2JK5C

Potassium channel kcsa in complex with tetrabutylammonium in high k
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/metal transport
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2jk5C00
4G28B 1XL6A 2JK5C 4WFHA 3T1CA 2AHZA 4GX5A 4G27B 2EIMC 1M56C 4GX1A 4HYOA 2WLMA 3K0DA 3FB5C 4PDRA 3SJQC 3ASOC 4BW5A 3SYQA 3T2MA 3R65A 3E8FA 3X2QC 4LBEC 2WLLA 3AG3C 3PJSK 3K04A 4PDMA 5B1BC 3VOUA 1KKDA 3K03A 1JVMA 2DYRC 4P9PA 2IH1C 3HPLC 5IY5C 3FB8C 3BEHA 4MW8A 4PA3A 4RO2A 1S5HC 5KUMA 2DWDC 1J95A 1M57C 2BOBC 3E83A 3F7VC 2P7TC 1QLEC 2H8PC 3ASNC 3LNMB 2HVKC 5KUKA 4I9WA 2HG5C 3K06A 2HVJC 4JTCB 3STZC 3SPHA 4LCUC 3OR6C 3RVZA 4RUFA 3RBZA 3SYOA 3OUFA 4MTFA 1OCRC 5EBWC 4F4LA 2EILC 3K08A 2QKSA 2ITCC 3IFXA 4GX0A 1OCOC 5B1AC 4QE7A 4R8CA 4UUJC 1BL8A 3GB7C 2A79B 3OR7C 3F5WC 4RUEA 4X89A 3AG2C 1ZWIC 4WFFA 4TWKA 1G4YB 4RAIA 4MW3A 4MSWC 2WLIB 4PA6A 3SPJA 2Q69A 2Y69C 2WLNA 3AG1C 4J9YB 2YEVA 3T4ZA 4EKWA 4QNHB 3SYCA 4PA7A 4H37A 3KG2A 3UKMA 4JTDB 2IH3C 2EIKC 4J9ZB 4XDKA 2Q67A 2ITDC 3SPGA 3K0GA 3E8GA 3LDDA 3SPIA 2EIJC 5CBGA 4MVZA 4P2ZA 1V55C 5CBFA 3TETA 3OUSA 2WLIA 4XDLA 2A9HA 2WLJA 2ZXWC 2X6AA 2OCCC 4PA9A 4P9OA 2Q68A 4X88A 3ABKC 4P30A 1P7BA 3ZRSA 2DYSC 3AG4C 3E8BA 4X8AA 2R9RB 5B3SC 3OGCC 4HZ3A 3EFFK 2NLJC 1R3JC 2HJFC 3SYAA 4WFGA 4QE9A 4MVOA 4GX2A 4MVQA 3WG7C 4WFEA 1K4CC 1V54C 3SPCA 4XDJA 2A0LA 3FB6C 3LUTB 5EBLC 5J9PC 3E8HA 3LDCA 4MTOA 2ATKC 2WLHA 1K4DC 1R3IC 3ABMC 4MVRA 3STLC 3RVYA 4PDLA 4MVSA 3TCUA 5EBMC 4OXSA 5CBHA 4ZBMA 1R3LC 1R3KC 1OCCC 2X6BA 4LP8A 5EC2C 3ZJZA 2EINC 4H33A 2X6CA 2AHYA 3E86A 2K1EA 3ABLC 3JYCA 3UM7A 2ZD9A 3E89A 4DXWA 3SYPA 1LNQA 2HFEC 3LDEA 4JTAB 4MVUA 4R50A 3T4DA 2QTOA 4KFMA 4MS2A 5E1AC 5EC1C 4CBCA 3RW0A 2WLKA 4R7CA 4MTGA 4PA4A 1OCZC 1ORQC 3F7YC 2BOCC 4PDVA 5BZBA 2WLLB 3IGAC 2KB1A 5EK0A 4MVMA 3FB7C 2Q6AA 2DWEC 4R6ZA 2W0FC 1XL4A
chains in the Genus database with same CATH superfamily
2WSSG 1RFYA 4LC1A 1AI5A 1MSDA 2JK5C 4DR4O 1Q5OA 4FVMA 2PZSA 1GN2A 4GX1A 1YF2A 4PI0A 1PKXA 5JQGB 1BQZA 5H2FZ 4DR6B 1MG1A 1K73W 1YTFD 1QHTA 1IDSA 1JQ0A 1Q8IA 1J95A 2P7TC 2QGNA 5L3CA 1NQTA 1SF9A 1SQVH 2ZKOA 2F4VO 2XTAA 4QGPA 2YDEA 3UO2A 5L3BA 5H9CA 3RVZA 3RBZA 2G38A 1T5EA 1OJHA 1ROPA 1VIBA 4U3FH 3G4SV 4O4IA 1X59A 4PD4F 2JIZG 4I5SA 3C3SA 3GVMA 2M7WA 4HAMA 3AK1A 3KCYA 1XREA 3CCJV 2CAZC 3SPIA 2E3CA 2E75B 4N23A 5BMVA 2P6JA 2EZOA 2OCCC 1SQGA 2CUGA 3ABKC 5CA1A 1ZUQA 3ZRVA 3VBBA 2YIBA 1VQMV 3SJBC 1PNKA 3S3XA 2BE3A 2EX3A 1P7GA 2HKOA 2WA3A 1I5XA 3FKSG 4FLZA 4RWUA 4DR5B 4I0XA 3ZMVA 4X62O 4JI2O 5LL6Y 1PD3A 2BTQB 5BXZA 5CB4B 4YHHB 1XI1A 4H33A 2HFEC 1J5EB 4JF3A 3T1HB 4PDVA 2DWEC 5JJEB 3H01A 4UVAA 4AHCA 2A7WA 5EIBC 4O2BA 4X20B 1EBOA 2PF4E 1YXBA 1H38A 5K1XA 4Q20A 1WA8B 1YCIA 3JCZA 5JH7A 1MOFA 5L3FA 1JJOA 1BZKA 2OTLV 3G67A 1M57C 2BOBC 3C3TA 5C8YB 4ZI7B 1L0NH 2H8PC 3E2EA 2F1MA 2HVKC 1FJGO 2Y48A 1WJZA 1N34B 1RPRA 2VQFO 5CA3A 4PELA 5EBWC 4GX0A 1QVGU 4UVCA 2JJ2G 3OR7C 1H8HG 5IY5B 3ZHVA 4IGGA 4KL1A 2UXNA 4IYHA 1M5IA 3EHBB 3KG2A 3B8MA 3OE7G 1KQSU 1H2KA 3A8TA 4JV5B 1KP3A 1WLEA 2HHHO 1HNXB 5TISZ 1PP9H 3CD6V 4P9OA 3HKBB 4NVPA 2WA4A 1S3JA 1KUQA 2DJVA 4P30A 3AG2B 2ZCEA 3JALB 3SDLA 4CC5A 4JI7O 4MVOA 4GX2A 4J7JA 3MDSA 4GKJB 3SJCC 4DR1O 4XDJA 2F43G 2A0LA 4I50A 5LGNA 5HFLA 1GK9A 1K9MW 4JAAA 4MVSA 4FZ1A 1FXKA 2OIEA 5D5QA 4WCEV 4LP8A 1H2LA 2AHYA 2LJ2A 4DK1A 1XMOB 5J2UA 2M6YA 3QF7A 2P06A 3JAKA 2CGNA 4QIWF 1XL4A 1YTFB 1ENVA 2DN9A 3ETEA 1FFXB 2ZDIA 2QWNB 1XHXA 2P67A 1JFFA 5LOVA 4Z2WA 1SESA 2LGWA 2IM9A 1AILA 1S5HC 1M57B 5JWPA 2DWDC 1HNZO 3CRQA 3LNMB 1HW7A 4JI6O 4LF7B 5HFMA 2BSKA 3ZRXA 3OR6C 4DV6B 1SC5B 2EILC 5LA6B 1OCOC 4R8CA 4DV3B 2R72A 4GKKB 3CMAV 4RAIA 4K8XA 4YJ3A 2HJDA 4PA6A 1VQLV 1I7FA 4J9YB 4E4EA 4LF6B 5KHKA 2FL4A 2P90A 4JTDB 1JCHA 1YZBA 3ABUA 1THZA 4O4LA 2EIJC 4DV1B 4P2ZA 2HR3A 2D3OW 1SERA 1GO3F 1W59A 5EYPA 2DQ0A 3EXAA 3H1IH 3Q4HB 2ETNA 2OWOA 4MVQA 2QWQB 5LHHA 4X1KA 3RYIA 1NVPD 1W0JG 1R3LC 3BAAA 4NXMO 4JZGA 3CRAA 1PL4A 3E86A 4DW1A 3AK2A 1R6NA 2CTQA 5IJ0B 4I4TA 3RYCB 1BMFG 4FLWA 1KC8W 2CDYA 4B3TO 4GT1A 2P22C 3JD0A 3H1KH 4UB8Z 3H1JH 2ADQB 4PI2A 4NKGB 1NR7A 2KQXA 3C90A 3T2MA 4HNAB 3AG3C 3VQWA 1VQOV 4FIPC 1W2BU 1UPGA 4DW0A 3BEHA 2ZE8A 3EVKA 1SQQH 5JQGA 4DR7B 4LR3A 1JPXA 2EZPA 3E22B 4I9WA 5KAFZ 3CPWU 1L0LH 4ZHQA 4DR2B 4DV5O 3KZIZ 4DV0O 1D2DA 2XOKG 3U10A 5LXTB 4UUJC 1GRJA 4OX9B 2JEXA 4EB6B 2JJ1G 5JCOC 1Q6UA 4MSWC 2F66C 4DV7O 1ZAUA 2Q8VA 1SETA 4UV8A 3UKMA 4U3JB 2XNDG 2QEXV 2PI4A 1D5AA 1VF6A 4F6RB 1XILA 3JD4A 4FFBB 2ZXWC 3HKCB 1XHZA 5EZYB 4DR4B 2D2CB 2V4DA 3WB0A 2LP7A 3E8BA 2ILMA 1M90W 3JAWB 5DECA 2GBOA 3LNNA 2GDSA 1AI4A 1Q90D 1RM1C 3G6EV 2YXHA 2PTMA 4BR6A 3W7UA 3HB3B 1E79G 1I5YA 4UCTA 1UFIA 3DC6A 3TCUA 4JI4O 4CH6A 2QDOA 5CBHA 4FZ0A 4JYYA 1R3KC 1K5SA 1N8RW 1L8DA 2X6CA 3K9SA 2Y4TA 5DM6V 4XBFA 3E89A 1KB9F 1GMGA 4DUYO 3ETDA 4GLXA 2QTOA 5E1AC 2YICA 2BOCC 5CB4A 4LF4B 4JYCA 4J10A 2AXTZ 4B3SO 2QE7G 4G28B 1N33O 3CWBH 2E5LB 1GH6A 5IWAB 4OPAA 2LW7A 1DF5A 1XUQA 3K03A 2AZ0A 3CS5A 1KU9A 3OT7A 3IC7A 2Z5UA 4FLYA 1AB3A 5KUMA 3BY6A 1FS0G 4X20A 3UCSC 2GUZB 5L3GA 2R9IA 2EBOA 4UV9A 3SYOA 2EIMB 4FLVA 3CCLV 3B77A 1URFA 4ZI7A 1H2MA 2UUBB 3S3WA 1IXBA 4MW3A 1DLBA 1S0VA 3QNEA 1M4UA 3SPJA 4AQYB 5FL7G 2YEVA 4IIJB 3SYCA 2JDIG 3ZEDA 4H37A 4JYBA 2YI9A 2QWRB 1BS3A 4K0KO 3N2KA 5KA5A 3L73H 4DK0A 5LMNO 3OFNG 3R66A 4JI0O 3OUSA 5DN6G 2ZE5A 1JX9A 4PA9A 1O9GA 4BW9A 3OM3B 4U7OA 1NVPB 1KMIZ 1Y74B 5B3SC 1WPXA 1XMQO 3K9AA 2HJFC 4DRXB 4QE9A 1K34A 3B09A 4X64O 1N32O 4FFKA 4EFEA 1K3EA 3JALA 4MVRA 1H8EG 3HR0A 1E1QG 1N36O 2RJZA 4H44B 4FJCC 5IT9N 1FJGB 5LP6C 2QSAA 5A9GA 2VQFB 1G8MA 2YXLA 2XAHA 3SYPA 3SJAC 1VQ5V 1LUWA 1Q3EA 2UUAB 4GX5A 3ICXA 1GN6A 3CCEV 2VRZA 2LGQA 4X65O 1GN3A 3LSUA 1Q81W 1PM9A 1VQ4V 5KHIA 5FNVB 1BE3H 1FFXA 3VQVA 1KBHA 1XOUA 4UCVA 1Y4MA 1S76D 2C2AA 1XNQB 3L74H 4B08A 3A2FA 4JI7B 3K06A 4JTCB 3ZBHA 4DR1B 2QKSA 3G71V 1KP2A 4UCSA 1IBKB 2WPDG 4RQFA 4WFFA 1EM1A 2WLIB 4MT8A 4JPRA 4LF8O 5LA6A 5LHIA 3T1YO 4TSFG 5EIBD 3HKDA 2XUMA 1F4NA 1I94O 4UCRA 5LYJB 2Q68A 5B3SB 1VF5B 1FKAO 2UXCO 5KHGA 3F5TA 2NLJC 2GTAA 3L70H 4ICGA 1F51A 4TT3G 1V9PA 4EFBA 2A3QA 3RN4A 1K4DC 2LW1A 3CSXA 1HNZB 3TK1A 1AR5A 4Z1MG 5KA6A 2XT9A 2IBZH 4JI1O 3ABLC 5H6RA 3B40A 4LFAO 3L9DA 2YIAA 1OZ0A 4JASA 2L6LA 3K04A 5CMUA 4B3RO 1FFTB 1HNWO 2IU0A 5ITZB 5IJ0A 3RYCA 1BT8A 3SJQC 3SR2C 3ASOC 3SYQA 3SGIA 3X2QC 1NTMH 4LBEC 1QU7A 2XAFA 5B1BC 5F2VO 1K33A 2VWKA 4L87A 2KKWA 3KCXA 4GCZA 4X1YB 4IHJB 3E83A 3ASNC 4DO2A 4FM2A 4HNAA 1HDJA 4WF9V 2JEUA 1RPOA 3FFQA 3OD4A 4GYCB 1MNGA 1YSCA 4DR3B 1G6UA 4FLTA 3I55V 3K08A 2B1IA 3E22A 2Q7GA 2V1DA 2P4VA 3HKEB 2YIBD 5LXTA 3ZX6A 4I9QA 2OT5A 3OMAB 4B3TB 3FAVB 5IYZB 1QR9A 2WLJA 3CX5F 3O9OA 1A32A 4LNUB 4U3JA 5JVDB 2NNUA 3CXCU 2P4KA 1Y67A 4F6RA 1VQNV 4WFGA 2Q7HA 3MD0A 4Q6GA 1QQCA 4B3MO 4FFBA 4J42A 2Q9LA 3HKCA 3JASB 1JR9A 5EZYA 5J9PC 3LDCA 4MTOA 4KXRA 1QBZA 3JAWA 2P5OA 3P3NA 3ZHSA 5JJJB 2OCCB 2B1GA 3M8AA 3ABKB 3ABLB 4CZZA 2EINC 3OTOO 4LFBO 3OGIB 4CC6A 2ZD9A 3BHPA 4WFBV 1NH2B 4JI8O 1UJWB 4DV0B 1VQ8V 5EC1C 4DV2B 3LSQA 3P3PA 1B3QA 2WLKA 1OCZC 1ORQC 1E1RG 1TA8A 4AILC 1TUBA 4DV7B 3RYHA 5KMGB 1IBMB 3L72H 3D3QA 1P4RA 2UUCO 1HWYA 4I55B 2ZINA 3R65A 1MSWD 1ZSPA 1R1BA 1AJNA 2ZR2A 4PDMA 1SQBH 1D5NA 1CEZA 1QNMA 3HPLC 1ZTEA 4MW8A 1KECA 3A0RA 1DK1A 1AR1B 3H9VA 1S5JA 3OEHG 2QM8A 1EN5A 3CCRV 4K3AA 3BA9A 4YJ2B 4F6EA 1TAEA 3D3IA 3CJHB 1COWG 3J80N 3IJ4A 3MHSC 4JI4B 4RUEA 1SQFA 1RSOA 2MW2B 1AI7A 1G4YB 1HP8A 2GUZA 4H0LB 2Y69C 3OW2U 4EKWA 1NU1H 2UU9B 4DUYB 1K8AW 1GAXA 2W0XA 2IH3C 4QJFB 3TETA 4B3SB 4X88A 1N33B 3BABA 4IIJA 1WNSA 5IYDO 1DF4A 4J7ZA 2R9RB 4HZ3A 3EFFK 3FYIB 4PHZA 2UXBO 2R70A 2BTOA 1VQPV 2KG7B 3J7AU 2MK3A 4H13B 1Y74A 2E76B 3AEIA 4JZ2A 4DRXA 1Z5VA 1R73A 1S77D 2N05A 3BVOA 3UQ8A 2IJJA 1OCZB 1B06A 2WAMA 2IJIA 2A06H 3F7YC 2YC0A 2X7RB 5BZBA 2WLLB 4IT5A 1YJWV 4UXNA 1FPOA 3CP1A 2W0FC 1YVWA 3ETGA 2EJ7A 4D7SA 4QPKA 4CH5A 3JAMN 1BSMA 1Z2GA 4K0KB 1VQKV 3K5NA 3E8FA 5J2TB 5LMNB 5BR8O 3QTCA 3FD9A 4JI0B 1IBLB 1B6QA 3ML0A 3CRCA 2DYRC 4G2KA 3JCUZ 1EFRG 2W6IG 4YY3B 1NKDA 3GWOA 1F4MA 1XMQB 3AG7A 2PI5A 4OGQB 4X64B 5FNVA 1N32B 1S72V 3N27A 3ZMUA 1FXVA 3PN1A 1W0KG 4QE7A 1N36B 2PYLA 1NI8A 4X89A 4GZRB 3BFRA 4KHPO 3AK3A 2IU3A 3U0ZA 5A2QN 4CH3A 1N34O 1FXKC 4CS2A 1HR0B 5KLVH 3K5OA 4KUMA 4O4JB 2IJHA 3JSLA 3CEIA 1BGYH 1QVFU 1QLNA 2WLIA 5GTIZ 2EILB 4UFZA 1YEWA 1OCOB 2QWPB 4X65B 2ZDIC 3I5DA 3I56V 5LYJA 2CE4A 2EULA 1V54C 1KKCA 2RN9A 3FB6C 4ASUG 1EZJA 1VQ6V 2EIJB 3RVYA 4PDLA 2B5UA 1OCCC 4TV8B 5B5EZ 3UT5B 3CCMV 3CCVV 3D36A 3T4DA 3QVNA 1LR1A 4FMTA 4R7CA 5L3DA 1SQXH 2ZNIA 3IGAC 1VMGA 2KB1A 4C7UA 2JGDB 4LF8B 4J7KA 4PDRA 1WPBA 2F4VB 4K35A 2N74A 1XBLA 3VOUA 2IH1C 5IYBO 5ITZA 1Q86W 2UXCB 1NJIW 2BTQA 3NXSA 2E74B 2XHBA 2WWWA 2QM7A 4N21A 1VQ9V 3B2EE 3RYFB 1OCRC 4F4LA 1VEWA 3IFXA 3AG3B 5B1AC 4X1YA 4IHJA 5KX5B 2YIDA 1FXKB 5GW7A 4JI1B 4LFAB 3JD3A 3CCSV 1N0JA 4LWSB 1V55C 1WA8A 2ADPA 2XASA 4B3RB 1HNWB 5FPRA 4X62B 4JI2B 4X8AA 1QCEA 5C8YA 2ZE7A 2ZNJA 2H3OA 3FAVA 1V54B 4DV1O 3RWRD 5LOVB 4BIZA 2RDCA 4JYAO 1OV9A 3ZRWB 3LUTB 4LF5O 3ABMC 5KAIZ 3VQYA 5EBMC 2ZXWB 4ZBMA 5EC2C 1I0HA 2JGUA 3JASA 3JYCA 3M7MX 2Q0AA 3K3WA 4JTAB 1WAZA 1RM1B 4LFCO 3OAAG 3HKBA 1NBMG 4LF9O 3DXRB 2B9ZA 5IJ9B 2UXDO 4YJ3B 2FKXA 4B7EA 2AHZA 3J81N 5CN0A 4X66O 1XEQA 4WBNB 3TGUH 1JMKC 3OMIB 5CA0B 1XNRO 1X4TA 5KMGA 1YITV 4YXWG 2Q7EA 1VF6C 4PA3A 5LBQA 4I55A 3G6BA 3IAYA 1QLEC 2NN4A 2RMKB 2CK3G 2CTPA 3JD2A 2ZM6O 2QR4A 4RUFA 3JARB 1OCRB 3K59A 3ZCCA 1Q6HA 5B1AB 3JATB 2F95B 4IL6Z 4IYIA 3OEEG 2QA4V 2HHHB 4TWKA 3WB2A 1TVKB 3ZMSA 3OTOB 4LFBB 2Q69A 4YJ2A 3TXSA 4JI8B 3U11A 4JI5O 3CJHA 3N2GB 2ITDC 3E35A 1CXZB 2W6JG 4OX9O 1JJ2U 4XDLA 3ZMZA 2X6AA 2Y0PA 2JVDA 4NTWA 1IZ3A 2LFRA 3ZRSA 2DYSC 3AG4C 3GWKC 4NTXA 3ETQA 2L35A 4TOIA 1Y66A 3SYAA 2CTRA 4DUZO 1Q82W 1K4CC 2IW5A 1R3IC 2FTKA 2Q73A 1M9NA 5LGTA 2DW4A 2AW9A 2ZIOA 1P84F 2KG7A 4X1IB 3K57A 4CH4A 4ZHQB 4O4HB 2ZIMA 3FYEB 4MS2A 2LFSA 1F23A 4MTGA 2Q0OC 5D5PA 4UB6Z 2KSDA 3FX7A 3CRRA 1XL6A 4ZIBA 3Q4HA 1M56C 3IC9A 5LP6B 1MA1A 3ZN0A 4JI6B 2WLLA 4D6TH 4LF4O 3CMEV 1S5LZ 5IY5C 3OTFA 4QPJA 4GUNA 4ZOLB 4JAVA 4TUYB 1QLEB 5LGUA 2E5LO 1FAFA 3F7VC 5J2TA 1IURA 4BAYA 4DYLA 5IWAO 2UXBB 3STZC 4FLUA 2F93B 3L71H 4JI3O 2ITCC 5DEDA 3AG2C 1R6KA 4B7KA 3O65A 2FMLA 4NXNO 5FLXN 1XDCA 1CPYA 5LMUO 4J9ZB 2Q67A 2YUAA 3ZHRA 3K0GA 5CBGA 2UUBO 1AROP 1FD9A 2DYSB 3AG4B 1WB8A 4AQYO 2XAQA 4O4JA 1QR8A 1YJNV 1VF7A 3CC4V 1GM8A 3W7SA 1FXHA 2Y4UA 1M1KW 4NXMB 5BR8B 1EN6A 3WG7C 3SPCA 5H5NA 2BCCH 2QKCA 1L1FA 2WLHA 1RP3B 3DC5A 4PJ0Z 4EB6A 1PNMA 3CXHF 4TV9B 2OTJV 2F23A 2ZT9B 2PY5A 1YIJV 4OPHA 4KFMA 2Y0IA 2QKAA 2VQEO 2CGOA 3THOA 1AI6A 4KHPB 2K9PA 2HP8A 5EK0A 1CP9A 4O2AB 4TV8A 1Y6XA 2CH7B 3UT5A 3CB2A 2DOSA 1SZXA 3A0HZ 4WFHA 2AZ2A 1N0NA 1M56B 2OCHA 1AJQA 2YEVB 5BY1A 2N04A 2QM4A 4BW5A 1NS1A 4DV4O 1FYJA 1SA0B 3H1HH 3N2KB 1PNLA 2XAJA 4DV5B 2JGDA 1IXMA 1ZLZA 2RCVA 3ZS8C 1M93A 2ARHA 3P30A 2UUAO 1Q6IA 3DSQA 1MMMA 1MABG 3LSSA 5LHGA 3ZHTA 1Y76B 2GTSA 3ASOB 3X2QB 2GSMB 3RGBA 5B1BB 1XNQO 1ZWIC 2ODMA 1WP7A 4I7ZB 5B1OA 2WLNA 3RYFA 3WB1A 1ZL8B 3ASNB 1PV0A 1H2GA 1Q7YW 3CC2V 3CCQV 2EIKC 2ZQMA 3ZIAG 5KX5A 5GONB 2ZE6A 1IBKO 3LDDA 4DR6O 5GTHZ 4BIOA 2EJRA 2JS5A 1EN4A 3CE2A 1R3JC 3WG7B 4LWSA 4JAUA 1SS3A 1Q43A 2ATKC 5E79Z 4J11A 5JCOA 1IVSA 4FLXA 2DMXA 1KD1W 3B4SA 4NYKA 4J80A 4BIUA 2K1EA 3ZRWA 4K8ZA 1LNQA 3L75H 3W7TA 4LH7A 2PGGA 3RW0A 3MAQA 3CRMA 4U7NA 1VQ7V 2Q6AA 2FYUH 1VARA 3K5MA 4X9QA 3MHHC 4HYOA 2EINB 2FB5A 3HKDB 3PJSK 1DTOA 3DXRA 5IJ9A 2PYJA 3QO8A 4RO2A 4WBNA 4DR5O 1H2NA 2RQ6A 4W4LA 1WP8A 5CA0A 3BRCA 4JGSA 4O4IB 2HG5C 4YHHO 1U96A 3WFVA 3OUFA 4JYAB 2OIGA 3CHXA 3B8NA 4LF5B 1J5EO 4D7TA 3T1HO 1NT2B 2A79B 1BHBA 3TXQA 5BMVB 3JARA 3T4ZA 3AG1C 3WU2Z 4QNHB 1MZFA 3JATA 2EIKB 3KKYA 4DR3O 5CA1B 1EZVH 2OYQA 1YHQV 4LFCB 3SPGA 1B04A 1SQPH 1TVKA 5CBFA 2A9HA 4LF9B 2AGAA 2UXDB 1U97A 2H94A 2YI8A 4X66B 3N2GA 1PPJH 4I0XB 1P49A 4FM0A 1K5QA 2Y69B 1R6TA 2X0LA 5FPOA 1XNRB 4WFEA 1TGOA 3QO7A 1GTOA 3JSNA 3VQXA 1I08A 1AP6A 5IE9A 4OXSA 1TUEB 2HLDG 2ZM6B 3UM7A 3A0BZ 1NTKH 4DXWA 3QG5A 3LDEA 1YI2V 1GN4A 1H2SB 4NB5A 4JV5O 4UCUA 3JD1A 4O2BB 4KP4A 1HNXO 4E2LA 4MVMA 3FB7C 1BCCH 4R6ZA 4NTYA 4X1IA 2DQ3A 2UXXA 5JH7B 4FK5C 4O4HA 4JI5B 2EIMC 4DV2O 3K0DA 3FB5C 5K1PA 3M99B 2VS0A 3CYOA 3OMNB 4YIPA 2V7QG 1JVMA 4GKJO 4P9PA 2QTSA 1AVMA 2VWJA 1SRYA 2LO1A 1IBMO 2GV9A 2YXYA 5LP6A 2O57A 2Q4PA 5KUKA 3CCUV 1O9HA 2HVJC 1K7DA 4DUZB 1K97A 1SKVA 4UVBA 4ZOLA 1XMOO 3T1YB 4TUYA 2Z3YA 5IDJA 1I94B 3GB7C 1AP5A 2DYRB 2LQTA 3UO3A 5KHJA 4L8JA 4PV1B 3AG1B 1DGSA 1G1XB 2HEPA 4PA7A 1Z5WA 5KHHA 3E8GA 1BHAA 4YIOA 3APQA 5B1NA 2ZR3A 3BPZA 1PL0A 1TUBB 4I50B 3RYHB 1YJ9V 2UU9O 4NR1A 1KYOF 1US6A 4LF7O 1AR4A 2DE0X 3RFRA 4DV6O 5EBLC 1GM7A 5J2UB 1XQ8A 3STLC 3G80A 4MTXA 3H1LH 4DV3O 2RNBA 3JAKB 4FPPA 3HKEA 4GKKO 4UCOA 3ZJZA 3W7WA 2YSUB 3K58A 4W4KA 4ABMA 4JI3B 4LF6O 1WN7A 1WB7A 4CBCA 1OHHG 4TQFA 1GKFA 5B66Z 5IYZA 1JOYA 4EEQA 2CTWA 1JFFB 1RSOB 2JRIA 3APOA 4TV9A 2JS3A 4NXNB 5IYCO 4WFAV 4LNUA 3T1CA 3BCCH 5JVDA 4G27B 3K5LA 3ZMTA 5LMUB 4CS4A 1NZ6A 1OCCB 2WLMA 4BWAA 4RQEA 4LH6A 3ZHQA 4O2AA 2CH7A 1KKDA 1YDXA 2BSKB 5AG2A 3FB8C 4AI8A 1ZX3A 1BQ0A 3QO5A 2NR5A 4ZKIA 1SA0A 3DTUB 1GM9A 4FM1A 4TQDA 1N4CA 2Z0AA 3SPHA 4LCUC 4A5UB 1IBLO 4MTFA 1LUVA 4YY3O 1NTZH 1NR1A 3ZN1A 1BL8A 3F5WC 4O4LB 3NR7A 3D8CA 1Y76A 1VP7A 3TJTA 2QWOB 5EYPB 1SZTA 4HBNA 4XDKA 1JA8A 2VQEB 3D36C 1F7YA 2QJ1A 5C93A 4B3MB 4MVZA 3K79A 3ZHUA 1ZL8A 1P7BA 1HR0O 5L3EA 4X1KB 3OGCC 3RYIB 5GONA 5H6QA 4DR7O 3W7XA 4DV4B 2GHYA 3BA8A 2YS8A 1AJPA 2IJKA 4DR2O 3E8HA 2PUSA 4I4TB 1V55B 4Z1VA 1NH2D 3ABTA 5JJNB 2X6BA 3CC7V 2UUCB 4MVUA 1MZEA 1IX9A 4R50A 1K92A 2Q5ZA 3P32A 4CS3A 3RT3C 2XAGA 3DGEA 2R9AA 4J41A 4PA4A 3ABMB
chains in the Genus database with same CATH topology
2WSSG 3ETGA 2QE7G 4G28B 4LC1A 1AI5A 4WFHA 2JK5C 4QPKA 1M56B 2YEVB 1AJQA 4GX1A 1VQKV 4BW5A 1PKXA 3E8FA 1PNLA 2XAJA 1DF5A 3K03A 1B6QA 3ML0A 2DYRC 4G2KA 1EFRG 1MG1A 1K73W 1IXMA 2W6IG 3IC7A 1NKDA 2Z5UA 3GWOA 1YTFD 3P30A 5KUMA 1F4MA 1JQ0A 3BY6A 1J95A 1FS0G 2P7TC 5L3CA 1NQTA 1MABG 3LSSA 5L3BA 5LHGA 2PI5A 5H9CA 5L3GA 2R9IA 3RVZA 2EBOA 4UV9A 3RBZA 3SYOA 2EIMB 1ROPA 1S72V 3ASOB 3ZMUA 3CCLV 3B77A 3X2QB 1FXVA 1W0KG 2GSMB 4QE7A 3G4SV 5B1BB 4X89A 1ZWIC 2IU3A 2JIZG 4I5SA 4MW3A 1DLBA 4HAMA 3QNEA 2M7WA 1S0VA 5B1OA 1FXKC 5FL7G 3SPJA 2WLNA 2YEVA 4KUMA 3SYCA 2JDIG 3ASNB 4H37A 1H2GA 4JYBA 2IJHA 1Q7YW 3CC2V 3CCQV 2EIKC 2ZQMA 3ZIAG 5KA5A 3CCJV 1QVFU 3LDDA 3SPIA 1QLNA 3OFNG 5DN6G 3OUSA 2WLIA 4N23A 2EILB 1JX9A 2P6JA 2EZOA 2OCCC 4PA9A 1OCOB 3ABKC 1NVPB 3OM3B 4U7OA 5B3SC 2EJRA 1WPXA 3ZRVA 3VBBA 3K9AA 2ZDIC 1R3JC 3I56V 2HJFC 3WG7B 1VQMV 4QE9A 1K34A 4JAUA 1PNKA 1V54C 3FB6C 2HKOA 4ASUG 1EZJA 1VQ6V 1I5XA 2ATKC 3FKSG 1K3EA 4MVRA 2EIJB 3ZMVA 1H8EG 3RVYA 1E1QG 4PDLA 4FJCC 2B5UA 1PD3A 1KD1W 1OCCC 4H33A 4BIUA 2K1EA 3ZRWA 3CCMV 1G8MA 3D36A 3CCVV 2XAHA 3SYPA 1LNQA 2HFEC 3W7TA 3T4DA 3RW0A 4FMTA 4R7CA 5L3DA 1VQ5V 4JF3A 4U7NA 4PDVA 3IGAC 2KB1A 1VQ7V 2Q6AA 2DWEC 3H01A 4UVAA 3MHHC 4GX5A 3CCEV 4HYOA 4PDRA 2EINB 1EBOA 1Q81W 1H38A 1VQ4V 3PJSK 3VOUA 1DTOA 4Q20A 2IH1C 3QO8A 3JCZA 5IYBO 1MOFA 5L3FA 1Q86W 4RO2A 1Y4MA 1NJIW 1S76D 2C2AA 2OTLV 3NXSA 1M57C 2BOBC 2H8PC 3E2EA 2HVKC 2WWWA 4JGSA 2HG5C 2Y48A 3K06A 4JTCB 1RPRA 2QM7A 4N21A 3WFVA 3OUFA 1VQ9V 5CA3A 4PELA 1OCRC 5EBWC 3B8NA 4F4LA 2QKSA 3IFXA 3AG3B 4GX0A 5B1AC 3G71V 1KP2A 1QVGU 4UVCA 2JJ2G 2A79B 3OR7C 2WPDG 1BHBA 4RQFA 4WFFA 1H8HG 5IY5B 1FXKB 2WLIB 5GW7A 2UXNA 4MT8A 4JPRA 3T4ZA 3AG1C 4QNHB 3EHBB 2EIKB 5LHIA 3KG2A 3B8MA 3OE7G 3JD3A 1KQSU 4TSFG 3CCSV 1YHQV 1KP3A 1WLEA 1F4NA 3SPGA 1V55C 5CBFA 2XASA 3CD6V 2A9HA 4P9OA 2Q68A 1S3JA 5B3SB 4P30A 2H94A 3AG2B 4X8AA 1QCEA 2NLJC 1K5QA 2Y69B 1F51A 4MVOA 4GX2A 2X0LA 1V54B 4TT3G 4WFEA 4BIZA 4XDJA 2F43G 2A0LA 3ZRWB 3LUTB 5LGNA 3ABMC 5HFLA 1K4DC 3QO7A 1GTOA 1GK9A 1K9MW 3TK1A 4MVSA 4Z1MG 5EBMC 4OXSA 1FXKA 2ZXWB 4ZBMA 5KA6A 4WCEV 4LP8A 5EC2C 1TUEB 2HLDG 2AHYA 3UM7A 3ABLC 3JYCA 5H6RA 4DXWA 3K3WA 4JTAB 3LDEA 1YI2V 1RM1B 3JD1A 4QIWF 4KP4A 1OZ0A 4JASA 3OAAG 4E2LA 4MVMA 3FB7C 3K04A 1NBMG 4R6ZA 5CMUA 1XL4A 1FFTB 1YTFB 1ENVA 2DQ3A 2IU0A 2UXXA 3ETEA 4FK5C 2ZDIA 2AHZA 5CN0A 2EIMC 3SJQC 3K0DA 3FB5C 3ASOC 3M99B 3SYQA 2P67A 3X2QC 3OMIB 4LBEC 3CYOA 3OMNB 2XAFA 1SESA 2V7QG 5B1BC 1JVMA 4P9PA 1YITV 1K33A 4YXWG 1SRYA 4PA3A 4L87A 5LBQA 1S5HC 1M57B 4GCZA 2DWDC 3E83A 3ASNC 1QLEC 2W0FC 4DO2A 3LNMB 5KUKA 3CCUV 2HVJC 2JEUA 4WF9V 5HFMA 2CK3G 3ZRXA 3JD2A 3OR6C 1K7DA 4RUFA 1RPOA 1OCRB 1K97A 3ZCCA 4UVBA 1YSCA 5B1AB 3I55V 2EILC 3K08A 2Z3YA 5IDJA 2B1IA 3OEEG 1OCOC 4R8CA 2QA4V 3GB7C 2DYRB 4TWKA 3CMAV 4RAIA 2V1DA 3ZMSA 3AG1B 4PA6A 1VQLV 2Q69A 4J9YB 4PA7A 4JTDB 2P90A 1JCHA 2OT5A 3ABUA 2ITDC 3E35A 1THZA 3E8GA 3OMAB 2EIJC 2W6JG 4P2ZA 1BHAA 1JJ2U 1QR9A 4XDLA 2HR3A 3ZMZA 2WLJA 2D3OW 5B1NA 1SERA 1GO3F 2X6AA 2ZR3A 1PL0A 2DQ0A 2LFRA 3ZRSA 2DYSC 3AG4C 1YJ9V 2NNUA 3CXCU 1Y66A 3SYAA 1VQNV 4WFGA 3MD0A 4MVQA 1Q82W 1K4CC 2IW5A 5EBLC 5J9PC 1GM7A 3LDCA 4MTOA 5LHHA 1R3IC 1QBZA 3STLC 2FTKA 1NVPD 4MTXA 1W0JG 4FPPA 1M9NA 5LGTA 2OCCB 1R3LC 2B1GA 3ABKB 3ABLB 4CZZA 3ZJZA 2DW4A 2EINC 3W7WA 2YSUB 3E86A 2ZD9A 1NH2B 4WFBV 1UJWB 1R6NA 1VQ8V 3FYEB 5EC1C 4MS2A 3LSQA 2LFSA 4CBCA 1OHHG 1BMFG 1F23A 2WLKA 4MTGA 1KC8W 1GKFA 1OCZC 1ORQC 1JOYA 4GT1A 1E1RG 3JD0A 5IYCO 4WFAV 1XL6A 3T1CA 1P4RA 4G27B 1HWYA 3ZMTA 1NR7A 1M56C 1OCCB 2WLMA 4RQEA 3ZN0A 3T2MA 3R65A 1MSWD 1AJNA 2WLLA 3AG3C 2ZR2A 1VQOV 4PDMA 1KKDA 4FIPC 1CEZA 1W2BU 3CMEV 3HPLC 5IY5C 3FB8C 3BEHA 4MW8A 4QPJA 1KECA 3A0RA 4JAVA 1AR1B 1QLEB 5LGUA 3QO5A 4ZKIA 3F7VC 3OEHG 3CP1A 4BAYA 1JPXA 3DTUB 1GM9A 2EZPA 4I9WA 3STZC 2QM8A 3SPHA 4LCUC 3CPWU 3CCRV 2XOKG 4MTFA 3D3IA 1NR1A 2ITCC 1COWG 3ZN1A 4UUJC 1BL8A 3MHSC 4RUEA 3F5WC 2JEXA 3AG2C 1R6KA 1AI7A 1G4YB 2JJ1G 4MSWC 2Y69C 3OW2U 4EKWA 1SETA 1SZTA 1CPYA 1K8AW 4UV8A 3UKMA 4XDKA 2IH3C 4J9ZB 4QJFB 2Q67A 2XNDG 2QEXV 3K0GA 5C93A 5CBGA 2PI4A 4MVZA 3TETA 3K79A 1AROP 3JD4A 2ZXWC 2DYSB 3AG4B 4X88A 1P7BA 2XAQA 5IYDO 1QR8A 5L3EA 1DF4A 2LP7A 1GM8A 3E8BA 2R9RB 1YJNV 1M90W 3CC4V 3OGCC 3W7SA 4HZ3A 5H6QA 3EFFK 1FXHA 3W7XA 1M1KW 3FYIB 2GHYA 1AI4A 1RM1C 1AJPA 3WG7C 2IJKA 3G6EV 1VQPV 3SPCA 2MK3A 1L1FA 3E8HA 3W7UA 2WLHA 3HB3B 3AEIA 1E79G 1I5YA 1V55B 1NH2D 3ABTA 3TCUA 5CBHA 1R3KC 1K5SA 1R73A 1N8RW 2X6BA 1PNMA 1S77D 3CC7V 2X6CA 5DM6V 4XBFA 3E89A 2OTJV 1GMGA 1YIJV 3ETDA 4MVUA 4R50A 1K92A 2QTOA 3P32A 4KFMA 5E1AC 2IJJA 1OCZB 2WAMA 2IJIA 2XAGA 3DGEA 3F7YC 2BOCC 2X7RB 1AI6A 5BZBA 2WLLB 5EK0A 1CP9A 4JYCA 1YJWV 4PA4A 4UXNA 3ABMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G28 B;  1XL6 A;  2JK5 C;  4WFH A;  3T1C A;  2AHZ A;  4GX5 A;  4G27 B;  2EIM C;  1M56 C;  4GX1 A;  4HYO A;  2WLM A;  3K0D A;  3FB5 C;  4PDR A;  3SJQ C;  3ASO C;  4BW5 A;  3SYQ A;  3T2M A;  3R65 A;  3E8F A;  3X2Q C;  4LBE C;  2WLL A;  3AG3 C;  3PJS K;  3K04 A;  4PDM A;  5B1B C;  3VOU A;  1KKD A;  3K03 A;  1JVM A;  2DYR C;  4P9P A;  2IH1 C;  3HPL C;  5IY5 C;  3FB8 C;  3BEH A;  4MW8 A;  4PA3 A;  4RO2 A;  1S5H C;  5KUM A;  2DWD C;  1J95 A;  1M57 C;  2BOB C;  3E83 A;  3F7V C;  2P7T C;  1QLE C;  2H8P C;  3ASN C;  3LNM B;  2HVK C;  5KUK A;  4I9W A;  2HG5 C;  3K06 A;  2HVJ C;  4JTC B;  3STZ C;  3SPH A;  4LCU C;  3OR6 C;  3RVZ A;  4RUF A;  3RBZ A;  3SYO A;  3OUF A;  4MTF A;  1OCR C;  5EBW C;  4F4L A;  2EIL C;  3K08 A;  2QKS A;  2ITC C;  3IFX A;  4GX0 A;  1OCO C;  5B1A C;  4QE7 A;  4R8C A;  4UUJ C;  1BL8 A;  3GB7 C;  2A79 B;  3OR7 C;  3F5W C;  4RUE A;  4X89 A;  3AG2 C;  1ZWI C;  4WFF A;  4TWK A;  1G4Y B;  4RAI A;  4MW3 A;  4MSW C;  2WLI B;  4PA6 A;  3SPJ A;  2Q69 A;  2Y69 C;  2WLN A;  3AG1 C;  4J9Y B;  2YEV A;  3T4Z A;  4EKW A;  4QNH B;  3SYC A;  4PA7 A;  4H37 A;  3KG2 A;  3UKM A;  4JTD B;  2IH3 C;  2EIK C;  4J9Z B;  4XDK A;  2Q67 A;  2ITD C;  3SPG A;  3K0G A;  3E8G A;  3LDD A;  3SPI A;  2EIJ C;  5CBG A;  4MVZ A;  4P2Z A;  1V55 C;  5CBF A;  3TET A;  3OUS A;  2WLI A;  4XDL A;  2A9H A;  2WLJ A;  2ZXW C;  2X6A A;  2OCC C;  4PA9 A;  4P9O A;  2Q68 A;  4X88 A;  3ABK C;  4P30 A;  1P7B A;  3ZRS A;  2DYS C;  3AG4 C;  3E8B A;  4X8A A;  2R9R B;  5B3S C;  3OGC C;  4HZ3 A;  3EFF K;  2NLJ C;  1R3J C;  2HJF C;  3SYA A;  4WFG A;  4QE9 A;  4MVO A;  4GX2 A;  4MVQ A;  3WG7 C;  4WFE A;  1K4C C;  1V54 C;  3SPC A;  4XDJ A;  2A0L A;  3FB6 C;  3LUT B;  5EBL C;  5J9P C;  3E8H A;  3LDC A;  4MTO A;  2ATK C;  2WLH A;  1K4D C;  1R3I C;  3ABM C;  4MVR A;  3STL C;  3RVY A;  4PDL A;  4MVS A;  3TCU A;  5EBM C;  4OXS A;  5CBH A;  4ZBM A;  1R3L C;  1R3K C;  1OCC C;  2X6B A;  4LP8 A;  5EC2 C;  3ZJZ A;  2EIN C;  4H33 A;  2X6C A;  2AHY A;  3E86 A;  2K1E A;  3ABL C;  3JYC A;  3UM7 A;  2ZD9 A;  3E89 A;  4DXW A;  3SYP A;  1LNQ A;  2HFE C;  3LDE A;  4JTA B;  4MVU A;  4R50 A;  3T4D A;  2QTO A;  4KFM A;  4MS2 A;  5E1A C;  5EC1 C;  4CBC A;  3RW0 A;  2WLK A;  4R7C A;  4MTG A;  4PA4 A;  1OCZ C;  1ORQ C;  3F7Y C;  2BOC C;  4PDV A;  5BZB A;  2WLL B;  3IGA C;  2KB1 A;  5EK0 A;  4MVM A;  3FB7 C;  2Q6A A;  2DWE C;  4R6Z A;  2W0F C;  1XL4 A; 
#chains in the Genus database with same CATH topology
 2WSS G;  1RFY A;  4LC1 A;  1AI5 A;  1MSD A;  2JK5 C;  4DR4 O;  1Q5O A;  4FVM A;  2PZS A;  1GN2 A;  4GX1 A;  1YF2 A;  4PI0 A;  1PKX A;  5JQG B;  1BQZ A;  5H2F Z;  4DR6 B;  1MG1 A;  1K73 W;  1YTF D;  1QHT A;  1IDS A;  1JQ0 A;  1Q8I A;  1J95 A;  2P7T C;  2QGN A;  5L3C A;  1NQT A;  1SF9 A;  1SQV H;  2ZKO A;  2F4V O;  2XTA A;  4QGP A;  2YDE A;  3UO2 A;  5L3B A;  5H9C A;  3RVZ A;  3RBZ A;  2G38 A;  1T5E A;  1OJH A;  1ROP A;  1VIB A;  4U3F H;  3G4S V;  4O4I A;  1X59 A;  4PD4 F;  2JIZ G;  4I5S A;  3C3S A;  3GVM A;  2M7W A;  4HAM A;  3AK1 A;  3KCY A;  1XRE A;  3CCJ V;  2CAZ C;  3SPI A;  2E3C A;  2E75 B;  4N23 A;  5BMV A;  2P6J A;  2EZO A;  2OCC C;  1SQG A;  2CUG A;  3ABK C;  5CA1 A;  1ZUQ A;  3ZRV A;  3VBB A;  2YIB A;  1VQM V;  3SJB C;  1PNK A;  3S3X A;  2BE3 A;  2EX3 A;  1P7G A;  2HKO A;  2WA3 A;  1I5X A;  3FKS G;  4FLZ A;  4RWU A;  4DR5 B;  4I0X A;  3ZMV A;  4X62 O;  4JI2 O;  5LL6 Y;  1PD3 A;  2BTQ B;  5BXZ A;  5CB4 B;  4YHH B;  1XI1 A;  4H33 A;  2HFE C;  1J5E B;  4JF3 A;  3T1H B;  4PDV A;  2DWE C;  5JJE B;  3H01 A;  4UVA A;  4AHC A;  2A7W A;  5EIB C;  4O2B A;  4X20 B;  1EBO A;  2PF4 E;  1YXB A;  1H38 A;  5K1X A;  4Q20 A;  1WA8 B;  1YCI A;  3JCZ A;  5JH7 A;  1MOF A;  5L3F A;  1JJO A;  1BZK A;  2OTL V;  3G67 A;  1M57 C;  2BOB C;  3C3T A;  5C8Y B;  4ZI7 B;  1L0N H;  2H8P C;  3E2E A;  2F1M A;  2HVK C;  1FJG O;  2Y48 A;  1WJZ A;  1N34 B;  1RPR A;  2VQF O;  5CA3 A;  4PEL A;  5EBW C;  4GX0 A;  1QVG U;  4UVC A;  2JJ2 G;  3OR7 C;  1H8H G;  5IY5 B;  3ZHV A;  4IGG A;  4KL1 A;  2UXN A;  4IYH A;  1M5I A;  3EHB B;  3KG2 A;  3B8M A;  3OE7 G;  1KQS U;  1H2K A;  3A8T A;  4JV5 B;  1KP3 A;  1WLE A;  2HHH O;  1HNX B;  5TIS Z;  1PP9 H;  3CD6 V;  4P9O A;  3HKB B;  4NVP A;  2WA4 A;  1S3J A;  1KUQ A;  2DJV A;  4P30 A;  3AG2 B;  2ZCE A;  3JAL B;  3SDL A;  4CC5 A;  4JI7 O;  4MVO A;  4GX2 A;  4J7J A;  3MDS A;  4GKJ B;  3SJC C;  4DR1 O;  4XDJ A;  2F43 G;  2A0L A;  4I50 A;  5LGN A;  5HFL A;  1GK9 A;  1K9M W;  4JAA A;  4MVS A;  4FZ1 A;  1FXK A;  2OIE A;  5D5Q A;  4WCE V;  4LP8 A;  1H2L A;  2AHY A;  2LJ2 A;  4DK1 A;  1XMO B;  5J2U A;  2M6Y A;  3QF7 A;  2P06 A;  3JAK A;  2CGN A;  4QIW F;  1XL4 A;  1YTF B;  1ENV A;  2DN9 A;  3ETE A;  1FFX B;  2ZDI A;  2QWN B;  1XHX A;  2P67 A;  1JFF A;  5LOV A;  4Z2W A;  1SES A;  2LGW A;  2IM9 A;  1AIL A;  1S5H C;  1M57 B;  5JWP A;  2DWD C;  1HNZ O;  3CRQ A;  3LNM B;  1HW7 A;  4JI6 O;  4LF7 B;  5HFM A;  2BSK A;  3ZRX A;  3OR6 C;  4DV6 B;  1SC5 B;  2EIL C;  5LA6 B;  1OCO C;  4R8C A;  4DV3 B;  2R72 A;  4GKK B;  3CMA V;  4RAI A;  4K8X A;  4YJ3 A;  2HJD A;  4PA6 A;  1VQL V;  1I7F A;  4J9Y B;  4E4E A;  4LF6 B;  5KHK A;  2FL4 A;  2P90 A;  4JTD B;  1JCH A;  1YZB A;  3ABU A;  1THZ A;  4O4L A;  2EIJ C;  4DV1 B;  4P2Z A;  2HR3 A;  2D3O W;  1SER A;  1GO3 F;  1W59 A;  5EYP A;  2DQ0 A;  3EXA A;  3H1I H;  3Q4H B;  2ETN A;  2OWO A;  4MVQ A;  2QWQ B;  5LHH A;  4X1K A;  3RYI A;  1NVP D;  1W0J G;  1R3L C;  3BAA A;  4NXM O;  4JZG A;  3CRA A;  1PL4 A;  3E86 A;  4DW1 A;  3AK2 A;  1R6N A;  2CTQ A;  5IJ0 B;  4I4T A;  3RYC B;  1BMF G;  4FLW A;  1KC8 W;  2CDY A;  4B3T O;  4GT1 A;  2P22 C;  3JD0 A;  3H1K H;  4UB8 Z;  3H1J H;  2ADQ B;  4PI2 A;  4NKG B;  1NR7 A;  2KQX A;  3C90 A;  3T2M A;  4HNA B;  3AG3 C;  3VQW A;  1VQO V;  4FIP C;  1W2B U;  1UPG A;  4DW0 A;  3BEH A;  2ZE8 A;  3EVK A;  1SQQ H;  5JQG A;  4DR7 B;  4LR3 A;  1JPX A;  2EZP A;  3E22 B;  4I9W A;  5KAF Z;  3CPW U;  1L0L H;  4ZHQ A;  4DR2 B;  4DV5 O;  3KZI Z;  4DV0 O;  1D2D A;  2XOK G;  3U10 A;  5LXT B;  4UUJ C;  1GRJ A;  4OX9 B;  2JEX A;  4EB6 B;  2JJ1 G;  5JCO C;  1Q6U A;  4MSW C;  2F66 C;  4DV7 O;  1ZAU A;  2Q8V A;  1SET A;  4UV8 A;  3UKM A;  4U3J B;  2XND G;  2QEX V;  2PI4 A;  1D5A A;  1VF6 A;  4F6R B;  1XIL A;  3JD4 A;  4FFB B;  2ZXW C;  3HKC B;  1XHZ A;  5EZY B;  4DR4 B;  2D2C B;  2V4D A;  3WB0 A;  2LP7 A;  3E8B A;  2ILM A;  1M90 W;  3JAW B;  5DEC A;  2GBO A;  3LNN A;  2GDS A;  1AI4 A;  1Q90 D;  1RM1 C;  3G6E V;  2YXH A;  2PTM A;  4BR6 A;  3W7U A;  3HB3 B;  1E79 G;  1I5Y A;  4UCT A;  1UFI A;  3DC6 A;  3TCU A;  4JI4 O;  4CH6 A;  2QDO A;  5CBH A;  4FZ0 A;  4JYY A;  1R3K C;  1K5S A;  1N8R W;  1L8D A;  2X6C A;  3K9S A;  2Y4T A;  5DM6 V;  4XBF A;  3E89 A;  1KB9 F;  1GMG A;  4DUY O;  3ETD A;  4GLX A;  2QTO A;  5E1A C;  2YIC A;  2BOC C;  5CB4 A;  4LF4 B;  4JYC A;  4J10 A;  2AXT Z;  4B3S O;  2QE7 G;  4G28 B;  1N33 O;  3CWB H;  2E5L B;  1GH6 A;  5IWA B;  4OPA A;  2LW7 A;  1DF5 A;  1XUQ A;  3K03 A;  2AZ0 A;  3CS5 A;  1KU9 A;  3OT7 A;  3IC7 A;  2Z5U A;  4FLY A;  1AB3 A;  5KUM A;  3BY6 A;  1FS0 G;  4X20 A;  3UCS C;  2GUZ B;  5L3G A;  2R9I A;  2EBO A;  4UV9 A;  3SYO A;  2EIM B;  4FLV A;  3CCL V;  3B77 A;  1URF A;  4ZI7 A;  1H2M A;  2UUB B;  3S3W A;  1IXB A;  4MW3 A;  1DLB A;  1S0V A;  3QNE A;  1M4U A;  3SPJ A;  4AQY B;  5FL7 G;  2YEV A;  4IIJ B;  3SYC A;  2JDI G;  3ZED A;  4H37 A;  4JYB A;  2YI9 A;  2QWR B;  1BS3 A;  4K0K O;  3N2K A;  5KA5 A;  3L73 H;  4DK0 A;  5LMN O;  3OFN G;  3R66 A;  4JI0 O;  3OUS A;  5DN6 G;  2ZE5 A;  1JX9 A;  4PA9 A;  1O9G A;  4BW9 A;  3OM3 B;  4U7O A;  1NVP B;  1KMI Z;  1Y74 B;  5B3S C;  1WPX A;  1XMQ O;  3K9A A;  2HJF C;  4DRX B;  4QE9 A;  1K34 A;  3B09 A;  4X64 O;  1N32 O;  4FFK A;  4EFE A;  1K3E A;  3JAL A;  4MVR A;  1H8E G;  3HR0 A;  1E1Q G;  1N36 O;  2RJZ A;  4H44 B;  4FJC C;  5IT9 N;  1FJG B;  5LP6 C;  2QSA A;  5A9G A;  2VQF B;  1G8M A;  2YXL A;  2XAH A;  3SYP A;  3SJA C;  1VQ5 V;  1LUW A;  1Q3E A;  2UUA B;  4GX5 A;  3ICX A;  1GN6 A;  3CCE V;  2VRZ A;  2LGQ A;  4X65 O;  1GN3 A;  3LSU A;  1Q81 W;  1PM9 A;  1VQ4 V;  5KHI A;  5FNV B;  1BE3 H;  1FFX A;  3VQV A;  1KBH A;  1XOU A;  4UCV A;  1Y4M A;  1S76 D;  2C2A A;  1XNQ B;  3L74 H;  4B08 A;  3A2F A;  4JI7 B;  3K06 A;  4JTC B;  3ZBH A;  4DR1 B;  2QKS A;  3G71 V;  1KP2 A;  4UCS A;  1IBK B;  2WPD G;  4RQF A;  4WFF A;  1EM1 A;  2WLI B;  4MT8 A;  4JPR A;  4LF8 O;  5LA6 A;  5LHI A;  3T1Y O;  4TSF G;  5EIB D;  3HKD A;  2XUM A;  1F4N A;  1I94 O;  4UCR A;  5LYJ B;  2Q68 A;  5B3S B;  1VF5 B;  1FKA O;  2UXC O;  5KHG A;  3F5T A;  2NLJ C;  2GTA A;  3L70 H;  4ICG A;  1F51 A;  4TT3 G;  1V9P A;  4EFB A;  2A3Q A;  3RN4 A;  1K4D C;  2LW1 A;  3CSX A;  1HNZ B;  3TK1 A;  1AR5 A;  4Z1M G;  5KA6 A;  2XT9 A;  2IBZ H;  4JI1 O;  3ABL C;  5H6R A;  3B40 A;  4LFA O;  3L9D A;  2YIA A;  1OZ0 A;  4JAS A;  2L6L A;  3K04 A;  5CMU A;  4B3R O;  1FFT B;  1HNW O;  2IU0 A;  5ITZ B;  5IJ0 A;  3RYC A;  1BT8 A;  3SJQ C;  3SR2 C;  3ASO C;  3SYQ A;  3SGI A;  3X2Q C;  1NTM H;  4LBE C;  1QU7 A;  2XAF A;  5B1B C;  5F2V O;  1K33 A;  2VWK A;  4L87 A;  2KKW A;  3KCX A;  4GCZ A;  4X1Y B;  4IHJ B;  3E83 A;  3ASN C;  4DO2 A;  4FM2 A;  4HNA A;  1HDJ A;  4WF9 V;  2JEU A;  1RPO A;  3FFQ A;  3OD4 A;  4GYC B;  1MNG A;  1YSC A;  4DR3 B;  1G6U A;  4FLT A;  3I55 V;  3K08 A;  2B1I A;  3E22 A;  2Q7G A;  2V1D A;  2P4V A;  3HKE B;  2YIB D;  5LXT A;  3ZX6 A;  4I9Q A;  2OT5 A;  3OMA B;  4B3T B;  3FAV B;  5IYZ B;  1QR9 A;  2WLJ A;  3CX5 F;  3O9O A;  1A32 A;  4LNU B;  4U3J A;  5JVD B;  2NNU A;  3CXC U;  2P4K A;  1Y67 A;  4F6R A;  1VQN V;  4WFG A;  2Q7H A;  3MD0 A;  4Q6G A;  1QQC A;  4B3M O;  4FFB A;  4J42 A;  2Q9L A;  3HKC A;  3JAS B;  1JR9 A;  5EZY A;  5J9P C;  3LDC A;  4MTO A;  4KXR A;  1QBZ A;  3JAW A;  2P5O A;  3P3N A;  3ZHS A;  5JJJ B;  2OCC B;  2B1G A;  3M8A A;  3ABK B;  3ABL B;  4CZZ A;  2EIN C;  3OTO O;  4LFB O;  3OGI B;  4CC6 A;  2ZD9 A;  3BHP A;  4WFB V;  1NH2 B;  4JI8 O;  1UJW B;  4DV0 B;  1VQ8 V;  5EC1 C;  4DV2 B;  3LSQ A;  3P3P A;  1B3Q A;  2WLK A;  1OCZ C;  1ORQ C;  1E1R G;  1TA8 A;  4AIL C;  1TUB A;  4DV7 B;  3RYH A;  5KMG B;  1IBM B;  3L72 H;  3D3Q A;  1P4R A;  2UUC O;  1HWY A;  4I55 B;  2ZIN A;  3R65 A;  1MSW D;  1ZSP A;  1R1B A;  1AJN A;  2ZR2 A;  4PDM A;  1SQB H;  1D5N A;  1CEZ A;  1QNM A;  3HPL C;  1ZTE A;  4MW8 A;  1KEC A;  3A0R A;  1DK1 A;  1AR1 B;  3H9V A;  1S5J A;  3OEH G;  2QM8 A;  1EN5 A;  3CCR V;  4K3A A;  3BA9 A;  4YJ2 B;  4F6E A;  1TAE A;  3D3I A;  3CJH B;  1COW G;  3J80 N;  3IJ4 A;  3MHS C;  4JI4 B;  4RUE A;  1SQF A;  1RSO A;  2MW2 B;  1AI7 A;  1G4Y B;  1HP8 A;  2GUZ A;  4H0L B;  2Y69 C;  3OW2 U;  4EKW A;  1NU1 H;  2UU9 B;  4DUY B;  1K8A W;  1GAX A;  2W0X A;  2IH3 C;  4QJF B;  3TET A;  4B3S B;  4X88 A;  1N33 B;  3BAB A;  4IIJ A;  1WNS A;  5IYD O;  1DF4 A;  4J7Z A;  2R9R B;  4HZ3 A;  3EFF K;  3FYI B;  4PHZ A;  2UXB O;  2R70 A;  2BTO A;  1VQP V;  2KG7 B;  3J7A U;  2MK3 A;  4H13 B;  1Y74 A;  2E76 B;  3AEI A;  4JZ2 A;  4DRX A;  1Z5V A;  1R73 A;  1S77 D;  2N05 A;  3BVO A;  3UQ8 A;  2IJJ A;  1OCZ B;  1B06 A;  2WAM A;  2IJI A;  2A06 H;  3F7Y C;  2YC0 A;  2X7R B;  5BZB A;  2WLL B;  4IT5 A;  1YJW V;  4UXN A;  1FPO A;  3CP1 A;  2W0F C;  1YVW A;  3ETG A;  2EJ7 A;  4D7S A;  4QPK A;  4CH5 A;  3JAM N;  1BSM A;  1Z2G A;  4K0K B;  1VQK V;  3K5N A;  3E8F A;  5J2T B;  5LMN B;  5BR8 O;  3QTC A;  3FD9 A;  4JI0 B;  1IBL B;  1B6Q A;  3ML0 A;  3CRC A;  2DYR C;  4G2K A;  3JCU Z;  1EFR G;  2W6I G;  4YY3 B;  1NKD A;  3GWO A;  1F4M A;  1XMQ B;  3AG7 A;  2PI5 A;  4OGQ B;  4X64 B;  5FNV A;  1N32 B;  1S72 V;  3N27 A;  3ZMU A;  1FXV A;  3PN1 A;  1W0K G;  4QE7 A;  1N36 B;  2PYL A;  1NI8 A;  4X89 A;  4GZR B;  3BFR A;  4KHP O;  3AK3 A;  2IU3 A;  3U0Z A;  5A2Q N;  4CH3 A;  1N34 O;  1FXK C;  4CS2 A;  1HR0 B;  5KLV H;  3K5O A;  4KUM A;  4O4J B;  2IJH A;  3JSL A;  3CEI A;  1BGY H;  1QVF U;  1QLN A;  2WLI A;  5GTI Z;  2EIL B;  4UFZ A;  1YEW A;  1OCO B;  2QWP B;  4X65 B;  2ZDI C;  3I5D A;  3I56 V;  5LYJ A;  2CE4 A;  2EUL A;  1V54 C;  1KKC A;  2RN9 A;  3FB6 C;  4ASU G;  1EZJ A;  1VQ6 V;  2EIJ B;  3RVY A;  4PDL A;  2B5U A;  1OCC C;  4TV8 B;  5B5E Z;  3UT5 B;  3CCM V;  3CCV V;  3D36 A;  3T4D A;  3QVN A;  1LR1 A;  4FMT A;  4R7C A;  5L3D A;  1SQX H;  2ZNI A;  3IGA C;  1VMG A;  2KB1 A;  4C7U A;  2JGD B;  4LF8 B;  4J7K A;  4PDR A;  1WPB A;  2F4V B;  4K35 A;  2N74 A;  1XBL A;  3VOU A;  2IH1 C;  5IYB O;  5ITZ A;  1Q86 W;  2UXC B;  1NJI W;  2BTQ A;  3NXS A;  2E74 B;  2XHB A;  2WWW A;  2QM7 A;  4N21 A;  1VQ9 V;  3B2E E;  3RYF B;  1OCR C;  4F4L A;  1VEW A;  3IFX A;  3AG3 B;  5B1A C;  4X1Y A;  4IHJ A;  5KX5 B;  2YID A;  1FXK B;  5GW7 A;  4JI1 B;  4LFA B;  3JD3 A;  3CCS V;  1N0J A;  4LWS B;  1V55 C;  1WA8 A;  2ADP A;  2XAS A;  4B3R B;  1HNW B;  5FPR A;  4X62 B;  4JI2 B;  4X8A A;  1QCE A;  5C8Y A;  2ZE7 A;  2ZNJ A;  2H3O A;  3FAV A;  1V54 B;  4DV1 O;  3RWR D;  5LOV B;  4BIZ A;  2RDC A;  4JYA O;  1OV9 A;  3ZRW B;  3LUT B;  4LF5 O;  3ABM C;  5KAI Z;  3VQY A;  5EBM C;  2ZXW B;  4ZBM A;  5EC2 C;  1I0H A;  2JGU A;  3JAS A;  3JYC A;  3M7M X;  2Q0A A;  3K3W A;  4JTA B;  1WAZ A;  1RM1 B;  4LFC O;  3OAA G;  3HKB A;  1NBM G;  4LF9 O;  3DXR B;  2B9Z A;  5IJ9 B;  2UXD O;  4YJ3 B;  2FKX A;  4B7E A;  2AHZ A;  3J81 N;  5CN0 A;  4X66 O;  1XEQ A;  4WBN B;  3TGU H;  1JMK C;  3OMI B;  5CA0 B;  1XNR O;  1X4T A;  5KMG A;  1YIT V;  4YXW G;  2Q7E A;  1VF6 C;  4PA3 A;  5LBQ A;  4I55 A;  3G6B A;  3IAY A;  1QLE C;  2NN4 A;  2RMK B;  2CK3 G;  2CTP A;  3JD2 A;  2ZM6 O;  2QR4 A;  4RUF A;  3JAR B;  1OCR B;  3K59 A;  3ZCC A;  1Q6H A;  5B1A B;  3JAT B;  2F95 B;  4IL6 Z;  4IYI A;  3OEE G;  2QA4 V;  2HHH B;  4TWK A;  3WB2 A;  1TVK B;  3ZMS A;  3OTO B;  4LFB B;  2Q69 A;  4YJ2 A;  3TXS A;  4JI8 B;  3U11 A;  4JI5 O;  3CJH A;  3N2G B;  2ITD C;  3E35 A;  1CXZ B;  2W6J G;  4OX9 O;  1JJ2 U;  4XDL A;  3ZMZ A;  2X6A A;  2Y0P A;  2JVD A;  4NTW A;  1IZ3 A;  2LFR A;  3ZRS A;  2DYS C;  3AG4 C;  3GWK C;  4NTX A;  3ETQ A;  2L35 A;  4TOI A;  1Y66 A;  3SYA A;  2CTR A;  4DUZ O;  1Q82 W;  1K4C C;  2IW5 A;  1R3I C;  2FTK A;  2Q73 A;  1M9N A;  5LGT A;  2DW4 A;  2AW9 A;  2ZIO A;  1P84 F;  2KG7 A;  4X1I B;  3K57 A;  4CH4 A;  4ZHQ B;  4O4H B;  2ZIM A;  3FYE B;  4MS2 A;  2LFS A;  1F23 A;  4MTG A;  2Q0O C;  5D5P A;  4UB6 Z;  2KSD A;  3FX7 A;  3CRR A;  1XL6 A;  4ZIB A;  3Q4H A;  1M56 C;  3IC9 A;  5LP6 B;  1MA1 A;  3ZN0 A;  4JI6 B;  2WLL A;  4D6T H;  4LF4 O;  3CME V;  1S5L Z;  5IY5 C;  3OTF A;  4QPJ A;  4GUN A;  4ZOL B;  4JAV A;  4TUY B;  1QLE B;  5LGU A;  2E5L O;  1FAF A;  3F7V C;  5J2T A;  1IUR A;  4BAY A;  4DYL A;  5IWA O;  2UXB B;  3STZ C;  4FLU A;  2F93 B;  3L71 H;  4JI3 O;  2ITC C;  5DED A;  3AG2 C;  1R6K A;  4B7K A;  3O65 A;  2FML A;  4NXN O;  5FLX N;  1XDC A;  1CPY A;  5LMU O;  4J9Z B;  2Q67 A;  2YUA A;  3ZHR A;  3K0G A;  5CBG A;  2UUB O;  1ARO P;  1FD9 A;  2DYS B;  3AG4 B;  1WB8 A;  4AQY O;  2XAQ A;  4O4J A;  1QR8 A;  1YJN V;  1VF7 A;  3CC4 V;  1GM8 A;  3W7S A;  1FXH A;  2Y4U A;  1M1K W;  4NXM B;  5BR8 B;  1EN6 A;  3WG7 C;  3SPC A;  5H5N A;  2BCC H;  2QKC A;  1L1F A;  2WLH A;  1RP3 B;  3DC5 A;  4PJ0 Z;  4EB6 A;  1PNM A;  3CXH F;  4TV9 B;  2OTJ V;  2F23 A;  2ZT9 B;  2PY5 A;  1YIJ V;  4OPH A;  4KFM A;  2Y0I A;  2QKA A;  2VQE O;  2CGO A;  3THO A;  1AI6 A;  4KHP B;  2K9P A;  2HP8 A;  5EK0 A;  1CP9 A;  4O2A B;  4TV8 A;  1Y6X A;  2CH7 B;  3UT5 A;  3CB2 A;  2DOS A;  1SZX A;  3A0H Z;  4WFH A;  2AZ2 A;  1N0N A;  1M56 B;  2OCH A;  1AJQ A;  2YEV B;  5BY1 A;  2N04 A;  2QM4 A;  4BW5 A;  1NS1 A;  4DV4 O;  1FYJ A;  1SA0 B;  3H1H H;  3N2K B;  1PNL A;  2XAJ A;  4DV5 B;  2JGD A;  1IXM A;  1ZLZ A;  2RCV A;  3ZS8 C;  1M93 A;  2ARH A;  3P30 A;  2UUA O;  1Q6I A;  3DSQ A;  1MMM A;  1MAB G;  3LSS A;  5LHG A;  3ZHT A;  1Y76 B;  2GTS A;  3ASO B;  3X2Q B;  2GSM B;  3RGB A;  5B1B B;  1XNQ O;  1ZWI C;  2ODM A;  1WP7 A;  4I7Z B;  5B1O A;  2WLN A;  3RYF A;  3WB1 A;  1ZL8 B;  3ASN B;  1PV0 A;  1H2G A;  1Q7Y W;  3CC2 V;  3CCQ V;  2EIK C;  2ZQM A;  3ZIA G;  5KX5 A;  5GON B;  2ZE6 A;  1IBK O;  3LDD A;  4DR6 O;  5GTH Z;  4BIO A;  2EJR A;  2JS5 A;  1EN4 A;  3CE2 A;  1R3J C;  3WG7 B;  4LWS A;  4JAU A;  1SS3 A;  1Q43 A;  2ATK C;  5E79 Z;  4J11 A;  5JCO A;  1IVS A;  4FLX A;  2DMX A;  1KD1 W;  3B4S A;  4NYK A;  4J80 A;  4BIU A;  2K1E A;  3ZRW A;  4K8Z A;  1LNQ A;  3L75 H;  3W7T A;  4LH7 A;  2PGG A;  3RW0 A;  3MAQ A;  3CRM A;  4U7N A;  1VQ7 V;  2Q6A A;  2FYU H;  1VAR A;  3K5M A;  4X9Q A;  3MHH C;  4HYO A;  2EIN B;  2FB5 A;  3HKD B;  3PJS K;  1DTO A;  3DXR A;  5IJ9 A;  2PYJ A;  3QO8 A;  4RO2 A;  4WBN A;  4DR5 O;  1H2N A;  2RQ6 A;  4W4L A;  1WP8 A;  5CA0 A;  3BRC A;  4JGS A;  4O4I B;  2HG5 C;  4YHH O;  1U96 A;  3WFV A;  3OUF A;  4JYA B;  2OIG A;  3CHX A;  3B8N A;  4LF5 B;  1J5E O;  4D7T A;  3T1H O;  1NT2 B;  2A79 B;  1BHB A;  3TXQ A;  5BMV B;  3JAR A;  3T4Z A;  3AG1 C;  3WU2 Z;  4QNH B;  1MZF A;  3JAT A;  2EIK B;  3KKY A;  4DR3 O;  5CA1 B;  1EZV H;  2OYQ A;  1YHQ V;  4LFC B;  3SPG A;  1B04 A;  1SQP H;  1TVK A;  5CBF A;  2A9H A;  4LF9 B;  2AGA A;  2UXD B;  1U97 A;  2H94 A;  2YI8 A;  4X66 B;  3N2G A;  1PPJ H;  4I0X B;  1P49 A;  4FM0 A;  1K5Q A;  2Y69 B;  1R6T A;  2X0L A;  5FPO A;  1XNR B;  4WFE A;  1TGO A;  3QO7 A;  1GTO A;  3JSN A;  3VQX A;  1I08 A;  1AP6 A;  5IE9 A;  4OXS A;  1TUE B;  2HLD G;  2ZM6 B;  3UM7 A;  3A0B Z;  1NTK H;  4DXW A;  3QG5 A;  3LDE A;  1YI2 V;  1GN4 A;  1H2S B;  4NB5 A;  4JV5 O;  4UCU A;  3JD1 A;  4O2B B;  4KP4 A;  1HNX O;  4E2L A;  4MVM A;  3FB7 C;  1BCC H;  4R6Z A;  4NTY A;  4X1I A;  2DQ3 A;  2UXX A;  5JH7 B;  4FK5 C;  4O4H A;  4JI5 B;  2EIM C;  4DV2 O;  3K0D A;  3FB5 C;  5K1P A;  3M99 B;  2VS0 A;  3CYO A;  3OMN B;  4YIP A;  2V7Q G;  1JVM A;  4GKJ O;  4P9P A;  2QTS A;  1AVM A;  2VWJ A;  1SRY A;  2LO1 A;  1IBM O;  2GV9 A;  2YXY A;  5LP6 A;  2O57 A;  2Q4P A;  5KUK A;  3CCU V;  1O9H A;  2HVJ C;  1K7D A;  4DUZ B;  1K97 A;  1SKV A;  4UVB A;  4ZOL A;  1XMO O;  3T1Y B;  4TUY A;  2Z3Y A;  5IDJ A;  1I94 B;  3GB7 C;  1AP5 A;  2DYR B;  2LQT A;  3UO3 A;  5KHJ A;  4L8J A;  4PV1 B;  3AG1 B;  1DGS A;  1G1X B;  2HEP A;  4PA7 A;  1Z5W A;  5KHH A;  3E8G A;  1BHA A;  4YIO A;  3APQ A;  5B1N A;  2ZR3 A;  3BPZ A;  1PL0 A;  1TUB B;  4I50 B;  3RYH B;  1YJ9 V;  2UU9 O;  4NR1 A;  1KYO F;  1US6 A;  4LF7 O;  1AR4 A;  2DE0 X;  3RFR A;  4DV6 O;  5EBL C;  1GM7 A;  5J2U B;  1XQ8 A;  3STL C;  3G80 A;  4MTX A;  3H1L H;  4DV3 O;  2RNB A;  3JAK B;  4FPP A;  3HKE A;  4GKK O;  4UCO A;  3ZJZ A;  3W7W A;  2YSU B;  3K58 A;  4W4K A;  4ABM A;  4JI3 B;  4LF6 O;  1WN7 A;  1WB7 A;  4CBC A;  1OHH G;  4TQF A;  1GKF A;  5B66 Z;  5IYZ A;  1JOY A;  4EEQ A;  2CTW A;  1JFF B;  1RSO B;  2JRI A;  3APO A;  4TV9 A;  2JS3 A;  4NXN B;  5IYC O;  4WFA V;  4LNU A;  3T1C A;  3BCC H;  5JVD A;  4G27 B;  3K5L A;  3ZMT A;  5LMU B;  4CS4 A;  1NZ6 A;  1OCC B;  2WLM A;  4BWA A;  4RQE A;  4LH6 A;  3ZHQ A;  4O2A A;  2CH7 A;  1KKD A;  1YDX A;  2BSK B;  5AG2 A;  3FB8 C;  4AI8 A;  1ZX3 A;  1BQ0 A;  3QO5 A;  2NR5 A;  4ZKI A;  1SA0 A;  3DTU B;  1GM9 A;  4FM1 A;  4TQD A;  1N4C A;  2Z0A A;  3SPH A;  4LCU C;  4A5U B;  1IBL O;  4MTF A;  1LUV A;  4YY3 O;  1NTZ H;  1NR1 A;  3ZN1 A;  1BL8 A;  3F5W C;  4O4L B;  3NR7 A;  3D8C A;  1Y76 A;  1VP7 A;  3TJT A;  2QWO B;  5EYP B;  1SZT A;  4HBN A;  4XDK A;  1JA8 A;  2VQE B;  3D36 C;  1F7Y A;  2QJ1 A;  5C93 A;  4B3M B;  4MVZ A;  3K79 A;  3ZHU A;  1ZL8 A;  1P7B A;  1HR0 O;  5L3E A;  4X1K B;  3OGC C;  3RYI B;  5GON A;  5H6Q A;  4DR7 O;  3W7X A;  4DV4 B;  2GHY A;  3BA8 A;  2YS8 A;  1AJP A;  2IJK A;  4DR2 O;  3E8H A;  2PUS A;  4I4T B;  1V55 B;  4Z1V A;  1NH2 D;  3ABT A;  5JJN B;  2X6B A;  3CC7 V;  2UUC B;  4MVU A;  1MZE A;  1IX9 A;  4R50 A;  1K92 A;  2Q5Z A;  3P32 A;  4CS3 A;  3RT3 C;  2XAG A;  3DGE A;  2R9A A;  4J41 A;  4PA4 A;  3ABM B; 
#chains in the Genus database with same CATH homology
 2WSS G;  3ETG A;  2QE7 G;  4G28 B;  4LC1 A;  1AI5 A;  4WFH A;  2JK5 C;  4QPK A;  1M56 B;  2YEV B;  1AJQ A;  4GX1 A;  1VQK V;  4BW5 A;  1PKX A;  3E8F A;  1PNL A;  2XAJ A;  1DF5 A;  3K03 A;  1B6Q A;  3ML0 A;  2DYR C;  4G2K A;  1EFR G;  1MG1 A;  1K73 W;  1IXM A;  2W6I G;  3IC7 A;  1NKD A;  2Z5U A;  3GWO A;  1YTF D;  3P30 A;  5KUM A;  1F4M A;  1JQ0 A;  3BY6 A;  1J95 A;  1FS0 G;  2P7T C;  5L3C A;  1NQT A;  1MAB G;  3LSS A;  5L3B A;  5LHG A;  2PI5 A;  5H9C A;  5L3G A;  2R9I A;  3RVZ A;  2EBO A;  4UV9 A;  3RBZ A;  3SYO A;  2EIM B;  1ROP A;  1S72 V;  3ASO B;  3ZMU A;  3CCL V;  3B77 A;  3X2Q B;  1FXV A;  1W0K G;  2GSM B;  4QE7 A;  3G4S V;  5B1B B;  4X89 A;  1ZWI C;  2IU3 A;  2JIZ G;  4I5S A;  4MW3 A;  1DLB A;  4HAM A;  3QNE A;  2M7W A;  1S0V A;  5B1O A;  1FXK C;  5FL7 G;  3SPJ A;  2WLN A;  2YEV A;  4KUM A;  3SYC A;  2JDI G;  3ASN B;  4H37 A;  1H2G A;  4JYB A;  2IJH A;  1Q7Y W;  3CC2 V;  3CCQ V;  2EIK C;  2ZQM A;  3ZIA G;  5KA5 A;  3CCJ V;  1QVF U;  3LDD A;  3SPI A;  1QLN A;  3OFN G;  5DN6 G;  3OUS A;  2WLI A;  4N23 A;  2EIL B;  1JX9 A;  2P6J A;  2EZO A;  2OCC C;  4PA9 A;  1OCO B;  3ABK C;  1NVP B;  3OM3 B;  4U7O A;  5B3S C;  2EJR A;  1WPX A;  3ZRV A;  3VBB A;  3K9A A;  2ZDI C;  1R3J C;  3I56 V;  2HJF C;  3WG7 B;  1VQM V;  4QE9 A;  1K34 A;  4JAU A;  1PNK A;  1V54 C;  3FB6 C;  2HKO A;  4ASU G;  1EZJ A;  1VQ6 V;  1I5X A;  2ATK C;  3FKS G;  1K3E A;  4MVR A;  2EIJ B;  3ZMV A;  1H8E G;  3RVY A;  1E1Q G;  4PDL A;  4FJC C;  2B5U A;  1PD3 A;  1KD1 W;  1OCC C;  4H33 A;  4BIU A;  2K1E A;  3ZRW A;  3CCM V;  1G8M A;  3D36 A;  3CCV V;  2XAH A;  3SYP A;  1LNQ A;  2HFE C;  3W7T A;  3T4D A;  3RW0 A;  4FMT A;  4R7C A;  5L3D A;  1VQ5 V;  4JF3 A;  4U7N A;  4PDV A;  3IGA C;  2KB1 A;  1VQ7 V;  2Q6A A;  2DWE C;  3H01 A;  4UVA A;  3MHH C;  4GX5 A;  3CCE V;  4HYO A;  4PDR A;  2EIN B;  1EBO A;  1Q81 W;  1H38 A;  1VQ4 V;  3PJS K;  3VOU A;  1DTO A;  4Q20 A;  2IH1 C;  3QO8 A;  3JCZ A;  5IYB O;  1MOF A;  5L3F A;  1Q86 W;  4RO2 A;  1Y4M A;  1NJI W;  1S76 D;  2C2A A;  2OTL V;  3NXS A;  1M57 C;  2BOB C;  2H8P C;  3E2E A;  2HVK C;  2WWW A;  4JGS A;  2HG5 C;  2Y48 A;  3K06 A;  4JTC B;  1RPR A;  2QM7 A;  4N21 A;  3WFV A;  3OUF A;  1VQ9 V;  5CA3 A;  4PEL A;  1OCR C;  5EBW C;  3B8N A;  4F4L A;  2QKS A;  3IFX A;  3AG3 B;  4GX0 A;  5B1A C;  3G71 V;  1KP2 A;  1QVG U;  4UVC A;  2JJ2 G;  2A79 B;  3OR7 C;  2WPD G;  1BHB A;  4RQF A;  4WFF A;  1H8H G;  5IY5 B;  1FXK B;  2WLI B;  5GW7 A;  2UXN A;  4MT8 A;  4JPR A;  3T4Z A;  3AG1 C;  4QNH B;  3EHB B;  2EIK B;  5LHI A;  3KG2 A;  3B8M A;  3OE7 G;  3JD3 A;  1KQS U;  4TSF G;  3CCS V;  1YHQ V;  1KP3 A;  1WLE A;  1F4N A;  3SPG A;  1V55 C;  5CBF A;  2XAS A;  3CD6 V;  2A9H A;  4P9O A;  2Q68 A;  1S3J A;  5B3S B;  4P30 A;  2H94 A;  3AG2 B;  4X8A A;  1QCE A;  2NLJ C;  1K5Q A;  2Y69 B;  1F51 A;  4MVO A;  4GX2 A;  2X0L A;  1V54 B;  4TT3 G;  4WFE A;  4BIZ A;  4XDJ A;  2F43 G;  2A0L A;  3ZRW B;  3LUT B;  5LGN A;  3ABM C;  5HFL A;  1K4D C;  3QO7 A;  1GTO A;  1GK9 A;  1K9M W;  3TK1 A;  4MVS A;  4Z1M G;  5EBM C;  4OXS A;  1FXK A;  2ZXW B;  4ZBM A;  5KA6 A;  4WCE V;  4LP8 A;  5EC2 C;  1TUE B;  2HLD G;  2AHY A;  3UM7 A;  3ABL C;  3JYC A;  5H6R A;  4DXW A;  3K3W A;  4JTA B;  3LDE A;  1YI2 V;  1RM1 B;  3JD1 A;  4QIW F;  4KP4 A;  1OZ0 A;  4JAS A;  3OAA G;  4E2L A;  4MVM A;  3FB7 C;  3K04 A;  1NBM G;  4R6Z A;  5CMU A;  1XL4 A;  1FFT B;  1YTF B;  1ENV A;  2DQ3 A;  2IU0 A;  2UXX A;  3ETE A;  4FK5 C;  2ZDI A;  2AHZ A;  5CN0 A;  2EIM C;  3SJQ C;  3K0D A;  3FB5 C;  3ASO C;  3M99 B;  3SYQ A;  2P67 A;  3X2Q C;  3OMI B;  4LBE C;  3CYO A;  3OMN B;  2XAF A;  1SES A;  2V7Q G;  5B1B C;  1JVM A;  4P9P A;  1YIT V;  1K33 A;  4YXW G;  1SRY A;  4PA3 A;  4L87 A;  5LBQ A;  1S5H C;  1M57 B;  4GCZ A;  2DWD C;  3E83 A;  3ASN C;  1QLE C;  2W0F C;  4DO2 A;  3LNM B;  5KUK A;  3CCU V;  2HVJ C;  2JEU A;  4WF9 V;  5HFM A;  2CK3 G;  3ZRX A;  3JD2 A;  3OR6 C;  1K7D A;  4RUF A;  1RPO A;  1OCR B;  1K97 A;  3ZCC A;  4UVB A;  1YSC A;  5B1A B;  3I55 V;  2EIL C;  3K08 A;  2Z3Y A;  5IDJ A;  2B1I A;  3OEE G;  1OCO C;  4R8C A;  2QA4 V;  3GB7 C;  2DYR B;  4TWK A;  3CMA V;  4RAI A;  2V1D A;  3ZMS A;  3AG1 B;  4PA6 A;  1VQL V;  2Q69 A;  4J9Y B;  4PA7 A;  4JTD B;  2P90 A;  1JCH A;  2OT5 A;  3ABU A;  2ITD C;  3E35 A;  1THZ A;  3E8G A;  3OMA B;  2EIJ C;  2W6J G;  4P2Z A;  1BHA A;  1JJ2 U;  1QR9 A;  4XDL A;  2HR3 A;  3ZMZ A;  2WLJ A;  2D3O W;  5B1N A;  1SER A;  1GO3 F;  2X6A A;  2ZR3 A;  1PL0 A;  2DQ0 A;  2LFR A;  3ZRS A;  2DYS C;  3AG4 C;  1YJ9 V;  2NNU A;  3CXC U;  1Y66 A;  3SYA A;  1VQN V;  4WFG A;  3MD0 A;  4MVQ A;  1Q82 W;  1K4C C;  2IW5 A;  5EBL C;  5J9P C;  1GM7 A;  3LDC A;  4MTO A;  5LHH A;  1R3I C;  1QBZ A;  3STL C;  2FTK A;  1NVP D;  4MTX A;  1W0J G;  4FPP A;  1M9N A;  5LGT A;  2OCC B;  1R3L C;  2B1G A;  3ABK B;  3ABL B;  4CZZ A;  3ZJZ A;  2DW4 A;  2EIN C;  3W7W A;  2YSU B;  3E86 A;  2ZD9 A;  1NH2 B;  4WFB V;  1UJW B;  1R6N A;  1VQ8 V;  3FYE B;  5EC1 C;  4MS2 A;  3LSQ A;  2LFS A;  4CBC A;  1OHH G;  1BMF G;  1F23 A;  2WLK A;  4MTG A;  1KC8 W;  1GKF A;  1OCZ C;  1ORQ C;  1JOY A;  4GT1 A;  1E1R G;  3JD0 A;  5IYC O;  4WFA V;  1XL6 A;  3T1C A;  1P4R A;  4G27 B;  1HWY A;  3ZMT A;  1NR7 A;  1M56 C;  1OCC B;  2WLM A;  4RQE A;  3ZN0 A;  3T2M A;  3R65 A;  1MSW D;  1AJN A;  2WLL A;  3AG3 C;  2ZR2 A;  1VQO V;  4PDM A;  1KKD A;  4FIP C;  1CEZ A;  1W2B U;  3CME V;  3HPL C;  5IY5 C;  3FB8 C;  3BEH A;  4MW8 A;  4QPJ A;  1KEC A;  3A0R A;  4JAV A;  1AR1 B;  1QLE B;  5LGU A;  3QO5 A;  4ZKI A;  3F7V C;  3OEH G;  3CP1 A;  4BAY A;  1JPX A;  3DTU B;  1GM9 A;  2EZP A;  4I9W A;  3STZ C;  2QM8 A;  3SPH A;  4LCU C;  3CPW U;  3CCR V;  2XOK G;  4MTF A;  3D3I A;  1NR1 A;  2ITC C;  1COW G;  3ZN1 A;  4UUJ C;  1BL8 A;  3MHS C;  4RUE A;  3F5W C;  2JEX A;  3AG2 C;  1R6K A;  1AI7 A;  1G4Y B;  2JJ1 G;  4MSW C;  2Y69 C;  3OW2 U;  4EKW A;  1SET A;  1SZT A;  1CPY A;  1K8A W;  4UV8 A;  3UKM A;  4XDK A;  2IH3 C;  4J9Z B;  4QJF B;  2Q67 A;  2XND G;  2QEX V;  3K0G A;  5C93 A;  5CBG A;  2PI4 A;  4MVZ A;  3TET A;  3K79 A;  1ARO P;  3JD4 A;  2ZXW C;  2DYS B;  3AG4 B;  4X88 A;  1P7B A;  2XAQ A;  5IYD O;  1QR8 A;  5L3E A;  1DF4 A;  2LP7 A;  1GM8 A;  3E8B A;  2R9R B;  1YJN V;  1M90 W;  3CC4 V;  3OGC C;  3W7S A;  4HZ3 A;  5H6Q A;  3EFF K;  1FXH A;  3W7X A;  1M1K W;  3FYI B;  2GHY A;  1AI4 A;  1RM1 C;  1AJP A;  3WG7 C;  2IJK A;  3G6E V;  1VQP V;  3SPC A;  2MK3 A;  1L1F A;  3E8H A;  3W7U A;  2WLH A;  3HB3 B;  3AEI A;  1E79 G;  1I5Y A;  1V55 B;  1NH2 D;  3ABT A;  3TCU A;  5CBH A;  1R3K C;  1K5S A;  1R73 A;  1N8R W;  2X6B A;  1PNM A;  1S77 D;  3CC7 V;  2X6C A;  5DM6 V;  4XBF A;  3E89 A;  2OTJ V;  1GMG A;  1YIJ V;  3ETD A;  4MVU A;  4R50 A;  1K92 A;  2QTO A;  3P32 A;  4KFM A;  5E1A C;  2IJJ A;  1OCZ B;  2WAM A;  2IJI A;  2XAG A;  3DGE A;  3F7Y C;  2BOC C;  2X7R B;  1AI6 A;  5BZB A;  2WLL B;  5EK0 A;  1CP9 A;  4JYC A;  1YJW V;  4PA4 A;  4UXN A;  3ABM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...