3K0GA

Crystal structure of cng mimicking nak mutant, nak-etpp, na+ complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
b'EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 32
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k0gA00
1V54C 2ITDC 1M56C 1KKDA 5EBLC 4P2ZA 3STZC 2Q6AA 2HG5C 3SPIA 4TWKA 3TETA 2ITCC 4PDMA 4J9YB 2DYRC 1ORQC 2OCCC 4JTDB 2YEVA 4WFFA 4MVOA 3E8FA 2ATKC 2W0FC 1OCZC 4X8AA 3UKMA 1J95A 3K03A 3X2QC 5CBFA 2WLNA 5E1AC 5EK0A 4EKWA 3OR7C 3STLC 3RVZA 1M57C 1XL4A 2WLJA 3WG7C 4P30A 1R3IC 3OGCC 3E8GA 5B1AC 3RBZA 3SYPA 2K1EA 3FB5C 1R3JC 2X6CA 3FB8C 4RO2A 4WFHA 4F4LA 2EILC 3T4ZA 3E8BA 4MVSA 4RUEA 1OCCC 2ZXWC 4HZ3A 3SYAA 3K0GA 3EFFK 3KG2A 2EIJC 3ABKC 4LBEC 2X6AA 4XDJA 4LCUC 3JYCA 3T4DA 4JTCB 1K4DC 4MTOA 3SPCA 5CBGA 3LDEA 4MVQA 2EIKC 4G28B 4MW3A 4QE9A 3K04A 1S5HC 1OCOC 1OCRC 3GB7C 2HJFC 4PA9A 5EC1C 3SPJA 2WLKA 2NLJC 4MVMA 3RVYA 2P7TC 3IGAC 4PDLA 4UUJC 2A79B 3ZJZA 4PA7A 3K06A 4WFGA 3UM7A 4R50A 2A0LA 2WLHA 2IH3C 3OR6C 4R7CA 3OUFA 4XDKA 2IH1C 2BOBC 3ABLC 4MS2A 3RW0A 3SYOA 4QNHB 3LUTB 5CBHA 5IY5C 1QLEC 5KUKA 1JVMA 2JK5C 3ASOC 2HVKC 3K0DA 3OUSA 4MW8A 1G4YB 2WLLB 4GX0A 3E89A 2WLLA 4GX2A 4MTGA 2WLIB 4R6ZA 4LP8A 1R3LC 2WLIA 4CBCA 4MSWC 4ZBMA 4PDRA 2AHZA 3F7YC 3HPLC 1LNQA 2EINC 4HYOA 3SPHA 2Y69C 3AG2C 2KB1A 3E8HA 5EBWC 3T2MA 2A9HA 2BOCC 4RUFA 2Q68A 2EIMC 3E86A 2R9RB 4JTAB 4MVUA 2Q67A 4PA6A 1P7BA 3E83A 4MTFA 2DYSC 3VOUA 4WFEA 5EBMC 4BW5A 3BEHA 3FB6C 3ZRSA 3PJSK 1BL8A 4OXSA 3R65A 4H33A 2HVJC 4PA3A 4R8CA 3SPGA 2QKSA 4DXWA 3AG4C 2H8PC 1ZWIC 3F5WC 2DWEC 3SJQC 5EC2C 1K4CC 3IFXA 3LDDA 3AG1C 4I9WA 2AHYA 3SYCA 3T1CA 2Q69A 3K08A 4P9OA 5KUMA 3SYQA 4X88A 2DWDC 5J9PC 4MVRA 4GX1A 4PDVA 1XL6A 3TCUA 4QE7A 1V55C 1R3KC 4XDLA 2X6BA 4KFMA 5B1BC 2ZD9A 4RAIA 2QTOA 4GX5A 4PA4A 4J9ZB 5B3SC 4G27B 3ASNC 4P9PA 2HFEC 3ABMC 4H37A 5BZBA 3LDCA 4X89A 3FB7C 2WLMA 4MVZA 3LNMB 3AG3C 3F7VC
chains in the Genus database with same CATH superfamily
2CH7A 1RP3B 1Y74A 1Q6IA 3TETA 2OCCC 3ZRWB 4WFFA 3EHBB 1EZJA 1M9NA 4LF9B 1OCZC 2XAJA 2KQXA 1GN2A 3DXRB 5EK0A 3VBBA 4O2AB 4YJ3A 3VQYA 5C93A 1FJGO 2K9PA 4I5SA 5B1AC 1FPOA 2IJKA 3M99B 2YIAA 3ZMVA 3AG7A 5KX5B 1KD1W 2ZXWC 5KAFZ 1M5IA 3RWRD 2P67A 1Q86W 3CE2A 1ZL8A 3VQWA 3E22B 1NTZH 1YIJV 4QNHB 5J2UB 1K5QA 1JVMA 3C3TA 3GWKC 2W6JG 3ZHRA 4H0LB 1XNQO 3HB3B 4MTGA 1L0LH 1MA1A 4U3JB 1HWYA 1URFA 2JJ2G 2PYJA 1KQSU 1R6KA 4BIUA 2GBOA 3QG5A 1XUQA 4ABMA 4GKKB 2ILMA 4KUMA 3E86A 3BFRA 4BIZA 4DV7O 4JTAB 4Z1VA 1CEZA 1HNXB 3FB6C 2EILB 3PJSK 1J5EO 3F5WC 3HKDA 5LMUO 2KSDA 5EC2C 1E1RG 2GDSA 3CCJV 3K5MA 2XUMA 2Y69B 1THZA 2DN9A 2YIBA 4X20B 2Q7EA 4UCVA 2DQ3A 1IURA 2UUBB 3L71H 1FFXA 4PHZA 3F7VC 1H2NA 2VWJA 2ITDC 5EBLC 5IYCO 4JYAB 2L35A 3QO7A 3WB2A 4B3RO 2GTAA 3E8FA 5JVDA 1HR0B 5BMVB 2DYSB 3QO8A 3CHXA 4GLXA 4E4EA 3KZIZ 4DR1O 1H38A 5IWAB 1VQ6V 2FMLA 1FXKA 1KKCA 3T4ZA 4DRXA 5LP6A 4MVSA 2RJZA 3KG2A 2ZDIA 2ZE7A 2V7QG 5KHJA 4XDJA 1S76D 1NTKH 4DR3B 5H2FZ 1IVSA 3RVYA 3FX7A 1ZSPA 2QWQB 4YJ3B 3EXAA 2Y0PA 5D5PA 4MT8A 3OAAG 2P22C 4GKKO 4GX2A 1BT8A 1N0JA 2NN4A 4MSWC 5DN6G 1MMMA 2B9ZA 3T2MA 1M90W 2Y69C 1O9HA 2A9HA 4IIJA 1BSMA 1SKVA 1O9GA 4NYKA 1YI2V 4BW9A 1Y67A 5JCOA 5HFLA 3ETEA 4H33A 3CD6V 4OX9B 3ZHQA 1KMIZ 3IFXA 4CS4A 1TVKA 3ZMSA 5IYZB 3UQ8A 5JJNB 2QDOA 2Q69A 1FYJA 2LGWA 1FFTB 1Y4MA 4DUZO 4RAIA 4GX5A 5KHKA 4U7OA 1BMFG 4G27B 1R6NA 3ABMC 3D36C 2WLMA 3R66A 4JYAO 2UXXA 2GUZA 4GKJB 3WB1A 1EZVH 4K3AA 3BABA 1YTFD 1I0HA 2W0FC 4X8AA 3ZHVA 3K03A 5IWAO 1NVPD 5KA5A 5J2TA 3RYHA 1M93A 4UB8Z 2XT9A 5LBQA 4JI4B 3KCYA 1FXVA 2R70A 1U96A 1A32A 3UO3A 4FFBA 3B2EE 4HZ3A 5ITZB 4NTWA 1GN6A 5LYJB 1K97A 1Q8IA 3IC7A 3H01A 3CC7V 3GB7C 3QNEA 3TK1A 2JS5A 1AR4A 2QE7G 3OMIB 3LUTB 1FXKB 4FZ0A 4IHJA 1AJQA 2OT5A 2WLLB 4R6ZA 5LXTA 1VQ4V 1VF6A 4HNAB 4FIPC 3CMEV 1ROPA 3BCCH 2IU3A 3JASB 2ADQB 4OX9O 1G6UA 4PA6A 4WF9V 4CZZA 1F23A 4BW5A 1WLEA 3HR0A 4R8CA 3R65A 1VQKV 3L75H 3F5TA 3CS5A 4DXWA 1PNMA 2B5UA 3JD4A 1H8EG 4JAVA 1SQPH 2AW9A 1PNKA 4ASUG 2GV9A 1ZX3A 1IBLB 4P9OA 1XL6A 2RDCA 4FPPA 5IT9N 4J80A 1DF4A 4GKJO 1TA8A 1K92A 4GYCB 4DR5B 1FD9A 2P4KA 2HP8A 1M56C 1CXZB 2ZT9B 3AEIA 2FL4A 2DYRC 2YEVA 2ATKC 1SQVH 1VP7A 3CCMV 4HAMA 2WLNA 2YI9A 1V54B 3ZN0A 1XL4A 1B06A 3WG7C 3SYPA 2GUZB 3APQA 2C2AA 4DV0B 1HNWB 4X1KA 5F2VO 2D2CB 5B1NA 1UPGA 1WB7A 2CE4A 3JAWB 3Q4HA 1S5HC 4PA9A 1AI4A 4UVAA 1GRJA 5LHGA 2UXNA 4O2BA 5IJ9A 1QLEC 2N05A 3T1YB 4TV8A 1MSDA 2A7WA 1WJZA 4FFBB 2AZ0A 1YVWA 4LP8A 1OJHA 4PV1B 3F7YC 3NXSA 1Z5WA 4X62B 2DMXA 3K9SA 1COWG 3CX5F 1IBLO 2JGUA 4X9QA 1TUBB 3L73H 4UCUA 5DEDA 1OZ0A 3LSSA 4J10A 4O4JB 1V55C 3ML0A 3HKCA 5IE9A 4PA4A 3AG4B 1LUVA 5BZBA 2WPDG 1PNLA 1V54C 1NZ6A 2YXYA 2Y0IA 3QO5A 4LF7O 4ZHQA 5L3BA 2UXBB 4NVPA 2EINB 1Y76B 2P6JA 1VQ7V 3ZRWA 3MDSA 4FLTA 2DOSA 3WFVA 3DXRA 4MTXA 4CH4A 2JRIA 1HNWO 4JASA 4ZOLA 4RUEA 5LGTA 1YDXA 3JD1A 1BZKA 2EJ7A 1K8AW 3CRRA 4O4LB 4X64O 4D6TH 3T4DA 4L87A 3K04A 1T5EA 3OE7G 3JCUZ 3ETDA 1SQBH 4PDLA 2A79B 3SJCC 3E22A 3T1YO 1NKDA 3CCRV 1IXMA 4UFZA 4UXNA 4LF8B 3ABLC 1JCHA 5J2UA 3JAMN 1HDJA 5GTHZ 4WCEV 3OTOO 1G1XB 2OCCB 4X1KB 4PJ0Z 4U3JA 1NVPB 1OCZB 4X62O 4PDRA 5KAIZ 1XILA 5H6RA 3VQVA 1OV9A 3OMNB 1PP9H 3G80A 5B1AB 3JARB 4AI8A 2RNBA 5CMUA 3ZBHA 4OXSA 4PA3A 1ZLZA 2Z0AA 3M8AA 1F7YA 2ZXWB 3AG4C 1AI5A 3B8MA 4J7ZA 4XBFA 3T1HB 1Q7YW 4TV8B 1VF5B 2CGNA 2ZNIA 2FB5A 5LOVB 1Y6XA 3AK2A 4TOIA 2P06A 4X20A 4MVRA 3K58A 4QE7A 1QBZA 4KXRA 4XDLA 4X1YA 1H2GA 4L8JA 4NXMO 3K5LA 2DJVA 4P9PA 4AILC 3BHPA 5KA6A 1JA8A 2E74B 1WP7A 1GAXA 2CDYA 4GT1A 5TISZ 2CTRA 3KKYA 3K57A 1QHTA 3VQXA 3EVKA 4MVOA 5B1BB 1AR5A 5LMUB 1I08A 4CC5A 2O57A 3W7WA 5BMVA 4DV6O 4GZRB 1FKAO 3HKEB 3RVZA 4A5UB 5CA1B 2WLJA 5IJ0B 3OGCC 4LH7A 5BR8B 4DR4O 5JWPA 4ZHQB 4ZKIA 3W7TA 1JPXA 2HJDA 4TQDA 3SJAC 4G2KA 4I50A 1WNSA 1BE3H 2EIKC 4MW3A 2EZOA 4JI3B 4LF8O 2QEXV 1MZFA 5LHHA 3D3QA 4UUJC 3O65A 2E5LB 4BR6A 3J81N 4B3RB 4RQFA 4YHHB 2WAMA 4NXNO 4R7CA 2LQTA 2MW2B 4ZOLB 5CBHA 1FXHA 1L0NH 3S3WA 4DO2A 2Q0AA 4DR1B 2XNDG 4GUNA 1XNRB 4JI1B 1QCEA 3OEHG 3M7MX 3FYEB 5GTIZ 4MVUA 2QWPB 5DM6V 3T1HO 1Q3EA 1P4RA 4EEQA 5JQGB 1DTOA 3SJQC 4NB5A 3CCLV 2HEPA 5IYZA 1H8HG 3A2FA 5IDJA 5KUMA 2QR4A 1JJ2U 1E79G 3U10A 3DTUB 2EX3A 1HW7A 1NI8A 2F93B 5B1BC 2PZSA 3I55V 2LGQA 2UU9O 3P3NA 4JV5B 5KHIA 3QTCA 1XMQO 3HKBB 1K73W 2ZR2A 4JI0B 3DSQA 3STZC 5EZYA 1RSOB 4YXWG 5BXZA 4ICGA 2M6YA 1IZ3A 2F43G 1H2KA 3O9OA 4J9YB 4DV5B 1N32B 4YIOA 3FAVA 3A0RA 1GM9A 1NR1A 5B66Z 4X1YB 2OCHA 5BR8O 5E1AC 1AJPA 1ZUQA 1I5XA 2CAZC 2NR5A 1SERA 1D2DA 2AXTZ 3STLC 3QVNA 1MNGA 1R3IC 3RBZA 4DUZB 1W59A 2UXDB 3CYOA 2CK3G 3ZIAG 4JPRA 1AI6A 1OCCC 4WFBV 4JI3O 5ITZA 3A8TA 3CRAA 3JCZA 3ABKC 2E5LO 1S5LZ 5LYJA 4CS3A 3A0HZ 4YHHO 4QE9A 3OD4A 5L3CA 3G6BA 3ABMB 5EC1C 1XOUA 3K06A 2WWWA 2RQ6A 1S72V 1XNRO 4XDKA 2IJHA 2BOBC 5IY5C 4JI1O 3H1KH 1JQ0A 3OUSA 1HNZB 2WLLA 4HNAA 2X0LA 2PUSA 4I50B 3HPLC 2ZKOA 3SPHA 5KHHA 3AG2C 1YITV 4LF5B 3JASA 4PI2A 2QKCA 2Q7HA 3CMAV 3BVOA 2Q67A 4I4TB 2QWRB 2R9AA 1VQ5V 2JIZG 4RQEA 4KP4A 1AJNA 4J42A 1Y66A 4DV4B 1N4CA 4ZI7B 1GMGA 1S77D 1S0VA 3AG1C 1PKXA 5B5EZ 3P30A 2HKOA 3K08A 5CN0A 4GX1A 1TAEA 4AHCA 4JV5O 3W7UA 3ASNC 4J7JA 4JI0O 1VARA 2XAGA 1F51A 2EJRA 1I7FA 1D5NA 4LWSB 1NH2D 4DV5O 1N32O 1Q90D 2HG5C 2DE0X 1K33A 4JYCA 1BHAA 3UCSC 1J95A 3SDLA 3X2QC 2CGOA 1SQQH 4LFAO 4LFCO 1UFIA 3MAQA 2UXDO 1PPJH 3FYIB 1VEWA 5FNVB 4B7EA 4FLUA 5JJJB 2N74A 1P49A 4JI5B 3FB5C 1JR9A 1R3JC 2Q5ZA 4BWAA 1XHZA 4DR2O 5EZYB 3K0GA 1SQGA 5H9CA 4JTCB 3FAVB 4MVQA 2Z5UA 3JAWA 1GH6A 2BSKA 3SPJA 1ENVA 3ZS8C 1N33B 2NLJC 3ZJZA 2ZQMA 1HNZO 1YF2A 2P90A 1M56B 3OTFA 5L3GA 3SYOA 3RW0A 2F66C 5LL6Y 3U0ZA 5KUKA 2EIJB 3CCEV 2DYRB 4LF5O 4D7TA 3SR2C 1Q5OA 3W7XA 4CH3A 1NQTA 2YDEA 5EBWC 2GHYA 4DV4O 3WG7B 1P84F 2YI8A 2XHBA 2ODMA 1PL0A 3FKSG 1YJWV 3SPGA 2EBOA 1W2BU 1MSWD 1TUBA 1GKFA 5HFMA 5BY1A 3LDDA 4DV3B 2ARHA 2PTMA 4UCSA 4O4JA 3IC9A 3C3SA 1TUEB 3G67A 1QLEB 3OEEG 2YICA 1D5AA 4MVZA 3LNMB 5IYBO 1EM1A 2JS3A 3CPWU 1EFRG 1N34O 4O4HA 4TWKA 4PDMA 5CB4B 2YXLA 1Y76A 5D5QA 1YSCA 2A3QA 2Y4TA 5H6QA 4JI5O 1S3JA 3AG3B 1KB9F 4K0KO 1TGOA 3OGIB 4K8XA 1KECA 1IXBA 4BIOA 3J7AU 3E2EA 1AI7A 3H1LH 2VS0A 1FAFA 4TV9B 2KKWA 3JD3A 1N33O 2EIJC 1YEWA 1V55B 4O4LA 4LCUC 4CH6A 2JVDA 3JD2A 3SPCA 4LF7B 1L1FA 1BS3A 1OCRC 2E75B 2P7TC 3IGAC 4FLYA 2WA3A 4B7KA 4JI6B 3ETGA 2N04A 5EIBC 3E35A 4IT5A 4DR7B 3P32A 1GN3A 1DLBA 4KHPO 1X4TA 4X65O 3K9AA 3E89A 4FMTA 1KC8W 3ZEDA 2ZCEA 4NTXA 4JF3A 4LFBO 2XTAA 2BSKB 3RYFB 4FVMA 5L3EA 4MTFA 3JARA 4X64B 4WFEA 2XOKG 4DV3O 3ZHUA 3J80N 4FM0A 2DWEC 4FLXA 1XDCA 2MK3A 3MHSC 2B1GA 2QGNA 1MG1A 5LP6C 3CC4V 3CP1A 5LOVA 4X88A 3CJHB 5FPOA 4CC6A 2ZDIC 3ZCCA 3OTOB 3S3XA 1VQOV 3C90A 1BGYH 4KFMA 2V1DA 4TQFA 2X7RB 3ABLB 3JALA 3JD0A 3CB2A 3AG3C 4C7UA 3N2KB 4LH6A 1UJWB 5FL7G 1QQCA 3H1IH 1GM7A 2ZIOA 1IBMB 4YY3O 4RWUA 2P4VA 4FM2A 3UKMA 4NR1A 3G6EV 1SRYA 4YIPA 3HKEA 1WP8A 5CA1A 2VQEB 5IJ0A 4FLVA 4WFHA 3FB8C 2AZ2A 4TUYB 4B08A 4UCOA 4NXMB 3SYAA 4EB6B 2GSMB 4O4HB 2RCVA 1W0JG 1SA0B 3JYCA 2XAHA 4UCTA 4JI6O 4DR7O 1XHXA 3LNNA 2HHHB 1NH2B 3ABUA 1BQ0A 2IU0A 1V9PA 2A0LA 2IH3C 2OIGA 3WB0A 2IH1C 4JZGA 4DV6B 3A0BZ 4JI8B 1QR8A 4CBCA 3THOA 4CS2A 2PGGA 3CRMA 1LNQA 1JFFB 4DR4B 2Q68A 1EN5A 2EIMC 2PYLA 4OPAA 4DUYB 1JX9A 4D7SA 1XMOB 2WSSG 1VQPV 2KG7B 2H8PC 3APOA 5JQGA 3B09A 1YTFB 3N27A 2XAQA 2FTKA 5C8YB 3JAKA 3OFNG 1JJOA 4NXNB 2F95B 2EIKB 3T1CA 3ZRXA 1H2LA 1VIBA 3IJ4A 4K8ZA 2IM9A 2UXCO 2IJIA 1IBMO 3HKBA 3TXQA 3CXCU 1YCIA 1RSOA 2PI5A 2ITCC 5JH7A 2PF4E 1KUQA 2BTQB 1VF6C 4I0XA 4BAYA 2VQEO 1WB8A 2F1MA 5CA3A 1QVFU 2QM8A 2EULA 4Z2WA 2F4VO 1NU1H 3ZHTA 3JALB 2HLDG 4B3TB 2K1EA 2QJ1A 2X6CA 2E76B 3H1HH 3OMAB 3TJTA 1L8DA 1QNMA 3RN4A 2Q9LA 2HHHO 2UU9B 1XMQB 2GTSA 2YIBD 2HJFC 1F4MA 4JI8O 4MVMA 3D36A 1Q81W 1NT2B 4B3MB 1KBHA 4I55B 2Q73A 2H3OA 2L6LA 3IAYA 3OUFA 5EIBD 3CXHF 3JSNA 4X1IB 3ASOC 1Q43A 5GONA 2VQFO 4YJ2B 1K7DA 2QKAA 2ZE8A 4DUYO 4JAAA 1XMOO 2KB1A 5LGNA 1OHHG 4LNUB 3E83A 4I4TA 4F6EA 3UT5B 4UB6Z 2YXHA 1BCCH 1OCCB 3RYCB 3GWOA 4JI2B 3ABKB 4ZI7A 2LW1A 4J41A 4QPKA 3ZMUA 3N2GB 2OWOA 3FD9A 4CH5A 1B04A 5B3SB 2JDIG 2X6BA 3AK1A 4LF6B 2H94A 5CA0A 3L70H 4JZ2A 4HBNA 5IY5B 1N8RW 4X89A 4LWSA 2NNUA 1SS3A 2Z3YA 1US6A 1RM1C 5KHGA 2EZPA 3RGBA 3RFRA 3JAKB 1Q6HA 4NKGB 3AG2B 1RPRA 2BTOA 2OTJV 4DV1B 2D3OW 5KMGB 3B40A 4B3TO 4B3SB 4O4IA 4IL6Z 1WA8B 2UUAO 2QTSA 1SQFA 1M57C 5FNVA 1MABG 1K3EA 3L9DA 3SJBC 1PV0A 4KL1A 3AG1B 2Q7GA 1DF5A 2RMKB 4FJCC 1IBKB 1DK1A 5A9GA 4IYHA 5JH7B 1GTOA 2X6AA 5K1XA 4I0XB 4B3MO 2OIEA 5CBGA 4JI7B 4WFAV 3ASNB 3WU2Z 1OCOC 3MHHC 3L74H 2LJ2A 4UCRA 4LFAB 4LFCB 2WLIB 1IDSA 2DQ0A 3DGEA 1BQZA 1RPOA 3X2QB 1VQ9V 4AQYB 4Q6GA 1R73A 3BA8A 4Z1MG 4DR2B 4JI2O 2IW5A 4JYYA 1Q82W 1VQNV 5B3SC 3K5NA 1NR7A 1VQ8V 1PM9A 4I7ZB 4N23A 4DV2B 1YJ9V 1R1BA 4LF9O 1AP5A 5GONB 4H13B 4LF6O 3CCQV 2JGDB 4FFKA 1B3QA 3SGIA 1MZEA 3DC6A 3RYIB 2QTOA 2HFEC 3FB7C 3D8CA 4H44B 4JYBA 4LF4B 1GO3F 1E1QG 4DV1O 1KYOF 2VWKA 3BY6A 1KKDA 2ZNJA 2CH7B 1Y74B 4B3SO 5EYPA 5LA6A 5CB4A 1ORQC 4QIWF 3CRQA 3U11A 2CTWA 2G38A 1XI1A 5CA0B 2LFSA 4FM1A 1IBKO 1W0KG 2B1IA 2EILC 2CTPA 1SQXH 4TV9A 4JI7O 3EFFK 1YHQV 3ZHSA 1HNXO 2ZM6B 1PD3A 1K4DC 3K79A 2ETNA 1KP3A 4PD4F 1N34B 1VF7A 1ZL8B 4O4IB 3CCUV 3K59A 4I9QA 1QU7A 2HR3A 1HP8A 4AQYO 2JK5C 2JJ1G 4K0KB 2QWOB 2UUBO 1AR1B 5IYDO 1KU9A 1X59A 1I94B 1FS0G 4DV2O 3RYFA 2DYSC 3VOUA 2ZE6A 3BEHA 3HKDB 1ZWIC 1HR0O 1SZXA 5FLXN 4PI0A 2AHYA 4TT3G 4UVCA 5J9PC 4W4KA 2V4DA 4KHPB 1OCRB 3CJHA 1AP6A 4QJFB 4LF4O 3ICXA 4X65B 1FFXB 2IBZH 4FK5C 4LFBB 4DR3O 1MOFA 1BHBA 3DC5A 4JGSA 1M1KW 4DR6B 3N2KA 2RN9A 3B77A 3SPIA 2M7WA 4JTDB 1XREA 5JVDB 3D3IA 2JEUA 3CC2V 3ZMTA 4ZIBA 1QLNA 1Z2GA 1XQ8A 2YS8A 3NR7A 4EFEA 1JMKC 4FLZA 3KCXA 2ZINA 5LP6B 2ZIMA 4DRXB 2BE3A 4TUYA 2ZM6O 4QPJA 3ABTA 3B8NA 4EB6A 1YJNV 5EYPB 5LA6B 4LBEC 5GW7A 1SA0A 4MTOA 3LDEA 2JEXA 2LP7A 1SC5B 3CSXA 4PA7A 2FYUH 4YY3B 3UM7A 4R50A 3OR6C 4LC1A 1G8MA 3OM3B 1LR1A 1I94O 4IYIA 4MW8A 3G4SV 4GX0A 2YC0A 3UO2A 2YUAA 3ZX6A 1GM8A 2OTLV 1QR9A 3E8HA 1YXBA 4IIJB 1JFFA 1GK9A 2Y4UA 1RFYA 1CP9A 4RUFA 3B4SA 4UVBA 4E2LA 1B6QA 5EBMC 1BL8A 3BA9A 3I56V 2KG7A 4UV9A 1N36B 2Y48A 1K4CC 2XASA 1TVKB 5C8YA 2CTQA 4I9WA 5JJEB 3BAAA 1WN7A 5DECA 2W6IG 2DWDC 1QVGU 1WPBA 4U3FH 1M4UA 2LW7A 1CPYA 4JI4O 1VQMV 1VMGA 1F4NA 4IGGA 3LSQA 4EFBA 2YIDA 4J9ZB 2R72A 4DR6O 4H37A 3LDCA 1PL4A 4P2ZA 2Q6AA 1U97A 1FXKC 1AB3A 2LO1A 3RT3C 4TSFG 2BTQA 2EIMB 2E3CA 5J2TB 5H5NA 3RYHB 3ZMZA 2Q4PA 4X66B 4P30A 1N0NA 2WA4A 3OT7A 3K3WA 4RO2A 3PN1A 2VRZA 3E8BA 1JOYA 4WBNA 2A06H 2UXCB 3P3PA 1P7GA 4DK0A 2F23A 2XAFA 4G28B 3K5OA 1K34A 1SZTA 2WLKA 2DW4A 1SF9A 2ADPA 4I55A 4OPHA 5LGUA 3G71V 1KP2A 4MS2A 3JATA 2BCCH 5JCOC 4X1IA 1YZBA 2F4VB 3K0DA 4IHJB 5LXTB 4PELA 5A2QN 1IX9A 4YJ2A 2UUCB 4NTYA 4F6RA 4HYOA 3OW2U 4DR5O 3TXSA 4LNUA 1NJIW 3CCVV 1N36O 4GCZA 2ZR3A 2QSAA 1XBLA 1WPXA 2HVJC 3UT5A 2QKSA 2R9IA 1R6TA 4UV8A 1H2MA 3RYCA 4LR3A 3AK3A 4J11A 2QM4A 4DK1A 3N2GA 4QGPA 3SYCA 2PY5A 3SYQA 2PI4A 4DYLA 4PDVA 3GVMA 3CEIA 2VQFB 3JSLA 3FFQA 1SESA 4O2AA 4DV0O 4FZ1A 2W0XA 3ZN1A 3H1JH 1I5YA 3ASOB 2FKXA 5LMNB 3ETQA 5B1OA 5KX5A 3BPZA 3LSUA 5K1PA 3ZRVA 2YEVB 5E79Z 4X66O 5AG2A 5KMGA 1DGSA 5CBFA 2ZE5A 1EN4A 1EBOA 4EKWA 3OR7C 1WA8A 2QM7A 3E8GA 2QWNB 1AROP 3MD0A 1H2SB 1ZAUA 3W7SA 4F4LA 3CRCA 2CUGA 4FLWA 1FJGB 4U7NA 3H9VA 3TGUH 2Q8VA 4J7KA 3Q4HB 4Q20A 1NBMG 1NS1A 5L3FA 4WFGA 2WLHA 1RM1B 2UUCO 2IJJA 4O2BB 4DW1A 5IJ9B 3CCSV 2HVKC 2UUAB 4W4LA 4WBNB 1G4YB 4JAUA 1R3LC 2WLIA 4OGQB 3QF7A 4DW0A 4ZBMA 2AHZA 2EINC 3BRCA 1GN4A 4K35A 1Q6UA 1XNQB 2BOCC 1M57B 1S5JA 2R9RB 3L72H 2QA4V 1AVMA 1P7BA 1WAZA 2UXBO 3ZRSA 2OYQA 5L3DA 3JATB 4DV7B 1EN6A 1K9MW 1K5SA 1AILA 2P5OA 1J5EB 4N21A 4F6RB 1ZTEA 2LFRA 3I5DA 1OCOB 1SETA 2JGDA 1VQLV 3TCUA 2AGAA 2Q0OC 3HKCB 5FPRA 1R3KC 5LHIA 2ZD9A 5LMNO 3RYIA 1NTMH 5KLVH 1LUWA 3CWBH 1XEQA 2YSUB 1Z5VA
chains in the Genus database with same CATH topology
1V54C 1E1QG 1KKDA 3BY6A 3QO5A 3CPWU 1EFRG 5L3BA 4TWKA 3TETA 2EINB 4PDMA 2OCCC 1ORQC 2P6JA 3ZRWB 1VQ7V 4WFFA 3ZRWA 3EHBB 1YSCA 1EZJA 4QIWF 5H6QA 1M9NA 1OCZC 2XAJA 1S3JA 3WFVA 3AG3B 5EK0A 3VBBA 4MTXA 5C93A 2LFSA 4I5SA 5B1AC 4JASA 1W0KG 1KECA 2IJKA 3E2EA 3M99B 1AI7A 2B1IA 2EILC 3ZMVA 4RUEA 5LGTA 1KD1W 2ZXWC 3JD1A 3JD3A 1K8AW 3EFFK 2EIJC 1YHQV 1V55B 4LCUC 3T4DA 3JD2A 1PD3A 1K4DC 3SPCA 2P67A 1Q86W 3K79A 1KP3A 1L1FA 4L87A 3K04A 3OE7G 1OCRC 3ETDA 2P7TC 3IGAC 4PDLA 2A79B 3CCUV 1NKDA 3ETGA 3CCRV 3E35A 1IXMA 2HR3A 3P32A 4UXNA 3ABLC 1YIJV 1DLBA 4QNHB 1JCHA 1K5QA 1JVMA 4WCEV 2JK5C 2JJ1G 2W6JG 2OCCB 3HB3B 3K9AA 3E89A 4MTGA 4FMTA 1NVPB 1HWYA 1OCZB 1KC8W 2JJ2G 1AR1B 5IYDO 1KQSU 4PDRA 4JF3A 1R6KA 4BIUA 5H6RA 1FS0G 3OMNB 4KUMA 3E86A 4BIZA 4JTAB 5B1AB 1CEZA 5L3EA 4MTFA 2DYSC 3VOUA 4WFEA 2XOKG 3BEHA 3FB6C 2EILB 5CMUA 3PJSK 4OXSA 4PA3A 2ZXWB 3AG4C 1AI5A 1ZWIC 3B8MA 2DWEC 3F5WC 4XBFA 5EC2C 1E1RG 3CCJV 2MK3A 3MHSC 1Q7YW 2B1GA 1MG1A 3CC4V 2Y69B 1THZA 2AHYA 3CP1A 4TT3G 4UVCA 4X88A 5J9PC 1OCRB 4MVRA 2ZDIC 3ZCCA 4QE7A 1QBZA 4QJFB 4XDLA 1VQOV 1H2GA 2DQ3A 4KFMA 2V1DA 2X7RB 3ABLB 4P9PA 5KA6A 3JD0A 4FK5C 3AG3C 3F7VC 1MOFA 4GT1A 1BHBA 2ITDC 4JGSA 1M1KW 1UJWB 5EBLC 5FL7G 3B77A 3SPIA 5IYCO 1GM7A 2M7WA 3QO7A 4JTDB 3D3IA 4MVOA 3E8FA 5B1BB 2JEUA 3CC2V 3W7WA 3UKMA 3G6EV 3ZMTA 1SRYA 2DYSB 1QLNA 3QO8A 3RVZA 2WLJA 1H38A 3OGCC 1VQ6V 4WFHA 3FB8C 1FXKA 3T4ZA 4MVSA 4QPJA 3ABTA 3SYAA 3B8NA 2GSMB 1YJNV 4ZKIA 3KG2A 2ZDIA 3W7TA 1JPXA 1W0JG 2V7QG 4LBEC 4XDJA 1S76D 5GW7A 3JYCA 4G2KA 2XAHA 4MTOA 3LDEA 2EIKC 4MW3A 2EZOA 2JEXA 2LP7A 2QEXV 5LHHA 1NH2B 3ABUA 3RVYA 4UUJC 2IU0A 4PA7A 3UM7A 4RQFA 4R50A 2A0LA 2WAMA 2IH3C 3OR6C 4R7CA 2IH1C 5CBHA 1FXHA 4LC1A 1G8MA 3OM3B 4DO2A 4MT8A 3OAAG 4MW8A 3G4SV 2XNDG 4GX0A 4GX2A 1QR8A 4CBCA 4MSWC 5DN6G 1GM8A 1LNQA 2OTLV 1QR9A 3T2MA 2Y69C 1QCEA 3E8HA 1M90W 1GK9A 2A9HA 1CP9A 3OEHG 4RUFA 2Q68A 2EIMC 3FYEB 4MVUA 4UVBA 5DM6V 1JX9A 4E2LA 1YI2V 1B6QA 5EBMC 5HFLA 1P4RA 1BL8A 3ETEA 4H33A 2WSSG 1VQPV 3CD6V 2H8PC 3I56V 1DTOA 4UV9A 3SJQC 1YTFB 3CCLV 2XAQA 1K4CC 2Y48A 3IFXA 2XASA 2FTKA 4I9WA 3ZMSA 3OFNG 1H8HG 2EIKB 2Q69A 2W6IG 5KUMA 3T1CA 3ZRXA 5IDJA 2DWDC 1QVGU 1E79G 1JJ2U 1FFTB 3DTUB 1CPYA 1VQMV 1Y4MA 1F4NA 5B1BC 3LSQA 4RAIA 4GX5A 4J9ZB 4U7OA 1BMFG 4G27B 3I55V 1R6NA 3ABMC 4H37A 3LDCA 2WLMA 2UXXA 2IJIA 1K73W 2ZR2A 3CXCU 4P2ZA 3STZC 2Q6AA 1FXKC 4YXWG 2PI5A 2F43G 2ITCC 4TSFG 1YTFD 4J9YB 2EIMB 2W0FC 3A0RA 4BAYA 4X8AA 3K03A 1GM9A 1NR1A 1NVPD 5CA3A 5KA5A 1QVFU 2QM8A 5E1AC 1AJPA 3ZMZA 1I5XA 1SERA 3STLC 5LBQA 4P30A 1R3IC 3RBZA 2HLDG 2K1EA 2X6CA 3K3WA 4RO2A 1FXVA 3OMAB 3E8BA 3CYOA 2CK3G 3ZIAG 1JOYA 4JPRA 1AI6A 1OCCC 4WFBV 4HZ3A 3JCZA 3ABKC 1K97A 3IC7A 2XAFA 4G28B 3H01A 4QE9A 5L3CA 3CC7V 3ABMB 3GB7C 5EC1C 2HJFC 1F4MA 1K34A 1SZTA 2WLKA 3QNEA 4MVMA 3D36A 1Q81W 3TK1A 2DW4A 3K06A 2WWWA 5LGUA 1S72V 3G71V 3OUFA 2IJHA 2BOBC 1KP2A 2QE7G 4MS2A 3OMIB 4XDKA 5IY5C 3LUTB 1FXKB 3ASOC 3K0DA 1JQ0A 3OUSA 1AJQA 2OT5A 2WLLB 4PELA 4R6ZA 2WLLA 1VQ4V 4FIPC 1K7DA 1ROPA 2X0LA 3CMEV 2IU3A 3HPLC 4HYOA 3SPHA 3AG2C 3OW2U 2KB1A 1YITV 5LGNA 1OHHG 3CMAV 1NJIW 4PA6A 2Q67A 4WF9V 3CCVV 4GCZA 3E83A 4CZZA 1F23A 2ZR3A 4BW5A 1WLEA 1VQ5V 2JIZG 4RQEA 3R65A 4R8CA 1WPXA 1AJNA 2HVJC 4KP4A 2QKSA 2R9IA 1OCCB 4DXWA 1Y66A 1VQKV 1PNMA 2B5UA 3GWOA 3JD4A 4UV8A 1H8EG 4JAVA 1GMGA 3ABKB 1S77D 1PNKA 1S0VA 3AG1C 4QPKA 3ZMUA 4ASUG 1PKXA 3P30A 3SYCA 2HKOA 3K08A 4P9OA 5CN0A 3SYQA 2PI4A 4GX1A 4PDVA 1XL6A 4FPPA 5B3SB 2JDIG 2X6BA 3W7UA 1SESA 2H94A 1DF4A 3ASNC 5IY5B 1N8RW 3ZN1A 2XAGA 1F51A 2EJRA 1I5YA 1K92A 4X89A 3ASOB 2NNUA 1NH2D 2Z3YA 1M56C 5B1OA 1RM1C 2EZPA 3AEIA 2HG5C 3ZRVA 1K33A 3AG2B 1RPRA 2DYRC 2YEVB 2YEVA 2OTJV 4JYCA 2ATKC 2D3OW 1BHAA 3CCMV 1J95A 3X2QC 5CBFA 4HAMA 2WLNA 1EBOA 4EKWA 3OR7C 1V54B 3FYIB 3ZN0A 1M57C 1XL4A 2QM7A 1MABG 1K3EA 3WG7C 3E8GA 3SYPA 1AROP 3FB5C 1R3JC 3MD0A 3W7SA 4F4LA 3AG1B 1DF5A 2C2AA 4FJCC 3K0GA 4U7NA 1GTOA 5H9CA 2X6AA 5B1NA 4JTCB 5CBGA 4MVQA 2Z5UA 4Q20A 4WFAV 3ASNB 1S5HC 1ENVA 1NBMG 1OCOC 3MHHC 4PA9A 3SPJA 2NLJC 1AI4A 3ZJZA 2ZQMA 5L3FA 4UVAA 4WFGA 5LHGA 2P90A 2WLHA 1M56B 1RM1B 2UXNA 5L3GA 2IJJA 3SYOA 3RW0A 1QLEC 5KUKA 2EIJB 3CCEV 3CCSV 2HVKC 2DYRB 1G4YB 2WLIB 3W7XA 4JAUA 1R3LC 2WLIA 4LP8A 2DQ0A 3DGEA 4ZBMA 1NQTA 1RPOA 3X2QB 1VQ9V 2AHZA 3F7YC 2EINC 3NXSA 1R73A 5EBWC 2BOCC 4Z1MG 1M57B 2GHYA 3WG7B 2R9RB 2IW5A 1Q82W 2QA4V 1P7BA 1PL0A 1VQNV 3ZRSA 3FKSG 5B3SC 1YJWV 3SPGA 1COWG 1NR7A 2EBOA 1VQ8V 4N23A 1W2BU 5L3DA 1MSWD 1K9MW 1YJ9V 1GKFA 1K5SA 5HFMA 3LDDA 1OZ0A 4N21A 3LSSA 3CCQV 2LFRA 1VQLV 1OCOB 1SETA 3TCUA 1V55C 3ML0A 1R3KC 5LHIA 2ZD9A 2QTOA 4PA4A 3AG4B 1TUEB 2HFEC 1QLEB 5BZBA 3OEEG 2WPDG 3FB7C 1PNLA 2YSUB 4MVZA 3LNMB 4JYBA 5IYBO 1GO3F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 C;  2ITD C;  1M56 C;  1KKD A;  5EBL C;  4P2Z A;  3STZ C;  2Q6A A;  2HG5 C;  3SPI A;  4TWK A;  3TET A;  2ITC C;  4PDM A;  4J9Y B;  2DYR C;  1ORQ C;  2OCC C;  4JTD B;  2YEV A;  4WFF A;  4MVO A;  3E8F A;  2ATK C;  2W0F C;  1OCZ C;  4X8A A;  3UKM A;  1J95 A;  3K03 A;  3X2Q C;  5CBF A;  2WLN A;  5E1A C;  5EK0 A;  4EKW A;  3OR7 C;  3STL C;  3RVZ A;  1M57 C;  1XL4 A;  2WLJ A;  3WG7 C;  4P30 A;  1R3I C;  3OGC C;  3E8G A;  5B1A C;  3RBZ A;  3SYP A;  2K1E A;  3FB5 C;  1R3J C;  2X6C A;  3FB8 C;  4RO2 A;  4WFH A;  4F4L A;  2EIL C;  3T4Z A;  3E8B A;  4MVS A;  4RUE A;  1OCC C;  2ZXW C;  4HZ3 A;  3SYA A;  3K0G A;  3EFF K;  3KG2 A;  2EIJ C;  3ABK C;  4LBE C;  2X6A A;  4XDJ A;  4LCU C;  3JYC A;  3T4D A;  4JTC B;  1K4D C;  4MTO A;  3SPC A;  5CBG A;  3LDE A;  4MVQ A;  2EIK C;  4G28 B;  4MW3 A;  4QE9 A;  3K04 A;  1S5H C;  1OCO C;  1OCR C;  3GB7 C;  2HJF C;  4PA9 A;  5EC1 C;  3SPJ A;  2WLK A;  2NLJ C;  4MVM A;  3RVY A;  2P7T C;  3IGA C;  4PDL A;  4UUJ C;  2A79 B;  3ZJZ A;  4PA7 A;  3K06 A;  4WFG A;  3UM7 A;  4R50 A;  2A0L A;  2WLH A;  2IH3 C;  3OR6 C;  4R7C A;  3OUF A;  4XDK A;  2IH1 C;  2BOB C;  3ABL C;  4MS2 A;  3RW0 A;  3SYO A;  4QNH B;  3LUT B;  5CBH A;  5IY5 C;  1QLE C;  5KUK A;  1JVM A;  2JK5 C;  3ASO C;  2HVK C;  3K0D A;  3OUS A;  4MW8 A;  1G4Y B;  2WLL B;  4GX0 A;  3E89 A;  2WLL A;  4GX2 A;  4MTG A;  2WLI B;  4R6Z A;  4LP8 A;  1R3L C;  2WLI A;  4CBC A;  4MSW C;  4ZBM A;  4PDR A;  2AHZ A;  3F7Y C;  3HPL C;  1LNQ A;  2EIN C;  4HYO A;  3SPH A;  2Y69 C;  3AG2 C;  2KB1 A;  3E8H A;  5EBW C;  3T2M A;  2A9H A;  2BOC C;  4RUF A;  2Q68 A;  2EIM C;  3E86 A;  2R9R B;  4JTA B;  4MVU A;  2Q67 A;  4PA6 A;  1P7B A;  3E83 A;  4MTF A;  2DYS C;  3VOU A;  4WFE A;  5EBM C;  4BW5 A;  3BEH A;  3FB6 C;  3ZRS A;  3PJS K;  1BL8 A;  4OXS A;  3R65 A;  4H33 A;  2HVJ C;  4PA3 A;  4R8C A;  3SPG A;  2QKS A;  4DXW A;  3AG4 C;  2H8P C;  1ZWI C;  3F5W C;  2DWE C;  3SJQ C;  5EC2 C;  1K4C C;  3IFX A;  3LDD A;  3AG1 C;  4I9W A;  2AHY A;  3SYC A;  3T1C A;  2Q69 A;  3K08 A;  4P9O A;  5KUM A;  3SYQ A;  4X88 A;  2DWD C;  5J9P C;  4MVR A;  4GX1 A;  4PDV A;  1XL6 A;  3TCU A;  4QE7 A;  1V55 C;  1R3K C;  4XDL A;  2X6B A;  4KFM A;  5B1B C;  2ZD9 A;  4RAI A;  2QTO A;  4GX5 A;  4PA4 A;  4J9Z B;  5B3S C;  4G27 B;  3ASN C;  4P9P A;  2HFE C;  3ABM C;  4H37 A;  5BZB A;  3LDC A;  4X89 A;  3FB7 C;  2WLM A;  4MVZ A;  3LNM B;  3AG3 C;  3F7V C; 
#chains in the Genus database with same CATH topology
 2CH7 A;  1RP3 B;  1Y74 A;  1Q6I A;  3TET A;  2OCC C;  3ZRW B;  4WFF A;  3EHB B;  1EZJ A;  1M9N A;  4LF9 B;  1OCZ C;  2XAJ A;  2KQX A;  1GN2 A;  3DXR B;  5EK0 A;  3VBB A;  4O2A B;  4YJ3 A;  3VQY A;  5C93 A;  1FJG O;  2K9P A;  4I5S A;  5B1A C;  1FPO A;  2IJK A;  3M99 B;  2YIA A;  3ZMV A;  3AG7 A;  5KX5 B;  1KD1 W;  2ZXW C;  5KAF Z;  1M5I A;  3RWR D;  2P67 A;  1Q86 W;  3CE2 A;  1ZL8 A;  3VQW A;  3E22 B;  1NTZ H;  1YIJ V;  4QNH B;  5J2U B;  1K5Q A;  1JVM A;  3C3T A;  3GWK C;  2W6J G;  3ZHR A;  4H0L B;  1XNQ O;  3HB3 B;  4MTG A;  1L0L H;  1MA1 A;  4U3J B;  1HWY A;  1URF A;  2JJ2 G;  2PYJ A;  1KQS U;  1R6K A;  4BIU A;  2GBO A;  3QG5 A;  1XUQ A;  4ABM A;  4GKK B;  2ILM A;  4KUM A;  3E86 A;  3BFR A;  4BIZ A;  4DV7 O;  4JTA B;  4Z1V A;  1CEZ A;  1HNX B;  3FB6 C;  2EIL B;  3PJS K;  1J5E O;  3F5W C;  3HKD A;  5LMU O;  2KSD A;  5EC2 C;  1E1R G;  2GDS A;  3CCJ V;  3K5M A;  2XUM A;  2Y69 B;  1THZ A;  2DN9 A;  2YIB A;  4X20 B;  2Q7E A;  4UCV A;  2DQ3 A;  1IUR A;  2UUB B;  3L71 H;  1FFX A;  4PHZ A;  3F7V C;  1H2N A;  2VWJ A;  2ITD C;  5EBL C;  5IYC O;  4JYA B;  2L35 A;  3QO7 A;  3WB2 A;  4B3R O;  2GTA A;  3E8F A;  5JVD A;  1HR0 B;  5BMV B;  2DYS B;  3QO8 A;  3CHX A;  4GLX A;  4E4E A;  3KZI Z;  4DR1 O;  1H38 A;  5IWA B;  1VQ6 V;  2FML A;  1FXK A;  1KKC A;  3T4Z A;  4DRX A;  5LP6 A;  4MVS A;  2RJZ A;  3KG2 A;  2ZDI A;  2ZE7 A;  2V7Q G;  5KHJ A;  4XDJ A;  1S76 D;  1NTK H;  4DR3 B;  5H2F Z;  1IVS A;  3RVY A;  3FX7 A;  1ZSP A;  2QWQ B;  4YJ3 B;  3EXA A;  2Y0P A;  5D5P A;  4MT8 A;  3OAA G;  2P22 C;  4GKK O;  4GX2 A;  1BT8 A;  1N0J A;  2NN4 A;  4MSW C;  5DN6 G;  1MMM A;  2B9Z A;  3T2M A;  1M90 W;  2Y69 C;  1O9H A;  2A9H A;  4IIJ A;  1BSM A;  1SKV A;  1O9G A;  4NYK A;  1YI2 V;  4BW9 A;  1Y67 A;  5JCO A;  5HFL A;  3ETE A;  4H33 A;  3CD6 V;  4OX9 B;  3ZHQ A;  1KMI Z;  3IFX A;  4CS4 A;  1TVK A;  3ZMS A;  5IYZ B;  3UQ8 A;  5JJN B;  2QDO A;  2Q69 A;  1FYJ A;  2LGW A;  1FFT B;  1Y4M A;  4DUZ O;  4RAI A;  4GX5 A;  5KHK A;  4U7O A;  1BMF G;  4G27 B;  1R6N A;  3ABM C;  3D36 C;  2WLM A;  3R66 A;  4JYA O;  2UXX A;  2GUZ A;  4GKJ B;  3WB1 A;  1EZV H;  4K3A A;  3BAB A;  1YTF D;  1I0H A;  2W0F C;  4X8A A;  3ZHV A;  3K03 A;  5IWA O;  1NVP D;  5KA5 A;  5J2T A;  3RYH A;  1M93 A;  4UB8 Z;  2XT9 A;  5LBQ A;  4JI4 B;  3KCY A;  1FXV A;  2R70 A;  1U96 A;  1A32 A;  3UO3 A;  4FFB A;  3B2E E;  4HZ3 A;  5ITZ B;  4NTW A;  1GN6 A;  5LYJ B;  1K97 A;  1Q8I A;  3IC7 A;  3H01 A;  3CC7 V;  3GB7 C;  3QNE A;  3TK1 A;  2JS5 A;  1AR4 A;  2QE7 G;  3OMI B;  3LUT B;  1FXK B;  4FZ0 A;  4IHJ A;  1AJQ A;  2OT5 A;  2WLL B;  4R6Z A;  5LXT A;  1VQ4 V;  1VF6 A;  4HNA B;  4FIP C;  3CME V;  1ROP A;  3BCC H;  2IU3 A;  3JAS B;  2ADQ B;  4OX9 O;  1G6U A;  4PA6 A;  4WF9 V;  4CZZ A;  1F23 A;  4BW5 A;  1WLE A;  3HR0 A;  4R8C A;  3R65 A;  1VQK V;  3L75 H;  3F5T A;  3CS5 A;  4DXW A;  1PNM A;  2B5U A;  3JD4 A;  1H8E G;  4JAV A;  1SQP H;  2AW9 A;  1PNK A;  4ASU G;  2GV9 A;  1ZX3 A;  1IBL B;  4P9O A;  1XL6 A;  2RDC A;  4FPP A;  5IT9 N;  4J80 A;  1DF4 A;  4GKJ O;  1TA8 A;  1K92 A;  4GYC B;  4DR5 B;  1FD9 A;  2P4K A;  2HP8 A;  1M56 C;  1CXZ B;  2ZT9 B;  3AEI A;  2FL4 A;  2DYR C;  2YEV A;  2ATK C;  1SQV H;  1VP7 A;  3CCM V;  4HAM A;  2WLN A;  2YI9 A;  1V54 B;  3ZN0 A;  1XL4 A;  1B06 A;  3WG7 C;  3SYP A;  2GUZ B;  3APQ A;  2C2A A;  4DV0 B;  1HNW B;  4X1K A;  5F2V O;  2D2C B;  5B1N A;  1UPG A;  1WB7 A;  2CE4 A;  3JAW B;  3Q4H A;  1S5H C;  4PA9 A;  1AI4 A;  4UVA A;  1GRJ A;  5LHG A;  2UXN A;  4O2B A;  5IJ9 A;  1QLE C;  2N05 A;  3T1Y B;  4TV8 A;  1MSD A;  2A7W A;  1WJZ A;  4FFB B;  2AZ0 A;  1YVW A;  4LP8 A;  1OJH A;  4PV1 B;  3F7Y C;  3NXS A;  1Z5W A;  4X62 B;  2DMX A;  3K9S A;  1COW G;  3CX5 F;  1IBL O;  2JGU A;  4X9Q A;  1TUB B;  3L73 H;  4UCU A;  5DED A;  1OZ0 A;  3LSS A;  4J10 A;  4O4J B;  1V55 C;  3ML0 A;  3HKC A;  5IE9 A;  4PA4 A;  3AG4 B;  1LUV A;  5BZB A;  2WPD G;  1PNL A;  1V54 C;  1NZ6 A;  2YXY A;  2Y0I A;  3QO5 A;  4LF7 O;  4ZHQ A;  5L3B A;  2UXB B;  4NVP A;  2EIN B;  1Y76 B;  2P6J A;  1VQ7 V;  3ZRW A;  3MDS A;  4FLT A;  2DOS A;  3WFV A;  3DXR A;  4MTX A;  4CH4 A;  2JRI A;  1HNW O;  4JAS A;  4ZOL A;  4RUE A;  5LGT A;  1YDX A;  3JD1 A;  1BZK A;  2EJ7 A;  1K8A W;  3CRR A;  4O4L B;  4X64 O;  4D6T H;  3T4D A;  4L87 A;  3K04 A;  1T5E A;  3OE7 G;  3JCU Z;  3ETD A;  1SQB H;  4PDL A;  2A79 B;  3SJC C;  3E22 A;  3T1Y O;  1NKD A;  3CCR V;  1IXM A;  4UFZ A;  4UXN A;  4LF8 B;  3ABL C;  1JCH A;  5J2U A;  3JAM N;  1HDJ A;  5GTH Z;  4WCE V;  3OTO O;  1G1X B;  2OCC B;  4X1K B;  4PJ0 Z;  4U3J A;  1NVP B;  1OCZ B;  4X62 O;  4PDR A;  5KAI Z;  1XIL A;  5H6R A;  3VQV A;  1OV9 A;  3OMN B;  1PP9 H;  3G80 A;  5B1A B;  3JAR B;  4AI8 A;  2RNB A;  5CMU A;  3ZBH A;  4OXS A;  4PA3 A;  1ZLZ A;  2Z0A A;  3M8A A;  1F7Y A;  2ZXW B;  3AG4 C;  1AI5 A;  3B8M A;  4J7Z A;  4XBF A;  3T1H B;  1Q7Y W;  4TV8 B;  1VF5 B;  2CGN A;  2ZNI A;  2FB5 A;  5LOV B;  1Y6X A;  3AK2 A;  4TOI A;  2P06 A;  4X20 A;  4MVR A;  3K58 A;  4QE7 A;  1QBZ A;  4KXR A;  4XDL A;  4X1Y A;  1H2G A;  4L8J A;  4NXM O;  3K5L A;  2DJV A;  4P9P A;  4AIL C;  3BHP A;  5KA6 A;  1JA8 A;  2E74 B;  1WP7 A;  1GAX A;  2CDY A;  4GT1 A;  5TIS Z;  2CTR A;  3KKY A;  3K57 A;  1QHT A;  3VQX A;  3EVK A;  4MVO A;  5B1B B;  1AR5 A;  5LMU B;  1I08 A;  4CC5 A;  2O57 A;  3W7W A;  5BMV A;  4DV6 O;  4GZR B;  1FKA O;  3HKE B;  3RVZ A;  4A5U B;  5CA1 B;  2WLJ A;  5IJ0 B;  3OGC C;  4LH7 A;  5BR8 B;  4DR4 O;  5JWP A;  4ZHQ B;  4ZKI A;  3W7T A;  1JPX A;  2HJD A;  4TQD A;  3SJA C;  4G2K A;  4I50 A;  1WNS A;  1BE3 H;  2EIK C;  4MW3 A;  2EZO A;  4JI3 B;  4LF8 O;  2QEX V;  1MZF A;  5LHH A;  3D3Q A;  4UUJ C;  3O65 A;  2E5L B;  4BR6 A;  3J81 N;  4B3R B;  4RQF A;  4YHH B;  2WAM A;  4NXN O;  4R7C A;  2LQT A;  2MW2 B;  4ZOL B;  5CBH A;  1FXH A;  1L0N H;  3S3W A;  4DO2 A;  2Q0A A;  4DR1 B;  2XND G;  4GUN A;  1XNR B;  4JI1 B;  1QCE A;  3OEH G;  3M7M X;  3FYE B;  5GTI Z;  4MVU A;  2QWP B;  5DM6 V;  3T1H O;  1Q3E A;  1P4R A;  4EEQ A;  5JQG B;  1DTO A;  3SJQ C;  4NB5 A;  3CCL V;  2HEP A;  5IYZ A;  1H8H G;  3A2F A;  5IDJ A;  5KUM A;  2QR4 A;  1JJ2 U;  1E79 G;  3U10 A;  3DTU B;  2EX3 A;  1HW7 A;  1NI8 A;  2F93 B;  5B1B C;  2PZS A;  3I55 V;  2LGQ A;  2UU9 O;  3P3N A;  4JV5 B;  5KHI A;  3QTC A;  1XMQ O;  3HKB B;  1K73 W;  2ZR2 A;  4JI0 B;  3DSQ A;  3STZ C;  5EZY A;  1RSO B;  4YXW G;  5BXZ A;  4ICG A;  2M6Y A;  1IZ3 A;  2F43 G;  1H2K A;  3O9O A;  4J9Y B;  4DV5 B;  1N32 B;  4YIO A;  3FAV A;  3A0R A;  1GM9 A;  1NR1 A;  5B66 Z;  4X1Y B;  2OCH A;  5BR8 O;  5E1A C;  1AJP A;  1ZUQ A;  1I5X A;  2CAZ C;  2NR5 A;  1SER A;  1D2D A;  2AXT Z;  3STL C;  3QVN A;  1MNG A;  1R3I C;  3RBZ A;  4DUZ B;  1W59 A;  2UXD B;  3CYO A;  2CK3 G;  3ZIA G;  4JPR A;  1AI6 A;  1OCC C;  4WFB V;  4JI3 O;  5ITZ A;  3A8T A;  3CRA A;  3JCZ A;  3ABK C;  2E5L O;  1S5L Z;  5LYJ A;  4CS3 A;  3A0H Z;  4YHH O;  4QE9 A;  3OD4 A;  5L3C A;  3G6B A;  3ABM B;  5EC1 C;  1XOU A;  3K06 A;  2WWW A;  2RQ6 A;  1S72 V;  1XNR O;  4XDK A;  2IJH A;  2BOB C;  5IY5 C;  4JI1 O;  3H1K H;  1JQ0 A;  3OUS A;  1HNZ B;  2WLL A;  4HNA A;  2X0L A;  2PUS A;  4I50 B;  3HPL C;  2ZKO A;  3SPH A;  5KHH A;  3AG2 C;  1YIT V;  4LF5 B;  3JAS A;  4PI2 A;  2QKC A;  2Q7H A;  3CMA V;  3BVO A;  2Q67 A;  4I4T B;  2QWR B;  2R9A A;  1VQ5 V;  2JIZ G;  4RQE A;  4KP4 A;  1AJN A;  4J42 A;  1Y66 A;  4DV4 B;  1N4C A;  4ZI7 B;  1GMG A;  1S77 D;  1S0V A;  3AG1 C;  1PKX A;  5B5E Z;  3P30 A;  2HKO A;  3K08 A;  5CN0 A;  4GX1 A;  1TAE A;  4AHC A;  4JV5 O;  3W7U A;  3ASN C;  4J7J A;  4JI0 O;  1VAR A;  2XAG A;  1F51 A;  2EJR A;  1I7F A;  1D5N A;  4LWS B;  1NH2 D;  4DV5 O;  1N32 O;  1Q90 D;  2HG5 C;  2DE0 X;  1K33 A;  4JYC A;  1BHA A;  3UCS C;  1J95 A;  3SDL A;  3X2Q C;  2CGO A;  1SQQ H;  4LFA O;  4LFC O;  1UFI A;  3MAQ A;  2UXD O;  1PPJ H;  3FYI B;  1VEW A;  5FNV B;  4B7E A;  4FLU A;  5JJJ B;  2N74 A;  1P49 A;  4JI5 B;  3FB5 C;  1JR9 A;  1R3J C;  2Q5Z A;  4BWA A;  1XHZ A;  4DR2 O;  5EZY B;  3K0G A;  1SQG A;  5H9C A;  4JTC B;  3FAV B;  4MVQ A;  2Z5U A;  3JAW A;  1GH6 A;  2BSK A;  3SPJ A;  1ENV A;  3ZS8 C;  1N33 B;  2NLJ C;  3ZJZ A;  2ZQM A;  1HNZ O;  1YF2 A;  2P90 A;  1M56 B;  3OTF A;  5L3G A;  3SYO A;  3RW0 A;  2F66 C;  5LL6 Y;  3U0Z A;  5KUK A;  2EIJ B;  3CCE V;  2DYR B;  4LF5 O;  4D7T A;  3SR2 C;  1Q5O A;  3W7X A;  4CH3 A;  1NQT A;  2YDE A;  5EBW C;  2GHY A;  4DV4 O;  3WG7 B;  1P84 F;  2YI8 A;  2XHB A;  2ODM A;  1PL0 A;  3FKS G;  1YJW V;  3SPG A;  2EBO A;  1W2B U;  1MSW D;  1TUB A;  1GKF A;  5HFM A;  5BY1 A;  3LDD A;  4DV3 B;  2ARH A;  2PTM A;  4UCS A;  4O4J A;  3IC9 A;  3C3S A;  1TUE B;  3G67 A;  1QLE B;  3OEE G;  2YIC A;  1D5A A;  4MVZ A;  3LNM B;  5IYB O;  1EM1 A;  2JS3 A;  3CPW U;  1EFR G;  1N34 O;  4O4H A;  4TWK A;  4PDM A;  5CB4 B;  2YXL A;  1Y76 A;  5D5Q A;  1YSC A;  2A3Q A;  2Y4T A;  5H6Q A;  4JI5 O;  1S3J A;  3AG3 B;  1KB9 F;  4K0K O;  1TGO A;  3OGI B;  4K8X A;  1KEC A;  1IXB A;  4BIO A;  3J7A U;  3E2E A;  1AI7 A;  3H1L H;  2VS0 A;  1FAF A;  4TV9 B;  2KKW A;  3JD3 A;  1N33 O;  2EIJ C;  1YEW A;  1V55 B;  4O4L A;  4LCU C;  4CH6 A;  2JVD A;  3JD2 A;  3SPC A;  4LF7 B;  1L1F A;  1BS3 A;  1OCR C;  2E75 B;  2P7T C;  3IGA C;  4FLY A;  2WA3 A;  4B7K A;  4JI6 B;  3ETG A;  2N04 A;  5EIB C;  3E35 A;  4IT5 A;  4DR7 B;  3P32 A;  1GN3 A;  1DLB A;  4KHP O;  1X4T A;  4X65 O;  3K9A A;  3E89 A;  4FMT A;  1KC8 W;  3ZED A;  2ZCE A;  4NTX A;  4JF3 A;  4LFB O;  2XTA A;  2BSK B;  3RYF B;  4FVM A;  5L3E A;  4MTF A;  3JAR A;  4X64 B;  4WFE A;  2XOK G;  4DV3 O;  3ZHU A;  3J80 N;  4FM0 A;  2DWE C;  4FLX A;  1XDC A;  2MK3 A;  3MHS C;  2B1G A;  2QGN A;  1MG1 A;  5LP6 C;  3CC4 V;  3CP1 A;  5LOV A;  4X88 A;  3CJH B;  5FPO A;  4CC6 A;  2ZDI C;  3ZCC A;  3OTO B;  3S3X A;  1VQO V;  3C90 A;  1BGY H;  4KFM A;  2V1D A;  4TQF A;  2X7R B;  3ABL B;  3JAL A;  3JD0 A;  3CB2 A;  3AG3 C;  4C7U A;  3N2K B;  4LH6 A;  1UJW B;  5FL7 G;  1QQC A;  3H1I H;  1GM7 A;  2ZIO A;  1IBM B;  4YY3 O;  4RWU A;  2P4V A;  4FM2 A;  3UKM A;  4NR1 A;  3G6E V;  1SRY A;  4YIP A;  3HKE A;  1WP8 A;  5CA1 A;  2VQE B;  5IJ0 A;  4FLV A;  4WFH A;  3FB8 C;  2AZ2 A;  4TUY B;  4B08 A;  4UCO A;  4NXM B;  3SYA A;  4EB6 B;  2GSM B;  4O4H B;  2RCV A;  1W0J G;  1SA0 B;  3JYC A;  2XAH A;  4UCT A;  4JI6 O;  4DR7 O;  1XHX A;  3LNN A;  2HHH B;  1NH2 B;  3ABU A;  1BQ0 A;  2IU0 A;  1V9P A;  2A0L A;  2IH3 C;  2OIG A;  3WB0 A;  2IH1 C;  4JZG A;  4DV6 B;  3A0B Z;  4JI8 B;  1QR8 A;  4CBC A;  3THO A;  4CS2 A;  2PGG A;  3CRM A;  1LNQ A;  1JFF B;  4DR4 B;  2Q68 A;  1EN5 A;  2EIM C;  2PYL A;  4OPA A;  4DUY B;  1JX9 A;  4D7S A;  1XMO B;  2WSS G;  1VQP V;  2KG7 B;  2H8P C;  3APO A;  5JQG A;  3B09 A;  1YTF B;  3N27 A;  2XAQ A;  2FTK A;  5C8Y B;  3JAK A;  3OFN G;  1JJO A;  4NXN B;  2F95 B;  2EIK B;  3T1C A;  3ZRX A;  1H2L A;  1VIB A;  3IJ4 A;  4K8Z A;  2IM9 A;  2UXC O;  2IJI A;  1IBM O;  3HKB A;  3TXQ A;  3CXC U;  1YCI A;  1RSO A;  2PI5 A;  2ITC C;  5JH7 A;  2PF4 E;  1KUQ A;  2BTQ B;  1VF6 C;  4I0X A;  4BAY A;  2VQE O;  1WB8 A;  2F1M A;  5CA3 A;  1QVF U;  2QM8 A;  2EUL A;  4Z2W A;  2F4V O;  1NU1 H;  3ZHT A;  3JAL B;  2HLD G;  4B3T B;  2K1E A;  2QJ1 A;  2X6C A;  2E76 B;  3H1H H;  3OMA B;  3TJT A;  1L8D A;  1QNM A;  3RN4 A;  2Q9L A;  2HHH O;  2UU9 B;  1XMQ B;  2GTS A;  2YIB D;  2HJF C;  1F4M A;  4JI8 O;  4MVM A;  3D36 A;  1Q81 W;  1NT2 B;  4B3M B;  1KBH A;  4I55 B;  2Q73 A;  2H3O A;  2L6L A;  3IAY A;  3OUF A;  5EIB D;  3CXH F;  3JSN A;  4X1I B;  3ASO C;  1Q43 A;  5GON A;  2VQF O;  4YJ2 B;  1K7D A;  2QKA A;  2ZE8 A;  4DUY O;  4JAA A;  1XMO O;  2KB1 A;  5LGN A;  1OHH G;  4LNU B;  3E83 A;  4I4T A;  4F6E A;  3UT5 B;  4UB6 Z;  2YXH A;  1BCC H;  1OCC B;  3RYC B;  3GWO A;  4JI2 B;  3ABK B;  4ZI7 A;  2LW1 A;  4J41 A;  4QPK A;  3ZMU A;  3N2G B;  2OWO A;  3FD9 A;  4CH5 A;  1B04 A;  5B3S B;  2JDI G;  2X6B A;  3AK1 A;  4LF6 B;  2H94 A;  5CA0 A;  3L70 H;  4JZ2 A;  4HBN A;  5IY5 B;  1N8R W;  4X89 A;  4LWS A;  2NNU A;  1SS3 A;  2Z3Y A;  1US6 A;  1RM1 C;  5KHG A;  2EZP A;  3RGB A;  3RFR A;  3JAK B;  1Q6H A;  4NKG B;  3AG2 B;  1RPR A;  2BTO A;  2OTJ V;  4DV1 B;  2D3O W;  5KMG B;  3B40 A;  4B3T O;  4B3S B;  4O4I A;  4IL6 Z;  1WA8 B;  2UUA O;  2QTS A;  1SQF A;  1M57 C;  5FNV A;  1MAB G;  1K3E A;  3L9D A;  3SJB C;  1PV0 A;  4KL1 A;  3AG1 B;  2Q7G A;  1DF5 A;  2RMK B;  4FJC C;  1IBK B;  1DK1 A;  5A9G A;  4IYH A;  5JH7 B;  1GTO A;  2X6A A;  5K1X A;  4I0X B;  4B3M O;  2OIE A;  5CBG A;  4JI7 B;  4WFA V;  3ASN B;  3WU2 Z;  1OCO C;  3MHH C;  3L74 H;  2LJ2 A;  4UCR A;  4LFA B;  4LFC B;  2WLI B;  1IDS A;  2DQ0 A;  3DGE A;  1BQZ A;  1RPO A;  3X2Q B;  1VQ9 V;  4AQY B;  4Q6G A;  1R73 A;  3BA8 A;  4Z1M G;  4DR2 B;  4JI2 O;  2IW5 A;  4JYY A;  1Q82 W;  1VQN V;  5B3S C;  3K5N A;  1NR7 A;  1VQ8 V;  1PM9 A;  4I7Z B;  4N23 A;  4DV2 B;  1YJ9 V;  1R1B A;  4LF9 O;  1AP5 A;  5GON B;  4H13 B;  4LF6 O;  3CCQ V;  2JGD B;  4FFK A;  1B3Q A;  3SGI A;  1MZE A;  3DC6 A;  3RYI B;  2QTO A;  2HFE C;  3FB7 C;  3D8C A;  4H44 B;  4JYB A;  4LF4 B;  1GO3 F;  1E1Q G;  4DV1 O;  1KYO F;  2VWK A;  3BY6 A;  1KKD A;  2ZNJ A;  2CH7 B;  1Y74 B;  4B3S O;  5EYP A;  5LA6 A;  5CB4 A;  1ORQ C;  4QIW F;  3CRQ A;  3U11 A;  2CTW A;  2G38 A;  1XI1 A;  5CA0 B;  2LFS A;  4FM1 A;  1IBK O;  1W0K G;  2B1I A;  2EIL C;  2CTP A;  1SQX H;  4TV9 A;  4JI7 O;  3EFF K;  1YHQ V;  3ZHS A;  1HNX O;  2ZM6 B;  1PD3 A;  1K4D C;  3K79 A;  2ETN A;  1KP3 A;  4PD4 F;  1N34 B;  1VF7 A;  1ZL8 B;  4O4I B;  3CCU V;  3K59 A;  4I9Q A;  1QU7 A;  2HR3 A;  1HP8 A;  4AQY O;  2JK5 C;  2JJ1 G;  4K0K B;  2QWO B;  2UUB O;  1AR1 B;  5IYD O;  1KU9 A;  1X59 A;  1I94 B;  1FS0 G;  4DV2 O;  3RYF A;  2DYS C;  3VOU A;  2ZE6 A;  3BEH A;  3HKD B;  1ZWI C;  1HR0 O;  1SZX A;  5FLX N;  4PI0 A;  2AHY A;  4TT3 G;  4UVC A;  5J9P C;  4W4K A;  2V4D A;  4KHP B;  1OCR B;  3CJH A;  1AP6 A;  4QJF B;  4LF4 O;  3ICX A;  4X65 B;  1FFX B;  2IBZ H;  4FK5 C;  4LFB B;  4DR3 O;  1MOF A;  1BHB A;  3DC5 A;  4JGS A;  1M1K W;  4DR6 B;  3N2K A;  2RN9 A;  3B77 A;  3SPI A;  2M7W A;  4JTD B;  1XRE A;  5JVD B;  3D3I A;  2JEU A;  3CC2 V;  3ZMT A;  4ZIB A;  1QLN A;  1Z2G A;  1XQ8 A;  2YS8 A;  3NR7 A;  4EFE A;  1JMK C;  4FLZ A;  3KCX A;  2ZIN A;  5LP6 B;  2ZIM A;  4DRX B;  2BE3 A;  4TUY A;  2ZM6 O;  4QPJ A;  3ABT A;  3B8N A;  4EB6 A;  1YJN V;  5EYP B;  5LA6 B;  4LBE C;  5GW7 A;  1SA0 A;  4MTO A;  3LDE A;  2JEX A;  2LP7 A;  1SC5 B;  3CSX A;  4PA7 A;  2FYU H;  4YY3 B;  3UM7 A;  4R50 A;  3OR6 C;  4LC1 A;  1G8M A;  3OM3 B;  1LR1 A;  1I94 O;  4IYI A;  4MW8 A;  3G4S V;  4GX0 A;  2YC0 A;  3UO2 A;  2YUA A;  3ZX6 A;  1GM8 A;  2OTL V;  1QR9 A;  3E8H A;  1YXB A;  4IIJ B;  1JFF A;  1GK9 A;  2Y4U A;  1RFY A;  1CP9 A;  4RUF A;  3B4S A;  4UVB A;  4E2L A;  1B6Q A;  5EBM C;  1BL8 A;  3BA9 A;  3I56 V;  2KG7 A;  4UV9 A;  1N36 B;  2Y48 A;  1K4C C;  2XAS A;  1TVK B;  5C8Y A;  2CTQ A;  4I9W A;  5JJE B;  3BAA A;  1WN7 A;  5DEC A;  2W6I G;  2DWD C;  1QVG U;  1WPB A;  4U3F H;  1M4U A;  2LW7 A;  1CPY A;  4JI4 O;  1VQM V;  1VMG A;  1F4N A;  4IGG A;  3LSQ A;  4EFB A;  2YID A;  4J9Z B;  2R72 A;  4DR6 O;  4H37 A;  3LDC A;  1PL4 A;  4P2Z A;  2Q6A A;  1U97 A;  1FXK C;  1AB3 A;  2LO1 A;  3RT3 C;  4TSF G;  2BTQ A;  2EIM B;  2E3C A;  5J2T B;  5H5N A;  3RYH B;  3ZMZ A;  2Q4P A;  4X66 B;  4P30 A;  1N0N A;  2WA4 A;  3OT7 A;  3K3W A;  4RO2 A;  3PN1 A;  2VRZ A;  3E8B A;  1JOY A;  4WBN A;  2A06 H;  2UXC B;  3P3P A;  1P7G A;  4DK0 A;  2F23 A;  2XAF A;  4G28 B;  3K5O A;  1K34 A;  1SZT A;  2WLK A;  2DW4 A;  1SF9 A;  2ADP A;  4I55 A;  4OPH A;  5LGU A;  3G71 V;  1KP2 A;  4MS2 A;  3JAT A;  2BCC H;  5JCO C;  4X1I A;  1YZB A;  2F4V B;  3K0D A;  4IHJ B;  5LXT B;  4PEL A;  5A2Q N;  1IX9 A;  4YJ2 A;  2UUC B;  4NTY A;  4F6R A;  4HYO A;  3OW2 U;  4DR5 O;  3TXS A;  4LNU A;  1NJI W;  3CCV V;  1N36 O;  4GCZ A;  2ZR3 A;  2QSA A;  1XBL A;  1WPX A;  2HVJ C;  3UT5 A;  2QKS A;  2R9I A;  1R6T A;  4UV8 A;  1H2M A;  3RYC A;  4LR3 A;  3AK3 A;  4J11 A;  2QM4 A;  4DK1 A;  3N2G A;  4QGP A;  3SYC A;  2PY5 A;  3SYQ A;  2PI4 A;  4DYL A;  4PDV A;  3GVM A;  3CEI A;  2VQF B;  3JSL A;  3FFQ A;  1SES A;  4O2A A;  4DV0 O;  4FZ1 A;  2W0X A;  3ZN1 A;  3H1J H;  1I5Y A;  3ASO B;  2FKX A;  5LMN B;  3ETQ A;  5B1O A;  5KX5 A;  3BPZ A;  3LSU A;  5K1P A;  3ZRV A;  2YEV B;  5E79 Z;  4X66 O;  5AG2 A;  5KMG A;  1DGS A;  5CBF A;  2ZE5 A;  1EN4 A;  1EBO A;  4EKW A;  3OR7 C;  1WA8 A;  2QM7 A;  3E8G A;  2QWN B;  1ARO P;  3MD0 A;  1H2S B;  1ZAU A;  3W7S A;  4F4L A;  3CRC A;  2CUG A;  4FLW A;  1FJG B;  4U7N A;  3H9V A;  3TGU H;  2Q8V A;  4J7K A;  3Q4H B;  4Q20 A;  1NBM G;  1NS1 A;  5L3F A;  4WFG A;  2WLH A;  1RM1 B;  2UUC O;  2IJJ A;  4O2B B;  4DW1 A;  5IJ9 B;  3CCS V;  2HVK C;  2UUA B;  4W4L A;  4WBN B;  1G4Y B;  4JAU A;  1R3L C;  2WLI A;  4OGQ B;  3QF7 A;  4DW0 A;  4ZBM A;  2AHZ A;  2EIN C;  3BRC A;  1GN4 A;  4K35 A;  1Q6U A;  1XNQ B;  2BOC C;  1M57 B;  1S5J A;  2R9R B;  3L72 H;  2QA4 V;  1AVM A;  1P7B A;  1WAZ A;  2UXB O;  3ZRS A;  2OYQ A;  5L3D A;  3JAT B;  4DV7 B;  1EN6 A;  1K9M W;  1K5S A;  1AIL A;  2P5O A;  1J5E B;  4N21 A;  4F6R B;  1ZTE A;  2LFR A;  3I5D A;  1OCO B;  1SET A;  2JGD A;  1VQL V;  3TCU A;  2AGA A;  2Q0O C;  3HKC B;  5FPR A;  1R3K C;  5LHI A;  2ZD9 A;  5LMN O;  3RYI A;  1NTM H;  5KLV H;  1LUW A;  3CWB H;  1XEQ A;  2YSU B;  1Z5V A; 
#chains in the Genus database with same CATH homology
 1V54 C;  1E1Q G;  1KKD A;  3BY6 A;  3QO5 A;  3CPW U;  1EFR G;  5L3B A;  4TWK A;  3TET A;  2EIN B;  4PDM A;  2OCC C;  1ORQ C;  2P6J A;  3ZRW B;  1VQ7 V;  4WFF A;  3ZRW A;  3EHB B;  1YSC A;  1EZJ A;  4QIW F;  5H6Q A;  1M9N A;  1OCZ C;  2XAJ A;  1S3J A;  3WFV A;  3AG3 B;  5EK0 A;  3VBB A;  4MTX A;  5C93 A;  2LFS A;  4I5S A;  5B1A C;  4JAS A;  1W0K G;  1KEC A;  2IJK A;  3E2E A;  3M99 B;  1AI7 A;  2B1I A;  2EIL C;  3ZMV A;  4RUE A;  5LGT A;  1KD1 W;  2ZXW C;  3JD1 A;  3JD3 A;  1K8A W;  3EFF K;  2EIJ C;  1YHQ V;  1V55 B;  4LCU C;  3T4D A;  3JD2 A;  1PD3 A;  1K4D C;  3SPC A;  2P67 A;  1Q86 W;  3K79 A;  1KP3 A;  1L1F A;  4L87 A;  3K04 A;  3OE7 G;  1OCR C;  3ETD A;  2P7T C;  3IGA C;  4PDL A;  2A79 B;  3CCU V;  1NKD A;  3ETG A;  3CCR V;  3E35 A;  1IXM A;  2HR3 A;  3P32 A;  4UXN A;  3ABL C;  1YIJ V;  1DLB A;  4QNH B;  1JCH A;  1K5Q A;  1JVM A;  4WCE V;  2JK5 C;  2JJ1 G;  2W6J G;  2OCC B;  3HB3 B;  3K9A A;  3E89 A;  4MTG A;  4FMT A;  1NVP B;  1HWY A;  1OCZ B;  1KC8 W;  2JJ2 G;  1AR1 B;  5IYD O;  1KQS U;  4PDR A;  4JF3 A;  1R6K A;  4BIU A;  5H6R A;  1FS0 G;  3OMN B;  4KUM A;  3E86 A;  4BIZ A;  4JTA B;  5B1A B;  1CEZ A;  5L3E A;  4MTF A;  2DYS C;  3VOU A;  4WFE A;  2XOK G;  3BEH A;  3FB6 C;  2EIL B;  5CMU A;  3PJS K;  4OXS A;  4PA3 A;  2ZXW B;  3AG4 C;  1AI5 A;  1ZWI C;  3B8M A;  2DWE C;  3F5W C;  4XBF A;  5EC2 C;  1E1R G;  3CCJ V;  2MK3 A;  3MHS C;  1Q7Y W;  2B1G A;  1MG1 A;  3CC4 V;  2Y69 B;  1THZ A;  2AHY A;  3CP1 A;  4TT3 G;  4UVC A;  4X88 A;  5J9P C;  1OCR B;  4MVR A;  2ZDI C;  3ZCC A;  4QE7 A;  1QBZ A;  4QJF B;  4XDL A;  1VQO V;  1H2G A;  2DQ3 A;  4KFM A;  2V1D A;  2X7R B;  3ABL B;  4P9P A;  5KA6 A;  3JD0 A;  4FK5 C;  3AG3 C;  3F7V C;  1MOF A;  4GT1 A;  1BHB A;  2ITD C;  4JGS A;  1M1K W;  1UJW B;  5EBL C;  5FL7 G;  3B77 A;  3SPI A;  5IYC O;  1GM7 A;  2M7W A;  3QO7 A;  4JTD B;  3D3I A;  4MVO A;  3E8F A;  5B1B B;  2JEU A;  3CC2 V;  3W7W A;  3UKM A;  3G6E V;  3ZMT A;  1SRY A;  2DYS B;  1QLN A;  3QO8 A;  3RVZ A;  2WLJ A;  1H38 A;  3OGC C;  1VQ6 V;  4WFH A;  3FB8 C;  1FXK A;  3T4Z A;  4MVS A;  4QPJ A;  3ABT A;  3SYA A;  3B8N A;  2GSM B;  1YJN V;  4ZKI A;  3KG2 A;  2ZDI A;  3W7T A;  1JPX A;  1W0J G;  2V7Q G;  4LBE C;  4XDJ A;  1S76 D;  5GW7 A;  3JYC A;  4G2K A;  2XAH A;  4MTO A;  3LDE A;  2EIK C;  4MW3 A;  2EZO A;  2JEX A;  2LP7 A;  2QEX V;  5LHH A;  1NH2 B;  3ABU A;  3RVY A;  4UUJ C;  2IU0 A;  4PA7 A;  3UM7 A;  4RQF A;  4R50 A;  2A0L A;  2WAM A;  2IH3 C;  3OR6 C;  4R7C A;  2IH1 C;  5CBH A;  1FXH A;  4LC1 A;  1G8M A;  3OM3 B;  4DO2 A;  4MT8 A;  3OAA G;  4MW8 A;  3G4S V;  2XND G;  4GX0 A;  4GX2 A;  1QR8 A;  4CBC A;  4MSW C;  5DN6 G;  1GM8 A;  1LNQ A;  2OTL V;  1QR9 A;  3T2M A;  2Y69 C;  1QCE A;  3E8H A;  1M90 W;  1GK9 A;  2A9H A;  1CP9 A;  3OEH G;  4RUF A;  2Q68 A;  2EIM C;  3FYE B;  4MVU A;  4UVB A;  5DM6 V;  1JX9 A;  4E2L A;  1YI2 V;  1B6Q A;  5EBM C;  5HFL A;  1P4R A;  1BL8 A;  3ETE A;  4H33 A;  2WSS G;  1VQP V;  3CD6 V;  2H8P C;  3I56 V;  1DTO A;  4UV9 A;  3SJQ C;  1YTF B;  3CCL V;  2XAQ A;  1K4C C;  2Y48 A;  3IFX A;  2XAS A;  2FTK A;  4I9W A;  3ZMS A;  3OFN G;  1H8H G;  2EIK B;  2Q69 A;  2W6I G;  5KUM A;  3T1C A;  3ZRX A;  5IDJ A;  2DWD C;  1QVG U;  1E79 G;  1JJ2 U;  1FFT B;  3DTU B;  1CPY A;  1VQM V;  1Y4M A;  1F4N A;  5B1B C;  3LSQ A;  4RAI A;  4GX5 A;  4J9Z B;  4U7O A;  1BMF G;  4G27 B;  3I55 V;  1R6N A;  3ABM C;  4H37 A;  3LDC A;  2WLM A;  2UXX A;  2IJI A;  1K73 W;  2ZR2 A;  3CXC U;  4P2Z A;  3STZ C;  2Q6A A;  1FXK C;  4YXW G;  2PI5 A;  2F43 G;  2ITC C;  4TSF G;  1YTF D;  4J9Y B;  2EIM B;  2W0F C;  3A0R A;  4BAY A;  4X8A A;  3K03 A;  1GM9 A;  1NR1 A;  1NVP D;  5CA3 A;  5KA5 A;  1QVF U;  2QM8 A;  5E1A C;  1AJP A;  3ZMZ A;  1I5X A;  1SER A;  3STL C;  5LBQ A;  4P30 A;  1R3I C;  3RBZ A;  2HLD G;  2K1E A;  2X6C A;  3K3W A;  4RO2 A;  1FXV A;  3OMA B;  3E8B A;  3CYO A;  2CK3 G;  3ZIA G;  1JOY A;  4JPR A;  1AI6 A;  1OCC C;  4WFB V;  4HZ3 A;  3JCZ A;  3ABK C;  1K97 A;  3IC7 A;  2XAF A;  4G28 B;  3H01 A;  4QE9 A;  5L3C A;  3CC7 V;  3ABM B;  3GB7 C;  5EC1 C;  2HJF C;  1F4M A;  1K34 A;  1SZT A;  2WLK A;  3QNE A;  4MVM A;  3D36 A;  1Q81 W;  3TK1 A;  2DW4 A;  3K06 A;  2WWW A;  5LGU A;  1S72 V;  3G71 V;  3OUF A;  2IJH A;  2BOB C;  1KP2 A;  2QE7 G;  4MS2 A;  3OMI B;  4XDK A;  5IY5 C;  3LUT B;  1FXK B;  3ASO C;  3K0D A;  1JQ0 A;  3OUS A;  1AJQ A;  2OT5 A;  2WLL B;  4PEL A;  4R6Z A;  2WLL A;  1VQ4 V;  4FIP C;  1K7D A;  1ROP A;  2X0L A;  3CME V;  2IU3 A;  3HPL C;  4HYO A;  3SPH A;  3AG2 C;  3OW2 U;  2KB1 A;  1YIT V;  5LGN A;  1OHH G;  3CMA V;  1NJI W;  4PA6 A;  2Q67 A;  4WF9 V;  3CCV V;  4GCZ A;  3E83 A;  4CZZ A;  1F23 A;  2ZR3 A;  4BW5 A;  1WLE A;  1VQ5 V;  2JIZ G;  4RQE A;  3R65 A;  4R8C A;  1WPX A;  1AJN A;  2HVJ C;  4KP4 A;  2QKS A;  2R9I A;  1OCC B;  4DXW A;  1Y66 A;  1VQK V;  1PNM A;  2B5U A;  3GWO A;  3JD4 A;  4UV8 A;  1H8E G;  4JAV A;  1GMG A;  3ABK B;  1S77 D;  1PNK A;  1S0V A;  3AG1 C;  4QPK A;  3ZMU A;  4ASU G;  1PKX A;  3P30 A;  3SYC A;  2HKO A;  3K08 A;  4P9O A;  5CN0 A;  3SYQ A;  2PI4 A;  4GX1 A;  4PDV A;  1XL6 A;  4FPP A;  5B3S B;  2JDI G;  2X6B A;  3W7U A;  1SES A;  2H94 A;  1DF4 A;  3ASN C;  5IY5 B;  1N8R W;  3ZN1 A;  2XAG A;  1F51 A;  2EJR A;  1I5Y A;  1K92 A;  4X89 A;  3ASO B;  2NNU A;  1NH2 D;  2Z3Y A;  1M56 C;  5B1O A;  1RM1 C;  2EZP A;  3AEI A;  2HG5 C;  3ZRV A;  1K33 A;  3AG2 B;  1RPR A;  2DYR C;  2YEV B;  2YEV A;  2OTJ V;  4JYC A;  2ATK C;  2D3O W;  1BHA A;  3CCM V;  1J95 A;  3X2Q C;  5CBF A;  4HAM A;  2WLN A;  1EBO A;  4EKW A;  3OR7 C;  1V54 B;  3FYI B;  3ZN0 A;  1M57 C;  1XL4 A;  2QM7 A;  1MAB G;  1K3E A;  3WG7 C;  3E8G A;  3SYP A;  1ARO P;  3FB5 C;  1R3J C;  3MD0 A;  3W7S A;  4F4L A;  3AG1 B;  1DF5 A;  2C2A A;  4FJC C;  3K0G A;  4U7N A;  1GTO A;  5H9C A;  2X6A A;  5B1N A;  4JTC B;  5CBG A;  4MVQ A;  2Z5U A;  4Q20 A;  4WFA V;  3ASN B;  1S5H C;  1ENV A;  1NBM G;  1OCO C;  3MHH C;  4PA9 A;  3SPJ A;  2NLJ C;  1AI4 A;  3ZJZ A;  2ZQM A;  5L3F A;  4UVA A;  4WFG A;  5LHG A;  2P90 A;  2WLH A;  1M56 B;  1RM1 B;  2UXN A;  5L3G A;  2IJJ A;  3SYO A;  3RW0 A;  1QLE C;  5KUK A;  2EIJ B;  3CCE V;  3CCS V;  2HVK C;  2DYR B;  1G4Y B;  2WLI B;  3W7X A;  4JAU A;  1R3L C;  2WLI A;  4LP8 A;  2DQ0 A;  3DGE A;  4ZBM A;  1NQT A;  1RPO A;  3X2Q B;  1VQ9 V;  2AHZ A;  3F7Y C;  2EIN C;  3NXS A;  1R73 A;  5EBW C;  2BOC C;  4Z1M G;  1M57 B;  2GHY A;  3WG7 B;  2R9R B;  2IW5 A;  1Q82 W;  2QA4 V;  1P7B A;  1PL0 A;  1VQN V;  3ZRS A;  3FKS G;  5B3S C;  1YJW V;  3SPG A;  1COW G;  1NR7 A;  2EBO A;  1VQ8 V;  4N23 A;  1W2B U;  5L3D A;  1MSW D;  1K9M W;  1YJ9 V;  1GKF A;  1K5S A;  5HFM A;  3LDD A;  1OZ0 A;  4N21 A;  3LSS A;  3CCQ V;  2LFR A;  1VQL V;  1OCO B;  1SET A;  3TCU A;  1V55 C;  3ML0 A;  1R3K C;  5LHI A;  2ZD9 A;  2QTO A;  4PA4 A;  3AG4 B;  1TUE B;  2HFE C;  1QLE B;  5BZB A;  3OEE G;  2WPD G;  3FB7 C;  1PNL A;  2YSU B;  4MVZ A;  3LNM B;  4JYB A;  5IYB O;  1GO3 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...