2ZQMA

Crystal structure of the prefoldin beta subunit from thermococcus strain ks-1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
114
structure length
114
Chain Sequence
MQNIPPQVQAMLGQLESYQQQLQLVVQQKQKVQLELTEAKKALDEIESLPDDAVVYKTVGTLIVKTTKDKAVAELKEKIETLEVRLNALERQEKKLNEKLKELTAQIQSALRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prefoldin beta subunit 1
publication title Structural and molecular characterization of the prefoldin beta subunit from Thermococcus strain KS-1
pubmed doi rcsb
source organism Thermococcus sp.
molecule tags Chaperone
total genus 45
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01920 Prefoldin_2 Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zqmA00
3AEIA 1FXKC 2ZDIC 1FXKB 2ZDIA 2ZQMA 1FXKA
chains in the Genus database with same CATH superfamily
2AZ2A 2KG7B 2E5LO 4LF7O 4O2AA 5JH7B 2YIAA 1G8MA 5HFLA 1K8AW 2ITCC 2ZXWC 2R72A 2BSKA 4OGQB 3BEHA 5B3SC 3W7TA 1O9HA 2EILC 1LNQA 2EIJB 2ADQB 1YHQV 1YEWA 2LFRA 1N4CA 1VQ6V 3S3WA 2FYUH 1K92A 3D36A 5GONA 4DV7B 2ZM6B 1VQ4V 5LOVA 3IGAC 2YEVA 2HR3A 5CBHA 1F23A 4DV5O 3CC4V 3ML0A 4PI2A 4TV8A 4MVRA 5CA1B 1HDJA 4FM2A 5DECA 1K5SA 3MHHC 3CP1A 1TAEA 3HB3B 5CMUA 4DR1O 2XAQA 2BSKB 2DYRC 1NJIW 3JALA 1BHAA 2ZQMA 4CH4A 3IJ4A 1FS0G 2OCHA 1DK1A 1VP7A 2ATKC 2GTSA 2NLJC 4O4JB 3H01A 3CX5F 2Q7GA 3APQA 3K9SA 3KCYA 2XAFA 4X9QA 4MTFA 1SS3A 3ZHVA 4NXNB 1VQOV 3JSNA 3OW2U 2E75B 3K5OA 3FYIB 4FLTA 2FMLA 3AG3B 1H2NA 3QO7A 4R8CA 1N34O 1NTKH 3J7AU 2BE3A 4RAIA 2QR4A 4EEQA 1VF5B 5IYBO 1SQPH 2JDIG 2WA3A 3VQXA 1DF5A 1M93A 3ZN1A 3OR7C 3ZRWB 1CP9A 3HKBA 3ABKC 4LP8A 3OUFA 3OFNG 3JALB 4G28B 2Z5UA 1W2BU 1EN6A 5KLVH 4X20B 5FPRA 4K0KB 4F4LA 1MABG 1BSMA 2P6JA 3ETGA 3JAMN 3DC5A 4HAMA 4JI4B 3LDDA 2CH7A 4RQFA 1OV9A 1VQ9V 1HNXB 2F1MA 5B1NA 3ZRSA 1URFA 3CRMA 3CCQV 2F23A 1VMGA 3SR2C 3CRRA 2IH1C 1P7GA 2FTKA 2PYLA 3ZN0A 1Q81W 1FFTB 1KP2A 2H8PC 3IC7A 3OGCC 4EFBA 5LMUB 1PNMA 2N04A 1R6NA 3ETDA 3E8HA 1K73W 4LFCO 3ZMUA 3C3TA 4DV1O 4X88A 1K4CC 4DR4O 4N23A 3HKEA 2LP7A 2HJFC 3N27A 1FXKC 4Q20A 5H6RA 1RSOB 3I5DA 2VQFO 4JI2B 1P7BA 2BCCH 5IJ9B 1N36B 4I50A 4U7OA 2VS0A 1RFYA 2CH7B 3K5LA 4JZGA 5LYJA 3JCZA 2H3OA 2L6LA 3RGBA 3ZHRA 2AHZA 3O65A 1MZFA 1ROPA 3K5NA 1IXBA 4I4TB 3THOA 3G4SV 1ZSPA 3R65A 4UCSA 4CZZA 3B2EE 2Y4TA 3APOA 5JJJB 3ZRXA 1N0JA 4DV6B 4P9PA 4HYOA 4ASUG 4MTOA 4KUMA 3K03A 1F7YA 3ZX6A 1KECA 1QU7A 3ZBHA 4GUNA 2V7QG 1OCRC 2QWRB 4EFEA 1Q86W 1ZTEA 1R3JC 1JFFB 2OTJV 5GTHZ 4U7NA 4XBFA 2WWWA 3MDSA 2UXNA 1MG1A 3CCUV 2DWDC 5LYJB 1WN7A 4UCUA 4CH3A 4CH6A 4WBNB 4UB8Z 2G38A 2QSAA 1QR9A 3VQYA 3JAWA 4HBNA 4ABMA 4J42A 3CCRV 2UUCB 3U11A 1VQ8V 3HKCA 5ITZB 3WG7C 4LFBB 1SF9A 2CAZC 4U3JB 2WLLA 3WU2Z 2F93B 1BT8A 4IYIA 1KKDA 2R70A 2Y48A 5LL6Y 1YVWA 1S3JA 3C90A 1I94B 4QIWF 1SC5B 3U10A 2A06H 3AG7A 4LF8O 4WFEA 5IWAO 5B1AB 4H0LB 1NU1H 1VQKV 1V54B 2AW9A 3ABMB 1YTFB 5KHIA 3GWKC 3BPZA 1XMOB 3OTFA 2X0LA 3N2KB 4JI5B 4B3SO 1E1QG 2D2CB 3FD9A 3FAVA 1HW7A 3EXAA 3LSUA 3B77A 3AG1B 4PJ0Z 2E76B 1M4UA 1E1RG 2FB5A 3HPLC 3BCCH 3QO8A 1R73A 4I9WA 2GTAA 2UXBB 1VIBA 2WLLB 5LXTA 3F5TA 3AG4B 4H13B 4X8AA 2ILMA 4OPAA 4CS4A 1SQBH 3D8CA 4YIPA 1GH6A 1FPOA 5KMGA 3BHPA 2XT9A 1IBLO 4DR2O 1GMGA 1MNGA 4FM1A 1NH2B 2R9RB 5FNVB 3N2GA 2HG5C 3ZHQA 3TXQA 3DXRA 1EM1A 2ZNIA 1PL4A 3G67A 2GUZA 3OEEG 1Y66A 3FAVB 1M57B 2QM8A 1Y76B 4GKKO 4OX9B 4I0XB 1Q8IA 1FD9A 1BZKA 3HR0A 3LDEA 2ZXWB 4IYHA 2DOSA 3FB8C 4FM0A 1PP9H 4X66B 5J9PC 5B3SB 2EILB 2VWJA 2EINC 4GKJB 1XDCA 4L87A 1MOFA 1IVSA 1G4YB 1BL8A 2ZINA 4JI0O 4JYAO 2A7WA 5IYZA 4I7ZB 2BTOA 4FFBA 3N2GB 3SDLA 4O4HB 5BR8O 4MVSA 1RP3B 2X7RB 4PDLA 3QNEA 3TETA 1IBKB 4E2LA 5JCOC 3UKMA 1BGYH 1YSCA 1AI6A 4C7UA 4W4LA 4TT3G 1XUQA 2LW1A 1T5EA 4DR3O 3ZIAG 2DYRB 1Q6IA 4JI6B 1YJNV 2PZSA 2PI5A 1EZJA 4AHCA 2A3QA 5IYZB 2ZR2A 3ABUA 1GM7A 2WA4A 4X62B 3J80N 3RVYA 4ZOLB 2XAGA 5KHJA 3GVMA 1VQNV 1UPGA 2CDYA 3O9OA 3K57A 4WFFA 1HNZB 3BA9A 2P06A 5L3EA 3DSQA 2DJVA 1JOYA 3JARA 1GM9A 2YXHA 1XI1A 2QTSA 1XNQB 3JCUZ 1H2KA 1WB8A 2P4KA 2HVJC 1AILA 5H9CA 4LH6A 3BFRA 5HFMA 2RMKB 1AJPA 3IFXA 5LGUA 5B5EZ 1IX9A 2JEUA 4EB6A 3E22A 4DV7O 2ZM6O 4GX1A 1TUEB 3AK1A 4H33A 4YXWG 1NTMH 1XREA 5EBMC 5IJ0B 1WJZA 3ZHSA 2BOCC 3STZC 2Y69C 1A32A 4LWSA 3CMAV 2DW4A 1Y74B 1AJQA 2YI9A 1X59A 1GN2A 1SQGA 3TXSA 4H44B 5DEDA 4MT8A 3R66A 1L1FA 5KX5A 5J2TB 1S5JA 3LSQA 4R50A 4NXNO 4RUFA 1JJOA 4LH7A 1XMQB 4WFGA 1EZVH 3ABMC 3CJHB 2IH3C 1FXKB 2QKSA 1WA8A 1LR1A 2R9IA 2BTQB 3IAYA 5CN0A 3CXCU 1VARA 1WAZA 4LWSB 4NR1A 3TJTA 5F2VO 1COWG 4F6RA 1FJGB 4O4LA 4LNUB 4GCZA 5L3FA 1H2MA 2KG7A 1XOUA 4P30A 2LO1A 3L70H 5JH7A 1OCOC 3CXHF 1KMIZ 4JAUA 1F4NA 1D5AA 4I5SA 3X2QC 2QWQB 1WB7A 1ZLZA 4PDVA 4ZBMA 4K0KO 1Y6XA 4Q6GA 4JI4O 2WLMA 1BE3H 1WA8B 4QNHB 4PA3A 1VQLV 2W0XA 2RJZA 1HNXO 3H1KH 4JGSA 3H1JH 2EJ7A 2P90A 1GN4A 1TA8A 4IL6Z 1M57C 3OT7A 3RBZA 4NTXA 5LMUO 1AI5A 5CA1A 2WLHA 2YSUB 3WG7B 1XILA 3U0ZA 2JIZG 2B5UA 3G71V 1HR0B 1JA8A 2CGNA 1NZ6A 4AILC 1JQ0A 3SGIA 4NVPA 4JI2O 5BY1A 4O4JA 1N36O 4J9YB 2IM9A 4I55B 4D6TH 3FFQA 5JJNB 4DUZB 3P30A 1IXMA 3JD2A 1QCEA 1Q82W 1KC8W 3ZRVA 3CHXA 4DV0B 5EBLC 3SYAA 1YTFD 4TOIA 4DV6O 2ETNA 1YIJV 3ICXA 3CMEV 4QE7A 5B1BC 3SPGA 1CXZB 2Q6AA 3ZRWA 2VRZA 4TQDA 4FLXA 1SESA 2F43G 4DV2B 3ZHUA 3PN1A 3RT3C 5LP6C 2YXYA 3LSSA 1VQMV 1W0KG 3CPWU 1NTZH 1BQ0A 4X20A 2QWOB 2K1EA 1BS3A 2CTQA 1JCHA 4O2BB 1XQ8A 4GX2A 3K59A 5JCOA 3E83A 2UUCO 1LUWA 3RVZA 1NH2D 2ZE6A 1OZ0A 4I9QA 1GM8A 4LFBO 1WP7A 2Q7EA 3OMNB 5EZYA 1YDXA 5JJEB 3P3PA 4DW1A 2UUBB 3CS5A 1I94O 2Q5ZA 1S5LZ 3A0RA 1ZAUA 3G6BA 1M90W 2WLIB 3DTUB 2DN9A 1K7DA 2EINB 3Q4HA 4ICGA 1XMOO 3RYIA 4YY3B 4DUYB 1YJ9V 3OD4A 2ZNJA 4JI5O 1FFXB 2MW2B 3E89A 4FLUA 1RSOA 3JSLA 4DR6B 4DV3B 1L0NH 1U96A 5IJ9A 1W0JG 2YIBD 2CE4A 4J11A 1V9PA 1EBOA 1B06A 1SKVA 4PHZA 4BIZA 1GKFA 3BVOA 3F7VC 3T1CA 5L3GA 4UVAA 2QKCA 1K4DC 2QJ1A 4Z1MG 4B3MB 1DLBA 1GO3F 2LQTA 5EZYB 2AZ0A 2XTAA 4I4TA 4CC5A 4AQYB 4GX0A 4X89A 4LC1A 1B04A 2X6AA 4DRXA 3FYEB 1R3KC 5KAIZ 1IDSA 2LW7A 4K8XA 2PF4E 3QG5A 2QDOA 4YJ3B 4TV9B 3Q4HB 2RDCA 1QLEB 3WB2A 3RYIB 1O9GA 3OM3B 4QGPA 2UU9B 1GRJA 1JFFA 2OIGA 4D7TA 4JTAB 2P7TC 5GW7A 1ZX3A 4OX9O 4UFZA 4JI3B 2IJKA 3KG2A 4WBNA 1MMMA 1JVMA 4LF6B 1KD1W 4X66O 3ZS8C 1Z5WA 4UCTA 5ITZA 1OCZC 4DRXB 4GKJO 5CB4B 4U3JA 4N21A 4HZ3A 3RWRD 4FVMA 2DWEC 3FB7C 2JJ1G 4JI1B 1Z2GA 3B8NA 3VQVA 4NKGB 2EIKC 1K97A 3ABLC 2P4VA 4B3RB 3AG2C 2K9PA 2X6BA 1Q5OA 1E79G 3MHSC 3CEIA 4PV1B 3SPJA 4L8JA 1IBKO 3MAQA 1N33B 1M56C 2ZE7A 3N2KA 3UCSC 1S5HC 3K06A 1RPRA 4BW9A 2Y69B 1YXBA 3RN4A 4QJFB 1QVFU 2YXLA 1ZWIC 2Q4PA 1B3QA 4TWKA 2QM7A 5LBQA 2QWPB 4JI6O 2VQEB 2GHYA 2NN4A 2B1GA 4NTYA 4UV9A 3SPHA 1CEZA 5FL7G 5BXZA 1K5QA 1BQZA 1N32B 4X62O 1VQPV 3CC2V 3UM7A 1F4MA 4X1YB 2JGDB 2P5OA 3AK3A 2EIMB 2Q0AA 4LR3A 3PJSK 1FYJA 3BAAA 2GBOA 2NNUA 5FNVA 3OMIB 2P22C 1VQ5V 1HNZO 3OUSA 1UJWB 1IURA 1DF4A 5CBGA 3OTOB 1HNWB 1PKXA 3ZJZA 3NXSA 4FLVA 1XNQO 1I5YA 4B3TO 1Y76A 2PGGA 4I0XA 1KBHA 1R6KA 1OCOB 2F4VB 4GLXA 1JJ2U 4J9ZB 2FKXA 1Q7YW 3DGEA 2IJJA 3RYFB 4KXRA 3X2QB 1KKCA 4FLWA 2YIBA 3BA8A 2PUSA 2Y4UA 5D5PA 4P9OA 4B7EA 3ZHTA 1AP6A 1HP8A 3K9AA 4O4HA 1YITV 5BZBA 4OXSA 2YIDA 4JAVA 4BAYA 4QPKA 4MVMA 1SETA 4DR5B 4BIOA 5IDJA 3LDCA 5GTIZ 4FLZA 3SJAC 5H6QA 3D36C 2Q8VA 3NR7A 4PDRA 4YHHB 3T1YB 4DV4B 3BRCA 5C93A 4DXWA 1XMQO 3ZMSA 4UV8A 4JTDB 5LMNB 1L8DA 4GT1A 2WSSG 5LHIA 3OE7G 2WLKA 4JYCA 4ZOLA 3K0GA 5KHKA 3QO5A 1FJGO 1SQFA 4FK5C 3AEIA 2Z3YA 3G6EV 3I55V 2LGQA 2ARHA 3ZCCA 2EZOA 3RYCA 4NXMB 2QTOA 4X1KB 2LJ2A 5LA6A 1HWYA 3ZMZA 1J5EB 1XNRB 5B1BB 2V4DA 1G1XB 3SPIA 5LHHA 2ZD9A 3T1HB 1NT2B 4JZ2A 4KHPB 5LP6B 1QLEC 2HHHB 2WAMA 2GV9A 4MVQA 5KA5A 5IJ0A 1BMFG 1YZBA 2JVDA 4BW5A 1FXHA 1S76D 3TGUH 1UFIA 2UUAB 1WP8A 2R9AA 3LNNA 3RYCB 1Y74A 4FPPA 3ASOC 1S72V 1OJHA 1HR0O 2DMXA 3JD1A 5LA6B 1D2DA 2OT5A 1KYOF 1KQSU 1SZXA 4HNAB 1XEQA 2A9HA 2B1IA 1NQTA 3W7UA 5J2TA 1LUVA 1U97A 4DUZO 4JI7B 5LHGA 2W0FC 3CYOA 4DO2A 3VBBA 4X1IB 4P2ZA 3CJHA 1GK9A 1FXKA 2XAJA 2XASA 1OHHG 2Q9LA 1VF6C 4DV0O 2ITDC 2LFSA 4TQFA 2BTQA 4FZ0A 3CRCA 2Q68A 2VWKA 1K34A 4J7JA 3OR6C 1TGOA 5JVDB 1Q43A 2EJRA 4X64B 2UXDB 1Q90D 4UCVA 4LNUA 1YCIA 3OMAB 2KKWA 5EK0A 4DV2O 3B4SA 1CPYA 4G2KA 2IJHA 2CK3G 3BY6A 2RNBA 5EC1C 3H1LH 2OTLV 3H1IH 2CTWA 4MVZA 5KAFZ 4YIOA 3UT5B 4X65B 4UCOA 2EIMC 2ADPA 3HKDB 4WFAV 3L75H 2CTRA 2IU3A 2JS5A 5DN6G 2UUBO 1TVKB 5EBWC 4DR7B 1F51A 4LCUC 1R1BA 3E8GA 1PNKA 3M7MX 1I08A 5K1PA 4ZHQA 1OCZB 2W6IG 4JYYA 1IBMB 4ZI7A 5BMVB 3AK2A 4YY3O 4DUYO 2PI4A 3SJQC 4KL1A 4LF4B 4LFAB 5L3BA 3W7WA 5D5QA 1AP5A 2EIKB 3ABLB 1SRYA 3JASA 3AG2B 4DR6O 3A8TA 4DV3O 4GZRB 3FB6C 4I55A 4F6EA 4JPRA 4A5UB 1M56B 1XL4A 1XHZA 5KUMA 4B3MO 1AI7A 3OEHG 4AQYO 2D3OW 5KHGA 4B08A 1W59A 3KZIZ 4XDLA 2F95B 1THZA 4ZHQB 3D3QA 1EFRG 2RN9A 1VQ7V 1M1KW 4ZI7B 2HLDG 3STLC 4MSWC 1EN4A 4IIJB 1Q6HA 3B8MA 2UU9O 4DYLA 1PL0A 3JASB 2KB1A 4MS2A 2UXCB 1GN6A 1QQCA 4KP4A 2AXTZ 4JV5B 3JATA 2M6YA 2N74A 1XL6A 1V55C 4JI3O 4QE9A 4IHJB 4Z2WA 2QGNA 5JQGB 1M9NA 4ZKIA 4LF6O 4O2BA 4DW0A 3RW0A 1Q3EA 3CCEV 4XDKA 1P49A 1ENVA 3SYPA 1L0LH 4IGGA 3JYCA 3D3IA 1I5XA 4O4IB 4RWUA 3CCSV 4JYBA 3MD0A 1G6UA 2QE7G 2W6JG 3CRAA 4JI1O 1JX9A 2M7WA 4B3RO 3ZMTA 2WLIA 1SA0B 5J2UB 3QTCA 4O2AB 1KB9F 1N33O 2IBZH 3K5MA 3BABA 2L35A 3JATB 1FFXA 2EZPA 2QM4A 3CRQA 4LBEC 4K8ZA 1H8EG 2PY5A 5TISZ 1FAFA 3FB5C 3VOUA 2CGOA 2P67A 2VQEO 3UQ8A 3JD4A 5GONB 2GSMB 1N32O 4LF9B 4JI8B 5CBFA 5LOVB 2UXXA 4KFMA 2YEVB 4MVOA 2YDEA 4YJ3A 4TV9A 4CH5A 1MA1A 5IYCO 4CS3A 1J95A 4TV8B 4JAAA 1NR7A 1YJWV 3H1HH 3OTOO 1HNWO 5B1OA 4FLYA 4GYCB 1XBLA 4G27B 2OIEA 5LGTA 3KCXA 4K35A 1B6QA 2XNDG 1D5NA 1AR1B 2UXBO 1R3IC 4LF5B 2F4VO 3B40A 5EC2C 1ZUQA 4PA9A 4PDMA 4R7CA 2ZIOA 4UVCA 1NS1A 2XUMA 4TSFG 2QA4V 5CB4A 3EVKA 3CSXA 5KUKA 4PA4A 1QLNA 1AROP 4RQEA 5A9GA 4QPJA 5L3CA 5H5NA 1OCCC 1P84F 4PD4F 2JS3A 1NVPB 5C8YA 2E5LB 4LF7B 3CCLV 1VF6A 3HKBB 2IU0A 4DK0A 5EIBC 4DR5O 5DM6V 3F5WC 3FKSG 1H8HG 1I7FA 4R6ZA 5FLXN 4PELA 2ZDIC 2QKAA 1NI8A 3ASOB 4YHHO 3T1YO 4DV4O 1RM1B 5IY5C 3DC6A 3OAAG 1X4TA 3A2FA 1BCCH 4J10A 5LMNO 3SYQA 1VEWA 3E35A 3E2EA 1ZL8A 3JD0A 1KP3A 3RYHA 3WB0A 3E86A 3CCMV 4GX5A 3TCUA 3CD6V 2YUAA 2AHYA 3M8AA 4NTWA 4X1YA 2DYSC 2JGDA 3E8BA 2OCCC 4DV5B 5C8YB 2Q7HA 4FJCC 2RCVA 1KU9A 1AVMA 2E3CA 4CC6A 1N0NA 4WF9V 5E79Z 4NXMO 2KQXA 2X6CA 3L9DA 1MSDA 2YI8A 2JJ2G 4DR1B 3HKEB 1J5EO 1XNRO 1DGSA 3L74H 3T1HO 3ASNC 4I50B 1MSWD 1SQVH 4KHPO 1ZL8B 4FIPC 1JMKC 1PPJH 2HHHO 3RYHB 4IT5A 3RYFA 3CCJV 2HP8A 2CUGA 2E74B 2WPDG 1N34B 1M5IA 3CCVV 1H2GA 2HKOA 3OGIB 1SERA 1AI4A 2UUAO 3ZMVA 2EIJC 4UUJC 5IT9N 4BIUA 3ZEDA 4JTCB 3WFVA 5CA0A 2CTPA 3QVNA 1Y67A 3K08A 5EIBD 2OYQA 2YC0A 2EX3A 3SYOA 1WNSA 4JI7O 3P32A 1US6A 1PV0A 4UVBA 3W7SA 2Q73A 3K3WA 2ZE5A 3JAWB 2HEPA 3HKCB 5FPOA 3E8FA 4UXNA 3UO3A 1AB3A 1N8RW 1S77D 4X64O 2UXDO 5KA6A 4J7KA 2H94A 2AGAA 4Z1VA 3JD3A 5CA0B 3J81N 4MTGA 4YJ2A 4LFCB 4X1KA 3TK1A 4DV1B 2JEXA 4DR4B 4XDJA 1WLEA 3M99B 1TUBA 3ABTA 4U3FH 1QR8A 5JWPA 3K0DA 2MK3A 3AG3C 3QF7A 2VQFB 3T4ZA 4X65O 1PNLA 1S0VA 3W7XA 5LP6A 2ZR3A 2HJDA 3SJBC 2C2AA 2RQ6A 3K58A 2A0LA 2XHBA 4UB6Z 2JRIA 1V55B 5LXTB 3SYCA 2Q0OC 1NBMG 3CB2A 1K3EA 4RO2A 1SZTA 3C3SA 1GN3A 1H2SB 4DR7O 5KMGB 1MZEA 2XOKG 2ZCEA 1R3LC 5H2FZ 3L71H 5CA3A 1AJNA 1K9MW 4YJ2B 1WPXA 1IBMO 1JPXA 3DXRB 4J7ZA 5KHHA 1TUBB 2JGUA 4LF4O 4LFAO 2GUZB 3JAKA 4HNAA 2F66C 2IW5A 1VF7A 2JK5C 3ETQA 2EULA 3T2MA 1YI2V 1QHTA 3RFRA 4J80A 2ZKOA 4E4EA 3FX7A 3GB7C 4PI0A 3EHBB 3SJCC 4X1IA 2O57A 4BWAA 4MTXA 5EYPA 2Z0AA 2LGWA 4WFHA 4CS2A 3LNMB 3VQWA 4UCRA 4WCEV 3H9VA 3K04A 2DE0X 3F7YC 5JVDA 1GTOA 5AG2A 3A0BZ 3LUTB 2Y0IA 3EFFK 4FFBB 4OPHA 4LF8B 1QNMA 4FZ1A 5IWAB 1RM1C 2WLNA 5K1XA 2N05A 2XAHA 3CC7V 4FMTA 3JAKB 1AR5A 1DTOA 2UXCO 5LGNA 2Y0PA 3GWOA 2HFEC 4WFBV 4JV5O 5A2QN 4B3SB 3WB1A 3KKYA 2B9ZA 3UT5A 3I56V 1KUQA 1AR4A 5EYPB 4W4KA 2Q69A 4B3TB 3HKDA 2WLJA 3ABKB 3CWBH 1Q6UA 4NB5A 1SQQH 2ZDIA 1BHBA 5L3DA 1TVKA 1EN5A 1YF2A 2PYJA 2GDSA 1JR9A 1IBLB 4DR2B 2A79B 2YS8A 2DQ3A 2V1DA 3P3NA 5BMVA 2OWOA 2Q67A 1Z5VA 1H2LA 3A0HZ 4PA7A 3JARB 1NKDA 4BR6A 4MVUA 1QBZA 2KSDA 2ZIMA 1XHXA 4J41A 1OCCB 5IYDO 2HVKC 2YICA 2DQ0A 2ZE8A 4TUYA 4GKKB 2ODMA 1ORQC 4D7SA 1PD3A 4CBCA 3L73H 4RUEA 4EB6B 5B1AC 1NVPD 3E22B 4LF9O 4JI8O 1V54C 5E1AC 1WPBA 2ZT9B 2PTMA 5IY5B 2EBOA 1NR1A 4JI0B 4JYAB 4K3AA 2BOBC 4JF3A 1RPOA 5BR8B 4MW8A 3CE2A 4IIJA 3S3XA 3SPCA 1I0HA 3AG1C 3IC9A 1PM9A 2DYSB 3K79A 1GAXA 4PA6A 4H37A 2OCCB 4DK1A 4TUYB 2QEXV 5IE9A 1Y4MA 2NR5A 1FXVA 1IZ3A 2QWNB 4B7KA 5KX5B 4ZIBA 4IHJA 3AG4C 5JQGA 4DR3B 3UO2A 4LF5O 1FKAO 1OCRB 4EKWA 4JASA 3ETEA 4FFKA 4O4IA 5B66Z 3ASNB 2FL4A 1P4RA 3L72H 4NYKA 3G80A 1QVGU 3T4DA 1SQXH 4AI8A 1H38A 1K33A 4MW3A 4F6RB 4O4LB 1SA0A 2IJIA 3B09A 1R6TA 5J2UA
chains in the Genus database with same CATH topology
1JJ2U 2HVJC 4J9ZB 1QLNA 1Q7YW 3DGEA 2IJJA 1AROP 1G8MA 5HFLA 4RQEA 5H9CA 1K8AW 3X2QB 4QPJA 5L3CA 2ITCC 5HFMA 2ZXWC 1OCCC 1AJPA 3IFXA 1NVPB 5LGUA 4P9OA 3BEHA 2JEUA 5B3SC 3W7TA 3CCLV 2EILC 1LNQA 2EIJB 2IU0A 3K9AA 4GX1A 1TUEB 1YITV 4H33A 5BZBA 4OXSA 1YHQV 4YXWG 2LFRA 5DM6V 4JAVA 3F5WC 3FKSG 1H8HG 4BAYA 4QPKA 4R6ZA 5EBMC 1VQ6V 4PELA 2ZDIC 1SETA 4MVMA 1K92A 3ASOB 3D36A 2BOCC 3STZC 2Y69C 1RM1B 5IDJA 5IY5C 1VQ4V 3LDCA 3OAAG 3CMAV 2DW4A 3IGAC 1AJQA 5H6QA 2YEVA 2HR3A 5CBHA 3SYQA 1F23A 3E35A 3E2EA 3JD0A 4PDRA 1KP3A 3CC4V 5C93A 4DXWA 3ML0A 3ZMSA 4MVRA 3E86A 4UV8A 3CCMV 4GX5A 4MT8A 3TCUA 3CD6V 1L1FA 2AHYA 4JTDB 1K5SA 2DYSC 3MHHC 3E8BA 3CP1A 2OCCC 3HB3B 5CMUA 2XAQA 4FJCC 3LSQA 4R50A 2DYRC 4GT1A 2WSSG 1NJIW 4RUFA 5LHIA 3OE7G 2WLKA 4JYCA 4WF9V 2ZQMA 4WFGA 1BHAA 3K0GA 3ABMC 1FS0G 2IH3C 1FXKB 2X6CA 2ATKC 3QO5A 2JJ2G 2NLJC 2QKSA 3H01A 3TETA 4MTFA 2XAFA 2R9IA 4FK5C 3AEIA 2Z3YA 3G6EV 1VQOV 3I55V 3OW2U 5CN0A 3CXCU 3ZCCA 2EZOA 3FYIB 1COWG 3AG3B 2QTOA 4GCZA 5L3FA 3ASNC 3QO7A 1MSWD 4R8CA 1HWYA 4P30A 4FIPC 4RAIA 3ZMZA 5B1BB 5IYBO 3SPIA 5LHHA 1OCOC 2JDIG 3CCJV 2ZD9A 1DF5A 2WPDG 3ZN1A 3CCVV 3OR7C 1QLEC 4JAUA 1F4NA 1H2GA 3ZRWB 1CP9A 4I5SA 3X2QC 2WAMA 3ABKC 2HKOA 4LP8A 3OUFA 3OFNG 4PDVA 4ZBMA 1AI4A 1SERA 4G28B 4MVQA 3ZMVA 2WLMA 5KA5A 2Z5UA 2EIJC 1BMFG 4QNHB 1W2BU 4UUJC 4PA3A 1VQLV 4BW5A 1FXHA 4BIUA 4JTCB 3WFVA 4JGSA 4F4LA 1S76D 1MABG 2P6JA 3ETGA 4HAMA 3K08A 2P90A 3LDDA 3ASOC 4FPPA 1S72V 1M57C 3SYOA 4RQFA 3JD1A 3RBZA 1VQ9V 3P32A 1AI5A 5B1NA 2OT5A 3ZRSA 4UVBA 1KQSU 3W7SA 3CCQV 2WLHA 2A9HA 2YSUB 3WG7B 2B1IA 2IH1C 1NQTA 2JIZG 2B5UA 3W7UA 3K3WA 2FTKA 3ZN0A 3G71V 1Q81W 1FFTB 1KP2A 2H8PC 3IC7A 3OGCC 3E8FA 1PNMA 5LHGA 1JQ0A 1R6NA 2W0FC 3CYOA 4DO2A 4UXNA 3ETDA 3E8HA 3VBBA 4P2ZA 1K73W 1N8RW 1S77D 1GK9A 1FXKA 2XAJA 2XASA 3ZMUA 1OHHG 5KA6A 4J9YB 2H94A 1K4CC 4X88A 2ITDC 2LFSA 4N23A 3P30A 2LP7A 3JD3A 2HJFC 1FXKC 2Q68A 4Q20A 1K34A 5H6RA 3OR6C 1IXMA 4MTGA 3JD2A 2EJRA 1QCEA 1P7BA 1Q82W 1KC8W 3ZRVA 3TK1A 2JEXA 4U7OA 5EBLC 3OMAB 3SYAA 4XDJA 1WLEA 1YTFD 5EK0A 3M99B 3ABTA 3JCZA 1QR8A 3K0DA 2MK3A 3AG3C 2AHZA 3T4ZA 1ROPA 1CPYA 1YIJV 1PNLA 3G4SV 1S0VA 4G2KA 3CMEV 3R65A 3W7XA 2IJHA 4QE7A 5B1BC 2CK3G 2ZR3A 4CZZA 3BY6A 3SPGA 3ZRWA 2Q6AA 3ZRXA 5EC1C 2C2AA 2OTLV 1SESA 2F43G 4P9PA 4HYOA 4MVZA 4ASUG 4MTOA 2A0LA 4KUMA 3K03A 2EIMC 3LSSA 1V55B 1VQMV 1KECA 1W0KG 3SYCA 4WFAV 1NBMG 1K3EA 2V7QG 3CPWU 1OCRC 4RO2A 1Q86W 1SZTA 2XOKG 2IU3A 1R3LC 1R3JC 5CA3A 2K1EA 1AJNA 5DN6G 1K9MW 2OTJV 1WPXA 4U7NA 1JCHA 4XBFA 2WWWA 4GX2A 1JPXA 2UXNA 1MG1A 3E83A 5EBWC 2DWDC 1F51A 4LCUC 3CCUV 3RVZA 1NH2D 1OZ0A 1GM8A 3E8GA 1PNKA 2IW5A 2JK5C 3OMNB 1OCZB 2W6IG 3T2MA 1QR9A 1YI2V 3CCRV 1VQ8V 3GB7C 2PI4A 3SJQC 3A0RA 3WG7C 3EHBB 5L3BA 3W7WA 1M90W 2WLIB 3DTUB 2EIKB 1K7DA 2EINB 1SRYA 3ABLB 3AG2B 4MTXA 2WLLA 1KKDA 4WFHA 2Y48A 1S3JA 3LNMB 4QIWF 3FB6C 1YJ9V 4WFEA 5B1AB 4JPRA 4WCEV 3E89A 3K04A 1VQKV 1M56B 1V54B 3F7YC 3ABMB 1XL4A 1GTOA 1YTFB 5KUMA 1W0JG 1AI7A 3LUTB 3EFFK 3OEHG 1EBOA 2D3OW 2X0LA 4BIZA 1RM1C 2WLNA 1GKFA 3T1CA 3F7VC 2XAHA 5L3GA 4UVAA 3CC7V 4FMTA 1K4DC 4XDLA 1E1QG 4Z1MG 1DTOA 1DLBA 1GO3F 1THZA 1EFRG 5LGNA 1VQ7V 3GWOA 3B77A 4GX0A 4X89A 4LC1A 3AG1B 2HFEC 1M1KW 4WFBV 2HLDG 2X6AA 3STLC 4MSWC 1E1RG 3B8MA 3FYEB 1R3KC 3HPLC 3QO8A 1R73A 1PL0A 3I56V 4I9WA 2KB1A 4MS2A 2WLLB 2Q69A 3AG4B 4X8AA 4KP4A 1QLEB 2WLJA 3ABKB 1XL6A 3OM3B 1V55C 1GMGA 4QE9A 1M9NA 1NH2B 4JTAB 4ZKIA 2R9RB 2ZDIA 2P7TC 3RW0A 5L3DA 1BHBA 2HG5C 3CCEV 4XDKA 1ENVA 3SYPA 5GW7A 3JYCA 3D3IA 1I5XA 3CCSV 3OEEG 4JYBA 2A79B 2IJKA 3MD0A 3KG2A 1Y66A 2DQ3A 2V1DA 1JVMA 2QE7G 2W6JG 1M57B 2QM8A 1KD1W 1JX9A 2Q67A 2M7WA 4PA7A 1OCZC 3ZMTA 1NKDA 2WLIA 4MVUA 1QBZA 3LDEA 4N21A 2ZXWB 1OCCB 5IYDO 4HZ3A 2HVKC 3FB8C 2DWEC 3FB7C 2JJ1G 2DQ0A 3B8NA 5J9PC 5B3SB 2EILB 2EIKC 1K97A 2EINC 3ABLC 3AG2C 1ORQC 2X6BA 4L87A 1MOFA 1G4YB 1PD3A 1BL8A 1E79G 3MHSC 3SPJA 4CBCA 2EZPA 4LBEC 4RUEA 5B1AC 1H8EG 1NVPD 1M56C 4MVSA 1V54C 1S5HC 3K06A 5E1AC 1RPRA 2Y69B 3FB5C 3VOUA 2P67A 4QJFB 5IY5B 1QVFU 2EBOA 1NR1A 2X7RB 4PDLA 3QNEA 2BOBC 1ZWIC 4JF3A 3JD4A 4E2LA 1RPOA 3UKMA 2GSMB 4TWKA 2QM7A 4MW8A 5LBQA 5CBFA 1YSCA 1AI6A 2UXXA 3SPCA 4KFMA 4TT3G 2GHYA 2YEVB 4MVOA 2B1GA 4UV9A 3AG1C 3SPHA 1CEZA 5FL7G 1K5QA 2DYSB 3K79A 4PA6A 4H37A 2OCCB 3ZIAG 1VQPV 5IYCO 1J95A 2DYRB 2QEXV 3CC2V 1Y4MA 3UM7A 1FXVA 1NR7A 1YJNV 1YJWV 2PI5A 1F4MA 1EZJA 3AG4C 2EIMB 3PJSK 2ZR2A 3ABUA 1GM7A 5B1OA 2NNUA 3OMIB 1OCRB 4EKWA 1VQ5V 4G27B 3RVYA 5LGTA 3OUSA 4JASA 2XAGA 3ETEA 1UJWB 1DF4A 5CBGA 1B6QA 2XNDG 1PKXA 3ZJZA 1AR1B 1VQNV 3NXSA 1R3IC 3ASNB 1I5YA 5EC2C 1P4RA 4WFFA 4PA9A 4PDMA 4R7CA 1QVGU 4UVCA 3T4DA 5L3EA 4TSFG 2QA4V 1H38A 1K33A 1JOYA 4MW3A 1R6KA 2IJIA 1GM9A 5KUKA 1OCOB 4PA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEI A;  1FXK C;  2ZDI C;  1FXK B;  2ZDI A;  2ZQM A;  1FXK A; 
#chains in the Genus database with same CATH topology
 2AZ2 A;  2KG7 B;  2E5L O;  4LF7 O;  4O2A A;  5JH7 B;  2YIA A;  1G8M A;  5HFL A;  1K8A W;  2ITC C;  2ZXW C;  2R72 A;  2BSK A;  4OGQ B;  3BEH A;  5B3S C;  3W7T A;  1O9H A;  2EIL C;  1LNQ A;  2EIJ B;  2ADQ B;  1YHQ V;  1YEW A;  2LFR A;  1N4C A;  1VQ6 V;  3S3W A;  2FYU H;  1K92 A;  3D36 A;  5GON A;  4DV7 B;  2ZM6 B;  1VQ4 V;  5LOV A;  3IGA C;  2YEV A;  2HR3 A;  5CBH A;  1F23 A;  4DV5 O;  3CC4 V;  3ML0 A;  4PI2 A;  4TV8 A;  4MVR A;  5CA1 B;  1HDJ A;  4FM2 A;  5DEC A;  1K5S A;  3MHH C;  3CP1 A;  1TAE A;  3HB3 B;  5CMU A;  4DR1 O;  2XAQ A;  2BSK B;  2DYR C;  1NJI W;  3JAL A;  1BHA A;  2ZQM A;  4CH4 A;  3IJ4 A;  1FS0 G;  2OCH A;  1DK1 A;  1VP7 A;  2ATK C;  2GTS A;  2NLJ C;  4O4J B;  3H01 A;  3CX5 F;  2Q7G A;  3APQ A;  3K9S A;  3KCY A;  2XAF A;  4X9Q A;  4MTF A;  1SS3 A;  3ZHV A;  4NXN B;  1VQO V;  3JSN A;  3OW2 U;  2E75 B;  3K5O A;  3FYI B;  4FLT A;  2FML A;  3AG3 B;  1H2N A;  3QO7 A;  4R8C A;  1N34 O;  1NTK H;  3J7A U;  2BE3 A;  4RAI A;  2QR4 A;  4EEQ A;  1VF5 B;  5IYB O;  1SQP H;  2JDI G;  2WA3 A;  3VQX A;  1DF5 A;  1M93 A;  3ZN1 A;  3OR7 C;  3ZRW B;  1CP9 A;  3HKB A;  3ABK C;  4LP8 A;  3OUF A;  3OFN G;  3JAL B;  4G28 B;  2Z5U A;  1W2B U;  1EN6 A;  5KLV H;  4X20 B;  5FPR A;  4K0K B;  4F4L A;  1MAB G;  1BSM A;  2P6J A;  3ETG A;  3JAM N;  3DC5 A;  4HAM A;  4JI4 B;  3LDD A;  2CH7 A;  4RQF A;  1OV9 A;  1VQ9 V;  1HNX B;  2F1M A;  5B1N A;  3ZRS A;  1URF A;  3CRM A;  3CCQ V;  2F23 A;  1VMG A;  3SR2 C;  3CRR A;  2IH1 C;  1P7G A;  2FTK A;  2PYL A;  3ZN0 A;  1Q81 W;  1FFT B;  1KP2 A;  2H8P C;  3IC7 A;  3OGC C;  4EFB A;  5LMU B;  1PNM A;  2N04 A;  1R6N A;  3ETD A;  3E8H A;  1K73 W;  4LFC O;  3ZMU A;  3C3T A;  4DV1 O;  4X88 A;  1K4C C;  4DR4 O;  4N23 A;  3HKE A;  2LP7 A;  2HJF C;  3N27 A;  1FXK C;  4Q20 A;  5H6R A;  1RSO B;  3I5D A;  2VQF O;  4JI2 B;  1P7B A;  2BCC H;  5IJ9 B;  1N36 B;  4I50 A;  4U7O A;  2VS0 A;  1RFY A;  2CH7 B;  3K5L A;  4JZG A;  5LYJ A;  3JCZ A;  2H3O A;  2L6L A;  3RGB A;  3ZHR A;  2AHZ A;  3O65 A;  1MZF A;  1ROP A;  3K5N A;  1IXB A;  4I4T B;  3THO A;  3G4S V;  1ZSP A;  3R65 A;  4UCS A;  4CZZ A;  3B2E E;  2Y4T A;  3APO A;  5JJJ B;  3ZRX A;  1N0J A;  4DV6 B;  4P9P A;  4HYO A;  4ASU G;  4MTO A;  4KUM A;  3K03 A;  1F7Y A;  3ZX6 A;  1KEC A;  1QU7 A;  3ZBH A;  4GUN A;  2V7Q G;  1OCR C;  2QWR B;  4EFE A;  1Q86 W;  1ZTE A;  1R3J C;  1JFF B;  2OTJ V;  5GTH Z;  4U7N A;  4XBF A;  2WWW A;  3MDS A;  2UXN A;  1MG1 A;  3CCU V;  2DWD C;  5LYJ B;  1WN7 A;  4UCU A;  4CH3 A;  4CH6 A;  4WBN B;  4UB8 Z;  2G38 A;  2QSA A;  1QR9 A;  3VQY A;  3JAW A;  4HBN A;  4ABM A;  4J42 A;  3CCR V;  2UUC B;  3U11 A;  1VQ8 V;  3HKC A;  5ITZ B;  3WG7 C;  4LFB B;  1SF9 A;  2CAZ C;  4U3J B;  2WLL A;  3WU2 Z;  2F93 B;  1BT8 A;  4IYI A;  1KKD A;  2R70 A;  2Y48 A;  5LL6 Y;  1YVW A;  1S3J A;  3C90 A;  1I94 B;  4QIW F;  1SC5 B;  3U10 A;  2A06 H;  3AG7 A;  4LF8 O;  4WFE A;  5IWA O;  5B1A B;  4H0L B;  1NU1 H;  1VQK V;  1V54 B;  2AW9 A;  3ABM B;  1YTF B;  5KHI A;  3GWK C;  3BPZ A;  1XMO B;  3OTF A;  2X0L A;  3N2K B;  4JI5 B;  4B3S O;  1E1Q G;  2D2C B;  3FD9 A;  3FAV A;  1HW7 A;  3EXA A;  3LSU A;  3B77 A;  3AG1 B;  4PJ0 Z;  2E76 B;  1M4U A;  1E1R G;  2FB5 A;  3HPL C;  3BCC H;  3QO8 A;  1R73 A;  4I9W A;  2GTA A;  2UXB B;  1VIB A;  2WLL B;  5LXT A;  3F5T A;  3AG4 B;  4H13 B;  4X8A A;  2ILM A;  4OPA A;  4CS4 A;  1SQB H;  3D8C A;  4YIP A;  1GH6 A;  1FPO A;  5KMG A;  3BHP A;  2XT9 A;  1IBL O;  4DR2 O;  1GMG A;  1MNG A;  4FM1 A;  1NH2 B;  2R9R B;  5FNV B;  3N2G A;  2HG5 C;  3ZHQ A;  3TXQ A;  3DXR A;  1EM1 A;  2ZNI A;  1PL4 A;  3G67 A;  2GUZ A;  3OEE G;  1Y66 A;  3FAV B;  1M57 B;  2QM8 A;  1Y76 B;  4GKK O;  4OX9 B;  4I0X B;  1Q8I A;  1FD9 A;  1BZK A;  3HR0 A;  3LDE A;  2ZXW B;  4IYH A;  2DOS A;  3FB8 C;  4FM0 A;  1PP9 H;  4X66 B;  5J9P C;  5B3S B;  2EIL B;  2VWJ A;  2EIN C;  4GKJ B;  1XDC A;  4L87 A;  1MOF A;  1IVS A;  1G4Y B;  1BL8 A;  2ZIN A;  4JI0 O;  4JYA O;  2A7W A;  5IYZ A;  4I7Z B;  2BTO A;  4FFB A;  3N2G B;  3SDL A;  4O4H B;  5BR8 O;  4MVS A;  1RP3 B;  2X7R B;  4PDL A;  3QNE A;  3TET A;  1IBK B;  4E2L A;  5JCO C;  3UKM A;  1BGY H;  1YSC A;  1AI6 A;  4C7U A;  4W4L A;  4TT3 G;  1XUQ A;  2LW1 A;  1T5E A;  4DR3 O;  3ZIA G;  2DYR B;  1Q6I A;  4JI6 B;  1YJN V;  2PZS A;  2PI5 A;  1EZJ A;  4AHC A;  2A3Q A;  5IYZ B;  2ZR2 A;  3ABU A;  1GM7 A;  2WA4 A;  4X62 B;  3J80 N;  3RVY A;  4ZOL B;  2XAG A;  5KHJ A;  3GVM A;  1VQN V;  1UPG A;  2CDY A;  3O9O A;  3K57 A;  4WFF A;  1HNZ B;  3BA9 A;  2P06 A;  5L3E A;  3DSQ A;  2DJV A;  1JOY A;  3JAR A;  1GM9 A;  2YXH A;  1XI1 A;  2QTS A;  1XNQ B;  3JCU Z;  1H2K A;  1WB8 A;  2P4K A;  2HVJ C;  1AIL A;  5H9C A;  4LH6 A;  3BFR A;  5HFM A;  2RMK B;  1AJP A;  3IFX A;  5LGU A;  5B5E Z;  1IX9 A;  2JEU A;  4EB6 A;  3E22 A;  4DV7 O;  2ZM6 O;  4GX1 A;  1TUE B;  3AK1 A;  4H33 A;  4YXW G;  1NTM H;  1XRE A;  5EBM C;  5IJ0 B;  1WJZ A;  3ZHS A;  2BOC C;  3STZ C;  2Y69 C;  1A32 A;  4LWS A;  3CMA V;  2DW4 A;  1Y74 B;  1AJQ A;  2YI9 A;  1X59 A;  1GN2 A;  1SQG A;  3TXS A;  4H44 B;  5DED A;  4MT8 A;  3R66 A;  1L1F A;  5KX5 A;  5J2T B;  1S5J A;  3LSQ A;  4R50 A;  4NXN O;  4RUF A;  1JJO A;  4LH7 A;  1XMQ B;  4WFG A;  1EZV H;  3ABM C;  3CJH B;  2IH3 C;  1FXK B;  2QKS A;  1WA8 A;  1LR1 A;  2R9I A;  2BTQ B;  3IAY A;  5CN0 A;  3CXC U;  1VAR A;  1WAZ A;  4LWS B;  4NR1 A;  3TJT A;  5F2V O;  1COW G;  4F6R A;  1FJG B;  4O4L A;  4LNU B;  4GCZ A;  5L3F A;  1H2M A;  2KG7 A;  1XOU A;  4P30 A;  2LO1 A;  3L70 H;  5JH7 A;  1OCO C;  3CXH F;  1KMI Z;  4JAU A;  1F4N A;  1D5A A;  4I5S A;  3X2Q C;  2QWQ B;  1WB7 A;  1ZLZ A;  4PDV A;  4ZBM A;  4K0K O;  1Y6X A;  4Q6G A;  4JI4 O;  2WLM A;  1BE3 H;  1WA8 B;  4QNH B;  4PA3 A;  1VQL V;  2W0X A;  2RJZ A;  1HNX O;  3H1K H;  4JGS A;  3H1J H;  2EJ7 A;  2P90 A;  1GN4 A;  1TA8 A;  4IL6 Z;  1M57 C;  3OT7 A;  3RBZ A;  4NTX A;  5LMU O;  1AI5 A;  5CA1 A;  2WLH A;  2YSU B;  3WG7 B;  1XIL A;  3U0Z A;  2JIZ G;  2B5U A;  3G71 V;  1HR0 B;  1JA8 A;  2CGN A;  1NZ6 A;  4AIL C;  1JQ0 A;  3SGI A;  4NVP A;  4JI2 O;  5BY1 A;  4O4J A;  1N36 O;  4J9Y B;  2IM9 A;  4I55 B;  4D6T H;  3FFQ A;  5JJN B;  4DUZ B;  3P30 A;  1IXM A;  3JD2 A;  1QCE A;  1Q82 W;  1KC8 W;  3ZRV A;  3CHX A;  4DV0 B;  5EBL C;  3SYA A;  1YTF D;  4TOI A;  4DV6 O;  2ETN A;  1YIJ V;  3ICX A;  3CME V;  4QE7 A;  5B1B C;  3SPG A;  1CXZ B;  2Q6A A;  3ZRW A;  2VRZ A;  4TQD A;  4FLX A;  1SES A;  2F43 G;  4DV2 B;  3ZHU A;  3PN1 A;  3RT3 C;  5LP6 C;  2YXY A;  3LSS A;  1VQM V;  1W0K G;  3CPW U;  1NTZ H;  1BQ0 A;  4X20 A;  2QWO B;  2K1E A;  1BS3 A;  2CTQ A;  1JCH A;  4O2B B;  1XQ8 A;  4GX2 A;  3K59 A;  5JCO A;  3E83 A;  2UUC O;  1LUW A;  3RVZ A;  1NH2 D;  2ZE6 A;  1OZ0 A;  4I9Q A;  1GM8 A;  4LFB O;  1WP7 A;  2Q7E A;  3OMN B;  5EZY A;  1YDX A;  5JJE B;  3P3P A;  4DW1 A;  2UUB B;  3CS5 A;  1I94 O;  2Q5Z A;  1S5L Z;  3A0R A;  1ZAU A;  3G6B A;  1M90 W;  2WLI B;  3DTU B;  2DN9 A;  1K7D A;  2EIN B;  3Q4H A;  4ICG A;  1XMO O;  3RYI A;  4YY3 B;  4DUY B;  1YJ9 V;  3OD4 A;  2ZNJ A;  4JI5 O;  1FFX B;  2MW2 B;  3E89 A;  4FLU A;  1RSO A;  3JSL A;  4DR6 B;  4DV3 B;  1L0N H;  1U96 A;  5IJ9 A;  1W0J G;  2YIB D;  2CE4 A;  4J11 A;  1V9P A;  1EBO A;  1B06 A;  1SKV A;  4PHZ A;  4BIZ A;  1GKF A;  3BVO A;  3F7V C;  3T1C A;  5L3G A;  4UVA A;  2QKC A;  1K4D C;  2QJ1 A;  4Z1M G;  4B3M B;  1DLB A;  1GO3 F;  2LQT A;  5EZY B;  2AZ0 A;  2XTA A;  4I4T A;  4CC5 A;  4AQY B;  4GX0 A;  4X89 A;  4LC1 A;  1B04 A;  2X6A A;  4DRX A;  3FYE B;  1R3K C;  5KAI Z;  1IDS A;  2LW7 A;  4K8X A;  2PF4 E;  3QG5 A;  2QDO A;  4YJ3 B;  4TV9 B;  3Q4H B;  2RDC A;  1QLE B;  3WB2 A;  3RYI B;  1O9G A;  3OM3 B;  4QGP A;  2UU9 B;  1GRJ A;  1JFF A;  2OIG A;  4D7T A;  4JTA B;  2P7T C;  5GW7 A;  1ZX3 A;  4OX9 O;  4UFZ A;  4JI3 B;  2IJK A;  3KG2 A;  4WBN A;  1MMM A;  1JVM A;  4LF6 B;  1KD1 W;  4X66 O;  3ZS8 C;  1Z5W A;  4UCT A;  5ITZ A;  1OCZ C;  4DRX B;  4GKJ O;  5CB4 B;  4U3J A;  4N21 A;  4HZ3 A;  3RWR D;  4FVM A;  2DWE C;  3FB7 C;  2JJ1 G;  4JI1 B;  1Z2G A;  3B8N A;  3VQV A;  4NKG B;  2EIK C;  1K97 A;  3ABL C;  2P4V A;  4B3R B;  3AG2 C;  2K9P A;  2X6B A;  1Q5O A;  1E79 G;  3MHS C;  3CEI A;  4PV1 B;  3SPJ A;  4L8J A;  1IBK O;  3MAQ A;  1N33 B;  1M56 C;  2ZE7 A;  3N2K A;  3UCS C;  1S5H C;  3K06 A;  1RPR A;  4BW9 A;  2Y69 B;  1YXB A;  3RN4 A;  4QJF B;  1QVF U;  2YXL A;  1ZWI C;  2Q4P A;  1B3Q A;  4TWK A;  2QM7 A;  5LBQ A;  2QWP B;  4JI6 O;  2VQE B;  2GHY A;  2NN4 A;  2B1G A;  4NTY A;  4UV9 A;  3SPH A;  1CEZ A;  5FL7 G;  5BXZ A;  1K5Q A;  1BQZ A;  1N32 B;  4X62 O;  1VQP V;  3CC2 V;  3UM7 A;  1F4M A;  4X1Y B;  2JGD B;  2P5O A;  3AK3 A;  2EIM B;  2Q0A A;  4LR3 A;  3PJS K;  1FYJ A;  3BAA A;  2GBO A;  2NNU A;  5FNV A;  3OMI B;  2P22 C;  1VQ5 V;  1HNZ O;  3OUS A;  1UJW B;  1IUR A;  1DF4 A;  5CBG A;  3OTO B;  1HNW B;  1PKX A;  3ZJZ A;  3NXS A;  4FLV A;  1XNQ O;  1I5Y A;  4B3T O;  1Y76 A;  2PGG A;  4I0X A;  1KBH A;  1R6K A;  1OCO B;  2F4V B;  4GLX A;  1JJ2 U;  4J9Z B;  2FKX A;  1Q7Y W;  3DGE A;  2IJJ A;  3RYF B;  4KXR A;  3X2Q B;  1KKC A;  4FLW A;  2YIB A;  3BA8 A;  2PUS A;  2Y4U A;  5D5P A;  4P9O A;  4B7E A;  3ZHT A;  1AP6 A;  1HP8 A;  3K9A A;  4O4H A;  1YIT V;  5BZB A;  4OXS A;  2YID A;  4JAV A;  4BAY A;  4QPK A;  4MVM A;  1SET A;  4DR5 B;  4BIO A;  5IDJ A;  3LDC A;  5GTI Z;  4FLZ A;  3SJA C;  5H6Q A;  3D36 C;  2Q8V A;  3NR7 A;  4PDR A;  4YHH B;  3T1Y B;  4DV4 B;  3BRC A;  5C93 A;  4DXW A;  1XMQ O;  3ZMS A;  4UV8 A;  4JTD B;  5LMN B;  1L8D A;  4GT1 A;  2WSS G;  5LHI A;  3OE7 G;  2WLK A;  4JYC A;  4ZOL A;  3K0G A;  5KHK A;  3QO5 A;  1FJG O;  1SQF A;  4FK5 C;  3AEI A;  2Z3Y A;  3G6E V;  3I55 V;  2LGQ A;  2ARH A;  3ZCC A;  2EZO A;  3RYC A;  4NXM B;  2QTO A;  4X1K B;  2LJ2 A;  5LA6 A;  1HWY A;  3ZMZ A;  1J5E B;  1XNR B;  5B1B B;  2V4D A;  1G1X B;  3SPI A;  5LHH A;  2ZD9 A;  3T1H B;  1NT2 B;  4JZ2 A;  4KHP B;  5LP6 B;  1QLE C;  2HHH B;  2WAM A;  2GV9 A;  4MVQ A;  5KA5 A;  5IJ0 A;  1BMF G;  1YZB A;  2JVD A;  4BW5 A;  1FXH A;  1S76 D;  3TGU H;  1UFI A;  2UUA B;  1WP8 A;  2R9A A;  3LNN A;  3RYC B;  1Y74 A;  4FPP A;  3ASO C;  1S72 V;  1OJH A;  1HR0 O;  2DMX A;  3JD1 A;  5LA6 B;  1D2D A;  2OT5 A;  1KYO F;  1KQS U;  1SZX A;  4HNA B;  1XEQ A;  2A9H A;  2B1I A;  1NQT A;  3W7U A;  5J2T A;  1LUV A;  1U97 A;  4DUZ O;  4JI7 B;  5LHG A;  2W0F C;  3CYO A;  4DO2 A;  3VBB A;  4X1I B;  4P2Z A;  3CJH A;  1GK9 A;  1FXK A;  2XAJ A;  2XAS A;  1OHH G;  2Q9L A;  1VF6 C;  4DV0 O;  2ITD C;  2LFS A;  4TQF A;  2BTQ A;  4FZ0 A;  3CRC A;  2Q68 A;  2VWK A;  1K34 A;  4J7J A;  3OR6 C;  1TGO A;  5JVD B;  1Q43 A;  2EJR A;  4X64 B;  2UXD B;  1Q90 D;  4UCV A;  4LNU A;  1YCI A;  3OMA B;  2KKW A;  5EK0 A;  4DV2 O;  3B4S A;  1CPY A;  4G2K A;  2IJH A;  2CK3 G;  3BY6 A;  2RNB A;  5EC1 C;  3H1L H;  2OTL V;  3H1I H;  2CTW A;  4MVZ A;  5KAF Z;  4YIO A;  3UT5 B;  4X65 B;  4UCO A;  2EIM C;  2ADP A;  3HKD B;  4WFA V;  3L75 H;  2CTR A;  2IU3 A;  2JS5 A;  5DN6 G;  2UUB O;  1TVK B;  5EBW C;  4DR7 B;  1F51 A;  4LCU C;  1R1B A;  3E8G A;  1PNK A;  3M7M X;  1I08 A;  5K1P A;  4ZHQ A;  1OCZ B;  2W6I G;  4JYY A;  1IBM B;  4ZI7 A;  5BMV B;  3AK2 A;  4YY3 O;  4DUY O;  2PI4 A;  3SJQ C;  4KL1 A;  4LF4 B;  4LFA B;  5L3B A;  3W7W A;  5D5Q A;  1AP5 A;  2EIK B;  3ABL B;  1SRY A;  3JAS A;  3AG2 B;  4DR6 O;  3A8T A;  4DV3 O;  4GZR B;  3FB6 C;  4I55 A;  4F6E A;  4JPR A;  4A5U B;  1M56 B;  1XL4 A;  1XHZ A;  5KUM A;  4B3M O;  1AI7 A;  3OEH G;  4AQY O;  2D3O W;  5KHG A;  4B08 A;  1W59 A;  3KZI Z;  4XDL A;  2F95 B;  1THZ A;  4ZHQ B;  3D3Q A;  1EFR G;  2RN9 A;  1VQ7 V;  1M1K W;  4ZI7 B;  2HLD G;  3STL C;  4MSW C;  1EN4 A;  4IIJ B;  1Q6H A;  3B8M A;  2UU9 O;  4DYL A;  1PL0 A;  3JAS B;  2KB1 A;  4MS2 A;  2UXC B;  1GN6 A;  1QQC A;  4KP4 A;  2AXT Z;  4JV5 B;  3JAT A;  2M6Y A;  2N74 A;  1XL6 A;  1V55 C;  4JI3 O;  4QE9 A;  4IHJ B;  4Z2W A;  2QGN A;  5JQG B;  1M9N A;  4ZKI A;  4LF6 O;  4O2B A;  4DW0 A;  3RW0 A;  1Q3E A;  3CCE V;  4XDK A;  1P49 A;  1ENV A;  3SYP A;  1L0L H;  4IGG A;  3JYC A;  3D3I A;  1I5X A;  4O4I B;  4RWU A;  3CCS V;  4JYB A;  3MD0 A;  1G6U A;  2QE7 G;  2W6J G;  3CRA A;  4JI1 O;  1JX9 A;  2M7W A;  4B3R O;  3ZMT A;  2WLI A;  1SA0 B;  5J2U B;  3QTC A;  4O2A B;  1KB9 F;  1N33 O;  2IBZ H;  3K5M A;  3BAB A;  2L35 A;  3JAT B;  1FFX A;  2EZP A;  2QM4 A;  3CRQ A;  4LBE C;  4K8Z A;  1H8E G;  2PY5 A;  5TIS Z;  1FAF A;  3FB5 C;  3VOU A;  2CGO A;  2P67 A;  2VQE O;  3UQ8 A;  3JD4 A;  5GON B;  2GSM B;  1N32 O;  4LF9 B;  4JI8 B;  5CBF A;  5LOV B;  2UXX A;  4KFM A;  2YEV B;  4MVO A;  2YDE A;  4YJ3 A;  4TV9 A;  4CH5 A;  1MA1 A;  5IYC O;  4CS3 A;  1J95 A;  4TV8 B;  4JAA A;  1NR7 A;  1YJW V;  3H1H H;  3OTO O;  1HNW O;  5B1O A;  4FLY A;  4GYC B;  1XBL A;  4G27 B;  2OIE A;  5LGT A;  3KCX A;  4K35 A;  1B6Q A;  2XND G;  1D5N A;  1AR1 B;  2UXB O;  1R3I C;  4LF5 B;  2F4V O;  3B40 A;  5EC2 C;  1ZUQ A;  4PA9 A;  4PDM A;  4R7C A;  2ZIO A;  4UVC A;  1NS1 A;  2XUM A;  4TSF G;  2QA4 V;  5CB4 A;  3EVK A;  3CSX A;  5KUK A;  4PA4 A;  1QLN A;  1ARO P;  4RQE A;  5A9G A;  4QPJ A;  5L3C A;  5H5N A;  1OCC C;  1P84 F;  4PD4 F;  2JS3 A;  1NVP B;  5C8Y A;  2E5L B;  4LF7 B;  3CCL V;  1VF6 A;  3HKB B;  2IU0 A;  4DK0 A;  5EIB C;  4DR5 O;  5DM6 V;  3F5W C;  3FKS G;  1H8H G;  1I7F A;  4R6Z A;  5FLX N;  4PEL A;  2ZDI C;  2QKA A;  1NI8 A;  3ASO B;  4YHH O;  3T1Y O;  4DV4 O;  1RM1 B;  5IY5 C;  3DC6 A;  3OAA G;  1X4T A;  3A2F A;  1BCC H;  4J10 A;  5LMN O;  3SYQ A;  1VEW A;  3E35 A;  3E2E A;  1ZL8 A;  3JD0 A;  1KP3 A;  3RYH A;  3WB0 A;  3E86 A;  3CCM V;  4GX5 A;  3TCU A;  3CD6 V;  2YUA A;  2AHY A;  3M8A A;  4NTW A;  4X1Y A;  2DYS C;  2JGD A;  3E8B A;  2OCC C;  4DV5 B;  5C8Y B;  2Q7H A;  4FJC C;  2RCV A;  1KU9 A;  1AVM A;  2E3C A;  4CC6 A;  1N0N A;  4WF9 V;  5E79 Z;  4NXM O;  2KQX A;  2X6C A;  3L9D A;  1MSD A;  2YI8 A;  2JJ2 G;  4DR1 B;  3HKE B;  1J5E O;  1XNR O;  1DGS A;  3L74 H;  3T1H O;  3ASN C;  4I50 B;  1MSW D;  1SQV H;  4KHP O;  1ZL8 B;  4FIP C;  1JMK C;  1PPJ H;  2HHH O;  3RYH B;  4IT5 A;  3RYF A;  3CCJ V;  2HP8 A;  2CUG A;  2E74 B;  2WPD G;  1N34 B;  1M5I A;  3CCV V;  1H2G A;  2HKO A;  3OGI B;  1SER A;  1AI4 A;  2UUA O;  3ZMV A;  2EIJ C;  4UUJ C;  5IT9 N;  4BIU A;  3ZED A;  4JTC B;  3WFV A;  5CA0 A;  2CTP A;  3QVN A;  1Y67 A;  3K08 A;  5EIB D;  2OYQ A;  2YC0 A;  2EX3 A;  3SYO A;  1WNS A;  4JI7 O;  3P32 A;  1US6 A;  1PV0 A;  4UVB A;  3W7S A;  2Q73 A;  3K3W A;  2ZE5 A;  3JAW B;  2HEP A;  3HKC B;  5FPO A;  3E8F A;  4UXN A;  3UO3 A;  1AB3 A;  1N8R W;  1S77 D;  4X64 O;  2UXD O;  5KA6 A;  4J7K A;  2H94 A;  2AGA A;  4Z1V A;  3JD3 A;  5CA0 B;  3J81 N;  4MTG A;  4YJ2 A;  4LFC B;  4X1K A;  3TK1 A;  4DV1 B;  2JEX A;  4DR4 B;  4XDJ A;  1WLE A;  3M99 B;  1TUB A;  3ABT A;  4U3F H;  1QR8 A;  5JWP A;  3K0D A;  2MK3 A;  3AG3 C;  3QF7 A;  2VQF B;  3T4Z A;  4X65 O;  1PNL A;  1S0V A;  3W7X A;  5LP6 A;  2ZR3 A;  2HJD A;  3SJB C;  2C2A A;  2RQ6 A;  3K58 A;  2A0L A;  2XHB A;  4UB6 Z;  2JRI A;  1V55 B;  5LXT B;  3SYC A;  2Q0O C;  1NBM G;  3CB2 A;  1K3E A;  4RO2 A;  1SZT A;  3C3S A;  1GN3 A;  1H2S B;  4DR7 O;  5KMG B;  1MZE A;  2XOK G;  2ZCE A;  1R3L C;  5H2F Z;  3L71 H;  5CA3 A;  1AJN A;  1K9M W;  4YJ2 B;  1WPX A;  1IBM O;  1JPX A;  3DXR B;  4J7Z A;  5KHH A;  1TUB B;  2JGU A;  4LF4 O;  4LFA O;  2GUZ B;  3JAK A;  4HNA A;  2F66 C;  2IW5 A;  1VF7 A;  2JK5 C;  3ETQ A;  2EUL A;  3T2M A;  1YI2 V;  1QHT A;  3RFR A;  4J80 A;  2ZKO A;  4E4E A;  3FX7 A;  3GB7 C;  4PI0 A;  3EHB B;  3SJC C;  4X1I A;  2O57 A;  4BWA A;  4MTX A;  5EYP A;  2Z0A A;  2LGW A;  4WFH A;  4CS2 A;  3LNM B;  3VQW A;  4UCR A;  4WCE V;  3H9V A;  3K04 A;  2DE0 X;  3F7Y C;  5JVD A;  1GTO A;  5AG2 A;  3A0B Z;  3LUT B;  2Y0I A;  3EFF K;  4FFB B;  4OPH A;  4LF8 B;  1QNM A;  4FZ1 A;  5IWA B;  1RM1 C;  2WLN A;  5K1X A;  2N05 A;  2XAH A;  3CC7 V;  4FMT A;  3JAK B;  1AR5 A;  1DTO A;  2UXC O;  5LGN A;  2Y0P A;  3GWO A;  2HFE C;  4WFB V;  4JV5 O;  5A2Q N;  4B3S B;  3WB1 A;  3KKY A;  2B9Z A;  3UT5 A;  3I56 V;  1KUQ A;  1AR4 A;  5EYP B;  4W4K A;  2Q69 A;  4B3T B;  3HKD A;  2WLJ A;  3ABK B;  3CWB H;  1Q6U A;  4NB5 A;  1SQQ H;  2ZDI A;  1BHB A;  5L3D A;  1TVK A;  1EN5 A;  1YF2 A;  2PYJ A;  2GDS A;  1JR9 A;  1IBL B;  4DR2 B;  2A79 B;  2YS8 A;  2DQ3 A;  2V1D A;  3P3N A;  5BMV A;  2OWO A;  2Q67 A;  1Z5V A;  1H2L A;  3A0H Z;  4PA7 A;  3JAR B;  1NKD A;  4BR6 A;  4MVU A;  1QBZ A;  2KSD A;  2ZIM A;  1XHX A;  4J41 A;  1OCC B;  5IYD O;  2HVK C;  2YIC A;  2DQ0 A;  2ZE8 A;  4TUY A;  4GKK B;  2ODM A;  1ORQ C;  4D7S A;  1PD3 A;  4CBC A;  3L73 H;  4RUE A;  4EB6 B;  5B1A C;  1NVP D;  3E22 B;  4LF9 O;  4JI8 O;  1V54 C;  5E1A C;  1WPB A;  2ZT9 B;  2PTM A;  5IY5 B;  2EBO A;  1NR1 A;  4JI0 B;  4JYA B;  4K3A A;  2BOB C;  4JF3 A;  1RPO A;  5BR8 B;  4MW8 A;  3CE2 A;  4IIJ A;  3S3X A;  3SPC A;  1I0H A;  3AG1 C;  3IC9 A;  1PM9 A;  2DYS B;  3K79 A;  1GAX A;  4PA6 A;  4H37 A;  2OCC B;  4DK1 A;  4TUY B;  2QEX V;  5IE9 A;  1Y4M A;  2NR5 A;  1FXV A;  1IZ3 A;  2QWN B;  4B7K A;  5KX5 B;  4ZIB A;  4IHJ A;  3AG4 C;  5JQG A;  4DR3 B;  3UO2 A;  4LF5 O;  1FKA O;  1OCR B;  4EKW A;  4JAS A;  3ETE A;  4FFK A;  4O4I A;  5B66 Z;  3ASN B;  2FL4 A;  1P4R A;  3L72 H;  4NYK A;  3G80 A;  1QVG U;  3T4D A;  1SQX H;  4AI8 A;  1H38 A;  1K33 A;  4MW3 A;  4F6R B;  4O4L B;  1SA0 A;  2IJI A;  3B09 A;  1R6T A;  5J2U A; 
#chains in the Genus database with same CATH homology
 1JJ2 U;  2HVJ C;  4J9Z B;  1QLN A;  1Q7Y W;  3DGE A;  2IJJ A;  1ARO P;  1G8M A;  5HFL A;  4RQE A;  5H9C A;  1K8A W;  3X2Q B;  4QPJ A;  5L3C A;  2ITC C;  5HFM A;  2ZXW C;  1OCC C;  1AJP A;  3IFX A;  1NVP B;  5LGU A;  4P9O A;  3BEH A;  2JEU A;  5B3S C;  3W7T A;  3CCL V;  2EIL C;  1LNQ A;  2EIJ B;  2IU0 A;  3K9A A;  4GX1 A;  1TUE B;  1YIT V;  4H33 A;  5BZB A;  4OXS A;  1YHQ V;  4YXW G;  2LFR A;  5DM6 V;  4JAV A;  3F5W C;  3FKS G;  1H8H G;  4BAY A;  4QPK A;  4R6Z A;  5EBM C;  1VQ6 V;  4PEL A;  2ZDI C;  1SET A;  4MVM A;  1K92 A;  3ASO B;  3D36 A;  2BOC C;  3STZ C;  2Y69 C;  1RM1 B;  5IDJ A;  5IY5 C;  1VQ4 V;  3LDC A;  3OAA G;  3CMA V;  2DW4 A;  3IGA C;  1AJQ A;  5H6Q A;  2YEV A;  2HR3 A;  5CBH A;  3SYQ A;  1F23 A;  3E35 A;  3E2E A;  3JD0 A;  4PDR A;  1KP3 A;  3CC4 V;  5C93 A;  4DXW A;  3ML0 A;  3ZMS A;  4MVR A;  3E86 A;  4UV8 A;  3CCM V;  4GX5 A;  4MT8 A;  3TCU A;  3CD6 V;  1L1F A;  2AHY A;  4JTD B;  1K5S A;  2DYS C;  3MHH C;  3E8B A;  3CP1 A;  2OCC C;  3HB3 B;  5CMU A;  2XAQ A;  4FJC C;  3LSQ A;  4R50 A;  2DYR C;  4GT1 A;  2WSS G;  1NJI W;  4RUF A;  5LHI A;  3OE7 G;  2WLK A;  4JYC A;  4WF9 V;  2ZQM A;  4WFG A;  1BHA A;  3K0G A;  3ABM C;  1FS0 G;  2IH3 C;  1FXK B;  2X6C A;  2ATK C;  3QO5 A;  2JJ2 G;  2NLJ C;  2QKS A;  3H01 A;  3TET A;  4MTF A;  2XAF A;  2R9I A;  4FK5 C;  3AEI A;  2Z3Y A;  3G6E V;  1VQO V;  3I55 V;  3OW2 U;  5CN0 A;  3CXC U;  3ZCC A;  2EZO A;  3FYI B;  1COW G;  3AG3 B;  2QTO A;  4GCZ A;  5L3F A;  3ASN C;  3QO7 A;  1MSW D;  4R8C A;  1HWY A;  4P30 A;  4FIP C;  4RAI A;  3ZMZ A;  5B1B B;  5IYB O;  3SPI A;  5LHH A;  1OCO C;  2JDI G;  3CCJ V;  2ZD9 A;  1DF5 A;  2WPD G;  3ZN1 A;  3CCV V;  3OR7 C;  1QLE C;  4JAU A;  1F4N A;  1H2G A;  3ZRW B;  1CP9 A;  4I5S A;  3X2Q C;  2WAM A;  3ABK C;  2HKO A;  4LP8 A;  3OUF A;  3OFN G;  4PDV A;  4ZBM A;  1AI4 A;  1SER A;  4G28 B;  4MVQ A;  3ZMV A;  2WLM A;  5KA5 A;  2Z5U A;  2EIJ C;  1BMF G;  4QNH B;  1W2B U;  4UUJ C;  4PA3 A;  1VQL V;  4BW5 A;  1FXH A;  4BIU A;  4JTC B;  3WFV A;  4JGS A;  4F4L A;  1S76 D;  1MAB G;  2P6J A;  3ETG A;  4HAM A;  3K08 A;  2P90 A;  3LDD A;  3ASO C;  4FPP A;  1S72 V;  1M57 C;  3SYO A;  4RQF A;  3JD1 A;  3RBZ A;  1VQ9 V;  3P32 A;  1AI5 A;  5B1N A;  2OT5 A;  3ZRS A;  4UVB A;  1KQS U;  3W7S A;  3CCQ V;  2WLH A;  2A9H A;  2YSU B;  3WG7 B;  2B1I A;  2IH1 C;  1NQT A;  2JIZ G;  2B5U A;  3W7U A;  3K3W A;  2FTK A;  3ZN0 A;  3G71 V;  1Q81 W;  1FFT B;  1KP2 A;  2H8P C;  3IC7 A;  3OGC C;  3E8F A;  1PNM A;  5LHG A;  1JQ0 A;  1R6N A;  2W0F C;  3CYO A;  4DO2 A;  4UXN A;  3ETD A;  3E8H A;  3VBB A;  4P2Z A;  1K73 W;  1N8R W;  1S77 D;  1GK9 A;  1FXK A;  2XAJ A;  2XAS A;  3ZMU A;  1OHH G;  5KA6 A;  4J9Y B;  2H94 A;  1K4C C;  4X88 A;  2ITD C;  2LFS A;  4N23 A;  3P30 A;  2LP7 A;  3JD3 A;  2HJF C;  1FXK C;  2Q68 A;  4Q20 A;  1K34 A;  5H6R A;  3OR6 C;  1IXM A;  4MTG A;  3JD2 A;  2EJR A;  1QCE A;  1P7B A;  1Q82 W;  1KC8 W;  3ZRV A;  3TK1 A;  2JEX A;  4U7O A;  5EBL C;  3OMA B;  3SYA A;  4XDJ A;  1WLE A;  1YTF D;  5EK0 A;  3M99 B;  3ABT A;  3JCZ A;  1QR8 A;  3K0D A;  2MK3 A;  3AG3 C;  2AHZ A;  3T4Z A;  1ROP A;  1CPY A;  1YIJ V;  1PNL A;  3G4S V;  1S0V A;  4G2K A;  3CME V;  3R65 A;  3W7X A;  2IJH A;  4QE7 A;  5B1B C;  2CK3 G;  2ZR3 A;  4CZZ A;  3BY6 A;  3SPG A;  3ZRW A;  2Q6A A;  3ZRX A;  5EC1 C;  2C2A A;  2OTL V;  1SES A;  2F43 G;  4P9P A;  4HYO A;  4MVZ A;  4ASU G;  4MTO A;  2A0L A;  4KUM A;  3K03 A;  2EIM C;  3LSS A;  1V55 B;  1VQM V;  1KEC A;  1W0K G;  3SYC A;  4WFA V;  1NBM G;  1K3E A;  2V7Q G;  3CPW U;  1OCR C;  4RO2 A;  1Q86 W;  1SZT A;  2XOK G;  2IU3 A;  1R3L C;  1R3J C;  5CA3 A;  2K1E A;  1AJN A;  5DN6 G;  1K9M W;  2OTJ V;  1WPX A;  4U7N A;  1JCH A;  4XBF A;  2WWW A;  4GX2 A;  1JPX A;  2UXN A;  1MG1 A;  3E83 A;  5EBW C;  2DWD C;  1F51 A;  4LCU C;  3CCU V;  3RVZ A;  1NH2 D;  1OZ0 A;  1GM8 A;  3E8G A;  1PNK A;  2IW5 A;  2JK5 C;  3OMN B;  1OCZ B;  2W6I G;  3T2M A;  1QR9 A;  1YI2 V;  3CCR V;  1VQ8 V;  3GB7 C;  2PI4 A;  3SJQ C;  3A0R A;  3WG7 C;  3EHB B;  5L3B A;  3W7W A;  1M90 W;  2WLI B;  3DTU B;  2EIK B;  1K7D A;  2EIN B;  1SRY A;  3ABL B;  3AG2 B;  4MTX A;  2WLL A;  1KKD A;  4WFH A;  2Y48 A;  1S3J A;  3LNM B;  4QIW F;  3FB6 C;  1YJ9 V;  4WFE A;  5B1A B;  4JPR A;  4WCE V;  3E89 A;  3K04 A;  1VQK V;  1M56 B;  1V54 B;  3F7Y C;  3ABM B;  1XL4 A;  1GTO A;  1YTF B;  5KUM A;  1W0J G;  1AI7 A;  3LUT B;  3EFF K;  3OEH G;  1EBO A;  2D3O W;  2X0L A;  4BIZ A;  1RM1 C;  2WLN A;  1GKF A;  3T1C A;  3F7V C;  2XAH A;  5L3G A;  4UVA A;  3CC7 V;  4FMT A;  1K4D C;  4XDL A;  1E1Q G;  4Z1M G;  1DTO A;  1DLB A;  1GO3 F;  1THZ A;  1EFR G;  5LGN A;  1VQ7 V;  3GWO A;  3B77 A;  4GX0 A;  4X89 A;  4LC1 A;  3AG1 B;  2HFE C;  1M1K W;  4WFB V;  2HLD G;  2X6A A;  3STL C;  4MSW C;  1E1R G;  3B8M A;  3FYE B;  1R3K C;  3HPL C;  3QO8 A;  1R73 A;  1PL0 A;  3I56 V;  4I9W A;  2KB1 A;  4MS2 A;  2WLL B;  2Q69 A;  3AG4 B;  4X8A A;  4KP4 A;  1QLE B;  2WLJ A;  3ABK B;  1XL6 A;  3OM3 B;  1V55 C;  1GMG A;  4QE9 A;  1M9N A;  1NH2 B;  4JTA B;  4ZKI A;  2R9R B;  2ZDI A;  2P7T C;  3RW0 A;  5L3D A;  1BHB A;  2HG5 C;  3CCE V;  4XDK A;  1ENV A;  3SYP A;  5GW7 A;  3JYC A;  3D3I A;  1I5X A;  3CCS V;  3OEE G;  4JYB A;  2A79 B;  2IJK A;  3MD0 A;  3KG2 A;  1Y66 A;  2DQ3 A;  2V1D A;  1JVM A;  2QE7 G;  2W6J G;  1M57 B;  2QM8 A;  1KD1 W;  1JX9 A;  2Q67 A;  2M7W A;  4PA7 A;  1OCZ C;  3ZMT A;  1NKD A;  2WLI A;  4MVU A;  1QBZ A;  3LDE A;  4N21 A;  2ZXW B;  1OCC B;  5IYD O;  4HZ3 A;  2HVK C;  3FB8 C;  2DWE C;  3FB7 C;  2JJ1 G;  2DQ0 A;  3B8N A;  5J9P C;  5B3S B;  2EIL B;  2EIK C;  1K97 A;  2EIN C;  3ABL C;  3AG2 C;  1ORQ C;  2X6B A;  4L87 A;  1MOF A;  1G4Y B;  1PD3 A;  1BL8 A;  1E79 G;  3MHS C;  3SPJ A;  4CBC A;  2EZP A;  4LBE C;  4RUE A;  5B1A C;  1H8E G;  1NVP D;  1M56 C;  4MVS A;  1V54 C;  1S5H C;  3K06 A;  5E1A C;  1RPR A;  2Y69 B;  3FB5 C;  3VOU A;  2P67 A;  4QJF B;  5IY5 B;  1QVF U;  2EBO A;  1NR1 A;  2X7R B;  4PDL A;  3QNE A;  2BOB C;  1ZWI C;  4JF3 A;  3JD4 A;  4E2L A;  1RPO A;  3UKM A;  2GSM B;  4TWK A;  2QM7 A;  4MW8 A;  5LBQ A;  5CBF A;  1YSC A;  1AI6 A;  2UXX A;  3SPC A;  4KFM A;  4TT3 G;  2GHY A;  2YEV B;  4MVO A;  2B1G A;  4UV9 A;  3AG1 C;  3SPH A;  1CEZ A;  5FL7 G;  1K5Q A;  2DYS B;  3K79 A;  4PA6 A;  4H37 A;  2OCC B;  3ZIA G;  1VQP V;  5IYC O;  1J95 A;  2DYR B;  2QEX V;  3CC2 V;  1Y4M A;  3UM7 A;  1FXV A;  1NR7 A;  1YJN V;  1YJW V;  2PI5 A;  1F4M A;  1EZJ A;  3AG4 C;  2EIM B;  3PJS K;  2ZR2 A;  3ABU A;  1GM7 A;  5B1O A;  2NNU A;  3OMI B;  1OCR B;  4EKW A;  1VQ5 V;  4G27 B;  3RVY A;  5LGT A;  3OUS A;  4JAS A;  2XAG A;  3ETE A;  1UJW B;  1DF4 A;  5CBG A;  1B6Q A;  2XND G;  1PKX A;  3ZJZ A;  1AR1 B;  1VQN V;  3NXS A;  1R3I C;  3ASN B;  1I5Y A;  5EC2 C;  1P4R A;  4WFF A;  4PA9 A;  4PDM A;  4R7C A;  1QVG U;  4UVC A;  3T4D A;  5L3E A;  4TSF G;  2QA4 V;  1H38 A;  1K33 A;  1JOY A;  4MW3 A;  1R6K A;  2IJI A;  1GM9 A;  5KUK A;  1OCO B;  4PA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...