1G4YB

1.60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium-calmodulin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
82
structure length
81
Chain Sequence
b'DTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALCIUM-ACTIVATED POTASSIUM CHANNEL RSK2
publication title Structure of the gating domain of a Ca2+-activated K+ channel complexed with Ca2+/calmodulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 33
structure length 81
sequence length 82
ec nomenclature
pdb deposition date 2001-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1g4yB00
3E89A 5KUKA 4H37A 1OCRC 1ORQC 2DYSC 4HZ3A 5IY5C 2A9HA 2BOBC 2AHYA 4F4LA 4H33A 2WLJA 3RBZA 2EIMC 2X6CA 4R8CA 2HJFC 3E8GA 2IH3C 5B1AC 3BEHA 4EKWA 4XDJA 3SPHA 2EIJC 4QNHB 2WLHA 5BZBA 4J9YB 1P7BA 2EILC 4ZBMA 5EC1C 3T1CA 4QE7A 4WFGA 3FB8C 3WG7C 2OCCC 3OUFA 2DYRC 4PA3A 3E8HA 3IFXA 4MS2A 4MVMA 3AG3C 3F7YC 3GB7C 4PDRA 5J9PC 2A0LA 1M57C 3LDEA 3F5WC 3ZRSA 2HVJC 4MVUA 4MTFA 4MTOA 4PA7A 3K08A 4MSWC 4MVSA 4PA4A 2DWDC 3OR7C 4TWKA 3ASNC 1K4CC 2WLNA 3ABKC 3PJSK 4PA6A 5EK0A 1R3IC 4MVRA 3R65A 3K06A 2WLLA 3T4ZA 4J9ZB 4R50A 5B3SC 1K4DC 2WLIA 4PA9A 1OCCC 4X8AA 3KG2A 2IH1C 4PDVA 4XDKA 3T4DA 4CBCA 4PDMA 2WLMA 4JTDB 1XL4A 2X6BA 4RAIA 3LUTB 3E83A 1S5HC 4QE9A 4XDLA 5B1BC 4BW5A 5CBFA 3F7VC 2YEVA 4MVQA 5EC2C 1BL8A 3SJQC 2WLLB 3SPIA 3SYCA 3UKMA 3ABMC 4DXWA 2BOCC 2HFEC 2ITDC 3E8FA 4RUEA 2WLIB 2ATKC 2Q6AA 4MTGA 2QTOA 4R6ZA 5CBGA 4P9PA 4GX0A 1QLEC 1XL6A 4PDLA 4G27B 4MW3A 3STLC 3RVYA 3VOUA 1R3LC 4R7CA 2HG5C 2Q67A 4LP8A 5CBHA 3OGCC 3ASOC 4JTCB 4P2ZA 2NLJC 1OCOC 2EINC 3FB6C 3AG2C 3E86A 1V54C 1J95A 3LDCA 3OUSA 2ITCC 3AG4C 4I9WA 4LBEC 3HPLC 2KB1A 3SYPA 3SYOA 2DWEC 3JYCA 4X89A 4OXSA 2R9RB 4GX1A 2QKSA 2HVKC 4LCUC 2P7TC 4G28B 2H8PC 3E8BA 3K0GA 4MVZA 2X6AA 2ZD9A 4RUFA 4UUJC 5E1AC 1M56C 5EBMC 2Q69A 3X2QC 3STZC 2W0FC 1R3JC 4WFHA 3EFFK 5EBLC 3K04A 4WFEA 3SPJA 3AG1C 1LNQA 2A79B 3SPCA 3UM7A 2Y69C 4GX2A 3SPGA 4P30A 2Q68A 1JVMA 5EBWC 3FB5C 1KKDA 4P9OA 4X88A 3TCUA 5KUMA 3RVZA 3ZJZA 1V55C 1R3KC 3SYQA 3T2MA 3K03A 2JK5C 4WFFA 1ZWIC 4RO2A 4KFMA 2AHZA 2WLKA 3LDDA 4GX5A 4HYOA 3RW0A 3K0DA 3FB7C 3OR6C 4MW8A 1G4YB 2ZXWC 3IGAC 4JTAB 3LNMB 4MVOA 3SYAA 3TETA 2EIKC 3ABLC 2K1EA 1OCZC
chains in the Genus database with same CATH superfamily
4AQYO 4UV9A 4PI0A 3JD1A 4R8CA 2Q73A 5EIBC 2IH3C 2GHYA 5H5NA 1BQ0A 4QE7A 1RM1C 4D7TA 2KG7A 3AG3B 4NB5A 1M57B 4JV5B 4FFKA 3BHPA 3D3IA 1XI1A 2WSSG 2LP7A 3MHHC 5L3BA 1EN5A 4ZIBA 1GMGA 3L75H 1WNSA 4R50A 5JJEB 3ICXA 3E2EA 1K4DC 1WP8A 1AP5A 1FJGO 1AI4A 4JTDB 4F6RA 2YICA 3LUTB 3J81N 3F7VC 3LSQA 1K5SA 2JGDA 5LXTB 5KHHA 3ZRXA 4GYCB 5JCOC 3A0BZ 1HDJA 4B08A 1X4TA 4WF9V 1I08A 2OIGA 3OE7G 1K34A 2EINB 3JALA 4LF8O 3LSUA 1DLBA 3A0RA 2B1GA 2ZKOA 3FD9A 1Q90D 3OMNB 3C3TA 1Q8IA 1Q6HA 4J11A 4LCUC 1FXVA 3CRRA 4MT8A 4J80A 2ZD9A 2ZQMA 4JI8B 2Q69A 3ZHRA 3STZC 5JQGB 1HWYA 1MNGA 4X9QA 3BRCA 2ZIOA 3SPCA 2ZR3A 1SQXH 1L0NH 1JJOA 4LF4B 4JI3B 1WAZA 4O2BA 1PD3A 5JWPA 1BMFG 3P3PA 1XMOB 1SQPH 4WFFA 2JK5C 4LFCB 3RYHA 1YDXA 1YF2A 2YIAA 3L9DA 1Y66A 2A06H 1SQBH 3CWBH 4B3TO 3QVNA 1CP9A 1EBOA 4O2AB 5FPOA 4GUNA 1FXKC 3E8GA 3CB2A 3T1YB 1RM1B 5B1NA 2QWOB 3B40A 1I94O 4OGQB 2F4VO 4MVUA 4WBNA 2JJ1G 5J2TA 2ZE7A 4JAAA 4DR5O 3T1HB 3T4ZA 1EM1A 3JASA 4JYYA 4B3MO 2E3CA 1D2DA 2ZDIC 3RYCB 4HNAA 4GX0A 1QCEA 4MW3A 3JAKA 4R7CA 4DR7B 4FFBB 3ML0A 1K8AW 1RFYA 4PELA 3ETQA 3APQA 4J41A 1BHBA 1US6A 2L6LA 3JARA 2P4KA 5J2UB 1HR0B 2V1DA 3M8AA 1IBMB 2ZNJA 3P30A 2Z5UA 2QA4V 4UUJC 3H01A 1Y76A 4JV5O 1CXZB 4IL6Z 3SPJA 1W0JG 5IJ9A 2W0XA 1OCOB 3K9SA 1PL4A 3ZN0A 3T2MA 1AI7A 1GO3F 3G6BA 4J7KA 4JI7B 3ZMZA 4GKKB 4GX5A 4UXNA 1K33A 1GM9A 4DO2A 3H1KH 2VQEB 4FLZA 3GVMA 2YIDA 1XHZA 3CP1A 2CAZC 2F95B 4GZRB 1OCRC 4HZ3A 2CGOA 4I50A 3CCRV 1FXKB 2AW9A 4I55B 2JS3A 2GV9A 3DC5A 2ZE8A 3CCMV 1W2BU 5KA5A 3AK2A 3APOA 5BZBA 5GONB 2JEUA 1G1XB 2OTLV 2HHHB 3VQWA 4JF3A 3G71V 2UXDB 2EULA 4I4TB 4CC6A 1BGYH 5LOVA 4JI8O 4FLYA 2W6IG 4CS3A 3H9VA 4O4LA 1IXBA 3OR7C 2PYLA 4JI6B 4ABMA 2WLNA 3K79A 2BSKA 4IIJA 4LF4O 3DGEA 2GSMB 4JI3O 3CE2A 3ZCCA 5B3SC 2ODMA 3K3WA 3T4DA 2YXYA 4YIOA 4CBCA 1XMOO 4JI1B 4FLWA 4XDLA 1R73A 4LFCO 4MVQA 1TGOA 4TT3G 4CH6A 3E8FA 4JPRA 3U0ZA 3I56V 5LGNA 4PDLA 1AR1B 4QJFB 1UPGA 2N74A 5K1XA 3KKYA 1QNMA 1ZL8B 5IDJA 3T1YO 5EYPB 2P6JA 4DUYB 1R6TA 5IYDO 2W6JG 1GM8A 4MVZA 1KKCA 1BHAA 3CD6V 2ZE6A 4LF6B 2W0FC 5EBLC 4A5UB 1YITV 2Y69C 1JVMA 3WFVA 4DV0B 3T1HO 1NI8A 4YXWG 1XOUA 2Q9LA 5HFLA 5LP6A 2JEXA 3FB7C 1JPXA 4JTAB 2ILMA 1LR1A 1YTFD 1OCRB 1WN7A 4UVCA 3MAQA 3H1JH 2OYQA 3G67A 3CRQA 4KP4A 2PTMA 4X20A 1XUQA 2FKXA 4DR7O 3JAMN 3CPWU 1FYJA 1NKDA 5CMUA 1VQ9V 1AVMA 4TV9B 1HR0O 2CUGA 1IBMO 2OWOA 4LFBB 3N2KB 4XBFA 4OPHA 1PPJH 2NR5A 1ZX3A 3CCQV 5B3SB 4U3JB 5BR8B 1NT2B 1XDCA 3OMAB 1TVKA 4GKKO 4TUYB 4KUMA 4JI7O 1IX9A 4E4EA 4JAVA 1SA0B 4YY3B 3UKMA 1YJ9V 1VQ4V 2BCCH 4RUEA 2VQEO 3MHSC 4JI2B 4DYLA 1RSOA 1WA8B 1GAXA 1OZ0A 4HBNA 4JTCB 1FPOA 1VMGA 5L3CA 3L73H 4J7ZA 3CS5A 3FYIB 3HPLC 1TUBB 3VBBA 1RPRA 2HHHO 3QG5A 1TAEA 2Q8VA 3FX7A 3JD0A 2UXDO 2JGUA 1VEWA 2YS8A 4OPAA 2XAHA 3KZIZ 5L3GA 2Y69B 4FVMA 2ZINA 1DF4A 4DW0A 5IWAB 4JI6O 1KKDA 4P9OA 4HAMA 4FM1A 1HNXB 1B3QA 1F4NA 4KFMA 2E74B 1VQMV 3BABA 1NU1H 4O4IB 4JI1O 2LGWA 2RNBA 2RDCA 3SJAC 4UV8A 2YC0A 2PGGA 3E89A 2AHYA 3G6EV 2EIMC 2E76B 2WWWA 3D36A 3ZX6A 3UQ8A 3U11A 4JYCA 1JCHA 1VQ5V 4LR3A 1VQKV 3CMAV 2Q7EA 5DN6G 3TK1A 3FB8C 5LGUA 1FD9A 2DYRC 4DUYO 5L3EA 2CTWA 3GB7C 3BCCH 3HB3B 4LF6O 5LYJB 1H2LA 4MTFA 2P5OA 3OMIB 1M1KW 1K73W 2CH7B 1LUWA 1XEQA 2Q0AA 3FAVB 2IBZH 3CYOA 4DV0O 5LXTA 3KG2A 1VF7A 4JYBA 3HKEB 2B9ZA 2VWKA 1BT8A 1FXHA 1CEZA 4NVPA 2XUMA 2E5LB 4KXRA 4TOIA 3VOUA 3RYFB 4P2ZA 3ZHTA 2RCVA 4PJ0Z 3VQXA 1S77D 2KB1A 1K7DA 5JQGA 2R9RB 4GX1A 2QKSA 4PD4F 2YXHA 5BXZA 1HNWB 2H8PC 2EJRA 1KU9A 4LFBO 1IBLB 4PHZA 4JI5B 3UM7A 2H3OA 4GX2A 3ZHQA 1AJQA 5LGTA 1B04A 1YHQV 1XHXA 3ZRWB 5BR8O 4FPPA 1J5EO 1L1FA 1OJHA 1SESA 1WLEA 1QU7A 4O2AA 4E2LA 3LNMB 2C2AA 2Q5ZA 4UVBA 4YY3O 2K1EA 4LF9B 5KHIA 2EIMB 2RN9A 4JI2O 2N05A 1I5YA 2FYUH 1SETA 2HJFC 4TQFA 5E79Z 3BEHA 1JA8A 4EKWA 4BIUA 3L74H 5KLVH 1BS3A 1P7BA 2DQ0A 4ZBMA 3HKDB 3UO2A 2DYRB 3DXRB 4JYAB 4X1YB 5EIBD 4K3AA 4ZOLA 1SQGA 1N32B 5CA1B 3OAAG 1BSMA 4TSFG 1R3IC 5EK0A 2R72A 4ZKIA 1PV0A 5IWAO 1YJNV 1E79G 5JCOA 3RYCA 1AR5A 4XDKA 2LW1A 1HNXO 1NTKH 1EFRG 5CBFA 3QO8A 4OX9B 4FFBA 5HFMA 1SS3A 5EZYB 5LA6B 2QTOA 1JR9A 1XL6A 4G27B 2UUAB 1M4UA 2XASA 5B66Z 1SRYA 5J2UA 3FKSG 2UU9B 3M99B 1AJPA 1V54C 4BIOA 4DR3B 1GK9A 4LH6A 4I0XB 2RMKB 4DUZB 2QWRB 4WFEA 4X65B 1Q6UA 1GN3A 4FM2A 1GRJA 2CDYA 2AZ2A 1M90W 2A79B 1URFA 1M5IA 4X88A 4NTWA 1Y67A 1VQ6V 1YJWV 5A9GA 4ZI7B 2CTQA 1KBHA 2AHZA 2IJJA 1FXKA 3B09A 1H2NA 1KUQA 1S5JA 4I55A 1XILA 3K58A 2DYSC 5GONA 1S5LZ 1P84F 4U3FH 4WFAV 2WLJA 2E5LO 2DE0X 4DV1B 4L8JA 1AROP 4DV7B 4AHCA 4UCTA 4I4TA 3ABTA 3WG7C 2PZSA 3L71H 1HNWO 1N0JA 2Y0PA 4EFBA 2JRIA 4PA4A 1Z5VA 3RWRD 1EN4A 4K35A 1IBLO 3ASNC 3ABKC 2IM9A 3VQYA 4JI5O 3EXAA 1AILA 3E35A 2ZDIA 1QQCA 2ZT9B 5DECA 4FM0A 1GM7A 2R9IA 2E75B 1Q6IA 1NQTA 3RT3C 3CCJV 5EC2C 5IT9N 2UUBB 4DV4B 4JZ2A 4LF9O 4U7OA 1ZL8A 2OTJV 5EYPA 4CZZA 3HKCB 5KX5B 2HG5C 4QPJA 3ABUA 3K59A 1V54B 2WAMA 1N0NA 3AG2C 3E86A 1HNZB 4NXNB 1S76D 3LDCA 2ITCC 3Q4HB 4BAYA 2GBOA 5LMUB 3ETGA 4JYAO 4CH4A 2P7TC 4MTXA 2YDEA 3RYIA 5ITZB 3H1HH 1MZEA 1SZXA 1VP7A 5EBMC 1XMQB 1N32O 4LFAB 3ZHUA 3JD2A 1KP2A 4J7JA 1PP9H 1D5AA 1FFXB 1QR9A 3QNEA 1N36B 4RWUA 1YCIA 3ZN1A 4OX9O 2EIKC 2DYSB 1DTOA 4LC1A 1VF6C 3NXSA 4H37A 3CCSV 1Z2GA 4H33A 3OT7A 1Y6XA 2UUAO 1COWG 5IE9A 1CPYA 4TV9A 2UU9O 1QHTA 3N2KA 1KD1W 4DR3O 3WG7B 1KC8W 3F5TA 1VQLV 4WFGA 3C90A 3B4SA 4B3RB 4PA3A 4CH3A 4U3JA 4RQEA 1VIBA 3ZRSA 3ASNB 1Y4MA 3ABKB 3ZRVA 4DUZO 2F93B 4IGGA 3CX5F 4X66B 5FLXN 4X65O 4PA6A 4TUYA 4NYKA 5FNVB 2M7WA 5A2QN 1LUVA 1SA0A 2QR4A 3BA9A 4L87A 4UB6Z 2D2CB 2IH1C 3CCEV 2QM8A 1WA8A 1XL4A 2JS5A 1S5HC 3TJTA 5CB4A 2WLLB 1NVPD 4NXMB 4FLUA 3W7XA 4O4JB 2QJ1A 3B77A 2BTQB 3AG2B 4DV1O 3AEIA 5LL6Y 4DV7O 1J95A 3KCXA 3OUSA 2KKWA 4I9WA 2AZ0A 4X89A 2IU3A 1YIJV 4H13B 3ZEDA 4CC5A 1AJNA 3X2QC 4EFEA 5KMGB 2PI4A 3VQVA 3HKBB 4LF5B 4O4IA 1WPXA 2EBOA 5KUMA 1BCCH 1PL0A 2Q4PA 3K03A 2ZIMA 4Q6GA 4JZGA 2EIKB 2PYJA 1MA1A 2UUBO 4ASUG 3JSNA 5J9PC 1EZJA 4DV4O 2RQ6A 3I5DA 2PY5A 1KB9F 4JASA 4BIZA 1EN6A 2EIJC 1HNZO 4NXNO 1THZA 3OTOB 5GTHZ 1H2SB 2ARHA 5LYJA 1BE3H 5LMUO 4UFZA 2CH7A 2QTSA 1BZKA 1B6QA 3F5WC 2GDSA 4MVSA 2R70A 4DR4B 1XMQO 2X0LA 3CRAA 1Y74B 4LFAO 1NBMG 3HKEA 3ZBHA 4IHJB 1AP6A 2OT5A 2B1IA 3CCLV 1N36O 1SQQH 2XTAA 1F4MA 2ETNA 5IYZA 1O9HA 3B8MA 3BA8A 2CK3G 3STLC 2YI8A 1Q5OA 3CJHB 4F6EA 1A32A 1NVPB 4BR6A 1IZ3A 1U97A 4UVAA 3BVOA 1MABG 4O4HB 3SYOA 2DWEC 3JYCA 3K5LA 4B7EA 4OXSA 1KQSU 2LW7A 3QO7A 3X2QB 3E8BA 1H2MA 3H1IH 3K0GA 4B3RO 3ZRWA 4KHPB 4WFHA 1ZAUA 4EB6B 3M7MX 4X66O 4P30A 2LO1A 1FAFA 3W7TA 2QDOA 1P4RA 4UCSA 3UCSC 1DGSA 1GN2A 3K0DA 4FK5C 4H0LB 3IGAC 2G38A 1P7GA 4X1IB 4DR6B 2PF4E 4NXMO 2A9HA 1SERA 2DMXA 3HKDA 3DXRA 2MK3A 2EIJB 4X1YA 1QBZA 2VS0A 1MOFA 4YJ2B 4CS2A 5EC1C 3GWOA 2NNUA 1H8HG 2OCCC 2BSKB 4DK1A 4Z2WA 2OCHA 1NJIW 2H94A 1F23A 1FFTB 4DR1B 2LFRA 1YVWA 4PA7A 4MTOA 3CC2V 1R6NA 4MSWC 3A8TA 3OFNG 3R65A 2LQTA 2EZOA 4LF5O 4W4LA 2QKCA 4X62B 5EZYA 5LA6A 3JCZA 2F66C 1H2GA 5C8YB 2P06A 3BAAA 3IAYA 2EZPA 1R1BA 4DXWA 4I9QA 1SF9A 1G6UA 1QLEC 3RGBA 1UJWB 4EEQA 2YEVB 5BMVB 4I0XA 3WB1A 3JATB 3FB6C 1GH6A 3U10A 3B8NA 3CXHF 2ZE5A 3OTOO 4RQFA 1EZVH 1H8EG 4RUFA 3N2GB 3OW2U 1MSWD 4I7ZB 4ZI7A 3THOA 5K1PA 4DR4O 4FLVA 1FS0G 5JVDB 1V55C 2XAGA 4RO2A 1XREA 2Y4TA 4BWAA 3L72H 1IURA 2IJIA 3SGIA 1E1RG 1IVSA 3ABLC 5DM6V 4TV8B 4ICGA 4X1KB 4J42A 5JH7B 3NR7A 2X6CA 1KP3A 4UCUA 5H6QA 1U96A 4XDJA 1Q7YW 2EILC 5KHKA 2OCCB 2UXBB 2F1MA 1PM9A 5B5EZ 2HVJC 4KHPO 5IJ0B 4DRXB 1K4CC 2ADPA 5LBQA 3E22B 1KYOF 3UT5B 3WB0A 2VWJA 4N21A 2HEPA 3LNNA 2UXCB 4PA9A 1V9PA 1SKVA 4GCZA 5FPRA 1H38A 3E83A 3DC6A 3HKCA 5KX5A 3SJQC 2BOCC 2HFEC 2WLIB 1QLEB 4R6ZA 5LHHA 4DR6O 2A3QA 3Q4HA 1R3LC 5KHJA 2Q7GA 3ZMVA 4DV2B 3BFRA 2IU0A 1YI2V 4JAUA 5ITZA 5KAFZ 3SR2C 4B3SB 5IYBO 3G80A 5JJJB 3JSLA 2D3OW 3ETEA 2IJHA 4G28B 3IC7A 1DK1A 1VQPV 2KSDA 2MW2B 1FFXA 4DR1O 4IYHA 3ZHVA 2A7WA 2WPDG 5EBWC 3FB5C 1Q3EA 2WA4A 1V55B 3K9AA 2UXNA 2NN4A 3QO5A 4W4KA 2JDIG 4X62O 5LMNB 3CMEV 2WA3A 2ZXWC 3ABLB 4TQDA 1S0VA 1JFFB 1VF5B 2JJ2G 5B1OA 1I5XA 1QR8A 3W7WA 1F7YA 1RPOA 4B7KA 2GUZB 1DF5A 1TUEB 1WPBA 1K9MW 2CTPA 2EILB 4UCRA 1KECA 3SPHA 2WLHA 4ZHQB 2QWNB 1JJ2U 2HP8A 3QTCA 1VQNV 4DV6B 4BW9A 5CA0B 1R6KA 1W0KG 1MMMA 2LFSA 3OM3B 5DEDA 5FNVA 4MS2A 3ZMTA 3JAWB 4K0KB 3DSQA 5D5PA 3C3SA 3K08A 4LWSB 2DWDC 2VQFB 4I5SA 2B5UA 4PV1B 3K06A 1JX9A 1ZLZA 2WLLA 1OCCC 2YI9A 4PDVA 2YSUB 4O4JA 4YJ3B 1IDSA 1QVFU 4QE9A 3SYCA 2BTQA 4CS4A 4UB8Z 4GKJB 2DOSA 2ZM6B 2Q6AA 5H9CA 3WB2A 2YIBA 3P32A 4LP8A 3OGCC 3ASOC 3AK3A 4IT5A 1OCOC 4LNUB 1AB3A 1T5EA 1Q86W 5KMGA 2EJ7A 1ZUQA 2UXBO 4K8XA 5E1AC 3OEHG 3HKBA 4GLXA 2V4DA 3TXSA 3K5OA 2YIBD 3K04A 3AG1C 4AI8A 5C93A 3H1LH 1L8DA 3SPGA 1SQFA 3TCUA 4C7UA 1VF6A 2O57A 1YSCA 2UXCO 2DJVA 2ZXWB 3BPZA 4JGSA 3OR6C 1G4YB 3LSSA 4NKGB 3A2FA 1GTOA 3RFRA 5KUKA 4F4LA 3SJBC 5H2FZ 1F51A 1I0HA 4ZOLB 5B1AC 4DV2O 2BTOA 3SJCC 2QEXV 4LF7B 4QIWF 4QNHB 4J9YB 2F43G 4B3SO 3T1CA 1IBKB 1RP3B 2XAFA 1N34B 1VQOV 5H6RA 1Y74A 4H44B 1HP8A 1H2KA 4IHJA 3S3WA 2KG7B 4WFBV 1JOYA 3W7SA 2AXTZ 1OCCB 4YHHB 1AI6A 2YUAA 1IXMA 4PDMA 1L0LH 2X6BA 5LMNO 4BW5A 3CJHA 5AG2A 1M9NA 2QWQB 1K97A 1M93A 2XT9A 1G8MA 4DW1A 1K3EA 4O4HA 4F6RB 1MZFA 1WJZA 3ASOB 2HJDA 4QPKA 2XOKG 2JGDB 2NLJC 2LGQA 3WU2Z 3J7AU 1XQ8A 2PUSA 1WP7A 4DV6O 3JALB 4EB6A 4JI0B 3JD3A 1XNRB 1OHHG 5CN0A 2L35A 5BY1A 3K5MA 3ZS8C 3AG1B 4D7SA 4K0KO 1JMKC 4K8ZA 3EVKA 4KL1A 1LNQA 3SDLA 1TUBA 2VQFO 4Z1VA 4U7NA 3N27A 3ZJZA 4X1IA 1ZWIC 2XNDG 2M6YA 4O2BB 4MVOA 2Y4UA 3TETA 2AGAA 5F2VO 1OCZC 4X8AA 4GKJO 2ZM6O 3QF7A 5IY5C 1NZ6A 3RYHB 3CRCA 2BOBC 4YJ2A 4DV3B 5B1AB 3UO3A 1I7FA 2ZR2A 3FFQA 1SQVH 2HLDG 4FIPC 4LH7A 3P3NA 3E8HA 2F23A 1AR4A 3IFXA 3ZMUA 1GN4A 3F7YC 4PDRA 4DK0A 2CTRA 2A0LA 1N8RW 4TWKA 4NR1A 4DV5B 5C8YA 1ROPA 4MVRA 5L3DA 3O65A 4WBNB 5J2TB 3IJ4A 5LHIA 3I55V 4RAIA 5B1BC 3CHXA 2FL4A 2YEVA 5BMVA 3JATA 3ABMC 3CC7V 1ENVA 5IYCO 2JIZG 2ATKC 3JASB 4MTGA 2X7RB 5CBGA 3FAVA 1PNKA 3RYIB 1SZTA 2OIEA 4D6TH 4JI4B 1YZBA 4Z1MG 1NH2D 3ETDA 1N33B 4DR2B 1YEWA 1Z5WA 2R9AA 4HNAB 3AG4C 3N2GA 4LBEC 5TISZ 5CA3A 3JAKB 3SYPA 4LF7O 1S72V 1N4CA 2UXXA 2UUCB 2HVKC 1IBKO 3AK1A 5KAIZ 2Q7HA 2GTAA 1N34O 3RYFA 2VRZA 1Q81W 4J10A 3R66A 5JVDA 3JARB 1MSDA 5L3FA 1B06A 1Y76B 3MDSA 3RVZA 1R3KC 4TV8A 3SYQA 4YHHO 5IJ9B 4X1KA 2EX3A 3L70H 3IC9A 5JH7A 2QE7G 1OCZB 2QM4A 5IY5B 3TGUH 1NTMH 3K57A 1ORQC 2HKOA 5LP6C 4IYIA 4X64B 2Q0OC 4WCEV 2Y48A 1J5EB 5KHGA 1S3JA 4I50B 1XNQB 3ZIAG 2FMLA 5IJ0A 1KMIZ 2P90A 1PKXA 5FL7G 4DRXA 4JI0O 3O9OA 4MVMA 4QGPA 1XNRO 1NTZH 3E22A 5GTIZ 3JCUZ 3UT5A 1JQ0A 5CB4B 1Q43A 3K5NA 3PJSK 3CEIA 3AG7A 4GT1A 5LOVB 3FYEB 4J9ZB 2XHBA 4O4LB 2WLIA 5B1BB 2FTKA 1OV9A 3ABMB 5CA1A 4IIJB 1W59A 3JD4A 1BL8A 1ZSPA 1NR1A 4AQYB 3DTUB 1HW7A 2P67A 2ZNIA 4FLTA 1BQZA 4P9PA 2ZCEA 2K9PA 1VQ8V 1YXBA 4DV3O 5GW7A 4FLXA 2PI5A 2QSAA 1NR7A 3AG4B 1Q82W 3CSXA 2KQXA 2QWPB 4FZ1A 3ZHSA 1K5QA 5LHGA 1WB8A 1K92A 1NH2B 2X6AA 3KCYA 1M56C 2XAJA 3EHBB 3ZMSA 2LJ2A 1TA8A 3CCVV 3OD4A 3A0HZ 2Q68A 1YTFB 4DV5O 4NTXA 2DN9A 3D8CA 2BE3A 1FJGB 1JFFA 1XBLA 4FZ0A 2P4VA 2CE4A 1VQ7V 2WLKA 3LDDA 5KA6A 4HYOA 3RW0A 2CGNA 5D5QA 4UCVA 2GUZA 3SYAA 2N04A 3OTFA 1D5NA 1E1QG 4G2KA 2P22C 5LP6B 4CH5A 4ZHQA 1MG1A 4N23A 1UFIA 5CA0A 3RBZA 4LF8B 4JI4O 3MD0A 1N33O 3S3XA 4DR2O 3JAWA 4X20B 4LWSA 3RN4A 3B2EE 3OUFA 3D36C 2UUCO 4FJCC 4PI2A 2IJKA 2Y0IA 1PNLA 3AG3C 3OEEG 1M57C 1QVGU 2HR3A 3LDEA 2QKAA 3PN1A 1FKAO 4YJ3A 2QGNA 5IYZB 3TXQA 3HR0A 4NTYA 2GTSA 1AI5A 2WLMA 3G4SV 1NS1A 1X59A 2ADQB 2YXLA 3CXCU 2FB5A 3SPIA 2Z3YA 1TVKB 2ITDC 4B3TB 4AILC 4LNUA 3W7UA 3RVYA 1SC5B 3CCUV 2Q67A 2Z0AA 5CBHA 1VARA 4X64O 2EINC 3OGIB 2IW5A 4UCOA 4FMTA 3D3QA 1RSOB 1GN6A 1GKFA 2V7QG 1XNQO 3J80N 1I94B 1M56B 2JVDA 2F4VB 3BY6A 3GWKC 1R3JC 4YIPA 3EFFK 4Q20A 1QLNA 5JJNB 1WB7A 4DR5B 2QM7A 1ZTEA 2XAQA 2DW4A 1O9GA 1PNMA 4B3MB 4MW8A 3CRMA 3CC4V 2DQ3A 2RJZA 1P49A
chains in the Genus database with same CATH topology
1EZJA 3E89A 5KUKA 4UV9A 3JD1A 4F4LA 2AHYA 3G6EV 2EIMC 3D36A 2WWWA 4JASA 4R8CA 4BIZA 1F51A 2IH3C 1JCHA 4JYCA 5B1AC 1VQ5V 2QEXV 2EIJC 4QIWF 4QNHB 1VQKV 2GHYA 1THZA 4J9YB 2F43G 3T1CA 3CMAV 4QE7A 5DN6G 1RM1C 3TK1A 3FB8C 5LGUA 2DYRC 2XAFA 3AG3B 5L3EA 1VQOV 1M57B 5H6RA 3GB7C 1B6QA 3F5WC 3D3IA 3HB3B 2WSSG 4MTFA 2LP7A 4MVSA 3OMIB 4WFBV 2X0LA 1JOYA 1M1KW 1K73W 3MHHC 3W7SA 5L3BA 1NBMG 1GMGA 1OCCB 3CYOA 4R50A 1AI6A 3E2EA 1K4DC 3KG2A 2OT5A 1IXMA 2B1IA 4PDMA 1AI4A 4JTDB 4JYBA 2X6BA 3CCLV 3LUTB 4BW5A 1M9NA 3F7VC 1K97A 3LSQA 1K5SA 1F4MA 1G8MA 3ZRXA 1FXHA 3B8MA 1K3EA 1CEZA 2CK3G 4WF9V 3STLC 3VOUA 3ASOB 3OE7G 1K34A 2EINB 4QPKA 2XOKG 1DLBA 2NLJC 4P2ZA 1NVPB 3A0RA 2B1GA 4UVAA 1MABG 3OMNB 3SYOA 2KB1A 1S77D 1K7DA 2DWEC 3JYCA 4OXSA 2R9RB 4GX1A 2QKSA 4LCUC 1KQSU 1FXVA 4MT8A 3JD3A 2H8PC 2EJRA 1OHHG 3QO7A 3X2QB 3E8BA 3K0GA 2ZD9A 2ZQMA 5CN0A 2Q69A 3ZRWA 3AG1B 3STZC 1HWYA 4WFHA 1LNQA 3SPCA 3UM7A 4GX2A 2ZR3A 1AJQA 4P30A 4U7NA 5LGTA 3W7TA 1YHQV 3ZRWB 1PD3A 1P4RA 1BMFG 3ZJZA 4FPPA 1L1FA 4WFFA 2JK5C 1ZWIC 1SESA 1WLEA 2XNDG 3K0DA 4FK5C 3IGAC 4E2LA 3LNMB 4MVOA 2C2AA 3TETA 1Y66A 4UVBA 2K1EA 1OCZC 4X8AA 2EIMB 5IY5C 1CP9A 2A9HA 2BOBC 1SERA 1EBOA 5B1AB 1I5YA 1SETA 2MK3A 1FXKC 2HJFC 3E8GA 2EIJB 3BEHA 4EKWA 4BIUA 2ZR2A 1QBZA 1RM1B 1P7BA 2HLDG 2DQ0A 1MOFA 4ZBMA 5B1NA 5EC1C 4FIPC 3GWOA 2NNUA 1H8HG 2DYRB 2OCCC 3E8HA 1NJIW 2H94A 1F23A 3IFXA 3ZMUA 1FFTB 3F7YC 4PDRA 2A0LA 2LFRA 4MVUA 4PA7A 4MTOA 1N8RW 1R6NA 2JJ1G 4MSWC 3CC2V 4TWKA 3OAAG 1ROPA 5EK0A 4TSFG 1R3IC 4MVRA 4ZKIA 3OFNG 3R65A 5L3DA 1YJNV 1E79G 2EZOA 3T4ZA 3JCZA 4XDKA 1H2GA 5LHIA 3I55V 4RAIA 5B1BC 1EFRG 5CBFA 2EZPA 3QO8A 2YEVA 4DXWA 5HFMA 3ABMC 3CC7V 1ENVA 5IYCO 2ZDIC 2JIZG 2ATKC 4MTGA 2X7RB 2QTOA 5CBGA 4GX0A 1PNKA 1QLEC 1QCEA 1XL6A 4G27B 4MW3A 1UJWB 2XASA 1SZTA 1SRYA 4R7CA 2YEVB 1K8AW 3ML0A 3FKSG 1NH2D 4Z1MG 3ETDA 3FB6C 4PELA 3M99B 1AJPA 1V54C 3B8NA 1GK9A 3AG4C 4LBEC 5CA3A 1BHBA 3SYPA 1S72V 4RQFA 2UXXA 2V1DA 2HVKC 3P30A 1H8EG 2Z5UA 4RUFA 2QA4V 4UUJC 3H01A 1Q81W 3OW2U 1MSWD 5L3FA 4WFEA 3SPJA 1W0JG 1M90W 2A79B 1OCOB 4X88A 1FS0G 3ZN0A 1VQ6V 3RVZA 1V55C 1R3KC 1YJWV 3SYQA 3T2MA 1AI7A 1GO3F 2XAGA 4RO2A 3ZMZA 2AHZA 2IJJA 4GX5A 4UXNA 1K33A 1GM9A 4DO2A 1FXKA 2IJIA 1E1RG 2QE7G 1OCZB 3ABLC 5DM6V 5IY5B 3CP1A 1OCRC 1ORQC 2DYSC 4HZ3A 2HKOA 3CCRV 4WFAV 1FXKB 2WLJA 2X6CA 1KP3A 5H6QA 4WCEV 1AROP 2Y48A 4XDJA 1S3JA 3CCMV 3ABTA 1W2BU 1Q7YW 5KA5A 5BZBA 2EILC 2OCCB 2JEUA 3ZIAG 2OTLV 3WG7C 4JF3A 2P90A 1PKXA 5FL7G 3G71V 4MVMA 1JQ0A 2HVJC 2W6IG 4PA4A 3OR7C 3ASNC 1K4CC 2WLNA 3ABKC 3K79A 3PJSK 5LBQA 3E35A 4GT1A 2ZDIA 3DGEA 2GSMB 3FYEB 4J9ZB 4N21A 3ZCCA 5B3SC 3K3WA 2WLIA 4PA9A 3T4DA 5B1BB 4CBCA 1GM7A 2R9IA 2FTKA 4GCZA 1H38A 1NQTA 3E83A 4XDLA 3ABMB 1R73A 3CCJV 4MVQA 5EC2C 3JD4A 1BL8A 3SJQC 4TT3G 1NR1A 2BOCC 2HFEC 3E8FA 4JPRA 2WLIB 1QLEB 3I56V 3DTUB 2P67A 4R6ZA 5LHHA 4P9PA 4U7OA 5LGNA 2OTJV 4PDLA 1AR1B 1R3LC 4QJFB 4CZZA 2HG5C 4QPJA 3ZMVA 3ABUA 1VQ8V 1V54B 2IU0A 2WAMA 5GW7A 1YI2V 2PI5A 4JAUA 1NR7A 3AG2C 3AG4B 3E86A 1Q82W 1S76D 3LDCA 2ITCC 5IYBO 5IDJA 4BAYA 2P6JA 3ETGA 1K5QA 5LHGA 2D3OW 3ETEA 2P7TC 4MTXA 1K92A 2IJHA 4G28B 5IYDO 2W6JG 1NH2B 1GM8A 3IC7A 4MVZA 2X6AA 1BHAA 3CD6V 1M56C 2XAJA 5EBMC 3EHBB 1VQPV 3ZMSA 2W0FC 5EBLC 3CCVV 1YITV 2Y69C 2Q68A 1JVMA 2WPDG 1YTFB 5EBWC 3FB5C 3JD2A 1KP2A 1V55B 3K9AA 3WFVA 2UXNA 3QO5A 1QR9A 4YXWG 2JDIG 3QNEA 5HFLA 1VQ7V 2WLKA 3LDDA 5KA6A 3CMEV 4HYOA 2JEXA 3RW0A 3FB7C 2ZXWC 1JPXA 3ABLB 4JTAB 3ZN1A 1S0VA 3SYAA 1YTFD 2EIKC 2DYSB 1OCRB 1DTOA 2JJ2G 5B1OA 4LC1A 4UVCA 1I5XA 1E1QG 4G2KA 1QR8A 3NXSA 4H37A 1MG1A 4N23A 3W7WA 3CCSV 4H33A 4KP4A 3RBZA 1RPOA 1COWG 1DF5A 1CPYA 1TUEB 1K9MW 3MD0A 3CPWU 2EILB 1NKDA 1KECA 3SPHA 1KD1W 2WLHA 5CMUA 1JJ2U 1VQNV 1KC8W 3WG7B 1VQ9V 1VQLV 4WFGA 1R6KA 1W0KG 2LFSA 3OUFA 3OM3B 4FJCC 2IJKA 4PA3A 4MS2A 4XBFA 1PNLA 3ZMTA 3AG3C 3OEEG 1M57C 4RQEA 1QVGU 2HR3A 3LDEA 3ZRSA 3ASNB 1Y4MA 3ABKB 3K08A 3ZRVA 2DWDC 4I5SA 3CCQV 2B5UA 4PA6A 2M7WA 5B3SB 3K06A 1JX9A 2WLLA 3OMAB 4L87A 1AI5A 1OCCC 2IH1C 4PDVA 3CCEV 2YSUB 2WLMA 4KUMA 2QM8A 3G4SV 1XL4A 1QVFU 1S5HC 4QE9A 3CXCU 4JAVA 3SYCA 2WLLB 3SPIA 3UKMA 1YJ9V 1NVPD 1VQ4V 2Z3YA 2ITDC 4RUEA 2Q6AA 3W7XA 3MHSC 5H9CA 3W7UA 1OZ0A 3P32A 3RVYA 3CCUV 3B77A 2Q67A 4LP8A 3AG2B 5CBHA 3OGCC 3ASOC 4JTCB 3AEIA 1OCOC 2EINC 2IW5A 5L3CA 4FMTA 1J95A 3OUSA 4I9WA 3FYIB 3HPLC 1Q86W 1GKFA 2V7QG 4X89A 3VBBA 2IU3A 1RPRA 1YIJV 1M56B 5E1AC 3JD0A 3OEHG 1AJNA 3BY6A 3X2QC 2XAHA 1R3JC 3EFFK 5L3GA 3K04A 2Y69B 3AG1C 4Q20A 5C93A 1QLNA 2QM7A 2PI4A 3SPGA 1DF4A 2XAQA 1KKDA 4P9OA 3TCUA 2DW4A 1WPXA 2EBOA 5KUMA 1PNMA 4HAMA 1PL0A 1YSCA 3K03A 1F4NA 4KFMA 1VQMV 2ZXWB 4JGSA 3OR6C 2EIKB 1G4YB 4MW8A 3CC4V 2DQ3A 3LSSA 4ASUG 4UV8A 1GTOA 5J9PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E89 A;  5KUK A;  4H37 A;  1OCR C;  1ORQ C;  2DYS C;  4HZ3 A;  5IY5 C;  2A9H A;  2BOB C;  2AHY A;  4F4L A;  4H33 A;  2WLJ A;  3RBZ A;  2EIM C;  2X6C A;  4R8C A;  2HJF C;  3E8G A;  2IH3 C;  5B1A C;  3BEH A;  4EKW A;  4XDJ A;  3SPH A;  2EIJ C;  4QNH B;  2WLH A;  5BZB A;  4J9Y B;  1P7B A;  2EIL C;  4ZBM A;  5EC1 C;  3T1C A;  4QE7 A;  4WFG A;  3FB8 C;  3WG7 C;  2OCC C;  3OUF A;  2DYR C;  4PA3 A;  3E8H A;  3IFX A;  4MS2 A;  4MVM A;  3AG3 C;  3F7Y C;  3GB7 C;  4PDR A;  5J9P C;  2A0L A;  1M57 C;  3LDE A;  3F5W C;  3ZRS A;  2HVJ C;  4MVU A;  4MTF A;  4MTO A;  4PA7 A;  3K08 A;  4MSW C;  4MVS A;  4PA4 A;  2DWD C;  3OR7 C;  4TWK A;  3ASN C;  1K4C C;  2WLN A;  3ABK C;  3PJS K;  4PA6 A;  5EK0 A;  1R3I C;  4MVR A;  3R65 A;  3K06 A;  2WLL A;  3T4Z A;  4J9Z B;  4R50 A;  5B3S C;  1K4D C;  2WLI A;  4PA9 A;  1OCC C;  4X8A A;  3KG2 A;  2IH1 C;  4PDV A;  4XDK A;  3T4D A;  4CBC A;  4PDM A;  2WLM A;  4JTD B;  1XL4 A;  2X6B A;  4RAI A;  3LUT B;  3E83 A;  1S5H C;  4QE9 A;  4XDL A;  5B1B C;  4BW5 A;  5CBF A;  3F7V C;  2YEV A;  4MVQ A;  5EC2 C;  1BL8 A;  3SJQ C;  2WLL B;  3SPI A;  3SYC A;  3UKM A;  3ABM C;  4DXW A;  2BOC C;  2HFE C;  2ITD C;  3E8F A;  4RUE A;  2WLI B;  2ATK C;  2Q6A A;  4MTG A;  2QTO A;  4R6Z A;  5CBG A;  4P9P A;  4GX0 A;  1QLE C;  1XL6 A;  4PDL A;  4G27 B;  4MW3 A;  3STL C;  3RVY A;  3VOU A;  1R3L C;  4R7C A;  2HG5 C;  2Q67 A;  4LP8 A;  5CBH A;  3OGC C;  3ASO C;  4JTC B;  4P2Z A;  2NLJ C;  1OCO C;  2EIN C;  3FB6 C;  3AG2 C;  3E86 A;  1V54 C;  1J95 A;  3LDC A;  3OUS A;  2ITC C;  3AG4 C;  4I9W A;  4LBE C;  3HPL C;  2KB1 A;  3SYP A;  3SYO A;  2DWE C;  3JYC A;  4X89 A;  4OXS A;  2R9R B;  4GX1 A;  2QKS A;  2HVK C;  4LCU C;  2P7T C;  4G28 B;  2H8P C;  3E8B A;  3K0G A;  4MVZ A;  2X6A A;  2ZD9 A;  4RUF A;  4UUJ C;  5E1A C;  1M56 C;  5EBM C;  2Q69 A;  3X2Q C;  3STZ C;  2W0F C;  1R3J C;  4WFH A;  3EFF K;  5EBL C;  3K04 A;  4WFE A;  3SPJ A;  3AG1 C;  1LNQ A;  2A79 B;  3SPC A;  3UM7 A;  2Y69 C;  4GX2 A;  3SPG A;  4P30 A;  2Q68 A;  1JVM A;  5EBW C;  3FB5 C;  1KKD A;  4P9O A;  4X88 A;  3TCU A;  5KUM A;  3RVZ A;  3ZJZ A;  1V55 C;  1R3K C;  3SYQ A;  3T2M A;  3K03 A;  2JK5 C;  4WFF A;  1ZWI C;  4RO2 A;  4KFM A;  2AHZ A;  2WLK A;  3LDD A;  4GX5 A;  4HYO A;  3RW0 A;  3K0D A;  3FB7 C;  3OR6 C;  4MW8 A;  1G4Y B;  2ZXW C;  3IGA C;  4JTA B;  3LNM B;  4MVO A;  3SYA A;  3TET A;  2EIK C;  3ABL C;  2K1E A;  1OCZ C; 
#chains in the Genus database with same CATH topology
 4AQY O;  4UV9 A;  4PI0 A;  3JD1 A;  4R8C A;  2Q73 A;  5EIB C;  2IH3 C;  2GHY A;  5H5N A;  1BQ0 A;  4QE7 A;  1RM1 C;  4D7T A;  2KG7 A;  3AG3 B;  4NB5 A;  1M57 B;  4JV5 B;  4FFK A;  3BHP A;  3D3I A;  1XI1 A;  2WSS G;  2LP7 A;  3MHH C;  5L3B A;  1EN5 A;  4ZIB A;  1GMG A;  3L75 H;  1WNS A;  4R50 A;  5JJE B;  3ICX A;  3E2E A;  1K4D C;  1WP8 A;  1AP5 A;  1FJG O;  1AI4 A;  4JTD B;  4F6R A;  2YIC A;  3LUT B;  3J81 N;  3F7V C;  3LSQ A;  1K5S A;  2JGD A;  5LXT B;  5KHH A;  3ZRX A;  4GYC B;  5JCO C;  3A0B Z;  1HDJ A;  4B08 A;  1X4T A;  4WF9 V;  1I08 A;  2OIG A;  3OE7 G;  1K34 A;  2EIN B;  3JAL A;  4LF8 O;  3LSU A;  1DLB A;  3A0R A;  2B1G A;  2ZKO A;  3FD9 A;  1Q90 D;  3OMN B;  3C3T A;  1Q8I A;  1Q6H A;  4J11 A;  4LCU C;  1FXV A;  3CRR A;  4MT8 A;  4J80 A;  2ZD9 A;  2ZQM A;  4JI8 B;  2Q69 A;  3ZHR A;  3STZ C;  5JQG B;  1HWY A;  1MNG A;  4X9Q A;  3BRC A;  2ZIO A;  3SPC A;  2ZR3 A;  1SQX H;  1L0N H;  1JJO A;  4LF4 B;  4JI3 B;  1WAZ A;  4O2B A;  1PD3 A;  5JWP A;  1BMF G;  3P3P A;  1XMO B;  1SQP H;  4WFF A;  2JK5 C;  4LFC B;  3RYH A;  1YDX A;  1YF2 A;  2YIA A;  3L9D A;  1Y66 A;  2A06 H;  1SQB H;  3CWB H;  4B3T O;  3QVN A;  1CP9 A;  1EBO A;  4O2A B;  5FPO A;  4GUN A;  1FXK C;  3E8G A;  3CB2 A;  3T1Y B;  1RM1 B;  5B1N A;  2QWO B;  3B40 A;  1I94 O;  4OGQ B;  2F4V O;  4MVU A;  4WBN A;  2JJ1 G;  5J2T A;  2ZE7 A;  4JAA A;  4DR5 O;  3T1H B;  3T4Z A;  1EM1 A;  3JAS A;  4JYY A;  4B3M O;  2E3C A;  1D2D A;  2ZDI C;  3RYC B;  4HNA A;  4GX0 A;  1QCE A;  4MW3 A;  3JAK A;  4R7C A;  4DR7 B;  4FFB B;  3ML0 A;  1K8A W;  1RFY A;  4PEL A;  3ETQ A;  3APQ A;  4J41 A;  1BHB A;  1US6 A;  2L6L A;  3JAR A;  2P4K A;  5J2U B;  1HR0 B;  2V1D A;  3M8A A;  1IBM B;  2ZNJ A;  3P30 A;  2Z5U A;  2QA4 V;  4UUJ C;  3H01 A;  1Y76 A;  4JV5 O;  1CXZ B;  4IL6 Z;  3SPJ A;  1W0J G;  5IJ9 A;  2W0X A;  1OCO B;  3K9S A;  1PL4 A;  3ZN0 A;  3T2M A;  1AI7 A;  1GO3 F;  3G6B A;  4J7K A;  4JI7 B;  3ZMZ A;  4GKK B;  4GX5 A;  4UXN A;  1K33 A;  1GM9 A;  4DO2 A;  3H1K H;  2VQE B;  4FLZ A;  3GVM A;  2YID A;  1XHZ A;  3CP1 A;  2CAZ C;  2F95 B;  4GZR B;  1OCR C;  4HZ3 A;  2CGO A;  4I50 A;  3CCR V;  1FXK B;  2AW9 A;  4I55 B;  2JS3 A;  2GV9 A;  3DC5 A;  2ZE8 A;  3CCM V;  1W2B U;  5KA5 A;  3AK2 A;  3APO A;  5BZB A;  5GON B;  2JEU A;  1G1X B;  2OTL V;  2HHH B;  3VQW A;  4JF3 A;  3G71 V;  2UXD B;  2EUL A;  4I4T B;  4CC6 A;  1BGY H;  5LOV A;  4JI8 O;  4FLY A;  2W6I G;  4CS3 A;  3H9V A;  4O4L A;  1IXB A;  3OR7 C;  2PYL A;  4JI6 B;  4ABM A;  2WLN A;  3K79 A;  2BSK A;  4IIJ A;  4LF4 O;  3DGE A;  2GSM B;  4JI3 O;  3CE2 A;  3ZCC A;  5B3S C;  2ODM A;  3K3W A;  3T4D A;  2YXY A;  4YIO A;  4CBC A;  1XMO O;  4JI1 B;  4FLW A;  4XDL A;  1R73 A;  4LFC O;  4MVQ A;  1TGO A;  4TT3 G;  4CH6 A;  3E8F A;  4JPR A;  3U0Z A;  3I56 V;  5LGN A;  4PDL A;  1AR1 B;  4QJF B;  1UPG A;  2N74 A;  5K1X A;  3KKY A;  1QNM A;  1ZL8 B;  5IDJ A;  3T1Y O;  5EYP B;  2P6J A;  4DUY B;  1R6T A;  5IYD O;  2W6J G;  1GM8 A;  4MVZ A;  1KKC A;  1BHA A;  3CD6 V;  2ZE6 A;  4LF6 B;  2W0F C;  5EBL C;  4A5U B;  1YIT V;  2Y69 C;  1JVM A;  3WFV A;  4DV0 B;  3T1H O;  1NI8 A;  4YXW G;  1XOU A;  2Q9L A;  5HFL A;  5LP6 A;  2JEX A;  3FB7 C;  1JPX A;  4JTA B;  2ILM A;  1LR1 A;  1YTF D;  1OCR B;  1WN7 A;  4UVC A;  3MAQ A;  3H1J H;  2OYQ A;  3G67 A;  3CRQ A;  4KP4 A;  2PTM A;  4X20 A;  1XUQ A;  2FKX A;  4DR7 O;  3JAM N;  3CPW U;  1FYJ A;  1NKD A;  5CMU A;  1VQ9 V;  1AVM A;  4TV9 B;  1HR0 O;  2CUG A;  1IBM O;  2OWO A;  4LFB B;  3N2K B;  4XBF A;  4OPH A;  1PPJ H;  2NR5 A;  1ZX3 A;  3CCQ V;  5B3S B;  4U3J B;  5BR8 B;  1NT2 B;  1XDC A;  3OMA B;  1TVK A;  4GKK O;  4TUY B;  4KUM A;  4JI7 O;  1IX9 A;  4E4E A;  4JAV A;  1SA0 B;  4YY3 B;  3UKM A;  1YJ9 V;  1VQ4 V;  2BCC H;  4RUE A;  2VQE O;  3MHS C;  4JI2 B;  4DYL A;  1RSO A;  1WA8 B;  1GAX A;  1OZ0 A;  4HBN A;  4JTC B;  1FPO A;  1VMG A;  5L3C A;  3L73 H;  4J7Z A;  3CS5 A;  3FYI B;  3HPL C;  1TUB B;  3VBB A;  1RPR A;  2HHH O;  3QG5 A;  1TAE A;  2Q8V A;  3FX7 A;  3JD0 A;  2UXD O;  2JGU A;  1VEW A;  2YS8 A;  4OPA A;  2XAH A;  3KZI Z;  5L3G A;  2Y69 B;  4FVM A;  2ZIN A;  1DF4 A;  4DW0 A;  5IWA B;  4JI6 O;  1KKD A;  4P9O A;  4HAM A;  4FM1 A;  1HNX B;  1B3Q A;  1F4N A;  4KFM A;  2E74 B;  1VQM V;  3BAB A;  1NU1 H;  4O4I B;  4JI1 O;  2LGW A;  2RNB A;  2RDC A;  3SJA C;  4UV8 A;  2YC0 A;  2PGG A;  3E89 A;  2AHY A;  3G6E V;  2EIM C;  2E76 B;  2WWW A;  3D36 A;  3ZX6 A;  3UQ8 A;  3U11 A;  4JYC A;  1JCH A;  1VQ5 V;  4LR3 A;  1VQK V;  3CMA V;  2Q7E A;  5DN6 G;  3TK1 A;  3FB8 C;  5LGU A;  1FD9 A;  2DYR C;  4DUY O;  5L3E A;  2CTW A;  3GB7 C;  3BCC H;  3HB3 B;  4LF6 O;  5LYJ B;  1H2L A;  4MTF A;  2P5O A;  3OMI B;  1M1K W;  1K73 W;  2CH7 B;  1LUW A;  1XEQ A;  2Q0A A;  3FAV B;  2IBZ H;  3CYO A;  4DV0 O;  5LXT A;  3KG2 A;  1VF7 A;  4JYB A;  3HKE B;  2B9Z A;  2VWK A;  1BT8 A;  1FXH A;  1CEZ A;  4NVP A;  2XUM A;  2E5L B;  4KXR A;  4TOI A;  3VOU A;  3RYF B;  4P2Z A;  3ZHT A;  2RCV A;  4PJ0 Z;  3VQX A;  1S77 D;  2KB1 A;  1K7D A;  5JQG A;  2R9R B;  4GX1 A;  2QKS A;  4PD4 F;  2YXH A;  5BXZ A;  1HNW B;  2H8P C;  2EJR A;  1KU9 A;  4LFB O;  1IBL B;  4PHZ A;  4JI5 B;  3UM7 A;  2H3O A;  4GX2 A;  3ZHQ A;  1AJQ A;  5LGT A;  1B04 A;  1YHQ V;  1XHX A;  3ZRW B;  5BR8 O;  4FPP A;  1J5E O;  1L1F A;  1OJH A;  1SES A;  1WLE A;  1QU7 A;  4O2A A;  4E2L A;  3LNM B;  2C2A A;  2Q5Z A;  4UVB A;  4YY3 O;  2K1E A;  4LF9 B;  5KHI A;  2EIM B;  2RN9 A;  4JI2 O;  2N05 A;  1I5Y A;  2FYU H;  1SET A;  2HJF C;  4TQF A;  5E79 Z;  3BEH A;  1JA8 A;  4EKW A;  4BIU A;  3L74 H;  5KLV H;  1BS3 A;  1P7B A;  2DQ0 A;  4ZBM A;  3HKD B;  3UO2 A;  2DYR B;  3DXR B;  4JYA B;  4X1Y B;  5EIB D;  4K3A A;  4ZOL A;  1SQG A;  1N32 B;  5CA1 B;  3OAA G;  1BSM A;  4TSF G;  1R3I C;  5EK0 A;  2R72 A;  4ZKI A;  1PV0 A;  5IWA O;  1YJN V;  1E79 G;  5JCO A;  3RYC A;  1AR5 A;  4XDK A;  2LW1 A;  1HNX O;  1NTK H;  1EFR G;  5CBF A;  3QO8 A;  4OX9 B;  4FFB A;  5HFM A;  1SS3 A;  5EZY B;  5LA6 B;  2QTO A;  1JR9 A;  1XL6 A;  4G27 B;  2UUA B;  1M4U A;  2XAS A;  5B66 Z;  1SRY A;  5J2U A;  3FKS G;  2UU9 B;  3M99 B;  1AJP A;  1V54 C;  4BIO A;  4DR3 B;  1GK9 A;  4LH6 A;  4I0X B;  2RMK B;  4DUZ B;  2QWR B;  4WFE A;  4X65 B;  1Q6U A;  1GN3 A;  4FM2 A;  1GRJ A;  2CDY A;  2AZ2 A;  1M90 W;  2A79 B;  1URF A;  1M5I A;  4X88 A;  4NTW A;  1Y67 A;  1VQ6 V;  1YJW V;  5A9G A;  4ZI7 B;  2CTQ A;  1KBH A;  2AHZ A;  2IJJ A;  1FXK A;  3B09 A;  1H2N A;  1KUQ A;  1S5J A;  4I55 A;  1XIL A;  3K58 A;  2DYS C;  5GON A;  1S5L Z;  1P84 F;  4U3F H;  4WFA V;  2WLJ A;  2E5L O;  2DE0 X;  4DV1 B;  4L8J A;  1ARO P;  4DV7 B;  4AHC A;  4UCT A;  4I4T A;  3ABT A;  3WG7 C;  2PZS A;  3L71 H;  1HNW O;  1N0J A;  2Y0P A;  4EFB A;  2JRI A;  4PA4 A;  1Z5V A;  3RWR D;  1EN4 A;  4K35 A;  1IBL O;  3ASN C;  3ABK C;  2IM9 A;  3VQY A;  4JI5 O;  3EXA A;  1AIL A;  3E35 A;  2ZDI A;  1QQC A;  2ZT9 B;  5DEC A;  4FM0 A;  1GM7 A;  2R9I A;  2E75 B;  1Q6I A;  1NQT A;  3RT3 C;  3CCJ V;  5EC2 C;  5IT9 N;  2UUB B;  4DV4 B;  4JZ2 A;  4LF9 O;  4U7O A;  1ZL8 A;  2OTJ V;  5EYP A;  4CZZ A;  3HKC B;  5KX5 B;  2HG5 C;  4QPJ A;  3ABU A;  3K59 A;  1V54 B;  2WAM A;  1N0N A;  3AG2 C;  3E86 A;  1HNZ B;  4NXN B;  1S76 D;  3LDC A;  2ITC C;  3Q4H B;  4BAY A;  2GBO A;  5LMU B;  3ETG A;  4JYA O;  4CH4 A;  2P7T C;  4MTX A;  2YDE A;  3RYI A;  5ITZ B;  3H1H H;  1MZE A;  1SZX A;  1VP7 A;  5EBM C;  1XMQ B;  1N32 O;  4LFA B;  3ZHU A;  3JD2 A;  1KP2 A;  4J7J A;  1PP9 H;  1D5A A;  1FFX B;  1QR9 A;  3QNE A;  1N36 B;  4RWU A;  1YCI A;  3ZN1 A;  4OX9 O;  2EIK C;  2DYS B;  1DTO A;  4LC1 A;  1VF6 C;  3NXS A;  4H37 A;  3CCS V;  1Z2G A;  4H33 A;  3OT7 A;  1Y6X A;  2UUA O;  1COW G;  5IE9 A;  1CPY A;  4TV9 A;  2UU9 O;  1QHT A;  3N2K A;  1KD1 W;  4DR3 O;  3WG7 B;  1KC8 W;  3F5T A;  1VQL V;  4WFG A;  3C90 A;  3B4S A;  4B3R B;  4PA3 A;  4CH3 A;  4U3J A;  4RQE A;  1VIB A;  3ZRS A;  3ASN B;  1Y4M A;  3ABK B;  3ZRV A;  4DUZ O;  2F93 B;  4IGG A;  3CX5 F;  4X66 B;  5FLX N;  4X65 O;  4PA6 A;  4TUY A;  4NYK A;  5FNV B;  2M7W A;  5A2Q N;  1LUV A;  1SA0 A;  2QR4 A;  3BA9 A;  4L87 A;  4UB6 Z;  2D2C B;  2IH1 C;  3CCE V;  2QM8 A;  1WA8 A;  1XL4 A;  2JS5 A;  1S5H C;  3TJT A;  5CB4 A;  2WLL B;  1NVP D;  4NXM B;  4FLU A;  3W7X A;  4O4J B;  2QJ1 A;  3B77 A;  2BTQ B;  3AG2 B;  4DV1 O;  3AEI A;  5LL6 Y;  4DV7 O;  1J95 A;  3KCX A;  3OUS A;  2KKW A;  4I9W A;  2AZ0 A;  4X89 A;  2IU3 A;  1YIJ V;  4H13 B;  3ZED A;  4CC5 A;  1AJN A;  3X2Q C;  4EFE A;  5KMG B;  2PI4 A;  3VQV A;  3HKB B;  4LF5 B;  4O4I A;  1WPX A;  2EBO A;  5KUM A;  1BCC H;  1PL0 A;  2Q4P A;  3K03 A;  2ZIM A;  4Q6G A;  4JZG A;  2EIK B;  2PYJ A;  1MA1 A;  2UUB O;  4ASU G;  3JSN A;  5J9P C;  1EZJ A;  4DV4 O;  2RQ6 A;  3I5D A;  2PY5 A;  1KB9 F;  4JAS A;  4BIZ A;  1EN6 A;  2EIJ C;  1HNZ O;  4NXN O;  1THZ A;  3OTO B;  5GTH Z;  1H2S B;  2ARH A;  5LYJ A;  1BE3 H;  5LMU O;  4UFZ A;  2CH7 A;  2QTS A;  1BZK A;  1B6Q A;  3F5W C;  2GDS A;  4MVS A;  2R70 A;  4DR4 B;  1XMQ O;  2X0L A;  3CRA A;  1Y74 B;  4LFA O;  1NBM G;  3HKE A;  3ZBH A;  4IHJ B;  1AP6 A;  2OT5 A;  2B1I A;  3CCL V;  1N36 O;  1SQQ H;  2XTA A;  1F4M A;  2ETN A;  5IYZ A;  1O9H A;  3B8M A;  3BA8 A;  2CK3 G;  3STL C;  2YI8 A;  1Q5O A;  3CJH B;  4F6E A;  1A32 A;  1NVP B;  4BR6 A;  1IZ3 A;  1U97 A;  4UVA A;  3BVO A;  1MAB G;  4O4H B;  3SYO A;  2DWE C;  3JYC A;  3K5L A;  4B7E A;  4OXS A;  1KQS U;  2LW7 A;  3QO7 A;  3X2Q B;  3E8B A;  1H2M A;  3H1I H;  3K0G A;  4B3R O;  3ZRW A;  4KHP B;  4WFH A;  1ZAU A;  4EB6 B;  3M7M X;  4X66 O;  4P30 A;  2LO1 A;  1FAF A;  3W7T A;  2QDO A;  1P4R A;  4UCS A;  3UCS C;  1DGS A;  1GN2 A;  3K0D A;  4FK5 C;  4H0L B;  3IGA C;  2G38 A;  1P7G A;  4X1I B;  4DR6 B;  2PF4 E;  4NXM O;  2A9H A;  1SER A;  2DMX A;  3HKD A;  3DXR A;  2MK3 A;  2EIJ B;  4X1Y A;  1QBZ A;  2VS0 A;  1MOF A;  4YJ2 B;  4CS2 A;  5EC1 C;  3GWO A;  2NNU A;  1H8H G;  2OCC C;  2BSK B;  4DK1 A;  4Z2W A;  2OCH A;  1NJI W;  2H94 A;  1F23 A;  1FFT B;  4DR1 B;  2LFR A;  1YVW A;  4PA7 A;  4MTO A;  3CC2 V;  1R6N A;  4MSW C;  3A8T A;  3OFN G;  3R65 A;  2LQT A;  2EZO A;  4LF5 O;  4W4L A;  2QKC A;  4X62 B;  5EZY A;  5LA6 A;  3JCZ A;  2F66 C;  1H2G A;  5C8Y B;  2P06 A;  3BAA A;  3IAY A;  2EZP A;  1R1B A;  4DXW A;  4I9Q A;  1SF9 A;  1G6U A;  1QLE C;  3RGB A;  1UJW B;  4EEQ A;  2YEV B;  5BMV B;  4I0X A;  3WB1 A;  3JAT B;  3FB6 C;  1GH6 A;  3U10 A;  3B8N A;  3CXH F;  2ZE5 A;  3OTO O;  4RQF A;  1EZV H;  1H8E G;  4RUF A;  3N2G B;  3OW2 U;  1MSW D;  4I7Z B;  4ZI7 A;  3THO A;  5K1P A;  4DR4 O;  4FLV A;  1FS0 G;  5JVD B;  1V55 C;  2XAG A;  4RO2 A;  1XRE A;  2Y4T A;  4BWA A;  3L72 H;  1IUR A;  2IJI A;  3SGI A;  1E1R G;  1IVS A;  3ABL C;  5DM6 V;  4TV8 B;  4ICG A;  4X1K B;  4J42 A;  5JH7 B;  3NR7 A;  2X6C A;  1KP3 A;  4UCU A;  5H6Q A;  1U96 A;  4XDJ A;  1Q7Y W;  2EIL C;  5KHK A;  2OCC B;  2UXB B;  2F1M A;  1PM9 A;  5B5E Z;  2HVJ C;  4KHP O;  5IJ0 B;  4DRX B;  1K4C C;  2ADP A;  5LBQ A;  3E22 B;  1KYO F;  3UT5 B;  3WB0 A;  2VWJ A;  4N21 A;  2HEP A;  3LNN A;  2UXC B;  4PA9 A;  1V9P A;  1SKV A;  4GCZ A;  5FPR A;  1H38 A;  3E83 A;  3DC6 A;  3HKC A;  5KX5 A;  3SJQ C;  2BOC C;  2HFE C;  2WLI B;  1QLE B;  4R6Z A;  5LHH A;  4DR6 O;  2A3Q A;  3Q4H A;  1R3L C;  5KHJ A;  2Q7G A;  3ZMV A;  4DV2 B;  3BFR A;  2IU0 A;  1YI2 V;  4JAU A;  5ITZ A;  5KAF Z;  3SR2 C;  4B3S B;  5IYB O;  3G80 A;  5JJJ B;  3JSL A;  2D3O W;  3ETE A;  2IJH A;  4G28 B;  3IC7 A;  1DK1 A;  1VQP V;  2KSD A;  2MW2 B;  1FFX A;  4DR1 O;  4IYH A;  3ZHV A;  2A7W A;  2WPD G;  5EBW C;  3FB5 C;  1Q3E A;  2WA4 A;  1V55 B;  3K9A A;  2UXN A;  2NN4 A;  3QO5 A;  4W4K A;  2JDI G;  4X62 O;  5LMN B;  3CME V;  2WA3 A;  2ZXW C;  3ABL B;  4TQD A;  1S0V A;  1JFF B;  1VF5 B;  2JJ2 G;  5B1O A;  1I5X A;  1QR8 A;  3W7W A;  1F7Y A;  1RPO A;  4B7K A;  2GUZ B;  1DF5 A;  1TUE B;  1WPB A;  1K9M W;  2CTP A;  2EIL B;  4UCR A;  1KEC A;  3SPH A;  2WLH A;  4ZHQ B;  2QWN B;  1JJ2 U;  2HP8 A;  3QTC A;  1VQN V;  4DV6 B;  4BW9 A;  5CA0 B;  1R6K A;  1W0K G;  1MMM A;  2LFS A;  3OM3 B;  5DED A;  5FNV A;  4MS2 A;  3ZMT A;  3JAW B;  4K0K B;  3DSQ A;  5D5P A;  3C3S A;  3K08 A;  4LWS B;  2DWD C;  2VQF B;  4I5S A;  2B5U A;  4PV1 B;  3K06 A;  1JX9 A;  1ZLZ A;  2WLL A;  1OCC C;  2YI9 A;  4PDV A;  2YSU B;  4O4J A;  4YJ3 B;  1IDS A;  1QVF U;  4QE9 A;  3SYC A;  2BTQ A;  4CS4 A;  4UB8 Z;  4GKJ B;  2DOS A;  2ZM6 B;  2Q6A A;  5H9C A;  3WB2 A;  2YIB A;  3P32 A;  4LP8 A;  3OGC C;  3ASO C;  3AK3 A;  4IT5 A;  1OCO C;  4LNU B;  1AB3 A;  1T5E A;  1Q86 W;  5KMG A;  2EJ7 A;  1ZUQ A;  2UXB O;  4K8X A;  5E1A C;  3OEH G;  3HKB A;  4GLX A;  2V4D A;  3TXS A;  3K5O A;  2YIB D;  3K04 A;  3AG1 C;  4AI8 A;  5C93 A;  3H1L H;  1L8D A;  3SPG A;  1SQF A;  3TCU A;  4C7U A;  1VF6 A;  2O57 A;  1YSC A;  2UXC O;  2DJV A;  2ZXW B;  3BPZ A;  4JGS A;  3OR6 C;  1G4Y B;  3LSS A;  4NKG B;  3A2F A;  1GTO A;  3RFR A;  5KUK A;  4F4L A;  3SJB C;  5H2F Z;  1F51 A;  1I0H A;  4ZOL B;  5B1A C;  4DV2 O;  2BTO A;  3SJC C;  2QEX V;  4LF7 B;  4QIW F;  4QNH B;  4J9Y B;  2F43 G;  4B3S O;  3T1C A;  1IBK B;  1RP3 B;  2XAF A;  1N34 B;  1VQO V;  5H6R A;  1Y74 A;  4H44 B;  1HP8 A;  1H2K A;  4IHJ A;  3S3W A;  2KG7 B;  4WFB V;  1JOY A;  3W7S A;  2AXT Z;  1OCC B;  4YHH B;  1AI6 A;  2YUA A;  1IXM A;  4PDM A;  1L0L H;  2X6B A;  5LMN O;  4BW5 A;  3CJH A;  5AG2 A;  1M9N A;  2QWQ B;  1K97 A;  1M93 A;  2XT9 A;  1G8M A;  4DW1 A;  1K3E A;  4O4H A;  4F6R B;  1MZF A;  1WJZ A;  3ASO B;  2HJD A;  4QPK A;  2XOK G;  2JGD B;  2NLJ C;  2LGQ A;  3WU2 Z;  3J7A U;  1XQ8 A;  2PUS A;  1WP7 A;  4DV6 O;  3JAL B;  4EB6 A;  4JI0 B;  3JD3 A;  1XNR B;  1OHH G;  5CN0 A;  2L35 A;  5BY1 A;  3K5M A;  3ZS8 C;  3AG1 B;  4D7S A;  4K0K O;  1JMK C;  4K8Z A;  3EVK A;  4KL1 A;  1LNQ A;  3SDL A;  1TUB A;  2VQF O;  4Z1V A;  4U7N A;  3N27 A;  3ZJZ A;  4X1I A;  1ZWI C;  2XND G;  2M6Y A;  4O2B B;  4MVO A;  2Y4U A;  3TET A;  2AGA A;  5F2V O;  1OCZ C;  4X8A A;  4GKJ O;  2ZM6 O;  3QF7 A;  5IY5 C;  1NZ6 A;  3RYH B;  3CRC A;  2BOB C;  4YJ2 A;  4DV3 B;  5B1A B;  3UO3 A;  1I7F A;  2ZR2 A;  3FFQ A;  1SQV H;  2HLD G;  4FIP C;  4LH7 A;  3P3N A;  3E8H A;  2F23 A;  1AR4 A;  3IFX A;  3ZMU A;  1GN4 A;  3F7Y C;  4PDR A;  4DK0 A;  2CTR A;  2A0L A;  1N8R W;  4TWK A;  4NR1 A;  4DV5 B;  5C8Y A;  1ROP A;  4MVR A;  5L3D A;  3O65 A;  4WBN B;  5J2T B;  3IJ4 A;  5LHI A;  3I55 V;  4RAI A;  5B1B C;  3CHX A;  2FL4 A;  2YEV A;  5BMV A;  3JAT A;  3ABM C;  3CC7 V;  1ENV A;  5IYC O;  2JIZ G;  2ATK C;  3JAS B;  4MTG A;  2X7R B;  5CBG A;  3FAV A;  1PNK A;  3RYI B;  1SZT A;  2OIE A;  4D6T H;  4JI4 B;  1YZB A;  4Z1M G;  1NH2 D;  3ETD A;  1N33 B;  4DR2 B;  1YEW A;  1Z5W A;  2R9A A;  4HNA B;  3AG4 C;  3N2G A;  4LBE C;  5TIS Z;  5CA3 A;  3JAK B;  3SYP A;  4LF7 O;  1S72 V;  1N4C A;  2UXX A;  2UUC B;  2HVK C;  1IBK O;  3AK1 A;  5KAI Z;  2Q7H A;  2GTA A;  1N34 O;  3RYF A;  2VRZ A;  1Q81 W;  4J10 A;  3R66 A;  5JVD A;  3JAR B;  1MSD A;  5L3F A;  1B06 A;  1Y76 B;  3MDS A;  3RVZ A;  1R3K C;  4TV8 A;  3SYQ A;  4YHH O;  5IJ9 B;  4X1K A;  2EX3 A;  3L70 H;  3IC9 A;  5JH7 A;  2QE7 G;  1OCZ B;  2QM4 A;  5IY5 B;  3TGU H;  1NTM H;  3K57 A;  1ORQ C;  2HKO A;  5LP6 C;  4IYI A;  4X64 B;  2Q0O C;  4WCE V;  2Y48 A;  1J5E B;  5KHG A;  1S3J A;  4I50 B;  1XNQ B;  3ZIA G;  2FML A;  5IJ0 A;  1KMI Z;  2P90 A;  1PKX A;  5FL7 G;  4DRX A;  4JI0 O;  3O9O A;  4MVM A;  4QGP A;  1XNR O;  1NTZ H;  3E22 A;  5GTI Z;  3JCU Z;  3UT5 A;  1JQ0 A;  5CB4 B;  1Q43 A;  3K5N A;  3PJS K;  3CEI A;  3AG7 A;  4GT1 A;  5LOV B;  3FYE B;  4J9Z B;  2XHB A;  4O4L B;  2WLI A;  5B1B B;  2FTK A;  1OV9 A;  3ABM B;  5CA1 A;  4IIJ B;  1W59 A;  3JD4 A;  1BL8 A;  1ZSP A;  1NR1 A;  4AQY B;  3DTU B;  1HW7 A;  2P67 A;  2ZNI A;  4FLT A;  1BQZ A;  4P9P A;  2ZCE A;  2K9P A;  1VQ8 V;  1YXB A;  4DV3 O;  5GW7 A;  4FLX A;  2PI5 A;  2QSA A;  1NR7 A;  3AG4 B;  1Q82 W;  3CSX A;  2KQX A;  2QWP B;  4FZ1 A;  3ZHS A;  1K5Q A;  5LHG A;  1WB8 A;  1K92 A;  1NH2 B;  2X6A A;  3KCY A;  1M56 C;  2XAJ A;  3EHB B;  3ZMS A;  2LJ2 A;  1TA8 A;  3CCV V;  3OD4 A;  3A0H Z;  2Q68 A;  1YTF B;  4DV5 O;  4NTX A;  2DN9 A;  3D8C A;  2BE3 A;  1FJG B;  1JFF A;  1XBL A;  4FZ0 A;  2P4V A;  2CE4 A;  1VQ7 V;  2WLK A;  3LDD A;  5KA6 A;  4HYO A;  3RW0 A;  2CGN A;  5D5Q A;  4UCV A;  2GUZ A;  3SYA A;  2N04 A;  3OTF A;  1D5N A;  1E1Q G;  4G2K A;  2P22 C;  5LP6 B;  4CH5 A;  4ZHQ A;  1MG1 A;  4N23 A;  1UFI A;  5CA0 A;  3RBZ A;  4LF8 B;  4JI4 O;  3MD0 A;  1N33 O;  3S3X A;  4DR2 O;  3JAW A;  4X20 B;  4LWS A;  3RN4 A;  3B2E E;  3OUF A;  3D36 C;  2UUC O;  4FJC C;  4PI2 A;  2IJK A;  2Y0I A;  1PNL A;  3AG3 C;  3OEE G;  1M57 C;  1QVG U;  2HR3 A;  3LDE A;  2QKA A;  3PN1 A;  1FKA O;  4YJ3 A;  2QGN A;  5IYZ B;  3TXQ A;  3HR0 A;  4NTY A;  2GTS A;  1AI5 A;  2WLM A;  3G4S V;  1NS1 A;  1X59 A;  2ADQ B;  2YXL A;  3CXC U;  2FB5 A;  3SPI A;  2Z3Y A;  1TVK B;  2ITD C;  4B3T B;  4AIL C;  4LNU A;  3W7U A;  3RVY A;  1SC5 B;  3CCU V;  2Q67 A;  2Z0A A;  5CBH A;  1VAR A;  4X64 O;  2EIN C;  3OGI B;  2IW5 A;  4UCO A;  4FMT A;  3D3Q A;  1RSO B;  1GN6 A;  1GKF A;  2V7Q G;  1XNQ O;  3J80 N;  1I94 B;  1M56 B;  2JVD A;  2F4V B;  3BY6 A;  3GWK C;  1R3J C;  4YIP A;  3EFF K;  4Q20 A;  1QLN A;  5JJN B;  1WB7 A;  4DR5 B;  2QM7 A;  1ZTE A;  2XAQ A;  2DW4 A;  1O9G A;  1PNM A;  4B3M B;  4MW8 A;  3CRM A;  3CC4 V;  2DQ3 A;  2RJZ A;  1P49 A; 
#chains in the Genus database with same CATH homology
 1EZJ A;  3E89 A;  5KUK A;  4UV9 A;  3JD1 A;  4F4L A;  2AHY A;  3G6E V;  2EIM C;  3D36 A;  2WWW A;  4JAS A;  4R8C A;  4BIZ A;  1F51 A;  2IH3 C;  1JCH A;  4JYC A;  5B1A C;  1VQ5 V;  2QEX V;  2EIJ C;  4QIW F;  4QNH B;  1VQK V;  2GHY A;  1THZ A;  4J9Y B;  2F43 G;  3T1C A;  3CMA V;  4QE7 A;  5DN6 G;  1RM1 C;  3TK1 A;  3FB8 C;  5LGU A;  2DYR C;  2XAF A;  3AG3 B;  5L3E A;  1VQO V;  1M57 B;  5H6R A;  3GB7 C;  1B6Q A;  3F5W C;  3D3I A;  3HB3 B;  2WSS G;  4MTF A;  2LP7 A;  4MVS A;  3OMI B;  4WFB V;  2X0L A;  1JOY A;  1M1K W;  1K73 W;  3MHH C;  3W7S A;  5L3B A;  1NBM G;  1GMG A;  1OCC B;  3CYO A;  4R50 A;  1AI6 A;  3E2E A;  1K4D C;  3KG2 A;  2OT5 A;  1IXM A;  2B1I A;  4PDM A;  1AI4 A;  4JTD B;  4JYB A;  2X6B A;  3CCL V;  3LUT B;  4BW5 A;  1M9N A;  3F7V C;  1K97 A;  3LSQ A;  1K5S A;  1F4M A;  1G8M A;  3ZRX A;  1FXH A;  3B8M A;  1K3E A;  1CEZ A;  2CK3 G;  4WF9 V;  3STL C;  3VOU A;  3ASO B;  3OE7 G;  1K34 A;  2EIN B;  4QPK A;  2XOK G;  1DLB A;  2NLJ C;  4P2Z A;  1NVP B;  3A0R A;  2B1G A;  4UVA A;  1MAB G;  3OMN B;  3SYO A;  2KB1 A;  1S77 D;  1K7D A;  2DWE C;  3JYC A;  4OXS A;  2R9R B;  4GX1 A;  2QKS A;  4LCU C;  1KQS U;  1FXV A;  4MT8 A;  3JD3 A;  2H8P C;  2EJR A;  1OHH G;  3QO7 A;  3X2Q B;  3E8B A;  3K0G A;  2ZD9 A;  2ZQM A;  5CN0 A;  2Q69 A;  3ZRW A;  3AG1 B;  3STZ C;  1HWY A;  4WFH A;  1LNQ A;  3SPC A;  3UM7 A;  4GX2 A;  2ZR3 A;  1AJQ A;  4P30 A;  4U7N A;  5LGT A;  3W7T A;  1YHQ V;  3ZRW B;  1PD3 A;  1P4R A;  1BMF G;  3ZJZ A;  4FPP A;  1L1F A;  4WFF A;  2JK5 C;  1ZWI C;  1SES A;  1WLE A;  2XND G;  3K0D A;  4FK5 C;  3IGA C;  4E2L A;  3LNM B;  4MVO A;  2C2A A;  3TET A;  1Y66 A;  4UVB A;  2K1E A;  1OCZ C;  4X8A A;  2EIM B;  5IY5 C;  1CP9 A;  2A9H A;  2BOB C;  1SER A;  1EBO A;  5B1A B;  1I5Y A;  1SET A;  2MK3 A;  1FXK C;  2HJF C;  3E8G A;  2EIJ B;  3BEH A;  4EKW A;  4BIU A;  2ZR2 A;  1QBZ A;  1RM1 B;  1P7B A;  2HLD G;  2DQ0 A;  1MOF A;  4ZBM A;  5B1N A;  5EC1 C;  4FIP C;  3GWO A;  2NNU A;  1H8H G;  2DYR B;  2OCC C;  3E8H A;  1NJI W;  2H94 A;  1F23 A;  3IFX A;  3ZMU A;  1FFT B;  3F7Y C;  4PDR A;  2A0L A;  2LFR A;  4MVU A;  4PA7 A;  4MTO A;  1N8R W;  1R6N A;  2JJ1 G;  4MSW C;  3CC2 V;  4TWK A;  3OAA G;  1ROP A;  5EK0 A;  4TSF G;  1R3I C;  4MVR A;  4ZKI A;  3OFN G;  3R65 A;  5L3D A;  1YJN V;  1E79 G;  2EZO A;  3T4Z A;  3JCZ A;  4XDK A;  1H2G A;  5LHI A;  3I55 V;  4RAI A;  5B1B C;  1EFR G;  5CBF A;  2EZP A;  3QO8 A;  2YEV A;  4DXW A;  5HFM A;  3ABM C;  3CC7 V;  1ENV A;  5IYC O;  2ZDI C;  2JIZ G;  2ATK C;  4MTG A;  2X7R B;  2QTO A;  5CBG A;  4GX0 A;  1PNK A;  1QLE C;  1QCE A;  1XL6 A;  4G27 B;  4MW3 A;  1UJW B;  2XAS A;  1SZT A;  1SRY A;  4R7C A;  2YEV B;  1K8A W;  3ML0 A;  3FKS G;  1NH2 D;  4Z1M G;  3ETD A;  3FB6 C;  4PEL A;  3M99 B;  1AJP A;  1V54 C;  3B8N A;  1GK9 A;  3AG4 C;  4LBE C;  5CA3 A;  1BHB A;  3SYP A;  1S72 V;  4RQF A;  2UXX A;  2V1D A;  2HVK C;  3P30 A;  1H8E G;  2Z5U A;  4RUF A;  2QA4 V;  4UUJ C;  3H01 A;  1Q81 W;  3OW2 U;  1MSW D;  5L3F A;  4WFE A;  3SPJ A;  1W0J G;  1M90 W;  2A79 B;  1OCO B;  4X88 A;  1FS0 G;  3ZN0 A;  1VQ6 V;  3RVZ A;  1V55 C;  1R3K C;  1YJW V;  3SYQ A;  3T2M A;  1AI7 A;  1GO3 F;  2XAG A;  4RO2 A;  3ZMZ A;  2AHZ A;  2IJJ A;  4GX5 A;  4UXN A;  1K33 A;  1GM9 A;  4DO2 A;  1FXK A;  2IJI A;  1E1R G;  2QE7 G;  1OCZ B;  3ABL C;  5DM6 V;  5IY5 B;  3CP1 A;  1OCR C;  1ORQ C;  2DYS C;  4HZ3 A;  2HKO A;  3CCR V;  4WFA V;  1FXK B;  2WLJ A;  2X6C A;  1KP3 A;  5H6Q A;  4WCE V;  1ARO P;  2Y48 A;  4XDJ A;  1S3J A;  3CCM V;  3ABT A;  1W2B U;  1Q7Y W;  5KA5 A;  5BZB A;  2EIL C;  2OCC B;  2JEU A;  3ZIA G;  2OTL V;  3WG7 C;  4JF3 A;  2P90 A;  1PKX A;  5FL7 G;  3G71 V;  4MVM A;  1JQ0 A;  2HVJ C;  2W6I G;  4PA4 A;  3OR7 C;  3ASN C;  1K4C C;  2WLN A;  3ABK C;  3K79 A;  3PJS K;  5LBQ A;  3E35 A;  4GT1 A;  2ZDI A;  3DGE A;  2GSM B;  3FYE B;  4J9Z B;  4N21 A;  3ZCC A;  5B3S C;  3K3W A;  2WLI A;  4PA9 A;  3T4D A;  5B1B B;  4CBC A;  1GM7 A;  2R9I A;  2FTK A;  4GCZ A;  1H38 A;  1NQT A;  3E83 A;  4XDL A;  3ABM B;  1R73 A;  3CCJ V;  4MVQ A;  5EC2 C;  3JD4 A;  1BL8 A;  3SJQ C;  4TT3 G;  1NR1 A;  2BOC C;  2HFE C;  3E8F A;  4JPR A;  2WLI B;  1QLE B;  3I56 V;  3DTU B;  2P67 A;  4R6Z A;  5LHH A;  4P9P A;  4U7O A;  5LGN A;  2OTJ V;  4PDL A;  1AR1 B;  1R3L C;  4QJF B;  4CZZ A;  2HG5 C;  4QPJ A;  3ZMV A;  3ABU A;  1VQ8 V;  1V54 B;  2IU0 A;  2WAM A;  5GW7 A;  1YI2 V;  2PI5 A;  4JAU A;  1NR7 A;  3AG2 C;  3AG4 B;  3E86 A;  1Q82 W;  1S76 D;  3LDC A;  2ITC C;  5IYB O;  5IDJ A;  4BAY A;  2P6J A;  3ETG A;  1K5Q A;  5LHG A;  2D3O W;  3ETE A;  2P7T C;  4MTX A;  1K92 A;  2IJH A;  4G28 B;  5IYD O;  2W6J G;  1NH2 B;  1GM8 A;  3IC7 A;  4MVZ A;  2X6A A;  1BHA A;  3CD6 V;  1M56 C;  2XAJ A;  5EBM C;  3EHB B;  1VQP V;  3ZMS A;  2W0F C;  5EBL C;  3CCV V;  1YIT V;  2Y69 C;  2Q68 A;  1JVM A;  2WPD G;  1YTF B;  5EBW C;  3FB5 C;  3JD2 A;  1KP2 A;  1V55 B;  3K9A A;  3WFV A;  2UXN A;  3QO5 A;  1QR9 A;  4YXW G;  2JDI G;  3QNE A;  5HFL A;  1VQ7 V;  2WLK A;  3LDD A;  5KA6 A;  3CME V;  4HYO A;  2JEX A;  3RW0 A;  3FB7 C;  2ZXW C;  1JPX A;  3ABL B;  4JTA B;  3ZN1 A;  1S0V A;  3SYA A;  1YTF D;  2EIK C;  2DYS B;  1OCR B;  1DTO A;  2JJ2 G;  5B1O A;  4LC1 A;  4UVC A;  1I5X A;  1E1Q G;  4G2K A;  1QR8 A;  3NXS A;  4H37 A;  1MG1 A;  4N23 A;  3W7W A;  3CCS V;  4H33 A;  4KP4 A;  3RBZ A;  1RPO A;  1COW G;  1DF5 A;  1CPY A;  1TUE B;  1K9M W;  3MD0 A;  3CPW U;  2EIL B;  1NKD A;  1KEC A;  3SPH A;  1KD1 W;  2WLH A;  5CMU A;  1JJ2 U;  1VQN V;  1KC8 W;  3WG7 B;  1VQ9 V;  1VQL V;  4WFG A;  1R6K A;  1W0K G;  2LFS A;  3OUF A;  3OM3 B;  4FJC C;  2IJK A;  4PA3 A;  4MS2 A;  4XBF A;  1PNL A;  3ZMT A;  3AG3 C;  3OEE G;  1M57 C;  4RQE A;  1QVG U;  2HR3 A;  3LDE A;  3ZRS A;  3ASN B;  1Y4M A;  3ABK B;  3K08 A;  3ZRV A;  2DWD C;  4I5S A;  3CCQ V;  2B5U A;  4PA6 A;  2M7W A;  5B3S B;  3K06 A;  1JX9 A;  2WLL A;  3OMA B;  4L87 A;  1AI5 A;  1OCC C;  2IH1 C;  4PDV A;  3CCE V;  2YSU B;  2WLM A;  4KUM A;  2QM8 A;  3G4S V;  1XL4 A;  1QVF U;  1S5H C;  4QE9 A;  3CXC U;  4JAV A;  3SYC A;  2WLL B;  3SPI A;  3UKM A;  1YJ9 V;  1NVP D;  1VQ4 V;  2Z3Y A;  2ITD C;  4RUE A;  2Q6A A;  3W7X A;  3MHS C;  5H9C A;  3W7U A;  1OZ0 A;  3P32 A;  3RVY A;  3CCU V;  3B77 A;  2Q67 A;  4LP8 A;  3AG2 B;  5CBH A;  3OGC C;  3ASO C;  4JTC B;  3AEI A;  1OCO C;  2EIN C;  2IW5 A;  5L3C A;  4FMT A;  1J95 A;  3OUS A;  4I9W A;  3FYI B;  3HPL C;  1Q86 W;  1GKF A;  2V7Q G;  4X89 A;  3VBB A;  2IU3 A;  1RPR A;  1YIJ V;  1M56 B;  5E1A C;  3JD0 A;  3OEH G;  1AJN A;  3BY6 A;  3X2Q C;  2XAH A;  1R3J C;  3EFF K;  5L3G A;  3K04 A;  2Y69 B;  3AG1 C;  4Q20 A;  5C93 A;  1QLN A;  2QM7 A;  2PI4 A;  3SPG A;  1DF4 A;  2XAQ A;  1KKD A;  4P9O A;  3TCU A;  2DW4 A;  1WPX A;  2EBO A;  5KUM A;  1PNM A;  4HAM A;  1PL0 A;  1YSC A;  3K03 A;  1F4N A;  4KFM A;  1VQM V;  2ZXW B;  4JGS A;  3OR6 C;  2EIK B;  1G4Y B;  4MW8 A;  3CC4 V;  2DQ3 A;  3LSS A;  4ASU G;  4UV8 A;  1GTO A;  5J9P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...