3N27A

Molecular basis of the inhibition of henipa viruses
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
78
structure length
73
Chain Sequence
KNADNINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDYGIDISIELNKAKSDLEESKEWIRRSNQKLDSIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of the Inhibition of Henipa Viruses
rcsb
source organism Nipah virus
molecule tags Viral protein
molecule keywords Fusion glycoprotein F0, linker, Fusion glycoprotein F0
total genus 34
structure length 73
sequence length 78
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3n27A00
3S3WA 2FB5A 3N27A 4FZ1A 2QTSA 1WP7A 4FZ0A 4NTXA 3S3XA 4NTYA 4NTWA 3IJ4A 2L35A 4NYKA 1WP8A
chains in the Genus database with same CATH superfamily
4B3RB 1Q81W 3ZHTA 3AK3A 5JJJB 4Q6GA 5AG2A 1NT2B 1EN5A 3ZIAG 3SR2C 4X66O 1BCCH 3JCZA 1NZ6A 1AI4A 2LGQA 3IFXA 2X7RB 2WSSG 4LF6B 2DJVA 4GYCB 4X1IB 3RT3C 4O2AB 1H2NA 2EX3A 4EB6A 1B3QA 2G38A 3TXSA 2M7WA 4DRXA 4JI0O 4HBNA 1Y6XA 3AG3B 3E86A 1IBMB 3RYIB 1H2MA 3JASA 1GRJA 2YUAA 3AK1A 5FNVB 2Q67A 3AG1C 1MZEA 1HNZO 1FPOA 3LNMB 4D7SA 3DSQA 3H01A 3UCSC 4E4EA 2JDIG 4BW9A 4UV9A 4QE7A 2CK3G 1VARA 4X20B 3VQVA 4LFBO 2ATKC 3RBZA 3L75H 4MVRA 1FFTB 2WAMA 4X20A 1QNMA 4UV8A 5H6QA 2Q69A 3H1HH 1QR9A 1M57C 1JR9A 1GN2A 2QTSA 5IYDO 1COWG 2B9ZA 4DV5O 3CCLV 4B3SB 4LP8A 4X64B 3EVKA 1AJNA 5CB4A 1SRYA 3CEIA 4ZHQA 4RUFA 1EN6A 4XDKA 1OCRC 3OEEG 1VF7A 4PA7A 3ZRVA 3T4DA 1IBLO 1PPJH 4TQFA 3BY6A 1GM8A 4K8XA 3RN4A 3X2QB 5JH7B 1HR0O 4NXMB 3STZC 3OE7G 2HJDA 3VQYA 1IXMA 1Q43A 4FLXA 3K03A 2CGNA 3WFVA 3ETQA 5L3GA 1ZAUA 3RYCB 1XDCA 2BOCC 4DR5B 1SZXA 2ZD9A 3ZHRA 3JATA 2YICA 4PDRA 1NS1A 1AILA 4NTYA 1XI1A 2AXTZ 2L35A 2UU9O 1WP7A 1GK9A 3DXRB 1Q7YW 1TAEA 3O9OA 1XILA 4PDVA 1P7BA 4YJ3A 3ETGA 3LDEA 2XAGA 1HP8A 4I7ZB 3CD6V 3CJHA 2RJZA 4B3RO 2B1IA 2Q7EA 3CXHF 1R1BA 1B06A 2EJRA 5C93A 2BCCH 3BRCA 3WG7B 2F23A 1XMQB 1TUBA 4JYYA 5GONB 4DV7O 4PA6A 4ZBMA 1RSOB 2EJ7A 4JI5O 1VMGA 1MG1A 1OHHG 3CC2V 2OIEA 4JASA 4LFAO 5KA5A 2AHZA 3TETA 1WB8A 4DV7B 1FFXB 3VBBA 4KUMA 2EILC 5CA0B 5KAIZ 2DYRC 3OGIB 3SJBC 1OV9A 3MAQA 1WNSA 3APOA 3P32A 4JGSA 1MSWD 3HKDB 4A5UB 4LF5B 3TK1A 4KFMA 3TGUH 2ZE5A 4DV1B 5IT9N 2Y0PA 5KLVH 1Q86W 2GBOA 2VRZA 3D36A 5JVDA 1D2DA 3E83A 2CGOA 2XAQA 5IDJA 5IYCO 4YXWG 2QSAA 3ASNB 4YHHB 1X4TA 2P67A 1YIJV 5JH7A 5JJEB 4YY3B 2UXBO 2FMLA 1VQOV 3ZRWB 2QM4A 1DK1A 2CTRA 3UT5A 3CSXA 2E76B 4DK0A 2OTJV 1FAFA 2PF4E 1BHBA 2F4VB 3ZHQA 2JGDA 4G2KA 1YSCA 5IJ9B 1QLEB 1M90W 4LC1A 2HLDG 3R65A 4MTOA 4NVPA 2HR3A 3W7UA 4I50B 1N0JA 3T1HB 3N2GA 5HFMA 3MHSC 5BMVA 4DV0B 4B7EA 1VQNV 2Y4UA 1DF4A 2E5LO 4LF9O 4JTDB 2ZQMA 2UUBO 3P30A 2IW5A 1TVKA 3L9DA 4UVAA 1R3IC 4HYOA 4JPRA 2DN9A 1M5IA 4R50A 4CS3A 3HKBB 3CJHB 5ITZB 4MW8A 2ZXWB 4R6ZA 3UQ8A 3ZRXA 1JCHA 1URFA 2KKWA 4UB8Z 1K73W 3ZMVA 1OJHA 5B1AC 4JI6B 3W7XA 4LF9B 3CCJV 2IU3A 2RN9A 1US6A 3O65A 1Y4MA 4TV9B 2JEXA 2ZE7A 2LFSA 1TUBB 5JJNB 4N23A 1Y74B 4DV2B 1QHTA 3NXSA 4EEQA 4AHCA 2WLNA 4LR3A 4MSWC 3Q4HB 3UKMA 5IE9A 4LF8B 3G4SV 1H8HG 4EB6B 1QQCA 2ARHA 3T1CA 4OPHA 4RAIA 1FXKA 2L6LA 1G8MA 2KG7A 1R3LC 3ZCCA 1H2LA 1F23A 3GB7C 1Q8IA 4TUYA 2E5LB 4Z1MG 2WLIA 2QM7A 1YZBA 1GKFA 2ADPA 3B2EE 1JMKC 1VQ9V 3C90A 4JI1B 4UFZA 1DLBA 3B77A 2AGAA 4TWKA 2JK5C 2Q0AA 1V55C 5FPOA 1ZTEA 3TCUA 5IWAB 2H8PC 3KKYA 1DGSA 4DV4B 4UCUA 4LWSB 5B3SB 1BMFG 4LFCB 4J80A 4X8AA 4YIOA 4JI8B 1IVSA 1YJNV 2ODMA 3ZS8C 4U3JA 5IWAO 2ZR2A 2YI8A 3K9AA 4MTXA 3EXAA 3CE2A 3JSNA 3C3TA 2FL4A 4CS4A 5KUKA 1FD9A 1SS3A 2HHHB 2EIMC 3VOUA 1TGOA 2GDSA 1BZKA 2KQXA 5EYPB 5BMVB 2JVDA 2W0FC 4PV1B 3WG7C 1WA8B 5CBFA 3APQA 1QBZA 4I50A 2H3OA 2WLMA 5L3FA 4EKWA 1N36O 2R70A 1WA8A 5LP6C 4J10A 2XHBA 1WAZA 1V54B 5ITZA 2HKOA 5JCOC 2KB1A 2ITCC 4DV0O 5LGNA 2YIAA 1W59A 2IH1C 4DUYB 3B4SA 4CH4A 1WN7A 1K5QA 1JJOA 2UXCB 1F7YA 1MOFA 1LNQA 3MDSA 4IHJB 4XBFA 3MD0A 1IZ3A 2NNUA 2Q0OC 3HKCA 4DUYO 2QDOA 4QIWF 3C3SA 4O4JB 4UCOA 4LH7A 3ZBHA 2BTOA 1L8DA 4YIPA 1HW7A 1F51A 2UUCB 4JI6O 3FAVB 4JF3A 2UXXA 4W4KA 1GH6A 4GT1A 4PA9A 2IH3C 4BW5A 3A8TA 5GONA 4Z1VA 4L8JA 3IJ4A 1OZ0A 1BT8A 4PD4F 1SQPH 2Y4TA 4GLXA 4CZZA 2XUMA 3GWKC 2JRIA 4LF6O 3WU2Z 2HP8A 4HNAA 1I94O 2CDYA 4FLTA 5GW7A 2P5OA 1XMOO 4JI8O 1G1XB 2XTAA 3KZIZ 3LDDA 1FJGO 4DR5O 3D3QA 3OEHG 1H2GA 2EINC 3OUFA 1SZTA 4BIZA 2JEUA 5LOVB 3K0GA 2UXCO 1FXHA 3G71V 2R72A 5LOVA 3JD4A 2ZR3A 4NKGB 4DR3O 1Z5WA 3JAWB 3JCUZ 2DYRB 4O4IA 1K9MW 5E1AC 2W0XA 2OCHA 4B3MB 4TUYB 5EC1C 5LHHA 5KHKA 4X62O 1AR5A 3QO5A 1W0KG 2XASA 1SKVA 5IY5C 3ASNC 1NTMH 1XMQO 2HG5C 2HJFC 3SYAA 1XQ8A 4G27B 1R6NA 4B3SO 3JSLA 3E89A 1H38A 3DGEA 3EFFK 3K9SA 3KCXA 1IBMO 4LF8O 4ASUG 1R6TA 4O4IB 4YJ2A 1U97A 1LUVA 4DUZB 1JVMA 4WF9V 1IBLB 2PI4A 2IJKA 3CS5A 4R8CA 3BEHA 1I94B 2HVKC 1M93A 2Y0IA 5GTHZ 4BIUA 1YF2A 4DV6B 2F95B 1S5HC 2JIZG 3ZHUA 1CP9A 1ORQC 4LFBB 1BHAA 2LW7A 1VQPV 5D5QA 4UCVA 4JI1O 4MW3A 2C2AA 1QCEA 3TJTA 2QKSA 3CRCA 2NN4A 4BWAA 2ADQB 4IGGA 1J5EO 1GAXA 1SA0B 3T2MA 4UUJC 1HNWO 2DQ0A 4WFEA 5B1OA 1QLEC 1NU1H 4B3MO 4RQFA 2EIMB 5JCOA 4WCEV 1CXZB 4HZ3A 5CBGA 1HNWB 3N2GB 1AB3A 4DR1B 1JA8A 2FTKA 3FAVA 1Z2GA 2UXNA 1R3JC 4JAAA 3FB6C 4MVOA 4NYKA 3E8HA 2VWJA 3A2FA 4JYCA 4YJ3B 1EZJA 1XNRO 1K33A 3DC6A 4DW1A 3PJSK 1GM7A 4FMTA 2F4VO 4L87A 4FLVA 1N33O 4H37A 2WLLB 4LF5O 2ZM6B 4MVQA 3HB3B 3CMEV 2BSKB 4O2BA 1MZFA 4X89A 5KMGA 1N36B 3ASOC 4NTWA 1E1QG 3ABMB 1VQ8V 3K5MA 3AG2B 3FYIB 1WLEA 4LF4B 2K1EA 2WA3A 1NKDA 3U0ZA 2VWKA 2FB5A 3T1YB 2JS3A 1G4YB 4X62B 2Q6AA 4PDMA 3E8BA 3K79A 1Q90D 1RPOA 2QKAA 3LNNA 1JFFB 4IYHA 3Q4HA 1K8AW 2BSKA 1NTZH 4DR2O 4XDLA 3ETEA 1MSDA 3RWRD 4ZI7B 3LDCA 1NI8A 1PL4A 5FPRA 4D7TA 3CXCU 4TV8A 4JV5O 2ZE8A 5EC2C 1KYOF 3OAAG 1FXVA 2AZ0A 5DM6V 4DO2A 3N2KA 1NH2B 1P84F 2N74A 2WLIB 1KP2A 3AG1B 4G28B 1AI6A 4KXRA 3QTCA 5CMUA 5EBLC 1Q82W 1KUQA 2K9PA 2EINB 4J42A 1HR0B 4NXMO 4H33A 1XREA 2JJ2G 1UJWB 1O9GA 4QGPA 1RPRA 2IJJA 2UUAO 1ZL8A 3BABA 4QPKA 3SYPA 3L70H 4MTGA 1KBHA 3K06A 4J11A 5CA1A 2UUAB 1HWYA 1NBMG 2YIBD 1S0VA 3CRQA 3SPIA 1RFYA 1Q6UA 2R9IA 1A32A 3A0HZ 3ICXA 1TA8A 2YC0A 3BCCH 4MVMA 5D5PA 1EBOA 4DV3B 4B3TB 4O4LA 4JZ2A 2QA4V 1MABG 4UCRA 1ROPA 3ABUA 1PNLA 4FPPA 2IBZH 4DV2O 5KMGB 3LSSA 1QLNA 3JATB 4FFKA 1EM1A 3P3PA 2HFEC 1V9PA 2EIKC 2P22C 4LFAB 4FZ0A 1R6KA 1G6UA 2DOSA 1LR1A 3RGBA 2QE7G 1S76D 1AJPA 1VQKV 3W7WA 2B1GA 2MW2B 1SQBH 1S3JA 5A2QN 1XUQA 2ETNA 2YI9A 4X1YA 2QWRB 5EZYB 1XHZA 4GX1A 5EIBC 4LF4O 2X6AA 3CP1A 1AJQA 3TXQA 4X1YB 5J2UA 3T4ZA 1I08A 2ZCEA 3QF7A 3HKCB 1NVPB 5B1NA 2KSDA 4WBNA 2MK3A 5LP6B 4DV6O 2ZM6O 1YVWA 4O2BB 4DW0A 4F4LA 3S3WA 1E1RG 2JS5A 3OMNB 3ZHSA 2ZXWC 1WJZA 2YXHA 3OW2U 2P4KA 1OCCB 3CC4V 4CBCA 4DRXB 2VQEB 1NR1A 5JQGA 1NVPD 1FFXA 4MTFA 3RFRA 4PDLA 4HNAB 4EFEA 1OCZC 2D2CB 3JD3A 4JTCB 3AG7A 1WB7A 5JQGB 2EIJB 1VF5B 2IJHA 1GN6A 2YEVA 3E22B 1KMIZ 3OUSA 1M56C 3F7YC 5JVDB 3ABKB 4WFFA 2FYUH 4DR1O 3BVOA 3ZN1A 3STLC 1Z5VA 3AG4C 3VQWA 4DK1A 3M99B 3I5DA 4ICGA 2VQFB 3CYOA 2OCCC 2F43G 3M8AA 5FNVA 2QTOA 2ZIMA 3UO2A 1HNXB 4MT8A 1MNGA 2P4VA 4DR4B 2UXBB 2UUCO 1GMGA 2XOKG 3JYCA 4X9QA 3E35A 4CS2A 5B1BC 1SETA 4J9YB 2PGGA 3ZHVA 2GUZA 4IL6Z 3WB2A 5JWPA 4BR6A 3JD0A 5IYZA 3JAMN 2CTQA 3AEIA 1N33B 5LGUA 5H5NA 5EYPA 1ZWIC 3BHPA 4LWSA 3CHXA 1VF6A 2LJ2A 4FZ1A 1NQTA 3RYCA 4LCUC 2WLJA 1FJGB 1ZL8B 5B5EZ 3K0DA 5C8YB 2AW9A 4TOIA 4K0KO 1K92A 4CC6A 3CCRV 4FM0A 5KHGA 3IGAC 1NH2D 2UU9B 2WLHA 3T1YO 1Q6IA 2YIBA 5KHHA 4O4LB 3JARB 4X65B 2OTLV 5H2FZ 3S3XA 2JGUA 1T5EA 1OCOB 3SYOA 4ZIBA 4LNUA 4JYAB 5IJ0B 4DR3B 2ZE6A 2LP7A 4JTAB 3RYHA 1VQMV 2R9AA 2A0LA 4U7OA 2ITDC 2EULA 2D3OW 3B8MA 4CH5A 1YTFB 5BZBA 3E8FA 2LFRA 1CEZA 5E79Z 2PZSA 2P06A 2A06H 1RP3B 1OCOC 1FS0G 3UM7A 2ZDIC 2X6CA 3PN1A 1W0JG 4FLYA 5EZYA 3VQXA 3ZX6A 3ZN0A 2OWOA 2GTAA 3SPJA 4X1KB 1GTOA 4O4HA 2BOBC 2A3QA 1N34O 1XNQB 3WB0A 5IYBO 3K5NA 2P6JA 1AR1B 1S5LZ 1X59A 3E2EA 3SPGA 1WP8A 4K35A 4OPAA 3ZMUA 3OM3B 4KHPB 1TVKB 3F5WC 1XEQA 1F4NA 3QNEA 1Y74A 1P4RA 3OFNG 3JASB 3ZMSA 1AI5A 2BTQB 5LGTA 1HNXO 4HAMA 5DEDA 4PI2A 3CCMV 1D5NA 4YHHO 2Y69B 2DQ3A 2RQ6A 3ZRSA 3ETDA 3RVYA 1GM9A 2PUSA 1KECA 4QNHB 5L3EA 3FD9A 2V7QG 4B08A 2HHHO 4FLWA 3QO8A 1AP5A 3H9VA 1EN4A 3CX5F 4DUZO 2QKCA 3FB7C 4TSFG 5A9GA 2QGNA 1XNRB 2LW1A 1N4CA 3SPHA 3SYCA 4I0XA 3OT7A 3AG3C 4FIPC 3RYIA 2XNDG 4FM1A 1KB9F 4CC5A 4PA3A 1K7DA 1THZA 5LHGA 2P90A 4J7JA 3P3NA 1MMMA 2GSMB 5FL7G 4GX2A 4O2AA 4KP4A 4K3AA 1LUWA 2HEPA 4E2LA 2W6JG 3N2KB 4NXNB 3H1JH 3H1LH 5B1AB 1P7GA 4UCTA 3U10A 5LYJB 3DC5A 3DTUB 3HR0A 4GKKO 4FK5C 1HNZB 4I55B 2WA4A 1UPGA 4TV8B 3ZEDA 4DXWA 2ZNIA 1OCCC 3JAWA 3ABKC 1XBLA 2O57A 4F6RB 1VQ6V 1EZVH 5K1XA 2Q5ZA 2UUBB 1J95A 3H1KH 4BAYA 4R7CA 1Q5OA 2ZDIA 2ILMA 4YJ2B 2E3CA 1IDSA 3SGIA 2AZ2A 5L3DA 2YDEA 4LF7O 3G6BA 2F66C 5IJ0A 1GN4A 1Y66A 4DV5B 3FX7A 1PKXA 4MVSA 4PI0A 3L72H 1KU9A 1QR8A 3CCUV 3LSUA 1ZX3A 1IX9A 3JARA 2XAFA 4H0LB 4FVMA 4U7NA 3OTFA 5J2TA 3BAAA 5LHIA 2NLJC 5L3CA 1KC8W 1PV0A 5EBMC 3RW0A 5LA6A 5C8YA 3J80N 1OCRB 4J7ZA 3A0BZ 2XT9A 1M4UA 1HDJA 5CN0A 2F93B 3W7SA 5HFLA 4ABMA 3RYHB 3OTOB 3J81N 5EK0A 1BGYH 4U3FH 2R9RB 1K97A 1Y67A 4LNUB 3X2QC 4JI0B 1YXBA 1RM1B 4OXSA 5EIBD 1P49A 1PD3A 1UFIA 3E8GA 3OD4A 3CCSV 1XNQO 5CBHA 2GHYA 3W7TA 2PYJA 2UXDB 4TQDA 2EBOA 5IY5B 3JD2A 4JV5B 5KHIA 2CTWA 4K0KB 2WLLA 3B09A 1SA0A 2YEVB 1V54C 3KG2A 1N32B 4LF7B 2M6YA 4DV4O 1U96A 4X1KA 4GKJO 1KKDA 4AI8A 3BPZA 5LMUB 4JAVA 3D3IA 4JI5B 4JYAO 1B04A 1OCZB 4J9ZB 3JALB 3IC9A 3K57A 3L74H 1SQFA 4J41A 4GKJB 2QR4A 1K34A 3UO3A 3OGCC 3CCEV 5LMUO 3K5OA 2V4DA 1Y76B 1FKAO 5H9CA 3D8CA 1BL8A 3RYFA 2N04A 1EFRG 3CMAV 2E74B 2QJ1A 3I56V 4DR6B 5CA0A 1KQSU 4DV1O 3AG4B 5KA6A 1N34B 2YXLA 5DECA 1M56B 4F6EA 5CA1B 5KHJA 2VQEO 4I9QA 4F6RA 1AI7A 3CRRA 1E79G 1K5SA 4DR2B 3K58A 2LQTA 2A79B 2QWPB 1L1FA 3ML0A 4LBEC 1J5EB 2Y48A 3D36C 3UT5B 1YCIA 3U11A 1QU7A 5IYZB 1SQVH 1R3KC 2YXYA 4LH6A 4CH6A 3HKEA 3HKEB 1CPYA 5B66Z 1QVFU 4I4TA 1ZUQA 4AILC 5CB4B 4RUEA 3CCQV 2YS8A 4AQYO 2PTMA 3N27A 2XAJA 2DWEC 4Q20A 1WPXA 1VQLV 4PA4A 2Q7HA 4TV9A 3AG2C 4QJFB 3B40A 1NR7A 5EBWC 4WFAV 2DE0X 5BR8O 4I4TB 4PELA 3OTOO 1IXBA 2DMXA 1L0NH 4AQYB 2Z0AA 1FXKB 2BTQA 3DXRA 4BIOA 1YITV 1AVMA 5F2VO 4B7KA 2IJIA 2H94A 4PHZA 1AR4A 4UCSA 3CRAA 5LP6A 1ENVA 1XL6A 1DTOA 1KP3A 1K4CC 1JFFA 4GX0A 3SJQC 3ABLC 3ABLB 1NTKH 1VIBA 2DWDC 5J2UB 4RO2A 1V55B 1N32O 2E75B 1BQ0A 5LYJA 4I5SA 4X1IA 4H44B 2RCVA 1PL0A 5KX5B 5LL6Y 2CE4A 4X64O 1M9NA 3AK2A 2N05A 4NB5A 1ZSPA 5LMNB 2QWOB 4I0XB 4P30A 1JX9A 1FXKC 3IC7A 3QVNA 1IBKO 1R73A 3GWOA 3BA8A 3G6EV 3K08A 3OMAB 1Q6HA 3HPLC 4ZKIA 4JI2O 4WBNB 2B5UA 4ZI7A 4UXNA 4OX9O 3ZRWA 4JI3B 2LO1A 1K3EA 2CH7B 4FJCC 1VP7A 2IM9A 5BXZA 4N21A 3QO7A 1H8EG 5KX5A 4MVZA 1N8RW 2RDCA 1SERA 3G80A 3IAYA 3MHHC 4U3JB 2CAZC 1BS3A 3OR6C 2Z3YA 1ZLZA 1YI2V 2ZT9B 3ASOB 4ZOLA 1AP6A 4W4LA 4JI2B 1PNMA 4YY3O 2ZIOA 2JGDB 4PJ0Z 1SQGA 2Q73A 3SDLA 1JJ2U 5LBQA 5LXTB 2A9HA 2EZOA 1VEWA 1GN3A 4ZHQB 1SQXH 3F7VC 4JYBA 2DW4A 5KAFZ 1JOYA 2QEXV 4DV3O 5DN6G 1QVGU 1K4DC 3ABMC 4X66B 1Q3EA 2WLKA 5KUMA 4IIJA 4D6TH 2IU0A 3L71H 1JQ0A 3CWBH 4UB6Z 3ZMTA 2OYQA 2CTPA 2W6IG 3K3WA 3SJCC 5IJ9A 2EIKB 2PY5A 4FFBB 5K1PA 1BSMA 4EFBA 4DR7O 5L3BA 2Z5UA 5BY1A 4FLZA 4KHPO 1NJIW 2Q7GA 4MVUA 3J7AU 3BA9A 1YJ9V 4GKKB 2ZINA 1H2KA 1VF6C 2Q4PA 4JI3O 3KCYA 5J2TB 3CB2A 2PI5A 1D5AA 2GV9A 3OMIB 4UVCA 4QPJA 4I55A 4NXNO 2HVJC 2F1MA 3NR7A 3I55V 4WFGA 2KG7B 2Q9LA 1PNKA 1SESA 1GO3F 4DYLA 1FYJA 1S5JA 2WWWA 1VQ4V 3K59A 2RNBA 2OT5A 4O4HB 1YEWA 2YSUB 3OR7C 2WPDG 4QE9A 3M7MX 4C7UA 1S72V 4I9WA 3H1IH 1VQ5V 5FLXN 2PYLA 4RQEA 3HKBA 1YJWV 3FB8C 2BE3A 3JD1A 1AROP 4MS2A 4K8ZA 3WB1A 3HKDA 4IYIA 2VS0A 1M1KW 1XOUA 3FKSG 2RMKB 4GX5A 3SPCA 4OX9B 3R66A 4WFBV 2GUZB 4DR4O 3QG5A 2YIDA 1PP9H 4NTXA 2Q68A 4XDJA 2QWNB 3ZMZA 2VQFO 1XL4A 2A7WA 4DR7B 5J9PC 1SF9A 4IT5A 5LMNO 1YHQV 5B3SC 1BQZA 2V1DA 4JI4O 2NR5A 1I5XA 1RSOA 1Y76A 1IURA 1RM1C 5BR8B 2EILB 3JAKB 3T1HO 3JAKA 2FKXA 4GUNA 5B1BB 2EIJC 1DF5A 1I0HA 1IBKB 1PM9A 2X0LA 3EHBB 1MA1A 1XMOB 3E22A 3CC7V 1I5YA 3JALA 4P9OA 3SYQA 1I7FA 4J7KA 1YTFD 4GCZA 4ZOLB 2CUGA 4JI4B 4CH3A 3RVZA 2Y69C 4LFCO 1O9HA 2DYSB 2DYSC 5GTIZ 3K04A 4RWUA 4B3TO 4KL1A 2CH7A 3RYFB 5H6RA 4IHJA 4Z2WA 4JZGA 4P2ZA 2OCCB 1N0NA 5LXTA 1B6QA 3CPWU 1W2BU 4X65O 2QWQB 3BFRA 3A0RA 4TT3G 4WFHA 1H2SB 3LSQA 3ZJZA 1SC5B 5TISZ 1SQQH 1KKCA 2AHYA 2LGWA 1BE3H 3GVMA 1L0LH 4IIJB 4GZRB 3THOA 2GTSA 1XHXA 3FB5C 3SJAC 2QM8A 3ABTA 3FFQA 3G67A 1F4MA 1JPXA 3CRMA 3L73H 4OGQB 3K5LA 2EZPA 4X88A 3CCVV 3F5TA 4O4JA 4JAUA 2UXDO 2P7TC 1S77D 2ZNJA 2JJ1G 1VQ7V 1TUEB 2X6BA 2ZKOA 4H13B 5LA6B 4FLUA 4NR1A 4P9PA 2XAHA 1M57B 4DR6O 2Q8VA 4FFBA 4FM2A 3FYEB 4JI7O 1WPBA 3B8NA 4UVBA 5CA3A 3LUTB 1YDXA 1KD1W 2OIGA 4JI7B
chains in the Genus database with same CATH topology
3S3WA 2FB5A 3N27A 4FZ1A 2QTSA 1WP7A 4FZ0A 4NTXA 3S3XA 4NTYA 4NTWA 3IJ4A 2L35A 4NYKA 1WP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3W A;  2FB5 A;  3N27 A;  4FZ1 A;  2QTS A;  1WP7 A;  4FZ0 A;  4NTX A;  3S3X A;  4NTY A;  4NTW A;  3IJ4 A;  2L35 A;  4NYK A;  1WP8 A; 
#chains in the Genus database with same CATH topology
 4B3R B;  1Q81 W;  3ZHT A;  3AK3 A;  5JJJ B;  4Q6G A;  5AG2 A;  1NT2 B;  1EN5 A;  3ZIA G;  3SR2 C;  4X66 O;  1BCC H;  3JCZ A;  1NZ6 A;  1AI4 A;  2LGQ A;  3IFX A;  2X7R B;  2WSS G;  4LF6 B;  2DJV A;  4GYC B;  4X1I B;  3RT3 C;  4O2A B;  1H2N A;  2EX3 A;  4EB6 A;  1B3Q A;  2G38 A;  3TXS A;  2M7W A;  4DRX A;  4JI0 O;  4HBN A;  1Y6X A;  3AG3 B;  3E86 A;  1IBM B;  3RYI B;  1H2M A;  3JAS A;  1GRJ A;  2YUA A;  3AK1 A;  5FNV B;  2Q67 A;  3AG1 C;  1MZE A;  1HNZ O;  1FPO A;  3LNM B;  4D7S A;  3DSQ A;  3H01 A;  3UCS C;  4E4E A;  2JDI G;  4BW9 A;  4UV9 A;  4QE7 A;  2CK3 G;  1VAR A;  4X20 B;  3VQV A;  4LFB O;  2ATK C;  3RBZ A;  3L75 H;  4MVR A;  1FFT B;  2WAM A;  4X20 A;  1QNM A;  4UV8 A;  5H6Q A;  2Q69 A;  3H1H H;  1QR9 A;  1M57 C;  1JR9 A;  1GN2 A;  2QTS A;  5IYD O;  1COW G;  2B9Z A;  4DV5 O;  3CCL V;  4B3S B;  4LP8 A;  4X64 B;  3EVK A;  1AJN A;  5CB4 A;  1SRY A;  3CEI A;  4ZHQ A;  4RUF A;  1EN6 A;  4XDK A;  1OCR C;  3OEE G;  1VF7 A;  4PA7 A;  3ZRV A;  3T4D A;  1IBL O;  1PPJ H;  4TQF A;  3BY6 A;  1GM8 A;  4K8X A;  3RN4 A;  3X2Q B;  5JH7 B;  1HR0 O;  4NXM B;  3STZ C;  3OE7 G;  2HJD A;  3VQY A;  1IXM A;  1Q43 A;  4FLX A;  3K03 A;  2CGN A;  3WFV A;  3ETQ A;  5L3G A;  1ZAU A;  3RYC B;  1XDC A;  2BOC C;  4DR5 B;  1SZX A;  2ZD9 A;  3ZHR A;  3JAT A;  2YIC A;  4PDR A;  1NS1 A;  1AIL A;  4NTY A;  1XI1 A;  2AXT Z;  2L35 A;  2UU9 O;  1WP7 A;  1GK9 A;  3DXR B;  1Q7Y W;  1TAE A;  3O9O A;  1XIL A;  4PDV A;  1P7B A;  4YJ3 A;  3ETG A;  3LDE A;  2XAG A;  1HP8 A;  4I7Z B;  3CD6 V;  3CJH A;  2RJZ A;  4B3R O;  2B1I A;  2Q7E A;  3CXH F;  1R1B A;  1B06 A;  2EJR A;  5C93 A;  2BCC H;  3BRC A;  3WG7 B;  2F23 A;  1XMQ B;  1TUB A;  4JYY A;  5GON B;  4DV7 O;  4PA6 A;  4ZBM A;  1RSO B;  2EJ7 A;  4JI5 O;  1VMG A;  1MG1 A;  1OHH G;  3CC2 V;  2OIE A;  4JAS A;  4LFA O;  5KA5 A;  2AHZ A;  3TET A;  1WB8 A;  4DV7 B;  1FFX B;  3VBB A;  4KUM A;  2EIL C;  5CA0 B;  5KAI Z;  2DYR C;  3OGI B;  3SJB C;  1OV9 A;  3MAQ A;  1WNS A;  3APO A;  3P32 A;  4JGS A;  1MSW D;  3HKD B;  4A5U B;  4LF5 B;  3TK1 A;  4KFM A;  3TGU H;  2ZE5 A;  4DV1 B;  5IT9 N;  2Y0P A;  5KLV H;  1Q86 W;  2GBO A;  2VRZ A;  3D36 A;  5JVD A;  1D2D A;  3E83 A;  2CGO A;  2XAQ A;  5IDJ A;  5IYC O;  4YXW G;  2QSA A;  3ASN B;  4YHH B;  1X4T A;  2P67 A;  1YIJ V;  5JH7 A;  5JJE B;  4YY3 B;  2UXB O;  2FML A;  1VQO V;  3ZRW B;  2QM4 A;  1DK1 A;  2CTR A;  3UT5 A;  3CSX A;  2E76 B;  4DK0 A;  2OTJ V;  1FAF A;  2PF4 E;  1BHB A;  2F4V B;  3ZHQ A;  2JGD A;  4G2K A;  1YSC A;  5IJ9 B;  1QLE B;  1M90 W;  4LC1 A;  2HLD G;  3R65 A;  4MTO A;  4NVP A;  2HR3 A;  3W7U A;  4I50 B;  1N0J A;  3T1H B;  3N2G A;  5HFM A;  3MHS C;  5BMV A;  4DV0 B;  4B7E A;  1VQN V;  2Y4U A;  1DF4 A;  2E5L O;  4LF9 O;  4JTD B;  2ZQM A;  2UUB O;  3P30 A;  2IW5 A;  1TVK A;  3L9D A;  4UVA A;  1R3I C;  4HYO A;  4JPR A;  2DN9 A;  1M5I A;  4R50 A;  4CS3 A;  3HKB B;  3CJH B;  5ITZ B;  4MW8 A;  2ZXW B;  4R6Z A;  3UQ8 A;  3ZRX A;  1JCH A;  1URF A;  2KKW A;  4UB8 Z;  1K73 W;  3ZMV A;  1OJH A;  5B1A C;  4JI6 B;  3W7X A;  4LF9 B;  3CCJ V;  2IU3 A;  2RN9 A;  1US6 A;  3O65 A;  1Y4M A;  4TV9 B;  2JEX A;  2ZE7 A;  2LFS A;  1TUB B;  5JJN B;  4N23 A;  1Y74 B;  4DV2 B;  1QHT A;  3NXS A;  4EEQ A;  4AHC A;  2WLN A;  4LR3 A;  4MSW C;  3Q4H B;  3UKM A;  5IE9 A;  4LF8 B;  3G4S V;  1H8H G;  4EB6 B;  1QQC A;  2ARH A;  3T1C A;  4OPH A;  4RAI A;  1FXK A;  2L6L A;  1G8M A;  2KG7 A;  1R3L C;  3ZCC A;  1H2L A;  1F23 A;  3GB7 C;  1Q8I A;  4TUY A;  2E5L B;  4Z1M G;  2WLI A;  2QM7 A;  1YZB A;  1GKF A;  2ADP A;  3B2E E;  1JMK C;  1VQ9 V;  3C90 A;  4JI1 B;  4UFZ A;  1DLB A;  3B77 A;  2AGA A;  4TWK A;  2JK5 C;  2Q0A A;  1V55 C;  5FPO A;  1ZTE A;  3TCU A;  5IWA B;  2H8P C;  3KKY A;  1DGS A;  4DV4 B;  4UCU A;  4LWS B;  5B3S B;  1BMF G;  4LFC B;  4J80 A;  4X8A A;  4YIO A;  4JI8 B;  1IVS A;  1YJN V;  2ODM A;  3ZS8 C;  4U3J A;  5IWA O;  2ZR2 A;  2YI8 A;  3K9A A;  4MTX A;  3EXA A;  3CE2 A;  3JSN A;  3C3T A;  2FL4 A;  4CS4 A;  5KUK A;  1FD9 A;  1SS3 A;  2HHH B;  2EIM C;  3VOU A;  1TGO A;  2GDS A;  1BZK A;  2KQX A;  5EYP B;  5BMV B;  2JVD A;  2W0F C;  4PV1 B;  3WG7 C;  1WA8 B;  5CBF A;  3APQ A;  1QBZ A;  4I50 A;  2H3O A;  2WLM A;  5L3F A;  4EKW A;  1N36 O;  2R70 A;  1WA8 A;  5LP6 C;  4J10 A;  2XHB A;  1WAZ A;  1V54 B;  5ITZ A;  2HKO A;  5JCO C;  2KB1 A;  2ITC C;  4DV0 O;  5LGN A;  2YIA A;  1W59 A;  2IH1 C;  4DUY B;  3B4S A;  4CH4 A;  1WN7 A;  1K5Q A;  1JJO A;  2UXC B;  1F7Y A;  1MOF A;  1LNQ A;  3MDS A;  4IHJ B;  4XBF A;  3MD0 A;  1IZ3 A;  2NNU A;  2Q0O C;  3HKC A;  4DUY O;  2QDO A;  4QIW F;  3C3S A;  4O4J B;  4UCO A;  4LH7 A;  3ZBH A;  2BTO A;  1L8D A;  4YIP A;  1HW7 A;  1F51 A;  2UUC B;  4JI6 O;  3FAV B;  4JF3 A;  2UXX A;  4W4K A;  1GH6 A;  4GT1 A;  4PA9 A;  2IH3 C;  4BW5 A;  3A8T A;  5GON A;  4Z1V A;  4L8J A;  3IJ4 A;  1OZ0 A;  1BT8 A;  4PD4 F;  1SQP H;  2Y4T A;  4GLX A;  4CZZ A;  2XUM A;  3GWK C;  2JRI A;  4LF6 O;  3WU2 Z;  2HP8 A;  4HNA A;  1I94 O;  2CDY A;  4FLT A;  5GW7 A;  2P5O A;  1XMO O;  4JI8 O;  1G1X B;  2XTA A;  3KZI Z;  3LDD A;  1FJG O;  4DR5 O;  3D3Q A;  3OEH G;  1H2G A;  2EIN C;  3OUF A;  1SZT A;  4BIZ A;  2JEU A;  5LOV B;  3K0G A;  2UXC O;  1FXH A;  3G71 V;  2R72 A;  5LOV A;  3JD4 A;  2ZR3 A;  4NKG B;  4DR3 O;  1Z5W A;  3JAW B;  3JCU Z;  2DYR B;  4O4I A;  1K9M W;  5E1A C;  2W0X A;  2OCH A;  4B3M B;  4TUY B;  5EC1 C;  5LHH A;  5KHK A;  4X62 O;  1AR5 A;  3QO5 A;  1W0K G;  2XAS A;  1SKV A;  5IY5 C;  3ASN C;  1NTM H;  1XMQ O;  2HG5 C;  2HJF C;  3SYA A;  1XQ8 A;  4G27 B;  1R6N A;  4B3S O;  3JSL A;  3E89 A;  1H38 A;  3DGE A;  3EFF K;  3K9S A;  3KCX A;  1IBM O;  4LF8 O;  4ASU G;  1R6T A;  4O4I B;  4YJ2 A;  1U97 A;  1LUV A;  4DUZ B;  1JVM A;  4WF9 V;  1IBL B;  2PI4 A;  2IJK A;  3CS5 A;  4R8C A;  3BEH A;  1I94 B;  2HVK C;  1M93 A;  2Y0I A;  5GTH Z;  4BIU A;  1YF2 A;  4DV6 B;  2F95 B;  1S5H C;  2JIZ G;  3ZHU A;  1CP9 A;  1ORQ C;  4LFB B;  1BHA A;  2LW7 A;  1VQP V;  5D5Q A;  4UCV A;  4JI1 O;  4MW3 A;  2C2A A;  1QCE A;  3TJT A;  2QKS A;  3CRC A;  2NN4 A;  4BWA A;  2ADQ B;  4IGG A;  1J5E O;  1GAX A;  1SA0 B;  3T2M A;  4UUJ C;  1HNW O;  2DQ0 A;  4WFE A;  5B1O A;  1QLE C;  1NU1 H;  4B3M O;  4RQF A;  2EIM B;  5JCO A;  4WCE V;  1CXZ B;  4HZ3 A;  5CBG A;  1HNW B;  3N2G B;  1AB3 A;  4DR1 B;  1JA8 A;  2FTK A;  3FAV A;  1Z2G A;  2UXN A;  1R3J C;  4JAA A;  3FB6 C;  4MVO A;  4NYK A;  3E8H A;  2VWJ A;  3A2F A;  4JYC A;  4YJ3 B;  1EZJ A;  1XNR O;  1K33 A;  3DC6 A;  4DW1 A;  3PJS K;  1GM7 A;  4FMT A;  2F4V O;  4L87 A;  4FLV A;  1N33 O;  4H37 A;  2WLL B;  4LF5 O;  2ZM6 B;  4MVQ A;  3HB3 B;  3CME V;  2BSK B;  4O2B A;  1MZF A;  4X89 A;  5KMG A;  1N36 B;  3ASO C;  4NTW A;  1E1Q G;  3ABM B;  1VQ8 V;  3K5M A;  3AG2 B;  3FYI B;  1WLE A;  4LF4 B;  2K1E A;  2WA3 A;  1NKD A;  3U0Z A;  2VWK A;  2FB5 A;  3T1Y B;  2JS3 A;  1G4Y B;  4X62 B;  2Q6A A;  4PDM A;  3E8B A;  3K79 A;  1Q90 D;  1RPO A;  2QKA A;  3LNN A;  1JFF B;  4IYH A;  3Q4H A;  1K8A W;  2BSK A;  1NTZ H;  4DR2 O;  4XDL A;  3ETE A;  1MSD A;  3RWR D;  4ZI7 B;  3LDC A;  1NI8 A;  1PL4 A;  5FPR A;  4D7T A;  3CXC U;  4TV8 A;  4JV5 O;  2ZE8 A;  5EC2 C;  1KYO F;  3OAA G;  1FXV A;  2AZ0 A;  5DM6 V;  4DO2 A;  3N2K A;  1NH2 B;  1P84 F;  2N74 A;  2WLI B;  1KP2 A;  3AG1 B;  4G28 B;  1AI6 A;  4KXR A;  3QTC A;  5CMU A;  5EBL C;  1Q82 W;  1KUQ A;  2K9P A;  2EIN B;  4J42 A;  1HR0 B;  4NXM O;  4H33 A;  1XRE A;  2JJ2 G;  1UJW B;  1O9G A;  4QGP A;  1RPR A;  2IJJ A;  2UUA O;  1ZL8 A;  3BAB A;  4QPK A;  3SYP A;  3L70 H;  4MTG A;  1KBH A;  3K06 A;  4J11 A;  5CA1 A;  2UUA B;  1HWY A;  1NBM G;  2YIB D;  1S0V A;  3CRQ A;  3SPI A;  1RFY A;  1Q6U A;  2R9I A;  1A32 A;  3A0H Z;  3ICX A;  1TA8 A;  2YC0 A;  3BCC H;  4MVM A;  5D5P A;  1EBO A;  4DV3 B;  4B3T B;  4O4L A;  4JZ2 A;  2QA4 V;  1MAB G;  4UCR A;  1ROP A;  3ABU A;  1PNL A;  4FPP A;  2IBZ H;  4DV2 O;  5KMG B;  3LSS A;  1QLN A;  3JAT B;  4FFK A;  1EM1 A;  3P3P A;  2HFE C;  1V9P A;  2EIK C;  2P22 C;  4LFA B;  4FZ0 A;  1R6K A;  1G6U A;  2DOS A;  1LR1 A;  3RGB A;  2QE7 G;  1S76 D;  1AJP A;  1VQK V;  3W7W A;  2B1G A;  2MW2 B;  1SQB H;  1S3J A;  5A2Q N;  1XUQ A;  2ETN A;  2YI9 A;  4X1Y A;  2QWR B;  5EZY B;  1XHZ A;  4GX1 A;  5EIB C;  4LF4 O;  2X6A A;  3CP1 A;  1AJQ A;  3TXQ A;  4X1Y B;  5J2U A;  3T4Z A;  1I08 A;  2ZCE A;  3QF7 A;  3HKC B;  1NVP B;  5B1N A;  2KSD A;  4WBN A;  2MK3 A;  5LP6 B;  4DV6 O;  2ZM6 O;  1YVW A;  4O2B B;  4DW0 A;  4F4L A;  3S3W A;  1E1R G;  2JS5 A;  3OMN B;  3ZHS A;  2ZXW C;  1WJZ A;  2YXH A;  3OW2 U;  2P4K A;  1OCC B;  3CC4 V;  4CBC A;  4DRX B;  2VQE B;  1NR1 A;  5JQG A;  1NVP D;  1FFX A;  4MTF A;  3RFR A;  4PDL A;  4HNA B;  4EFE A;  1OCZ C;  2D2C B;  3JD3 A;  4JTC B;  3AG7 A;  1WB7 A;  5JQG B;  2EIJ B;  1VF5 B;  2IJH A;  1GN6 A;  2YEV A;  3E22 B;  1KMI Z;  3OUS A;  1M56 C;  3F7Y C;  5JVD B;  3ABK B;  4WFF A;  2FYU H;  4DR1 O;  3BVO A;  3ZN1 A;  3STL C;  1Z5V A;  3AG4 C;  3VQW A;  4DK1 A;  3M99 B;  3I5D A;  4ICG A;  2VQF B;  3CYO A;  2OCC C;  2F43 G;  3M8A A;  5FNV A;  2QTO A;  2ZIM A;  3UO2 A;  1HNX B;  4MT8 A;  1MNG A;  2P4V A;  4DR4 B;  2UXB B;  2UUC O;  1GMG A;  2XOK G;  3JYC A;  4X9Q A;  3E35 A;  4CS2 A;  5B1B C;  1SET A;  4J9Y B;  2PGG A;  3ZHV A;  2GUZ A;  4IL6 Z;  3WB2 A;  5JWP A;  4BR6 A;  3JD0 A;  5IYZ A;  3JAM N;  2CTQ A;  3AEI A;  1N33 B;  5LGU A;  5H5N A;  5EYP A;  1ZWI C;  3BHP A;  4LWS A;  3CHX A;  1VF6 A;  2LJ2 A;  4FZ1 A;  1NQT A;  3RYC A;  4LCU C;  2WLJ A;  1FJG B;  1ZL8 B;  5B5E Z;  3K0D A;  5C8Y B;  2AW9 A;  4TOI A;  4K0K O;  1K92 A;  4CC6 A;  3CCR V;  4FM0 A;  5KHG A;  3IGA C;  1NH2 D;  2UU9 B;  2WLH A;  3T1Y O;  1Q6I A;  2YIB A;  5KHH A;  4O4L B;  3JAR B;  4X65 B;  2OTL V;  5H2F Z;  3S3X A;  2JGU A;  1T5E A;  1OCO B;  3SYO A;  4ZIB A;  4LNU A;  4JYA B;  5IJ0 B;  4DR3 B;  2ZE6 A;  2LP7 A;  4JTA B;  3RYH A;  1VQM V;  2R9A A;  2A0L A;  4U7O A;  2ITD C;  2EUL A;  2D3O W;  3B8M A;  4CH5 A;  1YTF B;  5BZB A;  3E8F A;  2LFR A;  1CEZ A;  5E79 Z;  2PZS A;  2P06 A;  2A06 H;  1RP3 B;  1OCO C;  1FS0 G;  3UM7 A;  2ZDI C;  2X6C A;  3PN1 A;  1W0J G;  4FLY A;  5EZY A;  3VQX A;  3ZX6 A;  3ZN0 A;  2OWO A;  2GTA A;  3SPJ A;  4X1K B;  1GTO A;  4O4H A;  2BOB C;  2A3Q A;  1N34 O;  1XNQ B;  3WB0 A;  5IYB O;  3K5N A;  2P6J A;  1AR1 B;  1S5L Z;  1X59 A;  3E2E A;  3SPG A;  1WP8 A;  4K35 A;  4OPA A;  3ZMU A;  3OM3 B;  4KHP B;  1TVK B;  3F5W C;  1XEQ A;  1F4N A;  3QNE A;  1Y74 A;  1P4R A;  3OFN G;  3JAS B;  3ZMS A;  1AI5 A;  2BTQ B;  5LGT A;  1HNX O;  4HAM A;  5DED A;  4PI2 A;  3CCM V;  1D5N A;  4YHH O;  2Y69 B;  2DQ3 A;  2RQ6 A;  3ZRS A;  3ETD A;  3RVY A;  1GM9 A;  2PUS A;  1KEC A;  4QNH B;  5L3E A;  3FD9 A;  2V7Q G;  4B08 A;  2HHH O;  4FLW A;  3QO8 A;  1AP5 A;  3H9V A;  1EN4 A;  3CX5 F;  4DUZ O;  2QKC A;  3FB7 C;  4TSF G;  5A9G A;  2QGN A;  1XNR B;  2LW1 A;  1N4C A;  3SPH A;  3SYC A;  4I0X A;  3OT7 A;  3AG3 C;  4FIP C;  3RYI A;  2XND G;  4FM1 A;  1KB9 F;  4CC5 A;  4PA3 A;  1K7D A;  1THZ A;  5LHG A;  2P90 A;  4J7J A;  3P3N A;  1MMM A;  2GSM B;  5FL7 G;  4GX2 A;  4O2A A;  4KP4 A;  4K3A A;  1LUW A;  2HEP A;  4E2L A;  2W6J G;  3N2K B;  4NXN B;  3H1J H;  3H1L H;  5B1A B;  1P7G A;  4UCT A;  3U10 A;  5LYJ B;  3DC5 A;  3DTU B;  3HR0 A;  4GKK O;  4FK5 C;  1HNZ B;  4I55 B;  2WA4 A;  1UPG A;  4TV8 B;  3ZED A;  4DXW A;  2ZNI A;  1OCC C;  3JAW A;  3ABK C;  1XBL A;  2O57 A;  4F6R B;  1VQ6 V;  1EZV H;  5K1X A;  2Q5Z A;  2UUB B;  1J95 A;  3H1K H;  4BAY A;  4R7C A;  1Q5O A;  2ZDI A;  2ILM A;  4YJ2 B;  2E3C A;  1IDS A;  3SGI A;  2AZ2 A;  5L3D A;  2YDE A;  4LF7 O;  3G6B A;  2F66 C;  5IJ0 A;  1GN4 A;  1Y66 A;  4DV5 B;  3FX7 A;  1PKX A;  4MVS A;  4PI0 A;  3L72 H;  1KU9 A;  1QR8 A;  3CCU V;  3LSU A;  1ZX3 A;  1IX9 A;  3JAR A;  2XAF A;  4H0L B;  4FVM A;  4U7N A;  3OTF A;  5J2T A;  3BAA A;  5LHI A;  2NLJ C;  5L3C A;  1KC8 W;  1PV0 A;  5EBM C;  3RW0 A;  5LA6 A;  5C8Y A;  3J80 N;  1OCR B;  4J7Z A;  3A0B Z;  2XT9 A;  1M4U A;  1HDJ A;  5CN0 A;  2F93 B;  3W7S A;  5HFL A;  4ABM A;  3RYH B;  3OTO B;  3J81 N;  5EK0 A;  1BGY H;  4U3F H;  2R9R B;  1K97 A;  1Y67 A;  4LNU B;  3X2Q C;  4JI0 B;  1YXB A;  1RM1 B;  4OXS A;  5EIB D;  1P49 A;  1PD3 A;  1UFI A;  3E8G A;  3OD4 A;  3CCS V;  1XNQ O;  5CBH A;  2GHY A;  3W7T A;  2PYJ A;  2UXD B;  4TQD A;  2EBO A;  5IY5 B;  3JD2 A;  4JV5 B;  5KHI A;  2CTW A;  4K0K B;  2WLL A;  3B09 A;  1SA0 A;  2YEV B;  1V54 C;  3KG2 A;  1N32 B;  4LF7 B;  2M6Y A;  4DV4 O;  1U96 A;  4X1K A;  4GKJ O;  1KKD A;  4AI8 A;  3BPZ A;  5LMU B;  4JAV A;  3D3I A;  4JI5 B;  4JYA O;  1B04 A;  1OCZ B;  4J9Z B;  3JAL B;  3IC9 A;  3K57 A;  3L74 H;  1SQF A;  4J41 A;  4GKJ B;  2QR4 A;  1K34 A;  3UO3 A;  3OGC C;  3CCE V;  5LMU O;  3K5O A;  2V4D A;  1Y76 B;  1FKA O;  5H9C A;  3D8C A;  1BL8 A;  3RYF A;  2N04 A;  1EFR G;  3CMA V;  2E74 B;  2QJ1 A;  3I56 V;  4DR6 B;  5CA0 A;  1KQS U;  4DV1 O;  3AG4 B;  5KA6 A;  1N34 B;  2YXL A;  5DEC A;  1M56 B;  4F6E A;  5CA1 B;  5KHJ A;  2VQE O;  4I9Q A;  4F6R A;  1AI7 A;  3CRR A;  1E79 G;  1K5S A;  4DR2 B;  3K58 A;  2LQT A;  2A79 B;  2QWP B;  1L1F A;  3ML0 A;  4LBE C;  1J5E B;  2Y48 A;  3D36 C;  3UT5 B;  1YCI A;  3U11 A;  1QU7 A;  5IYZ B;  1SQV H;  1R3K C;  2YXY A;  4LH6 A;  4CH6 A;  3HKE A;  3HKE B;  1CPY A;  5B66 Z;  1QVF U;  4I4T A;  1ZUQ A;  4AIL C;  5CB4 B;  4RUE A;  3CCQ V;  2YS8 A;  4AQY O;  2PTM A;  3N27 A;  2XAJ A;  2DWE C;  4Q20 A;  1WPX A;  1VQL V;  4PA4 A;  2Q7H A;  4TV9 A;  3AG2 C;  4QJF B;  3B40 A;  1NR7 A;  5EBW C;  4WFA V;  2DE0 X;  5BR8 O;  4I4T B;  4PEL A;  3OTO O;  1IXB A;  2DMX A;  1L0N H;  4AQY B;  2Z0A A;  1FXK B;  2BTQ A;  3DXR A;  4BIO A;  1YIT V;  1AVM A;  5F2V O;  4B7K A;  2IJI A;  2H94 A;  4PHZ A;  1AR4 A;  4UCS A;  3CRA A;  5LP6 A;  1ENV A;  1XL6 A;  1DTO A;  1KP3 A;  1K4C C;  1JFF A;  4GX0 A;  3SJQ C;  3ABL C;  3ABL B;  1NTK H;  1VIB A;  2DWD C;  5J2U B;  4RO2 A;  1V55 B;  1N32 O;  2E75 B;  1BQ0 A;  5LYJ A;  4I5S A;  4X1I A;  4H44 B;  2RCV A;  1PL0 A;  5KX5 B;  5LL6 Y;  2CE4 A;  4X64 O;  1M9N A;  3AK2 A;  2N05 A;  4NB5 A;  1ZSP A;  5LMN B;  2QWO B;  4I0X B;  4P30 A;  1JX9 A;  1FXK C;  3IC7 A;  3QVN A;  1IBK O;  1R73 A;  3GWO A;  3BA8 A;  3G6E V;  3K08 A;  3OMA B;  1Q6H A;  3HPL C;  4ZKI A;  4JI2 O;  4WBN B;  2B5U A;  4ZI7 A;  4UXN A;  4OX9 O;  3ZRW A;  4JI3 B;  2LO1 A;  1K3E A;  2CH7 B;  4FJC C;  1VP7 A;  2IM9 A;  5BXZ A;  4N21 A;  3QO7 A;  1H8E G;  5KX5 A;  4MVZ A;  1N8R W;  2RDC A;  1SER A;  3G80 A;  3IAY A;  3MHH C;  4U3J B;  2CAZ C;  1BS3 A;  3OR6 C;  2Z3Y A;  1ZLZ A;  1YI2 V;  2ZT9 B;  3ASO B;  4ZOL A;  1AP6 A;  4W4L A;  4JI2 B;  1PNM A;  4YY3 O;  2ZIO A;  2JGD B;  4PJ0 Z;  1SQG A;  2Q73 A;  3SDL A;  1JJ2 U;  5LBQ A;  5LXT B;  2A9H A;  2EZO A;  1VEW A;  1GN3 A;  4ZHQ B;  1SQX H;  3F7V C;  4JYB A;  2DW4 A;  5KAF Z;  1JOY A;  2QEX V;  4DV3 O;  5DN6 G;  1QVG U;  1K4D C;  3ABM C;  4X66 B;  1Q3E A;  2WLK A;  5KUM A;  4IIJ A;  4D6T H;  2IU0 A;  3L71 H;  1JQ0 A;  3CWB H;  4UB6 Z;  3ZMT A;  2OYQ A;  2CTP A;  2W6I G;  3K3W A;  3SJC C;  5IJ9 A;  2EIK B;  2PY5 A;  4FFB B;  5K1P A;  1BSM A;  4EFB A;  4DR7 O;  5L3B A;  2Z5U A;  5BY1 A;  4FLZ A;  4KHP O;  1NJI W;  2Q7G A;  4MVU A;  3J7A U;  3BA9 A;  1YJ9 V;  4GKK B;  2ZIN A;  1H2K A;  1VF6 C;  2Q4P A;  4JI3 O;  3KCY A;  5J2T B;  3CB2 A;  2PI5 A;  1D5A A;  2GV9 A;  3OMI B;  4UVC A;  4QPJ A;  4I55 A;  4NXN O;  2HVJ C;  2F1M A;  3NR7 A;  3I55 V;  4WFG A;  2KG7 B;  2Q9L A;  1PNK A;  1SES A;  1GO3 F;  4DYL A;  1FYJ A;  1S5J A;  2WWW A;  1VQ4 V;  3K59 A;  2RNB A;  2OT5 A;  4O4H B;  1YEW A;  2YSU B;  3OR7 C;  2WPD G;  4QE9 A;  3M7M X;  4C7U A;  1S72 V;  4I9W A;  3H1I H;  1VQ5 V;  5FLX N;  2PYL A;  4RQE A;  3HKB A;  1YJW V;  3FB8 C;  2BE3 A;  3JD1 A;  1ARO P;  4MS2 A;  4K8Z A;  3WB1 A;  3HKD A;  4IYI A;  2VS0 A;  1M1K W;  1XOU A;  3FKS G;  2RMK B;  4GX5 A;  3SPC A;  4OX9 B;  3R66 A;  4WFB V;  2GUZ B;  4DR4 O;  3QG5 A;  2YID A;  1PP9 H;  4NTX A;  2Q68 A;  4XDJ A;  2QWN B;  3ZMZ A;  2VQF O;  1XL4 A;  2A7W A;  4DR7 B;  5J9P C;  1SF9 A;  4IT5 A;  5LMN O;  1YHQ V;  5B3S C;  1BQZ A;  2V1D A;  4JI4 O;  2NR5 A;  1I5X A;  1RSO A;  1Y76 A;  1IUR A;  1RM1 C;  5BR8 B;  2EIL B;  3JAK B;  3T1H O;  3JAK A;  2FKX A;  4GUN A;  5B1B B;  2EIJ C;  1DF5 A;  1I0H A;  1IBK B;  1PM9 A;  2X0L A;  3EHB B;  1MA1 A;  1XMO B;  3E22 A;  3CC7 V;  1I5Y A;  3JAL A;  4P9O A;  3SYQ A;  1I7F A;  4J7K A;  1YTF D;  4GCZ A;  4ZOL B;  2CUG A;  4JI4 B;  4CH3 A;  3RVZ A;  2Y69 C;  4LFC O;  1O9H A;  2DYS B;  2DYS C;  5GTI Z;  3K04 A;  4RWU A;  4B3T O;  4KL1 A;  2CH7 A;  3RYF B;  5H6R A;  4IHJ A;  4Z2W A;  4JZG A;  4P2Z A;  2OCC B;  1N0N A;  5LXT A;  1B6Q A;  3CPW U;  1W2B U;  4X65 O;  2QWQ B;  3BFR A;  3A0R A;  4TT3 G;  4WFH A;  1H2S B;  3LSQ A;  3ZJZ A;  1SC5 B;  5TIS Z;  1SQQ H;  1KKC A;  2AHY A;  2LGW A;  1BE3 H;  3GVM A;  1L0L H;  4IIJ B;  4GZR B;  3THO A;  2GTS A;  1XHX A;  3FB5 C;  3SJA C;  2QM8 A;  3ABT A;  3FFQ A;  3G67 A;  1F4M A;  1JPX A;  3CRM A;  3L73 H;  4OGQ B;  3K5L A;  2EZP A;  4X88 A;  3CCV V;  3F5T A;  4O4J A;  4JAU A;  2UXD O;  2P7T C;  1S77 D;  2ZNJ A;  2JJ1 G;  1VQ7 V;  1TUE B;  2X6B A;  2ZKO A;  4H13 B;  5LA6 B;  4FLU A;  4NR1 A;  4P9P A;  2XAH A;  1M57 B;  4DR6 O;  2Q8V A;  4FFB A;  4FM2 A;  3FYE B;  4JI7 O;  1WPB A;  3B8N A;  4UVB A;  5CA3 A;  3LUT B;  1YDX A;  1KD1 W;  2OIG A;  4JI7 B; 
#chains in the Genus database with same CATH homology
 3S3W A;  2FB5 A;  3N27 A;  4FZ1 A;  2QTS A;  1WP7 A;  4FZ0 A;  4NTX A;  3S3X A;  4NTY A;  4NTW A;  3IJ4 A;  2L35 A;  4NYK A;  1WP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...