2ODMA

Crystal structure of s. aureus ylan, an essential leucine rich protein involved in the control of cell shape
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
79
Chain Sequence
ATMKNAALKQLTKDADEILHLIKVQLDNLCPLYEEVLDTQMFGLQKEVDFAVKLGLVDREDGKQIMLRLEKELSKLHEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords UPF0358 protein MW0995
publication title Crystal structure of S. aureus YlaN, an essential leucine rich protein involved in the control of cell shape.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 23
structure length 79
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07408 DUF1507 Protein of unknown function (DUF1507)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.750 Mainly Alpha Orthogonal Bundle Helix Hairpins SO2669-like 2odmA00
2NR5A 2GBOA 2ODMA
chains in the Genus database with same CATH superfamily
2GBOA 1PL4A 3QO5A 1K5SA 1KKDA 2G38A 3STZC 4UV9A 1RPRA 4DYLA 2DQ3A 2PY5A 2X0LA 4JYCA 1H2SB 4U3JB 4O4LA 3EVKA 4PDVA 3L74H 5LHHA 1Q7YW 4UVBA 1FJGO 1VQ4V 3WFVA 5IJ9A 4U3JA 5H5NA 3SPCA 1SKVA 2VWJA 4MSWC 4LFCB 4R50A 2EJ7A 2YC0A 3N2GA 2P4VA 1ZTEA 1W0JG 5KHJA 3J81N 1M1KW 3M7MX 1XEQA 4O4JA 3QNEA 4AQYO 3RYFB 2CE4A 5D5PA 2Y48A 2JGUA 4DR3B 1R3KC 2GTSA 4F4LA 1LNQA 3F5WC 4TT3G 1F7YA 3W7UA 3RYFA 4DR4B 4JI0O 5KHGA 3K5NA 2GSMB 1N32B 1K8AW 2QWRB 2ZNIA 1NKDA 4LFAO 2D3OW 1XREA 1YJWV 2QWPB 3CYOA 2VWKA 3F7VC 2V4DA 2Q5ZA 1YSCA 3S3XA 2QM8A 4WCEV 3IJ4A 2EILB 1SF9A 3CWBH 5KX5B 1Y6XA 4MW8A 3E22B 4EEQA 5BZBA 4J7JA 1IVSA 1R6NA 4TQDA 5L3BA 1U97A 4RO2A 3K06A 2EZPA 3BRCA 2XAQA 1FPOA 4CS2A 1DTOA 3T1CA 4EKWA 4TV8B 1XHXA 1N0NA 5D5QA 4DO2A 3B09A 1IBKO 3FB5C 1OV9A 2EIMC 3RYIB 4TQFA 1JPXA 4CH4A 4CZZA 4NTYA 1Q3EA 2LFSA 3RYIA 1NH2B 2QM7A 1XNQB 2XTAA 2ZXWB 4DR1O 1KMIZ 1AJNA 5KAFZ 4LF4O 1MSDA 5EIBD 3K5MA 4PA9A 5FNVA 2XAFA 1GKFA 4DUYB 4OPHA 1Z5WA 4FK5C 3OMIB 2N05A 3ZMUA 1K34A 1SQFA 1JFFA 1NQTA 1RP3B 2AW9A 4W4KA 2IU0A 1K4CC 3AG7A 4LFCO 2EIJB 2WLIB 3JAWA 1PNKA 1K9MW 1VMGA 3G80A 4DR3O 4MVQA 1AI7A 3ZIAG 1FXKB 3ZCCA 1EN5A 4DR4O 1N32O 1OCOC 2XUMA 1V55C 2F95B 3CRRA 1WP7A 3L73H 5TISZ 2WSSG 4JYYA 4UCUA 1Q6HA 4H13B 4JF3A 2F43G 1YF2A 1Q6UA 1H2NA 3K9AA 3OGIB 1K97A 1YZBA 5IY5B 5GTIZ 5JCOC 4D6TH 2Y69C 1UJWB 1AP5A 2P4KA 4OXSA 2QM4A 3JATA 5KAIZ 1K3EA 5FL7G 4CBCA 3D8CA 1XI1A 1VQLV 3CCQV 2H3OA 2CDYA 3ZHQA 2ATKC 3ZJZA 4KL1A 4IIJB 2ZQMA 1W2BU 3UO2A 1XNQO 3K03A 3ZX6A 1ZAUA 2WA3A 3BVOA 2UXDB 2DYRB 3P3PA 1QBZA 3TCUA 4P9OA 4Z1MG 4OX9B 1Q8IA 4DUYO 3BFRA 3ABKB 2F1MA 2DJVA 2HJFC 5LP6B 3P30A 1H8EG 3VQYA 3BA9A 1S77D 4WFBV 5LP6A 3LUTB 4LC1A 2IJHA 2GDSA 5BXZA 3B4SA 5CA0A 3ZMTA 4UV8A 4P30A 5IYZB 3DC6A 5E79Z 2O57A 4KHPB 3D36C 4B7KA 1H2KA 4J9YB 4X1IA 4LH7A 5DM6V 5IYZA 3K59A 5DN6G 2QWQB 3FB7C 2LGQA 3CJHB 4DR2B 1YEWA 3AK1A 2YSUB 4LP8A 3OR6C 3N27A 3E2EA 4TWKA 5FLXN 4LF8B 2BE3A 1RPOA 1DF5A 5KLVH 3JCUZ 4J7ZA 1FD9A 1D2DA 4YJ3B 3DGEA 4GYCB 3E8GA 4OGQB 1L0LH 3AG3B 4DK1A 2EIKB 2JJ2G 4JV5B 1Y74A 4WFHA 1SA0A 1FFXB 4FLXA 3E83A 4IGGA 5EBWC 5A2QN 2KG7B 2PGGA 1FFXA 1MA1A 4F6EA 3UKMA 3NXSA 2KG7A 5J9PC 4YIOA 4FM0A 5CB4B 4FLTA 1LR1A 3M8AA 2D2CB 3BEHA 1BHBA 1O9GA 2HR3A 4UXNA 1I5XA 5CB4A 3E8BA 2QR4A 5ITZB 2P6JA 4UCTA 2WLMA 3UT5B 2GV9A 2A79B 2QGNA 2IJKA 5B5EZ 5ITZA 2P67A 4D7SA 4DV3B 2YUAA 2HKOA 2B5UA 4CS3A 3CXCU 5B1NA 3Q4HB 1A32A 3W7TA 4FVMA 4TSFG 2UXDO 3N2KB 3CX5F 1S0VA 4XDLA 1M56C 4TUYB 4OX9O 2JEXA 3Q4HA 3IC9A 2R70A 5IDJA 1EM1A 3OTFA 4K8XA 3F7YC 2ZT9B 1LUWA 1GN3A 5IT9N 2C2AA 3SYQA 3DC5A 2P22C 4U3FH 2R9RB 2Q73A 1AJPA 2KB1A 4TOIA 5EBLC 5CBGA 2JGDA 4EFEA 4DV5B 3CC2V 1SERA 1JR9A 2EBOA 1NTKH 4IHJA 1URFA 4DXWA 5LHGA 4KHPO 1CP9A 1VQPV 5LA6B 2YI9A 4AILC 4ZOLB 1PNMA 2ZR3A 1JJ2U 3MHSC 3ABLB 4DR2O 5LA6A 1NS1A 2EIJC 4XDKA 3K3WA 5H2FZ 1H38A 2NN4A 1SZXA 1V54C 1GN2A 2FMLA 4YJ2B 4LF8O 4MS2A 1KB9F 1GRJA 4X9QA 4YJ2A 3CRCA 3JALB 1PD3A 4NVPA 2UXNA 3C3TA 1FXKC 4BWAA 5CA3A 1P49A 5IJ0A 3HKEB 2CTQA 5BMVB 1G4YB 4FLZA 4JV5O 2JS5A 3RN4A 2OCCB 1VQ8V 1MSWD 3JCZA 4JGSA 1PL0A 2XT9A 4J42A 4FFKA 1PV0A 3JSLA 4K35A 3ZHRA 5LMNB 2OIGA 1WB8A 1XNRB 3OEHG 3OUSA 2HG5C 4O2AA 5LBQA 2ZD9A 5LGTA 5J2UA 3R66A 1F23A 4NKGB 4JPRA 1KP2A 3ABTA 2FL4A 4DV3O 5B1AB 4YIPA 5KHIA 1NU1H 5JJNB 2E75B 2QKCA 2DE0X 1COWG 3SDLA 2X7RB 2YDEA 3OUFA 4UB8Z 1TGOA 1Q81W 4I9QA 4KP4A 2LP7A 1YXBA 3FYIB 4CH3A 1O9HA 2YICA 3WB0A 4DV2B 2P7TC 1SQXH 1AI6A 4LF9B 4LNUB 1VF6A 3I5DA 3QTCA 3RWRD 4ZHQB 3K5LA 1KD1W 4Q20A 1UFIA 4LNUA 2BSKB 4EB6B 3ZEDA 4JAUA 1EBOA 3ABKC 2BSKA 1P84F 2W6JG 3ETDA 1HNWB 3T1HB 3VBBA 2AGAA 3ZHTA 2WLLB 3FFQA 1BSMA 3STLC 3IFXA 1RM1B 4FFBB 1QQCA 3VOUA 2WLLA 4PI2A 3C3SA 4DR5B 1ZL8B 4QGPA 1GH6A 1YJNV 2IBZH 3ZRSA 4H33A 3HKDB 5B1BB 1K5QA 2R72A 1KECA 2X6BA 4MTGA 3TETA 2Z5UA 5GTHZ 3QVNA 2JIZG 3A8TA 2OIEA 2FYUH 4B3MB 2ZR2A 3UM7A 1IXBA 1TAEA 4FZ0A 3IAYA 1R3IC 3JD4A 3A0BZ 2Q4PA 3WB2A 4O4LB 1B04A 1B3QA 4MVUA 2Y0PA 5LMNO 2EIKC 2QSAA 5IJ9B 4X8AA 2JK5C 2PYLA 1XNRO 4YXWG 4J10A 4KFMA 2AXTZ 3N2GB 2CTWA 4JAAA 4O4JB 4WFEA 1YIJV 1L8DA 4RQFA 1WPXA 2WPDG 3K0DA 3SPHA 1XHZA 5LGNA 4I50A 2YIBA 1BCCH 1T5EA 3FYEB 4LF6B 4DV2O 2IH1C 3GWOA 3ZHUA 1M93A 1N8RW 2UUCB 4BIUA 3UCSC 4NXNB 5E1AC 2Q7EA 1XUQA 3L9DA 3T4DA 3W7WA 1L1FA 1DK1A 3RYCA 2ZDIC 2PI4A 4B7EA 1GAXA 2Q68A 3BY6A 4I9WA 5LXTB 1GN4A 1SC5B 2QKAA 2X6CA 1VARA 4MVZA 3SPIA 1AB3A 1XDCA 1M57B 1OCZC 3SYCA 5LXTA 3SJQC 4GX2A 4RAIA 1XMQB 3RFRA 1HNWO 3OR7C 3T1HO 1AP6A 4JI5B 5J2TA 3B8MA 2ZIMA 2L6LA 2K9PA 1SETA 4F6RB 4JTDB 3E8FA 3JAKB 4DR5O 4H0LB 1QCEA 4U7OA 2YI8A 4F6RA 4JTAB 2RJZA 3C90A 3LDEA 3JAKA 5L3CA 4O4IA 4GT1A 4IYIA 3ABLC 3T1YB 4XDJA 3H1KH 4QJFB 1EN4A 4B3MO 3LNNA 5FNVB 5KA6A 4H44B 3ASNC 2AZ0A 4UVCA 5HFMA 3D3QA 3KCYA 1JFFB 3E86A 4OPAA 5L3DA 1NI8A 3JD2A 1GM9A 4FIPC 1LUVA 3SPJA 1QLNA 4FJCC 3B40A 1I08A 2OCCC 2LJ2A 3H01A 4ZIBA 2ITDC 1QR9A 3AK3A 3JAWB 2DYSB 5EIBC 5HFLA 1R3JC 4IL6Z 3EXAA 4W4LA 2XAHA 1BT8A 3RT3C 2W0XA 1BL8A 3JD3A 4MTXA 1YCIA 1Z5VA 3JD0A 4PDRA 3DXRA 5EBMC 3JARB 3LSSA 4K0KB 4P9PA 4LF6O 4NXMB 5KHHA 3VQWA 1MZEA 1W0KG 3AG4C 2ZKOA 4DV4B 3JARA 5B1AC 3H1IH 2RN9A 2UUCO 3AG2B 4NXNO 1BS3A 3HB3B 3U0ZA 4MVSA 1JX9A 4B3RB 2WWWA 5KMGB 3RBZA 2EJRA 2H8PC 1FFTB 3MHHC 3RGBA 5LOVA 5KMGA 4TV9B 4DW1A 2Q6AA 4UCOA 2Q0OC 1XMQO 2PF4E 4JI5O 4TV9A 3JATB 1VEWA 4DR6B 1SQVH 4BW5A 1QNMA 3ZBHA 1PKXA 2EINB 1WPBA 4PA6A 1ORQC 1NJIW 1EZVH 2B9ZA 1QU7A 1SRYA 3K58A 2DWEC 4NTXA 4NYKA 2XOKG 4UVAA 5C93A 2JS3A 1RM1C 3OMNB 3T1YO 4X1KB 2HFEC 3QO8A 3FAVA 2N04A 4X1KA 1AI5A 1VF5B 1CXZB 3WG7B 1TVKB 1M9NA 4I55A 4K8ZA 3LSQA 3KZIZ 1I7FA 1S72V 1OCRB 1TVKA 1XBLA 5L3EA 4FLVA 4MVRA 5B1OA 5H6RA 3X2QB 4NTWA 4KUMA 3P3NA 2HVKC 1ZLZA 5EZYA 1RSOA 4QE9A 2YIBD 5CA0B 2A06H 1RFYA 1N0JA 1VF7A 3E89A 1N33B 4X1IB 5GW7A 4GX5A 4WFGA 1EN6A 1THZA 4HBNA 3T2MA 2LW7A 4DK0A 3SYAA 4X64B 5H6QA 1H8HG 2R9IA 3ZN1A 3CCSV 3MD0A 5B3SB 4QPKA 1D5AA 4K0KO 3G6BA 2IJIA 4B3TB 4NXMO 1GMGA 4DV4O 1TUBB 3SYOA 4D7TA 2E3CA 1QHTA 3TXSA 2P06A 4DR7B 4QNHB 1TUBA 4X66B 5EC2C 4B3RO 2ZE7A 5K1XA 1Y74B 1SA0B 1YITV 1HR0B 2IJJA 5CMUA 4PHZA 3ABMB 4RUFA 4B08A 2EILC 3CC7V 3BHPA 4PD4F 1BQ0A 4DR6O 1H2LA 4P2ZA 5JJEB 1MMMA 1S76D 2QDOA 5IYBO 1MZFA 4JI1B 1OCCB 1WA8A 4PJ0Z 5LYJB 2CH7B 4HYOA 3D3IA 3SJBC 3H1JH 3FB6C 1FXVA 2OTLV 3B77A 5LYJA 4G2KA 2CH7A 1ENVA 1HP8A 4ASUG 5JJJB 2YIAA 2ITCC 4H37A 2DOSA 4GX1A 1KKCA 4FLYA 1N36B 3ZRXA 2FKXA 4Q6GA 3LNMB 2RDCA 2JGDB 2VQFB 2ZXWC 4UUJC 4X1YB 2LO1A 4DW0A 1R73A 4Z2WA 2CTPA 4X1YA 3FB8C 3U11A 1L0NH 2NNUA 2A7WA 4IHJB 2ZDIA 4J41A 2MW2B 1N33O 1SQBH 1FXHA 3GWKC 3UO3A 2CGOA 3HPLC 4HAMA 2K1EA 1VQMV 2CTRA 2XHBA 3HKBA 2ETNA 3ZHVA 1U96A 3CPWU 3EFFK 1M5IA 3OE7G 1YDXA 2WA4A 1SS3A 2DYSC 3APQA 3CCLV 2Q0AA 3L75H 2UUBB 1WAZA 1N34B 4PA3A 3OAAG 4I7ZB 5IJ0B 1Q90D 2EIMB 4DR7O 1NBMG 4X66O 1WB7A 1XQ8A 1XL6A 4FZ1A 1IBLB 2OCHA 1CEZA 3SJCC 3TGUH 1S5HC 3OM3B 1HR0O 3RVYA 3AG2C 3OGCC 1Q86W 3CE2A 4JI6B 2FTKA 1K4DC 4NB5A 2CK3G 1IX9A 1FKAO 1WNSA 1Z2GA 2OWOA 1IURA 4O2AB 3TK1A 2IH3C 4BIZA 2ZINA 4JI1O 5J2UB 2Q9LA 5IY5C 3LDDA 2CAZC 3A2FA 4I5SA 4O2BB 1Y76B 2NLJC 4O2BA 1Y76A 2QTOA 3OT7A 2ZE5A 4ZBMA 2QA4V 3M99B 4JAVA 3T4ZA 2DMXA 2Q7GA 1N36O 2GUZA 1IZ3A 1NR7A 3ETQA 1B06A 4GX0A 4CH5A 1BMFG 2HP8A 1K33A 2VQFO 4PI0A 1V55B 3OW2U 2Q7HA 4E4EA 2F4VB 3W7SA 2F66C 4GUNA 4QIWF 1Q82W 2DYRC 2YEVA 4LF5B 1YVWA 2AHZA 2GHYA 2L35A 3DSQA 3WG7C 3CCEV 4UB6Z 4DV5O 4JI0B 4UFZA 2JDIG 2LW1A 2NR5A 3CMEV 1YHQV 3CXHF 3JYCA 5LP6C 3AK2A 1I0HA 1BE3H 3O9OA 3CRMA 1YTFB 1JCHA 3L72H 2B1GA 1WP8A 1MABG 2Y69B 4X88A 4DV0B 5JCOA 1UPGA 4EFBA 4WFFA 2PTMA 5EK0A 5L3FA 2F23A 2UUBO 1SQGA 4CH6A 1N34O 3VQVA 1ZUQA 2E5LB 5B3SC 1GO3F 1IBLO 3RYHA 4K3AA 1JVMA 2RMKB 5JQGA 1Q43A 1VQNV 5H9CA 2HHHB 1WJZA 4X20A 4JI6O 4QE7A 4DV7B 3I56V 4QPJA 5EYPB 1M90W 5FPRA 3HKCB 3AG3C 1P7GA 3CSXA 5LMUB 5EYPA 1SQQH 1GM8A 2UXBB 3HKCA 3SJAC 1BGYH 4LF4B 3ABMC 4N21A 1BZKA 2WLJA 2CGNA 2KSDA 4PA7A 5LHIA 4BAYA 4LH6A 2OTJV 4I50B 1AR4A 1VIBA 1AI4A 3L70H 2DW4A 5DEDA 3B8NA 4LF7B 4WBNB 1BHAA 1OCCC 4G27B 1TUEB 3IC7A 4L87A 4XBFA 5L3GA 1YI2V 4FLWA 5LL6Y 4JI8B 1SESA 2ZE6A 2ZCEA 3E35A 4WBNA 2ARHA 3D36A 3FKSG 3CS5A 2HEPA 5JVDB 2XNDG 3ABUA 3RYCB 4LF9O 4FPPA 2GTAA 3A0HZ 5JVDA 1QLEB 3L71H 4CC6A 2F4VO 5B66Z 1AJQA 3J7AU 1ZX3A 3BPZA 1FS0G 3CC4V 4LF5O 1V9PA 2ZM6B 4JI7B 4JYAB 3OTOB 2FB5A 2RQ6A 1NVPB 2Q69A 3B2EE 3KG2A 4B3SB 4HZ3A 4BR6A 3JASB 5J2TB 5KUMA 2X6AA 2JJ1G 1KP3A 1I5YA 4UCSA 5IYDO 3ML0A 4LBEC 2P90A 5C8YB 3JASA 3QG5A 1HDJA 3IGAC 5A9GA 4ZKIA 3TXQA 1IXMA 2AHYA 2W6IG 5C8YA 4DV0O 3CRQA 1JA8A 1AVMA 2E74B 5FPOA 5KX5A 4O4IB 3E8HA 4YY3B 3E22A 2BOBC 1PP9H 1GTOA 4AHCA 2ADQB 4JYBA 2IW5A 2E5LO 1NZ6A 1E1RG 1ZWIC 2HJDA 2WLKA 2M7WA 1AILA 4I4TB 3BA8A 1NR1A 3J80N 1Y4MA 4TV8A 2UXXA 4I4TA 2HHHO 4JASA 2BTOA 1M56B 3I55V 4DV7O 4GKKB 1S3JA 1H2MA 1KBHA 1US6A 1X59A 2XASA 2Z0AA 5LMUO 1SQPH 1G6UA 4GZRB 2W0FC 2UXBO 3JAMN 2KQXA 1P4RA 2UUAB 1AR5A 3NR7A 1G1XB 4LWSB 4MVMA 3H1LH 4FMTA 2YIDA 3DXRB 4RUEA 4LF7O 4LWSA 2BTQB 3AEIA 3BCCH 3QF7A 1DF4A 5IWAB 4JI8O 3ZN0A 2BTQA 4GCZA 3OFNG 4DV6B 5KHKA 3SGIA 1V54B 4MTOA 5GONB 1R6TA 2WLIA 1KYOF 2QWOB 4C7UA 1VQ9V 2ZM6O 1VQOV 5LOVB 4JI7O 3ZMSA 3CMAV 5GONA 4JYAO 3OTOO 1YTFD 4X89A 1VF6C 2UXCB 2A3QA 4B3SO 2JEUA 5BY1A 1FXKA 1R3LC 4BIOA 4JZGA 4ZI7B 2DN9A 1VQKV 3CCRV 2BOCC 5DECA 2R9AA 2F93B 4ZI7A 2H94A 1PNLA 2AZ2A 4ABMA 4DRXB 3CCJV 1P7BA 3FD9A 2Y4UA 2EZOA 4YY3O 1D5NA 4UCRA 4DRXA 2IM9A 1AR1B 2ADPA 2QKSA 3FAVB 2QTSA 1MOFA 2HVJC 1OZ0A 2RNBA 1KC8W 4R6ZA 4MTFA 3MDSA 1GM7A 5IYCO 4I55B 1VQ6V 1JMKC 5B1BC 4HNAB 3GVMA 2LGWA 3KCXA 3WU2Z 3DTUB 3ASOB 4GKKO 3K5OA 4HNAA 4FM1A 5EZYB 1RSOB 4IT5A 1M4UA 2ILMA 4JI2B 4IIJA 4N23A 4YHHB 2PI5A 3SR2C 2QE7G 2DQ0A 2ZNJA 4PA4A 1K92A 2UUAO 1DLBA 2WLHA 4UCVA 2Q8VA 4R8CA 1HW7A 4JTCB 3SYPA 4PV1B 1NT2B 4E2LA 3UQ8A 5IWAO 3H1HH 1VQ5V 1JQ0A 5CN0A 1MG1A 4GKJB 3BAAA 4DV6O 5LGUA 3AG1B 1NVPD 3VQXA 4X65B 2DWDC 3P32A 4R7CA 2OT5A 5BR8B 1GK9A 2QEXV 1R6KA 2UXCO 1K73W 5F2VO 3CJHA 3O65A 4J7KA 3TJTA 4CS4A 1JJOA 2PUSA 4PDMA 1QLEC 1WN7A 3CHXA 2EULA 1X4TA 2HLDG 3KKYA 5EC1C 4L8JA 5JH7B 2YXYA 1WA8B 3OD4A 1M57C 4YJ3A 4LCUC 5JH7A 4JI4B 3MAQA 2VS0A 5IE9A 1OJHA 4A5UB 3ZMVA 4IYHA 3R65A 4Z1VA 3CCUV 4CC5A 2VQEB 1F51A 1R1BA 3K79A 3ZRWB 1EZJA 3JSNA 4U7NA 1NTMH 1ROPA 2A0LA 1F4MA 3ZRWA 1E79G 1J5EB 1CPYA 2A9HA 4BW9A 1IDSA 1NH2D 2MK3A 3PJSK 3PN1A 4LR3A 4WFAV 5CBHA 4MVOA 1K7DA 4X62B 3LDCA 3JD1A 3UT5A 2QJ1A 4DV1B 1N4CA 4JI2O 4YHHO 1DGSA 3ZS8C 4RQEA 4O4HB 3ZHSA 2VRZA 3FX7A 1E1QG 1HNXB 3N2KA 4PDLA 1HWYA 1OCZB 4O4HA 4LFBB 4TUYA 3HKBB 3CCMV 3RVZA 3S3WA 4MW3A 4X64O 4I0XB 3CRAA 2KKWA 1S5LZ 1Y66A 5CA1B 4B3TO 4GKJO 2BCCH 4I0XA 1Q5OA 2UU9B 2PZSA 1HNZB 4DUZB 5CA1A 4X65O 4J80A 2B1IA 4NR1A 2JVDA 3CEIA 4KXRA 3ETGA 2EX3A 1VQ7V 4PELA 4FLUA 3G71V 3ZRVA 5BR8O 4AI8A 1PPJH 3G4SV 2ZIOA 3ETEA 4FM2A 4ZOLA 1S5JA 2N74A 3K0GA 3BABA 1XMOB 1I94B 3RW0A 2WAMA 1IBMB 3WB1A 2ZE8A 1ZSPA 3ASNB 1XOUA 1QR8A 2YS8A 4J11A 2Q67A 1FYJA 2XAJA 2ODMA 3JALA 1EFRG 5AG2A 4JI3B 4JI4O 1F4NA 1MNGA 3HKEA 1WLEA 1YJ9V 3H9VA 2QWNB 5BMVA 2V1DA 1SZTA 3QO7A 2VQEO 2EINC 1H2GA 3HR0A 4J9ZB 1VP7A 5KUKA 1FJGB 2GUZB 1J5EO 2WLNA 3THOA 1G8MA 1XILA 2RCVA 1Q6IA 3ZMZA 2OYQA 2YXLA 2Y4TA 1B6QA 4X62O 1OCOB 3AG4B 2YEVB 2PYJA 2V7QG 4GLXA 4DV1O 4AQYB 1NTZH 1J95A 5KA5A 3K04A 4ICGA 3K9SA 1KU9A 2LQTA 3EHBB 3OEEG 3ASOC 1KQSU 1OCRC 1HNXO 4LFAB 3X2QC 4LFBO 2LFRA 1AROP 1JOYA 3APOA 2E76B 5JWPA 4ZHQA 2JRIA 3U10A 2Y0IA 4WF9V 1QVFU 3CB2A 3OMAB 1PM9A 4EB6A 2UU9O 1HNZO 2CUGA 4DUZO 1TA8A 3ICXA 2IU3A 3F5TA 1QVGU 3K57A 1OHHG 3SPGA 3RYHB 4RWUA 3G6EV 5JQGB 4G28B 4JZ2A 1BQZA 3G67A 3CD6V 1Y67A 4X20B 3LSUA 1GN6A 3AG1C 1XMOO 4FFBA 1I94O 2XAGA 1IBKB 1XL4A 1ZL8A 1IBMO 5CBFA 3GB7C 4MT8A 2M6YA 3HKDA 3K08A 1KUQA 3CCVV 3W7XA 1FAFA 1W59A 3CP1A 2Z3YA 2YXHA 4DR1B 2P5OA 3A0RA 4JI3O 5K1PA
chains in the Genus database with same CATH topology
2NR5A 2GBOA 2ODMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NR5 A;  2GBO A;  2ODM A; 
#chains in the Genus database with same CATH topology
 2GBO A;  1PL4 A;  3QO5 A;  1K5S A;  1KKD A;  2G38 A;  3STZ C;  4UV9 A;  1RPR A;  4DYL A;  2DQ3 A;  2PY5 A;  2X0L A;  4JYC A;  1H2S B;  4U3J B;  4O4L A;  3EVK A;  4PDV A;  3L74 H;  5LHH A;  1Q7Y W;  4UVB A;  1FJG O;  1VQ4 V;  3WFV A;  5IJ9 A;  4U3J A;  5H5N A;  3SPC A;  1SKV A;  2VWJ A;  4MSW C;  4LFC B;  4R50 A;  2EJ7 A;  2YC0 A;  3N2G A;  2P4V A;  1ZTE A;  1W0J G;  5KHJ A;  3J81 N;  1M1K W;  3M7M X;  1XEQ A;  4O4J A;  3QNE A;  4AQY O;  3RYF B;  2CE4 A;  5D5P A;  2Y48 A;  2JGU A;  4DR3 B;  1R3K C;  2GTS A;  4F4L A;  1LNQ A;  3F5W C;  4TT3 G;  1F7Y A;  3W7U A;  3RYF A;  4DR4 B;  4JI0 O;  5KHG A;  3K5N A;  2GSM B;  1N32 B;  1K8A W;  2QWR B;  2ZNI A;  1NKD A;  4LFA O;  2D3O W;  1XRE A;  1YJW V;  2QWP B;  3CYO A;  2VWK A;  3F7V C;  2V4D A;  2Q5Z A;  1YSC A;  3S3X A;  2QM8 A;  4WCE V;  3IJ4 A;  2EIL B;  1SF9 A;  3CWB H;  5KX5 B;  1Y6X A;  4MW8 A;  3E22 B;  4EEQ A;  5BZB A;  4J7J A;  1IVS A;  1R6N A;  4TQD A;  5L3B A;  1U97 A;  4RO2 A;  3K06 A;  2EZP A;  3BRC A;  2XAQ A;  1FPO A;  4CS2 A;  1DTO A;  3T1C A;  4EKW A;  4TV8 B;  1XHX A;  1N0N A;  5D5Q A;  4DO2 A;  3B09 A;  1IBK O;  3FB5 C;  1OV9 A;  2EIM C;  3RYI B;  4TQF A;  1JPX A;  4CH4 A;  4CZZ A;  4NTY A;  1Q3E A;  2LFS A;  3RYI A;  1NH2 B;  2QM7 A;  1XNQ B;  2XTA A;  2ZXW B;  4DR1 O;  1KMI Z;  1AJN A;  5KAF Z;  4LF4 O;  1MSD A;  5EIB D;  3K5M A;  4PA9 A;  5FNV A;  2XAF A;  1GKF A;  4DUY B;  4OPH A;  1Z5W A;  4FK5 C;  3OMI B;  2N05 A;  3ZMU A;  1K34 A;  1SQF A;  1JFF A;  1NQT A;  1RP3 B;  2AW9 A;  4W4K A;  2IU0 A;  1K4C C;  3AG7 A;  4LFC O;  2EIJ B;  2WLI B;  3JAW A;  1PNK A;  1K9M W;  1VMG A;  3G80 A;  4DR3 O;  4MVQ A;  1AI7 A;  3ZIA G;  1FXK B;  3ZCC A;  1EN5 A;  4DR4 O;  1N32 O;  1OCO C;  2XUM A;  1V55 C;  2F95 B;  3CRR A;  1WP7 A;  3L73 H;  5TIS Z;  2WSS G;  4JYY A;  4UCU A;  1Q6H A;  4H13 B;  4JF3 A;  2F43 G;  1YF2 A;  1Q6U A;  1H2N A;  3K9A A;  3OGI B;  1K97 A;  1YZB A;  5IY5 B;  5GTI Z;  5JCO C;  4D6T H;  2Y69 C;  1UJW B;  1AP5 A;  2P4K A;  4OXS A;  2QM4 A;  3JAT A;  5KAI Z;  1K3E A;  5FL7 G;  4CBC A;  3D8C A;  1XI1 A;  1VQL V;  3CCQ V;  2H3O A;  2CDY A;  3ZHQ A;  2ATK C;  3ZJZ A;  4KL1 A;  4IIJ B;  2ZQM A;  1W2B U;  3UO2 A;  1XNQ O;  3K03 A;  3ZX6 A;  1ZAU A;  2WA3 A;  3BVO A;  2UXD B;  2DYR B;  3P3P A;  1QBZ A;  3TCU A;  4P9O A;  4Z1M G;  4OX9 B;  1Q8I A;  4DUY O;  3BFR A;  3ABK B;  2F1M A;  2DJV A;  2HJF C;  5LP6 B;  3P30 A;  1H8E G;  3VQY A;  3BA9 A;  1S77 D;  4WFB V;  5LP6 A;  3LUT B;  4LC1 A;  2IJH A;  2GDS A;  5BXZ A;  3B4S A;  5CA0 A;  3ZMT A;  4UV8 A;  4P30 A;  5IYZ B;  3DC6 A;  5E79 Z;  2O57 A;  4KHP B;  3D36 C;  4B7K A;  1H2K A;  4J9Y B;  4X1I A;  4LH7 A;  5DM6 V;  5IYZ A;  3K59 A;  5DN6 G;  2QWQ B;  3FB7 C;  2LGQ A;  3CJH B;  4DR2 B;  1YEW A;  3AK1 A;  2YSU B;  4LP8 A;  3OR6 C;  3N27 A;  3E2E A;  4TWK A;  5FLX N;  4LF8 B;  2BE3 A;  1RPO A;  1DF5 A;  5KLV H;  3JCU Z;  4J7Z A;  1FD9 A;  1D2D A;  4YJ3 B;  3DGE A;  4GYC B;  3E8G A;  4OGQ B;  1L0L H;  3AG3 B;  4DK1 A;  2EIK B;  2JJ2 G;  4JV5 B;  1Y74 A;  4WFH A;  1SA0 A;  1FFX B;  4FLX A;  3E83 A;  4IGG A;  5EBW C;  5A2Q N;  2KG7 B;  2PGG A;  1FFX A;  1MA1 A;  4F6E A;  3UKM A;  3NXS A;  2KG7 A;  5J9P C;  4YIO A;  4FM0 A;  5CB4 B;  4FLT A;  1LR1 A;  3M8A A;  2D2C B;  3BEH A;  1BHB A;  1O9G A;  2HR3 A;  4UXN A;  1I5X A;  5CB4 A;  3E8B A;  2QR4 A;  5ITZ B;  2P6J A;  4UCT A;  2WLM A;  3UT5 B;  2GV9 A;  2A79 B;  2QGN A;  2IJK A;  5B5E Z;  5ITZ A;  2P67 A;  4D7S A;  4DV3 B;  2YUA A;  2HKO A;  2B5U A;  4CS3 A;  3CXC U;  5B1N A;  3Q4H B;  1A32 A;  3W7T A;  4FVM A;  4TSF G;  2UXD O;  3N2K B;  3CX5 F;  1S0V A;  4XDL A;  1M56 C;  4TUY B;  4OX9 O;  2JEX A;  3Q4H A;  3IC9 A;  2R70 A;  5IDJ A;  1EM1 A;  3OTF A;  4K8X A;  3F7Y C;  2ZT9 B;  1LUW A;  1GN3 A;  5IT9 N;  2C2A A;  3SYQ A;  3DC5 A;  2P22 C;  4U3F H;  2R9R B;  2Q73 A;  1AJP A;  2KB1 A;  4TOI A;  5EBL C;  5CBG A;  2JGD A;  4EFE A;  4DV5 B;  3CC2 V;  1SER A;  1JR9 A;  2EBO A;  1NTK H;  4IHJ A;  1URF A;  4DXW A;  5LHG A;  4KHP O;  1CP9 A;  1VQP V;  5LA6 B;  2YI9 A;  4AIL C;  4ZOL B;  1PNM A;  2ZR3 A;  1JJ2 U;  3MHS C;  3ABL B;  4DR2 O;  5LA6 A;  1NS1 A;  2EIJ C;  4XDK A;  3K3W A;  5H2F Z;  1H38 A;  2NN4 A;  1SZX A;  1V54 C;  1GN2 A;  2FML A;  4YJ2 B;  4LF8 O;  4MS2 A;  1KB9 F;  1GRJ A;  4X9Q A;  4YJ2 A;  3CRC A;  3JAL B;  1PD3 A;  4NVP A;  2UXN A;  3C3T A;  1FXK C;  4BWA A;  5CA3 A;  1P49 A;  5IJ0 A;  3HKE B;  2CTQ A;  5BMV B;  1G4Y B;  4FLZ A;  4JV5 O;  2JS5 A;  3RN4 A;  2OCC B;  1VQ8 V;  1MSW D;  3JCZ A;  4JGS A;  1PL0 A;  2XT9 A;  4J42 A;  4FFK A;  1PV0 A;  3JSL A;  4K35 A;  3ZHR A;  5LMN B;  2OIG A;  1WB8 A;  1XNR B;  3OEH G;  3OUS A;  2HG5 C;  4O2A A;  5LBQ A;  2ZD9 A;  5LGT A;  5J2U A;  3R66 A;  1F23 A;  4NKG B;  4JPR A;  1KP2 A;  3ABT A;  2FL4 A;  4DV3 O;  5B1A B;  4YIP A;  5KHI A;  1NU1 H;  5JJN B;  2E75 B;  2QKC A;  2DE0 X;  1COW G;  3SDL A;  2X7R B;  2YDE A;  3OUF A;  4UB8 Z;  1TGO A;  1Q81 W;  4I9Q A;  4KP4 A;  2LP7 A;  1YXB A;  3FYI B;  4CH3 A;  1O9H A;  2YIC A;  3WB0 A;  4DV2 B;  2P7T C;  1SQX H;  1AI6 A;  4LF9 B;  4LNU B;  1VF6 A;  3I5D A;  3QTC A;  3RWR D;  4ZHQ B;  3K5L A;  1KD1 W;  4Q20 A;  1UFI A;  4LNU A;  2BSK B;  4EB6 B;  3ZED A;  4JAU A;  1EBO A;  3ABK C;  2BSK A;  1P84 F;  2W6J G;  3ETD A;  1HNW B;  3T1H B;  3VBB A;  2AGA A;  3ZHT A;  2WLL B;  3FFQ A;  1BSM A;  3STL C;  3IFX A;  1RM1 B;  4FFB B;  1QQC A;  3VOU A;  2WLL A;  4PI2 A;  3C3S A;  4DR5 B;  1ZL8 B;  4QGP A;  1GH6 A;  1YJN V;  2IBZ H;  3ZRS A;  4H33 A;  3HKD B;  5B1B B;  1K5Q A;  2R72 A;  1KEC A;  2X6B A;  4MTG A;  3TET A;  2Z5U A;  5GTH Z;  3QVN A;  2JIZ G;  3A8T A;  2OIE A;  2FYU H;  4B3M B;  2ZR2 A;  3UM7 A;  1IXB A;  1TAE A;  4FZ0 A;  3IAY A;  1R3I C;  3JD4 A;  3A0B Z;  2Q4P A;  3WB2 A;  4O4L B;  1B04 A;  1B3Q A;  4MVU A;  2Y0P A;  5LMN O;  2EIK C;  2QSA A;  5IJ9 B;  4X8A A;  2JK5 C;  2PYL A;  1XNR O;  4YXW G;  4J10 A;  4KFM A;  2AXT Z;  3N2G B;  2CTW A;  4JAA A;  4O4J B;  4WFE A;  1YIJ V;  1L8D A;  4RQF A;  1WPX A;  2WPD G;  3K0D A;  3SPH A;  1XHZ A;  5LGN A;  4I50 A;  2YIB A;  1BCC H;  1T5E A;  3FYE B;  4LF6 B;  4DV2 O;  2IH1 C;  3GWO A;  3ZHU A;  1M93 A;  1N8R W;  2UUC B;  4BIU A;  3UCS C;  4NXN B;  5E1A C;  2Q7E A;  1XUQ A;  3L9D A;  3T4D A;  3W7W A;  1L1F A;  1DK1 A;  3RYC A;  2ZDI C;  2PI4 A;  4B7E A;  1GAX A;  2Q68 A;  3BY6 A;  4I9W A;  5LXT B;  1GN4 A;  1SC5 B;  2QKA A;  2X6C A;  1VAR A;  4MVZ A;  3SPI A;  1AB3 A;  1XDC A;  1M57 B;  1OCZ C;  3SYC A;  5LXT A;  3SJQ C;  4GX2 A;  4RAI A;  1XMQ B;  3RFR A;  1HNW O;  3OR7 C;  3T1H O;  1AP6 A;  4JI5 B;  5J2T A;  3B8M A;  2ZIM A;  2L6L A;  2K9P A;  1SET A;  4F6R B;  4JTD B;  3E8F A;  3JAK B;  4DR5 O;  4H0L B;  1QCE A;  4U7O A;  2YI8 A;  4F6R A;  4JTA B;  2RJZ A;  3C90 A;  3LDE A;  3JAK A;  5L3C A;  4O4I A;  4GT1 A;  4IYI A;  3ABL C;  3T1Y B;  4XDJ A;  3H1K H;  4QJF B;  1EN4 A;  4B3M O;  3LNN A;  5FNV B;  5KA6 A;  4H44 B;  3ASN C;  2AZ0 A;  4UVC A;  5HFM A;  3D3Q A;  3KCY A;  1JFF B;  3E86 A;  4OPA A;  5L3D A;  1NI8 A;  3JD2 A;  1GM9 A;  4FIP C;  1LUV A;  3SPJ A;  1QLN A;  4FJC C;  3B40 A;  1I08 A;  2OCC C;  2LJ2 A;  3H01 A;  4ZIB A;  2ITD C;  1QR9 A;  3AK3 A;  3JAW B;  2DYS B;  5EIB C;  5HFL A;  1R3J C;  4IL6 Z;  3EXA A;  4W4L A;  2XAH A;  1BT8 A;  3RT3 C;  2W0X A;  1BL8 A;  3JD3 A;  4MTX A;  1YCI A;  1Z5V A;  3JD0 A;  4PDR A;  3DXR A;  5EBM C;  3JAR B;  3LSS A;  4K0K B;  4P9P A;  4LF6 O;  4NXM B;  5KHH A;  3VQW A;  1MZE A;  1W0K G;  3AG4 C;  2ZKO A;  4DV4 B;  3JAR A;  5B1A C;  3H1I H;  2RN9 A;  2UUC O;  3AG2 B;  4NXN O;  1BS3 A;  3HB3 B;  3U0Z A;  4MVS A;  1JX9 A;  4B3R B;  2WWW A;  5KMG B;  3RBZ A;  2EJR A;  2H8P C;  1FFT B;  3MHH C;  3RGB A;  5LOV A;  5KMG A;  4TV9 B;  4DW1 A;  2Q6A A;  4UCO A;  2Q0O C;  1XMQ O;  2PF4 E;  4JI5 O;  4TV9 A;  3JAT B;  1VEW A;  4DR6 B;  1SQV H;  4BW5 A;  1QNM A;  3ZBH A;  1PKX A;  2EIN B;  1WPB A;  4PA6 A;  1ORQ C;  1NJI W;  1EZV H;  2B9Z A;  1QU7 A;  1SRY A;  3K58 A;  2DWE C;  4NTX A;  4NYK A;  2XOK G;  4UVA A;  5C93 A;  2JS3 A;  1RM1 C;  3OMN B;  3T1Y O;  4X1K B;  2HFE C;  3QO8 A;  3FAV A;  2N04 A;  4X1K A;  1AI5 A;  1VF5 B;  1CXZ B;  3WG7 B;  1TVK B;  1M9N A;  4I55 A;  4K8Z A;  3LSQ A;  3KZI Z;  1I7F A;  1S72 V;  1OCR B;  1TVK A;  1XBL A;  5L3E A;  4FLV A;  4MVR A;  5B1O A;  5H6R A;  3X2Q B;  4NTW A;  4KUM A;  3P3N A;  2HVK C;  1ZLZ A;  5EZY A;  1RSO A;  4QE9 A;  2YIB D;  5CA0 B;  2A06 H;  1RFY A;  1N0J A;  1VF7 A;  3E89 A;  1N33 B;  4X1I B;  5GW7 A;  4GX5 A;  4WFG A;  1EN6 A;  1THZ A;  4HBN A;  3T2M A;  2LW7 A;  4DK0 A;  3SYA A;  4X64 B;  5H6Q A;  1H8H G;  2R9I A;  3ZN1 A;  3CCS V;  3MD0 A;  5B3S B;  4QPK A;  1D5A A;  4K0K O;  3G6B A;  2IJI A;  4B3T B;  4NXM O;  1GMG A;  4DV4 O;  1TUB B;  3SYO A;  4D7T A;  2E3C A;  1QHT A;  3TXS A;  2P06 A;  4DR7 B;  4QNH B;  1TUB A;  4X66 B;  5EC2 C;  4B3R O;  2ZE7 A;  5K1X A;  1Y74 B;  1SA0 B;  1YIT V;  1HR0 B;  2IJJ A;  5CMU A;  4PHZ A;  3ABM B;  4RUF A;  4B08 A;  2EIL C;  3CC7 V;  3BHP A;  4PD4 F;  1BQ0 A;  4DR6 O;  1H2L A;  4P2Z A;  5JJE B;  1MMM A;  1S76 D;  2QDO A;  5IYB O;  1MZF A;  4JI1 B;  1OCC B;  1WA8 A;  4PJ0 Z;  5LYJ B;  2CH7 B;  4HYO A;  3D3I A;  3SJB C;  3H1J H;  3FB6 C;  1FXV A;  2OTL V;  3B77 A;  5LYJ A;  4G2K A;  2CH7 A;  1ENV A;  1HP8 A;  4ASU G;  5JJJ B;  2YIA A;  2ITC C;  4H37 A;  2DOS A;  4GX1 A;  1KKC A;  4FLY A;  1N36 B;  3ZRX A;  2FKX A;  4Q6G A;  3LNM B;  2RDC A;  2JGD B;  2VQF B;  2ZXW C;  4UUJ C;  4X1Y B;  2LO1 A;  4DW0 A;  1R73 A;  4Z2W A;  2CTP A;  4X1Y A;  3FB8 C;  3U11 A;  1L0N H;  2NNU A;  2A7W A;  4IHJ B;  2ZDI A;  4J41 A;  2MW2 B;  1N33 O;  1SQB H;  1FXH A;  3GWK C;  3UO3 A;  2CGO A;  3HPL C;  4HAM A;  2K1E A;  1VQM V;  2CTR A;  2XHB A;  3HKB A;  2ETN A;  3ZHV A;  1U96 A;  3CPW U;  3EFF K;  1M5I A;  3OE7 G;  1YDX A;  2WA4 A;  1SS3 A;  2DYS C;  3APQ A;  3CCL V;  2Q0A A;  3L75 H;  2UUB B;  1WAZ A;  1N34 B;  4PA3 A;  3OAA G;  4I7Z B;  5IJ0 B;  1Q90 D;  2EIM B;  4DR7 O;  1NBM G;  4X66 O;  1WB7 A;  1XQ8 A;  1XL6 A;  4FZ1 A;  1IBL B;  2OCH A;  1CEZ A;  3SJC C;  3TGU H;  1S5H C;  3OM3 B;  1HR0 O;  3RVY A;  3AG2 C;  3OGC C;  1Q86 W;  3CE2 A;  4JI6 B;  2FTK A;  1K4D C;  4NB5 A;  2CK3 G;  1IX9 A;  1FKA O;  1WNS A;  1Z2G A;  2OWO A;  1IUR A;  4O2A B;  3TK1 A;  2IH3 C;  4BIZ A;  2ZIN A;  4JI1 O;  5J2U B;  2Q9L A;  5IY5 C;  3LDD A;  2CAZ C;  3A2F A;  4I5S A;  4O2B B;  1Y76 B;  2NLJ C;  4O2B A;  1Y76 A;  2QTO A;  3OT7 A;  2ZE5 A;  4ZBM A;  2QA4 V;  3M99 B;  4JAV A;  3T4Z A;  2DMX A;  2Q7G A;  1N36 O;  2GUZ A;  1IZ3 A;  1NR7 A;  3ETQ A;  1B06 A;  4GX0 A;  4CH5 A;  1BMF G;  2HP8 A;  1K33 A;  2VQF O;  4PI0 A;  1V55 B;  3OW2 U;  2Q7H A;  4E4E A;  2F4V B;  3W7S A;  2F66 C;  4GUN A;  4QIW F;  1Q82 W;  2DYR C;  2YEV A;  4LF5 B;  1YVW A;  2AHZ A;  2GHY A;  2L35 A;  3DSQ A;  3WG7 C;  3CCE V;  4UB6 Z;  4DV5 O;  4JI0 B;  4UFZ A;  2JDI G;  2LW1 A;  2NR5 A;  3CME V;  1YHQ V;  3CXH F;  3JYC A;  5LP6 C;  3AK2 A;  1I0H A;  1BE3 H;  3O9O A;  3CRM A;  1YTF B;  1JCH A;  3L72 H;  2B1G A;  1WP8 A;  1MAB G;  2Y69 B;  4X88 A;  4DV0 B;  5JCO A;  1UPG A;  4EFB A;  4WFF A;  2PTM A;  5EK0 A;  5L3F A;  2F23 A;  2UUB O;  1SQG A;  4CH6 A;  1N34 O;  3VQV A;  1ZUQ A;  2E5L B;  5B3S C;  1GO3 F;  1IBL O;  3RYH A;  4K3A A;  1JVM A;  2RMK B;  5JQG A;  1Q43 A;  1VQN V;  5H9C A;  2HHH B;  1WJZ A;  4X20 A;  4JI6 O;  4QE7 A;  4DV7 B;  3I56 V;  4QPJ A;  5EYP B;  1M90 W;  5FPR A;  3HKC B;  3AG3 C;  1P7G A;  3CSX A;  5LMU B;  5EYP A;  1SQQ H;  1GM8 A;  2UXB B;  3HKC A;  3SJA C;  1BGY H;  4LF4 B;  3ABM C;  4N21 A;  1BZK A;  2WLJ A;  2CGN A;  2KSD A;  4PA7 A;  5LHI A;  4BAY A;  4LH6 A;  2OTJ V;  4I50 B;  1AR4 A;  1VIB A;  1AI4 A;  3L70 H;  2DW4 A;  5DED A;  3B8N A;  4LF7 B;  4WBN B;  1BHA A;  1OCC C;  4G27 B;  1TUE B;  3IC7 A;  4L87 A;  4XBF A;  5L3G A;  1YI2 V;  4FLW A;  5LL6 Y;  4JI8 B;  1SES A;  2ZE6 A;  2ZCE A;  3E35 A;  4WBN A;  2ARH A;  3D36 A;  3FKS G;  3CS5 A;  2HEP A;  5JVD B;  2XND G;  3ABU A;  3RYC B;  4LF9 O;  4FPP A;  2GTA A;  3A0H Z;  5JVD A;  1QLE B;  3L71 H;  4CC6 A;  2F4V O;  5B66 Z;  1AJQ A;  3J7A U;  1ZX3 A;  3BPZ A;  1FS0 G;  3CC4 V;  4LF5 O;  1V9P A;  2ZM6 B;  4JI7 B;  4JYA B;  3OTO B;  2FB5 A;  2RQ6 A;  1NVP B;  2Q69 A;  3B2E E;  3KG2 A;  4B3S B;  4HZ3 A;  4BR6 A;  3JAS B;  5J2T B;  5KUM A;  2X6A A;  2JJ1 G;  1KP3 A;  1I5Y A;  4UCS A;  5IYD O;  3ML0 A;  4LBE C;  2P90 A;  5C8Y B;  3JAS A;  3QG5 A;  1HDJ A;  3IGA C;  5A9G A;  4ZKI A;  3TXQ A;  1IXM A;  2AHY A;  2W6I G;  5C8Y A;  4DV0 O;  3CRQ A;  1JA8 A;  1AVM A;  2E74 B;  5FPO A;  5KX5 A;  4O4I B;  3E8H A;  4YY3 B;  3E22 A;  2BOB C;  1PP9 H;  1GTO A;  4AHC A;  2ADQ B;  4JYB A;  2IW5 A;  2E5L O;  1NZ6 A;  1E1R G;  1ZWI C;  2HJD A;  2WLK A;  2M7W A;  1AIL A;  4I4T B;  3BA8 A;  1NR1 A;  3J80 N;  1Y4M A;  4TV8 A;  2UXX A;  4I4T A;  2HHH O;  4JAS A;  2BTO A;  1M56 B;  3I55 V;  4DV7 O;  4GKK B;  1S3J A;  1H2M A;  1KBH A;  1US6 A;  1X59 A;  2XAS A;  2Z0A A;  5LMU O;  1SQP H;  1G6U A;  4GZR B;  2W0F C;  2UXB O;  3JAM N;  2KQX A;  1P4R A;  2UUA B;  1AR5 A;  3NR7 A;  1G1X B;  4LWS B;  4MVM A;  3H1L H;  4FMT A;  2YID A;  3DXR B;  4RUE A;  4LF7 O;  4LWS A;  2BTQ B;  3AEI A;  3BCC H;  3QF7 A;  1DF4 A;  5IWA B;  4JI8 O;  3ZN0 A;  2BTQ A;  4GCZ A;  3OFN G;  4DV6 B;  5KHK A;  3SGI A;  1V54 B;  4MTO A;  5GON B;  1R6T A;  2WLI A;  1KYO F;  2QWO B;  4C7U A;  1VQ9 V;  2ZM6 O;  1VQO V;  5LOV B;  4JI7 O;  3ZMS A;  3CMA V;  5GON A;  4JYA O;  3OTO O;  1YTF D;  4X89 A;  1VF6 C;  2UXC B;  2A3Q A;  4B3S O;  2JEU A;  5BY1 A;  1FXK A;  1R3L C;  4BIO A;  4JZG A;  4ZI7 B;  2DN9 A;  1VQK V;  3CCR V;  2BOC C;  5DEC A;  2R9A A;  2F93 B;  4ZI7 A;  2H94 A;  1PNL A;  2AZ2 A;  4ABM A;  4DRX B;  3CCJ V;  1P7B A;  3FD9 A;  2Y4U A;  2EZO A;  4YY3 O;  1D5N A;  4UCR A;  4DRX A;  2IM9 A;  1AR1 B;  2ADP A;  2QKS A;  3FAV B;  2QTS A;  1MOF A;  2HVJ C;  1OZ0 A;  2RNB A;  1KC8 W;  4R6Z A;  4MTF A;  3MDS A;  1GM7 A;  5IYC O;  4I55 B;  1VQ6 V;  1JMK C;  5B1B C;  4HNA B;  3GVM A;  2LGW A;  3KCX A;  3WU2 Z;  3DTU B;  3ASO B;  4GKK O;  3K5O A;  4HNA A;  4FM1 A;  5EZY B;  1RSO B;  4IT5 A;  1M4U A;  2ILM A;  4JI2 B;  4IIJ A;  4N23 A;  4YHH B;  2PI5 A;  3SR2 C;  2QE7 G;  2DQ0 A;  2ZNJ A;  4PA4 A;  1K92 A;  2UUA O;  1DLB A;  2WLH A;  4UCV A;  2Q8V A;  4R8C A;  1HW7 A;  4JTC B;  3SYP A;  4PV1 B;  1NT2 B;  4E2L A;  3UQ8 A;  5IWA O;  3H1H H;  1VQ5 V;  1JQ0 A;  5CN0 A;  1MG1 A;  4GKJ B;  3BAA A;  4DV6 O;  5LGU A;  3AG1 B;  1NVP D;  3VQX A;  4X65 B;  2DWD C;  3P32 A;  4R7C A;  2OT5 A;  5BR8 B;  1GK9 A;  2QEX V;  1R6K A;  2UXC O;  1K73 W;  5F2V O;  3CJH A;  3O65 A;  4J7K A;  3TJT A;  4CS4 A;  1JJO A;  2PUS A;  4PDM A;  1QLE C;  1WN7 A;  3CHX A;  2EUL A;  1X4T A;  2HLD G;  3KKY A;  5EC1 C;  4L8J A;  5JH7 B;  2YXY A;  1WA8 B;  3OD4 A;  1M57 C;  4YJ3 A;  4LCU C;  5JH7 A;  4JI4 B;  3MAQ A;  2VS0 A;  5IE9 A;  1OJH A;  4A5U B;  3ZMV A;  4IYH A;  3R65 A;  4Z1V A;  3CCU V;  4CC5 A;  2VQE B;  1F51 A;  1R1B A;  3K79 A;  3ZRW B;  1EZJ A;  3JSN A;  4U7N A;  1NTM H;  1ROP A;  2A0L A;  1F4M A;  3ZRW A;  1E79 G;  1J5E B;  1CPY A;  2A9H A;  4BW9 A;  1IDS A;  1NH2 D;  2MK3 A;  3PJS K;  3PN1 A;  4LR3 A;  4WFA V;  5CBH A;  4MVO A;  1K7D A;  4X62 B;  3LDC A;  3JD1 A;  3UT5 A;  2QJ1 A;  4DV1 B;  1N4C A;  4JI2 O;  4YHH O;  1DGS A;  3ZS8 C;  4RQE A;  4O4H B;  3ZHS A;  2VRZ A;  3FX7 A;  1E1Q G;  1HNX B;  3N2K A;  4PDL A;  1HWY A;  1OCZ B;  4O4H A;  4LFB B;  4TUY A;  3HKB B;  3CCM V;  3RVZ A;  3S3W A;  4MW3 A;  4X64 O;  4I0X B;  3CRA A;  2KKW A;  1S5L Z;  1Y66 A;  5CA1 B;  4B3T O;  4GKJ O;  2BCC H;  4I0X A;  1Q5O A;  2UU9 B;  2PZS A;  1HNZ B;  4DUZ B;  5CA1 A;  4X65 O;  4J80 A;  2B1I A;  4NR1 A;  2JVD A;  3CEI A;  4KXR A;  3ETG A;  2EX3 A;  1VQ7 V;  4PEL A;  4FLU A;  3G71 V;  3ZRV A;  5BR8 O;  4AI8 A;  1PPJ H;  3G4S V;  2ZIO A;  3ETE A;  4FM2 A;  4ZOL A;  1S5J A;  2N74 A;  3K0G A;  3BAB A;  1XMO B;  1I94 B;  3RW0 A;  2WAM A;  1IBM B;  3WB1 A;  2ZE8 A;  1ZSP A;  3ASN B;  1XOU A;  1QR8 A;  2YS8 A;  4J11 A;  2Q67 A;  1FYJ A;  2XAJ A;  2ODM A;  3JAL A;  1EFR G;  5AG2 A;  4JI3 B;  4JI4 O;  1F4N A;  1MNG A;  3HKE A;  1WLE A;  1YJ9 V;  3H9V A;  2QWN B;  5BMV A;  2V1D A;  1SZT A;  3QO7 A;  2VQE O;  2EIN C;  1H2G A;  3HR0 A;  4J9Z B;  1VP7 A;  5KUK A;  1FJG B;  2GUZ B;  1J5E O;  2WLN A;  3THO A;  1G8M A;  1XIL A;  2RCV A;  1Q6I A;  3ZMZ A;  2OYQ A;  2YXL A;  2Y4T A;  1B6Q A;  4X62 O;  1OCO B;  3AG4 B;  2YEV B;  2PYJ A;  2V7Q G;  4GLX A;  4DV1 O;  4AQY B;  1NTZ H;  1J95 A;  5KA5 A;  3K04 A;  4ICG A;  3K9S A;  1KU9 A;  2LQT A;  3EHB B;  3OEE G;  3ASO C;  1KQS U;  1OCR C;  1HNX O;  4LFA B;  3X2Q C;  4LFB O;  2LFR A;  1ARO P;  1JOY A;  3APO A;  2E76 B;  5JWP A;  4ZHQ A;  2JRI A;  3U10 A;  2Y0I A;  4WF9 V;  1QVF U;  3CB2 A;  3OMA B;  1PM9 A;  4EB6 A;  2UU9 O;  1HNZ O;  2CUG A;  4DUZ O;  1TA8 A;  3ICX A;  2IU3 A;  3F5T A;  1QVG U;  3K57 A;  1OHH G;  3SPG A;  3RYH B;  4RWU A;  3G6E V;  5JQG B;  4G28 B;  4JZ2 A;  1BQZ A;  3G67 A;  3CD6 V;  1Y67 A;  4X20 B;  3LSU A;  1GN6 A;  3AG1 C;  1XMO O;  4FFB A;  1I94 O;  2XAG A;  1IBK B;  1XL4 A;  1ZL8 A;  1IBM O;  5CBF A;  3GB7 C;  4MT8 A;  2M6Y A;  3HKD A;  3K08 A;  1KUQ A;  3CCV V;  3W7X A;  1FAF A;  1W59 A;  3CP1 A;  2Z3Y A;  2YXH A;  4DR1 B;  2P5O A;  3A0R A;  4JI3 O;  5K1P A; 
#chains in the Genus database with same CATH homology
 2NR5 A;  2GBO A;  2ODM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...