3N27A

Molecular basis of the inhibition of henipa viruses
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
78
structure length
73
Chain Sequence
KNADNINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDYGIDISIELNKAKSDLEESKEWIRRSNQKLDSIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of the Inhibition of Henipa Viruses
rcsb
source organism Nipah virus
molecule tags Viral protein
molecule keywords Fusion glycoprotein F0, linker, Fusion glycoprotein F0
total genus 34
structure length 73
sequence length 78
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3n27A00
2L35A 4FZ1A 4NTYA 2FB5A 4NTXA 4NYKA 3S3WA 3N27A 4FZ0A 4NTWA 3S3XA 3IJ4A 2QTSA 1WP8A 1WP7A
chains in the Genus database with same CATH superfamily
1BSMA 5BXZA 5LP6B 1Y4MA 1K73W 4LP8A 5KAFZ 3RYFA 3HPLC 1N34O 2AGAA 2X6BA 5IY5C 1S76D 4LF7B 3RT3C 4UB6Z 1BHBA 1MOFA 4FM0A 1SRYA 5FNVB 4ZKIA 3LDEA 1PD3A 2ZE6A 5HFLA 1YZBA 2BSKB 2Q8VA 3A0RA 4DR1O 3FD9A 3FFQA 1LUVA 4QJFB 4A5UB 1IBMB 1NI8A 4RUEA 5J2UA 4J7KA 1F23A 1XMOO 5CB4B 2CTQA 4ZBMA 1AR4A 3ASNC 4I9QA 3ZMTA 4O2AB 5DN6G 3IC7A 4PA4A 4FFBA 2KG7B 2IH3C 3QO8A 5EBMC 2BTQA 4YXWG 4I55B 1M93A 4OX9B 1NU1H 3K59A 4TSFG 5LHGA 3K0GA 1L1FA 1Y67A 2P7TC 3QO5A 1YIJV 1L0LH 1RPOA 2BOCC 2L35A 1M1KW 3ZJZA 2XHBA 5IYCO 3IFXA 3JD1A 1IURA 3PN1A 1JQ0A 1OCRB 4O2AA 2WLLA 3C3SA 3K5NA 1K34A 3CXCU 1Z5WA 4TOIA 1QVFU 1PM9A 2Q5ZA 1B3QA 2YXYA 2B1GA 4I0XA 1JR9A 4CH5A 4X62B 4GUNA 4DW0A 1VP7A 2F43G 3P3PA 2QM8A 2E3CA 4RO2A 1YTFB 5KA5A 2EIMB 4JAAA 1XNQO 5LMUO 1D2DA 1VQMV 2Z0AA 3BHPA 3BA8A 3JATB 2XTAA 2QM4A 2OWOA 4LF9O 2KB1A 3CS5A 4K35A 1AP5A 1QVGU 2PF4E 4DV1B 4O4LA 4JAUA 1VF5B 4UVAA 4LF6O 5KMGA 1NQTA 3VQWA 4E2LA 4WFHA 4AQYB 1IVSA 1HNXB 1N0NA 1VQ4V 5B3SB 3E8HA 5IE9A 2DYSC 2CGOA 2UUBO 2DQ3A 2XAQA 3ZRXA 1HR0O 4LNUB 4MTFA 4PDRA 4DV0B 2Y0PA 4PI0A 2AW9A 2CGNA 5EC2C 2QWNB 1BZKA 4DV7O 5EZYB 1FD9A 3K5MA 3AG1B 2E75B 3JAWA 1J5EB 3NR7A 1PV0A 2QGNA 3SYAA 1R1BA 1HR0B 5JH7A 4HNAA 4CBCA 3T1HB 1KBHA 1FYJA 3OE7G 1PNKA 4H37A 1ENVA 2OT5A 2UXCO 4PHZA 2F4VB 4UV8A 1GTOA 2YEVB 2CAZC 5CBHA 3CMEV 2JEUA 4MVQA 3U0ZA 1XHZA 3CCEV 1M9NA 3SPGA 5IJ0B 1EZJA 1PNMA 5C8YB 1YI2V 3CCLV 2ILMA 1BMFG 2B9ZA 3IJ4A 2F23A 3UT5A 4R8CA 3K58A 3EHBB 3CJHA 5FL7G 2L6LA 4U3JA 2EJRA 3OD4A 4BW9A 2N74A 3R66A 4JZ2A 3ASOC 4DO2A 4ZI7B 1JFFA 3P3NA 4TQFA 1VF7A 1L8DA 2Q7GA 3K5OA 2UU9B 2EJ7A 1K5SA 1RPRA 3FB5C 2VRZA 2X7RB 5GW7A 1I94O 4L87A 3TXSA 4D6TH 2A06H 3ASNB 3AK3A 2EIKB 3SPCA 4LCUC 1X59A 2DW4A 2BTQB 3CRAA 2AXTZ 1WP7A 3OEEG 4FPPA 5D5PA 1ZTEA 2AHZA 2HG5C 3GVMA 2W6IG 2HVJC 2UU9O 5IWAO 3OT7A 1E1QG 4ZOLA 1MSWD 2YDEA 4C7UA 4EKWA 1GN6A 2QWRB 3B77A 2QM7A 4RQEA 1N0JA 2Q7EA 4JI7B 1MABG 4QIWF 1H2SB 3S3WA 5F2VO 1XNRB 4MW3A 2HJDA 5KHHA 3AG2B 1R3KC 4OPHA 4X64B 4NTXA 5CA1B 3CB2A 4DV3B 1NVPD 2JGDB 3TXQA 4FIPC 2CK3G 1XUQA 1XNQB 4PD4F 4UCOA 1OZ0A 3BCCH 4DV4B 3IC9A 1TA8A 2K9PA 4PDLA 3DTUB 4X1YB 1DF4A 2IJHA 2JK5C 4DR4B 2PZSA 4DXWA 2WAMA 3ZMUA 4NTWA 1K9MW 3C3TA 4JYAB 4WBNA 3ZRVA 3LNNA 4KHPB 3UO3A 3R65A 4DR6B 3T4ZA 1JOYA 5E1AC 3K0DA 2P6JA 5EYPB 4B3MB 3OFNG 2ARHA 5C8YA 1B6QA 4PA6A 3CEIA 4X66B 3BA9A 4JTDB 1I7FA 3F7YC 3WG7C 1KMIZ 4O4LB 1NS1A 4X1YA 4DV7B 2YXLA 5JQGA 4I4TB 3AK1A 2H8PC 2IU3A 4JI0B 1AILA 3RVZA 3E22A 1HW7A 3JSLA 3W7TA 4JGSA 2P06A 4MVSA 3UQ8A 5L3FA 4TUYA 4YJ2A 4DR2O 1G4YB 1K92A 1O9GA 2CUGA 4AHCA 4G28B 4YIOA 4LF8O 5B1AB 3WG7B 1OJHA 3QTCA 2GDSA 2ADPA 3E86A 3J80N 4CS3A 3SPIA 1JX9A 4GKJB 1YTFD 1NKDA 2WA4A 4Q6GA 2PUSA 1GH6A 3SR2C 5LOVB 3AG3C 3BVOA 4DV5O 4TV8B 2NN4A 3K9SA 2DJVA 4UCRA 2EIKC 4B3RO 3JD3A 4JI8B 4UFZA 1XL4A 4PJ0Z 1RM1B 3VOUA 1XILA 2ETNA 4U3FH 3SYQA 2XUMA 1SERA 1URFA 1BQ0A 4JYBA 1FXKC 2KQXA 3OTOO 1CP9A 5H2FZ 2QWPB 4FLUA 1G1XB 2ZIOA 1TVKB 2HP8A 2QJ1A 3H1LH 1QQCA 3CCRV 4TWKA 4DR1B 2JIZG 3RBZA 1XREA 1IBLO 4PELA 4KHPO 2ZIMA 1H2NA 1XOUA 1H2MA 3Q4HA 1XDCA 2EIJC 4G2KA 2QE7G 3M7MX 1VF6A 1RFYA 2DQ0A 3U11A 2ZDIC 5IYBO 3G6BA 4FVMA 5JVDA 2VS0A 5BMVB 4XBFA 1FXVA 3HKCA 5JJNB 4B7KA 1FPOA 3OMIB 4EFEA 4J41A 2WA3A 1BQZA 3ZX6A 2UXNA 3ZMZA 3UO2A 3OR7C 4MW8A 4BIOA 5LHHA 4JI7O 3D36A 3I55V 2RN9A 4NKGB 2EBOA 1I0HA 1XNRO 1KD1W 2X6CA 5B1OA 4B3TB 3W7XA 3DSQA 3RYCB 1MZEA 4JF3A 3JCUZ 4YJ2B 3E35A 1JVMA 2ZD9A 4LFAB 4BIUA 1YJ9V 1Q43A 2P67A 4PV1B 5LA6A 5CMUA 1N8RW 4I5SA 2CH7A 1HWYA 4FZ1A 3CWBH 3H1HH 1QLEC 1BGYH 2FMLA 3N2KB 4LWSB 2X6AA 2OCCB 3D3QA 2JJ1G 3LSSA 1N34B 2PGGA 2AHYA 2IW5A 3BPZA 3KZIZ 3VQVA 4MTGA 5ITZA 4WBNB 4J10A 4FZ0A 1NZ6A 3GWKC 4GKKO 4NXNO 1GK9A 1WA8A 2ODMA 2VQFB 4FJCC 5AG2A 5LXTB 4OGQB 4UB8Z 2P5OA 1F4NA 4FLVA 3OMAB 5LL6Y 2R9RB 2IH1C 4HAMA 2YIDA 2QWQB 1OCOC 4H13B 1QR8A 2G38A 4TV9A 3T4DA 1DLBA 1F51A 3L9DA 3CCJV 4K8ZA 1HP8A 2ITDC 3DC6A 5KUKA 2Q0AA 2EILB 1S5HC 1US6A 3QVNA 4UVCA 3CC2V 3RGBA 1WAZA 3OTFA 4I4TA 4KL1A 2ZM6O 1AI6A 3SYOA 3L71H 2WLIB 5LGUA 5LXTA 1I5YA 2RMKB 4RWUA 5EK0A 2HJFC 1BE3H 4LF5O 1W0JG 4UVBA 1KP2A 2W0FC 4HNAB 4WFEA 2DMXA 3A2FA 4NVPA 5LGNA 2ZM6B 1I94B 4RQFA 3J81N 4DV2B 2Q67A 4P9OA 4WFAV 5CBFA 3RN4A 2PTMA 2GBOA 3H1KH 1H8HG 3J7AU 4JAVA 1EN6A 1IXMA 3OUSA 1IXBA 1Y76B 3OM3B 1JCHA 2GTSA 3KCXA 3OMNB 4JPRA 3A0HZ 3JAMN 1AP6A 4UCVA 1OCZC 1Q6HA 3T2MA 2Y4TA 3SJQC 2WLHA 1T5EA 2LGQA 5BR8B 3FX7A 2XT9A 4PA3A 3LSUA 2VQFO 4AI8A 1L0NH 3A8TA 4NXNB 3QF7A 2OCCC 3NXSA 2M6YA 1WN7A 5LYJB 4FM1A 2YIAA 1VQ8V 1XI1A 3M8AA 5IYZA 1K5QA 1QLEB 1BL8A 5CA3A 4DV2O 2UXDO 1B06A 2OYQA 5BMVA 2EINB 3JD2A 3VQXA 2QKCA 4O4JA 4GZRB 3JD0A 3JASB 1N33O 2P22C 3QNEA 3T1YB 4YHHO 1HNZB 4TT3G 1VARA 4O2BB 5H5NA 2LJ2A 3VBBA 4I7ZB 4UCUA 4PI2A 4PDMA 1KKCA 4UCTA 2W0XA 3HKDB 1K4DC 1FXKA 2F1MA 5IJ9A 1AJNA 3SJAC 1YJNV 1CEZA 4K0KO 1R6NA 3T1YO 3X2QB 5J2TB 4MTXA 3BY6A 4JV5B 1LNQA 3GWOA 1EM1A 1NTKH 1M56C 5LMNO 4FLWA 4CH6A 1S77D 4KP4A 1YF2A 1YDXA 1OCCB 4LH7A 2FTKA 1M4UA 4CC5A 3H9VA 4LR3A 4DV6O 1HNWB 3ZHTA 4JV5O 1GAXA 4BIZA 4BAYA 2A79B 2F95B 5IWAB 3WB0A 2PYLA 1AROP 3ICXA 1I08A 3LSQA 1RM1C 3ABKB 2WLJA 1MMMA 4NXMB 2HHHO 1WB7A 5H6QA 3BRCA 1AR1B 1KKDA 2Q73A 2YIBA 2P90A 3EXAA 2Y4UA 5BZBA 4B3RB 1PNLA 4KXRA 3JD4A 3WFVA 1WPXA 5J2UB 4H33A 5KHKA 5IYZB 2QR4A 2RJZA 4J80A 4RAIA 2Q9LA 2WLIA 1JA8A 5K1PA 5IT9N 2CTPA 2CE4A 2QSAA 1N32O 3TGUH 3K08A 3HKBA 4E4EA 1Y6XA 1RSOB 3K79A 4F6RA 2YSUB 3A0BZ 4BR6A 4YHHB 1HNZO 1V55C 2JGUA 3ZN0A 1SQFA 1V54B 1V54C 1OCCC 3FKSG 4CS4A 2LW1A 2Q4PA 4N23A 4I0XB 4U3JB 3ZBHA 3LUTB 1V55B 3CCMV 3BABA 1M56B 4X1KA 4JI5O 4DRXB 1VQ5V 3O65A 4B3MO 1Z5VA 4K0KB 3I5DA 3SPJA 3ZRWA 4X64O 3W7WA 2JS3A 3L75H 1MG1A 3KG2A 4B08A 4IT5A 1FJGB 4GYCB 1FAFA 1IBLB 4O4HB 3CRMA 2ZNJA 1QBZA 1WLEA 5JVDB 3ZCCA 1Q81W 4GT1A 5A9GA 2N04A 4IIJA 4UV9A 3WU2Z 5JJEB 3OR6C 3ZHVA 2P4VA 1SETA 2ZDIA 2WLKA 4QE7A 1WB8A 1Y74A 2P4KA 2QTSA 1H38A 5JCOA 3RYHA 3K5LA 1NVPB 4JI2O 5LYJA 1GN2A 3B8NA 3DXRA 3G6EV 1EN5A 5EZYA 3E83A 1THZA 1ZLZA 2EINC 3RYCA 3JAKB 4JYYA 2IJKA 3B2EE 1NH2B 4KUMA 2BCCH 4JI3O 2IJJA 1ZX3A 4QGPA 1QR9A 4NR1A 5KHJA 5B1BC 1SQGA 2W6JG 4ZHQB 1S3JA 5EBWC 5B5EZ 4IYIA 1X4TA 3HKEB 3AEIA 2HR3A 1A32A 3BFRA 4EB6A 2N05A 2NLJC 1GRJA 4ASUG 4DUYO 1QHTA 1WP8A 4UUJC 2FL4A 1R6KA 3MHHC 1FXHA 3ZS8C 3JSNA 3DXRB 3OEHG 3CXHF 1LUWA 2UUAO 5FNVA 1OV9A 1YJWV 3GB7C 4TQDA 2DN9A 1VQ7V 3W7UA 1XMQB 4JYCA 1QLNA 4ZHQA 1Q8IA 1MZFA 1YVWA 2UXCB 2F4VO 1S72V 3E22B 4JTCB 5E79Z 4PDVA 3ZHQA 4EB6B 1YITV 4DK0A 4J9YB 3UCSC 2DYRB 4JTAB 1PP9H 2ZT9B 3HKDA 1TUBB 2A0LA 3T1HO 4OX9O 4IL6Z 4L8JA 1FFXB 2FKXA 1IBKO 1SA0A 2LO1A 2OTLV 5B3SC 2EZPA 4B3TO 4U7OA 5DEDA 1Q3EA 4LBEC 5GONB 5IDJA 4DR7O 3MDSA 2A3QA 2E74B 2GHYA 2B1IA 3ABMB 5LOVA 2GUZB 5JCOC 1TVKA 1N4CA 3SYCA 4X9QA 4FM2A 3JARB 2WSSG 4DYLA 5LGTA 1R3JC 5BY1A 1H8EG 4W4KA 1XQ8A 2YXHA 1QNMA 4DV1O 1OHHG 3ABUA 2EX3A 2RCVA 3W7SA 3SDLA 3WB1A 2ZNIA 3VQYA 1PPJH 1P7GA 1JFFB 1SC5B 1WNSA 3QO7A 4W4LA 2E5LB 2PYJA 2WLLB 3D3IA 4WFBV 1Y76A 4DV6B 2GV9A 3HKBB 1HNWO 1BS3A 5GTIZ 2LQTA 1R3IC 2OTJV 1ORQC 2WLMA 2DE0X 5EIBD 5LMUB 3CRQA 1PKXA 4LF8B 3E8GA 3D36C 4AILC 2UUAB 1GO3F 3B40A 4WF9V 1SF9A 3OUFA 1VQ6V 3CC4V 4DRXA 5CB4A 4D7SA 3G71V 2YI8A 2QA4V 1G8MA 4EEQA 1VQOV 3JATA 2DWEC 3BEHA 4R50A 1SZXA 3G80A 4IIJB 5EIBC 3L74H 3TETA 3ZMVA 1D5NA 4OXSA 1SQVH 1RP3B 2KG7A 3AK2A 4IHJA 4JI4B 3U10A 1V9PA 1U97A 4QPKA 1Q6IA 2FYUH 3JASA 2ATKC 1N32B 1AI5A 1ZL8B 1ZSPA 2HEPA 5KHIA 2D2CB 1P49A 2QDOA 1IZ3A 2O57A 3FYIB 1J95A 3ABMC 3APQA 3LNMB 4X20A 4YY3B 1QCEA 1UFIA 2CTRA 4PA9A 1EN4A 3B09A 3E8BA 1IBMO 4LFCB 4UCSA 4I50B 3CD6V 4GCZA 2XNDG 2Q68A 4B3SB 3ML0A 4YJ3B 2EIJB 4I55A 2GTAA 3N2KA 2V4DA 3N27A 1COWG 3RVYA 1MNGA 1S0VA 3TK1A 2KSDA 1VQKV 1FFTB 4LFCO 2R9IA 1AB3A 2VQEO 4OPAA 1N33B 1N36O 1AI4A 3F5TA 1AVMA 1FXKB 2Y0IA 1YHQV 2UXBB 3TCUA 1F7YA 4JI0O 3LDCA 1QU7A 2AZ2A 1NR1A 4P9PA 2JGDA 4HBNA 1SS3A 3G4SV 1Q82W 4TV9B 2MK3A 4MSWC 4LF7O 4X1IA 1P84F 3FAVB 4J42A 2QTOA 1NTMH 3FB8C 1GM9A 1K3EA 2E76B 2VWJA 2UXXA 1R3LC 5B1AC 2RQ6A 4R7CA 4GX2A 5B1BB 5KX5B 1UJWB 5GONA 5H6RA 1BCCH 5IY5B 1O9HA 3FYEB 3BAAA 2PI4A 4GX0A 1Z2GA 5KMGB 5EBLC 2OIEA 5LP6C 3WB2A 4FFKA 4Q20A 5K1XA 5JQGB 3F7VC 1ZL8A 4ICGA 5KA6A 4LNUA 2HKOA 1TGOA 4DUZB 1AI7A 4YIPA 3ZRWB 4PA7A 3P32A 1K8AW 1RSOA 5CBGA 2LP7A 3ABLC 1K33A 2HFEC 3APOA 4X65B 3MAQA 4O4JB 1SQBH 2LFSA 5B1NA 5IJ0A 2DWDC 3SJCC 3CMAV 2R70A 4X1KB 2ITCC 1H2KA 5B66Z 1AJQA 1IBKB 4FLZA 5C93A 4U7NA 5HFMA 3UM7A 4J9ZB 2EULA 4N21A 1H2LA 4X88A 2IBZH 4O2BA 5DM6V 1MA1A 2F93B 2MW2B 2CDYA 3B4SA 1J5EO 1FFXA 1JJOA 4WFGA 1WA8B 3HB3B 4JZGA 4DR4O 3ZHUA 3STLC 1EZVH 5LA6B 1YXBA 4X1IB 1I5XA 3ZRSA 3H1IH 4YY3O 1PL4A 1Q90D 2Z3YA 3ZHSA 1NBMG 1GKFA 4G27B 1M57B 2UUCO 5LHIA 1M5IA 2ZE7A 5FLXN 3HKEA 4X20B 3ETGA 3TJTA 2Q7HA 1XEQA 4I50A 5LBQA 2ZCEA 1FKAO 3SPHA 3OW2U 4MT8A 2ZXWC 1WJZA 3P30A 3JYCA 4MVZA 1VF6C 3ASOB 1Q7YW 2ZKOA 3S3XA 3I56V 1GN4A 1P7BA 1BT8A 4H44B 1W0KG 4ABMA 4B7EA 3ABTA 4YJ3A 1MSDA 2XAGA 4JI6B 4P30A 3AG2C 4J7ZA 3EFFK 1BHAA 1P4RA 3OAAG 4DR3B 3OTOB 1SQPH 1M90W 4FLXA 3X2QC 3CYOA 2JS5A 4NYKA 3F5WC 1NH2D 4P2ZA 3RYIA 3CP1A 5JJJB 5KHGA 3CC7V 2IM9A 1K97A 3ZIAG 2E5LO 1ZWIC 2QKAA 1NTZH 3FAVA 1K7DA 4JI5B 1OCZB 4HYOA 3FB7C 4IGGA 2JRIA 2B5UA 3O9OA 5L3DA 4LWSA 4LFAO 1IDSA 1XL6A 1S5JA 5LP6A 3RFRA 1R6TA 3DC5A 1XBLA 2QKSA 2NNUA 5J9PC 4AQYO 1HNXO 2CTWA 1SZTA 4LFBB 2M7WA 2Q0OC 3ETQA 4GLXA 4Z1VA 5L3EA 2HLDG 3N2GB 4I9WA 1KQSU 4DW1A 5LMNB 1TAEA 1JPXA 4CH3A 2BSKA 5CA1A 3SGIA 4DK1A 1XMOB 4CS2A 1SKVA 2ZE5A 5JH7B 3CCSV 4K8XA 3ZHRA 3K57A 3CCVV 1KECA 2UXBO 4RUFA 4IYHA 4K3AA 1ZAUA 2DYSB 3AG4C 4ZIBA 4LF9B 4CH4A 1DGSA 3E2EA 4X8AA 2XOKG 1DTOA 2ZR2A 4NXMO 4BWAA 4TUYB 3ZMSA 1K4CC 4DV5B 4GX1A 3CE2A 1W2BU 4WCEV 2BTOA 2FB5A 4QPJA 1OCOB 2R72A 4X62O 2CH7B 3JALA 4HZ3A 3IAYA 2EIMC 1VMGA 4DR3O 1GM8A 2V1DA 5CN0A 4DUYB 1W59A 4MTOA 2K1EA 3AG1C 3RW0A 3THOA 2ADQB 3LDDA 2WWWA 4MVMA 2HHHB 2A7WA 2BOBC 2Z5UA 1Q6UA 1IX9A 3AG7A 4JASA 3JAKA 1SESA 1YEWA 2XAFA 3AG4B 5J2TA 3IGAC 3T1CA 1H2GA 5DECA 1Q5OA 3K03A 4F6EA 4MVUA 1AJPA 3G67A 2ZQMA 4DUZO 3K9AA 4JYAO 1NT2B 3CX5F 5IYDO 2DYRC 2LFRA 2JEXA 2EILC 4XDKA 4DR2B 4DR6O 4XDLA 1KC8W 4ZOLB 1ZUQA 3L72H 1CPYA 1TUEB 4X66O 4FLTA 4FK5C 3K04A 3OGCC 3N2GA 4X89A 4O4IA 4J11A 4QE9A 2X0LA 1B04A 5TISZ 4LFBO 1SA0B 5A2QN 1HDJA 4FLYA 1Q86W 1F4MA 2Q6AA 1KU9A 1FJGO 5EYPA 2Q69A 4KFMA 1S5LZ 2H3OA 1EFRG 4JI8O 3OGIB 5KUMA 4DV3O 4B3SO 2ZE8A 3CHXA 2H94A 3C90A 3D8CA 1DK1A 1VIBA 1TUBA 1R73A 3H01A 1FS0G 4WFFA 1OCRC 4LC1A 3CCUV 4CC6A 1WPBA 3RYHB 4Z2WA 3KKYA 1SQQH 3RYFB 3FB6C 5L3BA 1EBOA 2YI9A 1Y66A 5CA0B 4O4HA 5BR8O 2OCHA 3L70H 3RYIB 3K06A 4DR5O 2JJ2G 2RDCA 4CZZA 5JWPA 3SYPA 2AZ0A 2A9HA 4JI1B 5GTHZ 1VQ9V 4J7JA 1KB9F 2VQEB 1NJIW 2ZXWB 1E79G 1LR1A 2VWKA 4JI4O 4NTYA 1Y74B 2R9AA 2BE3A 4UXNA 3CRCA 2XAJA 4LF5B 1SQXH 1YSCA 4TV8A 4JI6O 2LGWA 3CPWU 4F4LA 5CA0A 2DOSA 2KKWA 3K3WA 2F66C 4LF4B 3SJBC 1GN3A 2Y69C 2OIGA 3E89A 3EVKA 3CJHB 4IHJB 5L3GA 1E1RG 1NR7A 4JI1O 1U96A 3DGEA 5FPOA 3CRRA 4ZI7A 2XASA 1VQNV 3HR0A 4DR7B 1XMQO 4LF4O 3RWRD 2WLNA 5FPRA 4LF6B 1KP3A 2UUCB 4JI3B 1KUQA 3E8FA 5KAIZ 3Q4HB 5IJ9B 5H9CA 1D5AA 1YCIA 4D7TA 1G6UA 3JALB 1AR5A 1KYOF 4JI2B 4DV4O 2XAHA 2QEXV 3MD0A 4LH6A 4DV0O 3B8MA 1GM7A 2LW7A 4NB5A 2C2AA 2V7QG 4MS2A 1DF5A 4H0LB 3PJSK 3JARA 2QWOB 3ABLB 1JMKC 3AG3B 1M57C 2ZINA 4MVRA 2YC0A 5L3CA 2YUAA 3ABKC 3STZC 2JDIG 1ROPA 1XHXA 1PL0A 2JVDA 2YICA 3KCYA 2YEVA 5KX5A 3ETDA 3JCZA 4GX5A 2D3OW 4FFBB 2NR5A 3MHSC 2EZOA 4EFBA 4BW5A 4GKKB 2RNBA 2UXDB 3CCQV 3CSXA 1JJ2U 2GUZA 4FMTA 3QG5A 2YIBD 3UT5B 3ZN1A 4X65O 1VQLV 4Z1MG 2ZR3A 5D5QA 1GMGA 5EC1C 2Y69B 4QNHB 1VEWA 4XDJA 3L73H 3H1JH 2PY5A 5ITZB 4MVOA 2UUBB 2PI5A 3HKCB 4O4IB 3UKMA 2IU0A 2Y48A 4R6ZA 4F6RB 4GKJO 1N36B 2YS8A 1CXZB 3JAWB 5KLVH 2WPDG 3M99B 1VQPV 2GSMB 2HVKC 3ZEDA 1UPGA 2IJIA 4DR5B 3ETEA
chains in the Genus database with same CATH topology
2L35A 4FZ1A 4NTYA 2FB5A 4NTXA 4NYKA 3S3WA 3N27A 4FZ0A 4NTWA 3S3XA 3IJ4A 2QTSA 1WP8A 1WP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L35 A;  4FZ1 A;  4NTY A;  2FB5 A;  4NTX A;  4NYK A;  3S3W A;  3N27 A;  4FZ0 A;  4NTW A;  3S3X A;  3IJ4 A;  2QTS A;  1WP8 A;  1WP7 A; 
#chains in the Genus database with same CATH topology
 1BSM A;  5BXZ A;  5LP6 B;  1Y4M A;  1K73 W;  4LP8 A;  5KAF Z;  3RYF A;  3HPL C;  1N34 O;  2AGA A;  2X6B A;  5IY5 C;  1S76 D;  4LF7 B;  3RT3 C;  4UB6 Z;  1BHB A;  1MOF A;  4FM0 A;  1SRY A;  5FNV B;  4ZKI A;  3LDE A;  1PD3 A;  2ZE6 A;  5HFL A;  1YZB A;  2BSK B;  2Q8V A;  3A0R A;  4DR1 O;  3FD9 A;  3FFQ A;  1LUV A;  4QJF B;  4A5U B;  1IBM B;  1NI8 A;  4RUE A;  5J2U A;  4J7K A;  1F23 A;  1XMO O;  5CB4 B;  2CTQ A;  4ZBM A;  1AR4 A;  3ASN C;  4I9Q A;  3ZMT A;  4O2A B;  5DN6 G;  3IC7 A;  4PA4 A;  4FFB A;  2KG7 B;  2IH3 C;  3QO8 A;  5EBM C;  2BTQ A;  4YXW G;  4I55 B;  1M93 A;  4OX9 B;  1NU1 H;  3K59 A;  4TSF G;  5LHG A;  3K0G A;  1L1F A;  1Y67 A;  2P7T C;  3QO5 A;  1YIJ V;  1L0L H;  1RPO A;  2BOC C;  2L35 A;  1M1K W;  3ZJZ A;  2XHB A;  5IYC O;  3IFX A;  3JD1 A;  1IUR A;  3PN1 A;  1JQ0 A;  1OCR B;  4O2A A;  2WLL A;  3C3S A;  3K5N A;  1K34 A;  3CXC U;  1Z5W A;  4TOI A;  1QVF U;  1PM9 A;  2Q5Z A;  1B3Q A;  2YXY A;  2B1G A;  4I0X A;  1JR9 A;  4CH5 A;  4X62 B;  4GUN A;  4DW0 A;  1VP7 A;  2F43 G;  3P3P A;  2QM8 A;  2E3C A;  4RO2 A;  1YTF B;  5KA5 A;  2EIM B;  4JAA A;  1XNQ O;  5LMU O;  1D2D A;  1VQM V;  2Z0A A;  3BHP A;  3BA8 A;  3JAT B;  2XTA A;  2QM4 A;  2OWO A;  4LF9 O;  2KB1 A;  3CS5 A;  4K35 A;  1AP5 A;  1QVG U;  2PF4 E;  4DV1 B;  4O4L A;  4JAU A;  1VF5 B;  4UVA A;  4LF6 O;  5KMG A;  1NQT A;  3VQW A;  4E2L A;  4WFH A;  4AQY B;  1IVS A;  1HNX B;  1N0N A;  1VQ4 V;  5B3S B;  3E8H A;  5IE9 A;  2DYS C;  2CGO A;  2UUB O;  2DQ3 A;  2XAQ A;  3ZRX A;  1HR0 O;  4LNU B;  4MTF A;  4PDR A;  4DV0 B;  2Y0P A;  4PI0 A;  2AW9 A;  2CGN A;  5EC2 C;  2QWN B;  1BZK A;  4DV7 O;  5EZY B;  1FD9 A;  3K5M A;  3AG1 B;  2E75 B;  3JAW A;  1J5E B;  3NR7 A;  1PV0 A;  2QGN A;  3SYA A;  1R1B A;  1HR0 B;  5JH7 A;  4HNA A;  4CBC A;  3T1H B;  1KBH A;  1FYJ A;  3OE7 G;  1PNK A;  4H37 A;  1ENV A;  2OT5 A;  2UXC O;  4PHZ A;  2F4V B;  4UV8 A;  1GTO A;  2YEV B;  2CAZ C;  5CBH A;  3CME V;  2JEU A;  4MVQ A;  3U0Z A;  1XHZ A;  3CCE V;  1M9N A;  3SPG A;  5IJ0 B;  1EZJ A;  1PNM A;  5C8Y B;  1YI2 V;  3CCL V;  2ILM A;  1BMF G;  2B9Z A;  3IJ4 A;  2F23 A;  3UT5 A;  4R8C A;  3K58 A;  3EHB B;  3CJH A;  5FL7 G;  2L6L A;  4U3J A;  2EJR A;  3OD4 A;  4BW9 A;  2N74 A;  3R66 A;  4JZ2 A;  3ASO C;  4DO2 A;  4ZI7 B;  1JFF A;  3P3N A;  4TQF A;  1VF7 A;  1L8D A;  2Q7G A;  3K5O A;  2UU9 B;  2EJ7 A;  1K5S A;  1RPR A;  3FB5 C;  2VRZ A;  2X7R B;  5GW7 A;  1I94 O;  4L87 A;  3TXS A;  4D6T H;  2A06 H;  3ASN B;  3AK3 A;  2EIK B;  3SPC A;  4LCU C;  1X59 A;  2DW4 A;  2BTQ B;  3CRA A;  2AXT Z;  1WP7 A;  3OEE G;  4FPP A;  5D5P A;  1ZTE A;  2AHZ A;  2HG5 C;  3GVM A;  2W6I G;  2HVJ C;  2UU9 O;  5IWA O;  3OT7 A;  1E1Q G;  4ZOL A;  1MSW D;  2YDE A;  4C7U A;  4EKW A;  1GN6 A;  2QWR B;  3B77 A;  2QM7 A;  4RQE A;  1N0J A;  2Q7E A;  4JI7 B;  1MAB G;  4QIW F;  1H2S B;  3S3W A;  5F2V O;  1XNR B;  4MW3 A;  2HJD A;  5KHH A;  3AG2 B;  1R3K C;  4OPH A;  4X64 B;  4NTX A;  5CA1 B;  3CB2 A;  4DV3 B;  1NVP D;  2JGD B;  3TXQ A;  4FIP C;  2CK3 G;  1XUQ A;  1XNQ B;  4PD4 F;  4UCO A;  1OZ0 A;  3BCC H;  4DV4 B;  3IC9 A;  1TA8 A;  2K9P A;  4PDL A;  3DTU B;  4X1Y B;  1DF4 A;  2IJH A;  2JK5 C;  4DR4 B;  2PZS A;  4DXW A;  2WAM A;  3ZMU A;  4NTW A;  1K9M W;  3C3T A;  4JYA B;  4WBN A;  3ZRV A;  3LNN A;  4KHP B;  3UO3 A;  3R65 A;  4DR6 B;  3T4Z A;  1JOY A;  5E1A C;  3K0D A;  2P6J A;  5EYP B;  4B3M B;  3OFN G;  2ARH A;  5C8Y A;  1B6Q A;  4PA6 A;  3CEI A;  4X66 B;  3BA9 A;  4JTD B;  1I7F A;  3F7Y C;  3WG7 C;  1KMI Z;  4O4L B;  1NS1 A;  4X1Y A;  4DV7 B;  2YXL A;  5JQG A;  4I4T B;  3AK1 A;  2H8P C;  2IU3 A;  4JI0 B;  1AIL A;  3RVZ A;  3E22 A;  1HW7 A;  3JSL A;  3W7T A;  4JGS A;  2P06 A;  4MVS A;  3UQ8 A;  5L3F A;  4TUY A;  4YJ2 A;  4DR2 O;  1G4Y B;  1K92 A;  1O9G A;  2CUG A;  4AHC A;  4G28 B;  4YIO A;  4LF8 O;  5B1A B;  3WG7 B;  1OJH A;  3QTC A;  2GDS A;  2ADP A;  3E86 A;  3J80 N;  4CS3 A;  3SPI A;  1JX9 A;  4GKJ B;  1YTF D;  1NKD A;  2WA4 A;  4Q6G A;  2PUS A;  1GH6 A;  3SR2 C;  5LOV B;  3AG3 C;  3BVO A;  4DV5 O;  4TV8 B;  2NN4 A;  3K9S A;  2DJV A;  4UCR A;  2EIK C;  4B3R O;  3JD3 A;  4JI8 B;  4UFZ A;  1XL4 A;  4PJ0 Z;  1RM1 B;  3VOU A;  1XIL A;  2ETN A;  4U3F H;  3SYQ A;  2XUM A;  1SER A;  1URF A;  1BQ0 A;  4JYB A;  1FXK C;  2KQX A;  3OTO O;  1CP9 A;  5H2F Z;  2QWP B;  4FLU A;  1G1X B;  2ZIO A;  1TVK B;  2HP8 A;  2QJ1 A;  3H1L H;  1QQC A;  3CCR V;  4TWK A;  4DR1 B;  2JIZ G;  3RBZ A;  1XRE A;  1IBL O;  4PEL A;  4KHP O;  2ZIM A;  1H2N A;  1XOU A;  1H2M A;  3Q4H A;  1XDC A;  2EIJ C;  4G2K A;  2QE7 G;  3M7M X;  1VF6 A;  1RFY A;  2DQ0 A;  3U11 A;  2ZDI C;  5IYB O;  3G6B A;  4FVM A;  5JVD A;  2VS0 A;  5BMV B;  4XBF A;  1FXV A;  3HKC A;  5JJN B;  4B7K A;  1FPO A;  3OMI B;  4EFE A;  4J41 A;  2WA3 A;  1BQZ A;  3ZX6 A;  2UXN A;  3ZMZ A;  3UO2 A;  3OR7 C;  4MW8 A;  4BIO A;  5LHH A;  4JI7 O;  3D36 A;  3I55 V;  2RN9 A;  4NKG B;  2EBO A;  1I0H A;  1XNR O;  1KD1 W;  2X6C A;  5B1O A;  4B3T B;  3W7X A;  3DSQ A;  3RYC B;  1MZE A;  4JF3 A;  3JCU Z;  4YJ2 B;  3E35 A;  1JVM A;  2ZD9 A;  4LFA B;  4BIU A;  1YJ9 V;  1Q43 A;  2P67 A;  4PV1 B;  5LA6 A;  5CMU A;  1N8R W;  4I5S A;  2CH7 A;  1HWY A;  4FZ1 A;  3CWB H;  3H1H H;  1QLE C;  1BGY H;  2FML A;  3N2K B;  4LWS B;  2X6A A;  2OCC B;  3D3Q A;  2JJ1 G;  3LSS A;  1N34 B;  2PGG A;  2AHY A;  2IW5 A;  3BPZ A;  3KZI Z;  3VQV A;  4MTG A;  5ITZ A;  4WBN B;  4J10 A;  4FZ0 A;  1NZ6 A;  3GWK C;  4GKK O;  4NXN O;  1GK9 A;  1WA8 A;  2ODM A;  2VQF B;  4FJC C;  5AG2 A;  5LXT B;  4OGQ B;  4UB8 Z;  2P5O A;  1F4N A;  4FLV A;  3OMA B;  5LL6 Y;  2R9R B;  2IH1 C;  4HAM A;  2YID A;  2QWQ B;  1OCO C;  4H13 B;  1QR8 A;  2G38 A;  4TV9 A;  3T4D A;  1DLB A;  1F51 A;  3L9D A;  3CCJ V;  4K8Z A;  1HP8 A;  2ITD C;  3DC6 A;  5KUK A;  2Q0A A;  2EIL B;  1S5H C;  1US6 A;  3QVN A;  4UVC A;  3CC2 V;  3RGB A;  1WAZ A;  3OTF A;  4I4T A;  4KL1 A;  2ZM6 O;  1AI6 A;  3SYO A;  3L71 H;  2WLI B;  5LGU A;  5LXT A;  1I5Y A;  2RMK B;  4RWU A;  5EK0 A;  2HJF C;  1BE3 H;  4LF5 O;  1W0J G;  4UVB A;  1KP2 A;  2W0F C;  4HNA B;  4WFE A;  2DMX A;  3A2F A;  4NVP A;  5LGN A;  2ZM6 B;  1I94 B;  4RQF A;  3J81 N;  4DV2 B;  2Q67 A;  4P9O A;  4WFA V;  5CBF A;  3RN4 A;  2PTM A;  2GBO A;  3H1K H;  1H8H G;  3J7A U;  4JAV A;  1EN6 A;  1IXM A;  3OUS A;  1IXB A;  1Y76 B;  3OM3 B;  1JCH A;  2GTS A;  3KCX A;  3OMN B;  4JPR A;  3A0H Z;  3JAM N;  1AP6 A;  4UCV A;  1OCZ C;  1Q6H A;  3T2M A;  2Y4T A;  3SJQ C;  2WLH A;  1T5E A;  2LGQ A;  5BR8 B;  3FX7 A;  2XT9 A;  4PA3 A;  3LSU A;  2VQF O;  4AI8 A;  1L0N H;  3A8T A;  4NXN B;  3QF7 A;  2OCC C;  3NXS A;  2M6Y A;  1WN7 A;  5LYJ B;  4FM1 A;  2YIA A;  1VQ8 V;  1XI1 A;  3M8A A;  5IYZ A;  1K5Q A;  1QLE B;  1BL8 A;  5CA3 A;  4DV2 O;  2UXD O;  1B06 A;  2OYQ A;  5BMV A;  2EIN B;  3JD2 A;  3VQX A;  2QKC A;  4O4J A;  4GZR B;  3JD0 A;  3JAS B;  1N33 O;  2P22 C;  3QNE A;  3T1Y B;  4YHH O;  1HNZ B;  4TT3 G;  1VAR A;  4O2B B;  5H5N A;  2LJ2 A;  3VBB A;  4I7Z B;  4UCU A;  4PI2 A;  4PDM A;  1KKC A;  4UCT A;  2W0X A;  3HKD B;  1K4D C;  1FXK A;  2F1M A;  5IJ9 A;  1AJN A;  3SJA C;  1YJN V;  1CEZ A;  4K0K O;  1R6N A;  3T1Y O;  3X2Q B;  5J2T B;  4MTX A;  3BY6 A;  4JV5 B;  1LNQ A;  3GWO A;  1EM1 A;  1NTK H;  1M56 C;  5LMN O;  4FLW A;  4CH6 A;  1S77 D;  4KP4 A;  1YF2 A;  1YDX A;  1OCC B;  4LH7 A;  2FTK A;  1M4U A;  4CC5 A;  3H9V A;  4LR3 A;  4DV6 O;  1HNW B;  3ZHT A;  4JV5 O;  1GAX A;  4BIZ A;  4BAY A;  2A79 B;  2F95 B;  5IWA B;  3WB0 A;  2PYL A;  1ARO P;  3ICX A;  1I08 A;  3LSQ A;  1RM1 C;  3ABK B;  2WLJ A;  1MMM A;  4NXM B;  2HHH O;  1WB7 A;  5H6Q A;  3BRC A;  1AR1 B;  1KKD A;  2Q73 A;  2YIB A;  2P90 A;  3EXA A;  2Y4U A;  5BZB A;  4B3R B;  1PNL A;  4KXR A;  3JD4 A;  3WFV A;  1WPX A;  5J2U B;  4H33 A;  5KHK A;  5IYZ B;  2QR4 A;  2RJZ A;  4J80 A;  4RAI A;  2Q9L A;  2WLI A;  1JA8 A;  5K1P A;  5IT9 N;  2CTP A;  2CE4 A;  2QSA A;  1N32 O;  3TGU H;  3K08 A;  3HKB A;  4E4E A;  1Y6X A;  1RSO B;  3K79 A;  4F6R A;  2YSU B;  3A0B Z;  4BR6 A;  4YHH B;  1HNZ O;  1V55 C;  2JGU A;  3ZN0 A;  1SQF A;  1V54 B;  1V54 C;  1OCC C;  3FKS G;  4CS4 A;  2LW1 A;  2Q4P A;  4N23 A;  4I0X B;  4U3J B;  3ZBH A;  3LUT B;  1V55 B;  3CCM V;  3BAB A;  1M56 B;  4X1K A;  4JI5 O;  4DRX B;  1VQ5 V;  3O65 A;  4B3M O;  1Z5V A;  4K0K B;  3I5D A;  3SPJ A;  3ZRW A;  4X64 O;  3W7W A;  2JS3 A;  3L75 H;  1MG1 A;  3KG2 A;  4B08 A;  4IT5 A;  1FJG B;  4GYC B;  1FAF A;  1IBL B;  4O4H B;  3CRM A;  2ZNJ A;  1QBZ A;  1WLE A;  5JVD B;  3ZCC A;  1Q81 W;  4GT1 A;  5A9G A;  2N04 A;  4IIJ A;  4UV9 A;  3WU2 Z;  5JJE B;  3OR6 C;  3ZHV A;  2P4V A;  1SET A;  2ZDI A;  2WLK A;  4QE7 A;  1WB8 A;  1Y74 A;  2P4K A;  2QTS A;  1H38 A;  5JCO A;  3RYH A;  3K5L A;  1NVP B;  4JI2 O;  5LYJ A;  1GN2 A;  3B8N A;  3DXR A;  3G6E V;  1EN5 A;  5EZY A;  3E83 A;  1THZ A;  1ZLZ A;  2EIN C;  3RYC A;  3JAK B;  4JYY A;  2IJK A;  3B2E E;  1NH2 B;  4KUM A;  2BCC H;  4JI3 O;  2IJJ A;  1ZX3 A;  4QGP A;  1QR9 A;  4NR1 A;  5KHJ A;  5B1B C;  1SQG A;  2W6J G;  4ZHQ B;  1S3J A;  5EBW C;  5B5E Z;  4IYI A;  1X4T A;  3HKE B;  3AEI A;  2HR3 A;  1A32 A;  3BFR A;  4EB6 A;  2N05 A;  2NLJ C;  1GRJ A;  4ASU G;  4DUY O;  1QHT A;  1WP8 A;  4UUJ C;  2FL4 A;  1R6K A;  3MHH C;  1FXH A;  3ZS8 C;  3JSN A;  3DXR B;  3OEH G;  3CXH F;  1LUW A;  2UUA O;  5FNV A;  1OV9 A;  1YJW V;  3GB7 C;  4TQD A;  2DN9 A;  1VQ7 V;  3W7U A;  1XMQ B;  4JYC A;  1QLN A;  4ZHQ A;  1Q8I A;  1MZF A;  1YVW A;  2UXC B;  2F4V O;  1S72 V;  3E22 B;  4JTC B;  5E79 Z;  4PDV A;  3ZHQ A;  4EB6 B;  1YIT V;  4DK0 A;  4J9Y B;  3UCS C;  2DYR B;  4JTA B;  1PP9 H;  2ZT9 B;  3HKD A;  1TUB B;  2A0L A;  3T1H O;  4OX9 O;  4IL6 Z;  4L8J A;  1FFX B;  2FKX A;  1IBK O;  1SA0 A;  2LO1 A;  2OTL V;  5B3S C;  2EZP A;  4B3T O;  4U7O A;  5DED A;  1Q3E A;  4LBE C;  5GON B;  5IDJ A;  4DR7 O;  3MDS A;  2A3Q A;  2E74 B;  2GHY A;  2B1I A;  3ABM B;  5LOV A;  2GUZ B;  5JCO C;  1TVK A;  1N4C A;  3SYC A;  4X9Q A;  4FM2 A;  3JAR B;  2WSS G;  4DYL A;  5LGT A;  1R3J C;  5BY1 A;  1H8E G;  4W4K A;  1XQ8 A;  2YXH A;  1QNM A;  4DV1 O;  1OHH G;  3ABU A;  2EX3 A;  2RCV A;  3W7S A;  3SDL A;  3WB1 A;  2ZNI A;  3VQY A;  1PPJ H;  1P7G A;  1JFF B;  1SC5 B;  1WNS A;  3QO7 A;  4W4L A;  2E5L B;  2PYJ A;  2WLL B;  3D3I A;  4WFB V;  1Y76 A;  4DV6 B;  2GV9 A;  3HKB B;  1HNW O;  1BS3 A;  5GTI Z;  2LQT A;  1R3I C;  2OTJ V;  1ORQ C;  2WLM A;  2DE0 X;  5EIB D;  5LMU B;  3CRQ A;  1PKX A;  4LF8 B;  3E8G A;  3D36 C;  4AIL C;  2UUA B;  1GO3 F;  3B40 A;  4WF9 V;  1SF9 A;  3OUF A;  1VQ6 V;  3CC4 V;  4DRX A;  5CB4 A;  4D7S A;  3G71 V;  2YI8 A;  2QA4 V;  1G8M A;  4EEQ A;  1VQO V;  3JAT A;  2DWE C;  3BEH A;  4R50 A;  1SZX A;  3G80 A;  4IIJ B;  5EIB C;  3L74 H;  3TET A;  3ZMV A;  1D5N A;  4OXS A;  1SQV H;  1RP3 B;  2KG7 A;  3AK2 A;  4IHJ A;  4JI4 B;  3U10 A;  1V9P A;  1U97 A;  4QPK A;  1Q6I A;  2FYU H;  3JAS A;  2ATK C;  1N32 B;  1AI5 A;  1ZL8 B;  1ZSP A;  2HEP A;  5KHI A;  2D2C B;  1P49 A;  2QDO A;  1IZ3 A;  2O57 A;  3FYI B;  1J95 A;  3ABM C;  3APQ A;  3LNM B;  4X20 A;  4YY3 B;  1QCE A;  1UFI A;  2CTR A;  4PA9 A;  1EN4 A;  3B09 A;  3E8B A;  1IBM O;  4LFC B;  4UCS A;  4I50 B;  3CD6 V;  4GCZ A;  2XND G;  2Q68 A;  4B3S B;  3ML0 A;  4YJ3 B;  2EIJ B;  4I55 A;  2GTA A;  3N2K A;  2V4D A;  3N27 A;  1COW G;  3RVY A;  1MNG A;  1S0V A;  3TK1 A;  2KSD A;  1VQK V;  1FFT B;  4LFC O;  2R9I A;  1AB3 A;  2VQE O;  4OPA A;  1N33 B;  1N36 O;  1AI4 A;  3F5T A;  1AVM A;  1FXK B;  2Y0I A;  1YHQ V;  2UXB B;  3TCU A;  1F7Y A;  4JI0 O;  3LDC A;  1QU7 A;  2AZ2 A;  1NR1 A;  4P9P A;  2JGD A;  4HBN A;  1SS3 A;  3G4S V;  1Q82 W;  4TV9 B;  2MK3 A;  4MSW C;  4LF7 O;  4X1I A;  1P84 F;  3FAV B;  4J42 A;  2QTO A;  1NTM H;  3FB8 C;  1GM9 A;  1K3E A;  2E76 B;  2VWJ A;  2UXX A;  1R3L C;  5B1A C;  2RQ6 A;  4R7C A;  4GX2 A;  5B1B B;  5KX5 B;  1UJW B;  5GON A;  5H6R A;  1BCC H;  5IY5 B;  1O9H A;  3FYE B;  3BAA A;  2PI4 A;  4GX0 A;  1Z2G A;  5KMG B;  5EBL C;  2OIE A;  5LP6 C;  3WB2 A;  4FFK A;  4Q20 A;  5K1X A;  5JQG B;  3F7V C;  1ZL8 A;  4ICG A;  5KA6 A;  4LNU A;  2HKO A;  1TGO A;  4DUZ B;  1AI7 A;  4YIP A;  3ZRW B;  4PA7 A;  3P32 A;  1K8A W;  1RSO A;  5CBG A;  2LP7 A;  3ABL C;  1K33 A;  2HFE C;  3APO A;  4X65 B;  3MAQ A;  4O4J B;  1SQB H;  2LFS A;  5B1N A;  5IJ0 A;  2DWD C;  3SJC C;  3CMA V;  2R70 A;  4X1K B;  2ITC C;  1H2K A;  5B66 Z;  1AJQ A;  1IBK B;  4FLZ A;  5C93 A;  4U7N A;  5HFM A;  3UM7 A;  4J9Z B;  2EUL A;  4N21 A;  1H2L A;  4X88 A;  2IBZ H;  4O2B A;  5DM6 V;  1MA1 A;  2F93 B;  2MW2 B;  2CDY A;  3B4S A;  1J5E O;  1FFX A;  1JJO A;  4WFG A;  1WA8 B;  3HB3 B;  4JZG A;  4DR4 O;  3ZHU A;  3STL C;  1EZV H;  5LA6 B;  1YXB A;  4X1I B;  1I5X A;  3ZRS A;  3H1I H;  4YY3 O;  1PL4 A;  1Q90 D;  2Z3Y A;  3ZHS A;  1NBM G;  1GKF A;  4G27 B;  1M57 B;  2UUC O;  5LHI A;  1M5I A;  2ZE7 A;  5FLX N;  3HKE A;  4X20 B;  3ETG A;  3TJT A;  2Q7H A;  1XEQ A;  4I50 A;  5LBQ A;  2ZCE A;  1FKA O;  3SPH A;  3OW2 U;  4MT8 A;  2ZXW C;  1WJZ A;  3P30 A;  3JYC A;  4MVZ A;  1VF6 C;  3ASO B;  1Q7Y W;  2ZKO A;  3S3X A;  3I56 V;  1GN4 A;  1P7B A;  1BT8 A;  4H44 B;  1W0K G;  4ABM A;  4B7E A;  3ABT A;  4YJ3 A;  1MSD A;  2XAG A;  4JI6 B;  4P30 A;  3AG2 C;  4J7Z A;  3EFF K;  1BHA A;  1P4R A;  3OAA G;  4DR3 B;  3OTO B;  1SQP H;  1M90 W;  4FLX A;  3X2Q C;  3CYO A;  2JS5 A;  4NYK A;  3F5W C;  1NH2 D;  4P2Z A;  3RYI A;  3CP1 A;  5JJJ B;  5KHG A;  3CC7 V;  2IM9 A;  1K97 A;  3ZIA G;  2E5L O;  1ZWI C;  2QKA A;  1NTZ H;  3FAV A;  1K7D A;  4JI5 B;  1OCZ B;  4HYO A;  3FB7 C;  4IGG A;  2JRI A;  2B5U A;  3O9O A;  5L3D A;  4LWS A;  4LFA O;  1IDS A;  1XL6 A;  1S5J A;  5LP6 A;  3RFR A;  1R6T A;  3DC5 A;  1XBL A;  2QKS A;  2NNU A;  5J9P C;  4AQY O;  1HNX O;  2CTW A;  1SZT A;  4LFB B;  2M7W A;  2Q0O C;  3ETQ A;  4GLX A;  4Z1V A;  5L3E A;  2HLD G;  3N2G B;  4I9W A;  1KQS U;  4DW1 A;  5LMN B;  1TAE A;  1JPX A;  4CH3 A;  2BSK A;  5CA1 A;  3SGI A;  4DK1 A;  1XMO B;  4CS2 A;  1SKV A;  2ZE5 A;  5JH7 B;  3CCS V;  4K8X A;  3ZHR A;  3K57 A;  3CCV V;  1KEC A;  2UXB O;  4RUF A;  4IYH A;  4K3A A;  1ZAU A;  2DYS B;  3AG4 C;  4ZIB A;  4LF9 B;  4CH4 A;  1DGS A;  3E2E A;  4X8A A;  2XOK G;  1DTO A;  2ZR2 A;  4NXM O;  4BWA A;  4TUY B;  3ZMS A;  1K4C C;  4DV5 B;  4GX1 A;  3CE2 A;  1W2B U;  4WCE V;  2BTO A;  2FB5 A;  4QPJ A;  1OCO B;  2R72 A;  4X62 O;  2CH7 B;  3JAL A;  4HZ3 A;  3IAY A;  2EIM C;  1VMG A;  4DR3 O;  1GM8 A;  2V1D A;  5CN0 A;  4DUY B;  1W59 A;  4MTO A;  2K1E A;  3AG1 C;  3RW0 A;  3THO A;  2ADQ B;  3LDD A;  2WWW A;  4MVM A;  2HHH B;  2A7W A;  2BOB C;  2Z5U A;  1Q6U A;  1IX9 A;  3AG7 A;  4JAS A;  3JAK A;  1SES A;  1YEW A;  2XAF A;  3AG4 B;  5J2T A;  3IGA C;  3T1C A;  1H2G A;  5DEC A;  1Q5O A;  3K03 A;  4F6E A;  4MVU A;  1AJP A;  3G67 A;  2ZQM A;  4DUZ O;  3K9A A;  4JYA O;  1NT2 B;  3CX5 F;  5IYD O;  2DYR C;  2LFR A;  2JEX A;  2EIL C;  4XDK A;  4DR2 B;  4DR6 O;  4XDL A;  1KC8 W;  4ZOL B;  1ZUQ A;  3L72 H;  1CPY A;  1TUE B;  4X66 O;  4FLT A;  4FK5 C;  3K04 A;  3OGC C;  3N2G A;  4X89 A;  4O4I A;  4J11 A;  4QE9 A;  2X0L A;  1B04 A;  5TIS Z;  4LFB O;  1SA0 B;  5A2Q N;  1HDJ A;  4FLY A;  1Q86 W;  1F4M A;  2Q6A A;  1KU9 A;  1FJG O;  5EYP A;  2Q69 A;  4KFM A;  1S5L Z;  2H3O A;  1EFR G;  4JI8 O;  3OGI B;  5KUM A;  4DV3 O;  4B3S O;  2ZE8 A;  3CHX A;  2H94 A;  3C90 A;  3D8C A;  1DK1 A;  1VIB A;  1TUB A;  1R73 A;  3H01 A;  1FS0 G;  4WFF A;  1OCR C;  4LC1 A;  3CCU V;  4CC6 A;  1WPB A;  3RYH B;  4Z2W A;  3KKY A;  1SQQ H;  3RYF B;  3FB6 C;  5L3B A;  1EBO A;  2YI9 A;  1Y66 A;  5CA0 B;  4O4H A;  5BR8 O;  2OCH A;  3L70 H;  3RYI B;  3K06 A;  4DR5 O;  2JJ2 G;  2RDC A;  4CZZ A;  5JWP A;  3SYP A;  2AZ0 A;  2A9H A;  4JI1 B;  5GTH Z;  1VQ9 V;  4J7J A;  1KB9 F;  2VQE B;  1NJI W;  2ZXW B;  1E79 G;  1LR1 A;  2VWK A;  4JI4 O;  4NTY A;  1Y74 B;  2R9A A;  2BE3 A;  4UXN A;  3CRC A;  2XAJ A;  4LF5 B;  1SQX H;  1YSC A;  4TV8 A;  4JI6 O;  2LGW A;  3CPW U;  4F4L A;  5CA0 A;  2DOS A;  2KKW A;  3K3W A;  2F66 C;  4LF4 B;  3SJB C;  1GN3 A;  2Y69 C;  2OIG A;  3E89 A;  3EVK A;  3CJH B;  4IHJ B;  5L3G A;  1E1R G;  1NR7 A;  4JI1 O;  1U96 A;  3DGE A;  5FPO A;  3CRR A;  4ZI7 A;  2XAS A;  1VQN V;  3HR0 A;  4DR7 B;  1XMQ O;  4LF4 O;  3RWR D;  2WLN A;  5FPR A;  4LF6 B;  1KP3 A;  2UUC B;  4JI3 B;  1KUQ A;  3E8F A;  5KAI Z;  3Q4H B;  5IJ9 B;  5H9C A;  1D5A A;  1YCI A;  4D7T A;  1G6U A;  3JAL B;  1AR5 A;  1KYO F;  4JI2 B;  4DV4 O;  2XAH A;  2QEX V;  3MD0 A;  4LH6 A;  4DV0 O;  3B8M A;  1GM7 A;  2LW7 A;  4NB5 A;  2C2A A;  2V7Q G;  4MS2 A;  1DF5 A;  4H0L B;  3PJS K;  3JAR A;  2QWO B;  3ABL B;  1JMK C;  3AG3 B;  1M57 C;  2ZIN A;  4MVR A;  2YC0 A;  5L3C A;  2YUA A;  3ABK C;  3STZ C;  2JDI G;  1ROP A;  1XHX A;  1PL0 A;  2JVD A;  2YIC A;  3KCY A;  2YEV A;  5KX5 A;  3ETD A;  3JCZ A;  4GX5 A;  2D3O W;  4FFB B;  2NR5 A;  3MHS C;  2EZO A;  4EFB A;  4BW5 A;  4GKK B;  2RNB A;  2UXD B;  3CCQ V;  3CSX A;  1JJ2 U;  2GUZ A;  4FMT A;  3QG5 A;  2YIB D;  3UT5 B;  3ZN1 A;  4X65 O;  1VQL V;  4Z1M G;  2ZR3 A;  5D5Q A;  1GMG A;  5EC1 C;  2Y69 B;  4QNH B;  1VEW A;  4XDJ A;  3L73 H;  3H1J H;  2PY5 A;  5ITZ B;  4MVO A;  2UUB B;  2PI5 A;  3HKC B;  4O4I B;  3UKM A;  2IU0 A;  2Y48 A;  4R6Z A;  4F6R B;  4GKJ O;  1N36 B;  2YS8 A;  1CXZ B;  3JAW B;  5KLV H;  2WPD G;  3M99 B;  1VQP V;  2GSM B;  2HVK C;  3ZED A;  1UPG A;  2IJI A;  4DR5 B;  3ETE A; 
#chains in the Genus database with same CATH homology
 2L35 A;  4FZ1 A;  4NTY A;  2FB5 A;  4NTX A;  4NYK A;  3S3W A;  3N27 A;  4FZ0 A;  4NTW A;  3S3X A;  3IJ4 A;  2QTS A;  1WP8 A;  1WP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...