1YJWV

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yjwV00
3CCSV 1K9MW 3CC4V 3CXCU 1VQ7V 4WFAV 3I56V 3CCUV 1K8AW 3CCVV 2QA4V 3CC7V 1VQPV 1K73W 3OW2U 1KQSU 1KD1W 3CCLV 1Q7YW 1YI2V 1S72V 1N8RW 1M90W 3CCJV 1YJWV 1Q82W 3G71V 1W2BU 1NJIW 2QEXV 5DM6V 1VQKV 1YJ9V 3CCQV 4WFBV 1VQ6V 3G6EV 3CMAV 3CPWU 2OTJV 1R73A 3CMEV 1Q86W 1VQLV 1M1KW 1VQMV 1QVFU 1VQ9V 1VQ8V 4WF9V 3I55V 2D3OW 1VQOV 4WCEV 1YIJV 1Q81W 1KC8W 1JJ2U 1QVGU 1VQ4V 3G4SV 1YJNV 2OTLV 3CD6V 1YITV 1VQNV 3CC2V 3CCMV 3CCEV 3CCRV 1VQ5V 1YHQV
chains in the Genus database with same CATH superfamily
1SA0A 1JCHA 3OE7G 1J5EO 4B7KA 4LF9O 3M99B 2P7TC 2X6AA 1YJ9V 3TXQA 4UCOA 2UXBO 4YIPA 4MVZA 3RYIB 3BY6A 3E22B 4QJFB 2DYRC 1FJGO 4GKKB 2QM4A 4AQYB 3FYEB 2EIMC 2OIEA 2BOBC 2Y0PA 1MABG 2ZKOA 3N2KB 4GCZA 5E1AC 1Q6HA 3B2EE 4ZBMA 2MW2B 1BS3A 4RWUA 4H0LB 1NH2B 4TUYA 1QHTA 2DN9A 4CH3A 5B1BB 3JAKB 1W0JG 3M7MX 4EFEA 4X8AA 4JYAB 4IGGA 5LMUB 4LF5O 1XEQA 1AP6A 2FB5A 3RBZA 3U0ZA 2Q69A 3H9VA 1GM9A 2YIBD 3T1HO 1G1XB 1Y76A 1J5EB 1VEWA 4LNUA 3K08A 3KCXA 5FNVB 2BCCH 3APQA 3QO8A 1MNGA 4LP8A 1P84F 2N04A 4YXWG 2UXBB 4BW9A 5B1NA 1RFYA 1ROPA 1XQ8A 3CYOA 2M7WA 1FJGB 2HR3A 1GAXA 2EILC 3OEHG 3CD6V 1EM1A 2QR4A 3RYHA 3A0RA 4JI5B 5IJ9B 4FLYA 4GLXA 5CA0B 3QO7A 4O4HA 1AI5A 1XHXA 3E8HA 4JI2O 2WAMA 3WG7B 4EFBA 1DF5A 3UCSC 4LF5B 1ZX3A 3LSSA 2D3OW 3ABUA 1HR0B 4BW5A 2YIAA 2A3QA 4W4KA 3T1HB 3NR7A 2PTMA 4BWAA 4G28B 1M4UA 2Q8VA 3CC7V 3HKCA 3VQWA 4O4IB 2GSMB 5KAIZ 4UB8Z 4FZ0A 2E3CA 4YIOA 4X62B 3CMAV 1R6TA 3BABA 5KMGA 1YCIA 2ZXWC 4I4TB 4B08A 3OMNB 5B5EZ 4LBEC 4TWKA 4N23A 1Q8IA 2D2CB 5GW7A 2GUZA 4PA7A 5EZYA 4LH6A 1EN5A 4J80A 1WB7A 3M8AA 4O4JB 2HHHB 1B06A 1R1BA 3DXRB 3CRRA 4X1IB 3CMEV 2XAJA 3B4SA 2HVJC 2VQEO 4EB6B 4RQFA 3SJQC 4JV5O 4LF8O 1VQ5V 1K92A 2QTOA 4MTOA 2LO1A 1XHZA 2C2AA 1MOFA 1TGOA 3ETQA 3ZHRA 4RUEA 1H8EG 2G38A 3ZMUA 1XREA 1B6QA 2E76B 5IWAB 2ZE8A 1H2MA 1W59A 3ZRSA 1I7FA 5IY5B 5LYJB 2JVDA 4IL6Z 5KAFZ 3AG7A 2DYSB 4DV7O 2FL4A 5ITZB 5EC1C 1S5JA 2L35A 2XNDG 5JQGB 4ZKIA 2VQEB 5J9PC 2Q67A 1OZ0A 4DV1O 1EN6A 3H1KH 5IJ0B 1VIBA 4UCUA 3DGEA 3OMIB 3ASOC 4LF8B 1QCEA 4NTYA 4X1KA 3K5MA 2AZ0A 3TJTA 1NI8A 3AG2B 4MVMA 2P6JA 4N21A 2ARHA 4HNAA 2Y69B 5H9CA 4IIJA 3E8GA 2NN4A 2XAGA 3N2GA 4P9PA 2PF4E 4EEQA 2CTQA 4UCVA 5EIBC 1GM8A 1R3JC 1N33B 1QBZA 3IJ4A 1VQ7V 1DTOA 2GTSA 1RSOA 3B40A 4B3SO 4QPKA 2O57A 4PA4A 2XASA 2IJIA 1MSDA 3OMAB 4J10A 1P7BA 2WA3A 1ZLZA 4TOIA 4DV1B 1KP2A 2LW1A 1SQFA 1Q6IA 4GZRB 3ETEA 4ZI7A 2JEUA 4YHHB 4J41A 2CTRA 1NR7A 3MD0A 4ABMA 5CBGA 4LR3A 5A2QN 2XOKG 3CCRV 3GWOA 3CJHB 4G27B 3LDEA 1VF7A 2QKSA 4I9WA 5CA3A 2UXNA 1YZBA 1KKDA 3PN1A 1GH6A 2E74B 3T1YO 3OGCC 3DTUB 3JARB 2CH7A 2KB1A 1RPOA 1BE3H 4JASA 4X64O 1LUWA 4WBNB 1S5LZ 2OCCC 1N0NA 1PM9A 1NR1A 4JI8B 4ICGA 3N27A 2W6JG 2P4VA 1M56C 5GTHZ 2BSKA 1TAEA 3FKSG 2L6LA 1VQ8V 2X6CA 2Q73A 2WLJA 3C3SA 5FL7G 5CN0A 1QR9A 4O2BA 2ZR3A 1WB8A 3WU2Z 2E5LO 3QNEA 2UUBO 2EIJB 1NJIW 1XL4A 1Q3EA 1JR9A 3U10A 1TVKB 4U3JA 2Q7HA 4YJ2A 3SR2C 3ZRWB 2NR5A 1Y66A 1JOYA 4H33A 3OUFA 4X64B 1UJWB 4JI1O 2LW7A 2XHBA 2GUZB 2Q6AA 4DR3O 2OYQA 4QGPA 1S72V 4RO2A 1JVMA 3LNNA 4KUMA 2LGWA 3AG4C 1YEWA 3FD9A 1Y74A 2WA4A 3K58A 2XT9A 1SKVA 1EZJA 5EIBD 4Z1VA 2QWOB 2Z0AA 4KXRA 3HKDA 2EINC 1HP8A 1N34O 3E8FA 1DF4A 2VRZA 5FPRA 2ZM6B 2VQFO 3LNMB 2QDOA 1YXBA 4QE9A 4DW0A 3BA8A 2RNBA 4Z1MG 1PNKA 5KA5A 1IXMA 2QGNA 1EZVH 1PP9H 1FXKC 1KC8W 3H1JH 4UVAA 2ZXWB 1K3EA 1XNRO 2YDEA 1KKCA 5DECA 5DN6G 3WFVA 1OCZC 1GMGA 1WP7A 3FB8C 2P90A 4TT3G 1FYJA 1SZTA 3L70H 4X65O 4DV5B 1XDCA 4ZHQB 5B1OA 1N34B 1OCOC 3ZHUA 5B3SB 2VQFB 4NR1A 1ZUQA 4X1KB 3CCJV 3JSNA 4ASUG 1K4CC 3AG3C 2HJDA 1MG1A 3K57A 2AZ2A 2ZINA 3ASNC 2ZNIA 3JCZA 1FXKA 3SPIA 3FB6C 3N2GB 5CMUA 2RQ6A 4O4LA 5LHIA 5CBHA 1N32B 4MVSA 3RYFA 1K5SA 4OPHA 3D36C 5IYBO 5J2TA 1XILA 2E75B 3VQYA 3DC6A 1Z5WA 4B3MB 3CXHF 1M9NA 4JI3B 5GONA 2KQXA 4TV9A 2EZPA 2ILMA 1TA8A 1MSWD 4X65B 3F7VC 3WB0A 3U11A 2KG7A 1Q81W 4MTGA 1L0NH 3ZS8C 4ZI7B 5EBMC 4K0KB 5IYCO 1BSMA 2BE3A 3ASOB 1L0LH 4OGQB 4NTWA 3MAQA 1GN2A 1ZL8A 4I0XA 1HNWO 4I50A 2ZQMA 3T4ZA 3EVKA 3K79A 4K8XA 1JX9A 5FPOA 2PGGA 2EIKC 4DV6O 4NKGB 5KHHA 4JAVA 4LH7A 1U96A 4RAIA 5B1AC 4U3FH 3C3TA 3D36A 3SGIA 2PI4A 3O9OA 3JAWA 2RJZA 1H38A 4KHPB 1XOUA 1R3LC 4O2AA 2PUSA 3QO5A 1XMQB 3B8NA 3ZEDA 2OCHA 3NXSA 2Q4PA 4MVRA 2DOSA 3QF7A 2Z5UA 3H1HH 1DLBA 3OM3B 1HNWB 2F4VO 3BCCH 2CGNA 3SYCA 3I5DA 2IJHA 3G71V 1OCCC 2IM9A 4AHCA 4DV6B 1I5XA 1M1KW 3AK1A 4U3JB 4YJ2B 3BFRA 1H2NA 1JPXA 4X20A 2ZE5A 3IC9A 4PA6A 2A7WA 3UQ8A 4DR1B 3B77A 1IURA 4LFAB 1IBMO 2OCCB 4J11A 4F6RA 4JF3A 4FLTA 1IVSA 5EBWC 5LMNO 1QR8A 4J9ZB 2DQ3A 1AP5A 3K06A 3ABMB 4PDMA 2FKXA 1KP3A 3UO3A 3QVNA 1YHQV 3ZRXA 4DUZO 3LSQA 1KMIZ 3O65A 2GV9A 5D5PA 1GN6A 4PV1B 3RYCB 3FFQA 1TUBA 2EBOA 3CPWU 1BGYH 4DV3B 1WPXA 4I55B 2F23A 3L9DA 4LFCO 1CP9A 2IH3C 5H2FZ 3CC4V 3TCUA 4DYLA 3W7TA 5IT9N 3WB1A 4LF9B 1K73W 2PZSA 3OGIB 1Q43A 3DC5A 3ZMVA 3Q4HA 4JI7O 2QE7G 2R70A 1US6A 5HFLA 3VBBA 1JA8A 2BTQB 1Q6UA 3AG4B 3ABKB 2JGUA 1M57C 3B09A 1I94O 3K03A 3IFXA 5JVDA 3IAYA 1CEZA 2DWDC 2EINB 2UUAO 2V1DA 1CXZB 2UUCO 3ZIAG 3ABLC 3ZHTA 5L3GA 1IBKO 4CH6A 2EX3A 1UFIA 1E79G 4LFCB 1HNZO 1IZ3A 2X0LA 3JD3A 4NXNO 3OT7A 4DV0O 1FXKB 2WLIA 3VQVA 4IYHA 4DRXA 3W7XA 4LWSB 4JZGA 2JS5A 1AI6A 3RYFB 2OWOA 1M90W 3AG1B 1S3JA 4UVCA 2UXCO 4LF4O 3T2MA 3GB7C 1QVFU 1V55B 4GT1A 3BPZA 4CC5A 3K04A 4Q20A 4UVBA 1N4CA 2Q7EA 3KCYA 3OFNG 1X59A 1AI4A 2DW4A 1B04A 1OCOB 1XNQO 1P7GA 4DR2O 4FFBB 4WFEA 4U7NA 4U7OA 4JI2B 3CSXA 1RM1C 3JYCA 1XMOO 2IBZH 1ZL8B 3AG3B 2A9HA 3DSQA 2N74A 2ZT9B 2HKOA 3JATB 4DV0B 3FAVB 3SDLA 4LF6O 4BIUA 4YY3O 5LOVA 3JD1A 3LDCA 2X7RB 5KX5B 2MK3A 3HPLC 5CA1A 2K9PA 5F2VO 2Y0IA 2KKWA 2YXLA 4O2AB 4L87A 3ETDA 4XDLA 2CTPA 1XNQB 4TV8B 3W7UA 2CGOA 4IT5A 1JJOA 1EFRG 4PDRA 2DE0X 3HKBA 4GKJO 1XMOB 1HWYA 2XAHA 2A0LA 4LFBO 3WB2A 3RN4A 4L8JA 1N36O 1F51A 3RVYA 5CB4B 4JV5B 4Z2WA 4UCRA 3ZMSA 4PI0A 4MVUA 5B1AB 5JJEB 1Z5VA 3D3IA 1O9GA 2GHYA 1FFXB 1NTKH 1SA0B 1N0JA 1KECA 1WP8A 2P22C 1HW7A 2LFSA 4OXSA 3CP1A 5LXTA 4ZIBA 1PD3A 3MDSA 4K35A 4FM1A 4UCSA 3CE2A 4K3AA 2P06A 4KP4A 1Q5OA 4GKJB 3J7AU 4FZ1A 4DV7B 4QPJA 5D5QA 1YDXA 1N36B 1G8MA 3HKEA 4E4EA 1OCCB 4CS3A 5KHJA 1F4MA 4NTXA 1TUBB 3CB2A 4TUYB 3K5NA 4WCEV 1TUEB 1YITV 4KL1A 3CCEV 4DR7O 1AI7A 2IJKA 4JZ2A 1VF6C 1Y76B 1N8RW 4LNUB 3BAAA 2A79B 2Q0AA 3ICXA 3G6EV 1QU7A 1FS0G 3OTOO 3SJCC 3VOUA 5J2UA 1YTFD 1AJPA 2QJ1A 3GVMA 3K5LA 4I9QA 1Y67A 2DYRB 2YSUB 4TQFA 3SPHA 5L3BA 2IW5A 3P3NA 3K9AA 3K3WA 5IE9A 2XTAA 3ABTA 2EIMB 3JAMN 4B3SB 3RYHB 3F7YC 2X6BA 1KQSU 2RDCA 1Q82W 4MT8A 4IHJA 3OR7C 4O4HB 4MW3A 1KBHA 5KHIA 2YI8A 4A5UB 3FB5C 4PA9A 5LA6A 4J7KA 3A2FA 3ZHVA 1HDJA 4I7ZB 4ZOLA 3SYAA 4JI6O 4R6ZA 1ZWIC 5H6QA 4UB6Z 1VF6A 4PA3A 2WLIB 4JAUA 3AK3A 4WFHA 4JYBA 5DM6V 3T1YB 3X2QC 3HKCB 3JASA 1V54C 4B3TO 3H01A 1SZXA 1FKAO 2GTAA 1W0KG 3E89A 2EILB 3CCMV 4DR5O 5KMGB 2LQTA 5HFMA 1JFFA 5LGTA 1QLNA 1PL0A 2CK3G 3BVOA 4YJ3A 1UPGA 5EZYB 4XDJA 4DK1A 4FFKA 3ABLB 3D8CA 3VQXA 1VQOV 2R9IA 2QKAA 3RGBA 4FVMA 5LP6C 5IDJA 2E5LB 5K1XA 4GYCB 5IYDO 2UUBB 4FLXA 1J95A 3RT3C 3E22A 4CBCA 3JD0A 4D7TA 3S3WA 3ETGA 4B3TB 1VQ6V 2UXDO 3TXSA 2PY5A 1GN4A 3N2KA 2OTLV 4P30A 4JI1B 4PJ0Z 4DR3B 1B3QA 2YC0A 3JAKA 2JS3A 4Q6GA 2JGDA 3WG7C 4MS2A 4UFZA 2Q68A 3HKBB 2WWWA 5LGUA 4GX0A 4MVQA 1COWG 3SJBC 3QTCA 5LP6A 3CC2V 5BR8O 3SYQA 4DR6O 1YTFB 1EN4A 3LUTB 3KG2A 5EC2C 1X4TA 4H13B 5DEDA 4BIZA 1BZKA 1H2SB 4MSWC 4NVPA 1YJWV 1PV0A 4LF7O 4XDKA 4FLUA 2YEVA 1L1FA 1R73A 4HNAB 4IIJB 1S76D 4WF9V 5KUMA 5IJ9A 1WAZA 2ZE7A 5CA0A 2QM8A 2AHZA 3ZHSA 1XNRB 1OHHG 4LC1A 2QWQB 2Y4UA 1BT8A 4LCUC 3R65A 3E8BA 4CS2A 1F7YA 2CTWA 1XL6A 1XI1A 4J7JA 1FXVA 1RSOB 1ZTEA 3TK1A 2Y48A 2KSDA 1MA1A 3KZIZ 4HAMA 3HKEB 3ZCCA 2YICA 5GTIZ 1FXHA 4WFFA 2HLDG 3J80N 2WLLA 1MZFA 2OT5A 4NXMO 4JAAA 2JRIA 4FJCC 1YSCA 1R3IC 3MHSC 3SYOA 1H2GA 1DK1A 3E86A 3FB7C 1PKXA 4I4TA 2VS0A 2CAZC 2WSSG 4F4LA 1D2DA 3BA9A 2IJJA 4AI8A 1YF2A 4O4JA 4DO2A 4B3RO 1R6NA 4JTCB 5J2UB 2DYSC 3QG5A 1I0HA 1NZ6A 3I56V 1BCCH 2CH7B 4GUNA 4X1IA 2BOCC 1I5YA 1FD9A 2UXXA 2JIZG 4X88A 4I5SA 1VQMV 3HR0A 4JYYA 1WNSA 2BSKB 2WLKA 2YXYA 2HJFC 3CRMA 4RUFA 1K9MW 4OX9O 1ZAUA 2Y69C 2QM7A 5C8YA 1OV9A 4O2BB 4NYKA 4B7EA 3C90A 4JTDB 2PI5A 2OTJV 3JASB 2YUAA 1VARA 4PHZA 3G6BA 4GKKO 2W6IG 4H37A 3CCSV 3IGAC 3JD2A 4WFAV 3ZX6A 3BEHA 2LFRA 5ITZA 4AILC 4GX1A 2NLJC 5JQGA 5H5NA 1VQKV 4TSFG 4DW1A 1M93A 1NKDA 2H8PC 3E83A 1M56B 3E35A 4JYAO 1JQ0A 1NTMH 2R9AA 1Y74B 4G2KA 1IX9A 3TETA 1V9PA 3ZMZA 3CCUV 1K4DC 4FPPA 2F4VB 5L3DA 3HKDB 1ORQC 3IC7A 1AILA 4IYIA 1O9HA 3X2QB 4E2LA 4HZ3A 1V54B 4GX2A 1R6KA 1QLEC 5JH7A 1JJ2U 3F5WC 1NBMG 4JI5O 3EHBB 2AW9A 3JALA 4JYCA 3CCVV 1IBMB 2HEPA 5KHKA 5IYZA 1G4YB 1AROP 1SQGA 1K5QA 1VF5B 2JGDB 3KKYA 1KU9A 3L73H 5LMNB 5EK0A 1E1RG 3OTFA 3W7WA 5BXZA 3CJHA 2QTSA 1HR0O 3TGUH 4FMTA 1F23A 1SETA 4DUZB 2YIDA 4J9YB 1WN7A 2EIJC 3AK2A 4MTXA 5LP6B 1K8AW 5FLXN 2B9ZA 1KD1W 4J42A 3L72H 2UU9O 4R7CA 1SQXH 1D5NA 4X62O 3JARA 4BR6A 2ZIOA 3L74H 4WBNA 2YEVB 1GTOA 1LUVA 4X9QA 3G4SV 4JPRA 4FLWA 1URFA 2YS8A 3CEIA 4O4LB 1VQPV 4QIWF 2RCVA 2HHHO 4JI7B 5A9GA 4F6EA 3CRAA 1S0VA 1OCZB 1SF9A 5J2TB 4JI4O 4CH5A 5GONB 5LBQA 4TV9B 3CS5A 2ADQB 1I94B 1YIJV 2LJ2A 3ZBHA 4CS4A 2DWEC 3JCUZ 5KA6A 1SERA 1PNMA 2LGQA 2KG7B 3LSUA 2UUAB 2WLLB 2YI9A 4UXNA 1TVKA 2UU9B 1VMGA 1LNQA 3ZRWA 2UUCB 1OCRC 1R3KC 5L3EA 3ZN0A 2HP8A 1IBKB 2R9RB 4I0XB 3CHXA 4I50B 1ENVA 1HNZB 5IWAO 4NXNB 1GN3A 4UUJC 3ASNB 2F66C 2DQ0A 3THOA 4JGSA 3H1LH 1IDSA 2ZE6A 2UXCB 1DGSA 4LF4B 4JI4B 2Q9LA 3UO2A 3OEEG 2AHYA 3JAWB 5BY1A 2JJ1G 1AR1B 3L71H 5E79Z 4R50A 1L8DA 1BQZA 5B3SC 1SC5B 4MTFA 4DV2O 4JI0O 1PNLA 4C7UA 4DR2B 3CX5F 2GDSA 3OR6C 2JJ2G 1S5HC 4D7SA 2QWRB 4FLVA 1PPJH 1GKFA 5C8YB 3JSLA 2RN9A 5EYPA 1MMMA 1I08A 4FM0A 1F4NA 1YVWA 4PI2A 1Z2GA 2R72A 2EIKB 4UCTA 4JTAB 4LF6B 2VWKA 4UV9A 4YY3B 1N33O 4WFGA 1WA8A 4X20B 2WLHA 5LHHA 2JDIG 4FM2A 2A06H 1BQ0A 5KUKA 2FYUH 1S77D 2HVKC 2PYJA 3P30A 5LHGA 2CDYA 4ZHQA 1VQLV 1T5EA 1QQCA 4DV2B 1AR4A 4JI0B 4F6RB 4YHHO 5L3CA 4BIOA 2WLMA 4D6TH 2DJVA 3OW2U 3SYPA 1AR5A 2IU3A 1H2LA 3SPGA 4LFBB 2DMXA 4WFBV 1K34A 3OAAG 4XBFA 4FLZA 2QSAA 2FTKA 5H6RA 1GRJA 2P67A 5JCOC 3E2EA 1QNMA 1E1QG 1VQNV 1BHAA 2LP7A 5JH7B 2M6YA 1FFTB 4OPAA 3UM7A 3UT5A 4JI8O 1LR1A 3K5OA 2WPDG 2JEXA 3JALB 1XBLA 1IBLO 4X89A 5IYZB 3Q4HB 1Y4MA 2YXHA 4DUYO 3CWBH 2QEXV 4PDVA 3K0GA 3B8MA 1NQTA 3F5TA 3EFFK 5JVDB 4H44B 2GBOA 4X1YA 2RMKB 4KFMA 2ZDIC 1BL8A 3ZJZA 5JWPA 1GM7A 2ADPA 5JCOA 1G6UA 2H94A 4CZZA 1QLEB 3H1IH 2CE4A 4P2ZA 1ZSPA 2Z3YA 2ZIMA 4DR7B 2B1IA 2QWPB 2B5UA 3CRQA 3JD4A 1SQVH 5C93A 2F95B 3ZHQA 1IBLB 4DRXB 3G80A 3SPJA 3OTOB 2W0XA 5LGNA 3A8TA 4PD4F 1M5IA 4FIPC 3HB3B 3ABMC 3G67A 4DUYB 5KLVH 3P3PA 1VQ4V 1QVGU 2P4KA 3ZMTA 3RW0A 4EKWA 2QWNB 1PL4A 1AVMA 1M57B 2ATKC 4MW8A 3BHPA 3CXCU 1RP3B 2EJ7A 3J81N 2JK5C 5BMVA 2ZM6O 2WLNA 1K7DA 5B1BC 2VWJA 2ZDIA 3ZN1A 3K0DA 2XAQA 4NB5A 2ZR2A 2ZD9A 3P32A 3T4DA 2Q5ZA 5KHGA 4JI6B 1P4RA 1FPOA 4K8ZA 1KUQA 4PELA 4CH4A 3CCLV 5JJJB 1W2BU 3RYIA 1IXBA 3ABKC 5LOVB 2B1GA 3EXAA 5TISZ 1NVPD 1SS3A 5CA1B 2XAFA 4DV5O 4DR5B 2EZOA 1WJZA 3SJAC 3RYCA 1SQPH 2V4DA 3MHHC 2PYLA 1GO3F 1NT2B 4QE7A 1KYOF 1OCRB 4I55A 4HBNA 2K1EA 1Q86W 1RM1B 5EYPB 2ETNA 3R66A 1GK9A 1YJNV 5FNVA 2Q7GA 1N32O 2ZCEA 5B66Z 3AG1C 1U97A 4RQEA 3RVZA 3UKMA 2XUMA 2BTQA 1WA8B 4B3MO 4JI3O 2UXDB 1A32A 2HG5C 3RFRA 1V55C 1NU1H 4W4LA 3A0HZ 3W7SA 3A0BZ 3L75H 1WLEA 3FX7A 1BMFG 2NNUA 4K0KO 1SESA 2CUGA 5LXTB 3STZC 1SQQH 4BAYA 1THZA 1AJQA 5BZBA 2Y4TA 1Y6XA 2F43G 3T1CA 3LDDA 1VQ9V 1SRYA 1OJHA 3APOA 2ODMA 1AJNA 3OD4A 2P5OA 4LWSA 5BR8B 3GWKC 1BHBA 4DR6B 1Q90D 4O4IA 1NH2D 2QKCA 3RWRD 3PJSK 1EBOA 4DV4O 4LF7B 3UT5B 4TQDA 4KHPO 2IH1C 3STLC 5IY5C 3I55V 1XMQO 4GX5A 3ML0A 4DK0A 4FFBA 5LL6Y 4CC6A 3ZRVA 1HNXO 2N05A 2ITDC 3DXRA 4PDLA 4DR4O 1Q7YW 2EULA 2W0FC 5L3FA 1NS1A 2Q0OC 1RPRA 3AEIA 3JATA 2AGAA 4X66O 2ITCC 1FAFA 1H8HG 4EB6A 2BTOA 4X1YB 3FAVA 4IHJB 1H2KA 3D3QA 3FYIB 1CPYA 1P49A 3OUSA 1SQBH 2FMLA 5AG2A 3SPCA 4NXMB 4HYOA 3AG2C 1NVPB 5LA6B 4QNHB 5KX5A 4R8CA 4DR1O 2QA4V 4LFAO 1WPBA 4ZOLB 4DV4B 1YI2V 5K1PA 1K97A 1XUQA 3CCQV 5JJNB 4FK5C 2OIGA 5LYJA 1NTZH 3S3XA 2H3OA 4TV8A 4B3RB 2EJRA 2V7QG 2YIBA 3K9SA 4AQYO 3K59A 1HNXB 4DR4B 4UV8A 1AB3A 4MVOA 3BRCA 1D5AA 2IU0A 5CB4A 1JFFB 2F1MA 4X66B 1VP7A 5BMVB 2ZNJA 4DXWA 5IJ0A 5CBFA 4J7ZA 4YJ3B 1JMKC 1K33A 2F93B 4DV3O 1MZEA 5EBLC 5LMUO 1KB9F 3CRCA 2HFEC 4P9OA 1FFXA 2AXTZ 4OX9B
chains in the Genus database with same CATH topology
1JCHA 5B3SB 3OE7G 3ABTA 2DQ0A 2EIMB 3F7YC 2X6BA 1KQSU 4JGSA 3CCJV 1Q82W 4ASUG 3M99B 4MT8A 2P7TC 2X6AA 1YJ9V 1K4CC 3OR7C 3AG3C 3OEEG 2AHYA 4MVZA 1MG1A 4MW3A 3BY6A 4QJFB 2DYRC 2JJ1G 3ASNC 3JCZA 1FXKA 3SPIA 3FB6C 3FB5C 1AR1B 4R50A 4PA9A 5CMUA 5B3SC 4MTFA 5LHIA 5CBHA 3FYEB 2EIMC 1PNLA 2BOBC 1MABG 4MVSA 3SYAA 4GCZA 1K5SA 5E1AC 4R6ZA 1ZWIC 5H6QA 4ZBMA 5IYBO 4PA3A 2WLIB 4JAUA 4WFHA 3OR6C 2JJ2G 1S5HC 4JYBA 1NH2B 1M9NA 5DM6V 1GKFA 3X2QC 5B1BB 1W0JG 1V54C 1F4NA 4X8AA 2EZPA 3H01A 1MSWD 3F7VC 3RBZA 1Q81W 4MTGA 1W0KG 2Q69A 2EIKB 3E89A 4JTAB 1GM9A 4UV9A 2EILB 5EBMC 3CCMV 5IYCO 3ASOB 5HFMA 4WFGA 3K08A 5LGTA 1QLNA 3QO8A 1PL0A 2CK3G 2WLHA 4LP8A 4YXWG 2JDIG 5LHHA 4XDJA 2ZQMA 5B1NA 3T4ZA 5KUKA 1ROPA 1S77D 2HVKC 3K79A 3CYOA 1JX9A 3P30A 5LHGA 2M7WA 3ABLB 1VQLV 2EIKC 2HR3A 1VQOV 2EILC 2R9IA 4JAVA 3OEHG 3CD6V 4RAIA 5L3CA 5B1AC 3A0RA 5IDJA 2WLMA 3D36A 2PI4A 5IYDO 3QO7A 3OW2U 1AI5A 3SYPA 3E8HA 1J95A 2IU3A 4CBCA 3JD0A 3SPGA 2WAMA 4WFBV 1K34A 3ETGA 3OAAG 4XBFA 3WG7B 1H38A 1VQ6V 1DF5A 1R3LC 2FTKA 3LSSA 5H6RA 2D3OW 3ABUA 4BW5A 2P67A 3QO5A 3E2EA 3B8NA 2OTLV 4P30A 1E1QG 1VQNV 1BHAA 2LP7A 3NXSA 4G28B 4MVRA 1FFTB 2Z5UA 3UM7A 3CC7V 1DLBA 3OM3B 2GSMB 3WG7C 2WPDG 3SYCA 2JEXA 2IJHA 4MS2A 3G71V 1OCCC 4X89A 2Q68A 3CMAV 2WWWA 5LGUA 1I5XA 4GX0A 1M1KW 4MVQA 1COWG 1Y4MA 2ZXWC 3OMNB 4LBEC 4TWKA 1JPXA 4N23A 3CC2V 2QEXV 4PDVA 5GW7A 3SYQA 4PA6A 3K0GA 4PA7A 1YTFB 3B77A 3B8MA 1NQTA 3LUTB 3EFFK 2OCCB 3KG2A 5EC2C 4BIZA 4MSWC 1YJWV 4KFMA 2ZDIC 4XDKA 4JF3A 1BL8A 2YEVA 1R73A 1L1FA 3ZJZA 3CMEV 5EBWC 2XAJA 1GM7A 2HVJC 1S76D 4WF9V 1QR8A 5KUMA 4J9ZB 2DQ3A 2H94A 3K06A 4CZZA 4RQFA 1QLEB 3ABMB 4PDMA 4P2ZA 2QM8A 1KP3A 3SJQC 2AHZA 2Z3YA 1VQ5V 1OHHG 3ZRXA 1K92A 2B1IA 4LC1A 1YHQV 3LSQA 2B5UA 2QTOA 3JD4A 4MTOA 5C93A 4LCUC 3R65A 2C2AA 3E8BA 1MOFA 1XL6A 4RUEA 1H8EG 1FXVA 2EBOA 3ZMUA 3TK1A 3SPJA 1B6QA 3CPWU 2Y48A 5LGNA 4FIPC 3HB3B 1WPXA 3ABMC 4HAMA 3ZCCA 3ZRSA 5IY5B 1FXHA 1VQ4V 1CP9A 1QVGU 4WFFA 3ZMTA 3RW0A 4EKWA 2HLDG 2WLLA 2OT5A 2IH3C 1M57B 2ATKC 3CC4V 3TCUA 4MW8A 3CXCU 3W7TA 4FJCC 1K73W 1YSCA 2JK5C 2DYSB 2WLNA 1R3IC 3MHSC 3SYOA 1H2GA 1K7DA 5B1BC 3ZMVA 3E86A 2ZDIA 2QE7G 3FB7C 1PKXA 3ZN1A 3K0DA 5EC1C 2XAQA 5HFLA 2ZR2A 3VBBA 2XNDG 2ZD9A 2WSSG 3P32A 4F4LA 4ZKIA 5J9PC 2Q67A 3AG4B 1OZ0A 3ABKB 3T4DA 2IJJA 3DGEA 1M57C 3OMIB 3ASOC 3K03A 3IFXA 1QCEA 4DO2A 1R6NA 4JTCB 2DYSC 1P4RA 1CEZA 3I56V 2DWDC 3AG2B 2EINB 4MVMA 2V1DA 4PELA 2P6JA 3CCLV 4N21A 2BOCC 2Y69B 5H9CA 1I5YA 1W2BU 3ZIAG 2UXXA 2JIZG 3E8GA 4X88A 3ABLC 4I5SA 3ABKC 2XAGA 2B1GA 5L3GA 1VQMV 4P9PA 1E79G 1NVPD 2X0LA 3JD3A 2WLKA 2XAFA 1GM8A 2HJFC 2EZOA 1FXKB 2WLIA 1R3JC 4RUFA 1QBZA 1K9MW 2Y69C 2QM7A 1DTOA 1VQ7V 3MHHC 3W7XA 4QPKA 1AI6A 1GO3F 4PA4A 2XASA 2IJIA 1M90W 3AG1B 1S3JA 3OMAB 4QE7A 4UVCA 1P7BA 4JTDB 1OCRB 3T2MA 2PI5A 2OTJV 2K1EA 1KP2A 1Q86W 1RM1B 3GB7C 1QVFU 3ETEA 1V55B 2JEUA 4GT1A 1GK9A 1NR7A 3K04A 3MD0A 4Q20A 4UVBA 5CBGA 1YJNV 2XOKG 2W6IG 3OFNG 4H37A 3CCSV 3CCRV 3GWOA 1AI4A 3IGAC 4G27B 2DW4A 3LDEA 3JD2A 1OCOB 4WFAV 3AG1C 2QKSA 4I9WA 5CA3A 3BEHA 2LFRA 4RQEA 4GX1A 2UXNA 4WFEA 3RVZA 1KKDA 2NLJC 4U7NA 4U7OA 3UKMA 1VQKV 1RM1C 4TSFG 3JYCA 3OGCC 2HG5C 1V55C 1NKDA 3AG3B 2A9HA 2H8PC 3E83A 1M56B 3W7SA 3E35A 1JQ0A 2HKOA 3DTUB 1WLEA 4G2KA 1BMFG 1RPOA 2KB1A 2NNUA 4JASA 4BIUA 3TETA 1SESA 2OCCC 3ZMZA 3CCUV 1K4DC 1NR1A 4FPPA 3STZC 5L3DA 3JD1A 1ORQC 4BAYA 1THZA 3LDCA 2X7RB 2W6JG 1M56C 2MK3A 3IC7A 3HPLC 1AJQA 5BZBA 2F43G 3T1CA 3X2QB 3FKSG 4HZ3A 4E2LA 3LDDA 1V54B 4GX2A 1SRYA 1VQ8V 1VQ9V 1R6KA 1QLEC 2X6CA 1AJNA 2WLJA 4L87A 1JJ2U 5FL7G 3F5WC 1NBMG 3ETDA 4XDLA 5CN0A 1QR9A 1BHBA 3W7UA 2ZR3A 1NH2D 3EHBB 4JYCA 3CCVV 1EFRG 4PDRA 3QNEA 2EIJB 1G4YB 3PJSK 1NJIW 1EBOA 1XL4A 1AROP 1HWYA 2XAHA 1K5QA 2A0LA 3ZRWB 1F51A 2IH1C 3STLC 5IY5C 3RVYA 5EK0A 1E1RG 3W7WA 3I55V 1Y66A 1JOYA 4H33A 3OUFA 4FMTA 4GX5A 3ML0A 1F23A 1UJWB 1SETA 3ZMSA 4J9YB 4MVUA 3ZRVA 2EIJC 4MTXA 5B1AB 1K8AW 2ITDC 2Q6AA 3D3IA 4PDLA 1KD1W 2GHYA 1Q7YW 1S72V 2W0FC 4R7CA 5L3FA 4RO2A 1JVMA 1KECA 1RPRA 3AEIA 4KUMA 3AG4C 2ITCC 1H8HG 2LFSA 4OXSA 3FYIB 3CP1A 1EZJA 2YEVB 1GTOA 1CPYA 3G4SV 3OUSA 4JPRA 1PD3A 3SPCA 4HYOA 3AG2C 2EINC 1NVPB 4KP4A 4QNHB 3E8FA 4R8CA 2QA4V 1DF4A 1VQPV 4QIWF 3LNMB 1YI2V 1K97A 4QPJA 4QE9A 3CCQV 1S0VA 1G8MA 1OCZB 4Z1MG 4FK5C 1OCCB 1F4MA 1PNKA 5KA5A 1IXMA 5LBQA 4WCEV 1FXKC 1YIJV 1TUEB 1KC8W 2EJRA 4UVAA 2ZXWB 1YITV 2DWEC 2V7QG 3CCEV 5KA6A 1K3EA 1SERA 1PNMA 1AI7A 5DN6G 2WLLB 4UXNA 4UV8A 3WFVA 2IJKA 4MVOA 1OCZC 1LNQA 3ZRWA 1OCRC 1N8RW 1R3KC 2IU0A 1GMGA 2A79B 3FB8C 5L3EA 3ZN0A 4DXWA 3G6EV 5CBFA 2R9RB 1FS0G 2P90A 4TT3G 1ENVA 1K33A 3VOUA 1SZTA 5EBLC 4UUJC 1YTFD 1AJPA 2HFEC 2DYRB 2YSUB 3ASNB 5B1OA 3SPHA 5L3BA 2IW5A 3K9AA 3K3WA 1OCOC 4P9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS V;  1K9M W;  3CC4 V;  3CXC U;  1VQ7 V;  4WFA V;  3I56 V;  3CCU V;  1K8A W;  3CCV V;  2QA4 V;  3CC7 V;  1VQP V;  1K73 W;  3OW2 U;  1KQS U;  1KD1 W;  3CCL V;  1Q7Y W;  1YI2 V;  1S72 V;  1N8R W;  1M90 W;  3CCJ V;  1YJW V;  1Q82 W;  3G71 V;  1W2B U;  1NJI W;  2QEX V;  5DM6 V;  1VQK V;  1YJ9 V;  3CCQ V;  4WFB V;  1VQ6 V;  3G6E V;  3CMA V;  3CPW U;  2OTJ V;  1R73 A;  3CME V;  1Q86 W;  1VQL V;  1M1K W;  1VQM V;  1QVF U;  1VQ9 V;  1VQ8 V;  4WF9 V;  3I55 V;  2D3O W;  1VQO V;  4WCE V;  1YIJ V;  1Q81 W;  1KC8 W;  1JJ2 U;  1QVG U;  1VQ4 V;  3G4S V;  1YJN V;  2OTL V;  3CD6 V;  1YIT V;  1VQN V;  3CC2 V;  3CCM V;  3CCE V;  3CCR V;  1VQ5 V;  1YHQ V; 
#chains in the Genus database with same CATH topology
 1SA0 A;  1JCH A;  3OE7 G;  1J5E O;  4B7K A;  4LF9 O;  3M99 B;  2P7T C;  2X6A A;  1YJ9 V;  3TXQ A;  4UCO A;  2UXB O;  4YIP A;  4MVZ A;  3RYI B;  3BY6 A;  3E22 B;  4QJF B;  2DYR C;  1FJG O;  4GKK B;  2QM4 A;  4AQY B;  3FYE B;  2EIM C;  2OIE A;  2BOB C;  2Y0P A;  1MAB G;  2ZKO A;  3N2K B;  4GCZ A;  5E1A C;  1Q6H A;  3B2E E;  4ZBM A;  2MW2 B;  1BS3 A;  4RWU A;  4H0L B;  1NH2 B;  4TUY A;  1QHT A;  2DN9 A;  4CH3 A;  5B1B B;  3JAK B;  1W0J G;  3M7M X;  4EFE A;  4X8A A;  4JYA B;  4IGG A;  5LMU B;  4LF5 O;  1XEQ A;  1AP6 A;  2FB5 A;  3RBZ A;  3U0Z A;  2Q69 A;  3H9V A;  1GM9 A;  2YIB D;  3T1H O;  1G1X B;  1Y76 A;  1J5E B;  1VEW A;  4LNU A;  3K08 A;  3KCX A;  5FNV B;  2BCC H;  3APQ A;  3QO8 A;  1MNG A;  4LP8 A;  1P84 F;  2N04 A;  4YXW G;  2UXB B;  4BW9 A;  5B1N A;  1RFY A;  1ROP A;  1XQ8 A;  3CYO A;  2M7W A;  1FJG B;  2HR3 A;  1GAX A;  2EIL C;  3OEH G;  3CD6 V;  1EM1 A;  2QR4 A;  3RYH A;  3A0R A;  4JI5 B;  5IJ9 B;  4FLY A;  4GLX A;  5CA0 B;  3QO7 A;  4O4H A;  1AI5 A;  1XHX A;  3E8H A;  4JI2 O;  2WAM A;  3WG7 B;  4EFB A;  1DF5 A;  3UCS C;  4LF5 B;  1ZX3 A;  3LSS A;  2D3O W;  3ABU A;  1HR0 B;  4BW5 A;  2YIA A;  2A3Q A;  4W4K A;  3T1H B;  3NR7 A;  2PTM A;  4BWA A;  4G28 B;  1M4U A;  2Q8V A;  3CC7 V;  3HKC A;  3VQW A;  4O4I B;  2GSM B;  5KAI Z;  4UB8 Z;  4FZ0 A;  2E3C A;  4YIO A;  4X62 B;  3CMA V;  1R6T A;  3BAB A;  5KMG A;  1YCI A;  2ZXW C;  4I4T B;  4B08 A;  3OMN B;  5B5E Z;  4LBE C;  4TWK A;  4N23 A;  1Q8I A;  2D2C B;  5GW7 A;  2GUZ A;  4PA7 A;  5EZY A;  4LH6 A;  1EN5 A;  4J80 A;  1WB7 A;  3M8A A;  4O4J B;  2HHH B;  1B06 A;  1R1B A;  3DXR B;  3CRR A;  4X1I B;  3CME V;  2XAJ A;  3B4S A;  2HVJ C;  2VQE O;  4EB6 B;  4RQF A;  3SJQ C;  4JV5 O;  4LF8 O;  1VQ5 V;  1K92 A;  2QTO A;  4MTO A;  2LO1 A;  1XHZ A;  2C2A A;  1MOF A;  1TGO A;  3ETQ A;  3ZHR A;  4RUE A;  1H8E G;  2G38 A;  3ZMU A;  1XRE A;  1B6Q A;  2E76 B;  5IWA B;  2ZE8 A;  1H2M A;  1W59 A;  3ZRS A;  1I7F A;  5IY5 B;  5LYJ B;  2JVD A;  4IL6 Z;  5KAF Z;  3AG7 A;  2DYS B;  4DV7 O;  2FL4 A;  5ITZ B;  5EC1 C;  1S5J A;  2L35 A;  2XND G;  5JQG B;  4ZKI A;  2VQE B;  5J9P C;  2Q67 A;  1OZ0 A;  4DV1 O;  1EN6 A;  3H1K H;  5IJ0 B;  1VIB A;  4UCU A;  3DGE A;  3OMI B;  3ASO C;  4LF8 B;  1QCE A;  4NTY A;  4X1K A;  3K5M A;  2AZ0 A;  3TJT A;  1NI8 A;  3AG2 B;  4MVM A;  2P6J A;  4N21 A;  2ARH A;  4HNA A;  2Y69 B;  5H9C A;  4IIJ A;  3E8G A;  2NN4 A;  2XAG A;  3N2G A;  4P9P A;  2PF4 E;  4EEQ A;  2CTQ A;  4UCV A;  5EIB C;  1GM8 A;  1R3J C;  1N33 B;  1QBZ A;  3IJ4 A;  1VQ7 V;  1DTO A;  2GTS A;  1RSO A;  3B40 A;  4B3S O;  4QPK A;  2O57 A;  4PA4 A;  2XAS A;  2IJI A;  1MSD A;  3OMA B;  4J10 A;  1P7B A;  2WA3 A;  1ZLZ A;  4TOI A;  4DV1 B;  1KP2 A;  2LW1 A;  1SQF A;  1Q6I A;  4GZR B;  3ETE A;  4ZI7 A;  2JEU A;  4YHH B;  4J41 A;  2CTR A;  1NR7 A;  3MD0 A;  4ABM A;  5CBG A;  4LR3 A;  5A2Q N;  2XOK G;  3CCR V;  3GWO A;  3CJH B;  4G27 B;  3LDE A;  1VF7 A;  2QKS A;  4I9W A;  5CA3 A;  2UXN A;  1YZB A;  1KKD A;  3PN1 A;  1GH6 A;  2E74 B;  3T1Y O;  3OGC C;  3DTU B;  3JAR B;  2CH7 A;  2KB1 A;  1RPO A;  1BE3 H;  4JAS A;  4X64 O;  1LUW A;  4WBN B;  1S5L Z;  2OCC C;  1N0N A;  1PM9 A;  1NR1 A;  4JI8 B;  4ICG A;  3N27 A;  2W6J G;  2P4V A;  1M56 C;  5GTH Z;  2BSK A;  1TAE A;  3FKS G;  2L6L A;  1VQ8 V;  2X6C A;  2Q73 A;  2WLJ A;  3C3S A;  5FL7 G;  5CN0 A;  1QR9 A;  4O2B A;  2ZR3 A;  1WB8 A;  3WU2 Z;  2E5L O;  3QNE A;  2UUB O;  2EIJ B;  1NJI W;  1XL4 A;  1Q3E A;  1JR9 A;  3U10 A;  1TVK B;  4U3J A;  2Q7H A;  4YJ2 A;  3SR2 C;  3ZRW B;  2NR5 A;  1Y66 A;  1JOY A;  4H33 A;  3OUF A;  4X64 B;  1UJW B;  4JI1 O;  2LW7 A;  2XHB A;  2GUZ B;  2Q6A A;  4DR3 O;  2OYQ A;  4QGP A;  1S72 V;  4RO2 A;  1JVM A;  3LNN A;  4KUM A;  2LGW A;  3AG4 C;  1YEW A;  3FD9 A;  1Y74 A;  2WA4 A;  3K58 A;  2XT9 A;  1SKV A;  1EZJ A;  5EIB D;  4Z1V A;  2QWO B;  2Z0A A;  4KXR A;  3HKD A;  2EIN C;  1HP8 A;  1N34 O;  3E8F A;  1DF4 A;  2VRZ A;  5FPR A;  2ZM6 B;  2VQF O;  3LNM B;  2QDO A;  1YXB A;  4QE9 A;  4DW0 A;  3BA8 A;  2RNB A;  4Z1M G;  1PNK A;  5KA5 A;  1IXM A;  2QGN A;  1EZV H;  1PP9 H;  1FXK C;  1KC8 W;  3H1J H;  4UVA A;  2ZXW B;  1K3E A;  1XNR O;  2YDE A;  1KKC A;  5DEC A;  5DN6 G;  3WFV A;  1OCZ C;  1GMG A;  1WP7 A;  3FB8 C;  2P90 A;  4TT3 G;  1FYJ A;  1SZT A;  3L70 H;  4X65 O;  4DV5 B;  1XDC A;  4ZHQ B;  5B1O A;  1N34 B;  1OCO C;  3ZHU A;  5B3S B;  2VQF B;  4NR1 A;  1ZUQ A;  4X1K B;  3CCJ V;  3JSN A;  4ASU G;  1K4C C;  3AG3 C;  2HJD A;  1MG1 A;  3K57 A;  2AZ2 A;  2ZIN A;  3ASN C;  2ZNI A;  3JCZ A;  1FXK A;  3SPI A;  3FB6 C;  3N2G B;  5CMU A;  2RQ6 A;  4O4L A;  5LHI A;  5CBH A;  1N32 B;  4MVS A;  3RYF A;  1K5S A;  4OPH A;  3D36 C;  5IYB O;  5J2T A;  1XIL A;  2E75 B;  3VQY A;  3DC6 A;  1Z5W A;  4B3M B;  3CXH F;  1M9N A;  4JI3 B;  5GON A;  2KQX A;  4TV9 A;  2EZP A;  2ILM A;  1TA8 A;  1MSW D;  4X65 B;  3F7V C;  3WB0 A;  3U11 A;  2KG7 A;  1Q81 W;  4MTG A;  1L0N H;  3ZS8 C;  4ZI7 B;  5EBM C;  4K0K B;  5IYC O;  1BSM A;  2BE3 A;  3ASO B;  1L0L H;  4OGQ B;  4NTW A;  3MAQ A;  1GN2 A;  1ZL8 A;  4I0X A;  1HNW O;  4I50 A;  2ZQM A;  3T4Z A;  3EVK A;  3K79 A;  4K8X A;  1JX9 A;  5FPO A;  2PGG A;  2EIK C;  4DV6 O;  4NKG B;  5KHH A;  4JAV A;  4LH7 A;  1U96 A;  4RAI A;  5B1A C;  4U3F H;  3C3T A;  3D36 A;  3SGI A;  2PI4 A;  3O9O A;  3JAW A;  2RJZ A;  1H38 A;  4KHP B;  1XOU A;  1R3L C;  4O2A A;  2PUS A;  3QO5 A;  1XMQ B;  3B8N A;  3ZED A;  2OCH A;  3NXS A;  2Q4P A;  4MVR A;  2DOS A;  3QF7 A;  2Z5U A;  3H1H H;  1DLB A;  3OM3 B;  1HNW B;  2F4V O;  3BCC H;  2CGN A;  3SYC A;  3I5D A;  2IJH A;  3G71 V;  1OCC C;  2IM9 A;  4AHC A;  4DV6 B;  1I5X A;  1M1K W;  3AK1 A;  4U3J B;  4YJ2 B;  3BFR A;  1H2N A;  1JPX A;  4X20 A;  2ZE5 A;  3IC9 A;  4PA6 A;  2A7W A;  3UQ8 A;  4DR1 B;  3B77 A;  1IUR A;  4LFA B;  1IBM O;  2OCC B;  4J11 A;  4F6R A;  4JF3 A;  4FLT A;  1IVS A;  5EBW C;  5LMN O;  1QR8 A;  4J9Z B;  2DQ3 A;  1AP5 A;  3K06 A;  3ABM B;  4PDM A;  2FKX A;  1KP3 A;  3UO3 A;  3QVN A;  1YHQ V;  3ZRX A;  4DUZ O;  3LSQ A;  1KMI Z;  3O65 A;  2GV9 A;  5D5P A;  1GN6 A;  4PV1 B;  3RYC B;  3FFQ A;  1TUB A;  2EBO A;  3CPW U;  1BGY H;  4DV3 B;  1WPX A;  4I55 B;  2F23 A;  3L9D A;  4LFC O;  1CP9 A;  2IH3 C;  5H2F Z;  3CC4 V;  3TCU A;  4DYL A;  3W7T A;  5IT9 N;  3WB1 A;  4LF9 B;  1K73 W;  2PZS A;  3OGI B;  1Q43 A;  3DC5 A;  3ZMV A;  3Q4H A;  4JI7 O;  2QE7 G;  2R70 A;  1US6 A;  5HFL A;  3VBB A;  1JA8 A;  2BTQ B;  1Q6U A;  3AG4 B;  3ABK B;  2JGU A;  1M57 C;  3B09 A;  1I94 O;  3K03 A;  3IFX A;  5JVD A;  3IAY A;  1CEZ A;  2DWD C;  2EIN B;  2UUA O;  2V1D A;  1CXZ B;  2UUC O;  3ZIA G;  3ABL C;  3ZHT A;  5L3G A;  1IBK O;  4CH6 A;  2EX3 A;  1UFI A;  1E79 G;  4LFC B;  1HNZ O;  1IZ3 A;  2X0L A;  3JD3 A;  4NXN O;  3OT7 A;  4DV0 O;  1FXK B;  2WLI A;  3VQV A;  4IYH A;  4DRX A;  3W7X A;  4LWS B;  4JZG A;  2JS5 A;  1AI6 A;  3RYF B;  2OWO A;  1M90 W;  3AG1 B;  1S3J A;  4UVC A;  2UXC O;  4LF4 O;  3T2M A;  3GB7 C;  1QVF U;  1V55 B;  4GT1 A;  3BPZ A;  4CC5 A;  3K04 A;  4Q20 A;  4UVB A;  1N4C A;  2Q7E A;  3KCY A;  3OFN G;  1X59 A;  1AI4 A;  2DW4 A;  1B04 A;  1OCO B;  1XNQ O;  1P7G A;  4DR2 O;  4FFB B;  4WFE A;  4U7N A;  4U7O A;  4JI2 B;  3CSX A;  1RM1 C;  3JYC A;  1XMO O;  2IBZ H;  1ZL8 B;  3AG3 B;  2A9H A;  3DSQ A;  2N74 A;  2ZT9 B;  2HKO A;  3JAT B;  4DV0 B;  3FAV B;  3SDL A;  4LF6 O;  4BIU A;  4YY3 O;  5LOV A;  3JD1 A;  3LDC A;  2X7R B;  5KX5 B;  2MK3 A;  3HPL C;  5CA1 A;  2K9P A;  5F2V O;  2Y0I A;  2KKW A;  2YXL A;  4O2A B;  4L87 A;  3ETD A;  4XDL A;  2CTP A;  1XNQ B;  4TV8 B;  3W7U A;  2CGO A;  4IT5 A;  1JJO A;  1EFR G;  4PDR A;  2DE0 X;  3HKB A;  4GKJ O;  1XMO B;  1HWY A;  2XAH A;  2A0L A;  4LFB O;  3WB2 A;  3RN4 A;  4L8J A;  1N36 O;  1F51 A;  3RVY A;  5CB4 B;  4JV5 B;  4Z2W A;  4UCR A;  3ZMS A;  4PI0 A;  4MVU A;  5B1A B;  5JJE B;  1Z5V A;  3D3I A;  1O9G A;  2GHY A;  1FFX B;  1NTK H;  1SA0 B;  1N0J A;  1KEC A;  1WP8 A;  2P22 C;  1HW7 A;  2LFS A;  4OXS A;  3CP1 A;  5LXT A;  4ZIB A;  1PD3 A;  3MDS A;  4K35 A;  4FM1 A;  4UCS A;  3CE2 A;  4K3A A;  2P06 A;  4KP4 A;  1Q5O A;  4GKJ B;  3J7A U;  4FZ1 A;  4DV7 B;  4QPJ A;  5D5Q A;  1YDX A;  1N36 B;  1G8M A;  3HKE A;  4E4E A;  1OCC B;  4CS3 A;  5KHJ A;  1F4M A;  4NTX A;  1TUB B;  3CB2 A;  4TUY B;  3K5N A;  4WCE V;  1TUE B;  1YIT V;  4KL1 A;  3CCE V;  4DR7 O;  1AI7 A;  2IJK A;  4JZ2 A;  1VF6 C;  1Y76 B;  1N8R W;  4LNU B;  3BAA A;  2A79 B;  2Q0A A;  3ICX A;  3G6E V;  1QU7 A;  1FS0 G;  3OTO O;  3SJC C;  3VOU A;  5J2U A;  1YTF D;  1AJP A;  2QJ1 A;  3GVM A;  3K5L A;  4I9Q A;  1Y67 A;  2DYR B;  2YSU B;  4TQF A;  3SPH A;  5L3B A;  2IW5 A;  3P3N A;  3K9A A;  3K3W A;  5IE9 A;  2XTA A;  3ABT A;  2EIM B;  3JAM N;  4B3S B;  3RYH B;  3F7Y C;  2X6B A;  1KQS U;  2RDC A;  1Q82 W;  4MT8 A;  4IHJ A;  3OR7 C;  4O4H B;  4MW3 A;  1KBH A;  5KHI A;  2YI8 A;  4A5U B;  3FB5 C;  4PA9 A;  5LA6 A;  4J7K A;  3A2F A;  3ZHV A;  1HDJ A;  4I7Z B;  4ZOL A;  3SYA A;  4JI6 O;  4R6Z A;  1ZWI C;  5H6Q A;  4UB6 Z;  1VF6 A;  4PA3 A;  2WLI B;  4JAU A;  3AK3 A;  4WFH A;  4JYB A;  5DM6 V;  3T1Y B;  3X2Q C;  3HKC B;  3JAS A;  1V54 C;  4B3T O;  3H01 A;  1SZX A;  1FKA O;  2GTA A;  1W0K G;  3E89 A;  2EIL B;  3CCM V;  4DR5 O;  5KMG B;  2LQT A;  5HFM A;  1JFF A;  5LGT A;  1QLN A;  1PL0 A;  2CK3 G;  3BVO A;  4YJ3 A;  1UPG A;  5EZY B;  4XDJ A;  4DK1 A;  4FFK A;  3ABL B;  3D8C A;  3VQX A;  1VQO V;  2R9I A;  2QKA A;  3RGB A;  4FVM A;  5LP6 C;  5IDJ A;  2E5L B;  5K1X A;  4GYC B;  5IYD O;  2UUB B;  4FLX A;  1J95 A;  3RT3 C;  3E22 A;  4CBC A;  3JD0 A;  4D7T A;  3S3W A;  3ETG A;  4B3T B;  1VQ6 V;  2UXD O;  3TXS A;  2PY5 A;  1GN4 A;  3N2K A;  2OTL V;  4P30 A;  4JI1 B;  4PJ0 Z;  4DR3 B;  1B3Q A;  2YC0 A;  3JAK A;  2JS3 A;  4Q6G A;  2JGD A;  3WG7 C;  4MS2 A;  4UFZ A;  2Q68 A;  3HKB B;  2WWW A;  5LGU A;  4GX0 A;  4MVQ A;  1COW G;  3SJB C;  3QTC A;  5LP6 A;  3CC2 V;  5BR8 O;  3SYQ A;  4DR6 O;  1YTF B;  1EN4 A;  3LUT B;  3KG2 A;  5EC2 C;  1X4T A;  4H13 B;  5DED A;  4BIZ A;  1BZK A;  1H2S B;  4MSW C;  4NVP A;  1YJW V;  1PV0 A;  4LF7 O;  4XDK A;  4FLU A;  2YEV A;  1L1F A;  1R73 A;  4HNA B;  4IIJ B;  1S76 D;  4WF9 V;  5KUM A;  5IJ9 A;  1WAZ A;  2ZE7 A;  5CA0 A;  2QM8 A;  2AHZ A;  3ZHS A;  1XNR B;  1OHH G;  4LC1 A;  2QWQ B;  2Y4U A;  1BT8 A;  4LCU C;  3R65 A;  3E8B A;  4CS2 A;  1F7Y A;  2CTW A;  1XL6 A;  1XI1 A;  4J7J A;  1FXV A;  1RSO B;  1ZTE A;  3TK1 A;  2Y48 A;  2KSD A;  1MA1 A;  3KZI Z;  4HAM A;  3HKE B;  3ZCC A;  2YIC A;  5GTI Z;  1FXH A;  4WFF A;  2HLD G;  3J80 N;  2WLL A;  1MZF A;  2OT5 A;  4NXM O;  4JAA A;  2JRI A;  4FJC C;  1YSC A;  1R3I C;  3MHS C;  3SYO A;  1H2G A;  1DK1 A;  3E86 A;  3FB7 C;  1PKX A;  4I4T A;  2VS0 A;  2CAZ C;  2WSS G;  4F4L A;  1D2D A;  3BA9 A;  2IJJ A;  4AI8 A;  1YF2 A;  4O4J A;  4DO2 A;  4B3R O;  1R6N A;  4JTC B;  5J2U B;  2DYS C;  3QG5 A;  1I0H A;  1NZ6 A;  3I56 V;  1BCC H;  2CH7 B;  4GUN A;  4X1I A;  2BOC C;  1I5Y A;  1FD9 A;  2UXX A;  2JIZ G;  4X88 A;  4I5S A;  1VQM V;  3HR0 A;  4JYY A;  1WNS A;  2BSK B;  2WLK A;  2YXY A;  2HJF C;  3CRM A;  4RUF A;  1K9M W;  4OX9 O;  1ZAU A;  2Y69 C;  2QM7 A;  5C8Y A;  1OV9 A;  4O2B B;  4NYK A;  4B7E A;  3C90 A;  4JTD B;  2PI5 A;  2OTJ V;  3JAS B;  2YUA A;  1VAR A;  4PHZ A;  3G6B A;  4GKK O;  2W6I G;  4H37 A;  3CCS V;  3IGA C;  3JD2 A;  4WFA V;  3ZX6 A;  3BEH A;  2LFR A;  5ITZ A;  4AIL C;  4GX1 A;  2NLJ C;  5JQG A;  5H5N A;  1VQK V;  4TSF G;  4DW1 A;  1M93 A;  1NKD A;  2H8P C;  3E83 A;  1M56 B;  3E35 A;  4JYA O;  1JQ0 A;  1NTM H;  2R9A A;  1Y74 B;  4G2K A;  1IX9 A;  3TET A;  1V9P A;  3ZMZ A;  3CCU V;  1K4D C;  4FPP A;  2F4V B;  5L3D A;  3HKD B;  1ORQ C;  3IC7 A;  1AIL A;  4IYI A;  1O9H A;  3X2Q B;  4E2L A;  4HZ3 A;  1V54 B;  4GX2 A;  1R6K A;  1QLE C;  5JH7 A;  1JJ2 U;  3F5W C;  1NBM G;  4JI5 O;  3EHB B;  2AW9 A;  3JAL A;  4JYC A;  3CCV V;  1IBM B;  2HEP A;  5KHK A;  5IYZ A;  1G4Y B;  1ARO P;  1SQG A;  1K5Q A;  1VF5 B;  2JGD B;  3KKY A;  1KU9 A;  3L73 H;  5LMN B;  5EK0 A;  1E1R G;  3OTF A;  3W7W A;  5BXZ A;  3CJH A;  2QTS A;  1HR0 O;  3TGU H;  4FMT A;  1F23 A;  1SET A;  4DUZ B;  2YID A;  4J9Y B;  1WN7 A;  2EIJ C;  3AK2 A;  4MTX A;  5LP6 B;  1K8A W;  5FLX N;  2B9Z A;  1KD1 W;  4J42 A;  3L72 H;  2UU9 O;  4R7C A;  1SQX H;  1D5N A;  4X62 O;  3JAR A;  4BR6 A;  2ZIO A;  3L74 H;  4WBN A;  2YEV B;  1GTO A;  1LUV A;  4X9Q A;  3G4S V;  4JPR A;  4FLW A;  1URF A;  2YS8 A;  3CEI A;  4O4L B;  1VQP V;  4QIW F;  2RCV A;  2HHH O;  4JI7 B;  5A9G A;  4F6E A;  3CRA A;  1S0V A;  1OCZ B;  1SF9 A;  5J2T B;  4JI4 O;  4CH5 A;  5GON B;  5LBQ A;  4TV9 B;  3CS5 A;  2ADQ B;  1I94 B;  1YIJ V;  2LJ2 A;  3ZBH A;  4CS4 A;  2DWE C;  3JCU Z;  5KA6 A;  1SER A;  1PNM A;  2LGQ A;  2KG7 B;  3LSU A;  2UUA B;  2WLL B;  2YI9 A;  4UXN A;  1TVK A;  2UU9 B;  1VMG A;  1LNQ A;  3ZRW A;  2UUC B;  1OCR C;  1R3K C;  5L3E A;  3ZN0 A;  2HP8 A;  1IBK B;  2R9R B;  4I0X B;  3CHX A;  4I50 B;  1ENV A;  1HNZ B;  5IWA O;  4NXN B;  1GN3 A;  4UUJ C;  3ASN B;  2F66 C;  2DQ0 A;  3THO A;  4JGS A;  3H1L H;  1IDS A;  2ZE6 A;  2UXC B;  1DGS A;  4LF4 B;  4JI4 B;  2Q9L A;  3UO2 A;  3OEE G;  2AHY A;  3JAW B;  5BY1 A;  2JJ1 G;  1AR1 B;  3L71 H;  5E79 Z;  4R50 A;  1L8D A;  1BQZ A;  5B3S C;  1SC5 B;  4MTF A;  4DV2 O;  4JI0 O;  1PNL A;  4C7U A;  4DR2 B;  3CX5 F;  2GDS A;  3OR6 C;  2JJ2 G;  1S5H C;  4D7S A;  2QWR B;  4FLV A;  1PPJ H;  1GKF A;  5C8Y B;  3JSL A;  2RN9 A;  5EYP A;  1MMM A;  1I08 A;  4FM0 A;  1F4N A;  1YVW A;  4PI2 A;  1Z2G A;  2R72 A;  2EIK B;  4UCT A;  4JTA B;  4LF6 B;  2VWK A;  4UV9 A;  4YY3 B;  1N33 O;  4WFG A;  1WA8 A;  4X20 B;  2WLH A;  5LHH A;  2JDI G;  4FM2 A;  2A06 H;  1BQ0 A;  5KUK A;  2FYU H;  1S77 D;  2HVK C;  2PYJ A;  3P30 A;  5LHG A;  2CDY A;  4ZHQ A;  1VQL V;  1T5E A;  1QQC A;  4DV2 B;  1AR4 A;  4JI0 B;  4F6R B;  4YHH O;  5L3C A;  4BIO A;  2WLM A;  4D6T H;  2DJV A;  3OW2 U;  3SYP A;  1AR5 A;  2IU3 A;  1H2L A;  3SPG A;  4LFB B;  2DMX A;  4WFB V;  1K34 A;  3OAA G;  4XBF A;  4FLZ A;  2QSA A;  2FTK A;  5H6R A;  1GRJ A;  2P67 A;  5JCO C;  3E2E A;  1QNM A;  1E1Q G;  1VQN V;  1BHA A;  2LP7 A;  5JH7 B;  2M6Y A;  1FFT B;  4OPA A;  3UM7 A;  3UT5 A;  4JI8 O;  1LR1 A;  3K5O A;  2WPD G;  2JEX A;  3JAL B;  1XBL A;  1IBL O;  4X89 A;  5IYZ B;  3Q4H B;  1Y4M A;  2YXH A;  4DUY O;  3CWB H;  2QEX V;  4PDV A;  3K0G A;  3B8M A;  1NQT A;  3F5T A;  3EFF K;  5JVD B;  4H44 B;  2GBO A;  4X1Y A;  2RMK B;  4KFM A;  2ZDI C;  1BL8 A;  3ZJZ A;  5JWP A;  1GM7 A;  2ADP A;  5JCO A;  1G6U A;  2H94 A;  4CZZ A;  1QLE B;  3H1I H;  2CE4 A;  4P2Z A;  1ZSP A;  2Z3Y A;  2ZIM A;  4DR7 B;  2B1I A;  2QWP B;  2B5U A;  3CRQ A;  3JD4 A;  1SQV H;  5C93 A;  2F95 B;  3ZHQ A;  1IBL B;  4DRX B;  3G80 A;  3SPJ A;  3OTO B;  2W0X A;  5LGN A;  3A8T A;  4PD4 F;  1M5I A;  4FIP C;  3HB3 B;  3ABM C;  3G67 A;  4DUY B;  5KLV H;  3P3P A;  1VQ4 V;  1QVG U;  2P4K A;  3ZMT A;  3RW0 A;  4EKW A;  2QWN B;  1PL4 A;  1AVM A;  1M57 B;  2ATK C;  4MW8 A;  3BHP A;  3CXC U;  1RP3 B;  2EJ7 A;  3J81 N;  2JK5 C;  5BMV A;  2ZM6 O;  2WLN A;  1K7D A;  5B1B C;  2VWJ A;  2ZDI A;  3ZN1 A;  3K0D A;  2XAQ A;  4NB5 A;  2ZR2 A;  2ZD9 A;  3P32 A;  3T4D A;  2Q5Z A;  5KHG A;  4JI6 B;  1P4R A;  1FPO A;  4K8Z A;  1KUQ A;  4PEL A;  4CH4 A;  3CCL V;  5JJJ B;  1W2B U;  3RYI A;  1IXB A;  3ABK C;  5LOV B;  2B1G A;  3EXA A;  5TIS Z;  1NVP D;  1SS3 A;  5CA1 B;  2XAF A;  4DV5 O;  4DR5 B;  2EZO A;  1WJZ A;  3SJA C;  3RYC A;  1SQP H;  2V4D A;  3MHH C;  2PYL A;  1GO3 F;  1NT2 B;  4QE7 A;  1KYO F;  1OCR B;  4I55 A;  4HBN A;  2K1E A;  1Q86 W;  1RM1 B;  5EYP B;  2ETN A;  3R66 A;  1GK9 A;  1YJN V;  5FNV A;  2Q7G A;  1N32 O;  2ZCE A;  5B66 Z;  3AG1 C;  1U97 A;  4RQE A;  3RVZ A;  3UKM A;  2XUM A;  2BTQ A;  1WA8 B;  4B3M O;  4JI3 O;  2UXD B;  1A32 A;  2HG5 C;  3RFR A;  1V55 C;  1NU1 H;  4W4L A;  3A0H Z;  3W7S A;  3A0B Z;  3L75 H;  1WLE A;  3FX7 A;  1BMF G;  2NNU A;  4K0K O;  1SES A;  2CUG A;  5LXT B;  3STZ C;  1SQQ H;  4BAY A;  1THZ A;  1AJQ A;  5BZB A;  2Y4T A;  1Y6X A;  2F43 G;  3T1C A;  3LDD A;  1VQ9 V;  1SRY A;  1OJH A;  3APO A;  2ODM A;  1AJN A;  3OD4 A;  2P5O A;  4LWS A;  5BR8 B;  3GWK C;  1BHB A;  4DR6 B;  1Q90 D;  4O4I A;  1NH2 D;  2QKC A;  3RWR D;  3PJS K;  1EBO A;  4DV4 O;  4LF7 B;  3UT5 B;  4TQD A;  4KHP O;  2IH1 C;  3STL C;  5IY5 C;  3I55 V;  1XMQ O;  4GX5 A;  3ML0 A;  4DK0 A;  4FFB A;  5LL6 Y;  4CC6 A;  3ZRV A;  1HNX O;  2N05 A;  2ITD C;  3DXR A;  4PDL A;  4DR4 O;  1Q7Y W;  2EUL A;  2W0F C;  5L3F A;  1NS1 A;  2Q0O C;  1RPR A;  3AEI A;  3JAT A;  2AGA A;  4X66 O;  2ITC C;  1FAF A;  1H8H G;  4EB6 A;  2BTO A;  4X1Y B;  3FAV A;  4IHJ B;  1H2K A;  3D3Q A;  3FYI B;  1CPY A;  1P49 A;  3OUS A;  1SQB H;  2FML A;  5AG2 A;  3SPC A;  4NXM B;  4HYO A;  3AG2 C;  1NVP B;  5LA6 B;  4QNH B;  5KX5 A;  4R8C A;  4DR1 O;  2QA4 V;  4LFA O;  1WPB A;  4ZOL B;  4DV4 B;  1YI2 V;  5K1P A;  1K97 A;  1XUQ A;  3CCQ V;  5JJN B;  4FK5 C;  2OIG A;  5LYJ A;  1NTZ H;  3S3X A;  2H3O A;  4TV8 A;  4B3R B;  2EJR A;  2V7Q G;  2YIB A;  3K9S A;  4AQY O;  3K59 A;  1HNX B;  4DR4 B;  4UV8 A;  1AB3 A;  4MVO A;  3BRC A;  1D5A A;  2IU0 A;  5CB4 A;  1JFF B;  2F1M A;  4X66 B;  1VP7 A;  5BMV B;  2ZNJ A;  4DXW A;  5IJ0 A;  5CBF A;  4J7Z A;  4YJ3 B;  1JMK C;  1K33 A;  2F93 B;  4DV3 O;  1MZE A;  5EBL C;  5LMU O;  1KB9 F;  3CRC A;  2HFE C;  4P9O A;  1FFX A;  2AXT Z;  4OX9 B; 
#chains in the Genus database with same CATH homology
 1JCH A;  5B3S B;  3OE7 G;  3ABT A;  2DQ0 A;  2EIM B;  3F7Y C;  2X6B A;  1KQS U;  4JGS A;  3CCJ V;  1Q82 W;  4ASU G;  3M99 B;  4MT8 A;  2P7T C;  2X6A A;  1YJ9 V;  1K4C C;  3OR7 C;  3AG3 C;  3OEE G;  2AHY A;  4MVZ A;  1MG1 A;  4MW3 A;  3BY6 A;  4QJF B;  2DYR C;  2JJ1 G;  3ASN C;  3JCZ A;  1FXK A;  3SPI A;  3FB6 C;  3FB5 C;  1AR1 B;  4R50 A;  4PA9 A;  5CMU A;  5B3S C;  4MTF A;  5LHI A;  5CBH A;  3FYE B;  2EIM C;  1PNL A;  2BOB C;  1MAB G;  4MVS A;  3SYA A;  4GCZ A;  1K5S A;  5E1A C;  4R6Z A;  1ZWI C;  5H6Q A;  4ZBM A;  5IYB O;  4PA3 A;  2WLI B;  4JAU A;  4WFH A;  3OR6 C;  2JJ2 G;  1S5H C;  4JYB A;  1NH2 B;  1M9N A;  5DM6 V;  1GKF A;  3X2Q C;  5B1B B;  1W0J G;  1V54 C;  1F4N A;  4X8A A;  2EZP A;  3H01 A;  1MSW D;  3F7V C;  3RBZ A;  1Q81 W;  4MTG A;  1W0K G;  2Q69 A;  2EIK B;  3E89 A;  4JTA B;  1GM9 A;  4UV9 A;  2EIL B;  5EBM C;  3CCM V;  5IYC O;  3ASO B;  5HFM A;  4WFG A;  3K08 A;  5LGT A;  1QLN A;  3QO8 A;  1PL0 A;  2CK3 G;  2WLH A;  4LP8 A;  4YXW G;  2JDI G;  5LHH A;  4XDJ A;  2ZQM A;  5B1N A;  3T4Z A;  5KUK A;  1ROP A;  1S77 D;  2HVK C;  3K79 A;  3CYO A;  1JX9 A;  3P30 A;  5LHG A;  2M7W A;  3ABL B;  1VQL V;  2EIK C;  2HR3 A;  1VQO V;  2EIL C;  2R9I A;  4JAV A;  3OEH G;  3CD6 V;  4RAI A;  5L3C A;  5B1A C;  3A0R A;  5IDJ A;  2WLM A;  3D36 A;  2PI4 A;  5IYD O;  3QO7 A;  3OW2 U;  1AI5 A;  3SYP A;  3E8H A;  1J95 A;  2IU3 A;  4CBC A;  3JD0 A;  3SPG A;  2WAM A;  4WFB V;  1K34 A;  3ETG A;  3OAA G;  4XBF A;  3WG7 B;  1H38 A;  1VQ6 V;  1DF5 A;  1R3L C;  2FTK A;  3LSS A;  5H6R A;  2D3O W;  3ABU A;  4BW5 A;  2P67 A;  3QO5 A;  3E2E A;  3B8N A;  2OTL V;  4P30 A;  1E1Q G;  1VQN V;  1BHA A;  2LP7 A;  3NXS A;  4G28 B;  4MVR A;  1FFT B;  2Z5U A;  3UM7 A;  3CC7 V;  1DLB A;  3OM3 B;  2GSM B;  3WG7 C;  2WPD G;  3SYC A;  2JEX A;  2IJH A;  4MS2 A;  3G71 V;  1OCC C;  4X89 A;  2Q68 A;  3CMA V;  2WWW A;  5LGU A;  1I5X A;  4GX0 A;  1M1K W;  4MVQ A;  1COW G;  1Y4M A;  2ZXW C;  3OMN B;  4LBE C;  4TWK A;  1JPX A;  4N23 A;  3CC2 V;  2QEX V;  4PDV A;  5GW7 A;  3SYQ A;  4PA6 A;  3K0G A;  4PA7 A;  1YTF B;  3B77 A;  3B8M A;  1NQT A;  3LUT B;  3EFF K;  2OCC B;  3KG2 A;  5EC2 C;  4BIZ A;  4MSW C;  1YJW V;  4KFM A;  2ZDI C;  4XDK A;  4JF3 A;  1BL8 A;  2YEV A;  1R73 A;  1L1F A;  3ZJZ A;  3CME V;  5EBW C;  2XAJ A;  1GM7 A;  2HVJ C;  1S76 D;  4WF9 V;  1QR8 A;  5KUM A;  4J9Z B;  2DQ3 A;  2H94 A;  3K06 A;  4CZZ A;  4RQF A;  1QLE B;  3ABM B;  4PDM A;  4P2Z A;  2QM8 A;  1KP3 A;  3SJQ C;  2AHZ A;  2Z3Y A;  1VQ5 V;  1OHH G;  3ZRX A;  1K92 A;  2B1I A;  4LC1 A;  1YHQ V;  3LSQ A;  2B5U A;  2QTO A;  3JD4 A;  4MTO A;  5C93 A;  4LCU C;  3R65 A;  2C2A A;  3E8B A;  1MOF A;  1XL6 A;  4RUE A;  1H8E G;  1FXV A;  2EBO A;  3ZMU A;  3TK1 A;  3SPJ A;  1B6Q A;  3CPW U;  2Y48 A;  5LGN A;  4FIP C;  3HB3 B;  1WPX A;  3ABM C;  4HAM A;  3ZCC A;  3ZRS A;  5IY5 B;  1FXH A;  1VQ4 V;  1CP9 A;  1QVG U;  4WFF A;  3ZMT A;  3RW0 A;  4EKW A;  2HLD G;  2WLL A;  2OT5 A;  2IH3 C;  1M57 B;  2ATK C;  3CC4 V;  3TCU A;  4MW8 A;  3CXC U;  3W7T A;  4FJC C;  1K73 W;  1YSC A;  2JK5 C;  2DYS B;  2WLN A;  1R3I C;  3MHS C;  3SYO A;  1H2G A;  1K7D A;  5B1B C;  3ZMV A;  3E86 A;  2ZDI A;  2QE7 G;  3FB7 C;  1PKX A;  3ZN1 A;  3K0D A;  5EC1 C;  2XAQ A;  5HFL A;  2ZR2 A;  3VBB A;  2XND G;  2ZD9 A;  2WSS G;  3P32 A;  4F4L A;  4ZKI A;  5J9P C;  2Q67 A;  3AG4 B;  1OZ0 A;  3ABK B;  3T4D A;  2IJJ A;  3DGE A;  1M57 C;  3OMI B;  3ASO C;  3K03 A;  3IFX A;  1QCE A;  4DO2 A;  1R6N A;  4JTC B;  2DYS C;  1P4R A;  1CEZ A;  3I56 V;  2DWD C;  3AG2 B;  2EIN B;  4MVM A;  2V1D A;  4PEL A;  2P6J A;  3CCL V;  4N21 A;  2BOC C;  2Y69 B;  5H9C A;  1I5Y A;  1W2B U;  3ZIA G;  2UXX A;  2JIZ G;  3E8G A;  4X88 A;  3ABL C;  4I5S A;  3ABK C;  2XAG A;  2B1G A;  5L3G A;  1VQM V;  4P9P A;  1E79 G;  1NVP D;  2X0L A;  3JD3 A;  2WLK A;  2XAF A;  1GM8 A;  2HJF C;  2EZO A;  1FXK B;  2WLI A;  1R3J C;  4RUF A;  1QBZ A;  1K9M W;  2Y69 C;  2QM7 A;  1DTO A;  1VQ7 V;  3MHH C;  3W7X A;  4QPK A;  1AI6 A;  1GO3 F;  4PA4 A;  2XAS A;  2IJI A;  1M90 W;  3AG1 B;  1S3J A;  3OMA B;  4QE7 A;  4UVC A;  1P7B A;  4JTD B;  1OCR B;  3T2M A;  2PI5 A;  2OTJ V;  2K1E A;  1KP2 A;  1Q86 W;  1RM1 B;  3GB7 C;  1QVF U;  3ETE A;  1V55 B;  2JEU A;  4GT1 A;  1GK9 A;  1NR7 A;  3K04 A;  3MD0 A;  4Q20 A;  4UVB A;  5CBG A;  1YJN V;  2XOK G;  2W6I G;  3OFN G;  4H37 A;  3CCS V;  3CCR V;  3GWO A;  1AI4 A;  3IGA C;  4G27 B;  2DW4 A;  3LDE A;  3JD2 A;  1OCO B;  4WFA V;  3AG1 C;  2QKS A;  4I9W A;  5CA3 A;  3BEH A;  2LFR A;  4RQE A;  4GX1 A;  2UXN A;  4WFE A;  3RVZ A;  1KKD A;  2NLJ C;  4U7N A;  4U7O A;  3UKM A;  1VQK V;  1RM1 C;  4TSF G;  3JYC A;  3OGC C;  2HG5 C;  1V55 C;  1NKD A;  3AG3 B;  2A9H A;  2H8P C;  3E83 A;  1M56 B;  3W7S A;  3E35 A;  1JQ0 A;  2HKO A;  3DTU B;  1WLE A;  4G2K A;  1BMF G;  1RPO A;  2KB1 A;  2NNU A;  4JAS A;  4BIU A;  3TET A;  1SES A;  2OCC C;  3ZMZ A;  3CCU V;  1K4D C;  1NR1 A;  4FPP A;  3STZ C;  5L3D A;  3JD1 A;  1ORQ C;  4BAY A;  1THZ A;  3LDC A;  2X7R B;  2W6J G;  1M56 C;  2MK3 A;  3IC7 A;  3HPL C;  1AJQ A;  5BZB A;  2F43 G;  3T1C A;  3X2Q B;  3FKS G;  4HZ3 A;  4E2L A;  3LDD A;  1V54 B;  4GX2 A;  1SRY A;  1VQ8 V;  1VQ9 V;  1R6K A;  1QLE C;  2X6C A;  1AJN A;  2WLJ A;  4L87 A;  1JJ2 U;  5FL7 G;  3F5W C;  1NBM G;  3ETD A;  4XDL A;  5CN0 A;  1QR9 A;  1BHB A;  3W7U A;  2ZR3 A;  1NH2 D;  3EHB B;  4JYC A;  3CCV V;  1EFR G;  4PDR A;  3QNE A;  2EIJ B;  1G4Y B;  3PJS K;  1NJI W;  1EBO A;  1XL4 A;  1ARO P;  1HWY A;  2XAH A;  1K5Q A;  2A0L A;  3ZRW B;  1F51 A;  2IH1 C;  3STL C;  5IY5 C;  3RVY A;  5EK0 A;  1E1R G;  3W7W A;  3I55 V;  1Y66 A;  1JOY A;  4H33 A;  3OUF A;  4FMT A;  4GX5 A;  3ML0 A;  1F23 A;  1UJW B;  1SET A;  3ZMS A;  4J9Y B;  4MVU A;  3ZRV A;  2EIJ C;  4MTX A;  5B1A B;  1K8A W;  2ITD C;  2Q6A A;  3D3I A;  4PDL A;  1KD1 W;  2GHY A;  1Q7Y W;  1S72 V;  2W0F C;  4R7C A;  5L3F A;  4RO2 A;  1JVM A;  1KEC A;  1RPR A;  3AEI A;  4KUM A;  3AG4 C;  2ITC C;  1H8H G;  2LFS A;  4OXS A;  3FYI B;  3CP1 A;  1EZJ A;  2YEV B;  1GTO A;  1CPY A;  3G4S V;  3OUS A;  4JPR A;  1PD3 A;  3SPC A;  4HYO A;  3AG2 C;  2EIN C;  1NVP B;  4KP4 A;  4QNH B;  3E8F A;  4R8C A;  2QA4 V;  1DF4 A;  1VQP V;  4QIW F;  3LNM B;  1YI2 V;  1K97 A;  4QPJ A;  4QE9 A;  3CCQ V;  1S0V A;  1G8M A;  1OCZ B;  4Z1M G;  4FK5 C;  1OCC B;  1F4M A;  1PNK A;  5KA5 A;  1IXM A;  5LBQ A;  4WCE V;  1FXK C;  1YIJ V;  1TUE B;  1KC8 W;  2EJR A;  4UVA A;  2ZXW B;  1YIT V;  2DWE C;  2V7Q G;  3CCE V;  5KA6 A;  1K3E A;  1SER A;  1PNM A;  1AI7 A;  5DN6 G;  2WLL B;  4UXN A;  4UV8 A;  3WFV A;  2IJK A;  4MVO A;  1OCZ C;  1LNQ A;  3ZRW A;  1OCR C;  1N8R W;  1R3K C;  2IU0 A;  1GMG A;  2A79 B;  3FB8 C;  5L3E A;  3ZN0 A;  4DXW A;  3G6E V;  5CBF A;  2R9R B;  1FS0 G;  2P90 A;  4TT3 G;  1ENV A;  1K33 A;  3VOU A;  1SZT A;  5EBL C;  4UUJ C;  1YTF D;  1AJP A;  2HFE C;  2DYR B;  2YSU B;  3ASN B;  5B1O A;  3SPH A;  5L3B A;  2IW5 A;  3K9A A;  3K3W A;  1OCO C;  4P9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...