2ZQMA

Crystal structure of the prefoldin beta subunit from thermococcus strain ks-1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
114
structure length
114
Chain Sequence
MQNIPPQVQAMLGQLESYQQQLQLVVQQKQKVQLELTEAKKALDEIESLPDDAVVYKTVGTLIVKTTKDKAVAELKEKIETLEVRLNALERQEKKLNEKLKELTAQIQSALRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Prefoldin beta subunit 1
publication title Structural and molecular characterization of the prefoldin beta subunit from Thermococcus strain KS-1
pubmed doi rcsb
source organism Thermococcus sp.
total genus 45
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01920 Prefoldin_2 Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zqmA00
2ZQMA 1FXKC 1FXKA 1FXKB 2ZDIC 3AEIA 2ZDIA
chains in the Genus database with same CATH superfamily
3DC5A 3QO5A 1Z2GA 2B9ZA 2Q7HA 1Y67A 3RYCA 2KSDA 4JZ2A 5H2FZ 2R72A 4I9WA 2X6BA 3O9OA 1FYJA 2ITDC 4X62B 4JYAB 1BS3A 1ZL8B 2YIDA 4JI2B 5IWAB 3K3WA 5B1NA 2IU0A 4FMTA 3CHXA 4BIOA 4YHHO 2XAFA 4FLVA 1Q7YW 3P3NA 4DXWA 1VQ7V 4TQFA 2ZE8A 1N33B 1S3JA 2GV9A 4DK1A 3ZMUA 4LF8O 2H8PC 3CRQA 1AR5A 3SJQC 2BSKB 1NBMG 2CAZC 2WLLA 3RBZA 5H6QA 1MSWD 2A06H 1Y4MA 5L3GA 1U97A 1OCRB 4R8CA 1SRYA 3CJHB 3E2EA 4JV5O 4O4JA 3AG2C 3NR7A 4FVMA 2DJVA 4MTFA 2GHYA 2QKCA 4I55A 3KKYA 3K9AA 1P7BA 3AK1A 3RYHA 1EZVH 1RSOB 3G67A 1JCHA 1VARA 4R7CA 1VQPV 4MVQA 3SR2C 2EINB 1XEQA 2VQEO 1KKDA 1XREA 3L74H 4R50A 4J9YB 5CA0A 1TUEB 4I7ZB 3HKBA 2CH7B 4MS2A 3F7VC 4OX9B 2AW9A 2HVJC 2UXDO 5CMUA 4WFHA 4DR5B 3CWBH 2HKOA 3CEIA 2UXCO 1DGSA 2P5OA 2NN4A 1R6KA 2QWRB 3E8BA 3Q4HB 2F95B 1XMOO 1XNQB 2AGAA 1FXVA 3OAAG 4ZKIA 2XT9A 4O2AA 1DF5A 4U7OA 4UVCA 1P49A 4FZ1A 1H2SB 1SQFA 1FFXA 5CBGA 3E83A 4KXRA 1SETA 3CS5A 3AG3B 4H13B 2YC0A 3OTOB 1SQXH 1P7GA 1W0KG 4U3FH 1I0HA 2IU3A 2IJKA 3WG7B 5EIBD 4QGPA 1N0NA 3CE2A 1NR1A 3ETDA 4I50A 4CBCA 1OCZB 2LJ2A 2LGWA 2MW2B 4LNUA 3JALB 4KHPO 3OGCC 1EFRG 2PI5A 2X7RB 3K0GA 3FFQA 1JA8A 5GTHZ 3E8HA 4Z1MG 3OGIB 3IFXA 5FPOA 2HFEC 4MTXA 3T4DA 4JI6B 4P30A 2BSKA 4U3JA 1V9PA 1NS1A 5LOVB 2F23A 2QTOA 1HNZB 4X1YB 5J2UB 1XMQB 1EN5A 3CCJV 1O9GA 3K58A 3D36A 2E3CA 3DSQA 2P06A 3FX7A 1EN4A 4CZZA 1DLBA 1S0VA 2NR5A 1Q5OA 2YUAA 3MDSA 4OPAA 1OCOC 3SPGA 5C8YB 4PDLA 3J81N 1VQKV 4I9QA 1BGYH 3H1HH 2CH7A 2JJ1G 3ABMB 4DR3B 1IBKO 1HW7A 3MHHC 3OMIB 5HFMA 4PDVA 3K04A 5IJ9A 2F4VO 4YJ2B 4F6RA 2JJ2G 2PI4A 2Y69C 3JARB 3ASNC 1M4UA 3E22B 2CTPA 2UXNA 1ZSPA 1XHZA 1VQ8V 4JI4O 2GUZA 1XQ8A 5B1BB 4LF7B 4J7JA 4MVUA 4F4LA 4JYYA 4EFBA 3WB2A 4UUJC 3VQYA 3PJSK 5C93A 4FLUA 1AI6A 4LF8B 3RGBA 1NH2B 4LF5O 3FD9A 2IJHA 5J9PC 2ZE5A 2HR3A 2OTLV 2EZOA 2ETNA 2OCCC 3CRCA 4NTXA 1BE3H 5LP6B 1GTOA 4JV5B 3SJCC 1JPXA 2YICA 4U7NA 1SQBH 4HAMA 1LUWA 4HYOA 4X9QA 4DV3O 2OIGA 2JEXA 4IGGA 5BMVB 2UXXA 3BEHA 5BR8O 2ZR3A 4CH3A 2JDIG 2YIBA 3B4SA 1AROP 2G38A 3I5DA 1WP7A 2QR4A 3ZJZA 4DUYO 1O9HA 4D7TA 3KCXA 3UKMA 3ETQA 2DYSB 1KKCA 1GMGA 2UXCB 2ZDIA 4ZOLA 1B04A 4UCOA 2OYQA 4YIOA 5J2TA 3G6EV 4O4IB 4MVOA 4JYBA 2RMKB 3HKCB 4JPRA 2EIKC 2OT5A 4HBNA 1S77D 3BA8A 4IYIA 2HVKC 4DR4B 1PL4A 1AJPA 4H0LB 2RJZA 4PI0A 1YSCA 3L9DA 5IYZB 3JASB 1Q6HA 3JARA 3E22A 2K1EA 2JGDA 3CMAV 1FS0G 2W6JG 4X62O 3O65A 2HG5C 4B7EA 4FLZA 1RM1C 1M57B 2DQ3A 3W7TA 3LNNA 1GO3F 4FM2A 1YITV 3JYCA 1WB8A 3JD0A 3FB6C 1AI7A 4KHPB 1E79G 4LC1A 2BTQB 1WP8A 3L71H 3ABUA 1FFTB 1GN4A 4EEQA 2N74A 3G4SV 1BQZA 1SQQH 1N34O 4LFAB 4IIJA 4O4LB 3CC7V 2QSAA 5GONB 1PKXA 4TSFG 3CCVV 2Q73A 2Z0AA 1CPYA 3IC9A 4NVPA 2KB1A 3J80N 1AVMA 2DN9A 1Y76B 2BE3A 3C3TA 4MVZA 2ZD9A 3R65A 5CA1B 1J5EO 3CMEV 3FYEB 1T5EA 1K92A 5BMVA 4B3SO 4JAAA 1Q86W 1QU7A 5ITZB 1N36B 5FNVB 3UM7A 4YY3B 4OX9O 1N4CA 2XAJA 3AG7A 3DGEA 2EULA 1S76D 1IBKB 3LSUA 4CH5A 4NXNB 1NZ6A 3EVKA 4MW3A 1KB9F 4X1IB 4PDMA 4X20B 4XDLA 1IZ3A 5JH7B 1M1KW 1I7FA 5K1XA 4UCSA 4O4IA 1L8DA 1VQOV 4NB5A 3RYCB 2JIZG 2WPDG 3CCUV 5DECA 1XBLA 3I55V 3TJTA 1QR8A 2EX3A 3D3IA 3VQWA 4JI4B 3U11A 3FKSG 2HP8A 4KFMA 2VRZA 3SGIA 2M6YA 3IAYA 1XHXA 1V54C 4OXSA 4DV2B 4WFAV 1COWG 3K5OA 1FXKA 2XAGA 2VWKA 1BHBA 4PD4F 4GX2A 2GBOA 3CC2V 1R6TA 4NTYA 4LF5B 3N27A 4UCUA 5TISZ 1YTFD 5EBLC 1WPBA 3CCMV 3VOUA 3DC6A 1H2GA 4PA9A 2A7WA 4IYHA 3WB1A 1SQPH 4B08A 1JFFA 4I4TB 4Q20A 2QE7G 2P4KA 1MNGA 4BIZA 3LUTB 4O4LA 5KA6A 1TVKA 5LXTA 1YZBA 2EIMC 1HNZO 4GKKO 4DV3B 1IDSA 3ZEDA 3ZRSA 2MK3A 1AR4A 1M5IA 2Q0OC 1GAXA 1ZTEA 4RQFA 2WSSG 5CA0B 2UUCO 5B3SB 1SKVA 3HKBB 3TCUA 3G80A 1AJNA 2HJDA 2VQFB 4DUYB 3OFNG 5FL7G 4CC6A 1WJZA 3EFFK 1K97A 5E1AC 5KHHA 3CYOA 4J11A 2ZCEA 2EILB 1H38A 4H44B 2B1GA 5ITZA 3CB2A 1IXMA 2Z5UA 3AG2B 4DR3O 3HR0A 2IJJA 4CS2A 1CXZB 2ZE6A 4BIUA 3CCQV 1OCCB 4B3MO 3CRAA 3L75H 1FPOA 4LBEC 2Y48A 3ZRXA 3F5WC 1FJGO 2ZNJA 1CEZA 5JH7A 4JASA 5BY1A 1VP7A 2N04A 4P9PA 4N23A 4WFBV 4UFZA 2R9RB 3ABKC 5B1AC 3ZMTA 3K08A 4I50B 4LNUB 1VMGA 4FFKA 4LF7O 2A0LA 1EN6A 3K79A 5KLVH 2JS5A 1KP3A 4CH4A 1YJNV 1R3KC 2Q5ZA 2W6IG 5H6RA 3BRCA 2IH3C 2WLJA 1N34B 4W4LA 4U3JB 4RUEA 4LCUC 4UB6Z 3QO8A 3B77A 1NKDA 2XAQA 3G6BA 4ZBMA 2QWOB 1F4MA 2DE0X 3ASOB 4I4TA 1R3JC 5FLXN 1JVMA 3LNMB 2UUAO 3ETEA 3T4ZA 1J5EB 3OT7A 4O2BA 2F66C 3RYIB 3LSSA 4B3SB 4DO2A 3X2QC 4NYKA 2CGOA 4DV0O 2EJRA 1GRJA 3JSLA 1K3EA 1TUBB 1WAZA 4Z2WA 4DV6B 2X0LA 1BT8A 5IJ9B 4UVAA 4B3TO 4F6RB 1H2MA 2B5UA 1Y6XA 1VQLV 4LR3A 4MSWC 2BCCH 3CSXA 3CX5F 4NR1A 1Q6UA 5IYDO 4E4EA 3AG1C 1KU9A 5B1OA 5KUKA 2VWJA 2BOBC 5DEDA 4PA4A 3GB7C 3S3XA 1UPGA 4AHCA 4TT3G 4DR4O 1US6A 5A9GA 3EXAA 5L3CA 2DWDC 2GUZB 2V1DA 3APOA 1OCOB 2YIAA 3ZX6A 4P9OA 2BTOA 4NKGB 3BFRA 3HKDB 4X66B 4LFCO 3C3SA 2X6AA 2PUSA 3VQVA 1L1FA 4EB6A 1QNMA 4J80A 1ORQC 3ZS8C 2Z3YA 1LR1A 1SZXA 4LP8A 2L6LA 5EZYA 3AK3A 2QM7A 4ZHQB 3LDCA 1DK1A 1X4TA 1VQ6V 2Q6AA 3ZN0A 1OCRC 3TXSA 4DV7O 5EIBC 1MZEA 2DMXA 3B8MA 4LFAO 4MVMA 3E86A 3JSNA 4CS4A 3QVNA 5IDJA 1YCIA 2YXHA 3P3PA 1WLEA 4PHZA 2EINC 2LW1A 2F1MA 4GKKB 4ZI7A 3SYOA 2O57A 1WN7A 5KHIA 3CD6V 2OCHA 1RP3B 2UUCB 1B6QA 1QLNA 2JK5C 2YI9A 4HZ3A 3TK1A 2H3OA 1QLEB 1TGOA 4GYCB 3RYIA 4QIWF 4ZOLB 1N36O 2OCCB 2RNBA 3APQA 4TV9B 5D5PA 2WLMA 1QVGU 3ZHQA 5J2TB 3QO7A 4YJ3B 4IHJA 4YY3O 3HPLC 1TUBA 3L73H 1D2DA 4NXNO 4B3MB 3N2GB 2XUMA 4WFGA 2L35A 1FJGB 2JGDB 1WNSA 1VF5B 3K5MA 2D2CB 1IX9A 2UXBO 2P4VA 4J7ZA 5CBHA 1N32O 3SJAC 4J41A 4LFBO 1OCZC 2QWPB 3HKDA 3FYIB 4DV2O 4X89A 3ABLB 2QEXV 5LHGA 1XNRO 4IT5A 2YIBD 1KECA 5IYCO 1E1QG 4XDJA 4IIJB 1K4CC 2FMLA 1XOUA 3AK2A 2XHBA 4EFEA 5KAFZ 3T1YO 4JTAB 4KP4A 4JI7B 5JVDA 5LMNO 4ZHQA 2JRIA 3PN1A 4RO2A 4GT1A 4JAVA 4MW8A 2FTKA 1K33A 1R1BA 5DM6V 1Q3EA 1NI8A 1H8EG 1V55B 4X64O 2E5LB 4BAYA 2DYRB 2UUAB 4B3RO 1K5QA 4KUMA 2ZDIC 2Q68A 3K0DA 2KG7A 4HNAB 3K9SA 1G8MA 4OGQB 2Y0PA 2DOSA 2VQFO 4DV0B 2BOCC 4WCEV 4WBNB 3CPWU 1MG1A 3CRMA 4X1KA 4CS3A 1PPJH 4MTOA 3K59A 1QHTA 1KUQA 4QPJA 4K8XA 4ABMA 4B3TB 4TV9A 4JZGA 1HDJA 2PYJA 4YJ3A 3SPHA 3JD1A 5JQGA 1G6UA 1XUQA 3SPCA 4JAUA 3G71V 1E1RG 4JF3A 4UB8Z 1VQ5V 5JCOA 3N2GA 3M99B 1NH2D 1XL4A 3RVZA 5B1BC 3RW0A 3M8AA 2HLDG 3R66A 4LFCB 3ZN1A 3IC7A 1FXKB 4EKWA 3ZMZA 1R73A 5CN0A 4DR1O 2ZXWB 3ETGA 3GWOA 2DWEC 2XNDG 4PDRA 4A5UB 1P4RA 1L0LH 1A32A 2QM4A 1OJHA 3MHSC 1ZUQA 4E2LA 4YXWG 3T1HO 5LP6C 1JFFB 4DV7B 1AR1B 4DV5B 4DRXA 1BCCH 1TVKB 5LXTB 2CDYA 1NJIW 2PF4E 1N8RW 3WB0A 4CC5A 4AI8A 1TAEA 3VQXA 2R70A 1V54B 1PV0A 2EIJC 2PYLA 4JI1B 1KQSU 2IJIA 1PD3A 4OPHA 4DR2O 1BMFG 3BABA 4FK5C 2DYSC 1K9MW 5IY5B 2ZM6B 1WA8A 3KG2A 5KHKA 1RFYA 4C7UA 4HNAA 1IVSA 2YDEA 4TOIA 1S72V 5L3BA 4WBNA 3W7WA 3QNEA 2QWQB 4K0KO 4DV6O 3W7SA 3I56V 1NU1H 3CXCU 1KD1W 1MMMA 3K5NA 4PV1B 5D5QA 4G2KA 3SDLA 3F5TA 3AG4B 2UXBB 2OWOA 1SQGA 3P30A 2GTAA 1M57C 4UVBA 3A0BZ 1JOYA 3H01A 1N32B 4PA6A 4LFBB 5LHHA 1KMIZ 3D8CA 5KX5B 4X66O 3ZRWA 4K3AA 3ZBHA 2ZIMA 2Q67A 3OD4A 3LDEA 4J9ZB 1Y74B 3JAWB 2LFRA 2Q0AA 2Y0IA 2QWNB 4FPPA 3DTUB 1XNRB 5EC1C 1I5YA 1Q6IA 5A2QN 5CBFA 3B40A 2LW7A 2RQ6A 4I5SA 1XL6A 3T1YB 1MOFA 1MABG 1JMKC 5LMNB 1R3IC 4D6TH 2QGNA 2ARHA 3OUFA 3UT5A 1JJOA 3RT3C 2YEVB 2OTJV 5FPRA 1PM9A 1KC8W 3JAMN 1NVPB 2Q4PA 1D5NA 5B1AB 5LGNA 2IH1C 2ATKC 1H2LA 2C2AA 4YIPA 2QKAA 1ZX3A 1I94B 4X64B 4JTCB 4O2BB 5K1PA 4B3RB 4K8ZA 3IJ4A 2LQTA 2F93B 1LNQA 3ZIAG 4X88A 2YSUB 3E89A 1YHQV 4FFBB 2QM8A 2PY5A 3B2EE 2YS8A 1QR9A 3JD2A 5EK0A 2PZSA 3BAAA 4JGSA 2Y4TA 1Q82W 2ZQMA 1VF6C 4JI8O 5LMUO 5EBWC 1RPOA 1M56C 1OZ0A 2GTSA 1G1XB 5GTIZ 4FLXA 4DV4O 3OE7G 2JGUA 4GX0A 5IE9A 4LF6O 2GSMB 3OEHG 2WA4A 4JI5B 1TA8A 2EZPA 3JATB 4PELA 3U10A 2P90A 1K4DC 5AG2A 1Q90D 1SERA 5LYJA 3S3WA 3OMNB 1HR0B 3ZHTA 5EC2C 4BW9A 5LGTA 4FIPC 2R9IA 1SESA 1KP2A 1VQ9V 1N0JA 1PNLA 1WB7A 2W0FC 1YXBA 1BSMA 4EB6B 2FYUH 5L3FA 1SZTA 1EM1A 2CTRA 4DR1B 4H37A 5HFLA 1UFIA 5KX5A 5EZYB 2CTWA 5KMGB 5JJNB 1OV9A 2XOKG 3AG1B 4JI3B 3RVYA 1Y74A 3JAWA 1CP9A 1ENVA 4J42A 1GH6A 1YJ9V 3T1HB 2ZE7A 2NLJC 4DW0A 2CGNA 5KA5A 1PL0A 1L0NH 1VEWA 4JI7O 1SF9A 3HKEA 2ITCC 1F23A 5LBQA 4KL1A 4AQYB 3L70H 1ROPA 2V7QG 1H2NA 4UV8A 4NXMO 4ZI7B 3QTCA 2YEVA 5B3SC 3ICXA 1DF4A 1PNMA 3M7MX 4DR2B 4LF4B 2WLIB 2E5LO 1LUVA 2ZIOA 3SYAA 2EILC 4WFEA 4DW1A 4O4HB 4FFBA 1YIJV 3ZMSA 3OW2U 3CCRV 2Q7GA 1NTMH 2RDCA 4IHJB 5IJ0A 2FL4A 3KCYA 3ZRVA 1OCCC 1XILA 4K0KB 4QPKA 5DN6G 2UUBO 1BZKA 3E8FA 5B5EZ 3RWRD 3RYFB 1M93A 3DXRA 1S5LZ 4LWSA 2WLHA 2PGGA 1XI1A 1I08A 3JATA 3RFRA 1NQTA 4Q6GA 1QBZA 3ZMVA 5KAIZ 3ZHSA 5LA6A 2A79B 1SA0B 4IL6Z 3JAKB 1ZAUA 2JEUA 2EBOA 3OEEG 1K73W 4XBFA 4QJFB 5CB4A 3SYPA 3B09A 3HB3B 4R6ZA 2LFSA 3OM3B 4WFFA 3CC4V 3WFVA 1IBLO 4DR7O 5KMGA 2WLKA 2Y69B 1H2KA 3ASNB 3H1JH 4GCZA 5JVDB 1JJ2U 4ICGA 3T2MA 5CA3A 4LF9B 4DR6O 4LH7A 3BVOA 1FKAO 4JYCA 1QCEA 3ASOC 3D36C 4UV9A 4DV5O 1YI2V 3H1KH 1ZL8A 4MVRA 1X59A 4BW5A 3JD3A 1S5JA 3K03A 1JX9A 3KZIZ 2CK3G 4JI1O 2ILMA 2KG7B 1FAFA 2JS3A 5B66Z 1M90W 2UU9O 1AILA 4W4KA 5BXZA 1R6NA 2WLIA 4X1KB 1YVWA 2ZM6O 1D5AA 1EZJA 1DTOA 4QE9A 2XAHA 5LHIA 1SS3A 1AI5A 4JI8B 5LMUB 1K7DA 4O4HA 3CJHA 1VF7A 1THZA 1BL8A 4UCTA 5JQGB 3RN4A 3SYQA 4DV4B 4G28B 2ODMA 1RSOA 4LF6B 1GKFA 2AHYA 1S5HC 1BQ0A 2PTMA 2YI8A 1YDXA 3BCCH 1WPXA 4DV1O 2HHHB 3AG3C 3D3QA 4RUFA 5E79Z 3RYFA 1K5SA 2XASA 2P22C 3A0HZ 5L3DA 4WF9V 3WG7C 3NXSA 3QF7A 3MAQA 2H94A 1SA0A 4J10A 3JAKA 4GX5A 1AB3A 5F2VO 1GN6A 1VQNV 2E74B 3Q4HA 3E8GA 3H1LH 4FM0A 4FJCC 4RAIA 2EIKB 1B3QA 1AI4A 1URFA 4GZRB 4DRXB 1BHAA 3IGAC 4TV8B 3CXHF 4B7KA 3BA9A 2B1IA 3SJBC 4QNHB 4YHHB 2Q9LA 1Y66A 4PJ0Z 3MD0A 3FB8C 2P67A 4G27B 4FLWA 2A3QA 4NXMB 2ZT9B 2P7TC 2W0XA 1HNXO 5IT9N 1RM1B 3P32A 1FXHA 4GUNA 1I94O 4UCVA 3SYCA 3JALA 4DUZO 1K34A 3A2FA 1QLEC 1GM8A 1WA8B 1MZFA 2GDSA 5L3EA 3THOA 3CP1A 1HP8A 3UO2A 2CUGA 1IBMO 5JJEB 3ABMC 1KBHA 2AZ0A 2ADPA 2IM9A 3E35A 2XTAA 4JI0O 5LL6Y 1RPRA 5LOVA 3CCLV 5JCOC 4QE7A 3ZHVA 2UUBB 3T1CA 3TGUH 4X1YA 5J2UA 2EIJB 2QJ1A 3CCSV 1GM9A 4BR6A 2VQEB 5IYBO 4BWAA 3OR6C 1I5XA 3J7AU 4JI5O 4UXNA 1UJWB 2Y4UA 3K57A 1PNKA 3A8TA 2UXDB 4GKJO 5H9CA 4FZ0A 1HR0O 1VQMV 5C8YA 3FB5C 3ZRWB 2ZNIA 3ABLC 2HJFC 3TXQA 1HNWO 1NR7A 5EYPB 3STZC 2YXLA 3N2KB 4X65O 1GM7A 1XMOB 3FB7C 3ZCCA 4YJ2A 2DW4A 1YJWV 4PI2A 1W0JG 1AP6A 5LGUA 1J95A 1IXBA 1Q8IA 1IBLB 4DR7B 1KYOF 1F7YA 2WWWA 2DQ0A 2LGQA 4JI3O 1VQ4V 2EJ7A 2Q8VA 3FAVB 4DR6B 2IW5A 4JYAO 3UT5B 4JI2O 5IWAO 2AXTZ 4FM1A 4PA7A 3UQ8A 2QDOA 1ZLZA 1GN3A 1YF2A 4TV8A 2WA3A 2KQXA 1V55C 4K35A 2DYRC 4Z1VA 3LSQA 4PA3A 1NTZH 3C90A 3W7XA 4AQYO 3EHBB 4I0XB 1N33O 2RN9A 1M9NA 4TWKA 5JJJB 1OHHG 5H5NA 2IBZH 2OIEA 5KHGA 3ML0A 1HWYA 2UU9B 4LF4O 1EBOA 3ZHUA 1QQCA 2D3OW 3QG5A 4X8AA 4J7KA 2QTSA 5LP6A 3JCUZ 1W59A 1W2BU 3TETA 3ABTA 2ADQB 2QKSA 1Z5WA 3K06A 1YTFB 4GX1A 1GN2A 1SC5B 2EIMB 3SPIA 1ZWIC 5LYJB 2K9PA 2QA4V 5KUMA 2WLNA 1Q43A 4F6EA 4DV1B 1Z5VA 2WAMA 3BY6A 2ZKOA 1Q81W 3L72H 3H9VA 1FXKC 4D7SA 4DR5O 2ZXWC 4TUYB 3K5LA 2V4DA 2F4VB 2ZINA 1G4YB 1M56B 2FKXA 5JWPA 3GWKC 1U96A 1XNQO 2A9HA 5EYPA 3HKCA 4RQEA 3N2KA 4DK0A 2VS0A 3ZHRA 3VBBA 5IYZA 3JASA 2E75B 1H8HG 1MSDA 3HKEB 4ZIBA 4LF9O 3OTOO 3GVMA 4MT8A 4NTWA 1AP5A 4UCRA 3FAVA 3UCSC 3UO3A 2Q7EA 4CH6A 2P6JA 1AJQA 2HEPA 3A0RA 2ZR2A 1K8AW 1HNXB 3ABKB 4LH6A 4JTDB 1VIBA 2F43G 2WLLB 5BZBA 3STLC 5IY5C 1R3LC 4GLXA 4DUZB 4I0XA 2BTQA 1F4NA 2AHZA 1SQVH 2JVDA 3CCEV 2N05A 3BHPA 1JR9A 3JCZA 4ASUG 4JI6O 4O4JB 3CRRA 3JD4A 1IBMB 3OTFA 5IJ0B 4I55B 1YEWA 3LDDA 3RYHB 4JI0B 2FB5A 2M7WA 2NNUA 5EBMC 5GONA 2LO1A 4DYLA 1GK9A 3WU2Z 3SPJA 3BPZA 2KKWA 2RCVA 2E76B 1F51A 1XMQO 5GW7A 2CTQA 1B06A 5BR8B 2Q69A 1QVFU 1Y76A 3W7UA 1P84F 4XDKA 4N21A 3AEIA 3AG4C 4FLTA 3OR7C 3DXRB 4FLYA 4LWSB 3OUSA 1JQ0A 5CA1A 4L87A 1PP9H 4MVSA 1XDCA 2CE4A 2LP7A 4P2ZA 4H33A 4GKJB 4MTGA 5LA6B 2HHHO 2X6CA 1MA1A 2YXYA 4AILC 3X2QB 5FNVA 1NTKH 4RWUA 1NT2B 1IURA 1FD9A 3U0ZA 5CB4B 5KHJA 1HNWB 3B8NA 2AZ2A 3OMAB 4X65B 4TUYA 4TQDA 3H1IH 4O2AB 1NVPD 1VF6A 4L8JA 4X1IA 2R9AA 4X20A 1FFXB 3F7YC
chains in the Genus database with same CATH topology
3QO5A 4BW5A 1G8MA 3JD3A 4I9WA 2X6BA 4MW3A 3K03A 2BOCC 4WCEV 3CPWU 1S76D 2ITDC 4PDMA 1MG1A 4XDLA 1JX9A 1M1KW 2CK3G 3K3WA 4MTOA 5B1NA 2IU0A 1VQOV 4FMTA 2JIZG 2WPDG 4QPJA 1M90W 2XAFA 3CCUV 1Q7YW 1VQ7V 4DXWA 3I55V 1QR8A 1R6NA 2WLIA 3D3IA 1S3JA 3SPHA 3JD1A 1EZJA 3FKSG 1DTOA 4KFMA 3ZMUA 4QE9A 2XAHA 5LHIA 3SPCA 4JAUA 1AI5A 2H8PC 3G71V 1K7DA 1E1RG 1V54C 4JF3A 4OXSA 3SJQC 1NBMG 1VQ5V 2WLLA 4WFAV 1COWG 3RBZA 3M99B 1THZA 1NH2D 1BL8A 1XL4A 1FXKA 2XAGA 5H6QA 1BHBA 3SYQA 1MSWD 3RVZA 5B1BC 1Y4MA 5L3GA 4G28B 4GX2A 3RW0A 1GKFA 2AHYA 1S5HC 1OCRB 4R8CA 1SRYA 3CC2V 3E2EA 2HLDG 3ZN1A 3IC7A 3AG2C 4MTFA 1WPXA 1YTFD 2GHYA 1FXKB 5EBLC 4EKWA 3ZMZA 1R73A 5CN0A 3K9AA 1P7BA 3CCMV 2ZXWB 3AG3C 3VOUA 4RUFA 1JCHA 3ETGA 3GWOA 1H2GA 2DWEC 4PA9A 2XNDG 1K5SA 4Q20A 2QE7G 2XASA 4MVQA 4PDRA 4R7CA 2EINB 4BIZA 1P4RA 1VQPV 3LUTB 5L3DA 4WF9V 3WG7C 3NXSA 5KA6A 3MHSC 1KKDA 4R50A 4J9YB 2H94A 4E2LA 1TUEB 4YXWG 2EIMC 4GX5A 1AR1B 4MS2A 3F7VC 2HVJC 1VQNV 5CMUA 4WFHA 3ZRSA 2MK3A 2HKOA 1NJIW 3E8GA 4RQFA 2WSSG 1N8RW 4FJCC 5B3SB 3TCUA 4RAIA 2EIKB 1AJNA 1R6KA 1AI4A 1V54B 3OFNG 2EIJC 5FL7G 3EFFK 3E8BA 1K97A 3IGAC 5E1AC 1BHAA 1KQSU 3CYOA 2B1IA 2EILB 4QNHB 2IJIA 1H38A 1PD3A 1BMFG 1FXVA 2B1GA 3OAAG 4FK5C 1IXMA 1Y66A 4ZKIA 3MD0A 1DF5A 2DYSC 4U7OA 2Z5UA 3FB8C 4UVCA 2P67A 3AG2B 4G27B 5IY5B 1K9MW 2IJJA 2P7TC 3KG2A 5CBGA 3E83A 4BIUA 1SETA 3CCQV 1RM1B 1OCCB 3AG3B 3P32A 1FXHA 4LBEC 3SYCA 1K34A 2Y48A 3F5WC 3ZRXA 1S72V 1W0KG 5L3BA 1QLEC 1GM8A 3QNEA 2IU3A 3W7WA 2IJKA 3WG7B 1CEZA 5L3EA 3CP1A 3W7SA 3I56V 4JASA 1NR1A 3ETDA 4CBCA 3CXCU 1OCZB 4P9PA 4N23A 1KD1W 4WFBV 3OGCC 1EFRG 2PI5A 2X7RB 3ABMC 3K0GA 2R9RB 3E35A 4G2KA 1RPRA 3ABKC 3E8HA 5B1AC 4Z1MG 3ZMTA 3K08A 3CCLV 3IFXA 4QE7A 2HFEC 4MTXA 3T4DA 3AG4B 2A0LA 3T1CA 3K79A 3P30A 2EIJB 1M57C 4P30A 3CCSV 1GM9A 4UVBA 1KP3A 1JOYA 3H01A 5IYBO 4PA6A 5LHHA 1YJNV 1R3KC 3OR6C 1I5XA 2QTOA 2W6IG 5H6RA 3ZRWA 2IH3C 2WLJA 2Q67A 4UXNA 1UJWB 3LDEA 4J9ZB 3CCJV 1PNKA 4RUEA 4LCUC 5H9CA 3D36A 2LFRA 3QO8A 3B77A 4FPPA 1VQMV 1NKDA 3DTUB 2XAQA 3FB5C 5EC1C 1I5YA 4ZBMA 5CBFA 3ZRWB 4CZZA 1DLBA 1S0VA 3ABLC 2HJFC 1F4MA 3ASOB 1NR7A 1R3JC 1XL6A 4I5SA 3STZC 1JVMA 1OCOC 3LNMB 3SPGA 1GM7A 1MABG 1MOFA 3FB7C 1R3IC 3ZCCA 2DW4A 1YJWV 4PDLA 1VQKV 1W0JG 3ETEA 3T4ZA 5LGUA 1J95A 3OUFA 2YEVB 3ABMB 2JJ1G 2OTJV 1KC8W 3MHHC 2WWWA 3OMIB 2DQ0A 3LSSA 1NVPB 5HFMA 1VQ4V 5B1AB 4DO2A 3X2QC 5LGNA 4PDVA 3K04A 2IH1C 2JJ2G 2IW5A 2EJRA 2ATKC 2C2AA 2PI4A 2Y69C 4JTCB 1K3EA 3ASNC 4PA7A 2X0LA 2UXNA 1LNQA 3ZIAG 4X88A 2YSUB 3E89A 1V55C 1YHQV 4UVAA 2QM8A 1VQ8V 2DYRC 2B5UA 3LSQA 4PA3A 3W7XA 1VQLV 1QR9A 4MSWC 3EHBB 3JD2A 1M9NA 4TWKA 5EK0A 5IYDO 4JGSA 3AG1C 1Q82W 2ZQMA 1OHHG 5B1OA 5KUKA 2BOBC 4PA4A 3GB7C 3ML0A 5B1BB 1HWYA 4TT3G 5EBWC 1EBOA 1RPOA 1M56C 1OZ0A 4MVUA 4F4LA 2D3OW 5L3CA 2DWDC 2V1DA 3OE7G 4UUJC 1OCOB 4GX0A 3PJSK 4P9OA 5C93A 2GSMB 3OEHG 4X8AA 1AI6A 1NH2B 2EZPA 4PELA 2IJHA 2P90A 1K4DC 1SERA 2X6AA 3OMNB 5J9PC 1W2BU 3TETA 3ABTA 1L1FA 5EC2C 2HR3A 2OTLV 2EZOA 5LGTA 2OCCC 2QKSA 1ORQC 3K06A 4FIPC 2R9IA 1YTFB 1SESA 1KP2A 4GX1A 2Z3YA 4LP8A 2EIMB 3SPIA 1VQ9V 1ZWIC 2QM7A 1GTOA 1JPXA 1PNLA 2QA4V 2W0FC 5KUMA 3LDCA 1VQ6V 2Q6AA 2WLNA 3ZN0A 4U7NA 5L3FA 1OCRC 1SZTA 4HAMA 2WAMA 3BY6A 4H37A 5HFLA 1Q81W 4HYOA 3B8MA 2JEXA 1FXKC 4MVMA 2UXXA 3BEHA 3E86A 2ZR3A 2XOKG 2JDIG 2ZXWC 5IDJA 1AROP 3AG1B 1WLEA 3RVYA 1CP9A 1ENVA 3ZJZA 2EINC 1YJ9V 1G4YB 3UKMA 2NLJC 1M56B 3SYOA 5KA5A 1PL0A 2DYSB 2A9HA 3CD6V 4RQEA 2ITCC 1GMGA 1F23A 2ZDIA 5LBQA 1B6QA 1QLNA 1ROPA 2JK5C 2V7QG 3G6EV 4UV8A 4HZ3A 4MVOA 3TK1A 3VBBA 2YEVA 5B3SC 1QLEB 4JYBA 1H8HG 4JPRA 2EIKC 2OT5A 4QIWF 1S77D 1DF4A 1PNMA 2OCCB 4MT8A 2WLIB 2HVKC 2WLMA 1QVGU 1AJPA 3QO7A 1YSCA 3HPLC 3SYAA 2EILC 2K1EA 2P6JA 4WFEA 3CMAV 1AJQA 3A0RA 2ZR2A 1K8AW 1FS0G 3ABKB 4JTDB 2W6JG 2F43G 2WLLB 1YIJV 3ZMSA 3OW2U 5BZBA 3STLC 5IY5C 1R3LC 3CCRV 4WFGA 1F4NA 2HG5C 1RM1C 2AHZA 3ZRVA 1OCCC 1M57B 2DQ3A 3W7TA 3CCEV 4QPKA 1GO3F 5DN6G 3JCZA 4ASUG 1YITV 3E8FA 3JYCA 3JD0A 3FB6C 1AI7A 3JD4A 1E79G 4LC1A 3ABUA 5CBHA 1FFTB 3LDDA 2M7WA 2NNUA 5EBMC 1OCZC 3G4SV 1GK9A 3SPJA 3FYIB 1F51A 2WLHA 5GW7A 4X89A 2Q69A 3ABLB 1QVFU 2QEXV 3CC7V 3W7UA 1NQTA 5LHGA 4XDKA 1QBZA 4N21A 3ZMVA 3AEIA 1PKXA 2A79B 3AG4C 4TSFG 3OR7C 3CCVV 1KECA 1CPYA 5IYCO 1E1QG 1JQ0A 3OUSA 2KB1A 4XDJA 2JEUA 2EBOA 4L87A 1K4CC 3OEEG 1K73W 4XBFA 4MVSA 4QJFB 3SYPA 2LP7A 3HB3B 4R6ZA 2LFSA 4JTAB 4KP4A 4P2ZA 4H33A 4MTGA 4MVZA 2ZD9A 3OM3B 2X6CA 3R65A 4WFFA 3CC4V 3X2QB 3WFVA 4RO2A 3CMEV 4GT1A 3FYEB 1K92A 2WLKA 4JAVA 2Y69B 3B8NA 3ASNB 4GCZA 4MW8A 1JJ2U 2FTKA 3OMAB 3T2MA 5CA3A 1K33A 1Q86W 5DM6V 1H8EG 1V55B 4JYCA 1NVPD 1QCEA 3ASOC 4BAYA 2DYRB 3UM7A 1K5QA 4UV9A 4KUMA 2ZDIC 2Q68A 3K0DA 2XAJA 1YI2V 3DGEA 3F7YC 4MVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQM A;  1FXK C;  1FXK A;  1FXK B;  2ZDI C;  3AEI A;  2ZDI A; 
#chains in the Genus database with same CATH topology
 3DC5 A;  3QO5 A;  1Z2G A;  2B9Z A;  2Q7H A;  1Y67 A;  3RYC A;  2KSD A;  4JZ2 A;  5H2F Z;  2R72 A;  4I9W A;  2X6B A;  3O9O A;  1FYJ A;  2ITD C;  4X62 B;  4JYA B;  1BS3 A;  1ZL8 B;  2YID A;  4JI2 B;  5IWA B;  3K3W A;  5B1N A;  2IU0 A;  4FMT A;  3CHX A;  4BIO A;  4YHH O;  2XAF A;  4FLV A;  1Q7Y W;  3P3N A;  4DXW A;  1VQ7 V;  4TQF A;  2ZE8 A;  1N33 B;  1S3J A;  2GV9 A;  4DK1 A;  3ZMU A;  4LF8 O;  2H8P C;  3CRQ A;  1AR5 A;  3SJQ C;  2BSK B;  1NBM G;  2CAZ C;  2WLL A;  3RBZ A;  5H6Q A;  1MSW D;  2A06 H;  1Y4M A;  5L3G A;  1U97 A;  1OCR B;  4R8C A;  1SRY A;  3CJH B;  3E2E A;  4JV5 O;  4O4J A;  3AG2 C;  3NR7 A;  4FVM A;  2DJV A;  4MTF A;  2GHY A;  2QKC A;  4I55 A;  3KKY A;  3K9A A;  1P7B A;  3AK1 A;  3RYH A;  1EZV H;  1RSO B;  3G67 A;  1JCH A;  1VAR A;  4R7C A;  1VQP V;  4MVQ A;  3SR2 C;  2EIN B;  1XEQ A;  2VQE O;  1KKD A;  1XRE A;  3L74 H;  4R50 A;  4J9Y B;  5CA0 A;  1TUE B;  4I7Z B;  3HKB A;  2CH7 B;  4MS2 A;  3F7V C;  4OX9 B;  2AW9 A;  2HVJ C;  2UXD O;  5CMU A;  4WFH A;  4DR5 B;  3CWB H;  2HKO A;  3CEI A;  2UXC O;  1DGS A;  2P5O A;  2NN4 A;  1R6K A;  2QWR B;  3E8B A;  3Q4H B;  2F95 B;  1XMO O;  1XNQ B;  2AGA A;  1FXV A;  3OAA G;  4ZKI A;  2XT9 A;  4O2A A;  1DF5 A;  4U7O A;  4UVC A;  1P49 A;  4FZ1 A;  1H2S B;  1SQF A;  1FFX A;  5CBG A;  3E83 A;  4KXR A;  1SET A;  3CS5 A;  3AG3 B;  4H13 B;  2YC0 A;  3OTO B;  1SQX H;  1P7G A;  1W0K G;  4U3F H;  1I0H A;  2IU3 A;  2IJK A;  3WG7 B;  5EIB D;  4QGP A;  1N0N A;  3CE2 A;  1NR1 A;  3ETD A;  4I50 A;  4CBC A;  1OCZ B;  2LJ2 A;  2LGW A;  2MW2 B;  4LNU A;  3JAL B;  4KHP O;  3OGC C;  1EFR G;  2PI5 A;  2X7R B;  3K0G A;  3FFQ A;  1JA8 A;  5GTH Z;  3E8H A;  4Z1M G;  3OGI B;  3IFX A;  5FPO A;  2HFE C;  4MTX A;  3T4D A;  4JI6 B;  4P30 A;  2BSK A;  4U3J A;  1V9P A;  1NS1 A;  5LOV B;  2F23 A;  2QTO A;  1HNZ B;  4X1Y B;  5J2U B;  1XMQ B;  1EN5 A;  3CCJ V;  1O9G A;  3K58 A;  3D36 A;  2E3C A;  3DSQ A;  2P06 A;  3FX7 A;  1EN4 A;  4CZZ A;  1DLB A;  1S0V A;  2NR5 A;  1Q5O A;  2YUA A;  3MDS A;  4OPA A;  1OCO C;  3SPG A;  5C8Y B;  4PDL A;  3J81 N;  1VQK V;  4I9Q A;  1BGY H;  3H1H H;  2CH7 A;  2JJ1 G;  3ABM B;  4DR3 B;  1IBK O;  1HW7 A;  3MHH C;  3OMI B;  5HFM A;  4PDV A;  3K04 A;  5IJ9 A;  2F4V O;  4YJ2 B;  4F6R A;  2JJ2 G;  2PI4 A;  2Y69 C;  3JAR B;  3ASN C;  1M4U A;  3E22 B;  2CTP A;  2UXN A;  1ZSP A;  1XHZ A;  1VQ8 V;  4JI4 O;  2GUZ A;  1XQ8 A;  5B1B B;  4LF7 B;  4J7J A;  4MVU A;  4F4L A;  4JYY A;  4EFB A;  3WB2 A;  4UUJ C;  3VQY A;  3PJS K;  5C93 A;  4FLU A;  1AI6 A;  4LF8 B;  3RGB A;  1NH2 B;  4LF5 O;  3FD9 A;  2IJH A;  5J9P C;  2ZE5 A;  2HR3 A;  2OTL V;  2EZO A;  2ETN A;  2OCC C;  3CRC A;  4NTX A;  1BE3 H;  5LP6 B;  1GTO A;  4JV5 B;  3SJC C;  1JPX A;  2YIC A;  4U7N A;  1SQB H;  4HAM A;  1LUW A;  4HYO A;  4X9Q A;  4DV3 O;  2OIG A;  2JEX A;  4IGG A;  5BMV B;  2UXX A;  3BEH A;  5BR8 O;  2ZR3 A;  4CH3 A;  2JDI G;  2YIB A;  3B4S A;  1ARO P;  2G38 A;  3I5D A;  1WP7 A;  2QR4 A;  3ZJZ A;  4DUY O;  1O9H A;  4D7T A;  3KCX A;  3UKM A;  3ETQ A;  2DYS B;  1KKC A;  1GMG A;  2UXC B;  2ZDI A;  4ZOL A;  1B04 A;  4UCO A;  2OYQ A;  4YIO A;  5J2T A;  3G6E V;  4O4I B;  4MVO A;  4JYB A;  2RMK B;  3HKC B;  4JPR A;  2EIK C;  2OT5 A;  4HBN A;  1S77 D;  3BA8 A;  4IYI A;  2HVK C;  4DR4 B;  1PL4 A;  1AJP A;  4H0L B;  2RJZ A;  4PI0 A;  1YSC A;  3L9D A;  5IYZ B;  3JAS B;  1Q6H A;  3JAR A;  3E22 A;  2K1E A;  2JGD A;  3CMA V;  1FS0 G;  2W6J G;  4X62 O;  3O65 A;  2HG5 C;  4B7E A;  4FLZ A;  1RM1 C;  1M57 B;  2DQ3 A;  3W7T A;  3LNN A;  1GO3 F;  4FM2 A;  1YIT V;  3JYC A;  1WB8 A;  3JD0 A;  3FB6 C;  1AI7 A;  4KHP B;  1E79 G;  4LC1 A;  2BTQ B;  1WP8 A;  3L71 H;  3ABU A;  1FFT B;  1GN4 A;  4EEQ A;  2N74 A;  3G4S V;  1BQZ A;  1SQQ H;  1N34 O;  4LFA B;  4IIJ A;  4O4L B;  3CC7 V;  2QSA A;  5GON B;  1PKX A;  4TSF G;  3CCV V;  2Q73 A;  2Z0A A;  1CPY A;  3IC9 A;  4NVP A;  2KB1 A;  3J80 N;  1AVM A;  2DN9 A;  1Y76 B;  2BE3 A;  3C3T A;  4MVZ A;  2ZD9 A;  3R65 A;  5CA1 B;  1J5E O;  3CME V;  3FYE B;  1T5E A;  1K92 A;  5BMV A;  4B3S O;  4JAA A;  1Q86 W;  1QU7 A;  5ITZ B;  1N36 B;  5FNV B;  3UM7 A;  4YY3 B;  4OX9 O;  1N4C A;  2XAJ A;  3AG7 A;  3DGE A;  2EUL A;  1S76 D;  1IBK B;  3LSU A;  4CH5 A;  4NXN B;  1NZ6 A;  3EVK A;  4MW3 A;  1KB9 F;  4X1I B;  4PDM A;  4X20 B;  4XDL A;  1IZ3 A;  5JH7 B;  1M1K W;  1I7F A;  5K1X A;  4UCS A;  4O4I A;  1L8D A;  1VQO V;  4NB5 A;  3RYC B;  2JIZ G;  2WPD G;  3CCU V;  5DEC A;  1XBL A;  3I55 V;  3TJT A;  1QR8 A;  2EX3 A;  3D3I A;  3VQW A;  4JI4 B;  3U11 A;  3FKS G;  2HP8 A;  4KFM A;  2VRZ A;  3SGI A;  2M6Y A;  3IAY A;  1XHX A;  1V54 C;  4OXS A;  4DV2 B;  4WFA V;  1COW G;  3K5O A;  1FXK A;  2XAG A;  2VWK A;  1BHB A;  4PD4 F;  4GX2 A;  2GBO A;  3CC2 V;  1R6T A;  4NTY A;  4LF5 B;  3N27 A;  4UCU A;  5TIS Z;  1YTF D;  5EBL C;  1WPB A;  3CCM V;  3VOU A;  3DC6 A;  1H2G A;  4PA9 A;  2A7W A;  4IYH A;  3WB1 A;  1SQP H;  4B08 A;  1JFF A;  4I4T B;  4Q20 A;  2QE7 G;  2P4K A;  1MNG A;  4BIZ A;  3LUT B;  4O4L A;  5KA6 A;  1TVK A;  5LXT A;  1YZB A;  2EIM C;  1HNZ O;  4GKK O;  4DV3 B;  1IDS A;  3ZED A;  3ZRS A;  2MK3 A;  1AR4 A;  1M5I A;  2Q0O C;  1GAX A;  1ZTE A;  4RQF A;  2WSS G;  5CA0 B;  2UUC O;  5B3S B;  1SKV A;  3HKB B;  3TCU A;  3G80 A;  1AJN A;  2HJD A;  2VQF B;  4DUY B;  3OFN G;  5FL7 G;  4CC6 A;  1WJZ A;  3EFF K;  1K97 A;  5E1A C;  5KHH A;  3CYO A;  4J11 A;  2ZCE A;  2EIL B;  1H38 A;  4H44 B;  2B1G A;  5ITZ A;  3CB2 A;  1IXM A;  2Z5U A;  3AG2 B;  4DR3 O;  3HR0 A;  2IJJ A;  4CS2 A;  1CXZ B;  2ZE6 A;  4BIU A;  3CCQ V;  1OCC B;  4B3M O;  3CRA A;  3L75 H;  1FPO A;  4LBE C;  2Y48 A;  3ZRX A;  3F5W C;  1FJG O;  2ZNJ A;  1CEZ A;  5JH7 A;  4JAS A;  5BY1 A;  1VP7 A;  2N04 A;  4P9P A;  4N23 A;  4WFB V;  4UFZ A;  2R9R B;  3ABK C;  5B1A C;  3ZMT A;  3K08 A;  4I50 B;  4LNU B;  1VMG A;  4FFK A;  4LF7 O;  2A0L A;  1EN6 A;  3K79 A;  5KLV H;  2JS5 A;  1KP3 A;  4CH4 A;  1YJN V;  1R3K C;  2Q5Z A;  2W6I G;  5H6R A;  3BRC A;  2IH3 C;  2WLJ A;  1N34 B;  4W4L A;  4U3J B;  4RUE A;  4LCU C;  4UB6 Z;  3QO8 A;  3B77 A;  1NKD A;  2XAQ A;  3G6B A;  4ZBM A;  2QWO B;  1F4M A;  2DE0 X;  3ASO B;  4I4T A;  1R3J C;  5FLX N;  1JVM A;  3LNM B;  2UUA O;  3ETE A;  3T4Z A;  1J5E B;  3OT7 A;  4O2B A;  2F66 C;  3RYI B;  3LSS A;  4B3S B;  4DO2 A;  3X2Q C;  4NYK A;  2CGO A;  4DV0 O;  2EJR A;  1GRJ A;  3JSL A;  1K3E A;  1TUB B;  1WAZ A;  4Z2W A;  4DV6 B;  2X0L A;  1BT8 A;  5IJ9 B;  4UVA A;  4B3T O;  4F6R B;  1H2M A;  2B5U A;  1Y6X A;  1VQL V;  4LR3 A;  4MSW C;  2BCC H;  3CSX A;  3CX5 F;  4NR1 A;  1Q6U A;  5IYD O;  4E4E A;  3AG1 C;  1KU9 A;  5B1O A;  5KUK A;  2VWJ A;  2BOB C;  5DED A;  4PA4 A;  3GB7 C;  3S3X A;  1UPG A;  4AHC A;  4TT3 G;  4DR4 O;  1US6 A;  5A9G A;  3EXA A;  5L3C A;  2DWD C;  2GUZ B;  2V1D A;  3APO A;  1OCO B;  2YIA A;  3ZX6 A;  4P9O A;  2BTO A;  4NKG B;  3BFR A;  3HKD B;  4X66 B;  4LFC O;  3C3S A;  2X6A A;  2PUS A;  3VQV A;  1L1F A;  4EB6 A;  1QNM A;  4J80 A;  1ORQ C;  3ZS8 C;  2Z3Y A;  1LR1 A;  1SZX A;  4LP8 A;  2L6L A;  5EZY A;  3AK3 A;  2QM7 A;  4ZHQ B;  3LDC A;  1DK1 A;  1X4T A;  1VQ6 V;  2Q6A A;  3ZN0 A;  1OCR C;  3TXS A;  4DV7 O;  5EIB C;  1MZE A;  2DMX A;  3B8M A;  4LFA O;  4MVM A;  3E86 A;  3JSN A;  4CS4 A;  3QVN A;  5IDJ A;  1YCI A;  2YXH A;  3P3P A;  1WLE A;  4PHZ A;  2EIN C;  2LW1 A;  2F1M A;  4GKK B;  4ZI7 A;  3SYO A;  2O57 A;  1WN7 A;  5KHI A;  3CD6 V;  2OCH A;  1RP3 B;  2UUC B;  1B6Q A;  1QLN A;  2JK5 C;  2YI9 A;  4HZ3 A;  3TK1 A;  2H3O A;  1QLE B;  1TGO A;  4GYC B;  3RYI A;  4QIW F;  4ZOL B;  1N36 O;  2OCC B;  2RNB A;  3APQ A;  4TV9 B;  5D5P A;  2WLM A;  1QVG U;  3ZHQ A;  5J2T B;  3QO7 A;  4YJ3 B;  4IHJ A;  4YY3 O;  3HPL C;  1TUB A;  3L73 H;  1D2D A;  4NXN O;  4B3M B;  3N2G B;  2XUM A;  4WFG A;  2L35 A;  1FJG B;  2JGD B;  1WNS A;  1VF5 B;  3K5M A;  2D2C B;  1IX9 A;  2UXB O;  2P4V A;  4J7Z A;  5CBH A;  1N32 O;  3SJA C;  4J41 A;  4LFB O;  1OCZ C;  2QWP B;  3HKD A;  3FYI B;  4DV2 O;  4X89 A;  3ABL B;  2QEX V;  5LHG A;  1XNR O;  4IT5 A;  2YIB D;  1KEC A;  5IYC O;  1E1Q G;  4XDJ A;  4IIJ B;  1K4C C;  2FML A;  1XOU A;  3AK2 A;  2XHB A;  4EFE A;  5KAF Z;  3T1Y O;  4JTA B;  4KP4 A;  4JI7 B;  5JVD A;  5LMN O;  4ZHQ A;  2JRI A;  3PN1 A;  4RO2 A;  4GT1 A;  4JAV A;  4MW8 A;  2FTK A;  1K33 A;  1R1B A;  5DM6 V;  1Q3E A;  1NI8 A;  1H8E G;  1V55 B;  4X64 O;  2E5L B;  4BAY A;  2DYR B;  2UUA B;  4B3R O;  1K5Q A;  4KUM A;  2ZDI C;  2Q68 A;  3K0D A;  2KG7 A;  4HNA B;  3K9S A;  1G8M A;  4OGQ B;  2Y0P A;  2DOS A;  2VQF O;  4DV0 B;  2BOC C;  4WCE V;  4WBN B;  3CPW U;  1MG1 A;  3CRM A;  4X1K A;  4CS3 A;  1PPJ H;  4MTO A;  3K59 A;  1QHT A;  1KUQ A;  4QPJ A;  4K8X A;  4ABM A;  4B3T B;  4TV9 A;  4JZG A;  1HDJ A;  2PYJ A;  4YJ3 A;  3SPH A;  3JD1 A;  5JQG A;  1G6U A;  1XUQ A;  3SPC A;  4JAU A;  3G71 V;  1E1R G;  4JF3 A;  4UB8 Z;  1VQ5 V;  5JCO A;  3N2G A;  3M99 B;  1NH2 D;  1XL4 A;  3RVZ A;  5B1B C;  3RW0 A;  3M8A A;  2HLD G;  3R66 A;  4LFC B;  3ZN1 A;  3IC7 A;  1FXK B;  4EKW A;  3ZMZ A;  1R73 A;  5CN0 A;  4DR1 O;  2ZXW B;  3ETG A;  3GWO A;  2DWE C;  2XND G;  4PDR A;  4A5U B;  1P4R A;  1L0L H;  1A32 A;  2QM4 A;  1OJH A;  3MHS C;  1ZUQ A;  4E2L A;  4YXW G;  3T1H O;  5LP6 C;  1JFF B;  4DV7 B;  1AR1 B;  4DV5 B;  4DRX A;  1BCC H;  1TVK B;  5LXT B;  2CDY A;  1NJI W;  2PF4 E;  1N8R W;  3WB0 A;  4CC5 A;  4AI8 A;  1TAE A;  3VQX A;  2R70 A;  1V54 B;  1PV0 A;  2EIJ C;  2PYL A;  4JI1 B;  1KQS U;  2IJI A;  1PD3 A;  4OPH A;  4DR2 O;  1BMF G;  3BAB A;  4FK5 C;  2DYS C;  1K9M W;  5IY5 B;  2ZM6 B;  1WA8 A;  3KG2 A;  5KHK A;  1RFY A;  4C7U A;  4HNA A;  1IVS A;  2YDE A;  4TOI A;  1S72 V;  5L3B A;  4WBN A;  3W7W A;  3QNE A;  2QWQ B;  4K0K O;  4DV6 O;  3W7S A;  3I56 V;  1NU1 H;  3CXC U;  1KD1 W;  1MMM A;  3K5N A;  4PV1 B;  5D5Q A;  4G2K A;  3SDL A;  3F5T A;  3AG4 B;  2UXB B;  2OWO A;  1SQG A;  3P30 A;  2GTA A;  1M57 C;  4UVB A;  3A0B Z;  1JOY A;  3H01 A;  1N32 B;  4PA6 A;  4LFB B;  5LHH A;  1KMI Z;  3D8C A;  5KX5 B;  4X66 O;  3ZRW A;  4K3A A;  3ZBH A;  2ZIM A;  2Q67 A;  3OD4 A;  3LDE A;  4J9Z B;  1Y74 B;  3JAW B;  2LFR A;  2Q0A A;  2Y0I A;  2QWN B;  4FPP A;  3DTU B;  1XNR B;  5EC1 C;  1I5Y A;  1Q6I A;  5A2Q N;  5CBF A;  3B40 A;  2LW7 A;  2RQ6 A;  4I5S A;  1XL6 A;  3T1Y B;  1MOF A;  1MAB G;  1JMK C;  5LMN B;  1R3I C;  4D6T H;  2QGN A;  2ARH A;  3OUF A;  3UT5 A;  1JJO A;  3RT3 C;  2YEV B;  2OTJ V;  5FPR A;  1PM9 A;  1KC8 W;  3JAM N;  1NVP B;  2Q4P A;  1D5N A;  5B1A B;  5LGN A;  2IH1 C;  2ATK C;  1H2L A;  2C2A A;  4YIP A;  2QKA A;  1ZX3 A;  1I94 B;  4X64 B;  4JTC B;  4O2B B;  5K1P A;  4B3R B;  4K8Z A;  3IJ4 A;  2LQT A;  2F93 B;  1LNQ A;  3ZIA G;  4X88 A;  2YSU B;  3E89 A;  1YHQ V;  4FFB B;  2QM8 A;  2PY5 A;  3B2E E;  2YS8 A;  1QR9 A;  3JD2 A;  5EK0 A;  2PZS A;  3BAA A;  4JGS A;  2Y4T A;  1Q82 W;  2ZQM A;  1VF6 C;  4JI8 O;  5LMU O;  5EBW C;  1RPO A;  1M56 C;  1OZ0 A;  2GTS A;  1G1X B;  5GTI Z;  4FLX A;  4DV4 O;  3OE7 G;  2JGU A;  4GX0 A;  5IE9 A;  4LF6 O;  2GSM B;  3OEH G;  2WA4 A;  4JI5 B;  1TA8 A;  2EZP A;  3JAT B;  4PEL A;  3U10 A;  2P90 A;  1K4D C;  5AG2 A;  1Q90 D;  1SER A;  5LYJ A;  3S3W A;  3OMN B;  1HR0 B;  3ZHT A;  5EC2 C;  4BW9 A;  5LGT A;  4FIP C;  2R9I A;  1SES A;  1KP2 A;  1VQ9 V;  1N0J A;  1PNL A;  1WB7 A;  2W0F C;  1YXB A;  1BSM A;  4EB6 B;  2FYU H;  5L3F A;  1SZT A;  1EM1 A;  2CTR A;  4DR1 B;  4H37 A;  5HFL A;  1UFI A;  5KX5 A;  5EZY B;  2CTW A;  5KMG B;  5JJN B;  1OV9 A;  2XOK G;  3AG1 B;  4JI3 B;  3RVY A;  1Y74 A;  3JAW A;  1CP9 A;  1ENV A;  4J42 A;  1GH6 A;  1YJ9 V;  3T1H B;  2ZE7 A;  2NLJ C;  4DW0 A;  2CGN A;  5KA5 A;  1PL0 A;  1L0N H;  1VEW A;  4JI7 O;  1SF9 A;  3HKE A;  2ITC C;  1F23 A;  5LBQ A;  4KL1 A;  4AQY B;  3L70 H;  1ROP A;  2V7Q G;  1H2N A;  4UV8 A;  4NXM O;  4ZI7 B;  3QTC A;  2YEV A;  5B3S C;  3ICX A;  1DF4 A;  1PNM A;  3M7M X;  4DR2 B;  4LF4 B;  2WLI B;  2E5L O;  1LUV A;  2ZIO A;  3SYA A;  2EIL C;  4WFE A;  4DW1 A;  4O4H B;  4FFB A;  1YIJ V;  3ZMS A;  3OW2 U;  3CCR V;  2Q7G A;  1NTM H;  2RDC A;  4IHJ B;  5IJ0 A;  2FL4 A;  3KCY A;  3ZRV A;  1OCC C;  1XIL A;  4K0K B;  4QPK A;  5DN6 G;  2UUB O;  1BZK A;  3E8F A;  5B5E Z;  3RWR D;  3RYF B;  1M93 A;  3DXR A;  1S5L Z;  4LWS A;  2WLH A;  2PGG A;  1XI1 A;  1I08 A;  3JAT A;  3RFR A;  1NQT A;  4Q6G A;  1QBZ A;  3ZMV A;  5KAI Z;  3ZHS A;  5LA6 A;  2A79 B;  1SA0 B;  4IL6 Z;  3JAK B;  1ZAU A;  2JEU A;  2EBO A;  3OEE G;  1K73 W;  4XBF A;  4QJF B;  5CB4 A;  3SYP A;  3B09 A;  3HB3 B;  4R6Z A;  2LFS A;  3OM3 B;  4WFF A;  3CC4 V;  3WFV A;  1IBL O;  4DR7 O;  5KMG A;  2WLK A;  2Y69 B;  1H2K A;  3ASN B;  3H1J H;  4GCZ A;  5JVD B;  1JJ2 U;  4ICG A;  3T2M A;  5CA3 A;  4LF9 B;  4DR6 O;  4LH7 A;  3BVO A;  1FKA O;  4JYC A;  1QCE A;  3ASO C;  3D36 C;  4UV9 A;  4DV5 O;  1YI2 V;  3H1K H;  1ZL8 A;  4MVR A;  1X59 A;  4BW5 A;  3JD3 A;  1S5J A;  3K03 A;  1JX9 A;  3KZI Z;  2CK3 G;  4JI1 O;  2ILM A;  2KG7 B;  1FAF A;  2JS3 A;  5B66 Z;  1M90 W;  2UU9 O;  1AIL A;  4W4K A;  5BXZ A;  1R6N A;  2WLI A;  4X1K B;  1YVW A;  2ZM6 O;  1D5A A;  1EZJ A;  1DTO A;  4QE9 A;  2XAH A;  5LHI A;  1SS3 A;  1AI5 A;  4JI8 B;  5LMU B;  1K7D A;  4O4H A;  3CJH A;  1VF7 A;  1THZ A;  1BL8 A;  4UCT A;  5JQG B;  3RN4 A;  3SYQ A;  4DV4 B;  4G28 B;  2ODM A;  1RSO A;  4LF6 B;  1GKF A;  2AHY A;  1S5H C;  1BQ0 A;  2PTM A;  2YI8 A;  1YDX A;  3BCC H;  1WPX A;  4DV1 O;  2HHH B;  3AG3 C;  3D3Q A;  4RUF A;  5E79 Z;  3RYF A;  1K5S A;  2XAS A;  2P22 C;  3A0H Z;  5L3D A;  4WF9 V;  3WG7 C;  3NXS A;  3QF7 A;  3MAQ A;  2H94 A;  1SA0 A;  4J10 A;  3JAK A;  4GX5 A;  1AB3 A;  5F2V O;  1GN6 A;  1VQN V;  2E74 B;  3Q4H A;  3E8G A;  3H1L H;  4FM0 A;  4FJC C;  4RAI A;  2EIK B;  1B3Q A;  1AI4 A;  1URF A;  4GZR B;  4DRX B;  1BHA A;  3IGA C;  4TV8 B;  3CXH F;  4B7K A;  3BA9 A;  2B1I A;  3SJB C;  4QNH B;  4YHH B;  2Q9L A;  1Y66 A;  4PJ0 Z;  3MD0 A;  3FB8 C;  2P67 A;  4G27 B;  4FLW A;  2A3Q A;  4NXM B;  2ZT9 B;  2P7T C;  2W0X A;  1HNX O;  5IT9 N;  1RM1 B;  3P32 A;  1FXH A;  4GUN A;  1I94 O;  4UCV A;  3SYC A;  3JAL A;  4DUZ O;  1K34 A;  3A2F A;  1QLE C;  1GM8 A;  1WA8 B;  1MZF A;  2GDS A;  5L3E A;  3THO A;  3CP1 A;  1HP8 A;  3UO2 A;  2CUG A;  1IBM O;  5JJE B;  3ABM C;  1KBH A;  2AZ0 A;  2ADP A;  2IM9 A;  3E35 A;  2XTA A;  4JI0 O;  5LL6 Y;  1RPR A;  5LOV A;  3CCL V;  5JCO C;  4QE7 A;  3ZHV A;  2UUB B;  3T1C A;  3TGU H;  4X1Y A;  5J2U A;  2EIJ B;  2QJ1 A;  3CCS V;  1GM9 A;  4BR6 A;  2VQE B;  5IYB O;  4BWA A;  3OR6 C;  1I5X A;  3J7A U;  4JI5 O;  4UXN A;  1UJW B;  2Y4U A;  3K57 A;  1PNK A;  3A8T A;  2UXD B;  4GKJ O;  5H9C A;  4FZ0 A;  1HR0 O;  1VQM V;  5C8Y A;  3FB5 C;  3ZRW B;  2ZNI A;  3ABL C;  2HJF C;  3TXQ A;  1HNW O;  1NR7 A;  5EYP B;  3STZ C;  2YXL A;  3N2K B;  4X65 O;  1GM7 A;  1XMO B;  3FB7 C;  3ZCC A;  4YJ2 A;  2DW4 A;  1YJW V;  4PI2 A;  1W0J G;  1AP6 A;  5LGU A;  1J95 A;  1IXB A;  1Q8I A;  1IBL B;  4DR7 B;  1KYO F;  1F7Y A;  2WWW A;  2DQ0 A;  2LGQ A;  4JI3 O;  1VQ4 V;  2EJ7 A;  2Q8V A;  3FAV B;  4DR6 B;  2IW5 A;  4JYA O;  3UT5 B;  4JI2 O;  5IWA O;  2AXT Z;  4FM1 A;  4PA7 A;  3UQ8 A;  2QDO A;  1ZLZ A;  1GN3 A;  1YF2 A;  4TV8 A;  2WA3 A;  2KQX A;  1V55 C;  4K35 A;  2DYR C;  4Z1V A;  3LSQ A;  4PA3 A;  1NTZ H;  3C90 A;  3W7X A;  4AQY O;  3EHB B;  4I0X B;  1N33 O;  2RN9 A;  1M9N A;  4TWK A;  5JJJ B;  1OHH G;  5H5N A;  2IBZ H;  2OIE A;  5KHG A;  3ML0 A;  1HWY A;  2UU9 B;  4LF4 O;  1EBO A;  3ZHU A;  1QQC A;  2D3O W;  3QG5 A;  4X8A A;  4J7K A;  2QTS A;  5LP6 A;  3JCU Z;  1W59 A;  1W2B U;  3TET A;  3ABT A;  2ADQ B;  2QKS A;  1Z5W A;  3K06 A;  1YTF B;  4GX1 A;  1GN2 A;  1SC5 B;  2EIM B;  3SPI A;  1ZWI C;  5LYJ B;  2K9P A;  2QA4 V;  5KUM A;  2WLN A;  1Q43 A;  4F6E A;  4DV1 B;  1Z5V A;  2WAM A;  3BY6 A;  2ZKO A;  1Q81 W;  3L72 H;  3H9V A;  1FXK C;  4D7S A;  4DR5 O;  2ZXW C;  4TUY B;  3K5L A;  2V4D A;  2F4V B;  2ZIN A;  1G4Y B;  1M56 B;  2FKX A;  5JWP A;  3GWK C;  1U96 A;  1XNQ O;  2A9H A;  5EYP A;  3HKC A;  4RQE A;  3N2K A;  4DK0 A;  2VS0 A;  3ZHR A;  3VBB A;  5IYZ A;  3JAS A;  2E75 B;  1H8H G;  1MSD A;  3HKE B;  4ZIB A;  4LF9 O;  3OTO O;  3GVM A;  4MT8 A;  4NTW A;  1AP5 A;  4UCR A;  3FAV A;  3UCS C;  3UO3 A;  2Q7E A;  4CH6 A;  2P6J A;  1AJQ A;  2HEP A;  3A0R A;  2ZR2 A;  1K8A W;  1HNX B;  3ABK B;  4LH6 A;  4JTD B;  1VIB A;  2F43 G;  2WLL B;  5BZB A;  3STL C;  5IY5 C;  1R3L C;  4GLX A;  4DUZ B;  4I0X A;  2BTQ A;  1F4N A;  2AHZ A;  1SQV H;  2JVD A;  3CCE V;  2N05 A;  3BHP A;  1JR9 A;  3JCZ A;  4ASU G;  4JI6 O;  4O4J B;  3CRR A;  3JD4 A;  1IBM B;  3OTF A;  5IJ0 B;  4I55 B;  1YEW A;  3LDD A;  3RYH B;  4JI0 B;  2FB5 A;  2M7W A;  2NNU A;  5EBM C;  5GON A;  2LO1 A;  4DYL A;  1GK9 A;  3WU2 Z;  3SPJ A;  3BPZ A;  2KKW A;  2RCV A;  2E76 B;  1F51 A;  1XMQ O;  5GW7 A;  2CTQ A;  1B06 A;  5BR8 B;  2Q69 A;  1QVF U;  1Y76 A;  3W7U A;  1P84 F;  4XDK A;  4N21 A;  3AEI A;  3AG4 C;  4FLT A;  3OR7 C;  3DXR B;  4FLY A;  4LWS B;  3OUS A;  1JQ0 A;  5CA1 A;  4L87 A;  1PP9 H;  4MVS A;  1XDC A;  2CE4 A;  2LP7 A;  4P2Z A;  4H33 A;  4GKJ B;  4MTG A;  5LA6 B;  2HHH O;  2X6C A;  1MA1 A;  2YXY A;  4AIL C;  3X2Q B;  5FNV A;  1NTK H;  4RWU A;  1NT2 B;  1IUR A;  1FD9 A;  3U0Z A;  5CB4 B;  5KHJ A;  1HNW B;  3B8N A;  2AZ2 A;  3OMA B;  4X65 B;  4TUY A;  4TQD A;  3H1I H;  4O2A B;  1NVP D;  1VF6 A;  4L8J A;  4X1I A;  2R9A A;  4X20 A;  1FFX B;  3F7Y C; 
#chains in the Genus database with same CATH homology
 3QO5 A;  4BW5 A;  1G8M A;  3JD3 A;  4I9W A;  2X6B A;  4MW3 A;  3K03 A;  2BOC C;  4WCE V;  3CPW U;  1S76 D;  2ITD C;  4PDM A;  1MG1 A;  4XDL A;  1JX9 A;  1M1K W;  2CK3 G;  3K3W A;  4MTO A;  5B1N A;  2IU0 A;  1VQO V;  4FMT A;  2JIZ G;  2WPD G;  4QPJ A;  1M90 W;  2XAF A;  3CCU V;  1Q7Y W;  1VQ7 V;  4DXW A;  3I55 V;  1QR8 A;  1R6N A;  2WLI A;  3D3I A;  1S3J A;  3SPH A;  3JD1 A;  1EZJ A;  3FKS G;  1DTO A;  4KFM A;  3ZMU A;  4QE9 A;  2XAH A;  5LHI A;  3SPC A;  4JAU A;  1AI5 A;  2H8P C;  3G71 V;  1K7D A;  1E1R G;  1V54 C;  4JF3 A;  4OXS A;  3SJQ C;  1NBM G;  1VQ5 V;  2WLL A;  4WFA V;  1COW G;  3RBZ A;  3M99 B;  1THZ A;  1NH2 D;  1BL8 A;  1XL4 A;  1FXK A;  2XAG A;  5H6Q A;  1BHB A;  3SYQ A;  1MSW D;  3RVZ A;  5B1B C;  1Y4M A;  5L3G A;  4G28 B;  4GX2 A;  3RW0 A;  1GKF A;  2AHY A;  1S5H C;  1OCR B;  4R8C A;  1SRY A;  3CC2 V;  3E2E A;  2HLD G;  3ZN1 A;  3IC7 A;  3AG2 C;  4MTF A;  1WPX A;  1YTF D;  2GHY A;  1FXK B;  5EBL C;  4EKW A;  3ZMZ A;  1R73 A;  5CN0 A;  3K9A A;  1P7B A;  3CCM V;  2ZXW B;  3AG3 C;  3VOU A;  4RUF A;  1JCH A;  3ETG A;  3GWO A;  1H2G A;  2DWE C;  4PA9 A;  2XND G;  1K5S A;  4Q20 A;  2QE7 G;  2XAS A;  4MVQ A;  4PDR A;  4R7C A;  2EIN B;  4BIZ A;  1P4R A;  1VQP V;  3LUT B;  5L3D A;  4WF9 V;  3WG7 C;  3NXS A;  5KA6 A;  3MHS C;  1KKD A;  4R50 A;  4J9Y B;  2H94 A;  4E2L A;  1TUE B;  4YXW G;  2EIM C;  4GX5 A;  1AR1 B;  4MS2 A;  3F7V C;  2HVJ C;  1VQN V;  5CMU A;  4WFH A;  3ZRS A;  2MK3 A;  2HKO A;  1NJI W;  3E8G A;  4RQF A;  2WSS G;  1N8R W;  4FJC C;  5B3S B;  3TCU A;  4RAI A;  2EIK B;  1AJN A;  1R6K A;  1AI4 A;  1V54 B;  3OFN G;  2EIJ C;  5FL7 G;  3EFF K;  3E8B A;  1K97 A;  3IGA C;  5E1A C;  1BHA A;  1KQS U;  3CYO A;  2B1I A;  2EIL B;  4QNH B;  2IJI A;  1H38 A;  1PD3 A;  1BMF G;  1FXV A;  2B1G A;  3OAA G;  4FK5 C;  1IXM A;  1Y66 A;  4ZKI A;  3MD0 A;  1DF5 A;  2DYS C;  4U7O A;  2Z5U A;  3FB8 C;  4UVC A;  2P67 A;  3AG2 B;  4G27 B;  5IY5 B;  1K9M W;  2IJJ A;  2P7T C;  3KG2 A;  5CBG A;  3E83 A;  4BIU A;  1SET A;  3CCQ V;  1RM1 B;  1OCC B;  3AG3 B;  3P32 A;  1FXH A;  4LBE C;  3SYC A;  1K34 A;  2Y48 A;  3F5W C;  3ZRX A;  1S72 V;  1W0K G;  5L3B A;  1QLE C;  1GM8 A;  3QNE A;  2IU3 A;  3W7W A;  2IJK A;  3WG7 B;  1CEZ A;  5L3E A;  3CP1 A;  3W7S A;  3I56 V;  4JAS A;  1NR1 A;  3ETD A;  4CBC A;  3CXC U;  1OCZ B;  4P9P A;  4N23 A;  1KD1 W;  4WFB V;  3OGC C;  1EFR G;  2PI5 A;  2X7R B;  3ABM C;  3K0G A;  2R9R B;  3E35 A;  4G2K A;  1RPR A;  3ABK C;  3E8H A;  5B1A C;  4Z1M G;  3ZMT A;  3K08 A;  3CCL V;  3IFX A;  4QE7 A;  2HFE C;  4MTX A;  3T4D A;  3AG4 B;  2A0L A;  3T1C A;  3K79 A;  3P30 A;  2EIJ B;  1M57 C;  4P30 A;  3CCS V;  1GM9 A;  4UVB A;  1KP3 A;  1JOY A;  3H01 A;  5IYB O;  4PA6 A;  5LHH A;  1YJN V;  1R3K C;  3OR6 C;  1I5X A;  2QTO A;  2W6I G;  5H6R A;  3ZRW A;  2IH3 C;  2WLJ A;  2Q67 A;  4UXN A;  1UJW B;  3LDE A;  4J9Z B;  3CCJ V;  1PNK A;  4RUE A;  4LCU C;  5H9C A;  3D36 A;  2LFR A;  3QO8 A;  3B77 A;  4FPP A;  1VQM V;  1NKD A;  3DTU B;  2XAQ A;  3FB5 C;  5EC1 C;  1I5Y A;  4ZBM A;  5CBF A;  3ZRW B;  4CZZ A;  1DLB A;  1S0V A;  3ABL C;  2HJF C;  1F4M A;  3ASO B;  1NR7 A;  1R3J C;  1XL6 A;  4I5S A;  3STZ C;  1JVM A;  1OCO C;  3LNM B;  3SPG A;  1GM7 A;  1MAB G;  1MOF A;  3FB7 C;  1R3I C;  3ZCC A;  2DW4 A;  1YJW V;  4PDL A;  1VQK V;  1W0J G;  3ETE A;  3T4Z A;  5LGU A;  1J95 A;  3OUF A;  2YEV B;  3ABM B;  2JJ1 G;  2OTJ V;  1KC8 W;  3MHH C;  2WWW A;  3OMI B;  2DQ0 A;  3LSS A;  1NVP B;  5HFM A;  1VQ4 V;  5B1A B;  4DO2 A;  3X2Q C;  5LGN A;  4PDV A;  3K04 A;  2IH1 C;  2JJ2 G;  2IW5 A;  2EJR A;  2ATK C;  2C2A A;  2PI4 A;  2Y69 C;  4JTC B;  1K3E A;  3ASN C;  4PA7 A;  2X0L A;  2UXN A;  1LNQ A;  3ZIA G;  4X88 A;  2YSU B;  3E89 A;  1V55 C;  1YHQ V;  4UVA A;  2QM8 A;  1VQ8 V;  2DYR C;  2B5U A;  3LSQ A;  4PA3 A;  3W7X A;  1VQL V;  1QR9 A;  4MSW C;  3EHB B;  3JD2 A;  1M9N A;  4TWK A;  5EK0 A;  5IYD O;  4JGS A;  3AG1 C;  1Q82 W;  2ZQM A;  1OHH G;  5B1O A;  5KUK A;  2BOB C;  4PA4 A;  3GB7 C;  3ML0 A;  5B1B B;  1HWY A;  4TT3 G;  5EBW C;  1EBO A;  1RPO A;  1M56 C;  1OZ0 A;  4MVU A;  4F4L A;  2D3O W;  5L3C A;  2DWD C;  2V1D A;  3OE7 G;  4UUJ C;  1OCO B;  4GX0 A;  3PJS K;  4P9O A;  5C93 A;  2GSM B;  3OEH G;  4X8A A;  1AI6 A;  1NH2 B;  2EZP A;  4PEL A;  2IJH A;  2P90 A;  1K4D C;  1SER A;  2X6A A;  3OMN B;  5J9P C;  1W2B U;  3TET A;  3ABT A;  1L1F A;  5EC2 C;  2HR3 A;  2OTL V;  2EZO A;  5LGT A;  2OCC C;  2QKS A;  1ORQ C;  3K06 A;  4FIP C;  2R9I A;  1YTF B;  1SES A;  1KP2 A;  4GX1 A;  2Z3Y A;  4LP8 A;  2EIM B;  3SPI A;  1VQ9 V;  1ZWI C;  2QM7 A;  1GTO A;  1JPX A;  1PNL A;  2QA4 V;  2W0F C;  5KUM A;  3LDC A;  1VQ6 V;  2Q6A A;  2WLN A;  3ZN0 A;  4U7N A;  5L3F A;  1OCR C;  1SZT A;  4HAM A;  2WAM A;  3BY6 A;  4H37 A;  5HFL A;  1Q81 W;  4HYO A;  3B8M A;  2JEX A;  1FXK C;  4MVM A;  2UXX A;  3BEH A;  3E86 A;  2ZR3 A;  2XOK G;  2JDI G;  2ZXW C;  5IDJ A;  1ARO P;  3AG1 B;  1WLE A;  3RVY A;  1CP9 A;  1ENV A;  3ZJZ A;  2EIN C;  1YJ9 V;  1G4Y B;  3UKM A;  2NLJ C;  1M56 B;  3SYO A;  5KA5 A;  1PL0 A;  2DYS B;  2A9H A;  3CD6 V;  4RQE A;  2ITC C;  1GMG A;  1F23 A;  2ZDI A;  5LBQ A;  1B6Q A;  1QLN A;  1ROP A;  2JK5 C;  2V7Q G;  3G6E V;  4UV8 A;  4HZ3 A;  4MVO A;  3TK1 A;  3VBB A;  2YEV A;  5B3S C;  1QLE B;  4JYB A;  1H8H G;  4JPR A;  2EIK C;  2OT5 A;  4QIW F;  1S77 D;  1DF4 A;  1PNM A;  2OCC B;  4MT8 A;  2WLI B;  2HVK C;  2WLM A;  1QVG U;  1AJP A;  3QO7 A;  1YSC A;  3HPL C;  3SYA A;  2EIL C;  2K1E A;  2P6J A;  4WFE A;  3CMA V;  1AJQ A;  3A0R A;  2ZR2 A;  1K8A W;  1FS0 G;  3ABK B;  4JTD B;  2W6J G;  2F43 G;  2WLL B;  1YIJ V;  3ZMS A;  3OW2 U;  5BZB A;  3STL C;  5IY5 C;  1R3L C;  3CCR V;  4WFG A;  1F4N A;  2HG5 C;  1RM1 C;  2AHZ A;  3ZRV A;  1OCC C;  1M57 B;  2DQ3 A;  3W7T A;  3CCE V;  4QPK A;  1GO3 F;  5DN6 G;  3JCZ A;  4ASU G;  1YIT V;  3E8F A;  3JYC A;  3JD0 A;  3FB6 C;  1AI7 A;  3JD4 A;  1E79 G;  4LC1 A;  3ABU A;  5CBH A;  1FFT B;  3LDD A;  2M7W A;  2NNU A;  5EBM C;  1OCZ C;  3G4S V;  1GK9 A;  3SPJ A;  3FYI B;  1F51 A;  2WLH A;  5GW7 A;  4X89 A;  2Q69 A;  3ABL B;  1QVF U;  2QEX V;  3CC7 V;  3W7U A;  1NQT A;  5LHG A;  4XDK A;  1QBZ A;  4N21 A;  3ZMV A;  3AEI A;  1PKX A;  2A79 B;  3AG4 C;  4TSF G;  3OR7 C;  3CCV V;  1KEC A;  1CPY A;  5IYC O;  1E1Q G;  1JQ0 A;  3OUS A;  2KB1 A;  4XDJ A;  2JEU A;  2EBO A;  4L87 A;  1K4C C;  3OEE G;  1K73 W;  4XBF A;  4MVS A;  4QJF B;  3SYP A;  2LP7 A;  3HB3 B;  4R6Z A;  2LFS A;  4JTA B;  4KP4 A;  4P2Z A;  4H33 A;  4MTG A;  4MVZ A;  2ZD9 A;  3OM3 B;  2X6C A;  3R65 A;  4WFF A;  3CC4 V;  3X2Q B;  3WFV A;  4RO2 A;  3CME V;  4GT1 A;  3FYE B;  1K92 A;  2WLK A;  4JAV A;  2Y69 B;  3B8N A;  3ASN B;  4GCZ A;  4MW8 A;  1JJ2 U;  2FTK A;  3OMA B;  3T2M A;  5CA3 A;  1K33 A;  1Q86 W;  5DM6 V;  1H8E G;  1V55 B;  4JYC A;  1NVP D;  1QCE A;  3ASO C;  4BAY A;  2DYR B;  3UM7 A;  1K5Q A;  4UV9 A;  4KUM A;  2ZDI C;  2Q68 A;  3K0D A;  2XAJ A;  1YI2 V;  3DGE A;  3F7Y C;  4MVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...