2ZQMA

Crystal structure of the prefoldin beta subunit from thermococcus strain ks-1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
114
structure length
114
Chain Sequence
MQNIPPQVQAMLGQLESYQQQLQLVVQQKQKVQLELTEAKKALDEIESLPDDAVVYKTVGTLIVKTTKDKAVAELKEKIETLEVRLNALERQEKKLNEKLKELTAQIQSALRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prefoldin beta subunit 1
publication title Structural and molecular characterization of the prefoldin beta subunit from Thermococcus strain KS-1
pubmed doi rcsb
source organism Thermococcus sp.
molecule tags Chaperone
total genus 45
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01920 Prefoldin_2 Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zqmA00
1FXKB 2ZQMA 2ZDIA 1FXKA 2ZDIC 3AEIA 1FXKC
chains in the Genus database with same CATH superfamily
1IBKB 1Q81W 1H8HG 4OPAA 1QR8A 3FAVB 5KMGA 3AK2A 4JZ2A 4DV1B 4O2BB 3ZBHA 2ADQB 5TISZ 4O2AA 4X89A 1TVKB 3WU2Z 4JYAB 3TJTA 4GYCB 3DC6A 4LNUB 2EJ7A 1M90W 4DR3O 2P90A 3N27A 1N36O 3CRAA 3JD2A 4NTYA 5LMUO 4RQEA 5EIBD 4JI7O 2CTRA 5JCOC 1RSOB 1XL6A 2HHHO 5BZBA 1JR9A 2DMXA 4TQDA 3CMEV 4JPRA 1Y76A 2PGGA 2Y4UA 1KUQA 5EIBC 1VP7A 2M7WA 3KG2A 4ZI7A 1NVPB 2BCCH 3A2FA 3SPGA 3CCMV 3CXCU 2CH7A 4LCUC 1IBLO 1CP9A 1K33A 4DR3B 5B1NA 4EFEA 1EZJA 4FK5C 4UVAA 3SR2C 1FXKC 5HFMA 5LMUB 2IJJA 2HJFC 1FJGO 5C8YA 1AJQA 4O4IB 5LYJB 1PL0A 4UUJC 3M8AA 3G6EV 2WLIA 3E8FA 5CA1B 4AQYO 3D8CA 2F93B 3E2EA 3JD3A 2UUCB 2O57A 4LFAB 4H13B 1OV9A 3VBBA 4IIJB 3CD6V 2ZNJA 3KCXA 4F6RA 1WA8B 2AXTZ 3Q4HB 2HR3A 3FB5C 3HPLC 1MMMA 1R6TA 3DC5A 4MTGA 5GW7A 4JTDB 4BIOA 3H9VA 4K35A 4B3TB 2DWDC 4J9ZB 3U10A 2W0XA 2CTPA 4NXNO 3U0ZA 4LFBO 1NTZH 1EZVH 3UKMA 1DK1A 3OMIB 2UXDO 1KYOF 1EN5A 4NXMO 5CA3A 3OGCC 3SGIA 1ROPA 2YIDA 3QF7A 2VWKA 2XAGA 5L3FA 5BY1A 4UCUA 5KHGA 3UQ8A 2BOBC 1PM9A 3WB1A 2E76B 4JI8O 2ATKC 4PDLA 2QA4V 4LFBB 5LL6Y 2PZSA 1Q7YW 5H6QA 2UXDB 1GN4A 4GX0A 1SKVA 1TGOA 4O4LA 1VF5B 3H1KH 4IGGA 4DR4O 3ZRSA 4H44B 2P4VA 5H5NA 3ZMTA 3W7SA 1AROP 3GWOA 3T4DA 3E89A 5LHIA 3U11A 2PYJA 4YY3O 1PV0A 1I08A 5JVDA 2FMLA 1GN3A 1PL4A 1ZWIC 3RYIB 4CH6A 4ICGA 4DR2O 1K34A 1IZ3A 4FZ0A 1HP8A 1FXKB 4W4KA 1DF5A 2WLJA 4MW3A 4DR4B 4JAUA 1D5AA 5FLXN 3LDDA 5JCOA 1QLNA 4K3AA 3RT3C 2Q73A 2QGNA 4NTXA 2YS8A 3K0DA 1NR7A 1AP6A 2JJ2G 1RPRA 2Q7EA 2QKSA 2ZE8A 2AGAA 2B1GA 1WP7A 4DR2B 1SRYA 2H3OA 3ICXA 2DQ3A 4N23A 4X65B 2BOCC 1IBMO 1XI1A 5B5EZ 2EINB 5IYBO 2RJZA 1JA8A 3CCUV 1JQ0A 2LQTA 1TUBA 5D5QA 4GCZA 4U7NA 3ZN1A 1V54C 4JYBA 5LMNO 2WA3A 4WFAV 4R7CA 2DN9A 1VQMV 2QKCA 3K04A 5J2TB 5FNVA 1LUVA 2AZ2A 4JGSA 3LNMB 4FVMA 3AG3B 3MHHC 4PI2A 3JCUZ 1NTMH 2VQEB 4BAYA 3RVYA 3ABLC 1AR1B 1AI7A 4CH3A 1M56C 4HBNA 5LA6B 3T1CA 1VQKV 1K4CC 1OHHG 2Q8VA 3JALB 1OCOC 1JX9A 2DW4A 3K3WA 1AJPA 5LMNB 2EIMB 4JI1B 1QVGU 2GHYA 2FYUH 2MK3A 2ITCC 3CPWU 3HKEA 1HW7A 4JYCA 4DV0O 2EIKB 1SC5B 2ZXWC 3SYOA 4E4EA 1XMOB 2ZNIA 5LGTA 5CBFA 5IJ0B 4FLUA 1FFXA 1BQ0A 4JTCB 4TV9A 4FPPA 2DYRC 3OR7C 3FYIB 4GX2A 5BR8O 1XMQB 1FKAO 3IFXA 1V9PA 1RM1C 2DQ0A 4G28B 3AG4B 4PELA 1H2GA 2IH3C 5KA6A 3F7VC 3ABUA 4CH5A 3H1LH 4GKKO 3L9DA 1ZTEA 4WFGA 5KHIA 3JAWB 1NTKH 3K03A 3ZHRA 3OUFA 3JAMN 4RQFA 3ZRWB 5BR8B 2NR5A 1KC8W 1BE3H 3JARA 3K58A 2XAFA 3JAKB 4CBCA 3K06A 4DUYO 4DK0A 5CBHA 2CDYA 3ZJZA 4B3SO 1S72V 3RYHB 2YXHA 4X1IB 3BPZA 5KX5B 2N05A 1VF6A 2ZE5A 2ADPA 3QG5A 1V54B 3HKBB 3A8TA 2IM9A 3J81N 2DE0X 4X62O 4ZHQA 1US6A 2ODMA 4GKJB 1YZBA 2Q67A 4EFBA 4DUZO 2UU9O 1K5QA 3ABLB 4B3SB 2JS3A 1HWYA 1M56B 4KP4A 3ZMSA 4ZIBA 3GB7C 2BSKB 2YC0A 4PHZA 4MVUA 1OCZC 4GZRB 1K7DA 4ZOLA 1FYJA 2ZM6B 1K3EA 1SA0B 2KSDA 1AR5A 2R70A 5KHJA 3ETEA 4MSWC 4YJ3B 4X62B 5LP6C 1DLBA 1P49A 2JJ1G 2Q7GA 1E79G 3A0BZ 3JD1A 3K08A 3QVNA 4K8ZA 4TWKA 2ZXWB 1L0LH 4TV8A 4MTOA 4J7ZA 1VQ9V 2BTQA 3T2MA 1S76D 4P9OA 2HKOA 3STZC 4FLXA 4GUNA 3WFVA 4MVMA 4OPHA 2CUGA 3WG7B 2ZKOA 3BVOA 1NQTA 1Q6HA 1S5HC 4LC1A 4RAIA 4YJ2A 1QNMA 2QEXV 5ITZA 2WLLA 2RCVA 2FTKA 4W4LA 4QPJA 5GONA 3ABKC 2ITDC 5CA0B 3OGIB 2UXCO 3O65A 3LSUA 4QE7A 1QQCA 1YTFB 1Z5WA 4JI3O 3OFNG 4AILC 1Q90D 2CGOA 4IYIA 2QWRB 3CB2A 1YJNV 4BW5A 1L0NH 4XBFA 4JI4O 5IE9A 2PI4A 5FPOA 1BHBA 2WWWA 3GWKC 3L74H 1I94O 4K8XA 1GKFA 4Z1VA 1RFYA 5JH7A 5KAIZ 3UO2A 3TK1A 2UXCB 4YIPA 5CB4A 4O4JA 2Q9LA 2RMKB 3N2KA 4F4LA 5B1AC 4JI3B 4MS2A 4PA3A 2YXYA 3D36A 1NVPD 2PUSA 3TXQA 2AHZA 4ASUG 4LF6O 2NLJC 3UO3A 1KU9A 1S5JA 1JMKC 4X20B 3APOA 3K5OA 2EBOA 4WFFA 3O9OA 1YJ9V 1GO3F 5EZYB 2CAZC 1QCEA 2X6AA 1GN6A 1VQOV 5KMGB 3ZS8C 2UUBB 1KP2A 3VQVA 1EM1A 1JCHA 3EVKA 1IBKO 4DR6O 4MVQA 4I9WA 3STLC 3ASNC 5KAFZ 4DV3O 2OT5A 3OTFA 4I0XA 3SYQA 3X2QC 3OEEG 4X9QA 1KP3A 1HNXO 4O2AB 4JF3A 5EYPA 1G4YB 4WFEA 4J41A 2K1EA 2F1MA 4JYAO 1JPXA 1AI4A 3LNNA 2LJ2A 4FLVA 2QR4A 4JASA 1F51A 5KHKA 1GH6A 1M57B 4DR6B 2G38A 2HVJC 5LP6A 2K9PA 4FMTA 1ZLZA 1OCRB 3B8NA 4DV3B 1Y76B 1SETA 1HNXB 5A9GA 1J5EB 3CC2V 4ZI7B 3K5NA 3EFFK 2CH7B 1NU1H 2KB1A 2V4DA 4DV5B 2F43G 3DGEA 4AHCA 4X8AA 1KB9F 1R3KC 2AW9A 1Q43A 1BT8A 3H01A 3CCLV 3LUTB 4HNAA 3AG2C 3H1JH 4BIUA 4UV8A 5C8YB 1NH2D 2B1IA 4KL1A 1B6QA 1GM9A 2IJIA 1SQFA 4J9YB 1F23A 3OEHG 1AI5A 3BA8A 3TETA 4HAMA 4DW1A 2X6CA 2D2CB 2YDEA 1BS3A 2UUCO 5IY5C 4LFAO 2QM7A 5LXTA 2IU0A 5J9PC 1MZFA 4I7ZB 2FL4A 1G6UA 2XTAA 1ORQC 3JCZA 1AVMA 5IJ9A 4X1YB 5EK0A 4LWSA 1YITV 4B3TO 1YI2V 4FLWA 2IJHA 4MVSA 3QO7A 1F4MA 2EX3A 1PP9H 3E22A 1K73W 5C93A 3JD4A 1KBHA 1RSOA 3ZRVA 3P3PA 3UT5B 3F5TA 4B3MO 5B3SC 5F2VO 5KLVH 2OIGA 3RFRA 3T1HO 2OYQA 1IVSA 4CS3A 1XNQB 5BXZA 1M4UA 4JAAA 3OMAB 2JGDB 3CSXA 1I5XA 2JRIA 3RW0A 2DOSA 5LBQA 1KKCA 1M93A 1EBOA 2YI8A 4O4IA 4B3MB 4XDLA 1DF4A 1MOFA 4IT5A 5CMUA 5JVDB 1Z2GA 1VQ6V 3T1HB 5CA1A 3CJHA 4JI2O 4DRXB 4U3JB 3W7UA 4H37A 4IIJA 2D3OW 4YXWG 3BA9A 2Q0AA 3K79A 5B1OA 1E1QG 2Q69A 4UV9A 2BE3A 2QTSA 4FFBA 4EB6A 2X6BA 3UCSC 2WPDG 1WPBA 5B1BC 1R6NA 5EC1C 2Z5UA 1COWG 3BEHA 2QWQB 4JI2B 2WSSG 2GSMB 2IH1C 5JWPA 2QSAA 1XOUA 2R9IA 4NR1A 1NS1A 1K92A 5JJEB 1CPYA 3HKDA 1BGYH 5EBMC 5LOVA 4X65O 3KZIZ 1QLEC 4X66O 2ZD9A 2JEUA 4GT1A 1WPXA 4LH6A 3M99B 1VF6C 1TUBB 1WN7A 2P4KA 4H33A 4EKWA 3J7AU 2VWJA 1N0NA 5FNVB 4UCOA 5FL7G 3JSNA 5H2FZ 1ZUQA 3P32A 4CH4A 3FFQA 3AK3A 3ZEDA 1SQGA 3ZHUA 2VQEO 1SF9A 4X66B 3TGUH 1Y74A 2HVKC 2VS0A 4I55A 3ZHTA 5D5PA 3RGBA 2QWOB 4GX1A 2QWPB 5KHHA 3L75H 4JI1O 3RYCA 3FX7A 1THZA 3HKEB 2P5OA 1Y6XA 2P7TC 1PNKA 2P6JA 5LGNA 1XDCA 4PDRA 1FFXB 1S5LZ 1XMOO 4QIWF 1XUQA 3EXAA 4TV9B 1X59A 3BAAA 4ABMA 1Q8IA 4JI6B 1J95A 4PJ0Z 4I4TB 1XMQO 1GAXA 2ETNA 3JATA 2QE7G 1B3QA 4RUEA 3K57A 4FLYA 1H2KA 2KKWA 3IC9A 3AEIA 4RUFA 2QKAA 2CE4A 5L3EA 5IYZA 2RNBA 4UB8Z 2GTSA 1ZX3A 2Y4TA 1R6KA 3JARB 5DEDA 4LBEC 3R65A 4I9QA 1IXMA 4JAVA 5J2UA 4FM2A 4FIPC 5E1AC 5IYCO 1QLEB 3CEIA 4QJFB 2YIBD 1DTOA 1RPOA 2XASA 2ZIMA 3JALA 4CZZA 5K1PA 4LR3A 2FB5A 1YVWA 4IYHA 3B40A 4MTFA 4ZHQB 4WFHA 4JI0B 1HDJA 4X1KA 2CGNA 3D36C 3FKSG 2LGWA 3HR0A 4GKJO 2B9ZA 4TUYA 4WBNA 3ASOC 3OUSA 2JEXA 2XOKG 3K0GA 3AK1A 2KQXA 4OX9O 1N33O 4DR5O 3JSLA 3RYFA 1HNWO 1FS0G 4WFBV 1PNMA 2BTOA 5L3GA 3E8BA 1WB8A 1K97A 2Q5ZA 3CRRA 3H1IH 2DYSC 2ZM6O 1I0HA 1YF2A 4B7KA 3VOUA 2R9RB 3TCUA 3E83A 2JVDA 3B8MA 4PA7A 4DV4O 4OX9B 4TV8B 1N33B 3ABMC 4D6TH 4DR5B 2WLMA 2XHBA 1V55C 1KQSU 4KHPB 1FD9A 3QO8A 3W7WA 1HNWB 2CTQA 4R8CA 2BTQB 4YHHO 1OCOB 2EIJC 2EZOA 4FLTA 3CC7V 1W0KG 4CS4A 4I5SA 2IBZH 5GTIZ 4DV4B 4FM0A 4O4HA 4YJ2B 2OCCC 2YI9A 1EN6A 5ITZB 2A0LA 3SJBC 3HKCB 2YICA 2ILMA 2DJVA 1GK9A 5GONB 1NJIW 1GM7A 3I55V 3CS5A 4YHHB 2WA4A 2DYRB 2YEVA 2LW7A 1XQ8A 3PN1A 1RM1B 5L3BA 4NVPA 1SZTA 3SJAC 1P4RA 3JD0A 1OCCC 4AI8A 5KUMA 2W0FC 5IDJA 1LNQA 4QE9A 5K1XA 2XAQA 4LF8B 3JASA 4K0KO 5JH7B 1XHXA 3CWBH 1QVFU 1PKXA 5BMVA 5IT9N 4O4JB 4BWAA 3T1YB 3BRCA 4IL6Z 4LP8A 4ZKIA 3OTOB 1IURA 1BQZA 3L71H 4D7TA 3EHBB 1WNSA 4NKGB 4K0KB 4X88A 1HNZO 1XILA 3CX5F 4IHJA 4E2LA 2KG7A 1ZL8B 2YXLA 2RQ6A 2YIBA 4D7SA 3SJCC 4NTWA 5IWAB 2Q6AA 3RBZA 3MDSA 1SQXH 2UUBO 2ARHA 3NR7A 5FPRA 2JS5A 2CK3G 1JFFA 4MVRA 4DR7O 2ZINA 3ABMB 3ZX6A 5EYPB 1HNZB 2IJKA 4J10A 1KMIZ 1OCZB 1O9HA 3SYCA 2QJ1A 2OTLV 2LFRA 5JQGA 2GUZA 1M5IA 4XDKA 4PA6A 4TSFG 3ZN0A 1U96A 1QHTA 2Q4PA 4DV6B 1YCIA 2V1DA 2JIZG 5LP6B 2OTJV 1KKDA 2XNDG 4L87A 2OCCB 3QNEA 4DR7B 1YXBA 1P84F 1NZ6A 2PTMA 5CBGA 1AI6A 1J5EO 3OT7A 3WB2A 3QO5A 2RDCA 3DXRA 5L3DA 4DV5O 2UXNA 1Z5VA 4HNAB 1OCCB 1R3IC 1SESA 4FJCC 4R50A 1CXZB 1W0JG 4DR1B 4FLZA 1I7FA 1JJOA 1UFIA 3R66A 3RWRD 2Y0PA 5DM6V 1XREA 3MD0A 1QBZA 2E74B 3FYEB 2B5UA 1VEWA 2L35A 5L3CA 3CCSV 3ABKB 3SDLA 1AP5A 3HB3B 3DTUB 4X64B 2R72A 2Z0AA 4I50A 5LXTB 3BFRA 4J11A 1AJNA 1VQ8V 2EJRA 3MHSC 2RN9A 4CC6A 3L73H 3SPIA 5IJ9B 1TUEB 4LWSB 1VMGA 2W6IG 3VQWA 3CCEV 1H2MA 2WLIB 3N2GA 4CS2A 1N34B 2F23A 3FB7C 3A0RA 3TXSA 1MSWD 3PJSK 1YEWA 4DO2A 3SJQC 5B1AB 3E22B 1N0JA 3C3SA 1UPGA 3FAVA 4TT3G 4F6RB 1T5EA 3K5LA 4O2BA 5JJJB 4R6ZA 2E3CA 1IX9A 1G8MA 2QTOA 3E8GA 4L8JA 1Q86W 4FFKA 1Q6IA 3F7YC 2C2AA 3I56V 1Y67A 5LHHA 3VQXA 1TVKA 1XNQO 1TA8A 1Q3EA 1N36B 4JV5O 4LNUA 1OJHA 3B2EE 4JI7B 1VQ7V 4ZBMA 1E1RG 5A2QN 2HHHB 3ASNB 1FAFA 3ZMVA 4KXRA 3X2QB 1SQBH 2LO1A 1YJWV 2E75B 1W59A 1WLEA 2EILC 2PI5A 3CJHB 4GLXA 1IBLB 3K59A 1ZAUA 3GVMA 2A7WA 4O4LB 4WF9V 4JV5B 3B4SA 3E86A 2UXBO 2WLKA 1Y66A 4QPKA 4JZGA 2A9HA 2FKXA 3CP1A 2JGUA 1FJGB 1PNLA 4HYOA 4FFBB 4EB6B 2PY5A 2LGQA 1EFRG 1Y4MA 2HP8A 3IAYA 2EINC 3L72H 3ZRXA 3M7MX 4X1YA 5LYJA 1CEZA 1R3JC 3ABTA 4DXWA 4AQYB 4UVBA 4UXNA 3C3TA 3S3WA 5HFLA 2R9AA 4P9PA 2A79B 2UXBB 1LR1A 1IDSA 4N21A 1YHQV 1XL4A 4P30A 3CHXA 2LP7A 4JI5O 3AG2B 3CCQV 3HKDB 3AG3C 2A06H 1VQPV 2NNUA 5LOVB 4LF7O 1WA8A 4KFMA 5LHGA 3Q4HA 3SYPA 3UT5A 4PDVA 1H2NA 4NB5A 2MW2B 2X0LA 2QWNB 2ZCEA 4NXNB 3BCCH 4Z2WA 2YUAA 1NH2B 1R3LC 1VARA 1D2DA 4MW8A 2ZR2A 2UUAO 4NXMB 3SYAA 2EIMC 4UCSA 2WLHA 4J80A 5IY5B 2JGDA 1TAEA 3W7TA 1XNRO 1OZ0A 3JYCA 4JI5B 3CMAV 4EEQA 3WB0A 1H2LA 3P3NA 4LF7B 2GV9A 2EIKC 5EC2C 4JI8B 1I5YA 1BL8A 1Y74B 2YIAA 4I55B 1JVMA 2GTAA 3FD9A 1MG1A 1SS3A 2XT9A 1H2SB 2W6JG 5LGUA 4DRXA 2UUAB 2IU3A 4U3JA 3RYCB 4GX5A 1ENVA 2X7RB 4UB6Z 1N4CA 3BY6A 1XNRB 3AG4C 5CN0A 3CRMA 4OXSA 1U97A 4DV2O 3IGAC 4UCTA 1YSCA 3KCYA 4BR6A 1AB3A 3J80N 3D3IA 2EILB 5DECA 5B3SB 4YY3B 3OR6C 3OM3B 3RYIA 4JI6O 1URFA 1Q5OA 3G80A 2F66C 5EBLC 1FXKA 2LW1A 4P2ZA 1H38A 1XBLA 3L70H 4WCEV 4U3FH 3JATB 4DV2B 4B3RO 2UXXA 1H8EG 4XDJA 3S3XA 4CC5A 3E8HA 4MTXA 4LF9O 2N04A 3VQYA 2JDIG 1X4TA 2QM8A 1QR9A 1KECA 5IYZB 1W2BU 3OE7G 1UJWB 4B08A 3LSQA 2WAMA 4PD4F 3B09A 5J2UB 3KKYA 1RP3B 1XEQA 4U7OA 2LFSA 4A5UB 1IBMB 4B3RB 1BHAA 4RWUA 4LF9B 2Y69C 5B1BB 4F6EA 1NR1A 3CCJV 2HFEC 4PA9A 3APQA 5GTHZ 4MVZA 4C7UA 2P22C 2HLDG 3CRQA 4X1KB 2M6YA 2P67A 3G67A 4QNHB 4JI0O 1FPOA 4J7JA 4TUYB 4WBNB 5J2TA 2HEPA 3B77A 1BMFG 3ETQA 4DK1A 3W7XA 5JJNB 1R1BA 1P7GA 3RYFB 2EULA 1LUWA 1DGSA 2DWEC 1M9NA 3K9SA 1S77D 4UCVA 4PV1B 4UFZA 1GTOA 5LA6A 2VQFO 4LH7A 3RVZA 3G71V 4DV7O 2Y0IA 1BSMA 4I4TA 1B06A 2Q68A 2XAHA 4MVOA 1O9GA 3K9AA 4DV0B 2E5LO 3WG7C 4Q20A 1GM8A 3NXSA 2A3QA 1K4DC 1N32O 1D5NA 1SQVH 1VF7A 1WAZA 1YTFD 3D3QA 4KHPO 2GBOA 5IJ0A 2VQFB 4ZOLB 3T4ZA 4DV7B 1BZKA 2HJDA 2XAJA 4HZ3A 1SQQH 4QGPA 1VQ4V 2PF4E 1IXBA 3FB6C 4O4HB 2CTWA 2E5LB 1MNGA 4GKKB 4JYYA 3LSSA 5EBWC 1N32B 4FZ1A 4RO2A 1YIJV 1S3JA 4MT8A 1GRJA 2QDOA 3JAWA 2YEVB 1JOYA 4J7KA 2IW5A 3CE2A 2ZDIC 3ZRWA 1GN2A 3CRCA 1VQ5V 3JAKA 4DUYB 4Q6GA 3OAAG 3OD4A 1L8DA 1NKDA 1ZSPA 3CCRV 2F4VO 1M1KW 3BABA 4PDMA 3JASB 2Y69B 3SPJA 2ZQMA 5H9CA 2VRZA 3ZCCA 4LF8O 1S0VA 2WLLB 3RYHA 4X1IA 1G1XB 5IYDO 5KX5A 5BMVB 2H8PC 1A32A 2ZIOA 4G2KA 3HKBA 1WB7A 1VQNV 3C90A 1WJZA 3BHPA 4KUMA 3I5DA 1AR4A 2XUMA 1XHZA 1K9MW 3ML0A 3T1YO 4DW0A 5E79Z 5KUKA 4DUZB 4FM1A 2UU9B 3E35A 3RN4A 3K5MA 5DN6G 2F4VB 3OTOO 1HR0O 2AHYA 3A0HZ 3CC4V 1SQPH 4B7EA 3G4SV 2AZ0A 2BSKA 4IHJB 1R73A 2KG7B 1Q82W 3THOA 3LDCA 1P7BA 1L1FA 4OGQB 2PYLA 2OCHA 5CB4B 3AG1C 4LFCO 1SA0A 1PPJH 4G27B 3N2KB 4YJ3A 3ZHQA 4DYLA 4NYKA 4Z1MG 1M57C 5IWAO 1JFFB 4J42A 3ASOB 1MA1A 1MZEA 1OCRC 1HR0B 3ZHVA 4LF5O 1MSDA 1SERA 3HKCA 2V7QG 3ETDA 1KD1W 3ETGA 5AG2A 3ZMZA 5JQGB 2DYSB 1FFTB 1Q6UA 2GUZB 1K8AW 3CXHF 3ZHSA 4UCRA 4LFCB 4JTAB 5H6RA 1YDXA 4DV6O 1B04A 3MAQA 2Q7HA 1F4NA 2OIEA 2ZE7A 1F7YA 4I0XB 2ZE6A 3H1HH 4LF5B 2ZT9B 1GMGA 1V55B 4PA4A 4UVCA 1K5SA 2YSUB 5KA5A 2ZR3A 1VQLV 2H94A 3DXRB 3CCVV 2EIJB 5CA0A 2OWOA 4H0LB 3F5WC 2L6LA 1EN4A 2JK5C 3LDEA 1WP8A 3P30A 4DR1O 4JI4B 1N8RW 3IJ4A 2QM4A 1SZXA 3AG7A 1QU7A 1I94B 1BCCH 1AILA 4TQFA 4BIZA 2GDSA 1NT2B 1ZL8A 2Z3YA 4PI0A 4LF4O 1NI8A 2NN4A 4I50B 1FXHA 1VIBA 2ZDIA 4X64O 2Y48A 4LF6B 2EZPA 3OW2U 1JJ2U 4DV1O 3CYOA 1FXVA 2P06A 3SPHA 5B66Z 4X20A 1NBMG 2F95B 3ZIAG 4TOIA 2Q0OC 3N2GB 2HG5C 3UM7A 2N74A 5EZYA 3ZMUA 2WLNA 3OMNB 1PD3A 3SPCA 3AG1B 3IC7A 1N34O 4LF4B 3G6BA 1MABG 3FB8C 3QTCA 4BW9A 4YIOA 3DSQA
chains in the Genus database with same CATH topology
1Q81W 1H8HG 4KFMA 5LHGA 3SYPA 1QR8A 3AEIA 4RUFA 4PDVA 5L3EA 2X0LA 4P9OA 2HKOA 3STZC 3WFVA 1R6KA 1NH2B 4LBEC 3R65A 1R3LC 1IXMA 4JAVA 4MVMA 4MW8A 2ZR2A 3WG7B 4FIPC 3SYAA 4X89A 5E1AC 1NQTA 2EIMC 1S5HC 4LC1A 4RAIA 2WLHA 2QEXV 5IY5B 3W7TA 2WLLA 5IYCO 1QLEB 1OZ0A 3JYCA 3CMAV 2FTKA 4QPJA 4QJFB 1M90W 3ABKC 2P90A 2ITDC 3JD2A 2EIKC 1DTOA 4QE7A 1RPOA 4RQEA 1YTFB 5EC2C 2XASA 1I5YA 1BL8A 4CZZA 1XL6A 3OFNG 1JVMA 5BZBA 3CMEV 4MTFA 1MG1A 4WFHA 4JPRA 2W6JG 5LGUA 1YJNV 2M7WA 3FKSG 3KG2A 4BW5A 1NVPB 3SPGA 4XBFA 2IU3A 3CCMV 3CXCU 4GX5A 1ENVA 2X7RB 3ASOC 4LCUC 2PI4A 3BY6A 3OUSA 1BHBA 2WWWA 2JEXA 1CP9A 2XOKG 3K0GA 1GKFA 3AG4C 5CN0A 1K33A 4OXSA 3TK1A 5B1NA 1EZJA 1FS0G 4WFBV 1PNMA 3IGAC 4FK5C 3E8BA 1FXKC 1YSCA 4UVAA 5HFMA 5L3GA 1K97A 2IJJA 3D3IA 4F4LA 2EILB 2HJFC 5B1AC 5B3SB 3OR6C 4MS2A 2DYSC 4PA3A 3D36A 1NVPD 3OM3B 1AJQA 2AHZA 4ASUG 2NLJC 3VOUA 1PL0A 2R9RB 3TCUA 4UUJC 3E83A 3G6EV 2WLIA 3B8MA 4PA7A 3E8FA 2EBOA 4WFFA 5EBLC 1YJ9V 3E2EA 1GO3F 3JD3A 1FXKA 4P2ZA 1H38A 4WCEV 3ABMC 3VBBA 2WLMA 1KQSU 1V55C 1QCEA 3CD6V 2UXXA 1H8EG 3QO8A 4XDJA 3W7WA 3E8HA 4MTXA 4R8CA 2X6AA 2JDIG 1VQOV 2HR3A 2QM8A 1OCOB 1KP2A 2EIJC 1QR9A 1KECA 3FB5C 3HPLC 1JCHA 4MTGA 2EZOA 4MVQA 5GW7A 4I9WA 1W2BU 4JTDB 3OE7G 1UJWB 3LSQA 3STLC 3ASNC 2WAMA 3CC7V 1W0KG 2DWDC 4J9ZB 2OT5A 3SYQA 3X2QC 3OEEG 4I5SA 1KP3A 3UKMA 3OMIB 4JF3A 1G4YB 2OCCC 4WFEA 5CA3A 3OGCC 1ROPA 4U7OA 2K1EA 2A0LA 2LFSA 1NJIW 2XAGA 1GK9A 5L3FA 1BHAA 1GM7A 3I55V 1JPXA 1AI4A 2Y69C 5B1BB 1NR1A 2DYRB 4JASA 1F51A 2YEVA 2BOBC 1M57B 3CCJV 2HVJC 2HFEC 4PA9A 1RM1B 4FMTA 4MVZA 5L3BA 1OCRB 2ATKC 3B8NA 4PDLA 2QA4V 1SZTA 1P4RA 1SETA 2HLDG 1OCCC 3JD0A 5KUMA 2P67A 2W0FC 3CC2V 4QNHB 1Q7YW 5H6QA 4GX0A 3EFFK 5IDJA 1LNQA 4QE9A 2KB1A 3B77A 2XAQA 1BMFG 3W7XA 2F43G 3DGEA 4X8AA 1QVFU 3ZRSA 1R3KC 1PKXA 2DWEC 1M9NA 1S77D 3ZMTA 3W7SA 1AROP 3H01A 3GWOA 3CCLV 3LUTB 3AG2C 4BIUA 1GTOA 3T4DA 3E89A 4UV8A 5LHIA 3RVZA 3G71V 1NH2D 2B1IA 4LP8A 1B6QA 1GM9A 4ZKIA 1ZWIC 2Q68A 2XAHA 2IJIA 4MVOA 4J9YB 1K34A 3EHBB 3K9AA 1F23A 3OEHG 3WG7C 1AI5A 1FXKB 4X88A 1DF5A 2WLJA 4HAMA 3TETA 4MW3A 2X6CA 4Q20A 1GM8A 3NXSA 1K4DC 5IY5C 4E2LA 4JAUA 2QM7A 3LDDA 1YTFD 2IU0A 5J9PC 1QLNA 3T4ZA 2Q6AA 3RBZA 1ORQC 2XAJA 3JCZA 3K0DA 1NR7A 2CK3G 2JJ2G 4HZ3A 4MVRA 5EK0A 1RPRA 2QKSA 1YITV 2B1GA 3ABMB 1VQ4V 3FB6C 1SRYA 1YI2V 3LSSA 2IJHA 2IJKA 2DQ3A 5EBWC 1OCZB 4N23A 4RO2A 1YIJV 4MVSA 3SYCA 3QO7A 1F4MA 1S3JA 2BOCC 2LFRA 4MT8A 2OTLV 1K73W 5C93A 4XDKA 3JD4A 3ZMUA 2EINB 4PA6A 4TSFG 3ZN0A 2YEVB 1JOYA 5IYBO 2IW5A 2V1DA 2JIZG 2OTJV 3CCUV 3ZRVA 1KKDA 1JQ0A 2XNDG 2ZDIC 4L87A 3ZRWA 3ZN1A 4GCZA 4U7NA 2OCCB 1V54C 5B3SC 3QNEA 1VQ5V 4JYBA 3OAAG 1NKDA 3CCRV 4WFAV 4R7CA 1VQMV 5CBGA 1AI6A 1M1KW 3K04A 4PDMA 2Y69B 3SPJA 4JGSA 3QO5A 2ZQMA 3LNMB 5H9CA 3AG3B 3MHHC 3OMAB 3ZCCA 4BAYA 3RVYA 2WLLB 1S0VA 3ABLC 5IYDO 5L3DA 2H8PC 1I5XA 3RW0A 1AR1B 1AI7A 2UXNA 1M56C 4G2KA 1VQNV 5LBQA 1OCCB 1R3IC 1SESA 4FJCC 4R50A 3T1CA 4KUMA 1W0JG 1VQKV 1K4CC 1EBOA 1OHHG 1K9MW 3ML0A 4XDLA 1DF4A 1OCOC 1JX9A 2DW4A 1MOFA 1AJPA 3K3WA 5CMUA 5KUKA 1VQ6V 2EIMB 1QVGU 2GHYA 3E35A 5DN6G 2MK3A 5DM6V 3MD0A 1QBZA 3FYEB 3CC4V 2AHYA 2B5UA 2ITCC 5L3CA 3W7UA 3CCSV 4H37A 3ABKB 3G4SV 3CPWU 4JYCA 4YXWG 2D3OW 3HB3B 3K79A 5B1OA 2EIKB 1E1QG 1R73A 2Q69A 3DTUB 4UV9A 2ZXWC 1Q82W 3SYOA 5LGTA 3LDCA 1P7BA 1L1FA 5CBFA 2X6BA 1AJNA 3AG1C 1VQ8V 2EJRA 4G27B 4JTCB 3MHSC 2WPDG 5B1BC 1R6NA 4FPPA 2DYRC 3OR7C 5EC1C 2Z5UA 3FYIB 4GX2A 3SPIA 4Z1MG 1M57C 1COWG 3BEHA 3ASOB 3IFXA 1TUEB 1RM1C 2DQ0A 2WSSG 4G28B 1OCRC 2GSMB 2W6IG 2IH1C 3AG4B 4PELA 3CCEV 1H2GA 2WLIB 2IH3C 1SERA 2R9IA 5KA6A 2V7QG 3F7VC 3ABUA 3ETDA 1KD1W 3FB7C 3A0RA 1MSWD 3PJSK 3ETGA 4DO2A 4WFGA 3SJQC 1K92A 3ZMZA 5B1AB 1CPYA 2DYSB 1FFTB 5EBMC 1K8AW 1QLEC 4JTAB 5H6RA 4TT3G 2ZD9A 3K03A 2JEUA 3OUFA 4GT1A 4RQFA 1WPXA 3ZRWB 3M99B 1KC8W 4R6ZA 2XAFA 1F4NA 4CBCA 1G8MA 2QTOA 3E8GA 3K06A 4H33A 4EKWA 1Q86W 3F7YC 2C2AA 3I56V 1GMGA 5CBHA 1V55B 3ZJZA 5LHHA 4PA4A 4UVCA 5FL7G 3P32A 1K5SA 1S72V 2YSUB 5KA5A 2ZR3A 1VQLV 2H94A 3CCVV 2EIJB 1VQ7V 4ZBMA 1E1RG 1V54B 3ASNB 3F5WC 3ZMVA 2HVKC 3X2QB 2JK5C 3LDEA 1YJWV 3P30A 1WLEA 4GX1A 2EILC 1N8RW 2Q67A 2PI5A 1K5QA 3ABLB 1HWYA 1M56B 1THZA 4KP4A 3ZMSA 4BIZA 4WF9V 3E86A 3GB7C 2WLKA 1Y66A 2Z3YA 4QPKA 2A9HA 2P7TC 1PNKA 3CP1A 1OCZC 4MVUA 1PNLA 4HYOA 1FXHA 2ZDIA 1K7DA 2P6JA 5LGNA 1K3EA 4PDRA 2Y48A 1EFRG 1Y4MA 4QIWF 3ETEA 4MSWC 2EZPA 2EINC 3OW2U 3ZRXA 1JJ2U 1CEZA 1J95A 1DLBA 1R3JC 3CYOA 1FXVA 3ABTA 3SPHA 2JJ1G 3K08A 1E79G 3JD1A 4DXWA 4UVBA 1NBMG 4UXNA 3ZIAG 4TWKA 2ZXWB 5HFLA 4P9PA 2HG5C 2A79B 3UM7A 4N21A 1YHQV 1XL4A 4MTOA 2WLNA 2LP7A 1PD3A 3OMNB 2QE7G 3AG1B 3IC7A 4P30A 3SPCA 1VQ9V 3AG2B 1MABG 3FB8C 4RUEA 3CCQV 3T2MA 1S76D 3AG3C 1VQPV 2NNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXK B;  2ZQM A;  2ZDI A;  1FXK A;  2ZDI C;  3AEI A;  1FXK C; 
#chains in the Genus database with same CATH topology
 1IBK B;  1Q81 W;  1H8H G;  4OPA A;  1QR8 A;  3FAV B;  5KMG A;  3AK2 A;  4JZ2 A;  4DV1 B;  4O2B B;  3ZBH A;  2ADQ B;  5TIS Z;  4O2A A;  4X89 A;  1TVK B;  3WU2 Z;  4JYA B;  3TJT A;  4GYC B;  3DC6 A;  4LNU B;  2EJ7 A;  1M90 W;  4DR3 O;  2P90 A;  3N27 A;  1N36 O;  3CRA A;  3JD2 A;  4NTY A;  5LMU O;  4RQE A;  5EIB D;  4JI7 O;  2CTR A;  5JCO C;  1RSO B;  1XL6 A;  2HHH O;  5BZB A;  1JR9 A;  2DMX A;  4TQD A;  3CME V;  4JPR A;  1Y76 A;  2PGG A;  2Y4U A;  1KUQ A;  5EIB C;  1VP7 A;  2M7W A;  3KG2 A;  4ZI7 A;  1NVP B;  2BCC H;  3A2F A;  3SPG A;  3CCM V;  3CXC U;  2CH7 A;  4LCU C;  1IBL O;  1CP9 A;  1K33 A;  4DR3 B;  5B1N A;  4EFE A;  1EZJ A;  4FK5 C;  4UVA A;  3SR2 C;  1FXK C;  5HFM A;  5LMU B;  2IJJ A;  2HJF C;  1FJG O;  5C8Y A;  1AJQ A;  4O4I B;  5LYJ B;  1PL0 A;  4UUJ C;  3M8A A;  3G6E V;  2WLI A;  3E8F A;  5CA1 B;  4AQY O;  3D8C A;  2F93 B;  3E2E A;  3JD3 A;  2UUC B;  2O57 A;  4LFA B;  4H13 B;  1OV9 A;  3VBB A;  4IIJ B;  3CD6 V;  2ZNJ A;  3KCX A;  4F6R A;  1WA8 B;  2AXT Z;  3Q4H B;  2HR3 A;  3FB5 C;  3HPL C;  1MMM A;  1R6T A;  3DC5 A;  4MTG A;  5GW7 A;  4JTD B;  4BIO A;  3H9V A;  4K35 A;  4B3T B;  2DWD C;  4J9Z B;  3U10 A;  2W0X A;  2CTP A;  4NXN O;  3U0Z A;  4LFB O;  1NTZ H;  1EZV H;  3UKM A;  1DK1 A;  3OMI B;  2UXD O;  1KYO F;  1EN5 A;  4NXM O;  5CA3 A;  3OGC C;  3SGI A;  1ROP A;  2YID A;  3QF7 A;  2VWK A;  2XAG A;  5L3F A;  5BY1 A;  4UCU A;  5KHG A;  3UQ8 A;  2BOB C;  1PM9 A;  3WB1 A;  2E76 B;  4JI8 O;  2ATK C;  4PDL A;  2QA4 V;  4LFB B;  5LL6 Y;  2PZS A;  1Q7Y W;  5H6Q A;  2UXD B;  1GN4 A;  4GX0 A;  1SKV A;  1TGO A;  4O4L A;  1VF5 B;  3H1K H;  4IGG A;  4DR4 O;  3ZRS A;  4H44 B;  2P4V A;  5H5N A;  3ZMT A;  3W7S A;  1ARO P;  3GWO A;  3T4D A;  3E89 A;  5LHI A;  3U11 A;  2PYJ A;  4YY3 O;  1PV0 A;  1I08 A;  5JVD A;  2FML A;  1GN3 A;  1PL4 A;  1ZWI C;  3RYI B;  4CH6 A;  4ICG A;  4DR2 O;  1K34 A;  1IZ3 A;  4FZ0 A;  1HP8 A;  1FXK B;  4W4K A;  1DF5 A;  2WLJ A;  4MW3 A;  4DR4 B;  4JAU A;  1D5A A;  5FLX N;  3LDD A;  5JCO A;  1QLN A;  4K3A A;  3RT3 C;  2Q73 A;  2QGN A;  4NTX A;  2YS8 A;  3K0D A;  1NR7 A;  1AP6 A;  2JJ2 G;  1RPR A;  2Q7E A;  2QKS A;  2ZE8 A;  2AGA A;  2B1G A;  1WP7 A;  4DR2 B;  1SRY A;  2H3O A;  3ICX A;  2DQ3 A;  4N23 A;  4X65 B;  2BOC C;  1IBM O;  1XI1 A;  5B5E Z;  2EIN B;  5IYB O;  2RJZ A;  1JA8 A;  3CCU V;  1JQ0 A;  2LQT A;  1TUB A;  5D5Q A;  4GCZ A;  4U7N A;  3ZN1 A;  1V54 C;  4JYB A;  5LMN O;  2WA3 A;  4WFA V;  4R7C A;  2DN9 A;  1VQM V;  2QKC A;  3K04 A;  5J2T B;  5FNV A;  1LUV A;  2AZ2 A;  4JGS A;  3LNM B;  4FVM A;  3AG3 B;  3MHH C;  4PI2 A;  3JCU Z;  1NTM H;  2VQE B;  4BAY A;  3RVY A;  3ABL C;  1AR1 B;  1AI7 A;  4CH3 A;  1M56 C;  4HBN A;  5LA6 B;  3T1C A;  1VQK V;  1K4C C;  1OHH G;  2Q8V A;  3JAL B;  1OCO C;  1JX9 A;  2DW4 A;  3K3W A;  1AJP A;  5LMN B;  2EIM B;  4JI1 B;  1QVG U;  2GHY A;  2FYU H;  2MK3 A;  2ITC C;  3CPW U;  3HKE A;  1HW7 A;  4JYC A;  4DV0 O;  2EIK B;  1SC5 B;  2ZXW C;  3SYO A;  4E4E A;  1XMO B;  2ZNI A;  5LGT A;  5CBF A;  5IJ0 B;  4FLU A;  1FFX A;  1BQ0 A;  4JTC B;  4TV9 A;  4FPP A;  2DYR C;  3OR7 C;  3FYI B;  4GX2 A;  5BR8 O;  1XMQ B;  1FKA O;  3IFX A;  1V9P A;  1RM1 C;  2DQ0 A;  4G28 B;  3AG4 B;  4PEL A;  1H2G A;  2IH3 C;  5KA6 A;  3F7V C;  3ABU A;  4CH5 A;  3H1L H;  4GKK O;  3L9D A;  1ZTE A;  4WFG A;  5KHI A;  3JAW B;  1NTK H;  3K03 A;  3ZHR A;  3OUF A;  3JAM N;  4RQF A;  3ZRW B;  5BR8 B;  2NR5 A;  1KC8 W;  1BE3 H;  3JAR A;  3K58 A;  2XAF A;  3JAK B;  4CBC A;  3K06 A;  4DUY O;  4DK0 A;  5CBH A;  2CDY A;  3ZJZ A;  4B3S O;  1S72 V;  3RYH B;  2YXH A;  4X1I B;  3BPZ A;  5KX5 B;  2N05 A;  1VF6 A;  2ZE5 A;  2ADP A;  3QG5 A;  1V54 B;  3HKB B;  3A8T A;  2IM9 A;  3J81 N;  2DE0 X;  4X62 O;  4ZHQ A;  1US6 A;  2ODM A;  4GKJ B;  1YZB A;  2Q67 A;  4EFB A;  4DUZ O;  2UU9 O;  1K5Q A;  3ABL B;  4B3S B;  2JS3 A;  1HWY A;  1M56 B;  4KP4 A;  3ZMS A;  4ZIB A;  3GB7 C;  2BSK B;  2YC0 A;  4PHZ A;  4MVU A;  1OCZ C;  4GZR B;  1K7D A;  4ZOL A;  1FYJ A;  2ZM6 B;  1K3E A;  1SA0 B;  2KSD A;  1AR5 A;  2R70 A;  5KHJ A;  3ETE A;  4MSW C;  4YJ3 B;  4X62 B;  5LP6 C;  1DLB A;  1P49 A;  2JJ1 G;  2Q7G A;  1E79 G;  3A0B Z;  3JD1 A;  3K08 A;  3QVN A;  4K8Z A;  4TWK A;  2ZXW B;  1L0L H;  4TV8 A;  4MTO A;  4J7Z A;  1VQ9 V;  2BTQ A;  3T2M A;  1S76 D;  4P9O A;  2HKO A;  3STZ C;  4FLX A;  4GUN A;  3WFV A;  4MVM A;  4OPH A;  2CUG A;  3WG7 B;  2ZKO A;  3BVO A;  1NQT A;  1Q6H A;  1S5H C;  4LC1 A;  4RAI A;  4YJ2 A;  1QNM A;  2QEX V;  5ITZ A;  2WLL A;  2RCV A;  2FTK A;  4W4L A;  4QPJ A;  5GON A;  3ABK C;  2ITD C;  5CA0 B;  3OGI B;  2UXC O;  3O65 A;  3LSU A;  4QE7 A;  1QQC A;  1YTF B;  1Z5W A;  4JI3 O;  3OFN G;  4AIL C;  1Q90 D;  2CGO A;  4IYI A;  2QWR B;  3CB2 A;  1YJN V;  4BW5 A;  1L0N H;  4XBF A;  4JI4 O;  5IE9 A;  2PI4 A;  5FPO A;  1BHB A;  2WWW A;  3GWK C;  3L74 H;  1I94 O;  4K8X A;  1GKF A;  4Z1V A;  1RFY A;  5JH7 A;  5KAI Z;  3UO2 A;  3TK1 A;  2UXC B;  4YIP A;  5CB4 A;  4O4J A;  2Q9L A;  2RMK B;  3N2K A;  4F4L A;  5B1A C;  4JI3 B;  4MS2 A;  4PA3 A;  2YXY A;  3D36 A;  1NVP D;  2PUS A;  3TXQ A;  2AHZ A;  4ASU G;  4LF6 O;  2NLJ C;  3UO3 A;  1KU9 A;  1S5J A;  1JMK C;  4X20 B;  3APO A;  3K5O A;  2EBO A;  4WFF A;  3O9O A;  1YJ9 V;  1GO3 F;  5EZY B;  2CAZ C;  1QCE A;  2X6A A;  1GN6 A;  1VQO V;  5KMG B;  3ZS8 C;  2UUB B;  1KP2 A;  3VQV A;  1EM1 A;  1JCH A;  3EVK A;  1IBK O;  4DR6 O;  4MVQ A;  4I9W A;  3STL C;  3ASN C;  5KAF Z;  4DV3 O;  2OT5 A;  3OTF A;  4I0X A;  3SYQ A;  3X2Q C;  3OEE G;  4X9Q A;  1KP3 A;  1HNX O;  4O2A B;  4JF3 A;  5EYP A;  1G4Y B;  4WFE A;  4J41 A;  2K1E A;  2F1M A;  4JYA O;  1JPX A;  1AI4 A;  3LNN A;  2LJ2 A;  4FLV A;  2QR4 A;  4JAS A;  1F51 A;  5KHK A;  1GH6 A;  1M57 B;  4DR6 B;  2G38 A;  2HVJ C;  5LP6 A;  2K9P A;  4FMT A;  1ZLZ A;  1OCR B;  3B8N A;  4DV3 B;  1Y76 B;  1SET A;  1HNX B;  5A9G A;  1J5E B;  3CC2 V;  4ZI7 B;  3K5N A;  3EFF K;  2CH7 B;  1NU1 H;  2KB1 A;  2V4D A;  4DV5 B;  2F43 G;  3DGE A;  4AHC A;  4X8A A;  1KB9 F;  1R3K C;  2AW9 A;  1Q43 A;  1BT8 A;  3H01 A;  3CCL V;  3LUT B;  4HNA A;  3AG2 C;  3H1J H;  4BIU A;  4UV8 A;  5C8Y B;  1NH2 D;  2B1I A;  4KL1 A;  1B6Q A;  1GM9 A;  2IJI A;  1SQF A;  4J9Y B;  1F23 A;  3OEH G;  1AI5 A;  3BA8 A;  3TET A;  4HAM A;  4DW1 A;  2X6C A;  2D2C B;  2YDE A;  1BS3 A;  2UUC O;  5IY5 C;  4LFA O;  2QM7 A;  5LXT A;  2IU0 A;  5J9P C;  1MZF A;  4I7Z B;  2FL4 A;  1G6U A;  2XTA A;  1ORQ C;  3JCZ A;  1AVM A;  5IJ9 A;  4X1Y B;  5EK0 A;  4LWS A;  1YIT V;  4B3T O;  1YI2 V;  4FLW A;  2IJH A;  4MVS A;  3QO7 A;  1F4M A;  2EX3 A;  1PP9 H;  3E22 A;  1K73 W;  5C93 A;  3JD4 A;  1KBH A;  1RSO A;  3ZRV A;  3P3P A;  3UT5 B;  3F5T A;  4B3M O;  5B3S C;  5F2V O;  5KLV H;  2OIG A;  3RFR A;  3T1H O;  2OYQ A;  1IVS A;  4CS3 A;  1XNQ B;  5BXZ A;  1M4U A;  4JAA A;  3OMA B;  2JGD B;  3CSX A;  1I5X A;  2JRI A;  3RW0 A;  2DOS A;  5LBQ A;  1KKC A;  1M93 A;  1EBO A;  2YI8 A;  4O4I A;  4B3M B;  4XDL A;  1DF4 A;  1MOF A;  4IT5 A;  5CMU A;  5JVD B;  1Z2G A;  1VQ6 V;  3T1H B;  5CA1 A;  3CJH A;  4JI2 O;  4DRX B;  4U3J B;  3W7U A;  4H37 A;  4IIJ A;  2D3O W;  4YXW G;  3BA9 A;  2Q0A A;  3K79 A;  5B1O A;  1E1Q G;  2Q69 A;  4UV9 A;  2BE3 A;  2QTS A;  4FFB A;  4EB6 A;  2X6B A;  3UCS C;  2WPD G;  1WPB A;  5B1B C;  1R6N A;  5EC1 C;  2Z5U A;  1COW G;  3BEH A;  2QWQ B;  4JI2 B;  2WSS G;  2GSM B;  2IH1 C;  5JWP A;  2QSA A;  1XOU A;  2R9I A;  4NR1 A;  1NS1 A;  1K92 A;  5JJE B;  1CPY A;  3HKD A;  1BGY H;  5EBM C;  5LOV A;  4X65 O;  3KZI Z;  1QLE C;  4X66 O;  2ZD9 A;  2JEU A;  4GT1 A;  1WPX A;  4LH6 A;  3M99 B;  1VF6 C;  1TUB B;  1WN7 A;  2P4K A;  4H33 A;  4EKW A;  3J7A U;  2VWJ A;  1N0N A;  5FNV B;  4UCO A;  5FL7 G;  3JSN A;  5H2F Z;  1ZUQ A;  3P32 A;  4CH4 A;  3FFQ A;  3AK3 A;  3ZED A;  1SQG A;  3ZHU A;  2VQE O;  1SF9 A;  4X66 B;  3TGU H;  1Y74 A;  2HVK C;  2VS0 A;  4I55 A;  3ZHT A;  5D5P A;  3RGB A;  2QWO B;  4GX1 A;  2QWP B;  5KHH A;  3L75 H;  4JI1 O;  3RYC A;  3FX7 A;  1THZ A;  3HKE B;  2P5O A;  1Y6X A;  2P7T C;  1PNK A;  2P6J A;  5LGN A;  1XDC A;  4PDR A;  1FFX B;  1S5L Z;  1XMO O;  4QIW F;  1XUQ A;  3EXA A;  4TV9 B;  1X59 A;  3BAA A;  4ABM A;  1Q8I A;  4JI6 B;  1J95 A;  4PJ0 Z;  4I4T B;  1XMQ O;  1GAX A;  2ETN A;  3JAT A;  2QE7 G;  1B3Q A;  4RUE A;  3K57 A;  4FLY A;  1H2K A;  2KKW A;  3IC9 A;  3AEI A;  4RUF A;  2QKA A;  2CE4 A;  5L3E A;  5IYZ A;  2RNB A;  4UB8 Z;  2GTS A;  1ZX3 A;  2Y4T A;  1R6K A;  3JAR B;  5DED A;  4LBE C;  3R65 A;  4I9Q A;  1IXM A;  4JAV A;  5J2U A;  4FM2 A;  4FIP C;  5E1A C;  5IYC O;  1QLE B;  3CEI A;  4QJF B;  2YIB D;  1DTO A;  1RPO A;  2XAS A;  2ZIM A;  3JAL A;  4CZZ A;  5K1P A;  4LR3 A;  2FB5 A;  1YVW A;  4IYH A;  3B40 A;  4MTF A;  4ZHQ B;  4WFH A;  4JI0 B;  1HDJ A;  4X1K A;  2CGN A;  3D36 C;  3FKS G;  2LGW A;  3HR0 A;  4GKJ O;  2B9Z A;  4TUY A;  4WBN A;  3ASO C;  3OUS A;  2JEX A;  2XOK G;  3K0G A;  3AK1 A;  2KQX A;  4OX9 O;  1N33 O;  4DR5 O;  3JSL A;  3RYF A;  1HNW O;  1FS0 G;  4WFB V;  1PNM A;  2BTO A;  5L3G A;  3E8B A;  1WB8 A;  1K97 A;  2Q5Z A;  3CRR A;  3H1I H;  2DYS C;  2ZM6 O;  1I0H A;  1YF2 A;  4B7K A;  3VOU A;  2R9R B;  3TCU A;  3E83 A;  2JVD A;  3B8M A;  4PA7 A;  4DV4 O;  4OX9 B;  4TV8 B;  1N33 B;  3ABM C;  4D6T H;  4DR5 B;  2WLM A;  2XHB A;  1V55 C;  1KQS U;  4KHP B;  1FD9 A;  3QO8 A;  3W7W A;  1HNW B;  2CTQ A;  4R8C A;  2BTQ B;  4YHH O;  1OCO B;  2EIJ C;  2EZO A;  4FLT A;  3CC7 V;  1W0K G;  4CS4 A;  4I5S A;  2IBZ H;  5GTI Z;  4DV4 B;  4FM0 A;  4O4H A;  4YJ2 B;  2OCC C;  2YI9 A;  1EN6 A;  5ITZ B;  2A0L A;  3SJB C;  3HKC B;  2YIC A;  2ILM A;  2DJV A;  1GK9 A;  5GON B;  1NJI W;  1GM7 A;  3I55 V;  3CS5 A;  4YHH B;  2WA4 A;  2DYR B;  2YEV A;  2LW7 A;  1XQ8 A;  3PN1 A;  1RM1 B;  5L3B A;  4NVP A;  1SZT A;  3SJA C;  1P4R A;  3JD0 A;  1OCC C;  4AI8 A;  5KUM A;  2W0F C;  5IDJ A;  1LNQ A;  4QE9 A;  5K1X A;  2XAQ A;  4LF8 B;  3JAS A;  4K0K O;  5JH7 B;  1XHX A;  3CWB H;  1QVF U;  1PKX A;  5BMV A;  5IT9 N;  4O4J B;  4BWA A;  3T1Y B;  3BRC A;  4IL6 Z;  4LP8 A;  4ZKI A;  3OTO B;  1IUR A;  1BQZ A;  3L71 H;  4D7T A;  3EHB B;  1WNS A;  4NKG B;  4K0K B;  4X88 A;  1HNZ O;  1XIL A;  3CX5 F;  4IHJ A;  4E2L A;  2KG7 A;  1ZL8 B;  2YXL A;  2RQ6 A;  2YIB A;  4D7S A;  3SJC C;  4NTW A;  5IWA B;  2Q6A A;  3RBZ A;  3MDS A;  1SQX H;  2UUB O;  2ARH A;  3NR7 A;  5FPR A;  2JS5 A;  2CK3 G;  1JFF A;  4MVR A;  4DR7 O;  2ZIN A;  3ABM B;  3ZX6 A;  5EYP B;  1HNZ B;  2IJK A;  4J10 A;  1KMI Z;  1OCZ B;  1O9H A;  3SYC A;  2QJ1 A;  2OTL V;  2LFR A;  5JQG A;  2GUZ A;  1M5I A;  4XDK A;  4PA6 A;  4TSF G;  3ZN0 A;  1U96 A;  1QHT A;  2Q4P A;  4DV6 B;  1YCI A;  2V1D A;  2JIZ G;  5LP6 B;  2OTJ V;  1KKD A;  2XND G;  4L87 A;  2OCC B;  3QNE A;  4DR7 B;  1YXB A;  1P84 F;  1NZ6 A;  2PTM A;  5CBG A;  1AI6 A;  1J5E O;  3OT7 A;  3WB2 A;  3QO5 A;  2RDC A;  3DXR A;  5L3D A;  4DV5 O;  2UXN A;  1Z5V A;  4HNA B;  1OCC B;  1R3I C;  1SES A;  4FJC C;  4R50 A;  1CXZ B;  1W0J G;  4DR1 B;  4FLZ A;  1I7F A;  1JJO A;  1UFI A;  3R66 A;  3RWR D;  2Y0P A;  5DM6 V;  1XRE A;  3MD0 A;  1QBZ A;  2E74 B;  3FYE B;  2B5U A;  1VEW A;  2L35 A;  5L3C A;  3CCS V;  3ABK B;  3SDL A;  1AP5 A;  3HB3 B;  3DTU B;  4X64 B;  2R72 A;  2Z0A A;  4I50 A;  5LXT B;  3BFR A;  4J11 A;  1AJN A;  1VQ8 V;  2EJR A;  3MHS C;  2RN9 A;  4CC6 A;  3L73 H;  3SPI A;  5IJ9 B;  1TUE B;  4LWS B;  1VMG A;  2W6I G;  3VQW A;  3CCE V;  1H2M A;  2WLI B;  3N2G A;  4CS2 A;  1N34 B;  2F23 A;  3FB7 C;  3A0R A;  3TXS A;  1MSW D;  3PJS K;  1YEW A;  4DO2 A;  3SJQ C;  5B1A B;  3E22 B;  1N0J A;  3C3S A;  1UPG A;  3FAV A;  4TT3 G;  4F6R B;  1T5E A;  3K5L A;  4O2B A;  5JJJ B;  4R6Z A;  2E3C A;  1IX9 A;  1G8M A;  2QTO A;  3E8G A;  4L8J A;  1Q86 W;  4FFK A;  1Q6I A;  3F7Y C;  2C2A A;  3I56 V;  1Y67 A;  5LHH A;  3VQX A;  1TVK A;  1XNQ O;  1TA8 A;  1Q3E A;  1N36 B;  4JV5 O;  4LNU A;  1OJH A;  3B2E E;  4JI7 B;  1VQ7 V;  4ZBM A;  1E1R G;  5A2Q N;  2HHH B;  3ASN B;  1FAF A;  3ZMV A;  4KXR A;  3X2Q B;  1SQB H;  2LO1 A;  1YJW V;  2E75 B;  1W59 A;  1WLE A;  2EIL C;  2PI5 A;  3CJH B;  4GLX A;  1IBL B;  3K59 A;  1ZAU A;  3GVM A;  2A7W A;  4O4L B;  4WF9 V;  4JV5 B;  3B4S A;  3E86 A;  2UXB O;  2WLK A;  1Y66 A;  4QPK A;  4JZG A;  2A9H A;  2FKX A;  3CP1 A;  2JGU A;  1FJG B;  1PNL A;  4HYO A;  4FFB B;  4EB6 B;  2PY5 A;  2LGQ A;  1EFR G;  1Y4M A;  2HP8 A;  3IAY A;  2EIN C;  3L72 H;  3ZRX A;  3M7M X;  4X1Y A;  5LYJ A;  1CEZ A;  1R3J C;  3ABT A;  4DXW A;  4AQY B;  4UVB A;  4UXN A;  3C3T A;  3S3W A;  5HFL A;  2R9A A;  4P9P A;  2A79 B;  2UXB B;  1LR1 A;  1IDS A;  4N21 A;  1YHQ V;  1XL4 A;  4P30 A;  3CHX A;  2LP7 A;  4JI5 O;  3AG2 B;  3CCQ V;  3HKD B;  3AG3 C;  2A06 H;  1VQP V;  2NNU A;  5LOV B;  4LF7 O;  1WA8 A;  4KFM A;  5LHG A;  3Q4H A;  3SYP A;  3UT5 A;  4PDV A;  1H2N A;  4NB5 A;  2MW2 B;  2X0L A;  2QWN B;  2ZCE A;  4NXN B;  3BCC H;  4Z2W A;  2YUA A;  1NH2 B;  1R3L C;  1VAR A;  1D2D A;  4MW8 A;  2ZR2 A;  2UUA O;  4NXM B;  3SYA A;  2EIM C;  4UCS A;  2WLH A;  4J80 A;  5IY5 B;  2JGD A;  1TAE A;  3W7T A;  1XNR O;  1OZ0 A;  3JYC A;  4JI5 B;  3CMA V;  4EEQ A;  3WB0 A;  1H2L A;  3P3N A;  4LF7 B;  2GV9 A;  2EIK C;  5EC2 C;  4JI8 B;  1I5Y A;  1BL8 A;  1Y74 B;  2YIA A;  4I55 B;  1JVM A;  2GTA A;  3FD9 A;  1MG1 A;  1SS3 A;  2XT9 A;  1H2S B;  2W6J G;  5LGU A;  4DRX A;  2UUA B;  2IU3 A;  4U3J A;  3RYC B;  4GX5 A;  1ENV A;  2X7R B;  4UB6 Z;  1N4C A;  3BY6 A;  1XNR B;  3AG4 C;  5CN0 A;  3CRM A;  4OXS A;  1U97 A;  4DV2 O;  3IGA C;  4UCT A;  1YSC A;  3KCY A;  4BR6 A;  1AB3 A;  3J80 N;  3D3I A;  2EIL B;  5DEC A;  5B3S B;  4YY3 B;  3OR6 C;  3OM3 B;  3RYI A;  4JI6 O;  1URF A;  1Q5O A;  3G80 A;  2F66 C;  5EBL C;  1FXK A;  2LW1 A;  4P2Z A;  1H38 A;  1XBL A;  3L70 H;  4WCE V;  4U3F H;  3JAT B;  4DV2 B;  4B3R O;  2UXX A;  1H8E G;  4XDJ A;  3S3X A;  4CC5 A;  3E8H A;  4MTX A;  4LF9 O;  2N04 A;  3VQY A;  2JDI G;  1X4T A;  2QM8 A;  1QR9 A;  1KEC A;  5IYZ B;  1W2B U;  3OE7 G;  1UJW B;  4B08 A;  3LSQ A;  2WAM A;  4PD4 F;  3B09 A;  5J2U B;  3KKY A;  1RP3 B;  1XEQ A;  4U7O A;  2LFS A;  4A5U B;  1IBM B;  4B3R B;  1BHA A;  4RWU A;  4LF9 B;  2Y69 C;  5B1B B;  4F6E A;  1NR1 A;  3CCJ V;  2HFE C;  4PA9 A;  3APQ A;  5GTH Z;  4MVZ A;  4C7U A;  2P22 C;  2HLD G;  3CRQ A;  4X1K B;  2M6Y A;  2P67 A;  3G67 A;  4QNH B;  4JI0 O;  1FPO A;  4J7J A;  4TUY B;  4WBN B;  5J2T A;  2HEP A;  3B77 A;  1BMF G;  3ETQ A;  4DK1 A;  3W7X A;  5JJN B;  1R1B A;  1P7G A;  3RYF B;  2EUL A;  1LUW A;  1DGS A;  2DWE C;  1M9N A;  3K9S A;  1S77 D;  4UCV A;  4PV1 B;  4UFZ A;  1GTO A;  5LA6 A;  2VQF O;  4LH7 A;  3RVZ A;  3G71 V;  4DV7 O;  2Y0I A;  1BSM A;  4I4T A;  1B06 A;  2Q68 A;  2XAH A;  4MVO A;  1O9G A;  3K9A A;  4DV0 B;  2E5L O;  3WG7 C;  4Q20 A;  1GM8 A;  3NXS A;  2A3Q A;  1K4D C;  1N32 O;  1D5N A;  1SQV H;  1VF7 A;  1WAZ A;  1YTF D;  3D3Q A;  4KHP O;  2GBO A;  5IJ0 A;  2VQF B;  4ZOL B;  3T4Z A;  4DV7 B;  1BZK A;  2HJD A;  2XAJ A;  4HZ3 A;  1SQQ H;  4QGP A;  1VQ4 V;  2PF4 E;  1IXB A;  3FB6 C;  4O4H B;  2CTW A;  2E5L B;  1MNG A;  4GKK B;  4JYY A;  3LSS A;  5EBW C;  1N32 B;  4FZ1 A;  4RO2 A;  1YIJ V;  1S3J A;  4MT8 A;  1GRJ A;  2QDO A;  3JAW A;  2YEV B;  1JOY A;  4J7K A;  2IW5 A;  3CE2 A;  2ZDI C;  3ZRW A;  1GN2 A;  3CRC A;  1VQ5 V;  3JAK A;  4DUY B;  4Q6G A;  3OAA G;  3OD4 A;  1L8D A;  1NKD A;  1ZSP A;  3CCR V;  2F4V O;  1M1K W;  3BAB A;  4PDM A;  3JAS B;  2Y69 B;  3SPJ A;  2ZQM A;  5H9C A;  2VRZ A;  3ZCC A;  4LF8 O;  1S0V A;  2WLL B;  3RYH A;  4X1I A;  1G1X B;  5IYD O;  5KX5 A;  5BMV B;  2H8P C;  1A32 A;  2ZIO A;  4G2K A;  3HKB A;  1WB7 A;  1VQN V;  3C90 A;  1WJZ A;  3BHP A;  4KUM A;  3I5D A;  1AR4 A;  2XUM A;  1XHZ A;  1K9M W;  3ML0 A;  3T1Y O;  4DW0 A;  5E79 Z;  5KUK A;  4DUZ B;  4FM1 A;  2UU9 B;  3E35 A;  3RN4 A;  3K5M A;  5DN6 G;  2F4V B;  3OTO O;  1HR0 O;  2AHY A;  3A0H Z;  3CC4 V;  1SQP H;  4B7E A;  3G4S V;  2AZ0 A;  2BSK A;  4IHJ B;  1R73 A;  2KG7 B;  1Q82 W;  3THO A;  3LDC A;  1P7B A;  1L1F A;  4OGQ B;  2PYL A;  2OCH A;  5CB4 B;  3AG1 C;  4LFC O;  1SA0 A;  1PPJ H;  4G27 B;  3N2K B;  4YJ3 A;  3ZHQ A;  4DYL A;  4NYK A;  4Z1M G;  1M57 C;  5IWA O;  1JFF B;  4J42 A;  3ASO B;  1MA1 A;  1MZE A;  1OCR C;  1HR0 B;  3ZHV A;  4LF5 O;  1MSD A;  1SER A;  3HKC A;  2V7Q G;  3ETD A;  1KD1 W;  3ETG A;  5AG2 A;  3ZMZ A;  5JQG B;  2DYS B;  1FFT B;  1Q6U A;  2GUZ B;  1K8A W;  3CXH F;  3ZHS A;  4UCR A;  4LFC B;  4JTA B;  5H6R A;  1YDX A;  4DV6 O;  1B04 A;  3MAQ A;  2Q7H A;  1F4N A;  2OIE A;  2ZE7 A;  1F7Y A;  4I0X B;  2ZE6 A;  3H1H H;  4LF5 B;  2ZT9 B;  1GMG A;  1V55 B;  4PA4 A;  4UVC A;  1K5S A;  2YSU B;  5KA5 A;  2ZR3 A;  1VQL V;  2H94 A;  3DXR B;  3CCV V;  2EIJ B;  5CA0 A;  2OWO A;  4H0L B;  3F5W C;  2L6L A;  1EN4 A;  2JK5 C;  3LDE A;  1WP8 A;  3P30 A;  4DR1 O;  4JI4 B;  1N8R W;  3IJ4 A;  2QM4 A;  1SZX A;  3AG7 A;  1QU7 A;  1I94 B;  1BCC H;  1AIL A;  4TQF A;  4BIZ A;  2GDS A;  1NT2 B;  1ZL8 A;  2Z3Y A;  4PI0 A;  4LF4 O;  1NI8 A;  2NN4 A;  4I50 B;  1FXH A;  1VIB A;  2ZDI A;  4X64 O;  2Y48 A;  4LF6 B;  2EZP A;  3OW2 U;  1JJ2 U;  4DV1 O;  3CYO A;  1FXV A;  2P06 A;  3SPH A;  5B66 Z;  4X20 A;  1NBM G;  2F95 B;  3ZIA G;  4TOI A;  2Q0O C;  3N2G B;  2HG5 C;  3UM7 A;  2N74 A;  5EZY A;  3ZMU A;  2WLN A;  3OMN B;  1PD3 A;  3SPC A;  3AG1 B;  3IC7 A;  1N34 O;  4LF4 B;  3G6B A;  1MAB G;  3FB8 C;  3QTC A;  4BW9 A;  4YIO A;  3DSQ A; 
#chains in the Genus database with same CATH homology
 1Q81 W;  1H8H G;  4KFM A;  5LHG A;  3SYP A;  1QR8 A;  3AEI A;  4RUF A;  4PDV A;  5L3E A;  2X0L A;  4P9O A;  2HKO A;  3STZ C;  3WFV A;  1R6K A;  1NH2 B;  4LBE C;  3R65 A;  1R3L C;  1IXM A;  4JAV A;  4MVM A;  4MW8 A;  2ZR2 A;  3WG7 B;  4FIP C;  3SYA A;  4X89 A;  5E1A C;  1NQT A;  2EIM C;  1S5H C;  4LC1 A;  4RAI A;  2WLH A;  2QEX V;  5IY5 B;  3W7T A;  2WLL A;  5IYC O;  1QLE B;  1OZ0 A;  3JYC A;  3CMA V;  2FTK A;  4QPJ A;  4QJF B;  1M90 W;  3ABK C;  2P90 A;  2ITD C;  3JD2 A;  2EIK C;  1DTO A;  4QE7 A;  1RPO A;  4RQE A;  1YTF B;  5EC2 C;  2XAS A;  1I5Y A;  1BL8 A;  4CZZ A;  1XL6 A;  3OFN G;  1JVM A;  5BZB A;  3CME V;  4MTF A;  1MG1 A;  4WFH A;  4JPR A;  2W6J G;  5LGU A;  1YJN V;  2M7W A;  3FKS G;  3KG2 A;  4BW5 A;  1NVP B;  3SPG A;  4XBF A;  2IU3 A;  3CCM V;  3CXC U;  4GX5 A;  1ENV A;  2X7R B;  3ASO C;  4LCU C;  2PI4 A;  3BY6 A;  3OUS A;  1BHB A;  2WWW A;  2JEX A;  1CP9 A;  2XOK G;  3K0G A;  1GKF A;  3AG4 C;  5CN0 A;  1K33 A;  4OXS A;  3TK1 A;  5B1N A;  1EZJ A;  1FS0 G;  4WFB V;  1PNM A;  3IGA C;  4FK5 C;  3E8B A;  1FXK C;  1YSC A;  4UVA A;  5HFM A;  5L3G A;  1K97 A;  2IJJ A;  3D3I A;  4F4L A;  2EIL B;  2HJF C;  5B1A C;  5B3S B;  3OR6 C;  4MS2 A;  2DYS C;  4PA3 A;  3D36 A;  1NVP D;  3OM3 B;  1AJQ A;  2AHZ A;  4ASU G;  2NLJ C;  3VOU A;  1PL0 A;  2R9R B;  3TCU A;  4UUJ C;  3E83 A;  3G6E V;  2WLI A;  3B8M A;  4PA7 A;  3E8F A;  2EBO A;  4WFF A;  5EBL C;  1YJ9 V;  3E2E A;  1GO3 F;  3JD3 A;  1FXK A;  4P2Z A;  1H38 A;  4WCE V;  3ABM C;  3VBB A;  2WLM A;  1KQS U;  1V55 C;  1QCE A;  3CD6 V;  2UXX A;  1H8E G;  3QO8 A;  4XDJ A;  3W7W A;  3E8H A;  4MTX A;  4R8C A;  2X6A A;  2JDI G;  1VQO V;  2HR3 A;  2QM8 A;  1OCO B;  1KP2 A;  2EIJ C;  1QR9 A;  1KEC A;  3FB5 C;  3HPL C;  1JCH A;  4MTG A;  2EZO A;  4MVQ A;  5GW7 A;  4I9W A;  1W2B U;  4JTD B;  3OE7 G;  1UJW B;  3LSQ A;  3STL C;  3ASN C;  2WAM A;  3CC7 V;  1W0K G;  2DWD C;  4J9Z B;  2OT5 A;  3SYQ A;  3X2Q C;  3OEE G;  4I5S A;  1KP3 A;  3UKM A;  3OMI B;  4JF3 A;  1G4Y B;  2OCC C;  4WFE A;  5CA3 A;  3OGC C;  1ROP A;  4U7O A;  2K1E A;  2A0L A;  2LFS A;  1NJI W;  2XAG A;  1GK9 A;  5L3F A;  1BHA A;  1GM7 A;  3I55 V;  1JPX A;  1AI4 A;  2Y69 C;  5B1B B;  1NR1 A;  2DYR B;  4JAS A;  1F51 A;  2YEV A;  2BOB C;  1M57 B;  3CCJ V;  2HVJ C;  2HFE C;  4PA9 A;  1RM1 B;  4FMT A;  4MVZ A;  5L3B A;  1OCR B;  2ATK C;  3B8N A;  4PDL A;  2QA4 V;  1SZT A;  1P4R A;  1SET A;  2HLD G;  1OCC C;  3JD0 A;  5KUM A;  2P67 A;  2W0F C;  3CC2 V;  4QNH B;  1Q7Y W;  5H6Q A;  4GX0 A;  3EFF K;  5IDJ A;  1LNQ A;  4QE9 A;  2KB1 A;  3B77 A;  2XAQ A;  1BMF G;  3W7X A;  2F43 G;  3DGE A;  4X8A A;  1QVF U;  3ZRS A;  1R3K C;  1PKX A;  2DWE C;  1M9N A;  1S77 D;  3ZMT A;  3W7S A;  1ARO P;  3H01 A;  3GWO A;  3CCL V;  3LUT B;  3AG2 C;  4BIU A;  1GTO A;  3T4D A;  3E89 A;  4UV8 A;  5LHI A;  3RVZ A;  3G71 V;  1NH2 D;  2B1I A;  4LP8 A;  1B6Q A;  1GM9 A;  4ZKI A;  1ZWI C;  2Q68 A;  2XAH A;  2IJI A;  4MVO A;  4J9Y B;  1K34 A;  3EHB B;  3K9A A;  1F23 A;  3OEH G;  3WG7 C;  1AI5 A;  1FXK B;  4X88 A;  1DF5 A;  2WLJ A;  4HAM A;  3TET A;  4MW3 A;  2X6C A;  4Q20 A;  1GM8 A;  3NXS A;  1K4D C;  5IY5 C;  4E2L A;  4JAU A;  2QM7 A;  3LDD A;  1YTF D;  2IU0 A;  5J9P C;  1QLN A;  3T4Z A;  2Q6A A;  3RBZ A;  1ORQ C;  2XAJ A;  3JCZ A;  3K0D A;  1NR7 A;  2CK3 G;  2JJ2 G;  4HZ3 A;  4MVR A;  5EK0 A;  1RPR A;  2QKS A;  1YIT V;  2B1G A;  3ABM B;  1VQ4 V;  3FB6 C;  1SRY A;  1YI2 V;  3LSS A;  2IJH A;  2IJK A;  2DQ3 A;  5EBW C;  1OCZ B;  4N23 A;  4RO2 A;  1YIJ V;  4MVS A;  3SYC A;  3QO7 A;  1F4M A;  1S3J A;  2BOC C;  2LFR A;  4MT8 A;  2OTL V;  1K73 W;  5C93 A;  4XDK A;  3JD4 A;  3ZMU A;  2EIN B;  4PA6 A;  4TSF G;  3ZN0 A;  2YEV B;  1JOY A;  5IYB O;  2IW5 A;  2V1D A;  2JIZ G;  2OTJ V;  3CCU V;  3ZRV A;  1KKD A;  1JQ0 A;  2XND G;  2ZDI C;  4L87 A;  3ZRW A;  3ZN1 A;  4GCZ A;  4U7N A;  2OCC B;  1V54 C;  5B3S C;  3QNE A;  1VQ5 V;  4JYB A;  3OAA G;  1NKD A;  3CCR V;  4WFA V;  4R7C A;  1VQM V;  5CBG A;  1AI6 A;  1M1K W;  3K04 A;  4PDM A;  2Y69 B;  3SPJ A;  4JGS A;  3QO5 A;  2ZQM A;  3LNM B;  5H9C A;  3AG3 B;  3MHH C;  3OMA B;  3ZCC A;  4BAY A;  3RVY A;  2WLL B;  1S0V A;  3ABL C;  5IYD O;  5L3D A;  2H8P C;  1I5X A;  3RW0 A;  1AR1 B;  1AI7 A;  2UXN A;  1M56 C;  4G2K A;  1VQN V;  5LBQ A;  1OCC B;  1R3I C;  1SES A;  4FJC C;  4R50 A;  3T1C A;  4KUM A;  1W0J G;  1VQK V;  1K4C C;  1EBO A;  1OHH G;  1K9M W;  3ML0 A;  4XDL A;  1DF4 A;  1OCO C;  1JX9 A;  2DW4 A;  1MOF A;  1AJP A;  3K3W A;  5CMU A;  5KUK A;  1VQ6 V;  2EIM B;  1QVG U;  2GHY A;  3E35 A;  5DN6 G;  2MK3 A;  5DM6 V;  3MD0 A;  1QBZ A;  3FYE B;  3CC4 V;  2AHY A;  2B5U A;  2ITC C;  5L3C A;  3W7U A;  3CCS V;  4H37 A;  3ABK B;  3G4S V;  3CPW U;  4JYC A;  4YXW G;  2D3O W;  3HB3 B;  3K79 A;  5B1O A;  2EIK B;  1E1Q G;  1R73 A;  2Q69 A;  3DTU B;  4UV9 A;  2ZXW C;  1Q82 W;  3SYO A;  5LGT A;  3LDC A;  1P7B A;  1L1F A;  5CBF A;  2X6B A;  1AJN A;  3AG1 C;  1VQ8 V;  2EJR A;  4G27 B;  4JTC B;  3MHS C;  2WPD G;  5B1B C;  1R6N A;  4FPP A;  2DYR C;  3OR7 C;  5EC1 C;  2Z5U A;  3FYI B;  4GX2 A;  3SPI A;  4Z1M G;  1M57 C;  1COW G;  3BEH A;  3ASO B;  3IFX A;  1TUE B;  1RM1 C;  2DQ0 A;  2WSS G;  4G28 B;  1OCR C;  2GSM B;  2W6I G;  2IH1 C;  3AG4 B;  4PEL A;  3CCE V;  1H2G A;  2WLI B;  2IH3 C;  1SER A;  2R9I A;  5KA6 A;  2V7Q G;  3F7V C;  3ABU A;  3ETD A;  1KD1 W;  3FB7 C;  3A0R A;  1MSW D;  3PJS K;  3ETG A;  4DO2 A;  4WFG A;  3SJQ C;  1K92 A;  3ZMZ A;  5B1A B;  1CPY A;  2DYS B;  1FFT B;  5EBM C;  1K8A W;  1QLE C;  4JTA B;  5H6R A;  4TT3 G;  2ZD9 A;  3K03 A;  2JEU A;  3OUF A;  4GT1 A;  4RQF A;  1WPX A;  3ZRW B;  3M99 B;  1KC8 W;  4R6Z A;  2XAF A;  1F4N A;  4CBC A;  1G8M A;  2QTO A;  3E8G A;  3K06 A;  4H33 A;  4EKW A;  1Q86 W;  3F7Y C;  2C2A A;  3I56 V;  1GMG A;  5CBH A;  1V55 B;  3ZJZ A;  5LHH A;  4PA4 A;  4UVC A;  5FL7 G;  3P32 A;  1K5S A;  1S72 V;  2YSU B;  5KA5 A;  2ZR3 A;  1VQL V;  2H94 A;  3CCV V;  2EIJ B;  1VQ7 V;  4ZBM A;  1E1R G;  1V54 B;  3ASN B;  3F5W C;  3ZMV A;  2HVK C;  3X2Q B;  2JK5 C;  3LDE A;  1YJW V;  3P30 A;  1WLE A;  4GX1 A;  2EIL C;  1N8R W;  2Q67 A;  2PI5 A;  1K5Q A;  3ABL B;  1HWY A;  1M56 B;  1THZ A;  4KP4 A;  3ZMS A;  4BIZ A;  4WF9 V;  3E86 A;  3GB7 C;  2WLK A;  1Y66 A;  2Z3Y A;  4QPK A;  2A9H A;  2P7T C;  1PNK A;  3CP1 A;  1OCZ C;  4MVU A;  1PNL A;  4HYO A;  1FXH A;  2ZDI A;  1K7D A;  2P6J A;  5LGN A;  1K3E A;  4PDR A;  2Y48 A;  1EFR G;  1Y4M A;  4QIW F;  3ETE A;  4MSW C;  2EZP A;  2EIN C;  3OW2 U;  3ZRX A;  1JJ2 U;  1CEZ A;  1J95 A;  1DLB A;  1R3J C;  3CYO A;  1FXV A;  3ABT A;  3SPH A;  2JJ1 G;  3K08 A;  1E79 G;  3JD1 A;  4DXW A;  4UVB A;  1NBM G;  4UXN A;  3ZIA G;  4TWK A;  2ZXW B;  5HFL A;  4P9P A;  2HG5 C;  2A79 B;  3UM7 A;  4N21 A;  1YHQ V;  1XL4 A;  4MTO A;  2WLN A;  2LP7 A;  1PD3 A;  3OMN B;  2QE7 G;  3AG1 B;  3IC7 A;  4P30 A;  3SPC A;  1VQ9 V;  3AG2 B;  1MAB G;  3FB8 C;  4RUE A;  3CCQ V;  3T2M A;  1S76 D;  3AG3 C;  1VQP V;  2NNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...