2JK5C

Potassium channel kcsa in complex with tetrabutylammonium in high k
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2jk5C00
2WLIB 1ORQC 3IGAC 2ATKC 3K0DA 4MSWC 4R50A 4X8AA 5E1AC 2ZXWC 4WFEA 3SYOA 3AG2C 3ABLC 1R3KC 4R8CA 1XL4A 5CBFA 1M56C 5KUKA 2WLLB 3F7YC 3R65A 4MVQA 3E89A 4MVZA 3LDDA 4MVMA 4PA4A 4XDJA 2HVJC 1XL6A 4PDVA 3SJQC 4QE7A 1ZWIC 1R3IC 2W0FC 3SPGA 3F7VC 4MW8A 4BW5A 2WLJA 4XDKA 2EINC 4PDRA 4MTGA 3T2MA 2BOBC 2A0LA 3SPHA 5IY5C 3ABKC 4PA3A 3T4ZA 1KKDA 2KB1A 3E8HA 3OGCC 4GX2A 4J9YB 5EBMC 1V55C 2Q69A 3LDEA 2IH1C 1OCRC 5EBWC 4RUFA 2Q6AA 2NLJC 3RBZA 2R9RB 4JTDB 2HVKC 5CBGA 1OCOC 4WFFA 5B1BC 4MVSA 2JK5C 4PDMA 1BL8A 2WLHA 4LBEC 2WLMA 1R3LC 4MVOA 4WFHA 2Y69C 2A9HA 3EFFK 4J9ZB 5B3SC 2DYSC 4CBCA 3RW0A 3SPCA 3LNMB 4X88A 3T4DA 4RAIA 3OR6C 4MTOA 2YEVA 2K1EA 4P30A 3SYPA 3ASOC 2HJFC 1OCZC 4H37A 4PA6A 4XDLA 3SYQA 5CBHA 3K03A 1LNQA 2X6BA 3E8GA 4GX5A 3K06A 4P9PA 3X2QC 4LCUC 3OR7C 4P2ZA 3F5WC 4I9WA 2Q68A 3K04A 3IFXA 4TWKA 2WLNA 2AHYA 4X89A 3FB7C 3BEHA 4MW3A 3WG7C 4R7CA 1P7BA 4JTCB 4GX0A 3E8BA 3FB6C 2EILC 2P7TC 2WLKA 4EKWA 4PDLA 5KUMA 5J9PC 2ITDC 4OXSA 2A79B 4KFMA 3RVYA 4MVUA 3E8FA 4JTAB 3VOUA 2DYRC 2EIMC 3OUSA 2IH3C 1V54C 2HG5C 3HPLC 3RVZA 4P9OA 3ZJZA 4DXWA 3ASNC 2HFEC 1J95A 1K4CC 3KG2A 2X6AA 4G28B 2EIJC 4G27B 4PA7A 4UUJC 3E86A 3TCUA 3JYCA 4HZ3A 3SYAA 2EIKC 4H33A 5EC1C 5EBLC 4ZBMA 2H8PC 3SYCA 4MVRA 3FB5C 4QNHB 3UM7A 3SPJA 3ABMC 4RUEA 1M57C 4R6ZA 5BZBA 3T1CA 2QTOA 3E83A 3SPIA 3AG4C 1QLEC 2Q67A 5EC2C 2ITCC 5B1AC 4RO2A 4F4LA 4PA9A 1S5HC 3AG1C 3UKMA 3LUTB 3FB8C 3STZC 5EK0A 4GX1A 1G4YB 1OCCC 2WLIA 4MS2A 3K0GA 3ZRSA 2AHZA 2OCCC 4MTFA 3LDCA 3GB7C 4LP8A 1JVMA 2X6CA 4WFGA 2WLLA 4HYOA 1K4DC 2DWEC 3TETA 3STLC 3K08A 1R3JC 2QKSA 3OUFA 2BOCC 3AG3C 2ZD9A 3PJSK 2DWDC 4QE9A
chains in the Genus database with same CATH superfamily
2PYLA 4QPKA 5JWPA 5CA0A 4WFEA 3SYOA 1EZVH 1R3KC 2WPDG 4DV4O 2EBOA 3JAWB 5JJJB 3ZRVA 4X66B 3QTCA 2LFRA 5IJ0A 4DR1O 2AZ2A 3JALB 4XDKA 2CK3G 2Q0OC 4I7ZB 1BMFG 4MT8A 2NNUA 4X1YB 3ZMSA 2WLMA 3N2GB 3BA8A 1GAXA 3LNMB 3OR6C 4YXWG 2GDSA 3L70H 1T5EA 4Q20A 4CS4A 4GUNA 1N8RW 4AQYB 4JI2O 2X7RB 4B3TO 1EZJA 3T1YB 4FLTA 2F93B 1US6A 2LP7A 3L75H 4DV5O 5LMNO 3UCSC 1SETA 2JJ2G 3SJCC 1YI2V 4I4TA 4PDLA 2CDYA 4PV1B 4NXMO 3UT5B 1WJZA 1OCZB 3OUSA 3HPLC 3ASNC 4Z1MG 2EIJC 4DK0A 1Y4MA 4OX9O 4H33A 4ZBMA 5CMUA 2BCCH 1NZ6A 3TGUH 3UT5A 1H2KA 3BFRA 3SPIA 2XNDG 1N34O 3WG7B 4FLYA 3S3XA 3CCEV 2VQEO 1XI1A 5DEDA 4PI2A 4UCOA 1U97A 1PNKA 4D6TH 1YCIA 4HYOA 1V54B 3X2QB 2QKSA 4JI5O 4DV1B 1UFIA 5K1XA 3K0DA 2QKAA 2JDIG 1VQPV 3RYCA 3ZRWB 1YDXA 2Q7EA 2XAQA 2OCHA 1XL6A 3AG4B 1KU9A 1P49A 1AR5A 1ZWIC 3AG1B 2EINC 3APOA 4X1IB 1OHHG 4K8XA 4PA3A 3OGIB 5BR8B 3RYFA 5EBWC 3ZRWA 1CXZB 1FS0G 4JGSA 5CBGA 1BL8A 1IXMA 1AJNA 2Y69C 2Z0AA 3FAVA 2BTQA 4X1IA 3T4DA 5LOVA 4FZ1A 2KSDA 1KQSU 1QHTA 2QJ1A 4PA6A 5CBHA 1TUBA 4I55B 4J41A 3OD4A 2XAFA 4GX5A 3K06A 1KD1W 4LFBB 3F5WC 3I55V 1DGSA 4F6EA 4LNUA 3AG7A 2Q68A 5JVDB 4PELA 3P30A 2AHYA 5L3DA 3BHPA 5KLVH 5B1BB 3HKEA 4X62B 3OM3B 3E8BA 1NR1A 5KUMA 3ZBHA 4FVMA 1VQLV 3DTUB 4IYHA 4CH3A 2DOSA 2XASA 4UVAA 4JI1B 4J42A 4PA7A 3SYAA 3EXAA 1Q7YW 1K97A 3EHBB 5BZBA 1CPYA 4DUYB 3ZHQA 1F23A 4KHPO 1Y66A 5LGTA 4FK5C 3H1JH 1Y76A 4GX1A 4JASA 4B3MO 1SF9A 1KUQA 1RFYA 2UUCB 3W7TA 1AI7A 5H6QA 1ZLZA 2EJ7A 4UCRA 2EZPA 2UUBO 4DV5B 4ZIBA 2JVDA 4AILC 2G38A 3BPZA 2LJ2A 5GONB 2PTMA 4NYKA 4QE7A 3P32A 4K0KO 2Q6AA 1BQ0A 1R73A 2HVKC 3ABTA 2DYSC 5EYPA 4B7KA 1HNWO 1MSDA 2RJZA 2K1EA 5LMUO 2MK3A 1LNQA 2WWWA 4P2ZA 3H01A 3VQYA 2UXDO 2UXCO 3DC5A 2ZR3A 1TAEA 1M93A 4X89A 4LF6B 4K8ZA 2P90A 1JPXA 4IT5A 4FLZA 4KFMA 3VOUA 4OPHA 3CRMA 3OAAG 3W7XA 4DV7B 2LGQA 3K5OA 2UXBB 3VQVA 1NR7A 1GRJA 1NTMH 2ZT9B 3IAYA 1X4TA 4J80A 5DECA 2DE0X 4ZI7B 4LH6A 1NVPD 3CCJV 1SERA 3CEIA 2XHBA 2ZDIC 3JSLA 2EILB 1G4YB 3ZRSA 2OCCC 1SS3A 2PGGA 2VQFB 1VIBA 3OEEG 2OTLV 4JAUA 2EIMB 3CCVV 1MG1A 3OT7A 4IHJA 3CMEV 3ZIAG 2ZD9A 1VF5B 5KHJA 3CMAV 1IX9A 2PI4A 3GVMA 5BXZA 1H2MA 2XUMA 3OTOB 4O4IA 1VARA 3LDDA 3K5MA 3FYIB 3DGEA 3RYHA 3HR0A 1H2LA 4DV6O 4MW8A 3UO2A 1GH6A 1GM7A 5IJ9B 1FXKC 4BIOA 1HW7A 1V55C 1VQ7V 1YEWA 2IJKA 1R6NA 2QEXV 1ROPA 5GTIZ 1A32A 5LP6C 1SESA 3EFFK 1E1QG 2YI9A 3SPCA 2EX3A 4YY3O 4O4HB 3ASOC 4BIUA 3K03A 3IC9A 1YJNV 1I94O 1QBZA 1NJIW 3CJHB 1UPGA 1XHXA 4X20B 2CTPA 1K92A 1IBMB 1OCRB 2WLNA 1Q82W 2Q0AA 1WN7A 3L71H 5JH7A 3A0BZ 3D3IA 2PY5A 1O9HA 4UV9A 4FIPC 2LQTA 4JI4B 1JJOA 3TXSA 3J81N 1J95A 1K4CC 2JEUA 3TCUA 3ZRXA 2ADQB 4UCVA 4DR4B 3B8NA 4X66O 4O4LB 3G6BA 1BZKA 5D5PA 2L6LA 2Y48A 5LXTB 4TT3G 4PA9A 5IDJA 4ZKIA 5J2TB 2Q9LA 1OCCC 4I50A 5FNVB 5J2UA 4MTFA 4O4LA 3TETA 1XREA 3STLC 3K08A 4QE9A 2F43G 2Y0PA 3AG3C 1SA0B 4N23A 3SJAC 4FFKA 4MSWC 4NTWA 4TV8A 3ABMB 3JARA 3K59A 2FL4A 4PA4A 4B3RB 4YHHB 5IE9A 4WBNA 2YXLA 4AQYO 3K9SA 5IYDO 4BW5A 3AK1A 2W0FC 1SA0A 3TXQA 3G80A 2NR5A 1YSCA 1HP8A 1KKDA 3CCMV 3T1YO 4K3AA 4FLUA 4DO2A 1M9NA 4PJ0Z 4GKKB 4RUFA 4RQEA 2YC0A 1HNXB 2YXYA 4Z1VA 4J9ZB 4KP4A 4CBCA 4NB5A 3WB0A 1EN6A 1M56B 4JF3A 4UB6Z 3N2KB 4P30A 1XILA 3B09A 1BCCH 2X6BA 4LF8B 3OE7G 3I5DA 1N0JA 3X2QC 3OR7C 1WB8A 3QO5A 2IJJA 2IU0A 4O2BB 3G6EV 5FPOA 1H8EG 5B1OA 5CA1A 4L87A 1FFTB 2OWOA 1RSOB 3RFRA 1BS3A 2HR3A 4JI8B 2DQ3A 5J9PC 1VQ5V 2GSMB 1B3QA 3CC7V 3GWOA 2ZKOA 3CCLV 3ZJZA 4CZZA 4IL6Z 5K1PA 3VBBA 4DV1O 1QQCA 1AROP 3RT3C 1XNRB 3FB5C 2Z5UA 4QNHB 1NQTA 4AI8A 3SPJA 4CC5A 1PL4A 1QLEC 3H1IH 5EC2C 3KCXA 3QO7A 1VQNV 1EM1A 1K73W 2F23A 2MW2B 3FB8C 5EK0A 4IGGA 3J80N 2R70A 3SGIA 2OTJV 5BR8O 1M1KW 4DV3O 2UUAB 1K3EA 3H1LH 3OMAB 1EBOA 1I94B 4WFBV 2W6IG 1M4UA 1QCEA 4I0XA 2YICA 4U3JB 3E35A 1VP7A 5CN0A 2RQ6A 5CBFA 5KUKA 4DR7B 2ZDIA 1LUVA 4JI6B 3KZIZ 2HVJC 2LW7A 4PDVA 1FD9A 1PNLA 3JATB 3L73H 1MZFA 4IIJA 3RGBA 1THZA 4PDRA 3M99B 4LFBO 2YIBA 5IJ0B 1NU1H 3H9VA 2Q73A 1D5NA 4CS3A 2WLHA 5BY1A 1KP3A 5JQGA 4X62O 1BQZA 3RW0A 4X88A 2IM9A 2C2AA 2JS5A 3B2EE 4EB6A 1G8MA 1FXKA 3IJ4A 3ZHSA 4JI1O 1WP7A 4LH7A 5LP6A 3S3WA 3K04A 4B7EA 5IY5B 4DUYO 1TVKA 3A0RA 5LGUA 1ZAUA 3CCSV 3HKBA 4DUZB 4EKWA 3M7MX 3ETEA 3CYOA 4NVPA 2A7WA 2UUCO 2DYRC 2YIAA 3RVZA 2QA4V 3O9OA 4DXWA 2OT5A 1W2BU 4I4TB 1D5AA 2DN9A 5EC1C 2QGNA 1K9MW 1XHZA 2KG7A 2P4VA 3B77A 4JI3B 3CPWU 3UQ8A 2E75B 2PZSA 3DC6A 2GHYA 1K33A 2AXTZ 4JZGA 2RCVA 4RO2A 1JCHA 3GB7C 1XMOB 2XAGA 4DV0B 3SJQC 3G4SV 1FXVA 1ORQC 4R50A 1ZTEA 4BWAA 4EFEA 2O57A 2QWQB 3RN4A 2XTAA 4U7OA 3K58A 3RYCB 2IW5A 3T1HB 3SJBC 2ARHA 3HKDA 1Q81W 4UFZA 5EIBC 4AHCA 4LF6O 5LL6Y 1IURA 3FFQA 3RYFB 3A2FA 1COWG 1URFA 2YEVA 1NTZH 4YJ2A 2F1MA 1KBHA 3FAVB 1Q5OA 1KC8W 2JIZG 2BTQB 1WNSA 3D8CA 4DV7O 2H94A 3A0HZ 5LOVB 3ZCCA 2UXBO 1RP3B 4DV3B 1K7DA 3CRAA 4LC1A 1TUBB 2UXXA 1N36B 5JJEB 1OCOB 5KMGA 3CSXA 3TJTA 5H6RA 4LNUB 2P7TC 1BE3H 1CP9A 2VQFO 3HKEB 1XDCA 3D36C 4HZ3A 2BSKA 1JR9A 2H8PC 3KKYA 4MVRA 1TGOA 2W0XA 1IXBA 2CE4A 3OTOO 2QWRB 3JD2A 1I08A 3MHSC 3GWKC 2GTAA 1JX9A 1WB7A 2Q67A 2M6YA 1B6QA 3ZMTA 5JCOC 2YDEA 3LUTB 1YXBA 3BA9A 1VQOV 1AB3A 1YF2A 4NKGB 4DR6B 3LSSA 2R9IA 5ITZB 2QM8A 1VMGA 2R72A 2ZE5A 3OUFA 1Y76B 4YIPA 1DF4A 3AG2C 4KXRA 1M90W 3CXCU 4BW9A 3ZHVA 4FMTA 3CRRA 1VQ6V 5ITZA 1MOFA 4FLXA 3Q4HA 4B08A 4MTGA 1F4NA 1HDJA 2JEXA 3ABKC 3E8HA 4FFBB 1IBMO 1XEQA 4CH4A 2V1DA 2F4VB 1WA8A 3B8MA 4FFBA 3APQA 2WA4A 4GCZA 3JAMN 1PKXA 4LF7B 2HJFC 1RPOA 5IYBO 1ZUQA 5EYPB 4JI4O 2JRIA 4DR4O 1VQ4V 4LR3A 3SR2C 1Z2GA 5L3GA 5LYJA 4UCTA 1NI8A 1Q3EA 1SC5B 2GTSA 1BGYH 1AR4A 3CXHF 3VQWA 4CH6A 2EIKC 2P4KA 2OYQA 4BR6A 3E2EA 4GZRB 4RUEA 1M57C 3BAAA 4UCUA 4BIZA 4B3RO 4YHHO 3K3WA 1FFXA 4W4LA 3BCCH 5B1AC 2WSSG 5D5QA 2WLIA 4NTXA 3ZEDA 4JI7B 4GKKO 2LO1A 1HNXO 3O65A 3ASNB 2N05A 3T2MA 3CC4V 2CTRA 2EIJB 2YXHA 3W7UA 3L74H 3JSNA 2CTWA 5E1AC 2ZXWC 3ABLC 1BHBA 1YTFB 4IHJB 4F6RA 3NXSA 4LF8O 1R3IC 3OW2U 1WP8A 2WLJA 4UXNA 4X64B 3BABA 5KX5B 4O4IB 2KB1A 3RYHB 1Q6IA 5B66Z 4O2AB 1N0NA 3R66A 4RWUA 3ETDA 4LBEC 1R1BA 1GKFA 5B3SC 4JI8O 5KX5A 4RAIA 4MTOA 2YIBD 3CB2A 2OIEA 3ABUA 1E79G 1RPRA 3ZHRA 4O2AA 4LFCB 3W7SA 3JD3A 4JYAB 2EINB 5C8YA 1EFRG 2ZCEA 1XNRO 2LW1A 4O4JA 4DYLA 4FM0A 1K34A 2ZE6A 1P7BA 2Y69B 3D3QA 1E1RG 1P4RA 3FB6C 2P22C 2UUAO 2QWNB 3BY6A 1SKVA 2QM7A 2HG5C 2YI8A 3B4SA 5JH7B 5KHGA 4DR2B 1GN3A 5EZYA 2YS8A 1PPJH 4UUJC 3E86A 1AP6A 1I5XA 2CUGA 2CH7A 4DR7O 5CB4A 4JI6O 5A9GA 3WU2Z 4B3SB 4RQFA 1S5HC 3AK2A 4W4KA 3NR7A 3D36A 3LDCA 2WLLA 2DWEC 1W0KG 4NTYA 2XAHA 2E76B 3RBZA 4I50B 4G2KA 5J2UB 3JCUZ 3JAKA 5JCOA 3F7YC 2RN9A 2ZIMA 5CA3A 2QWOB 5FL7G 4TV8B 3JARB 2BOBC 3OGCC 4J9YB 1S5JA 4TV9B 5KAFZ 4WBNB 5BMVA 2JK5C 3JCZA 4LF9B 2UU9B 3CC2V 1LR1A 4DUZO 3WB2A 4UCSA 1YJWV 2Y4TA 3G71V 4TV9A 1OCZC 4H37A 2ZNJA 4X1KA 5B5EZ 1Z5WA 2ZM6B 5KHIA 2IJHA 1WLEA 1N4CA 2IJIA 3U10A 4E2LA 5E79Z 1K8AW 2JS3A 2CTQA 4JI3O 3K9AA 3C3SA 3BEHA 5H2FZ 3WG7C 2B5UA 3DSQA 1N32B 1SRYA 2VRZA 2ADPA 2DYSB 5CA1B 4HNAA 2HLDG 4IYIA 2EJRA 2PI5A 1EN4A 1DLBA 1XMOO 3TK1A 2KQXA 1V54C 4P9OA 4OPAA 4DV0O 2HFEC 1AI5A 1VF6C 4G27B 2VS0A 3JD1A 1V9PA 3SYCA 2JGDA 2BE3A 4R6ZA 4Z2WA 1ZSPA 4LWSA 5L3BA 3AG4C 2B1IA 2HP8A 2Z3YA 1H38A 2Q5ZA 3AG1C 3MDSA 5LBQA 3T1HO 2Q7HA 4MS2A 3ETQA 4J11A 1P84F 1NT2B 3QVNA 1GK9A 4A5UB 5HFMA 3RWRD 4NXNB 4JV5O 1R6KA 1YJ9V 5H9CA 3BVOA 2Q7GA 3JASA 4X8AA 2E3CA 4QPJA 4DRXB 1S76D 5LHGA 1S5LZ 4MVZA 4YJ3A 4FM2A 4I0XB 1IDSA 1GM9A 3PN1A 1O9GA 2W6JG 3OMIB 3HKCA 2OCCB 4H0LB 4DRXA 1PP9H 1MNGA 5KAIZ 4IIJB 4KL1A 1N36O 2R9RB 4WFFA 5B1BC 3MHHC 4DR5B 1SQVH 1J5EB 5KHHA 2RMKB 3RYIA 3L9DA 1S72V 3IC7A 3SYQA 5JQGB 2KKWA 3E8GA 1MZEA 4EB6B 4FZ0A 2A06H 3EVKA 1FXKB 1TUEB 1V55B 2JJ1G 2GUZA 1Y74A 2GBOA 2H3OA 1PD3A 1RM1B 2YIDA 2XAJA 2VWKA 1XBLA 1KB9F 5LP6B 5L3CA 2WLKA 1QR8A 2PYJA 1S0VA 4DR6O 1TVKB 1F51A 3A8TA 1Q6UA 2IU3A 3ASOB 3HKBB 4JAVA 2IH3C 4Q6GA 3L72H 2M7WA 2X6AA 2E5LB 3OFNG 1SQBH 4FLVA 1Z5VA 3T1CA 2ZE7A 4ZHQA 1MMMA 2FYUH 4JYCA 4TUYB 1JFFA 1M5IA 3WB1A 1G1XB 1GN2A 2KG7B 1Q8IA 1QR9A 2F66C 4TQDA 1AILA 1FYJA 1SZTA 3JAWA 2F4VO 4X65B 4TUYA 4MVSA 1S77D 1FXHA 2ATKC 5AG2A 5JJNB 1AJQA 1H2NA 2FKXA 3JALA 1IZ3A 4J7ZA 4MVMA 1SQQH 4LF7O 1K5SA 4QIWF 1LUWA 2XOKG 3C3TA 2DW4A 4EFBA 4X1YA 1IBKB 1FJGB 3N2GA 3T4ZA 1OCCB 2K9PA 1IBLB 3ML0A 2IH1C 4I5SA 3KCYA 1DF5A 1JMKC 3CP1A 1IVSA 3AG3B 1ZX3A 2RDCA 3H1HH 3ZMUA 1R6TA 3THOA 3HKDB 1VQ9V 4H13B 5GW7A 2UXNA 2ZR2A 1X59A 2QR4A 4GLXA 4XDLA 1YTFD 5F2VO 3LSQA 4P9PA 2N74A 2YEVB 4YJ2B 4PI0A 4LF4B 1N33B 1DTOA 4TWKA 4JV5B 1B04A 3CCUV 3H1KH 3CS5A 3ZHUA 4CS2A 4JAAA 2BTOA 4JTCB 4TOIA 5EIBD 2EILC 1MABG 3BRCA 2ITDC 1GTOA 1NTKH 1VF7A 4JI7O 4OXSA 5KMGB 3E8FA 2LGWA 2EIMC 4DW1A 4U7NA 1AP5A 4DR3B 1BT8A 4LFAB 5EBLC 4LF5B 3UM7A 4KUMA 2QTOA 3E83A 5IWAB 2ITCC 2BSKB 1HR0B 2PF4E 3UKMA 1I5YA 4X64O 1VF6A 3STZC 1L0LH 4DV2B 4FLWA 3OEHG 3G67A 1XNQB 3CWBH 2DWDC 1Y67A 4JI0B 2PUSA 1UJWB 5IT9N 3SDLA 2HEPA 2HHHB 1QLEB 4LFCO 1EN5A 2N04A 2XT9A 3ZMVA 1Q90D 4JYAO 1S3JA 1XMQB 4GX2A 5IYCO 2Q69A 1OV9A 1OCRC 3LSUA 1GO3F 3J7AU 3Q4HB 1VQ8V 3CE2A 4PDMA 4DK1A 2F95B 2V4DA 4WFHA 4I55A 4DV4B 2FB5A 1WA8B 3N27A 5JVDA 5FLXN 4DR1B 3LNNA 2RNBA 5A2QN 4I9QA 2GV9A 1SQGA 4DR2O 4FPPA 3AEIA 4LCUC 2P6JA 1CEZA 1L8DA 2E74B 4D7SA 3IFXA 2WA3A 3FB7C 1FAFA 2ZE8A 4B3SO 2P67A 3QO8A 4R7CA 1WAZA 2AGAA 2FTKA 1AVMA 2P5OA 3K5NA 1SZXA 4TQFA 1Q86W 5LYJB 2QM4A 4JI2B 1QVFU 1QU7A 4B3TB 1VQKV 4UB8Z 3QF7A 3ZN0A 3ABMC 5LMNB 3JD4A 1PM9A 5HFLA 3CCRV 4F4LA 2FMLA 5B1NA 4NXMB 1KMIZ 1BSMA 1YIJV 1FFXB 4WFGA 4QGPA 1FPOA 2DYRB 1F7YA 1KKCA 2BOCC 5GONA 4LF9O 2WLIB 5GTHZ 4GYCB 2UU9O 4OX9B 1GN6A 1OJHA 4N21A 2CGNA 1M56C 1YVWA 3MAQA 5KHKA 1N34B 2ZM6O 3ICXA 2VQEB 3SPGA 3F7VC 2A0LA 3SPHA 1AJPA 4EEQA 1WPXA 3CRQA 4F6RB 2LFSA 4ICGA 1F4MA 3M8AA 1GN4A 4JI5B 1R3LC 1L1FA 1N32O 3UO3A 1PL0A 1HWYA 3CHXA 1HNZO 4H44B 2D3OW 3FX7A 3CCQV 1KYOF 5KA5A 2ZINA 4NR1A 1SQPH 3CRCA 1JA8A 2QWPB 5LGNA 5LHIA 1G6UA 2AZ0A 5H5NA 5C8YB 2ILMA 1JOYA 4GX0A 4GKJO 4O4JB 3U0ZA 1QNMA 2A79B 4MVUA 4JTAB 3FD9A 4NXNO 1I0HA 4K35A 4ZI7A 2Q4PA 5L3FA 1YHQV 2DMXA 4JYBA 3WFVA 4ZOLB 5EZYB 3K79A 2Q8VA 1NH2D 4X9QA 2EZOA 4WFAV 2CH7B 1L0NH 3FYEB 5CB4B 3DXRB 2AHZA 1W0JG 1JVMA 4ZOLA 4OGQB 3C90A 3CX5F 1AR1B 1RM1C 4WCEV 1I7FA 3PJSK 2B1GA 4JZ2A 4DR5O 3IGAC 1J5EO 1TA8A 1XL4A 4UVBA 2WLLB 2YSUB 3ZMZA 3R65A 2ZIOA 5IJ9A 3DXRA 3E89A 4XDJA 2L35A 1PV0A 1ZL8B 4TSFG 1MA1A 3P3PA 3K57A 1K5QA 4KHPB 3JAKB 4B3MB 2YUAA 5EBMC 1MSWD 4CC6A 2NLJC 4HBNA 5IY5C 2QE7G 4L8JA 1ZL8A 4O4HA 4MVOA 2A9HA 2UUBB 1ENVA 1NBMG 3AG2B 5BMVB 1B06A 4HAMA 4CH5A 2DJVA 2JGUA 3CJHA 4X20A 4JYYA 1YITV 3OMNB 5LA6B 3B40A 2ZNIA 3W7WA 1VQMV 1SQXH 2E5LO 3ABKB 1XQ8A 4UV8A 4X1KB 2AW9A 4K0KB 3AK3A 1JJ2U 2DQ0A 1XOUA 5LA6A 1Q43A 4MTXA 4E4EA 3CD6V 1U96A 1HNWB 5LHHA 5LMUB 1P7GA 2ZQMA 4X65O 3U11A 3KG2A 4G28B 4HNAB 5LXTA 1NS1A 2UXDB 4ASUG 2UXCB 5J2TA 3ZX6A 1D2DA 5C93A 1JQ0A 5FNVA 4UVCA 2Y0IA 3ZS8C 1H2GA 3ETGA 2A3QA 2JGDB 4PHZA 1HNZB 1IBKO 1QLNA 1FJGO 2QSAA 4LWSB 1IBLO 1H8HG 4LP8A 2X0LA 1YZBA 2X6CA 1K4DC 4XBFA 1AI4A 2V7QG 2EIKB 3P3NA 4R8CA 2CAZC 2IBZH 1VEWA 4MVQA 1M57B 1QVGU 2HKOA 4U3FH 3JD0A 3JASB 3FKSG 4GKJB 5B1AB 3MD0A 4J7KA 3VQXA 4YJ3B 4YIOA 2HJDA 3K5LA 4LF4O 1N33O 3LDEA 5TISZ 1WPBA 1NKDA 1AI6A 4PD4F 4JTDB 1OCOC 3N2KA 1PNMA 2VWJA 1BHAA 3HKCB 2NN4A 3QG5A 2ZXWB 4BAYA 3ABLB 2B9ZA 1KP2A 4ABMA 2R9AA 5IYZB 2WAMA 4O2BA 3SYPA 1Q6HA 5DM6V 2OIGA 1SQFA 1Y6XA 5L3EA 4DV6B 2ODMA 2ETNA 4QJFB 4DR3O 2D2CB 2CGOA 3RYIB 2QDOA 1RSOA 4LFAO 4LF5O 4I9WA 1OZ0A 3ZHTA 1NVPB 4C7UA 2Y4UA 5IYZA 4MW3A 2QTSA 5IWAO 3HB3B 5DN6G 1HR0O 5B3SB 4D7TA 2GUZB 1Y74B 2EULA 4DV2O 4FJCC 3I56V 5KA6A 5FPRA 4YY3B 3RVYA 3QNEA 3F5TA 1XNQO 4JPRA 1FKAO 1W59A 3OTFA 1DK1A 3JYCA 4JI0O 4J10A 3ZN1A 4FM1A 1XUQA 4DW0A 1NH2B 3E22B 2P06A 1GM8A 4GT1A 2HHHO 2QKCA 5CA0B 4J7JA 1H2SB 4U3JA 1XMQO 4ZHQB 3K0GA 1KECA 1JFFB 3E22A 1GMGA 1R3JC 3JATA 4WF9V
chains in the Genus database with same CATH topology
1UJWB 4MSWC 4QPKA 5E1AC 2ZXWC 4WFEA 3SYOA 3ABLC 1R3KC 2WPDG 2EBOA 1BHBA 3ABMB 3ZRVA 1YTFB 2LFRA 4PA4A 3NXSA 1QLEB 5IYDO 4BW5A 1R3IC 2W0FC 3OW2U 2WLJA 4UXNA 4XDKA 3ZMVA 3T2MA 1YSCA 1S3JA 2CK3G 1KKDA 2KB1A 4GX2A 3CCMV 5IYCO 2Q69A 1OCRC 4DO2A 1BMFG 1M9NA 4MT8A 1GO3F 4RUFA 1VQ8V 4RQEA 2NNUA 4PDMA 3ETDA 4LBEC 3ZMSA 2WLMA 4WFHA 4J9ZB 1GKFA 4KP4A 5B3SC 4CBCA 3LNMB 4RAIA 3OR6C 4YXWG 1M56B 4JF3A 4MTOA 4Q20A 3ABUA 1E79G 1RPRA 4P30A 1N8RW 2X6BA 4FPPA 3OE7G 3W7SA 3X2QC 3JD3A 2X7RB 3AEIA 4LCUC 2P6JA 2EINB 1CEZA 3OR7C 1EZJA 1EFRG 3QO5A 2IJJA 2IU0A 3G6EV 1H8EG 2LP7A 3IFXA 5B1OA 3FB7C 1SETA 1K34A 4L87A 2P67A 1FFTB 1P7BA 3QO8A 2JJ2G 4R7CA 2Y69B 2FTKA 1YI2V 2HR3A 1E1RG 2DQ3A 1P4RA 3FB6C 5J9PC 1VQ5V 4PDLA 2GSMB 3CC7V 3GWOA 1Q86W 3BY6A 3CCLV 1OCZB 3ZJZA 2QM7A 3OUSA 4CZZA 2HG5C 3HPLC 1QVFU 3ASNC 4Z1MG 4UUJC 3VBBA 2EIJC 1Y4MA 3E86A 1VQKV 1AROP 4H33A 4ZBMA 1I5XA 5CMUA 3FB5C 2Z5UA 3ZN0A 1NQTA 4QNHB 3SPJA 3ABMC 3JD4A 3SPIA 2XNDG 5HFLA 3WG7B 3CCRV 1QLEC 5EC2C 3QO7A 4RQFA 3CCEV 1VQNV 4F4LA 1K73W 1S5HC 5B1NA 3FB8C 5EK0A 3D36A 2OTJV 1M1KW 3LDCA 1YIJV 1K3EA 1PNKA 3OMAB 4WFGA 2WLLA 1EBOA 2DYRB 4HYOA 2DWEC 1V54B 1W0KG 4WFBV 2W6IG 3X2QB 1QCEA 2QKSA 2XAHA 2BOCC 3RBZA 2WLIB 3E35A 3K0DA 5CN0A 4G2KA 4N21A 2JDIG 1VQPV 5CBFA 1M56C 5KUKA 3F7YC 3ZRWB 2ZDIA 2XAQA 2HVJC 1XL6A 4PDVA 1PNLA 3AG4B 5CA3A 1ZWIC 3SPGA 1THZA 3F7VC 5FL7G 3AG1B 2EINC 4PDRA 1OHHG 3M99B 2BOBC 2A0LA 3SPHA 1AJPA 4PA3A 3CC4V 1WPXA 3OGCC 4J9YB 2LFSA 5EBWC 3ZRWA 1FS0G 4JGSA 1F4MA 5CBGA 2JK5C 1BL8A 1IXMA 2WLHA 3JCZA 1R3LC 1AJNA 1KP3A 2Y69C 1L1FA 3CC2V 1PL0A 3RW0A 4X88A 3T4DA 1HWYA 2C2AA 2D3OW 1YJWV 1G8MA 3CCQV 1KQSU 1FXKA 3G71V 5KA5A 1OCZC 4H37A 4PA6A 5CBHA 2XAFA 2IJHA 1WLEA 4GX5A 2IJIA 3K06A 4E2LA 1KD1W 3F5WC 3I55V 1K8AW 2Q68A 3K04A 5LGNA 4PELA 3P30A 5LHIA 2AHYA 3K9AA 5L3DA 3BEHA 5IY5B 3A0RA 5B1BB 3WG7C 2B5UA 5LGUA 3CCSV 1SRYA 1JOYA 3OM3B 4GX0A 2DYSB 3E8BA 4EKWA 1NR1A 5KUMA 2HLDG 2EJRA 2PI5A 3ETEA 3CYOA 2A79B 1VQLV 1DLBA 4MVUA 4JTAB 3TK1A 3DTUB 2DYRC 1V54C 3RVZA 4DXWA 2QA4V 2OT5A 4P9OA 2XASA 2HFEC 1AI5A 4UVAA 1W2BU 4G27B 5L3FA 4PA7A 3JD1A 3SYAA 1YHQV 5EC1C 3SYCA 1K9MW 4JYBA 1Q7YW 3WFVA 3B77A 1K97A 4R6ZA 3EHBB 3CPWU 5BZBA 1CPYA 3K79A 5L3BA 3AG4C 2B1IA 2GHYA 1K33A 1NH2D 2EZOA 2Z3YA 4RO2A 1F23A 4WFAV 1H38A 1Y66A 3AG1C 5LGTA 4FK5C 3FYEB 5LBQA 4GX1A 4JASA 1JCHA 4MS2A 2AHZA 1GK9A 1W0JG 3GB7C 1JVMA 5HFMA 2XAGA 3W7TA 1R6KA 1AI7A 5H6QA 1AR1B 4WCEV 1RM1C 1YJ9V 3SJQC 3PJSK 2B1GA 5H9CA 4WF9V 1FXVA 3G4SV 2EZPA 1ORQC 3IGAC 4R50A 4X8AA 1XL4A 4QPJA 4UVBA 1S76D 2WLLB 2YSUB 3ZMZA 3R65A 5LHGA 3E89A 4MVZA 4XDJA 4TSFG 4U7OA 1GM9A 4QE7A 1K5QA 2IW5A 2W6JG 3OMIB 5EBMC 2OCCB 3P32A 1Q81W 1MSWD 2NLJC 2Q6AA 1R73A 2R9RB 2HVKC 5IY5C 4WFFA 2QE7G 5B1BC 3MHHC 4MVOA 2A9HA 3ABTA 2DYSC 1ENVA 1NBMG 3AG2B 1COWG 2YEVA 4HAMA 1S72V 2K1EA 2MK3A 3IC7A 3SYQA 1YITV 3OMNB 1LNQA 2WWWA 3E8GA 1KC8W 2JIZG 3W7WA 1VQMV 2H94A 3ZCCA 4P2ZA 3ABKB 1FXKB 1TUEB 3H01A 4UV8A 1K7DA 1V55B 2JJ1G 4LC1A 2ZR3A 2UXXA 1PD3A 4X89A 1RM1B 2XAJA 1OCOB 1JJ2U 2DQ0A 5H6RA 4MTXA 5L3CA 3CD6V 2P7TC 2P90A 2WLKA 5LHHA 1JPXA 1QR8A 1S0VA 4KFMA 1CP9A 1F51A 2IU3A 3VOUA 3ASOB 4JAVA 2IH3C 2ZQMA 3OAAG 3KG2A 4G28B 2M7WA 2X6AA 3W7XA 4HZ3A 3OFNG 2H8PC 1NR7A 4MVRA 4ASUG 3JD2A 3MHSC 5C93A 3T1CA 1JQ0A 4UVCA 1NVPD 4JYCA 1H2GA 3ETGA 1JX9A 3CCJV 2Q67A 1SERA 1B6QA 3ZMTA 3LUTB 2ZDIC 1QLNA 1QR9A 1VQOV 2EILB 1G4YB 3ZRSA 2OCCC 3LSSA 2R9IA 1H8HG 4LP8A 3OEEG 2OTLV 2X0LA 2X6CA 1SZTA 4JAUA 1K4DC 2EIMB 3CCVV 4XBFA 2QM8A 1MG1A 1AI4A 3CMEV 3OUFA 4MVSA 3ZIAG 2ZD9A 1S77D 1FXHA 2ATKC 2V7QG 1DF4A 3CMAV 2EIKB 3AG2C 2PI4A 1AJQA 4R8CA 1M90W 3CXCU 4MVQA 1M57B 4FMTA 4MVMA 2HKOA 3LDDA 1QVGU 3FYIB 3DGEA 1K5SA 4QIWF 3JD0A 1VQ6V 1MOFA 3FKSG 2XOKG 2DW4A 5B1AB 3MD0A 4MW8A 4MTGA 1F4NA 1GM7A 2JEXA 3ABKC 1FXKC 3T4ZA 3E8HA 1OCCB 1V55C 3LDEA 3ML0A 1VQ7V 2IH1C 4I5SA 1NKDA 2IJKA 1AI6A 1DF5A 1R6NA 2V1DA 3W7UA 4JTDB 2QEXV 1OCOC 3B8MA 3CP1A 1PNMA 1ROPA 1BHAA 3AG3B 1SESA 3EFFK 3ZMUA 1E1QG 3SPCA 2ZXWB 1VQ9V 4BAYA 3ABLB 5GW7A 1KP2A 4GCZA 2UXNA 2ZR2A 1PKXA 2WAMA 3SYPA 3ASOC 2HJFC 1RPOA 4XDLA 5IYBO 1YTFD 5DM6V 4BIUA 3K03A 5L3EA 4QJFB 1YJNV 1QBZA 3LSQA 4P9PA 1NJIW 2YEVB 4I9WA 1K92A 1OZ0A 1NVPB 1VQ4V 1OCRB 1DTOA 2WLNA 4TWKA 1Q82W 3CCUV 4MW3A 5L3GA 3HB3B 4JTCB 5DN6G 5B3SB 2EILC 3D3IA 1MABG 2ITDC 1GTOA 4FJCC 3I56V 4OXSA 5KA6A 3RVYA 4UV9A 3QNEA 3E8FA 4FIPC 2EIMC 4JPRA 4U7NA 1J95A 1K4CC 2JEUA 3TCUA 3JYCA 3ZRXA 2EIKC 5EBLC 3ZN1A 3UM7A 3B8NA 3E2EA 4KUMA 4RUEA 1NH2B 1M57C 4BIZA 2QTOA 1GM8A 3E83A 4GT1A 3K3WA 2Y48A 2ITCC 4TT3G 5B1AC 4PA9A 3UKMA 5IDJA 1I5YA 2WSSG 4ZKIA 3STZC 1OCCC 2WLIA 3K0GA 4MTFA 1KECA 3OEHG 3TETA 3ASNB 3K08A 1GMGA 1R3JC 2F43G 4QE9A 3AG3C 3STLC 2DWDC 2EIJB 4N23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLI B;  1ORQ C;  3IGA C;  2ATK C;  3K0D A;  4MSW C;  4R50 A;  4X8A A;  5E1A C;  2ZXW C;  4WFE A;  3SYO A;  3AG2 C;  3ABL C;  1R3K C;  4R8C A;  1XL4 A;  5CBF A;  1M56 C;  5KUK A;  2WLL B;  3F7Y C;  3R65 A;  4MVQ A;  3E89 A;  4MVZ A;  3LDD A;  4MVM A;  4PA4 A;  4XDJ A;  2HVJ C;  1XL6 A;  4PDV A;  3SJQ C;  4QE7 A;  1ZWI C;  1R3I C;  2W0F C;  3SPG A;  3F7V C;  4MW8 A;  4BW5 A;  2WLJ A;  4XDK A;  2EIN C;  4PDR A;  4MTG A;  3T2M A;  2BOB C;  2A0L A;  3SPH A;  5IY5 C;  3ABK C;  4PA3 A;  3T4Z A;  1KKD A;  2KB1 A;  3E8H A;  3OGC C;  4GX2 A;  4J9Y B;  5EBM C;  1V55 C;  2Q69 A;  3LDE A;  2IH1 C;  1OCR C;  5EBW C;  4RUF A;  2Q6A A;  2NLJ C;  3RBZ A;  2R9R B;  4JTD B;  2HVK C;  5CBG A;  1OCO C;  4WFF A;  5B1B C;  4MVS A;  2JK5 C;  4PDM A;  1BL8 A;  2WLH A;  4LBE C;  2WLM A;  1R3L C;  4MVO A;  4WFH A;  2Y69 C;  2A9H A;  3EFF K;  4J9Z B;  5B3S C;  2DYS C;  4CBC A;  3RW0 A;  3SPC A;  3LNM B;  4X88 A;  3T4D A;  4RAI A;  3OR6 C;  4MTO A;  2YEV A;  2K1E A;  4P30 A;  3SYP A;  3ASO C;  2HJF C;  1OCZ C;  4H37 A;  4PA6 A;  4XDL A;  3SYQ A;  5CBH A;  3K03 A;  1LNQ A;  2X6B A;  3E8G A;  4GX5 A;  3K06 A;  4P9P A;  3X2Q C;  4LCU C;  3OR7 C;  4P2Z A;  3F5W C;  4I9W A;  2Q68 A;  3K04 A;  3IFX A;  4TWK A;  2WLN A;  2AHY A;  4X89 A;  3FB7 C;  3BEH A;  4MW3 A;  3WG7 C;  4R7C A;  1P7B A;  4JTC B;  4GX0 A;  3E8B A;  3FB6 C;  2EIL C;  2P7T C;  2WLK A;  4EKW A;  4PDL A;  5KUM A;  5J9P C;  2ITD C;  4OXS A;  2A79 B;  4KFM A;  3RVY A;  4MVU A;  3E8F A;  4JTA B;  3VOU A;  2DYR C;  2EIM C;  3OUS A;  2IH3 C;  1V54 C;  2HG5 C;  3HPL C;  3RVZ A;  4P9O A;  3ZJZ A;  4DXW A;  3ASN C;  2HFE C;  1J95 A;  1K4C C;  3KG2 A;  2X6A A;  4G28 B;  2EIJ C;  4G27 B;  4PA7 A;  4UUJ C;  3E86 A;  3TCU A;  3JYC A;  4HZ3 A;  3SYA A;  2EIK C;  4H33 A;  5EC1 C;  5EBL C;  4ZBM A;  2H8P C;  3SYC A;  4MVR A;  3FB5 C;  4QNH B;  3UM7 A;  3SPJ A;  3ABM C;  4RUE A;  1M57 C;  4R6Z A;  5BZB A;  3T1C A;  2QTO A;  3E83 A;  3SPI A;  3AG4 C;  1QLE C;  2Q67 A;  5EC2 C;  2ITC C;  5B1A C;  4RO2 A;  4F4L A;  4PA9 A;  1S5H C;  3AG1 C;  3UKM A;  3LUT B;  3FB8 C;  3STZ C;  5EK0 A;  4GX1 A;  1G4Y B;  1OCC C;  2WLI A;  4MS2 A;  3K0G A;  3ZRS A;  2AHZ A;  2OCC C;  4MTF A;  3LDC A;  3GB7 C;  4LP8 A;  1JVM A;  2X6C A;  4WFG A;  2WLL A;  4HYO A;  1K4D C;  2DWE C;  3TET A;  3STL C;  3K08 A;  1R3J C;  2QKS A;  3OUF A;  2BOC C;  3AG3 C;  2ZD9 A;  3PJS K;  2DWD C;  4QE9 A; 
#chains in the Genus database with same CATH topology
 2PYL A;  4QPK A;  5JWP A;  5CA0 A;  4WFE A;  3SYO A;  1EZV H;  1R3K C;  2WPD G;  4DV4 O;  2EBO A;  3JAW B;  5JJJ B;  3ZRV A;  4X66 B;  3QTC A;  2LFR A;  5IJ0 A;  4DR1 O;  2AZ2 A;  3JAL B;  4XDK A;  2CK3 G;  2Q0O C;  4I7Z B;  1BMF G;  4MT8 A;  2NNU A;  4X1Y B;  3ZMS A;  2WLM A;  3N2G B;  3BA8 A;  1GAX A;  3LNM B;  3OR6 C;  4YXW G;  2GDS A;  3L70 H;  1T5E A;  4Q20 A;  4CS4 A;  4GUN A;  1N8R W;  4AQY B;  4JI2 O;  2X7R B;  4B3T O;  1EZJ A;  3T1Y B;  4FLT A;  2F93 B;  1US6 A;  2LP7 A;  3L75 H;  4DV5 O;  5LMN O;  3UCS C;  1SET A;  2JJ2 G;  3SJC C;  1YI2 V;  4I4T A;  4PDL A;  2CDY A;  4PV1 B;  4NXM O;  3UT5 B;  1WJZ A;  1OCZ B;  3OUS A;  3HPL C;  3ASN C;  4Z1M G;  2EIJ C;  4DK0 A;  1Y4M A;  4OX9 O;  4H33 A;  4ZBM A;  5CMU A;  2BCC H;  1NZ6 A;  3TGU H;  3UT5 A;  1H2K A;  3BFR A;  3SPI A;  2XND G;  1N34 O;  3WG7 B;  4FLY A;  3S3X A;  3CCE V;  2VQE O;  1XI1 A;  5DED A;  4PI2 A;  4UCO A;  1U97 A;  1PNK A;  4D6T H;  1YCI A;  4HYO A;  1V54 B;  3X2Q B;  2QKS A;  4JI5 O;  4DV1 B;  1UFI A;  5K1X A;  3K0D A;  2QKA A;  2JDI G;  1VQP V;  3RYC A;  3ZRW B;  1YDX A;  2Q7E A;  2XAQ A;  2OCH A;  1XL6 A;  3AG4 B;  1KU9 A;  1P49 A;  1AR5 A;  1ZWI C;  3AG1 B;  2EIN C;  3APO A;  4X1I B;  1OHH G;  4K8X A;  4PA3 A;  3OGI B;  5BR8 B;  3RYF A;  5EBW C;  3ZRW A;  1CXZ B;  1FS0 G;  4JGS A;  5CBG A;  1BL8 A;  1IXM A;  1AJN A;  2Y69 C;  2Z0A A;  3FAV A;  2BTQ A;  4X1I A;  3T4D A;  5LOV A;  4FZ1 A;  2KSD A;  1KQS U;  1QHT A;  2QJ1 A;  4PA6 A;  5CBH A;  1TUB A;  4I55 B;  4J41 A;  3OD4 A;  2XAF A;  4GX5 A;  3K06 A;  1KD1 W;  4LFB B;  3F5W C;  3I55 V;  1DGS A;  4F6E A;  4LNU A;  3AG7 A;  2Q68 A;  5JVD B;  4PEL A;  3P30 A;  2AHY A;  5L3D A;  3BHP A;  5KLV H;  5B1B B;  3HKE A;  4X62 B;  3OM3 B;  3E8B A;  1NR1 A;  5KUM A;  3ZBH A;  4FVM A;  1VQL V;  3DTU B;  4IYH A;  4CH3 A;  2DOS A;  2XAS A;  4UVA A;  4JI1 B;  4J42 A;  4PA7 A;  3SYA A;  3EXA A;  1Q7Y W;  1K97 A;  3EHB B;  5BZB A;  1CPY A;  4DUY B;  3ZHQ A;  1F23 A;  4KHP O;  1Y66 A;  5LGT A;  4FK5 C;  3H1J H;  1Y76 A;  4GX1 A;  4JAS A;  4B3M O;  1SF9 A;  1KUQ A;  1RFY A;  2UUC B;  3W7T A;  1AI7 A;  5H6Q A;  1ZLZ A;  2EJ7 A;  4UCR A;  2EZP A;  2UUB O;  4DV5 B;  4ZIB A;  2JVD A;  4AIL C;  2G38 A;  3BPZ A;  2LJ2 A;  5GON B;  2PTM A;  4NYK A;  4QE7 A;  3P32 A;  4K0K O;  2Q6A A;  1BQ0 A;  1R73 A;  2HVK C;  3ABT A;  2DYS C;  5EYP A;  4B7K A;  1HNW O;  1MSD A;  2RJZ A;  2K1E A;  5LMU O;  2MK3 A;  1LNQ A;  2WWW A;  4P2Z A;  3H01 A;  3VQY A;  2UXD O;  2UXC O;  3DC5 A;  2ZR3 A;  1TAE A;  1M93 A;  4X89 A;  4LF6 B;  4K8Z A;  2P90 A;  1JPX A;  4IT5 A;  4FLZ A;  4KFM A;  3VOU A;  4OPH A;  3CRM A;  3OAA G;  3W7X A;  4DV7 B;  2LGQ A;  3K5O A;  2UXB B;  3VQV A;  1NR7 A;  1GRJ A;  1NTM H;  2ZT9 B;  3IAY A;  1X4T A;  4J80 A;  5DEC A;  2DE0 X;  4ZI7 B;  4LH6 A;  1NVP D;  3CCJ V;  1SER A;  3CEI A;  2XHB A;  2ZDI C;  3JSL A;  2EIL B;  1G4Y B;  3ZRS A;  2OCC C;  1SS3 A;  2PGG A;  2VQF B;  1VIB A;  3OEE G;  2OTL V;  4JAU A;  2EIM B;  3CCV V;  1MG1 A;  3OT7 A;  4IHJ A;  3CME V;  3ZIA G;  2ZD9 A;  1VF5 B;  5KHJ A;  3CMA V;  1IX9 A;  2PI4 A;  3GVM A;  5BXZ A;  1H2M A;  2XUM A;  3OTO B;  4O4I A;  1VAR A;  3LDD A;  3K5M A;  3FYI B;  3DGE A;  3RYH A;  3HR0 A;  1H2L A;  4DV6 O;  4MW8 A;  3UO2 A;  1GH6 A;  1GM7 A;  5IJ9 B;  1FXK C;  4BIO A;  1HW7 A;  1V55 C;  1VQ7 V;  1YEW A;  2IJK A;  1R6N A;  2QEX V;  1ROP A;  5GTI Z;  1A32 A;  5LP6 C;  1SES A;  3EFF K;  1E1Q G;  2YI9 A;  3SPC A;  2EX3 A;  4YY3 O;  4O4H B;  3ASO C;  4BIU A;  3K03 A;  3IC9 A;  1YJN V;  1I94 O;  1QBZ A;  1NJI W;  3CJH B;  1UPG A;  1XHX A;  4X20 B;  2CTP A;  1K92 A;  1IBM B;  1OCR B;  2WLN A;  1Q82 W;  2Q0A A;  1WN7 A;  3L71 H;  5JH7 A;  3A0B Z;  3D3I A;  2PY5 A;  1O9H A;  4UV9 A;  4FIP C;  2LQT A;  4JI4 B;  1JJO A;  3TXS A;  3J81 N;  1J95 A;  1K4C C;  2JEU A;  3TCU A;  3ZRX A;  2ADQ B;  4UCV A;  4DR4 B;  3B8N A;  4X66 O;  4O4L B;  3G6B A;  1BZK A;  5D5P A;  2L6L A;  2Y48 A;  5LXT B;  4TT3 G;  4PA9 A;  5IDJ A;  4ZKI A;  5J2T B;  2Q9L A;  1OCC C;  4I50 A;  5FNV B;  5J2U A;  4MTF A;  4O4L A;  3TET A;  1XRE A;  3STL C;  3K08 A;  4QE9 A;  2F43 G;  2Y0P A;  3AG3 C;  1SA0 B;  4N23 A;  3SJA C;  4FFK A;  4MSW C;  4NTW A;  4TV8 A;  3ABM B;  3JAR A;  3K59 A;  2FL4 A;  4PA4 A;  4B3R B;  4YHH B;  5IE9 A;  4WBN A;  2YXL A;  4AQY O;  3K9S A;  5IYD O;  4BW5 A;  3AK1 A;  2W0F C;  1SA0 A;  3TXQ A;  3G80 A;  2NR5 A;  1YSC A;  1HP8 A;  1KKD A;  3CCM V;  3T1Y O;  4K3A A;  4FLU A;  4DO2 A;  1M9N A;  4PJ0 Z;  4GKK B;  4RUF A;  4RQE A;  2YC0 A;  1HNX B;  2YXY A;  4Z1V A;  4J9Z B;  4KP4 A;  4CBC A;  4NB5 A;  3WB0 A;  1EN6 A;  1M56 B;  4JF3 A;  4UB6 Z;  3N2K B;  4P30 A;  1XIL A;  3B09 A;  1BCC H;  2X6B A;  4LF8 B;  3OE7 G;  3I5D A;  1N0J A;  3X2Q C;  3OR7 C;  1WB8 A;  3QO5 A;  2IJJ A;  2IU0 A;  4O2B B;  3G6E V;  5FPO A;  1H8E G;  5B1O A;  5CA1 A;  4L87 A;  1FFT B;  2OWO A;  1RSO B;  3RFR A;  1BS3 A;  2HR3 A;  4JI8 B;  2DQ3 A;  5J9P C;  1VQ5 V;  2GSM B;  1B3Q A;  3CC7 V;  3GWO A;  2ZKO A;  3CCL V;  3ZJZ A;  4CZZ A;  4IL6 Z;  5K1P A;  3VBB A;  4DV1 O;  1QQC A;  1ARO P;  3RT3 C;  1XNR B;  3FB5 C;  2Z5U A;  4QNH B;  1NQT A;  4AI8 A;  3SPJ A;  4CC5 A;  1PL4 A;  1QLE C;  3H1I H;  5EC2 C;  3KCX A;  3QO7 A;  1VQN V;  1EM1 A;  1K73 W;  2F23 A;  2MW2 B;  3FB8 C;  5EK0 A;  4IGG A;  3J80 N;  2R70 A;  3SGI A;  2OTJ V;  5BR8 O;  1M1K W;  4DV3 O;  2UUA B;  1K3E A;  3H1L H;  3OMA B;  1EBO A;  1I94 B;  4WFB V;  2W6I G;  1M4U A;  1QCE A;  4I0X A;  2YIC A;  4U3J B;  3E35 A;  1VP7 A;  5CN0 A;  2RQ6 A;  5CBF A;  5KUK A;  4DR7 B;  2ZDI A;  1LUV A;  4JI6 B;  3KZI Z;  2HVJ C;  2LW7 A;  4PDV A;  1FD9 A;  1PNL A;  3JAT B;  3L73 H;  1MZF A;  4IIJ A;  3RGB A;  1THZ A;  4PDR A;  3M99 B;  4LFB O;  2YIB A;  5IJ0 B;  1NU1 H;  3H9V A;  2Q73 A;  1D5N A;  4CS3 A;  2WLH A;  5BY1 A;  1KP3 A;  5JQG A;  4X62 O;  1BQZ A;  3RW0 A;  4X88 A;  2IM9 A;  2C2A A;  2JS5 A;  3B2E E;  4EB6 A;  1G8M A;  1FXK A;  3IJ4 A;  3ZHS A;  4JI1 O;  1WP7 A;  4LH7 A;  5LP6 A;  3S3W A;  3K04 A;  4B7E A;  5IY5 B;  4DUY O;  1TVK A;  3A0R A;  5LGU A;  1ZAU A;  3CCS V;  3HKB A;  4DUZ B;  4EKW A;  3M7M X;  3ETE A;  3CYO A;  4NVP A;  2A7W A;  2UUC O;  2DYR C;  2YIA A;  3RVZ A;  2QA4 V;  3O9O A;  4DXW A;  2OT5 A;  1W2B U;  4I4T B;  1D5A A;  2DN9 A;  5EC1 C;  2QGN A;  1K9M W;  1XHZ A;  2KG7 A;  2P4V A;  3B77 A;  4JI3 B;  3CPW U;  3UQ8 A;  2E75 B;  2PZS A;  3DC6 A;  2GHY A;  1K33 A;  2AXT Z;  4JZG A;  2RCV A;  4RO2 A;  1JCH A;  3GB7 C;  1XMO B;  2XAG A;  4DV0 B;  3SJQ C;  3G4S V;  1FXV A;  1ORQ C;  4R50 A;  1ZTE A;  4BWA A;  4EFE A;  2O57 A;  2QWQ B;  3RN4 A;  2XTA A;  4U7O A;  3K58 A;  3RYC B;  2IW5 A;  3T1H B;  3SJB C;  2ARH A;  3HKD A;  1Q81 W;  4UFZ A;  5EIB C;  4AHC A;  4LF6 O;  5LL6 Y;  1IUR A;  3FFQ A;  3RYF B;  3A2F A;  1COW G;  1URF A;  2YEV A;  1NTZ H;  4YJ2 A;  2F1M A;  1KBH A;  3FAV B;  1Q5O A;  1KC8 W;  2JIZ G;  2BTQ B;  1WNS A;  3D8C A;  4DV7 O;  2H94 A;  3A0H Z;  5LOV B;  3ZCC A;  2UXB O;  1RP3 B;  4DV3 B;  1K7D A;  3CRA A;  4LC1 A;  1TUB B;  2UXX A;  1N36 B;  5JJE B;  1OCO B;  5KMG A;  3CSX A;  3TJT A;  5H6R A;  4LNU B;  2P7T C;  1BE3 H;  1CP9 A;  2VQF O;  3HKE B;  1XDC A;  3D36 C;  4HZ3 A;  2BSK A;  1JR9 A;  2H8P C;  3KKY A;  4MVR A;  1TGO A;  2W0X A;  1IXB A;  2CE4 A;  3OTO O;  2QWR B;  3JD2 A;  1I08 A;  3MHS C;  3GWK C;  2GTA A;  1JX9 A;  1WB7 A;  2Q67 A;  2M6Y A;  1B6Q A;  3ZMT A;  5JCO C;  2YDE A;  3LUT B;  1YXB A;  3BA9 A;  1VQO V;  1AB3 A;  1YF2 A;  4NKG B;  4DR6 B;  3LSS A;  2R9I A;  5ITZ B;  2QM8 A;  1VMG A;  2R72 A;  2ZE5 A;  3OUF A;  1Y76 B;  4YIP A;  1DF4 A;  3AG2 C;  4KXR A;  1M90 W;  3CXC U;  4BW9 A;  3ZHV A;  4FMT A;  3CRR A;  1VQ6 V;  5ITZ A;  1MOF A;  4FLX A;  3Q4H A;  4B08 A;  4MTG A;  1F4N A;  1HDJ A;  2JEX A;  3ABK C;  3E8H A;  4FFB B;  1IBM O;  1XEQ A;  4CH4 A;  2V1D A;  2F4V B;  1WA8 A;  3B8M A;  4FFB A;  3APQ A;  2WA4 A;  4GCZ A;  3JAM N;  1PKX A;  4LF7 B;  2HJF C;  1RPO A;  5IYB O;  1ZUQ A;  5EYP B;  4JI4 O;  2JRI A;  4DR4 O;  1VQ4 V;  4LR3 A;  3SR2 C;  1Z2G A;  5L3G A;  5LYJ A;  4UCT A;  1NI8 A;  1Q3E A;  1SC5 B;  2GTS A;  1BGY H;  1AR4 A;  3CXH F;  3VQW A;  4CH6 A;  2EIK C;  2P4K A;  2OYQ A;  4BR6 A;  3E2E A;  4GZR B;  4RUE A;  1M57 C;  3BAA A;  4UCU A;  4BIZ A;  4B3R O;  4YHH O;  3K3W A;  1FFX A;  4W4L A;  3BCC H;  5B1A C;  2WSS G;  5D5Q A;  2WLI A;  4NTX A;  3ZED A;  4JI7 B;  4GKK O;  2LO1 A;  1HNX O;  3O65 A;  3ASN B;  2N05 A;  3T2M A;  3CC4 V;  2CTR A;  2EIJ B;  2YXH A;  3W7U A;  3L74 H;  3JSN A;  2CTW A;  5E1A C;  2ZXW C;  3ABL C;  1BHB A;  1YTF B;  4IHJ B;  4F6R A;  3NXS A;  4LF8 O;  1R3I C;  3OW2 U;  1WP8 A;  2WLJ A;  4UXN A;  4X64 B;  3BAB A;  5KX5 B;  4O4I B;  2KB1 A;  3RYH B;  1Q6I A;  5B66 Z;  4O2A B;  1N0N A;  3R66 A;  4RWU A;  3ETD A;  4LBE C;  1R1B A;  1GKF A;  5B3S C;  4JI8 O;  5KX5 A;  4RAI A;  4MTO A;  2YIB D;  3CB2 A;  2OIE A;  3ABU A;  1E79 G;  1RPR A;  3ZHR A;  4O2A A;  4LFC B;  3W7S A;  3JD3 A;  4JYA B;  2EIN B;  5C8Y A;  1EFR G;  2ZCE A;  1XNR O;  2LW1 A;  4O4J A;  4DYL A;  4FM0 A;  1K34 A;  2ZE6 A;  1P7B A;  2Y69 B;  3D3Q A;  1E1R G;  1P4R A;  3FB6 C;  2P22 C;  2UUA O;  2QWN B;  3BY6 A;  1SKV A;  2QM7 A;  2HG5 C;  2YI8 A;  3B4S A;  5JH7 B;  5KHG A;  4DR2 B;  1GN3 A;  5EZY A;  2YS8 A;  1PPJ H;  4UUJ C;  3E86 A;  1AP6 A;  1I5X A;  2CUG A;  2CH7 A;  4DR7 O;  5CB4 A;  4JI6 O;  5A9G A;  3WU2 Z;  4B3S B;  4RQF A;  1S5H C;  3AK2 A;  4W4K A;  3NR7 A;  3D36 A;  3LDC A;  2WLL A;  2DWE C;  1W0K G;  4NTY A;  2XAH A;  2E76 B;  3RBZ A;  4I50 B;  4G2K A;  5J2U B;  3JCU Z;  3JAK A;  5JCO A;  3F7Y C;  2RN9 A;  2ZIM A;  5CA3 A;  2QWO B;  5FL7 G;  4TV8 B;  3JAR B;  2BOB C;  3OGC C;  4J9Y B;  1S5J A;  4TV9 B;  5KAF Z;  4WBN B;  5BMV A;  2JK5 C;  3JCZ A;  4LF9 B;  2UU9 B;  3CC2 V;  1LR1 A;  4DUZ O;  3WB2 A;  4UCS A;  1YJW V;  2Y4T A;  3G71 V;  4TV9 A;  1OCZ C;  4H37 A;  2ZNJ A;  4X1K A;  5B5E Z;  1Z5W A;  2ZM6 B;  5KHI A;  2IJH A;  1WLE A;  1N4C A;  2IJI A;  3U10 A;  4E2L A;  5E79 Z;  1K8A W;  2JS3 A;  2CTQ A;  4JI3 O;  3K9A A;  3C3S A;  3BEH A;  5H2F Z;  3WG7 C;  2B5U A;  3DSQ A;  1N32 B;  1SRY A;  2VRZ A;  2ADP A;  2DYS B;  5CA1 B;  4HNA A;  2HLD G;  4IYI A;  2EJR A;  2PI5 A;  1EN4 A;  1DLB A;  1XMO O;  3TK1 A;  2KQX A;  1V54 C;  4P9O A;  4OPA A;  4DV0 O;  2HFE C;  1AI5 A;  1VF6 C;  4G27 B;  2VS0 A;  3JD1 A;  1V9P A;  3SYC A;  2JGD A;  2BE3 A;  4R6Z A;  4Z2W A;  1ZSP A;  4LWS A;  5L3B A;  3AG4 C;  2B1I A;  2HP8 A;  2Z3Y A;  1H38 A;  2Q5Z A;  3AG1 C;  3MDS A;  5LBQ A;  3T1H O;  2Q7H A;  4MS2 A;  3ETQ A;  4J11 A;  1P84 F;  1NT2 B;  3QVN A;  1GK9 A;  4A5U B;  5HFM A;  3RWR D;  4NXN B;  4JV5 O;  1R6K A;  1YJ9 V;  5H9C A;  3BVO A;  2Q7G A;  3JAS A;  4X8A A;  2E3C A;  4QPJ A;  4DRX B;  1S76 D;  5LHG A;  1S5L Z;  4MVZ A;  4YJ3 A;  4FM2 A;  4I0X B;  1IDS A;  1GM9 A;  3PN1 A;  1O9G A;  2W6J G;  3OMI B;  3HKC A;  2OCC B;  4H0L B;  4DRX A;  1PP9 H;  1MNG A;  5KAI Z;  4IIJ B;  4KL1 A;  1N36 O;  2R9R B;  4WFF A;  5B1B C;  3MHH C;  4DR5 B;  1SQV H;  1J5E B;  5KHH A;  2RMK B;  3RYI A;  3L9D A;  1S72 V;  3IC7 A;  3SYQ A;  5JQG B;  2KKW A;  3E8G A;  1MZE A;  4EB6 B;  4FZ0 A;  2A06 H;  3EVK A;  1FXK B;  1TUE B;  1V55 B;  2JJ1 G;  2GUZ A;  1Y74 A;  2GBO A;  2H3O A;  1PD3 A;  1RM1 B;  2YID A;  2XAJ A;  2VWK A;  1XBL A;  1KB9 F;  5LP6 B;  5L3C A;  2WLK A;  1QR8 A;  2PYJ A;  1S0V A;  4DR6 O;  1TVK B;  1F51 A;  3A8T A;  1Q6U A;  2IU3 A;  3ASO B;  3HKB B;  4JAV A;  2IH3 C;  4Q6G A;  3L72 H;  2M7W A;  2X6A A;  2E5L B;  3OFN G;  1SQB H;  4FLV A;  1Z5V A;  3T1C A;  2ZE7 A;  4ZHQ A;  1MMM A;  2FYU H;  4JYC A;  4TUY B;  1JFF A;  1M5I A;  3WB1 A;  1G1X B;  1GN2 A;  2KG7 B;  1Q8I A;  1QR9 A;  2F66 C;  4TQD A;  1AIL A;  1FYJ A;  1SZT A;  3JAW A;  2F4V O;  4X65 B;  4TUY A;  4MVS A;  1S77 D;  1FXH A;  2ATK C;  5AG2 A;  5JJN B;  1AJQ A;  1H2N A;  2FKX A;  3JAL A;  1IZ3 A;  4J7Z A;  4MVM A;  1SQQ H;  4LF7 O;  1K5S A;  4QIW F;  1LUW A;  2XOK G;  3C3T A;  2DW4 A;  4EFB A;  4X1Y A;  1IBK B;  1FJG B;  3N2G A;  3T4Z A;  1OCC B;  2K9P A;  1IBL B;  3ML0 A;  2IH1 C;  4I5S A;  3KCY A;  1DF5 A;  1JMK C;  3CP1 A;  1IVS A;  3AG3 B;  1ZX3 A;  2RDC A;  3H1H H;  3ZMU A;  1R6T A;  3THO A;  3HKD B;  1VQ9 V;  4H13 B;  5GW7 A;  2UXN A;  2ZR2 A;  1X59 A;  2QR4 A;  4GLX A;  4XDL A;  1YTF D;  5F2V O;  3LSQ A;  4P9P A;  2N74 A;  2YEV B;  4YJ2 B;  4PI0 A;  4LF4 B;  1N33 B;  1DTO A;  4TWK A;  4JV5 B;  1B04 A;  3CCU V;  3H1K H;  3CS5 A;  3ZHU A;  4CS2 A;  4JAA A;  2BTO A;  4JTC B;  4TOI A;  5EIB D;  2EIL C;  1MAB G;  3BRC A;  2ITD C;  1GTO A;  1NTK H;  1VF7 A;  4JI7 O;  4OXS A;  5KMG B;  3E8F A;  2LGW A;  2EIM C;  4DW1 A;  4U7N A;  1AP5 A;  4DR3 B;  1BT8 A;  4LFA B;  5EBL C;  4LF5 B;  3UM7 A;  4KUM A;  2QTO A;  3E83 A;  5IWA B;  2ITC C;  2BSK B;  1HR0 B;  2PF4 E;  3UKM A;  1I5Y A;  4X64 O;  1VF6 A;  3STZ C;  1L0L H;  4DV2 B;  4FLW A;  3OEH G;  3G67 A;  1XNQ B;  3CWB H;  2DWD C;  1Y67 A;  4JI0 B;  2PUS A;  1UJW B;  5IT9 N;  3SDL A;  2HEP A;  2HHH B;  1QLE B;  4LFC O;  1EN5 A;  2N04 A;  2XT9 A;  3ZMV A;  1Q90 D;  4JYA O;  1S3J A;  1XMQ B;  4GX2 A;  5IYC O;  2Q69 A;  1OV9 A;  1OCR C;  3LSU A;  1GO3 F;  3J7A U;  3Q4H B;  1VQ8 V;  3CE2 A;  4PDM A;  4DK1 A;  2F95 B;  2V4D A;  4WFH A;  4I55 A;  4DV4 B;  2FB5 A;  1WA8 B;  3N27 A;  5JVD A;  5FLX N;  4DR1 B;  3LNN A;  2RNB A;  5A2Q N;  4I9Q A;  2GV9 A;  1SQG A;  4DR2 O;  4FPP A;  3AEI A;  4LCU C;  2P6J A;  1CEZ A;  1L8D A;  2E74 B;  4D7S A;  3IFX A;  2WA3 A;  3FB7 C;  1FAF A;  2ZE8 A;  4B3S O;  2P67 A;  3QO8 A;  4R7C A;  1WAZ A;  2AGA A;  2FTK A;  1AVM A;  2P5O A;  3K5N A;  1SZX A;  4TQF A;  1Q86 W;  5LYJ B;  2QM4 A;  4JI2 B;  1QVF U;  1QU7 A;  4B3T B;  1VQK V;  4UB8 Z;  3QF7 A;  3ZN0 A;  3ABM C;  5LMN B;  3JD4 A;  1PM9 A;  5HFL A;  3CCR V;  4F4L A;  2FML A;  5B1N A;  4NXM B;  1KMI Z;  1BSM A;  1YIJ V;  1FFX B;  4WFG A;  4QGP A;  1FPO A;  2DYR B;  1F7Y A;  1KKC A;  2BOC C;  5GON A;  4LF9 O;  2WLI B;  5GTH Z;  4GYC B;  2UU9 O;  4OX9 B;  1GN6 A;  1OJH A;  4N21 A;  2CGN A;  1M56 C;  1YVW A;  3MAQ A;  5KHK A;  1N34 B;  2ZM6 O;  3ICX A;  2VQE B;  3SPG A;  3F7V C;  2A0L A;  3SPH A;  1AJP A;  4EEQ A;  1WPX A;  3CRQ A;  4F6R B;  2LFS A;  4ICG A;  1F4M A;  3M8A A;  1GN4 A;  4JI5 B;  1R3L C;  1L1F A;  1N32 O;  3UO3 A;  1PL0 A;  1HWY A;  3CHX A;  1HNZ O;  4H44 B;  2D3O W;  3FX7 A;  3CCQ V;  1KYO F;  5KA5 A;  2ZIN A;  4NR1 A;  1SQP H;  3CRC A;  1JA8 A;  2QWP B;  5LGN A;  5LHI A;  1G6U A;  2AZ0 A;  5H5N A;  5C8Y B;  2ILM A;  1JOY A;  4GX0 A;  4GKJ O;  4O4J B;  3U0Z A;  1QNM A;  2A79 B;  4MVU A;  4JTA B;  3FD9 A;  4NXN O;  1I0H A;  4K35 A;  4ZI7 A;  2Q4P A;  5L3F A;  1YHQ V;  2DMX A;  4JYB A;  3WFV A;  4ZOL B;  5EZY B;  3K79 A;  2Q8V A;  1NH2 D;  4X9Q A;  2EZO A;  4WFA V;  2CH7 B;  1L0N H;  3FYE B;  5CB4 B;  3DXR B;  2AHZ A;  1W0J G;  1JVM A;  4ZOL A;  4OGQ B;  3C90 A;  3CX5 F;  1AR1 B;  1RM1 C;  4WCE V;  1I7F A;  3PJS K;  2B1G A;  4JZ2 A;  4DR5 O;  3IGA C;  1J5E O;  1TA8 A;  1XL4 A;  4UVB A;  2WLL B;  2YSU B;  3ZMZ A;  3R65 A;  2ZIO A;  5IJ9 A;  3DXR A;  3E89 A;  4XDJ A;  2L35 A;  1PV0 A;  1ZL8 B;  4TSF G;  1MA1 A;  3P3P A;  3K57 A;  1K5Q A;  4KHP B;  3JAK B;  4B3M B;  2YUA A;  5EBM C;  1MSW D;  4CC6 A;  2NLJ C;  4HBN A;  5IY5 C;  2QE7 G;  4L8J A;  1ZL8 A;  4O4H A;  4MVO A;  2A9H A;  2UUB B;  1ENV A;  1NBM G;  3AG2 B;  5BMV B;  1B06 A;  4HAM A;  4CH5 A;  2DJV A;  2JGU A;  3CJH A;  4X20 A;  4JYY A;  1YIT V;  3OMN B;  5LA6 B;  3B40 A;  2ZNI A;  3W7W A;  1VQM V;  1SQX H;  2E5L O;  3ABK B;  1XQ8 A;  4UV8 A;  4X1K B;  2AW9 A;  4K0K B;  3AK3 A;  1JJ2 U;  2DQ0 A;  1XOU A;  5LA6 A;  1Q43 A;  4MTX A;  4E4E A;  3CD6 V;  1U96 A;  1HNW B;  5LHH A;  5LMU B;  1P7G A;  2ZQM A;  4X65 O;  3U11 A;  3KG2 A;  4G28 B;  4HNA B;  5LXT A;  1NS1 A;  2UXD B;  4ASU G;  2UXC B;  5J2T A;  3ZX6 A;  1D2D A;  5C93 A;  1JQ0 A;  5FNV A;  4UVC A;  2Y0I A;  3ZS8 C;  1H2G A;  3ETG A;  2A3Q A;  2JGD B;  4PHZ A;  1HNZ B;  1IBK O;  1QLN A;  1FJG O;  2QSA A;  4LWS B;  1IBL O;  1H8H G;  4LP8 A;  2X0L A;  1YZB A;  2X6C A;  1K4D C;  4XBF A;  1AI4 A;  2V7Q G;  2EIK B;  3P3N A;  4R8C A;  2CAZ C;  2IBZ H;  1VEW A;  4MVQ A;  1M57 B;  1QVG U;  2HKO A;  4U3F H;  3JD0 A;  3JAS B;  3FKS G;  4GKJ B;  5B1A B;  3MD0 A;  4J7K A;  3VQX A;  4YJ3 B;  4YIO A;  2HJD A;  3K5L A;  4LF4 O;  1N33 O;  3LDE A;  5TIS Z;  1WPB A;  1NKD A;  1AI6 A;  4PD4 F;  4JTD B;  1OCO C;  3N2K A;  1PNM A;  2VWJ A;  1BHA A;  3HKC B;  2NN4 A;  3QG5 A;  2ZXW B;  4BAY A;  3ABL B;  2B9Z A;  1KP2 A;  4ABM A;  2R9A A;  5IYZ B;  2WAM A;  4O2B A;  3SYP A;  1Q6H A;  5DM6 V;  2OIG A;  1SQF A;  1Y6X A;  5L3E A;  4DV6 B;  2ODM A;  2ETN A;  4QJF B;  4DR3 O;  2D2C B;  2CGO A;  3RYI B;  2QDO A;  1RSO A;  4LFA O;  4LF5 O;  4I9W A;  1OZ0 A;  3ZHT A;  1NVP B;  4C7U A;  2Y4U A;  5IYZ A;  4MW3 A;  2QTS A;  5IWA O;  3HB3 B;  5DN6 G;  1HR0 O;  5B3S B;  4D7T A;  2GUZ B;  1Y74 B;  2EUL A;  4DV2 O;  4FJC C;  3I56 V;  5KA6 A;  5FPR A;  4YY3 B;  3RVY A;  3QNE A;  3F5T A;  1XNQ O;  4JPR A;  1FKA O;  1W59 A;  3OTF A;  1DK1 A;  3JYC A;  4JI0 O;  4J10 A;  3ZN1 A;  4FM1 A;  1XUQ A;  4DW0 A;  1NH2 B;  3E22 B;  2P06 A;  1GM8 A;  4GT1 A;  2HHH O;  2QKC A;  5CA0 B;  4J7J A;  1H2S B;  4U3J A;  1XMQ O;  4ZHQ B;  3K0G A;  1KEC A;  1JFF B;  3E22 A;  1GMG A;  1R3J C;  3JAT A;  4WF9 V; 
#chains in the Genus database with same CATH homology
 1UJW B;  4MSW C;  4QPK A;  5E1A C;  2ZXW C;  4WFE A;  3SYO A;  3ABL C;  1R3K C;  2WPD G;  2EBO A;  1BHB A;  3ABM B;  3ZRV A;  1YTF B;  2LFR A;  4PA4 A;  3NXS A;  1QLE B;  5IYD O;  4BW5 A;  1R3I C;  2W0F C;  3OW2 U;  2WLJ A;  4UXN A;  4XDK A;  3ZMV A;  3T2M A;  1YSC A;  1S3J A;  2CK3 G;  1KKD A;  2KB1 A;  4GX2 A;  3CCM V;  5IYC O;  2Q69 A;  1OCR C;  4DO2 A;  1BMF G;  1M9N A;  4MT8 A;  1GO3 F;  4RUF A;  1VQ8 V;  4RQE A;  2NNU A;  4PDM A;  3ETD A;  4LBE C;  3ZMS A;  2WLM A;  4WFH A;  4J9Z B;  1GKF A;  4KP4 A;  5B3S C;  4CBC A;  3LNM B;  4RAI A;  3OR6 C;  4YXW G;  1M56 B;  4JF3 A;  4MTO A;  4Q20 A;  3ABU A;  1E79 G;  1RPR A;  4P30 A;  1N8R W;  2X6B A;  4FPP A;  3OE7 G;  3W7S A;  3X2Q C;  3JD3 A;  2X7R B;  3AEI A;  4LCU C;  2P6J A;  2EIN B;  1CEZ A;  3OR7 C;  1EZJ A;  1EFR G;  3QO5 A;  2IJJ A;  2IU0 A;  3G6E V;  1H8E G;  2LP7 A;  3IFX A;  5B1O A;  3FB7 C;  1SET A;  1K34 A;  4L87 A;  2P67 A;  1FFT B;  1P7B A;  3QO8 A;  2JJ2 G;  4R7C A;  2Y69 B;  2FTK A;  1YI2 V;  2HR3 A;  1E1R G;  2DQ3 A;  1P4R A;  3FB6 C;  5J9P C;  1VQ5 V;  4PDL A;  2GSM B;  3CC7 V;  3GWO A;  1Q86 W;  3BY6 A;  3CCL V;  1OCZ B;  3ZJZ A;  2QM7 A;  3OUS A;  4CZZ A;  2HG5 C;  3HPL C;  1QVF U;  3ASN C;  4Z1M G;  4UUJ C;  3VBB A;  2EIJ C;  1Y4M A;  3E86 A;  1VQK V;  1ARO P;  4H33 A;  4ZBM A;  1I5X A;  5CMU A;  3FB5 C;  2Z5U A;  3ZN0 A;  1NQT A;  4QNH B;  3SPJ A;  3ABM C;  3JD4 A;  3SPI A;  2XND G;  5HFL A;  3WG7 B;  3CCR V;  1QLE C;  5EC2 C;  3QO7 A;  4RQF A;  3CCE V;  1VQN V;  4F4L A;  1K73 W;  1S5H C;  5B1N A;  3FB8 C;  5EK0 A;  3D36 A;  2OTJ V;  1M1K W;  3LDC A;  1YIJ V;  1K3E A;  1PNK A;  3OMA B;  4WFG A;  2WLL A;  1EBO A;  2DYR B;  4HYO A;  2DWE C;  1V54 B;  1W0K G;  4WFB V;  2W6I G;  3X2Q B;  1QCE A;  2QKS A;  2XAH A;  2BOC C;  3RBZ A;  2WLI B;  3E35 A;  3K0D A;  5CN0 A;  4G2K A;  4N21 A;  2JDI G;  1VQP V;  5CBF A;  1M56 C;  5KUK A;  3F7Y C;  3ZRW B;  2ZDI A;  2XAQ A;  2HVJ C;  1XL6 A;  4PDV A;  1PNL A;  3AG4 B;  5CA3 A;  1ZWI C;  3SPG A;  1THZ A;  3F7V C;  5FL7 G;  3AG1 B;  2EIN C;  4PDR A;  1OHH G;  3M99 B;  2BOB C;  2A0L A;  3SPH A;  1AJP A;  4PA3 A;  3CC4 V;  1WPX A;  3OGC C;  4J9Y B;  2LFS A;  5EBW C;  3ZRW A;  1FS0 G;  4JGS A;  1F4M A;  5CBG A;  2JK5 C;  1BL8 A;  1IXM A;  2WLH A;  3JCZ A;  1R3L C;  1AJN A;  1KP3 A;  2Y69 C;  1L1F A;  3CC2 V;  1PL0 A;  3RW0 A;  4X88 A;  3T4D A;  1HWY A;  2C2A A;  2D3O W;  1YJW V;  1G8M A;  3CCQ V;  1KQS U;  1FXK A;  3G71 V;  5KA5 A;  1OCZ C;  4H37 A;  4PA6 A;  5CBH A;  2XAF A;  2IJH A;  1WLE A;  4GX5 A;  2IJI A;  3K06 A;  4E2L A;  1KD1 W;  3F5W C;  3I55 V;  1K8A W;  2Q68 A;  3K04 A;  5LGN A;  4PEL A;  3P30 A;  5LHI A;  2AHY A;  3K9A A;  5L3D A;  3BEH A;  5IY5 B;  3A0R A;  5B1B B;  3WG7 C;  2B5U A;  5LGU A;  3CCS V;  1SRY A;  1JOY A;  3OM3 B;  4GX0 A;  2DYS B;  3E8B A;  4EKW A;  1NR1 A;  5KUM A;  2HLD G;  2EJR A;  2PI5 A;  3ETE A;  3CYO A;  2A79 B;  1VQL V;  1DLB A;  4MVU A;  4JTA B;  3TK1 A;  3DTU B;  2DYR C;  1V54 C;  3RVZ A;  4DXW A;  2QA4 V;  2OT5 A;  4P9O A;  2XAS A;  2HFE C;  1AI5 A;  4UVA A;  1W2B U;  4G27 B;  5L3F A;  4PA7 A;  3JD1 A;  3SYA A;  1YHQ V;  5EC1 C;  3SYC A;  1K9M W;  4JYB A;  1Q7Y W;  3WFV A;  3B77 A;  1K97 A;  4R6Z A;  3EHB B;  3CPW U;  5BZB A;  1CPY A;  3K79 A;  5L3B A;  3AG4 C;  2B1I A;  2GHY A;  1K33 A;  1NH2 D;  2EZO A;  2Z3Y A;  4RO2 A;  1F23 A;  4WFA V;  1H38 A;  1Y66 A;  3AG1 C;  5LGT A;  4FK5 C;  3FYE B;  5LBQ A;  4GX1 A;  4JAS A;  1JCH A;  4MS2 A;  2AHZ A;  1GK9 A;  1W0J G;  3GB7 C;  1JVM A;  5HFM A;  2XAG A;  3W7T A;  1R6K A;  1AI7 A;  5H6Q A;  1AR1 B;  4WCE V;  1RM1 C;  1YJ9 V;  3SJQ C;  3PJS K;  2B1G A;  5H9C A;  4WF9 V;  1FXV A;  3G4S V;  2EZP A;  1ORQ C;  3IGA C;  4R50 A;  4X8A A;  1XL4 A;  4QPJ A;  4UVB A;  1S76 D;  2WLL B;  2YSU B;  3ZMZ A;  3R65 A;  5LHG A;  3E89 A;  4MVZ A;  4XDJ A;  4TSF G;  4U7O A;  1GM9 A;  4QE7 A;  1K5Q A;  2IW5 A;  2W6J G;  3OMI B;  5EBM C;  2OCC B;  3P32 A;  1Q81 W;  1MSW D;  2NLJ C;  2Q6A A;  1R73 A;  2R9R B;  2HVK C;  5IY5 C;  4WFF A;  2QE7 G;  5B1B C;  3MHH C;  4MVO A;  2A9H A;  3ABT A;  2DYS C;  1ENV A;  1NBM G;  3AG2 B;  1COW G;  2YEV A;  4HAM A;  1S72 V;  2K1E A;  2MK3 A;  3IC7 A;  3SYQ A;  1YIT V;  3OMN B;  1LNQ A;  2WWW A;  3E8G A;  1KC8 W;  2JIZ G;  3W7W A;  1VQM V;  2H94 A;  3ZCC A;  4P2Z A;  3ABK B;  1FXK B;  1TUE B;  3H01 A;  4UV8 A;  1K7D A;  1V55 B;  2JJ1 G;  4LC1 A;  2ZR3 A;  2UXX A;  1PD3 A;  4X89 A;  1RM1 B;  2XAJ A;  1OCO B;  1JJ2 U;  2DQ0 A;  5H6R A;  4MTX A;  5L3C A;  3CD6 V;  2P7T C;  2P90 A;  2WLK A;  5LHH A;  1JPX A;  1QR8 A;  1S0V A;  4KFM A;  1CP9 A;  1F51 A;  2IU3 A;  3VOU A;  3ASO B;  4JAV A;  2IH3 C;  2ZQM A;  3OAA G;  3KG2 A;  4G28 B;  2M7W A;  2X6A A;  3W7X A;  4HZ3 A;  3OFN G;  2H8P C;  1NR7 A;  4MVR A;  4ASU G;  3JD2 A;  3MHS C;  5C93 A;  3T1C A;  1JQ0 A;  4UVC A;  1NVP D;  4JYC A;  1H2G A;  3ETG A;  1JX9 A;  3CCJ V;  2Q67 A;  1SER A;  1B6Q A;  3ZMT A;  3LUT B;  2ZDI C;  1QLN A;  1QR9 A;  1VQO V;  2EIL B;  1G4Y B;  3ZRS A;  2OCC C;  3LSS A;  2R9I A;  1H8H G;  4LP8 A;  3OEE G;  2OTL V;  2X0L A;  2X6C A;  1SZT A;  4JAU A;  1K4D C;  2EIM B;  3CCV V;  4XBF A;  2QM8 A;  1MG1 A;  1AI4 A;  3CME V;  3OUF A;  4MVS A;  3ZIA G;  2ZD9 A;  1S77 D;  1FXH A;  2ATK C;  2V7Q G;  1DF4 A;  3CMA V;  2EIK B;  3AG2 C;  2PI4 A;  1AJQ A;  4R8C A;  1M90 W;  3CXC U;  4MVQ A;  1M57 B;  4FMT A;  4MVM A;  2HKO A;  3LDD A;  1QVG U;  3FYI B;  3DGE A;  1K5S A;  4QIW F;  3JD0 A;  1VQ6 V;  1MOF A;  3FKS G;  2XOK G;  2DW4 A;  5B1A B;  3MD0 A;  4MW8 A;  4MTG A;  1F4N A;  1GM7 A;  2JEX A;  3ABK C;  1FXK C;  3T4Z A;  3E8H A;  1OCC B;  1V55 C;  3LDE A;  3ML0 A;  1VQ7 V;  2IH1 C;  4I5S A;  1NKD A;  2IJK A;  1AI6 A;  1DF5 A;  1R6N A;  2V1D A;  3W7U A;  4JTD B;  2QEX V;  1OCO C;  3B8M A;  3CP1 A;  1PNM A;  1ROP A;  1BHA A;  3AG3 B;  1SES A;  3EFF K;  3ZMU A;  1E1Q G;  3SPC A;  2ZXW B;  1VQ9 V;  4BAY A;  3ABL B;  5GW7 A;  1KP2 A;  4GCZ A;  2UXN A;  2ZR2 A;  1PKX A;  2WAM A;  3SYP A;  3ASO C;  2HJF C;  1RPO A;  4XDL A;  5IYB O;  1YTF D;  5DM6 V;  4BIU A;  3K03 A;  5L3E A;  4QJF B;  1YJN V;  1QBZ A;  3LSQ A;  4P9P A;  1NJI W;  2YEV B;  4I9W A;  1K92 A;  1OZ0 A;  1NVP B;  1VQ4 V;  1OCR B;  1DTO A;  2WLN A;  4TWK A;  1Q82 W;  3CCU V;  4MW3 A;  5L3G A;  3HB3 B;  4JTC B;  5DN6 G;  5B3S B;  2EIL C;  3D3I A;  1MAB G;  2ITD C;  1GTO A;  4FJC C;  3I56 V;  4OXS A;  5KA6 A;  3RVY A;  4UV9 A;  3QNE A;  3E8F A;  4FIP C;  2EIM C;  4JPR A;  4U7N A;  1J95 A;  1K4C C;  2JEU A;  3TCU A;  3JYC A;  3ZRX A;  2EIK C;  5EBL C;  3ZN1 A;  3UM7 A;  3B8N A;  3E2E A;  4KUM A;  4RUE A;  1NH2 B;  1M57 C;  4BIZ A;  2QTO A;  1GM8 A;  3E83 A;  4GT1 A;  3K3W A;  2Y48 A;  2ITC C;  4TT3 G;  5B1A C;  4PA9 A;  3UKM A;  5IDJ A;  1I5Y A;  2WSS G;  4ZKI A;  3STZ C;  1OCC C;  2WLI A;  3K0G A;  4MTF A;  1KEC A;  3OEH G;  3TET A;  3ASN B;  3K08 A;  1GMG A;  1R3J C;  2F43 G;  4QE9 A;  3AG3 C;  3STL C;  2DWD C;  2EIJ B;  4N23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...