2ODMA

Crystal structure of s. aureus ylan, an essential leucine rich protein involved in the control of cell shape
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
79
Chain Sequence
ATMKNAALKQLTKDADEILHLIKVQLDNLCPLYEEVLDTQMFGLQKEVDFAVKLGLVDREDGKQIMLRLEKELSKLHEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0358 protein MW0995
publication title Crystal structure of S. aureus YlaN, an essential leucine rich protein involved in the control of cell shape.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
total genus 23
structure length 79
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07408 DUF1507 Protein of unknown function (DUF1507)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.750 Mainly Alpha Orthogonal Bundle Helix Hairpins SO2669-like 2odmA00
2NR5A 2ODMA 2GBOA
chains in the Genus database with same CATH superfamily
4L8JA 5GTIZ 2W0XA 1YXBA 4O4IB 4I0XA 3FD9A 2DWDC 1L1FA 1ZL8B 3JD4A 4JZ2A 1QVFU 4O4LA 4KHPB 4WFAV 2Q8VA 2KG7A 3DC6A 3DC5A 3SPIA 3P30A 5B1NA 1BCCH 1IURA 5IWAB 1V9PA 5CBHA 5BMVA 3JSLA 1XBLA 5FL7G 4UCTA 5B3SB 1K5SA 2LO1A 4CH6A 5KMGA 3ZHTA 2KKWA 2UU9O 1BT8A 1KP3A 4QGPA 3IC9A 1QNMA 4WBNB 2F66C 4QE7A 4ZKIA 5IY5C 2F23A 5EYPB 4JTAB 2XTAA 2RN9A 3E83A 1XL4A 1IBMB 4LR3A 4AILC 1K4CC 5JH7B 4DV7B 5LP6B 3CCQV 2E74B 4GX5A 4K35A 3CE2A 3E2EA 4GLXA 1PPJH 2N74A 2HP8A 5EC1C 3RBZA 3BEHA 4DRXA 3GVMA 2AZ2A 2BOBC 3CX5F 2KSDA 4LFAB 1IBLB 5JWPA 2GSMB 1FFXB 1Q8IA 2ATKC 1IVSA 1KB9F 4R8CA 1WLEA 5LXTA 2L6LA 4DV0O 3E8GA 2ADPA 4JI6B 1RFYA 1MA1A 3CRCA 3QO7A 1N0JA 5D5PA 2A9HA 3OFNG 1S5HC 1M57B 2DN9A 4UUJC 2IU0A 4K0KO 5LHIA 4DUYO 1R3KC 2DWEC 3AG3C 3TXSA 1K7DA 4BAYA 3SYPA 3CRMA 1YJWV 3OEHG 2UUAO 5J2TA 5IYDO 2DYRC 1Q7YW 4J80A 2CTRA 3JAKA 3SYOA 4FLWA 4HZ3A 2VQEB 5IDJA 1F4NA 1XNQB 3T1YO 1NVPB 1FXKA 3H1KH 1HNWB 4FM0A 4EFEA 1WA8B 2XASA 2R9AA 4H13B 2ZQMA 4PA3A 4FLVA 3RVYA 4Z2WA 1I08A 4B3RB 4YIPA 4X1KA 5C93A 1PNLA 2Q68A 3T4ZA 2ZE7A 3C90A 3ETQA 3G67A 4JAUA 1Y6XA 3IJ4A 4IYHA 2AW9A 2DQ0A 3CSXA 3FFQA 4JI1B 5IJ9A 1X4TA 2IH3C 3CEIA 1NTMH 4TV9B 2ZXWC 3CS5A 3X2QB 1VQ7V 4GT1A 2P4VA 3KKYA 5LMNB 1YJNV 4UCSA 3LSUA 3DXRA 2P06A 3G80A 2OIGA 4DR1O 2CTPA 4JYAO 1M9NA 1J5EB 2QR4A 2P6JA 1AJPA 4IL6Z 4WCEV 5FPRA 1QLNA 1Q86W 1Y76B 5EIBC 1NR7A 5EIBD 3AK2A 2CH7A 1R6KA 1N36B 4O4HB 5DEDA 1H8EG 3EXAA 1XMOB 3OMNB 1W0KG 4LF8O 4I7ZB 3CCEV 1MZFA 5D5QA 2ZT9B 1OCCC 3WB1A 5KX5A 4PDVA 3OGCC 4YJ2B 1R6TA 2ZR3A 1H2NA 5IYZB 4HNAB 4X8AA 1HNXO 4FZ0A 4LF5O 3N2GA 4U3JB 1SA0A 1YTFD 3HKBB 2BTOA 1N0NA 2AXTZ 3HR0A 2PTMA 4DV3O 1G6UA 3T4DA 2MK3A 3QTCA 4PA9A 1JPXA 2Q0OC 3D8CA 4PA6A 5FNVA 5TISZ 4X62B 4TUYB 1SS3A 5IYBO 4I50A 4MVZA 2FTKA 4MW8A 5JQGB 2DYSC 4FIPC 3FYIB 2IW5A 4LF4B 1NH2B 2M7WA 2JK5C 1SQFA 4DUYB 2XNDG 1GN6A 2DE0X 2ZIOA 3RYIB 2X6BA 4WFEA 5LGTA 3Q4HA 1FXVA 3F7YC 2EIMC 1HR0B 3ZHVA 1KD1W 3ZHSA 3T1YB 2EILC 3K9SA 4JI7B 5LA6A 3KCYA 1IXBA 5B5EZ 2B9ZA 2P4KA 3WFVA 1QQCA 1HWYA 5BR8B 4H33A 2VQFB 1I5XA 4RUEA 4J41A 1WNSA 4EKWA 1FS0G 2XUMA 5LBQA 1OCZC 3H1JH 2P67A 3CB2A 1H2GA 5CA1B 4CS2A 4CC5A 4X66O 4TV8A 1ENVA 5AG2A 4DK0A 4JI8O 4Q20A 1NTZH 1PM9A 1PD3A 1US6A 1ROPA 4ZBMA 2HVJC 5LOVA 4DV4B 5IJ0B 2R9IA 4JGSA 5JVDB 3QF7A 1COWG 3LDDA 1JCHA 3U11A 3A2FA 3ABKB 4AHCA 3W7UA 1AJNA 2OIEA 4ASUG 4LF6O 1M56B 4H44B 4FFBB 2M6YA 2DMXA 4YJ3A 3H9VA 2EX3A 4BWAA 4O4JB 3GWOA 2WLNA 1Q6UA 3RYCA 5J9PC 3IGAC 1TAEA 5J2UA 1R1BA 4JV5O 1WB8A 3ML0A 3WB2A 4LF8B 4AQYO 1ZLZA 1Q81W 2E5LB 3ZRXA 1HNZO 4JI5O 1SF9A 5EZYA 2ZE6A 3F5TA 3RFRA 1XNRB 5IY5B 4I55B 2PI4A 2WLMA 4LF7B 3SPGA 5GTHZ 4WFFA 4LFCO 2PF4E 2JS5A 4GKKB 5IYCO 4FMTA 1GO3F 1Q90D 1VQ9V 4RO2A 4DV3B 1BQ0A 1K3EA 2B1IA 4LF9O 1GN3A 3B40A 1WP8A 1NJIW 3HKDB 2DW4A 2IH1C 3CC7V 3ETGA 2AGAA 4O4IA 4FM1A 1EFRG 1SRYA 3KG2A 3CYOA 2UXDB 4OPAA 1ZL8A 1YSCA 3BAAA 1NT2B 4FFKA 1S3JA 1KYOF 3D36A 3FB8C 4DR3O 4DUZB 3CC4V 5HFMA 2GHYA 4TSFG 2LW1A 2A79B 2BCCH 4MTOA 3JAMN 1VQLV 4X20B 1AJQA 1SZXA 2Q69A 4MVUA 2IBZH 4JAVA 4JYYA 5A2QN 4UXNA 2Q6AA 5L3GA 4JZGA 1ORQC 3SJBC 2EJ7A 2DYRB 1AI6A 2QM7A 2UXXA 4NVPA 2R72A 4WBNA 3JALB 3AEIA 3ZMTA 1THZA 4R50A 5EYPA 4X9QA 2UUBO 3EFFK 1AR4A 3CP1A 4P30A 1H2SB 3OD4A 2GTSA 1IX9A 1Q3EA 3RYFB 5JH7A 2AHZA 3AK1A 1PNMA 4MSWC 1IBKO 5LP6A 4DR7O 3OEEG 5DN6G 4GKJB 2FYUH 1AP5A 5EBLC 3M8AA 4YY3O 3L71H 1GMGA 5EBWC 1XREA 2LP7A 4BIZA 1NU1H 1JMKC 3OR6C 3DGEA 3A0RA 2ZXWB 1I94O 2WAMA 1FFXA 4U7OA 1Q43A 3ZHRA 4OX9B 1N8RW 4PDLA 3G6BA 2YS8A 4QE9A 3TCUA 1P4RA 2X7RB 3O9OA 4G27B 1IDSA 1XL6A 3STLC 3SYCA 4E4EA 1H38A 1DF5A 1TVKB 1KC8W 1F51A 1YDXA 4IHJB 4P9PA 1TUEB 2YIAA 1BQZA 1KP2A 4FPPA 4IGGA 3ZRWB 3ABMC 2YIBD 3BHPA 4AQYB 3RWRD 4PA4A 4XDJA 1OCRC 2Y48A 4FJCC 2Q9LA 5C8YB 2Q7HA 4J7JA 1S76D 4EEQA 3B09A 1I7FA 2JJ2G 4LFCB 2YXYA 2RNBA 1WA8A 3K58A 2PYJA 5JCOC 2HG5C 1GKFA 2WLHA 4UB8Z 1YTFB 4DR6B 4NXNO 4X1IB 1ZSPA 2HLDG 4ZI7B 3B77A 5JJEB 3HKCB 5L3CA 4DV5O 2PGGA 2Y4TA 3J81N 5CBGA 3AG2C 3E8FA 5IE9A 1H2KA 3O65A 4FK5C 1EN5A 4CH5A 3H01A 3ETDA 1EM1A 4DR4O 4TV9A 3A0BZ 2CAZC 4DR3B 4J42A 3NXSA 3CJHB 4P9OA 3ZHQA 1QR9A 3WB0A 4D6TH 1S5JA 2DYSB 4YXWG 2WA3A 1DTOA 1K5QA 4PI0A 2JS3A 2XAGA 1AI4A 2XAHA 3TK1A 1UFIA 1YJ9V 1Y76A 2V1DA 3FB6C 2RDCA 5ITZB 4BW9A 1EZVH 2EIMB 3L74H 4R6ZA 4O4HA 3UQ8A 4KL1A 4D7SA 2QTSA 1GM8A 4LCUC 2A7WA 2Q7GA 4HAMA 2UUBB 2LGWA 1BGYH 4XBFA 1D5NA 4B3SO 5CA0B 1BSMA 2QWOB 4ABMA 4DV6O 2CTQA 3N27A 4N23A 4YJ2A 3C3SA 5DM6V 5IYZA 4HNAA 4BIOA 5KHHA 1GAXA 4PD4F 3ABLC 2X6AA 2Y69C 4U3JA 3HKBA 4UV9A 2PYLA 4MVSA 5B1AB 4FLZA 2NLJC 3ZBHA 4MT8A 2QE7G 2PZSA 3K57A 4DV1O 2Z5UA 3ZMVA 3SPCA 4JI2O 3E86A 1S72V 1NI8A 5KAFZ 3I5DA 4NTYA 1TUBB 4TUYA 2E3CA 4B7EA 1K33A 1SQXH 3I55V 5JQGA 4J7KA 1AVMA 2CDYA 1Q6IA 2RCVA 4K8ZA 3JASB 5EC2C 3CCVV 1MSWD 1VARA 3G6EV 4F6RB 4DR2O 2XOKG 3LDEA 3APQA 1WPBA 1F7YA 3RYIA 1VMGA 3ZN0A 3UM7A 2IJHA 1XEQA 2Q7EA 1NBMG 2P22C 1URFA 5KAIZ 4JI4O 1GTOA 3THOA 2YIDA 3MD0A 3OE7G 2EIKB 4Q6GA 1QLEB 1DGSA 2H3OA 2EIJC 1SKVA 5LHGA 4FM2A 1XMQO 4DV2O 2E75B 1M93A 4ZHQB 5CA1A 4YHHO 4MVOA 2UU9B 4JI0O 2CK3G 1NR1A 2ZE8A 1N33O 4BW5A 4CH3A 1FKAO 4DR4B 4F6EA 3CCLV 1QBZA 1SQGA 3G4SV 5IJ0A 5JVDA 4JI3O 2YICA 3ZRSA 3AG4C 1XUQA 1FJGO 2Q0AA 2K1EA 1NS1A 2IU3A 5H2FZ 4UCUA 3UO2A 4FFBA 4X1YB 2IJJA 5FLXN 1EN6A 3TJTA 2QTOA 5B66Z 2HKOA 2UXCO 4O4JA 3ZMUA 2YDEA 1YEWA 1R6NA 3BPZA 1GRJA 1FAFA 5BXZA 2HHHO 1AI7A 3H1LH 2OCHA 4KUMA 3ZN1A 3SPJA 2Q5ZA 4DV6B 1Z2GA 4DV0B 4FZ1A 4I55A 3B4SA 2ZR2A 3BA8A 1OJHA 3B8MA 1MZEA 3K79A 3KZIZ 4PJ0Z 4DW1A 2N04A 4A5UB 2JEXA 4W4LA 1O9HA 1OHHG 3J80N 2VWKA 2ZIMA 3K04A 2BSKB 4K0KB 5KA5A 4UCRA 1VQ5V 1FD9A 3SR2C 3TXQA 1N4CA 1YHQV 4MTFA 2UUAB 3FB7C 3CMAV 3D3QA 1W0JG 2OYQA 3HKDA 1YITV 2OCCB 1RPRA 4LWSB 3ASOC 1K73W 4R7CA 3B2EE 1VQNV 4RAIA 2B5UA 1P7GA 3T1HO 2E76B 2IJIA 2KB1A 4I9QA 3JCZA 4DR2B 3ZX6A 1FYJA 4LH7A 4I5SA 5BY1A 4RUFA 1N32O 3CCJV 3CCRV 1QHTA 4X20A 4RQFA 4W4KA 3ZEDA 1YI2V 4UVBA 3ETEA 1FXHA 3ABMB 4HYOA 3M7MX 3W7XA 5L3BA 2QWNB 3OMAB 4MVMA 4PELA 4PI2A 1OCRB 4X64O 2QEXV 2O57A 1FFTB 3JALA 4B3MO 5LYJB 4HBNA 4MTGA 2IM9A 4UVCA 3IFXA 1XHXA 3CCSV 4UVAA 3T1CA 3QNEA 1AROP 1I0HA 3MDSA 2AHYA 1CXZB 4DR1B 4JYAB 3OGIB 1Y74B 5LMUO 3RYFA 2JEUA 3JARB 3R65A 4JF3A 3M99B 4NXMO 2PUSA 4LBEC 1YF2A 3QVNA 2EZPA 3ASNC 1N33B 2BTQB 1JR9A 2JGDB 5CMUA 1VF5B 2D2CB 2ZD9A 4LP8A 3AG2B 4QJFB 2ZNJA 5L3FA 1R3LC 3K3WA 3UCSC 4UB6Z 3CD6V 4LFBO 1J95A 4K8XA 3E8BA 3RYHB 2HR3A 1DK1A 4UCVA 3HKEB 1VF6A 2GTAA 4FLTA 2VRZA 4J7ZA 2Z3YA 5GONB 1HNXB 2WLIB 4LF5B 2X0LA 5B1OA 1JJ2U 3LNMB 1HW7A 3MHSC 5JJNB 5JJJB 1H8HG 3APOA 2YI9A 1TVKA 4IHJA 4LNUA 1AR1B 3E8HA 2UXCB 5HFLA 2OTLV 1CEZA 4EFBA 1V54C 3ZRWA 2YC0A 4KHPO 4WFBV 4J11A 4DW0A 3PN1A 1MMMA 2CTWA 1KQSU 3CWBH 5C8YA 2C2AA 3AG1C 5K1PA 5IWAO 4FLYA 2PI5A 4O2AB 5KLVH 2NN4A 3LSQA 2DQ3A 3MAQA 5CBFA 2NR5A 3CRRA 2FB5A 3CMEV 1RSOB 1XOUA 2LFSA 2ODMA 4PDRA 2H8PC 1V55C 1KKDA 3AK3A 3ABLB 2A0LA 2Y69B 4X1IA 1VQMV 4ZI7A 1VQKV 1RM1C 3HKCA 2OTJV 3I56V 1N34O 3AG3B 3SJCC 5KHGA 2A06H 2YUAA 3SJQC 1IBMO 3FYEB 3IAYA 2QWQB 2YXLA 5A9GA 3OR7C 4DV7O 3FAVB 3BVOA 1VF7A 4RQEA 4CS4A 2F93B 3CCMV 3CJHA 4JYBA 2WA4A 3G71V 3DSQA 3P3NA 2ZM6O 4H37A 3RGBA 1SERA 2ZNIA 1PNKA 2Q73A 3BABA 2GBOA 3E22B 1VEWA 1UPGA 4X66B 3VQWA 3CHXA 1FXKC 5E79Z 4CZZA 4LFAO 1IBLO 2HVKC 1L8DA 4X64B 4JI8B 1JA8A 3SYQA 5ITZA 3N2KB 4CC6A 4JI6O 1AP6A 1GK9A 1G8MA 2Q67A 4GZRB 4QPKA 3JYCA 1X59A 4DYLA 1XILA 4MVQA 1LUWA 5CA0A 2ZDIA 1AR5A 2XAFA 4LF6B 2Y4UA 1OCOC 4B08A 1SQPH 3K0DA 4NXMB 2YEVB 2GUZB 4UFZA 4LNUB 3GWKC 1O9GA 2WLLB 3VQVA 3ZIAG 4E2LA 4JV5B 3OUSA 2P90A 1HNWO 4JI5B 1HNZB 1SETA 2FKXA 3RW0A 4GUNA 2VWJA 4JAAA 1BHAA 3JD3A 1NKDA 1ZX3A 1TUBA 3QO8A 3K5LA 1S0VA 3UT5B 2MW2B 2HEPA 3LUTB 3JAWB 1OCCB 3CC2V 3AG4B 4FLXA 1BE3H 1R73A 4U7NA 3JASA 2UUCO 4JI1O 4IT5A 1PV0A 1KUQA 4F6RA 1LNQA 1OZ0A 1K8AW 4GX1A 1U97A 1S5LZ 1L0NH 4LF9B 1VIBA 4I4TB 2RJZA 3ABKC 5CB4B 1H2MA 3SGIA 5LMNO 1K97A 2K9PA 1M56C 4ZOLB 4IIJB 1JOYA 5GW7A 2LFRA 2HFEC 3UO3A 2P5OA 1LUVA 1MOFA 4I9WA 4O2BB 2ZKOA 2EINC 3ZMSA 1J5EO 1G1XB 2JVDA 4JTDB 5EK0A 4OXSA 4NTWA 4DXWA 3QG5A 1N36O 3NR7A 1XMOO 2XT9A 4ZHQA 1N34B 3SDLA 2RQ6A 1B3QA 1SQVH 4B3TO 1JQ0A 1JFFB 1KECA 3IC7A 4GX2A 3FKSG 2XHBA 2IJKA 1EBOA 2QSAA 2EILB 3ASOB 2ITDC 4X88A 4UCOA 1L0LH 2EULA 2OT5A 1KMIZ 2NNUA 4UV8A 2WWWA 4F4LA 2KQXA 3JATB 2ZM6B 4L87A 1NQTA 4ZIBA 5FPOA 1VQPV 3LNNA 1IBKB 4EB6B 4DR7B 2QDOA 1M1KW 1GH6A 1IXMA 3ZHUA 1PKXA 2JIZG 1OCZB 3D3IA 1M90W 4YY3B 4X1YA 3JD2A 4JASA 2QWPB 1CPYA 3ICXA 2FL4A 2LW7A 4X62O 1WB7A 4QNHB 1EZJA 4WF9V 1VQ8V 1PL0A 2QKCA 1I94B 4NYKA 5KUMA 1SC5B 2ZINA 4D7TA 1G4YB 1ZTEA 4LF4O 1KU9A 1BS3A 2ARHA 5E1AC 2W6JG 1QR8A 2EZOA 2X6CA 3JCUZ 1QVGU 3VQXA 3E35A 4I0XB 4TT3G 5B1BC 1HR0O 2PY5A 1ZUQA 3VBBA 2BSKA 1K92A 4O4LB 4JI7O 1QCEA 3ASNB 3F7VC 4PHZA 2KG7B 4TWKA 1RPOA 1EN4A 1PP9H 2WPDG 5L3EA 5BR8O 4NB5A 2XAJA 3OTOO 5BMVB 3TETA 4LWSA 1SZTA 4MS2A 1BZKA 1MSDA 2VQFO 4DR5O 1I5YA 4YIOA 5LGUA 1K9MW 5LHHA 1NZ6A 3K06A 1Z5WA 1UJWB 5KMGB 2UUCB 4NXNB 3WG7C 3JD0A 3VQYA 4J9YB 2QKSA 2QA4V 1Y66A 3OMIB 3K5NA 2F1MA 3R66A 1K4DC 4DV5B 2CE4A 1VF6C 1KKCA 3RVZA 4B7KA 1TGOA 1WAZA 1V54B 3K08A 2YIBA 4TQFA 2UXBO 4DV4O 1SQQH 4RWUA 2Q4PA 4WFHA 2L35A 1F4MA 1WPXA 1VQOV 1GM9A 2F43G 4LH6A 1A32A 3AG1B 3BCCH 2DOSA 3J7AU 2F95B 1HP8A 5LYJA 3ZCCA 2G38A 1NTKH 3TGUH 2CUGA 4DRXB 2V4DA 4QPJA 2HJFC 1V55B 1T5EA 5JCOA 1Y74A 4KP4A 1P7BA 3FX7A 1YCIA 3JARA 4J9ZB 1RM1B 1AB3A 2E5LO 4B3TB 1B04A 2BTQA 3D36C 2JGDA 3OTFA 2LQTA 3GB7C 5CN0A 5LXTB 1XNRO 2UXNA 1Q6HA 2Z0AA 3OUFA 4LF7O 3ZMZA 3K0GA 3CXHF 3W7SA 1FPOA 3STZC 2QM8A 1ZAUA 3U10A 4B3SB 3RYHA 4GKKO 5B3SC 1MNGA 3HKEA 4DO2A 2JRIA 5GONA 2WLIA 2ZCEA 2XAQA 5J2TB 3JAKB 1GM7A 3K59A 2QJ1A 4KXRA 4CBCA 4BIUA 2LGQA 3W7WA 2UXDO 1FXKB 4DV1B 3L9DA 2Y0PA 5K1XA 4JI2B 4MVRA 3CPWU 1D2DA 1ZWIC 4DUZO 4IYIA 4BR6A 5LP6C 4X1KB 4Z1VA 4C7UA 2QM4A 4O2AA 3MHHC 5IT9N 1QU7A 3BFRA 1RSOA 1M5IA 4DK1A 4LC1A 4CS3A 5IJ9B 1B06A 2EJRA 1OCOB 3B8NA 2R70A 3WU2Z 2DJVA 2RMKB 4TQDA 3JSNA 5KHIA 3HPLC 3K5OA 4KFMA 2ZDIC 3L70H 3OTOB 4K3AA 5KA6A 2F4VO 3UKMA 1E79G 4DR5B 1TA8A 1JJOA 3BRCA 3DXRB 2W6IG 1AI5A 4JI4B 4X65O 1PL4A 1Y67A 5B1AC 3FAVA 3RN4A 2WSSG 1M57C 4JTCB 3CXCU 1GN2A 4JPRA 1K34A 4GKJO 1Q5OA 2CH7B 2A3QA 1XMQB 4DV2B 3W7TA 4YHHB 1HDJA 1D5AA 3E22A 4JI0B 2B1GA 2LJ2A 1W2BU 3OW2U 1U96A 2UXBB 1XQ8A 3OAAG 1NVPD 3H1HH 5KX5B 1SQBH 4ICGA 4MTXA 3BY6A 5KUKA 3OM3B 3N2KA 4OX9O 1GN4A 3N2GB 1SA0B 1S77D 1M4UA 2QWRB 2YSUB 4JI3B 1YIJV 2V7QG 3S3WA 3BA9A 2EINB 3U0ZA 3PJSK 1FJGB 3ZJZA 1SESA 1E1QG 2EBOA 3A8TA 3SYAA 3L73H 2ADQB 1H2LA 1WJZA 2YEVA 3CRQA 4OPHA 2GUZA 4J10A 5FNVB 2ETNA 1BL8A 1P49A 4I50B 3X2QC 3LSSA 4GYCB 2QKAA 2BE3A 2WLLA 1B6QA 5H5NA 1CP9A 1RP3B 5LGNA 3C3TA 1JX9A 2HHHB 3A0HZ 4NR1A 2EIKC 1QLEC 3ZRVA 3VOUA 1YVWA 5CA3A 2ITCC 4DR6O 3KCXA 3UT5A 2CGOA 3K9AA 4X89A 4G28B 3JAWA 4MW3A 3K5MA 5L3DA 3Q4HB 1VQ4V 1Z5VA 1MABG 5H6QA 5KHKA 1YZBA 4P2ZA 1VP7A 5LA6B 4CH4A 2BOCC 1DLBA 4Z1MG 3OT7A 3P3PA 1W59A 2ILMA 4PV1B 3RT3C 4FLUA 1Q82W 3EVKA 3JD1A 2VS0A 4N21A 2OWOA 1BMFG 2AZ0A 4I4TA 5CB4A 2Y0IA 2ZE5A 3K03A 1F23A 4ZOLA 5F2VO 4IIJA 3EHBB 5DECA 1XDCA 3ABUA 5H9CA 2FMLA 2WLJA 3T1HB 3SJAC 4O2BA 2JDIG 4TV8B 3P32A 4QIWF 3DTUB 3E89A 3ZS8C 1N32B 2N05A 3QO5A 2R9RB 4TOIA 4XDLA 2P7TC 4AI8A 5B1BB 1JVMA 5LL6Y 1E1RG 3HB3B 3SPHA 2JGUA 2D3OW 1R3IC 5EBMC 5LOVB 2F4VB 2YI8A 5BZBA 3CRAA 1LR1A 2QGNA 1JFFA 1BHBA 4X65B 4PDMA 3LDCA 4B3MB 1IZ3A 1XI1A 3FB5C 2GV9A 1NH2D 4YJ3B 4OGQB 2CGNA 1KBHA 4H0LB 2WLKA 3JATA 3RYCB 5LMUB 5J2UB 3T2MA 3WG7B 1MG1A 2OCCC 4EB6A 4WFGA 5KHJA 2EIJB 3F5WC 5EZYB 3L72H 5H6RA 4G2KA 4GX0A 2HJDA 3CCUV 1WP7A 2VQEO 2H94A 1XNQO 4GCZA 1OV9A 4XDKA 3S3XA 3H1IH 3L75H 1VQ6V 4LFBB 2JJ1G 4JYCA 1XHZA 1R3JC 4NTXA 1P84F 4NKGB 4PA7A 1WN7A 1DF4A 3AG7A 2GDSA 4B3RO 4FVMA 4U3FH 3ABTA 1Y4MA 2YXHA 1AILA 2W0FC
chains in the Genus database with same CATH topology
2NR5A 2ODMA 2GBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NR5 A;  2ODM A;  2GBO A; 
#chains in the Genus database with same CATH topology
 4L8J A;  5GTI Z;  2W0X A;  1YXB A;  4O4I B;  4I0X A;  3FD9 A;  2DWD C;  1L1F A;  1ZL8 B;  3JD4 A;  4JZ2 A;  1QVF U;  4O4L A;  4KHP B;  4WFA V;  2Q8V A;  2KG7 A;  3DC6 A;  3DC5 A;  3SPI A;  3P30 A;  5B1N A;  1BCC H;  1IUR A;  5IWA B;  1V9P A;  5CBH A;  5BMV A;  3JSL A;  1XBL A;  5FL7 G;  4UCT A;  5B3S B;  1K5S A;  2LO1 A;  4CH6 A;  5KMG A;  3ZHT A;  2KKW A;  2UU9 O;  1BT8 A;  1KP3 A;  4QGP A;  3IC9 A;  1QNM A;  4WBN B;  2F66 C;  4QE7 A;  4ZKI A;  5IY5 C;  2F23 A;  5EYP B;  4JTA B;  2XTA A;  2RN9 A;  3E83 A;  1XL4 A;  1IBM B;  4LR3 A;  4AIL C;  1K4C C;  5JH7 B;  4DV7 B;  5LP6 B;  3CCQ V;  2E74 B;  4GX5 A;  4K35 A;  3CE2 A;  3E2E A;  4GLX A;  1PPJ H;  2N74 A;  2HP8 A;  5EC1 C;  3RBZ A;  3BEH A;  4DRX A;  3GVM A;  2AZ2 A;  2BOB C;  3CX5 F;  2KSD A;  4LFA B;  1IBL B;  5JWP A;  2GSM B;  1FFX B;  1Q8I A;  2ATK C;  1IVS A;  1KB9 F;  4R8C A;  1WLE A;  5LXT A;  2L6L A;  4DV0 O;  3E8G A;  2ADP A;  4JI6 B;  1RFY A;  1MA1 A;  3CRC A;  3QO7 A;  1N0J A;  5D5P A;  2A9H A;  3OFN G;  1S5H C;  1M57 B;  2DN9 A;  4UUJ C;  2IU0 A;  4K0K O;  5LHI A;  4DUY O;  1R3K C;  2DWE C;  3AG3 C;  3TXS A;  1K7D A;  4BAY A;  3SYP A;  3CRM A;  1YJW V;  3OEH G;  2UUA O;  5J2T A;  5IYD O;  2DYR C;  1Q7Y W;  4J80 A;  2CTR A;  3JAK A;  3SYO A;  4FLW A;  4HZ3 A;  2VQE B;  5IDJ A;  1F4N A;  1XNQ B;  3T1Y O;  1NVP B;  1FXK A;  3H1K H;  1HNW B;  4FM0 A;  4EFE A;  1WA8 B;  2XAS A;  2R9A A;  4H13 B;  2ZQM A;  4PA3 A;  4FLV A;  3RVY A;  4Z2W A;  1I08 A;  4B3R B;  4YIP A;  4X1K A;  5C93 A;  1PNL A;  2Q68 A;  3T4Z A;  2ZE7 A;  3C90 A;  3ETQ A;  3G67 A;  4JAU A;  1Y6X A;  3IJ4 A;  4IYH A;  2AW9 A;  2DQ0 A;  3CSX A;  3FFQ A;  4JI1 B;  5IJ9 A;  1X4T A;  2IH3 C;  3CEI A;  1NTM H;  4TV9 B;  2ZXW C;  3CS5 A;  3X2Q B;  1VQ7 V;  4GT1 A;  2P4V A;  3KKY A;  5LMN B;  1YJN V;  4UCS A;  3LSU A;  3DXR A;  2P06 A;  3G80 A;  2OIG A;  4DR1 O;  2CTP A;  4JYA O;  1M9N A;  1J5E B;  2QR4 A;  2P6J A;  1AJP A;  4IL6 Z;  4WCE V;  5FPR A;  1QLN A;  1Q86 W;  1Y76 B;  5EIB C;  1NR7 A;  5EIB D;  3AK2 A;  2CH7 A;  1R6K A;  1N36 B;  4O4H B;  5DED A;  1H8E G;  3EXA A;  1XMO B;  3OMN B;  1W0K G;  4LF8 O;  4I7Z B;  3CCE V;  1MZF A;  5D5Q A;  2ZT9 B;  1OCC C;  3WB1 A;  5KX5 A;  4PDV A;  3OGC C;  4YJ2 B;  1R6T A;  2ZR3 A;  1H2N A;  5IYZ B;  4HNA B;  4X8A A;  1HNX O;  4FZ0 A;  4LF5 O;  3N2G A;  4U3J B;  1SA0 A;  1YTF D;  3HKB B;  2BTO A;  1N0N A;  2AXT Z;  3HR0 A;  2PTM A;  4DV3 O;  1G6U A;  3T4D A;  2MK3 A;  3QTC A;  4PA9 A;  1JPX A;  2Q0O C;  3D8C A;  4PA6 A;  5FNV A;  5TIS Z;  4X62 B;  4TUY B;  1SS3 A;  5IYB O;  4I50 A;  4MVZ A;  2FTK A;  4MW8 A;  5JQG B;  2DYS C;  4FIP C;  3FYI B;  2IW5 A;  4LF4 B;  1NH2 B;  2M7W A;  2JK5 C;  1SQF A;  4DUY B;  2XND G;  1GN6 A;  2DE0 X;  2ZIO A;  3RYI B;  2X6B A;  4WFE A;  5LGT A;  3Q4H A;  1FXV A;  3F7Y C;  2EIM C;  1HR0 B;  3ZHV A;  1KD1 W;  3ZHS A;  3T1Y B;  2EIL C;  3K9S A;  4JI7 B;  5LA6 A;  3KCY A;  1IXB A;  5B5E Z;  2B9Z A;  2P4K A;  3WFV A;  1QQC A;  1HWY A;  5BR8 B;  4H33 A;  2VQF B;  1I5X A;  4RUE A;  4J41 A;  1WNS A;  4EKW A;  1FS0 G;  2XUM A;  5LBQ A;  1OCZ C;  3H1J H;  2P67 A;  3CB2 A;  1H2G A;  5CA1 B;  4CS2 A;  4CC5 A;  4X66 O;  4TV8 A;  1ENV A;  5AG2 A;  4DK0 A;  4JI8 O;  4Q20 A;  1NTZ H;  1PM9 A;  1PD3 A;  1US6 A;  1ROP A;  4ZBM A;  2HVJ C;  5LOV A;  4DV4 B;  5IJ0 B;  2R9I A;  4JGS A;  5JVD B;  3QF7 A;  1COW G;  3LDD A;  1JCH A;  3U11 A;  3A2F A;  3ABK B;  4AHC A;  3W7U A;  1AJN A;  2OIE A;  4ASU G;  4LF6 O;  1M56 B;  4H44 B;  4FFB B;  2M6Y A;  2DMX A;  4YJ3 A;  3H9V A;  2EX3 A;  4BWA A;  4O4J B;  3GWO A;  2WLN A;  1Q6U A;  3RYC A;  5J9P C;  3IGA C;  1TAE A;  5J2U A;  1R1B A;  4JV5 O;  1WB8 A;  3ML0 A;  3WB2 A;  4LF8 B;  4AQY O;  1ZLZ A;  1Q81 W;  2E5L B;  3ZRX A;  1HNZ O;  4JI5 O;  1SF9 A;  5EZY A;  2ZE6 A;  3F5T A;  3RFR A;  1XNR B;  5IY5 B;  4I55 B;  2PI4 A;  2WLM A;  4LF7 B;  3SPG A;  5GTH Z;  4WFF A;  4LFC O;  2PF4 E;  2JS5 A;  4GKK B;  5IYC O;  4FMT A;  1GO3 F;  1Q90 D;  1VQ9 V;  4RO2 A;  4DV3 B;  1BQ0 A;  1K3E A;  2B1I A;  4LF9 O;  1GN3 A;  3B40 A;  1WP8 A;  1NJI W;  3HKD B;  2DW4 A;  2IH1 C;  3CC7 V;  3ETG A;  2AGA A;  4O4I A;  4FM1 A;  1EFR G;  1SRY A;  3KG2 A;  3CYO A;  2UXD B;  4OPA A;  1ZL8 A;  1YSC A;  3BAA A;  1NT2 B;  4FFK A;  1S3J A;  1KYO F;  3D36 A;  3FB8 C;  4DR3 O;  4DUZ B;  3CC4 V;  5HFM A;  2GHY A;  4TSF G;  2LW1 A;  2A79 B;  2BCC H;  4MTO A;  3JAM N;  1VQL V;  4X20 B;  1AJQ A;  1SZX A;  2Q69 A;  4MVU A;  2IBZ H;  4JAV A;  4JYY A;  5A2Q N;  4UXN A;  2Q6A A;  5L3G A;  4JZG A;  1ORQ C;  3SJB C;  2EJ7 A;  2DYR B;  1AI6 A;  2QM7 A;  2UXX A;  4NVP A;  2R72 A;  4WBN A;  3JAL B;  3AEI A;  3ZMT A;  1THZ A;  4R50 A;  5EYP A;  4X9Q A;  2UUB O;  3EFF K;  1AR4 A;  3CP1 A;  4P30 A;  1H2S B;  3OD4 A;  2GTS A;  1IX9 A;  1Q3E A;  3RYF B;  5JH7 A;  2AHZ A;  3AK1 A;  1PNM A;  4MSW C;  1IBK O;  5LP6 A;  4DR7 O;  3OEE G;  5DN6 G;  4GKJ B;  2FYU H;  1AP5 A;  5EBL C;  3M8A A;  4YY3 O;  3L71 H;  1GMG A;  5EBW C;  1XRE A;  2LP7 A;  4BIZ A;  1NU1 H;  1JMK C;  3OR6 C;  3DGE A;  3A0R A;  2ZXW B;  1I94 O;  2WAM A;  1FFX A;  4U7O A;  1Q43 A;  3ZHR A;  4OX9 B;  1N8R W;  4PDL A;  3G6B A;  2YS8 A;  4QE9 A;  3TCU A;  1P4R A;  2X7R B;  3O9O A;  4G27 B;  1IDS A;  1XL6 A;  3STL C;  3SYC A;  4E4E A;  1H38 A;  1DF5 A;  1TVK B;  1KC8 W;  1F51 A;  1YDX A;  4IHJ B;  4P9P A;  1TUE B;  2YIA A;  1BQZ A;  1KP2 A;  4FPP A;  4IGG A;  3ZRW B;  3ABM C;  2YIB D;  3BHP A;  4AQY B;  3RWR D;  4PA4 A;  4XDJ A;  1OCR C;  2Y48 A;  4FJC C;  2Q9L A;  5C8Y B;  2Q7H A;  4J7J A;  1S76 D;  4EEQ A;  3B09 A;  1I7F A;  2JJ2 G;  4LFC B;  2YXY A;  2RNB A;  1WA8 A;  3K58 A;  2PYJ A;  5JCO C;  2HG5 C;  1GKF A;  2WLH A;  4UB8 Z;  1YTF B;  4DR6 B;  4NXN O;  4X1I B;  1ZSP A;  2HLD G;  4ZI7 B;  3B77 A;  5JJE B;  3HKC B;  5L3C A;  4DV5 O;  2PGG A;  2Y4T A;  3J81 N;  5CBG A;  3AG2 C;  3E8F A;  5IE9 A;  1H2K A;  3O65 A;  4FK5 C;  1EN5 A;  4CH5 A;  3H01 A;  3ETD A;  1EM1 A;  4DR4 O;  4TV9 A;  3A0B Z;  2CAZ C;  4DR3 B;  4J42 A;  3NXS A;  3CJH B;  4P9O A;  3ZHQ A;  1QR9 A;  3WB0 A;  4D6T H;  1S5J A;  2DYS B;  4YXW G;  2WA3 A;  1DTO A;  1K5Q A;  4PI0 A;  2JS3 A;  2XAG A;  1AI4 A;  2XAH A;  3TK1 A;  1UFI A;  1YJ9 V;  1Y76 A;  2V1D A;  3FB6 C;  2RDC A;  5ITZ B;  4BW9 A;  1EZV H;  2EIM B;  3L74 H;  4R6Z A;  4O4H A;  3UQ8 A;  4KL1 A;  4D7S A;  2QTS A;  1GM8 A;  4LCU C;  2A7W A;  2Q7G A;  4HAM A;  2UUB B;  2LGW A;  1BGY H;  4XBF A;  1D5N A;  4B3S O;  5CA0 B;  1BSM A;  2QWO B;  4ABM A;  4DV6 O;  2CTQ A;  3N27 A;  4N23 A;  4YJ2 A;  3C3S A;  5DM6 V;  5IYZ A;  4HNA A;  4BIO A;  5KHH A;  1GAX A;  4PD4 F;  3ABL C;  2X6A A;  2Y69 C;  4U3J A;  3HKB A;  4UV9 A;  2PYL A;  4MVS A;  5B1A B;  4FLZ A;  2NLJ C;  3ZBH A;  4MT8 A;  2QE7 G;  2PZS A;  3K57 A;  4DV1 O;  2Z5U A;  3ZMV A;  3SPC A;  4JI2 O;  3E86 A;  1S72 V;  1NI8 A;  5KAF Z;  3I5D A;  4NTY A;  1TUB B;  4TUY A;  2E3C A;  4B7E A;  1K33 A;  1SQX H;  3I55 V;  5JQG A;  4J7K A;  1AVM A;  2CDY A;  1Q6I A;  2RCV A;  4K8Z A;  3JAS B;  5EC2 C;  3CCV V;  1MSW D;  1VAR A;  3G6E V;  4F6R B;  4DR2 O;  2XOK G;  3LDE A;  3APQ A;  1WPB A;  1F7Y A;  3RYI A;  1VMG A;  3ZN0 A;  3UM7 A;  2IJH A;  1XEQ A;  2Q7E A;  1NBM G;  2P22 C;  1URF A;  5KAI Z;  4JI4 O;  1GTO A;  3THO A;  2YID A;  3MD0 A;  3OE7 G;  2EIK B;  4Q6G A;  1QLE B;  1DGS A;  2H3O A;  2EIJ C;  1SKV A;  5LHG A;  4FM2 A;  1XMQ O;  4DV2 O;  2E75 B;  1M93 A;  4ZHQ B;  5CA1 A;  4YHH O;  4MVO A;  2UU9 B;  4JI0 O;  2CK3 G;  1NR1 A;  2ZE8 A;  1N33 O;  4BW5 A;  4CH3 A;  1FKA O;  4DR4 B;  4F6E A;  3CCL V;  1QBZ A;  1SQG A;  3G4S V;  5IJ0 A;  5JVD A;  4JI3 O;  2YIC A;  3ZRS A;  3AG4 C;  1XUQ A;  1FJG O;  2Q0A A;  2K1E A;  1NS1 A;  2IU3 A;  5H2F Z;  4UCU A;  3UO2 A;  4FFB A;  4X1Y B;  2IJJ A;  5FLX N;  1EN6 A;  3TJT A;  2QTO A;  5B66 Z;  2HKO A;  2UXC O;  4O4J A;  3ZMU A;  2YDE A;  1YEW A;  1R6N A;  3BPZ A;  1GRJ A;  1FAF A;  5BXZ A;  2HHH O;  1AI7 A;  3H1L H;  2OCH A;  4KUM A;  3ZN1 A;  3SPJ A;  2Q5Z A;  4DV6 B;  1Z2G A;  4DV0 B;  4FZ1 A;  4I55 A;  3B4S A;  2ZR2 A;  3BA8 A;  1OJH A;  3B8M A;  1MZE A;  3K79 A;  3KZI Z;  4PJ0 Z;  4DW1 A;  2N04 A;  4A5U B;  2JEX A;  4W4L A;  1O9H A;  1OHH G;  3J80 N;  2VWK A;  2ZIM A;  3K04 A;  2BSK B;  4K0K B;  5KA5 A;  4UCR A;  1VQ5 V;  1FD9 A;  3SR2 C;  3TXQ A;  1N4C A;  1YHQ V;  4MTF A;  2UUA B;  3FB7 C;  3CMA V;  3D3Q A;  1W0J G;  2OYQ A;  3HKD A;  1YIT V;  2OCC B;  1RPR A;  4LWS B;  3ASO C;  1K73 W;  4R7C A;  3B2E E;  1VQN V;  4RAI A;  2B5U A;  1P7G A;  3T1H O;  2E76 B;  2IJI A;  2KB1 A;  4I9Q A;  3JCZ A;  4DR2 B;  3ZX6 A;  1FYJ A;  4LH7 A;  4I5S A;  5BY1 A;  4RUF A;  1N32 O;  3CCJ V;  3CCR V;  1QHT A;  4X20 A;  4RQF A;  4W4K A;  3ZED A;  1YI2 V;  4UVB A;  3ETE A;  1FXH A;  3ABM B;  4HYO A;  3M7M X;  3W7X A;  5L3B A;  2QWN B;  3OMA B;  4MVM A;  4PEL A;  4PI2 A;  1OCR B;  4X64 O;  2QEX V;  2O57 A;  1FFT B;  3JAL A;  4B3M O;  5LYJ B;  4HBN A;  4MTG A;  2IM9 A;  4UVC A;  3IFX A;  1XHX A;  3CCS V;  4UVA A;  3T1C A;  3QNE A;  1ARO P;  1I0H A;  3MDS A;  2AHY A;  1CXZ B;  4DR1 B;  4JYA B;  3OGI B;  1Y74 B;  5LMU O;  3RYF A;  2JEU A;  3JAR B;  3R65 A;  4JF3 A;  3M99 B;  4NXM O;  2PUS A;  4LBE C;  1YF2 A;  3QVN A;  2EZP A;  3ASN C;  1N33 B;  2BTQ B;  1JR9 A;  2JGD B;  5CMU A;  1VF5 B;  2D2C B;  2ZD9 A;  4LP8 A;  3AG2 B;  4QJF B;  2ZNJ A;  5L3F A;  1R3L C;  3K3W A;  3UCS C;  4UB6 Z;  3CD6 V;  4LFB O;  1J95 A;  4K8X A;  3E8B A;  3RYH B;  2HR3 A;  1DK1 A;  4UCV A;  3HKE B;  1VF6 A;  2GTA A;  4FLT A;  2VRZ A;  4J7Z A;  2Z3Y A;  5GON B;  1HNX B;  2WLI B;  4LF5 B;  2X0L A;  5B1O A;  1JJ2 U;  3LNM B;  1HW7 A;  3MHS C;  5JJN B;  5JJJ B;  1H8H G;  3APO A;  2YI9 A;  1TVK A;  4IHJ A;  4LNU A;  1AR1 B;  3E8H A;  2UXC B;  5HFL A;  2OTL V;  1CEZ A;  4EFB A;  1V54 C;  3ZRW A;  2YC0 A;  4KHP O;  4WFB V;  4J11 A;  4DW0 A;  3PN1 A;  1MMM A;  2CTW A;  1KQS U;  3CWB H;  5C8Y A;  2C2A A;  3AG1 C;  5K1P A;  5IWA O;  4FLY A;  2PI5 A;  4O2A B;  5KLV H;  2NN4 A;  3LSQ A;  2DQ3 A;  3MAQ A;  5CBF A;  2NR5 A;  3CRR A;  2FB5 A;  3CME V;  1RSO B;  1XOU A;  2LFS A;  2ODM A;  4PDR A;  2H8P C;  1V55 C;  1KKD A;  3AK3 A;  3ABL B;  2A0L A;  2Y69 B;  4X1I A;  1VQM V;  4ZI7 A;  1VQK V;  1RM1 C;  3HKC A;  2OTJ V;  3I56 V;  1N34 O;  3AG3 B;  3SJC C;  5KHG A;  2A06 H;  2YUA A;  3SJQ C;  1IBM O;  3FYE B;  3IAY A;  2QWQ B;  2YXL A;  5A9G A;  3OR7 C;  4DV7 O;  3FAV B;  3BVO A;  1VF7 A;  4RQE A;  4CS4 A;  2F93 B;  3CCM V;  3CJH A;  4JYB A;  2WA4 A;  3G71 V;  3DSQ A;  3P3N A;  2ZM6 O;  4H37 A;  3RGB A;  1SER A;  2ZNI A;  1PNK A;  2Q73 A;  3BAB A;  2GBO A;  3E22 B;  1VEW A;  1UPG A;  4X66 B;  3VQW A;  3CHX A;  1FXK C;  5E79 Z;  4CZZ A;  4LFA O;  1IBL O;  2HVK C;  1L8D A;  4X64 B;  4JI8 B;  1JA8 A;  3SYQ A;  5ITZ A;  3N2K B;  4CC6 A;  4JI6 O;  1AP6 A;  1GK9 A;  1G8M A;  2Q67 A;  4GZR B;  4QPK A;  3JYC A;  1X59 A;  4DYL A;  1XIL A;  4MVQ A;  1LUW A;  5CA0 A;  2ZDI A;  1AR5 A;  2XAF A;  4LF6 B;  2Y4U A;  1OCO C;  4B08 A;  1SQP H;  3K0D A;  4NXM B;  2YEV B;  2GUZ B;  4UFZ A;  4LNU B;  3GWK C;  1O9G A;  2WLL B;  3VQV A;  3ZIA G;  4E2L A;  4JV5 B;  3OUS A;  2P90 A;  1HNW O;  4JI5 B;  1HNZ B;  1SET A;  2FKX A;  3RW0 A;  4GUN A;  2VWJ A;  4JAA A;  1BHA A;  3JD3 A;  1NKD A;  1ZX3 A;  1TUB A;  3QO8 A;  3K5L A;  1S0V A;  3UT5 B;  2MW2 B;  2HEP A;  3LUT B;  3JAW B;  1OCC B;  3CC2 V;  3AG4 B;  4FLX A;  1BE3 H;  1R73 A;  4U7N A;  3JAS A;  2UUC O;  4JI1 O;  4IT5 A;  1PV0 A;  1KUQ A;  4F6R A;  1LNQ A;  1OZ0 A;  1K8A W;  4GX1 A;  1U97 A;  1S5L Z;  1L0N H;  4LF9 B;  1VIB A;  4I4T B;  2RJZ A;  3ABK C;  5CB4 B;  1H2M A;  3SGI A;  5LMN O;  1K97 A;  2K9P A;  1M56 C;  4ZOL B;  4IIJ B;  1JOY A;  5GW7 A;  2LFR A;  2HFE C;  3UO3 A;  2P5O A;  1LUV A;  1MOF A;  4I9W A;  4O2B B;  2ZKO A;  2EIN C;  3ZMS A;  1J5E O;  1G1X B;  2JVD A;  4JTD B;  5EK0 A;  4OXS A;  4NTW A;  4DXW A;  3QG5 A;  1N36 O;  3NR7 A;  1XMO O;  2XT9 A;  4ZHQ A;  1N34 B;  3SDL A;  2RQ6 A;  1B3Q A;  1SQV H;  4B3T O;  1JQ0 A;  1JFF B;  1KEC A;  3IC7 A;  4GX2 A;  3FKS G;  2XHB A;  2IJK A;  1EBO A;  2QSA A;  2EIL B;  3ASO B;  2ITD C;  4X88 A;  4UCO A;  1L0L H;  2EUL A;  2OT5 A;  1KMI Z;  2NNU A;  4UV8 A;  2WWW A;  4F4L A;  2KQX A;  3JAT B;  2ZM6 B;  4L87 A;  1NQT A;  4ZIB A;  5FPO A;  1VQP V;  3LNN A;  1IBK B;  4EB6 B;  4DR7 B;  2QDO A;  1M1K W;  1GH6 A;  1IXM A;  3ZHU A;  1PKX A;  2JIZ G;  1OCZ B;  3D3I A;  1M90 W;  4YY3 B;  4X1Y A;  3JD2 A;  4JAS A;  2QWP B;  1CPY A;  3ICX A;  2FL4 A;  2LW7 A;  4X62 O;  1WB7 A;  4QNH B;  1EZJ A;  4WF9 V;  1VQ8 V;  1PL0 A;  2QKC A;  1I94 B;  4NYK A;  5KUM A;  1SC5 B;  2ZIN A;  4D7T A;  1G4Y B;  1ZTE A;  4LF4 O;  1KU9 A;  1BS3 A;  2ARH A;  5E1A C;  2W6J G;  1QR8 A;  2EZO A;  2X6C A;  3JCU Z;  1QVG U;  3VQX A;  3E35 A;  4I0X B;  4TT3 G;  5B1B C;  1HR0 O;  2PY5 A;  1ZUQ A;  3VBB A;  2BSK A;  1K92 A;  4O4L B;  4JI7 O;  1QCE A;  3ASN B;  3F7V C;  4PHZ A;  2KG7 B;  4TWK A;  1RPO A;  1EN4 A;  1PP9 H;  2WPD G;  5L3E A;  5BR8 O;  4NB5 A;  2XAJ A;  3OTO O;  5BMV B;  3TET A;  4LWS A;  1SZT A;  4MS2 A;  1BZK A;  1MSD A;  2VQF O;  4DR5 O;  1I5Y A;  4YIO A;  5LGU A;  1K9M W;  5LHH A;  1NZ6 A;  3K06 A;  1Z5W A;  1UJW B;  5KMG B;  2UUC B;  4NXN B;  3WG7 C;  3JD0 A;  3VQY A;  4J9Y B;  2QKS A;  2QA4 V;  1Y66 A;  3OMI B;  3K5N A;  2F1M A;  3R66 A;  1K4D C;  4DV5 B;  2CE4 A;  1VF6 C;  1KKC A;  3RVZ A;  4B7K A;  1TGO A;  1WAZ A;  1V54 B;  3K08 A;  2YIB A;  4TQF A;  2UXB O;  4DV4 O;  1SQQ H;  4RWU A;  2Q4P A;  4WFH A;  2L35 A;  1F4M A;  1WPX A;  1VQO V;  1GM9 A;  2F43 G;  4LH6 A;  1A32 A;  3AG1 B;  3BCC H;  2DOS A;  3J7A U;  2F95 B;  1HP8 A;  5LYJ A;  3ZCC A;  2G38 A;  1NTK H;  3TGU H;  2CUG A;  4DRX B;  2V4D A;  4QPJ A;  2HJF C;  1V55 B;  1T5E A;  5JCO A;  1Y74 A;  4KP4 A;  1P7B A;  3FX7 A;  1YCI A;  3JAR A;  4J9Z B;  1RM1 B;  1AB3 A;  2E5L O;  4B3T B;  1B04 A;  2BTQ A;  3D36 C;  2JGD A;  3OTF A;  2LQT A;  3GB7 C;  5CN0 A;  5LXT B;  1XNR O;  2UXN A;  1Q6H A;  2Z0A A;  3OUF A;  4LF7 O;  3ZMZ A;  3K0G A;  3CXH F;  3W7S A;  1FPO A;  3STZ C;  2QM8 A;  1ZAU A;  3U10 A;  4B3S B;  3RYH A;  4GKK O;  5B3S C;  1MNG A;  3HKE A;  4DO2 A;  2JRI A;  5GON A;  2WLI A;  2ZCE A;  2XAQ A;  5J2T B;  3JAK B;  1GM7 A;  3K59 A;  2QJ1 A;  4KXR A;  4CBC A;  4BIU A;  2LGQ A;  3W7W A;  2UXD O;  1FXK B;  4DV1 B;  3L9D A;  2Y0P A;  5K1X A;  4JI2 B;  4MVR A;  3CPW U;  1D2D A;  1ZWI C;  4DUZ O;  4IYI A;  4BR6 A;  5LP6 C;  4X1K B;  4Z1V A;  4C7U A;  2QM4 A;  4O2A A;  3MHH C;  5IT9 N;  1QU7 A;  3BFR A;  1RSO A;  1M5I A;  4DK1 A;  4LC1 A;  4CS3 A;  5IJ9 B;  1B06 A;  2EJR A;  1OCO B;  3B8N A;  2R70 A;  3WU2 Z;  2DJV A;  2RMK B;  4TQD A;  3JSN A;  5KHI A;  3HPL C;  3K5O A;  4KFM A;  2ZDI C;  3L70 H;  3OTO B;  4K3A A;  5KA6 A;  2F4V O;  3UKM A;  1E79 G;  4DR5 B;  1TA8 A;  1JJO A;  3BRC A;  3DXR B;  2W6I G;  1AI5 A;  4JI4 B;  4X65 O;  1PL4 A;  1Y67 A;  5B1A C;  3FAV A;  3RN4 A;  2WSS G;  1M57 C;  4JTC B;  3CXC U;  1GN2 A;  4JPR A;  1K34 A;  4GKJ O;  1Q5O A;  2CH7 B;  2A3Q A;  1XMQ B;  4DV2 B;  3W7T A;  4YHH B;  1HDJ A;  1D5A A;  3E22 A;  4JI0 B;  2B1G A;  2LJ2 A;  1W2B U;  3OW2 U;  1U96 A;  2UXB B;  1XQ8 A;  3OAA G;  1NVP D;  3H1H H;  5KX5 B;  1SQB H;  4ICG A;  4MTX A;  3BY6 A;  5KUK A;  3OM3 B;  3N2K A;  4OX9 O;  1GN4 A;  3N2G B;  1SA0 B;  1S77 D;  1M4U A;  2QWR B;  2YSU B;  4JI3 B;  1YIJ V;  2V7Q G;  3S3W A;  3BA9 A;  2EIN B;  3U0Z A;  3PJS K;  1FJG B;  3ZJZ A;  1SES A;  1E1Q G;  2EBO A;  3A8T A;  3SYA A;  3L73 H;  2ADQ B;  1H2L A;  1WJZ A;  2YEV A;  3CRQ A;  4OPH A;  2GUZ A;  4J10 A;  5FNV B;  2ETN A;  1BL8 A;  1P49 A;  4I50 B;  3X2Q C;  3LSS A;  4GYC B;  2QKA A;  2BE3 A;  2WLL A;  1B6Q A;  5H5N A;  1CP9 A;  1RP3 B;  5LGN A;  3C3T A;  1JX9 A;  2HHH B;  3A0H Z;  4NR1 A;  2EIK C;  1QLE C;  3ZRV A;  3VOU A;  1YVW A;  5CA3 A;  2ITC C;  4DR6 O;  3KCX A;  3UT5 A;  2CGO A;  3K9A A;  4X89 A;  4G28 B;  3JAW A;  4MW3 A;  3K5M A;  5L3D A;  3Q4H B;  1VQ4 V;  1Z5V A;  1MAB G;  5H6Q A;  5KHK A;  1YZB A;  4P2Z A;  1VP7 A;  5LA6 B;  4CH4 A;  2BOC C;  1DLB A;  4Z1M G;  3OT7 A;  3P3P A;  1W59 A;  2ILM A;  4PV1 B;  3RT3 C;  4FLU A;  1Q82 W;  3EVK A;  3JD1 A;  2VS0 A;  4N21 A;  2OWO A;  1BMF G;  2AZ0 A;  4I4T A;  5CB4 A;  2Y0I A;  2ZE5 A;  3K03 A;  1F23 A;  4ZOL A;  5F2V O;  4IIJ A;  3EHB B;  5DEC A;  1XDC A;  3ABU A;  5H9C A;  2FML A;  2WLJ A;  3T1H B;  3SJA C;  4O2B A;  2JDI G;  4TV8 B;  3P32 A;  4QIW F;  3DTU B;  3E89 A;  3ZS8 C;  1N32 B;  2N05 A;  3QO5 A;  2R9R B;  4TOI A;  4XDL A;  2P7T C;  4AI8 A;  5B1B B;  1JVM A;  5LL6 Y;  1E1R G;  3HB3 B;  3SPH A;  2JGU A;  2D3O W;  1R3I C;  5EBM C;  5LOV B;  2F4V B;  2YI8 A;  5BZB A;  3CRA A;  1LR1 A;  2QGN A;  1JFF A;  1BHB A;  4X65 B;  4PDM A;  3LDC A;  4B3M B;  1IZ3 A;  1XI1 A;  3FB5 C;  2GV9 A;  1NH2 D;  4YJ3 B;  4OGQ B;  2CGN A;  1KBH A;  4H0L B;  2WLK A;  3JAT A;  3RYC B;  5LMU B;  5J2U B;  3T2M A;  3WG7 B;  1MG1 A;  2OCC C;  4EB6 A;  4WFG A;  5KHJ A;  2EIJ B;  3F5W C;  5EZY B;  3L72 H;  5H6R A;  4G2K A;  4GX0 A;  2HJD A;  3CCU V;  1WP7 A;  2VQE O;  2H94 A;  1XNQ O;  4GCZ A;  1OV9 A;  4XDK A;  3S3X A;  3H1I H;  3L75 H;  1VQ6 V;  4LFB B;  2JJ1 G;  4JYC A;  1XHZ A;  1R3J C;  4NTX A;  1P84 F;  4NKG B;  4PA7 A;  1WN7 A;  1DF4 A;  3AG7 A;  2GDS A;  4B3R O;  4FVM A;  4U3F H;  3ABT A;  1Y4M A;  2YXH A;  1AIL A;  2W0F C; 
#chains in the Genus database with same CATH homology
 2NR5 A;  2ODM A;  2GBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...