B;  1IBM O;  5FLX N;  4B3S O;  4LFA O;  5BY1 A;  4DUZ O;  4LFC O;  1FKA O;  4JI5 O;  4DUY O;  5BXZ A;  3J81 N;  4GKK O;  4K0K O;  4GKJ O;  4DR4 O;  4DV6 O;  1XMO O;  4DR3 O;  4OX9 O;  4DR2 O;  2ZKO A;  4JV5 O;  4X64 O;  4AQY O;  1KUQ A;  2UUB O;  3J80 N;  1FYJ A;  2LW7 A;  2N74 A;  4JI2 O;  1J5E O;  2JRI A;  4DV7 O;  3O65 A;  1D2D A;  5LMN O;  4KHP O;  1XEQ A;  2DJV A;  1YZB A;  1G1X B;  2UXB O;  3R66 A;  4B3M O;  4JYA O;  4DV5 O;  1FJG O;  4DR1 O;  4JI8 O;  1XMQ O;  2DOS A;  4LF6 O;  4LF5 O;  5BR8 O;  2HHH O;  4X65 O;  4JI6 O;  4OPH A;  1IBK O;  4JI4 O;  4DV4 O;  4JI7 O;  4DV2 O;  1X59 A;  4LF9 O;  1AIL A;  1HNW O;  1A32 A;  1DK1 A;  4DR7 O;  1N33 O;  4YY3 O;  4LFB O;  3SDL A;  4NXN O;  4DV0 O;  1N34 O;  4LF4 O;  1I94 O;  4B3T O;  2UUC O;  2F4V O;  1N32 O;  2VQE O;  4X66 O;  2UU9 O;  1HNZ O;  4B3R O;  4X62 O;  4JI3 O;  5LMU O;  1NS1 A;  2UUA O;  2E5L O;  4DR6 O;  2FKX A;  4YHH O;  2UXD O;  3OTO O;  5LL6 Y;  1R6T A;  4DV1 O;  1HNX O;  2Z0A A;  2ZM6 O;  1N36 O;  4LF8 O;  1F7Y A;  4DV3 O;  4LF7 O;  1AB3 A;  5A2Q N;  3J7A U;  4NXM O;  1R1B A;  3M8A A;  3T1H O;  2AGA A;  1XNQ O;  3T1Y O;  4JI0 O;  1HR0 O;  4JI1 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...