2ODMA

Crystal structure of s. aureus ylan, an essential leucine rich protein involved in the control of cell shape
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
79
Chain Sequence
b'ATMKNAALKQLTKDADEILHLIKVQLDNLCPLYEEVLDTQMFGLQKEVDFAVKLGLVDREDGKQIMLRLEKELSKLHEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0358 protein MW0995
publication title Crystal structure of S. aureus YlaN, an essential leucine rich protein involved in the control of cell shape.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
total genus 23
structure length 79
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07408 DUF1507 Protein of unknown function (DUF1507)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.750 Mainly Alpha Orthogonal Bundle Helix Hairpins SO2669-like 2odmA00
2GBOA 2ODMA 2NR5A
chains in the Genus database with same CATH superfamily
1XHXA 2UXBB 2CTPA 3GVMA 4IIJA 5FPOA 5B3SB 2VRZA 4MVMA 2EJRA 2JIZG 4OX9B 2ZM6B 1R3IC 4IHJA 5EBWC 4JI7B 3D36C 4OPAA 4OPHA 4MTGA 3LSQA 4UVAA 3P32A 1CPYA 2KG7B 5LA6B 3DC6A 2Q67A 1NI8A 4O2BB 5ITZB 4LF9O 4NTXA 4QJFB 1HNXB 4NYKA 5EIBD 2FB5A 4DR3O 4JI3O 4KL1A 3K9SA 3GB7C 2NN4A 3HKBB 4I4TB 3K5MA 2LFRA 1G4YB 2F1MA 4JI1B 4J42A 1Q7YW 3S3WA 1H2KA 4G28B 5KHHA 2Q7EA 1NR7A 3BFRA 4WFEA 3T1HB 1GM8A 4DV7O 3K3WA 1RFYA 1ZL8A 4PI0A 5BR8O 2WPDG 3L72H 2UUCO 4MTXA 4UUJC 2WLIA 1DK1A 1U97A 3CB2A 1W0JG 1ZUQA 2RNBA 4ZI7A 2HVKC 1KBHA 4JI4O 3ETEA 4YHHO 1K4CC 4LF4O 4AQYB 1YVWA 2QWQB 2PTMA 4FZ1A 3K08A 3FX7A 5KAIZ 1P4RA 1CP9A 2CDYA 3C3SA 3G80A 5JJEB 2Q68A 5LHIA 2JJ2G 1NKDA 2RQ6A 2PY5A 1XILA 2AW9A 1Y66A 5EYPA 3B4SA 3OUSA 3ABKC 1YTFD 2CUGA 1PD3A 1BMFG 3OMIB 1V54C 3JSNA 4U3JA 4DRXA 2Q0OC 1H38A 4X9QA 4DR5B 4B7EA 1Y4MA 5D5PA 3H1KH 3OEEG 1FXVA 4DR1B 3SPJA 4JI8B 4CH6A 1I94O 4HAMA 5LYJA 1K8AW 2FYUH 4X8AA 5CBFA 4YY3B 4FLXA 5K1PA 4J9YB 5DECA 3CCJV 3ABKB 5IT9N 3GWOA 4GX2A 1JR9A 5LMNB 1I08A 4HNAA 4I55B 3JAMN 1V54B 3RYCB 3L71H 3STZC 3ZN0A 5BXZA 4DV1B 2JJ1G 4NXNO 1M56C 4K8ZA 1WB7A 2H94A 3JAWA 3B8NA 5JVDA 1J5EB 2DWEC 1JJ2U 1M9NA 3U10A 4JTAB 3RYIA 4MW8A 1VQNV 2ZE6A 3CCSV 2P4KA 1R1BA 1GN6A 3K59A 2Y69C 3RW0A 1XOUA 1QLNA 4LWSA 1TA8A 3H9VA 1IBKB 1W59A 1X59A 1BHAA 3QO7A 2HKOA 2P6JA 1GN2A 2ZIOA 3K5LA 1M56B 2B9ZA 2ZE8A 5H9CA 2P5OA 1S72V 4MVSA 2WWWA 4RUEA 2K1EA 3CRRA 1NTZH 5J2TB 4DV0O 1AP6A 3AG4C 1L0LH 2OCHA 3BAAA 2PYLA 5IYCO 1VQMV 2ITCC 3J80N 4HBNA 4X66B 2L6LA 2Y69B 5EIBC 4MTOA 5JQGA 4ZOLA 2Q0AA 4JI5B 1LR1A 1ZAUA 4FK5C 5EBLC 3ZRWB 5CA0A 2XNDG 4I50B 4RO2A 2B5UA 1IVSA 1H2GA 1QVGU 4JAAA 2YI9A 3CWBH 1M5IA 2AZ2A 1ORQC 4LH7A 1Q86W 3JATB 4XDJA 1S0VA 4LF8O 4NXMO 1D5NA 3AG4B 5C8YA 5BY1A 2XASA 4MS2A 4E2LA 4UCUA 5A9GA 2HP8A 4MW3A 2WAMA 3T1YB 1XEQA 4FJCC 1NZ6A 2QEXV 4LF6B 2EIJC 1GN4A 4DV2B 4YIOA 3CCEV 3DXRB 4NTYA 1HNZB 2YUAA 4FPPA 3CMEV 1JVMA 1L0NH 1YHQV 1NTMH 1Q8IA 2CK3G 3BA8A 3T4DA 1YJNV 5FPRA 2KSDA 1TVKA 3IJ4A 1CEZA 3E2EA 2P90A 2QTOA 2EBOA 1AB3A 1M90W 1SQXH 2VWKA 1VQPV 2YEVB 4P2ZA 1AR1B 2EIJB 4DUZB 3BEHA 4DV4O 2QWNB 2Z0AA 5CA0B 2W6IG 2HLDG 4O2AB 4WFHA 1Q90D 4K0KB 2ADPA 5KAFZ 2OCCC 2BTQA 4G2KA 2EINC 1GAXA 1YTFB 4B3TO 1ZLZA 3OFNG 1NTKH 4CZZA 4UFZA 1K34A 5EZYB 2OTLV 3E35A 4DR7B 3TETA 4H37A 3W7XA 4JGSA 4BIZA 1E79G 1SA0A 2WLLB 1AR4A 2HJFC 4DR2O 2EX3A 4PDLA 1H8HG 3CD6V 5H2FZ 3CC2V 2F95B 1TUEB 1MSDA 2M7WA 5CA3A 3ASOC 3D3IA 4H44B 3AK3A 2OCCB 2YDEA 2IM9A 2EINB 1W2BU 1TVKB 5GTIZ 3SPHA 3CJHB 2ZD9A 4J10A 4KHPO 2LP7A 4X1IA 3SYPA 1KKCA 2O57A 4N23A 3CCRV 1NR1A 3H01A 2UU9O 4LF7O 1N36B 1VQ9V 2QM8A 2CTQA 4ZHQB 4FMTA 4QPJA 5LOVA 1IBMB 3UO3A 1EBOA 3TXQA 4E4EA 2B1IA 1GTOA 4R50A 3VQXA 4HYOA 5IJ0A 2RN9A 1PP9H 3QO8A 4B08A 3ASOB 2X6CA 1VF7A 5JH7A 1XNRO 3FAVB 2V1DA 3K03A 1VQ4V 1AP5A 2JVDA 4PD4F 3C3TA 2HEPA 4LFCB 3ZRXA 2NLJC 2Q6AA 1BHBA 4LFAO 3ABUA 4GX5A 1K92A 1SA0B 2DN9A 1FFXB 5FNVA 3WFVA 5LP6C 3C90A 1PL4A 1S5JA 1VQ8V 3HKDA 4O4LB 1EZVH 4JZ2A 1BS3A 4LF5B 3M99B 3ZJZA 1GH6A 1AI6A 5H5NA 2LQTA 2Q73A 1K9MW 1IBLB 2A9HA 4O4IB 2HHHO 4NKGB 2XOKG 4X65B 3I56V 4J11A 2PYJA 3LSUA 3JARB 4MVZA 4DR4B 1IXMA 4I9QA 3K5NA 1KP3A 1FJGO 3RFRA 4YJ3B 3CE2A 1D5AA 1XUQA 2IJKA 1QLEC 5LP6B 5B1NA 2JDIG 2ZDIC 1BE3H 2Q9LA 3QTCA 4GKJO 1QR9A 3CRCA 3DC5A 2YXLA 3RGBA 2KG7A 3EFFK 1IDSA 1PV0A 1K4DC 4H0LB 3G67A 3B8MA 4O2BA 2EILC 2EIMC 3ZHRA 4F6EA 5ITZA 3EVKA 4P30A 4EB6B 2LJ2A 1N33B 1ENVA 1RP3B 2AGAA 4I4TA 4DV5O 3B77A 4BW5A 3T2MA 1H2SB 1R3LC 2UUAB 1IXBA 2QTSA 1DF4A 2R70A 3LDEA 1QLEB 4GYCB 4TQDA 1OHHG 3D36A 4TT3G 3CYOA 2Q8VA 5JWPA 2X7RB 4PI2A 1SERA 1I5XA 1JFFB 3G6EV 2K9PA 2H3OA 1F51A 2EILB 2EIMB 1MZFA 2CTWA 3A0HZ 3W7WA 2R9AA 5DN6G 2VQFB 5L3EA 3EXAA 2JGDB 3NXSA 4RQEA 4WCEV 1EFRG 3A8TA 2E74B 4J9ZB 1UFIA 3B2EE 2GUZB 4ZBMA 4FLUA 2DYRC 5L3FA 3OGIB 1UPGA 3LDDA 3APQA 3B09A 5K1XA 3CRMA 3K04A 3ICXA 5GW7A 4L87A 1TAEA 1BCCH 4O4JA 4OXSA 4JV5B 1PNMA 2ZINA 4DK0A 4B3MO 3ML0A 2ZT9B 4DK1A 4HZ3A 2Q69A 4FLYA 1H8EG 4R7CA 3FD9A 5GONB 4Z1MG 1Z2GA 1S5HC 4P9OA 2GSMB 5HFMA 4B3SB 4YXWG 2DYRB 3FFQA 1XDCA 1WA8B 4J80A 4NB5A 1NS1A 3SGIA 1N4CA 4AILC 1P7GA 2GDSA 4FM2A 1RM1C 2DE0X 3AEIA 2YIBA 3IC9A 5LMUO 4PA4A 2DQ3A 5CB4B 1H2NA 5KMGB 1OZ0A 4YIPA 2BOCC 4I55A 2UXCO 3SR2C 3RYCA 5D5QA 1Y76B 3ZRVA 3D8CA 1YEWA 1S3JA 1V9PA 3B40A 1M1KW 3Q4HB 1AJPA 4GX1A 2PF4E 1YCIA 4JI0O 3OGCC 3SPGA 5L3GA 4JF3A 1U96A 4LF9B 3W7UA 2QWOB 1TGOA 3JD2A 4Q6GA 4DR3B 2XAFA 4JI3B 3VBBA 4DV6O 1RM1B 2WA3A 1XNQO 4J7KA 3JASB 2F4VO 4O4JB 2IJJA 3ZIAG 2UXNA 3BY6A 3WB1A 5LHGA 5CBGA 4DV7B 1Q6HA 1KMIZ 5EK0A 1T5EA 5BR8B 4PA7A 1Q43A 1YXBA 4WBNB 3H1HH 4JYYA 2UUCB 3X2QC 2ZR2A 3CRQA 5J2TA 2IW5A 1SQPH 1WLEA 4FIPC 4FM0A 3QG5A 1OV9A 4DW0A 4JI4B 2BSKB 4YHHB 2WLJA 4UVBA 2HVJC 1DF5A 4LF4B 1KP2A 3JSLA 1OCOC 1X4TA 4EFBA 2OIEA 2Y4TA 2QR4A 3K79A 4KXRA 1VP7A 4CH5A 1AJNA 2L35A 2A7WA 3ZRWA 2ZR3A 5LXTB 4I50A 3AK1A 1ZSPA 2AHYA 3E8HA 1N32O 4IGGA 3E8BA 1YIJV 3X2QB 3LDCA 3E8GA 1EN4A 2WA4A 3JATA 3CCMV 1N0JA 4NR1A 1VF6C 4JYAO 2XT9A 1OCOB 1NVPD 4BIUA 2BTOA 5L3CA 2UXDO 4TV9B 1AI5A 1VMGA 2QKCA 1WJZA 2QWPB 1I94B 3E22B 4F6RB 2WSSG 1URFA 3DXRA 4WFFA 3ZHTA 4WFAV 3A2FA 1TUBB 5CA1B 1HNWO 2V7QG 4FLVA 1FYJA 1F4NA 4NXNB 4YJ2B 5LL6Y 4ICGA 3JD1A 3ZMSA 1FXKC 4F4LA 4JTCB 2JS5A 2LW1A 1XBLA 1OCCC 5JCOC 5FLXN 2GTSA 1RPRA 2YEVA 4KFMA 2P06A 4W4LA 3IGAC 3OT7A 4CH4A 3OR6C 4UCVA 3ZBHA 1GO3F 4X62O 3A0BZ 4QNHB 2ODMA 3ZHUA 1XMOO 1A32A 1XL4A 3BVOA 2GBOA 4O2AA 2EJ7A 5C93A 2F23A 4X1KB 1XMQO 3SYAA 2MW2B 5IWAO 5TISZ 4JAVA 2EULA 1KECA 2W0XA 1W0KG 1SQFA 4DV3O 3OW2U 3FYEB 1FXKB 4GLXA 1N34O 5KUMA 2Y0IA 5EZYA 1OCCB 3S3XA 1KD1W 4LR3A 3MAQA 1KYOF 1QR8A 4FLTA 4FFBB 5BMVB 2WLLA 3LUTB 4AHCA 1WPXA 5KHJA 4DV0B 4GCZA 1KU9A 4PDMA 2LFSA 1AR5A 3OAAG 1NBMG 4H33A 1DGSA 2W0FC 1NT2B 2PI5A 1IX9A 3TCUA 3CJHA 4GT1A 4QE9A 5H6RA 3UKMA 3N2GB 4DUYO 2XAGA 4R8CA 4BAYA 4EKWA 3SYOA 2FMLA 2X6AA 1M93A 2RDCA 4LC1A 5IJ9B 4ZHQA 1D2DA 3L75H 3CEIA 3H1JH 4LF8B 2D2CB 4NXMB 3OD4A 2DMXA 4RWUA 3AG7A 4JI2O 4GUNA 4D7SA 5IYDO 2QGNA 3RYHB 2QJ1A 3KG2A 3O65A 3WB0A 3RWRD 1OCZC 1GMGA 3HKCB 3APOA 3FAVA 4FFKA 1GK9A 3P30A 3RYFB 3BPZA 1G6UA 4JI6O 4FLZA 5LGTA 3CX5F 3A0RA 3W7SA 1JOYA 4GKKO 1LUVA 5GTHZ 1Q3EA 1FFXA 3BCCH 4XDKA 2E5LO 4DR6O 2DJVA 4TUYB 5IYZB 3U0ZA 4O4LA 2QKAA 2LGWA 1OCZB 4TSFG 2JEUA 2FKXA 4WFGA 2N74A 4DV4B 1HR0O 4O4IA 3G71V 4JPRA 1GRJA 1SZTA 4LFBO 1JX9A 1MZEA 2JRIA 3SJBC 1M4UA 1YJ9V 4X1YB 3JALB 2QM7A 3JARA 4NTWA 2XUMA 3K06A 2ILMA 5LBQA 1VQLV 3E86A 3LSSA 4YJ3A 3AG1C 3D3QA 5JJNB 5LP6A 4JAUA 2BE3A 3AG2C 4B3TB 2EZOA 5BZBA 2N05A 1BZKA 4QE7A 1VQ6V 4BIOA 2VQEO 1AVMA 1EN6A 3CMAV 1E1QG 1S5LZ 4B3RO 1DTOA 2KB1A 2A3QA 3RT3C 3HKEB 2YIDA 4CH3A 1GKFA 2Z5UA 2Y0PA 5EC1C 4DR2B 1NVPB 1K97A 4LP8A 2WLMA 4EB6A 4K3AA 3ASNC 2ZQMA 2QA4V 3K0DA 4PHZA 4TWKA 1PL0A 3AG1B 1LNQA 3AG2B 3OTOO 3UCSC 2ZDIA 1K5QA 4UCOA 4X64O 4KHPB 2IH1C 1BQ0A 1SETA 2OIGA 3DSQA 1ROPA 4LNUB 2M6YA 3CSXA 2UU9B 4LF7B 1JFFA 3I5DA 3BABA 4N21A 4A5UB 5IE9A 1L8DA 4W4KA 1QQCA 4UCRA 2ZCEA 3RVZA 2KKWA 3O9OA 3ASNB 2BOBC 2YI8A 1BL8A 2F66C 2JGDA 4O4HB 5KX5B 1B06A 3RVYA 3EHBB 2UUBO 2ZKOA 2GUZA 2P7TC 4X20B 1XNRB 1FXHA 3SJAC 1XQ8A 3ZX6A 4X89A 2XHBA 3CC4V 2CH7B 5CMUA 1SQVH 3AG3C 4K35A 3P3PA 3VQVA 4WF9V 5J2UB 2DWDC 4Q20A 4LFAB 3KCXA 3BRCA 3TGUH 1QBZA 3ZHQA 1FPOA 3VOUA 1R73A 3QNEA 4U7NA 2EZPA 5GONA 5E1AC 1MABG 2JK5C 5AG2A 5DEDA 4J7ZA 1WN7A 1AROP 1AILA 3CCQV 2UXBO 1N0NA 3ETGA 4UCSA 2HHHB 2Y48A 2NR5A 3J7AU 1ZX3A 4J41A 1WA8A 4OX9O 3AG3B 2ZM6O 3JAKB 4IYHA 3W7TA 1Y74B 4JI7O 2A06H 3E8FA 3UT5B 3CC7V 1FJGB 2LW7A 5CB4A 3DTUB 4DW1A 1SESA 2VWJA 1BGYH 5KMGA 3ZHSA 3L9DA 3SPCA 5L3DA 4U7OA 1ZWIC 1Y76A 4GKJB 3CS5A 1R6KA 1HNXO 3Q4HA 2P67A 1WP8A 2H8PC 1I0HA 1I5YA 2X0LA 1UJWB 4JI1O 5IY5C 5J9PC 1PPJH 4PA3A 4DV5B 4UV8A 3JASA 2XTAA 3LNMB 3T1HO 1YJWV 2ADQB 2ATKC 2Q5ZA 5KLVH 3CXHF 1MG1A 2G38A 3WU2Z 3HB3B 1FD9A 3N2KB 1VARA 4WBNA 2WLNA 4CC6A 3GWKC 4AQYO 1QVFU 2AHZA 3QO5A 3ZEDA 5IY5B 1SC5B 1K33A 1EM1A 3E83A 4MT8A 2BSKA 3DGEA 2ZNJA 5E79Z 5KA5A 3CXCU 1YDXA 4X88A 5EC2C 1R6NA 3BA9A 5IYBO 2YS8A 4TV8B 1RSOB 1K73W 2ITDC 1Q5OA 3PN1A 3WB2A 1Q82W 1NU1H 3G6BA 2XAQA 5LXTA 2E3CA 2LO1A 2ZXWC 4DR5O 4B3MB 2ZE7A 4DR1O 1P49A 2A0LA 4JI8O 1Q81W 5JJJB 1AI7A 2R72A 1M57C 1P84F 3L70H 4YY3O 4PELA 2IJHA 4TV9A 4IIJB 2F43G 1FAFA 3ZN1A 5F2VO 2HR3A 3E22A 1Z5VA 4F6RA 1IURA 2YICA 4QPKA 1YITV 5LMNO 4IHJB 1VEWA 2IU3A 2ZXWB 1SQQH 4UB8Z 5LMUB 4Z1VA 4DV1O 2OTJV 1TUBA 5CA1A 2YXYA 1FKAO 4CS4A 3ZS8C 1SZXA 2RMKB 3OTFA 4ZKIA 2UXCB 2CGNA 2ARHA 1VF6A 2ZIMA 4YJ2A 1J5EO 2DQ0A 1M57B 1O9GA 4JYBA 2B1GA 4JI0B 3ABMC 2GHYA 4PJ0Z 1WNSA 3ETQA 4RAIA 4DO2A 4FZ0A 4TQFA 3SDLA 4DV6B 4PA6A 1IBKO 1XNQB 1QCEA 1S77D 2F4VB 1Y67A 1K7DA 1HDJA 4X1KA 3SYQA 3FYIB 1ZL8B 4DXWA 2QE7G 1B6QA 1G1XB 1JJOA 2WLIB 2RJZA 4MTFA 3ZMUA 4MVQA 1FXKA 2IU0A 4MVUA 3ABMB 4ZI7B 3JYCA 1SQGA 2VS0A 1Y6XA 4LBEC 4NVPA 5JCOA 3CPWU 1HP8A 4X66O 4FFBA 5BMVA 1YZBA 2OT5A 4KUMA 1XREA 1QU7A 3TXSA 4JI5O 1E1RG 4R6ZA 3CCVV 1YI2V 2HG5C 3F7VC 4GX0A 1IZ3A 1K5SA 4JASA 5EYPB 1SKVA 4EFEA 2YXHA 3TJTA 2PUSA 3OR7C 4D7TA 1SRYA 4H13B 5B1BC 3OEHG 4U3JB 4DRXB 1N32B 2QKSA 3N2GA 3MHSC 2FL4A 4JTDB 3FB8C 4C7UA 5CN0A 3KZIZ 3ZRSA 2EIKC 4G27B 4KP4A 5IJ9A 3OMNB 3R65A 2CAZC 3JCUZ 2PI4A 1ZTEA 3T1YO 4JYAB 3KKYA 5LYJB 2JEXA 1NQTA 4RQFA 3K57A 1AI4A 3E89A 4LF6O 4DV2O 3RYHA 2UXDB 3F5WC 1HNZO 1EN5A 3I55V 3HKCA 3OM3B 4XDLA 4Z2WA 1VQ7V 5B1BB 4HNAB 2GTAA 1VIBA 2RCVA 3RYFA 1HNWB 1KB9F 3TK1A 1BT8A 2AZ0A 4IYIA 2EIKB 2X6BA 2CTRA 3R66A 5CBHA 4L8JA 4WFBV 4CS3A 4P9PA 5HFLA 3JAWB 3SJCC 5JVDB 3ZMVA 2R9IA 1KKDA 3OUFA 5B1OA 4TUYA 5IYZA 4DUZO 3CCUV 4XBFA 3T4ZA 2Q4PA 3RYIB 5FL7G 1R6TA 3F7YC 1WB8A 3L74H 4K0KO 1OCRC 3H1IH 4I5SA 1R3KC 4LWSB 4BR6A 4X62B 1MMMA 1XMOB 1JPXA 4ZIBA 4X1YA 4QIWF 3JALA 1L1FA 1XMQB 3AK2A 3ETDA 2P22C 2ETNA 5IWAB 2YSUB 2R9RB 2CE4A 3ABLC 3FB6C 1WP7A 4U3FH 4EEQA 3MHHC 4DR7O 4DV3B 1NH2D 1COWG 4RUFA 1XI1A 1N34B 4ABMA 3JD3A 3VQWA 2UXXA 2HFEC 1SQBH 4TOIA 3HKEA 3F5TA 1GN3A 2ZE5A 1OCRB 5LGUA 4DYLA 4ASUG 1J95A 5KHGA 5JQGB 4UXNA 4ZOLB 1HWYA 3K0GA 3RBZA 2F93B 3QVNA 2W6JG 2D3OW 2E76B 2Q7GA 1EZJA 4MVOA 4CBCA 4GZRB 1KUQA 3ABLB 1XL6A 4B7KA 3K5OA 2FTKA 2HJDA 3P3NA 1N36O 2NNUA 3ZHVA 1OJHA 3ABTA 1YF2A 3THOA 4DUYB 5C8YB 3UM7A 1IBMO 2QM4A 3BHPA 4LNUA 2OYQA 1WPBA 1PNLA 1CXZB 1MOFA 3JD4A 4FLWA 4JI2B 5EBMC 1VQOV 3T1CA 4PDVA 2V4DA 2QSAA 4LCUC 2XAHA 1GM9A 4O4HA 4PDRA 5KX5A 4JYCA 1FFTB 5B66Z 1VQKV 1BQZA 3JCZA 1THZA 5KHIA 1RPOA 3LNNA 4LFCO 4X20A 5LGNA 2DYSC 1S76D 1JMKC 1FS0G 2CH7A 3JD0A 4CC5A 2P4VA 4D6TH 3FKSG 1R3JC 5J2UA 4JI6B 3M7MX 3RN4A 4IL6Z 1O9HA 1JQ0A 4GKKB 5KA6A 2JS3A 4IT5A 5B5EZ 2BCCH 2KQXA 4LF5O 1LUWA 1JCHA 2QWRB 2Q7HA 5LHHA 2E5LB 1B3QA 1IBLO 1JA8A 4DR6B 1AJQA 4AI8A 2CGOA 3G4SV 4X65O 1P7BA 3HR0A 4OGQB 3SYCA 3ZCCA 1Q6UA 4UV9A 5DM6V 4FVMA 3SPIA 5B1AC 3CCLV 1KQSU 2DYSB 2YC0A 1HR0B 3UO2A 2MK3A 4DR4O 3N27A 4BWAA 2DW4A 4LFBB 2BTQB 3K9AA 2Z3YA 1MNGA 3JAKA 1Y74A 3MDSA 3M8AA 4UVCA 3CHXA 4I0XA 3UT5A 2ZNIA 3STLC 1VQ5V 3VQYA 3L73H 3IC7A 4LH6A 5A2QN 1QHTA 2IH3C 4QGPA 3SJQC 3WG7C 2YIAA 3ZMTA 2VQEB 2E75B 2PZSA 4B3RB 3H1LH 1N33O 2AXTZ 4FM1A 5B1AB 1F4MA 2UUAO 4I9WA 5KUKA 1I7FA 3CRAA 1MA1A 1GM7A 2YIBD 2GV9A 1B04A 3FB5C 5KHKA 2C2AA 4MVRA 5L3BA 1MSWD 4X1IB 2QDOA 3HPLC 3KCYA 3OTOB 1V55C 4X64B 1HW7A 2WLKA 3NR7A 4CS2A 1VF5B 2LGQA 1H2MA 3N2KA 5LOVB 3WG7B 1NJIW 4J7JA 2VQFO 1Q6IA 2IJIA 2A79B 5IJ0B 5LA6A 1PM9A 4UB6Z 1K3EA 1PKXA 1G8MA 2XAJA 5H6QA 1PNKA 5JH7B 1QNMA 3K58A 1KC8W 1YSCA 1H2LA 2Y4UA 1BSMA 2PGGA 3FB7C 4UCTA 3CP1A 3HKBA 4I7ZB 2OWOA 4MSWC 2UUBB 2WLHA 4I0XB 3OE7G 3J81N 4TV8A 1RSOA 5B3SC 1V55B 4JV5O 4JZGA 1SF9A 3MD0A 2N04A 1F23A 5IDJA 1F7YA 5FNVB 4BW9A 3U11A 2JGUA 3HKDB 1NH2B 1WAZA 1DLBA 3QF7A 1XHZA 2IBZH 1SS3A 1Z5WA 4K8XA 4PV1B 3IAYA 4B3SO 4PA9A 3IFXA 1N8RW 3UQ8A 1US6A 3OMAB 3PJSK 2DOSA 3ZMZA
chains in the Genus database with same CATH topology
2GBOA 2ODMA 2NR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBO A;  2ODM A;  2NR5 A; 
#chains in the Genus database with same CATH topology
 1XHX A;  2UXB B;  2CTP A;  3GVM A;  4IIJ A;  5FPO A;  5B3S B;  2VRZ A;  4MVM A;  2EJR A;  2JIZ G;  4OX9 B;  2ZM6 B;  1R3I C;  4IHJ A;  5EBW C;  4JI7 B;  3D36 C;  4OPA A;  4OPH A;  4MTG A;  3LSQ A;  4UVA A;  3P32 A;  1CPY A;  2KG7 B;  5LA6 B;  3DC6 A;  2Q67 A;  1NI8 A;  4O2B B;  5ITZ B;  4LF9 O;  4NTX A;  4QJF B;  1HNX B;  4NYK A;  5EIB D;  2FB5 A;  4DR3 O;  4JI3 O;  4KL1 A;  3K9S A;  3GB7 C;  2NN4 A;  3HKB B;  4I4T B;  3K5M A;  2LFR A;  1G4Y B;  2F1M A;  4JI1 B;  4J42 A;  1Q7Y W;  3S3W A;  1H2K A;  4G28 B;  5KHH A;  2Q7E A;  1NR7 A;  3BFR A;  4WFE A;  3T1H B;  1GM8 A;  4DV7 O;  3K3W A;  1RFY A;  1ZL8 A;  4PI0 A;  5BR8 O;  2WPD G;  3L72 H;  2UUC O;  4MTX A;  4UUJ C;  2WLI A;  1DK1 A;  1U97 A;  3CB2 A;  1W0J G;  1ZUQ A;  2RNB A;  4ZI7 A;  2HVK C;  1KBH A;  4JI4 O;  3ETE A;  4YHH O;  1K4C C;  4LF4 O;  4AQY B;  1YVW A;  2QWQ B;  2PTM A;  4FZ1 A;  3K08 A;  3FX7 A;  5KAI Z;  1P4R A;  1CP9 A;  2CDY A;  3C3S A;  3G80 A;  5JJE B;  2Q68 A;  5LHI A;  2JJ2 G;  1NKD A;  2RQ6 A;  2PY5 A;  1XIL A;  2AW9 A;  1Y66 A;  5EYP A;  3B4S A;  3OUS A;  3ABK C;  1YTF D;  2CUG A;  1PD3 A;  1BMF G;  3OMI B;  1V54 C;  3JSN A;  4U3J A;  4DRX A;  2Q0O C;  1H38 A;  4X9Q A;  4DR5 B;  4B7E A;  1Y4M A;  5D5P A;  3H1K H;  3OEE G;  1FXV A;  4DR1 B;  3SPJ A;  4JI8 B;  4CH6 A;  1I94 O;  4HAM A;  5LYJ A;  1K8A W;  2FYU H;  4X8A A;  5CBF A;  4YY3 B;  4FLX A;  5K1P A;  4J9Y B;  5DEC A;  3CCJ V;  3ABK B;  5IT9 N;  3GWO A;  4GX2 A;  1JR9 A;  5LMN B;  1I08 A;  4HNA A;  4I55 B;  3JAM N;  1V54 B;  3RYC B;  3L71 H;  3STZ C;  3ZN0 A;  5BXZ A;  4DV1 B;  2JJ1 G;  4NXN O;  1M56 C;  4K8Z A;  1WB7 A;  2H94 A;  3JAW A;  3B8N A;  5JVD A;  1J5E B;  2DWE C;  1JJ2 U;  1M9N A;  3U10 A;  4JTA B;  3RYI A;  4MW8 A;  1VQN V;  2ZE6 A;  3CCS V;  2P4K A;  1R1B A;  1GN6 A;  3K59 A;  2Y69 C;  3RW0 A;  1XOU A;  1QLN A;  4LWS A;  1TA8 A;  3H9V A;  1IBK B;  1W59 A;  1X59 A;  1BHA A;  3QO7 A;  2HKO A;  2P6J A;  1GN2 A;  2ZIO A;  3K5L A;  1M56 B;  2B9Z A;  2ZE8 A;  5H9C A;  2P5O A;  1S72 V;  4MVS A;  2WWW A;  4RUE A;  2K1E A;  3CRR A;  1NTZ H;  5J2T B;  4DV0 O;  1AP6 A;  3AG4 C;  1L0L H;  2OCH A;  3BAA A;  2PYL A;  5IYC O;  1VQM V;  2ITC C;  3J80 N;  4HBN A;  4X66 B;  2L6L A;  2Y69 B;  5EIB C;  4MTO A;  5JQG A;  4ZOL A;  2Q0A A;  4JI5 B;  1LR1 A;  1ZAU A;  4FK5 C;  5EBL C;  3ZRW B;  5CA0 A;  2XND G;  4I50 B;  4RO2 A;  2B5U A;  1IVS A;  1H2G A;  1QVG U;  4JAA A;  2YI9 A;  3CWB H;  1M5I A;  2AZ2 A;  1ORQ C;  4LH7 A;  1Q86 W;  3JAT B;  4XDJ A;  1S0V A;  4LF8 O;  4NXM O;  1D5N A;  3AG4 B;  5C8Y A;  5BY1 A;  2XAS A;  4MS2 A;  4E2L A;  4UCU A;  5A9G A;  2HP8 A;  4MW3 A;  2WAM A;  3T1Y B;  1XEQ A;  4FJC C;  1NZ6 A;  2QEX V;  4LF6 B;  2EIJ C;  1GN4 A;  4DV2 B;  4YIO A;  3CCE V;  3DXR B;  4NTY A;  1HNZ B;  2YUA A;  4FPP A;  3CME V;  1JVM A;  1L0N H;  1YHQ V;  1NTM H;  1Q8I A;  2CK3 G;  3BA8 A;  3T4D A;  1YJN V;  5FPR A;  2KSD A;  1TVK A;  3IJ4 A;  1CEZ A;  3E2E A;  2P90 A;  2QTO A;  2EBO A;  1AB3 A;  1M90 W;  1SQX H;  2VWK A;  1VQP V;  2YEV B;  4P2Z A;  1AR1 B;  2EIJ B;  4DUZ B;  3BEH A;  4DV4 O;  2QWN B;  2Z0A A;  5CA0 B;  2W6I G;  2HLD G;  4O2A B;  4WFH A;  1Q90 D;  4K0K B;  2ADP A;  5KAF Z;  2OCC C;  2BTQ A;  4G2K A;  2EIN C;  1GAX A;  1YTF B;  4B3T O;  1ZLZ A;  3OFN G;  1NTK H;  4CZZ A;  4UFZ A;  1K34 A;  5EZY B;  2OTL V;  3E35 A;  4DR7 B;  3TET A;  4H37 A;  3W7X A;  4JGS A;  4BIZ A;  1E79 G;  1SA0 A;  2WLL B;  1AR4 A;  2HJF C;  4DR2 O;  2EX3 A;  4PDL A;  1H8H G;  3CD6 V;  5H2F Z;  3CC2 V;  2F95 B;  1TUE B;  1MSD A;  2M7W A;  5CA3 A;  3ASO C;  3D3I A;  4H44 B;  3AK3 A;  2OCC B;  2YDE A;  2IM9 A;  2EIN B;  1W2B U;  1TVK B;  5GTI Z;  3SPH A;  3CJH B;  2ZD9 A;  4J10 A;  4KHP O;  2LP7 A;  4X1I A;  3SYP A;  1KKC A;  2O57 A;  4N23 A;  3CCR V;  1NR1 A;  3H01 A;  2UU9 O;  4LF7 O;  1N36 B;  1VQ9 V;  2QM8 A;  2CTQ A;  4ZHQ B;  4FMT A;  4QPJ A;  5LOV A;  1IBM B;  3UO3 A;  1EBO A;  3TXQ A;  4E4E A;  2B1I A;  1GTO A;  4R50 A;  3VQX A;  4HYO A;  5IJ0 A;  2RN9 A;  1PP9 H;  3QO8 A;  4B08 A;  3ASO B;  2X6C A;  1VF7 A;  5JH7 A;  1XNR O;  3FAV B;  2V1D A;  3K03 A;  1VQ4 V;  1AP5 A;  2JVD A;  4PD4 F;  3C3T A;  2HEP A;  4LFC B;  3ZRX A;  2NLJ C;  2Q6A A;  1BHB A;  4LFA O;  3ABU A;  4GX5 A;  1K92 A;  1SA0 B;  2DN9 A;  1FFX B;  5FNV A;  3WFV A;  5LP6 C;  3C90 A;  1PL4 A;  1S5J A;  1VQ8 V;  3HKD A;  4O4L B;  1EZV H;  4JZ2 A;  1BS3 A;  4LF5 B;  3M99 B;  3ZJZ A;  1GH6 A;  1AI6 A;  5H5N A;  2LQT A;  2Q73 A;  1K9M W;  1IBL B;  2A9H A;  4O4I B;  2HHH O;  4NKG B;  2XOK G;  4X65 B;  3I56 V;  4J11 A;  2PYJ A;  3LSU A;  3JAR B;  4MVZ A;  4DR4 B;  1IXM A;  4I9Q A;  3K5N A;  1KP3 A;  1FJG O;  3RFR A;  4YJ3 B;  3CE2 A;  1D5A A;  1XUQ A;  2IJK A;  1QLE C;  5LP6 B;  5B1N A;  2JDI G;  2ZDI C;  1BE3 H;  2Q9L A;  3QTC A;  4GKJ O;  1QR9 A;  3CRC A;  3DC5 A;  2YXL A;  3RGB A;  2KG7 A;  3EFF K;  1IDS A;  1PV0 A;  1K4D C;  4H0L B;  3G67 A;  3B8M A;  4O2B A;  2EIL C;  2EIM C;  3ZHR A;  4F6E A;  5ITZ A;  3EVK A;  4P30 A;  4EB6 B;  2LJ2 A;  1N33 B;  1ENV A;  1RP3 B;  2AGA A;  4I4T A;  4DV5 O;  3B77 A;  4BW5 A;  3T2M A;  1H2S B;  1R3L C;  2UUA B;  1IXB A;  2QTS A;  1DF4 A;  2R70 A;  3LDE A;  1QLE B;  4GYC B;  4TQD A;  1OHH G;  3D36 A;  4TT3 G;  3CYO A;  2Q8V A;  5JWP A;  2X7R B;  4PI2 A;  1SER A;  1I5X A;  1JFF B;  3G6E V;  2K9P A;  2H3O A;  1F51 A;  2EIL B;  2EIM B;  1MZF A;  2CTW A;  3A0H Z;  3W7W A;  2R9A A;  5DN6 G;  2VQF B;  5L3E A;  3EXA A;  2JGD B;  3NXS A;  4RQE A;  4WCE V;  1EFR G;  3A8T A;  2E74 B;  4J9Z B;  1UFI A;  3B2E E;  2GUZ B;  4ZBM A;  4FLU A;  2DYR C;  5L3F A;  3OGI B;  1UPG A;  3LDD A;  3APQ A;  3B09 A;  5K1X A;  3CRM A;  3K04 A;  3ICX A;  5GW7 A;  4L87 A;  1TAE A;  1BCC H;  4O4J A;  4OXS A;  4JV5 B;  1PNM A;  2ZIN A;  4DK0 A;  4B3M O;  3ML0 A;  2ZT9 B;  4DK1 A;  4HZ3 A;  2Q69 A;  4FLY A;  1H8E G;  4R7C A;  3FD9 A;  5GON B;  4Z1M G;  1Z2G A;  1S5H C;  4P9O A;  2GSM B;  5HFM A;  4B3S B;  4YXW G;  2DYR B;  3FFQ A;  1XDC A;  1WA8 B;  4J80 A;  4NB5 A;  1NS1 A;  3SGI A;  1N4C A;  4AIL C;  1P7G A;  2GDS A;  4FM2 A;  1RM1 C;  2DE0 X;  3AEI A;  2YIB A;  3IC9 A;  5LMU O;  4PA4 A;  2DQ3 A;  5CB4 B;  1H2N A;  5KMG B;  1OZ0 A;  4YIP A;  2BOC C;  4I55 A;  2UXC O;  3SR2 C;  3RYC A;  5D5Q A;  1Y76 B;  3ZRV A;  3D8C A;  1YEW A;  1S3J A;  1V9P A;  3B40 A;  1M1K W;  3Q4H B;  1AJP A;  4GX1 A;  2PF4 E;  1YCI A;  4JI0 O;  3OGC C;  3SPG A;  5L3G A;  4JF3 A;  1U96 A;  4LF9 B;  3W7U A;  2QWO B;  1TGO A;  3JD2 A;  4Q6G A;  4DR3 B;  2XAF A;  4JI3 B;  3VBB A;  4DV6 O;  1RM1 B;  2WA3 A;  1XNQ O;  4J7K A;  3JAS B;  2F4V O;  4O4J B;  2IJJ A;  3ZIA G;  2UXN A;  3BY6 A;  3WB1 A;  5LHG A;  5CBG A;  4DV7 B;  1Q6H A;  1KMI Z;  5EK0 A;  1T5E A;  5BR8 B;  4PA7 A;  1Q43 A;  1YXB A;  4WBN B;  3H1H H;  4JYY A;  2UUC B;  3X2Q C;  2ZR2 A;  3CRQ A;  5J2T A;  2IW5 A;  1SQP H;  1WLE A;  4FIP C;  4FM0 A;  3QG5 A;  1OV9 A;  4DW0 A;  4JI4 B;  2BSK B;  4YHH B;  2WLJ A;  4UVB A;  2HVJ C;  1DF5 A;  4LF4 B;  1KP2 A;  3JSL A;  1OCO C;  1X4T A;  4EFB A;  2OIE A;  2Y4T A;  2QR4 A;  3K79 A;  4KXR A;  1VP7 A;  4CH5 A;  1AJN A;  2L35 A;  2A7W A;  3ZRW A;  2ZR3 A;  5LXT B;  4I50 A;  3AK1 A;  1ZSP A;  2AHY A;  3E8H A;  1N32 O;  4IGG A;  3E8B A;  1YIJ V;  3X2Q B;  3LDC A;  3E8G A;  1EN4 A;  2WA4 A;  3JAT A;  3CCM V;  1N0J A;  4NR1 A;  1VF6 C;  4JYA O;  2XT9 A;  1OCO B;  1NVP D;  4BIU A;  2BTO A;  5L3C A;  2UXD O;  4TV9 B;  1AI5 A;  1VMG A;  2QKC A;  1WJZ A;  2QWP B;  1I94 B;  3E22 B;  4F6R B;  2WSS G;  1URF A;  3DXR A;  4WFF A;  3ZHT A;  4WFA V;  3A2F A;  1TUB B;  5CA1 B;  1HNW O;  2V7Q G;  4FLV A;  1FYJ A;  1F4N A;  4NXN B;  4YJ2 B;  5LL6 Y;  4ICG A;  3JD1 A;  3ZMS A;  1FXK C;  4F4L A;  4JTC B;  2JS5 A;  2LW1 A;  1XBL A;  1OCC C;  5JCO C;  5FLX N;  2GTS A;  1RPR A;  2YEV A;  4KFM A;  2P06 A;  4W4L A;  3IGA C;  3OT7 A;  4CH4 A;  3OR6 C;  4UCV A;  3ZBH A;  1GO3 F;  4X62 O;  3A0B Z;  4QNH B;  2ODM A;  3ZHU A;  1XMO O;  1A32 A;  1XL4 A;  3BVO A;  2GBO A;  4O2A A;  2EJ7 A;  5C93 A;  2F23 A;  4X1K B;  1XMQ O;  3SYA A;  2MW2 B;  5IWA O;  5TIS Z;  4JAV A;  2EUL A;  1KEC A;  2W0X A;  1W0K G;  1SQF A;  4DV3 O;  3OW2 U;  3FYE B;  1FXK B;  4GLX A;  1N34 O;  5KUM A;  2Y0I A;  5EZY A;  1OCC B;  3S3X A;  1KD1 W;  4LR3 A;  3MAQ A;  1KYO F;  1QR8 A;  4FLT A;  4FFB B;  5BMV B;  2WLL A;  3LUT B;  4AHC A;  1WPX A;  5KHJ A;  4DV0 B;  4GCZ A;  1KU9 A;  4PDM A;  2LFS A;  1AR5 A;  3OAA G;  1NBM G;  4H33 A;  1DGS A;  2W0F C;  1NT2 B;  2PI5 A;  1IX9 A;  3TCU A;  3CJH A;  4GT1 A;  4QE9 A;  5H6R A;  3UKM A;  3N2G B;  4DUY O;  2XAG A;  4R8C A;  4BAY A;  4EKW A;  3SYO A;  2FML A;  2X6A A;  1M93 A;  2RDC A;  4LC1 A;  5IJ9 B;  4ZHQ A;  1D2D A;  3L75 H;  3CEI A;  3H1J H;  4LF8 B;  2D2C B;  4NXM B;  3OD4 A;  2DMX A;  4RWU A;  3AG7 A;  4JI2 O;  4GUN A;  4D7S A;  5IYD O;  2QGN A;  3RYH B;  2QJ1 A;  3KG2 A;  3O65 A;  3WB0 A;  3RWR D;  1OCZ C;  1GMG A;  3HKC B;  3APO A;  3FAV A;  4FFK A;  1GK9 A;  3P30 A;  3RYF B;  3BPZ A;  1G6U A;  4JI6 O;  4FLZ A;  5LGT A;  3CX5 F;  3A0R A;  3W7S A;  1JOY A;  4GKK O;  1LUV A;  5GTH Z;  1Q3E A;  1FFX A;  3BCC H;  4XDK A;  2E5L O;  4DR6 O;  2DJV A;  4TUY B;  5IYZ B;  3U0Z A;  4O4L A;  2QKA A;  2LGW A;  1OCZ B;  4TSF G;  2JEU A;  2FKX A;  4WFG A;  2N74 A;  4DV4 B;  1HR0 O;  4O4I A;  3G71 V;  4JPR A;  1GRJ A;  1SZT A;  4LFB O;  1JX9 A;  1MZE A;  2JRI A;  3SJB C;  1M4U A;  1YJ9 V;  4X1Y B;  3JAL B;  2QM7 A;  3JAR A;  4NTW A;  2XUM A;  3K06 A;  2ILM A;  5LBQ A;  1VQL V;  3E86 A;  3LSS A;  4YJ3 A;  3AG1 C;  3D3Q A;  5JJN B;  5LP6 A;  4JAU A;  2BE3 A;  3AG2 C;  4B3T B;  2EZO A;  5BZB A;  2N05 A;  1BZK A;  4QE7 A;  1VQ6 V;  4BIO A;  2VQE O;  1AVM A;  1EN6 A;  3CMA V;  1E1Q G;  1S5L Z;  4B3R O;  1DTO A;  2KB1 A;  2A3Q A;  3RT3 C;  3HKE B;  2YID A;  4CH3 A;  1GKF A;  2Z5U A;  2Y0P A;  5EC1 C;  4DR2 B;  1NVP B;  1K97 A;  4LP8 A;  2WLM A;  4EB6 A;  4K3A A;  3ASN C;  2ZQM A;  2QA4 V;  3K0D A;  4PHZ A;  4TWK A;  1PL0 A;  3AG1 B;  1LNQ A;  3AG2 B;  3OTO O;  3UCS C;  2ZDI A;  1K5Q A;  4UCO A;  4X64 O;  4KHP B;  2IH1 C;  1BQ0 A;  1SET A;  2OIG A;  3DSQ A;  1ROP A;  4LNU B;  2M6Y A;  3CSX A;  2UU9 B;  4LF7 B;  1JFF A;  3I5D A;  3BAB A;  4N21 A;  4A5U B;  5IE9 A;  1L8D A;  4W4K A;  1QQC A;  4UCR A;  2ZCE A;  3RVZ A;  2KKW A;  3O9O A;  3ASN B;  2BOB C;  2YI8 A;  1BL8 A;  2F66 C;  2JGD A;  4O4H B;  5KX5 B;  1B06 A;  3RVY A;  3EHB B;  2UUB O;  2ZKO A;  2GUZ A;  2P7T C;  4X20 B;  1XNR B;  1FXH A;  3SJA C;  1XQ8 A;  3ZX6 A;  4X89 A;  2XHB A;  3CC4 V;  2CH7 B;  5CMU A;  1SQV H;  3AG3 C;  4K35 A;  3P3P A;  3VQV A;  4WF9 V;  5J2U B;  2DWD C;  4Q20 A;  4LFA B;  3KCX A;  3BRC A;  3TGU H;  1QBZ A;  3ZHQ A;  1FPO A;  3VOU A;  1R73 A;  3QNE A;  4U7N A;  2EZP A;  5GON A;  5E1A C;  1MAB G;  2JK5 C;  5AG2 A;  5DED A;  4J7Z A;  1WN7 A;  1ARO P;  1AIL A;  3CCQ V;  2UXB O;  1N0N A;  3ETG A;  4UCS A;  2HHH B;  2Y48 A;  2NR5 A;  3J7A U;  1ZX3 A;  4J41 A;  1WA8 A;  4OX9 O;  3AG3 B;  2ZM6 O;  3JAK B;  4IYH A;  3W7T A;  1Y74 B;  4JI7 O;  2A06 H;  3E8F A;  3UT5 B;  3CC7 V;  1FJG B;  2LW7 A;  5CB4 A;  3DTU B;  4DW1 A;  1SES A;  2VWJ A;  1BGY H;  5KMG A;  3ZHS A;  3L9D A;  3SPC A;  5L3D A;  4U7O A;  1ZWI C;  1Y76 A;  4GKJ B;  3CS5 A;  1R6K A;  1HNX O;  3Q4H A;  2P67 A;  1WP8 A;  2H8P C;  1I0H A;  1I5Y A;  2X0L A;  1UJW B;  4JI1 O;  5IY5 C;  5J9P C;  1PPJ H;  4PA3 A;  4DV5 B;  4UV8 A;  3JAS A;  2XTA A;  3LNM B;  3T1H O;  1YJW V;  2ADQ B;  2ATK C;  2Q5Z A;  5KLV H;  3CXH F;  1MG1 A;  2G38 A;  3WU2 Z;  3HB3 B;  1FD9 A;  3N2K B;  1VAR A;  4WBN A;  2WLN A;  4CC6 A;  3GWK C;  4AQY O;  1QVF U;  2AHZ A;  3QO5 A;  3ZED A;  5IY5 B;  1SC5 B;  1K33 A;  1EM1 A;  3E83 A;  4MT8 A;  2BSK A;  3DGE A;  2ZNJ A;  5E79 Z;  5KA5 A;  3CXC U;  1YDX A;  4X88 A;  5EC2 C;  1R6N A;  3BA9 A;  5IYB O;  2YS8 A;  4TV8 B;  1RSO B;  1K73 W;  2ITD C;  1Q5O A;  3PN1 A;  3WB2 A;  1Q82 W;  1NU1 H;  3G6B A;  2XAQ A;  5LXT A;  2E3C A;  2LO1 A;  2ZXW C;  4DR5 O;  4B3M B;  2ZE7 A;  4DR1 O;  1P49 A;  2A0L A;  4JI8 O;  1Q81 W;  5JJJ B;  1AI7 A;  2R72 A;  1M57 C;  1P84 F;  3L70 H;  4YY3 O;  4PEL A;  2IJH A;  4TV9 A;  4IIJ B;  2F43 G;  1FAF A;  3ZN1 A;  5F2V O;  2HR3 A;  3E22 A;  1Z5V A;  4F6R A;  1IUR A;  2YIC A;  4QPK A;  1YIT V;  5LMN O;  4IHJ B;  1VEW A;  2IU3 A;  2ZXW B;  1SQQ H;  4UB8 Z;  5LMU B;  4Z1V A;  4DV1 O;  2OTJ V;  1TUB A;  5CA1 A;  2YXY A;  1FKA O;  4CS4 A;  3ZS8 C;  1SZX A;  2RMK B;  3OTF A;  4ZKI A;  2UXC B;  2CGN A;  2ARH A;  1VF6 A;  2ZIM A;  4YJ2 A;  1J5E O;  2DQ0 A;  1M57 B;  1O9G A;  4JYB A;  2B1G A;  4JI0 B;  3ABM C;  2GHY A;  4PJ0 Z;  1WNS A;  3ETQ A;  4RAI A;  4DO2 A;  4FZ0 A;  4TQF A;  3SDL A;  4DV6 B;  4PA6 A;  1IBK O;  1XNQ B;  1QCE A;  1S77 D;  2F4V B;  1Y67 A;  1K7D A;  1HDJ A;  4X1K A;  3SYQ A;  3FYI B;  1ZL8 B;  4DXW A;  2QE7 G;  1B6Q A;  1G1X B;  1JJO A;  2WLI B;  2RJZ A;  4MTF A;  3ZMU A;  4MVQ A;  1FXK A;  2IU0 A;  4MVU A;  3ABM B;  4ZI7 B;  3JYC A;  1SQG A;  2VS0 A;  1Y6X A;  4LBE C;  4NVP A;  5JCO A;  3CPW U;  1HP8 A;  4X66 O;  4FFB A;  5BMV A;  1YZB A;  2OT5 A;  4KUM A;  1XRE A;  1QU7 A;  3TXS A;  4JI5 O;  1E1R G;  4R6Z A;  3CCV V;  1YI2 V;  2HG5 C;  3F7V C;  4GX0 A;  1IZ3 A;  1K5S A;  4JAS A;  5EYP B;  1SKV A;  4EFE A;  2YXH A;  3TJT A;  2PUS A;  3OR7 C;  4D7T A;  1SRY A;  4H13 B;  5B1B C;  3OEH G;  4U3J B;  4DRX B;  1N32 B;  2QKS A;  3N2G A;  3MHS C;  2FL4 A;  4JTD B;  3FB8 C;  4C7U A;  5CN0 A;  3KZI Z;  3ZRS A;  2EIK C;  4G27 B;  4KP4 A;  5IJ9 A;  3OMN B;  3R65 A;  2CAZ C;  3JCU Z;  2PI4 A;  1ZTE A;  3T1Y O;  4JYA B;  3KKY A;  5LYJ B;  2JEX A;  1NQT A;  4RQF A;  3K57 A;  1AI4 A;  3E89 A;  4LF6 O;  4DV2 O;  3RYH A;  2UXD B;  3F5W C;  1HNZ O;  1EN5 A;  3I55 V;  3HKC A;  3OM3 B;  4XDL A;  4Z2W A;  1VQ7 V;  5B1B B;  4HNA B;  2GTA A;  1VIB A;  2RCV A;  3RYF A;  1HNW B;  1KB9 F;  3TK1 A;  1BT8 A;  2AZ0 A;  4IYI A;  2EIK B;  2X6B A;  2CTR A;  3R66 A;  5CBH A;  4L8J A;  4WFB V;  4CS3 A;  4P9P A;  5HFL A;  3JAW B;  3SJC C;  5JVD B;  3ZMV A;  2R9I A;  1KKD A;  3OUF A;  5B1O A;  4TUY A;  5IYZ A;  4DUZ O;  3CCU V;  4XBF A;  3T4Z A;  2Q4P A;  3RYI B;  5FL7 G;  1R6T A;  3F7Y C;  1WB8 A;  3L74 H;  4K0K O;  1OCR C;  3H1I H;  4I5S A;  1R3K C;  4LWS B;  4BR6 A;  4X62 B;  1MMM A;  1XMO B;  1JPX A;  4ZIB A;  4X1Y A;  4QIW F;  3JAL A;  1L1F A;  1XMQ B;  3AK2 A;  3ETD A;  2P22 C;  2ETN A;  5IWA B;  2YSU B;  2R9R B;  2CE4 A;  3ABL C;  3FB6 C;  1WP7 A;  4U3F H;  4EEQ A;  3MHH C;  4DR7 O;  4DV3 B;  1NH2 D;  1COW G;  4RUF A;  1XI1 A;  1N34 B;  4ABM A;  3JD3 A;  3VQW A;  2UXX A;  2HFE C;  1SQB H;  4TOI A;  3HKE A;  3F5T A;  1GN3 A;  2ZE5 A;  1OCR B;  5LGU A;  4DYL A;  4ASU G;  1J95 A;  5KHG A;  5JQG B;  4UXN A;  4ZOL B;  1HWY A;  3K0G A;  3RBZ A;  2F93 B;  3QVN A;  2W6J G;  2D3O W;  2E76 B;  2Q7G A;  1EZJ A;  4MVO A;  4CBC A;  4GZR B;  1KUQ A;  3ABL B;  1XL6 A;  4B7K A;  3K5O A;  2FTK A;  2HJD A;  3P3N A;  1N36 O;  2NNU A;  3ZHV A;  1OJH A;  3ABT A;  1YF2 A;  3THO A;  4DUY B;  5C8Y B;  3UM7 A;  1IBM O;  2QM4 A;  3BHP A;  4LNU A;  2OYQ A;  1WPB A;  1PNL A;  1CXZ B;  1MOF A;  3JD4 A;  4FLW A;  4JI2 B;  5EBM C;  1VQO V;  3T1C A;  4PDV A;  2V4D A;  2QSA A;  4LCU C;  2XAH A;  1GM9 A;  4O4H A;  4PDR A;  5KX5 A;  4JYC A;  1FFT B;  5B66 Z;  1VQK V;  1BQZ A;  3JCZ A;  1THZ A;  5KHI A;  1RPO A;  3LNN A;  4LFC O;  4X20 A;  5LGN A;  2DYS C;  1S76 D;  1JMK C;  1FS0 G;  2CH7 A;  3JD0 A;  4CC5 A;  2P4V A;  4D6T H;  3FKS G;  1R3J C;  5J2U A;  4JI6 B;  3M7M X;  3RN4 A;  4IL6 Z;  1O9H A;  1JQ0 A;  4GKK B;  5KA6 A;  2JS3 A;  4IT5 A;  5B5E Z;  2BCC H;  2KQX A;  4LF5 O;  1LUW A;  1JCH A;  2QWR B;  2Q7H A;  5LHH A;  2E5L B;  1B3Q A;  1IBL O;  1JA8 A;  4DR6 B;  1AJQ A;  4AI8 A;  2CGO A;  3G4S V;  4X65 O;  1P7B A;  3HR0 A;  4OGQ B;  3SYC A;  3ZCC A;  1Q6U A;  4UV9 A;  5DM6 V;  4FVM A;  3SPI A;  5B1A C;  3CCL V;  1KQS U;  2DYS B;  2YC0 A;  1HR0 B;  3UO2 A;  2MK3 A;  4DR4 O;  3N27 A;  4BWA A;  2DW4 A;  4LFB B;  2BTQ B;  3K9A A;  2Z3Y A;  1MNG A;  3JAK A;  1Y74 A;  3MDS A;  3M8A A;  4UVC A;  3CHX A;  4I0X A;  3UT5 A;  2ZNI A;  3STL C;  1VQ5 V;  3VQY A;  3L73 H;  3IC7 A;  4LH6 A;  5A2Q N;  1QHT A;  2IH3 C;  4QGP A;  3SJQ C;  3WG7 C;  2YIA A;  3ZMT A;  2VQE B;  2E75 B;  2PZS A;  4B3R B;  3H1L H;  1N33 O;  2AXT Z;  4FM1 A;  5B1A B;  1F4M A;  2UUA O;  4I9W A;  5KUK A;  1I7F A;  3CRA A;  1MA1 A;  1GM7 A;  2YIB D;  2GV9 A;  1B04 A;  3FB5 C;  5KHK A;  2C2A A;  4MVR A;  5L3B A;  1MSW D;  4X1I B;  2QDO A;  3HPL C;  3KCY A;  3OTO B;  1V55 C;  4X64 B;  1HW7 A;  2WLK A;  3NR7 A;  4CS2 A;  1VF5 B;  2LGQ A;  1H2M A;  3N2K A;  5LOV B;  3WG7 B;  1NJI W;  4J7J A;  2VQF O;  1Q6I A;  2IJI A;  2A79 B;  5IJ0 B;  5LA6 A;  1PM9 A;  4UB6 Z;  1K3E A;  1PKX A;  1G8M A;  2XAJ A;  5H6Q A;  1PNK A;  5JH7 B;  1QNM A;  3K58 A;  1KC8 W;  1YSC A;  1H2L A;  2Y4U A;  1BSM A;  2PGG A;  3FB7 C;  4UCT A;  3CP1 A;  3HKB A;  4I7Z B;  2OWO A;  4MSW C;  2UUB B;  2WLH A;  4I0X B;  3OE7 G;  3J81 N;  4TV8 A;  1RSO A;  5B3S C;  1V55 B;  4JV5 O;  4JZG A;  1SF9 A;  3MD0 A;  2N04 A;  1F23 A;  5IDJ A;  1F7Y A;  5FNV B;  4BW9 A;  3U11 A;  2JGU A;  3HKD B;  1NH2 B;  1WAZ A;  1DLB A;  3QF7 A;  1XHZ A;  2IBZ H;  1SS3 A;  1Z5W A;  4K8X A;  4PV1 B;  3IAY A;  4B3S O;  4PA9 A;  3IFX A;  1N8R W;  3UQ8 A;  1US6 A;  3OMA B;  3PJS K;  2DOS A;  3ZMZ A; 
#chains in the Genus database with same CATH homology
 2GBO A;  2ODM A;  2NR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...