2ZQMA

Crystal structure of the prefoldin beta subunit from thermococcus strain ks-1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
114
structure length
114
Chain Sequence
b'MQNIPPQVQAMLGQLESYQQQLQLVVQQKQKVQLELTEAKKALDEIESLPDDAVVYKTVGTLIVKTTKDKAVAELKEKIETLEVRLNALERQEKKLNEKLKELTAQIQSALRPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prefoldin beta subunit 1
publication title Structural and molecular characterization of the prefoldin beta subunit from Thermococcus strain KS-1
pubmed doi rcsb
source organism Thermococcus sp.
molecule tags Chaperone
total genus 45
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01920 Prefoldin_2 Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zqmA00
1FXKC 2ZQMA 1FXKB 3AEIA 2ZDIA 1FXKA 2ZDIC
chains in the Genus database with same CATH superfamily
2QTOA 4X66O 2YI9A 4JTDB 5D5PA 3W7WA 5GONA 1N36B 3HKDB 1NR7A 3TGUH 1HNXB 1NS1A 5B1AC 1ZUQA 2A7WA 4X1YA 5B3SC 4AQYB 1YTFD 3K3WA 4ZI7A 4ZIBA 4Z2WA 1A32A 4JZ2A 2QR4A 1XOUA 1WNSA 1WP7A 3OGCC 1M57B 1AB3A 2VS0A 4UB6Z 2DJVA 1M4UA 1SZTA 2UU9O 1ENVA 2QGNA 3PJSK 4H37A 2EZPA 2BSKB 2NLJC 3ASNC 3PN1A 3JD3A 5BR8O 4FFBA 1UFIA 5EBLC 2B9ZA 2BTQB 2DQ0A 2E3CA 3RFRA 2XT9A 3W7TA 3K5NA 5LHHA 1AR4A 3L9DA 2Q5ZA 5JVDA 3ABKB 5EC2C 3N2KB 5LXTB 4Q6GA 2VWKA 3AG1B 1RM1B 1FFXA 2YEVB 3BAAA 3HKBB 4DV4B 4BIZA 2UXDB 3CEIA 1R6TA 2JVDA 4QE7A 1DTOA 1GN6A 4LF4O 5B1BB 2UUBB 3STZC 2PTMA 3UQ8A 2QSAA 3I56V 4FZ1A 1QCEA 4RO2A 3N2GB 4PA3A 3OW2U 4LP8A 1FXVA 2YXHA 2KQXA 3X2QC 4WFFA 2ITCC 1MZEA 3GVMA 2E76B 1EM1A 2NR5A 3ZMVA 1BSMA 4KL1A 2R72A 4G27B 4E4EA 3J7AU 4TV8A 3ZEDA 3CD6V 3ZN1A 2GSMB 4DR1O 4D6TH 1MA1A 1THZA 3B8NA 2LFRA 1Y4MA 1FD9A 2EIJC 3LSQA 1Q90D 3EFFK 1U96A 3G67A 3IJ4A 4DV1O 2W6IG 3LSUA 2BE3A 5J2TB 5LMNB 4QGPA 4DYLA 4E2LA 5IY5B 3QO5A 5H6RA 3ZHVA 3RYFB 3Q4HA 3JYCA 5BMVB 3OAAG 4WF9V 1AJPA 4DK0A 4DR7O 1H8EG 3T4ZA 4UCVA 1WAZA 1KQSU 2ZCEA 1S0VA 4R7CA 2HHHO 3T1CA 1QU7A 3FYEB 1EFRG 2AZ2A 4JI1B 1XNRB 2WLMA 5EC1C 4UCRA 2LW7A 1JMKC 4F4LA 5H2FZ 1Q86W 2P90A 5JCOC 1RSOA 3FB7C 1Y76A 2HJDA 2JIZG 1XMOB 1Y6XA 2W0XA 2F66C 3S3XA 1K4DC 2UUCB 2DWEC 2EULA 3JAKB 3K9SA 1N32O 3CMEV 3H01A 5KLVH 4J7JA 1L1FA 1TVKB 2JEUA 4GX2A 3OTOB 4JV5B 5JCOA 4U3FH 4WCEV 3CCSV 1PNKA 4LR3A 4FFKA 2QKCA 4IIJA 1B06A 2OCCB 2KB1A 3AG4C 4ASUG 4CH4A 1YHQV 1UPGA 1V55B 2EILB 4XDLA 2ADQB 1AJNA 4JI6B 2R70A 4K3AA 1KU9A 5GTHZ 5IYZB 1E1QG 4JAUA 4P2ZA 5EZYB 2GUZB 1ZL8A 1ZX3A 1VF6A 4B3SO 2XASA 1BE3H 3JD4A 1M57C 2DWDC 4JI4O 4LWSB 4I4TB 5BXZA 4QIWF 2PGGA 4UCOA 2ZT9B 3VQXA 2CTRA 5B1NA 2CE4A 1H2NA 5GW7A 3ZHUA 2BOCC 2LP7A 3JAMN 2UU9B 3H1LH 3OEEG 3UM7A 2FMLA 1YTFB 1N8RW 1FFTB 1N0JA 5BR8B 4WFBV 4O4HA 1AP6A 3ABKC 3TETA 4O2BB 4L87A 1RPOA 3SDLA 3BA9A 4WFHA 2BSKA 3B4SA 4LFAO 1OCCB 2AHZA 1QNMA 3AG1C 3ZRWB 1RM1C 1YDXA 4J7ZA 3CCLV 1Z2GA 3BCCH 3E8FA 5IT9N 2ZD9A 1WB7A 1SESA 2WLLA 1GO3F 3BFRA 2X7RB 5B1BC 2CGNA 4FLUA 3ASOB 5LBQA 2YEVA 1W0KG 3TJTA 3HKBA 1OV9A 5FNVA 4CH6A 2IH3C 2AZ0A 2UXNA 4L8JA 4PD4F 2AW9A 3ZRSA 1XMQO 4DXWA 2CH7B 1KMIZ 5HFMA 4GKJB 2QA4V 5IJ0B 2PI5A 3N2GA 5CBHA 1XDCA 2B1IA 3T1YB 2WLNA 1U97A 5GONB 2ZM6B 4MVQA 1D2DA 2Y0PA 2XUMA 1FPOA 4MT8A 2ZE7A 3A0RA 4D7TA 1H8HG 1YIJV 2JGUA 1MSDA 4ZI7B 4XDKA 2IBZH 1N36O 1PL0A 1HNXO 2EIKB 2PF4E 2XAHA 2LGQA 3B40A 2ZIOA 5IY5C 2WPDG 4AQYO 4UCTA 3ZJZA 3M99B 4R6ZA 2DYSB 3QG5A 1VF7A 3K59A 4KXRA 4O2AB 4B3TO 4FFBB 3RGBA 1KC8W 4FLYA 4UVBA 2P4KA 5J2TA 4FZ0A 4JYBA 2HHHB 3JD0A 3RYFA 1Q6HA 3OMAB 3TCUA 1BQZA 4Q20A 5BMVA 3U10A 2F93B 4QJFB 2X0LA 3QO7A 2VQFB 1FFXB 1EN6A 2A9HA 1H2KA 4EFBA 5TISZ 1VQKV 5DEDA 3JASA 2ITDC 3B2EE 3WU2Z 1N32B 1R73A 3K06A 4ZHQA 2ZR3A 3LUTB 1TUBA 4DV4O 4MVRA 1SC5B 1I5XA 2B1GA 3CC2V 2UXDO 4TQDA 4DV5O 4J41A 4AI8A 2YIDA 2OCCC 3JAKA 3OUFA 1V55C 3K0GA 3MD0A 4OX9O 3G71V 2UUBO 1TVKA 4I0XB 1LNQA 4FIPC 2YIAA 3QF7A 1VQNV 4PDRA 2DMXA 4TV8B 2V1DA 3H1KH 1GRJA 3ZHTA 1GKFA 3K79A 4KHPO 1AVMA 4CZZA 2LW1A 3FB8C 3ABMB 1FXHA 4FK5C 2EJ7A 4WFAV 3QTCA 2O57A 1RPRA 1WPBA 2GUZA 2LQTA 2AXTZ 4MVSA 3UCSC 1XQ8A 4D7SA 3CRAA 1SERA 1BT8A 4FMTA 1RP3B 3E22A 1R3IC 1OCRB 4LWSA 3GWOA 4EFEA 4I7ZB 1Y74B 1M1KW 1CEZA 3A2FA 1XBLA 2Y0IA 1HP8A 2WLKA 2W6JG 5L3FA 4R50A 1OCCC 5LMNO 3FKSG 1L0LH 3K58A 4X1IA 4FVMA 2QWQB 1HW7A 5K1PA 4LFAB 2NN4A 4BAYA 4DW0A 1K4CC 2MK3A 2ARHA 1BGYH 1COWG 1JJOA 5BZBA 1IVSA 2ZE5A 2Q0OC 4U3JA 3SYQA 4JI1O 4KUMA 1XNRO 1K5QA 1B04A 1TA8A 3ZRWA 4LF7B 3P3NA 2IW5A 5C8YA 4QPKA 2Q7EA 4YXWG 3JCZA 4GYCB 3T4DA 4LF9O 3L70H 1YCIA 1Q7YW 2L35A 2UUCO 3DTUB 3DGEA 5EYPB 3H1HH 1K3EA 3BVOA 4IIJB 3OTOO 5CBGA 3CRCA 1IX9A 2WA4A 3CCQV 4Z1MG 2OIEA 4DO2A 3OR7C 5CBFA 4GUNA 5ITZB 4H0LB 4O4JA 1BQ0A 3OGIB 4OGQB 2A79B 1L0NH 4F6RB 1NZ6A 2DQ3A 5B66Z 4JI6O 1H2SB 3W7XA 3CCUV 2EIKC 1N34B 4OPHA 3K5OA 3R66A 4JI2B 2PYJA 3K57A 1Q5OA 2DYSC 2OTLV 4I9QA 4K8ZA 3ZHQA 4DV0B 1WP8A 1J5EO 3JD1A 3P3PA 5LYJA 4GKKB 2WA3A 1Y67A 4B3TB 1M93A 1SA0A 3JATB 2BTOA 1DGSA 3VQVA 3RYCA 1QVGU 4TV9B 4O4HB 1O9GA 3BEHA 3STLC 4TWKA 1FS0G 2JEXA 3SJAC 1XILA 2D2CB 4O2AA 3DSQA 4TUYB 1K73W 4JTCB 3MHHC 2WLLB 2E74B 1WA8B 4UB8Z 2CTQA 4EKWA 2IJKA 3HB3B 1MMMA 3H1JH 3CE2A 1ZSPA 1MOFA 3ZHRA 1JCHA 4FM2A 3JALB 1L8DA 1VQLV 2XAGA 1BHBA 1HDJA 3F7VC 3IFXA 1NQTA 2IJHA 4X89A 5FNVB 2AGAA 4W4LA 1OHHG 1NJIW 1FAFA 1AR5A 4DV5B 4QPJA 4LF5O 4PDMA 2HP8A 2JS3A 4OX9B 1R3KC 1PKXA 4MTXA 2ZNJA 1KECA 1Q6UA 2NNUA 3AK1A 4MTGA 3CCJV 1K33A 1SS3A 2VWJA 4GKJO 1JR9A 4PA9A 2YXLA 4KHPB 4I0XA 1AI7A 2WAMA 2CAZC 4G28B 3T1YO 5KA5A 4B3MB 4I5SA 5LA6A 1IDSA 2JK5C 5JH7B 1JA8A 2ZM6O 1M9NA 3SPCA 1QLNA 2XAJA 5LHIA 4FM1A 1GN4A 1S76D 2VRZA 3JAWA 3K5LA 5LMUB 1HNWO 3CC4V 1DF4A 1P7GA 1YITV 1S77D 4TSFG 4JI5B 3EVKA 1J95A 4DV3B 5FL7G 2Q69A 1MABG 2N04A 1G6UA 1SQQH 2IH1C 2XTAA 3E35A 1IURA 5D5QA 4LC1A 1GM9A 3F7YC 2R9IA 2GTAA 2GBOA 3U11A 4JI3B 1P49A 1Y74A 2X6BA 3WG7B 2DYRB 2CGOA 2A06H 4KFMA 1SQBH 1I5YA 1F4MA 3L75H 2KG7A 3JCUZ 1YI2V 1K5SA 3JASB 4KP4A 4N21A 4CH3A 2P6JA 2VQFO 2EX3A 4HYOA 4ZHQB 4DUZB 2EIMC 4LF9B 1SRYA 1TUBB 2H8PC 2IU0A 4NVPA 4UCUA 1IBMB 3O65A 1VQ5V 3TK1A 1XI1A 2QM4A 1BHAA 3LSSA 3K03A 1XL4A 4RQEA 1JFFA 2F23A 2JJ2G 3A8TA 1AI6A 1BCCH 4PA6A 2QKSA 1R6NA 1P84F 5EYPA 2UXBO 2XNDG 1VF6C 5IYCO 5HFLA 2DOSA 2YXYA 2HEPA 1K34A 3E86A 3ZMTA 1UJWB 1FKAO 3L74H 4GX5A 3K5MA 1I94B 1QLEB 1WJZA 2FB5A 4LH6A 4O4IA 1M56B 1S5JA 1FJGB 3ZHSA 2RMKB 5ITZA 3HR0A 1LUVA 2M7WA 2QWRB 4F6RA 3E22B 2W0FC 1J5EB 3CMAV 5B5EZ 3IC9A 1NVPD 5EBWC 1R1BA 3JSNA 2FL4A 1GK9A 2KKWA 5LOVB 2ATKC 3FD9A 4PDVA 4X1IB 2Q8VA 3OFNG 5CN0A 3E8BA 5L3DA 4X20B 2QDOA 2HR3A 2Y4UA 3VOUA 1GAXA 3OR6C 4NKGB 1KBHA 3JATA 4I9WA 1SQFA 4TV9A 2P4VA 3U0ZA 3H9VA 1ZWIC 4U3JB 4O4LA 3CCVV 4ABMA 2IJJA 3CC7V 4MW3A 2LO1A 5L3GA 2X6AA 5C8YB 4A5UB 3RT3C 4TUYA 4ZKIA 1FYJA 4I55B 4OXSA 3ZMSA 1WA8A 2R9AA 4X64O 3VBBA 2VQEB 2QKAA 1KYOF 2Q73A 4LF7O 1DK1A 1VIBA 4LF5B 3HKCA 1S5HC 3JALA 2Y48A 1I0HA 1NR1A 4WFEA 2EINB 4U7OA 2Q4PA 4PI2A 4X88A 3OE7G 2CTWA 4MTFA 4MS2A 3RN4A 4O4JB 1G4YB 5JWPA 1VARA 1WN7A 4JI0B 5DN6G 2HFEC 2PYLA 2Q67A 1F23A 4J10A 3QO8A 3FB6C 2ADPA 3ABTA 3OTFA 3SYPA 2CDYA 4CS4A 4BIUA 4J80A 4IL6Z 1SQGA 3F5WC 1QVFU 1HNWB 2AHYA 3SPJA 3D36A 5LYJB 1YXBA 1NT2B 1N34O 4JI2O 1GM8A 1O9HA 5JH7A 1F51A 2H3OA 4JAVA 1SA0B 1OCOB 4MSWC 3UKMA 3RYCB 2N74A 4EB6A 2QWOB 2Q7HA 3HKEA 3ZRVA 5J2UA 4DV0O 1G8MA 4YJ2A 3TXSA 1VQ6V 3SGIA 3G6EV 4P30A 4GKKO 3S3WA 4DRXA 3WG7C 4FLZA 2YC0A 2DYRC 2Z3YA 1MG1A 3AEIA 1HR0B 5KHGA 1M5IA 1NI8A 1AILA 2K1EA 1TUEB 4PV1B 4X1KB 4FJCC 5BY1A 4IYHA 1XEQA 3ZBHA 2ODMA 3ML0A 2F4VB 5H5NA 2GTSA 3CRRA 4Z1VA 1IZ3A 2HVJC 3FAVA 2YIBA 3MDSA 5A9GA 1PM9A 1Q43A 4K35A 4LFBO 5L3BA 1AP5A 2Y69B 2D3OW 2G38A 2RQ6A 4DV2O 3CP1A 1Q82W 3NR7A 2JJ1G 2ILMA 3ASNB 1VF5B 2QM8A 2Y4TA 2ZKOA 1KKDA 4NTXA 4UXNA 3CXCU 2UXBB 1Q6IA 4NXNO 1QLEC 2EILC 3GWKC 4LFCB 3ETGA 2HG5C 2Q7GA 1M56C 2YDEA 4B7KA 3KCXA 4MVUA 5LP6A 2P06A 1R6KA 4OPAA 5LA6B 5IE9A 3H1IH 2QTSA 2Q6AA 2OYQA 1SQVH 5LGTA 4YJ3B 2F1MA 3F5TA 3ICXA 3JAWB 4P9PA 4GZRB 1IBKB 2ZE6A 1AI5A 2ZR2A 1XREA 1I08A 1VQMV 1BL8A 4B3MO 3ZRXA 3M8AA 1CP9A 1XHXA 2ETNA 3I55V 2PY5A 3ABUA 4LBEC 4JASA 5LMUO 1SQXH 3K9AA 3VQWA 5LHGA 4JI5O 4DV3O 4NYKA 4YY3B 1QHTA 1K9MW 1PD3A 4GX1A 4HBNA 1NVPB 2DE0X 4CC5A 2OTJV 5EK0A 5LOVA 4G2KA 2YIBD 2EZOA 4GCZA 2KG7B 3SYOA 4X20A 1YJ9V 4JI3O 3CS5A 4I50B 3W7SA 5KMGA 3KCYA 2F95B 5K1XA 4CS2A 2WSSG 3OT7A 4GT1A 1PNLA 4EEQA 2EIJB 1H2MA 5A2QN 5IYBO 3RW0A 4X64B 3UT5A 1AI4A 3ASOC 1ZAUA 4FM0A 2FYUH 4I55A 1JFFB 1VQ7V 2UXCB 4DUZO 1SETA 2EINC 3T1HB 2LJ2A 4JI7B 1WLEA 1JPXA 1N33B 1IBMO 2CK3G 1VQ8V 4X65O 3FX7A 4X9QA 1GMGA 2YICA 4LNUB 4K0KO 5H9CA 3LDCA 4NXMB 3LNMB 3SPGA 4B3RB 5KHJA 4O4IB 4UUJC 1KD1W 5JQGA 3ETQA 1ORQC 4J42A 4C7UA 1Z5WA 1I94O 3I5DA 4BW9A 5CB4A 3UO3A 3OD4A 5JJJB 3L71H 2R9RB 1YJNV 3CCMV 1OCOC 1FJGO 4QE9A 2XOKG 3WB2A 2GDSA 3DC6A 2K9PA 2Q9LA 3OM3B 1P7BA 3DXRA 5H6QA 5JJEB 4DV6B 2QEXV 1SZXA 4JYCA 2UUAB 3CPWU 1K92A 3K04A 2DN9A 4WFGA 4JF3A 4FLXA 4DV7O 3A0BZ 3CRMA 5KX5A 1EZVH 1BZKA 4O4LB 2YI8A 5CMUA 1KP3A 4HZ3A 4DR5B 1NH2D 4DW1A 3BHPA 2JS5A 2HKOA 3QNEA 5EIBD 1WB8A 2JDIG 1EBOA 3JARB 2RDCA 4JI8B 1VQ4V 1H2LA 1GH6A 4JYYA 2V4DA 3SYAA 3APOA 2Y69C 4BW5A 2WLIA 3M7MX 5L3CA 5CA3A 2V7QG 3J80N 2HLDG 1PP9H 4X1KA 4LFBB 3IAYA 3BPZA 3W7UA 3HKCB 4DV2B 1GTOA 2JGDB 3LDDA 4P9OA 1GN3A 2YUAA 2XAQA 2OT5A 2VQEO 2P5OA 3CCRV 3RBZA 4LF6B 1BMFG 2QJ1A 3AG2B 1PNMA 3HPLC 4H44B 2GV9A 4NXNB 4DR2B 4YIOA 5IJ9A 1S3JA 1D5NA 3RYIB 4GLXA 3CJHA 3CX5F 1XUQA 1JVMA 1XHZA 5B1OA 4UV9A 2QWNB 3ABMC 3D3QA 4JI0O 4R8CA 2PZSA 2IJIA 3AG7A 1Q8IA 4CBCA 4JPRA 4J7KA 3IGAC 3KG2A 5FLXN 4YHHB 1VP7A 1CPYA 4EB6B 4YJ3A 2RCVA 3HKEB 5J2UB 1OCRC 3ZMZA 2OCHA 4YJ2B 1YSCA 4PDLA 2X6CA 3N27A 4MVOA 4DRXB 3AK3A 1SQPH 3K0DA 5IDJA 3C3SA 2JRIA 2L6LA 4DR6B 1ROPA 4MVMA 1D5AA 1TGOA 1IBLB 3SJCC 3SPIA 4RWUA 3RYHA 5CA1A 2ZINA 1CXZB 2Z5UA 4RQFA 1HR0O 2PUSA 1Q81W 1SF9A 5C93A 2EBOA 4H33A 3GB7C 4BIOA 1IXMA 3FAVB 2IU3A 3SJQC 1K8AW 4I50A 1KUQA 4ZOLA 3ZX6A 1NU1H 1VEWA 4IHJA 5KAIZ 2F4VO 1XNQB 1F7YA 2XAFA 1NTKH 3ABLB 4X65B 1NTZH 2QM7A 5KHKA 5KUKA 2P22C 4K0KB 4DR3O 2E75B 5LP6B 4PHZA 3RVZA 1LR1A 1PL4A 4UV8A 2N05A 2E5LO 2LGWA 2WWWA 4W4KA 4LNUA 1YF2A 4LFCO 1E1RG 1MSWD 2Q0AA 1GM7A 1GN2A 5CA0A 4TOIA 1QR9A 3TXQA 3CCEV 4JYAO 4JTAB 4IT5A 1YEWA 3BY6A 3SJBC 2ZXWB 4DK1A 1IBKO 4RUFA 5F2VO 5J9PC 3ZN0A 1M90W 3SYCA 4IGGA 3G80A 3E8GA 3OMNB 3CRQA 1EN5A 2ZDIC 1MNGA 4WBNA 4X66B 4AHCA 4DV7B 3RWRD 3LDEA 3G4SV 2YSUB 4YY3O 1YJWV 4YIPA 4PI0A 4RAIA 4J9YB 4PJ0Z 5KMGB 3VQYA 4X62O 2LFSA 3HKDA 2YS8A 1OJHA 2BOBC 2ZDIA 3FFQA 3CWBH 3ZS8C 3UT5B 1Q3EA 3AK2A 1NH2B 1H2GA 4PELA 4DUYO 3EHBB 3JARA 5IWAO 1BS3A 1HWYA 2FKXA 5LGNA 2M6YA 2ZIMA 4IYIA 4UCSA 3AG2C 4FLTA 2RN9A 1V54B 4LF8O 2XHBA 4LH7A 2ZQMA 1JOYA 1RFYA 3C3TA 2UXCO 3T1HO 1R3JC 4JI7O 1N33O 2JGDA 1Z5VA 4ICGA 2BTQA 4MVZA 3E8HA 1S72V 1JX9A 1HNZO 4RUEA 5KHHA 2QWPB 4F6EA 1DLBA 2P7TC 3N2KA 5JQGB 1W59A 2OWOA 5LXTA 4NXMO 2F43G 2BCCH 3D36C 1R3LC 5CB4B 3L72H 4LF4B 4J11A 3RYIA 2Q68A 4B3RO 1US6A 1FXKB 1AR1B 1VQPV 4U7NA 4MW8A 3EXAA 4HNAB 4BR6A 3KZIZ 1X59A 1OCZB 3DXRB 1N0NA 2DW4A 1JQ0A 3BABA 3THOA 5JJNB 2ZE8A 4DR4O 1NTMH 1E79G 5FPRA 3CYOA 2GHYA 3AG3B 5KX5B 3MAQA 4NR1A 4DV6O 2A3QA 3ZMUA 3L73H 2C2AA 1ZTEA 4X1YB 4DR1B 3KKYA 3E83A 2UUAO 5KHIA 4UVAA 3QVNA 1K97A 4NB5A 1B6QA 2FTKA 4J9ZB 3D8CA 4DR5O 1QR8A 4DV1B 4B7EA 2WLIB 5LL6Y 2KSDA 1I7FA 3O9OA 4JI8O 5DECA 5B1AB 5KUMA 5B3SB 2Z0AA 2CUGA 3ZCCA 4DR7B 3ABLC 3JSLA 1MZFA 1YVWA 3J81N 4K8XA 5E79Z 5JVDB 3ETEA 3OMIB 1AROP 3E89A 4AILC 3P30A 3P32A 2PI4A 3WB1A 5LP6C 4DR3B 5L3EA 3A0HZ 5IJ9B 1VQ9V 1H38A 3CJHB 4LF6O 1PV0A 1S5LZ 2OIGA 1KB9F 3WB0A 2E5LB 4DR2O 2UXXA 1URFA 5KA6A 4ZBMA 1LUWA 2IM9A 3DC5A 4FPPA 2ZNIA 1VQOV 2ZXWC 4JYAB 3BRCA 4UVCA 2P67A 2B5UA 1XL6A 3CB2A 4NTWA 4YHHO 1K7DA 3ETDA 5LGUA 2RJZA 3X2QB 4CC6A 5AG2A 2H94A 4PA7A 1EZJA 1W0JG 3K08A 1AJQA 4X8AA 4B3SB 4CS3A 3RYHB 3CSXA 2WLJA 5CA1B 4N23A 3JD2A 4JI4B 5IYZA 1N4CA 4X62B 1Y66A 3R65A 4DR6O 3CXHF 5EZYA 5IYDO 1IBLO 3G6BA 5EIBC 2HJFC 4JGSA 2WLHA 1KP2A 2EJRA 4ZOLB 1NKDA 3B8MA 3FYIB 3Q4HB 4DUYB 4I4TA 1T5EA 4XDJA 5IWAB 1SKVA 3C90A 4FLVA 4IHJB 1NBMG 1V54C 2RNBA 4MTOA 1QQCA 4JZGA 2HVKC 3B09A 4LF8B 2CTPA 1F4NA 1OZ0A 3T2MA 1TAEA 4FLWA 1V9PA 2MW2B 5E1AC 1ZLZA 1B3QA 1XNQO 1RSOB 1Y76B 3UO2A 1IXBA 4O2BA 5GTIZ 3SR2C 1VMGA 1X4TA 3CHXA 1YZBA 1HNZB 3E2EA 3OUSA 3BA8A 3NXSA 5CA0B 1FXKC 4H13B 2A0LA 1XMOO 3MHSC 5KAFZ 3IC7A 4PA4A 1OCZC 4GX0A 4CH5A 3WFVA 2EIMB 4HAMA 1WPXA 2QE7G 1DF5A 4TT3G 1XMQB 4LCUC 4JV5O 3LNNA 4B08A 1FXKA 3B77A 4TQFA 5EBMC 3AG3C 3RVYA 4HNAA 4UFZA 4BWAA 4QNHB 4DR4B 1P4RA 4WBNB 1PPJH 3ZIAG 3FB5C 3D3IA 1KKCA 4JAAA 1W2BU 1JJ2U 5FPOA 3OEHG 2CH7A 1EN4A 1QBZA 1ZL8B 3APQA 5IJ0A 4NTYA 5DM6V 4XBFA 1G1XB 3AG4B 3SPHA
chains in the Genus database with same CATH topology
3GB7C 2QTOA 1IXMA 4JTDB 1LNQA 4FIPC 3W7WA 1VQNV 2IU3A 1S5HC 4PDRA 1NR7A 3SJQC 1K8AW 2Y48A 5B1AC 2V1DA 1NR1A 4WFEA 5B3SC 2EINB 4U7OA 1GKFA 3K3WA 1YTFD 3K79A 4X88A 3OE7G 4CZZA 3FB8C 4MTFA 3OGCC 4MS2A 1M57B 2XAFA 3ABMB 1FXHA 3ABLB 1G4YB 4FK5C 2QM7A 5KUKA 1SZTA 4WFAV 1ENVA 3PJSK 5DN6G 4H37A 2HFEC 2EZPA 1RPRA 2NLJC 2Q67A 1F23A 3ASNC 3QO8A 4MVSA 3FB6C 3ABTA 3RVZA 3JD3A 3SYPA 1SERA 4FMTA 1R3IC 4UV8A 1OCRB 5EBLC 4BIUA 2DQ0A 2WWWA 3W7TA 3GWOA 5LHHA 3F5WC 1QVFU 1E1RG 2AHYA 3SPJA 1MSWD 3D36A 1M1KW 1GM7A 1CEZA 3ABKB 2WLKA 2W6JG 5L3FA 1GM8A 4R50A 5EC2C 1F51A 1OCCC 1QR9A 3FKSG 4JAVA 4MSWC 1OCOB 3CCEV 3UKMA 4JTAB 3AG1B 1RM1B 3ZRVA 1G8MA 2YEVB 3BY6A 1VQ6V 2ZXWB 3G6EV 4BAYA 4P30A 1K4CC 4BIZA 2MK3A 4RUFA 3WG7C 1COWG 5BZBA 5J9PC 2DYRC 2Z3YA 3ZN0A 1MG1A 1M90W 3AEIA 3SYQA 4KUMA 3SYCA 4QE7A 1DTOA 3E8GA 3OMNB 1K5QA 5B1BB 3STZC 3ZRWA 2IW5A 2ZDIC 4QPKA 3I56V 1QCEA 4RO2A 4YXWG 3JCZA 4PA3A 3OW2U 2K1EA 1TUEB 3T4DA 4LP8A 3LDEA 1FXVA 3G4SV 3X2QC 4WFFA 2ITCC 4FJCC 1Q7YW 2YSUB 1YJWV 4RAIA 4J9YB 3DTUB 3DGEA 3ML0A 1K3EA 3ZMVA 2HVJC 2LFSA 4G27B 5CBGA 5L3BA 2Y69B 2BOBC 2ZDIA 2D3OW 3CP1A 1Q82W 3CD6V 2JJ1G 3ZN1A 2GSMB 3CCQV 1NH2B 1H2GA 3ASNB 4PELA 4Z1MG 3EHBB 2QM8A 4DO2A 3OR7C 5CBFA 1KKDA 1THZA 1HWYA 3B8NA 4UXNA 5LGNA 3CXCU 2LFRA 2A79B 1Y4MA 3AG2C 2EIJC 3LSQA 1QLEC 2DQ3A 2EILC 1V54B 3W7XA 3EFFK 3CCUV 3ETGA 2ZQMA 2W6IG 2HG5C 2EIKC 1JOYA 1M56C 4MVUA 1R3JC 4E2LA 1R6KA 3QO5A 5H6RA 5IY5B 2DYSC 2OTLV 2Q6AA 3JYCA 4MVZA 3E8HA 3OAAG 4WF9V 5LGTA 1AJPA 1S72V 1JX9A 3JD1A 1H8EG 4P9PA 4RUEA 3T4ZA 1KQSU 1DLBA 2P7TC 1AI5A 1S0VA 2ZR2A 4R7CA 1VQMV 1BL8A 3T1CA 3ZRXA 2F43G 3FYEB 1EFRG 1CP9A 1QVGU 1R3LC 3BEHA 3STLC 2WLMA 5EC1C 3I55V 4TWKA 2Q68A 4F4LA 3ABUA 1Q86W 2P90A 4LBEC 1FS0G 1FXKB 2JEXA 4JASA 1AR1B 1VQPV 4U7NA 4MW8A 3FB7C 2JIZG 3K9AA 1OCZB 5LHGA 1K73W 4JTCB 3MHHC 2DW4A 1JQ0A 2WLLB 1K9MW 1K4DC 1PD3A 4GX1A 2DWEC 1NVPB 2OTJV 4EKWA 3CMEV 3H01A 5EK0A 2IJKA 1L1FA 3HB3B 4G2KA 2JEUA 4GX2A 2EZOA 1E79G 1MOFA 3CYOA 2GHYA 1JCHA 3AG3B 4GCZA 3SYOA 1YJ9V 4WCEV 3CCSV 1PNKA 1VQLV 3W7SA 2XAGA 3ZMUA 1BHBA 3F7VC 2C2AA 3IFXA 1NQTA 3SPHA 2IJHA 4X89A 3E83A 2WSSG 2OCCB 1OHHG 1NJIW 2KB1A 3AG4C 4GT1A 4UVAA 1PNLA 1V55B 4ASUG 4QPJA 2EIJB 1YHQV 4PDMA 2EILB 1K97A 4XDLA 5IYBO 3RW0A 1AJNA 1B6QA 1R3KC 1AI4A 2FTKA 3ASOC 4J9ZB 1QR8A 1E1QG 1PKXA 2WLIB 4JAUA 4MTXA 1VQ7V 4P2ZA 1KECA 1SETA 2EINC 2NNUA 5B1AB 1JPXA 1WLEA 4MTGA 3CCJV 5KUMA 5B3SB 1K33A 2CK3G 2XASA 1VQ8V 3ZCCA 3JD4A 1M57C 2DWDC 4PA9A 3ABLC 1GMGA 4QIWF 1AI7A 3LDCA 5H9CA 2WAMA 4G28B 3ETEA 5B1NA 5GW7A 3OMIB 5KA5A 1AROP 3E89A 2BOCC 4I5SA 2LP7A 2JK5C 3LNMB 1M9NA 3P30A 3SPGA 3P32A 3SPCA 2PI4A 2XAJA 1QLNA 5LHIA 3OEEG 4UUJC 5L3EA 3UM7A 1S76D 1VQ9V 1KD1W 1H38A 3CC4V 1YTFB 1DF4A 1N8RW 1ORQC 1YITV 1FFTB 1S77D 4TSFG 4WFBV 1J95A 3ABKC 3TETA 5FL7G 4L87A 2UXXA 2Q69A 1RPOA 2R9RB 1YJNV 1MABG 4WFHA 4ZBMA 1OCOC 5KA6A 3CCMV 4QE9A 2XOKG 1OCCB 2AHZA 3AG1C 3E35A 2IH1C 3ZRWB 1RM1C 4FPPA 1VQOV 3CCLV 3OM3B 3E8FA 1P7BA 2ZXWC 4LC1A 1GM9A 3F7YC 2R9IA 5H6QA 2ZD9A 1SESA 4UVCA 2WLLA 2P67A 1GO3F 3WG7B 2X6BA 2QEXV 2B5UA 2DYRB 2X7RB 4JYCA 1XL6A 5B1BC 3CPWU 1K92A 3K04A 4KFMA 1I5YA 4WFGA 4JF3A 1F4MA 3ASOB 1YI2V 5LBQA 1K5SA 4KP4A 2YEVA 1W0KG 5CMUA 1KP3A 1K7DA 3ETDA 4HZ3A 4N21A 5LGUA 1NH2D 2P6JA 2HKOA 2IH3C 3QNEA 4HYOA 2JDIG 2UXNA 3X2QB 1EBOA 2EIMC 2H94A 1SRYA 2H8PC 2IU0A 4PA7A 1VQ4V 1EZJA 1W0JG 3K08A 1AJQA 4X8AA 3ZRSA 1VQ5V 3TK1A 4DXWA 2WLJA 5HFMA 4N23A 3JD2A 3SYAA 2QA4V 1BHAA 3LSSA 2Y69C 3K03A 2WLIA 4BW5A 5L3CA 2PI5A 1XL4A 5CA3A 2V7QG 4RQEA 1Y66A 2HLDG 3R65A 5CBHA 5IYDO 2B1IA 2JJ2G 2WLNA 1AI6A 3W7UA 4PA6A 2HJFC 4JGSA 4MVQA 1GTOA 2QKSA 2WLHA 1R6NA 3LDDA 4P9OA 1KP2A 2EJRA 1NKDA 3B8MA 3FYIB 4MT8A 3A0RA 2XAQA 2XNDG 5IYCO 2OT5A 4XDJA 5HFLA 1H8HG 3CCRV 1K34A 3RBZA 1YIJV 1BMFG 3E86A 3ZMTA 1NBMG 4XDKA 1UJWB 1V54C 4GX5A 3AG2B 4MTOA 1QLEB 1PNMA 3HPLC 1PL0A 2HVKC 2EIKB 2XAHA 1F4NA 1M56B 1S3JA 5IY5C 1OZ0A 2WPDG 3T2MA 3ZJZA 5E1AC 3M99B 4R6ZA 1JVMA 2DYSB 2M7WA 5B1OA 4UV9A 3ABMC 2W0FC 3CMAV 1KC8W 1NVPD 5EBWC 4R8CA 4UVBA 1GK9A 3E2EA 3OUSA 2IJIA 4CBCA 3NXSA 4JYBA 3JD0A 4JPRA 1FXKC 2ATKC 2A0LA 3IGAC 3KG2A 3MHSC 3OMAB 3TCUA 4Q20A 4PDVA 1CPYA 3IC7A 4PA4A 4QJFB 1OCZC 3OFNG 3E8BA 5CN0A 2X0LA 3QO7A 4GX0A 5L3DA 3WFVA 2EIMB 4HAMA 1OCRC 3ZMZA 1YSCA 4PDLA 2HR3A 2A9HA 2X6CA 3VOUA 4MVOA 1WPXA 3OR6C 2QE7G 4I9WA 1DF5A 4TT3G 1VQKV 4LCUC 2ITDC 1ZWIC 3CCVV 3K0DA 5IDJA 1FXKA 3B77A 2IJJA 5EBMC 3CC7V 1R73A 3AG3C 3K06A 4MW3A 2ZR3A 3RVYA 5L3GA 2X6AA 4QNHB 1ROPA 3LUTB 4MVMA 1P4RA 4ZKIA 3ZIAG 3FB5C 3D3IA 4MVRA 4OXSA 1I5XA 2B1GA 3SPIA 1W2BU 1JJ2U 3CC2V 3OEHG 1QBZA 3ZMSA 2OCCC 2Z5UA 3OUFA 4RQFA 1V55C 3K0GA 3MD0A 4XBFA 3VBBA 5DM6V 3G71V 1Q81W 5C93A 2EBOA 3AG4B 4H33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXK C;  2ZQM A;  1FXK B;  3AEI A;  2ZDI A;  1FXK A;  2ZDI C; 
#chains in the Genus database with same CATH topology
 2QTO A;  4X66 O;  2YI9 A;  4JTD B;  5D5P A;  3W7W A;  5GON A;  1N36 B;  3HKD B;  1NR7 A;  3TGU H;  1HNX B;  1NS1 A;  5B1A C;  1ZUQ A;  2A7W A;  4X1Y A;  5B3S C;  4AQY B;  1YTF D;  3K3W A;  4ZI7 A;  4ZIB A;  4Z2W A;  1A32 A;  4JZ2 A;  2QR4 A;  1XOU A;  1WNS A;  1WP7 A;  3OGC C;  1M57 B;  1AB3 A;  2VS0 A;  4UB6 Z;  2DJV A;  1M4U A;  1SZT A;  2UU9 O;  1ENV A;  2QGN A;  3PJS K;  4H37 A;  2EZP A;  2BSK B;  2NLJ C;  3ASN C;  3PN1 A;  3JD3 A;  5BR8 O;  4FFB A;  1UFI A;  5EBL C;  2B9Z A;  2BTQ B;  2DQ0 A;  2E3C A;  3RFR A;  2XT9 A;  3W7T A;  3K5N A;  5LHH A;  1AR4 A;  3L9D A;  2Q5Z A;  5JVD A;  3ABK B;  5EC2 C;  3N2K B;  5LXT B;  4Q6G A;  2VWK A;  3AG1 B;  1RM1 B;  1FFX A;  2YEV B;  3BAA A;  3HKB B;  4DV4 B;  4BIZ A;  2UXD B;  3CEI A;  1R6T A;  2JVD A;  4QE7 A;  1DTO A;  1GN6 A;  4LF4 O;  5B1B B;  2UUB B;  3STZ C;  2PTM A;  3UQ8 A;  2QSA A;  3I56 V;  4FZ1 A;  1QCE A;  4RO2 A;  3N2G B;  4PA3 A;  3OW2 U;  4LP8 A;  1FXV A;  2YXH A;  2KQX A;  3X2Q C;  4WFF A;  2ITC C;  1MZE A;  3GVM A;  2E76 B;  1EM1 A;  2NR5 A;  3ZMV A;  1BSM A;  4KL1 A;  2R72 A;  4G27 B;  4E4E A;  3J7A U;  4TV8 A;  3ZED A;  3CD6 V;  3ZN1 A;  2GSM B;  4DR1 O;  4D6T H;  1MA1 A;  1THZ A;  3B8N A;  2LFR A;  1Y4M A;  1FD9 A;  2EIJ C;  3LSQ A;  1Q90 D;  3EFF K;  1U96 A;  3G67 A;  3IJ4 A;  4DV1 O;  2W6I G;  3LSU A;  2BE3 A;  5J2T B;  5LMN B;  4QGP A;  4DYL A;  4E2L A;  5IY5 B;  3QO5 A;  5H6R A;  3ZHV A;  3RYF B;  3Q4H A;  3JYC A;  5BMV B;  3OAA G;  4WF9 V;  1AJP A;  4DK0 A;  4DR7 O;  1H8E G;  3T4Z A;  4UCV A;  1WAZ A;  1KQS U;  2ZCE A;  1S0V A;  4R7C A;  2HHH O;  3T1C A;  1QU7 A;  3FYE B;  1EFR G;  2AZ2 A;  4JI1 B;  1XNR B;  2WLM A;  5EC1 C;  4UCR A;  2LW7 A;  1JMK C;  4F4L A;  5H2F Z;  1Q86 W;  2P90 A;  5JCO C;  1RSO A;  3FB7 C;  1Y76 A;  2HJD A;  2JIZ G;  1XMO B;  1Y6X A;  2W0X A;  2F66 C;  3S3X A;  1K4D C;  2UUC B;  2DWE C;  2EUL A;  3JAK B;  3K9S A;  1N32 O;  3CME V;  3H01 A;  5KLV H;  4J7J A;  1L1F A;  1TVK B;  2JEU A;  4GX2 A;  3OTO B;  4JV5 B;  5JCO A;  4U3F H;  4WCE V;  3CCS V;  1PNK A;  4LR3 A;  4FFK A;  2QKC A;  4IIJ A;  1B06 A;  2OCC B;  2KB1 A;  3AG4 C;  4ASU G;  4CH4 A;  1YHQ V;  1UPG A;  1V55 B;  2EIL B;  4XDL A;  2ADQ B;  1AJN A;  4JI6 B;  2R70 A;  4K3A A;  1KU9 A;  5GTH Z;  5IYZ B;  1E1Q G;  4JAU A;  4P2Z A;  5EZY B;  2GUZ B;  1ZL8 A;  1ZX3 A;  1VF6 A;  4B3S O;  2XAS A;  1BE3 H;  3JD4 A;  1M57 C;  2DWD C;  4JI4 O;  4LWS B;  4I4T B;  5BXZ A;  4QIW F;  2PGG A;  4UCO A;  2ZT9 B;  3VQX A;  2CTR A;  5B1N A;  2CE4 A;  1H2N A;  5GW7 A;  3ZHU A;  2BOC C;  2LP7 A;  3JAM N;  2UU9 B;  3H1L H;  3OEE G;  3UM7 A;  2FML A;  1YTF B;  1N8R W;  1FFT B;  1N0J A;  5BR8 B;  4WFB V;  4O4H A;  1AP6 A;  3ABK C;  3TET A;  4O2B B;  4L87 A;  1RPO A;  3SDL A;  3BA9 A;  4WFH A;  2BSK A;  3B4S A;  4LFA O;  1OCC B;  2AHZ A;  1QNM A;  3AG1 C;  3ZRW B;  1RM1 C;  1YDX A;  4J7Z A;  3CCL V;  1Z2G A;  3BCC H;  3E8F A;  5IT9 N;  2ZD9 A;  1WB7 A;  1SES A;  2WLL A;  1GO3 F;  3BFR A;  2X7R B;  5B1B C;  2CGN A;  4FLU A;  3ASO B;  5LBQ A;  2YEV A;  1W0K G;  3TJT A;  3HKB A;  1OV9 A;  5FNV A;  4CH6 A;  2IH3 C;  2AZ0 A;  2UXN A;  4L8J A;  4PD4 F;  2AW9 A;  3ZRS A;  1XMQ O;  4DXW A;  2CH7 B;  1KMI Z;  5HFM A;  4GKJ B;  2QA4 V;  5IJ0 B;  2PI5 A;  3N2G A;  5CBH A;  1XDC A;  2B1I A;  3T1Y B;  2WLN A;  1U97 A;  5GON B;  2ZM6 B;  4MVQ A;  1D2D A;  2Y0P A;  2XUM A;  1FPO A;  4MT8 A;  2ZE7 A;  3A0R A;  4D7T A;  1H8H G;  1YIJ V;  2JGU A;  1MSD A;  4ZI7 B;  4XDK A;  2IBZ H;  1N36 O;  1PL0 A;  1HNX O;  2EIK B;  2PF4 E;  2XAH A;  2LGQ A;  3B40 A;  2ZIO A;  5IY5 C;  2WPD G;  4AQY O;  4UCT A;  3ZJZ A;  3M99 B;  4R6Z A;  2DYS B;  3QG5 A;  1VF7 A;  3K59 A;  4KXR A;  4O2A B;  4B3T O;  4FFB B;  3RGB A;  1KC8 W;  4FLY A;  4UVB A;  2P4K A;  5J2T A;  4FZ0 A;  4JYB A;  2HHH B;  3JD0 A;  3RYF A;  1Q6H A;  3OMA B;  3TCU A;  1BQZ A;  4Q20 A;  5BMV A;  3U10 A;  2F93 B;  4QJF B;  2X0L A;  3QO7 A;  2VQF B;  1FFX B;  1EN6 A;  2A9H A;  1H2K A;  4EFB A;  5TIS Z;  1VQK V;  5DED A;  3JAS A;  2ITD C;  3B2E E;  3WU2 Z;  1N32 B;  1R73 A;  3K06 A;  4ZHQ A;  2ZR3 A;  3LUT B;  1TUB A;  4DV4 O;  4MVR A;  1SC5 B;  1I5X A;  2B1G A;  3CC2 V;  2UXD O;  4TQD A;  4DV5 O;  4J41 A;  4AI8 A;  2YID A;  2OCC C;  3JAK A;  3OUF A;  1V55 C;  3K0G A;  3MD0 A;  4OX9 O;  3G71 V;  2UUB O;  1TVK A;  4I0X B;  1LNQ A;  4FIP C;  2YIA A;  3QF7 A;  1VQN V;  4PDR A;  2DMX A;  4TV8 B;  2V1D A;  3H1K H;  1GRJ A;  3ZHT A;  1GKF A;  3K79 A;  4KHP O;  1AVM A;  4CZZ A;  2LW1 A;  3FB8 C;  3ABM B;  1FXH A;  4FK5 C;  2EJ7 A;  4WFA V;  3QTC A;  2O57 A;  1RPR A;  1WPB A;  2GUZ A;  2LQT A;  2AXT Z;  4MVS A;  3UCS C;  1XQ8 A;  4D7S A;  3CRA A;  1SER A;  1BT8 A;  4FMT A;  1RP3 B;  3E22 A;  1R3I C;  1OCR B;  4LWS A;  3GWO A;  4EFE A;  4I7Z B;  1Y74 B;  1M1K W;  1CEZ A;  3A2F A;  1XBL A;  2Y0I A;  1HP8 A;  2WLK A;  2W6J G;  5L3F A;  4R50 A;  1OCC C;  5LMN O;  3FKS G;  1L0L H;  3K58 A;  4X1I A;  4FVM A;  2QWQ B;  1HW7 A;  5K1P A;  4LFA B;  2NN4 A;  4BAY A;  4DW0 A;  1K4C C;  2MK3 A;  2ARH A;  1BGY H;  1COW G;  1JJO A;  5BZB A;  1IVS A;  2ZE5 A;  2Q0O C;  4U3J A;  3SYQ A;  4JI1 O;  4KUM A;  1XNR O;  1K5Q A;  1B04 A;  1TA8 A;  3ZRW A;  4LF7 B;  3P3N A;  2IW5 A;  5C8Y A;  4QPK A;  2Q7E A;  4YXW G;  3JCZ A;  4GYC B;  3T4D A;  4LF9 O;  3L70 H;  1YCI A;  1Q7Y W;  2L35 A;  2UUC O;  3DTU B;  3DGE A;  5EYP B;  3H1H H;  1K3E A;  3BVO A;  4IIJ B;  3OTO O;  5CBG A;  3CRC A;  1IX9 A;  2WA4 A;  3CCQ V;  4Z1M G;  2OIE A;  4DO2 A;  3OR7 C;  5CBF A;  4GUN A;  5ITZ B;  4H0L B;  4O4J A;  1BQ0 A;  3OGI B;  4OGQ B;  2A79 B;  1L0N H;  4F6R B;  1NZ6 A;  2DQ3 A;  5B66 Z;  4JI6 O;  1H2S B;  3W7X A;  3CCU V;  2EIK C;  1N34 B;  4OPH A;  3K5O A;  3R66 A;  4JI2 B;  2PYJ A;  3K57 A;  1Q5O A;  2DYS C;  2OTL V;  4I9Q A;  4K8Z A;  3ZHQ A;  4DV0 B;  1WP8 A;  1J5E O;  3JD1 A;  3P3P A;  5LYJ A;  4GKK B;  2WA3 A;  1Y67 A;  4B3T B;  1M93 A;  1SA0 A;  3JAT B;  2BTO A;  1DGS A;  3VQV A;  3RYC A;  1QVG U;  4TV9 B;  4O4H B;  1O9G A;  3BEH A;  3STL C;  4TWK A;  1FS0 G;  2JEX A;  3SJA C;  1XIL A;  2D2C B;  4O2A A;  3DSQ A;  4TUY B;  1K73 W;  4JTC B;  3MHH C;  2WLL B;  2E74 B;  1WA8 B;  4UB8 Z;  2CTQ A;  4EKW A;  2IJK A;  3HB3 B;  1MMM A;  3H1J H;  3CE2 A;  1ZSP A;  1MOF A;  3ZHR A;  1JCH A;  4FM2 A;  3JAL B;  1L8D A;  1VQL V;  2XAG A;  1BHB A;  1HDJ A;  3F7V C;  3IFX A;  1NQT A;  2IJH A;  4X89 A;  5FNV B;  2AGA A;  4W4L A;  1OHH G;  1NJI W;  1FAF A;  1AR5 A;  4DV5 B;  4QPJ A;  4LF5 O;  4PDM A;  2HP8 A;  2JS3 A;  4OX9 B;  1R3K C;  1PKX A;  4MTX A;  2ZNJ A;  1KEC A;  1Q6U A;  2NNU A;  3AK1 A;  4MTG A;  3CCJ V;  1K33 A;  1SS3 A;  2VWJ A;  4GKJ O;  1JR9 A;  4PA9 A;  2YXL A;  4KHP B;  4I0X A;  1AI7 A;  2WAM A;  2CAZ C;  4G28 B;  3T1Y O;  5KA5 A;  4B3M B;  4I5S A;  5LA6 A;  1IDS A;  2JK5 C;  5JH7 B;  1JA8 A;  2ZM6 O;  1M9N A;  3SPC A;  1QLN A;  2XAJ A;  5LHI A;  4FM1 A;  1GN4 A;  1S76 D;  2VRZ A;  3JAW A;  3K5L A;  5LMU B;  1HNW O;  3CC4 V;  1DF4 A;  1P7G A;  1YIT V;  1S77 D;  4TSF G;  4JI5 B;  3EVK A;  1J95 A;  4DV3 B;  5FL7 G;  2Q69 A;  1MAB G;  2N04 A;  1G6U A;  1SQQ H;  2IH1 C;  2XTA A;  3E35 A;  1IUR A;  5D5Q A;  4LC1 A;  1GM9 A;  3F7Y C;  2R9I A;  2GTA A;  2GBO A;  3U11 A;  4JI3 B;  1P49 A;  1Y74 A;  2X6B A;  3WG7 B;  2DYR B;  2CGO A;  2A06 H;  4KFM A;  1SQB H;  1I5Y A;  1F4M A;  3L75 H;  2KG7 A;  3JCU Z;  1YI2 V;  1K5S A;  3JAS B;  4KP4 A;  4N21 A;  4CH3 A;  2P6J A;  2VQF O;  2EX3 A;  4HYO A;  4ZHQ B;  4DUZ B;  2EIM C;  4LF9 B;  1SRY A;  1TUB B;  2H8P C;  2IU0 A;  4NVP A;  4UCU A;  1IBM B;  3O65 A;  1VQ5 V;  3TK1 A;  1XI1 A;  2QM4 A;  1BHA A;  3LSS A;  3K03 A;  1XL4 A;  4RQE A;  1JFF A;  2F23 A;  2JJ2 G;  3A8T A;  1AI6 A;  1BCC H;  4PA6 A;  2QKS A;  1R6N A;  1P84 F;  5EYP A;  2UXB O;  2XND G;  1VF6 C;  5IYC O;  5HFL A;  2DOS A;  2YXY A;  2HEP A;  1K34 A;  3E86 A;  3ZMT A;  1UJW B;  1FKA O;  3L74 H;  4GX5 A;  3K5M A;  1I94 B;  1QLE B;  1WJZ A;  2FB5 A;  4LH6 A;  4O4I A;  1M56 B;  1S5J A;  1FJG B;  3ZHS A;  2RMK B;  5ITZ A;  3HR0 A;  1LUV A;  2M7W A;  2QWR B;  4F6R A;  3E22 B;  2W0F C;  1J5E B;  3CMA V;  5B5E Z;  3IC9 A;  1NVP D;  5EBW C;  1R1B A;  3JSN A;  2FL4 A;  1GK9 A;  2KKW A;  5LOV B;  2ATK C;  3FD9 A;  4PDV A;  4X1I B;  2Q8V A;  3OFN G;  5CN0 A;  3E8B A;  5L3D A;  4X20 B;  2QDO A;  2HR3 A;  2Y4U A;  3VOU A;  1GAX A;  3OR6 C;  4NKG B;  1KBH A;  3JAT A;  4I9W A;  1SQF A;  4TV9 A;  2P4V A;  3U0Z A;  3H9V A;  1ZWI C;  4U3J B;  4O4L A;  3CCV V;  4ABM A;  2IJJ A;  3CC7 V;  4MW3 A;  2LO1 A;  5L3G A;  2X6A A;  5C8Y B;  4A5U B;  3RT3 C;  4TUY A;  4ZKI A;  1FYJ A;  4I55 B;  4OXS A;  3ZMS A;  1WA8 A;  2R9A A;  4X64 O;  3VBB A;  2VQE B;  2QKA A;  1KYO F;  2Q73 A;  4LF7 O;  1DK1 A;  1VIB A;  4LF5 B;  3HKC A;  1S5H C;  3JAL A;  2Y48 A;  1I0H A;  1NR1 A;  4WFE A;  2EIN B;  4U7O A;  2Q4P A;  4PI2 A;  4X88 A;  3OE7 G;  2CTW A;  4MTF A;  4MS2 A;  3RN4 A;  4O4J B;  1G4Y B;  5JWP A;  1VAR A;  1WN7 A;  4JI0 B;  5DN6 G;  2HFE C;  2PYL A;  2Q67 A;  1F23 A;  4J10 A;  3QO8 A;  3FB6 C;  2ADP A;  3ABT A;  3OTF A;  3SYP A;  2CDY A;  4CS4 A;  4BIU A;  4J80 A;  4IL6 Z;  1SQG A;  3F5W C;  1QVF U;  1HNW B;  2AHY A;  3SPJ A;  3D36 A;  5LYJ B;  1YXB A;  1NT2 B;  1N34 O;  4JI2 O;  1GM8 A;  1O9H A;  5JH7 A;  1F51 A;  2H3O A;  4JAV A;  1SA0 B;  1OCO B;  4MSW C;  3UKM A;  3RYC B;  2N74 A;  4EB6 A;  2QWO B;  2Q7H A;  3HKE A;  3ZRV A;  5J2U A;  4DV0 O;  1G8M A;  4YJ2 A;  3TXS A;  1VQ6 V;  3SGI A;  3G6E V;  4P30 A;  4GKK O;  3S3W A;  4DRX A;  3WG7 C;  4FLZ A;  2YC0 A;  2DYR C;  2Z3Y A;  1MG1 A;  3AEI A;  1HR0 B;  5KHG A;  1M5I A;  1NI8 A;  1AIL A;  2K1E A;  1TUE B;  4PV1 B;  4X1K B;  4FJC C;  5BY1 A;  4IYH A;  1XEQ A;  3ZBH A;  2ODM A;  3ML0 A;  2F4V B;  5H5N A;  2GTS A;  3CRR A;  4Z1V A;  1IZ3 A;  2HVJ C;  3FAV A;  2YIB A;  3MDS A;  5A9G A;  1PM9 A;  1Q43 A;  4K35 A;  4LFB O;  5L3B A;  1AP5 A;  2Y69 B;  2D3O W;  2G38 A;  2RQ6 A;  4DV2 O;  3CP1 A;  1Q82 W;  3NR7 A;  2JJ1 G;  2ILM A;  3ASN B;  1VF5 B;  2QM8 A;  2Y4T A;  2ZKO A;  1KKD A;  4NTX A;  4UXN A;  3CXC U;  2UXB B;  1Q6I A;  4NXN O;  1QLE C;  2EIL C;  3GWK C;  4LFC B;  3ETG A;  2HG5 C;  2Q7G A;  1M56 C;  2YDE A;  4B7K A;  3KCX A;  4MVU A;  5LP6 A;  2P06 A;  1R6K A;  4OPA A;  5LA6 B;  5IE9 A;  3H1I H;  2QTS A;  2Q6A A;  2OYQ A;  1SQV H;  5LGT A;  4YJ3 B;  2F1M A;  3F5T A;  3ICX A;  3JAW B;  4P9P A;  4GZR B;  1IBK B;  2ZE6 A;  1AI5 A;  2ZR2 A;  1XRE A;  1I08 A;  1VQM V;  1BL8 A;  4B3M O;  3ZRX A;  3M8A A;  1CP9 A;  1XHX A;  2ETN A;  3I55 V;  2PY5 A;  3ABU A;  4LBE C;  4JAS A;  5LMU O;  1SQX H;  3K9A A;  3VQW A;  5LHG A;  4JI5 O;  4DV3 O;  4NYK A;  4YY3 B;  1QHT A;  1K9M W;  1PD3 A;  4GX1 A;  4HBN A;  1NVP B;  2DE0 X;  4CC5 A;  2OTJ V;  5EK0 A;  5LOV A;  4G2K A;  2YIB D;  2EZO A;  4GCZ A;  2KG7 B;  3SYO A;  4X20 A;  1YJ9 V;  4JI3 O;  3CS5 A;  4I50 B;  3W7S A;  5KMG A;  3KCY A;  2F95 B;  5K1X A;  4CS2 A;  2WSS G;  3OT7 A;  4GT1 A;  1PNL A;  4EEQ A;  2EIJ B;  1H2M A;  5A2Q N;  5IYB O;  3RW0 A;  4X64 B;  3UT5 A;  1AI4 A;  3ASO C;  1ZAU A;  4FM0 A;  2FYU H;  4I55 A;  1JFF B;  1VQ7 V;  2UXC B;  4DUZ O;  1SET A;  2EIN C;  3T1H B;  2LJ2 A;  4JI7 B;  1WLE A;  1JPX A;  1N33 B;  1IBM O;  2CK3 G;  1VQ8 V;  4X65 O;  3FX7 A;  4X9Q A;  1GMG A;  2YIC A;  4LNU B;  4K0K O;  5H9C A;  3LDC A;  4NXM B;  3LNM B;  3SPG A;  4B3R B;  5KHJ A;  4O4I B;  4UUJ C;  1KD1 W;  5JQG A;  3ETQ A;  1ORQ C;  4J42 A;  4C7U A;  1Z5W A;  1I94 O;  3I5D A;  4BW9 A;  5CB4 A;  3UO3 A;  3OD4 A;  5JJJ B;  3L71 H;  2R9R B;  1YJN V;  3CCM V;  1OCO C;  1FJG O;  4QE9 A;  2XOK G;  3WB2 A;  2GDS A;  3DC6 A;  2K9P A;  2Q9L A;  3OM3 B;  1P7B A;  3DXR A;  5H6Q A;  5JJE B;  4DV6 B;  2QEX V;  1SZX A;  4JYC A;  2UUA B;  3CPW U;  1K92 A;  3K04 A;  2DN9 A;  4WFG A;  4JF3 A;  4FLX A;  4DV7 O;  3A0B Z;  3CRM A;  5KX5 A;  1EZV H;  1BZK A;  4O4L B;  2YI8 A;  5CMU A;  1KP3 A;  4HZ3 A;  4DR5 B;  1NH2 D;  4DW1 A;  3BHP A;  2JS5 A;  2HKO A;  3QNE A;  5EIB D;  1WB8 A;  2JDI G;  1EBO A;  3JAR B;  2RDC A;  4JI8 B;  1VQ4 V;  1H2L A;  1GH6 A;  4JYY A;  2V4D A;  3SYA A;  3APO A;  2Y69 C;  4BW5 A;  2WLI A;  3M7M X;  5L3C A;  5CA3 A;  2V7Q G;  3J80 N;  2HLD G;  1PP9 H;  4X1K A;  4LFB B;  3IAY A;  3BPZ A;  3W7U A;  3HKC B;  4DV2 B;  1GTO A;  2JGD B;  3LDD A;  4P9O A;  1GN3 A;  2YUA A;  2XAQ A;  2OT5 A;  2VQE O;  2P5O A;  3CCR V;  3RBZ A;  4LF6 B;  1BMF G;  2QJ1 A;  3AG2 B;  1PNM A;  3HPL C;  4H44 B;  2GV9 A;  4NXN B;  4DR2 B;  4YIO A;  5IJ9 A;  1S3J A;  1D5N A;  3RYI B;  4GLX A;  3CJH A;  3CX5 F;  1XUQ A;  1JVM A;  1XHZ A;  5B1O A;  4UV9 A;  2QWN B;  3ABM C;  3D3Q A;  4JI0 O;  4R8C A;  2PZS A;  2IJI A;  3AG7 A;  1Q8I A;  4CBC A;  4JPR A;  4J7K A;  3IGA C;  3KG2 A;  5FLX N;  4YHH B;  1VP7 A;  1CPY A;  4EB6 B;  4YJ3 A;  2RCV A;  3HKE B;  5J2U B;  1OCR C;  3ZMZ A;  2OCH A;  4YJ2 B;  1YSC A;  4PDL A;  2X6C A;  3N27 A;  4MVO A;  4DRX B;  3AK3 A;  1SQP H;  3K0D A;  5IDJ A;  3C3S A;  2JRI A;  2L6L A;  4DR6 B;  1ROP A;  4MVM A;  1D5A A;  1TGO A;  1IBL B;  3SJC C;  3SPI A;  4RWU A;  3RYH A;  5CA1 A;  2ZIN A;  1CXZ B;  2Z5U A;  4RQF A;  1HR0 O;  2PUS A;  1Q81 W;  1SF9 A;  5C93 A;  2EBO A;  4H33 A;  3GB7 C;  4BIO A;  1IXM A;  3FAV B;  2IU3 A;  3SJQ C;  1K8A W;  4I50 A;  1KUQ A;  4ZOL A;  3ZX6 A;  1NU1 H;  1VEW A;  4IHJ A;  5KAI Z;  2F4V O;  1XNQ B;  1F7Y A;  2XAF A;  1NTK H;  3ABL B;  4X65 B;  1NTZ H;  2QM7 A;  5KHK A;  5KUK A;  2P22 C;  4K0K B;  4DR3 O;  2E75 B;  5LP6 B;  4PHZ A;  3RVZ A;  1LR1 A;  1PL4 A;  4UV8 A;  2N05 A;  2E5L O;  2LGW A;  2WWW A;  4W4K A;  4LNU A;  1YF2 A;  4LFC O;  1E1R G;  1MSW D;  2Q0A A;  1GM7 A;  1GN2 A;  5CA0 A;  4TOI A;  1QR9 A;  3TXQ A;  3CCE V;  4JYA O;  4JTA B;  4IT5 A;  1YEW A;  3BY6 A;  3SJB C;  2ZXW B;  4DK1 A;  1IBK O;  4RUF A;  5F2V O;  5J9P C;  3ZN0 A;  1M90 W;  3SYC A;  4IGG A;  3G80 A;  3E8G A;  3OMN B;  3CRQ A;  1EN5 A;  2ZDI C;  1MNG A;  4WBN A;  4X66 B;  4AHC A;  4DV7 B;  3RWR D;  3LDE A;  3G4S V;  2YSU B;  4YY3 O;  1YJW V;  4YIP A;  4PI0 A;  4RAI A;  4J9Y B;  4PJ0 Z;  5KMG B;  3VQY A;  4X62 O;  2LFS A;  3HKD A;  2YS8 A;  1OJH A;  2BOB C;  2ZDI A;  3FFQ A;  3CWB H;  3ZS8 C;  3UT5 B;  1Q3E A;  3AK2 A;  1NH2 B;  1H2G A;  4PEL A;  4DUY O;  3EHB B;  3JAR A;  5IWA O;  1BS3 A;  1HWY A;  2FKX A;  5LGN A;  2M6Y A;  2ZIM A;  4IYI A;  4UCS A;  3AG2 C;  4FLT A;  2RN9 A;  1V54 B;  4LF8 O;  2XHB A;  4LH7 A;  2ZQM A;  1JOY A;  1RFY A;  3C3T A;  2UXC O;  3T1H O;  1R3J C;  4JI7 O;  1N33 O;  2JGD A;  1Z5V A;  4ICG A;  2BTQ A;  4MVZ A;  3E8H A;  1S72 V;  1JX9 A;  1HNZ O;  4RUE A;  5KHH A;  2QWP B;  4F6E A;  1DLB A;  2P7T C;  3N2K A;  5JQG B;  1W59 A;  2OWO A;  5LXT A;  4NXM O;  2F43 G;  2BCC H;  3D36 C;  1R3L C;  5CB4 B;  3L72 H;  4LF4 B;  4J11 A;  3RYI A;  2Q68 A;  4B3R O;  1US6 A;  1FXK B;  1AR1 B;  1VQP V;  4U7N A;  4MW8 A;  3EXA A;  4HNA B;  4BR6 A;  3KZI Z;  1X59 A;  1OCZ B;  3DXR B;  1N0N A;  2DW4 A;  1JQ0 A;  3BAB A;  3THO A;  5JJN B;  2ZE8 A;  4DR4 O;  1NTM H;  1E79 G;  5FPR A;  3CYO A;  2GHY A;  3AG3 B;  5KX5 B;  3MAQ A;  4NR1 A;  4DV6 O;  2A3Q A;  3ZMU A;  3L73 H;  2C2A A;  1ZTE A;  4X1Y B;  4DR1 B;  3KKY A;  3E83 A;  2UUA O;  5KHI A;  4UVA A;  3QVN A;  1K97 A;  4NB5 A;  1B6Q A;  2FTK A;  4J9Z B;  3D8C A;  4DR5 O;  1QR8 A;  4DV1 B;  4B7E A;  2WLI B;  5LL6 Y;  2KSD A;  1I7F A;  3O9O A;  4JI8 O;  5DEC A;  5B1A B;  5KUM A;  5B3S B;  2Z0A A;  2CUG A;  3ZCC A;  4DR7 B;  3ABL C;  3JSL A;  1MZF A;  1YVW A;  3J81 N;  4K8X A;  5E79 Z;  5JVD B;  3ETE A;  3OMI B;  1ARO P;  3E89 A;  4AIL C;  3P30 A;  3P32 A;  2PI4 A;  3WB1 A;  5LP6 C;  4DR3 B;  5L3E A;  3A0H Z;  5IJ9 B;  1VQ9 V;  1H38 A;  3CJH B;  4LF6 O;  1PV0 A;  1S5L Z;  2OIG A;  1KB9 F;  3WB0 A;  2E5L B;  4DR2 O;  2UXX A;  1URF A;  5KA6 A;  4ZBM A;  1LUW A;  2IM9 A;  3DC5 A;  4FPP A;  2ZNI A;  1VQO V;  2ZXW C;  4JYA B;  3BRC A;  4UVC A;  2P67 A;  2B5U A;  1XL6 A;  3CB2 A;  4NTW A;  4YHH O;  1K7D A;  3ETD A;  5LGU A;  2RJZ A;  3X2Q B;  4CC6 A;  5AG2 A;  2H94 A;  4PA7 A;  1EZJ A;  1W0J G;  3K08 A;  1AJQ A;  4X8A A;  4B3S B;  4CS3 A;  3RYH B;  3CSX A;  2WLJ A;  5CA1 B;  4N23 A;  3JD2 A;  4JI4 B;  5IYZ A;  1N4C A;  4X62 B;  1Y66 A;  3R65 A;  4DR6 O;  3CXH F;  5EZY A;  5IYD O;  1IBL O;  3G6B A;  5EIB C;  2HJF C;  4JGS A;  2WLH A;  1KP2 A;  2EJR A;  4ZOL B;  1NKD A;  3B8M A;  3FYI B;  3Q4H B;  4DUY B;  4I4T A;  1T5E A;  4XDJ A;  5IWA B;  1SKV A;  3C90 A;  4FLV A;  4IHJ B;  1NBM G;  1V54 C;  2RNB A;  4MTO A;  1QQC A;  4JZG A;  2HVK C;  3B09 A;  4LF8 B;  2CTP A;  1F4N A;  1OZ0 A;  3T2M A;  1TAE A;  4FLW A;  1V9P A;  2MW2 B;  5E1A C;  1ZLZ A;  1B3Q A;  1XNQ O;  1RSO B;  1Y76 B;  3UO2 A;  1IXB A;  4O2B A;  5GTI Z;  3SR2 C;  1VMG A;  1X4T A;  3CHX A;  1YZB A;  1HNZ B;  3E2E A;  3OUS A;  3BA8 A;  3NXS A;  5CA0 B;  1FXK C;  4H13 B;  2A0L A;  1XMO O;  3MHS C;  5KAF Z;  3IC7 A;  4PA4 A;  1OCZ C;  4GX0 A;  4CH5 A;  3WFV A;  2EIM B;  4HAM A;  1WPX A;  2QE7 G;  1DF5 A;  4TT3 G;  1XMQ B;  4LCU C;  4JV5 O;  3LNN A;  4B08 A;  1FXK A;  3B77 A;  4TQF A;  5EBM C;  3AG3 C;  3RVY A;  4HNA A;  4UFZ A;  4BWA A;  4QNH B;  4DR4 B;  1P4R A;  4WBN B;  1PPJ H;  3ZIA G;  3FB5 C;  3D3I A;  1KKC A;  4JAA A;  1W2B U;  1JJ2 U;  5FPO A;  3OEH G;  2CH7 A;  1EN4 A;  1QBZ A;  1ZL8 B;  3APQ A;  5IJ0 A;  4NTY A;  5DM6 V;  4XBF A;  1G1X B;  3AG4 B;  3SPH A; 
#chains in the Genus database with same CATH homology
 3GB7 C;  2QTO A;  1IXM A;  4JTD B;  1LNQ A;  4FIP C;  3W7W A;  1VQN V;  2IU3 A;  1S5H C;  4PDR A;  1NR7 A;  3SJQ C;  1K8A W;  2Y48 A;  5B1A C;  2V1D A;  1NR1 A;  4WFE A;  5B3S C;  2EIN B;  4U7O A;  1GKF A;  3K3W A;  1YTF D;  3K79 A;  4X88 A;  3OE7 G;  4CZZ A;  3FB8 C;  4MTF A;  3OGC C;  4MS2 A;  1M57 B;  2XAF A;  3ABM B;  1FXH A;  3ABL B;  1G4Y B;  4FK5 C;  2QM7 A;  5KUK A;  1SZT A;  4WFA V;  1ENV A;  3PJS K;  5DN6 G;  4H37 A;  2HFE C;  2EZP A;  1RPR A;  2NLJ C;  2Q67 A;  1F23 A;  3ASN C;  3QO8 A;  4MVS A;  3FB6 C;  3ABT A;  3RVZ A;  3JD3 A;  3SYP A;  1SER A;  4FMT A;  1R3I C;  4UV8 A;  1OCR B;  5EBL C;  4BIU A;  2DQ0 A;  2WWW A;  3W7T A;  3GWO A;  5LHH A;  3F5W C;  1QVF U;  1E1R G;  2AHY A;  3SPJ A;  1MSW D;  3D36 A;  1M1K W;  1GM7 A;  1CEZ A;  3ABK B;  2WLK A;  2W6J G;  5L3F A;  1GM8 A;  4R50 A;  5EC2 C;  1F51 A;  1OCC C;  1QR9 A;  3FKS G;  4JAV A;  4MSW C;  1OCO B;  3CCE V;  3UKM A;  4JTA B;  3AG1 B;  1RM1 B;  3ZRV A;  1G8M A;  2YEV B;  3BY6 A;  1VQ6 V;  2ZXW B;  3G6E V;  4BAY A;  4P30 A;  1K4C C;  4BIZ A;  2MK3 A;  4RUF A;  3WG7 C;  1COW G;  5BZB A;  5J9P C;  2DYR C;  2Z3Y A;  3ZN0 A;  1MG1 A;  1M90 W;  3AEI A;  3SYQ A;  4KUM A;  3SYC A;  4QE7 A;  1DTO A;  3E8G A;  3OMN B;  1K5Q A;  5B1B B;  3STZ C;  3ZRW A;  2IW5 A;  2ZDI C;  4QPK A;  3I56 V;  1QCE A;  4RO2 A;  4YXW G;  3JCZ A;  4PA3 A;  3OW2 U;  2K1E A;  1TUE B;  3T4D A;  4LP8 A;  3LDE A;  1FXV A;  3G4S V;  3X2Q C;  4WFF A;  2ITC C;  4FJC C;  1Q7Y W;  2YSU B;  1YJW V;  4RAI A;  4J9Y B;  3DTU B;  3DGE A;  3ML0 A;  1K3E A;  3ZMV A;  2HVJ C;  2LFS A;  4G27 B;  5CBG A;  5L3B A;  2Y69 B;  2BOB C;  2ZDI A;  2D3O W;  3CP1 A;  1Q82 W;  3CD6 V;  2JJ1 G;  3ZN1 A;  2GSM B;  3CCQ V;  1NH2 B;  1H2G A;  3ASN B;  4PEL A;  4Z1M G;  3EHB B;  2QM8 A;  4DO2 A;  3OR7 C;  5CBF A;  1KKD A;  1THZ A;  1HWY A;  3B8N A;  4UXN A;  5LGN A;  3CXC U;  2LFR A;  2A79 B;  1Y4M A;  3AG2 C;  2EIJ C;  3LSQ A;  1QLE C;  2DQ3 A;  2EIL C;  1V54 B;  3W7X A;  3EFF K;  3CCU V;  3ETG A;  2ZQM A;  2W6I G;  2HG5 C;  2EIK C;  1JOY A;  1M56 C;  4MVU A;  1R3J C;  4E2L A;  1R6K A;  3QO5 A;  5H6R A;  5IY5 B;  2DYS C;  2OTL V;  2Q6A A;  3JYC A;  4MVZ A;  3E8H A;  3OAA G;  4WF9 V;  5LGT A;  1AJP A;  1S72 V;  1JX9 A;  3JD1 A;  1H8E G;  4P9P A;  4RUE A;  3T4Z A;  1KQS U;  1DLB A;  2P7T C;  1AI5 A;  1S0V A;  2ZR2 A;  4R7C A;  1VQM V;  1BL8 A;  3T1C A;  3ZRX A;  2F43 G;  3FYE B;  1EFR G;  1CP9 A;  1QVG U;  1R3L C;  3BEH A;  3STL C;  2WLM A;  5EC1 C;  3I55 V;  4TWK A;  2Q68 A;  4F4L A;  3ABU A;  1Q86 W;  2P90 A;  4LBE C;  1FS0 G;  1FXK B;  2JEX A;  4JAS A;  1AR1 B;  1VQP V;  4U7N A;  4MW8 A;  3FB7 C;  2JIZ G;  3K9A A;  1OCZ B;  5LHG A;  1K73 W;  4JTC B;  3MHH C;  2DW4 A;  1JQ0 A;  2WLL B;  1K9M W;  1K4D C;  1PD3 A;  4GX1 A;  2DWE C;  1NVP B;  2OTJ V;  4EKW A;  3CME V;  3H01 A;  5EK0 A;  2IJK A;  1L1F A;  3HB3 B;  4G2K A;  2JEU A;  4GX2 A;  2EZO A;  1E79 G;  1MOF A;  3CYO A;  2GHY A;  1JCH A;  3AG3 B;  4GCZ A;  3SYO A;  1YJ9 V;  4WCE V;  3CCS V;  1PNK A;  1VQL V;  3W7S A;  2XAG A;  3ZMU A;  1BHB A;  3F7V C;  2C2A A;  3IFX A;  1NQT A;  3SPH A;  2IJH A;  4X89 A;  3E83 A;  2WSS G;  2OCC B;  1OHH G;  1NJI W;  2KB1 A;  3AG4 C;  4GT1 A;  4UVA A;  1PNL A;  1V55 B;  4ASU G;  4QPJ A;  2EIJ B;  1YHQ V;  4PDM A;  2EIL B;  1K97 A;  4XDL A;  5IYB O;  3RW0 A;  1AJN A;  1B6Q A;  1R3K C;  1AI4 A;  2FTK A;  3ASO C;  4J9Z B;  1QR8 A;  1E1Q G;  1PKX A;  2WLI B;  4JAU A;  4MTX A;  1VQ7 V;  4P2Z A;  1KEC A;  1SET A;  2EIN C;  2NNU A;  5B1A B;  1JPX A;  1WLE A;  4MTG A;  3CCJ V;  5KUM A;  5B3S B;  1K33 A;  2CK3 G;  2XAS A;  1VQ8 V;  3ZCC A;  3JD4 A;  1M57 C;  2DWD C;  4PA9 A;  3ABL C;  1GMG A;  4QIW F;  1AI7 A;  3LDC A;  5H9C A;  2WAM A;  4G28 B;  3ETE A;  5B1N A;  5GW7 A;  3OMI B;  5KA5 A;  1ARO P;  3E89 A;  2BOC C;  4I5S A;  2LP7 A;  2JK5 C;  3LNM B;  1M9N A;  3P30 A;  3SPG A;  3P32 A;  3SPC A;  2PI4 A;  2XAJ A;  1QLN A;  5LHI A;  3OEE G;  4UUJ C;  5L3E A;  3UM7 A;  1S76 D;  1VQ9 V;  1KD1 W;  1H38 A;  3CC4 V;  1YTF B;  1DF4 A;  1N8R W;  1ORQ C;  1YIT V;  1FFT B;  1S77 D;  4TSF G;  4WFB V;  1J95 A;  3ABK C;  3TET A;  5FL7 G;  4L87 A;  2UXX A;  2Q69 A;  1RPO A;  2R9R B;  1YJN V;  1MAB G;  4WFH A;  4ZBM A;  1OCO C;  5KA6 A;  3CCM V;  4QE9 A;  2XOK G;  1OCC B;  2AHZ A;  3AG1 C;  3E35 A;  2IH1 C;  3ZRW B;  1RM1 C;  4FPP A;  1VQO V;  3CCL V;  3OM3 B;  3E8F A;  1P7B A;  2ZXW C;  4LC1 A;  1GM9 A;  3F7Y C;  2R9I A;  5H6Q A;  2ZD9 A;  1SES A;  4UVC A;  2WLL A;  2P67 A;  1GO3 F;  3WG7 B;  2X6B A;  2QEX V;  2B5U A;  2DYR B;  2X7R B;  4JYC A;  1XL6 A;  5B1B C;  3CPW U;  1K92 A;  3K04 A;  4KFM A;  1I5Y A;  4WFG A;  4JF3 A;  1F4M A;  3ASO B;  1YI2 V;  5LBQ A;  1K5S A;  4KP4 A;  2YEV A;  1W0K G;  5CMU A;  1KP3 A;  1K7D A;  3ETD A;  4HZ3 A;  4N21 A;  5LGU A;  1NH2 D;  2P6J A;  2HKO A;  2IH3 C;  3QNE A;  4HYO A;  2JDI G;  2UXN A;  3X2Q B;  1EBO A;  2EIM C;  2H94 A;  1SRY A;  2H8P C;  2IU0 A;  4PA7 A;  1VQ4 V;  1EZJ A;  1W0J G;  3K08 A;  1AJQ A;  4X8A A;  3ZRS A;  1VQ5 V;  3TK1 A;  4DXW A;  2WLJ A;  5HFM A;  4N23 A;  3JD2 A;  3SYA A;  2QA4 V;  1BHA A;  3LSS A;  2Y69 C;  3K03 A;  2WLI A;  4BW5 A;  5L3C A;  2PI5 A;  1XL4 A;  5CA3 A;  2V7Q G;  4RQE A;  1Y66 A;  2HLD G;  3R65 A;  5CBH A;  5IYD O;  2B1I A;  2JJ2 G;  2WLN A;  1AI6 A;  3W7U A;  4PA6 A;  2HJF C;  4JGS A;  4MVQ A;  1GTO A;  2QKS A;  2WLH A;  1R6N A;  3LDD A;  4P9O A;  1KP2 A;  2EJR A;  1NKD A;  3B8M A;  3FYI B;  4MT8 A;  3A0R A;  2XAQ A;  2XND G;  5IYC O;  2OT5 A;  4XDJ A;  5HFL A;  1H8H G;  3CCR V;  1K34 A;  3RBZ A;  1YIJ V;  1BMF G;  3E86 A;  3ZMT A;  1NBM G;  4XDK A;  1UJW B;  1V54 C;  4GX5 A;  3AG2 B;  4MTO A;  1QLE B;  1PNM A;  3HPL C;  1PL0 A;  2HVK C;  2EIK B;  2XAH A;  1F4N A;  1M56 B;  1S3J A;  5IY5 C;  1OZ0 A;  2WPD G;  3T2M A;  3ZJZ A;  5E1A C;  3M99 B;  4R6Z A;  1JVM A;  2DYS B;  2M7W A;  5B1O A;  4UV9 A;  3ABM C;  2W0F C;  3CMA V;  1KC8 W;  1NVP D;  5EBW C;  4R8C A;  4UVB A;  1GK9 A;  3E2E A;  3OUS A;  2IJI A;  4CBC A;  3NXS A;  4JYB A;  3JD0 A;  4JPR A;  1FXK C;  2ATK C;  2A0L A;  3IGA C;  3KG2 A;  3MHS C;  3OMA B;  3TCU A;  4Q20 A;  4PDV A;  1CPY A;  3IC7 A;  4PA4 A;  4QJF B;  1OCZ C;  3OFN G;  3E8B A;  5CN0 A;  2X0L A;  3QO7 A;  4GX0 A;  5L3D A;  3WFV A;  2EIM B;  4HAM A;  1OCR C;  3ZMZ A;  1YSC A;  4PDL A;  2HR3 A;  2A9H A;  2X6C A;  3VOU A;  4MVO A;  1WPX A;  3OR6 C;  2QE7 G;  4I9W A;  1DF5 A;  4TT3 G;  1VQK V;  4LCU C;  2ITD C;  1ZWI C;  3CCV V;  3K0D A;  5IDJ A;  1FXK A;  3B77 A;  2IJJ A;  5EBM C;  3CC7 V;  1R73 A;  3AG3 C;  3K06 A;  4MW3 A;  2ZR3 A;  3RVY A;  5L3G A;  2X6A A;  4QNH B;  1ROP A;  3LUT B;  4MVM A;  1P4R A;  4ZKI A;  3ZIA G;  3FB5 C;  3D3I A;  4MVR A;  4OXS A;  1I5X A;  2B1G A;  3SPI A;  1W2B U;  1JJ2 U;  3CC2 V;  3OEH G;  1QBZ A;  3ZMS A;  2OCC C;  2Z5U A;  3OUF A;  4RQF A;  1V55 C;  3K0G A;  3MD0 A;  4XBF A;  3VBB A;  5DM6 V;  3G71 V;  1Q81 W;  5C93 A;  2EBO A;  3AG4 B;  4H33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...