3K0GA

Crystal structure of cng mimicking nak mutant, nak-etpp, na+ complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 32
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k0gA00
3SYPA 4MVOA 3RVZA 3LDEA 3K06A 1V54C 3K04A 1OCCC 3AG1C 5CBHA 3SPHA 4R8CA 2EIJC 2DWEC 1J95A 2OCCC 4WFGA 4G28B 2QKSA 2NLJC 2JK5C 3FB5C 1M56C 2ZXWC 4BW5A 4UUJC 3STZC 5EC1C 3E8HA 4PA6A 4PA4A 4X89A 4PDMA 2ATKC 3SPGA 4HYOA 1OCZC 2WLNA 2X6BA 3FB8C 2DYSC 3K0DA 4KFMA 1R3JC 3F7YC 4J9YB 5KUKA 3ASNC 3F7VC 2A79B 2P7TC 1LNQA 1K4DC 4MW8A 4P9OA 4I9WA 4PDRA 1ZWIC 3ASOC 3K03A 4TWKA 4R50A 4JTAB 4GX5A 3SPJA 2A0LA 3SPIA 1R3LC 1S5HC 1V55C 1KKDA 4P9PA 2Q6AA 4MVUA 4LBEC 4RO2A 3FB6C 4RUFA 3RW0A 2HVKC 2K1EA 2Y69C 2YEVA 1BL8A 4MTOA 1JVMA 2IH3C 2WLLB 2Q68A 4HZ3A 4MTFA 4WFEA 2Q69A 2ZD9A 5CBFA 3E8BA 3GB7C 3E8GA 3T2MA 4P2ZA 2EIKC 3RBZA 4R7CA 3ZRSA 2IH1C 3UM7A 4MVSA 2WLIB 4PA9A 3E8FA 2WLIA 4QE9A 3K0GA 3LDCA 1QLEC 5EC2C 3OUFA 2ITDC 2KB1A 4PDVA 3E89A 3SJQC 4GX0A 4DXWA 1OCRC 4MVMA 4MVZA 4WFHA 5EBMC 3T4DA 3T4ZA 2WLMA 4RUEA 3WG7C 2HVJC 3ZJZA 4PDLA 3ABLC 3OR7C 3ABKC 4PA7A 5EK0A 4LCUC 4GX2A 3LUTB 3TCUA 4CBCA 4MW3A 3KG2A 2WLLA 3SYAA 3F5WC 4GX1A 4MTGA 5B3SC 4X88A 3FB7C 2HFEC 4PA3A 4RAIA 3LNMB 4EKWA 5BZBA 5J9PC 2EINC 2Q67A 3OGCC 3TETA 3VOUA 5E1AC 2BOBC 4JTCB 4H33A 4P30A 3RVYA 3E83A 4OXSA 3SPCA 2H8PC 5KUMA 3OR6C 4ZBMA 4XDKA 3IFXA 3R65A 3IGAC 3K08A 4MVRA 1M57C 3SYQA 3STLC 2A9HA 3SYOA 5EBWC 1P7BA 3AG4C 1G4YB 4XDLA 2DYRC 2X6AA 3T1CA 3UKMA 3ABMC 4JTDB 2BOCC 2WLHA 4MS2A 4MSWC 4QE7A 5B1AC 1XL6A 2WLJA 2ITCC 1K4CC 4F4LA 1OCOC 1R3KC 3EFFK 5CBGA 4R6ZA 4X8AA 2R9RB 2WLKA 3AG3C 3E86A 2QTOA 4LP8A 5IY5C 1R3IC 3OUSA 3SYCA 3JYCA 4H37A 2HJFC 2W0FC 2AHZA 3BEHA 5B1BC 2EIMC 3PJSK 1XL4A 3LDDA 2EILC 2DWDC 4QNHB 4WFFA 4MVQA 4J9ZB 3X2QC 5EBLC 2HG5C 2AHYA 2X6CA 3HPLC 3AG2C 1ORQC 4XDJA 4G27B
chains in the Genus database with same CATH superfamily
3SYPA 1Q82W 3LDEA 4I4TA 4JYAO 3WU2Z 5IJ9A 4JYBA 1DK1A 2UXNA 3IJ4A 2VQEO 4PA6A 1K33A 4IYIA 4XBFA 2KQXA 4JYAB 4JYCA 3X2QB 4TWKA 3Q4HA 2XAJA 5LMUB 3CCEV 4X64O 3L70H 2RN9A 2VQEB 4UVAA 1H2LA 2YIBA 2KKWA 1IBMB 1HW7A 2WLLB 3LSUA 5CBFA 3K58A 1THZA 4R7CA 1I5XA 5CMUA 1BMFG 1I94O 1XDCA 1W2BU 3W7XA 3T1HO 4O4JB 5ITZA 1LR1A 4QJFB 1PKXA 2HJDA 2QWOB 1I94B 2WLLA 5JJEB 4JI4B 4BIUA 1X4TA 2XAHA 1XOUA 2BTQA 2AXTZ 2JEXA 4CZZA 5BR8O 2P06A 3IGAC 3QF7A 2AZ2A 3DXRA 4QE7A 2HLDG 1R3KC 5JVDA 3JARA 4FFBB 3ZMZA 1XNQO 1S72V 5BR8B 1XQ8A 4ZIBA 1M90W 3ZMSA 2CH7B 3PN1A 3K9AA 3P3PA 4Z1VA 3LSQA 5LOVA 3CSXA 2OIEA 3KCYA 3AG4B 1XNQB 3D36A 2Y48A 1SZXA 3DC6A 1OCOB 3ZIAG 4JZGA 4NVPA 3E8HA 2E5LO 1K34A 1IXBA 3GVMA 2ZR3A 2IM9A 3F7YC 1S76D 3F7VC 2A79B 2UU9B 5LGUA 4CH3A 3R66A 2JGUA 3AG2B 3ZMVA 5CA1B 4YHHO 1Y4MA 5A2QN 3OGIB 5EIBD 1VF6A 3CEIA 2HVKC 1D5NA 4MTOA 2E5LB 4NXMB 1AJPA 4F6EA 4U7NA 2EIKC 3N2KB 3B8MA 4E4EA 4X65O 3NR7A 3JALB 4DV7O 3T4DA 4IHJB 4WFBV 1BS3A 3C90A 5CA1A 2QWQB 1VQMV 4GKKB 4PDLA 2LW7A 4X65B 3FAVA 3ABTA 5AG2A 5J9PC 3E2EA 3N2KA 5IJ0B 3H1JH 3SPCA 4CS2A 3RWRD 3D8CA 2WA4A 1F23A 4TOIA 1PM9A 4TSFG 4L8JA 4WCEV 3H9VA 3N2GB 4IHJA 1AR4A 1SKVA 3RYIB 2F4VO 3CHXA 3G71V 3QO7A 3RFRA 2NNUA 5IJ0A 3D3QA 3FD9A 1YI2V 1PNLA 4MVQA 3CPWU 3P32A 2GSMB 1GN4A 3N2GA 5EIBC 3AG1C 3ZEDA 4JI7O 1JX9A 3IC9A 3W7UA 4UCUA 4X89A 4WFAV 3ASOC 1FFXB 4JI7B 3CX5F 1UFIA 4JZ2A 1BQ0A 3RW0A 4FLXA 4MT8A 4N21A 5JH7A 4DV1B 4HAMA 3GB7C 4X9QA 1D5AA 1S77D 3WB2A 5LYJA 4PA9A 1AI7A 1WA8B 1QLEC 4O4IB 2Z0AA 4O2BA 2ZE8A 3K5OA 1URFA 5K1PA 1RM1C 2Q7HA 3HKEB 4DK0A 1N34O 3CCLV 3OR7C 2YXHA 3ZRWB 2Q0AA 1YZBA 2CTRA 4TT3G 1NR7A 4X88A 1F51A 2EIKB 4TQFA 5E1AC 4H33A 2C2AA 4H13B 1IBLO 2PY5A 3CB2A 2GDSA 3CRQA 3K5MA 4CC5A 3GWOA 1XHXA 1E1QG 4K8ZA 2X6AA 1RSOA 2JIZG 4L87A 5IE9A 4R6ZA 3ZRVA 2WLKA 1R3IC 2ZKOA 1KBHA 1MZFA 4HNAA 3EHBB 1GRJA 1EN4A 2P6JA 2ZE6A 2X6CA 4G27B 1XMQB 1NU1H 2RMKB 1KP3A 1S0VA 4G28B 1ZL8B 2NLJC 5LP6C 4QIWF 2GBOA 2ZXWC 4BW5A 2QM4A 1Q6HA 4UCVA 2EJ7A 4DRXB 4DV0O 1HDJA 1AVMA 3W7TA 1CPYA 3TJTA 1GN2A 1SZTA 1QR8A 4PJ0Z 3J81N 3KZIZ 1CP9A 4LBEC 4PHZA 1SERA 1WLEA 2HHHO 3AG1B 4B3TB 3CRRA 1VQLV 1AI4A 4JI1B 2IBZH 3T2MA 2W0XA 2W6JG 3JASB 2F66C 4DRXA 4GCZA 4PELA 2HHHB 5DEDA 3ASOB 1N32B 1TA8A 3T4ZA 4YJ3A 3WG7C 3ZJZA 1WB7A 2LFSA 4LF4O 1JOYA 1DF4A 5CA3A 1Z2GA 4GX1A 2DOSA 1H2KA 1CEZA 2XUMA 2FYUH 1I5YA 2QJ1A 1QLEB 2UXCO 4LF4B 4TV8B 4UFZA 1RM1B 2PI5A 3ABMC 4B3SO 4YY3O 1KUQA 3K9SA 1N33O 3APOA 2XASA 4JF3A 1XEQA 3CCRV 4IT5A 1SS3A 1I7FA 3QO5A 5FNVB 2YXLA 1GKFA 3B09A 3OEHG 3I55V 2ETNA 2YUAA 1JJOA 4H0LB 4B3SB 4YY3B 2UUAO 2D2CB 1W0KG 4TV8A 3SGIA 1QNMA 1EFRG 5KA5A 1F4MA 1NQTA 2X0LA 2HP8A 2QKCA 3G67A 3TXSA 1B06A 2YC0A 2R70A 4PA4A 4CS3A 1L0NH 4HYOA 2QWNB 3K03A 3UCSC 1IDSA 3ZHTA 4RQFA 5FNVA 4J80A 1HR0O 1XUQA 3QVNA 4NXNB 4Q6GA 1FPOA 2PTMA 3LNNA 5LP6B 2ZXWB 2F1MA 3CC7V 3U11A 3J80N 4C7UA 1LUWA 3OMIB 2JGDB 2JJ2G 2WLIB 1HR0B 4DUZO 2QA4V 2ZE7A 3TGUH 1H8HG 5LHHA 2P5OA 2DN9A 3E89A 4MVMA 4TUYB 1I0HA 1KU9A 1AI6A 2LQTA 3ABLC 3E35A 3ABKC 5FL7G 4DK1A 4I0XA 1SA0A 5IYCO 1WP7A 3JD1A 2Q8VA 1ENVA 1Q3EA 1GTOA 3FB7C 3L72H 1FJGB 2A3QA 3TETA 4DR5O 2JGDA 1G6UA 2IJJA 2Q7EA 1Q5OA 1ZLZA 3R65A 3P30A 2GUZB 2LJ2A 1IXMA 2M7WA 4JGSA 1VQNV 1AILA 3WG7B 1F7YA 3ZBHA 2DE0X 3OAAG 5DECA 2V7QG 1MSDA 2AHZA 4X1IB 3CCUV 1T5EA 1TAEA 5JJNB 4LF6O 5H6RA 1NH2D 1VF6C 2F23A 5CA0A 4DYLA 3ABMB 4LR3A 5IT9N 2KG7A 4LFAO 5IJ9B 1FXVA 4I5SA 2LGQA 3CRAA 4WBNB 1Q43A 1UPGA 1P84F 5EC1C 3H1IH 3AK3A 4YIOA 4NTYA 4B08A 3B4SA 3K0DA 2CGOA 3DC5A 3ZHQA 1VQ5V 3T1YO 3GWKC 1NI8A 1AB3A 2Y0IA 3CXCU 4LWSB 2HKOA 2HR3A 3BABA 5LMUO 1OV9A 2HEPA 4WBNA 4QPKA 4EFBA 1IBMO 3T1YB 3H01A 4MVSA 5LBQA 3K0GA 4D7SA 4K3AA 2ITDC 1DTOA 5ITZB 1OCRC 2M6YA 1AI5A 4DV3B 1K7DA 2VQFO 5KHKA 4RUEA 1NTMH 4PA7A 4LWSA 3E22A 1G8MA 1G1XB 5H5NA 3TK1A 1VF7A 4X1KA 2CTPA 4DR1B 2BTQB 4GKJB 3SDLA 3OR6C 2VQFB 4JI4O 1R1BA 2RQ6A 1KKCA 1P7BA 2XAQA 4DR4O 1NVPD 3DXRB 2BOCC 3ABLB 3ABKB 2ZT9B 4IIJB 3JARB 5JVDB 2F95B 2IU3A 3OUSA 4DR3B 3BEHA 2ZIMA 3OW2U 2DWDC 3H1HH 5LOVB 4DR4B 5IWAB 5JWPA 1VARA 3B2EE 3P3NA 1RPRA 2LO1A 4PI2A 3K04A 4J41A 4JAAA 4HBNA 1PNKA 1Y66A 3FB5C 2JEUA 3ZRXA 4IIJA 4LF9O 4UCOA 5D5PA 1D2DA 3SPGA 1VQ6V 1OCZC 2H3OA 2WLNA 4DV2B 4DV6O 5IYZB 4P9OA 2EX3A 1R6NA 1JPXA 2WA3A 4Q20A 3OTOO 5LXTA 2QSAA 3FB6C 4LF9B 2VWJA 2UU9O 1MZEA 1M9NA 1BGYH 4JAUA 3HKCB 2N05A 2ZR2A 4DV6B 4UV8A 3M99B 5KAIZ 5JQGB 2WWWA 3WFVA 3OTOB 1QVFU 1Q8IA 4NXMO 4JI0O 4NTWA 1Z5VA 5IYZA 2Q73A 4MVZA 4D6TH 1GM7A 3JD2A 1K8AW 5EK0A 3CCVV 4FIPC 2QDOA 4FLTA 3TCUA 2RCVA 3HKCA 4QPJA 3FAVB 2UUCO 4JI0B 4OX9O 4GKKO 4PA3A 1COWG 1S5LZ 2OIGA 3LNMB 3L71H 1IX9A 3B8NA 3OFNG 5CB4B 5EZYB 1NKDA 2V4DA 4JTCB 3VOUA 5JQGA 3CE2A 1YHQV 2RJZA 4AQYO 5HFMA 1ZX3A 1QU7A 1KECA 1OCRB 2QM8A 1B04A 1SQXH 2UUCB 4ZKIA 4MS2A 4OX9B 1NR1A 3EFFK 3WB0A 4UCSA 3HKBB 4LFCB 3RYHA 4AQYB 1PP9H 1J5EO 2BCCH 4B3MO 5CB4A 5EZYA 2CE4A 3FFQA 4DR2B 5GONA 1BSMA 2AHYA 3G6BA 4LF7B 1NH2B 2B1GA 1IVSA 2DWEC 1FAFA 1J5EB 4FLVA 1XMOB 1N36O 4B3MB 2FL4A 3HKBA 4KFMA 1SQFA 2IW5A 3A8TA 1GAXA 3AK2A 1R3JC 4J9YB 1QHTA 4MW8A 1L1FA 4I9WA 1K73W 3EVKA 4X62O 4O4HA 3SPJA 1VQ4V 3DSQA 4LNUB 1N36B 2WAMA 4G2KA 4RUFA 3CMEV 1YXBA 5JH7B 4X1YA 1BL8A 2B5UA 1JVMA 3O65A 3K5LA 2GV9A 1SQBH 2Q69A 3MAQA 4UVCA 4EB6B 2IJHA 4DV1O 4X62B 5LYJB 1OCZB 4PD4F 3AG2C 2JVDA 1VEWA 3AEIA 4ZOLB 3JD0A 4O2BB 2KB1A 1MMMA 4WFHA 4FZ1A 4GZRB 2BSKA 1JFFA 4LNUA 4CH6A 4ABMA 5KHIA 1XBLA 1L8DA 4TV9B 1YF2A 3F5WC 1Y67A 2PUSA 4LF5O 1HP8A 3C3SA 3MHHC 4UVBA 4EB6A 2OCHA 2GTSA 4FM1A 2R9IA 3TXQA 4RWUA 2YSUB 5KHGA 4ZOLA 5BY1A 1RPOA 2A9HA 1GH6A 4FVMA 5GW7A 4F6RA 4XDLA 1RSOB 1UJWB 2BE3A 1NVPB 2WLJA 4JI8O 2ITCC 4LF5B 4FLWA 1SETA 4TV9A 4JAVA 2Y0PA 4K0KB 3RYFA 3D3IA 2EILC 4HNAB 4B3RO 4QNHB 2IJIA 2HG5C 4JI8B 3RYCA 2P22C 2ADPA 2QKSA 4LF8O 4TQDA 4JI5B 1XMQO 2P67A 5FPOA 4B3RB 3BA8A 1JMKC 2VS0A 1VQPV 2CAZC 4JTAB 3VQXA 4X66B 2A06H 1QCEA 4LF8B 2YIAA 3K57A 4B7KA 1XHZA 3OE7G 2PYJA 4EFEA 4N23A 4NTXA 5L3FA 5JJJB 3IAYA 3A0HZ 2P90A 2Y69C 3RT3C 1VQOV 1TGOA 2YICA 3UO2A 2F43G 4HZ3A 1HNXB 3E8GA 1IURA 4P2ZA 4B3TO 4BWAA 2D3OW 5C8YB 3KCXA 4JI1O 3W7WA 5CN0A 1MG1A 4YJ3B 1Z5WA 4UXNA 1K3EA 5KA6A 4LCUC 1N32O 1YEWA 5B3SC 5BZBA 4CC6A 4NB5A 5C8YA 3JCUZ 2H8PC 1VIBA 3K08A 3K59A 1YCIA 2ZIOA 2ZINA 4DW0A 5CBGA 2RDCA 1WPXA 3L9DA 1M4UA 1CXZB 2EIMC 1P4RA 2P4KA 2FB5A 4FLYA 3AG7A 4O4LA 5EYPA 4OPHA 1M93A 2Q7GA 4XDJA 1SESA 2DJVA 1Q81W 3K06A 2YEVB 2OCCC 4QGPA 2OWOA 4FM0A 1NJIW 3K3WA 4DO2A 2XNDG 3A0BZ 2X6BA 2EILB 5L3GA 4RQEA 1JA8A 4DR7B 5KUKA 3ASNC 2DQ0A 2P7TC 5LGTA 2E76B 4GX5A 2DW4A 1MOFA 3QG5A 4DUYO 4MVUA 2Q9LA 3ZN1A 2YS8A 1XREA 1K97A 4ZI7B 1K5SA 2YEVA 2YIDA 2QE7G 4MTFA 4NXNO 5LL6Y 1BHBA 3M8AA 2G38A 1WN7A 1YSCA 3F5TA 5J2UB 3CCJV 3ZMTA 4H44B 4DUYB 1XILA 5EC2C 1QLNA 2UXBB 1PPJH 3OUFA 1RP3B 2FMLA 4YIPA 1WNSA 1US6A 3U0ZA 3ICXA 3JD4A 2Y69B 1SA0B 4I0XB 4ZI7A 5B5EZ 4I55A 1PV0A 4CBCA 5LHGA 1KD1W 4W4LA 3SYAA 5L3DA 4LH6A 2F93B 4DV4B 1AR5A 4P30A 3SJBC 4FFKA 2WPDG 5J2UA 1TVKA 2MK3A 1FJGO 1YIJV 3G4SV 1VQKV 2WLHA 4FK5C 1SRYA 3JAMN 4X8AA 3AG3C 4DV5B 4K8XA 5L3CA 5IYDO 5B3SB 2N04A 2W0FC 3JATB 5E79Z 1WAZA 4WFFA 3A2FA 4OGQB 3ZCCA 4JV5B 5BMVA 3HPLC 3SPIA 3SR2C 5DN6G 2JS3A 1HNZB 1H2NA 5CA0B 1P7GA 5H2FZ 1IBKB 2EIJC 2KG7B 1EZVH 2JK5C 3BAAA 1M5IA 3OEEG 1AROP 4EEQA 3H1LH 1BCCH 3ABUA 2DYSC 2EIMB 3JATA 1V9PA 4ZHQB 1NTKH 1BZKA 3HR0A 1K4DC 4A5UB 4PDRA 1V55C 1KKDA 1WPBA 1NBMG 4J10A 2Q5ZA 1WB8A 2OCCB 3VQVA 2IH3C 4FJCC 1BHAA 4ICGA 2ZD9A 2ARHA 4I50B 1NS1A 5LA6B 2A7WA 4KL1A 3RBZA 3ZRSA 3VBBA 2IH1C 5JCOC 1Y6XA 4UCRA 1PD3A 4WF9V 3G80A 2OYQA 5J2TB 3ASNB 4ZHQA 3VQWA 3CC4V 1NZ6A 1N0JA 1BE3H 4DR6O 2VRZA 2BTOA 2WLMA 2Y4UA 4J7JA 4YJ2A 1GMGA 2H94A 3E22B 2JJ1G 4DV3O 3KG2A 4BAYA 3THOA 4I50A 1VP7A 4RAIA 4X1KB 5LA6A 2EINC 4FLUA 1BT8A 3OGCC 2ZM6B 1FYJA 1TUEB 4GYCB 4DR6B 1XI1A 2ZDIC 4BW9A 5J2TA 2FKXA 3CXHF 2QGNA 1FFTB 1M57C 4DR1O 2DMXA 4GKJO 2ZE5A 3S3WA 1EN6A 1Q90D 2QWRB 4K35A 1K4CC 4O2AB 1MSWD 5IY5C 3SYCA 1Y76A 5LMNO 5B1BC 1QR9A 2L6LA 3ZN0A 4U3JA 1JR9A 4NR1A 3UT5A 1KB9F 1LUVA 4DR3O 3SJAC 3L74H 5L3BA 4MVOA 1VQ8V 5IWAO 5LMNB 1M56C 4O2AA 5B66Z 3AG3B 3FKSG 1N0NA 3FB8C 3SJCC 4JI6O 2XTAA 2Y4TA 2LFRA 4X64B 1VQ7V 1FXKC 4UB8Z 2R72A 1F4NA 5LXTB 2PZSA 4DV2O 2QM7A 4IYHA 1B3QA 3J7AU 2B9ZA 2EIJB 2XT9A 2UUBO 4JI6B 3ZX6A 1H2SB 2IJKA 3T1HB 5GTIZ 4FLZA 2DYSB 2EBOA 3CRCA 3BFRA 2EZOA 4O4JA 4BIOA 2UUBB 3JCZA 1V55B 1YDXA 3ZS8C 2HVJC 3BCCH 1QVGU 4LH7A 2XAGA 4J7KA 3MD0A 4EKWA 4B7EA 3BPZA 5K1XA 4JASA 4IL6Z 2VWKA 3SYOA 2E74B 2NN4A 3CCMV 1QBZA 1DF5A 4FFBA 4LP8A 3E86A 3RYHB 1XL4A 2EINB 2W6IG 3JSLA 3UO3A 2CH7A 5JCOA 1IZ3A 3B77A 1GM9A 4LFCO 1OHHG 2QEXV 4FZ0A 5GONB 5EBLC 4U3FH 1AJNA 3BA9A 1M57B 4GT1A 3RVZA 1GK9A 3L75H 1W0JG 1YITV 2XAFA 1KP2A 4DR2O 2JDIG 1R73A 5LGNA 3OMAB 4U7OA 2AZ0A 4LF7O 5IY5B 2CUGA 3CJHB 3EXAA 2QTSA 4YXWG 5B1BB 4YHHB 1XMOO 2AW9A 2EZPA 3ZMUA 3DGEA 2QWPB 2ZNJA 4O4HB 1ZWIC 1PNMA 2ZDIA 3L73H 4GLXA 4P9PA 3B40A 1K92A 1NT2B 4RO2A 1DLBA 4X1YB 1SQGA 1R6TA 1JCHA 3LSSA 2Q68A 4JI3O 3JAWB 1M56B 3E8BA 1W59A 1HNWO 5L3EA 2E3CA 3CJHA 3RGBA 4DV7B 3BRCA 1VQ9V 1FXKB 2YI8A 3JALA 1K9MW 5EBMC 2BSKB 1JFFB 2O57A 4JI3B 1EBOA 2OT5A 4LFBO 4UB6Z 1HNWB 1AP5A 2Z3YA 1SQVH 4MW3A 1Q86W 5IYBO 3JAWA 1FS0G 2PGGA 3OM3B 1PL4A 3CWBH 4KP4A 5KLVH 1U96A 1H2MA 2LP7A 3I5DA 1O9GA 4LFBB 2F4VB 1FXKA 5FPRA 1KQSU 4F6RB 4X20B 3H1KH 3M7MX 5D5QA 3RYIA 5B1AC 3A0RA 2EJRA 3OMNB 3KKYA 1EM1A 1YJWV 1KYOF 3ETEA 4I7ZB 3RYFB 4GUNA 4H37A 3OD4A 3PJSK 3HB3B 4ASUG 1R6KA 4K0KO 5LHIA 3AK1A 1YJNV 1ORQC 1OZ0A 3RYCB 3CCSV 1V54C 4X20A 3RN4A 3SPHA 3W7SA 1J95A 1SQQH 3NXSA 3G6EV 5DM6V 4FMTA 1VF5B 4JYYA 2X7RB 4JI2O 3ZHVA 1SF9A 4MTXA 5IDJA 4JI5O 2R9AA 1FFXA 2A0LA 1WJZA 1R3LC 1ZTEA 3CYOA 2CTWA 2CTQA 2ILMA 5KAFZ 2EULA 3ZHRA 4JI2B 2K1EA 3MDSA 4LC1A 4X66O 3ETQA 2ADQB 1WP8A 5H9CA 2AGAA 2LGWA 1MA1A 1HWYA 3JSNA 3UQ8A 3BVOA 1HNXO 3LDCA 1N34B 1WA8A 4O4IA 5KHJA 4GX0A 5BXZA 1I08A 3HKEA 1E1RG 4E2LA 3ZRWA 5B1NA 3BHPA 2QR4A 2ODMA 3U10A 1SQPH 1IBLB 2XHBA 4J42A 2XOKG 3CD6V 1Y74B 4CH5A 2GHYA 2BOBC 2JS5A 3RVYA 3E83A 3CS5A 3C3TA 4MVRA 1GM8A 3STLC 1P49A 1G4YB 2DYRC 4MSWC 1Q7YW 2R9RB 1N8RW 1YTFD 2QTOA 1PL0A 2PYLA 1H8EG 3CC2V 3JYCA 1AP6A 2CGNA 1BQZA 3LDDA 4AHCA 1SC5B 3OT7A 1Y74A 4FM2A 4O4LB 4CS4A 5EYPB 4PV1B 4W4KA 4NYKA 3HKDB 4BIZA 1AR1B 4J11A 1QQCA 2YIBD 1OCCC 5CBHA 4R8CA 1Q6UA 3JAKB 5B1AB 1ZL8A 4KUMA 3CRMA 4DV0B 4UUJC 3STZC 4PDMA 1TUBB 4UCTA 1FXHA 2RNBA 1OJHA 2LW1A 5HFLA 5TISZ 2NR5A 2QKAA 3HKDA 4DR7O 3QO8A 1V54B 1KMIZ 3N27A 2OTLV 1ZSPA 1FD9A 1JQ0A 3JAKA 4JPRA 2GTAA 4AI8A 5FLXN 1JJ2U 1ROPA 4Z1MG 3JASA 5KX5B 1TUBA 1O9HA 3E8FA 1S5JA 4Z2WA 1ZAUA 1GN3A 4I9QA 3S3XA 4PDVA 2Q4PA 3SJQC 1K5QA 2DQ3A 2UXBO 1H2GA 3QNEA 4I55B 4GX2A 5A9GA 1VMGA 2IU0A 2HFEC 4CH4A 2UXCB 1M1KW 2K9PA 1NTZH 2UXXA 4OXSA 5KUMA 5KX5A 4ZBMA 1TVKB 3K5NA 4XDKA 3IFXA 2OTJV 3DTUB 3ML0A 2YXYA 1Q6IA 2MW2B 4DV4O 5EBWC 3I56V 1N33B 3T1CA 3UKMA 2P4VA 3K79A 1XL6A 4F4LA 2Q0OC 3CCQV 2PI4A 3FYIB 2WSSG 2UUAB 4DV5O 2Z5UA 4J9ZB 1MABG 3X2QC 5BMVB 3IC7A 1H38A 2FTKA 3O9OA 1S3JA 3ZHUA 3FYEB 1KC8W 1ZUQA 2DYRB 3OTFA 4JV5O 4WFGA 2JRIA 1E79G 1HNZO 2ZCEA 4NKGB 3CMAV 3FX7A 2PF4E 1IBKO 2ATKC 1A32A 1L0LH 4FPPA 2UXDO 2CDYA 1EN5A 2V1DA 2CK3G 1LNQA 4BR6A 4R50A 4D7TA 1S5HC 5B1OA 5KMGB 3ETGA 2Q6AA 1YVWA 1OCCB 2ZNIA 1X59A 1GN6A 4WFEA 5LP6A 4DUZB 2ZQMA 2UXDB 2YI9A 3WB1A 2N74A 3UM7A 4UV9A 4AILC 2WLIA 4QE9A 1XNRO 3VQYA 3ZHSA 1MNGA 1U97A 4DW1A 4DXWA 3CP1A 5F2VO 4KXRA 5KMGA 3D36C 4TUYA 5C93A 4YJ2B 3QTCA 4IGGA 4OPAA 2B1IA 3LUTB 4DR5B 2YDEA 1EZJA 3JD3A 5H6QA 4MTGA 5KHHA 1XNRB 1GO3F 1AJQA 2Q67A 5GTHZ 1N4CA 1DGSA 1YJ9V 3MHSC 2L35A 1RFYA 2GUZA 3SYQA 4I4TB 2ZM6O 4KHPO 3AG4C 4JTDB 1OCOC 2E75B 4LF6B 1YTFB 1Y76B 2HJFC 4X1IA 4U3JB 4PI0A 3UT5B 1FKAO 4KHPB 3BY6A 3Q4HB 4J7ZA 3ETDA 2KSDA 3APQA 4LFAB 1B6QA
chains in the Genus database with same CATH topology
1M57B 3SYPA 1Q82W 4GT1A 3RVZA 1GK9A 3LDEA 1W0JG 1W0KG 1YITV 1EFRG 2XAFA 5KA5A 1KP2A 1F4MA 1NQTA 2JDIG 1R73A 2QKSA 2X0LA 3OMAB 5LGNA 4JYBA 4U7OA 2P67A 2UXNA 5IY5B 4PA6A 4PA4A 1K33A 4HYOA 4YXWG 1VQPV 5B1BB 4XBFA 2EZPA 3ZMUA 3DGEA 4JYCA 3X2QB 1ZWIC 3K03A 4TWKA 1PNMA 4JTAB 2ZDIA 4RQFA 2XAJA 3CCEV 1QCEA 4P9PA 1K92A 3OE7G 4RO2A 4N23A 5L3FA 1DLBA 4UVAA 2P90A 2Y69C 1VQOV 1JCHA 2WLLB 2F43G 2Q68A 3LSSA 4HZ3A 5CBFA 1M56B 2ZXWB 3E8BA 3E8GA 3CC7V 1THZA 4P2ZA 4R7CA 2D3OW 3OMIB 5L3EA 1I5XA 5CMUA 1BMFG 3W7WA 2JJ2G 2WLIB 5CN0A 1W2BU 2QA4V 3W7XA 1VQ9V 1FXKB 1H8HG 5LHHA 1K9MW 3E89A 4MVMA 5EBMC 1MG1A 1EBOA 2OT5A 4QJFB 1PKXA 4UXNA 1AI6A 1K3EA 3ABLC 3E35A 5KA6A 3ABKC 5FL7G 4LCUC 5IYCO 2Z3YA 3JD1A 4MW3A 1Q86W 5IYBO 2WLLA 1ENVA 5B3SC 1GTOA 1FS0G 3OM3B 2XAHA 3FB7C 4BIUA 5BZBA 4KP4A 3TETA 2H8PC 2IJJA 2LP7A 2JEXA 4CZZA 3R65A 3P30A 3IGAC 1FXKA 3K08A 1IXMA 2M7WA 1KQSU 4JGSA 1VQNV 3WG7B 4QE7A 5B1AC 3A0RA 2EJRA 2HLDG 3OMNB 1R3KC 5CBGA 3OAAG 1YJWV 1WPXA 3ETEA 2V7QG 3ZMZA 4H37A 1S72V 2AHZA 2EIMC 1P4RA 3PJSK 1M90W 3ZMSA 3CCUV 3HB3B 3K9AA 4ASUG 1R6KA 3LSQA 5LHIA 1YJNV 1ORQC 4XDJA 1OZ0A 1SESA 5H6RA 3CCSV 1NH2D 1Q81W 3K06A 1V54C 2YEVB 3AG4B 3SPHA 3W7SA 2OCCC 3ABMB 1J95A 3D36A 2Y48A 1FXVA 3NXSA 3G6EV 4I5SA 1OCOB 5DM6V 4FMTA 1NJIW 3K3WA 3ZIAG 5EC1C 4DO2A 2X7RB 3E8HA 2XNDG 2X6BA 3K0DA 4MTXA 5IDJA 1K34A 2EILB 2ZR3A 3F7YC 5L3GA 4RQEA 1S76D 5KUKA 3ASNC 3F7VC 2DQ0A 2A79B 2P7TC 1VQ5V 5LGTA 5LGUA 4GX5A 2DW4A 2A0LA 1MOFA 3ZMVA 3AG2B 1R3LC 1Y4MA 3CYOA 4MVUA 3ZN1A 3CXCU 1K97A 2HVKC 1K5SA 2HKOA 2HR3A 2K1EA 2YEVA 4MTOA 4LC1A 2QE7G 4MTFA 1BHBA 5H9CA 1AJPA 4U7NA 2EIKC 3B8MA 1HWYA 4QPKA 3H01A 4MVSA 1YSCA 5LBQA 3CCJV 3K0GA 3ZMTA 3LDCA 5EC2C 1QLNA 3OUFA 2ITDC 1DTOA 4GX0A 1OCRC 3T4DA 1AI5A 4WFBV 1K7DA 1VQMV 4RUEA 1E1RG 4PDLA 4E2LA 4PA7A 3JD4A 2Y69B 3ZRWA 5B1NA 1G8MA 4CBCA 5LHGA 1KD1W 3SYAA 5L3DA 3ABTA 2XOKG 3CD6V 3TK1A 5J9PC 3E2EA 2GHYA 2BOBC 4P30A 3RVYA 3E83A 3SPCA 3OR6C 2WPDG 1F23A 2MK3A 4TSFG 4MVRA 1GM8A 4WCEV 1YIJV 3STLC 3G4SV 1P7BA 2XAQA 1G4YB 2DYRC 1VQKV 1NVPD 2BOCC 2WLHA 3ABLB 4MSWC 1Q7YW 3ABKB 4FK5C 1SRYA 3G71V 4X8AA 2R9RB 1N8RW 1YTFD 3AG3C 3QO7A 2QTOA 1PL0A 5L3CA 1H8EG 2IU3A 3OUSA 3JYCA 5IYDO 5B3SB 3CC2V 3BEHA 2W0FC 3LDDA 3OW2U 2NNUA 2DWDC 1YI2V 4WFFA 1PNLA 4MVQA 3CPWU 3ZCCA 3P32A 3HPLC 3SPIA 4BIZA 1AR1B 5DN6G 1RPRA 2GSMB 3K04A 1OCCC 3AG1C 5CBHA 4R8CA 2EIJC 1PNKA 1Y66A 5B1AB 4KUMA 2JK5C 3FB5C 2JEUA 1JX9A 4UUJC 3ZRXA 3STZC 3W7UA 3OEEG 1AROP 4X89A 4PDMA 3SPGA 1VQ6V 1OCZC 2WLNA 3ABUA 2DYSC 2EIMB 4WFAV 1K4DC 4P9OA 1FXHA 4PDRA 3ASOC 4Q20A 1R6NA 1JPXA 5HFLA 1V55C 1KKDA 3FB6C 3RW0A 3QO8A 4MT8A 1V54B 4N21A 2OTLV 1NBMG 1M9NA 2OCCB 4JAUA 2IH3C 1JQ0A 4FJCC 1BHAA 4HAMA 4JPRA 2ZD9A 3GB7C 2ZR2A 3RBZA 4UV8A 1JJ2U 3M99B 1ROPA 3ZRSA 3VBBA 2IH1C 4Z1MG 1S77D 2WWWA 3WFVA 1QVFU 4PA9A 1PD3A 3E8FA 4WF9V 1AI7A 3ASNB 1QLEC 3CC4V 4PDVA 3SJQC 4MVZA 1K5QA 1RM1C 1GM7A 3JD2A 2DQ3A 2WLMA 3CCLV 1K8AW 3OR7C 5EK0A 1GMGA 3CCVV 2H94A 3ZRWB 1H2GA 2JJ1G 3QNEA 4FIPC 4GX2A 3TCUA 3KG2A 4BAYA 4TT3G 4QPJA 1NR7A 4X88A 1F51A 1COWG 2HFEC 4PA3A 2EIKB 3LNMB 4RAIA 2IU0A 2EINC 3B8NA 1M1KW 3OFNG 3OGCC 1NKDA 5E1AC 4JTCB 2UXXA 4H33A 3VOUA 2C2AA 4OXSA 1TUEB 5KUMA 4ZBMA 1YHQV 4XDKA 2ZDIC 3IFXA 2OTJV 3DTUB 3ML0A 5HFMA 1M57C 1FFTB 3GWOA 1KECA 1OCRB 5EBWC 1E1QG 3I56V 2QM8A 3T1CA 2X6AA 3UKMA 4ZKIA 2JIZG 4L87A 3K79A 4MS2A 1NR1A 1XL6A 4F4LA 1K4CC 3EFFK 4R6ZA 3ZRVA 1MSWD 3CCQV 2WLKA 5IY5C 2PI4A 1R3IC 3SYCA 3FYIB 5B1BC 1QR9A 3ZN0A 3EHBB 2WSSG 2Z5UA 4J9ZB 1MABG 3X2QC 2P6JA 3IC7A 1H38A 2AHYA 2FTKA 2X6CA 4G27B 5L3BA 1S3JA 4MVOA 1VQ8V 1NH2B 3FYEB 1KC8W 2B1GA 1KP3A 2DYRB 4WFGA 2DWEC 1S0VA 4G28B 2NLJC 4QIWF 1E79G 1M56C 2ZXWC 4BW5A 3CMAV 3AG3B 3FKSG 2ATKC 3FB8C 4KFMA 2IW5A 4FPPA 1R3JC 2LFRA 4J9YB 3W7TA 1CPYA 1VQ7V 1FXKC 2V1DA 2CK3G 1LNQA 1SZTA 4MW8A 1L1FA 4I9WA 1K73W 1QR8A 1F4NA 4R50A 3SPJA 1VQ4V 1S5HC 5B1OA 2QM7A 3ETGA 2Q6AA 1CP9A 2WAMA 4G2KA 4LBEC 4RUFA 3CMEV 1SERA 1WLEA 1OCCB 3AG1B 1VQLV 1BL8A 1AI4A 1JVMA 2B5UA 2EIJB 4WFEA 2Q69A 2ZQMA 3T2MA 4UVCA 2IJKA 2W6JG 2IJHA 3UM7A 1OCZB 2DYSB 4UV9A 2WLIA 4QE9A 4GCZA 3AEIA 2EBOA 3JD0A 4PELA 2EZOA 2KB1A 3ASOB 4DXWA 4WFHA 3CP1A 3JCZA 3T4ZA 1V55B 3WG7C 3ZJZA 2HVJC 5C93A 2LFSA 2B1IA 1QVGU 1JOYA 1DF4A 3LUTB 5CA3A 2XAGA 1EZJA 3JD3A 3F5WC 3MD0A 5H6QA 4GX1A 4MTGA 4EKWA 1GO3F 1AJQA 4UVBA 3MHHC 2Q67A 1CEZA 2R9IA 4JASA 1YJ9V 3MHSC 1I5YA 2YSUB 1QLEB 3SYQA 1RPOA 2A9HA 3SYOA 5GW7A 1RM1B 3AG4C 4XDLA 1UJWB 2PI5A 3ABMC 4JTDB 3CCMV 1NVPB 2WLJA 2ITCC 1OCOC 1QBZA 1DF5A 1SETA 4LP8A 3E86A 4JAVA 1YTFB 2XASA 4JF3A 2HJFC 3CCRV 3D3IA 1XL4A 2EINB 2EILC 2W6IG 3QO5A 4QNHB 3B77A 1GM9A 2IJIA 1OHHG 2QEXV 3BY6A 5EBLC 3ETDA 2HG5C 1GKFA 3AG2C 3OEHG 1AJNA 3I55V 1B6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYP A;  4MVO A;  3RVZ A;  3LDE A;  3K06 A;  1V54 C;  3K04 A;  1OCC C;  3AG1 C;  5CBH A;  3SPH A;  4R8C A;  2EIJ C;  2DWE C;  1J95 A;  2OCC C;  4WFG A;  4G28 B;  2QKS A;  2NLJ C;  2JK5 C;  3FB5 C;  1M56 C;  2ZXW C;  4BW5 A;  4UUJ C;  3STZ C;  5EC1 C;  3E8H A;  4PA6 A;  4PA4 A;  4X89 A;  4PDM A;  2ATK C;  3SPG A;  4HYO A;  1OCZ C;  2WLN A;  2X6B A;  3FB8 C;  2DYS C;  3K0D A;  4KFM A;  1R3J C;  3F7Y C;  4J9Y B;  5KUK A;  3ASN C;  3F7V C;  2A79 B;  2P7T C;  1LNQ A;  1K4D C;  4MW8 A;  4P9O A;  4I9W A;  4PDR A;  1ZWI C;  3ASO C;  3K03 A;  4TWK A;  4R50 A;  4JTA B;  4GX5 A;  3SPJ A;  2A0L A;  3SPI A;  1R3L C;  1S5H C;  1V55 C;  1KKD A;  4P9P A;  2Q6A A;  4MVU A;  4LBE C;  4RO2 A;  3FB6 C;  4RUF A;  3RW0 A;  2HVK C;  2K1E A;  2Y69 C;  2YEV A;  1BL8 A;  4MTO A;  1JVM A;  2IH3 C;  2WLL B;  2Q68 A;  4HZ3 A;  4MTF A;  4WFE A;  2Q69 A;  2ZD9 A;  5CBF A;  3E8B A;  3GB7 C;  3E8G A;  3T2M A;  4P2Z A;  2EIK C;  3RBZ A;  4R7C A;  3ZRS A;  2IH1 C;  3UM7 A;  4MVS A;  2WLI B;  4PA9 A;  3E8F A;  2WLI A;  4QE9 A;  3K0G A;  3LDC A;  1QLE C;  5EC2 C;  3OUF A;  2ITD C;  2KB1 A;  4PDV A;  3E89 A;  3SJQ C;  4GX0 A;  4DXW A;  1OCR C;  4MVM A;  4MVZ A;  4WFH A;  5EBM C;  3T4D A;  3T4Z A;  2WLM A;  4RUE A;  3WG7 C;  2HVJ C;  3ZJZ A;  4PDL A;  3ABL C;  3OR7 C;  3ABK C;  4PA7 A;  5EK0 A;  4LCU C;  4GX2 A;  3LUT B;  3TCU A;  4CBC A;  4MW3 A;  3KG2 A;  2WLL A;  3SYA A;  3F5W C;  4GX1 A;  4MTG A;  5B3S C;  4X88 A;  3FB7 C;  2HFE C;  4PA3 A;  4RAI A;  3LNM B;  4EKW A;  5BZB A;  5J9P C;  2EIN C;  2Q67 A;  3OGC C;  3TET A;  3VOU A;  5E1A C;  2BOB C;  4JTC B;  4H33 A;  4P30 A;  3RVY A;  3E83 A;  4OXS A;  3SPC A;  2H8P C;  5KUM A;  3OR6 C;  4ZBM A;  4XDK A;  3IFX A;  3R65 A;  3IGA C;  3K08 A;  4MVR A;  1M57 C;  3SYQ A;  3STL C;  2A9H A;  3SYO A;  5EBW C;  1P7B A;  3AG4 C;  1G4Y B;  4XDL A;  2DYR C;  2X6A A;  3T1C A;  3UKM A;  3ABM C;  4JTD B;  2BOC C;  2WLH A;  4MS2 A;  4MSW C;  4QE7 A;  5B1A C;  1XL6 A;  2WLJ A;  2ITC C;  1K4C C;  4F4L A;  1OCO C;  1R3K C;  3EFF K;  5CBG A;  4R6Z A;  4X8A A;  2R9R B;  2WLK A;  3AG3 C;  3E86 A;  2QTO A;  4LP8 A;  5IY5 C;  1R3I C;  3OUS A;  3SYC A;  3JYC A;  4H37 A;  2HJF C;  2W0F C;  2AHZ A;  3BEH A;  5B1B C;  2EIM C;  3PJS K;  1XL4 A;  3LDD A;  2EIL C;  2DWD C;  4QNH B;  4WFF A;  4MVQ A;  4J9Z B;  3X2Q C;  5EBL C;  2HG5 C;  2AHY A;  2X6C A;  3HPL C;  3AG2 C;  1ORQ C;  4XDJ A;  4G27 B; 
#chains in the Genus database with same CATH topology
 3SYP A;  1Q82 W;  3LDE A;  4I4T A;  4JYA O;  3WU2 Z;  5IJ9 A;  4JYB A;  1DK1 A;  2UXN A;  3IJ4 A;  2VQE O;  4PA6 A;  1K33 A;  4IYI A;  4XBF A;  2KQX A;  4JYA B;  4JYC A;  3X2Q B;  4TWK A;  3Q4H A;  2XAJ A;  5LMU B;  3CCE V;  4X64 O;  3L70 H;  2RN9 A;  2VQE B;  4UVA A;  1H2L A;  2YIB A;  2KKW A;  1IBM B;  1HW7 A;  2WLL B;  3LSU A;  5CBF A;  3K58 A;  1THZ A;  4R7C A;  1I5X A;  5CMU A;  1BMF G;  1I94 O;  1XDC A;  1W2B U;  3W7X A;  3T1H O;  4O4J B;  5ITZ A;  1LR1 A;  4QJF B;  1PKX A;  2HJD A;  2QWO B;  1I94 B;  2WLL A;  5JJE B;  4JI4 B;  4BIU A;  1X4T A;  2XAH A;  1XOU A;  2BTQ A;  2AXT Z;  2JEX A;  4CZZ A;  5BR8 O;  2P06 A;  3IGA C;  3QF7 A;  2AZ2 A;  3DXR A;  4QE7 A;  2HLD G;  1R3K C;  5JVD A;  3JAR A;  4FFB B;  3ZMZ A;  1XNQ O;  1S72 V;  5BR8 B;  1XQ8 A;  4ZIB A;  1M90 W;  3ZMS A;  2CH7 B;  3PN1 A;  3K9A A;  3P3P A;  4Z1V A;  3LSQ A;  5LOV A;  3CSX A;  2OIE A;  3KCY A;  3AG4 B;  1XNQ B;  3D36 A;  2Y48 A;  1SZX A;  3DC6 A;  1OCO B;  3ZIA G;  4JZG A;  4NVP A;  3E8H A;  2E5L O;  1K34 A;  1IXB A;  3GVM A;  2ZR3 A;  2IM9 A;  3F7Y C;  1S76 D;  3F7V C;  2A79 B;  2UU9 B;  5LGU A;  4CH3 A;  3R66 A;  2JGU A;  3AG2 B;  3ZMV A;  5CA1 B;  4YHH O;  1Y4M A;  5A2Q N;  3OGI B;  5EIB D;  1VF6 A;  3CEI A;  2HVK C;  1D5N A;  4MTO A;  2E5L B;  4NXM B;  1AJP A;  4F6E A;  4U7N A;  2EIK C;  3N2K B;  3B8M A;  4E4E A;  4X65 O;  3NR7 A;  3JAL B;  4DV7 O;  3T4D A;  4IHJ B;  4WFB V;  1BS3 A;  3C90 A;  5CA1 A;  2QWQ B;  1VQM V;  4GKK B;  4PDL A;  2LW7 A;  4X65 B;  3FAV A;  3ABT A;  5AG2 A;  5J9P C;  3E2E A;  3N2K A;  5IJ0 B;  3H1J H;  3SPC A;  4CS2 A;  3RWR D;  3D8C A;  2WA4 A;  1F23 A;  4TOI A;  1PM9 A;  4TSF G;  4L8J A;  4WCE V;  3H9V A;  3N2G B;  4IHJ A;  1AR4 A;  1SKV A;  3RYI B;  2F4V O;  3CHX A;  3G71 V;  3QO7 A;  3RFR A;  2NNU A;  5IJ0 A;  3D3Q A;  3FD9 A;  1YI2 V;  1PNL A;  4MVQ A;  3CPW U;  3P32 A;  2GSM B;  1GN4 A;  3N2G A;  5EIB C;  3AG1 C;  3ZED A;  4JI7 O;  1JX9 A;  3IC9 A;  3W7U A;  4UCU A;  4X89 A;  4WFA V;  3ASO C;  1FFX B;  4JI7 B;  3CX5 F;  1UFI A;  4JZ2 A;  1BQ0 A;  3RW0 A;  4FLX A;  4MT8 A;  4N21 A;  5JH7 A;  4DV1 B;  4HAM A;  3GB7 C;  4X9Q A;  1D5A A;  1S77 D;  3WB2 A;  5LYJ A;  4PA9 A;  1AI7 A;  1WA8 B;  1QLE C;  4O4I B;  2Z0A A;  4O2B A;  2ZE8 A;  3K5O A;  1URF A;  5K1P A;  1RM1 C;  2Q7H A;  3HKE B;  4DK0 A;  1N34 O;  3CCL V;  3OR7 C;  2YXH A;  3ZRW B;  2Q0A A;  1YZB A;  2CTR A;  4TT3 G;  1NR7 A;  4X88 A;  1F51 A;  2EIK B;  4TQF A;  5E1A C;  4H33 A;  2C2A A;  4H13 B;  1IBL O;  2PY5 A;  3CB2 A;  2GDS A;  3CRQ A;  3K5M A;  4CC5 A;  3GWO A;  1XHX A;  1E1Q G;  4K8Z A;  2X6A A;  1RSO A;  2JIZ G;  4L87 A;  5IE9 A;  4R6Z A;  3ZRV A;  2WLK A;  1R3I C;  2ZKO A;  1KBH A;  1MZF A;  4HNA A;  3EHB B;  1GRJ A;  1EN4 A;  2P6J A;  2ZE6 A;  2X6C A;  4G27 B;  1XMQ B;  1NU1 H;  2RMK B;  1KP3 A;  1S0V A;  4G28 B;  1ZL8 B;  2NLJ C;  5LP6 C;  4QIW F;  2GBO A;  2ZXW C;  4BW5 A;  2QM4 A;  1Q6H A;  4UCV A;  2EJ7 A;  4DRX B;  4DV0 O;  1HDJ A;  1AVM A;  3W7T A;  1CPY A;  3TJT A;  1GN2 A;  1SZT A;  1QR8 A;  4PJ0 Z;  3J81 N;  3KZI Z;  1CP9 A;  4LBE C;  4PHZ A;  1SER A;  1WLE A;  2HHH O;  3AG1 B;  4B3T B;  3CRR A;  1VQL V;  1AI4 A;  4JI1 B;  2IBZ H;  3T2M A;  2W0X A;  2W6J G;  3JAS B;  2F66 C;  4DRX A;  4GCZ A;  4PEL A;  2HHH B;  5DED A;  3ASO B;  1N32 B;  1TA8 A;  3T4Z A;  4YJ3 A;  3WG7 C;  3ZJZ A;  1WB7 A;  2LFS A;  4LF4 O;  1JOY A;  1DF4 A;  5CA3 A;  1Z2G A;  4GX1 A;  2DOS A;  1H2K A;  1CEZ A;  2XUM A;  2FYU H;  1I5Y A;  2QJ1 A;  1QLE B;  2UXC O;  4LF4 B;  4TV8 B;  4UFZ A;  1RM1 B;  2PI5 A;  3ABM C;  4B3S O;  4YY3 O;  1KUQ A;  3K9S A;  1N33 O;  3APO A;  2XAS A;  4JF3 A;  1XEQ A;  3CCR V;  4IT5 A;  1SS3 A;  1I7F A;  3QO5 A;  5FNV B;  2YXL A;  1GKF A;  3B09 A;  3OEH G;  3I55 V;  2ETN A;  2YUA A;  1JJO A;  4H0L B;  4B3S B;  4YY3 B;  2UUA O;  2D2C B;  1W0K G;  4TV8 A;  3SGI A;  1QNM A;  1EFR G;  5KA5 A;  1F4M A;  1NQT A;  2X0L A;  2HP8 A;  2QKC A;  3G67 A;  3TXS A;  1B06 A;  2YC0 A;  2R70 A;  4PA4 A;  4CS3 A;  1L0N H;  4HYO A;  2QWN B;  3K03 A;  3UCS C;  1IDS A;  3ZHT A;  4RQF A;  5FNV A;  4J80 A;  1HR0 O;  1XUQ A;  3QVN A;  4NXN B;  4Q6G A;  1FPO A;  2PTM A;  3LNN A;  5LP6 B;  2ZXW B;  2F1M A;  3CC7 V;  3U11 A;  3J80 N;  4C7U A;  1LUW A;  3OMI B;  2JGD B;  2JJ2 G;  2WLI B;  1HR0 B;  4DUZ O;  2QA4 V;  2ZE7 A;  3TGU H;  1H8H G;  5LHH A;  2P5O A;  2DN9 A;  3E89 A;  4MVM A;  4TUY B;  1I0H A;  1KU9 A;  1AI6 A;  2LQT A;  3ABL C;  3E35 A;  3ABK C;  5FL7 G;  4DK1 A;  4I0X A;  1SA0 A;  5IYC O;  1WP7 A;  3JD1 A;  2Q8V A;  1ENV A;  1Q3E A;  1GTO A;  3FB7 C;  3L72 H;  1FJG B;  2A3Q A;  3TET A;  4DR5 O;  2JGD A;  1G6U A;  2IJJ A;  2Q7E A;  1Q5O A;  1ZLZ A;  3R65 A;  3P30 A;  2GUZ B;  2LJ2 A;  1IXM A;  2M7W A;  4JGS A;  1VQN V;  1AIL A;  3WG7 B;  1F7Y A;  3ZBH A;  2DE0 X;  3OAA G;  5DEC A;  2V7Q G;  1MSD A;  2AHZ A;  4X1I B;  3CCU V;  1T5E A;  1TAE A;  5JJN B;  4LF6 O;  5H6R A;  1NH2 D;  1VF6 C;  2F23 A;  5CA0 A;  4DYL A;  3ABM B;  4LR3 A;  5IT9 N;  2KG7 A;  4LFA O;  5IJ9 B;  1FXV A;  4I5S A;  2LGQ A;  3CRA A;  4WBN B;  1Q43 A;  1UPG A;  1P84 F;  5EC1 C;  3H1I H;  3AK3 A;  4YIO A;  4NTY A;  4B08 A;  3B4S A;  3K0D A;  2CGO A;  3DC5 A;  3ZHQ A;  1VQ5 V;  3T1Y O;  3GWK C;  1NI8 A;  1AB3 A;  2Y0I A;  3CXC U;  4LWS B;  2HKO A;  2HR3 A;  3BAB A;  5LMU O;  1OV9 A;  2HEP A;  4WBN A;  4QPK A;  4EFB A;  1IBM O;  3T1Y B;  3H01 A;  4MVS A;  5LBQ A;  3K0G A;  4D7S A;  4K3A A;  2ITD C;  1DTO A;  5ITZ B;  1OCR C;  2M6Y A;  1AI5 A;  4DV3 B;  1K7D A;  2VQF O;  5KHK A;  4RUE A;  1NTM H;  4PA7 A;  4LWS A;  3E22 A;  1G8M A;  1G1X B;  5H5N A;  3TK1 A;  1VF7 A;  4X1K A;  2CTP A;  4DR1 B;  2BTQ B;  4GKJ B;  3SDL A;  3OR6 C;  2VQF B;  4JI4 O;  1R1B A;  2RQ6 A;  1KKC A;  1P7B A;  2XAQ A;  4DR4 O;  1NVP D;  3DXR B;  2BOC C;  3ABL B;  3ABK B;  2ZT9 B;  4IIJ B;  3JAR B;  5JVD B;  2F95 B;  2IU3 A;  3OUS A;  4DR3 B;  3BEH A;  2ZIM A;  3OW2 U;  2DWD C;  3H1H H;  5LOV B;  4DR4 B;  5IWA B;  5JWP A;  1VAR A;  3B2E E;  3P3N A;  1RPR A;  2LO1 A;  4PI2 A;  3K04 A;  4J41 A;  4JAA A;  4HBN A;  1PNK A;  1Y66 A;  3FB5 C;  2JEU A;  3ZRX A;  4IIJ A;  4LF9 O;  4UCO A;  5D5P A;  1D2D A;  3SPG A;  1VQ6 V;  1OCZ C;  2H3O A;  2WLN A;  4DV2 B;  4DV6 O;  5IYZ B;  4P9O A;  2EX3 A;  1R6N A;  1JPX A;  2WA3 A;  4Q20 A;  3OTO O;  5LXT A;  2QSA A;  3FB6 C;  4LF9 B;  2VWJ A;  2UU9 O;  1MZE A;  1M9N A;  1BGY H;  4JAU A;  3HKC B;  2N05 A;  2ZR2 A;  4DV6 B;  4UV8 A;  3M99 B;  5KAI Z;  5JQG B;  2WWW A;  3WFV A;  3OTO B;  1QVF U;  1Q8I A;  4NXM O;  4JI0 O;  4NTW A;  1Z5V A;  5IYZ A;  2Q73 A;  4MVZ A;  4D6T H;  1GM7 A;  3JD2 A;  1K8A W;  5EK0 A;  3CCV V;  4FIP C;  2QDO A;  4FLT A;  3TCU A;  2RCV A;  3HKC A;  4QPJ A;  3FAV B;  2UUC O;  4JI0 B;  4OX9 O;  4GKK O;  4PA3 A;  1COW G;  1S5L Z;  2OIG A;  3LNM B;  3L71 H;  1IX9 A;  3B8N A;  3OFN G;  5CB4 B;  5EZY B;  1NKD A;  2V4D A;  4JTC B;  3VOU A;  5JQG A;  3CE2 A;  1YHQ V;  2RJZ A;  4AQY O;  5HFM A;  1ZX3 A;  1QU7 A;  1KEC A;  1OCR B;  2QM8 A;  1B04 A;  1SQX H;  2UUC B;  4ZKI A;  4MS2 A;  4OX9 B;  1NR1 A;  3EFF K;  3WB0 A;  4UCS A;  3HKB B;  4LFC B;  3RYH A;  4AQY B;  1PP9 H;  1J5E O;  2BCC H;  4B3M O;  5CB4 A;  5EZY A;  2CE4 A;  3FFQ A;  4DR2 B;  5GON A;  1BSM A;  2AHY A;  3G6B A;  4LF7 B;  1NH2 B;  2B1G A;  1IVS A;  2DWE C;  1FAF A;  1J5E B;  4FLV A;  1XMO B;  1N36 O;  4B3M B;  2FL4 A;  3HKB A;  4KFM A;  1SQF A;  2IW5 A;  3A8T A;  1GAX A;  3AK2 A;  1R3J C;  4J9Y B;  1QHT A;  4MW8 A;  1L1F A;  4I9W A;  1K73 W;  3EVK A;  4X62 O;  4O4H A;  3SPJ A;  1VQ4 V;  3DSQ A;  4LNU B;  1N36 B;  2WAM A;  4G2K A;  4RUF A;  3CME V;  1YXB A;  5JH7 B;  4X1Y A;  1BL8 A;  2B5U A;  1JVM A;  3O65 A;  3K5L A;  2GV9 A;  1SQB H;  2Q69 A;  3MAQ A;  4UVC A;  4EB6 B;  2IJH A;  4DV1 O;  4X62 B;  5LYJ B;  1OCZ B;  4PD4 F;  3AG2 C;  2JVD A;  1VEW A;  3AEI A;  4ZOL B;  3JD0 A;  4O2B B;  2KB1 A;  1MMM A;  4WFH A;  4FZ1 A;  4GZR B;  2BSK A;  1JFF A;  4LNU A;  4CH6 A;  4ABM A;  5KHI A;  1XBL A;  1L8D A;  4TV9 B;  1YF2 A;  3F5W C;  1Y67 A;  2PUS A;  4LF5 O;  1HP8 A;  3C3S A;  3MHH C;  4UVB A;  4EB6 A;  2OCH A;  2GTS A;  4FM1 A;  2R9I A;  3TXQ A;  4RWU A;  2YSU B;  5KHG A;  4ZOL A;  5BY1 A;  1RPO A;  2A9H A;  1GH6 A;  4FVM A;  5GW7 A;  4F6R A;  4XDL A;  1RSO B;  1UJW B;  2BE3 A;  1NVP B;  2WLJ A;  4JI8 O;  2ITC C;  4LF5 B;  4FLW A;  1SET A;  4TV9 A;  4JAV A;  2Y0P A;  4K0K B;  3RYF A;  3D3I A;  2EIL C;  4HNA B;  4B3R O;  4QNH B;  2IJI A;  2HG5 C;  4JI8 B;  3RYC A;  2P22 C;  2ADP A;  2QKS A;  4LF8 O;  4TQD A;  4JI5 B;  1XMQ O;  2P67 A;  5FPO A;  4B3R B;  3BA8 A;  1JMK C;  2VS0 A;  1VQP V;  2CAZ C;  4JTA B;  3VQX A;  4X66 B;  2A06 H;  1QCE A;  4LF8 B;  2YIA A;  3K57 A;  4B7K A;  1XHZ A;  3OE7 G;  2PYJ A;  4EFE A;  4N23 A;  4NTX A;  5L3F A;  5JJJ B;  3IAY A;  3A0H Z;  2P90 A;  2Y69 C;  3RT3 C;  1VQO V;  1TGO A;  2YIC A;  3UO2 A;  2F43 G;  4HZ3 A;  1HNX B;  3E8G A;  1IUR A;  4P2Z A;  4B3T O;  4BWA A;  2D3O W;  5C8Y B;  3KCX A;  4JI1 O;  3W7W A;  5CN0 A;  1MG1 A;  4YJ3 B;  1Z5W A;  4UXN A;  1K3E A;  5KA6 A;  4LCU C;  1N32 O;  1YEW A;  5B3S C;  5BZB A;  4CC6 A;  4NB5 A;  5C8Y A;  3JCU Z;  2H8P C;  1VIB A;  3K08 A;  3K59 A;  1YCI A;  2ZIO A;  2ZIN A;  4DW0 A;  5CBG A;  2RDC A;  1WPX A;  3L9D A;  1M4U A;  1CXZ B;  2EIM C;  1P4R A;  2P4K A;  2FB5 A;  4FLY A;  3AG7 A;  4O4L A;  5EYP A;  4OPH A;  1M93 A;  2Q7G A;  4XDJ A;  1SES A;  2DJV A;  1Q81 W;  3K06 A;  2YEV B;  2OCC C;  4QGP A;  2OWO A;  4FM0 A;  1NJI W;  3K3W A;  4DO2 A;  2XND G;  3A0B Z;  2X6B A;  2EIL B;  5L3G A;  4RQE A;  1JA8 A;  4DR7 B;  5KUK A;  3ASN C;  2DQ0 A;  2P7T C;  5LGT A;  2E76 B;  4GX5 A;  2DW4 A;  1MOF A;  3QG5 A;  4DUY O;  4MVU A;  2Q9L A;  3ZN1 A;  2YS8 A;  1XRE A;  1K97 A;  4ZI7 B;  1K5S A;  2YEV A;  2YID A;  2QE7 G;  4MTF A;  4NXN O;  5LL6 Y;  1BHB A;  3M8A A;  2G38 A;  1WN7 A;  1YSC A;  3F5T A;  5J2U B;  3CCJ V;  3ZMT A;  4H44 B;  4DUY B;  1XIL A;  5EC2 C;  1QLN A;  2UXB B;  1PPJ H;  3OUF A;  1RP3 B;  2FML A;  4YIP A;  1WNS A;  1US6 A;  3U0Z A;  3ICX A;  3JD4 A;  2Y69 B;  1SA0 B;  4I0X B;  4ZI7 A;  5B5E Z;  4I55 A;  1PV0 A;  4CBC A;  5LHG A;  1KD1 W;  4W4L A;  3SYA A;  5L3D A;  4LH6 A;  2F93 B;  4DV4 B;  1AR5 A;  4P30 A;  3SJB C;  4FFK A;  2WPD G;  5J2U A;  1TVK A;  2MK3 A;  1FJG O;  1YIJ V;  3G4S V;  1VQK V;  2WLH A;  4FK5 C;  1SRY A;  3JAM N;  4X8A A;  3AG3 C;  4DV5 B;  4K8X A;  5L3C A;  5IYD O;  5B3S B;  2N04 A;  2W0F C;  3JAT B;  5E79 Z;  1WAZ A;  4WFF A;  3A2F A;  4OGQ B;  3ZCC A;  4JV5 B;  5BMV A;  3HPL C;  3SPI A;  3SR2 C;  5DN6 G;  2JS3 A;  1HNZ B;  1H2N A;  5CA0 B;  1P7G A;  5H2F Z;  1IBK B;  2EIJ C;  2KG7 B;  1EZV H;  2JK5 C;  3BAA A;  1M5I A;  3OEE G;  1ARO P;  4EEQ A;  3H1L H;  1BCC H;  3ABU A;  2DYS C;  2EIM B;  3JAT A;  1V9P A;  4ZHQ B;  1NTK H;  1BZK A;  3HR0 A;  1K4D C;  4A5U B;  4PDR A;  1V55 C;  1KKD A;  1WPB A;  1NBM G;  4J10 A;  2Q5Z A;  1WB8 A;  2OCC B;  3VQV A;  2IH3 C;  4FJC C;  1BHA A;  4ICG A;  2ZD9 A;  2ARH A;  4I50 B;  1NS1 A;  5LA6 B;  2A7W A;  4KL1 A;  3RBZ A;  3ZRS A;  3VBB A;  2IH1 C;  5JCO C;  1Y6X A;  4UCR A;  1PD3 A;  4WF9 V;  3G80 A;  2OYQ A;  5J2T B;  3ASN B;  4ZHQ A;  3VQW A;  3CC4 V;  1NZ6 A;  1N0J A;  1BE3 H;  4DR6 O;  2VRZ A;  2BTO A;  2WLM A;  2Y4U A;  4J7J A;  4YJ2 A;  1GMG A;  2H94 A;  3E22 B;  2JJ1 G;  4DV3 O;  3KG2 A;  4BAY A;  3THO A;  4I50 A;  1VP7 A;  4RAI A;  4X1K B;  5LA6 A;  2EIN C;  4FLU A;  1BT8 A;  3OGC C;  2ZM6 B;  1FYJ A;  1TUE B;  4GYC B;  4DR6 B;  1XI1 A;  2ZDI C;  4BW9 A;  5J2T A;  2FKX A;  3CXH F;  2QGN A;  1FFT B;  1M57 C;  4DR1 O;  2DMX A;  4GKJ O;  2ZE5 A;  3S3W A;  1EN6 A;  1Q90 D;  2QWR B;  4K35 A;  1K4C C;  4O2A B;  1MSW D;  5IY5 C;  3SYC A;  1Y76 A;  5LMN O;  5B1B C;  1QR9 A;  2L6L A;  3ZN0 A;  4U3J A;  1JR9 A;  4NR1 A;  3UT5 A;  1KB9 F;  1LUV A;  4DR3 O;  3SJA C;  3L74 H;  5L3B A;  4MVO A;  1VQ8 V;  5IWA O;  5LMN B;  1M56 C;  4O2A A;  5B66 Z;  3AG3 B;  3FKS G;  1N0N A;  3FB8 C;  3SJC C;  4JI6 O;  2XTA A;  2Y4T A;  2LFR A;  4X64 B;  1VQ7 V;  1FXK C;  4UB8 Z;  2R72 A;  1F4N A;  5LXT B;  2PZS A;  4DV2 O;  2QM7 A;  4IYH A;  1B3Q A;  3J7A U;  2B9Z A;  2EIJ B;  2XT9 A;  2UUB O;  4JI6 B;  3ZX6 A;  1H2S B;  2IJK A;  3T1H B;  5GTI Z;  4FLZ A;  2DYS B;  2EBO A;  3CRC A;  3BFR A;  2EZO A;  4O4J A;  4BIO A;  2UUB B;  3JCZ A;  1V55 B;  1YDX A;  3ZS8 C;  2HVJ C;  3BCC H;  1QVG U;  4LH7 A;  2XAG A;  4J7K A;  3MD0 A;  4EKW A;  4B7E A;  3BPZ A;  5K1X A;  4JAS A;  4IL6 Z;  2VWK A;  3SYO A;  2E74 B;  2NN4 A;  3CCM V;  1QBZ A;  1DF5 A;  4FFB A;  4LP8 A;  3E86 A;  3RYH B;  1XL4 A;  2EIN B;  2W6I G;  3JSL A;  3UO3 A;  2CH7 A;  5JCO A;  1IZ3 A;  3B77 A;  1GM9 A;  4LFC O;  1OHH G;  2QEX V;  4FZ0 A;  5GON B;  5EBL C;  4U3F H;  1AJN A;  3BA9 A;  1M57 B;  4GT1 A;  3RVZ A;  1GK9 A;  3L75 H;  1W0J G;  1YIT V;  2XAF A;  1KP2 A;  4DR2 O;  2JDI G;  1R73 A;  5LGN A;  3OMA B;  4U7O A;  2AZ0 A;  4LF7 O;  5IY5 B;  2CUG A;  3CJH B;  3EXA A;  2QTS A;  4YXW G;  5B1B B;  4YHH B;  1XMO O;  2AW9 A;  2EZP A;  3ZMU A;  3DGE A;  2QWP B;  2ZNJ A;  4O4H B;  1ZWI C;  1PNM A;  2ZDI A;  3L73 H;  4GLX A;  4P9P A;  3B40 A;  1K92 A;  1NT2 B;  4RO2 A;  1DLB A;  4X1Y B;  1SQG A;  1R6T A;  1JCH A;  3LSS A;  2Q68 A;  4JI3 O;  3JAW B;  1M56 B;  3E8B A;  1W59 A;  1HNW O;  5L3E A;  2E3C A;  3CJH A;  3RGB A;  4DV7 B;  3BRC A;  1VQ9 V;  1FXK B;  2YI8 A;  3JAL A;  1K9M W;  5EBM C;  2BSK B;  1JFF B;  2O57 A;  4JI3 B;  1EBO A;  2OT5 A;  4LFB O;  4UB6 Z;  1HNW B;  1AP5 A;  2Z3Y A;  1SQV H;  4MW3 A;  1Q86 W;  5IYB O;  3JAW A;  1FS0 G;  2PGG A;  3OM3 B;  1PL4 A;  3CWB H;  4KP4 A;  5KLV H;  1U96 A;  1H2M A;  2LP7 A;  3I5D A;  1O9G A;  4LFB B;  2F4V B;  1FXK A;  5FPR A;  1KQS U;  4F6R B;  4X20 B;  3H1K H;  3M7M X;  5D5Q A;  3RYI A;  5B1A C;  3A0R A;  2EJR A;  3OMN B;  3KKY A;  1EM1 A;  1YJW V;  1KYO F;  3ETE A;  4I7Z B;  3RYF B;  4GUN A;  4H37 A;  3OD4 A;  3PJS K;  3HB3 B;  4ASU G;  1R6K A;  4K0K O;  5LHI A;  3AK1 A;  1YJN V;  1ORQ C;  1OZ0 A;  3RYC B;  3CCS V;  1V54 C;  4X20 A;  3RN4 A;  3SPH A;  3W7S A;  1J95 A;  1SQQ H;  3NXS A;  3G6E V;  5DM6 V;  4FMT A;  1VF5 B;  4JYY A;  2X7R B;  4JI2 O;  3ZHV A;  1SF9 A;  4MTX A;  5IDJ A;  4JI5 O;  2R9A A;  1FFX A;  2A0L A;  1WJZ A;  1R3L C;  1ZTE A;  3CYO A;  2CTW A;  2CTQ A;  2ILM A;  5KAF Z;  2EUL A;  3ZHR A;  4JI2 B;  2K1E A;  3MDS A;  4LC1 A;  4X66 O;  3ETQ A;  2ADQ B;  1WP8 A;  5H9C A;  2AGA A;  2LGW A;  1MA1 A;  1HWY A;  3JSN A;  3UQ8 A;  3BVO A;  1HNX O;  3LDC A;  1N34 B;  1WA8 A;  4O4I A;  5KHJ A;  4GX0 A;  5BXZ A;  1I08 A;  3HKE A;  1E1R G;  4E2L A;  3ZRW A;  5B1N A;  3BHP A;  2QR4 A;  2ODM A;  3U10 A;  1SQP H;  1IBL B;  2XHB A;  4J42 A;  2XOK G;  3CD6 V;  1Y74 B;  4CH5 A;  2GHY A;  2BOB C;  2JS5 A;  3RVY A;  3E83 A;  3CS5 A;  3C3T A;  4MVR A;  1GM8 A;  3STL C;  1P49 A;  1G4Y B;  2DYR C;  4MSW C;  1Q7Y W;  2R9R B;  1N8R W;  1YTF D;  2QTO A;  1PL0 A;  2PYL A;  1H8E G;  3CC2 V;  3JYC A;  1AP6 A;  2CGN A;  1BQZ A;  3LDD A;  4AHC A;  1SC5 B;  3OT7 A;  1Y74 A;  4FM2 A;  4O4L B;  4CS4 A;  5EYP B;  4PV1 B;  4W4K A;  4NYK A;  3HKD B;  4BIZ A;  1AR1 B;  4J11 A;  1QQC A;  2YIB D;  1OCC C;  5CBH A;  4R8C A;  1Q6U A;  3JAK B;  5B1A B;  1ZL8 A;  4KUM A;  3CRM A;  4DV0 B;  4UUJ C;  3STZ C;  4PDM A;  1TUB B;  4UCT A;  1FXH A;  2RNB A;  1OJH A;  2LW1 A;  5HFL A;  5TIS Z;  2NR5 A;  2QKA A;  3HKD A;  4DR7 O;  3QO8 A;  1V54 B;  1KMI Z;  3N27 A;  2OTL V;  1ZSP A;  1FD9 A;  1JQ0 A;  3JAK A;  4JPR A;  2GTA A;  4AI8 A;  5FLX N;  1JJ2 U;  1ROP A;  4Z1M G;  3JAS A;  5KX5 B;  1TUB A;  1O9H A;  3E8F A;  1S5J A;  4Z2W A;  1ZAU A;  1GN3 A;  4I9Q A;  3S3X A;  4PDV A;  2Q4P A;  3SJQ C;  1K5Q A;  2DQ3 A;  2UXB O;  1H2G A;  3QNE A;  4I55 B;  4GX2 A;  5A9G A;  1VMG A;  2IU0 A;  2HFE C;  4CH4 A;  2UXC B;  1M1K W;  2K9P A;  1NTZ H;  2UXX A;  4OXS A;  5KUM A;  5KX5 A;  4ZBM A;  1TVK B;  3K5N A;  4XDK A;  3IFX A;  2OTJ V;  3DTU B;  3ML0 A;  2YXY A;  1Q6I A;  2MW2 B;  4DV4 O;  5EBW C;  3I56 V;  1N33 B;  3T1C A;  3UKM A;  2P4V A;  3K79 A;  1XL6 A;  4F4L A;  2Q0O C;  3CCQ V;  2PI4 A;  3FYI B;  2WSS G;  2UUA B;  4DV5 O;  2Z5U A;  4J9Z B;  1MAB G;  3X2Q C;  5BMV B;  3IC7 A;  1H38 A;  2FTK A;  3O9O A;  1S3J A;  3ZHU A;  3FYE B;  1KC8 W;  1ZUQ A;  2DYR B;  3OTF A;  4JV5 O;  4WFG A;  2JRI A;  1E79 G;  1HNZ O;  2ZCE A;  4NKG B;  3CMA V;  3FX7 A;  2PF4 E;  1IBK O;  2ATK C;  1A32 A;  1L0L H;  4FPP A;  2UXD O;  2CDY A;  1EN5 A;  2V1D A;  2CK3 G;  1LNQ A;  4BR6 A;  4R50 A;  4D7T A;  1S5H C;  5B1O A;  5KMG B;  3ETG A;  2Q6A A;  1YVW A;  1OCC B;  2ZNI A;  1X59 A;  1GN6 A;  4WFE A;  5LP6 A;  4DUZ B;  2ZQM A;  2UXD B;  2YI9 A;  3WB1 A;  2N74 A;  3UM7 A;  4UV9 A;  4AIL C;  2WLI A;  4QE9 A;  1XNR O;  3VQY A;  3ZHS A;  1MNG A;  1U97 A;  4DW1 A;  4DXW A;  3CP1 A;  5F2V O;  4KXR A;  5KMG A;  3D36 C;  4TUY A;  5C93 A;  4YJ2 B;  3QTC A;  4IGG A;  4OPA A;  2B1I A;  3LUT B;  4DR5 B;  2YDE A;  1EZJ A;  3JD3 A;  5H6Q A;  4MTG A;  5KHH A;  1XNR B;  1GO3 F;  1AJQ A;  2Q67 A;  5GTH Z;  1N4C A;  1DGS A;  1YJ9 V;  3MHS C;  2L35 A;  1RFY A;  2GUZ A;  3SYQ A;  4I4T B;  2ZM6 O;  4KHP O;  3AG4 C;  4JTD B;  1OCO C;  2E75 B;  4LF6 B;  1YTF B;  1Y76 B;  2HJF C;  4X1I A;  4U3J B;  4PI0 A;  3UT5 B;  1FKA O;  4KHP B;  3BY6 A;  3Q4H B;  4J7Z A;  3ETD A;  2KSD A;  3APQ A;  4LFA B;  1B6Q A; 
#chains in the Genus database with same CATH homology
 1M57 B;  3SYP A;  1Q82 W;  4GT1 A;  3RVZ A;  1GK9 A;  3LDE A;  1W0J G;  1W0K G;  1YIT V;  1EFR G;  2XAF A;  5KA5 A;  1KP2 A;  1F4M A;  1NQT A;  2JDI G;  1R73 A;  2QKS A;  2X0L A;  3OMA B;  5LGN A;  4JYB A;  4U7O A;  2P67 A;  2UXN A;  5IY5 B;  4PA6 A;  4PA4 A;  1K33 A;  4HYO A;  4YXW G;  1VQP V;  5B1B B;  4XBF A;  2EZP A;  3ZMU A;  3DGE A;  4JYC A;  3X2Q B;  1ZWI C;  3K03 A;  4TWK A;  1PNM A;  4JTA B;  2ZDI A;  4RQF A;  2XAJ A;  3CCE V;  1QCE A;  4P9P A;  1K92 A;  3OE7 G;  4RO2 A;  4N23 A;  5L3F A;  1DLB A;  4UVA A;  2P90 A;  2Y69 C;  1VQO V;  1JCH A;  2WLL B;  2F43 G;  2Q68 A;  3LSS A;  4HZ3 A;  5CBF A;  1M56 B;  2ZXW B;  3E8B A;  3E8G A;  3CC7 V;  1THZ A;  4P2Z A;  4R7C A;  2D3O W;  3OMI B;  5L3E A;  1I5X A;  5CMU A;  1BMF G;  3W7W A;  2JJ2 G;  2WLI B;  5CN0 A;  1W2B U;  2QA4 V;  3W7X A;  1VQ9 V;  1FXK B;  1H8H G;  5LHH A;  1K9M W;  3E89 A;  4MVM A;  5EBM C;  1MG1 A;  1EBO A;  2OT5 A;  4QJF B;  1PKX A;  4UXN A;  1AI6 A;  1K3E A;  3ABL C;  3E35 A;  5KA6 A;  3ABK C;  5FL7 G;  4LCU C;  5IYC O;  2Z3Y A;  3JD1 A;  4MW3 A;  1Q86 W;  5IYB O;  2WLL A;  1ENV A;  5B3S C;  1GTO A;  1FS0 G;  3OM3 B;  2XAH A;  3FB7 C;  4BIU A;  5BZB A;  4KP4 A;  3TET A;  2H8P C;  2IJJ A;  2LP7 A;  2JEX A;  4CZZ A;  3R65 A;  3P30 A;  3IGA C;  1FXK A;  3K08 A;  1IXM A;  2M7W A;  1KQS U;  4JGS A;  1VQN V;  3WG7 B;  4QE7 A;  5B1A C;  3A0R A;  2EJR A;  2HLD G;  3OMN B;  1R3K C;  5CBG A;  3OAA G;  1YJW V;  1WPX A;  3ETE A;  2V7Q G;  3ZMZ A;  4H37 A;  1S72 V;  2AHZ A;  2EIM C;  1P4R A;  3PJS K;  1M90 W;  3ZMS A;  3CCU V;  3HB3 B;  3K9A A;  4ASU G;  1R6K A;  3LSQ A;  5LHI A;  1YJN V;  1ORQ C;  4XDJ A;  1OZ0 A;  1SES A;  5H6R A;  3CCS V;  1NH2 D;  1Q81 W;  3K06 A;  1V54 C;  2YEV B;  3AG4 B;  3SPH A;  3W7S A;  2OCC C;  3ABM B;  1J95 A;  3D36 A;  2Y48 A;  1FXV A;  3NXS A;  3G6E V;  4I5S A;  1OCO B;  5DM6 V;  4FMT A;  1NJI W;  3K3W A;  3ZIA G;  5EC1 C;  4DO2 A;  2X7R B;  3E8H A;  2XND G;  2X6B A;  3K0D A;  4MTX A;  5IDJ A;  1K34 A;  2EIL B;  2ZR3 A;  3F7Y C;  5L3G A;  4RQE A;  1S76 D;  5KUK A;  3ASN C;  3F7V C;  2DQ0 A;  2A79 B;  2P7T C;  1VQ5 V;  5LGT A;  5LGU A;  4GX5 A;  2DW4 A;  2A0L A;  1MOF A;  3ZMV A;  3AG2 B;  1R3L C;  1Y4M A;  3CYO A;  4MVU A;  3ZN1 A;  3CXC U;  1K97 A;  2HVK C;  1K5S A;  2HKO A;  2HR3 A;  2K1E A;  2YEV A;  4MTO A;  4LC1 A;  2QE7 G;  4MTF A;  1BHB A;  5H9C A;  1AJP A;  4U7N A;  2EIK C;  3B8M A;  1HWY A;  4QPK A;  3H01 A;  4MVS A;  1YSC A;  5LBQ A;  3CCJ V;  3K0G A;  3ZMT A;  3LDC A;  5EC2 C;  1QLN A;  3OUF A;  2ITD C;  1DTO A;  4GX0 A;  1OCR C;  3T4D A;  1AI5 A;  4WFB V;  1K7D A;  1VQM V;  4RUE A;  1E1R G;  4PDL A;  4E2L A;  4PA7 A;  3JD4 A;  2Y69 B;  3ZRW A;  5B1N A;  1G8M A;  4CBC A;  5LHG A;  1KD1 W;  3SYA A;  5L3D A;  3ABT A;  2XOK G;  3CD6 V;  3TK1 A;  5J9P C;  3E2E A;  2GHY A;  2BOB C;  4P30 A;  3RVY A;  3E83 A;  3SPC A;  3OR6 C;  2WPD G;  1F23 A;  2MK3 A;  4TSF G;  4MVR A;  1GM8 A;  4WCE V;  1YIJ V;  3STL C;  3G4S V;  1P7B A;  2XAQ A;  1G4Y B;  2DYR C;  1VQK V;  1NVP D;  2BOC C;  2WLH A;  3ABL B;  4MSW C;  1Q7Y W;  3ABK B;  4FK5 C;  1SRY A;  3G71 V;  4X8A A;  2R9R B;  1N8R W;  1YTF D;  3AG3 C;  3QO7 A;  2QTO A;  1PL0 A;  5L3C A;  1H8E G;  2IU3 A;  3OUS A;  3JYC A;  5IYD O;  5B3S B;  3CC2 V;  3BEH A;  2W0F C;  3LDD A;  3OW2 U;  2NNU A;  2DWD C;  1YI2 V;  4WFF A;  1PNL A;  4MVQ A;  3CPW U;  3ZCC A;  3P32 A;  3HPL C;  3SPI A;  4BIZ A;  1AR1 B;  5DN6 G;  1RPR A;  2GSM B;  3K04 A;  1OCC C;  3AG1 C;  5CBH A;  4R8C A;  2EIJ C;  1PNK A;  1Y66 A;  5B1A B;  4KUM A;  2JK5 C;  3FB5 C;  2JEU A;  1JX9 A;  4UUJ C;  3ZRX A;  3STZ C;  3W7U A;  3OEE G;  1ARO P;  4X89 A;  4PDM A;  3SPG A;  1VQ6 V;  1OCZ C;  2WLN A;  3ABU A;  2DYS C;  2EIM B;  4WFA V;  1K4D C;  4P9O A;  1FXH A;  4PDR A;  3ASO C;  4Q20 A;  1R6N A;  1JPX A;  5HFL A;  1V55 C;  1KKD A;  3FB6 C;  3RW0 A;  3QO8 A;  4MT8 A;  1V54 B;  4N21 A;  2OTL V;  1NBM G;  1M9N A;  2OCC B;  4JAU A;  2IH3 C;  1JQ0 A;  4FJC C;  1BHA A;  4HAM A;  4JPR A;  2ZD9 A;  3GB7 C;  2ZR2 A;  3RBZ A;  4UV8 A;  1JJ2 U;  3M99 B;  1ROP A;  3ZRS A;  3VBB A;  2IH1 C;  4Z1M G;  1S77 D;  2WWW A;  3WFV A;  1QVF U;  4PA9 A;  1PD3 A;  3E8F A;  4WF9 V;  1AI7 A;  3ASN B;  1QLE C;  3CC4 V;  4PDV A;  3SJQ C;  4MVZ A;  1K5Q A;  1RM1 C;  1GM7 A;  3JD2 A;  2DQ3 A;  2WLM A;  3CCL V;  1K8A W;  3OR7 C;  5EK0 A;  1GMG A;  3CCV V;  2H94 A;  3ZRW B;  1H2G A;  2JJ1 G;  3QNE A;  4FIP C;  4GX2 A;  3TCU A;  3KG2 A;  4BAY A;  4TT3 G;  4QPJ A;  1NR7 A;  4X88 A;  1F51 A;  1COW G;  2HFE C;  4PA3 A;  2EIK B;  3LNM B;  4RAI A;  2IU0 A;  2EIN C;  3B8N A;  1M1K W;  3OFN G;  3OGC C;  1NKD A;  5E1A C;  4JTC B;  2UXX A;  4H33 A;  3VOU A;  2C2A A;  4OXS A;  1TUE B;  5KUM A;  4ZBM A;  1YHQ V;  4XDK A;  2ZDI C;  3IFX A;  2OTJ V;  3DTU B;  3ML0 A;  5HFM A;  1M57 C;  1FFT B;  3GWO A;  1KEC A;  1OCR B;  5EBW C;  1E1Q G;  3I56 V;  2QM8 A;  3T1C A;  2X6A A;  3UKM A;  4ZKI A;  2JIZ G;  4L87 A;  3K79 A;  4MS2 A;  1NR1 A;  1XL6 A;  4F4L A;  1K4C C;  3EFF K;  4R6Z A;  3ZRV A;  1MSW D;  3CCQ V;  2WLK A;  5IY5 C;  2PI4 A;  1R3I C;  3SYC A;  3FYI B;  5B1B C;  1QR9 A;  3ZN0 A;  3EHB B;  2WSS G;  2Z5U A;  4J9Z B;  1MAB G;  3X2Q C;  2P6J A;  3IC7 A;  1H38 A;  2AHY A;  2FTK A;  2X6C A;  4G27 B;  5L3B A;  1S3J A;  4MVO A;  1VQ8 V;  1NH2 B;  3FYE B;  1KC8 W;  2B1G A;  1KP3 A;  2DYR B;  4WFG A;  2DWE C;  1S0V A;  4G28 B;  2NLJ C;  4QIW F;  1E79 G;  1M56 C;  2ZXW C;  4BW5 A;  3CMA V;  3AG3 B;  3FKS G;  2ATK C;  3FB8 C;  4KFM A;  2IW5 A;  4FPP A;  1R3J C;  2LFR A;  4J9Y B;  3W7T A;  1CPY A;  1VQ7 V;  1FXK C;  2V1D A;  2CK3 G;  1LNQ A;  1SZT A;  4MW8 A;  1L1F A;  4I9W A;  1K73 W;  1QR8 A;  1F4N A;  4R50 A;  3SPJ A;  1VQ4 V;  1S5H C;  5B1O A;  2QM7 A;  3ETG A;  2Q6A A;  1CP9 A;  2WAM A;  4G2K A;  4LBE C;  4RUF A;  3CME V;  1SER A;  1WLE A;  1OCC B;  3AG1 B;  1VQL V;  1BL8 A;  1AI4 A;  1JVM A;  2B5U A;  2EIJ B;  4WFE A;  2Q69 A;  2ZQM A;  3T2M A;  4UVC A;  2IJK A;  2W6J G;  2IJH A;  3UM7 A;  1OCZ B;  2DYS B;  4UV9 A;  2WLI A;  4QE9 A;  4GCZ A;  3AEI A;  2EBO A;  3JD0 A;  4PEL A;  2EZO A;  2KB1 A;  3ASO B;  4DXW A;  4WFH A;  3CP1 A;  3JCZ A;  3T4Z A;  1V55 B;  3WG7 C;  3ZJZ A;  2HVJ C;  5C93 A;  2LFS A;  2B1I A;  1QVG U;  1JOY A;  1DF4 A;  3LUT B;  5CA3 A;  2XAG A;  1EZJ A;  3JD3 A;  3F5W C;  3MD0 A;  5H6Q A;  4GX1 A;  4MTG A;  4EKW A;  1GO3 F;  1AJQ A;  4UVB A;  3MHH C;  2Q67 A;  1CEZ A;  2R9I A;  4JAS A;  1YJ9 V;  3MHS C;  1I5Y A;  2YSU B;  1QLE B;  3SYQ A;  1RPO A;  2A9H A;  3SYO A;  5GW7 A;  1RM1 B;  3AG4 C;  4XDL A;  1UJW B;  2PI5 A;  3ABM C;  4JTD B;  3CCM V;  1NVP B;  2WLJ A;  2ITC C;  1OCO C;  1QBZ A;  1DF5 A;  1SET A;  4LP8 A;  3E86 A;  4JAV A;  1YTF B;  2XAS A;  4JF3 A;  2HJF C;  3CCR V;  3D3I A;  1XL4 A;  2EIN B;  2EIL C;  2W6I G;  3QO5 A;  4QNH B;  3B77 A;  1GM9 A;  2IJI A;  1OHH G;  2QEX V;  3BY6 A;  5EBL C;  3ETD A;  2HG5 C;  1GKF A;  3AG2 C;  3OEH G;  1AJN A;  3I55 V;  1B6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...