1G4YB

1.60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium-calmodulin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
82
structure length
81
Chain Sequence
DTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords CALCIUM-ACTIVATED POTASSIUM CHANNEL RSK2
publication title Structure of the gating domain of a Ca2+-activated K+ channel complexed with Ca2+/calmodulin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 33
structure length 81
sequence length 82
ec nomenclature
pdb deposition date 2001-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1g4yB00
2R9RB 2NLJC 2WLNA 3E89A 4JTAB 4TWKA 4XDLA 2EIMC 2EINC 1OCRC 4H37A 3SPJA 2Y69C 3AG2C 4HZ3A 1JVMA 4LP8A 3T4DA 4X88A 3OR7C 4MW8A 3PJSK 4P9OA 4J9YB 1P7BA 2WLMA 2DWEC 2DYRC 3KG2A 4P9PA 4QE7A 5J9PC 3JYCA 3LNMB 3ABKC 3UKMA 3E8BA 2EIKC 3ZRSA 3IFXA 3FB6C 5EBWC 4OXSA 5CBFA 2WLHA 4MTOA 4MVRA 4MVMA 3LDDA 5BZBA 3K03A 3LDCA 4RUFA 4X89A 1LNQA 2WLJA 4PDRA 3F5WC 2QTOA 3RBZA 2BOBC 5EC2C 4P30A 4HYOA 3K08A 4MVZA 4GX1A 2WLKA 4LBEC 4R50A 2OCCC 1ZWIC 3SYAA 2EIJC 3AG4C 4RUEA 2ITCC 3RVZA 2X6AA 2ZD9A 4JTCB 2HFEC 5EC1C 4GX5A 2DWDC 2K1EA 4MS2A 1V55C 4MTFA 4UUJC 1XL6A 2BOCC 4XDJA 4MVSA 3TETA 2X6BA 3ASOC 5EBLC 2HJFC 3K06A 3BEHA 3SJQC 3TCUA 1V54C 2Q6AA 1OCCC 4CBCA 1QLEC 2H8PC 2JK5C 2WLLA 3E86A 3IGAC 3SPHA 3SPIA 3LUTB 5EK0A 2QKSA 4R7CA 4BW5A 5E1AC 4X8AA 4XDKA 2IH3C 1G4YB 5IY5C 3FB7C 4GX2A 4MW3A 3SPGA 3UM7A 1M56C 3K0GA 5KUKA 1BL8A 4R6ZA 1XL4A 2WLIA 3X2QC 2X6CA 3F7VC 2HVJC 5CBGA 3E8HA 2P7TC 2A79B 4PDVA 4WFFA 3SYQA 3E83A 5B1BC 5B3SC 3HPLC 3RVYA 5B1AC 1R3JC 3SYPA 2WLLB 4MVUA 4PA7A 5EBMC 3STLC 3ASNC 3FB5C 2Q67A 4RO2A 4PDMA 2YEVA 1S5HC 2A9HA 3RW0A 1R3KC 3AG3C 4MTGA 1K4CC 3OUSA 3WG7C 2EILC 3AG1C 3SPCA 2IH1C 1M57C 2AHZA 4MVQA 3T4ZA 4MVOA 4H33A 3K0DA 4KFMA 4QNHB 2AHYA 3GB7C 3OUFA 4P2ZA 4WFGA 3LDEA 2W0FC 3R65A 4ZBMA 1R3LC 4JTDB 1OCOC 1R3IC 3F7YC 2KB1A 4DXWA 5KUMA 1OCZC 2ATKC 3VOUA 3E8FA 4MSWC 3ABLC 4G28B 4QE9A 2HG5C 3SYOA 3SYCA 1J95A 3EFFK 3T2MA 3ABMC 3ZJZA 1ORQC 1K4DC 2ITDC 3E8GA 4PA6A 2Q68A 3STZC 4I9WA 4RAIA 5CBHA 4GX0A 4PDLA 3T1CA 3OGCC 4PA9A 2Q69A 2A0LA 3FB8C 4J9ZB 4LCUC 3K04A 4PA3A 4G27B 4EKWA 4F4LA 2HVKC 4WFEA 2DYSC 4WFHA 2WLIB 1KKDA 3OR6C 4PA4A 4R8CA 2ZXWC
chains in the Genus database with same CATH superfamily
2DN9A 1Q6UA 3RGBA 1Q82W 4LF6O 4IHJA 3T1YO 4J80A 4DV3B 4LP8A 1JPXA 2DQ0A 1KD1W 1N32B 1GTOA 1AROP 4NTXA 4UVAA 1UPGA 2ILMA 1GK9A 5BZBA 4RWUA 2E5LO 3SDLA 4PI0A 3WFVA 2CTPA 4NTYA 2GDSA 2GUZB 5EC2C 5GW7A 3EHBB 3A0RA 4I50A 4LF4B 1I7FA 2EZPA 3G67A 4UUJC 4NXNO 1VEWA 4Q6GA 2QA4V 4J41A 3BAAA 3SJQC 2HJFC 2QJ1A 2EIMB 2F93B 4K0KO 3FAVA 2CGOA 3DGEA 4DO2A 1Z2GA 5LOVA 3SJCC 3BFRA 2M7WA 1NZ6A 3D36C 4BIUA 4QGPA 5KUKA 3QO8A 2X6CA 1S5JA 3TXQA 2P7TC 3CRRA 2RCVA 5JCOC 2Z5UA 4JI4O 1YTFD 3FKSG 4JGSA 3EVKA 5LA6B 4UV9A 2ZE6A 4I5SA 2W6JG 2VRZA 4KXRA 4YY3B 1MOFA 1FJGB 1R73A 1FPOA 3K0DA 3QNEA 1HR0B 1FFTB 3LNNA 4LFBB 1QCEA 4QNHB 2DE0X 3JSNA 5LXTA 1H2SB 1J5EO 1HNZO 2ZM6O 3FYIB 3WU2Z 4FMTA 4I0XA 4JV5B 1NJIW 2QWPB 2ATKC 5J2TB 4O4JB 2Q68A 2CE4A 1Y4MA 4GX0A 4PA9A 2DJVA 1A32A 3DSQA 2ADPA 1V55B 4X62O 1Z5VA 2DYSC 3VQVA 4J10A 4DR2B 1IVSA 3OD4A 2RN9A 1JX9A 4UV8A 4TOIA 2QWOB 4XDLA 3G4SV 2VWJA 1OCCB 5AG2A 3H01A 1WJZA 4MW8A 3BA8A 1JMKC 2UUCO 2UUBB 3KG2A 3DXRA 2ZR2A 4CS3A 5CN0A 4LF6B 2R72A 3O65A 2M6YA 4JI5O 1WNSA 4X89A 4U3JB 3ZMZA 5L3DA 1FXVA 4OPAA 3KKYA 1AR1B 2E5LB 2HLDG 2X6AA 2ZD9A 4JTCB 4NYKA 1AILA 1M57B 4FFKA 4LH6A 5DECA 1GN4A 1HWYA 2P6JA 4AQYO 3OMAB 1PL0A 1BT8A 1VQ9V 4NXNB 3LUTB 3IAYA 4X8AA 1AR4A 4CS4A 1VQKV 1B06A 4JI8O 4K0KB 1MZFA 4E2LA 1EN6A 4NTWA 4IGGA 4WFAV 1AVMA 5B3SC 4NR1A 4DV5O 4H44B 2Y4TA 2Q5ZA 4QPJA 4RO2A 4CH3A 4MTGA 2IH1C 3T4ZA 3CC2V 4JI4B 5KAFZ 3CSXA 4UB6Z 3K5OA 1OZ0A 5D5QA 4LR3A 5KHGA 4U3FH 3C90A 2XASA 3BVOA 3L71H 1CPYA 1PV0A 4TQDA 1XEQA 1QLEB 1NQTA 2GUZA 2YXHA 2BCCH 2CDYA 1HNZB 1J5EB 2ZM6B 2WSSG 4DR7O 3HKDB 1SQXH 3E8GA 2MK3A 2PF4E 4PA6A 4JI1O 3AG4B 1YJ9V 3B8MA 2HVKC 2R70A 4WFHA 2UXXA 2ZQMA 4PHZA 1AJPA 3L70H 4B3SO 4B3RB 1RPRA 4K8ZA 2RJZA 1JVMA 4LNUA 2YDEA 3CS5A 1EZVH 2GSMB 3H1JH 3JYCA 5EBWC 3UT5B 2CH7B 2UUCB 1MA1A 4RUFA 5LHIA 2KSDA 2JGDB 3L73H 2QTOA 2F43G 5FPOA 3ASNB 5EIBD 4JI5B 3A0BZ 3AG3B 4QPKA 2FL4A 1Y76B 3ZN0A 3BEHA 3CCUV 3THOA 3OGIB 4OPHA 1WA8B 1JA8A 1OCOB 4IL6Z 5J2TA 4FK5C 4O4JA 4BW5A 5JH7B 1M93A 2Q0OC 4GX2A 1BS3A 1GN3A 1NVPD 1L8DA 3W7SA 1EN5A 4WFFA 2W6IG 4DV7O 4JI8B 2NN4A 2QE7G 3VQXA 5L3FA 2XAHA 2LP7A 5LGNA 4DV5B 3J7AU 1Q86W 1I08A 2V4DA 4UCTA 4TV9B 3CC4V 1D5NA 4U3JA 2ZNIA 3H1IH 2KKWA 4PV1B 1R3IC 1B3QA 1MNGA 2A3QA 4I55B 1N33O 5B66Z 1M56B 3JD0A 1QNMA 1Y74B 1Y66A 4J7ZA 4LCUC 4EKWA 4DR7B 2EJ7A 5KX5A 2ZINA 3JD4A 1GMGA 3ZMTA 4JI1B 2HP8A 3SJBC 1ZUQA 3AG2C 2LQTA 3BRCA 1V9PA 3ZRVA 2YEVB 1AI4A 3P32A 1BGYH 1YTFB 4UCUA 2F66C 4WCEV 2BSKA 4LF9O 2CK3G 1GO3F 1LNQA 3A8TA 4PDRA 4DR5O 5E79Z 2IJHA 3CCRV 2A7WA 2LW1A 1KBHA 3AG1B 2K1EA 4FLZA 4MTXA 1OJHA 5LYJB 2YICA 1TAEA 3ZRWB 5LP6A 4DR3O 2WLLA 2UXCO 2EJRA 3N2KB 3DC5A 3JAKA 1QQCA 4N23A 3OEEG 4R6ZA 4FPPA 2JVDA 2PI4A 2QDOA 2BE3A 3LSQA 3SYQA 4E4EA 5KA5A 3R66A 2AW9A 4KL1A 1FKAO 4DV7B 4UVBA 1XREA 2IU0A 3CMAV 1AR5A 2GTAA 3QO7A 4W4LA 2XAJA 1SESA 1QBZA 4JTDB 1WPXA 4DXWA 1OCZC 3ABLC 2ZKOA 4H0LB 5LMUO 4CC5A 1Y76A 2ITDC 1S72V 2EIJB 3APQA 1N33B 5LP6C 3RYIB 1WA8A 1FXHA 5CA1A 3G80A 3U0ZA 4ABMA 1V54B 2EINC 4H37A 2Y69C 4PD4F 4JI7O 2Q8VA 3QO5A 1THZA 3ETDA 4UCOA 5JJJB 3W7WA 3LNMB 4DV0B 3ZRSA 4YHHO 1SQGA 2HR3A 2XAGA 1URFA 5DEDA 2WPDG 3K08A 3CRQA 4WF9V 1ZWIC 1MABG 4O2AB 4LF9B 2WAMA 4TV9A 3OMNB 2EILB 4GX5A 4MTFA 4DR5B 1L0LH 4J7JA 2X6BA 4DW0A 4I55A 2H94A 2X0LA 4IIJB 2EBOA 1BQ0A 3ETEA 3CB2A 1GKFA 1Y74A 2IJJA 2LW7A 3JASB 1M1KW 4DR3B 2UXCB 4FLUA 1N34O 1JQ0A 1Z5WA 1EBOA 3CX5F 4UCVA 1GAXA 1IZ3A 3E83A 5B1AC 4X65O 3ZHQA 4MVUA 5ITZB 3J80N 5EBMC 4DV2O 3JARB 2YEVA 3WB2A 2IM9A 4GUNA 1K4CC 3WG7C 3HKCB 1OHHG 1HNXO 3RYCA 4J7KA 1U97A 5IJ9B 2D2CB 4O2BB 4GYCB 5JJEB 4DR1O 2KB1A 3RYHB 1ZTEA 3RFRA 1SQBH 1DF4A 1S3JA 2UU9O 2HG5C 2GTSA 3ABMC 5LYJA 3ZRWA 3CXHF 2E75B 2IU3A 4LF7B 3E22B 2PUSA 4RQFA 5B5EZ 5CA3A 3E89A 4X1IB 2FMLA 5H5NA 3SPJA 1NVPB 3T4DA 4X88A 4BIOA 2F4VB 1G8MA 2UXBO 3CP1A 3K79A 1JOYA 4JI7B 2UXNA 2LO1A 1K33A 5B1BB 2OIGA 3U11A 2OT5A 4YHHB 3OFNG 2OCCC 4FVMA 1QR8A 1LUVA 2EX3A 2QWNB 4JI0O 4EB6B 2DMXA 3JAWB 2DWDC 5L3GA 1TGOA 2HJDA 1KMIZ 4ZKIA 4JYAO 3UO3A 2Z0AA 4JI3O 5H6QA 4D7SA 4DR6O 2XT9A 5JVDB 4XDKA 3AK1A 1BL8A 3RYIA 1XL4A 3B2EE 3F7VC 2PZSA 4X64O 1AJNA 1VF6C 4AHCA 2ZXWB 5BY1A 4X65B 4DV2B 2YC0A 1VQNV 3FX7A 1RSOA 1NH2D 2JJ1G 4BW9A 1WN7A 1R1BA 1HNXB 2QM4A 2PYLA 2V7QG 3ZEDA 4O2AA 3SYOA 1IURA 5HFLA 1X59A 3ZMUA 2EULA 2OYQA 1QR9A 2YXYA 1M9NA 3TGUH 4KP4A 3U10A 1FXKB 2UU9B 2A0LA 4J9ZB 5KLVH 1UFIA 4IIJA 1H2MA 2A06H 3CRMA 3BABA 4R8CA 1ROPA 3ASOB 2H3OA 2CTRA 3ZS8C 3O9OA 2NLJC 3JASA 1YHQV 5L3BA 3LSUA 4J42A 4JASA 3TJTA 4JZ2A 2YIBD 4LFAO 1KYOF 2Q7GA 1XNQO 2P5OA 2E76B 2NR5A 2IJKA 3FB6C 5LBQA 2AXTZ 3JARA 3QF7A 5IWAB 4UB8Z 2UXBB 5H6RA 3HKCA 2RMKB 4DRXB 3L74H 1H2NA 4R50A 4NVPA 1XQ8A 2ITCC 2QTSA 1Q3EA 4O2BA 5BXZA 1YSCA 2CGNA 1NU1H 3RYHA 4LF5O 4DV4O 5CA0B 4JI0B 3CCSV 1MZEA 2B1IA 1SQPH 3T1YB 1CP9A 1G6UA 1SQFA 4R7CA 5E1AC 4JYAB 3QG5A 1EM1A 4JI3B 1PPJH 3QTCA 4DR6B 2UXDO 1KKCA 5J2UA 3ZMVA 2WA3A 3IC9A 1R3JC 3STLC 1VQOV 4YJ2B 1VQMV 2QGNA 2CAZC 2YXLA 3N2GB 2AHZA 4F6RA 1BSMA 3H1HH 3ZN1A 4L87A 3AK2A 4P2ZA 1I5XA 2E3CA 3K5LA 3ABKB 1EN4A 2EIKB 1K7DA 3KCYA 4YIPA 1F7YA 3ZBHA 4EB6A 3EFFK 4YXWG 4AILC 4RAIA 4ZHQB 4F4LA 1RP3B 4NXMO 5A9GA 1SC5B 1F4NA 1F51A 1R6TA 1MSWD 1E79G 2N04A 3ABTA 4X20B 4OGQB 4DV6O 2JEUA 2DWEC 4Z1VA 4X66O 3MHHC 3HR0A 4PI2A 1COWG 1YF2A 3X2QB 3OEHG 2OCHA 1PL4A 4MTOA 1VARA 3LDCA 4Z2WA 5LMNO 1SS3A 1UJWB 5GTHZ 3TK1A 4X62B 4B3TO 1IXBA 1PNKA 2ODMA 3TETA 5LHGA 1B04A 4DK1A 3CCQV 4ZI7B 4C7UA 2GHYA 1HW7A 3KCXA 1OV9A 1Q6IA 1Q90D 5JJNB 1Q7YW 5LA6A 3JD3A 4K3AA 1FXKA 1PNLA 2Q4PA 1I94O 1GN6A 2Y0IA 3OTFA 1GRJA 3K57A 1RM1B 1Y6XA 1G1XB 1KB9F 1FD9A 2XOKG 5IYZB 3ETQA 4K35A 1R6KA 1NR1A 1L1FA 4AQYB 2AHYA 3AEIA 3S3XA 1XHZA 3F7YC 4DRXA 3T1HO 4MSWC 1Q8IA 1HDJA 5L3CA 2CTWA 1W0JG 3AG7A 3T1CA 1VQLV 3B4SA 1GM7A 5CA0A 1KUQA 4PA4A 1NS1A 2XHBA 1YCIA 3W7UA 4NXMB 2CUGA 5L3EA 5IY5B 3K59A 2WLHA 4DV6B 1BZKA 2Y4UA 2B9ZA 1E1QG 4YJ2A 4X66B 1VQ4V 3N2GA 3RBZA 3ABMB 4HYOA 1BE3H 2Q7HA 1NH2B 3HB3B 2CTQA 5KMGB 5KHIA 4JYCA 5LMNB 1U96A 5EC1C 5BMVB 1GH6A 1V55C 4CH6A 2BOCC 5KA6A 1P49A 4B3SB 2GBOA 1B6QA 4HAMA 1OCCC 5BR8O 1JCHA 3K58A 4FLXA 2P4VA 4PJ0Z 2JK5C 1N4CA 3SPHA 3I56V 4FFBB 5FNVB 4MW3A 4ZHQA 1DK1A 3K0GA 2YIAA 1W59A 5JQGB 1CXZB 3FFQA 3D3IA 2P4KA 4KUMA 3RVYA 1N36O 1I94B 1VMGA 1IBMO 2Q67A 5FL7G 2OCCB 1S5HC 4L8JA 2A9HA 3OUSA 3SPCA 2V1DA 4I7ZB 1M57C 2XAQA 3HKDA 4TT3G 4MVQA 1YZBA 3SR2C 3CRAA 1H38A 1DLBA 4ZBMA 3ETGA 1SKVA 2AZ0A 4BWAA 3E2EA 3OMIB 3T1HB 4FLVA 4ZI7A 5CBHA 2XNDG 1BHBA 3UT5A 5TISZ 2CH7A 3ZCCA 5A2QN 1LR1A 2JGDA 1OCRC 2P22C 4X1YB 2QR4A 4PELA 2DYRC 1M5IA 2IW5A 3B77A 3NXSA 3FD9A 3UKMA 5HFMA 4JI2O 1VIBA 2KG7B 2UUAO 5LGTA 1AB3A 4UCRA 1L0NH 1QVFU 1PD3A 2E74B 3P3NA 1NTKH 3AG4C 5JH7A 5K1PA 1SETA 2YSUB 2RQ6A 1S0VA 2HHHO 1SZXA 1KECA 2ZDIA 1XUQA 2H8PC 3DC6A 3GVMA 3JD2A 4DW1A 2Z3YA 4LH7A 4FLWA 2YUAA 3KZIZ 1SA0B 1XMQO 5BR8B 4ICGA 1FS0G 4ZIBA 1F4MA 2ZE5A 3HPLC 3SJAC 2PTMA 4DUYO 2DYSB 2ZIOA 3SYPA 4Z1MG 3ASNC 1YITV 4FZ0A 3AG3C 1N36B 4CZZA 3TXSA 5FPRA 1IBMB 4KFMA 1EFRG 2ZE8A 3OUFA 1JR9A 2DW4A 3D3QA 3VBBA 5K1XA 1OCOC 2ZCEA 2O57A 3VOUA 5KMGA 4BAYA 4FM1A 1WLEA 1K97A 3T2MA 3J81N 3HKBB 5IDJA 1R6NA 4I9WA 5LXTB 1E1RG 4CH5A 4X1KB 4O4IB 4UVCA 4I0XB 4JPRA 4FFBA 4KHPO 2WLNA 4JTAB 5FNVA 2YS8A 3OM3B 1YJNV 4J9YB 5JQGA 1XHXA 3UO2A 5CB4B 3ZX6A 5FLXN 2YIBA 4OXSA 2KQXA 1O9HA 3LDDA 3G6BA 3JSLA 1FAFA 5B3SB 5LMUB 5IJ0B 4YJ3B 4JI2B 3N2KA 3L72H 3RVZA 4O4LB 4TQFA 1AP5A 1VP7A 2C2AA 1XNRO 4FM0A 4XDJA 1SQQH 4MVSA 4D6TH 4LFBO 3A0HZ 3CMEV 3TCUA 1I0HA 4GZRB 2HHHB 5KHHA 3ICXA 2F23A 3MD0A 3LSSA 2JEXA 1ZX3A 1WPBA 4ASUG 5LGUA 1XMQB 3BA9A 4DR2O 1XI1A 4X1YA 4TUYB 3ZIAG 2QKCA 3D36A 2LGWA 3AG1C 4UXNA 4H33A 2KG7A 3GB7C 1PKXA 3OTOO 5JCOA 1ZL8B 3BPZA 1YVWA 1GM9A 4EFBA 4G28B 4B3MO 1Q5OA 3H9VA 2P06A 3BCCH 1N34B 1H2LA 5DM6V 2JS3A 5IT9N 4G2KA 4WFEA 5EZYB 2WLIB 1NI8A 3CCMV 3CJHB 2D3OW 1TVKB 1SA0A 1MSDA 4HZ3A 2BTQB 3CWBH 4KHPB 3CCLV 2K9PA 4DR1B 2LFSA 1SQVH 3MAQA 3E8BA 1QLNA 2QEXV 2DOSA 3ZHTA 2HKOA 2N05A 2PGGA 1TA8A 4NB5A 1KP3A 1JJOA 3F5WC 3WB0A 1YJWV 4LNUB 2EIJC 3ABUA 2HFEC 4FIPC 2JIZG 3RYFB 3VQYA 2G38A 1V54C 3L9DA 2QWQB 4XBFA 5ITZA 2P90A 1XNRB 3HKBA 3OT7A 4X1KA 4O4IA 5CBGA 3K5MA 2HVJC 1AI6A 5IJ9A 3CRCA 3FB5C 3Q4HB 4GT1A 4DV1O 2AZ2A 2YI8A 4B3RO 1I5YA 5CB4A 2EILC 1NTZH 3AG2B 4MVOA 4HNAB 5IE9A 4DYLA 4WFGA 3LDEA 3JD1A 3APOA 4O4HB 5IJ0A 1M4UA 4FJCC 4YJ3A 3ZHUA 3K5NA 3S3WA 3E22A 3UQ8A 1Q43A 3OTOB 1W0KG 2QM8A 2XTAA 4O4LA 4X1IA 3ML0A 2YIDA 4X64B 4B3MB 1TUEB 4X9QA 3K3WA 4NKGB 4TWKA 1W2BU 2R9IA 1SRYA 2FKXA 2P67A 3PJSK 4P9PA 4QE7A 5D5PA 5J9PC 4JZGA 4EFEA 2OTJV 3JAWA 5KX5B 5EIBC 3IFXA 5CBFA 2F95B 4MVMA 3IJ4A 4TUYA 3EXAA 3SGIA 3CPWU 3QVNA 4GX1A 5JVDA 4IYIA 4RUEA 3ZHRA 3OAAG 3CYOA 1DF5A 3M7MX 2YI9A 4U7NA 4GLXA 4IT5A 2ZE7A 1RFYA 1XL6A 2F1MA 1FYJA 1ZL8A 4TV8B 1K34A 5IYCO 2BSKB 4ZOLB 2ETNA 1OCRB 3OW2U 3CE2A 4JYBA 4LFAB 1OCZB 1BHAA 5H9CA 3ABLB 1QU7A 1XNQB 2DYRB 2R9AA 4DUZO 1K73W 2LJ2A 1BCCH 3I55V 5EZYA 2WLIA 3CJHA 1VQ6V 4WBNB 1VQPV 5B1BC 1TVKA 5LP6B 2L35A 1O9GA 2WLLB 4TSFG 2BTQA 5B1OA 4IYHA 3JAKB 5GONB 2EINB 2LFRA 1DTOA 2Y69B 1VF5B 4LF5B 3JCZA 1AI5A 3CCVV 1LUWA 4DV1B 4DV4B 4LWSB 1P7GA 3MDSA 3IC7A 3ZMSA 3M8AA 4GKJO 1EZJA 5B1NA 1Q81W 1US6A 4JAUA 1H2GA 3ZJZA 2UXDB 4LFCO 4LC1A 2RDCA 4BIZA 1N0JA 3RYFA 3OGCC 2Q69A 4JF3A 5C8YB 5LHHA 1WAZA 1KKDA 4JI6O 1NT2B 3P3PA 2ZXWC 1S5LZ 1D5AA 4CS2A 2EIMC 4GCZA 5GTIZ 1HNWO 3OR7C 1GM8A 3HKEB 1TUBB 1IX9A 2NNUA 3CCEV 5CMUA 1XOUA 2W0XA 1YI2V 2L6LA 3Q4HA 5CA1B 4DR4O 1Y67A 2IJIA 2WLJA 3MHSC 5B1AB 1YDXA 1YEWA 2VQFO 4P30A 5H2FZ 4MVZA 2JGUA 3C3SA 4HNAA 3A2FA 1FXKC 3WG7B 2QSAA 2LGQA 4O4HA 4OX9O 3ASOC 2ARHA 3GWOA 1AJQA 3I5DA 3JATB 4GKKO 5EYPB 3IGAC 3SPIA 2PYJA 2IH3C 4QJFB 3D8CA 2Q0AA 3PN1A 2Y0PA 4MT8A 4PDVA 3RT3C 4DUZB 2VWKA 1JFFB 4B7KA 1WP7A 4PA7A 2QM7A 1N8RW 1MG1A 3H1KH 1WB7A 3N27A 2BTOA 4Q20A 1K9MW 1M90W 1P4RA 4B3TB 2X7RB 1D2DA 5DN6G 1JJ2U 3G6EV 1SERA 1SF9A 5IYBO 2W0FC 3R65A 3CCJV 1X4TA 4DV0O 3ZHVA 4LF8O 1H8EG 3BHPA 5KUMA 3ZRXA 3B8NA 3E8FA 3SYCA 1K8AW 1J95A 2QKAA 1H2KA 1ORQC 1F23A 3RYCB 4X20A 4GKJB 4TV8A 4K8XA 1IBLO 3C3TA 1SZTA 1FFXB 4B08A 4ZOLA 4CC6A 4J11A 1IBKO 2Y48A 3CHXA 3CEIA 2VS0A 4DK0A 4LFCB 3RWRD 5KHJA 1K5SA 4I9QA 3P30A 2R9RB 1XDCA 4FLTA 1WB8A 4JI6B 2ZR3A 1P7BA 2WLMA 4I4TB 4WBNA 1XMOO 3ABKC 2EIKC 1HNWB 2IBZH 1PM9A 1VQ7V 4MVRA 1H8HG 1QHTA 4B7EA 3JALB 4UFZA 5GONA 1ZSPA 3H1LH 4LBEC 3SYAA 4DR4B 2XAFA 4LWSA 1AP6A 2VQEO 1K92A 2VQFB 1NBMG 4YIOA 1S76D 3K06A 2FTKA 2Q6AA 3NR7A 4CBCA 1QLEC 4OX9B 2RNBA 4JAAA 4AI8A 4UCSA 5IYZA 3FYEB 5KAIZ 3FB7C 3SPGA 5C8YA 4H13B 4IHJB 4GKKB 1N0NA 3BY6A 5C93A 3X2QC 3W7TA 3CXCU 2N74A 4LF7O 4PDMA 3HKEA 1R3KC 2FB5A 1TUBA 2ADQB 2WA4A 5KHKA 2OWOA 2EZOA 4D7TA 4I50B 2QWRB 3B40A 4EEQA 2F4VO 1HP8A 4F6EA 1VQ8V 3W7XA 3UCSC 1GN2A 4QE9A 1YXBA 2HEPA 1RPOA 3FAVB 3B09A 4LF8B 1K4DC 1KP2A 5LOVB 3STZC 1RSOB 2OTLV 4PDLA 1ENVA 3JATA 4PA3A 2JS5A 1RM1C 4DV3O 5EYPA 1N32O 2JRIA 3OR6C 1IBLB 3AK3A 2DQ3A 3VQWA 1T5EA 1IBKB 1VQ5V 3F5TA 3G71V 1NTMH 4P9OA 1ZAUA 4QIWF 1IDSA 1P84F 1IXMA 2ZT9B 5BMVA 1JFFA 4N21A 1K3EA 1NR7A 3K9AA 3M99B 2Q7EA 1YIJV 1QVGU 3K03A 2ZDIC 2WWWA 4W4KA 1ZLZA 4LF4O 2ZIMA 1XMOB 5JWPA 2BOBC 3JCUZ 3JAMN 2WLKA 1XBLA 1Q6HA 3CD6V 2AGAA 5LL6Y 4JAVA 2OIEA 4U7OA 4MS2A 2Q9LA 4FZ1A 1MMMA 5EBLC 2VQEB 3E86A 4RQEA 1CEZA 2XUMA 5EK0A 2QKSA 2GV9A 1FFXA 1PP9H 1G4YB 5IY5C 3UM7A 1M56C 1WP8A 3RN4A 3OE7G 2UUAB 3E35A 3E8HA 2A79B 2JDIG 2MW2B 3DXRB 2FYUH 1BQZA 4BR6A 4JYYA 2ZNJA 1FJGO 4FM2A 4YY3O 4HBNA 1HR0O 1K5QA 3ZHSA 1VF7A 3RW0A 1XILA 4I4TA 2B5UA 2PI5A 2JJ2G 4JV5O 1KU9A 1PNMA 4A5UB 5J2UB 1S77D 2Q73A 3JALA 3K9SA 1R3LC 1VF6A 3WB1A 2PY5A 2B1GA 3CC7V 5IYDO 5IWAO 5F2VO 1BMFG 4FLYA 4F6RB 1KC8W 1DGSA 4WFBV 3FB8C 3K04A 4G27B 4DUYB 3GWKC 4CH4A 1NKDA 3DTUB 3L75H 1KQSU 1AI7A 2UUBO
chains in the Genus database with same CATH topology
3W7UA 4TWKA 1V54B 2EINC 1W2BU 1Q82W 2R9IA 4H37A 2Y69C 1SRYA 4LP8A 1JPXA 2DQ0A 2P67A 3PJSK 1KD1W 3QO5A 1GTOA 1AROP 1THZA 3ETDA 4P9PA 4QE7A 5IY5B 5L3EA 5J9PC 3W7WA 4UVAA 3LNMB 2OTJV 3ZRSA 3IFXA 5CBFA 2WLHA 1GK9A 4MVMA 5BZBA 1E1QG 2HR3A 3WFVA 2XAGA 3CPWU 1VQ4V 3RBZA 2WPDG 5EC2C 3ABMB 5GW7A 3EHBB 3K08A 4HYOA 1NH2B 4GX1A 3HB3B 4WF9V 3A0RA 1ZWIC 1MABG 4RUEA 2WAMA 3OAAG 4JYCA 3CYOA 1DF5A 3OMNB 2EILB 4U7NA 2EZPA 4GX5A 5EC1C 4UUJC 1V55C 4MTFA 1XL6A 2BOCC 1K34A 5IYCO 2X6BA 5KA6A 2QA4V 1B6QA 2HJFC 3SJQC 4HAMA 2H94A 2EIMB 1OCCC 2X0LA 1JCHA 1OCRB 3I56V 3SPHA 2JK5C 3OW2U 2EBOA 3DGEA 4DO2A 4JYBA 3ETEA 1GKFA 1OCZB 1BHAA 2IJJA 3ABLB 5H9CA 1M1KW 2M7WA 2DYRB 4MW3A 1K73W 4BIUA 3K0GA 5KUKA 3QO8A 3I55V 2WLIA 2X6CA 1JQ0A 1EBOA 2P7TC 3D3IA 1VQ6V 4KUMA 1VQPV 2Z5UA 3E83A 5B1BC 3RVYA 5B1AC 2WLLB 4MVUA 4TSFG 1YTFD 5EBMC 3FKSG 2Q67A 5B1OA 4JGSA 5FL7G 4UV9A 2OCCB 1S5HC 2YEVA 2A9HA 4I5SA 2W6JG 1K4CC 3OUSA 2EINB 2LFRA 3WG7C 3SPCA 2Y69B 1DTOA 1OHHG 2V1DA 1M57C 2XAQA 4MVQA 4TT3G 1MOFA 1R73A 3K0DA 3QNEA 1FFTB 3JCZA 1QCEA 1AI5A 4QNHB 3CCVV 1H38A 1DLBA 3FYIB 3IC7A 4ZBMA 4FMTA 3ETGA 3ZMSA 1NJIW 2KB1A 2ATKC 1DF4A 1EZJA 1S3JA 5B1NA 2HG5C 4JAUA 1Q81W 3E2EA 1H2GA 3ZJZA 3ABMC 3OMIB 4LC1A 2Q68A 4BIZA 1Y4MA 5CBHA 2XNDG 4GX0A 3OGCC 4PA9A 2Q69A 3ZRWA 4JF3A 1BHBA 1V55B 2DYSC 5LHHA 2IU3A 1KKDA 3ZCCA 2ZXWC 4RQFA 1JX9A 4UV8A 5CA3A 3E89A 4XDLA 3G4SV 2EIMC 1OCCB 4GCZA 1OCRC 3SPJA 1NVPB 3H01A 3T4DA 4X88A 3OR7C 4MW8A 1GM8A 4PELA 2DYRC 3KG2A 2IW5A 2ZR2A 1G8MA 3B77A 3NXSA 2NNUA 3CCEV 5CMUA 5CN0A 3UKMA 3CP1A 3K79A 5HFMA 1YI2V 1JOYA 2UXNA 5LGTA 1K33A 5B1BB 2IJIA 2WLJA 3MHSC 4X89A 1QVFU 1PD3A 5B1AB 5L3DA 3ZMZA 1FXVA 4P30A 2OT5A 4MVZA 3OFNG 2OCCC 1QR8A 1AR1B 3AG4C 1FXKC 2HLDG 2X6AA 2ZD9A 4JTCB 3WG7B 1SETA 2YSUB 1M57B 2DWDC 5L3GA 1S0VA 1HWYA 2P6JA 1KECA 3ASOC 3GWOA 1AJQA 2ZDIA 3OMAB 4ZKIA 1PL0A 2H8PC 5H6QA 1VQ9V 3IGAC 3SPIA 3JD2A 3LUTB 2Z3YA 4X8AA 4XDKA 2IH3C 4QJFB 1VQKV 1BL8A 1XL4A 1FS0G 3F7VC 4E2LA 4MT8A 4WFAV 4PDVA 1AJNA 1F4MA 5B3SC 3HPLC 2DYSB 3SYPA 4Z1MG 4PA7A 2QM7A 1N8RW 4QPJA 1MG1A 3ASNC 4RO2A 1YITV 2ZXWB 3AG3C 4Q20A 4MTGA 1K9MW 1M90W 1P4RA 2X7RB 2IH1C 3T4ZA 4CZZA 5DN6G 1JJ2U 3CC2V 3G6EV 1SERA 1VQNV 1OZ0A 4KFMA 1EFRG 3OUFA 5IYBO 1NH2D 2JJ1G 2DW4A 2W0FC 3R65A 3CCJV 2XASA 1CPYA 3VBBA 1QLEB 1OCOC 1NQTA 1H8EG 2V7QG 5KUMA 3ZRXA 3B8NA 3VOUA 3E8FA 4BAYA 1WLEA 2WSSG 3SYOA 3SYCA 5HFLA 1K8AW 1J95A 1K97A 3T2MA 3ZMUA 1ORQC 1F23A 1QR9A 1M9NA 2MK3A 3E8GA 1R6NA 5IDJA 4KP4A 4PA6A 1SZTA 3AG4B 4I9WA 1FXKB 1YJ9V 1E1RG 2A0LA 3B8MA 4J9ZB 2HVKC 2Y48A 4UVCA 4WFHA 4JPRA 2UXXA 2ZQMA 1AJPA 1K5SA 4R8CA 1ROPA 3ASOB 3P30A 2R9RB 2NLJC 1YHQV 2WLNA 4JTAB 5L3BA 1RPRA 1JVMA 3OM3B 4JASA 1YJNV 4J9YB 2ZR3A 1P7BA 2WLMA 2GSMB 3JYCA 2IJKA 3ABKC 2EIKC 3FB6C 5EBWC 4OXSA 5LBQA 1VQ7V 4MVRA 1H8HG 3LDDA 4RUFA 5LHIA 5B3SB 5H6RA 2QTOA 2F43G 3ASNB 4LBEC 4R50A 3SYAA 3RVZA 2ITCC 3AG3B 2XAFA 1K92A 1YSCA 2C2AA 4QPKA 4XDJA 3ZN0A 4MVSA 1NBMG 3CMEV 1S76D 3K06A 2FTKA 3BEHA 3TCUA 3CCSV 3CCUV 2Q6AA 4CBCA 2B1IA 1CP9A 1QLEC 1OCOB 4FK5C 4R7CA 4BW5A 5E1AC 3FYEB 3FB7C 4GX2A 3SPGA 3BY6A 3MD0A 5C93A 3LSSA 3X2QC 2JEXA 1NVPD 3W7SA 3ZMVA 3W7TA 4ASUG 4WFFA 2W6IG 5LGUA 3CXCU 1R3JC 3STLC 1VQOV 2QE7G 5L3FA 4PDMA 3ZIAG 1VQMV 1R3KC 3D36A 3AG1C 2XAHA 2LP7A 2AHZA 5LGNA 4UXNA 1Q86W 4H33A 3ZN1A 2EZOA 4L87A 3GB7C 4P2ZA 1I5XA 1PKXA 1VQ8V 3CC4V 3ABKB 2EIKB 1K7DA 3W7XA 1R3IC 1GM9A 4G28B 4QE9A 1RPOA 1M56B 3EFFK 4YXWG 1K4DC 1KP2A 3JD0A 5DM6V 3STZC 1Y66A 4RAIA 2OTLV 4PDLA 1ENVA 4LCUC 4EKWA 4PA3A 4G2KA 1RM1C 4F4LA 4WFEA 2WLIB 3JD4A 1GMGA 3OR6C 3ZMTA 1F4NA 3CCMV 1F51A 2D3OW 1MSWD 1E79G 2DQ3A 3ABTA 1VQ5V 3AG2C 4HZ3A 3G71V 4P9OA 3ZRVA 2YEVB 1AI4A 4QIWF 2JEUA 3P32A 2DWEC 3CCLV 1IXMA 1YTFB 3MHHC 2LFSA 3E8BA 1QLNA 2QEXV 1COWG 3X2QB 1K3EA 1NR7A 3K9AA 3M99B 3OEHG 4MTOA 4N21A 4WCEV 1YIJV 1QVGU 2HKOA 2ZDIC 3K03A 3LDCA 2WWWA 2CK3G 1GO3F 1LNQA 4PDRA 1KP3A 3F5WC 1UJWB 2BOBC 2IJHA 3CCRV 2WLKA 1YJWV 3CD6V 2EIJC 3ABUA 3TK1A 4JAVA 2HFEC 3AG1B 4U7OA 2K1EA 4MS2A 4MTXA 4FIPC 1PNKA 2JIZG 3TETA 5LHGA 3CCQV 3ZRWB 5EBLC 1V54C 2GHYA 2WLLA 3E86A 4XBFA 2P90A 4RQEA 2EJRA 1CEZA 5EK0A 1Q7YW 2QKSA 3JD3A 1FXKA 1G4YB 1PNLA 4N23A 5IY5C 3UM7A 1M56C 3OEEG 3OE7G 4R6ZA 4FPPA 5CBGA 2HVJC 1AI6A 3E35A 3E8HA 2PI4A 2A79B 2JDIG 3LSQA 3SYQA 1RM1B 5KA5A 3FB5C 1K5QA 4GT1A 2XOKG 3RW0A 1I5YA 2EILC 2B5UA 1R6KA 3AG2B 4UVBA 2PI5A 1NR1A 2JJ2G 4MVOA 2IU0A 1L1FA 3CMAV 1PNMA 2AHYA 4WFGA 3LDEA 3QO7A 1S77D 2XAJA 3AEIA 3JD1A 1SESA 1QBZA 1R3LC 4JTDB 3F7YC 4FJCC 1WPXA 4DXWA 1OCZC 2B1GA 4MSWC 3ABLC 3CC7V 1W0KG 2QM8A 5IYDO 3ML0A 1BMFG 5L3CA 1KC8W 2ITDC 1S72V 1W0JG 2EIJB 3T1CA 4WFBV 1VQLV 3FB8C 1KQSU 1GM7A 3K04A 4G27B 1TUEB 1NKDA 1FXHA 3DTUB 4PA4A 1AI7A 3K3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9R B;  2NLJ C;  2WLN A;  3E89 A;  4JTA B;  4TWK A;  4XDL A;  2EIM C;  2EIN C;  1OCR C;  4H37 A;  3SPJ A;  2Y69 C;  3AG2 C;  4HZ3 A;  1JVM A;  4LP8 A;  3T4D A;  4X88 A;  3OR7 C;  4MW8 A;  3PJS K;  4P9O A;  4J9Y B;  1P7B A;  2WLM A;  2DWE C;  2DYR C;  3KG2 A;  4P9P A;  4QE7 A;  5J9P C;  3JYC A;  3LNM B;  3ABK C;  3UKM A;  3E8B A;  2EIK C;  3ZRS A;  3IFX A;  3FB6 C;  5EBW C;  4OXS A;  5CBF A;  2WLH A;  4MTO A;  4MVR A;  4MVM A;  3LDD A;  5BZB A;  3K03 A;  3LDC A;  4RUF A;  4X89 A;  1LNQ A;  2WLJ A;  4PDR A;  3F5W C;  2QTO A;  3RBZ A;  2BOB C;  5EC2 C;  4P30 A;  4HYO A;  3K08 A;  4MVZ A;  4GX1 A;  2WLK A;  4LBE C;  4R50 A;  2OCC C;  1ZWI C;  3SYA A;  2EIJ C;  3AG4 C;  4RUE A;  2ITC C;  3RVZ A;  2X6A A;  2ZD9 A;  4JTC B;  2HFE C;  5EC1 C;  4GX5 A;  2DWD C;  2K1E A;  4MS2 A;  1V55 C;  4MTF A;  4UUJ C;  1XL6 A;  2BOC C;  4XDJ A;  4MVS A;  3TET A;  2X6B A;  3ASO C;  5EBL C;  2HJF C;  3K06 A;  3BEH A;  3SJQ C;  3TCU A;  1V54 C;  2Q6A A;  1OCC C;  4CBC A;  1QLE C;  2H8P C;  2JK5 C;  2WLL A;  3E86 A;  3IGA C;  3SPH A;  3SPI A;  3LUT B;  5EK0 A;  2QKS A;  4R7C A;  4BW5 A;  5E1A C;  4X8A A;  4XDK A;  2IH3 C;  1G4Y B;  5IY5 C;  3FB7 C;  4GX2 A;  4MW3 A;  3SPG A;  3UM7 A;  1M56 C;  3K0G A;  5KUK A;  1BL8 A;  4R6Z A;  1XL4 A;  2WLI A;  3X2Q C;  2X6C A;  3F7V C;  2HVJ C;  5CBG A;  3E8H A;  2P7T C;  2A79 B;  4PDV A;  4WFF A;  3SYQ A;  3E83 A;  5B1B C;  5B3S C;  3HPL C;  3RVY A;  5B1A C;  1R3J C;  3SYP A;  2WLL B;  4MVU A;  4PA7 A;  5EBM C;  3STL C;  3ASN C;  3FB5 C;  2Q67 A;  4RO2 A;  4PDM A;  2YEV A;  1S5H C;  2A9H A;  3RW0 A;  1R3K C;  3AG3 C;  4MTG A;  1K4C C;  3OUS A;  3WG7 C;  2EIL C;  3AG1 C;  3SPC A;  2IH1 C;  1M57 C;  2AHZ A;  4MVQ A;  3T4Z A;  4MVO A;  4H33 A;  3K0D A;  4KFM A;  4QNH B;  2AHY A;  3GB7 C;  3OUF A;  4P2Z A;  4WFG A;  3LDE A;  2W0F C;  3R65 A;  4ZBM A;  1R3L C;  4JTD B;  1OCO C;  1R3I C;  3F7Y C;  2KB1 A;  4DXW A;  5KUM A;  1OCZ C;  2ATK C;  3VOU A;  3E8F A;  4MSW C;  3ABL C;  4G28 B;  4QE9 A;  2HG5 C;  3SYO A;  3SYC A;  1J95 A;  3EFF K;  3T2M A;  3ABM C;  3ZJZ A;  1ORQ C;  1K4D C;  2ITD C;  3E8G A;  4PA6 A;  2Q68 A;  3STZ C;  4I9W A;  4RAI A;  5CBH A;  4GX0 A;  4PDL A;  3T1C A;  3OGC C;  4PA9 A;  2Q69 A;  2A0L A;  3FB8 C;  4J9Z B;  4LCU C;  3K04 A;  4PA3 A;  4G27 B;  4EKW A;  4F4L A;  2HVK C;  4WFE A;  2DYS C;  4WFH A;  2WLI B;  1KKD A;  3OR6 C;  4PA4 A;  4R8C A;  2ZXW C; 
#chains in the Genus database with same CATH topology
 2DN9 A;  1Q6U A;  3RGB A;  1Q82 W;  4LF6 O;  4IHJ A;  3T1Y O;  4J80 A;  4DV3 B;  4LP8 A;  1JPX A;  2DQ0 A;  1KD1 W;  1N32 B;  1GTO A;  1ARO P;  4NTX A;  4UVA A;  1UPG A;  2ILM A;  1GK9 A;  5BZB A;  4RWU A;  2E5L O;  3SDL A;  4PI0 A;  3WFV A;  2CTP A;  4NTY A;  2GDS A;  2GUZ B;  5EC2 C;  5GW7 A;  3EHB B;  3A0R A;  4I50 A;  4LF4 B;  1I7F A;  2EZP A;  3G67 A;  4UUJ C;  4NXN O;  1VEW A;  4Q6G A;  2QA4 V;  4J41 A;  3BAA A;  3SJQ C;  2HJF C;  2QJ1 A;  2EIM B;  2F93 B;  4K0K O;  3FAV A;  2CGO A;  3DGE A;  4DO2 A;  1Z2G A;  5LOV A;  3SJC C;  3BFR A;  2M7W A;  1NZ6 A;  3D36 C;  4BIU A;  4QGP A;  5KUK A;  3QO8 A;  2X6C A;  1S5J A;  3TXQ A;  2P7T C;  3CRR A;  2RCV A;  5JCO C;  2Z5U A;  4JI4 O;  1YTF D;  3FKS G;  4JGS A;  3EVK A;  5LA6 B;  4UV9 A;  2ZE6 A;  4I5S A;  2W6J G;  2VRZ A;  4KXR A;  4YY3 B;  1MOF A;  1FJG B;  1R73 A;  1FPO A;  3K0D A;  3QNE A;  1HR0 B;  1FFT B;  3LNN A;  4LFB B;  1QCE A;  4QNH B;  2DE0 X;  3JSN A;  5LXT A;  1H2S B;  1J5E O;  1HNZ O;  2ZM6 O;  3FYI B;  3WU2 Z;  4FMT A;  4I0X A;  4JV5 B;  1NJI W;  2QWP B;  2ATK C;  5J2T B;  4O4J B;  2Q68 A;  2CE4 A;  1Y4M A;  4GX0 A;  4PA9 A;  2DJV A;  1A32 A;  3DSQ A;  2ADP A;  1V55 B;  4X62 O;  1Z5V A;  2DYS C;  3VQV A;  4J10 A;  4DR2 B;  1IVS A;  3OD4 A;  2RN9 A;  1JX9 A;  4UV8 A;  4TOI A;  2QWO B;  4XDL A;  3G4S V;  2VWJ A;  1OCC B;  5AG2 A;  3H01 A;  1WJZ A;  4MW8 A;  3BA8 A;  1JMK C;  2UUC O;  2UUB B;  3KG2 A;  3DXR A;  2ZR2 A;  4CS3 A;  5CN0 A;  4LF6 B;  2R72 A;  3O65 A;  2M6Y A;  4JI5 O;  1WNS A;  4X89 A;  4U3J B;  3ZMZ A;  5L3D A;  1FXV A;  4OPA A;  3KKY A;  1AR1 B;  2E5L B;  2HLD G;  2X6A A;  2ZD9 A;  4JTC B;  4NYK A;  1AIL A;  1M57 B;  4FFK A;  4LH6 A;  5DEC A;  1GN4 A;  1HWY A;  2P6J A;  4AQY O;  3OMA B;  1PL0 A;  1BT8 A;  1VQ9 V;  4NXN B;  3LUT B;  3IAY A;  4X8A A;  1AR4 A;  4CS4 A;  1VQK V;  1B06 A;  4JI8 O;  4K0K B;  1MZF A;  4E2L A;  1EN6 A;  4NTW A;  4IGG A;  4WFA V;  1AVM A;  5B3S C;  4NR1 A;  4DV5 O;  4H44 B;  2Y4T A;  2Q5Z A;  4QPJ A;  4RO2 A;  4CH3 A;  4MTG A;  2IH1 C;  3T4Z A;  3CC2 V;  4JI4 B;  5KAF Z;  3CSX A;  4UB6 Z;  3K5O A;  1OZ0 A;  5D5Q A;  4LR3 A;  5KHG A;  4U3F H;  3C90 A;  2XAS A;  3BVO A;  3L71 H;  1CPY A;  1PV0 A;  4TQD A;  1XEQ A;  1QLE B;  1NQT A;  2GUZ A;  2YXH A;  2BCC H;  2CDY A;  1HNZ B;  1J5E B;  2ZM6 B;  2WSS G;  4DR7 O;  3HKD B;  1SQX H;  3E8G A;  2MK3 A;  2PF4 E;  4PA6 A;  4JI1 O;  3AG4 B;  1YJ9 V;  3B8M A;  2HVK C;  2R70 A;  4WFH A;  2UXX A;  2ZQM A;  4PHZ A;  1AJP A;  3L70 H;  4B3S O;  4B3R B;  1RPR A;  4K8Z A;  2RJZ A;  1JVM A;  4LNU A;  2YDE A;  3CS5 A;  1EZV H;  2GSM B;  3H1J H;  3JYC A;  5EBW C;  3UT5 B;  2CH7 B;  2UUC B;  1MA1 A;  4RUF A;  5LHI A;  2KSD A;  2JGD B;  3L73 H;  2QTO A;  2F43 G;  5FPO A;  3ASN B;  5EIB D;  4JI5 B;  3A0B Z;  3AG3 B;  4QPK A;  2FL4 A;  1Y76 B;  3ZN0 A;  3BEH A;  3CCU V;  3THO A;  3OGI B;  4OPH A;  1WA8 B;  1JA8 A;  1OCO B;  4IL6 Z;  5J2T A;  4FK5 C;  4O4J A;  4BW5 A;  5JH7 B;  1M93 A;  2Q0O C;  4GX2 A;  1BS3 A;  1GN3 A;  1NVP D;  1L8D A;  3W7S A;  1EN5 A;  4WFF A;  2W6I G;  4DV7 O;  4JI8 B;  2NN4 A;  2QE7 G;  3VQX A;  5L3F A;  2XAH A;  2LP7 A;  5LGN A;  4DV5 B;  3J7A U;  1Q86 W;  1I08 A;  2V4D A;  4UCT A;  4TV9 B;  3CC4 V;  1D5N A;  4U3J A;  2ZNI A;  3H1I H;  2KKW A;  4PV1 B;  1R3I C;  1B3Q A;  1MNG A;  2A3Q A;  4I55 B;  1N33 O;  5B66 Z;  1M56 B;  3JD0 A;  1QNM A;  1Y74 B;  1Y66 A;  4J7Z A;  4LCU C;  4EKW A;  4DR7 B;  2EJ7 A;  5KX5 A;  2ZIN A;  3JD4 A;  1GMG A;  3ZMT A;  4JI1 B;  2HP8 A;  3SJB C;  1ZUQ A;  3AG2 C;  2LQT A;  3BRC A;  1V9P A;  3ZRV A;  2YEV B;  1AI4 A;  3P32 A;  1BGY H;  1YTF B;  4UCU A;  2F66 C;  4WCE V;  2BSK A;  4LF9 O;  2CK3 G;  1GO3 F;  1LNQ A;  3A8T A;  4PDR A;  4DR5 O;  5E79 Z;  2IJH A;  3CCR V;  2A7W A;  2LW1 A;  1KBH A;  3AG1 B;  2K1E A;  4FLZ A;  4MTX A;  1OJH A;  5LYJ B;  2YIC A;  1TAE A;  3ZRW B;  5LP6 A;  4DR3 O;  2WLL A;  2UXC O;  2EJR A;  3N2K B;  3DC5 A;  3JAK A;  1QQC A;  4N23 A;  3OEE G;  4R6Z A;  4FPP A;  2JVD A;  2PI4 A;  2QDO A;  2BE3 A;  3LSQ A;  3SYQ A;  4E4E A;  5KA5 A;  3R66 A;  2AW9 A;  4KL1 A;  1FKA O;  4DV7 B;  4UVB A;  1XRE A;  2IU0 A;  3CMA V;  1AR5 A;  2GTA A;  3QO7 A;  4W4L A;  2XAJ A;  1SES A;  1QBZ A;  4JTD B;  1WPX A;  4DXW A;  1OCZ C;  3ABL C;  2ZKO A;  4H0L B;  5LMU O;  4CC5 A;  1Y76 A;  2ITD C;  1S72 V;  2EIJ B;  3APQ A;  1N33 B;  5LP6 C;  3RYI B;  1WA8 A;  1FXH A;  5CA1 A;  3G80 A;  3U0Z A;  4ABM A;  1V54 B;  2EIN C;  4H37 A;  2Y69 C;  4PD4 F;  4JI7 O;  2Q8V A;  3QO5 A;  1THZ A;  3ETD A;  4UCO A;  5JJJ B;  3W7W A;  3LNM B;  4DV0 B;  3ZRS A;  4YHH O;  1SQG A;  2HR3 A;  2XAG A;  1URF A;  5DED A;  2WPD G;  3K08 A;  3CRQ A;  4WF9 V;  1ZWI C;  1MAB G;  4O2A B;  4LF9 B;  2WAM A;  4TV9 A;  3OMN B;  2EIL B;  4GX5 A;  4MTF A;  4DR5 B;  1L0L H;  4J7J A;  2X6B A;  4DW0 A;  4I55 A;  2H94 A;  2X0L A;  4IIJ B;  2EBO A;  1BQ0 A;  3ETE A;  3CB2 A;  1GKF A;  1Y74 A;  2IJJ A;  2LW7 A;  3JAS B;  1M1K W;  4DR3 B;  2UXC B;  4FLU A;  1N34 O;  1JQ0 A;  1Z5W A;  1EBO A;  3CX5 F;  4UCV A;  1GAX A;  1IZ3 A;  3E83 A;  5B1A C;  4X65 O;  3ZHQ A;  4MVU A;  5ITZ B;  3J80 N;  5EBM C;  4DV2 O;  3JAR B;  2YEV A;  3WB2 A;  2IM9 A;  4GUN A;  1K4C C;  3WG7 C;  3HKC B;  1OHH G;  1HNX O;  3RYC A;  4J7K A;  1U97 A;  5IJ9 B;  2D2C B;  4O2B B;  4GYC B;  5JJE B;  4DR1 O;  2KB1 A;  3RYH B;  1ZTE A;  3RFR A;  1SQB H;  1DF4 A;  1S3J A;  2UU9 O;  2HG5 C;  2GTS A;  3ABM C;  5LYJ A;  3ZRW A;  3CXH F;  2E75 B;  2IU3 A;  4LF7 B;  3E22 B;  2PUS A;  4RQF A;  5B5E Z;  5CA3 A;  3E89 A;  4X1I B;  2FML A;  5H5N A;  3SPJ A;  1NVP B;  3T4D A;  4X88 A;  4BIO A;  2F4V B;  1G8M A;  2UXB O;  3CP1 A;  3K79 A;  1JOY A;  4JI7 B;  2UXN A;  2LO1 A;  1K33 A;  5B1B B;  2OIG A;  3U11 A;  2OT5 A;  4YHH B;  3OFN G;  2OCC C;  4FVM A;  1QR8 A;  1LUV A;  2EX3 A;  2QWN B;  4JI0 O;  4EB6 B;  2DMX A;  3JAW B;  2DWD C;  5L3G A;  1TGO A;  2HJD A;  1KMI Z;  4ZKI A;  4JYA O;  3UO3 A;  2Z0A A;  4JI3 O;  5H6Q A;  4D7S A;  4DR6 O;  2XT9 A;  5JVD B;  4XDK A;  3AK1 A;  1BL8 A;  3RYI A;  1XL4 A;  3B2E E;  3F7V C;  2PZS A;  4X64 O;  1AJN A;  1VF6 C;  4AHC A;  2ZXW B;  5BY1 A;  4X65 B;  4DV2 B;  2YC0 A;  1VQN V;  3FX7 A;  1RSO A;  1NH2 D;  2JJ1 G;  4BW9 A;  1WN7 A;  1R1B A;  1HNX B;  2QM4 A;  2PYL A;  2V7Q G;  3ZED A;  4O2A A;  3SYO A;  1IUR A;  5HFL A;  1X59 A;  3ZMU A;  2EUL A;  2OYQ A;  1QR9 A;  2YXY A;  1M9N A;  3TGU H;  4KP4 A;  3U10 A;  1FXK B;  2UU9 B;  2A0L A;  4J9Z B;  5KLV H;  1UFI A;  4IIJ A;  1H2M A;  2A06 H;  3CRM A;  3BAB A;  4R8C A;  1ROP A;  3ASO B;  2H3O A;  2CTR A;  3ZS8 C;  3O9O A;  2NLJ C;  3JAS A;  1YHQ V;  5L3B A;  3LSU A;  4J42 A;  4JAS A;  3TJT A;  4JZ2 A;  2YIB D;  4LFA O;  1KYO F;  2Q7G A;  1XNQ O;  2P5O A;  2E76 B;  2NR5 A;  2IJK A;  3FB6 C;  5LBQ A;  2AXT Z;  3JAR A;  3QF7 A;  5IWA B;  4UB8 Z;  2UXB B;  5H6R A;  3HKC A;  2RMK B;  4DRX B;  3L74 H;  1H2N A;  4R50 A;  4NVP A;  1XQ8 A;  2ITC C;  2QTS A;  1Q3E A;  4O2B A;  5BXZ A;  1YSC A;  2CGN A;  1NU1 H;  3RYH A;  4LF5 O;  4DV4 O;  5CA0 B;  4JI0 B;  3CCS V;  1MZE A;  2B1I A;  1SQP H;  3T1Y B;  1CP9 A;  1G6U A;  1SQF A;  4R7C A;  5E1A C;  4JYA B;  3QG5 A;  1EM1 A;  4JI3 B;  1PPJ H;  3QTC A;  4DR6 B;  2UXD O;  1KKC A;  5J2U A;  3ZMV A;  2WA3 A;  3IC9 A;  1R3J C;  3STL C;  1VQO V;  4YJ2 B;  1VQM V;  2QGN A;  2CAZ C;  2YXL A;  3N2G B;  2AHZ A;  4F6R A;  1BSM A;  3H1H H;  3ZN1 A;  4L87 A;  3AK2 A;  4P2Z A;  1I5X A;  2E3C A;  3K5L A;  3ABK B;  1EN4 A;  2EIK B;  1K7D A;  3KCY A;  4YIP A;  1F7Y A;  3ZBH A;  4EB6 A;  3EFF K;  4YXW G;  4AIL C;  4RAI A;  4ZHQ B;  4F4L A;  1RP3 B;  4NXM O;  5A9G A;  1SC5 B;  1F4N A;  1F51 A;  1R6T A;  1MSW D;  1E79 G;  2N04 A;  3ABT A;  4X20 B;  4OGQ B;  4DV6 O;  2JEU A;  2DWE C;  4Z1V A;  4X66 O;  3MHH C;  3HR0 A;  4PI2 A;  1COW G;  1YF2 A;  3X2Q B;  3OEH G;  2OCH A;  1PL4 A;  4MTO A;  1VAR A;  3LDC A;  4Z2W A;  5LMN O;  1SS3 A;  1UJW B;  5GTH Z;  3TK1 A;  4X62 B;  4B3T O;  1IXB A;  1PNK A;  2ODM A;  3TET A;  5LHG A;  1B04 A;  4DK1 A;  3CCQ V;  4ZI7 B;  4C7U A;  2GHY A;  1HW7 A;  3KCX A;  1OV9 A;  1Q6I A;  1Q90 D;  5JJN B;  1Q7Y W;  5LA6 A;  3JD3 A;  4K3A A;  1FXK A;  1PNL A;  2Q4P A;  1I94 O;  1GN6 A;  2Y0I A;  3OTF A;  1GRJ A;  3K57 A;  1RM1 B;  1Y6X A;  1G1X B;  1KB9 F;  1FD9 A;  2XOK G;  5IYZ B;  3ETQ A;  4K35 A;  1R6K A;  1NR1 A;  1L1F A;  4AQY B;  2AHY A;  3AEI A;  3S3X A;  1XHZ A;  3F7Y C;  4DRX A;  3T1H O;  4MSW C;  1Q8I A;  1HDJ A;  5L3C A;  2CTW A;  1W0J G;  3AG7 A;  3T1C A;  1VQL V;  3B4S A;  1GM7 A;  5CA0 A;  1KUQ A;  4PA4 A;  1NS1 A;  2XHB A;  1YCI A;  3W7U A;  4NXM B;  2CUG A;  5L3E A;  5IY5 B;  3K59 A;  2WLH A;  4DV6 B;  1BZK A;  2Y4U A;  2B9Z A;  1E1Q G;  4YJ2 A;  4X66 B;  1VQ4 V;  3N2G A;  3RBZ A;  3ABM B;  4HYO A;  1BE3 H;  2Q7H A;  1NH2 B;  3HB3 B;  2CTQ A;  5KMG B;  5KHI A;  4JYC A;  5LMN B;  1U96 A;  5EC1 C;  5BMV B;  1GH6 A;  1V55 C;  4CH6 A;  2BOC C;  5KA6 A;  1P49 A;  4B3S B;  2GBO A;  1B6Q A;  4HAM A;  1OCC C;  5BR8 O;  1JCH A;  3K58 A;  4FLX A;  2P4V A;  4PJ0 Z;  2JK5 C;  1N4C A;  3SPH A;  3I56 V;  4FFB B;  5FNV B;  4MW3 A;  4ZHQ A;  1DK1 A;  3K0G A;  2YIA A;  1W59 A;  5JQG B;  1CXZ B;  3FFQ A;  3D3I A;  2P4K A;  4KUM A;  3RVY A;  1N36 O;  1I94 B;  1VMG A;  1IBM O;  2Q67 A;  5FL7 G;  2OCC B;  1S5H C;  4L8J A;  2A9H A;  3OUS A;  3SPC A;  2V1D A;  4I7Z B;  1M57 C;  2XAQ A;  3HKD A;  4TT3 G;  4MVQ A;  1YZB A;  3SR2 C;  3CRA A;  1H38 A;  1DLB A;  4ZBM A;  3ETG A;  1SKV A;  2AZ0 A;  4BWA A;  3E2E A;  3OMI B;  3T1H B;  4FLV A;  4ZI7 A;  5CBH A;  2XND G;  1BHB A;  3UT5 A;  5TIS Z;  2CH7 A;  3ZCC A;  5A2Q N;  1LR1 A;  2JGD A;  1OCR C;  2P22 C;  4X1Y B;  2QR4 A;  4PEL A;  2DYR C;  1M5I A;  2IW5 A;  3B77 A;  3NXS A;  3FD9 A;  3UKM A;  5HFM A;  4JI2 O;  1VIB A;  2KG7 B;  2UUA O;  5LGT A;  1AB3 A;  4UCR A;  1L0N H;  1QVF U;  1PD3 A;  2E74 B;  3P3N A;  1NTK H;  3AG4 C;  5JH7 A;  5K1P A;  1SET A;  2YSU B;  2RQ6 A;  1S0V A;  2HHH O;  1SZX A;  1KEC A;  2ZDI A;  1XUQ A;  2H8P C;  3DC6 A;  3GVM A;  3JD2 A;  4DW1 A;  2Z3Y A;  4LH7 A;  4FLW A;  2YUA A;  3KZI Z;  1SA0 B;  1XMQ O;  5BR8 B;  4ICG A;  1FS0 G;  4ZIB A;  1F4M A;  2ZE5 A;  3HPL C;  3SJA C;  2PTM A;  4DUY O;  2DYS B;  2ZIO A;  3SYP A;  4Z1M G;  3ASN C;  1YIT V;  4FZ0 A;  3AG3 C;  1N36 B;  4CZZ A;  3TXS A;  5FPR A;  1IBM B;  4KFM A;  1EFR G;  2ZE8 A;  3OUF A;  1JR9 A;  2DW4 A;  3D3Q A;  3VBB A;  5K1X A;  1OCO C;  2ZCE A;  2O57 A;  3VOU A;  5KMG A;  4BAY A;  4FM1 A;  1WLE A;  1K97 A;  3T2M A;  3J81 N;  3HKB B;  5IDJ A;  1R6N A;  4I9W A;  5LXT B;  1E1R G;  4CH5 A;  4X1K B;  4O4I B;  4UVC A;  4I0X B;  4JPR A;  4FFB A;  4KHP O;  2WLN A;  4JTA B;  5FNV A;  2YS8 A;  3OM3 B;  1YJN V;  4J9Y B;  5JQG A;  1XHX A;  3UO2 A;  5CB4 B;  3ZX6 A;  5FLX N;  2YIB A;  4OXS A;  2KQX A;  1O9H A;  3LDD A;  3G6B A;  3JSL A;  1FAF A;  5B3S B;  5LMU B;  5IJ0 B;  4YJ3 B;  4JI2 B;  3N2K A;  3L72 H;  3RVZ A;  4O4L B;  4TQF A;  1AP5 A;  1VP7 A;  2C2A A;  1XNR O;  4FM0 A;  4XDJ A;  1SQQ H;  4MVS A;  4D6T H;  4LFB O;  3A0H Z;  3CME V;  3TCU A;  1I0H A;  4GZR B;  2HHH B;  5KHH A;  3ICX A;  2F23 A;  3MD0 A;  3LSS A;  2JEX A;  1ZX3 A;  1WPB A;  4ASU G;  5LGU A;  1XMQ B;  3BA9 A;  4DR2 O;  1XI1 A;  4X1Y A;  4TUY B;  3ZIA G;  2QKC A;  3D36 A;  2LGW A;  3AG1 C;  4UXN A;  4H33 A;  2KG7 A;  3GB7 C;  1PKX A;  3OTO O;  5JCO A;  1ZL8 B;  3BPZ A;  1YVW A;  1GM9 A;  4EFB A;  4G28 B;  4B3M O;  1Q5O A;  3H9V A;  2P06 A;  3BCC H;  1N34 B;  1H2L A;  5DM6 V;  2JS3 A;  5IT9 N;  4G2K A;  4WFE A;  5EZY B;  2WLI B;  1NI8 A;  3CCM V;  3CJH B;  2D3O W;  1TVK B;  1SA0 A;  1MSD A;  4HZ3 A;  2BTQ B;  3CWB H;  4KHP B;  3CCL V;  2K9P A;  4DR1 B;  2LFS A;  1SQV H;  3MAQ A;  3E8B A;  1QLN A;  2QEX V;  2DOS A;  3ZHT A;  2HKO A;  2N05 A;  2PGG A;  1TA8 A;  4NB5 A;  1KP3 A;  1JJO A;  3F5W C;  3WB0 A;  1YJW V;  4LNU B;  2EIJ C;  3ABU A;  2HFE C;  4FIP C;  2JIZ G;  3RYF B;  3VQY A;  2G38 A;  1V54 C;  3L9D A;  2QWQ B;  4XBF A;  5ITZ A;  2P90 A;  1XNR B;  3HKB A;  3OT7 A;  4X1K A;  4O4I A;  5CBG A;  3K5M A;  2HVJ C;  1AI6 A;  5IJ9 A;  3CRC A;  3FB5 C;  3Q4H B;  4GT1 A;  4DV1 O;  2AZ2 A;  2YI8 A;  4B3R O;  1I5Y A;  5CB4 A;  2EIL C;  1NTZ H;  3AG2 B;  4MVO A;  4HNA B;  5IE9 A;  4DYL A;  4WFG A;  3LDE A;  3JD1 A;  3APO A;  4O4H B;  5IJ0 A;  1M4U A;  4FJC C;  4YJ3 A;  3ZHU A;  3K5N A;  3S3W A;  3E22 A;  3UQ8 A;  1Q43 A;  3OTO B;  1W0K G;  2QM8 A;  2XTA A;  4O4L A;  4X1I A;  3ML0 A;  2YID A;  4X64 B;  4B3M B;  1TUE B;  4X9Q A;  3K3W A;  4NKG B;  4TWK A;  1W2B U;  2R9I A;  1SRY A;  2FKX A;  2P67 A;  3PJS K;  4P9P A;  4QE7 A;  5D5P A;  5J9P C;  4JZG A;  4EFE A;  2OTJ V;  3JAW A;  5KX5 B;  5EIB C;  3IFX A;  5CBF A;  2F95 B;  4MVM A;  3IJ4 A;  4TUY A;  3EXA A;  3SGI A;  3CPW U;  3QVN A;  4GX1 A;  5JVD A;  4IYI A;  4RUE A;  3ZHR A;  3OAA G;  3CYO A;  1DF5 A;  3M7M X;  2YI9 A;  4U7N A;  4GLX A;  4IT5 A;  2ZE7 A;  1RFY A;  1XL6 A;  2F1M A;  1FYJ A;  1ZL8 A;  4TV8 B;  1K34 A;  5IYC O;  2BSK B;  4ZOL B;  2ETN A;  1OCR B;  3OW2 U;  3CE2 A;  4JYB A;  4LFA B;  1OCZ B;  1BHA A;  5H9C A;  3ABL B;  1QU7 A;  1XNQ B;  2DYR B;  2R9A A;  4DUZ O;  1K73 W;  2LJ2 A;  1BCC H;  3I55 V;  5EZY A;  2WLI A;  3CJH A;  1VQ6 V;  4WBN B;  1VQP V;  5B1B C;  1TVK A;  5LP6 B;  2L35 A;  1O9G A;  2WLL B;  4TSF G;  2BTQ A;  5B1O A;  4IYH A;  3JAK B;  5GON B;  2EIN B;  2LFR A;  1DTO A;  2Y69 B;  1VF5 B;  4LF5 B;  3JCZ A;  1AI5 A;  3CCV V;  1LUW A;  4DV1 B;  4DV4 B;  4LWS B;  1P7G A;  3MDS A;  3IC7 A;  3ZMS A;  3M8A A;  4GKJ O;  1EZJ A;  5B1N A;  1Q81 W;  1US6 A;  4JAU A;  1H2G A;  3ZJZ A;  2UXD B;  4LFC O;  4LC1 A;  2RDC A;  4BIZ A;  1N0J A;  3RYF A;  3OGC C;  2Q69 A;  4JF3 A;  5C8Y B;  5LHH A;  1WAZ A;  1KKD A;  4JI6 O;  1NT2 B;  3P3P A;  2ZXW C;  1S5L Z;  1D5A A;  4CS2 A;  2EIM C;  4GCZ A;  5GTI Z;  1HNW O;  3OR7 C;  1GM8 A;  3HKE B;  1TUB B;  1IX9 A;  2NNU A;  3CCE V;  5CMU A;  1XOU A;  2W0X A;  1YI2 V;  2L6L A;  3Q4H A;  5CA1 B;  4DR4 O;  1Y67 A;  2IJI A;  2WLJ A;  3MHS C;  5B1A B;  1YDX A;  1YEW A;  2VQF O;  4P30 A;  5H2F Z;  4MVZ A;  2JGU A;  3C3S A;  4HNA A;  3A2F A;  1FXK C;  3WG7 B;  2QSA A;  2LGQ A;  4O4H A;  4OX9 O;  3ASO C;  2ARH A;  3GWO A;  1AJQ A;  3I5D A;  3JAT B;  4GKK O;  5EYP B;  3IGA C;  3SPI A;  2PYJ A;  2IH3 C;  4QJF B;  3D8C A;  2Q0A A;  3PN1 A;  2Y0P A;  4MT8 A;  4PDV A;  3RT3 C;  4DUZ B;  2VWK A;  1JFF B;  4B7K A;  1WP7 A;  4PA7 A;  2QM7 A;  1N8R W;  1MG1 A;  3H1K H;  1WB7 A;  3N27 A;  2BTO A;  4Q20 A;  1K9M W;  1M90 W;  1P4R A;  4B3T B;  2X7R B;  1D2D A;  5DN6 G;  1JJ2 U;  3G6E V;  1SER A;  1SF9 A;  5IYB O;  2W0F C;  3R65 A;  3CCJ V;  1X4T A;  4DV0 O;  3ZHV A;  4LF8 O;  1H8E G;  3BHP A;  5KUM A;  3ZRX A;  3B8N A;  3E8F A;  3SYC A;  1K8A W;  1J95 A;  2QKA A;  1H2K A;  1ORQ C;  1F23 A;  3RYC B;  4X20 A;  4GKJ B;  4TV8 A;  4K8X A;  1IBL O;  3C3T A;  1SZT A;  1FFX B;  4B08 A;  4ZOL A;  4CC6 A;  4J11 A;  1IBK O;  2Y48 A;  3CHX A;  3CEI A;  2VS0 A;  4DK0 A;  4LFC B;  3RWR D;  5KHJ A;  1K5S A;  4I9Q A;  3P30 A;  2R9R B;  1XDC A;  4FLT A;  1WB8 A;  4JI6 B;  2ZR3 A;  1P7B A;  2WLM A;  4I4T B;  4WBN A;  1XMO O;  3ABK C;  2EIK C;  1HNW B;  2IBZ H;  1PM9 A;  1VQ7 V;  4MVR A;  1H8H G;  1QHT A;  4B7E A;  3JAL B;  4UFZ A;  5GON A;  1ZSP A;  3H1L H;  4LBE C;  3SYA A;  4DR4 B;  2XAF A;  4LWS A;  1AP6 A;  2VQE O;  1K92 A;  2VQF B;  1NBM G;  4YIO A;  1S76 D;  3K06 A;  2FTK A;  2Q6A A;  3NR7 A;  4CBC A;  1QLE C;  4OX9 B;  2RNB A;  4JAA A;  4AI8 A;  4UCS A;  5IYZ A;  3FYE B;  5KAI Z;  3FB7 C;  3SPG A;  5C8Y A;  4H13 B;  4IHJ B;  4GKK B;  1N0N A;  3BY6 A;  5C93 A;  3X2Q C;  3W7T A;  3CXC U;  2N74 A;  4LF7 O;  4PDM A;  3HKE A;  1R3K C;  2FB5 A;  1TUB A;  2ADQ B;  2WA4 A;  5KHK A;  2OWO A;  2EZO A;  4D7T A;  4I50 B;  2QWR B;  3B40 A;  4EEQ A;  2F4V O;  1HP8 A;  4F6E A;  1VQ8 V;  3W7X A;  3UCS C;  1GN2 A;  4QE9 A;  1YXB A;  2HEP A;  1RPO A;  3FAV B;  3B09 A;  4LF8 B;  1K4D C;  1KP2 A;  5LOV B;  3STZ C;  1RSO B;  2OTL V;  4PDL A;  1ENV A;  3JAT A;  4PA3 A;  2JS5 A;  1RM1 C;  4DV3 O;  5EYP A;  1N32 O;  2JRI A;  3OR6 C;  1IBL B;  3AK3 A;  2DQ3 A;  3VQW A;  1T5E A;  1IBK B;  1VQ5 V;  3F5T A;  3G71 V;  1NTM H;  4P9O A;  1ZAU A;  4QIW F;  1IDS A;  1P84 F;  1IXM A;  2ZT9 B;  5BMV A;  1JFF A;  4N21 A;  1K3E A;  1NR7 A;  3K9A A;  3M99 B;  2Q7E A;  1YIJ V;  1QVG U;  3K03 A;  2ZDI C;  2WWW A;  4W4K A;  1ZLZ A;  4LF4 O;  2ZIM A;  1XMO B;  5JWP A;  2BOB C;  3JCU Z;  3JAM N;  2WLK A;  1XBL A;  1Q6H A;  3CD6 V;  2AGA A;  5LL6 Y;  4JAV A;  2OIE A;  4U7O A;  4MS2 A;  2Q9L A;  4FZ1 A;  1MMM A;  5EBL C;  2VQE B;  3E86 A;  4RQE A;  1CEZ A;  2XUM A;  5EK0 A;  2QKS A;  2GV9 A;  1FFX A;  1PP9 H;  1G4Y B;  5IY5 C;  3UM7 A;  1M56 C;  1WP8 A;  3RN4 A;  3OE7 G;  2UUA B;  3E35 A;  3E8H A;  2A79 B;  2JDI G;  2MW2 B;  3DXR B;  2FYU H;  1BQZ A;  4BR6 A;  4JYY A;  2ZNJ A;  1FJG O;  4FM2 A;  4YY3 O;  4HBN A;  1HR0 O;  1K5Q A;  3ZHS A;  1VF7 A;  3RW0 A;  1XIL A;  4I4T A;  2B5U A;  2PI5 A;  2JJ2 G;  4JV5 O;  1KU9 A;  1PNM A;  4A5U B;  5J2U B;  1S77 D;  2Q73 A;  3JAL A;  3K9S A;  1R3L C;  1VF6 A;  3WB1 A;  2PY5 A;  2B1G A;  3CC7 V;  5IYD O;  5IWA O;  5F2V O;  1BMF G;  4FLY A;  4F6R B;  1KC8 W;  1DGS A;  4WFB V;  3FB8 C;  3K04 A;  4G27 B;  4DUY B;  3GWK C;  4CH4 A;  1NKD A;  3DTU B;  3L75 H;  1KQS U;  1AI7 A;  2UUB O; 
#chains in the Genus database with same CATH homology
 3W7U A;  4TWK A;  1V54 B;  2EIN C;  1W2B U;  1Q82 W;  2R9I A;  4H37 A;  2Y69 C;  1SRY A;  4LP8 A;  1JPX A;  2DQ0 A;  2P67 A;  3PJS K;  1KD1 W;  3QO5 A;  1GTO A;  1ARO P;  1THZ A;  3ETD A;  4P9P A;  4QE7 A;  5IY5 B;  5L3E A;  5J9P C;  3W7W A;  4UVA A;  3LNM B;  2OTJ V;  3ZRS A;  3IFX A;  5CBF A;  2WLH A;  1GK9 A;  4MVM A;  5BZB A;  1E1Q G;  2HR3 A;  3WFV A;  2XAG A;  3CPW U;  1VQ4 V;  3RBZ A;  2WPD G;  5EC2 C;  3ABM B;  5GW7 A;  3EHB B;  3K08 A;  4HYO A;  1NH2 B;  4GX1 A;  3HB3 B;  4WF9 V;  3A0R A;  1ZWI C;  1MAB G;  4RUE A;  2WAM A;  3OAA G;  4JYC A;  3CYO A;  1DF5 A;  3OMN B;  2EIL B;  4U7N A;  2EZP A;  4GX5 A;  5EC1 C;  4UUJ C;  1V55 C;  4MTF A;  1XL6 A;  2BOC C;  1K34 A;  5IYC O;  2X6B A;  5KA6 A;  2QA4 V;  1B6Q A;  2HJF C;  3SJQ C;  4HAM A;  2H94 A;  2EIM B;  1OCC C;  2X0L A;  1JCH A;  1OCR B;  3I56 V;  3SPH A;  2JK5 C;  3OW2 U;  2EBO A;  3DGE A;  4DO2 A;  4JYB A;  3ETE A;  1GKF A;  1OCZ B;  1BHA A;  2IJJ A;  3ABL B;  5H9C A;  1M1K W;  2M7W A;  2DYR B;  4MW3 A;  1K73 W;  4BIU A;  3K0G A;  5KUK A;  3QO8 A;  3I55 V;  2WLI A;  2X6C A;  1JQ0 A;  1EBO A;  2P7T C;  3D3I A;  1VQ6 V;  4KUM A;  1VQP V;  2Z5U A;  3E83 A;  5B1B C;  3RVY A;  5B1A C;  2WLL B;  4MVU A;  4TSF G;  1YTF D;  5EBM C;  3FKS G;  2Q67 A;  5B1O A;  4JGS A;  5FL7 G;  4UV9 A;  2OCC B;  1S5H C;  2YEV A;  2A9H A;  4I5S A;  2W6J G;  1K4C C;  3OUS A;  2EIN B;  2LFR A;  3WG7 C;  3SPC A;  2Y69 B;  1DTO A;  1OHH G;  2V1D A;  1M57 C;  2XAQ A;  4MVQ A;  4TT3 G;  1MOF A;  1R73 A;  3K0D A;  3QNE A;  1FFT B;  3JCZ A;  1QCE A;  1AI5 A;  4QNH B;  3CCV V;  1H38 A;  1DLB A;  3FYI B;  3IC7 A;  4ZBM A;  4FMT A;  3ETG A;  3ZMS A;  1NJI W;  2KB1 A;  2ATK C;  1DF4 A;  1EZJ A;  1S3J A;  5B1N A;  2HG5 C;  4JAU A;  1Q81 W;  3E2E A;  1H2G A;  3ZJZ A;  3ABM C;  3OMI B;  4LC1 A;  2Q68 A;  4BIZ A;  1Y4M A;  5CBH A;  2XND G;  4GX0 A;  3OGC C;  4PA9 A;  2Q69 A;  3ZRW A;  4JF3 A;  1BHB A;  1V55 B;  2DYS C;  5LHH A;  2IU3 A;  1KKD A;  3ZCC A;  2ZXW C;  4RQF A;  1JX9 A;  4UV8 A;  5CA3 A;  3E89 A;  4XDL A;  3G4S V;  2EIM C;  1OCC B;  4GCZ A;  1OCR C;  3SPJ A;  1NVP B;  3H01 A;  3T4D A;  4X88 A;  3OR7 C;  4MW8 A;  1GM8 A;  4PEL A;  2DYR C;  3KG2 A;  2IW5 A;  2ZR2 A;  1G8M A;  3B77 A;  3NXS A;  2NNU A;  3CCE V;  5CMU A;  5CN0 A;  3UKM A;  3CP1 A;  3K79 A;  5HFM A;  1YI2 V;  1JOY A;  2UXN A;  5LGT A;  1K33 A;  5B1B B;  2IJI A;  2WLJ A;  3MHS C;  4X89 A;  1QVF U;  1PD3 A;  5B1A B;  5L3D A;  3ZMZ A;  1FXV A;  4P30 A;  2OT5 A;  4MVZ A;  3OFN G;  2OCC C;  1QR8 A;  1AR1 B;  3AG4 C;  1FXK C;  2HLD G;  2X6A A;  2ZD9 A;  4JTC B;  3WG7 B;  1SET A;  2YSU B;  1M57 B;  2DWD C;  5L3G A;  1S0V A;  1HWY A;  2P6J A;  1KEC A;  3ASO C;  3GWO A;  1AJQ A;  2ZDI A;  3OMA B;  4ZKI A;  1PL0 A;  2H8P C;  5H6Q A;  1VQ9 V;  3IGA C;  3SPI A;  3JD2 A;  3LUT B;  2Z3Y A;  4X8A A;  4XDK A;  2IH3 C;  4QJF B;  1VQK V;  1BL8 A;  1XL4 A;  1FS0 G;  3F7V C;  4E2L A;  4MT8 A;  4WFA V;  4PDV A;  1AJN A;  1F4M A;  5B3S C;  3HPL C;  2DYS B;  3SYP A;  4Z1M G;  4PA7 A;  2QM7 A;  1N8R W;  4QPJ A;  1MG1 A;  3ASN C;  4RO2 A;  1YIT V;  2ZXW B;  3AG3 C;  4Q20 A;  4MTG A;  1K9M W;  1M90 W;  1P4R A;  2X7R B;  2IH1 C;  3T4Z A;  4CZZ A;  5DN6 G;  1JJ2 U;  3CC2 V;  3G6E V;  1SER A;  1VQN V;  1OZ0 A;  4KFM A;  1EFR G;  3OUF A;  5IYB O;  1NH2 D;  2JJ1 G;  2DW4 A;  2W0F C;  3R65 A;  3CCJ V;  2XAS A;  1CPY A;  3VBB A;  1QLE B;  1OCO C;  1NQT A;  1H8E G;  2V7Q G;  5KUM A;  3ZRX A;  3B8N A;  3VOU A;  3E8F A;  4BAY A;  1WLE A;  2WSS G;  3SYO A;  3SYC A;  5HFL A;  1K8A W;  1J95 A;  1K97 A;  3T2M A;  3ZMU A;  1ORQ C;  1F23 A;  1QR9 A;  1M9N A;  2MK3 A;  3E8G A;  1R6N A;  5IDJ A;  4KP4 A;  4PA6 A;  1SZT A;  3AG4 B;  4I9W A;  1FXK B;  1YJ9 V;  1E1R G;  2A0L A;  3B8M A;  4J9Z B;  2HVK C;  2Y48 A;  4UVC A;  4WFH A;  4JPR A;  2UXX A;  2ZQM A;  1AJP A;  1K5S A;  4R8C A;  1ROP A;  3ASO B;  3P30 A;  2R9R B;  2NLJ C;  1YHQ V;  2WLN A;  4JTA B;  5L3B A;  1RPR A;  1JVM A;  3OM3 B;  4JAS A;  1YJN V;  4J9Y B;  2ZR3 A;  1P7B A;  2WLM A;  2GSM B;  3JYC A;  2IJK A;  3ABK C;  2EIK C;  3FB6 C;  5EBW C;  4OXS A;  5LBQ A;  1VQ7 V;  4MVR A;  1H8H G;  3LDD A;  4RUF A;  5LHI A;  5B3S B;  5H6R A;  2QTO A;  2F43 G;  3ASN B;  4LBE C;  4R50 A;  3SYA A;  3RVZ A;  2ITC C;  3AG3 B;  2XAF A;  1K92 A;  1YSC A;  2C2A A;  4QPK A;  4XDJ A;  3ZN0 A;  4MVS A;  1NBM G;  3CME V;  1S76 D;  3K06 A;  2FTK A;  3BEH A;  3TCU A;  3CCS V;  3CCU V;  2Q6A A;  4CBC A;  2B1I A;  1CP9 A;  1QLE C;  1OCO B;  4FK5 C;  4R7C A;  4BW5 A;  5E1A C;  3FYE B;  3FB7 C;  4GX2 A;  3SPG A;  3BY6 A;  3MD0 A;  5C93 A;  3LSS A;  3X2Q C;  2JEX A;  1NVP D;  3W7S A;  3ZMV A;  3W7T A;  4ASU G;  4WFF A;  2W6I G;  5LGU A;  3CXC U;  1R3J C;  3STL C;  1VQO V;  2QE7 G;  5L3F A;  4PDM A;  3ZIA G;  1VQM V;  1R3K C;  3D36 A;  3AG1 C;  2XAH A;  2LP7 A;  2AHZ A;  5LGN A;  4UXN A;  1Q86 W;  4H33 A;  3ZN1 A;  2EZO A;  4L87 A;  3GB7 C;  4P2Z A;  1I5X A;  1PKX A;  1VQ8 V;  3CC4 V;  3ABK B;  2EIK B;  1K7D A;  3W7X A;  1R3I C;  1GM9 A;  4G28 B;  4QE9 A;  1RPO A;  1M56 B;  3EFF K;  4YXW G;  1K4D C;  1KP2 A;  3JD0 A;  5DM6 V;  3STZ C;  1Y66 A;  4RAI A;  2OTL V;  4PDL A;  1ENV A;  4LCU C;  4EKW A;  4PA3 A;  4G2K A;  1RM1 C;  4F4L A;  4WFE A;  2WLI B;  3JD4 A;  1GMG A;  3OR6 C;  3ZMT A;  1F4N A;  3CCM V;  1F51 A;  2D3O W;  1MSW D;  1E79 G;  2DQ3 A;  3ABT A;  1VQ5 V;  3AG2 C;  4HZ3 A;  3G71 V;  4P9O A;  3ZRV A;  2YEV B;  1AI4 A;  4QIW F;  2JEU A;  3P32 A;  2DWE C;  3CCL V;  1IXM A;  1YTF B;  3MHH C;  2LFS A;  3E8B A;  1QLN A;  2QEX V;  1COW G;  3X2Q B;  1K3E A;  1NR7 A;  3K9A A;  3M99 B;  3OEH G;  4MTO A;  4N21 A;  4WCE V;  1YIJ V;  1QVG U;  2HKO A;  2ZDI C;  3K03 A;  3LDC A;  2WWW A;  2CK3 G;  1GO3 F;  1LNQ A;  4PDR A;  1KP3 A;  3F5W C;  1UJW B;  2BOB C;  2IJH A;  3CCR V;  2WLK A;  1YJW V;  3CD6 V;  2EIJ C;  3ABU A;  3TK1 A;  4JAV A;  2HFE C;  3AG1 B;  4U7O A;  2K1E A;  4MS2 A;  4MTX A;  4FIP C;  1PNK A;  2JIZ G;  3TET A;  5LHG A;  3CCQ V;  3ZRW B;  5EBL C;  1V54 C;  2GHY A;  2WLL A;  3E86 A;  4XBF A;  2P90 A;  4RQE A;  2EJR A;  1CEZ A;  5EK0 A;  1Q7Y W;  2QKS A;  3JD3 A;  1FXK A;  1G4Y B;  1PNL A;  4N23 A;  5IY5 C;  3UM7 A;  1M56 C;  3OEE G;  3OE7 G;  4R6Z A;  4FPP A;  5CBG A;  2HVJ C;  1AI6 A;  3E35 A;  3E8H A;  2PI4 A;  2A79 B;  2JDI G;  3LSQ A;  3SYQ A;  1RM1 B;  5KA5 A;  3FB5 C;  1K5Q A;  4GT1 A;  2XOK G;  3RW0 A;  1I5Y A;  2EIL C;  2B5U A;  1R6K A;  3AG2 B;  4UVB A;  2PI5 A;  1NR1 A;  2JJ2 G;  4MVO A;  2IU0 A;  1L1F A;  3CMA V;  1PNM A;  2AHY A;  4WFG A;  3LDE A;  3QO7 A;  1S77 D;  2XAJ A;  3AEI A;  3JD1 A;  1SES A;  1QBZ A;  1R3L C;  4JTD B;  3F7Y C;  4FJC C;  1WPX A;  4DXW A;  1OCZ C;  2B1G A;  4MSW C;  3ABL C;  3CC7 V;  1W0K G;  2QM8 A;  5IYD O;  3ML0 A;  1BMF G;  5L3C A;  1KC8 W;  2ITD C;  1S72 V;  1W0J G;  2EIJ B;  3T1C A;  4WFB V;  1VQL V;  3FB8 C;  1KQS U;  1GM7 A;  3K04 A;  4G27 B;  1TUE B;  1NKD A;  1FXH A;  3DTU B;  4PA4 A;  1AI7 A;  3K3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...