3N27A

Molecular basis of the inhibition of henipa viruses
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
78
structure length
73
Chain Sequence
KNADNINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDYGIDISIELNKAKSDLEESKEWIRRSNQKLDSIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion glycoprotein F0, linker, Fusion glycoprotein F0
publication title Molecular Basis of the Inhibition of Henipa Viruses
rcsb
source organism Nipah virus
molecule tags Viral protein
total genus 34
structure length 73
sequence length 78
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3n27A00
1WP8A 4FZ1A 2QTSA 4FZ0A 4NTWA 3IJ4A 3S3XA 4NTYA 4NYKA 3N27A 2L35A 1WP7A 4NTXA 3S3WA 2FB5A
chains in the Genus database with same CATH superfamily
2P90A 3OR7C 2OCCB 3K5LA 4WFBV 1B6QA 1RFYA 1YJ9V 3QF7A 1AJNA 2ZDIC 1BZKA 2Z3YA 3AG1B 1OCCB 5K1PA 1E1RG 4B3MB 1RSOA 3ZEDA 4JI7O 2HJFC 4JI1O 1OHHG 2YIBA 3DXRB 1YI2V 4FFKA 3B2EE 1L1FA 3OE7G 1M57C 4U3FH 3M99B 3ICXA 3G71V 4DUZB 5IJ9B 2Z5UA 3E89A 3J81N 4GLXA 4DR4B 2UU9B 2AHYA 2WSSG 4YHHO 2IU3A 1SQVH 1NI8A 2JEXA 2ZT9B 3OGIB 3WB0A 2DWDC 3S3XA 4L87A 4LFBO 1AR1B 2UUBB 1XMOO 2BTQA 3SDLA 3ML0A 3E83A 1XMQB 2A0LA 4UV8A 2BSKB 5BR8O 5IYCO 3OAAG 1M90W 3HB3B 3OTFA 2ATKC 3VBBA 5BY1A 3APOA 4D7SA 3AG4C 4X1IB 1R3JC 2HLDG 3SJCC 3G80A 4LWSA 3CP1A 3AG2C 1JFFB 3RYHB 3TGUH 4DR6B 4JASA 5E1AC 2ZM6O 3HKDA 5TISZ 4X1KA 2PY5A 4UFZA 5FNVB 3Q4HB 1GK9A 1N4CA 1H2SB 1U96A 4H13B 2R72A 2DYSB 3U10A 5LHIA 2LGQA 2OTJV 2YEVA 1K34A 5EBLC 5EBMC 5DECA 4FFBA 4ZKIA 2F93B 1HP8A 4G2KA 5JVDB 3GWKC 2Y4UA 2LFRA 3RFRA 4TQFA 4PA7A 5JH7A 2D3OW 4X65B 2A9HA 2MW2B 1YSCA 2UXBO 2E5LB 1K92A 2N74A 3X2QC 1G6UA 3CX5F 2YIAA 2Y0IA 4BWAA 3JD3A 1T5EA 2Q0OC 1IBMB 4JYCA 4JI3B 4RUEA 1XL6A 3CE2A 5LBQA 4K8XA 3F7VC 5B1NA 3JSLA 4GZRB 1V54B 3OMIB 1MNGA 3K5MA 2DN9A 2YSUB 1ZTEA 1KECA 3CPWU 3ASNC 1XL4A 4MVMA 5LA6A 1OZ0A 3AG3B 2A3QA 3EFFK 1PNLA 4DV7B 3FB5C 1EBOA 3DC6A 4LF5O 4KHPO 1IBLO 3SYAA 2FTKA 1QQCA 3KZIZ 3B40A 2M7WA 4HNAA 4U3JB 3GB7C 1OCZC 2F4VB 1HNWO 2XT9A 5J2UA 1WA8B 2FL4A 3B09A 2HHHO 3T1HB 4OX9O 1R3IC 4MT8A 5ITZA 3N27A 2FB5A 5B66Z 3M8AA 2KB1A 3SYPA 1Q86W 2OIGA 4JGSA 2JJ1G 1FXHA 4UCVA 4O2AB 1B06A 1IURA 4YIOA 1WJZA 2JS3A 1K97A 2QWOB 4CH6A 4PV1B 4TSFG 3L72H 3M7MX 4JV5O 4UCTA 3F5TA 4W4KA 5A2QN 1HR0B 2RCVA 1Q7YW 1NTKH 1FFTB 4NXMO 4DR2B 3H1IH 1CXZB 3JSNA 1B3QA 3K3WA 4WCEV 4IL6Z 3K08A 3LUTB 1FXKC 5A9GA 3CCVV 3BHPA 1JPXA 1MA1A 5LOVB 3CXCU 2X6AA 2WA4A 3FX7A 1AI6A 3EHBB 4JI0O 4EEQA 2D2CB 4NR1A 1YTFB 3JYCA 3U0ZA 2F66C 1NTZH 4FM1A 1JQ0A 3P3PA 2ITCC 1N8RW 5J9PC 4I9WA 3DXRA 4DW1A 1OCRC 3P32A 1YJWV 2LP7A 5H2FZ 4DRXB 1R73A 3ASOC 5IJ9A 1FJGO 3MDSA 1KYOF 2YXHA 5CA1B 4OGQB 5H9CA 2Q4PA 4TV9B 5IY5C 5KUMA 3KCYA 3ETEA 4J9ZB 1D5NA 3RYFB 2K9PA 2WLIB 5BMVB 4J7ZA 1FFXB 4FZ0A 4TV8A 3DTUB 1ZWIC 4GX1A 4JTDB 4LF8B 2CH7A 2OCHA 1YIJV 2QKSA 4U7NA 4E4EA 1SS3A 4DV4O 2YI9A 1VEWA 4KXRA 4K8ZA 4TQDA 4Z2WA 5KAIZ 1VF6A 4X1IA 4PJ0Z 2JK5C 4PDLA 4ZBMA 2HKOA 4WF9V 1NU1H 4MW8A 4X62O 1K9MW 3ETGA 2Y0PA 3E8BA 3JD0A 3STLC 1THZA 2E75B 2EIMB 1N33B 2HR3A 4BW9A 1K5SA 3ZHQA 1GO3F 3Q4HA 4DV1B 4FLXA 2EIKB 3HKBA 4I0XA 4P2ZA 5H6RA 1P7BA 1LNQA 3K79A 1ORQC 3L73H 5BXZA 1JX9A 1GAXA 2ILMA 3JAKA 5EZYA 3CCEV 1TUBB 1BHBA 3FB6C 1GM9A 5DM6V 3H1LH 2B9ZA 2QDOA 3LSQA 3J80N 1YDXA 4OPAA 4DV0O 4ZI7A 3ZX6A 3E22B 1RPRA 3A0HZ 1XNRB 3CMEV 3AK2A 4XDKA 1F23A 2G38A 1IBKB 3E8GA 4KL1A 1K4CC 3H01A 1VIBA 4GX2A 4Z1MG 1Q6HA 2DMXA 4I50B 5IWAO 2ZE7A 4MVRA 2JRIA 4DR1O 1N36B 1QLEB 4B7KA 5L3FA 3EVKA 3QO5A 4X88A 2RN9A 1FKAO 3N2KA 2F1MA 1IVSA 4DV6O 1QLNA 3DGEA 1BHAA 3CCMV 2WLKA 4MTXA 2CTQA 2YI8A 4JAAA 2Q0AA 3U11A 4LF7B 5IT9N 5KUKA 1M9NA 4O4LB 3FYEB 1B04A 3GWOA 1N32B 5KLVH 2ZCEA 2UUCO 2OIEA 3ZHRA 3CC7V 4U3JA 2VQFO 3CCQV 4X66B 5KX5B 1G4YB 4K0KB 3JASB 4NKGB 2EILC 4MVZA 1WA8A 2UUAB 4WFGA 1Y66A 2V1DA 4JYBA 1H8EG 3ABLB 1VQ8V 2QE7G 4PDVA 4DV2O 4DR3O 3HKCB 1MSWD 4GYCB 1TVKB 5B1AB 1SESA 5D5QA 5FPOA 4O4JA 2CGOA 3BABA 4LF4B 2YIBD 1BL8A 5LHHA 4TT3G 4O4IB 4UUJC 1TA8A 4GCZA 5LHGA 2UXDO 3JD2A 4ZOLB 1S3JA 3G67A 2VQEO 2KG7B 3W7SA 4DUYO 3LSSA 4B3TO 5GTIZ 4AQYB 2E76B 4MTGA 2FMLA 2XHBA 5FL7G 1H2LA 1QR8A 3T1YO 1ZL8B 3ABMB 3H1KH 4IIJB 5B1BB 2ZIMA 1N34O 3D3QA 3NXSA 2CDYA 5JCOA 2Q8VA 1JVMA 2GHYA 2Q69A 4UVBA 1FYJA 1ZX3A 1BQ0A 3RWRD 2OTLV 1UPGA 4X64B 1VQ5V 3I55V 4JI2O 4RO2A 4FJCC 1WP8A 4DR7O 5CA1A 4IYHA 3E2EA 3L74H 2HEPA 1VMGA 3FAVB 4LF6O 4TV9A 2Y48A 1O9HA 1JCHA 5GONB 4ZHQA 1NS1A 3UO3A 4JI7B 4O4HB 2P7TC 4B3SB 1AILA 1FFXA 4JI1B 5CA3A 4RWUA 3RN4A 4NTYA 2IH1C 4NTXA 1PM9A 4LF9O 3A0RA 4QPKA 2EIJB 1VP7A 4YHHB 5LYJA 3MHHC 2X0LA 2Y4TA 3JCZA 3JAWB 3K58A 2RNBA 4X8AA 4LFBB 4WFEA 4LC1A 1FD9A 1XMOB 1M4UA 3HKEB 5IJ0A 4DR5O 5BR8B 1KKCA 3CCRV 2UXCO 4MS2A 3WG7C 4KUMA 4PA9A 2DJVA 1XI1A 3RT3C 2QA4V 2A7WA 4F4LA 1V9PA 5KMGB 2AW9A 1DF4A 2Q68A 3CRRA 1S0VA 3J7AU 3PN1A 2ZM6B 4JTAB 2R9AA 2LJ2A 3C90A 3CJHA 4JI8O 1NZ6A 5CBHA 5FLXN 3JD4A 1DF5A 1Q81W 2K1EA 3E22A 4F6RB 3ZHUA 3H1JH 3S3WA 1V55C 2ADQB 3OTOO 5CBGA 4K3AA 4YJ3B 3BCCH 1XBLA 4LR3A 4X20B 3K9AA 1I94O 3RW0A 4ABMA 4CH4A 5CMUA 2R9IA 3CEIA 3SJQC 2OCCC 4X1YA 2NLJC 1UFIA 2WLLB 4HYOA 1EN6A 2UXBB 4RUFA 3AG1C 3MAQA 1H2GA 1BGYH 2YDEA 1SA0A 1QR9A 2DOSA 1PP9H 3IGAC 4O4LA 1OCOB 1KUQA 5HFMA 4WFAV 2R70A 4LH6A 4X9QA 1M5IA 2EULA 3CRMA 1HNZO 4JPRA 4ASUG 3DC5A 2W6JG 1Q5OA 5KX5A 4FM0A 1AI5A 1H2KA 2CUGA 3BRCA 1NQTA 2XAHA 1AROP 3JASA 3JATB 4EB6A 1OV9A 1Q6UA 2X7RB 3K0GA 1WB8A 2UXXA 2QWNB 1P7GA 2JJ2G 1H38A 5EYPB 3UO2A 3G6BA 4Q20A 5IYZB 3KCXA 4E2LA 3N2GB 4LF5B 4KHPB 2HP8A 4CH5A 1IBLB 1GM7A 3VQWA 1JJ2U 3JALB 1XILA 2ZQMA 1XNQO 3ZIAG 1E79G 1TVKA 5IDJA 2HFEC 1I08A 2A79B 4BIOA 2QKCA 4MW3A 1HNWB 1M56B 1VF6C 3AK1A 5JQGB 2EINB 1URFA 4YJ2A 5LGNA 5B3SC 1LUWA 2HHHB 4OX9B 4ZOLA 2F95B 1L8DA 3BA8A 4G28B 2XUMA 1KP2A 5L3BA 1W2BU 2P67A 3QVNA 1KKDA 5C8YA 2CK3G 4JTCB 2H3OA 2EZPA 4QE7A 1BSMA 1XDCA 4O2BB 1ZL8A 2DE0X 4I55B 3TXQA 2AGAA 2RQ6A 2ZINA 4IIJA 2JDIG 4FLTA 4JV5B 1S77D 4X65O 2IJIA 3B8MA 4NXMB 1JMKC 5C93A 2OT5A 1Q43A 3OFNG 3AEIA 4H37A 1QCEA 5CBFA 4DV5O 3R66A 3LNNA 1WPBA 3OGCC 3FAVA 2HJDA 2R9RB 3G6EV 4JI0B 1O9GA 3FKSG 3CRAA 1I5YA 3SGIA 2CE4A 5GONA 2PF4E 4AI8A 3RBZA 4ICGA 4P9PA 1AR4A 1G8MA 3ZMZA 1FAFA 5LP6A 4PELA 4JYYA 5JJJB 4DW0A 3BY6A 4PD4F 4WFHA 1FJGB 4YY3O 3LSUA 3OMAB 1OJHA 3QTCA 3TK1A 5J2TA 3ZS8C 1KB9F 3AG3C 4CZZA 3B8NA 4J7KA 2B1IA 2EX3A 3IFXA 3APQA 2VWKA 3UT5B 4J42A 3W7WA 3ZHVA 5LL6Y 3HKEA 2QEXV 1PL4A 3D8CA 1QU7A 2ITDC 3CSXA 3TJTA 3CRQA 1VQLV 4J9YB 1MABG 1I5XA 4DV4B 3THOA 4QJFB 5KHJA 4B3RO 1JA8A 3WFVA 3CB2A 1VF7A 4X62B 2F43G 2RDCA 5E79Z 3ZCCA 1BS3A 1IDSA 1NH2D 1IXMA 1SQPH 1X59A 1US6A 3BPZA 2NNUA 4UCRA 3SYOA 4GKKO 4K35A 4UCOA 1K5QA 3OEHG 2BSKA 1R6NA 1YEWA 3CCUV 3ABKC 2GBOA 4LFAO 2GTAA 1DGSA 2CAZC 2YICA 1E1QG 4MVSA 5KHGA 4CS4A 4DV0B 1YJNV 1Y76B 1JFFA 3RYHA 4JI4O 4UV9A 2ETNA 2DYRB 4DV3O 5JCOC 5L3DA 2IJJA 2HVJC 5FNVA 1SKVA 2PUSA 4FIPC 4I7ZB 2W6IG 3ZN0A 3OD4A 5IWAB 5JJEB 4GT1A 1VQ4V 1Q8IA 1Y4MA 4DR1B 2Q9LA 3RYCB 4PDMA 1SQBH 2Y69B 2EZOA 4MTOA 4DV6B 4H0LB 4CS3A 1TAEA 2XAFA 2EJRA 3ZMTA 4NTWA 3T4ZA 3K59A 3EXAA 1RSOB 1J5EO 5JVDA 4R7CA 4BAYA 1HNXB 1K4DC 3K9SA 3ZRSA 3UQ8A 3N2GA 3QO8A 4GUNA 1KU9A 1GTOA 4J80A 2UUCB 4LP8A 1EFRG 1PNKA 1AI4A 2VQFB 2LW1A 2P06A 3K04A 3SPIA 2WWWA 1Y6XA 1L0NH 3QO7A 2Q6AA 1Q6IA 4YXWG 5JQGA 2JGDB 3SPGA 3JAMN 3ZN1A 5KHHA 1L0LH 2BTQB 1YHQV 2IW5A 2EIMC 3RVYA 4UXNA 1COWG 4DV2B 4J10A 1LR1A 4XBFA 5IYBO 1YVWA 2EIKC 4BIUA 3JCUZ 2P5OA 1EN4A 2AHZA 4FLVA 1GN4A 4PA6A 2XAJA 3LDCA 4CC6A 1RM1B 2QM4A 4I9QA 2EJ7A 3KG2A 5LMNO 2UXDB 3HKDB 1Y67A 4JZGA 4X1KB 4BIZA 2VQEB 4DUYB 1I7FA 4B3TB 1KP3A 4DYLA 2CTWA 5B5EZ 2GV9A 3T1YB 2AXTZ 4FFBB 4MVUA 2N05A 3RGBA 4JF3A 1N34B 3MHSC 2NR5A 2IJHA 4IGGA 4O2AA 2XNDG 1VQ6V 3ZJZA 4R6ZA 1EZJA 4DK1A 3QG5A 2NN4A 1Z5VA 4XDLA 3VQYA 4R50A 3I56V 1XHZA 2YIDA 3ZRXA 5D5PA 4JI2B 1WB7A 2YC0A 4DR7B 4ZIBA 1ROPA 4IHJB 2IJKA 4JAUA 3ZHTA 1VQMV 4LFCO 3WB1A 1J95A 1D2DA 3SPHA 1EZVH 4JZ2A 4CS2A 1GKFA 5LOVA 1QHTA 1WP7A 1EM1A 2QSAA 3GVMA 2PZSA 2XAQA 4WBNB 5K1XA 2ZXWC 4LF9B 1D5AA 1VQKV 1SZTA 1N0NA 2QTSA 4J7JA 4R8CA 5EC1C 1BT8A 3E35A 4DRXA 1RPOA 1RP3B 4RAIA 1PD3A 4HNAB 1NVPD 2GTSA 1W0JG 4BW5A 1SRYA 1S5LZ 1Q3EA 4DR5B 1Q90D 3STZC 4JI5O 4JI6O 3RYFA 2LGWA 1JJOA 2WLIA 1SZXA 5BMVA 3WB2A 2UXCB 4NXNO 2PYLA 4UCUA 1M57B 4KP4A 4LBEC 1VQ9V 1AP6A 1XREA 3ABUA 1XHXA 3KKYA 3CC4V 4B08A 1FS0G 1MZEA 3BA9A 3L70H 2GUZB 1PPJH 1VQ7V 2KSDA 4DK0A 4JI8B 1MG1A 2UXNA 3A8TA 5CN0A 3PJSK 3ABMC 5B1BC 1V55B 2IU0A 2Q7GA 3FD9A 2BE3A 2VWJA 3B77A 3CHXA 2FYUH 3OTOB 1A32A 2Z0AA 4EKWA 4FVMA 1SF9A 3AG4B 3UM7A 2ZD9A 2B5UA 2Q5ZA 2L6LA 2JEUA 5LMUO 1IX9A 3AG2B 3RYCA 1I94B 1Z2GA 3UCSC 4CC5A 3CRCA 2QM7A 1JR9A 1TUBA 2WLJA 1ZUQA 3P30A 1SQGA 1F51A 3CD6V 4JYAO 4B3SO 4GKJO 2QM8A 1S5JA 4W4LA 2F23A 5LP6C 1LUVA 5KHIA 5CA0B 1Y74B 1ZLZA 1FXVA 3DSQA 1HNZB 3D3IA 4PA3A 4IT5A 4EFEA 5CB4B 4G27B 1BCCH 2ZE5A 4I50A 2EIJC 1PL0A 3TETA 1K8AW 1AJQA 1AVMA 1SC5B 2LQTA 2JGDA 2YXYA 2RMKB 4TV8B 3CXHF 1CEZA 4TUYB 4B3MO 5GW7A 1AJPA 3X2QB 2DQ3A 1WAZA 2CH7B 1Z5WA 1OCCC 2P6JA 1YF2A 1QVFU 1XNQB 2YS8A 5L3GA 2IBZH 2KKWA 2GSMB 1HW7A 2QTOA 3OUSA 3FB8C 4TWKA 4DUZO 1H8HG 3ZRVA 2V4DA 5B3SB 2VS0A 4DR4O 2E74B 2HG5C 2UU9O 4OPHA 1KMIZ 3R65A 5KHKA 2FKXA 3ASNB 3HKBB 4I0XB 3UKMA 2UUBO 3O65A 3OM3B 2JGUA 2BOCC 1XMQO 1SETA 3JAKB 5EZYB 3W7XA 3HKCA 3TXSA 3VQVA 2CGNA 1OCZB 3D36A 2WLHA 2Q7HA 2XASA 2BTOA 5LXTB 1GH6A 1MOFA 5KA6A 4MVQA 2YXLA 3A2FA 4LNUB 2MK3A 2V7QG 3E8FA 5HFLA 4MVOA 4PDRA 4ZI7B 2X6CA 3SJAC 4N21A 5GTHZ 4DR6O 4FLWA 4NVPA 3C3TA 1M93A 4O4IA 4FMTA 1MMMA 3NR7A 1U97A 4Z1VA 3I5DA 4DV5B 2KG7A 1M1KW 4IHJA 3AK3A 1R6KA 5DEDA 4P9OA 1OCOC 1Q82W 1AI7A 3P3NA 2W0FC 2A06H 3ZMUA 2X6BA 1ZSPA 4PHZA 3N2KB 2DYSC 1GM8A 1X4TA 3IJ4A 1GN3A 2E3CA 3JARB 1TUEB 1YCIA 2BCCH 4WBNA 5JJNB 2QWRB 2YUAA 1NH2B 4YY3B 5B1OA 1NR1A 3OT7A 2E5LO 1FXKB 2P4KA 1H2NA 1NTMH 2WLNA 4FLYA 5KAFZ 1VARA 1ENVA 2OYQA 4KFMA 1VF5B 3E8HA 2ZDIA 2ZE6A 1P49A 4AILC 4U7OA 4UVAA 2QR4A 4GX5A 1IBMO 2KQXA 2OWOA 3VQXA 4JI3O 4QGPA 3BEHA 3OUFA 1GN2A 1MZFA 1F4NA 4O4HA 1M56C 2O57A 2EINC 1IZ3A 3BAAA 4UB6Z 3SYCA 1OCRB 4N23A 1K73W 2ZKOA 1V54C 3ASOB 1IXBA 1KC8W 1WPXA 4B3RB 2AZ0A 1WN7A 1XUQA 4FM2A 1S5HC 4TOIA 5IY5B 4DV7O 2GUZA 1XQ8A 4O4JB 3FB7C 1SQXH 2IH3C 4I4TB 1QBZA 3ZRWB 3ETDA 1HDJA 3CMAV 3JAWA 1P84F 4A5UB 3F7YC 3SR2C 2JS5A 2B1GA 2F4VO 4GKKB 3SYQA 2PTMA 4H44B 3IC9A 1AR5A 4DO2A 3ABKB 1KBHA 2Q67A 1W59A 2M6YA 3T2MA 1PKXA 3T1HO 3BFRA 2PGGA 3H1HH 3RYIB 3OMNB 4LFAB 1WNSA 5H6QA 3K57A 2LFSA 3T4DA 3K03A 4X89A 1KQSU 5KMGA 5IE9A 4FLUA 4JI4B 4MSWC 2QKAA 3FYIB 2ZR3A 4DV3B 3K5OA 1SERA 3CCSV 1GMGA 3LDEA 4D6TH 2LO1A 4F6RA 3CWBH 1NBMG 2C2AA 1S72V 2ZNIA 1CPYA 4BR6A 5CA0A 1Y74A 1HR0O 3ETQA 3K0DA 4DR2O 5EC2C 4C7UA 3ZBHA 5L3EA 1VQNV 3H9VA 1QVGU 4YJ3A 5CB4A 4H33A 3ZHSA 3AG7A 2DWEC 4ZHQB 4X20A 1J5EB 1YITV 1YZBA 1VQPV 1AB3A 2LW7A 1PNMA 1AP5A 1N0JA 2WLLA 4TUYA 4NYKA 3K5NA 3OEEG 3G4SV 1BE3H 1F4MA 1ZAUA 4JAVA 1PV0A 2WAMA 3W7TA 5L3CA 5AG2A 1G1XB 5LYJB 1I0HA 3BVOA 3CS5A 2QJ1A 2WA3A 4FZ1A 4YIPA 3ABTA 2ODMA 3WU2Z 4QNHB 5IJ0B 3L9DA 3JATA 3ZMSA 5IYDO 2EBOA 1XOUA 4AHCA 2WPDG 4L8JA 4LH7A 2RJZA 3B4SA 5EYPA 2HVKC 4EFBA 4HZ3A 5IYZA 1CP9A 3HPLC 3OW2U 4LF8O 4I5SA 2QWPB 1S76D 1MSDA 4FK5C 4D7TA 3JALA 4PI0A 4RQEA 1YTFD 5LGTA 4UB8Z 5LXTA 2JIZG 4LCUC 2EILB 3CJHB 4LNUA 3OR6C 5LMNB 2ZNJA 2CTPA 1YXBA 2W0XA 4P30A 1EN5A 4FLZA 2QGNA 2CTRA 1N33O 3ZMVA 2ZE8A 4CBCA 2DYRC 1XEQA 2PYJA 1R6TA 3LDDA 4DV1O 1P4RA 4DR3B 1BMFG 5JWPA 5EBWC 3CCLV 2JVDA 2H8PC 4PI2A 4HBNA 3CC2V 4LWSB 4X1YB 1KD1W 4O2BA 5EIBC 2Y69C 4I55A 3JARA 1NVPB 1HNXO 4Q6GA 1SA0B 3A0BZ 1TGOA 4F6EA 4UCSA 2ARHA 1DLBA 1XNRO 5F2VO 4LFCB 1FXKA 2XOKG 1IBKO 1H2MA 2XAGA 2YEVB 3SPJA 3FFQA 2PI5A 2ZIOA 2L35A 1N36O 1WLEA 4EB6B 5DN6G 2ZXWB 2QWQB 4J11A 1QLEC 1GRJA 5JH7B 2VRZA 4UVCA 4GX0A 2XTAA 3K06A 5EIBD 4CH3A 2Q73A 4LF7O 3IC7A 2ADPA 3L71H 5BZBA 3SPCA 3IAYA 2ZR2A 1NJIW 4LF6B 1N32O 1K33A 3L75H 2IM9A 4I4TA 4XDJA 2P22C 3ZRWA 3QNEA 4YJ2B 4JI5B 2DQ0A 4J41A 4JI6B 3UT5A 4X66O 3TCUA 3F5WC 3O9OA 2BOBC 1DK1A 5LGUA 1JOYA 1W0KG 4NXNB 4K0KO 3RVZA 1RM1C 5H5NA 4QIWF 2PI4A 4QPJA 2N04A 2P4VA 2UUAO 4MTFA 3CYOA 4WFFA 5C8YB 1SQFA 3CCJV 4OXSA 5LA6B 3RYIA 1FPOA 4NB5A 3W7UA 3ABLC 3HR0A 3VOUA 1R3KC 1K3EA 3D36C 3E86A 5B1AC 4LF4O 5J2UB 1R1BA 4HAMA 2GDSA 4QE9A 4B7EA 1GN6A 3WG7B 1F7YA 4FPPA 3C3SA 5ITZB 1UJWB 5EK0A 5LMUB 1R3LC 1VQOV 4AQYO 3JD1A 3SJBC 2H94A 2Q7EA 1HWYA 4RQFA 2WLMA 5KA5A 1NKDA 1DTOA 4JYAB 3T1CA 4GKJB 3LNMB 5LP6B 1NR7A 1Y76A 5FPRA 1NT2B 1K7DA 2AZ2A 4IYIA 3MD0A 4DXWA 1BQZA 5J2TB 4X64O 1SQQH 1QNMA 4PA4A 2DW4A
chains in the Genus database with same CATH topology
1WP8A 4FZ1A 2QTSA 4FZ0A 4NTWA 3IJ4A 3S3XA 4NTYA 4NYKA 3N27A 2L35A 1WP7A 4NTXA 3S3WA 2FB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WP8 A;  4FZ1 A;  2QTS A;  4FZ0 A;  4NTW A;  3IJ4 A;  3S3X A;  4NTY A;  4NYK A;  3N27 A;  2L35 A;  1WP7 A;  4NTX A;  3S3W A;  2FB5 A; 
#chains in the Genus database with same CATH topology
 2P90 A;  3OR7 C;  2OCC B;  3K5L A;  4WFB V;  1B6Q A;  1RFY A;  1YJ9 V;  3QF7 A;  1AJN A;  2ZDI C;  1BZK A;  2Z3Y A;  3AG1 B;  1OCC B;  5K1P A;  1E1R G;  4B3M B;  1RSO A;  3ZED A;  4JI7 O;  2HJF C;  4JI1 O;  1OHH G;  2YIB A;  3DXR B;  1YI2 V;  4FFK A;  3B2E E;  1L1F A;  3OE7 G;  1M57 C;  4U3F H;  3M99 B;  3ICX A;  3G71 V;  4DUZ B;  5IJ9 B;  2Z5U A;  3E89 A;  3J81 N;  4GLX A;  4DR4 B;  2UU9 B;  2AHY A;  2WSS G;  4YHH O;  2IU3 A;  1SQV H;  1NI8 A;  2JEX A;  2ZT9 B;  3OGI B;  3WB0 A;  2DWD C;  3S3X A;  4L87 A;  4LFB O;  1AR1 B;  2UUB B;  1XMO O;  2BTQ A;  3SDL A;  3ML0 A;  3E83 A;  1XMQ B;  2A0L A;  4UV8 A;  2BSK B;  5BR8 O;  5IYC O;  3OAA G;  1M90 W;  3HB3 B;  3OTF A;  2ATK C;  3VBB A;  5BY1 A;  3APO A;  4D7S A;  3AG4 C;  4X1I B;  1R3J C;  2HLD G;  3SJC C;  3G80 A;  4LWS A;  3CP1 A;  3AG2 C;  1JFF B;  3RYH B;  3TGU H;  4DR6 B;  4JAS A;  5E1A C;  2ZM6 O;  3HKD A;  5TIS Z;  4X1K A;  2PY5 A;  4UFZ A;  5FNV B;  3Q4H B;  1GK9 A;  1N4C A;  1H2S B;  1U96 A;  4H13 B;  2R72 A;  2DYS B;  3U10 A;  5LHI A;  2LGQ A;  2OTJ V;  2YEV A;  1K34 A;  5EBL C;  5EBM C;  5DEC A;  4FFB A;  4ZKI A;  2F93 B;  1HP8 A;  4G2K A;  5JVD B;  3GWK C;  2Y4U A;  2LFR A;  3RFR A;  4TQF A;  4PA7 A;  5JH7 A;  2D3O W;  4X65 B;  2A9H A;  2MW2 B;  1YSC A;  2UXB O;  2E5L B;  1K92 A;  2N74 A;  3X2Q C;  1G6U A;  3CX5 F;  2YIA A;  2Y0I A;  4BWA A;  3JD3 A;  1T5E A;  2Q0O C;  1IBM B;  4JYC A;  4JI3 B;  4RUE A;  1XL6 A;  3CE2 A;  5LBQ A;  4K8X A;  3F7V C;  5B1N A;  3JSL A;  4GZR B;  1V54 B;  3OMI B;  1MNG A;  3K5M A;  2DN9 A;  2YSU B;  1ZTE A;  1KEC A;  3CPW U;  3ASN C;  1XL4 A;  4MVM A;  5LA6 A;  1OZ0 A;  3AG3 B;  2A3Q A;  3EFF K;  1PNL A;  4DV7 B;  3FB5 C;  1EBO A;  3DC6 A;  4LF5 O;  4KHP O;  1IBL O;  3SYA A;  2FTK A;  1QQC A;  3KZI Z;  3B40 A;  2M7W A;  4HNA A;  4U3J B;  3GB7 C;  1OCZ C;  2F4V B;  1HNW O;  2XT9 A;  5J2U A;  1WA8 B;  2FL4 A;  3B09 A;  2HHH O;  3T1H B;  4OX9 O;  1R3I C;  4MT8 A;  5ITZ A;  3N27 A;  2FB5 A;  5B66 Z;  3M8A A;  2KB1 A;  3SYP A;  1Q86 W;  2OIG A;  4JGS A;  2JJ1 G;  1FXH A;  4UCV A;  4O2A B;  1B06 A;  1IUR A;  4YIO A;  1WJZ A;  2JS3 A;  1K97 A;  2QWO B;  4CH6 A;  4PV1 B;  4TSF G;  3L72 H;  3M7M X;  4JV5 O;  4UCT A;  3F5T A;  4W4K A;  5A2Q N;  1HR0 B;  2RCV A;  1Q7Y W;  1NTK H;  1FFT B;  4NXM O;  4DR2 B;  3H1I H;  1CXZ B;  3JSN A;  1B3Q A;  3K3W A;  4WCE V;  4IL6 Z;  3K08 A;  3LUT B;  1FXK C;  5A9G A;  3CCV V;  3BHP A;  1JPX A;  1MA1 A;  5LOV B;  3CXC U;  2X6A A;  2WA4 A;  3FX7 A;  1AI6 A;  3EHB B;  4JI0 O;  4EEQ A;  2D2C B;  4NR1 A;  1YTF B;  3JYC A;  3U0Z A;  2F66 C;  1NTZ H;  4FM1 A;  1JQ0 A;  3P3P A;  2ITC C;  1N8R W;  5J9P C;  4I9W A;  3DXR A;  4DW1 A;  1OCR C;  3P32 A;  1YJW V;  2LP7 A;  5H2F Z;  4DRX B;  1R73 A;  3ASO C;  5IJ9 A;  1FJG O;  3MDS A;  1KYO F;  2YXH A;  5CA1 B;  4OGQ B;  5H9C A;  2Q4P A;  4TV9 B;  5IY5 C;  5KUM A;  3KCY A;  3ETE A;  4J9Z B;  1D5N A;  3RYF B;  2K9P A;  2WLI B;  5BMV B;  4J7Z A;  1FFX B;  4FZ0 A;  4TV8 A;  3DTU B;  1ZWI C;  4GX1 A;  4JTD B;  4LF8 B;  2CH7 A;  2OCH A;  1YIJ V;  2QKS A;  4U7N A;  4E4E A;  1SS3 A;  4DV4 O;  2YI9 A;  1VEW A;  4KXR A;  4K8Z A;  4TQD A;  4Z2W A;  5KAI Z;  1VF6 A;  4X1I A;  4PJ0 Z;  2JK5 C;  4PDL A;  4ZBM A;  2HKO A;  4WF9 V;  1NU1 H;  4MW8 A;  4X62 O;  1K9M W;  3ETG A;  2Y0P A;  3E8B A;  3JD0 A;  3STL C;  1THZ A;  2E75 B;  2EIM B;  1N33 B;  2HR3 A;  4BW9 A;  1K5S A;  3ZHQ A;  1GO3 F;  3Q4H A;  4DV1 B;  4FLX A;  2EIK B;  3HKB A;  4I0X A;  4P2Z A;  5H6R A;  1P7B A;  1LNQ A;  3K79 A;  1ORQ C;  3L73 H;  5BXZ A;  1JX9 A;  1GAX A;  2ILM A;  3JAK A;  5EZY A;  3CCE V;  1TUB B;  1BHB A;  3FB6 C;  1GM9 A;  5DM6 V;  3H1L H;  2B9Z A;  2QDO A;  3LSQ A;  3J80 N;  1YDX A;  4OPA A;  4DV0 O;  4ZI7 A;  3ZX6 A;  3E22 B;  1RPR A;  3A0H Z;  1XNR B;  3CME V;  3AK2 A;  4XDK A;  1F23 A;  2G38 A;  1IBK B;  3E8G A;  4KL1 A;  1K4C C;  3H01 A;  1VIB A;  4GX2 A;  4Z1M G;  1Q6H A;  2DMX A;  4I50 B;  5IWA O;  2ZE7 A;  4MVR A;  2JRI A;  4DR1 O;  1N36 B;  1QLE B;  4B7K A;  5L3F A;  3EVK A;  3QO5 A;  4X88 A;  2RN9 A;  1FKA O;  3N2K A;  2F1M A;  1IVS A;  4DV6 O;  1QLN A;  3DGE A;  1BHA A;  3CCM V;  2WLK A;  4MTX A;  2CTQ A;  2YI8 A;  4JAA A;  2Q0A A;  3U11 A;  4LF7 B;  5IT9 N;  5KUK A;  1M9N A;  4O4L B;  3FYE B;  1B04 A;  3GWO A;  1N32 B;  5KLV H;  2ZCE A;  2UUC O;  2OIE A;  3ZHR A;  3CC7 V;  4U3J A;  2VQF O;  3CCQ V;  4X66 B;  5KX5 B;  1G4Y B;  4K0K B;  3JAS B;  4NKG B;  2EIL C;  4MVZ A;  1WA8 A;  2UUA B;  4WFG A;  1Y66 A;  2V1D A;  4JYB A;  1H8E G;  3ABL B;  1VQ8 V;  2QE7 G;  4PDV A;  4DV2 O;  4DR3 O;  3HKC B;  1MSW D;  4GYC B;  1TVK B;  5B1A B;  1SES A;  5D5Q A;  5FPO A;  4O4J A;  2CGO A;  3BAB A;  4LF4 B;  2YIB D;  1BL8 A;  5LHH A;  4TT3 G;  4O4I B;  4UUJ C;  1TA8 A;  4GCZ A;  5LHG A;  2UXD O;  3JD2 A;  4ZOL B;  1S3J A;  3G67 A;  2VQE O;  2KG7 B;  3W7S A;  4DUY O;  3LSS A;  4B3T O;  5GTI Z;  4AQY B;  2E76 B;  4MTG A;  2FML A;  2XHB A;  5FL7 G;  1H2L A;  1QR8 A;  3T1Y O;  1ZL8 B;  3ABM B;  3H1K H;  4IIJ B;  5B1B B;  2ZIM A;  1N34 O;  3D3Q A;  3NXS A;  2CDY A;  5JCO A;  2Q8V A;  1JVM A;  2GHY A;  2Q69 A;  4UVB A;  1FYJ A;  1ZX3 A;  1BQ0 A;  3RWR D;  2OTL V;  1UPG A;  4X64 B;  1VQ5 V;  3I55 V;  4JI2 O;  4RO2 A;  4FJC C;  1WP8 A;  4DR7 O;  5CA1 A;  4IYH A;  3E2E A;  3L74 H;  2HEP A;  1VMG A;  3FAV B;  4LF6 O;  4TV9 A;  2Y48 A;  1O9H A;  1JCH A;  5GON B;  4ZHQ A;  1NS1 A;  3UO3 A;  4JI7 B;  4O4H B;  2P7T C;  4B3S B;  1AIL A;  1FFX A;  4JI1 B;  5CA3 A;  4RWU A;  3RN4 A;  4NTY A;  2IH1 C;  4NTX A;  1PM9 A;  4LF9 O;  3A0R A;  4QPK A;  2EIJ B;  1VP7 A;  4YHH B;  5LYJ A;  3MHH C;  2X0L A;  2Y4T A;  3JCZ A;  3JAW B;  3K58 A;  2RNB A;  4X8A A;  4LFB B;  4WFE A;  4LC1 A;  1FD9 A;  1XMO B;  1M4U A;  3HKE B;  5IJ0 A;  4DR5 O;  5BR8 B;  1KKC A;  3CCR V;  2UXC O;  4MS2 A;  3WG7 C;  4KUM A;  4PA9 A;  2DJV A;  1XI1 A;  3RT3 C;  2QA4 V;  2A7W A;  4F4L A;  1V9P A;  5KMG B;  2AW9 A;  1DF4 A;  2Q68 A;  3CRR A;  1S0V A;  3J7A U;  3PN1 A;  2ZM6 B;  4JTA B;  2R9A A;  2LJ2 A;  3C90 A;  3CJH A;  4JI8 O;  1NZ6 A;  5CBH A;  5FLX N;  3JD4 A;  1DF5 A;  1Q81 W;  2K1E A;  3E22 A;  4F6R B;  3ZHU A;  3H1J H;  3S3W A;  1V55 C;  2ADQ B;  3OTO O;  5CBG A;  4K3A A;  4YJ3 B;  3BCC H;  1XBL A;  4LR3 A;  4X20 B;  3K9A A;  1I94 O;  3RW0 A;  4ABM A;  4CH4 A;  5CMU A;  2R9I A;  3CEI A;  3SJQ C;  2OCC C;  4X1Y A;  2NLJ C;  1UFI A;  2WLL B;  4HYO A;  1EN6 A;  2UXB B;  4RUF A;  3AG1 C;  3MAQ A;  1H2G A;  1BGY H;  2YDE A;  1SA0 A;  1QR9 A;  2DOS A;  1PP9 H;  3IGA C;  4O4L A;  1OCO B;  1KUQ A;  5HFM A;  4WFA V;  2R70 A;  4LH6 A;  4X9Q A;  1M5I A;  2EUL A;  3CRM A;  1HNZ O;  4JPR A;  4ASU G;  3DC5 A;  2W6J G;  1Q5O A;  5KX5 A;  4FM0 A;  1AI5 A;  1H2K A;  2CUG A;  3BRC A;  1NQT A;  2XAH A;  1ARO P;  3JAS A;  3JAT B;  4EB6 A;  1OV9 A;  1Q6U A;  2X7R B;  3K0G A;  1WB8 A;  2UXX A;  2QWN B;  1P7G A;  2JJ2 G;  1H38 A;  5EYP B;  3UO2 A;  3G6B A;  4Q20 A;  5IYZ B;  3KCX A;  4E2L A;  3N2G B;  4LF5 B;  4KHP B;  2HP8 A;  4CH5 A;  1IBL B;  1GM7 A;  3VQW A;  1JJ2 U;  3JAL B;  1XIL A;  2ZQM A;  1XNQ O;  3ZIA G;  1E79 G;  1TVK A;  5IDJ A;  2HFE C;  1I08 A;  2A79 B;  4BIO A;  2QKC A;  4MW3 A;  1HNW B;  1M56 B;  1VF6 C;  3AK1 A;  5JQG B;  2EIN B;  1URF A;  4YJ2 A;  5LGN A;  5B3S C;  1LUW A;  2HHH B;  4OX9 B;  4ZOL A;  2F95 B;  1L8D A;  3BA8 A;  4G28 B;  2XUM A;  1KP2 A;  5L3B A;  1W2B U;  2P67 A;  3QVN A;  1KKD A;  5C8Y A;  2CK3 G;  4JTC B;  2H3O A;  2EZP A;  4QE7 A;  1BSM A;  1XDC A;  4O2B B;  1ZL8 A;  2DE0 X;  4I55 B;  3TXQ A;  2AGA A;  2RQ6 A;  2ZIN A;  4IIJ A;  2JDI G;  4FLT A;  4JV5 B;  1S77 D;  4X65 O;  2IJI A;  3B8M A;  4NXM B;  1JMK C;  5C93 A;  2OT5 A;  1Q43 A;  3OFN G;  3AEI A;  4H37 A;  1QCE A;  5CBF A;  4DV5 O;  3R66 A;  3LNN A;  1WPB A;  3OGC C;  3FAV A;  2HJD A;  2R9R B;  3G6E V;  4JI0 B;  1O9G A;  3FKS G;  3CRA A;  1I5Y A;  3SGI A;  2CE4 A;  5GON A;  2PF4 E;  4AI8 A;  3RBZ A;  4ICG A;  4P9P A;  1AR4 A;  1G8M A;  3ZMZ A;  1FAF A;  5LP6 A;  4PEL A;  4JYY A;  5JJJ B;  4DW0 A;  3BY6 A;  4PD4 F;  4WFH A;  1FJG B;  4YY3 O;  3LSU A;  3OMA B;  1OJH A;  3QTC A;  3TK1 A;  5J2T A;  3ZS8 C;  1KB9 F;  3AG3 C;  4CZZ A;  3B8N A;  4J7K A;  2B1I A;  2EX3 A;  3IFX A;  3APQ A;  2VWK A;  3UT5 B;  4J42 A;  3W7W A;  3ZHV A;  5LL6 Y;  3HKE A;  2QEX V;  1PL4 A;  3D8C A;  1QU7 A;  2ITD C;  3CSX A;  3TJT A;  3CRQ A;  1VQL V;  4J9Y B;  1MAB G;  1I5X A;  4DV4 B;  3THO A;  4QJF B;  5KHJ A;  4B3R O;  1JA8 A;  3WFV A;  3CB2 A;  1VF7 A;  4X62 B;  2F43 G;  2RDC A;  5E79 Z;  3ZCC A;  1BS3 A;  1IDS A;  1NH2 D;  1IXM A;  1SQP H;  1X59 A;  1US6 A;  3BPZ A;  2NNU A;  4UCR A;  3SYO A;  4GKK O;  4K35 A;  4UCO A;  1K5Q A;  3OEH G;  2BSK A;  1R6N A;  1YEW A;  3CCU V;  3ABK C;  2GBO A;  4LFA O;  2GTA A;  1DGS A;  2CAZ C;  2YIC A;  1E1Q G;  4MVS A;  5KHG A;  4CS4 A;  4DV0 B;  1YJN V;  1Y76 B;  1JFF A;  3RYH A;  4JI4 O;  4UV9 A;  2ETN A;  2DYR B;  4DV3 O;  5JCO C;  5L3D A;  2IJJ A;  2HVJ C;  5FNV A;  1SKV A;  2PUS A;  4FIP C;  4I7Z B;  2W6I G;  3ZN0 A;  3OD4 A;  5IWA B;  5JJE B;  4GT1 A;  1VQ4 V;  1Q8I A;  1Y4M A;  4DR1 B;  2Q9L A;  3RYC B;  4PDM A;  1SQB H;  2Y69 B;  2EZO A;  4MTO A;  4DV6 B;  4H0L B;  4CS3 A;  1TAE A;  2XAF A;  2EJR A;  3ZMT A;  4NTW A;  3T4Z A;  3K59 A;  3EXA A;  1RSO B;  1J5E O;  5JVD A;  4R7C A;  4BAY A;  1HNX B;  1K4D C;  3K9S A;  3ZRS A;  3UQ8 A;  3N2G A;  3QO8 A;  4GUN A;  1KU9 A;  1GTO A;  4J80 A;  2UUC B;  4LP8 A;  1EFR G;  1PNK A;  1AI4 A;  2VQF B;  2LW1 A;  2P06 A;  3K04 A;  3SPI A;  2WWW A;  1Y6X A;  1L0N H;  3QO7 A;  2Q6A A;  1Q6I A;  4YXW G;  5JQG A;  2JGD B;  3SPG A;  3JAM N;  3ZN1 A;  5KHH A;  1L0L H;  2BTQ B;  1YHQ V;  2IW5 A;  2EIM C;  3RVY A;  4UXN A;  1COW G;  4DV2 B;  4J10 A;  1LR1 A;  4XBF A;  5IYB O;  1YVW A;  2EIK C;  4BIU A;  3JCU Z;  2P5O A;  1EN4 A;  2AHZ A;  4FLV A;  1GN4 A;  4PA6 A;  2XAJ A;  3LDC A;  4CC6 A;  1RM1 B;  2QM4 A;  4I9Q A;  2EJ7 A;  3KG2 A;  5LMN O;  2UXD B;  3HKD B;  1Y67 A;  4JZG A;  4X1K B;  4BIZ A;  2VQE B;  4DUY B;  1I7F A;  4B3T B;  1KP3 A;  4DYL A;  2CTW A;  5B5E Z;  2GV9 A;  3T1Y B;  2AXT Z;  4FFB B;  4MVU A;  2N05 A;  3RGB A;  4JF3 A;  1N34 B;  3MHS C;  2NR5 A;  2IJH A;  4IGG A;  4O2A A;  2XND G;  1VQ6 V;  3ZJZ A;  4R6Z A;  1EZJ A;  4DK1 A;  3QG5 A;  2NN4 A;  1Z5V A;  4XDL A;  3VQY A;  4R50 A;  3I56 V;  1XHZ A;  2YID A;  3ZRX A;  5D5P A;  4JI2 B;  1WB7 A;  2YC0 A;  4DR7 B;  4ZIB A;  1ROP A;  4IHJ B;  2IJK A;  4JAU A;  3ZHT A;  1VQM V;  4LFC O;  3WB1 A;  1J95 A;  1D2D A;  3SPH A;  1EZV H;  4JZ2 A;  4CS2 A;  1GKF A;  5LOV A;  1QHT A;  1WP7 A;  1EM1 A;  2QSA A;  3GVM A;  2PZS A;  2XAQ A;  4WBN B;  5K1X A;  2ZXW C;  4LF9 B;  1D5A A;  1VQK V;  1SZT A;  1N0N A;  2QTS A;  4J7J A;  4R8C A;  5EC1 C;  1BT8 A;  3E35 A;  4DRX A;  1RPO A;  1RP3 B;  4RAI A;  1PD3 A;  4HNA B;  1NVP D;  2GTS A;  1W0J G;  4BW5 A;  1SRY A;  1S5L Z;  1Q3E A;  4DR5 B;  1Q90 D;  3STZ C;  4JI5 O;  4JI6 O;  3RYF A;  2LGW A;  1JJO A;  2WLI A;  1SZX A;  5BMV A;  3WB2 A;  2UXC B;  4NXN O;  2PYL A;  4UCU A;  1M57 B;  4KP4 A;  4LBE C;  1VQ9 V;  1AP6 A;  1XRE A;  3ABU A;  1XHX A;  3KKY A;  3CC4 V;  4B08 A;  1FS0 G;  1MZE A;  3BA9 A;  3L70 H;  2GUZ B;  1PPJ H;  1VQ7 V;  2KSD A;  4DK0 A;  4JI8 B;  1MG1 A;  2UXN A;  3A8T A;  5CN0 A;  3PJS K;  3ABM C;  5B1B C;  1V55 B;  2IU0 A;  2Q7G A;  3FD9 A;  2BE3 A;  2VWJ A;  3B77 A;  3CHX A;  2FYU H;  3OTO B;  1A32 A;  2Z0A A;  4EKW A;  4FVM A;  1SF9 A;  3AG4 B;  3UM7 A;  2ZD9 A;  2B5U A;  2Q5Z A;  2L6L A;  2JEU A;  5LMU O;  1IX9 A;  3AG2 B;  3RYC A;  1I94 B;  1Z2G A;  3UCS C;  4CC5 A;  3CRC A;  2QM7 A;  1JR9 A;  1TUB A;  2WLJ A;  1ZUQ A;  3P30 A;  1SQG A;  1F51 A;  3CD6 V;  4JYA O;  4B3S O;  4GKJ O;  2QM8 A;  1S5J A;  4W4L A;  2F23 A;  5LP6 C;  1LUV A;  5KHI A;  5CA0 B;  1Y74 B;  1ZLZ A;  1FXV A;  3DSQ A;  1HNZ B;  3D3I A;  4PA3 A;  4IT5 A;  4EFE A;  5CB4 B;  4G27 B;  1BCC H;  2ZE5 A;  4I50 A;  2EIJ C;  1PL0 A;  3TET A;  1K8A W;  1AJQ A;  1AVM A;  1SC5 B;  2LQT A;  2JGD A;  2YXY A;  2RMK B;  4TV8 B;  3CXH F;  1CEZ A;  4TUY B;  4B3M O;  5GW7 A;  1AJP A;  3X2Q B;  2DQ3 A;  1WAZ A;  2CH7 B;  1Z5W A;  1OCC C;  2P6J A;  1YF2 A;  1QVF U;  1XNQ B;  2YS8 A;  5L3G A;  2IBZ H;  2KKW A;  2GSM B;  1HW7 A;  2QTO A;  3OUS A;  3FB8 C;  4TWK A;  4DUZ O;  1H8H G;  3ZRV A;  2V4D A;  5B3S B;  2VS0 A;  4DR4 O;  2E74 B;  2HG5 C;  2UU9 O;  4OPH A;  1KMI Z;  3R65 A;  5KHK A;  2FKX A;  3ASN B;  3HKB B;  4I0X B;  3UKM A;  2UUB O;  3O65 A;  3OM3 B;  2JGU A;  2BOC C;  1XMQ O;  1SET A;  3JAK B;  5EZY B;  3W7X A;  3HKC A;  3TXS A;  3VQV A;  2CGN A;  1OCZ B;  3D36 A;  2WLH A;  2Q7H A;  2XAS A;  2BTO A;  5LXT B;  1GH6 A;  1MOF A;  5KA6 A;  4MVQ A;  2YXL A;  3A2F A;  4LNU B;  2MK3 A;  2V7Q G;  3E8F A;  5HFL A;  4MVO A;  4PDR A;  4ZI7 B;  2X6C A;  3SJA C;  4N21 A;  5GTH Z;  4DR6 O;  4FLW A;  4NVP A;  3C3T A;  1M93 A;  4O4I A;  4FMT A;  1MMM A;  3NR7 A;  1U97 A;  4Z1V A;  3I5D A;  4DV5 B;  2KG7 A;  1M1K W;  4IHJ A;  3AK3 A;  1R6K A;  5DED A;  4P9O A;  1OCO C;  1Q82 W;  1AI7 A;  3P3N A;  2W0F C;  2A06 H;  3ZMU A;  2X6B A;  1ZSP A;  4PHZ A;  3N2K B;  2DYS C;  1GM8 A;  1X4T A;  3IJ4 A;  1GN3 A;  2E3C A;  3JAR B;  1TUE B;  1YCI A;  2BCC H;  4WBN A;  5JJN B;  2QWR B;  2YUA A;  1NH2 B;  4YY3 B;  5B1O A;  1NR1 A;  3OT7 A;  2E5L O;  1FXK B;  2P4K A;  1H2N A;  1NTM H;  2WLN A;  4FLY A;  5KAF Z;  1VAR A;  1ENV A;  2OYQ A;  4KFM A;  1VF5 B;  3E8H A;  2ZDI A;  2ZE6 A;  1P49 A;  4AIL C;  4U7O A;  4UVA A;  2QR4 A;  4GX5 A;  1IBM O;  2KQX A;  2OWO A;  3VQX A;  4JI3 O;  4QGP A;  3BEH A;  3OUF A;  1GN2 A;  1MZF A;  1F4N A;  4O4H A;  1M56 C;  2O57 A;  2EIN C;  1IZ3 A;  3BAA A;  4UB6 Z;  3SYC A;  1OCR B;  4N23 A;  1K73 W;  2ZKO A;  1V54 C;  3ASO B;  1IXB A;  1KC8 W;  1WPX A;  4B3R B;  2AZ0 A;  1WN7 A;  1XUQ A;  4FM2 A;  1S5H C;  4TOI A;  5IY5 B;  4DV7 O;  2GUZ A;  1XQ8 A;  4O4J B;  3FB7 C;  1SQX H;  2IH3 C;  4I4T B;  1QBZ A;  3ZRW B;  3ETD A;  1HDJ A;  3CMA V;  3JAW A;  1P84 F;  4A5U B;  3F7Y C;  3SR2 C;  2JS5 A;  2B1G A;  2F4V O;  4GKK B;  3SYQ A;  2PTM A;  4H44 B;  3IC9 A;  1AR5 A;  4DO2 A;  3ABK B;  1KBH A;  2Q67 A;  1W59 A;  2M6Y A;  3T2M A;  1PKX A;  3T1H O;  3BFR A;  2PGG A;  3H1H H;  3RYI B;  3OMN B;  4LFA B;  1WNS A;  5H6Q A;  3K57 A;  2LFS A;  3T4D A;  3K03 A;  4X89 A;  1KQS U;  5KMG A;  5IE9 A;  4FLU A;  4JI4 B;  4MSW C;  2QKA A;  3FYI B;  2ZR3 A;  4DV3 B;  3K5O A;  1SER A;  3CCS V;  1GMG A;  3LDE A;  4D6T H;  2LO1 A;  4F6R A;  3CWB H;  1NBM G;  2C2A A;  1S72 V;  2ZNI A;  1CPY A;  4BR6 A;  5CA0 A;  1Y74 A;  1HR0 O;  3ETQ A;  3K0D A;  4DR2 O;  5EC2 C;  4C7U A;  3ZBH A;  5L3E A;  1VQN V;  3H9V A;  1QVG U;  4YJ3 A;  5CB4 A;  4H33 A;  3ZHS A;  3AG7 A;  2DWE C;  4ZHQ B;  4X20 A;  1J5E B;  1YIT V;  1YZB A;  1VQP V;  1AB3 A;  2LW7 A;  1PNM A;  1AP5 A;  1N0J A;  2WLL A;  4TUY A;  4NYK A;  3K5N A;  3OEE G;  3G4S V;  1BE3 H;  1F4M A;  1ZAU A;  4JAV A;  1PV0 A;  2WAM A;  3W7T A;  5L3C A;  5AG2 A;  1G1X B;  5LYJ B;  1I0H A;  3BVO A;  3CS5 A;  2QJ1 A;  2WA3 A;  4FZ1 A;  4YIP A;  3ABT A;  2ODM A;  3WU2 Z;  4QNH B;  5IJ0 B;  3L9D A;  3JAT A;  3ZMS A;  5IYD O;  2EBO A;  1XOU A;  4AHC A;  2WPD G;  4L8J A;  4LH7 A;  2RJZ A;  3B4S A;  5EYP A;  2HVK C;  4EFB A;  4HZ3 A;  5IYZ A;  1CP9 A;  3HPL C;  3OW2 U;  4LF8 O;  4I5S A;  2QWP B;  1S76 D;  1MSD A;  4FK5 C;  4D7T A;  3JAL A;  4PI0 A;  4RQE A;  1YTF D;  5LGT A;  4UB8 Z;  5LXT A;  2JIZ G;  4LCU C;  2EIL B;  3CJH B;  4LNU A;  3OR6 C;  5LMN B;  2ZNJ A;  2CTP A;  1YXB A;  2W0X A;  4P30 A;  1EN5 A;  4FLZ A;  2QGN A;  2CTR A;  1N33 O;  3ZMV A;  2ZE8 A;  4CBC A;  2DYR C;  1XEQ A;  2PYJ A;  1R6T A;  3LDD A;  4DV1 O;  1P4R A;  4DR3 B;  1BMF G;  5JWP A;  5EBW C;  3CCL V;  2JVD A;  2H8P C;  4PI2 A;  4HBN A;  3CC2 V;  4LWS B;  4X1Y B;  1KD1 W;  4O2B A;  5EIB C;  2Y69 C;  4I55 A;  3JAR A;  1NVP B;  1HNX O;  4Q6G A;  1SA0 B;  3A0B Z;  1TGO A;  4F6E A;  4UCS A;  2ARH A;  1DLB A;  1XNR O;  5F2V O;  4LFC B;  1FXK A;  2XOK G;  1IBK O;  1H2M A;  2XAG A;  2YEV B;  3SPJ A;  3FFQ A;  2PI5 A;  2ZIO A;  2L35 A;  1N36 O;  1WLE A;  4EB6 B;  5DN6 G;  2ZXW B;  2QWQ B;  4J11 A;  1QLE C;  1GRJ A;  5JH7 B;  2VRZ A;  4UVC A;  4GX0 A;  2XTA A;  3K06 A;  5EIB D;  4CH3 A;  2Q73 A;  4LF7 O;  3IC7 A;  2ADP A;  3L71 H;  5BZB A;  3SPC A;  3IAY A;  2ZR2 A;  1NJI W;  4LF6 B;  1N32 O;  1K33 A;  3L75 H;  2IM9 A;  4I4T A;  4XDJ A;  2P22 C;  3ZRW A;  3QNE A;  4YJ2 B;  4JI5 B;  2DQ0 A;  4J41 A;  4JI6 B;  3UT5 A;  4X66 O;  3TCU A;  3F5W C;  3O9O A;  2BOB C;  1DK1 A;  5LGU A;  1JOY A;  1W0K G;  4NXN B;  4K0K O;  3RVZ A;  1RM1 C;  5H5N A;  4QIW F;  2PI4 A;  4QPJ A;  2N04 A;  2P4V A;  2UUA O;  4MTF A;  3CYO A;  4WFF A;  5C8Y B;  1SQF A;  3CCJ V;  4OXS A;  5LA6 B;  3RYI A;  1FPO A;  4NB5 A;  3W7U A;  3ABL C;  3HR0 A;  3VOU A;  1R3K C;  1K3E A;  3D36 C;  3E86 A;  5B1A C;  4LF4 O;  5J2U B;  1R1B A;  4HAM A;  2GDS A;  4QE9 A;  4B7E A;  1GN6 A;  3WG7 B;  1F7Y A;  4FPP A;  3C3S A;  5ITZ B;  1UJW B;  5EK0 A;  5LMU B;  1R3L C;  1VQO V;  4AQY O;  3JD1 A;  3SJB C;  2H94 A;  2Q7E A;  1HWY A;  4RQF A;  2WLM A;  5KA5 A;  1NKD A;  1DTO A;  4JYA B;  3T1C A;  4GKJ B;  3LNM B;  5LP6 B;  1NR7 A;  1Y76 A;  5FPR A;  1NT2 B;  1K7D A;  2AZ2 A;  4IYI A;  3MD0 A;  4DXW A;  1BQZ A;  5J2T B;  4X64 O;  1SQQ H;  1QNM A;  4PA4 A;  2DW4 A; 
#chains in the Genus database with same CATH homology
 1WP8 A;  4FZ1 A;  2QTS A;  4FZ0 A;  4NTW A;  3IJ4 A;  3S3X A;  4NTY A;  4NYK A;  3N27 A;  2L35 A;  1WP7 A;  4NTX A;  3S3W A;  2FB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...