3N27A

Molecular basis of the inhibition of henipa viruses
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
78
structure length
73
Chain Sequence
KNADNINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDYGIDISIELNKAKSDLEESKEWIRRSNQKLDSIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Fusion glycoprotein F0, linker, Fusion glycoprotein F0
publication title Molecular Basis of the Inhibition of Henipa Viruses
rcsb
source organism Nipah virus
total genus 34
structure length 73
sequence length 78
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3n27A00
4FZ1A 4NYKA 2L35A 3IJ4A 2QTSA 4NTXA 1WP7A 3N27A 3S3WA 3S3XA 2FB5A 4FZ0A 1WP8A 4NTWA 4NTYA
chains in the Genus database with same CATH superfamily
1Y74A 1SA0A 3RWRD 1QLEB 1IBLB 2X6BA 3BPZA 4I4TA 3AK3A 4J11A 1SRYA 5EC2C 5GONB 4JI6B 2EINB 2Q5ZA 2EIKC 1NVPD 2Y4UA 4DR4O 2LW1A 4DV3O 3KKYA 1VQKV 1JOYA 3E2EA 4X1YA 2VS0A 4BR6A 1CEZA 1W2BU 1Y6XA 1G4YB 2LGQA 3QG5A 1NTKH 4DW1A 4WFGA 1WP8A 5IDJA 3ZMUA 1HNWB 3A2FA 2DN9A 5D5PA 3OTOO 4I5SA 4ZIBA 2V1DA 3I5DA 4LBEC 3BA9A 5IYZA 3SPJA 4I9QA 1CXZB 4OPAA 3RYFA 4J7KA 4FM2A 5A9GA 3RFRA 4PELA 3ABKB 4JI2O 3JYCA 2KG7A 5EYPA 5CA3A 2GUZA 4FPPA 1MNGA 1M1KW 2HFEC 1N32B 2HVJC 3JD4A 4GX2A 2LFSA 3D36C 5LXTB 3FAVA 1B3QA 4NB5A 2CDYA 3LSQA 4DV0O 4B3RO 3BEHA 2ZNIA 2QEXV 5KHKA 3FB5C 2GBOA 1NS1A 3JAWA 5CBHA 5KAFZ 1MMMA 1QQCA 1KECA 1S77D 1YDXA 1GN2A 1VP7A 2LGWA 5H5NA 5ITZB 2QM8A 4FFBB 1B6QA 1H2GA 1ORQC 1BZKA 1FXKC 2QM4A 3F5TA 3A8TA 3G67A 2UXBO 1JFFB 4LFCO 5IY5C 1K33A 3O9OA 4FMTA 1MSDA 1ZUQA 2D2CB 4Z2WA 3LDEA 4E4EA 1NKDA 2EX3A 2FYUH 1IZ3A 2QWRB 5LBQA 3OD4A 4JI6O 2UUCB 2P06A 2F95B 3T2MA 3JAMN 1KUQA 2BSKA 3N27A 3ETGA 3CCSV 3ETDA 3B2EE 5KMGB 1EZVH 1FXHA 1L0NH 2EULA 1KP2A 4DR2O 4O2BA 2D3OW 1VMGA 1QLNA 1JCHA 3ICXA 4Z1VA 2E5LB 1IVSA 1YJNV 4DR1O 3KCXA 2FMLA 1V55B 3ML0A 5FPRA 2EIJB 1GO3F 3H1KH 1GN4A 2GV9A 2UUBO 4UB6Z 3HKDB 3CJHB 4U3JA 4FIPC 4TV8B 4JYYA 2YEVB 1VF6C 4PDVA 1VQNV 3QF7A 1D2DA 4NYKA 3CRRA 4LNUA 4X65B 3PN1A 1YJWV 3OUSA 1JR9A 1R6NA 5CMUA 1MABG 4QNHB 2ZINA 3IFXA 2Z0AA 4UUJC 4OX9O 4FLUA 2PUSA 2K1EA 4PA9A 2ZM6O 3W7XA 3APQA 1S3JA 2RN9A 3K5OA 4X1IB 5GONA 1HNZB 1TUBB 3CCUV 1K92A 5JVDB 1QNMA 5JJEB 2CUGA 1GH6A 2XAQA 2DYRB 2IU3A 4IHJB 2EIMC 5LMNB 3FB7C 3K5NA 4YIOA 1OCOB 3TK1A 3CE2A 1K4DC 4JI8O 3A0HZ 2XASA 2GSMB 4BW5A 4ZBMA 4ZHQB 2Y48A 5DM6V 2ZE5A 4GX5A 4MTXA 3SGIA 3ZRXA 1NVPB 4GYCB 1YEWA 4MVOA 3H1IH 2UUCO 3M7MX 4K3AA 3B09A 2JS5A 1X59A 2PZSA 1R3KC 4GX1A 2JDIG 3AEIA 1MSWD 2B1IA 1ZL8B 3OR6C 2R9IA 4BAYA 5L3GA 4LF5O 4NKGB 4KFMA 5KAIZ 4YJ2B 1Q90D 3EXAA 2OCCC 3JSNA 1Q82W 4NXMB 4J9YB 5E79Z 1SQVH 2BOCC 5LXTA 3PJSK 3CCJV 3CWBH 1BE3H 2ODMA 1GM9A 3CCLV 2E5LO 3WG7C 3ZRWA 2UUAB 3CXCU 4GKJB 1IXMA 4DR3O 4QE7A 1XL4A 4RQFA 3WFVA 2ZNJA 3K79A 4PI0A 1ROPA 3T1HB 5BR8B 1Z2GA 4K0KB 4EEQA 2QJ1A 4F6EA 2YS8A 3SPHA 5JCOA 4JPRA 1YVWA 4FFBA 4X20B 1O9GA 4PA6A 4X65O 3EFFK 3X2QC 1AJNA 1EN5A 2M7WA 1JFFA 2HG5C 4F4LA 5LGNA 3ABMC 2OWOA 3E86A 2F66C 2JRIA 4I4TB 4O2AB 1XMOB 1AILA 4AQYB 3SPIA 1AR4A 4CH5A 3F5WC 5FLXN 2BTOA 1D5NA 5JH7B 1YF2A 1J5EO 3B77A 1FXVA 1K4CC 1FXKA 4EB6A 1BHBA 2LP7A 1BQ0A 2ILMA 4X1YB 3X2QB 4FM0A 4CH6A 4P9OA 3ABMB 1SERA 2YICA 4U7NA 3SYCA 1UFIA 4MVMA 1MG1A 4QIWF 1LR1A 3CRAA 5KMGA 1KD1W 5TISZ 3A0RA 3OMNB 2YIBD 4DR7O 4YHHO 2WLIB 4CH4A 1RM1C 2IBZH 5B1AC 5B1NA 1SC5B 2DWDC 2ZDIA 2W0FC 4WCEV 3WB2A 2Q73A 3G71V 2DW4A 5DN6G 2GUZB 1E79G 3H9VA 3P3NA 4JTCB 2X6AA 2OTLV 3W7WA 1R73A 3HKDA 1Q81W 2ETNA 3CJHA 2PI4A 3IAYA 2XOKG 4TV8A 4EFBA 2YEVA 2ITDC 2LQTA 4UVCA 4NTXA 4NXMO 3B4SA 5B1AB 3K3WA 1FFTB 1AI5A 5KA6A 2PGGA 2VQFB 4KHPO 5LMUB 1V9PA 3RN4A 2Q9LA 1R3IC 3RVZA 2Q7EA 4TQDA 3JAWB 1KB9F 3RYIB 4CS4A 1XL6A 2GHYA 1RPRA 3JATB 4EFEA 5LOVB 2Y4TA 3K04A 1VIBA 4J42A 1WB7A 2XAHA 4K0KO 2ZE7A 1BS3A 3CSXA 1L1FA 2UXCB 4NVPA 3APOA 4JI4O 1M57C 4PDRA 1M56C 4WFHA 4IHJA 4ICGA 3ABUA 3TCUA 2X7RB 2Q8VA 1I5XA 4GKKB 2HLDG 3RGBA 2V4DA 1YZBA 2Q0AA 3DGEA 3TETA 4ZHQA 4PA3A 3FD9A 1ZSPA 4IL6Z 4TV9B 2P90A 2JIZG 4AQYO 1M5IA 2JJ2G 1XEQA 2EILB 4JI1O 2BSKB 2VQEO 3L70H 4BIOA 3UO2A 3RVYA 3ZX6A 2GTAA 1ZL8A 5KHGA 4KXRA 3AG3C 4YJ2A 4N23A 3ABLB 4O2BB 2UU9O 1LUWA 4RQEA 2ZIMA 1Y76B 2QGNA 4I55B 1B04A 2N04A 5B1BC 4FFKA 5HFLA 1N36B 1G1XB 3K59A 4JI0O 4DV2O 3D8CA 3T1CA 3T4DA 4ZOLB 1JJ2U 4NXNO 1AB3A 2F1MA 3K58A 5GTIZ 2R72A 3BFRA 2QM7A 3C3TA 2BOBC 4IYHA 2FB5A 3AG2C 4IT5A 4LF6B 2F43G 4FJCC 1OCCC 4HZ3A 4X20A 3S3XA 2VQFO 4LFBB 3THOA 3WU2Z 1EZJA 1YXBA 1OJHA 1CPYA 1Z5VA 1YCIA 2QA4V 5JWPA 5LGTA 4O2AA 5L3FA 4GT1A 3IGAC 3F7YC 4IIJB 2A9HA 1BQZA 5A2QN 1XNQO 1QU7A 3K08A 3K9SA 4HBNA 2F23A 5JH7A 2WLKA 1GKFA 1P7BA 1I94B 2IJKA 1U97A 3ETEA 4JASA 1YITV 1XUQA 2N74A 2CGOA 4W4KA 1GM8A 4DV4B 4LH6A 4Q20A 2YXHA 4GKKO 3UO3A 1JA8A 3N2KB 1F51A 3TXQA 2EIKB 4LWSB 2YUAA 3L74H 5B1OA 2WLIA 1NTMH 5JQGB 1PD3A 1KU9A 4XDLA 1KP3A 1NI8A 4X89A 4UCVA 4CZZA 1GMGA 4J80A 3SYPA 2QWOB 1M9NA 4F6RB 3RBZA 4X64B 3VQYA 2ZXWC 1EN6A 3P3PA 3LUTB 3M8AA 2UXXA 3E89A 3JARB 2ZR2A 4RUFA 5H6RA 1XREA 3ZMVA 3MDSA 1OHHG 1Q86W 1NZ6A 1QR9A 3O65A 1N4CA 3ABTA 2VRZA 1Q6IA 3ZRWB 3OE7G 3L73H 3L71H 4B3MO 1AI4A 3RYIA 5LGUA 2LJ2A 4O4HB 2OTJV 3JATA 5LOVA 1I7FA 3G6BA 2P4VA 3K5MA 5IWAO 1L8DA 2B1GA 4PDMA 3H1HH 4KUMA 2V7QG 4JYBA 1L0LH 5JJNB 2E3CA 1XMQB 2F4VO 3L75H 5KUMA 3CC4V 4UVBA 1HR0O 4JI7B 1PNKA 4HNAA 3B8MA 1IBLO 2NN4A 4UFZA 3QO5A 4TV9A 3ZHRA 1AI7A 4UCRA 3HR0A 2X6CA 5C8YB 1HDJA 4PDLA 4WBNB 2Q68A 1FXKB 1ZLZA 4EB6B 1I94O 2WAMA 1R1BA 4RUEA 2DMXA 5IY5B 3R66A 4TOIA 5L3CA 1KC8W 1FJGB 3JD2A 3NR7A 5KHIA 5FNVB 1NJIW 4R7CA 4D7SA 2BCCH 3ZMZA 1VQMV 1JVMA 3SPGA 1AR5A 5IYDO 1HNWO 1Y76A 3D3QA 4I55A 4U3FH 4G27B 3E22A 3J81N 2KB1A 2XTAA 4B3SB 3JD3A 1K5QA 4UCTA 5LL6Y 2DQ0A 4ZOLA 4JI3B 1W0KG 3ZMTA 4DR5B 1BL8A 4X64O 4NTWA 1AR1B 3P32A 4MW8A 4H0LB 4YY3B 1N32O 4MTOA 4FVMA 2A06H 4R6ZA 4CC5A 1Q7YW 2WLMA 2IH3C 3FFQA 1DTOA 1PNMA 3JD1A 2DYSC 3OTFA 1Z5WA 1G8MA 1URFA 4AILC 1PPJH 2P67A 3FB6C 3CX5F 2RCVA 1K34A 4IIJA 2AHYA 1EFRG 2AZ2A 1CP9A 1V54C 2HHHB 1K7DA 3MHSC 2N05A 2FL4A 1F7YA 1H2MA 5CA1A 1P4RA 2L6LA 3T1YB 1WB8A 1FFXB 2IH1C 1K9MW 3H1JH 3E8GA 5CBFA 4J7JA 4LF8B 2JJ1G 4JYAB 5EBLC 2GDSA 3G4SV 1JJOA 2ITCC 1GM7A 3N2KA 4LWSA 4U7OA 3FYEB 3OEEG 1IXBA 3R65A 1HW7A 2EZOA 2YIDA 2CGNA 5H6QA 1N34B 1H8EG 5JQGA 4Q6GA 4MVQA 4DRXB 3CXHF 3AK2A 2EIMB 1VQ8V 1OCZC 1IBKB 5L3DA 1FKAO 3GB7C 4OXSA 1IBMB 2PI5A 5JJJB 4F6RA 3TJTA 1FJGO 2XUMA 2WPDG 2HR3A 4JI5B 2CH7B 2ZIOA 1Q6UA 3VQWA 2EJRA 2YIBA 2K9PA 2CE4A 3JARA 3ZEDA 4E2LA 3K06A 4HYOA 3LSSA 5J9PC 2A7WA 4YJ3B 1RPOA 1H2LA 5GTHZ 4O4LA 3LNMB 3SYOA 4H13B 3SYQA 3ASNC 4PA7A 4X88A 3HKCA 3DTUB 2JK5C 4DV6B 4TUYA 5IJ9B 3AG1C 1YSCA 2IM9A 4DV1B 3SYAA 5LP6C 2OCCB 4I50B 4MVSA 2LFRA 3QVNA 3UT5B 4K8ZA 3D36A 4O4HA 4DR5O 1W0JG 5BMVA 1PL0A 4ZKIA 1EM1A 4FK5C 4LF7B 5BXZA 3WG7B 2HP8A 1XBLA 4L87A 3J80N 4I0XA 3CCRV 2XAGA 4MVRA 3TGUH 4C7UA 5J2TB 1AVMA 2QR4A 4D6TH 2FKXA 1RFYA 1HNZO 4DUZB 3C3SA 5C8YA 4ASUG 1VF7A 4WBNA 2Q0OC 4UCOA 2ADQB 1GK9A 4P30A 4DK0A 1YHQV 1KQSU 1S0VA 4O4IB 4JAUA 5LMNO 3K9AA 4B7KA 1SESA 3WB1A 2AGAA 3E35A 4X1KB 5FNVA 5KLVH 3GWKC 3CCMV 3LNNA 1GN6A 3JSLA 3HKBA 3SR2C 1Q8IA 1RP3B 2CAZC 4A5UB 3MAQA 2YIAA 1SZXA 1GN3A 4LF9B 1LUVA 1N34O 2YI9A 1RSOA 2A3QA 3KCYA 2CTWA 2RJZA 1SQXH 1IBKO 3ZRVA 2HJFC 1YIJV 4B3TB 3CRQA 2YXLA 3OGCC 5B5EZ 4QE9A 1OCRC 2P22C 5IJ0A 2MW2B 4N21A 4P2ZA 2YSUB 2PY5A 3LDDA 2EZPA 1RM1B 3ASOC 3E83A 1PL4A 1GTOA 4R8CA 3JAKB 1YTFD 4JTDB 4UV8A 4JZ2A 1K73W 2R9AA 1WJZA 1D5AA 2EJ7A 2QKSA 3SJQC 2QDOA 2UUAO 5CA0A 5CB4B 1N0NA 4GKJO 2Y69C 2AHZA 4DV1O 2H8PC 4BIUA 4LFAB 1VF6A 3IC9A 1N33B 1WPBA 3T1HO 5BR8O 2OIEA 2ZD9A 3RYCB 4LF7O 3ZHTA 1VQ7V 5BY1A 1ZWIC 1FFXA 4O4JB 1P84F 2QWQB 1WLEA 1U96A 2WLNA 4LR3A 1B06A 3AG4C 3BABA 4HNAB 4JAVA 4DV7B 4DV3B 1WNSA 2NLJC 5KA5A 4FLYA 5D5QA 2Q67A 3CD6V 1XMOO 1SF9A 5H9CA 4QPJA 2LO1A 5CBGA 4AI8A 1GAXA 4DRXA 1M57B 4DUZO 2XHBA 1M56B 1YI2V 1Q6HA 1AJPA 5FPOA 4J10A 2XNDG 1H38A 3MD0A 3ZBHA 1SKVA 2JEXA 1MZEA 2IJJA 3OTOB 3ZRSA 1SQBH 4H37A 1VARA 2CH7A 2OIGA 4DYLA 4LCUC 3DXRB 1XILA 1H2SB 1JQ0A 1N8RW 3ZN0A 1KBHA 4YJ3A 1PNLA 3E22B 4LH7A 2OYQA 4LF9O 2ATKC 4UCUA 4XDJA 3SJBC 4DXWA 2WLJA 5IJ9A 1QVFU 2P6JA 2RNBA 3AG3B 4I50A 3FX7A 4MTGA 4DV0B 3UT5A 4LP8A 4B3TO 5FL7G 1W59A 4BIZA 2WA4A 4JF3A 3W7UA 1BGYH 1F4NA 1N0JA 2ZT9B 3EVKA 3DC5A 3OUFA 5B1BB 2QWPB 4DUYB 4JAAA 4ZI7B 5E1AC 1BCCH 4PA4A 1FYJA 3SDLA 3GVMA 1M93A 3BHPA 5LMUO 3G80A 1QLEC 3RT3C 3IJ4A 4TT3G 1SQGA 1XHZA 2Y0PA 3ZN1A 3E8FA 4FM1A 2EINC 1DK1A 1P7GA 5J2TA 2ZR3A 4PJ0Z 1N33O 4JGSA 3AG2B 1LNQA 2UXBB 2QTOA 3E8BA 1S5JA 5CA1B 1F23A 1OCCB 1KYOF 2XT9A 3BAAA 1SETA 2UXCO 3OM3B 1VQ5V 2VWKA 1I08A 3BA8A 4O4IA 1NH2D 1WA8B 1Y66A 4D7TA 3B8NA 5AG2A 4X1KA 1DF5A 4DV7O 3VQXA 2JS3A 1XNRB 2Z5UA 4X9QA 3K0DA 1GRJA 3U11A 5C93A 1WP7A 5F2VO 5KHHA 3ABKC 2Z3YA 4UCSA 4DR2B 4G28B 1F4MA 1E1RG 3K57A 3QTCA 4MVZA 2Q4PA 5H2FZ 2JGDB 4H33A 1KKDA 4DR1B 2L35A 4ABMA 3DSQA 1PV0A 2GTSA 4O4LB 4KP4A 3JAKA 2UUBB 3A0BZ 3HKCB 4TWKA 4CS3A 1N36O 3KG2A 1JX9A 1K8AW 4TUYB 4CH3A 1BHAA 2QWNB 1E1QG 3U10A 3J7AU 2ZXWB 5CB4A 2JGUA 3VOUA 2XAFA 5HFMA 2ADPA 1FAFA 1M4UA 4GCZA 5BMVB 5KHJA 1SZTA 3ZMSA 1EN4A 5JCOC 1NR7A 3RYCA 3CPWU 1YTFB 4OX9B 4OPHA 2ZM6B 4YIPA 3JCZA 4DUYO 4MS2A 5KX5B 4LF6O 4O4JA 5L3BA 1VEWA 4I0XB 4LFBO 1NU1H 1QR8A 3F7VC 3W7TA 3KZIZ 2Q69A 5B3SC 1SQFA 2DWEC 4QGPA 1AP6A 3UM7A 5IYCO 1XHXA 1S72V 3FB8C 1G6UA 4PHZA 1K5SA 2WWWA 1Q43A 4FZ1A 2AXTZ 4DO2A 4NR1A 1O9HA 2C2AA 4JI8B 4BW9A 3ZIAG 1HP8A 4B7EA 1BT8A 2HEPA 5B3SB 3UCSC 4QJFB 4B08A 3HPLC 2OCHA 3L72H 4DV4O 4FZ0A 2HVKC 2LW7A 2Q6AA 1VQ9V 3OGIB 2EBOA 2RDCA 2WLLB 5EIBC 1XNRO 3DXRA 3QO8A 2ARHA 3HKBB 5EC1C 1MOFA 2ZDIC 4LF5B 1RSOB 1TUEB 2R70A 1V55C 3ZHQA 2EIJC 3HKEB 1S76D 2ZQMA 4UV9A 1TVKB 3Q4HB 3QNEA 5IJ0B 1KKCA 3WB0A 3CMAV 2F93B 2PF4E 3CCEV 4UVAA 2CTQA 4DR3B 2BE3A 5EBMC 3CRMA 3DC6A 1FD9A 3P30A 2QTSA 3CP1A 3N2GB 1TA8A 4XBFA 4ZI7A 5B66Z 2BTQA 4GZRB 3JALB 3I56V 3SPCA 3JASA 5CA0B 4FLTA 4JTAB 2VWJA 2YDEA 1HNXB 3CC2V 4JYCA 4X62B 1BMFG 2WA3A 3E8HA 2CTRA 3RYHA 1R3LC 4JV5B 2E76B 5LA6B 4PV1B 4AHCA 4GUNA 2DYRC 4J9ZB 5BZBA 1UJWB 2DYSB 1MZFA 1OZ0A 5K1XA 1YJ9V 1XMQO 1H8HG 1Q3EA 1PP9H 1VQOV 1T5EA 1OCOC 2IU0A 2AW9A 5GW7A 4K8XA 1I5YA 1NT2B 1WA8A 3CC7V 1J5EB 2B5UA 1V54B 3K03A 2YI8A 4JI7O 5LYJB 2CTPA 3H01A 1MA1A 1DGSA 1VQPV 3CHXA 1K3EA 3M99B 1SS3A 3I55V 2W6JG 1QCEA 4MT8A 1IX9A 2Q7HA 1J95A 2DQ3A 2PYLA 3ZHVA 1XQ8A 1XOUA 1EBOA 1X4TA 4RWUA 3UKMA 1JPXA 1H2KA 2B9ZA 3SJCC 4DR7B 1THZA 4YHHB 3BY6A 1NH2B 5IT9N 1PKXA 2W0XA 4OGQB 3ZHUA 3RW0A 3ZHSA 3OT7A 2JGDA 4LF4B 4FLWA 4XDKA 1VQ4V 2IJHA 1OCZB 2QKCA 2DE0X 3ETQA 2IJIA 4CS2A 1NTZH 1P49A 4MW3A 5EK0A 4DR6B 4WF9V 2W6IG 2PYJA 5J2UB 2DJVA 4WFAV 4B3SO 1WN7A 1IDSA 2Q7GA 4CBCA 4X66B 3K5LA 1WAZA 2YC0A 1BSMA 5EZYB 4JI3O 5L3EA 1AROP 4KHPB 1NQTA 3ZS8C 4KL1A 1DF4A 2E74B 5DEDA 3ASNB 4YY3O 3CB2A 1SQQH 2X0LA 3C90A 1VQLV 1QVGU 3AG1B 2R9RB 5KX5A 1Q5OA 2WSSG 3CCVV 4DV5B 4WFFA 5LP6B 3B40A 2NR5A 4H44B 2ZE6A 4GX0A 1HNXO 4X62O 5ITZA 4JI4B 2KQXA 2CK3G 3UQ8A 1COWG 4IYIA 2HHHO 3H1LH 4IGGA 4JV5O 2PTMA 1QBZA 1Y74B 2O57A 4MVUA 1SA0B 5LHHA 1HWYA 4NTYA 4DW0A 3U0ZA 3T1YO 5KUKA 1JMKC 2RMKB 4JZGA 4LF8O 4Z1MG 4UXNA 4JI1B 2DOSA 3AG7A 4JYAO 2QKAA 2WLHA 2VQEB 3CS5A 3STLC 3S3WA 1TGOA 4L8JA 2WLLA 3GWOA 2ZKOA 2A79B 4FLVA 2JVDA 1AP5A 4MTFA 4WFEA 2Y0IA 1KMIZ 1WPXA 1K97A 3T4ZA 2RQ6A 4TSFG 1M90W 1R6KA 2UXNA 2QE7G 4RO2A 3HKEA 3W7SA 2HKOA 2UU9B 3BVOA 1IBMO 3VQVA 1ZTEA 4X8AA 1TVKA 3Q4HA 1IURA 4JI5O 2M6YA 3QO7A 5LHGA 5IYZB 3CCQV 4K35A 3RYFB 4JI0B 4LF4O 3K0GA 4DV2B 4P9PA 2P5OA 3G6EV 4FLXA 3OEHG 1XI1A 4GLXA 2P7TC 4PI2A 1UPGA 4NXNB 2KG7B 2UXDB 3N2GA 5EYPB 4DK1A 1NR1A 2QSAA 3JALA 4DV6O 4DR6O 1OCRB 3FAVB 2H3OA 4J41A 4X66O 3OR7C 3ASOB 5LA6A 1R3JC 3FKSG 3HB3B 1PM9A 2A0LA 3OAAG 1XNQB 1AI6A 2Y69B 3STZC 4DV5O 4W4LA 2OT5A 4X1IA 4DR4B 4MSWC 4QPKA 3LSUA 1TUBA 3CYOA 4PD4F 5JVDA 5LYJA 2G38A 1DLBA 1Y4MA 1SQPH 2EILC 2YXYA 2H94A 2MK3A 3IC7A 3MHHC 3TXSA 3VBBA 3OW2U 1OV9A 4FLZA 5IYBO 4I9WA 3CEIA 5K1PA 5LHIA 3AG4B 5DECA 2HJDA 1R6TA 3JCUZ 3OMIB 3ZCCA 4WFBV 1FS0G 5IE9A 3ABLC 5EIBD 3D3IA 3OMAB 1I0HA 1QHTA 4RAIA 2IW5A 1FPOA 3L9DA 1XDCA 3JD0A 3NXSA 4JI2B 4BWAA 4YXWG 2E75B 4CC6A 3ZJZA 1ENVA 2ZCEA 3FYIB 1VQ6V 5EBWC 5J2UA 1A32A 5CN0A 4TQFA 3OFNG 4B3RB 4R50A 5EZYA 4I7ZB 3SJAC 3AK1A 2KSDA 2AZ0A 4G2KA 3LDCA 4UB8Z 1Y67A 4HAMA 1ZX3A 1TAEA 4B3MB 1H2NA 3EHBB 2NNUA 1NBMG 2BTQB 2KKWA 2ZE8A 3JASB 2UXDO 3CMEV 5LP6A 3CRCA 4J7ZA 4U3JB 5IWAB 2P4KA 2JEUA 4EKWA 3BCCH 2F4VB 1ZAUA 4LNUB 1AJQA 4LFAO 1S5LZ 3BRCA 3RYHB 1S5HC 1US6A 2XAJA 1VF5B 2FTKA 4LC1A 4LFCB 1HR0B
chains in the Genus database with same CATH topology
4FZ1A 4NYKA 2L35A 3IJ4A 2QTSA 4NTXA 1WP7A 3N27A 3S3WA 3S3XA 2FB5A 4FZ0A 1WP8A 4NTWA 4NTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZ1 A;  4NYK A;  2L35 A;  3IJ4 A;  2QTS A;  4NTX A;  1WP7 A;  3N27 A;  3S3W A;  3S3X A;  2FB5 A;  4FZ0 A;  1WP8 A;  4NTW A;  4NTY A; 
#chains in the Genus database with same CATH topology
 1Y74 A;  1SA0 A;  3RWR D;  1QLE B;  1IBL B;  2X6B A;  3BPZ A;  4I4T A;  3AK3 A;  4J11 A;  1SRY A;  5EC2 C;  5GON B;  4JI6 B;  2EIN B;  2Q5Z A;  2EIK C;  1NVP D;  2Y4U A;  4DR4 O;  2LW1 A;  4DV3 O;  3KKY A;  1VQK V;  1JOY A;  3E2E A;  4X1Y A;  2VS0 A;  4BR6 A;  1CEZ A;  1W2B U;  1Y6X A;  1G4Y B;  2LGQ A;  3QG5 A;  1NTK H;  4DW1 A;  4WFG A;  1WP8 A;  5IDJ A;  3ZMU A;  1HNW B;  3A2F A;  2DN9 A;  5D5P A;  3OTO O;  4I5S A;  4ZIB A;  2V1D A;  3I5D A;  4LBE C;  3BA9 A;  5IYZ A;  3SPJ A;  4I9Q A;  1CXZ B;  4OPA A;  3RYF A;  4J7K A;  4FM2 A;  5A9G A;  3RFR A;  4PEL A;  3ABK B;  4JI2 O;  3JYC A;  2KG7 A;  5EYP A;  5CA3 A;  2GUZ A;  4FPP A;  1MNG A;  1M1K W;  2HFE C;  1N32 B;  2HVJ C;  3JD4 A;  4GX2 A;  2LFS A;  3D36 C;  5LXT B;  3FAV A;  1B3Q A;  4NB5 A;  2CDY A;  3LSQ A;  4DV0 O;  4B3R O;  3BEH A;  2ZNI A;  2QEX V;  5KHK A;  3FB5 C;  2GBO A;  1NS1 A;  3JAW A;  5CBH A;  5KAF Z;  1MMM A;  1QQC A;  1KEC A;  1S77 D;  1YDX A;  1GN2 A;  1VP7 A;  2LGW A;  5H5N A;  5ITZ B;  2QM8 A;  4FFB B;  1B6Q A;  1H2G A;  1ORQ C;  1BZK A;  1FXK C;  2QM4 A;  3F5T A;  3A8T A;  3G67 A;  2UXB O;  1JFF B;  4LFC O;  5IY5 C;  1K33 A;  3O9O A;  4FMT A;  1MSD A;  1ZUQ A;  2D2C B;  4Z2W A;  3LDE A;  4E4E A;  1NKD A;  2EX3 A;  2FYU H;  1IZ3 A;  2QWR B;  5LBQ A;  3OD4 A;  4JI6 O;  2UUC B;  2P06 A;  2F95 B;  3T2M A;  3JAM N;  1KUQ A;  2BSK A;  3N27 A;  3ETG A;  3CCS V;  3ETD A;  3B2E E;  5KMG B;  1EZV H;  1FXH A;  1L0N H;  2EUL A;  1KP2 A;  4DR2 O;  4O2B A;  2D3O W;  1VMG A;  1QLN A;  1JCH A;  3ICX A;  4Z1V A;  2E5L B;  1IVS A;  1YJN V;  4DR1 O;  3KCX A;  2FML A;  1V55 B;  3ML0 A;  5FPR A;  2EIJ B;  1GO3 F;  3H1K H;  1GN4 A;  2GV9 A;  2UUB O;  4UB6 Z;  3HKD B;  3CJH B;  4U3J A;  4FIP C;  4TV8 B;  4JYY A;  2YEV B;  1VF6 C;  4PDV A;  1VQN V;  3QF7 A;  1D2D A;  4NYK A;  3CRR A;  4LNU A;  4X65 B;  3PN1 A;  1YJW V;  3OUS A;  1JR9 A;  1R6N A;  5CMU A;  1MAB G;  4QNH B;  2ZIN A;  3IFX A;  2Z0A A;  4UUJ C;  4OX9 O;  4FLU A;  2PUS A;  2K1E A;  4PA9 A;  2ZM6 O;  3W7X A;  3APQ A;  1S3J A;  2RN9 A;  3K5O A;  4X1I B;  5GON A;  1HNZ B;  1TUB B;  3CCU V;  1K92 A;  5JVD B;  1QNM A;  5JJE B;  2CUG A;  1GH6 A;  2XAQ A;  2DYR B;  2IU3 A;  4IHJ B;  2EIM C;  5LMN B;  3FB7 C;  3K5N A;  4YIO A;  1OCO B;  3TK1 A;  3CE2 A;  1K4D C;  4JI8 O;  3A0H Z;  2XAS A;  2GSM B;  4BW5 A;  4ZBM A;  4ZHQ B;  2Y48 A;  5DM6 V;  2ZE5 A;  4GX5 A;  4MTX A;  3SGI A;  3ZRX A;  1NVP B;  4GYC B;  1YEW A;  4MVO A;  3H1I H;  2UUC O;  3M7M X;  4K3A A;  3B09 A;  2JS5 A;  1X59 A;  2PZS A;  1R3K C;  4GX1 A;  2JDI G;  3AEI A;  1MSW D;  2B1I A;  1ZL8 B;  3OR6 C;  2R9I A;  4BAY A;  5L3G A;  4LF5 O;  4NKG B;  4KFM A;  5KAI Z;  4YJ2 B;  1Q90 D;  3EXA A;  2OCC C;  3JSN A;  1Q82 W;  4NXM B;  4J9Y B;  5E79 Z;  1SQV H;  2BOC C;  5LXT A;  3PJS K;  3CCJ V;  3CWB H;  1BE3 H;  2ODM A;  1GM9 A;  3CCL V;  2E5L O;  3WG7 C;  3ZRW A;  2UUA B;  3CXC U;  4GKJ B;  1IXM A;  4DR3 O;  4QE7 A;  1XL4 A;  4RQF A;  3WFV A;  2ZNJ A;  3K79 A;  4PI0 A;  1ROP A;  3T1H B;  5BR8 B;  1Z2G A;  4K0K B;  4EEQ A;  2QJ1 A;  4F6E A;  2YS8 A;  3SPH A;  5JCO A;  4JPR A;  1YVW A;  4FFB A;  4X20 B;  1O9G A;  4PA6 A;  4X65 O;  3EFF K;  3X2Q C;  1AJN A;  1EN5 A;  2M7W A;  1JFF A;  2HG5 C;  4F4L A;  5LGN A;  3ABM C;  2OWO A;  3E86 A;  2F66 C;  2JRI A;  4I4T B;  4O2A B;  1XMO B;  1AIL A;  4AQY B;  3SPI A;  1AR4 A;  4CH5 A;  3F5W C;  5FLX N;  2BTO A;  1D5N A;  5JH7 B;  1YF2 A;  1J5E O;  3B77 A;  1FXV A;  1K4C C;  1FXK A;  4EB6 A;  1BHB A;  2LP7 A;  1BQ0 A;  2ILM A;  4X1Y B;  3X2Q B;  4FM0 A;  4CH6 A;  4P9O A;  3ABM B;  1SER A;  2YIC A;  4U7N A;  3SYC A;  1UFI A;  4MVM A;  1MG1 A;  4QIW F;  1LR1 A;  3CRA A;  5KMG A;  1KD1 W;  5TIS Z;  3A0R A;  3OMN B;  2YIB D;  4DR7 O;  4YHH O;  2WLI B;  4CH4 A;  1RM1 C;  2IBZ H;  5B1A C;  5B1N A;  1SC5 B;  2DWD C;  2ZDI A;  2W0F C;  4WCE V;  3WB2 A;  2Q73 A;  3G71 V;  2DW4 A;  5DN6 G;  2GUZ B;  1E79 G;  3H9V A;  3P3N A;  4JTC B;  2X6A A;  2OTL V;  3W7W A;  1R73 A;  3HKD A;  1Q81 W;  2ETN A;  3CJH A;  2PI4 A;  3IAY A;  2XOK G;  4TV8 A;  4EFB A;  2YEV A;  2ITD C;  2LQT A;  4UVC A;  4NTX A;  4NXM O;  3B4S A;  5B1A B;  3K3W A;  1FFT B;  1AI5 A;  5KA6 A;  2PGG A;  2VQF B;  4KHP O;  5LMU B;  1V9P A;  3RN4 A;  2Q9L A;  1R3I C;  3RVZ A;  2Q7E A;  4TQD A;  3JAW B;  1KB9 F;  3RYI B;  4CS4 A;  1XL6 A;  2GHY A;  1RPR A;  3JAT B;  4EFE A;  5LOV B;  2Y4T A;  3K04 A;  1VIB A;  4J42 A;  1WB7 A;  2XAH A;  4K0K O;  2ZE7 A;  1BS3 A;  3CSX A;  1L1F A;  2UXC B;  4NVP A;  3APO A;  4JI4 O;  1M57 C;  4PDR A;  1M56 C;  4WFH A;  4IHJ A;  4ICG A;  3ABU A;  3TCU A;  2X7R B;  2Q8V A;  1I5X A;  4GKK B;  2HLD G;  3RGB A;  2V4D A;  1YZB A;  2Q0A A;  3DGE A;  3TET A;  4ZHQ A;  4PA3 A;  3FD9 A;  1ZSP A;  4IL6 Z;  4TV9 B;  2P90 A;  2JIZ G;  4AQY O;  1M5I A;  2JJ2 G;  1XEQ A;  2EIL B;  4JI1 O;  2BSK B;  2VQE O;  3L70 H;  4BIO A;  3UO2 A;  3RVY A;  3ZX6 A;  2GTA A;  1ZL8 A;  5KHG A;  4KXR A;  3AG3 C;  4YJ2 A;  4N23 A;  3ABL B;  4O2B B;  2UU9 O;  1LUW A;  4RQE A;  2ZIM A;  1Y76 B;  2QGN A;  4I55 B;  1B04 A;  2N04 A;  5B1B C;  4FFK A;  5HFL A;  1N36 B;  1G1X B;  3K59 A;  4JI0 O;  4DV2 O;  3D8C A;  3T1C A;  3T4D A;  4ZOL B;  1JJ2 U;  4NXN O;  1AB3 A;  2F1M A;  3K58 A;  5GTI Z;  2R72 A;  3BFR A;  2QM7 A;  3C3T A;  2BOB C;  4IYH A;  2FB5 A;  3AG2 C;  4IT5 A;  4LF6 B;  2F43 G;  4FJC C;  1OCC C;  4HZ3 A;  4X20 A;  3S3X A;  2VQF O;  4LFB B;  3THO A;  3WU2 Z;  1EZJ A;  1YXB A;  1OJH A;  1CPY A;  1Z5V A;  1YCI A;  2QA4 V;  5JWP A;  5LGT A;  4O2A A;  5L3F A;  4GT1 A;  3IGA C;  3F7Y C;  4IIJ B;  2A9H A;  1BQZ A;  5A2Q N;  1XNQ O;  1QU7 A;  3K08 A;  3K9S A;  4HBN A;  2F23 A;  5JH7 A;  2WLK A;  1GKF A;  1P7B A;  1I94 B;  2IJK A;  1U97 A;  3ETE A;  4JAS A;  1YIT V;  1XUQ A;  2N74 A;  2CGO A;  4W4K A;  1GM8 A;  4DV4 B;  4LH6 A;  4Q20 A;  2YXH A;  4GKK O;  3UO3 A;  1JA8 A;  3N2K B;  1F51 A;  3TXQ A;  2EIK B;  4LWS B;  2YUA A;  3L74 H;  5B1O A;  2WLI A;  1NTM H;  5JQG B;  1PD3 A;  1KU9 A;  4XDL A;  1KP3 A;  1NI8 A;  4X89 A;  4UCV A;  4CZZ A;  1GMG A;  4J80 A;  3SYP A;  2QWO B;  1M9N A;  4F6R B;  3RBZ A;  4X64 B;  3VQY A;  2ZXW C;  1EN6 A;  3P3P A;  3LUT B;  3M8A A;  2UXX A;  3E89 A;  3JAR B;  2ZR2 A;  4RUF A;  5H6R A;  1XRE A;  3ZMV A;  3MDS A;  1OHH G;  1Q86 W;  1NZ6 A;  1QR9 A;  3O65 A;  1N4C A;  3ABT A;  2VRZ A;  1Q6I A;  3ZRW B;  3OE7 G;  3L73 H;  3L71 H;  4B3M O;  1AI4 A;  3RYI A;  5LGU A;  2LJ2 A;  4O4H B;  2OTJ V;  3JAT A;  5LOV A;  1I7F A;  3G6B A;  2P4V A;  3K5M A;  5IWA O;  1L8D A;  2B1G A;  4PDM A;  3H1H H;  4KUM A;  2V7Q G;  4JYB A;  1L0L H;  5JJN B;  2E3C A;  1XMQ B;  2F4V O;  3L75 H;  5KUM A;  3CC4 V;  4UVB A;  1HR0 O;  4JI7 B;  1PNK A;  4HNA A;  3B8M A;  1IBL O;  2NN4 A;  4UFZ A;  3QO5 A;  4TV9 A;  3ZHR A;  1AI7 A;  4UCR A;  3HR0 A;  2X6C A;  5C8Y B;  1HDJ A;  4PDL A;  4WBN B;  2Q68 A;  1FXK B;  1ZLZ A;  4EB6 B;  1I94 O;  2WAM A;  1R1B A;  4RUE A;  2DMX A;  5IY5 B;  3R66 A;  4TOI A;  5L3C A;  1KC8 W;  1FJG B;  3JD2 A;  3NR7 A;  5KHI A;  5FNV B;  1NJI W;  4R7C A;  4D7S A;  2BCC H;  3ZMZ A;  1VQM V;  1JVM A;  3SPG A;  1AR5 A;  5IYD O;  1HNW O;  1Y76 A;  3D3Q A;  4I55 A;  4U3F H;  4G27 B;  3E22 A;  3J81 N;  2KB1 A;  2XTA A;  4B3S B;  3JD3 A;  1K5Q A;  4UCT A;  5LL6 Y;  2DQ0 A;  4ZOL A;  4JI3 B;  1W0K G;  3ZMT A;  4DR5 B;  1BL8 A;  4X64 O;  4NTW A;  1AR1 B;  3P32 A;  4MW8 A;  4H0L B;  4YY3 B;  1N32 O;  4MTO A;  4FVM A;  2A06 H;  4R6Z A;  4CC5 A;  1Q7Y W;  2WLM A;  2IH3 C;  3FFQ A;  1DTO A;  1PNM A;  3JD1 A;  2DYS C;  3OTF A;  1Z5W A;  1G8M A;  1URF A;  4AIL C;  1PPJ H;  2P67 A;  3FB6 C;  3CX5 F;  2RCV A;  1K34 A;  4IIJ A;  2AHY A;  1EFR G;  2AZ2 A;  1CP9 A;  1V54 C;  2HHH B;  1K7D A;  3MHS C;  2N05 A;  2FL4 A;  1F7Y A;  1H2M A;  5CA1 A;  1P4R A;  2L6L A;  3T1Y B;  1WB8 A;  1FFX B;  2IH1 C;  1K9M W;  3H1J H;  3E8G A;  5CBF A;  4J7J A;  4LF8 B;  2JJ1 G;  4JYA B;  5EBL C;  2GDS A;  3G4S V;  1JJO A;  2ITC C;  1GM7 A;  3N2K A;  4LWS A;  4U7O A;  3FYE B;  3OEE G;  1IXB A;  3R65 A;  1HW7 A;  2EZO A;  2YID A;  2CGN A;  5H6Q A;  1N34 B;  1H8E G;  5JQG A;  4Q6G A;  4MVQ A;  4DRX B;  3CXH F;  3AK2 A;  2EIM B;  1VQ8 V;  1OCZ C;  1IBK B;  5L3D A;  1FKA O;  3GB7 C;  4OXS A;  1IBM B;  2PI5 A;  5JJJ B;  4F6R A;  3TJT A;  1FJG O;  2XUM A;  2WPD G;  2HR3 A;  4JI5 B;  2CH7 B;  2ZIO A;  1Q6U A;  3VQW A;  2EJR A;  2YIB A;  2K9P A;  2CE4 A;  3JAR A;  3ZED A;  4E2L A;  3K06 A;  4HYO A;  3LSS A;  5J9P C;  2A7W A;  4YJ3 B;  1RPO A;  1H2L A;  5GTH Z;  4O4L A;  3LNM B;  3SYO A;  4H13 B;  3SYQ A;  3ASN C;  4PA7 A;  4X88 A;  3HKC A;  3DTU B;  2JK5 C;  4DV6 B;  4TUY A;  5IJ9 B;  3AG1 C;  1YSC A;  2IM9 A;  4DV1 B;  3SYA A;  5LP6 C;  2OCC B;  4I50 B;  4MVS A;  2LFR A;  3QVN A;  3UT5 B;  4K8Z A;  3D36 A;  4O4H A;  4DR5 O;  1W0J G;  5BMV A;  1PL0 A;  4ZKI A;  1EM1 A;  4FK5 C;  4LF7 B;  5BXZ A;  3WG7 B;  2HP8 A;  1XBL A;  4L87 A;  3J80 N;  4I0X A;  3CCR V;  2XAG A;  4MVR A;  3TGU H;  4C7U A;  5J2T B;  1AVM A;  2QR4 A;  4D6T H;  2FKX A;  1RFY A;  1HNZ O;  4DUZ B;  3C3S A;  5C8Y A;  4ASU G;  1VF7 A;  4WBN A;  2Q0O C;  4UCO A;  2ADQ B;  1GK9 A;  4P30 A;  4DK0 A;  1YHQ V;  1KQS U;  1S0V A;  4O4I B;  4JAU A;  5LMN O;  3K9A A;  4B7K A;  1SES A;  3WB1 A;  2AGA A;  3E35 A;  4X1K B;  5FNV A;  5KLV H;  3GWK C;  3CCM V;  3LNN A;  1GN6 A;  3JSL A;  3HKB A;  3SR2 C;  1Q8I A;  1RP3 B;  2CAZ C;  4A5U B;  3MAQ A;  2YIA A;  1SZX A;  1GN3 A;  4LF9 B;  1LUV A;  1N34 O;  2YI9 A;  1RSO A;  2A3Q A;  3KCY A;  2CTW A;  2RJZ A;  1SQX H;  1IBK O;  3ZRV A;  2HJF C;  1YIJ V;  4B3T B;  3CRQ A;  2YXL A;  3OGC C;  5B5E Z;  4QE9 A;  1OCR C;  2P22 C;  5IJ0 A;  2MW2 B;  4N21 A;  4P2Z A;  2YSU B;  2PY5 A;  3LDD A;  2EZP A;  1RM1 B;  3ASO C;  3E83 A;  1PL4 A;  1GTO A;  4R8C A;  3JAK B;  1YTF D;  4JTD B;  4UV8 A;  4JZ2 A;  1K73 W;  2R9A A;  1WJZ A;  1D5A A;  2EJ7 A;  2QKS A;  3SJQ C;  2QDO A;  2UUA O;  5CA0 A;  5CB4 B;  1N0N A;  4GKJ O;  2Y69 C;  2AHZ A;  4DV1 O;  2H8P C;  4BIU A;  4LFA B;  1VF6 A;  3IC9 A;  1N33 B;  1WPB A;  3T1H O;  5BR8 O;  2OIE A;  2ZD9 A;  3RYC B;  4LF7 O;  3ZHT A;  1VQ7 V;  5BY1 A;  1ZWI C;  1FFX A;  4O4J B;  1P84 F;  2QWQ B;  1WLE A;  1U96 A;  2WLN A;  4LR3 A;  1B06 A;  3AG4 C;  3BAB A;  4HNA B;  4JAV A;  4DV7 B;  4DV3 B;  1WNS A;  2NLJ C;  5KA5 A;  4FLY A;  5D5Q A;  2Q67 A;  3CD6 V;  1XMO O;  1SF9 A;  5H9C A;  4QPJ A;  2LO1 A;  5CBG A;  4AI8 A;  1GAX A;  4DRX A;  1M57 B;  4DUZ O;  2XHB A;  1M56 B;  1YI2 V;  1Q6H A;  1AJP A;  5FPO A;  4J10 A;  2XND G;  1H38 A;  3MD0 A;  3ZBH A;  1SKV A;  2JEX A;  1MZE A;  2IJJ A;  3OTO B;  3ZRS A;  1SQB H;  4H37 A;  1VAR A;  2CH7 A;  2OIG A;  4DYL A;  4LCU C;  3DXR B;  1XIL A;  1H2S B;  1JQ0 A;  1N8R W;  3ZN0 A;  1KBH A;  4YJ3 A;  1PNL A;  3E22 B;  4LH7 A;  2OYQ A;  4LF9 O;  2ATK C;  4UCU A;  4XDJ A;  3SJB C;  4DXW A;  2WLJ A;  5IJ9 A;  1QVF U;  2P6J A;  2RNB A;  3AG3 B;  4I50 A;  3FX7 A;  4MTG A;  4DV0 B;  3UT5 A;  4LP8 A;  4B3T O;  5FL7 G;  1W59 A;  4BIZ A;  2WA4 A;  4JF3 A;  3W7U A;  1BGY H;  1F4N A;  1N0J A;  2ZT9 B;  3EVK A;  3DC5 A;  3OUF A;  5B1B B;  2QWP B;  4DUY B;  4JAA A;  4ZI7 B;  5E1A C;  1BCC H;  4PA4 A;  1FYJ A;  3SDL A;  3GVM A;  1M93 A;  3BHP A;  5LMU O;  3G80 A;  1QLE C;  3RT3 C;  3IJ4 A;  4TT3 G;  1SQG A;  1XHZ A;  2Y0P A;  3ZN1 A;  3E8F A;  4FM1 A;  2EIN C;  1DK1 A;  1P7G A;  5J2T A;  2ZR3 A;  4PJ0 Z;  1N33 O;  4JGS A;  3AG2 B;  1LNQ A;  2UXB B;  2QTO A;  3E8B A;  1S5J A;  5CA1 B;  1F23 A;  1OCC B;  1KYO F;  2XT9 A;  3BAA A;  1SET A;  2UXC O;  3OM3 B;  1VQ5 V;  2VWK A;  1I08 A;  3BA8 A;  4O4I A;  1NH2 D;  1WA8 B;  1Y66 A;  4D7T A;  3B8N A;  5AG2 A;  4X1K A;  1DF5 A;  4DV7 O;  3VQX A;  2JS3 A;  1XNR B;  2Z5U A;  4X9Q A;  3K0D A;  1GRJ A;  3U11 A;  5C93 A;  1WP7 A;  5F2V O;  5KHH A;  3ABK C;  2Z3Y A;  4UCS A;  4DR2 B;  4G28 B;  1F4M A;  1E1R G;  3K57 A;  3QTC A;  4MVZ A;  2Q4P A;  5H2F Z;  2JGD B;  4H33 A;  1KKD A;  4DR1 B;  2L35 A;  4ABM A;  3DSQ A;  1PV0 A;  2GTS A;  4O4L B;  4KP4 A;  3JAK A;  2UUB B;  3A0B Z;  3HKC B;  4TWK A;  4CS3 A;  1N36 O;  3KG2 A;  1JX9 A;  1K8A W;  4TUY B;  4CH3 A;  1BHA A;  2QWN B;  1E1Q G;  3U10 A;  3J7A U;  2ZXW B;  5CB4 A;  2JGU A;  3VOU A;  2XAF A;  5HFM A;  2ADP A;  1FAF A;  1M4U A;  4GCZ A;  5BMV B;  5KHJ A;  1SZT A;  3ZMS A;  1EN4 A;  5JCO C;  1NR7 A;  3RYC A;  3CPW U;  1YTF B;  4OX9 B;  4OPH A;  2ZM6 B;  4YIP A;  3JCZ A;  4DUY O;  4MS2 A;  5KX5 B;  4LF6 O;  4O4J A;  5L3B A;  1VEW A;  4I0X B;  4LFB O;  1NU1 H;  1QR8 A;  3F7V C;  3W7T A;  3KZI Z;  2Q69 A;  5B3S C;  1SQF A;  2DWE C;  4QGP A;  1AP6 A;  3UM7 A;  5IYC O;  1XHX A;  1S72 V;  3FB8 C;  1G6U A;  4PHZ A;  1K5S A;  2WWW A;  1Q43 A;  4FZ1 A;  2AXT Z;  4DO2 A;  4NR1 A;  1O9H A;  2C2A A;  4JI8 B;  4BW9 A;  3ZIA G;  1HP8 A;  4B7E A;  1BT8 A;  2HEP A;  5B3S B;  3UCS C;  4QJF B;  4B08 A;  3HPL C;  2OCH A;  3L72 H;  4DV4 O;  4FZ0 A;  2HVK C;  2LW7 A;  2Q6A A;  1VQ9 V;  3OGI B;  2EBO A;  2RDC A;  2WLL B;  5EIB C;  1XNR O;  3DXR A;  3QO8 A;  2ARH A;  3HKB B;  5EC1 C;  1MOF A;  2ZDI C;  4LF5 B;  1RSO B;  1TUE B;  2R70 A;  1V55 C;  3ZHQ A;  2EIJ C;  3HKE B;  1S76 D;  2ZQM A;  4UV9 A;  1TVK B;  3Q4H B;  3QNE A;  5IJ0 B;  1KKC A;  3WB0 A;  3CMA V;  2F93 B;  2PF4 E;  3CCE V;  4UVA A;  2CTQ A;  4DR3 B;  2BE3 A;  5EBM C;  3CRM A;  3DC6 A;  1FD9 A;  3P30 A;  2QTS A;  3CP1 A;  3N2G B;  1TA8 A;  4XBF A;  4ZI7 A;  5B66 Z;  2BTQ A;  4GZR B;  3JAL B;  3I56 V;  3SPC A;  3JAS A;  5CA0 B;  4FLT A;  4JTA B;  2VWJ A;  2YDE A;  1HNX B;  3CC2 V;  4JYC A;  4X62 B;  1BMF G;  2WA3 A;  3E8H A;  2CTR A;  3RYH A;  1R3L C;  4JV5 B;  2E76 B;  5LA6 B;  4PV1 B;  4AHC A;  4GUN A;  2DYR C;  4J9Z B;  5BZB A;  1UJW B;  2DYS B;  1MZF A;  1OZ0 A;  5K1X A;  1YJ9 V;  1XMQ O;  1H8H G;  1Q3E A;  1PP9 H;  1VQO V;  1T5E A;  1OCO C;  2IU0 A;  2AW9 A;  5GW7 A;  4K8X A;  1I5Y A;  1NT2 B;  1WA8 A;  3CC7 V;  1J5E B;  2B5U A;  1V54 B;  3K03 A;  2YI8 A;  4JI7 O;  5LYJ B;  2CTP A;  3H01 A;  1MA1 A;  1DGS A;  1VQP V;  3CHX A;  1K3E A;  3M99 B;  1SS3 A;  3I55 V;  2W6J G;  1QCE A;  4MT8 A;  1IX9 A;  2Q7H A;  1J95 A;  2DQ3 A;  2PYL A;  3ZHV A;  1XQ8 A;  1XOU A;  1EBO A;  1X4T A;  4RWU A;  3UKM A;  1JPX A;  1H2K A;  2B9Z A;  3SJC C;  4DR7 B;  1THZ A;  4YHH B;  3BY6 A;  1NH2 B;  5IT9 N;  1PKX A;  2W0X A;  4OGQ B;  3ZHU A;  3RW0 A;  3ZHS A;  3OT7 A;  2JGD A;  4LF4 B;  4FLW A;  4XDK A;  1VQ4 V;  2IJH A;  1OCZ B;  2QKC A;  2DE0 X;  3ETQ A;  2IJI A;  4CS2 A;  1NTZ H;  1P49 A;  4MW3 A;  5EK0 A;  4DR6 B;  4WF9 V;  2W6I G;  2PYJ A;  5J2U B;  2DJV A;  4WFA V;  4B3S O;  1WN7 A;  1IDS A;  2Q7G A;  4CBC A;  4X66 B;  3K5L A;  1WAZ A;  2YC0 A;  1BSM A;  5EZY B;  4JI3 O;  5L3E A;  1ARO P;  4KHP B;  1NQT A;  3ZS8 C;  4KL1 A;  1DF4 A;  2E74 B;  5DED A;  3ASN B;  4YY3 O;  3CB2 A;  1SQQ H;  2X0L A;  3C90 A;  1VQL V;  1QVG U;  3AG1 B;  2R9R B;  5KX5 A;  1Q5O A;  2WSS G;  3CCV V;  4DV5 B;  4WFF A;  5LP6 B;  3B40 A;  2NR5 A;  4H44 B;  2ZE6 A;  4GX0 A;  1HNX O;  4X62 O;  5ITZ A;  4JI4 B;  2KQX A;  2CK3 G;  3UQ8 A;  1COW G;  4IYI A;  2HHH O;  3H1L H;  4IGG A;  4JV5 O;  2PTM A;  1QBZ A;  1Y74 B;  2O57 A;  4MVU A;  1SA0 B;  5LHH A;  1HWY A;  4NTY A;  4DW0 A;  3U0Z A;  3T1Y O;  5KUK A;  1JMK C;  2RMK B;  4JZG A;  4LF8 O;  4Z1M G;  4UXN A;  4JI1 B;  2DOS A;  3AG7 A;  4JYA O;  2QKA A;  2WLH A;  2VQE B;  3CS5 A;  3STL C;  3S3W A;  1TGO A;  4L8J A;  2WLL A;  3GWO A;  2ZKO A;  2A79 B;  4FLV A;  2JVD A;  1AP5 A;  4MTF A;  4WFE A;  2Y0I A;  1KMI Z;  1WPX A;  1K97 A;  3T4Z A;  2RQ6 A;  4TSF G;  1M90 W;  1R6K A;  2UXN A;  2QE7 G;  4RO2 A;  3HKE A;  3W7S A;  2HKO A;  2UU9 B;  3BVO A;  1IBM O;  3VQV A;  1ZTE A;  4X8A A;  1TVK A;  3Q4H A;  1IUR A;  4JI5 O;  2M6Y A;  3QO7 A;  5LHG A;  5IYZ B;  3CCQ V;  4K35 A;  3RYF B;  4JI0 B;  4LF4 O;  3K0G A;  4DV2 B;  4P9P A;  2P5O A;  3G6E V;  4FLX A;  3OEH G;  1XI1 A;  4GLX A;  2P7T C;  4PI2 A;  1UPG A;  4NXN B;  2KG7 B;  2UXD B;  3N2G A;  5EYP B;  4DK1 A;  1NR1 A;  2QSA A;  3JAL A;  4DV6 O;  4DR6 O;  1OCR B;  3FAV B;  2H3O A;  4J41 A;  4X66 O;  3OR7 C;  3ASO B;  5LA6 A;  1R3J C;  3FKS G;  3HB3 B;  1PM9 A;  2A0L A;  3OAA G;  1XNQ B;  1AI6 A;  2Y69 B;  3STZ C;  4DV5 O;  4W4L A;  2OT5 A;  4X1I A;  4DR4 B;  4MSW C;  4QPK A;  3LSU A;  1TUB A;  3CYO A;  4PD4 F;  5JVD A;  5LYJ A;  2G38 A;  1DLB A;  1Y4M A;  1SQP H;  2EIL C;  2YXY A;  2H94 A;  2MK3 A;  3IC7 A;  3MHH C;  3TXS A;  3VBB A;  3OW2 U;  1OV9 A;  4FLZ A;  5IYB O;  4I9W A;  3CEI A;  5K1P A;  5LHI A;  3AG4 B;  5DEC A;  2HJD A;  1R6T A;  3JCU Z;  3OMI B;  3ZCC A;  4WFB V;  1FS0 G;  5IE9 A;  3ABL C;  5EIB D;  3D3I A;  3OMA B;  1I0H A;  1QHT A;  4RAI A;  2IW5 A;  1FPO A;  3L9D A;  1XDC A;  3JD0 A;  3NXS A;  4JI2 B;  4BWA A;  4YXW G;  2E75 B;  4CC6 A;  3ZJZ A;  1ENV A;  2ZCE A;  3FYI B;  1VQ6 V;  5EBW C;  5J2U A;  1A32 A;  5CN0 A;  4TQF A;  3OFN G;  4B3R B;  4R50 A;  5EZY A;  4I7Z B;  3SJA C;  3AK1 A;  2KSD A;  2AZ0 A;  4G2K A;  3LDC A;  4UB8 Z;  1Y67 A;  4HAM A;  1ZX3 A;  1TAE A;  4B3M B;  1H2N A;  3EHB B;  2NNU A;  1NBM G;  2BTQ B;  2KKW A;  2ZE8 A;  3JAS B;  2UXD O;  3CME V;  5LP6 A;  3CRC A;  4J7Z A;  4U3J B;  5IWA B;  2P4K A;  2JEU A;  4EKW A;  3BCC H;  2F4V B;  1ZAU A;  4LNU B;  1AJQ A;  4LFA O;  1S5L Z;  3BRC A;  3RYH B;  1S5H C;  1US6 A;  2XAJ A;  1VF5 B;  2FTK A;  4LC1 A;  4LFC B;  1HR0 B; 
#chains in the Genus database with same CATH homology
 4FZ1 A;  4NYK A;  2L35 A;  3IJ4 A;  2QTS A;  4NTX A;  1WP7 A;  3N27 A;  3S3W A;  3S3X A;  2FB5 A;  4FZ0 A;  1WP8 A;  4NTW A;  4NTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...