1YJWV

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yjwV00
3CXCU 3CCUV 3CC4V 3CC7V 3CCQV 2OTJV 3CCJV 5DM6V 3CCSV 1YJ9V 3CC2V 1NJIW 3G6EV 3CMAV 1VQLV 3G4SV 1KC8W 2QA4V 3CCRV 1S72V 1R73A 1VQ5V 1VQ6V 1VQ7V 4WCEV 3I55V 1YJNV 1VQ8V 3G71V 3CCEV 2QEXV 1N8RW 1K9MW 1K8AW 1YIJV 4WFBV 1Q82W 3I56V 1QVGU 1YI2V 3CD6V 3CCMV 1YITV 1VQKV 1M1KW 1K73W 1M90W 1VQ9V 3OW2U 1Q7YW 4WFAV 1JJ2U 1VQMV 1YJWV 1QVFU 1VQNV 1Q81W 1KD1W 3CMEV 4WF9V 1YHQV 2OTLV 1VQPV 1VQOV 3CCLV 3CPWU 2D3OW 1KQSU 1VQ4V 3CCVV 1Q86W 1W2BU
chains in the Genus database with same CATH superfamily
2F93B 2B9ZA 3ZRWB 1DLBA 1MZFA 5B1OA 1ZL8A 2X7RB 2CGNA 2CTPA 3HPLC 3T1YB 5KX5A 1S0VA 3SPGA 3QO7A 3BHPA 4LF8O 4DV4O 2KQXA 1NQTA 1RPRA 3QO5A 1K34A 4OPHA 3TK1A 1GAXA 4YJ2A 4X64B 3VQVA 1RSOA 2N05A 4TQDA 4JI5B 2BE3A 2L6LA 2Y0IA 4J10A 4LF6B 1GK9A 4LF4O 3G67A 3EFFK 3JALA 4U3JB 1GMGA 1QR8A 2EIKC 3OTOO 3SJCC 4DV3O 1NBMG 1YF2A 4LFAO 1M56B 2QKCA 4JAVA 3IJ4A 4TV9A 4PD4F 5KAIZ 2UU9O 3A8TA 1ZUQA 5H9CA 3G4SV 1K5QA 4FLTA 3ZN1A 3CRMA 1IBMB 2Y69C 4MVOA 2V1DA 4LR3A 2LJ2A 2DYRC 4FK5C 2EIJC 4PDMA 3RYFA 3SJBC 1N0NA 3ASOC 4J7KA 2QGNA 2Q5ZA 2GHYA 1M4UA 3DXRB 4O2AA 4B08A 5C8YB 3F7VC 3B2EE 2ODMA 2ZNIA 1GN3A 1AI5A 3JYCA 1JPXA 3OUSA 1GN2A 5LOVA 4MW3A 1W0KG 4DR7B 4FLZA 3A0RA 4FLWA 2FYUH 1YJNV 2E76B 2BOBC 4EB6B 1FJGB 3ZMZA 4JI0B 4LWSB 3RVYA 3O65A 1K4DC 3CXHF 3ZMVA 1PPJH 1H2SB 4MTOA 5KHIA 4H33A 4UCOA 4G28B 3JD0A 4C7UA 2QM4A 5BY1A 4LP8A 1JFFB 4GKKB 3X2QB 4H37A 1WP7A 4JI5O 4LF6O 1WJZA 1AI7A 1VQNV 2EBOA 1JX9A 1UFIA 4F4LA 3QTCA 4HYOA 4DR2B 3N2GA 4I0XA 2IU0A 3CCUV 1K4CC 2Q7GA 2ZDIA 4OXSA 1YDXA 4ZI7A 1KBHA 1Y67A 4NXMB 1PL4A 1M9NA 3AG4B 1FS0G 2YUAA 4O2BB 5KMGB 2A7WA 4DV1B 2YEVB 1IBMO 2HKOA 4GX5A 1IXMA 1M1KW 4X20A 2R9IA 5IJ9A 1M57B 2HEPA 3JAKA 1G8MA 5GONA 1BGYH 3RGBA 3I5DA 2PY5A 4QE7A 2ZINA 4RQEA 5EIBD 2BTQB 3F7YC 1XHZA 4JV5B 3LDCA 5LHIA 1COWG 3O9OA 3CCRV 2DMXA 4O4HB 4J9ZB 3OEHG 1SQQH 3RYCA 4DR3B 4F6RB 4DR7O 4J41A 3ETGA 3B77A 2CTQA 2K1EA 1FJGO 1QCEA 1ROPA 3OGIB 3CYOA 2Q67A 4JI0O 1TUEB 3AG1C 3B40A 3ABKB 4B7KA 3E2EA 4WFEA 4ZHQB 3W7WA 4U3FH 3BY6A 4FIPC 3K58A 1AILA 3CCMV 5IE9A 2PTMA 4QGPA 3JAWA 3JAMN 2WLHA 4RQFA 2XAFA 4CC5A 5HFMA 4DV7B 4DR2O 2JS3A 2RN9A 3OTFA 1FAFA 4NXMO 1Q82W 1BS3A 4J9YB 1WN7A 2EIKB 1FKAO 3R66A 4DV1O 1JJ2U 1FXKB 4IYHA 2QDOA 2R70A 4UCUA 3HKBA 1KKCA 1PNMA 2QM7A 4GT1A 3NR7A 3RFRA 2HLDG 2Q8VA 1R6KA 2Y69B 4JV5O 1E79G 4OX9B 1SF9A 3J80N 2DYRB 1XILA 2EIJB 1WLEA 1WNSA 4DR1B 3ASOB 3BRCA 3P3NA 2WLLB 4QE9A 2CTRA 5HFLA 4DR3O 1W2BU 1XNRB 1SZTA 4X1IA 2ZE8A 5L3BA 2AZ2A 3LUTB 2QWOB 3N2KA 5FPRA 4MVZA 1IX9A 5LMUB 4YIOA 3RYFB 2YIAA 3C90A 4UCRA 4UUJC 2UXDB 3OMAB 4LFCB 4IT5A 1S77D 1R6NA 1SQVH 1EZJA 1R3JC 2D3OW 5J9PC 2JIZG 1KP2A 4K35A 1THZA 4PHZA 3FD9A 1SZXA 1HWYA 4DW1A 1Y6XA 3FYIB 3HKCB 2GSMB 4DV7O 3ZRVA 3JASB 4QNHB 1VQ9V 1DGSA 1GKFA 3PN1A 3OD4A 5LA6B 1K7DA 4I50B 1AI6A 2HR3A 2MK3A 1AR4A 3IFXA 3KG2A 5EBWC 2XAJA 4HNAB 4O4IA 4KL1A 2WLNA 2WA3A 1M5IA 2Q0OC 4OX9O 1YJWV 2AHYA 4X9QA 3MHHC 3LSUA 4DR1O 1OHHG 1SKVA 3QF7A 3UO2A 1Q86W 3CC2V 2AXTZ 1YCIA 1XNRO 1R73A 3ZRWA 1HNXB 2W0XA 4NR1A 2W6JG 1SA0B 3ABMC 3U0ZA 1K97A 1B04A 3RWRD 4CS4A 2BTOA 1VEWA 3STLC 3E83A 2UXDO 1J95A 4LFCO 2HJFC 2WLIB 3AG1B 2JEXA 2A0LA 2N04A 2QA4V 3OR6C 5IDJA 4MW8A 1UJWB 2JJ2G 1GO3F 4D7SA 1L0NH 3AEIA 4TWKA 4U3JA 2CGOA 2YXHA 4NTXA 2P67A 1VQOV 4FLUA 1ENVA 2IM9A 1R3LC 3IC9A 1SRYA 1NH2B 2ADQB 2P7TC 2F23A 2PZSA 4B3TB 2KG7B 5CA3A 1PL0A 1T5EA 1QVGU 1NI8A 5KUKA 5LGTA 1YITV 3WB1A 2DN9A 2UUCB 4RUEA 5AG2A 4MVMA 5EZYB 1DK1A 2YS8A 3DXRA 2HHHB 3MD0A 5C8YA 3CCVV 1US6A 5FPOA 2XAQA 2LW7A 5FLXN 3QNEA 5JJJB 4DR4B 1OZ0A 3P32A 3H01A 4EB6A 1HNXO 4JYCA 4MVSA 5BR8O 1FFTB 5CBGA 2WSSG 3TXSA 3HKBB 5LHGA 4LWSA 1TVKB 4EFEA 5BXZA 3CB2A 1Q43A 4DYLA 2EJRA 4TUYB 1JFFA 1H2MA 5C93A 3WG7C 1Y66A 4R8CA 3SYOA 2IBZH 3W7UA 3IC7A 3E8GA 2ZM6B 4KFMA 1P7BA 4BR6A 1YXBA 1OJHA 2IJJA 4X65B 3T2MA 2YC0A 1WB7A 4UB6Z 3CMAV 2LP7A 1KUQA 4O4JB 4FM2A 1YTFD 4JI3B 2JEUA 4O2BA 4EEQA 2CAZC 4LC1A 1A32A 3SYAA 4B3TO 2ETNA 3ZIAG 2YEVA 3LNMB 3UCSC 2G38A 2DW4A 2UUCO 4E4EA 4IHJB 2JJ1G 1MNGA 2HHHO 4MT8A 1QNMA 2BTQA 3AK1A 1VQ5V 2DQ0A 2V4DA 3WFVA 4E2LA 1KMIZ 2P4KA 3K08A 2VWKA 4O4HA 1TA8A 1ZLZA 2LFSA 4DR4O 3CS5A 1YTFB 4F6RA 4KXRA 1XL6A 1KECA 1D2DA 1KQSU 1WPBA 2FKXA 1V55C 2UXNA 4ZHQA 4R50A 2QSAA 2CH7B 1RFYA 4WFBV 3ABMB 4UVCA 5B1NA 5H6QA 1ZWIC 1M90W 4JAUA 4TQFA 2ADPA 5JVDB 3HKDB 2Z0AA 4AILC 4JTCB 2ZM6O 1W59A 2FL4A 3CCJV 1Z5WA 2YSUB 3UT5B 4K8XA 2L35A 4X65O 3FX7A 2X6AA 2Z5UA 3ZRSA 1VQ7V 5JH7B 3CRRA 3ZS8C 3ZEDA 4FFBB 4BIZA 4FZ1A 2EZOA 2HVKC 4UCTA 5DN6G 4JI3O 3F5TA 3K03A 5L3EA 1FXKA 2YXLA 1LR1A 4UCSA 2ITCC 4X1KB 2CUGA 1EN4A 1I08A 1QHTA 4JAAA 2QWQB 3OW2U 2WLLA 2DJVA 2HFEC 1B3QA 1Q6UA 1AI4A 3L73H 3DSQA 2Q0AA 1XREA 3STZC 3I55V 3DC5A 3AG2C 1H2NA 4JPRA 4DUYB 1OV9A 2FMLA 1WB8A 3ZMUA 3BCCH 3FB8C 5GTIZ 5L3FA 1IDSA 5IYZB 3B8MA 4OPAA 2KSDA 3T1HB 5DM6V 1XEQA 2WLMA 3AK3A 4HAMA 4CZZA 2PYJA 2YI8A 2AGAA 1MMMA 1VF6C 1NTMH 1P84F 3VQWA 4DW0A 4YIPA 3HKCA 3WG7B 4JZ2A 2IJKA 4NYKA 1P7GA 3JD2A 4GX2A 2HP8A 3JASA 1F4MA 4I55B 3T1YO 2RQ6A 4UVAA 3CXCU 1E1QG 2XASA 5LA6A 4I50A 1Q6IA 1NTZH 4JASA 3SPCA 2A79B 4X64O 3L70H 4CS2A 4H0LB 1OCRB 3H1KH 4HNAA 2C2AA 5CBFA 1GTOA 1KD1W 1PP9H 4L87A 4FMTA 1NVPB 4BWAA 2R9AA 5A9GA 2OT5A 3ABUA 3TXQA 1TUBB 4KP4A 2JDIG 1BSMA 3UM7A 1SA0A 1JMKC 4YXWG 4LF5B 2AZ0A 4B3RB 1GRJA 4PA6A 3H1HH 1QVFU 4RAIA 4F6EA 2YXYA 4DUYO 4X1YB 5LHHA 3ZRXA 2PI5A 3JATB 1AP5A 4PA4A 1V55B 2WLIA 3T1HO 1NU1H 4PI2A 1AJQA 3CRAA 1ZSPA 3SJQC 1N33B 5IJ0B 4MVRA 4KUMA 3D8CA 3OEEG 3TGUH 2ZE7A 1I94B 2OCCC 3BA9A 2HJDA 1WPXA 2PUSA 1AROP 4K0KB 2VS0A 5L3GA 4CH6A 2DWEC 4X89A 2GDSA 2KG7A 1Y74B 3CD6V 2B5UA 2ZD9A 2XOKG 1QLEC 4GKKO 1AP6A 5CA0B 2KKWA 2GUZB 2OTLV 1Q5OA 3CCLV 4FVMA 5EZYA 4TT3G 1EZVH 3VBBA 4CH3A 2CDYA 3H1LH 2YICA 1Y76B 4X62B 1UPGA 5LMNB 3CX5F 5CN0A 2ZKOA 4LF5O 2EZPA 4B3RO 1U96A 4CS3A 2MW2B 3RYIB 1TVKA 3K5OA 4I4TB 5EYPB 3P30A 1WP8A 3WU2Z 5KAFZ 4IL6Z 2M6YA 2HG5C 3CHXA 4FPPA 4TUYA 3JD3A 1LUVA 4YJ3B 3JCUZ 3OUFA 3GVMA 1H2LA 1N33O 4BAYA 2QWRB 3K06A 2OTJV 1K5SA 1I94O 3BABA 3FYEB 5JQGB 1Q3EA 1BQZA 4K0KO 4O4JA 4DUZB 4Z1VA 3HKEB 3DC6A 1EN6A 3NXSA 4JF3A 4NB5A 4XDKA 2QTSA 2CTWA 2ZQMA 5KLVH 2QE7G 4WF9V 1BMFG 5LP6C 4TOIA 3KKYA 5B1AC 1WA8B 1SETA 4YHHB 1L0LH 3U11A 2OIEA 1NJIW 4IHJA 3D3IA 5GW7A 2F4VB 2X6CA 5BMVB 1XHXA 1CPYA 1ZX3A 1YSCA 1D5AA 1GM8A 4JI2B 4I9QA 1I0HA 1NR1A 1MSDA 5LL6Y 5CMUA 3AK2A 5LMNO 3E86A 4GX1A 3CJHB 2IH1C 3CWBH 2XAHA 3APQA 4ZOLB 3T1CA 4DRXB 4WBNB 1Z5VA 4XBFA 1IBKB 1TAEA 3KCXA 4I7ZB 4ZBMA 3JSNA 4QPKA 1BQ0A 3E22B 4U7OA 2ZNJA 4RWUA 3M8AA 4TSFG 4L8JA 1K8AW 1EM1A 2EILC 2CH7A 2RJZA 4KHPB 1VQKV 3CE2A 1Q7YW 1G4YB 1XMOB 2ZR3A 1J5EB 3K5LA 1IVSA 1MA1A 4MTFA 4FLVA 5JVDA 3HKDA 5FNVB 1XUQA 1HP8A 2V7QG 3C3SA 2R72A 4G27B 4EKWA 3FB6C 3UT5A 4U7NA 2UXXA 4UV9A 4FM1A 5CB4B 3RYHA 3L75H 5JH7A 1PKXA 2ATKC 1TGOA 4IGGA 4FFBA 4JYYA 5LMUO 4DUZO 1IXBA 2P4VA 4JTAB 1NH2D 3BFRA 3E8HA 2EX3A 2OCCB 3SYQA 1Q90D 3ZMTA 3ICXA 1KB9F 3CRQA 4D6TH 2DYSC 4YHHO 4X1KA 4NXNB 4Q20A 3JD1A 2F4VO 1SESA 1K73W 3EXAA 5EC1C 1QLEB 4PJ0Z 2JGDA 2Q9LA 4JI2O 2LQTA 4CBCA 1AJPA 1IZ3A 2QWPB 2AW9A 1JA8A 1L1FA 1BZKA 5IWAB 1S72V 4DV0B 1K33A 1IBKO 5KA6A 3ZHQA 4AI8A 3WB2A 4BW9A 3WB0A 2P6JA 3JSLA 2NLJC 2O57A 4H44B 4LBEC 4KHPO 4QIWF 1Y4MA 3B8NA 2LFRA 1MOFA 5IYZA 1XMOO 1J5EO 1F23A 3CCSV 1S3JA 4UCVA 2UUAB 1YZBA 2XT9A 1H38A 2QEXV 3TETA 1QQCA 3QO8A 2H8PC 2HVJC 2IW5A 2F66C 4Z2WA 4J80A 4UFZA 5BZBA 2OYQA 2QJ1A 5IT9N 4I55A 4JI4B 5KA5A 5JCOC 4JI7B 2E3CA 4DV2B 4FJCC 5B5EZ 2CE4A 1V9PA 2AHZA 5L3DA 5B1BC 1F7YA 3JARB 3UQ8A 2H3OA 2VWJA 3THOA 5B3SC 4TV8B 4DR6B 1I5XA 1IBLB 3FAVB 1R3KC 3W7SA 3W7XA 1CP9A 1NT2B 4NXNO 5KHGA 1HR0B 3MHSC 1XI1A 2F95B 3A0BZ 2LW1A 4LNUB 4JZGA 5LP6B 5B1AB 4DK0A 2DWDC 3EVKA 3H1JH 4QJFB 2K9PA 2Z3YA 3VQYA 1SQPH 4ICGA 1VARA 1JQ0A 4LF9B 2ZR2A 1K9MW 2BSKB 1SQGA 4UB8Z 4CH4A 5IWAO 4PA3A 4DV0O 1DTOA 1TUBA 5H5NA 2VRZA 4BIUA 5IYCO 4PA9A 1SERA 4W4KA 4WFGA 1JOYA 2YIBA 2QM8A 1F51A 4CH5A 4X1YA 4GX0A 3OT7A 1NTKH 4LF8B 1P49A 3JATA 3OMNB 2IJHA 2A06H 3OAAG 3OGCC 1N36B 3ABLC 4I9WA 5IYDO 4LCUC 5IJ0A 4MVUA 4QPJA 1L8DA 2P90A 3SYPA 4X66B 1G1XB 2QTOA 5FL7G 2NN4A 1RM1C 1VMGA 3G6EV 5TISZ 1XNQB 4JI4O 4PDVA 4WFHA 1PNLA 3A0HZ 1JCHA 4JI7O 4DV2O 1DF4A 2IJIA 2ILMA 3SYCA 3KCYA 5JWPA 1Y74A 3FB7C 1Q81W 1MG1A 3SR2C 1VF7A 2Q4PA 1P4RA 3L9DA 5CA0A 4DR6O 1EFRG 1FFXB 1IBLO 4DXWA 2GUZA 4HBNA 4NTYA 4LH7A 1HR0O 1KU9A 4A5UB 3RYHB 4FLXA 2DYSB 1D5NA 2IU3A 1Y76A 1R6TA 1G6UA 3B09A 5J2UB 4LF9O 4ABMA 5LXTB 1VQPV 3K79A 2WA4A 4B3SB 3B4SA 5H2FZ 5LYJB 3U10A 1DF5A 3D36C 2LGQA 1VF5B 1YJ9V 3RYIA 5EIBC 2P06A 3S3XA 3MAQA 1S5HC 3N27A 4I4TA 5EYPA 4BW5A 3ETQA 1YEWA 3FB5C 3Q4HB 2RDCA 1VP7A 2UUBB 2JGDB 4GYCB 4YJ3A 4P9OA 4PA7A 1N36O 5CA1B 1BE3H 4ZKIA 1GN6A 4N23A 2YDEA 3K04A 3SDLA 4X66O 4LH6A 5ITZB 4WCEV 3J81N 2FTKA 2VQEB 5JQGA 1XNQO 3K5NA 2EIMC 1I5YA 1VF6A 1FXKC 3HKEA 3BAAA 1JR9A 3K59A 2PI4A 3CMEV 5K1PA 1FXHA 5EC2C 1KYOF 4R7CA 3QVNA 1S5LZ 3H1IH 5IYBO 1FXVA 1WA8A 2Q7EA 1SC5B 1AB3A 1B06A 1KKDA 5BMVA 4JTDB 5B1BB 4B3MB 3ZHSA 1H2KA 2W0FC 5B3SB 4UVBA 1NVPD 2GBOA 5EBLC 3CJHA 4ZOLA 2ZIOA 3KZIZ 4B7EA 4DRXA 2E75B 4WBNA 1MABG 3CEIA 3BPZA 3ETEA 1NS1A 4FFKA 1Q6HA 1XDCA 2YIDA 2LO1A 2WWWA 3AG7A 1N4CA 4B3SO 5B66Z 1HNWB 3E8BA 3E22A 1O9HA 3G6BA 2Q73A 2YIBD 3UO3A 2E5LB 1WAZA 1PNKA 3LDDA 1NZ6A 3GWOA 3FFQA 2P5OA 3BVOA 2F43G 1MZEA 1I7FA 2W6IG 2UUBO 2A9HA 2EULA 1KC8W 5FNVA 5A2QN 2WLKA 3IGAC 1YVWA 2XUMA 2ZXWC 5CB4A 1GM7A 3ABLB 2DOSA 3ZHUA 2VQEO 2DQ3A 4JYBA 3TJTA 2N74A 1GH6A 3DTUB 5DEDA 1EN5A 5H6RA 5J2TB 1QLNA 1RM1B 4GCZA 5E1AC 4LFBB 4GLXA 4OGQB 4J42A 5K1XA 1ZAUA 1AJNA 4MS2A 5JJNB 3LSQA 4LF7B 1LNQA 2GV9A 3ZX6A 4B3MO 2GTAA 2ZDIC 5LGNA 2LGWA 3VQXA 3OFNG 3ZHVA 3L72H 3C3TA 1BHBA 1VQLV 4WFFA 2DE0X 3ZCCA 3F5WC 3ZBHA 3GWKC 3VOUA 2X6BA 4MTXA 1HNWO 4JI8B 4JYAB 4IIJB 2E5LO 1K3EA 5LBQA 4AHCA 4NKGB 1V54C 1SQXH 1HNZB 4DV5B 3T4DA 1URFA 1X4TA 1B6QA 3ABTA 1H8HG 1OCZC 3JCZA 5GTHZ 2B1IA 4PI0A 4W4LA 4HZ3A 4X8AA 3OM3B 3L71H 3D3QA 4YY3B 2ZE5A 2B1GA 3ZN0A 1ZL8B 2PGGA 2YI9A 5KX5B 1VQ8V 5JJEB 1K92A 4LFBO 1PM9A 4PDLA 2UXCB 3AG2B 1Q8IA 1ORQC 3AG3C 3JARA 4FZ0A 2EIMB 3GB7C 4I5SA 4PV1B 2QKAA 3ASNC 4TV8A 4AQYB 3ZHTA 3FAVA 1XQ8A 1YHQV 4YJ2B 4LF7O 3S3WA 1RSOB 5CBHA 2D2CB 3RT3C 5D5PA 3T4ZA 4LNUA 5LP6A 3K5MA 4DO2A 3LDEA 3JALB 3J7AU 4O4LA 3ZHRA 2BSKA 2XAGA 2A3QA 3K3WA 1VQMV 4TV9B 1AR5A 4DV6B 3PJSK 4BIOA 1KP3A 1RPOA 1QU7A 4JI8O 4JYAO 2NNUA 3APOA 2ZT9B 1N0JA 2M7WA 4DR5B 1AVMA 2Q69A 2CK3G 4JI1B 1HNZO 4DV5O 2XNDG 1OCOC 2PF4E 2UXBB 4O2AB 4DK1A 2WPDG 4X62O 2Y4TA 1OCCC 3A2FA 3HR0A 1XMQB 4GKJB 4NTWA 1N34B 1GM9A 5LOVB 3H9VA 4YY3O 4MTGA 5KHKA 2Q68A 1N32B 2H94A 4ZIBA 2NR5A 2ZXWB 3SGIA 2JK5C 1GN4A 4P30A 1H2GA 2XHBA 2UXCO 4AQYO 1FFXA 3LNNA 3SJAC 2GTSA 4PDRA 3OR7C 2ARHA 1PV0A 1FYJA 3I56V 4G2KA 1X59A 1FPOA 3UKMA 4N21A 3N2GB 3ETDA 4I0XB 5J2UA 4ZI7B 5LXTA 4J7ZA 1M93A 1E1RG 1CXZB 3K0DA 5EBMC 5EK0A 2JVDA 3K0GA 4Z1MG 1NKDA 4DV6O 5LYJA 2RCVA 4GUNA 4K3AA 5BR8B 3QG5A 4IYIA 1XL4A 3HB3B 5E79Z 1YIJV 4X20B 4DR5O 1ZTEA 3L74H 5IJ9B 3CRCA 3JAKB 4J7JA 5DECA 5GONB 4JI1O 4EFBA 5IY5C 3Q4HA 1SQFA 2QR4A 2UXBO 3OMIB 1BCCH 2EINC 1F4NA 3CPWU 5CA1A 1V54B 1S5JA 3EHBB 2WLJA 1XMQO 2RMKB 4GKJO 3ZJZA 4UV8A 1N34O 3MDSA 3RYCB 2ZCEA 5L3CA 5ITZA 3BA8A 1OCZB 1JVMA 1QR9A 2QWNB 1N32O 4P2ZA 2VQFB 4FLYA 1NR7A 1U97A 3SPIA 4MSWC 1IURA 1SS3A 2P22C 2X0LA 5JCOA 3CCEV 2KB1A 2OWOA 1VIBA 4X88A 5KUMA 4RUFA 2OIGA 3AG3B 3JAWB 4RO2A 2EJ7A 1M56C 3ASNB 4H13B 3TCUA 1AR1B 3DGEA 2OCHA 4FM0A 2R9RB 5F2VO 3LSSA 4JI6B 3BEHA 1Z2GA 3W7TA 4Q6GA 1YI2V 2WAMA 4K8ZA 2Y48A 1XBLA 2Y4UA 3P3PA 4R6ZA 3CC4V 3SPHA 3CCQV 3M99B 4ASUG 4NVPA 4O4LB 2ZE6A 1VQ6V 2PYLA 1OCOB 2JGUA 3M7MX 1LUWA 3RBZA 1OCCB 4X1IB 1BHAA 3N2KB 3R65A 1BL8A 2VQFO 1RP3B 3E8FA 1QBZA 3K57A 2ZIMA 3E35A 4JGSA 5J2TA 3X2QC 4DV4B 1N8RW 5KMGA 1OCRC 2Y0PA 3K9SA 2UUAO 2EILB 3JD4A 2QKSA 1BT8A 4XDJA 4D7TA 5LGUA 3ZMSA 1VQ4V 4UXNA 2ITDC 3RVZA 1H8EG 4LF4B 4XDLA 1JJOA 3AG4C 1PD3A 1HDJA 1FD9A 1XOUA 3OTOB 1W0JG 1CEZA 4DV3B 3G71V 3RN4A 2Q6AA 4LFAB 2E74B 4P9PA 3RW0A 5D5QA 4JI6O 2FB5A 1O9GA 5KHJA 2Q7HA 1M57C 3FKSG 4WFAV 3CSXA 2UU9B 1S76D 1R3IC 4IIJA 2F1MA 2JRIA 3IAYA 3CC7V 1MSWD 2BOCC 1EBOA 4CC6A 2RNBA 3SPJA 3D36A 3ML0A 1HW7A 1SQBH 5KHHA 3K9AA 4O4IB 3G80A 2BCCH 2JS5A 3CP1A 2IH3C 4PELA 1R1BA 3OE7G 3E89A 5IY5B 4J11A 4MVQA 4GZRB 2XTAA 2EINB 3ABKC
chains in the Genus database with same CATH topology
5H6RA 1SETA 1QLNA 1RM1B 3ZRWB 4GCZA 5E1AC 1DLBA 2XAQA 1NJIW 3D3IA 5GW7A 2X6CA 5B1OA 2X7RB 3QNEA 1CPYA 1YSCA 3HPLC 1OZ0A 1GM8A 3P32A 1S0VA 3SPGA 3QO7A 1AJNA 3H01A 1NR1A 4MS2A 3LSQA 5CMUA 4JYCA 1NQTA 4MVSA 1RPRA 1FFTB 1LNQA 5CBGA 2WSSG 3QO5A 3E86A 4GX1A 2IH1C 3T1CA 2XAHA 1K34A 2ZDIC 3TK1A 5LHGA 5LGNA 3OFNG 4XBFA 4ZBMA 4QPKA 1BHBA 1VQLV 4WFFA 4U7OA 3ZCCA 2EJRA 3F5WC 1GK9A 3VOUA 4TSFG 1K8AW 3EFFK 5C93A 2X6BA 3WG7C 1GMGA 2EILC 4MTXA 1QR8A 1Y66A 2EIKC 1VQKV 4R8CA 3SYOA 3W7UA 1NBMG 3IC7A 1Q7YW 3E8GA 4KFMA 1G4YB 1P7BA 2ZR3A 1M56B 4JAVA 1K3EA 2IJJA 5LBQA 4MTFA 3T2MA 1V54C 2V7QG 5H9CA 4G27B 4EKWA 3T4DA 3CMAV 3G4SV 1K5QA 2LP7A 3ZN1A 3FB6C 2Y69C 4U7NA 4MVOA 2V1DA 1YTFD 1B6QA 2UXXA 4UV9A 2JEUA 2DYRC 3ABTA 1H8HG 4FK5C 1OCZC 2EIJC 4PDMA 1PKXA 3JCZA 4LC1A 2ATKC 3ASOC 2B1IA 3SYAA 2GHYA 4HZ3A 4X8AA 3ZIAG 2YEVA 3LNMB 3OM3B 4JTAB 1NH2D 2DW4A 3F7VC 3E8HA 1AI5A 2OCCB 3SYQA 3JYCA 1JPXA 2B1GA 2JJ1G 3ZN0A 3OUSA 4MT8A 4MW3A 3ZMTA 1W0KG 1VQ5V 2DQ0A 3A0RA 3WFVA 4E2LA 1YJNV 1VQ8V 2DYSC 1K92A 2BOBC 4Q20A 3JD1A 3K08A 1SESA 4PDLA 3AG2B 3AG3C 1ORQC 4I5SA 3ZMZA 2EIMB 2LFSA 3GB7C 1K73W 1YTFB 5EC1C 1QLEB 3ASNC 1XL6A 1KECA 3RVYA 1K4DC 1YHQV 3ZMVA 4CBCA 1AJPA 1KQSU 5CBHA 4MTOA 1L1FA 4H33A 4G28B 1V55C 3JD0A 3T4ZA 2UXNA 4LP8A 4DO2A 3LDEA 1S72V 3CCVV 1K33A 5KA6A 4R50A 4H37A 3X2QB 4WFBV 3ABMB 4UVCA 5B1NA 2XAGA 5H6QA 1AI7A 1ZWIC 2P6JA 3K3WA 2NLJC 1M90W 1VQNV 1VQMV 2EBOA 1JX9A 4JAUA 3PJSK 4F4LA 4LBEC 4QIWF 1KP3A 1Y4MA 3B8NA 4HYOA 4JTCB 2LFRA 1MOFA 1RPOA 2IU0A 3CCUV 1K4CC 1F23A 2NNUA 2ZDIA 4OXSA 3CCJV 3CCSV 2YSUB 1S3JA 1M9NA 2M7WA 3AG4B 1FS0G 2X6AA 2Z5UA 3ZRSA 1VQ7V 1H38A 2Q69A 2CK3G 2QEXV 2XNDG 3TETA 1OCOC 4BIZA 2YEVB 2EZOA 3QO8A 2HKOA 4GX5A 1IXMA 1M1KW 2HVKC 2H8PC 2WPDG 5DN6G 2HVJC 2R9IA 2IW5A 1M57B 1OCCC 1G8MA 5BZBA 3K03A 5L3EA 1FXKA 4QE7A 5KA5A 4RQEA 3F7YC 1GM9A 3LDCA 2ITCC 5LHIA 4FJCC 1COWG 3CCRV 4MTGA 2AHZA 5L3DA 5B1BC 4J9ZB 3OEHG 2Q68A 2H94A 5B3SC 2ZXWB 2JK5C 1I5XA 4P30A 3ETGA 1H2GA 1R3KC 3B77A 3W7SA 1CP9A 3W7XA 3OW2U 2K1EA 2WLLA 3MHSC 1QCEA 2HFEC 1ROPA 3CYOA 2Q67A 1AI4A 1TUEB 3AG1C 5B1AB 3ABKB 3E2EA 2DWDC 4WFEA 4QJFB 3W7WA 2Z3YA 3BY6A 4PDRA 3OR7C 3STZC 4FIPC 1JQ0A 3I55V 2ZR2A 1K9MW 3AG2C 4JPRA 3I56V 4PA3A 1DTOA 3CCMV 3ZMUA 4BIUA 3FB8C 4G2KA 5IYCO 4PA9A 1SERA 5L3FA 3UKMA 4N21A 3ETDA 4WFGA 3B8MA 1JOYA 2WLHA 4RQFA 2QM8A 2XAFA 1F51A 4GX0A 1E1RG 3K0DA 5EK0A 5EBMC 4Z1MG 5HFMA 3K0GA 5DM6V 1NKDA 2WLMA 4HAMA 4CZZA 3OMNB 2IJHA 1XL4A 3HB3B 3OAAG 1YIJV 1Q82W 3OGCC 4J9YB 3ABLC 3WG7B 4I9WA 2IJKA 2EIKB 3JD2A 4GX2A 5IYDO 5IY5C 1JJ2U 1FXKB 4LCUC 1F4MA 4MVUA 4QPJA 3OMIB 2P90A 3SYPA 2EINC 1F4NA 3CPWU 4UVAA 2QTOA 5FL7G 3CXCU 1PNMA 2QM7A 1RM1C 4GT1A 1V54B 1E1QG 3EHBB 3G6EV 2XASA 2WLJA 4PDVA 4WFHA 3ZJZA 4UV8A 1PNLA 2HLDG 1R6KA 2Y69B 1E79G 1JCHA 4JASA 2A79B 3SPCA 5L3CA 2DYRB 1DF4A 2IJIA 1OCZB 3SYCA 2EIJB 1JVMA 1WLEA 1QR9A 3ASOB 4QE9A 2WLLB 1OCRB 5HFLA 2C2AA 5CBFA 1GTOA 3FB7C 1Q81W 1MG1A 4P2ZA 1KD1W 1NR7A 1P4RA 4L87A 1W2BU 1EFRG 4DXWA 3SPIA 1SZTA 5L3BA 4MSWC 4FMTA 3LUTB 1NVPB 2X0LA 4MVZA 3CCEV 2KB1A 2OT5A 3ABUA 2DYSB 2IU3A 4KP4A 2JDIG 3UM7A 4X88A 5KUMA 4UUJC 4RUFA 4YXWG 3OMAB 3AG3B 4RO2A 4PA6A 1M56C 1QVFU 4RAIA 1S77D 3ASNB 1R6NA 3TCUA 1VQPV 1EZJA 5LHHA 1AR1B 1R3JC 3DGEA 5J9PC 3K79A 2D3OW 2JIZG 1KP2A 3ZRXA 2PI5A 1THZA 1DF5A 2R9RB 1YJ9V 1HWYA 4PA4A 1V55B 2WLIA 3LSSA 3BEHA 1S5HC 3FYIB 4BW5A 2GSMB 3W7TA 3ZRVA 1AJQA 3FB5C 3SJQC 1YI2V 4MVRA 4QNHB 4KUMA 1VQ9V 2WAMA 4P9OA 2Y48A 3OEEG 4PA7A 1GKFA 2OCCC 4ZKIA 1WPXA 4N23A 1AROP 4R6ZA 3CC4V 3SPHA 3K04A 1K7DA 3CCQV 5L3GA 3M99B 4ASUG 1AI6A 1VQ6V 2DWEC 2HR3A 2MK3A 4WCEV 4X89A 2FTKA 3IFXA 3KG2A 5EBWC 2XAJA 1OCOB 2EIMC 3CD6V 2B5UA 1I5YA 1FXKC 2WLNA 2ZD9A 2XOKG 1QLEC 1YJWV 2AHYA 3MHHC 2PI4A 3CMEV 3RBZA 2OTLV 1FXHA 5EC2C 1OCCB 1OHHG 4R7CA 3CCLV 1BHAA 4TT3G 1Q86W 3VBBA 3R65A 5IYBO 1BL8A 3CC2V 3E8FA 1QBZA 1FXVA 3E35A 4JGSA 1R73A 3ZRWA 3X2QC 1KKDA 2W6JG 4JTDB 1N8RW 5B1BB 3ABMC 1K97A 1OCRC 5CN0A 2W0FC 5B3SB 2EILB 4UVBA 3JD4A 2QKSA 3STLC 4XDJA 3E83A 1NVPD 1J95A 5LGUA 2EZPA 3ZMSA 4UXNA 1VQ4V 2HJFC 5EBLC 2ITDC 3RVZA 2WLIB 1H8EG 3AG1B 1MABG 2A0LA 2JEXA 3ETEA 4XDLA 3AG4C 1PD3A 2QA4V 3OR6C 3P30A 2WWWA 5IDJA 4MW8A 1W0JG 3E8BA 1CEZA 1UJWB 3G71V 2HG5C 4FPPA 2Q6AA 2JJ2G 1GO3F 3RW0A 4P9PA 3JD3A 3AEIA 4TWKA 1PNKA 3LDDA 1M57C 3FKSG 4WFAV 3GWOA 3OUFA 1S76D 2F43G 2P67A 1VQOV 2W6IG 1ENVA 1R3IC 4BAYA 3K06A 2A9HA 1R3LC 3CC7V 1SRYA 1NH2B 2OTJV 2P7TC 1K5SA 1MSWD 2BOCC 1KC8W 1EBOA 2WLKA 3FYEB 3SPJA 3D36A 3IGAC 3ML0A 3K9AA 5CA3A 1PL0A 2ZXWC 1QVGU 5KUKA 1GM7A 3ABLB 3NXSA 4JF3A 5LGTA 3CP1A 2IH3C 4PELA 1YITV 4RUEA 4XDKA 4MVMA 2DQ3A 2ZQMA 3E89A 3OE7G 4JYBA 4MVQA 5IY5B 2QE7G 4WF9V 1BMFG 3MD0A 3DTUB 2EINB 5B1AC 3ABKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC U;  3CCU V;  3CC4 V;  3CC7 V;  3CCQ V;  2OTJ V;  3CCJ V;  5DM6 V;  3CCS V;  1YJ9 V;  3CC2 V;  1NJI W;  3G6E V;  3CMA V;  1VQL V;  3G4S V;  1KC8 W;  2QA4 V;  3CCR V;  1S72 V;  1R73 A;  1VQ5 V;  1VQ6 V;  1VQ7 V;  4WCE V;  3I55 V;  1YJN V;  1VQ8 V;  3G71 V;  3CCE V;  2QEX V;  1N8R W;  1K9M W;  1K8A W;  1YIJ V;  4WFB V;  1Q82 W;  3I56 V;  1QVG U;  1YI2 V;  3CD6 V;  3CCM V;  1YIT V;  1VQK V;  1M1K W;  1K73 W;  1M90 W;  1VQ9 V;  3OW2 U;  1Q7Y W;  4WFA V;  1JJ2 U;  1VQM V;  1YJW V;  1QVF U;  1VQN V;  1Q81 W;  1KD1 W;  3CME V;  4WF9 V;  1YHQ V;  2OTL V;  1VQP V;  1VQO V;  3CCL V;  3CPW U;  2D3O W;  1KQS U;  1VQ4 V;  3CCV V;  1Q86 W;  1W2B U; 
#chains in the Genus database with same CATH topology
 2F93 B;  2B9Z A;  3ZRW B;  1DLB A;  1MZF A;  5B1O A;  1ZL8 A;  2X7R B;  2CGN A;  2CTP A;  3HPL C;  3T1Y B;  5KX5 A;  1S0V A;  3SPG A;  3QO7 A;  3BHP A;  4LF8 O;  4DV4 O;  2KQX A;  1NQT A;  1RPR A;  3QO5 A;  1K34 A;  4OPH A;  3TK1 A;  1GAX A;  4YJ2 A;  4X64 B;  3VQV A;  1RSO A;  2N05 A;  4TQD A;  4JI5 B;  2BE3 A;  2L6L A;  2Y0I A;  4J10 A;  4LF6 B;  1GK9 A;  4LF4 O;  3G67 A;  3EFF K;  3JAL A;  4U3J B;  1GMG A;  1QR8 A;  2EIK C;  3OTO O;  3SJC C;  4DV3 O;  1NBM G;  1YF2 A;  4LFA O;  1M56 B;  2QKC A;  4JAV A;  3IJ4 A;  4TV9 A;  4PD4 F;  5KAI Z;  2UU9 O;  3A8T A;  1ZUQ A;  5H9C A;  3G4S V;  1K5Q A;  4FLT A;  3ZN1 A;  3CRM A;  1IBM B;  2Y69 C;  4MVO A;  2V1D A;  4LR3 A;  2LJ2 A;  2DYR C;  4FK5 C;  2EIJ C;  4PDM A;  3RYF A;  3SJB C;  1N0N A;  3ASO C;  4J7K A;  2QGN A;  2Q5Z A;  2GHY A;  1M4U A;  3DXR B;  4O2A A;  4B08 A;  5C8Y B;  3F7V C;  3B2E E;  2ODM A;  2ZNI A;  1GN3 A;  1AI5 A;  3JYC A;  1JPX A;  3OUS A;  1GN2 A;  5LOV A;  4MW3 A;  1W0K G;  4DR7 B;  4FLZ A;  3A0R A;  4FLW A;  2FYU H;  1YJN V;  2E76 B;  2BOB C;  4EB6 B;  1FJG B;  3ZMZ A;  4JI0 B;  4LWS B;  3RVY A;  3O65 A;  1K4D C;  3CXH F;  3ZMV A;  1PPJ H;  1H2S B;  4MTO A;  5KHI A;  4H33 A;  4UCO A;  4G28 B;  3JD0 A;  4C7U A;  2QM4 A;  5BY1 A;  4LP8 A;  1JFF B;  4GKK B;  3X2Q B;  4H37 A;  1WP7 A;  4JI5 O;  4LF6 O;  1WJZ A;  1AI7 A;  1VQN V;  2EBO A;  1JX9 A;  1UFI A;  4F4L A;  3QTC A;  4HYO A;  4DR2 B;  3N2G A;  4I0X A;  2IU0 A;  3CCU V;  1K4C C;  2Q7G A;  2ZDI A;  4OXS A;  1YDX A;  4ZI7 A;  1KBH A;  1Y67 A;  4NXM B;  1PL4 A;  1M9N A;  3AG4 B;  1FS0 G;  2YUA A;  4O2B B;  5KMG B;  2A7W A;  4DV1 B;  2YEV B;  1IBM O;  2HKO A;  4GX5 A;  1IXM A;  1M1K W;  4X20 A;  2R9I A;  5IJ9 A;  1M57 B;  2HEP A;  3JAK A;  1G8M A;  5GON A;  1BGY H;  3RGB A;  3I5D A;  2PY5 A;  4QE7 A;  2ZIN A;  4RQE A;  5EIB D;  2BTQ B;  3F7Y C;  1XHZ A;  4JV5 B;  3LDC A;  5LHI A;  1COW G;  3O9O A;  3CCR V;  2DMX A;  4O4H B;  4J9Z B;  3OEH G;  1SQQ H;  3RYC A;  4DR3 B;  4F6R B;  4DR7 O;  4J41 A;  3ETG A;  3B77 A;  2CTQ A;  2K1E A;  1FJG O;  1QCE A;  1ROP A;  3OGI B;  3CYO A;  2Q67 A;  4JI0 O;  1TUE B;  3AG1 C;  3B40 A;  3ABK B;  4B7K A;  3E2E A;  4WFE A;  4ZHQ B;  3W7W A;  4U3F H;  3BY6 A;  4FIP C;  3K58 A;  1AIL A;  3CCM V;  5IE9 A;  2PTM A;  4QGP A;  3JAW A;  3JAM N;  2WLH A;  4RQF A;  2XAF A;  4CC5 A;  5HFM A;  4DV7 B;  4DR2 O;  2JS3 A;  2RN9 A;  3OTF A;  1FAF A;  4NXM O;  1Q82 W;  1BS3 A;  4J9Y B;  1WN7 A;  2EIK B;  1FKA O;  3R66 A;  4DV1 O;  1JJ2 U;  1FXK B;  4IYH A;  2QDO A;  2R70 A;  4UCU A;  3HKB A;  1KKC A;  1PNM A;  2QM7 A;  4GT1 A;  3NR7 A;  3RFR A;  2HLD G;  2Q8V A;  1R6K A;  2Y69 B;  4JV5 O;  1E79 G;  4OX9 B;  1SF9 A;  3J80 N;  2DYR B;  1XIL A;  2EIJ B;  1WLE A;  1WNS A;  4DR1 B;  3ASO B;  3BRC A;  3P3N A;  2WLL B;  4QE9 A;  2CTR A;  5HFL A;  4DR3 O;  1W2B U;  1XNR B;  1SZT A;  4X1I A;  2ZE8 A;  5L3B A;  2AZ2 A;  3LUT B;  2QWO B;  3N2K A;  5FPR A;  4MVZ A;  1IX9 A;  5LMU B;  4YIO A;  3RYF B;  2YIA A;  3C90 A;  4UCR A;  4UUJ C;  2UXD B;  3OMA B;  4LFC B;  4IT5 A;  1S77 D;  1R6N A;  1SQV H;  1EZJ A;  1R3J C;  2D3O W;  5J9P C;  2JIZ G;  1KP2 A;  4K35 A;  1THZ A;  4PHZ A;  3FD9 A;  1SZX A;  1HWY A;  4DW1 A;  1Y6X A;  3FYI B;  3HKC B;  2GSM B;  4DV7 O;  3ZRV A;  3JAS B;  4QNH B;  1VQ9 V;  1DGS A;  1GKF A;  3PN1 A;  3OD4 A;  5LA6 B;  1K7D A;  4I50 B;  1AI6 A;  2HR3 A;  2MK3 A;  1AR4 A;  3IFX A;  3KG2 A;  5EBW C;  2XAJ A;  4HNA B;  4O4I A;  4KL1 A;  2WLN A;  2WA3 A;  1M5I A;  2Q0O C;  4OX9 O;  1YJW V;  2AHY A;  4X9Q A;  3MHH C;  3LSU A;  4DR1 O;  1OHH G;  1SKV A;  3QF7 A;  3UO2 A;  1Q86 W;  3CC2 V;  2AXT Z;  1YCI A;  1XNR O;  1R73 A;  3ZRW A;  1HNX B;  2W0X A;  4NR1 A;  2W6J G;  1SA0 B;  3ABM C;  3U0Z A;  1K97 A;  1B04 A;  3RWR D;  4CS4 A;  2BTO A;  1VEW A;  3STL C;  3E83 A;  2UXD O;  1J95 A;  4LFC O;  2HJF C;  2WLI B;  3AG1 B;  2JEX A;  2A0L A;  2N04 A;  2QA4 V;  3OR6 C;  5IDJ A;  4MW8 A;  1UJW B;  2JJ2 G;  1GO3 F;  4D7S A;  1L0N H;  3AEI A;  4TWK A;  4U3J A;  2CGO A;  2YXH A;  4NTX A;  2P67 A;  1VQO V;  4FLU A;  1ENV A;  2IM9 A;  1R3L C;  3IC9 A;  1SRY A;  1NH2 B;  2ADQ B;  2P7T C;  2F23 A;  2PZS A;  4B3T B;  2KG7 B;  5CA3 A;  1PL0 A;  1T5E A;  1QVG U;  1NI8 A;  5KUK A;  5LGT A;  1YIT V;  3WB1 A;  2DN9 A;  2UUC B;  4RUE A;  5AG2 A;  4MVM A;  5EZY B;  1DK1 A;  2YS8 A;  3DXR A;  2HHH B;  3MD0 A;  5C8Y A;  3CCV V;  1US6 A;  5FPO A;  2XAQ A;  2LW7 A;  5FLX N;  3QNE A;  5JJJ B;  4DR4 B;  1OZ0 A;  3P32 A;  3H01 A;  4EB6 A;  1HNX O;  4JYC A;  4MVS A;  5BR8 O;  1FFT B;  5CBG A;  2WSS G;  3TXS A;  3HKB B;  5LHG A;  4LWS A;  1TVK B;  4EFE A;  5BXZ A;  3CB2 A;  1Q43 A;  4DYL A;  2EJR A;  4TUY B;  1JFF A;  1H2M A;  5C93 A;  3WG7 C;  1Y66 A;  4R8C A;  3SYO A;  2IBZ H;  3W7U A;  3IC7 A;  3E8G A;  2ZM6 B;  4KFM A;  1P7B A;  4BR6 A;  1YXB A;  1OJH A;  2IJJ A;  4X65 B;  3T2M A;  2YC0 A;  1WB7 A;  4UB6 Z;  3CMA V;  2LP7 A;  1KUQ A;  4O4J B;  4FM2 A;  1YTF D;  4JI3 B;  2JEU A;  4O2B A;  4EEQ A;  2CAZ C;  4LC1 A;  1A32 A;  3SYA A;  4B3T O;  2ETN A;  3ZIA G;  2YEV A;  3LNM B;  3UCS C;  2G38 A;  2DW4 A;  2UUC O;  4E4E A;  4IHJ B;  2JJ1 G;  1MNG A;  2HHH O;  4MT8 A;  1QNM A;  2BTQ A;  3AK1 A;  1VQ5 V;  2DQ0 A;  2V4D A;  3WFV A;  4E2L A;  1KMI Z;  2P4K A;  3K08 A;  2VWK A;  4O4H A;  1TA8 A;  1ZLZ A;  2LFS A;  4DR4 O;  3CS5 A;  1YTF B;  4F6R A;  4KXR A;  1XL6 A;  1KEC A;  1D2D A;  1KQS U;  1WPB A;  2FKX A;  1V55 C;  2UXN A;  4ZHQ A;  4R50 A;  2QSA A;  2CH7 B;  1RFY A;  4WFB V;  3ABM B;  4UVC A;  5B1N A;  5H6Q A;  1ZWI C;  1M90 W;  4JAU A;  4TQF A;  2ADP A;  5JVD B;  3HKD B;  2Z0A A;  4AIL C;  4JTC B;  2ZM6 O;  1W59 A;  2FL4 A;  3CCJ V;  1Z5W A;  2YSU B;  3UT5 B;  4K8X A;  2L35 A;  4X65 O;  3FX7 A;  2X6A A;  2Z5U A;  3ZRS A;  1VQ7 V;  5JH7 B;  3CRR A;  3ZS8 C;  3ZED A;  4FFB B;  4BIZ A;  4FZ1 A;  2EZO A;  2HVK C;  4UCT A;  5DN6 G;  4JI3 O;  3F5T A;  3K03 A;  5L3E A;  1FXK A;  2YXL A;  1LR1 A;  4UCS A;  2ITC C;  4X1K B;  2CUG A;  1EN4 A;  1I08 A;  1QHT A;  4JAA A;  2QWQ B;  3OW2 U;  2WLL A;  2DJV A;  2HFE C;  1B3Q A;  1Q6U A;  1AI4 A;  3L73 H;  3DSQ A;  2Q0A A;  1XRE A;  3STZ C;  3I55 V;  3DC5 A;  3AG2 C;  1H2N A;  4JPR A;  4DUY B;  1OV9 A;  2FML A;  1WB8 A;  3ZMU A;  3BCC H;  3FB8 C;  5GTI Z;  5L3F A;  1IDS A;  5IYZ B;  3B8M A;  4OPA A;  2KSD A;  3T1H B;  5DM6 V;  1XEQ A;  2WLM A;  3AK3 A;  4HAM A;  4CZZ A;  2PYJ A;  2YI8 A;  2AGA A;  1MMM A;  1VF6 C;  1NTM H;  1P84 F;  3VQW A;  4DW0 A;  4YIP A;  3HKC A;  3WG7 B;  4JZ2 A;  2IJK A;  4NYK A;  1P7G A;  3JD2 A;  4GX2 A;  2HP8 A;  3JAS A;  1F4M A;  4I55 B;  3T1Y O;  2RQ6 A;  4UVA A;  3CXC U;  1E1Q G;  2XAS A;  5LA6 A;  4I50 A;  1Q6I A;  1NTZ H;  4JAS A;  3SPC A;  2A79 B;  4X64 O;  3L70 H;  4CS2 A;  4H0L B;  1OCR B;  3H1K H;  4HNA A;  2C2A A;  5CBF A;  1GTO A;  1KD1 W;  1PP9 H;  4L87 A;  4FMT A;  1NVP B;  4BWA A;  2R9A A;  5A9G A;  2OT5 A;  3ABU A;  3TXQ A;  1TUB B;  4KP4 A;  2JDI G;  1BSM A;  3UM7 A;  1SA0 A;  1JMK C;  4YXW G;  4LF5 B;  2AZ0 A;  4B3R B;  1GRJ A;  4PA6 A;  3H1H H;  1QVF U;  4RAI A;  4F6E A;  2YXY A;  4DUY O;  4X1Y B;  5LHH A;  3ZRX A;  2PI5 A;  3JAT B;  1AP5 A;  4PA4 A;  1V55 B;  2WLI A;  3T1H O;  1NU1 H;  4PI2 A;  1AJQ A;  3CRA A;  1ZSP A;  3SJQ C;  1N33 B;  5IJ0 B;  4MVR A;  4KUM A;  3D8C A;  3OEE G;  3TGU H;  2ZE7 A;  1I94 B;  2OCC C;  3BA9 A;  2HJD A;  1WPX A;  2PUS A;  1ARO P;  4K0K B;  2VS0 A;  5L3G A;  4CH6 A;  2DWE C;  4X89 A;  2GDS A;  2KG7 A;  1Y74 B;  3CD6 V;  2B5U A;  2ZD9 A;  2XOK G;  1QLE C;  4GKK O;  1AP6 A;  5CA0 B;  2KKW A;  2GUZ B;  2OTL V;  1Q5O A;  3CCL V;  4FVM A;  5EZY A;  4TT3 G;  1EZV H;  3VBB A;  4CH3 A;  2CDY A;  3H1L H;  2YIC A;  1Y76 B;  4X62 B;  1UPG A;  5LMN B;  3CX5 F;  5CN0 A;  2ZKO A;  4LF5 O;  2EZP A;  4B3R O;  1U96 A;  4CS3 A;  2MW2 B;  3RYI B;  1TVK A;  3K5O A;  4I4T B;  5EYP B;  3P30 A;  1WP8 A;  3WU2 Z;  5KAF Z;  4IL6 Z;  2M6Y A;  2HG5 C;  3CHX A;  4FPP A;  4TUY A;  3JD3 A;  1LUV A;  4YJ3 B;  3JCU Z;  3OUF A;  3GVM A;  1H2L A;  1N33 O;  4BAY A;  2QWR B;  3K06 A;  2OTJ V;  1K5S A;  1I94 O;  3BAB A;  3FYE B;  5JQG B;  1Q3E A;  1BQZ A;  4K0K O;  4O4J A;  4DUZ B;  4Z1V A;  3HKE B;  3DC6 A;  1EN6 A;  3NXS A;  4JF3 A;  4NB5 A;  4XDK A;  2QTS A;  2CTW A;  2ZQM A;  5KLV H;  2QE7 G;  4WF9 V;  1BMF G;  5LP6 C;  4TOI A;  3KKY A;  5B1A C;  1WA8 B;  1SET A;  4YHH B;  1L0L H;  3U11 A;  2OIE A;  1NJI W;  4IHJ A;  3D3I A;  5GW7 A;  2F4V B;  2X6C A;  5BMV B;  1XHX A;  1CPY A;  1ZX3 A;  1YSC A;  1D5A A;  1GM8 A;  4JI2 B;  4I9Q A;  1I0H A;  1NR1 A;  1MSD A;  5LL6 Y;  5CMU A;  3AK2 A;  5LMN O;  3E86 A;  4GX1 A;  3CJH B;  2IH1 C;  3CWB H;  2XAH A;  3APQ A;  4ZOL B;  3T1C A;  4DRX B;  4WBN B;  1Z5V A;  4XBF A;  1IBK B;  1TAE A;  3KCX A;  4I7Z B;  4ZBM A;  3JSN A;  4QPK A;  1BQ0 A;  3E22 B;  4U7O A;  2ZNJ A;  4RWU A;  3M8A A;  4TSF G;  4L8J A;  1K8A W;  1EM1 A;  2EIL C;  2CH7 A;  2RJZ A;  4KHP B;  1VQK V;  3CE2 A;  1Q7Y W;  1G4Y B;  1XMO B;  2ZR3 A;  1J5E B;  3K5L A;  1IVS A;  1MA1 A;  4MTF A;  4FLV A;  5JVD A;  3HKD A;  5FNV B;  1XUQ A;  1HP8 A;  2V7Q G;  3C3S A;  2R72 A;  4G27 B;  4EKW A;  3FB6 C;  3UT5 A;  4U7N A;  2UXX A;  4UV9 A;  4FM1 A;  5CB4 B;  3RYH A;  3L75 H;  5JH7 A;  1PKX A;  2ATK C;  1TGO A;  4IGG A;  4FFB A;  4JYY A;  5LMU O;  4DUZ O;  1IXB A;  2P4V A;  4JTA B;  1NH2 D;  3BFR A;  3E8H A;  2EX3 A;  2OCC B;  3SYQ A;  1Q90 D;  3ZMT A;  3ICX A;  1KB9 F;  3CRQ A;  4D6T H;  2DYS C;  4YHH O;  4X1K A;  4NXN B;  4Q20 A;  3JD1 A;  2F4V O;  1SES A;  1K73 W;  3EXA A;  5EC1 C;  1QLE B;  4PJ0 Z;  2JGD A;  2Q9L A;  4JI2 O;  2LQT A;  4CBC A;  1AJP A;  1IZ3 A;  2QWP B;  2AW9 A;  1JA8 A;  1L1F A;  1BZK A;  5IWA B;  1S72 V;  4DV0 B;  1K33 A;  1IBK O;  5KA6 A;  3ZHQ A;  4AI8 A;  3WB2 A;  4BW9 A;  3WB0 A;  2P6J A;  3JSL A;  2NLJ C;  2O57 A;  4H44 B;  4LBE C;  4KHP O;  4QIW F;  1Y4M A;  3B8N A;  2LFR A;  1MOF A;  5IYZ A;  1XMO O;  1J5E O;  1F23 A;  3CCS V;  1S3J A;  4UCV A;  2UUA B;  1YZB A;  2XT9 A;  1H38 A;  2QEX V;  3TET A;  1QQC A;  3QO8 A;  2H8P C;  2HVJ C;  2IW5 A;  2F66 C;  4Z2W A;  4J80 A;  4UFZ A;  5BZB A;  2OYQ A;  2QJ1 A;  5IT9 N;  4I55 A;  4JI4 B;  5KA5 A;  5JCO C;  4JI7 B;  2E3C A;  4DV2 B;  4FJC C;  5B5E Z;  2CE4 A;  1V9P A;  2AHZ A;  5L3D A;  5B1B C;  1F7Y A;  3JAR B;  3UQ8 A;  2H3O A;  2VWJ A;  3THO A;  5B3S C;  4TV8 B;  4DR6 B;  1I5X A;  1IBL B;  3FAV B;  1R3K C;  3W7S A;  3W7X A;  1CP9 A;  1NT2 B;  4NXN O;  5KHG A;  1HR0 B;  3MHS C;  1XI1 A;  2F95 B;  3A0B Z;  2LW1 A;  4LNU B;  4JZG A;  5LP6 B;  5B1A B;  4DK0 A;  2DWD C;  3EVK A;  3H1J H;  4QJF B;  2K9P A;  2Z3Y A;  3VQY A;  1SQP H;  4ICG A;  1VAR A;  1JQ0 A;  4LF9 B;  2ZR2 A;  1K9M W;  2BSK B;  1SQG A;  4UB8 Z;  4CH4 A;  5IWA O;  4PA3 A;  4DV0 O;  1DTO A;  1TUB A;  5H5N A;  2VRZ A;  4BIU A;  5IYC O;  4PA9 A;  1SER A;  4W4K A;  4WFG A;  1JOY A;  2YIB A;  2QM8 A;  1F51 A;  4CH5 A;  4X1Y A;  4GX0 A;  3OT7 A;  1NTK H;  4LF8 B;  1P49 A;  3JAT A;  3OMN B;  2IJH A;  2A06 H;  3OAA G;  3OGC C;  1N36 B;  3ABL C;  4I9W A;  5IYD O;  4LCU C;  5IJ0 A;  4MVU A;  4QPJ A;  1L8D A;  2P90 A;  3SYP A;  4X66 B;  1G1X B;  2QTO A;  5FL7 G;  2NN4 A;  1RM1 C;  1VMG A;  3G6E V;  5TIS Z;  1XNQ B;  4JI4 O;  4PDV A;  4WFH A;  1PNL A;  3A0H Z;  1JCH A;  4JI7 O;  4DV2 O;  1DF4 A;  2IJI A;  2ILM A;  3SYC A;  3KCY A;  5JWP A;  1Y74 A;  3FB7 C;  1Q81 W;  1MG1 A;  3SR2 C;  1VF7 A;  2Q4P A;  1P4R A;  3L9D A;  5CA0 A;  4DR6 O;  1EFR G;  1FFX B;  1IBL O;  4DXW A;  2GUZ A;  4HBN A;  4NTY A;  4LH7 A;  1HR0 O;  1KU9 A;  4A5U B;  3RYH B;  4FLX A;  2DYS B;  1D5N A;  2IU3 A;  1Y76 A;  1R6T A;  1G6U A;  3B09 A;  5J2U B;  4LF9 O;  4ABM A;  5LXT B;  1VQP V;  3K79 A;  2WA4 A;  4B3S B;  3B4S A;  5H2F Z;  5LYJ B;  3U10 A;  1DF5 A;  3D36 C;  2LGQ A;  1VF5 B;  1YJ9 V;  3RYI A;  5EIB C;  2P06 A;  3S3X A;  3MAQ A;  1S5H C;  3N27 A;  4I4T A;  5EYP A;  4BW5 A;  3ETQ A;  1YEW A;  3FB5 C;  3Q4H B;  2RDC A;  1VP7 A;  2UUB B;  2JGD B;  4GYC B;  4YJ3 A;  4P9O A;  4PA7 A;  1N36 O;  5CA1 B;  1BE3 H;  4ZKI A;  1GN6 A;  4N23 A;  2YDE A;  3K04 A;  3SDL A;  4X66 O;  4LH6 A;  5ITZ B;  4WCE V;  3J81 N;  2FTK A;  2VQE B;  5JQG A;  1XNQ O;  3K5N A;  2EIM C;  1I5Y A;  1VF6 A;  1FXK C;  3HKE A;  3BAA A;  1JR9 A;  3K59 A;  2PI4 A;  3CME V;  5K1P A;  1FXH A;  5EC2 C;  1KYO F;  4R7C A;  3QVN A;  1S5L Z;  3H1I H;  5IYB O;  1FXV A;  1WA8 A;  2Q7E A;  1SC5 B;  1AB3 A;  1B06 A;  1KKD A;  5BMV A;  4JTD B;  5B1B B;  4B3M B;  3ZHS A;  1H2K A;  2W0F C;  5B3S B;  4UVB A;  1NVP D;  2GBO A;  5EBL C;  3CJH A;  4ZOL A;  2ZIO A;  3KZI Z;  4B7E A;  4DRX A;  2E75 B;  4WBN A;  1MAB G;  3CEI A;  3BPZ A;  3ETE A;  1NS1 A;  4FFK A;  1Q6H A;  1XDC A;  2YID A;  2LO1 A;  2WWW A;  3AG7 A;  1N4C A;  4B3S O;  5B66 Z;  1HNW B;  3E8B A;  3E22 A;  1O9H A;  3G6B A;  2Q73 A;  2YIB D;  3UO3 A;  2E5L B;  1WAZ A;  1PNK A;  3LDD A;  1NZ6 A;  3GWO A;  3FFQ A;  2P5O A;  3BVO A;  2F43 G;  1MZE A;  1I7F A;  2W6I G;  2UUB O;  2A9H A;  2EUL A;  1KC8 W;  5FNV A;  5A2Q N;  2WLK A;  3IGA C;  1YVW A;  2XUM A;  2ZXW C;  5CB4 A;  1GM7 A;  3ABL B;  2DOS A;  3ZHU A;  2VQE O;  2DQ3 A;  4JYB A;  3TJT A;  2N74 A;  1GH6 A;  3DTU B;  5DED A;  1EN5 A;  5H6R A;  5J2T B;  1QLN A;  1RM1 B;  4GCZ A;  5E1A C;  4LFB B;  4GLX A;  4OGQ B;  4J42 A;  5K1X A;  1ZAU A;  1AJN A;  4MS2 A;  5JJN B;  3LSQ A;  4LF7 B;  1LNQ A;  2GV9 A;  3ZX6 A;  4B3M O;  2GTA A;  2ZDI C;  5LGN A;  2LGW A;  3VQX A;  3OFN G;  3ZHV A;  3L72 H;  3C3T A;  1BHB A;  1VQL V;  4WFF A;  2DE0 X;  3ZCC A;  3F5W C;  3ZBH A;  3GWK C;  3VOU A;  2X6B A;  4MTX A;  1HNW O;  4JI8 B;  4JYA B;  4IIJ B;  2E5L O;  1K3E A;  5LBQ A;  4AHC A;  4NKG B;  1V54 C;  1SQX H;  1HNZ B;  4DV5 B;  3T4D A;  1URF A;  1X4T A;  1B6Q A;  3ABT A;  1H8H G;  1OCZ C;  3JCZ A;  5GTH Z;  2B1I A;  4PI0 A;  4W4L A;  4HZ3 A;  4X8A A;  3OM3 B;  3L71 H;  3D3Q A;  4YY3 B;  2ZE5 A;  2B1G A;  3ZN0 A;  1ZL8 B;  2PGG A;  2YI9 A;  5KX5 B;  1VQ8 V;  5JJE B;  1K92 A;  4LFB O;  1PM9 A;  4PDL A;  2UXC B;  3AG2 B;  1Q8I A;  1ORQ C;  3AG3 C;  3JAR A;  4FZ0 A;  2EIM B;  3GB7 C;  4I5S A;  4PV1 B;  2QKA A;  3ASN C;  4TV8 A;  4AQY B;  3ZHT A;  3FAV A;  1XQ8 A;  1YHQ V;  4YJ2 B;  4LF7 O;  3S3W A;  1RSO B;  5CBH A;  2D2C B;  3RT3 C;  5D5P A;  3T4Z A;  4LNU A;  5LP6 A;  3K5M A;  4DO2 A;  3LDE A;  3JAL B;  3J7A U;  4O4L A;  3ZHR A;  2BSK A;  2XAG A;  2A3Q A;  3K3W A;  1VQM V;  4TV9 B;  1AR5 A;  4DV6 B;  3PJS K;  4BIO A;  1KP3 A;  1RPO A;  1QU7 A;  4JI8 O;  4JYA O;  2NNU A;  3APO A;  2ZT9 B;  1N0J A;  2M7W A;  4DR5 B;  1AVM A;  2Q69 A;  2CK3 G;  4JI1 B;  1HNZ O;  4DV5 O;  2XND G;  1OCO C;  2PF4 E;  2UXB B;  4O2A B;  4DK1 A;  2WPD G;  4X62 O;  2Y4T A;  1OCC C;  3A2F A;  3HR0 A;  1XMQ B;  4GKJ B;  4NTW A;  1N34 B;  1GM9 A;  5LOV B;  3H9V A;  4YY3 O;  4MTG A;  5KHK A;  2Q68 A;  1N32 B;  2H94 A;  4ZIB A;  2NR5 A;  2ZXW B;  3SGI A;  2JK5 C;  1GN4 A;  4P30 A;  1H2G A;  2XHB A;  2UXC O;  4AQY O;  1FFX A;  3LNN A;  3SJA C;  2GTS A;  4PDR A;  3OR7 C;  2ARH A;  1PV0 A;  1FYJ A;  3I56 V;  4G2K A;  1X59 A;  1FPO A;  3UKM A;  4N21 A;  3N2G B;  3ETD A;  4I0X B;  5J2U A;  4ZI7 B;  5LXT A;  4J7Z A;  1M93 A;  1E1R G;  1CXZ B;  3K0D A;  5EBM C;  5EK0 A;  2JVD A;  3K0G A;  4Z1M G;  1NKD A;  4DV6 O;  5LYJ A;  2RCV A;  4GUN A;  4K3A A;  5BR8 B;  3QG5 A;  4IYI A;  1XL4 A;  3HB3 B;  5E79 Z;  1YIJ V;  4X20 B;  4DR5 O;  1ZTE A;  3L74 H;  5IJ9 B;  3CRC A;  3JAK B;  4J7J A;  5DEC A;  5GON B;  4JI1 O;  4EFB A;  5IY5 C;  3Q4H A;  1SQF A;  2QR4 A;  2UXB O;  3OMI B;  1BCC H;  2EIN C;  1F4N A;  3CPW U;  5CA1 A;  1V54 B;  1S5J A;  3EHB B;  2WLJ A;  1XMQ O;  2RMK B;  4GKJ O;  3ZJZ A;  4UV8 A;  1N34 O;  3MDS A;  3RYC B;  2ZCE A;  5L3C A;  5ITZ A;  3BA8 A;  1OCZ B;  1JVM A;  1QR9 A;  2QWN B;  1N32 O;  4P2Z A;  2VQF B;  4FLY A;  1NR7 A;  1U97 A;  3SPI A;  4MSW C;  1IUR A;  1SS3 A;  2P22 C;  2X0L A;  5JCO A;  3CCE V;  2KB1 A;  2OWO A;  1VIB A;  4X88 A;  5KUM A;  4RUF A;  2OIG A;  3AG3 B;  3JAW B;  4RO2 A;  2EJ7 A;  1M56 C;  3ASN B;  4H13 B;  3TCU A;  1AR1 B;  3DGE A;  2OCH A;  4FM0 A;  2R9R B;  5F2V O;  3LSS A;  4JI6 B;  3BEH A;  1Z2G A;  3W7T A;  4Q6G A;  1YI2 V;  2WAM A;  4K8Z A;  2Y48 A;  1XBL A;  2Y4U A;  3P3P A;  4R6Z A;  3CC4 V;  3SPH A;  3CCQ V;  3M99 B;  4ASU G;  4NVP A;  4O4L B;  2ZE6 A;  1VQ6 V;  2PYL A;  1OCO B;  2JGU A;  3M7M X;  1LUW A;  3RBZ A;  1OCC B;  4X1I B;  1BHA A;  3N2K B;  3R65 A;  1BL8 A;  2VQF O;  1RP3 B;  3E8F A;  1QBZ A;  3K57 A;  2ZIM A;  3E35 A;  4JGS A;  5J2T A;  3X2Q C;  4DV4 B;  1N8R W;  5KMG A;  1OCR C;  2Y0P A;  3K9S A;  2UUA O;  2EIL B;  3JD4 A;  2QKS A;  1BT8 A;  4XDJ A;  4D7T A;  5LGU A;  3ZMS A;  1VQ4 V;  4UXN A;  2ITD C;  3RVZ A;  1H8E G;  4LF4 B;  4XDL A;  1JJO A;  3AG4 C;  1PD3 A;  1HDJ A;  1FD9 A;  1XOU A;  3OTO B;  1W0J G;  1CEZ A;  4DV3 B;  3G71 V;  3RN4 A;  2Q6A A;  4LFA B;  2E74 B;  4P9P A;  3RW0 A;  5D5Q A;  4JI6 O;  2FB5 A;  1O9G A;  5KHJ A;  2Q7H A;  1M57 C;  3FKS G;  4WFA V;  3CSX A;  2UU9 B;  1S76 D;  1R3I C;  4IIJ A;  2F1M A;  2JRI A;  3IAY A;  3CC7 V;  1MSW D;  2BOC C;  1EBO A;  4CC6 A;  2RNB A;  3SPJ A;  3D36 A;  3ML0 A;  1HW7 A;  1SQB H;  5KHH A;  3K9A A;  4O4I B;  3G80 A;  2BCC H;  2JS5 A;  3CP1 A;  2IH3 C;  4PEL A;  1R1B A;  3OE7 G;  3E89 A;  5IY5 B;  4J11 A;  4MVQ A;  4GZR B;  2XTA A;  2EIN B;  3ABK C; 
#chains in the Genus database with same CATH homology
 5H6R A;  1SET A;  1QLN A;  1RM1 B;  3ZRW B;  4GCZ A;  5E1A C;  1DLB A;  2XAQ A;  1NJI W;  3D3I A;  5GW7 A;  2X6C A;  5B1O A;  2X7R B;  3QNE A;  1CPY A;  1YSC A;  3HPL C;  1OZ0 A;  1GM8 A;  3P32 A;  1S0V A;  3SPG A;  3QO7 A;  1AJN A;  3H01 A;  1NR1 A;  4MS2 A;  3LSQ A;  5CMU A;  4JYC A;  1NQT A;  4MVS A;  1RPR A;  1FFT B;  1LNQ A;  5CBG A;  2WSS G;  3QO5 A;  3E86 A;  4GX1 A;  2IH1 C;  3T1C A;  2XAH A;  1K34 A;  2ZDI C;  3TK1 A;  5LHG A;  5LGN A;  3OFN G;  4XBF A;  4ZBM A;  4QPK A;  1BHB A;  1VQL V;  4WFF A;  4U7O A;  3ZCC A;  2EJR A;  3F5W C;  1GK9 A;  3VOU A;  4TSF G;  1K8A W;  3EFF K;  5C93 A;  2X6B A;  3WG7 C;  1GMG A;  2EIL C;  4MTX A;  1QR8 A;  1Y66 A;  2EIK C;  1VQK V;  4R8C A;  3SYO A;  3W7U A;  1NBM G;  3IC7 A;  1Q7Y W;  3E8G A;  4KFM A;  1G4Y B;  1P7B A;  2ZR3 A;  1M56 B;  4JAV A;  1K3E A;  2IJJ A;  5LBQ A;  4MTF A;  3T2M A;  1V54 C;  2V7Q G;  5H9C A;  4G27 B;  4EKW A;  3T4D A;  3CMA V;  3G4S V;  1K5Q A;  2LP7 A;  3ZN1 A;  3FB6 C;  2Y69 C;  4U7N A;  4MVO A;  2V1D A;  1YTF D;  1B6Q A;  2UXX A;  4UV9 A;  2JEU A;  2DYR C;  3ABT A;  1H8H G;  4FK5 C;  1OCZ C;  2EIJ C;  4PDM A;  1PKX A;  3JCZ A;  4LC1 A;  2ATK C;  3ASO C;  2B1I A;  3SYA A;  2GHY A;  4HZ3 A;  4X8A A;  3ZIA G;  2YEV A;  3LNM B;  3OM3 B;  4JTA B;  1NH2 D;  2DW4 A;  3F7V C;  3E8H A;  1AI5 A;  2OCC B;  3SYQ A;  3JYC A;  1JPX A;  2B1G A;  2JJ1 G;  3ZN0 A;  3OUS A;  4MT8 A;  4MW3 A;  3ZMT A;  1W0K G;  1VQ5 V;  2DQ0 A;  3A0R A;  3WFV A;  4E2L A;  1YJN V;  1VQ8 V;  2DYS C;  1K92 A;  2BOB C;  4Q20 A;  3JD1 A;  3K08 A;  1SES A;  4PDL A;  3AG2 B;  3AG3 C;  1ORQ C;  4I5S A;  3ZMZ A;  2EIM B;  2LFS A;  3GB7 C;  1K73 W;  1YTF B;  5EC1 C;  1QLE B;  3ASN C;  1XL6 A;  1KEC A;  3RVY A;  1K4D C;  1YHQ V;  3ZMV A;  4CBC A;  1AJP A;  1KQS U;  5CBH A;  4MTO A;  1L1F A;  4H33 A;  4G28 B;  1V55 C;  3JD0 A;  3T4Z A;  2UXN A;  4LP8 A;  4DO2 A;  3LDE A;  1S72 V;  3CCV V;  1K33 A;  5KA6 A;  4R50 A;  4H37 A;  3X2Q B;  4WFB V;  3ABM B;  4UVC A;  5B1N A;  2XAG A;  5H6Q A;  1AI7 A;  1ZWI C;  2P6J A;  3K3W A;  2NLJ C;  1M90 W;  1VQN V;  1VQM V;  2EBO A;  1JX9 A;  4JAU A;  3PJS K;  4F4L A;  4LBE C;  4QIW F;  1KP3 A;  1Y4M A;  3B8N A;  4HYO A;  4JTC B;  2LFR A;  1MOF A;  1RPO A;  2IU0 A;  3CCU V;  1K4C C;  1F23 A;  2NNU A;  2ZDI A;  4OXS A;  3CCJ V;  3CCS V;  2YSU B;  1S3J A;  1M9N A;  2M7W A;  3AG4 B;  1FS0 G;  2X6A A;  2Z5U A;  3ZRS A;  1VQ7 V;  1H38 A;  2Q69 A;  2CK3 G;  2QEX V;  2XND G;  3TET A;  1OCO C;  4BIZ A;  2YEV B;  2EZO A;  3QO8 A;  2HKO A;  4GX5 A;  1IXM A;  1M1K W;  2HVK C;  2H8P C;  2WPD G;  5DN6 G;  2HVJ C;  2R9I A;  2IW5 A;  1M57 B;  1OCC C;  1G8M A;  5BZB A;  3K03 A;  5L3E A;  1FXK A;  4QE7 A;  5KA5 A;  4RQE A;  3F7Y C;  1GM9 A;  3LDC A;  2ITC C;  5LHI A;  4FJC C;  1COW G;  3CCR V;  4MTG A;  2AHZ A;  5L3D A;  5B1B C;  4J9Z B;  3OEH G;  2Q68 A;  2H94 A;  5B3S C;  2ZXW B;  2JK5 C;  1I5X A;  4P30 A;  3ETG A;  1H2G A;  1R3K C;  3B77 A;  3W7S A;  1CP9 A;  3W7X A;  3OW2 U;  2K1E A;  2WLL A;  3MHS C;  1QCE A;  2HFE C;  1ROP A;  3CYO A;  2Q67 A;  1AI4 A;  1TUE B;  3AG1 C;  5B1A B;  3ABK B;  3E2E A;  2DWD C;  4WFE A;  4QJF B;  3W7W A;  2Z3Y A;  3BY6 A;  4PDR A;  3OR7 C;  3STZ C;  4FIP C;  1JQ0 A;  3I55 V;  2ZR2 A;  1K9M W;  3AG2 C;  4JPR A;  3I56 V;  4PA3 A;  1DTO A;  3CCM V;  3ZMU A;  4BIU A;  3FB8 C;  4G2K A;  5IYC O;  4PA9 A;  1SER A;  5L3F A;  3UKM A;  4N21 A;  3ETD A;  4WFG A;  3B8M A;  1JOY A;  2WLH A;  4RQF A;  2QM8 A;  2XAF A;  1F51 A;  4GX0 A;  1E1R G;  3K0D A;  5EK0 A;  5EBM C;  4Z1M G;  5HFM A;  3K0G A;  5DM6 V;  1NKD A;  2WLM A;  4HAM A;  4CZZ A;  3OMN B;  2IJH A;  1XL4 A;  3HB3 B;  3OAA G;  1YIJ V;  1Q82 W;  3OGC C;  4J9Y B;  3ABL C;  3WG7 B;  4I9W A;  2IJK A;  2EIK B;  3JD2 A;  4GX2 A;  5IYD O;  5IY5 C;  1JJ2 U;  1FXK B;  4LCU C;  1F4M A;  4MVU A;  4QPJ A;  3OMI B;  2P90 A;  3SYP A;  2EIN C;  1F4N A;  3CPW U;  4UVA A;  2QTO A;  5FL7 G;  3CXC U;  1PNM A;  2QM7 A;  1RM1 C;  4GT1 A;  1V54 B;  1E1Q G;  3EHB B;  3G6E V;  2XAS A;  2WLJ A;  4PDV A;  4WFH A;  3ZJZ A;  4UV8 A;  1PNL A;  2HLD G;  1R6K A;  2Y69 B;  1E79 G;  1JCH A;  4JAS A;  2A79 B;  3SPC A;  5L3C A;  2DYR B;  1DF4 A;  2IJI A;  1OCZ B;  3SYC A;  2EIJ B;  1JVM A;  1WLE A;  1QR9 A;  3ASO B;  4QE9 A;  2WLL B;  1OCR B;  5HFL A;  2C2A A;  5CBF A;  1GTO A;  3FB7 C;  1Q81 W;  1MG1 A;  4P2Z A;  1KD1 W;  1NR7 A;  1P4R A;  4L87 A;  1W2B U;  1EFR G;  4DXW A;  3SPI A;  1SZT A;  5L3B A;  4MSW C;  4FMT A;  3LUT B;  1NVP B;  2X0L A;  4MVZ A;  3CCE V;  2KB1 A;  2OT5 A;  3ABU A;  2DYS B;  2IU3 A;  4KP4 A;  2JDI G;  3UM7 A;  4X88 A;  5KUM A;  4UUJ C;  4RUF A;  4YXW G;  3OMA B;  3AG3 B;  4RO2 A;  4PA6 A;  1M56 C;  1QVF U;  4RAI A;  1S77 D;  3ASN B;  1R6N A;  3TCU A;  1VQP V;  1EZJ A;  5LHH A;  1AR1 B;  1R3J C;  3DGE A;  5J9P C;  3K79 A;  2D3O W;  2JIZ G;  1KP2 A;  3ZRX A;  2PI5 A;  1THZ A;  1DF5 A;  2R9R B;  1YJ9 V;  1HWY A;  4PA4 A;  1V55 B;  2WLI A;  3LSS A;  3BEH A;  1S5H C;  3FYI B;  4BW5 A;  2GSM B;  3W7T A;  3ZRV A;  1AJQ A;  3FB5 C;  3SJQ C;  1YI2 V;  4MVR A;  4QNH B;  4KUM A;  1VQ9 V;  2WAM A;  4P9O A;  2Y48 A;  3OEE G;  4PA7 A;  1GKF A;  2OCC C;  4ZKI A;  1WPX A;  4N23 A;  1ARO P;  4R6Z A;  3CC4 V;  3SPH A;  3K04 A;  1K7D A;  3CCQ V;  5L3G A;  3M99 B;  4ASU G;  1AI6 A;  1VQ6 V;  2DWE C;  2HR3 A;  2MK3 A;  4WCE V;  4X89 A;  2FTK A;  3IFX A;  3KG2 A;  5EBW C;  2XAJ A;  1OCO B;  2EIM C;  3CD6 V;  2B5U A;  1I5Y A;  1FXK C;  2WLN A;  2ZD9 A;  2XOK G;  1QLE C;  1YJW V;  2AHY A;  3MHH C;  2PI4 A;  3CME V;  3RBZ A;  2OTL V;  1FXH A;  5EC2 C;  1OCC B;  1OHH G;  4R7C A;  3CCL V;  1BHA A;  4TT3 G;  1Q86 W;  3VBB A;  3R65 A;  5IYB O;  1BL8 A;  3CC2 V;  3E8F A;  1QBZ A;  1FXV A;  3E35 A;  4JGS A;  1R73 A;  3ZRW A;  3X2Q C;  1KKD A;  2W6J G;  4JTD B;  1N8R W;  5B1B B;  3ABM C;  1K97 A;  1OCR C;  5CN0 A;  2W0F C;  5B3S B;  2EIL B;  4UVB A;  3JD4 A;  2QKS A;  3STL C;  4XDJ A;  3E83 A;  1NVP D;  1J95 A;  5LGU A;  2EZP A;  3ZMS A;  4UXN A;  1VQ4 V;  2HJF C;  5EBL C;  2ITD C;  3RVZ A;  2WLI B;  1H8E G;  3AG1 B;  1MAB G;  2A0L A;  2JEX A;  3ETE A;  4XDL A;  3AG4 C;  1PD3 A;  2QA4 V;  3OR6 C;  3P30 A;  2WWW A;  5IDJ A;  4MW8 A;  1W0J G;  3E8B A;  1CEZ A;  1UJW B;  3G71 V;  2HG5 C;  4FPP A;  2Q6A A;  2JJ2 G;  1GO3 F;  3RW0 A;  4P9P A;  3JD3 A;  3AEI A;  4TWK A;  1PNK A;  3LDD A;  1M57 C;  3FKS G;  4WFA V;  3GWO A;  3OUF A;  1S76 D;  2F43 G;  2P67 A;  1VQO V;  2W6I G;  1ENV A;  1R3I C;  4BAY A;  3K06 A;  2A9H A;  1R3L C;  3CC7 V;  1SRY A;  1NH2 B;  2OTJ V;  2P7T C;  1K5S A;  1MSW D;  2BOC C;  1KC8 W;  1EBO A;  2WLK A;  3FYE B;  3SPJ A;  3D36 A;  3IGA C;  3ML0 A;  3K9A A;  5CA3 A;  1PL0 A;  2ZXW C;  1QVG U;  5KUK A;  1GM7 A;  3ABL B;  3NXS A;  4JF3 A;  5LGT A;  3CP1 A;  2IH3 C;  4PEL A;  1YIT V;  4RUE A;  4XDK A;  4MVM A;  2DQ3 A;  2ZQM A;  3E89 A;  3OE7 G;  4JYB A;  4MVQ A;  5IY5 B;  2QE7 G;  4WF9 V;  1BMF G;  3MD0 A;  3DTU B;  2EIN B;  5B1A C;  3ABK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...