3K0GA

Crystal structure of cng mimicking nak mutant, nak-etpp, na+ complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
total genus 32
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k0gA00
3T2MA 4HZ3A 3TETA 2IH1C 2A9HA 4XDJA 3ZJZA 4MVZA 3RBZA 5EBLC 3FB5C 2R9RB 4PA4A 4QE7A 4P2ZA 3T4DA 5CBFA 2EIMC 2OCCC 3IGAC 3LDDA 4P30A 3SYQA 4BW5A 4GX5A 2BOCC 1R3KC 3OGCC 2EILC 4GX0A 3FB6C 4JTAB 1KKDA 4MVRA 1P7BA 2WLLA 1K4CC 3OR7C 4PDMA 4G28B 2YEVA 4P9OA 4TWKA 3LDCA 4R8CA 3RVYA 2P7TC 4PDLA 4WFEA 5J9PC 1M56C 2DYSC 2KB1A 2ZD9A 4PDVA 1R3LC 3SYAA 2WLLB 4J9YB 3VOUA 3T4ZA 2DWEC 2HVKC 3E8FA 5B1AC 2HG5C 4PA9A 3F5WC 3K0DA 3K04A 3FB8C 4MVSA 1QLEC 2NLJC 3GB7C 3ABKC 1R3IC 2HFEC 3ABLC 5CBGA 2A79B 1OCZC 1M57C 2WLNA 4I9WA 3SPJA 4J9ZB 4QE9A 4UUJC 1G4YB 4XDKA 2WLKA 2WLIA 2X6AA 4JTDB 4LBEC 4PDRA 3F7YC 4RO2A 4RUEA 2Q6AA 3ABMC 4MW3A 2BOBC 3E8HA 4P9PA 2DYRC 4GX1A 3LUTB 4MTGA 4KFMA 2WLIB 3F7VC 4X88A 1OCOC 4PA3A 3SJQC 3TCUA 5EC2C 3K06A 3UM7A 2IH3C 3RVZA 3T1CA 5KUKA 2Q68A 2K1EA 5EK0A 2EIKC 3STZC 4EKWA 2ZXWC 5B3SC 5BZBA 4LCUC 4RUFA 2WLJA 1OCRC 3EFFK 4MW8A 4R50A 2WLMA 3FB7C 2A0LA 4OXSA 4R7CA 4MVUA 4H37A 1S5HC 3K08A 4QNHB 1R3JC 5CBHA 1BL8A 2W0FC 3AG3C 3K0GA 3LDEA 4MS2A 3LNMB 3SPCA 3UKMA 5KUMA 2HJFC 3E8GA 2Q67A 3RW0A 3JYCA 3SYCA 1OCCC 4X89A 2ITCC 3R65A 4X8AA 5IY5C 4G27B 3AG1C 3HPLC 1ZWIC 4WFHA 2JK5C 1J95A 2AHZA 3OUFA 2ITDC 1V54C 3IFXA 2X6CA 4WFGA 1LNQA 4F4LA 5B1BC 3ASNC 2HVJC 3ASOC 2DWDC 3SYPA 1JVMA 3K03A 3OR6C 3ZRSA 5EC1C 3X2QC 3WG7C 4MTFA 4PA7A 4MVQA 3OUSA 5E1AC 3E86A 2EINC 3AG4C 4PA6A 4JTCB 1V55C 3AG2C 1XL4A 4MTOA 5EBMC 4R6ZA 4ZBMA 3SYOA 4MSWC 2Y69C 3SPIA 4GX2A 2WLHA 4HYOA 4WFFA 3KG2A 3E83A 5EBWC 3STLC 4XDLA 4MVMA 4RAIA 2AHYA 1K4DC 4LP8A 3BEHA 2H8PC 3E89A 3PJSK 2QKSA 2Q69A 1XL6A 2EIJC 2QTOA 4MVOA 4H33A 1ORQC 2X6BA 3E8BA 3SPGA 3SPHA 4CBCA 4DXWA 2ATKC
chains in the Genus database with same CATH superfamily
1IURA 1SA0A 5LOVB 3T1YO 5CA3A 1QNMA 1N36O 1P7BA 3ZMTA 2QWRB 2P6JA 5F2VO 3ZN0A 4G28B 1Z5VA 3LDCA 4KP4A 3GWOA 4B3MO 4O4LA 1XEQA 3CE2A 5JH7B 4BIZA 1FXKA 3FD9A 5JJNB 2ADPA 1NU1H 4FLWA 1VF7A 2CE4A 1YJNV 3JSNA 3CPWU 1GH6A 3RYIA 3JAWB 1QLEB 2JGDA 1MOFA 3MD0A 1PPJH 1NTKH 4GX1A 2B5UA 1JR9A 3AK2A 1AI6A 2ZDIA 3B40A 1YI2V 4I55B 2Q0OC 3JD4A 2ODMA 3QNEA 4R50A 4X20B 2OTJV 5ITZA 4H37A 4Q6GA 2W0FC 4L8JA 3OMAB 4ZI7A 1N8RW 1Y76B 1XQ8A 4CS2A 4DV3O 2GSMB 4UXNA 1E1QG 1SQPH 4DW1A 2AXTZ 2QTSA 3OFNG 4YXWG 4O4IA 2JEXA 3ZCCA 1FXHA 1DF5A 1O9HA 3ASNC 5GTIZ 4YJ3B 4GUNA 3ZRSA 3FX7A 4MTFA 3HB3B 2QJ1A 1ZSPA 2PUSA 5IYBO 3JCZA 1BT8A 3SYOA 5GTHZ 1YZBA 4MT8A 4J80A 2WA3A 3QO7A 3OTOB 4JI4B 3L72H 4DR6B 1YSCA 2H8PC 1I08A 3E89A 1EZVH 4JI5B 4U3JB 2BTQB 4IHJA 4D7TA 4HBNA 3B09A 2H94A 4LH7A 5EZYB 2HHHO 1JOYA 4JI6O 3FKSG 4UVCA 1FAFA 4LF9B 1F4MA 5H6QA 4GYCB 3T1HB 2ZE5A 4LC1A 1RFYA 1AROP 2XAFA 1HNXO 4K3AA 4WCEV 4B3TB 3E8FA 5IYDO 3CP1A 4DV7B 1L0LH 1M93A 3ETDA 3ABLC 1HWYA 5LA6A 1U97A 4I4TA 3ETGA 4UCUA 1G4YB 1IBLO 4LBEC 3I55V 4G2KA 4WF9V 4MW3A 4P9PA 3K59A 2QA4V 2OCHA 1VQOV 1NI8A 3AG1B 4O4HA 1R6NA 2Q68A 1IBKO 2PF4E 1P4RA 1JFFA 2QEXV 1GM7A 1SZXA 2ZE6A 4LCUC 3HKBB 2ZKOA 4D7SA 1P7GA 4FPPA 1S5HC 1I0HA 3AG3C 1MZEA 2IU3A 5KUMA 2Q67A 2Q4PA 4DR7O 2ILMA 2GUZA 5J2UB 4O2AB 1H2SB 5KHGA 1K34A 4O4JB 2AHZA 3OUFA 1AR5A 1I5YA 5DM6V 2XAHA 1LNQA 1WB7A 2LP7A 2M7WA 1VQLV 1VQ8V 1X59A 4O2BB 1K33A 1PL4A 1K92A 2PI5A 4C7UA 4JAUA 5CA0A 3RGBA 3FAVA 1WP8A 4JI2O 4LF5B 4KHPB 3W7UA 3FFQA 3H01A 5FPOA 3G71V 3JCUZ 5EBWC 3ICXA 1SQFA 4CH5A 3CD6V 3PJSK 5CMUA 3SGIA 2QTOA 2R9AA 1XNQO 2DYSB 4CBCA 3ZJZA 2ZIMA 3P30A 2Y4UA 4JTAB 1EN5A 2WLLA 3DC5A 3OR7C 2JVDA 1YJWV 1M56C 4PI0A 3BHPA 1R1BA 3K5MA 4W4KA 1EN6A 1IXMA 3APOA 1XMOO 2EIKB 3JALA 1HNZB 2HJDA 1XHXA 1Q8IA 3KCYA 1Z5WA 1BZKA 2A3QA 1OZ0A 4TSFG 4K8ZA 2XNDG 1GAXA 2PY5A 4YJ2A 4FVMA 4LWSA 4JI1O 4CS4A 1OCCB 1N36B 5IJ0A 2HKOA 2IM9A 3L71H 4EKWA 3DSQA 1AI7A 4FMTA 4B3MB 2E3CA 4LFBO 1R3JC 3K0GA 3SPCA 3JD3A 2ZQMA 1V55B 3K79A 1MZFA 4CZZA 1YF2A 3K9AA 2XASA 4J41A 4G27B 4DW0A 3J7AU 4I50B 4ZOLB 5H5NA 1GMGA 4DR3O 4F4LA 3SYPA 4JV5O 1P84F 3VQWA 4JYAO 3BFRA 3E86A 5LXTA 3HKDA 2OTLV 2JGUA 2ETNA 4UCVA 3K57A 5JVDB 5FLXN 4UB6Z 4DV1O 3UT5B 2D2CB 1PV0A 3ZRWA 2IBZH 4AILC 1AP5A 4IT5A 2K9PA 2UXNA 3JD2A 4Z2WA 2PYLA 1EN4A 2R9RB 4P2ZA 4RWUA 5LHIA 3OAAG 3IGAC 2EILC 3QF7A 2MK3A 5J9PC 1KP2A 1COWG 2E75B 2FMLA 5D5QA 1ROPA 4J9YB 2ZNJA 2HG5C 4QJFB 3F5WC 4B3SO 1TA8A 3HKCA 1Y74A 2IJKA 1M57C 4WFAV 3SPJA 1U96A 4UFZA 4PDRA 4X1KA 3ABLB 2P22C 2HHHB 1BHBA 1SKVA 3GVMA 4JI6B 3H1LH 2QR4A 4IYIA 3ZHQA 1OCRC 4TV8B 2WLMA 4OXSA 1QBZA 4QNHB 3LDEA 3SJBC 3BY6A 1GN6A 2Z5UA 5IJ9A 1VQ6V 4TUYB 1IBLB 1GN2A 3RYFA 1GM8A 2OIGA 1VQ7V 4NTYA 1H2LA 1RM1B 3ZMVA 2PTMA 5LMUB 3CMEV 4MVQA 2BTOA 3OUSA 5C8YA 3OTOO 4DR6O 1IBKB 1Q90D 4HYOA 1R73A 3E83A 1Q82W 4JI5O 2ARHA 1JJ2U 3PN1A 4DR7B 4MVOA 1Q5OA 1VQ9V 5LOVA 2JJ1G 1G6UA 1K5QA 3D8CA 2ATKC 1J5EB 3T2MA 1SS3A 4JPRA 1THZA 3APQA 3T1HO 4LF6B 5H6RA 3H1HH 4MVRA 4B3TO 1ZLZA 2UXXA 1YHQV 5JH7A 2E74B 4JI2B 4JASA 1HNWO 5KMGB 5KHHA 2Q8VA 4GT1A 3G6BA 4PDVA 5CA1B 3IJ4A 1RPOA 3T4ZA 1UPGA 2AGAA 3AG7A 1M56B 4GKKO 1VARA 3JAWA 3K04A 3FB8C 4JYCA 1KMIZ 2NLJC 5KHKA 5B3SB 1XNQB 4UCOA 4QE9A 3ZRVA 2Q6AA 3FYEB 1MNGA 4I55A 1YCIA 2YICA 4MTGA 1MSDA 4X20A 3CYOA 2UU9O 3RVZA 2K1EA 3P3PA 4UV9A 5K1PA 3CHXA 3EFFK 2UUCO 1N0JA 1K7DA 1YJ9V 1N4CA 2EINB 2YXHA 3LSQA 1H2KA 4TQFA 1XMOB 3SYCA 3WB1A 4YIPA 1I94B 1MABG 4X8AA 2CTWA 3AG1C 2CAZC 2IJHA 4YJ3A 3N2KA 2W6JG 2QWOB 5JQGB 1JPXA 3M8AA 4EFBA 4JI1B 1XDCA 1O9GA 2CK3G 2P90A 2RNBA 4UCRA 2DW4A 4DV5O 2NNUA 2EIMB 3ETQA 4B7EA 2RQ6A 4LFBB 2H3OA 4AI8A 5C93A 2BTQA 4DV2O 2C2AA 2Y4TA 3MHSC 3G4SV 3CC4V 1ORQC 4F6EA 5DN6G 1L8DA 3CCSV 4QE7A 4U3FH 5CBFA 5KX5B 1QCEA 1DGSA 1JCHA 3BA8A 4JV5B 2R70A 3RWRD 4JYAB 1NTZH 1K4CC 1AJPA 2Q7EA 4AQYO 4J11A 4Z1MG 1AR4A 2DYSC 2LFRA 4LR3A 4NB5A 1CPYA 1SRYA 2DWEC 4DR5B 3KCXA 4H0LB 4DV1B 2Y48A 1WN7A 1KUQA 1W0JG 1XNRO 2WLNA 4BAYA 2V4DA 1AR1B 3SJAC 2L6LA 2X6AA 3CX5F 3L9DA 2WA4A 4FLYA 3OEHG 4JF3A 1M57B 3E8HA 1WP7A 1S76D 4X1YB 1ENVA 1VF5B 1K5SA 1B04A 1R6KA 3I56V 3CC2V 5KUKA 3STZC 2EIKC 1W0KG 2WLJA 3A8TA 1AP6A 3CCEV 2E5LB 1TAEA 3A0BZ 3K08A 4DR2O 1B3QA 4O2AA 3UKMA 3BABA 2A7WA 1OCRB 1YITV 4B3SB 1F23A 3L74H 4O4JA 1N0NA 3JSLA 4TV9B 2IJIA 1OCCC 3R65A 2UXBO 2VRZA 5LP6B 4H44B 4FJCC 4O2BA 1UJWB 3H9VA 1LUVA 3OE7G 4WFGA 1Q3EA 1KQSU 1V55C 2CH7A 5EIBC 3CB2A 1K8AW 2RCVA 2F43G 1TVKB 2P5OA 4GX2A 4WFFA 1M1KW 3G80A 3ZHRA 3THOA 3B77A 2Q69A 1YTFB 2F95B 2XUMA 2EJRA 4XDJA 4MVZA 1MSWD 2HP8A 3ZHSA 4DV6O 2GTAA 2MW2B 2ZNIA 2DJVA 3JARB 2QM7A 4X62O 4I0XB 1KB9F 1NS1A 4PA9A 2LGWA 5JCOC 1XOUA 4J9ZB 2N74A 4Q20A 3DXRB 4PELA 2QE7G 5H2FZ 4LNUB 3F7YC 3QTCA 5J2TA 1YTFD 3KKYA 1HW7A 2DN9A 3TGUH 1WA8B 2YXYA 4EFEA 3SJQC 1NVPB 3K06A 4IL6Z 3CJHA 5TISZ 2NR5A 1HNWB 3HKEA 1AJNA 2UUBO 2P67A 4FFBB 4MS2A 1PP9H 2QM4A 4OGQB 1OV9A 1TGOA 4GKKB 1H8EG 4I50A 1ZL8B 2ZIOA 3DC6A 2LO1A 4ZOLA 3JYCA 5L3DA 2ITDC 2WSSG 2YI8A 5LMUO 4U7NA 3QO8A 1X4TA 2YIBD 3M7MX 4BWAA 1Q43A 2DWDC 3K03A 2VWJA 3ZS8C 3ZX6A 4F6RB 1VQ5V 2UU9B 2AZ0A 3W7SA 1N32O 3UT5A 1Q6HA 1VQPV 5K1XA 2UUCB 1S77D 4X65O 1BSMA 2RDCA 1NVPD 3BEHA 1J5EO 1H2NA 4PV1B 1YEWA 3VQXA 3N2GB 3A0HZ 2EIJC 3VQYA 1RM1C 4X1IB 4PI2A 4BIOA 4LF6O 4DV4O 2GBOA 2FKXA 5B1AB 4PA4A 2D3OW 1SZTA 4WFBV 1KKDA 4BW9A 3JAKB 1L1FA 4R8CA 3RVYA 2JGDB 4PDLA 4DV5B 3K5OA 2HR3A 2X7RB 5KA5A 3ZMSA 4DV2B 4YHHB 4MVSA 1LR1A 3JAMN 2ZXWB 3E2EA 4I7ZB 2AW9A 2XT9A 3RYHB 5IYZB 3CXHF 4EB6A 1EBOA 4JTDB 2XOKG 2XTAA 1GKFA 3F7VC 4X88A 1BE3H 2FYUH 3Q4HA 4TV8A 1QQCA 3T1CA 1YXBA 4AQYB 1XI1A 5B3SC 1I5XA 4RUFA 1FJGO 5KHJA 1I94O 1HDJA 3L75H 2DE0X 4TUYA 3D36C 1XNRB 4WFHA 3RT3C 1SERA 4NYKA 1M9NA 4Z1VA 1EFRG 4H13B 2A06H 2WAMA 2ZE7A 2EINC 3LNNA 4NKGB 1BMFG 1VP7A 4UCTA 4FM2A 3K5NA 4U7OA 1DK1A 4DR2B 2Y0IA 3B8MA 5A9GA 4LFAO 5LL6Y 2ZM6B 2UXBB 4HZ3A 1N33O 1E1RG 4CH4A 4PJ0Z 1QLNA 4CH3A 2BE3A 2EIMC 4DUZO 1XUQA 1V9PA 3OGCC 3D3QA 3BVOA 5KMGA 1GRJA 4FFKA 2JEUA 5CA1A 4IIJB 3JD1A 1CXZB 1DLBA 3CCLV 4DR5O 1XMQO 2KB1A 1Y6XA 3JATB 2HVKC 4DR1O 3ML0A 2KSDA 2XHBA 4ZKIA 2L35A 1SETA 3U10A 3GB7C 3O9OA 3MHHC 2HFEC 3C3SA 2HLDG 5EIBD 4HAMA 5FNVB 2X0LA 3D36A 4RUEA 4RQFA 1QHTA 3DGEA 4I9QA 1QVGU 2OWOA 1QR8A 1FYJA 3BA9A 4PA3A 1YVWA 4DV6B 2E5LO 3UM7A 2UXCO 2PGGA 1YDXA 5IE9A 3OM3B 5HFMA 1NT2B 2E76B 3OT7A 4X62B 4JZGA 3X2QB 2BSKA 3TXSA 2YS8A 4E2LA 2YC0A 1H2GA 1JJOA 4DV0O 5LGUA 2XAGA 5JQGA 4YIOA 5EYPB 4BR6A 1BQZA 2UUAB 3KZIZ 3D3IA 3IFXA 3E35A 3EVKA 5H9CA 5E1AC 1FFXB 5KAFZ 3QG5A 3U11A 5EBMC 3B4SA 5L3CA 1NTMH 2OCCB 5LP6C 3S3WA 3ABTA 3LSSA 1IVSA 2UUBB 3K3WA 1YIJV 3ABUA 5KX5A 5LYJA 4K35A 4EEQA 4FLZA 2QWQB 4TOIA 1L0NH 2JS5A 2Q0AA 1IBMO 2EIJB 1FPOA 5EBLC 3K9SA 3OMNB 4UVAA 1S0VA 1SQBH 1WPBA 3CCJV 3P32A 1H38A 3JALB 2AZ2A 4PDMA 2YIAA 3ZIAG 2IJJA 4B08A 2VQEO 1N32B 2ZD9A 4FIPC 4X65B 4NXNO 3B2EE 1G1XB 1Y66A 2KKWA 1WB8A 5CBGA 4OX9O 4DV4B 2BOBC 2B1GA 3F5TA 3LUTB 4HNAB 3J80N 2BCCH 2JJ2G 1JA8A 5EC2C 5IYCO 2EBOA 5BZBA 1XREA 4QIWF 2WWWA 3CCVV 1BL8A 4CC5A 3E8GA 4ABMA 3AG4B 3CRAA 2VS0A 4L87A 4X89A 2ITCC 2Q9LA 3ZMUA 3CSXA 4FLUA 2WPDG 2ADQB 5B1OA 5BMVB 1JVMA 1FS0G 1KD1W 5EC1C 1TVKA 5D5PA 1Y76A 4KL1A 2RN9A 4JTCB 3S3XA 2EULA 2M6YA 1FJGB 5GONB 3UO3A 3STLC 1M5IA 3R66A 2AHYA 4LP8A 4JAAA 5B66Z 2QKSA 4KUMA 3MDSA 2DQ0A 4XBFA 4WBNB 5DEDA 3U0ZA 1WAZA 1FXVA 4LF7B 3E22B 3ZHUA 4GLXA 4JZ2A 3M99B 1NZ6A 2XAJA 3L73H 1NKDA 4K0KO 1Y74B 1QR9A 1TUEB 4W4LA 4I0XA 2GHYA 4U3JA 1JX9A 4X1KB 5AG2A 4YHHO 3TXQA 3J81N 2YIBA 3VOUA 5EZYA 2YEVB 5B1AC 2Q7HA 1NH2B 3CCQV 1NJIW 1FXKC 3JASB 3DXRA 2Q7GA 4LNUA 4UVBA 2XAQA 4LFAB 3QVNA 1QVFU 3VBBA 4NXMO 3TETA 1WA8A 1N33B 2VQFO 1ZTEA 3BPZA 5LMNO 2EX3A 2B9ZA 4DUZB 4KFMA 2EZOA 2WLIB 3ZBHA 3CMAV 2LW1A 1TUBB 5IY5B 5IJ9B 2ZDIC 5BR8O 2ZE8A 1Q6IA 4J7KA 5EK0A 2ZXWC 1K9MW 1VMGA 1XMQB 3G67A 1ZL8A 2A0LA 3G6EV 5B1BB 2R9IA 1FKAO 5CB4B 4FM1A 4LFCO 2DMXA 3H1IH 3OMIB 3WG7B 5LGNA 4DR1B 5KA6A 4ZHQB 2ZT9B 1PNKA 2V1DA 2ZCEA 5HFLA 1FD9A 5JJEB 3C3TA 1Y4MA 1ZWIC 4FLVA 4DRXB 1F4NA 1NH2D 1WPXA 3RN4A 3OEEG 3HKBA 2DOSA 1D5AA 1V54C 1SC5B 4F6RA 2CTRA 3I5DA 3ASOC 1HP8A 3OR6C 2N04A 2V7QG 4JI8O 2QWPB 2UXCB 5J2UA 5IT9N 4R6ZA 2F1MA 2JDIG 3N2GA 4X9QA 4X1IA 1OHHG 4D6TH 2ZM6O 3DTUB 1VQKV 3AK3A 2F93B 1JMKC 4DV0B 4LF8O 5JWPA 2CUGA 1VQMV 3JAKA 3SYQA 5LHHA 4BW5A 1RSOB 1VIBA 3IC7A 3ABKB 1OCZB 2G38A 1MG1A 1JQ0A 4TWKA 1R6TA 2QWNB 1S5JA 2F66C 2P4VA 2JIZG 1OCOB 4JI7O 2CTPA 3RYHA 5IYZA 3ZHTA 1R3IC 2F4VO 2PZSA 2EJ7A 1IBMB 4DO2A 3A0RA 1IXBA 1PL0A 1VQNV 1FFTB 1Z2GA 4JI0B 3SDLA 2IU0A 3N2KB 3EXAA 2KG7B 3N27A 2QKCA 5LBQA 2VQEB 4ICGA 4LF4O 1UFIA 4KXRA 1SQXH 2HJFC 4NXNB 3CCMV 4OPHA 2UUAO 2KQXA 4BIUA 4OX9B 3RYCB 3IAYA 1PNLA 4GKJB 4J42A 1DF4A 2QSAA 1SF9A 3X2QC 4IGGA 4PA7A 1NR7A 1D2DA 3MAQA 2QDOA 1SQQH 2NN4A 3SPIA 2WLHA 1RPRA 1B06A 4FZ1A 2P4KA 1T5EA 1AB3A 3SPGA 1KYOF 1SQGA 4DXWA 2A9HA 5CN0A 1M90W 3TK1A 4IIJA 2OCCC 5JVDA 4P30A 1Y67A 4DUYO 2O57A 4GX5A 2RMKB 4FZ0A 3FB6C 3ZEDA 1PD3A 1SA0B 3CRMA 3JATA 1RP3B 5KAIZ 1GO3F 3ABMB 3K58A 4B3RB 1R3LC 3SYAA 2YSUB 1VQ4V 5IWAO 3K0DA 5JCOA 5FNVA 1Q7YW 4O4LB 4X66O 1Q86W 3W7WA 1FXKB 1W2BU 1Q6UA 4JAVA 2Z0AA 4FM0A 2DYRC 4LH6A 3RYIB 4AHCA 4I5SA 3TCUA 4K0KB 2PYJA 1KU9A 3OTFA 4RQEA 1VEWA 3FB7C 2DQ3A 4JGSA 2GV9A 5EYPA 2QKAA 3CRRA 5ITZB 2W0XA 3RW0A 2CH7B 4YY3O 2PI4A 4NXMB 4ZI7B 2VQFB 3OW2U 3CRQA 4FLXA 2X6CA 1FFXA 5LMNB 1N34O 4GZRB 4O4IB 3W7TA 1V54B 3AG4C 5FL7G 1F7YA 3ASOB 5BR8B 4PD4F 4PHZA 1AILA 3AG2C 2YXLA 3BRCA 1NBMG 2CGNA 3KG2A 1G8MA 4LF7O 3WB0A 1F51A 1BHAA 4DR4O 5KLVH 4LFCB 1ZX3A 1S5LZ 4FLTA 4NTXA 3RBZA 3T4DA 4JI3O 1PM9A 4IHJB 4MTXA 1R3KC 4GX0A 2FTKA 2P06A 4J7ZA 3T1YB 2FB5A 2F23A 4P9OA 1IX9A 4JI8B 3AEIA 4WFEA 5E79Z 4UB8Z 5J2TB 2UXDO 1AVMA 1I7FA 4OPAA 2JRIA 1DTOA 4CH6A 3CJHB 2ZR3A 1D5NA 4I9WA 4LF8B 4HNAA 2WLKA 1VF6C 4DK1A 3HKEB 2LGQA 1K97A 2N05A 1KC8W 5LA6B 4I4TB 1AI4A 1P49A 1S3JA 2ZR2A 5DECA 3A2FA 2IH3C 4CS3A 1SESA 1CEZA 3AK1A 4MW8A 3ETEA 2YDEA 4R7CA 4MVUA 4O4HB 3ASNB 1HR0O 1K3EA 5CBHA 1KECA 3UQ8A 4X64O 4JI7B 3FYIB 1JFFB 5LGTA 1A32A 2YI9A 4CC6A 1XBLA 1US6A 2F4VB 5IY5C 5BMVA 4DV3B 2GUZB 3ZN1A 5B1BC 2HVJC 3WG7C 5GONA 4PA6A 4MTOA 3EHBB 1GM9A 3JD0A 2Y69C 5CA0B 4LF4B 3FAVB 1GK9A 4N21A 4WBNA 4XDLA 4MVMA 2YIDA 1K4DC 1WJZA 2JS3A 3E22A 1GN4A 3IC9A 1CP9A 1EZJA 3ZHVA 2EZPA 1QU7A 2LFSA 4TT3G 1IDSA 4ZIBA 1OJHA 4NR1A 3VQVA 3CXCU 1VF6A 3LDDA 3OGIB 5L3EA 4A5UB 2OT5A 1BCCH 1W59A 2YEVA 3OD4A 4EB6B 1ZAUA 4K8XA 3JASA 1XILA 2WLLB 3L70H 3CS5A 3H1KH 3Q4HB 5BXZA 3TJTA 1QLEC 1HNXB 3ABKC 2A79B 1OCZC 3B8NA 2OYQA 4UUJC 4XDKA 2R72A 2WLIA 4JI0O 4RO2A 1TUBA 1H8HG 3AG3B 2VWKA 2LW7A 5GW7A 4DUYB 1OCOC 3GWKC 1PNMA 2DYRB 2CGOA 5CB4A 4B7KA 1GTOA 4YJ2B 1M4UA 4LWSB 4ZHQA 5IJ0B 5IWAB 4JI4O 4TQDA 1PKXA 3LNMB 4DRXA 4X1YA 5FPRA 4GKJO 5B5EZ 4X66B 3ZMZA 1S72V 1EM1A 4UCSA 3HPLC 4N23A 1J95A 3K5LA 2GTSA 4JYBA 2Q5ZA 3LSUA 5KHIA 3QO5A 1KKCA 2GDSA 2CTQA 1BS3A 4LF9O 4TV9A 3UO2A 2IW5A 4IYHA 2FL4A 1XL4A 1WNSA 2QM8A 3CWBH 3WU2Z 1B6QA 4ZBMA 5LP6A 1SQVH 4UV8A 2OIEA 5LXTB 3HKDB 2RJZA 1H2MA 3AG2B 4ASUG 4RAIA 4DV7O 5BY1A 1LUWA 5L3GA 2X6BA 2HEPA 1RSOA 3P3NA 4YY3B 2IH1C 3ZRXA 1ZUQA 3FB5C 3C90A 1XHZA 3ZRWB 3WB2A 1KBHA 1GN3A 2BOCC 5B1NA 4DYLA 1N34B 4B3RO 3RFRA 3CCRV 3O65A 2P7TC 1IZ3A 2Z3YA 3BAAA 4GCZA 4J7JA 3H1JH 4DR4B 4FK5C 5A2QN 1E79G 1NR1A 3BCCH 3SR2C 5L3FA 3SJCC 1URFA 2B1IA 4QPJA 3JARA 3ABMC 3HKCB 4JI3B 3WFVA 5JJJB 1BGYH 4NVPA 2BSKB 2KG7A 2QGNA 2W6IG 1NQTA 4LF5O 4KHPO 3W7XA 1K73W 4DK0A 3CEIA 3UCSC 2UXDB 5IDJA 3RYCA 3CC7V 3CCUV 1MMMA 2YUAA 2LQTA 2ZINA 2JK5C 4QGPA 3HR0A 1MA1A 5L3BA 5LHGA 4FFBA 1AJQA 4JYYA 4QPKA 3CRCA 3RYFB 3NR7A 4E4EA 5LYJB 4NTWA 2CDYA 1AI5A 4J10A 4DR3B 1Q81W 1KP3A 4MSWC 2Y0PA 5C8YB 2LJ2A 1HR0B 2EILB 1WLEA 4X64B 2Y69B 1XL6A 1BQ0A 3NXSA 4H33A 1HNZO 2Q73A 3E8BA 3SPHA
chains in the Genus database with same CATH topology
3T2MA 4HZ3A 4JPRA 2A9HA 1E1RG 5CN0A 1THZA 1M90W 3TK1A 1QLNA 2EIMC 2OCCC 5CA3A 4P30A 4GX5A 3OGCC 5H6RA 3FB6C 4MVRA 1P7BA 1PD3A 3ZMTA 2JEUA 2P6JA 2UXXA 3JD1A 3ZN0A 4G28B 1YHQV 3LDCA 1DLBA 1GO3F 4JASA 3CCLV 4KP4A 3ABMB 3GWOA 2KB1A 4GT1A 4PDVA 1R3LC 3SYAA 2YSUB 1VQ4V 1RPOA 3T4ZA 2HVKC 4BIZA 1FXKA 1M56B 3K0DA 3ML0A 4ZKIA 1Q7YW 1SETA 3FB8C 3K04A 4JYCA 2NLJC 1Q86W 3GB7C 3MHHC 5B3SB 3W7WA 2HFEC 1FXKB 1YJNV 3CPWU 1W2BU 4QE9A 2HLDG 4JAVA 3ZRVA 4HAMA 2X0LA 3D36A 1QLEB 4RUEA 4RQFA 1MOFA 2Q6AA 3MD0A 3FYEB 3DGEA 2DYRC 4GX1A 1QVGU 1QR8A 2B5UA 4MTGA 4PA3A 1AI6A 4I5SA 3TCUA 2ZDIA 3CYOA 1YI2V 3UM7A 3JD4A 3RVZA 2K1EA 3QNEA 4UV9A 4RQEA 3EFFK 4R50A 3FB7C 2OTJV 3OM3B 2DQ3A 4JGSA 4H37A 1K7DA 5HFMA 1YJ9V 2W0FC 3X2QB 3OMAB 2EINB 1N8RW 4E2LA 2GSMB 3LSQA 1E1QG 1H2GA 4UXNA 5LGUA 3RW0A 2XAGA 3SYCA 3OFNG 1MABG 4X8AA 3AG1C 4YXWG 2PI4A 2IJHA 2JEXA 3ZCCA 2W6JG 1FXHA 3OW2U 1DF5A 3D3IA 3IFXA 2X6CA 3E35A 1JPXA 3ASNC 5H9CA 3W7TA 3ZRSA 1V54B 4MTFA 5E1AC 3HB3B 2CK3G 3AG4C 5FL7G 2P90A 3ASOB 3AG2C 2DW4A 5IYBO 2NNUA 5EBMC 3JCZA 5L3CA 3SYOA 2EIMB 2OCCB 3ABTA 1NBMG 3LSSA 3KG2A 4MT8A 3QO7A 1G8MA 3K3WA 1YSCA 5C93A 1F51A 2H8PC 1BHAA 3E89A 2C2AA 1YIJV 3MHSC 3G4SV 3ABUA 3CC4V 1ORQC 5DN6G 2EIJB 2H94A 3CCSV 3RBZA 5EBLC 4QE7A 3T4DA 5CBFA 3OMNB 4UVAA 1QCEA 1S0VA 1JOYA 3FKSG 4UVCA 4MTXA 1R3KC 1JCHA 4GX0A 3CCJV 3P32A 1H38A 2FTKA 1F4MA 5H6QA 1K4CC 4PDMA 1AJPA 4P9OA 3ZIAG 3AEIA 2IJJA 4LC1A 4WFEA 4Z1MG 2DYSC 2ZD9A 1AROP 2LFRA 2XAFA 4WCEV 1CPYA 1SRYA 2DWEC 3E8FA 4FIPC 5IYDO 3CP1A 2Y48A 1DTOA 1Y66A 1W0JG 2ZR3A 3ETDA 3ABLC 5CBGA 4I9WA 1HWYA 2WLNA 4BAYA 1AR1B 3ETGA 1G4YB 2WLKA 4LBEC 2X6AA 3I55V 3OEHG 4G2KA 4WF9V 4JF3A 4MW3A 1M57B 2BOBC 3E8HA 4P9PA 1K97A 2QA4V 1KC8W 2B1GA 1S76D 3LUTB 1ENVA 1AI4A 2JJ2G 1VQOV 1S3JA 5EC2C 1K5SA 2ZR2A 1R6KA 3AG1B 3I56V 2IH3C 3CC2V 5IYCO 1R6NA 1SESA 2EBOA 2Q68A 3STZC 5KUKA 2EIKC 1CEZA 1P4RA 1W0KG 5BZBA 2QEXV 1GM7A 4LCUC 2WLJA 4MW8A 3ETEA 4QIWF 4R7CA 3CCEV 2WWWA 4FPPA 4MVUA 3ASNB 1S5HC 3K08A 3CCVV 1K3EA 5CBHA 1KECA 1BL8A 3AG3C 3UKMA 3FYIB 2IU3A 5KUMA 3E8GA 1OCRB 5LGTA 1YITV 1F23A 2Q67A 3AG4B 2IJIA 4L87A 1OCCC 4X89A 2ITCC 3R65A 5IY5C 3ZMUA 1K34A 4FJCC 1UJWB 2AHZA 3OUFA 1I5YA 5DM6V 2XAHA 3OE7G 3ZN1A 4WFGA 1LNQA 2LP7A 2M7WA 5B1BC 2WPDG 2HVJC 5B1OA 1VQLV 1VQ8V 1K33A 1JVMA 1K92A 1FS0G 2PI5A 1KD1W 5EC1C 4JAUA 3WG7C 1KQSU 4PA6A 4JTCB 1V55C 3W7UA 4MTOA 1K8AW 2F43G 3EHBB 1GM9A 3JD0A 3H01A 2Y69C 4GX2A 4WFFA 3G71V 1M1KW 1GK9A 4N21A 5EBWC 3STLC 4XDLA 4MVMA 2AHYA 1K4DC 4LP8A 3CD6V 3PJSK 5CMUA 2QKSA 3B77A 2Q69A 1CP9A 1EZJA 4KUMA 1YTFB 2QTOA 2DQ0A 4XBFA 2EZPA 2DYSB 1FXVA 4CBCA 2LFSA 2EJRA 4TT3G 4XDJA 3ZJZA 4MVZA 1MSWD 3CXCU 3LDDA 3M99B 3P30A 4JTAB 2XAJA 1NKDA 5L3EA 2OT5A 2WLLA 3OR7C 1QR9A 1TUEB 2YEVA 1YJWV 2GHYA 1M56C 1JX9A 2QM7A 2WLLB 3VOUA 2YEVB 5B1AC 1NH2B 3CCQV 4PA9A 1FXKC 1NJIW 1IXMA 1QLEC 4UVBA 2EIKB 2XAQA 3ABKC 2A79B 1OCZC 3B8NA 1QVFU 3VBBA 4J9ZB 4Q20A 4PELA 4UUJC 4XDKA 2QE7G 2WLIA 3TETA 3F7YC 4RO2A 1H8HG 3AG3B 1YTFD 1OZ0A 4TSFG 2XNDG 5GW7A 4KFMA 2EZOA 2WLIB 3CMAV 1OCOC 1OCCB 1PNMA 3SJQC 5IY5B 3K06A 2DYRB 1NVPB 2ZDIC 2HKOA 4EKWA 5EK0A 1GTOA 2ZXWC 1K9MW 1AI7A 4FMTA 2A0LA 3G6EV 5B1BB 1AJNA 2R9IA 2P67A 1R3JC 1PKXA 3K0GA 4MS2A 3SPCA 3LNMB 3OMIB 3WG7B 5LGNA 1H8EG 3JD3A 5KA6A 2ZQMA 1PNKA 2V1DA 1V55B 3K79A 5HFLA 3JYCA 4CZZA 3K9AA 3ZMZA 1S72V 2XASA 1Y4MA 4G27B 5L3DA 3HPLC 1ZWIC 1F4NA 1J95A 1WPXA 4N23A 2ITDC 1NH2D 2WSSG 3OEEG 1V54C 4JYBA 4U7NA 3QO8A 1GMGA 4F4LA 3SYPA 3ASOC 2DWDC 3QO5A 3K03A 3OR6C 2V7QG 3E86A 2IW5A 1VQ5V 2OTLV 1XL4A 3W7SA 2QM8A 4R6ZA 1B6QA 4ZBMA 1VQPV 4UV8A 2JDIG 1S77D 3AG2B 4ASUG 1NVPD 1OHHG 4RAIA 3BEHA 3DTUB 1VQKV 5L3GA 2EIJC 3ZRWA 1RM1C 2X6BA 2UXNA 3JD2A 2IH1C 3ZRXA 3FB5C 2R9RB 4PA4A 5B1AB 4P2ZA 3ZRWB 5LHIA 1VQMV 2D3OW 3OAAG 3IGAC 3SYQA 5LHHA 4BW5A 1SZTA 2BOCC 2EILC 5B1NA 3IC7A 3ABKB 4WFBV 2MK3A 1KKDA 1OCZB 1MG1A 1JQ0A 1L1FA 3CCRV 4TWKA 4R8CA 3RVYA 2P7TC 4PDLA 5J9PC 1KP2A 1COWG 1ROPA 4J9YB 2HR3A 2JIZG 2X7RB 1OCOB 2Z3YA 2HG5C 4GCZA 4QJFB 3F5WC 5KA5A 3ZMSA 4FK5C 4MVSA 1E79G 1R3IC 2ZXWB 3E2EA 2IJKA 1M57C 1NR1A 4WFAV 3SPJA 5L3FA 1EBOA 4JTDB 4PDRA 2B1IA 4DO2A 4QPJA 3ABLB 3A0RA 3ABMC 1PL0A 2XOKG 1BHBA 3WFVA 1GKFA 1VQNV 1FFTB 3F7VC 4X88A 2W6IG 1NQTA 3T1CA 3W7XA 5B3SC 2IU0A 1K73W 1I5XA 4RUFA 5LBQA 1OCRC 2WLMA 4OXSA 1QBZA 4QNHB 5IDJA 3LDEA 3CC7V 2HJFC 3CCMV 3CCUV 3BY6A 2Z5UA 4BIUA 1VQ6V 4WFHA 2JK5C 1PNLA 1SERA 1GM8A 1DF4A 1M9NA 5L3BA 1EFRG 1VQ7V 5LHGA 1AJQA 4QPKA 1RM1B 3X2QC 3ZMVA 2WAMA 4PA7A 3CMEV 1NR7A 3OUSA 4MVQA 1AI5A 2EINC 1BMFG 1Q81W 1KP3A 4MSWC 3SPIA 4HYOA 2WLHA 1R73A 1RPRA 4U7OA 3E83A 1Q82W 2EILB 1WLEA 1JJ2U 3B8MA 2Y69B 1XL6A 4MVOA 3NXSA 1VQ9V 4H33A 2JJ1G 1K5QA 3E8BA 3SPGA 3SPHA 4DXWA 2ATKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T2M A;  4HZ3 A;  3TET A;  2IH1 C;  2A9H A;  4XDJ A;  3ZJZ A;  4MVZ A;  3RBZ A;  5EBL C;  3FB5 C;  2R9R B;  4PA4 A;  4QE7 A;  4P2Z A;  3T4D A;  5CBF A;  2EIM C;  2OCC C;  3IGA C;  3LDD A;  4P30 A;  3SYQ A;  4BW5 A;  4GX5 A;  2BOC C;  1R3K C;  3OGC C;  2EIL C;  4GX0 A;  3FB6 C;  4JTA B;  1KKD A;  4MVR A;  1P7B A;  2WLL A;  1K4C C;  3OR7 C;  4PDM A;  4G28 B;  2YEV A;  4P9O A;  4TWK A;  3LDC A;  4R8C A;  3RVY A;  2P7T C;  4PDL A;  4WFE A;  5J9P C;  1M56 C;  2DYS C;  2KB1 A;  2ZD9 A;  4PDV A;  1R3L C;  3SYA A;  2WLL B;  4J9Y B;  3VOU A;  3T4Z A;  2DWE C;  2HVK C;  3E8F A;  5B1A C;  2HG5 C;  4PA9 A;  3F5W C;  3K0D A;  3K04 A;  3FB8 C;  4MVS A;  1QLE C;  2NLJ C;  3GB7 C;  3ABK C;  1R3I C;  2HFE C;  3ABL C;  5CBG A;  2A79 B;  1OCZ C;  1M57 C;  2WLN A;  4I9W A;  3SPJ A;  4J9Z B;  4QE9 A;  4UUJ C;  1G4Y B;  4XDK A;  2WLK A;  2WLI A;  2X6A A;  4JTD B;  4LBE C;  4PDR A;  3F7Y C;  4RO2 A;  4RUE A;  2Q6A A;  3ABM C;  4MW3 A;  2BOB C;  3E8H A;  4P9P A;  2DYR C;  4GX1 A;  3LUT B;  4MTG A;  4KFM A;  2WLI B;  3F7V C;  4X88 A;  1OCO C;  4PA3 A;  3SJQ C;  3TCU A;  5EC2 C;  3K06 A;  3UM7 A;  2IH3 C;  3RVZ A;  3T1C A;  5KUK A;  2Q68 A;  2K1E A;  5EK0 A;  2EIK C;  3STZ C;  4EKW A;  2ZXW C;  5B3S C;  5BZB A;  4LCU C;  4RUF A;  2WLJ A;  1OCR C;  3EFF K;  4MW8 A;  4R50 A;  2WLM A;  3FB7 C;  2A0L A;  4OXS A;  4R7C A;  4MVU A;  4H37 A;  1S5H C;  3K08 A;  4QNH B;  1R3J C;  5CBH A;  1BL8 A;  2W0F C;  3AG3 C;  3K0G A;  3LDE A;  4MS2 A;  3LNM B;  3SPC A;  3UKM A;  5KUM A;  2HJF C;  3E8G A;  2Q67 A;  3RW0 A;  3JYC A;  3SYC A;  1OCC C;  4X89 A;  2ITC C;  3R65 A;  4X8A A;  5IY5 C;  4G27 B;  3AG1 C;  3HPL C;  1ZWI C;  4WFH A;  2JK5 C;  1J95 A;  2AHZ A;  3OUF A;  2ITD C;  1V54 C;  3IFX A;  2X6C A;  4WFG A;  1LNQ A;  4F4L A;  5B1B C;  3ASN C;  2HVJ C;  3ASO C;  2DWD C;  3SYP A;  1JVM A;  3K03 A;  3OR6 C;  3ZRS A;  5EC1 C;  3X2Q C;  3WG7 C;  4MTF A;  4PA7 A;  4MVQ A;  3OUS A;  5E1A C;  3E86 A;  2EIN C;  3AG4 C;  4PA6 A;  4JTC B;  1V55 C;  3AG2 C;  1XL4 A;  4MTO A;  5EBM C;  4R6Z A;  4ZBM A;  3SYO A;  4MSW C;  2Y69 C;  3SPI A;  4GX2 A;  2WLH A;  4HYO A;  4WFF A;  3KG2 A;  3E83 A;  5EBW C;  3STL C;  4XDL A;  4MVM A;  4RAI A;  2AHY A;  1K4D C;  4LP8 A;  3BEH A;  2H8P C;  3E89 A;  3PJS K;  2QKS A;  2Q69 A;  1XL6 A;  2EIJ C;  2QTO A;  4MVO A;  4H33 A;  1ORQ C;  2X6B A;  3E8B A;  3SPG A;  3SPH A;  4CBC A;  4DXW A;  2ATK C; 
#chains in the Genus database with same CATH topology
 1IUR A;  1SA0 A;  5LOV B;  3T1Y O;  5CA3 A;  1QNM A;  1N36 O;  1P7B A;  3ZMT A;  2QWR B;  2P6J A;  5F2V O;  3ZN0 A;  4G28 B;  1Z5V A;  3LDC A;  4KP4 A;  3GWO A;  4B3M O;  4O4L A;  1XEQ A;  3CE2 A;  5JH7 B;  4BIZ A;  1FXK A;  3FD9 A;  5JJN B;  2ADP A;  1NU1 H;  4FLW A;  1VF7 A;  2CE4 A;  1YJN V;  3JSN A;  3CPW U;  1GH6 A;  3RYI A;  3JAW B;  1QLE B;  2JGD A;  1MOF A;  3MD0 A;  1PPJ H;  1NTK H;  4GX1 A;  2B5U A;  1JR9 A;  3AK2 A;  1AI6 A;  2ZDI A;  3B40 A;  1YI2 V;  4I55 B;  2Q0O C;  3JD4 A;  2ODM A;  3QNE A;  4R50 A;  4X20 B;  2OTJ V;  5ITZ A;  4H37 A;  4Q6G A;  2W0F C;  4L8J A;  3OMA B;  4ZI7 A;  1N8R W;  1Y76 B;  1XQ8 A;  4CS2 A;  4DV3 O;  2GSM B;  4UXN A;  1E1Q G;  1SQP H;  4DW1 A;  2AXT Z;  2QTS A;  3OFN G;  4YXW G;  4O4I A;  2JEX A;  3ZCC A;  1FXH A;  1DF5 A;  1O9H A;  3ASN C;  5GTI Z;  4YJ3 B;  4GUN A;  3ZRS A;  3FX7 A;  4MTF A;  3HB3 B;  2QJ1 A;  1ZSP A;  2PUS A;  5IYB O;  3JCZ A;  1BT8 A;  3SYO A;  5GTH Z;  1YZB A;  4MT8 A;  4J80 A;  2WA3 A;  3QO7 A;  3OTO B;  4JI4 B;  3L72 H;  4DR6 B;  1YSC A;  2H8P C;  1I08 A;  3E89 A;  1EZV H;  4JI5 B;  4U3J B;  2BTQ B;  4IHJ A;  4D7T A;  4HBN A;  3B09 A;  2H94 A;  4LH7 A;  5EZY B;  2HHH O;  1JOY A;  4JI6 O;  3FKS G;  4UVC A;  1FAF A;  4LF9 B;  1F4M A;  5H6Q A;  4GYC B;  3T1H B;  2ZE5 A;  4LC1 A;  1RFY A;  1ARO P;  2XAF A;  1HNX O;  4K3A A;  4WCE V;  4B3T B;  3E8F A;  5IYD O;  3CP1 A;  4DV7 B;  1L0L H;  1M93 A;  3ETD A;  3ABL C;  1HWY A;  5LA6 A;  1U97 A;  4I4T A;  3ETG A;  4UCU A;  1G4Y B;  1IBL O;  4LBE C;  3I55 V;  4G2K A;  4WF9 V;  4MW3 A;  4P9P A;  3K59 A;  2QA4 V;  2OCH A;  1VQO V;  1NI8 A;  3AG1 B;  4O4H A;  1R6N A;  2Q68 A;  1IBK O;  2PF4 E;  1P4R A;  1JFF A;  2QEX V;  1GM7 A;  1SZX A;  2ZE6 A;  4LCU C;  3HKB B;  2ZKO A;  4D7S A;  1P7G A;  4FPP A;  1S5H C;  1I0H A;  3AG3 C;  1MZE A;  2IU3 A;  5KUM A;  2Q67 A;  2Q4P A;  4DR7 O;  2ILM A;  2GUZ A;  5J2U B;  4O2A B;  1H2S B;  5KHG A;  1K34 A;  4O4J B;  2AHZ A;  3OUF A;  1AR5 A;  1I5Y A;  5DM6 V;  2XAH A;  1LNQ A;  1WB7 A;  2LP7 A;  2M7W A;  1VQL V;  1VQ8 V;  1X59 A;  4O2B B;  1K33 A;  1PL4 A;  1K92 A;  2PI5 A;  4C7U A;  4JAU A;  5CA0 A;  3RGB A;  3FAV A;  1WP8 A;  4JI2 O;  4LF5 B;  4KHP B;  3W7U A;  3FFQ A;  3H01 A;  5FPO A;  3G71 V;  3JCU Z;  5EBW C;  3ICX A;  1SQF A;  4CH5 A;  3CD6 V;  3PJS K;  5CMU A;  3SGI A;  2QTO A;  2R9A A;  1XNQ O;  2DYS B;  4CBC A;  3ZJZ A;  2ZIM A;  3P30 A;  2Y4U A;  4JTA B;  1EN5 A;  2WLL A;  3DC5 A;  3OR7 C;  2JVD A;  1YJW V;  1M56 C;  4PI0 A;  3BHP A;  1R1B A;  3K5M A;  4W4K A;  1EN6 A;  1IXM A;  3APO A;  1XMO O;  2EIK B;  3JAL A;  1HNZ B;  2HJD A;  1XHX A;  1Q8I A;  3KCY A;  1Z5W A;  1BZK A;  2A3Q A;  1OZ0 A;  4TSF G;  4K8Z A;  2XND G;  1GAX A;  2PY5 A;  4YJ2 A;  4FVM A;  4LWS A;  4JI1 O;  4CS4 A;  1OCC B;  1N36 B;  5IJ0 A;  2HKO A;  2IM9 A;  3L71 H;  4EKW A;  3DSQ A;  1AI7 A;  4FMT A;  4B3M B;  2E3C A;  4LFB O;  1R3J C;  3K0G A;  3SPC A;  3JD3 A;  2ZQM A;  1V55 B;  3K79 A;  1MZF A;  4CZZ A;  1YF2 A;  3K9A A;  2XAS A;  4J41 A;  4G27 B;  4DW0 A;  3J7A U;  4I50 B;  4ZOL B;  5H5N A;  1GMG A;  4DR3 O;  4F4L A;  3SYP A;  4JV5 O;  1P84 F;  3VQW A;  4JYA O;  3BFR A;  3E86 A;  5LXT A;  3HKD A;  2OTL V;  2JGU A;  2ETN A;  4UCV A;  3K57 A;  5JVD B;  5FLX N;  4UB6 Z;  4DV1 O;  3UT5 B;  2D2C B;  1PV0 A;  3ZRW A;  2IBZ H;  4AIL C;  1AP5 A;  4IT5 A;  2K9P A;  2UXN A;  3JD2 A;  4Z2W A;  2PYL A;  1EN4 A;  2R9R B;  4P2Z A;  4RWU A;  5LHI A;  3OAA G;  3IGA C;  2EIL C;  3QF7 A;  2MK3 A;  5J9P C;  1KP2 A;  1COW G;  2E75 B;  2FML A;  5D5Q A;  1ROP A;  4J9Y B;  2ZNJ A;  2HG5 C;  4QJF B;  3F5W C;  4B3S O;  1TA8 A;  3HKC A;  1Y74 A;  2IJK A;  1M57 C;  4WFA V;  3SPJ A;  1U96 A;  4UFZ A;  4PDR A;  4X1K A;  3ABL B;  2P22 C;  2HHH B;  1BHB A;  1SKV A;  3GVM A;  4JI6 B;  3H1L H;  2QR4 A;  4IYI A;  3ZHQ A;  1OCR C;  4TV8 B;  2WLM A;  4OXS A;  1QBZ A;  4QNH B;  3LDE A;  3SJB C;  3BY6 A;  1GN6 A;  2Z5U A;  5IJ9 A;  1VQ6 V;  4TUY B;  1IBL B;  1GN2 A;  3RYF A;  1GM8 A;  2OIG A;  1VQ7 V;  4NTY A;  1H2L A;  1RM1 B;  3ZMV A;  2PTM A;  5LMU B;  3CME V;  4MVQ A;  2BTO A;  3OUS A;  5C8Y A;  3OTO O;  4DR6 O;  1IBK B;  1Q90 D;  4HYO A;  1R73 A;  3E83 A;  1Q82 W;  4JI5 O;  2ARH A;  1JJ2 U;  3PN1 A;  4DR7 B;  4MVO A;  1Q5O A;  1VQ9 V;  5LOV A;  2JJ1 G;  1G6U A;  1K5Q A;  3D8C A;  2ATK C;  1J5E B;  3T2M A;  1SS3 A;  4JPR A;  1THZ A;  3APQ A;  3T1H O;  4LF6 B;  5H6R A;  3H1H H;  4MVR A;  4B3T O;  1ZLZ A;  2UXX A;  1YHQ V;  5JH7 A;  2E74 B;  4JI2 B;  4JAS A;  1HNW O;  5KMG B;  5KHH A;  2Q8V A;  4GT1 A;  3G6B A;  4PDV A;  5CA1 B;  3IJ4 A;  1RPO A;  3T4Z A;  1UPG A;  2AGA A;  3AG7 A;  1M56 B;  4GKK O;  1VAR A;  3JAW A;  3K04 A;  3FB8 C;  4JYC A;  1KMI Z;  2NLJ C;  5KHK A;  5B3S B;  1XNQ B;  4UCO A;  4QE9 A;  3ZRV A;  2Q6A A;  3FYE B;  1MNG A;  4I55 A;  1YCI A;  2YIC A;  4MTG A;  1MSD A;  4X20 A;  3CYO A;  2UU9 O;  3RVZ A;  2K1E A;  3P3P A;  4UV9 A;  5K1P A;  3CHX A;  3EFF K;  2UUC O;  1N0J A;  1K7D A;  1YJ9 V;  1N4C A;  2EIN B;  2YXH A;  3LSQ A;  1H2K A;  4TQF A;  1XMO B;  3SYC A;  3WB1 A;  4YIP A;  1I94 B;  1MAB G;  4X8A A;  2CTW A;  3AG1 C;  2CAZ C;  2IJH A;  4YJ3 A;  3N2K A;  2W6J G;  2QWO B;  5JQG B;  1JPX A;  3M8A A;  4EFB A;  4JI1 B;  1XDC A;  1O9G A;  2CK3 G;  2P90 A;  2RNB A;  4UCR A;  2DW4 A;  4DV5 O;  2NNU A;  2EIM B;  3ETQ A;  4B7E A;  2RQ6 A;  4LFB B;  2H3O A;  4AI8 A;  5C93 A;  2BTQ A;  4DV2 O;  2C2A A;  2Y4T A;  3MHS C;  3G4S V;  3CC4 V;  1ORQ C;  4F6E A;  5DN6 G;  1L8D A;  3CCS V;  4QE7 A;  4U3F H;  5CBF A;  5KX5 B;  1QCE A;  1DGS A;  1JCH A;  3BA8 A;  4JV5 B;  2R70 A;  3RWR D;  4JYA B;  1NTZ H;  1K4C C;  1AJP A;  2Q7E A;  4AQY O;  4J11 A;  4Z1M G;  1AR4 A;  2DYS C;  2LFR A;  4LR3 A;  4NB5 A;  1CPY A;  1SRY A;  2DWE C;  4DR5 B;  3KCX A;  4H0L B;  4DV1 B;  2Y48 A;  1WN7 A;  1KUQ A;  1W0J G;  1XNR O;  2WLN A;  4BAY A;  2V4D A;  1AR1 B;  3SJA C;  2L6L A;  2X6A A;  3CX5 F;  3L9D A;  2WA4 A;  4FLY A;  3OEH G;  4JF3 A;  1M57 B;  3E8H A;  1WP7 A;  1S76 D;  4X1Y B;  1ENV A;  1VF5 B;  1K5S A;  1B04 A;  1R6K A;  3I56 V;  3CC2 V;  5KUK A;  3STZ C;  2EIK C;  1W0K G;  2WLJ A;  3A8T A;  1AP6 A;  3CCE V;  2E5L B;  1TAE A;  3A0B Z;  3K08 A;  4DR2 O;  1B3Q A;  4O2A A;  3UKM A;  3BAB A;  2A7W A;  1OCR B;  1YIT V;  4B3S B;  1F23 A;  3L74 H;  4O4J A;  1N0N A;  3JSL A;  4TV9 B;  2IJI A;  1OCC C;  3R65 A;  2UXB O;  2VRZ A;  5LP6 B;  4H44 B;  4FJC C;  4O2B A;  1UJW B;  3H9V A;  1LUV A;  3OE7 G;  4WFG A;  1Q3E A;  1KQS U;  1V55 C;  2CH7 A;  5EIB C;  3CB2 A;  1K8A W;  2RCV A;  2F43 G;  1TVK B;  2P5O A;  4GX2 A;  4WFF A;  1M1K W;  3G80 A;  3ZHR A;  3THO A;  3B77 A;  2Q69 A;  1YTF B;  2F95 B;  2XUM A;  2EJR A;  4XDJ A;  4MVZ A;  1MSW D;  2HP8 A;  3ZHS A;  4DV6 O;  2GTA A;  2MW2 B;  2ZNI A;  2DJV A;  3JAR B;  2QM7 A;  4X62 O;  4I0X B;  1KB9 F;  1NS1 A;  4PA9 A;  2LGW A;  5JCO C;  1XOU A;  4J9Z B;  2N74 A;  4Q20 A;  3DXR B;  4PEL A;  2QE7 G;  5H2F Z;  4LNU B;  3F7Y C;  3QTC A;  5J2T A;  1YTF D;  3KKY A;  1HW7 A;  2DN9 A;  3TGU H;  1WA8 B;  2YXY A;  4EFE A;  3SJQ C;  1NVP B;  3K06 A;  4IL6 Z;  3CJH A;  5TIS Z;  2NR5 A;  1HNW B;  3HKE A;  1AJN A;  2UUB O;  2P67 A;  4FFB B;  4MS2 A;  1PP9 H;  2QM4 A;  4OGQ B;  1OV9 A;  1TGO A;  4GKK B;  1H8E G;  4I50 A;  1ZL8 B;  2ZIO A;  3DC6 A;  2LO1 A;  4ZOL A;  3JYC A;  5L3D A;  2ITD C;  2WSS G;  2YI8 A;  5LMU O;  4U7N A;  3QO8 A;  1X4T A;  2YIB D;  3M7M X;  4BWA A;  1Q43 A;  2DWD C;  3K03 A;  2VWJ A;  3ZS8 C;  3ZX6 A;  4F6R B;  1VQ5 V;  2UU9 B;  2AZ0 A;  3W7S A;  1N32 O;  3UT5 A;  1Q6H A;  1VQP V;  5K1X A;  2UUC B;  1S77 D;  4X65 O;  1BSM A;  2RDC A;  1NVP D;  3BEH A;  1J5E O;  1H2N A;  4PV1 B;  1YEW A;  3VQX A;  3N2G B;  3A0H Z;  2EIJ C;  3VQY A;  1RM1 C;  4X1I B;  4PI2 A;  4BIO A;  4LF6 O;  4DV4 O;  2GBO A;  2FKX A;  5B1A B;  4PA4 A;  2D3O W;  1SZT A;  4WFB V;  1KKD A;  4BW9 A;  3JAK B;  1L1F A;  4R8C A;  3RVY A;  2JGD B;  4PDL A;  4DV5 B;  3K5O A;  2HR3 A;  2X7R B;  5KA5 A;  3ZMS A;  4DV2 B;  4YHH B;  4MVS A;  1LR1 A;  3JAM N;  2ZXW B;  3E2E A;  4I7Z B;  2AW9 A;  2XT9 A;  3RYH B;  5IYZ B;  3CXH F;  4EB6 A;  1EBO A;  4JTD B;  2XOK G;  2XTA A;  1GKF A;  3F7V C;  4X88 A;  1BE3 H;  2FYU H;  3Q4H A;  4TV8 A;  1QQC A;  3T1C A;  1YXB A;  4AQY B;  1XI1 A;  5B3S C;  1I5X A;  4RUF A;  1FJG O;  5KHJ A;  1I94 O;  1HDJ A;  3L75 H;  2DE0 X;  4TUY A;  3D36 C;  1XNR B;  4WFH A;  3RT3 C;  1SER A;  4NYK A;  1M9N A;  4Z1V A;  1EFR G;  4H13 B;  2A06 H;  2WAM A;  2ZE7 A;  2EIN C;  3LNN A;  4NKG B;  1BMF G;  1VP7 A;  4UCT A;  4FM2 A;  3K5N A;  4U7O A;  1DK1 A;  4DR2 B;  2Y0I A;  3B8M A;  5A9G A;  4LFA O;  5LL6 Y;  2ZM6 B;  2UXB B;  4HZ3 A;  1N33 O;  1E1R G;  4CH4 A;  4PJ0 Z;  1QLN A;  4CH3 A;  2BE3 A;  2EIM C;  4DUZ O;  1XUQ A;  1V9P A;  3OGC C;  3D3Q A;  3BVO A;  5KMG A;  1GRJ A;  4FFK A;  2JEU A;  5CA1 A;  4IIJ B;  3JD1 A;  1CXZ B;  1DLB A;  3CCL V;  4DR5 O;  1XMQ O;  2KB1 A;  1Y6X A;  3JAT B;  2HVK C;  4DR1 O;  3ML0 A;  2KSD A;  2XHB A;  4ZKI A;  2L35 A;  1SET A;  3U10 A;  3GB7 C;  3O9O A;  3MHH C;  2HFE C;  3C3S A;  2HLD G;  5EIB D;  4HAM A;  5FNV B;  2X0L A;  3D36 A;  4RUE A;  4RQF A;  1QHT A;  3DGE A;  4I9Q A;  1QVG U;  2OWO A;  1QR8 A;  1FYJ A;  3BA9 A;  4PA3 A;  1YVW A;  4DV6 B;  2E5L O;  3UM7 A;  2UXC O;  2PGG A;  1YDX A;  5IE9 A;  3OM3 B;  5HFM A;  1NT2 B;  2E76 B;  3OT7 A;  4X62 B;  4JZG A;  3X2Q B;  2BSK A;  3TXS A;  2YS8 A;  4E2L A;  2YC0 A;  1H2G A;  1JJO A;  4DV0 O;  5LGU A;  2XAG A;  5JQG A;  4YIO A;  5EYP B;  4BR6 A;  1BQZ A;  2UUA B;  3KZI Z;  3D3I A;  3IFX A;  3E35 A;  3EVK A;  5H9C A;  5E1A C;  1FFX B;  5KAF Z;  3QG5 A;  3U11 A;  5EBM C;  3B4S A;  5L3C A;  1NTM H;  2OCC B;  5LP6 C;  3S3W A;  3ABT A;  3LSS A;  1IVS A;  2UUB B;  3K3W A;  1YIJ V;  3ABU A;  5KX5 A;  5LYJ A;  4K35 A;  4EEQ A;  4FLZ A;  2QWQ B;  4TOI A;  1L0N H;  2JS5 A;  2Q0A A;  1IBM O;  2EIJ B;  1FPO A;  5EBL C;  3K9S A;  3OMN B;  4UVA A;  1S0V A;  1SQB H;  1WPB A;  3CCJ V;  3P32 A;  1H38 A;  3JAL B;  2AZ2 A;  4PDM A;  2YIA A;  3ZIA G;  2IJJ A;  4B08 A;  2VQE O;  1N32 B;  2ZD9 A;  4FIP C;  4X65 B;  4NXN O;  3B2E E;  1G1X B;  1Y66 A;  2KKW A;  1WB8 A;  5CBG A;  4OX9 O;  4DV4 B;  2BOB C;  2B1G A;  3F5T A;  3LUT B;  4HNA B;  3J80 N;  2BCC H;  2JJ2 G;  1JA8 A;  5EC2 C;  5IYC O;  2EBO A;  5BZB A;  1XRE A;  4QIW F;  2WWW A;  3CCV V;  1BL8 A;  4CC5 A;  3E8G A;  4ABM A;  3AG4 B;  3CRA A;  2VS0 A;  4L87 A;  4X89 A;  2ITC C;  2Q9L A;  3ZMU A;  3CSX A;  4FLU A;  2WPD G;  2ADQ B;  5B1O A;  5BMV B;  1JVM A;  1FS0 G;  1KD1 W;  5EC1 C;  1TVK A;  5D5P A;  1Y76 A;  4KL1 A;  2RN9 A;  4JTC B;  3S3X A;  2EUL A;  2M6Y A;  1FJG B;  5GON B;  3UO3 A;  3STL C;  1M5I A;  3R66 A;  2AHY A;  4LP8 A;  4JAA A;  5B66 Z;  2QKS A;  4KUM A;  3MDS A;  2DQ0 A;  4XBF A;  4WBN B;  5DED A;  3U0Z A;  1WAZ A;  1FXV A;  4LF7 B;  3E22 B;  3ZHU A;  4GLX A;  4JZ2 A;  3M99 B;  1NZ6 A;  2XAJ A;  3L73 H;  1NKD A;  4K0K O;  1Y74 B;  1QR9 A;  1TUE B;  4W4L A;  4I0X A;  2GHY A;  4U3J A;  1JX9 A;  4X1K B;  5AG2 A;  4YHH O;  3TXQ A;  3J81 N;  2YIB A;  3VOU A;  5EZY A;  2YEV B;  5B1A C;  2Q7H A;  1NH2 B;  3CCQ V;  1NJI W;  1FXK C;  3JAS B;  3DXR A;  2Q7G A;  4LNU A;  4UVB A;  2XAQ A;  4LFA B;  3QVN A;  1QVF U;  3VBB A;  4NXM O;  3TET A;  1WA8 A;  1N33 B;  2VQF O;  1ZTE A;  3BPZ A;  5LMN O;  2EX3 A;  2B9Z A;  4DUZ B;  4KFM A;  2EZO A;  2WLI B;  3ZBH A;  3CMA V;  2LW1 A;  1TUB B;  5IY5 B;  5IJ9 B;  2ZDI C;  5BR8 O;  2ZE8 A;  1Q6I A;  4J7K A;  5EK0 A;  2ZXW C;  1K9M W;  1VMG A;  1XMQ B;  3G67 A;  1ZL8 A;  2A0L A;  3G6E V;  5B1B B;  2R9I A;  1FKA O;  5CB4 B;  4FM1 A;  4LFC O;  2DMX A;  3H1I H;  3OMI B;  3WG7 B;  5LGN A;  4DR1 B;  5KA6 A;  4ZHQ B;  2ZT9 B;  1PNK A;  2V1D A;  2ZCE A;  5HFL A;  1FD9 A;  5JJE B;  3C3T A;  1Y4M A;  1ZWI C;  4FLV A;  4DRX B;  1F4N A;  1NH2 D;  1WPX A;  3RN4 A;  3OEE G;  3HKB A;  2DOS A;  1D5A A;  1V54 C;  1SC5 B;  4F6R A;  2CTR A;  3I5D A;  3ASO C;  1HP8 A;  3OR6 C;  2N04 A;  2V7Q G;  4JI8 O;  2QWP B;  2UXC B;  5J2U A;  5IT9 N;  4R6Z A;  2F1M A;  2JDI G;  3N2G A;  4X9Q A;  4X1I A;  1OHH G;  4D6T H;  2ZM6 O;  3DTU B;  1VQK V;  3AK3 A;  2F93 B;  1JMK C;  4DV0 B;  4LF8 O;  5JWP A;  2CUG A;  1VQM V;  3JAK A;  3SYQ A;  5LHH A;  4BW5 A;  1RSO B;  1VIB A;  3IC7 A;  3ABK B;  1OCZ B;  2G38 A;  1MG1 A;  1JQ0 A;  4TWK A;  1R6T A;  2QWN B;  1S5J A;  2F66 C;  2P4V A;  2JIZ G;  1OCO B;  4JI7 O;  2CTP A;  3RYH A;  5IYZ A;  3ZHT A;  1R3I C;  2F4V O;  2PZS A;  2EJ7 A;  1IBM B;  4DO2 A;  3A0R A;  1IXB A;  1PL0 A;  1VQN V;  1FFT B;  1Z2G A;  4JI0 B;  3SDL A;  2IU0 A;  3N2K B;  3EXA A;  2KG7 B;  3N27 A;  2QKC A;  5LBQ A;  2VQE B;  4ICG A;  4LF4 O;  1UFI A;  4KXR A;  1SQX H;  2HJF C;  4NXN B;  3CCM V;  4OPH A;  2UUA O;  2KQX A;  4BIU A;  4OX9 B;  3RYC B;  3IAY A;  1PNL A;  4GKJ B;  4J42 A;  1DF4 A;  2QSA A;  1SF9 A;  3X2Q C;  4IGG A;  4PA7 A;  1NR7 A;  1D2D A;  3MAQ A;  2QDO A;  1SQQ H;  2NN4 A;  3SPI A;  2WLH A;  1RPR A;  1B06 A;  4FZ1 A;  2P4K A;  1T5E A;  1AB3 A;  3SPG A;  1KYO F;  1SQG A;  4DXW A;  2A9H A;  5CN0 A;  1M90 W;  3TK1 A;  4IIJ A;  2OCC C;  5JVD A;  4P30 A;  1Y67 A;  4DUY O;  2O57 A;  4GX5 A;  2RMK B;  4FZ0 A;  3FB6 C;  3ZED A;  1PD3 A;  1SA0 B;  3CRM A;  3JAT A;  1RP3 B;  5KAI Z;  1GO3 F;  3ABM B;  3K58 A;  4B3R B;  1R3L C;  3SYA A;  2YSU B;  1VQ4 V;  5IWA O;  3K0D A;  5JCO A;  5FNV A;  1Q7Y W;  4O4L B;  4X66 O;  1Q86 W;  3W7W A;  1FXK B;  1W2B U;  1Q6U A;  4JAV A;  2Z0A A;  4FM0 A;  2DYR C;  4LH6 A;  3RYI B;  4AHC A;  4I5S A;  3TCU A;  4K0K B;  2PYJ A;  1KU9 A;  3OTF A;  4RQE A;  1VEW A;  3FB7 C;  2DQ3 A;  4JGS A;  2GV9 A;  5EYP A;  2QKA A;  3CRR A;  5ITZ B;  2W0X A;  3RW0 A;  2CH7 B;  4YY3 O;  2PI4 A;  4NXM B;  4ZI7 B;  2VQF B;  3OW2 U;  3CRQ A;  4FLX A;  2X6C A;  1FFX A;  5LMN B;  1N34 O;  4GZR B;  4O4I B;  3W7T A;  1V54 B;  3AG4 C;  5FL7 G;  1F7Y A;  3ASO B;  5BR8 B;  4PD4 F;  4PHZ A;  1AIL A;  3AG2 C;  2YXL A;  3BRC A;  1NBM G;  2CGN A;  3KG2 A;  1G8M A;  4LF7 O;  3WB0 A;  1F51 A;  1BHA A;  4DR4 O;  5KLV H;  4LFC B;  1ZX3 A;  1S5L Z;  4FLT A;  4NTX A;  3RBZ A;  3T4D A;  4JI3 O;  1PM9 A;  4IHJ B;  4MTX A;  1R3K C;  4GX0 A;  2FTK A;  2P06 A;  4J7Z A;  3T1Y B;  2FB5 A;  2F23 A;  4P9O A;  1IX9 A;  4JI8 B;  3AEI A;  4WFE A;  5E79 Z;  4UB8 Z;  5J2T B;  2UXD O;  1AVM A;  1I7F A;  4OPA A;  2JRI A;  1DTO A;  4CH6 A;  3CJH B;  2ZR3 A;  1D5N A;  4I9W A;  4LF8 B;  4HNA A;  2WLK A;  1VF6 C;  4DK1 A;  3HKE B;  2LGQ A;  1K97 A;  2N05 A;  1KC8 W;  5LA6 B;  4I4T B;  1AI4 A;  1P49 A;  1S3J A;  2ZR2 A;  5DEC A;  3A2F A;  2IH3 C;  4CS3 A;  1SES A;  1CEZ A;  3AK1 A;  4MW8 A;  3ETE A;  2YDE A;  4R7C A;  4MVU A;  4O4H B;  3ASN B;  1HR0 O;  1K3E A;  5CBH A;  1KEC A;  3UQ8 A;  4X64 O;  4JI7 B;  3FYI B;  1JFF B;  5LGT A;  1A32 A;  2YI9 A;  4CC6 A;  1XBL A;  1US6 A;  2F4V B;  5IY5 C;  5BMV A;  4DV3 B;  2GUZ B;  3ZN1 A;  5B1B C;  2HVJ C;  3WG7 C;  5GON A;  4PA6 A;  4MTO A;  3EHB B;  1GM9 A;  3JD0 A;  2Y69 C;  5CA0 B;  4LF4 B;  3FAV B;  1GK9 A;  4N21 A;  4WBN A;  4XDL A;  4MVM A;  2YID A;  1K4D C;  1WJZ A;  2JS3 A;  3E22 A;  1GN4 A;  3IC9 A;  1CP9 A;  1EZJ A;  3ZHV A;  2EZP A;  1QU7 A;  2LFS A;  4TT3 G;  1IDS A;  4ZIB A;  1OJH A;  4NR1 A;  3VQV A;  3CXC U;  1VF6 A;  3LDD A;  3OGI B;  5L3E A;  4A5U B;  2OT5 A;  1BCC H;  1W59 A;  2YEV A;  3OD4 A;  4EB6 B;  1ZAU A;  4K8X A;  3JAS A;  1XIL A;  2WLL B;  3L70 H;  3CS5 A;  3H1K H;  3Q4H B;  5BXZ A;  3TJT A;  1QLE C;  1HNX B;  3ABK C;  2A79 B;  1OCZ C;  3B8N A;  2OYQ A;  4UUJ C;  4XDK A;  2R72 A;  2WLI A;  4JI0 O;  4RO2 A;  1TUB A;  1H8H G;  3AG3 B;  2VWK A;  2LW7 A;  5GW7 A;  4DUY B;  1OCO C;  3GWK C;  1PNM A;  2DYR B;  2CGO A;  5CB4 A;  4B7K A;  1GTO A;  4YJ2 B;  1M4U A;  4LWS B;  4ZHQ A;  5IJ0 B;  5IWA B;  4JI4 O;  4TQD A;  1PKX A;  3LNM B;  4DRX A;  4X1Y A;  5FPR A;  4GKJ O;  5B5E Z;  4X66 B;  3ZMZ A;  1S72 V;  1EM1 A;  4UCS A;  3HPL C;  4N23 A;  1J95 A;  3K5L A;  2GTS A;  4JYB A;  2Q5Z A;  3LSU A;  5KHI A;  3QO5 A;  1KKC A;  2GDS A;  2CTQ A;  1BS3 A;  4LF9 O;  4TV9 A;  3UO2 A;  2IW5 A;  4IYH A;  2FL4 A;  1XL4 A;  1WNS A;  2QM8 A;  3CWB H;  3WU2 Z;  1B6Q A;  4ZBM A;  5LP6 A;  1SQV H;  4UV8 A;  2OIE A;  5LXT B;  3HKD B;  2RJZ A;  1H2M A;  3AG2 B;  4ASU G;  4RAI A;  4DV7 O;  5BY1 A;  1LUW A;  5L3G A;  2X6B A;  2HEP A;  1RSO A;  3P3N A;  4YY3 B;  2IH1 C;  3ZRX A;  1ZUQ A;  3FB5 C;  3C90 A;  1XHZ A;  3ZRW B;  3WB2 A;  1KBH A;  1GN3 A;  2BOC C;  5B1N A;  4DYL A;  1N34 B;  4B3R O;  3RFR A;  3CCR V;  3O65 A;  2P7T C;  1IZ3 A;  2Z3Y A;  3BAA A;  4GCZ A;  4J7J A;  3H1J H;  4DR4 B;  4FK5 C;  5A2Q N;  1E79 G;  1NR1 A;  3BCC H;  3SR2 C;  5L3F A;  3SJC C;  1URF A;  2B1I A;  4QPJ A;  3JAR A;  3ABM C;  3HKC B;  4JI3 B;  3WFV A;  5JJJ B;  1BGY H;  4NVP A;  2BSK B;  2KG7 A;  2QGN A;  2W6I G;  1NQT A;  4LF5 O;  4KHP O;  3W7X A;  1K73 W;  4DK0 A;  3CEI A;  3UCS C;  2UXD B;  5IDJ A;  3RYC A;  3CC7 V;  3CCU V;  1MMM A;  2YUA A;  2LQT A;  2ZIN A;  2JK5 C;  4QGP A;  3HR0 A;  1MA1 A;  5L3B A;  5LHG A;  4FFB A;  1AJQ A;  4JYY A;  4QPK A;  3CRC A;  3RYF B;  3NR7 A;  4E4E A;  5LYJ B;  4NTW A;  2CDY A;  1AI5 A;  4J10 A;  4DR3 B;  1Q81 W;  1KP3 A;  4MSW C;  2Y0P A;  5C8Y B;  2LJ2 A;  1HR0 B;  2EIL B;  1WLE A;  4X64 B;  2Y69 B;  1XL6 A;  1BQ0 A;  3NXS A;  4H33 A;  1HNZ O;  2Q73 A;  3E8B A;  3SPH A; 
#chains in the Genus database with same CATH homology
 3T2M A;  4HZ3 A;  4JPR A;  2A9H A;  1E1R G;  5CN0 A;  1THZ A;  1M90 W;  3TK1 A;  1QLN A;  2EIM C;  2OCC C;  5CA3 A;  4P30 A;  4GX5 A;  3OGC C;  5H6R A;  3FB6 C;  4MVR A;  1P7B A;  1PD3 A;  3ZMT A;  2JEU A;  2P6J A;  2UXX A;  3JD1 A;  3ZN0 A;  4G28 B;  1YHQ V;  3LDC A;  1DLB A;  1GO3 F;  4JAS A;  3CCL V;  4KP4 A;  3ABM B;  3GWO A;  2KB1 A;  4GT1 A;  4PDV A;  1R3L C;  3SYA A;  2YSU B;  1VQ4 V;  1RPO A;  3T4Z A;  2HVK C;  4BIZ A;  1FXK A;  1M56 B;  3K0D A;  3ML0 A;  4ZKI A;  1Q7Y W;  1SET A;  3FB8 C;  3K04 A;  4JYC A;  2NLJ C;  1Q86 W;  3GB7 C;  3MHH C;  5B3S B;  3W7W A;  2HFE C;  1FXK B;  1YJN V;  3CPW U;  1W2B U;  4QE9 A;  2HLD G;  4JAV A;  3ZRV A;  4HAM A;  2X0L A;  3D36 A;  1QLE B;  4RUE A;  4RQF A;  1MOF A;  2Q6A A;  3MD0 A;  3FYE B;  3DGE A;  2DYR C;  4GX1 A;  1QVG U;  1QR8 A;  2B5U A;  4MTG A;  4PA3 A;  1AI6 A;  4I5S A;  3TCU A;  2ZDI A;  3CYO A;  1YI2 V;  3UM7 A;  3JD4 A;  3RVZ A;  2K1E A;  3QNE A;  4UV9 A;  4RQE A;  3EFF K;  4R50 A;  3FB7 C;  2OTJ V;  3OM3 B;  2DQ3 A;  4JGS A;  4H37 A;  1K7D A;  5HFM A;  1YJ9 V;  2W0F C;  3X2Q B;  3OMA B;  2EIN B;  1N8R W;  4E2L A;  2GSM B;  3LSQ A;  1E1Q G;  1H2G A;  4UXN A;  5LGU A;  3RW0 A;  2XAG A;  3SYC A;  3OFN G;  1MAB G;  4X8A A;  3AG1 C;  4YXW G;  2PI4 A;  2IJH A;  2JEX A;  3ZCC A;  2W6J G;  1FXH A;  3OW2 U;  1DF5 A;  3D3I A;  3IFX A;  2X6C A;  3E35 A;  1JPX A;  3ASN C;  5H9C A;  3W7T A;  3ZRS A;  1V54 B;  4MTF A;  5E1A C;  3HB3 B;  2CK3 G;  3AG4 C;  5FL7 G;  2P90 A;  3ASO B;  3AG2 C;  2DW4 A;  5IYB O;  2NNU A;  5EBM C;  3JCZ A;  5L3C A;  3SYO A;  2EIM B;  2OCC B;  3ABT A;  1NBM G;  3LSS A;  3KG2 A;  4MT8 A;  3QO7 A;  1G8M A;  3K3W A;  1YSC A;  5C93 A;  1F51 A;  2H8P C;  1BHA A;  3E89 A;  2C2A A;  1YIJ V;  3MHS C;  3G4S V;  3ABU A;  3CC4 V;  1ORQ C;  5DN6 G;  2EIJ B;  2H94 A;  3CCS V;  3RBZ A;  5EBL C;  4QE7 A;  3T4D A;  5CBF A;  3OMN B;  4UVA A;  1QCE A;  1S0V A;  1JOY A;  3FKS G;  4UVC A;  4MTX A;  1R3K C;  1JCH A;  4GX0 A;  3CCJ V;  3P32 A;  1H38 A;  2FTK A;  1F4M A;  5H6Q A;  1K4C C;  4PDM A;  1AJP A;  4P9O A;  3ZIA G;  3AEI A;  2IJJ A;  4LC1 A;  4WFE A;  4Z1M G;  2DYS C;  2ZD9 A;  1ARO P;  2LFR A;  2XAF A;  4WCE V;  1CPY A;  1SRY A;  2DWE C;  3E8F A;  4FIP C;  5IYD O;  3CP1 A;  2Y48 A;  1DTO A;  1Y66 A;  1W0J G;  2ZR3 A;  3ETD A;  3ABL C;  5CBG A;  4I9W A;  1HWY A;  2WLN A;  4BAY A;  1AR1 B;  3ETG A;  1G4Y B;  2WLK A;  4LBE C;  2X6A A;  3I55 V;  3OEH G;  4G2K A;  4WF9 V;  4JF3 A;  4MW3 A;  1M57 B;  2BOB C;  3E8H A;  4P9P A;  1K97 A;  2QA4 V;  1KC8 W;  2B1G A;  1S76 D;  3LUT B;  1ENV A;  1AI4 A;  2JJ2 G;  1VQO V;  1S3J A;  5EC2 C;  1K5S A;  2ZR2 A;  1R6K A;  3AG1 B;  3I56 V;  2IH3 C;  3CC2 V;  5IYC O;  1R6N A;  1SES A;  2EBO A;  2Q68 A;  3STZ C;  5KUK A;  2EIK C;  1CEZ A;  1P4R A;  1W0K G;  5BZB A;  2QEX V;  1GM7 A;  4LCU C;  2WLJ A;  4MW8 A;  3ETE A;  4QIW F;  4R7C A;  3CCE V;  2WWW A;  4FPP A;  4MVU A;  3ASN B;  1S5H C;  3K08 A;  3CCV V;  1K3E A;  5CBH A;  1KEC A;  1BL8 A;  3AG3 C;  3UKM A;  3FYI B;  2IU3 A;  5KUM A;  3E8G A;  1OCR B;  5LGT A;  1YIT V;  1F23 A;  2Q67 A;  3AG4 B;  2IJI A;  4L87 A;  1OCC C;  4X89 A;  2ITC C;  3R65 A;  5IY5 C;  3ZMU A;  1K34 A;  4FJC C;  1UJW B;  2AHZ A;  3OUF A;  1I5Y A;  5DM6 V;  2XAH A;  3OE7 G;  3ZN1 A;  4WFG A;  1LNQ A;  2LP7 A;  2M7W A;  5B1B C;  2WPD G;  2HVJ C;  5B1O A;  1VQL V;  1VQ8 V;  1K33 A;  1JVM A;  1K92 A;  1FS0 G;  2PI5 A;  1KD1 W;  5EC1 C;  4JAU A;  3WG7 C;  1KQS U;  4PA6 A;  4JTC B;  1V55 C;  3W7U A;  4MTO A;  1K8A W;  2F43 G;  3EHB B;  1GM9 A;  3JD0 A;  3H01 A;  2Y69 C;  4GX2 A;  4WFF A;  3G71 V;  1M1K W;  1GK9 A;  4N21 A;  5EBW C;  3STL C;  4XDL A;  4MVM A;  2AHY A;  1K4D C;  4LP8 A;  3CD6 V;  3PJS K;  5CMU A;  2QKS A;  3B77 A;  2Q69 A;  1CP9 A;  1EZJ A;  4KUM A;  1YTF B;  2QTO A;  2DQ0 A;  4XBF A;  2EZP A;  2DYS B;  1FXV A;  4CBC A;  2LFS A;  2EJR A;  4TT3 G;  4XDJ A;  3ZJZ A;  4MVZ A;  1MSW D;  3CXC U;  3LDD A;  3M99 B;  3P30 A;  4JTA B;  2XAJ A;  1NKD A;  5L3E A;  2OT5 A;  2WLL A;  3OR7 C;  1QR9 A;  1TUE B;  2YEV A;  1YJW V;  2GHY A;  1M56 C;  1JX9 A;  2QM7 A;  2WLL B;  3VOU A;  2YEV B;  5B1A C;  1NH2 B;  3CCQ V;  4PA9 A;  1FXK C;  1NJI W;  1IXM A;  1QLE C;  4UVB A;  2EIK B;  2XAQ A;  3ABK C;  2A79 B;  1OCZ C;  3B8N A;  1QVF U;  3VBB A;  4J9Z B;  4Q20 A;  4PEL A;  4UUJ C;  4XDK A;  2QE7 G;  2WLI A;  3TET A;  3F7Y C;  4RO2 A;  1H8H G;  3AG3 B;  1YTF D;  1OZ0 A;  4TSF G;  2XND G;  5GW7 A;  4KFM A;  2EZO A;  2WLI B;  3CMA V;  1OCO C;  1OCC B;  1PNM A;  3SJQ C;  5IY5 B;  3K06 A;  2DYR B;  1NVP B;  2ZDI C;  2HKO A;  4EKW A;  5EK0 A;  1GTO A;  2ZXW C;  1K9M W;  1AI7 A;  4FMT A;  2A0L A;  3G6E V;  5B1B B;  1AJN A;  2R9I A;  2P67 A;  1R3J C;  1PKX A;  3K0G A;  4MS2 A;  3SPC A;  3LNM B;  3OMI B;  3WG7 B;  5LGN A;  1H8E G;  3JD3 A;  5KA6 A;  2ZQM A;  1PNK A;  2V1D A;  1V55 B;  3K79 A;  5HFL A;  3JYC A;  4CZZ A;  3K9A A;  3ZMZ A;  1S72 V;  2XAS A;  1Y4M A;  4G27 B;  5L3D A;  3HPL C;  1ZWI C;  1F4N A;  1J95 A;  1WPX A;  4N23 A;  2ITD C;  1NH2 D;  2WSS G;  3OEE G;  1V54 C;  4JYB A;  4U7N A;  3QO8 A;  1GMG A;  4F4L A;  3SYP A;  3ASO C;  2DWD C;  3QO5 A;  3K03 A;  3OR6 C;  2V7Q G;  3E86 A;  2IW5 A;  1VQ5 V;  2OTL V;  1XL4 A;  3W7S A;  2QM8 A;  4R6Z A;  1B6Q A;  4ZBM A;  1VQP V;  4UV8 A;  2JDI G;  1S77 D;  3AG2 B;  4ASU G;  1NVP D;  1OHH G;  4RAI A;  3BEH A;  3DTU B;  1VQK V;  5L3G A;  2EIJ C;  3ZRW A;  1RM1 C;  2X6B A;  2UXN A;  3JD2 A;  2IH1 C;  3ZRX A;  3FB5 C;  2R9R B;  4PA4 A;  5B1A B;  4P2Z A;  3ZRW B;  5LHI A;  1VQM V;  2D3O W;  3OAA G;  3IGA C;  3SYQ A;  5LHH A;  4BW5 A;  1SZT A;  2BOC C;  2EIL C;  5B1N A;  3IC7 A;  3ABK B;  4WFB V;  2MK3 A;  1KKD A;  1OCZ B;  1MG1 A;  1JQ0 A;  1L1F A;  3CCR V;  4TWK A;  4R8C A;  3RVY A;  2P7T C;  4PDL A;  5J9P C;  1KP2 A;  1COW G;  1ROP A;  4J9Y B;  2HR3 A;  2JIZ G;  2X7R B;  1OCO B;  2Z3Y A;  2HG5 C;  4GCZ A;  4QJF B;  3F5W C;  5KA5 A;  3ZMS A;  4FK5 C;  4MVS A;  1E79 G;  1R3I C;  2ZXW B;  3E2E A;  2IJK A;  1M57 C;  1NR1 A;  4WFA V;  3SPJ A;  5L3F A;  1EBO A;  4JTD B;  4PDR A;  2B1I A;  4DO2 A;  4QPJ A;  3ABL B;  3A0R A;  3ABM C;  1PL0 A;  2XOK G;  1BHB A;  3WFV A;  1GKF A;  1VQN V;  1FFT B;  3F7V C;  4X88 A;  2W6I G;  1NQT A;  3T1C A;  3W7X A;  5B3S C;  2IU0 A;  1K73 W;  1I5X A;  4RUF A;  5LBQ A;  1OCR C;  2WLM A;  4OXS A;  1QBZ A;  4QNH B;  5IDJ A;  3LDE A;  3CC7 V;  2HJF C;  3CCM V;  3CCU V;  3BY6 A;  2Z5U A;  4BIU A;  1VQ6 V;  4WFH A;  2JK5 C;  1PNL A;  1SER A;  1GM8 A;  1DF4 A;  1M9N A;  5L3B A;  1EFR G;  1VQ7 V;  5LHG A;  1AJQ A;  4QPK A;  1RM1 B;  3X2Q C;  3ZMV A;  2WAM A;  4PA7 A;  3CME V;  1NR7 A;  3OUS A;  4MVQ A;  1AI5 A;  2EIN C;  1BMF G;  1Q81 W;  1KP3 A;  4MSW C;  3SPI A;  4HYO A;  2WLH A;  1R73 A;  1RPR A;  4U7O A;  3E83 A;  1Q82 W;  2EIL B;  1WLE A;  1JJ2 U;  3B8M A;  2Y69 B;  1XL6 A;  4MVO A;  3NXS A;  1VQ9 V;  4H33 A;  2JJ1 G;  1K5Q A;  3E8B A;  3SPG A;  3SPH A;  4DXW A;  2ATK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...