1OCRB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
total genus 65
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ocrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ocrB02
5PCYA 3UACA 3JTBA 1AG6A 4A2GA 1KDIA 1URIA 1E5YA 1JXDA 4BDVB 1J5CA 1SF3A 2HRHA 3KW8A 2PPDA 3FQYA 3ZIYA 3SBQA 2HRGA 1SF5A 4PCYA 2AZUA 1QNIA 3EH5B 3H56A 2UX6A 1X9RA 2GB2A 3S3DB 4QLWA 3S3BB 1OE1A 3NSYA 4HHGA 1L9RA 2BP0B 1TKWA 2QPEB 4M4RB 2XWZA 4YSOA 5B7EA 4NB7A 3TBBA 2IWKA 4GP4B 7PAZA 2FT7A 4BXVA 1A4AA 2Q5BA 4K9JA 1FA4A 1R1CA 1PZCA 4FAAB 2QT6A 2TSBA 1ASPA 2UX7A 4W1TA 1SFHA 1PNCA 2FJSA 5F7BA 4GXFA 4GYBA 1W8EA 5I6LA 4DPCX 3FU8A 3GDCA 4BDVA 4MFHA 3ABMB 1NIEA 4HHWA 2DYSB 2HX7A 1AZUA 1JZJA 1PLAA 4N8UA 5B7MA 5PAZA 2OJ1A 1GYCA 1JERA 4A2EA 1BQ5A 4BXSV 2BP8B 3UABA 2DV6A 1OF0A 2BP0A 2I85A 2VSKB 4E9YA 3AG2B 4WTQA 4F7KA 1KCWA 1W6WA 3DIVA 2YEVB 1IKOP 1PLCA 2XYBA 2P80A 4KNSA 2XV2A 1HAWA 1A8ZA 3ABGA 1TEFA 3G5WA 4RH4A 1JZFA 2HZHA 3ABLB 4E9XA 1BXVA 4KOBA 1NIBA 2XVBA 3TU6A 4AZUA 1KGYE 3UAEA 1E5ZA 4N4YB 3IEAA 5I6MA 3TBCA 1CYWA 1RZPA 1X9UA 3AG4B 1RZQA 4Q8BA 3ASOB 2FWLB 1E30A 2BP8A 1PF3A 1ZDSA 3EF4A 3PAVA 1IBZA 2AFNA 1PY0A 1L9OA 1BXUA 3FYIB 1HFUA 1NIDA 2MTAA 4UAHA 1ADWA 5I28A 3X1BA 4A68A 5EHFA 3SQRA 1J5DA 3D12B 4KO9A 1QLEB 4BK5C 5D4JA 3NP4A 4E9WA 1OOWA 4E9RA 4DP0X 1TU2A 1CURA 2BZ7A 3DTUB 2J56A 2W8CA 1ILUA 1VLXA 2XXFA 1CYXA 1ZDQA 4DPBX 2DWTA 1NWPA 1NTDA 5F7AA 3WKQA 3NJMA 3FSVA 3GXUB 1ET8A 1NIAA 1J9RA 1ILSA 1PZAA 5I6OA 3QJUB 1GW0A 1AACA 4QKTA 1BQKA 1E67A 2PCYA 2YXVA 3HB3B 3NYKA 3QPKA 2BZCA 1WA1X 2IDUA 2PPAA 3PXLA 1AZRA 4F2FA 1OCOB 2YAMA 3QJQB 3GYRA 2FT8A 2PPCA 2HLEB 3PAUA 3FPXA 2XLLA 2IH9A 1NINA 2JKWA 4JKNA 3TASA 2UXFA 3CVCA 3X1GA 2AZAA 5I5IA 3N2JA 2DY2A 2CALA 1WA2X 3EHBB 3NJFA 3CG8A 1JVOA 1MDAA 4ENZA 5D4HA 4DP7X 2IWEA 4DP6X 4KO6A 1L9PA 4GP8B 2QDWA 1OE2A 5ANHA 1EHKB 3FQ1A 1V55B 5I6NA 2YAEA 2N0MA 4P5SA 1JXGA 2IDFA 2UXTA 1DZ0A 4JHUA 2ZONA 3MBWB 3U25A 4E9VA 4A66A 3T6WA 2GHZA 3T6ZA 1F56A 1MG2C 2BO0A 3S8FB 2DWSA 1BXAA 1EZLA 1A3ZA 2R7EA 2I7SA 2FTAA 2IDTA 3C75A 3FSAA 9PCYA 3NSCA 5IY5B 1BEXA 2B08A 5AFAA 3S8GB 5TK2A 3L45A 4YSPA 3X1FA 2IDQA 2H3XC 1J9SA 3QJRB 3T71A 3FS9A 4DP4X 2RACA 2P80D 2B3IA 3BVDB 2VSMB 3EH4B 3WNIA 3AY2A 2IH8A 5I6PA 4EF3A 1GR7A 2MRYA 4E9TA 2FT6A 2E86A 3N55A 3FYEB 4WKXA 1SHWA 2WO2B 1AZNA 2PCFA 1RCYA 3NT0A 1JOIA 1A65A 2BWIA 2FQDA 3IE9A 2GI0A 4X4KA 1UATA 5I5MA 1WA0X 1SHXA 3FT0A 4DP5X 4YSRA 1HAUA 3ERXA 1GY1A 4G72B 2EIJB 4KOCA 2YXWA 3CVDA 3QJVB 3QJSB 2FQFA 5B1JA 1AG0A 2ZOOA 3IN0A 2J55A 2AANA 1YLBB 1NWOA 2X88A 4P5RA 2OV0A 1GS6X 3X1EA 4DPAX 4AKOA 1E65A 2EIMB 1NPJA 2YAQA 3IN2A 1MZYA 4CSPA 3NJJA 4HCFA 1KBVA 4DP1X 4DP2X 4YL4A 3NJNA 1XB8A 3SBRA 4PAZA 1NZRA 1ZV2A 4L0PB 4AKQA 1SDDA 3T6XA 1AAJA 1CC3A 2CBPA 3OQRA 2ZXWB 1KYAA 2PP8A 4GP5B 1AANA 2FQGA 5B1JC 2VMJA 1IBYA 4BWWA 1AQ8A 1BYPA 1AR1B 3CVBA 1L9TA 6PAZA 1GS7A 1N68A 2Q9OA 3OM3B 4DP9X 2J5WA 2YARA 3WG7B 2VN3A 2I7OA 5LDUA 2GBAA 2PPEA 2JXMA 5B1BB 1KBWA 2XX1A 6PCYA 2BWDA 1AS7A 2YAPA 2IWFA 2X87A 4FA7B 1JZHA 3CZUB 8PAZA 2PLTA 4UANA 5E9NA 2R7EB 1A4CA 4JHVA 4NERA 1W6LA 3OMNB 2VM3A 3NSDA 1MG3C 2CAKA 2VW7A 3UGEA 1XB6A 3OMAB 1AOZA 5B3SB 1BQRA 3MX0B 4YSQA 1JZEA 3FQ2A 3NJGA 3ABKB 4YSEA 2YAOA 4G70B 2XV0A 3FSWA 2VM4A 4BWUA 2PP7A 4AKPA 1SNRA 1N70A 3V9CA 4G71B 1BAWA 2Y69B 4HCGA 3ZX1A 3PCYA 1KDJA 1L9QA 5I5JA 1ZIAA 1SJMA 2HX9A 4A2HA 3JT2A 2XV3A 1ID2A 2YQBA 4E9QA 3FU9A 2XUWA 1DYZA 3NJHA 3CDZB 1XMEB 4W9ZA 4YSTA 1ET7A 1PNDA 3KW7A 4AI7A 1MZZA 1A4BA 1SFDA 3OMIB 2GC7C 1OV8A 2XX0A 3H4FA 2DYRB 1WS7A 2H5UA 1L9SA 2IDSA 4HZ1A 1BYOA 1AZCA 7PCYA 4TXVB 3BQVA 1OCRB 1AS6A 1JXFA 1QHQA 2NRDA 1GSKA 1KV7A 1PLBA 2EILB 2VW4A 3NJKA 1RKRA 4KO5A 5FC9A 4BWTA 1M57B 4UF7C 1M56B 2CUAA 1OCZB 3TA4D 4KO7A 2OCCB 2LLNA 4A67A 3WI9A 1KCBA 2ZWNA 5I6KA 5TK4A 1T5KA 5I26A 1V54B 1ZPUA 3DKHA 1M9WA 1B3IA 3PAZA 4YVUA 4ZK8A 4A2DA 1I53A 3NJIA 1SDDB 2AVFA 4YSSA 5AZUA 3X1NA 2Y1AA 1GS8A 3CDZA 2W88A 3H4HA 1AZBA 1WAEA 2WO3B 1OCCB 4CSZA 2TSAA 5A7EA 1NDTA 4G7SB 3FPYA 1IUZA 2FNWA 2J57A 4YSCA 1PZBA 2A3TA 2BHFA 3FU7B 3X2QB 5AKRA 1CUOA 1ASOA 4A2FA 1JVLA 3T6VA 2HX8A 3AZUA 4HIPA 1FFTB 3NP3A 3QJTB 2YAHA 4G7RB 3PLYA 2JFCA 3AG3B 2BW5A 3WNJA 1NIFA 5B7FA 3ZBMA 1J9QA 1IC0A 2PP9A 2CCWA 3ZDWA 3IBOA 1AIZA 4YSDA 3WIAA 2GC4C 2UXVA 3EH3B 4M3HA 3RYMA 3AG1B 2FQEA 3PPSA 1WS8A 1TEGA 2VW6A 4NAJA 3T9WA 2EINB 1NPNA 2BW4A 3FU7A 3S3CB 3NSFA 1NICA 3UAAA 3SBPA 2WSDA 4HCIA 4GY4A 3UADA 1V10A 1ZIBA 2HXAA 2YAFA 1PMYA 4E9SA 3NJLA 4AX3A 1FWXA 2H47C 1ASQA 3ASNB 2XU9A 3HEIB 4F2EA 4YSUA 4DP8X 2QPDB 4YVNA 2XXGA 2EIKB 4HAKA 5B1KA 4YSAA 3FSZA 3OD3A 3V9EA 1AS8A 1OE3A 2UXGA 3WKPA 1JZGA 2QDVA 4KNUA 2PPFA 1GY2A 4G7QB 2GSMB 1ETJA 1XB3A 1J9TA 1PAZA 2CJ3A 5D4IA 4HALA 2GIMA 5B1AB 4Q89A 1PCSA 3AW5A 3QQXA 1ET5A 2IAAC 1JZIA 4KNTA
chains in the Genus database with same CATH superfamily
1E40A 1HNZB 4YEFA 5AOIA 3TN0B 5C0RL 1CPUA 4KMLB 3FAVA 2UXCB 5DTFA 2ZUQC 4AGPA 1AGDA 3U2SA 2QTOA 3OLDA 1QWNA 3ARPA 1YYMH 3RZCB 2ADGB 3T4AA 3FN3A 4P30A 4H8UA 2UZYA 2E5LO 3M45A 1TZGH 1U4EA 1OE1A 1YRKA 1LEGB 1T83C 5DJ2A 4N8VA 1KXVA 1A5FL 2Y07H 4KZ0A 3ZQWA 1NOLA 2F54B 3PHOB 5KSVB 1MFCL 2QR4A 3N85L 4M7LL 4DR3O 2XBDA 2IWKA 2QSVA 1E28B 3CHRA 1SN5A 4LAQL 4BXVA 3TT3L 5D55A 5DK2A 4QOKD 4BH7A 2QT6A 1SJXA 3PY9A 3GBDA 4J9YB 3SQOL 1YQVH 2QM7A 1FFOB 2CSPA 3CE2A 1HU8A 4KK6D 4UV9A 1X5JA 1MXGA 3D4CA 5FYKD 3F5WB 3D33A 4P2OC 2P67A 3JSLA 3ABMB 1F3JB 3L9RB 1XIWB 5F6IC 1FHNA 1KCRH 2APBA 1OSZA 1DN2A 1U8QA 3QJFA 4HIIA 4M8QB 2R0WL 1U8PA 1OAZH 2XPGB 1X5YA 3L5XH 5KJ7E 5ELIA 3FRPG 4FIPC 2A74A 5KHIA 1BVNT 3WENA 3WU2Z 3FT2B 5GGVL 4DRXA 5HGBB 5A1AA 4PV1C 4Z95H 4TV9A 4XPBL 3BKCH 3VMOA 1VIBA 3VVVA 3WFCL 4M7ZC 3QIUD 5EIIG 4F20A 2A83A 1PLCA 5GS0H 1T6BX 4AVIA 3O3AA 4CJ0A 1KV3A 3ABGA 3LZRA 4XBPB 5FNVA 1A6VL 3EAKA 5JW3L 2C4FU 1BSIA 2ZWSA 3OTFA 4X7TB 3TN0C 5KYNA 4QHNA 3STZA 4WFFD 3AWFA 2ZDIA 3SQBA 4GQ9L 4EDWH 1HNXO 4WY7H 5HPOA 3ZDZF 2QSAA 1G9NL 4PJGB 4AZUA 4P49A 4ZFZB 2OXHB 3E8UH 1UJ3C 1ROPA 3DC0A 3AQDA 3RNKB 2Z0UA 3L5WA 4HS8H 3RWGB 2V2WA 3PAVA 3KDPB 1LLAA 3N2GB 4GIPD 1AGBB 4HFWA 1KBPA 1E8WA 3I6LE 5ESVB 4XNAA 1G8MA 1Q5OA 1HSAA 1N8OE 4U4IA 3QG7L 1X5ZA 4GO8A 3S35L 5I8KL 1N0LB 2C1OA 1JCVA 2QQKL 4JKPL 2VC2H 3DV4B 4TPRL 3QAQA 1U96A 1VFAB 1E8ZA 4AQOA 5EEWA 3KPOA 3F5WC 1KTBA 1FDLH 5JW4Q 1XGPA 2W8CA 3BQUD 3ABMC 3LXAA 4BQBA 1TEYA 1XIWC 1D2OA 3B43A 1GAXA 3IJ8A 3MCLH 4X9IA 2HYMA 4S2SA 2EIEA 2DIJA 3MRDB 1B4LA 1BG1A 4C54A 1PYWA 1KWGA 3MZTA 3WKMH 1SRYA 5KSBF 4HU8A 1U21A 1UZ6F 2WMPA 3UAJD 5ISZA 5D71H 1S77D 3WDJA 1E5CA 3AGWA 3VI4A 4JKLA 3D69A 3T0XA 3UCRA 4L05A 4LXFA 1KIRA 5IOKA 12E8H 3QJQB 4IKKA 2CRYA 4NRZA 3QDMB 4KX8A 5T1LA 4ZPTB 4PY8J 2QKCA 3QCUH 1KC8W 2PO6A 1ZK5A 4I0XB 2DQGL 4XZUB 5LCVH 2YGQA 5LMNO 1U0QA 4LESA 1ZE3C 1UXWB 3EJPA 5FECA 1KLFB 1HZHH 2PABA 3VCLB 1T5WA 4LLVA 1KMGA 1A0QH 4DPRA 1EHKB 4B3EA 1JNLL 4YHIB 3RLSA 1O9WA 2QHRH 3V2AR 2ZYSA 5D6CB 4P3CL 1IAOA 3B3IB 5LGJA 4MTFA 1P6AB 4WJG3 4UM9A 5EN3A 1IGTB 4ERSL 3CFEB 4G9DB 4CW1A 43C9B 4ABMA 4XNXL 5DMGD 2FK9A 3HE6C 3IAPA 1RU9H 4KDTA 5IFAH 4DQOL 1NBYB 1UFIA 3FSAA 3HG1D 3UJJH 2HVJA 1ADQL 2ICWJ 1WJZA 2APVA 5C3IA 4HUNB 2Y2YA 3A6OA 2BMKA 1M53A 1HQRB 4X6CA 4ABWA 1VKXA 1E9OA 1W72A 5AW8B 5L4IA 2HMID 2QA4V 3HG5A 3PV6A 1DJGA 2H8PA 3RIFK 1MLBB 2DD8L 4QRQB 4BIUA 5CJOL 4TUYB 4FP8H 4I4TB 2WNXA 4MVBD 1PY9A 3GI9H 3BRGC 2V33A 3VGAB 4KRPB 5JJEB 1MFEL 5IK3A 5IB4B 3CX2A 4FADA 1G43A 4NZJA 2DKSA 2D2OA 5GS0D 4ALAL 1SHWA 3OKDB 1KOAA 3CRCA 1QFWH 1H15A 2VLRE 4P2RE 5HDQL 2FQDA 3LN4B 1JF5A 5FGSA 1OQXA 2KC0A 4YBHA 3I6GA 1D5ZA 4JB9H 1D5NA 2VIRB 3O9WA 5C7XL 1HHJB 2BRRL 3EJUA 2XWCA 4QO1A 5HI4C 3ZRCC 5CD5D 3OKKB 4JGUA 4DK6A 2FQFA 2AQPA 1I9JL 1JV5B 4LLYA 4NDMA 3G5VA 2HT2C 1AHMA 2CU9A 4OV5A 1AOHA 4AKOA 2JXMB 1AQDB 2C9QA 4LDLB 3LEVH 3O8XA 4ONOA 4HCFA 4NKOA 3ZSTA 5CMUA 1U8JB 4E5XB 1ZSDA 1MHEA 5T3XE 4LFAO 1PKQE 1M1XB 3NJNA 1KP2A 3SYAA 1HK6A 1MJJA 3GWJA 4JO8A 3W11C 4KJWD 5FDYA 1ZV2A 5IFHL 4JFFE 1MCWW 3T6XA 1JGUL 1LP9B 1GTOA 3CXCU 1E4XL 3FZUD 2YEZB 3H9SB 4PS3A 5L3CA 1CQKA 4G6FB 1VFUA 4PJ8D 3KWTA 3SJVE 1GZHC 2FYYB 1M3JA 4RWYH 2GHYA 4FXTA 4OLXL 3ABTA 4H13B 1FAIH 2OTUB 4WFGD 1AQ8A 1T7YA 4OLWL 5F71A 1OOAA 4H7VA 3HZKA 4NBYB 4A6YL 4PP2B 2R72A 1AP2A 2K3HA 2PPEA 3B37A 3SKUD 5EZPA 4HIHA 3QDGE 1GA2A 5L3EA 2PKDA 4AE1A 4A2LA 3M17A 4PS8A 2X6CA 3OC8A 5AVTB 5C0FB 3OWRA 4J2XA 3DBSA 1WRFA 2HLFC 5I0YA 3BC9A 2BXZA 1EEUA 4B9KC 1F7YA 4F8QA 1FVCB 2X0VA 1FPTL 2CAKA 2D4FA 3LPFA 3MV9E 4F15C 5IT2L 3IU4L 3OE7G 4B0MB 2JKLA 5FA3A 5DC9B 4AQEB 4I77H 4WW1B 5H35A 3A8TA 5B3SB 2XXCB 1Z5HA 2NR6C 1E4WH 2HJDA 3ZN0A 1F1DA 3N1MC 4M6NL 1F0LA 1MF2H 4NFDA 3S3JA 3TXAA 5D1QE 2YKLH 1AD0A 1FZOA 3QUXB 5KYYB 4BWUA 5KVDH 5DWUH 1V3JA 4P2QA 4IGBD 1J8SA 4P2ZA 5K39B 1WP7A 3J27A 3TYFA 1K5QA 1KDJA 4GAYB 1SJMA 3T04D 3FF8A 4HS3A 1B2YA 2ZWLT 3GHPA 4QRSA 1ZEAH 4ODUA 1KXTA 1XGTA 2ESVE 2OYMA 4JFPB 4G43A 2AEQL 4X6DA 5AEAA 4RMTA 1ZLZA 2C3VB 3CZNA 4LKXA 2F6AA 3CSBA 4DERA 4PJXE 2I25N 3L1OH 2PN5A 4I18B 1MJ8H 2YN5A 4DCQA 3NSJA 1JPGA 4M61A 4H13C 3DHUA 1IXMA 4KHXH 1AZCA 4WO4B 5C8YA 4KK8D 2NRDA 3BVVA 3WN6A 4QHUA 5L2KD 1GSKA 1PLBA 2A99A 3HC3L 4TVPH 4GAAA 3ZYJA 1L5GB 5DLML 2V9QA 4ADJA 25C8L 4NQVB 1OPGH 3MI6A 2OCCB 2VQ1A 2R29A 2FBOJ 1FIGH 3RAJH 4F3FB 2Y22A 4N2HA 1G0XA 2Y36H 3ZMZA 5IJ0B 3APFA 4X9BA 1V54B 3QI9C 2OBGA 5C07E 4ODWB 3EGDA 1M9WA 1YNTF 5EZJB 4RRPM 1FFQA 3G5XB 1H2LA 1EBAA 2EO1A 3AXLB 2GJRA 3LKNA 2I9TB 3LNMB 2W88A 2E46A 5KHKA 2QWPB 3I3EA 2UXDO 4W9JC 3C8HA 2LLLA 2YRLA 1KCSL 1WH0A 2MQ0A 1YXBA 4PHXA 1TGOA 3HAEH 3MGOA 5B3SC 5IJ9B 3TNNA 5IUSA 1XD0A 2Y1ZA 3HI5H 1I1AC 3A47A 3FPYA 1QMUA 1NI8A 4GEJA 4HS6B 2EDHA 4QUOA 4X98B 3QUZC 3X2QB 1VPOH 3B7YA 1XMQB 3PNWA 2I27N 4MZIA 3GSQB 3C9NA 4G8GD 3FFCB 3OAYK 1XAUA 2CIKB 2MCPL 2DI7A 4HD5A 4NQCD 2Y6SD 4YZFF 4YY3B 1C08A 3KR3L 3MAQA 3L7EA 1DEEA 1DSFH 5CZRA 3G08A 3TV8A 3ETQA 2CGRH 1TQCC 2ZYRA 2D3OW 1KIPB 3PLYA 4BW9A 5IYZA 1I85A 3TP4A 1X5KA 2BDNH 2PYEA 3PDOA 5JO5A 5KZCB 3L3OB 4FMKA 4PLOB 4UVAA 3IDNB 4HA1A 2NLJA 4HUXB 1AR4A 2FJGA 1N12A 4AW7A 3K5MA 1IJ9A 5DGRA 3H1IH 2FEDD 2NY6B 3MC0A 2JJUA 1XOUA 3QIWA 1X59A 4I18C 3AG1B 5H6RA 3IMRA 1BQ0A 1SBSH 5ANMA 2RQEA 4P3WA 3GLZA 2DJSA 4PBDA 5E9AA 4N20A 3IDJA 1VQLV 4ZS7H 1MWAA 2XOKG 4Y4HA 4WO4C 5D5MA 3WFEH 5IIEB 4TUKH 1ZL8A 1CFNA 1NC4D 3S3CB 4I55A 2EIZB 3GXIA 4UAOB 2DTML 4U7NA 2QGNA 3UBXG 5CJXA 4RSVA 2WXLA 2JEUA 4FJYA 1V5JA 2E27H 1FGVL 1O5PA 2LJ2A 1EPFA 4WV1B 1HZLA 4JFQA 1BBDL 2G5RA 5EA0L 3FK3A 4BZ1A 1V54C 4UMSA 4DO4A 1TJHH 4JR9L 2HG5B 3HR5A 4F2EA 1XH3A 4R3SB 4OZFG 3ELQA 4DP8X 5A2JH 1BMGA 2VR9A 1QFWI 3FSZA 1WIUA 3QDJB 3D4GA 2UVEA 1OGAE 4PB0L 4FMFA 1KCUL 4FQ1L 1XXFC 4JI2O 1VQPV 1BWMA 4KI5C 1Q90A 1BZ9B 1Q9KA 5C0CE 1T83A 1XGYH 2F1BA 3LZNA 3BA9A 4I87A 1HJBC 4MXQC 3EJQA 4OKDA 4TVSa 3CD6V 3HC0A 3NRPA 2K7QA 5MEPA 1ET5A 2H26B 4MJIE 1A9VA 3NK4A 5FUCC 5SV3A 1ZT1B 3ZKMD 4HUWB 3NIDE 3HN8A 4NYKA 3ZO9A 1XREA 3CUPA 1NDMA 3KD4A 3RE0A 5FYJU 2LFGA 2R1WA 4XH2A 5CLTA 1CLYH 4JANB 1SF3A 5DVOA 5AUMB 4WU5B 3ZL1A 1X4XA 1ZXKA 3L3OC 4P2OA 4V2CB 5I1AA 5BOPA 4XCFL 1KTCA 3QNXB 1QNIA 3SDCB 1HHHB 3BPZA 2NY6C 3GSNL 3H9HA 4WVRA 5EC2C 1W59A 4I5BB 1WAZA 3TETA 2FHBA 2BFVH 2YPKB 2ZE7A 5AL8A 3UBGA 3N43B 2WXHA 2EVFA 4ZOLB 1N36B 4O4YL 1JPTH 4HXBL 4PJAF 4X6FB 1YMMB 4TVPD 3U7YH 4U1JA 4UVCA 1BVLA 4UAOC 3DURB 4GG6B 3HNSL 1FZJB 1IGCL 2B1HL 1TQTA 3B7SA 2VLLB 2GUZA 1MDTA 3Q8EA 4WV1C 1ZTEA 3ARBB 1IURA 3L2LA 5FHBH 4CADA 1UUNA 1ZK9A 2JJSC 6TAAA 3VXSD 4NAMA 4LCWE 1TO4A 1NEZG 4OJFH 1IC7H 1YEHH 3TN0A 2HG5C 4OY9A 3GDCA 5F7EH 2A06H 2AK1L 4Z7QE 3GBNH 5CZKA 3M8OL 4N8UA 4P5MA 2VR7A 4CH6A 5CZXD 1OP3H 1EERB 1G4RA 1ZS2A 2OJ1A 4K7PX 4UINL 5L2JB 1EJOH 3ARZA 1AKJD 4LT7A 3RZCA 3BWSA 1DLFH 4BXSV 4JO3H 2OYLA 2F8OA 4X64B 1MRCL 1OT1A 5FCUH 3ULVF 1LEGA 5ADOL 1OF0A 1OQOA 4P59L 4XNDA 4DN4L 3PHOA 4M02A 2NY5C 4DO2A 5KSVA 1LK2B 5HVGB 1ICTA 5DZAA 1KU9A 3K81A 1N33O 1E28A 2XV2A 5GHWL 2VOTA 4GW4B 2DJUA 4Z5RA 2XT9A 3TVMC 1F4WL 3N9GL 4MA7H 3KWWB 2P4VA 5JPMC 5EEYA 1Z9MA 4XHJC 4ATWA 1UB6B 3BPOC 1FFOA 4NN5B 5BQ7B 1BXVA 3GJFK 4WUUE 5SWSD 1CMOA 1INDL 5D93B 3F5WA 4PJFE 5F8RC 3L9RA 1XIWA 4WCEV 1SPDA 2ICEB 2K4WA 3FU5A 3SDCC 2WQVA 2VXVH 3NFPB 4YXKL 2CUHA 1NMAL 5DYOB 1U8NB 4AEEA 3TM6A 2XPGA 4NFBA 5FKAB 5IEHB 3GLEA 3KXFD 2Q3ZA 3SGDH 4W4OC 1CFTB 3BKMH 2IH3B 1COWG 1A6TA 2CDGB 5HGBA 2Y2TA 5IMOA 5TQ0H 5I0VA 4N1CA 1WN7A 1UHVA 2VLKB 1VF5B 4DGUA 4JHZA 1ZS8B 1B4JL 4ELKB 4LVHC 5DSCB 3L9DA 5T1KB 3DHPA 2FX7L 2JCCA 5ID1A 3ARBC 3Q06A 3KGUA 4N0CD 1INQB 4FYRA 1MEXH 4XBPA 5IG7B 3JATB 4OBRA 2P5ED 1GJWA 3KGSA 5E9DB 5JQ6L 1A7NL 4X7TA 5M94B 5KYWA 4FCAA 4PJ9B 5BUPA 4ZSOE 1D5MB 4D0DB 2GUOA 4NQDD 2VZTA 4XC1L 5F88B 2DMKA 3ZMRA 4OCYH 5F3FA 1DFBH 3O4LD 5DUPH 4HWNA 4PY8I 4GYCB 1TUEB 2OXHA 4UI2A 4CC5A 2IFFL 1ILSA 2AK4B 3D39E 4RLDA 5J5EA 3WTVA 1JRHL 2NY2D 3RNKA 3V0VB 1M7UA 2FEJA 1WTLA 4TWKA 4TQ8A 3RWGA 2XWBB 1RUML 3IFXA 3GMPB 3HBGA 4PJ5A 1RPRA 1HNWB 2X2HA 1HHIA 3ECWA 2E4FA 4YFLF 1AGBA 1A32A 2O30A 2VN6A 4U3XA 3HE6A 1AZZC 2FECL 5DO8A 5ESVA 4X8GA 1DF4A 3UTQB 4Z7NB 4X80H 5A2BA 4PGDB 5D1XC 1N0LA 4E4EA 2NSQA 5IW3A 4NN5C 4Y9BA 3CAFA 2UY6B 2AJVH 5I5IA 4Y19B 3DV4A 4D8PB 1HKLL 3VH8G 5JHDD 1VFAA 2QTEA 2D7QA 5D93C 4DV3O 4AOFA 2NX5D 5LHDA 1JF1A 2ICEC 3P32A 3RFRA 4HOMA 3K1DA 2X4TB 2Y7LA 4MZ3A 1LILA 1H3TA 3FB6C 1P7KB 4ZJ9A 5C70A 1EFQA 2ICWI 5BS0D 4D9LH 1KC5L 3S9DB 2IDFA 1KJ3L 4R26H 2UZIL 4F1SA 2IH3C 1CLVA 1CTMA 1R73A 4RMUA 4E9VA 4JI3B 4KL1A 3BH9B 3L71H 2EC9T 3DO3A 1T3FB 1EZVY 3FFQA 5FOJA 1UFUA 1A3ZA 4MVZA 3CCMV 2VDKB 3U4BH 4W4KA 3ZYIA 4ZPTA 2WLJA 1EMTH 2ZYIA 2X0UA 4JN1H 4OCWH 4I0XA 2JKRM 3QO1B 4BIKA 3WEBA 4XZUA 3FT1A 4PJ9C 3ZU8A 2G5BB 5EU6D 2A4CA 1AR1C 3RWJB 1UXWA 3PRZA 3MJ7B 2H0JA 2IBGA 3L54A 4ZX3A 1KLFA 2ZXQA 3T0ED 2BNRB 1AR2A 1IBKO 4LARH 2ZIMA 3E35A 1E0OB 1N2RB 1R3HB 4AQYO 2CGYA 1O7DE 3EH4B 3VXRB 4FABH 4A7GA 4YHIA 5C3LD 3TV3L 3TTSA 5D6CA 4L1HA 2DJVA 3B3IA 2QVMA 1PLGH 1LEKB 3FOMA 3WNLA 1A2YB 1NFDE 4QJ4B 1IGTA 3BISA 3CFEA 4G9DA 4IOIB 1BHBA 5C09B 2XWJA 43C9A 1A65A 4JRXD 3Q8BA 1GYUA 1WA0X 4P9HH 1JSYA 3HI1B 1HAUA 3FB7C 1GY1A 1TU2B 1ANUA 1FXVA 1WBXB 1L0PA 1GZHA 3CFJA 1F4NA 4Z7WA 3UPAA 5IHUH 3AS0A 4ZBJA 5L9DL 5TFSH 2AEPH 1GC1H 3VXUA 4DGVL 3H42L 3PE9A 4M43L 1GM8A 4PG2C 2CR6A 5SX5H 4DOHE 3A0RA 2X70A 2EICA 3GIZL 4LPTA 5IW1B 3THML 3V7MA 4TUYA 1KULA 4GCZA 4WGVB 4I4TA 3V0AC 1BM7A 3CC1A 1IFHH 4YDNA 3K04A 1GGYA 5BOZG 1FVDB 2K45A 5IB4A 1BQLH 2I60L 1EHXA 3LSUA 1RMFL 3B56A 5LMUB 1Y6XA 1KBKA 3OKDA 1OLZA 1I5YA 4MNGB 5SX4H 4QRRD 4W6YB 2YRPA 2B2XH 3CC5B 3GNML 3PJSA 4QYAA 4XNUL 1TENA 1QFPA 3EZ8A 1I7ZB 4JPVH 2ZNIA 2GJPA 4JJHA 4JI7B 2IIJA 1V7MH 2VIRA 3WJMB 1IGFL 1HHJA 1WT5C 2FQGA 5B1JC 1RY7B 3OKKA 1ZVSA 2R1YB 2NR6A 3EOTL 1JV5A 2ZKHL 2Z1KA 3MV8E 1Z5VA 1U3HD 3VJ6A 5C0RH 2XN0A 4X9GA 4N86A 1I8MB 2JXMA 1AQDA 4PJHF 4IMKC 2Z8WC 2R9RB 3TBYB 1U8JA 5D5QA 4R5XA 3FUJA 3HZVB 3S5LB 1M1XA 4NHCL 3M7MX 4V1DA 4E68A 2OLDA 1AI4A 4JHVA 3RL1B 5HHPB 4J8RB 5BZZA 3N04A 1MFCH 2H32B 2Z92A 3N85H 4M7LH 2VW7A 4HAFA 2YEZA 3H9SA 3SO5A 5BRPA 1XB6A 4B08A 4LAQH 2DYPB 4GS7B 1YEJL 3NEEA 4AQAA 4AV5A 3BH4A 4DUYO 2OTUA 4XCEA 1BZOA 1U8LB 2K6YA 3OPZL 1V9PA 3JD1A 5T3ZL 4ZFFA 3LSSA 4WTWA 2XQBH 1HOEA 1WIPA 5I76B 3WNPA 1SQGA 2BTQB 5KSBE 1UZ6E 2CBMA 1MCBA 2YK1L 4N8VG 2R0WH 3JWDC 4TOIA 1MCOL 2JLPA 3FONB 3HHRB 4G7VL 3SGDI 1X6NA 1ZT7B 5IQ9B 3BVOA 4O2AB 4APXB 1S4IA 6CGTA 5DFWH 1DYZA 1ZANH 4XRCB 3OLGA 2R23B 4XNMA 3GQFA 4YSTA 1OJHA 4B3TO 1D9KB 4AI7A 4BZ2H 5IQOA 1KSRA 4XPBH 4W9GC 3HZYA 1M6OB 3WFCH 1FVCA 2XX0A 3BYTA 3VFRB 2CA3A 2AEOA 5AW2B 1YN6B 1JQ0A 4XO5A 4J10A 4WW1A 1KY7A 4H88H 3OEEG 3RL2A 1IX2A 1A6VH 1MY5A 3FUKA 2IU0A 2KUTA 4KK9D 4GQPH 4RRPG 5DQDH 1TVKB 4KXDA 3GLDA 2JJWA 2CQVA 1Q0YL 2LLNA 1QWUA 5L8JB 5K39A 5LAXA 2JIZG 3PV7A 2B9ZA 3UL4A 3T1YB 1I3GL 1ZPUA 3DX9B 4GAYA 3T1HB 4CMHB 3K03A 1EAQA 4F9LC 2CZNA 4DQAA 3E8FA 5H9CA 2ZG2A 4IU3B 4R2GD 5GRUL 2H9GB 2AJXL 1CLCA 3S3WA 2MJWA 4M5ZL 4UQAA 1OSPL 1MN4A 4HPYH 2C3VA 4LCCB 4GS7C 1RK1B 3CDGB 2NT1A 3QG7H 2YLKA 4I18A 4JI5O 4R84A 1INEL 1W72L 3GMLB 4WKZB 2BHFA 2A3TA 4GSDL 3S35H 5I8KH 2AHIA 4NGHL 2QQKH 2J3SA 2OI9C 2FYVA 3CZFB 4JKPH 3K4AA 4WO4A 4TPRH 1ASOA 1AIFB 3PUCA 4U0QB 4U7SA 3K4ZA 2HX8A 3P4MB 5KSAC 4BFFA 1L5GA 1CIDA 3UZQB 1KZQA 3DXAE 3NAAL 2YD0A 4NQVA 1J8HB 4KBPA 5ICZB 5C0AD 4F3FA 3HBQA 4PWIA 3Q5YA 2DDQL 5IJ0A 1QHOA 2I07B 2YAHA 3NIGB 4Z8FL 2FCBA 2QR0A 4ODWA 1EN5A 4PDVA 4EEQA 2E59A 1B06A 3G5XA 5AZEL 1CE6A 5HHXH 4XO4A 3AXLA 3C5JB 2GSGB 2I9TA 2CCWA 1XGZA 4OIFA 4TNWK 3V6ZB 3P9MB 1DO5A 3BP4B 3V7AG 1M7DB 5IJ9A 1AD9B 1HEZB 4CGTA 1JPFB 5AB9A 1JX9A 4HS6A 2DQGH 4A7QA 4HQQL 4KMQA 2HEPA 3UAAA 3O6FD 5HI5D 2XN9E 3FFCA 4NC1E 4DV1O 3MBEB 5EO9B 4OUOA 3QDAA 2CIKA 2VMCA 5IJBC 4ICWA 5ABZA 4RAIA 2FATL 4N0UE 1XCQB 5K69A 4JE4B 3OZLA 4JFEA 1QA9A 4MNQD 1JNLH 4CMHC 2ZUWA 4DV2B 5LKNA 3HEIB 5JLZB 4WCYL 1KIPA 4P3CH 5B22A 3FCBA 3L3OA 4YVNA 1ACCA 3IWVA 4UTBH 3IDNA 4ERSH 1XHHA 2JE8A 2Y48A 2WQ8A 4XNXH 4LCCC 2ZOKA 3FF7A 1JD7A 3GVMA 2UXGA 5EC2A 5T1DL 1P7QA 2E7LC 3LV3A 2PPFA 3QUYD 5E7FA 2VLRB 1GY2A 1D5IH 2ED8A 1KTLA 5IIEA 4L1SA 3E2HB 5D7JD 2YJLA 1HL8A 1MCHA 2EIZA 1HC1A 3T3PF 3OTOB 3L95A 4QIRA 3O65A 3KKYA 1NAMB 2NQCA 3VQ1C 4RAHA 2BIMA 4WV1A 4PW9A 2DD8H 1KFAL 1BIHA 1TJXA 2XWTB 3W81A 1ZT4B 5CJOH 2XASA 2DLIA 3ZKNC 1KDIA 2PTVA 2CBOA 2MHAB 4M3KB 4ZXBD 2Q0AA 3GPEA 2HG5A 2V2TB 1MFEH 3KPLB 2IU3A 4R3SA 4FFYH 1CXLA 3ZTEA 1MW0A 4JY6B 4ALAH 4YJZL 5DM6V 4PYHA 1JI1A 1PKQB 4FKKA 4N22A 3QDJA 5SX4I 1JG9A 1Q1PA 3MRGB 4YLBA 2MCG1 1ECYA 4LOVA 2B9AA 4JCWA 5CS7A 3P73A 1DVSA 2YFOA 3MSPA 1O5DT 1SVCP 3VXMB 4KY1H 1BZ9A 3WS3B 5IVZB 5C7XH 4AEFA 2WQXA 2BRRH 4J3UA 5F7MC 2WYIA 4PJDB 3WD5H 3LNGA 3MBEC 3N40F 4RCAA 3O6ML 4WTZA 1DQQB 2W60A 4DK5A 4XAKD 3TVMA 3ZTNL 2YQGA 4E2OA 4Z1PA 5JPMA 1KYFA 2FZ3B 2E7BA 5I6LA 3G6JF 4CH5A 4X7DC 5AUMA 1EFXA 1NIEA 1SXZA 4WU5A 4RZCA 2DYSB 3RGVD 3ZBHA 1SEQL 1PLAA 4L3EE 4YXHL 1OB0A 2G9HB 3PWPE 1G6RA 3BLKA 3MXWL 2YXYA 3QNXA 1H2SB 3SDCA 3SD2A 1BLNB 3L75H 3WMSA 4AWJC 2ZD0A 1DZBA 4I5BA 5A2IH 3F7RA 4U1SB 2YPKA 4XVOA 2PUSA 4ZOLA 4W4OA 3KPTA 1U8OB 1IBGL 2VSKB 2FH8A 3E2HC 4X6FA 1YMMA 2Y72A 5F6HI 1A3RH 1QU7A 2HT4D 2R39A 4GG6A 1FZJA 3KYMB 2ZJSL 4P2CG 3N50A 4HGKC 2VLLA 3AUVA 5HYJB 3SOBL 5EF1A 2JGUA 3G5WA 5A2KH 3ARBA 4PWJA 4X20B 3QGVA 3NK3A 2HKHL 4K7PL 5KVMC 1LO0L 2IBZX 4P05A 3FT4B 4U6VH 2Q86B 4U3HA 3EYSL 1K6QL 2X89A 2XQYG 1ZLUK 4JGMA 3DYPA 3C08H 3P4LA 1CD0A 5DJ0B 1X9UA 3ZHLA 1LMIA 4JFXB 1J0IA 3D2UB 3T8XB 2XTJE 5L2JA 2EUWA 2X4PA 3DJZA 3U9PL 2JDIG 2EUXA 1S9WB 5IT2H 3BFQG 3BESR 4WEBL 5CGYD 4H0LB 4TF4A 3FYIB 2C34A 2MTAA 1SBBA 1LK2A 4YZFE 3P1VA 4M6NH 1KECA 2X42A 1IGML 4KO9A 4GW4A 5BZWB 5HY9B 3S5ZA 3HE7D 3ATFA 3P02A 5I19L 3KWWA 5D7LE 5TH2B 2F7QA 3LXUX 2BZ7A 4X5PA 5BO1H 3O6LL 5D1XA 1UB6A 3TJTA 3TH4T 3CCJV 1JVMA 2XA3A 4S1QL 5BQ7A 1RJYB 1W8NA 3OG4B 1ZA3A 2FVNA 3MOAH 3ZJAA 2DYSC 4UTCA 1HSBB 2N04A 4RO2A 2XA8L 4L3FA 2FO1A 2VWKA 2DWTA 3HBPA 4NENB 2BVYA 2ICEA 3SZKC 3SDYH 1OW0C 1NCWL 3FUEA 3NFPA 2E76C 2L6LA 5C07B 1PD0A 1P69B 1U8NA 5DYOA 5CLYA 1PAMA 4IIJB 2AEQH 5FKAA 5IEHA 4NZFA 1CFTA 4ZTOL 1MWAL 2IH3A 2CDGA 4HLJA 2EKJA 3KPRD 3MCKA 4KJPC 4PV9B 2VLKA 2VUYA 3GI8L 4DR1B 4QXTB 4EN3B 1ZS8A 3SKMB 5DSCA 4RBPK 4FQXB 4ELKA 5A2LH 5T1KA 3KPPB 3MFFB 3Q6GH 4W9LC 4JKNA 5ESQB 1WQVT 3HC3H 4AIEA 1INQA 2ZZUT 1QG3A 4D8OA 1XTMA 3JATA 3RYFB 5D1QC 5DLMH 5B1OA 5E9DA 3SSGA 1Q6HA 1H0DB 2DMXA 1HH6B 4PJ9A 3EHBB 1GHFL 3CG8A 1D5MA 1JTPA 1XH2A 1XR8B 5E6ID 2O61B 5B39B 4ADIA 3ARFD 5BY1A 3DXRB 2VERA 4KTYA 5KVFE 2DWDB 1EZSA 2R70A 1TDQA 3PHSA 1JCHA 2AK4A 3WUWG 2VXUL 1DZ0A 4TUOB 5AQ0A 3OKYA 4NKMB 2DPKA 4MRBA 5E1GA 4JTDB 1NCIA 2XWBA 3F3HA 5AALA 1O7SA 5DN6G 4B9IA 3TYGL 2MPAL 3Q8FA 5AKVA 2WUCL 1EZLA 2YXLA 3WN5B 1W91A 1YUKB 4OIIL 4XMLL 2YGNA 3Q48A 4B0MM 5DZ9A 5JHLA 4WI3A 4QWWD 3UC2A 2VCOA 2VAAB 4BFRA 2MCPH 3FB7A 4GT0A 5IYDO 5MP6L 4PGDA 4U1IA 3BPNB 5TK2A 4TNVF 5CKGA 3KR3H 5GRJH 1QSVA 1NCHA 2UY6A 3K46A 1U8MA 3IMVA 4NKGB 3N1QC 4Y19A 2K7PA 1COBA 1I8IA 4D8PA 1I5XA 2JQMA 2H1XA 4DR5B 3GJEB 4PG2A 3IFOB 4JL1A 3CSXA 1P7KA 5KOMC 1URFA 1BFSA 2OR9L 5J2UB 4D7SA 3TESA 4PJAE 2R1XB 4UDUB 4JI1B 3MV7E 1FL6B 2WBKA 3WNMA 3B2UD 4WKXA 2V7NB 3QB7C 2ZCKL 1OGAB 1P1VA 5L6YL 1JOIA 4AENB 4EN3C 4UCUA 5IGXL 1XEDA 3NUKA 4HIXL 1UD6A 5CIPH 5EO0A 3OJDB 1U92B 1BAFL 4DP5X 5IESH 5C0CB 1KKDA 2DTMH 1AO7B 3APCA 3EH2A 4AYDC 2Y1YA 1H38A 1FGVH 3QO1A 4XC3L 4ATTA 2KKQA 5B1JA 1WT5A 3DX6B 3W0WD 3LVEA 1O6SA 1BBDH 1S46A 3JAMN 4IIZA 2X88A 3II3A 3RWJA 2FDBP 3MJ7A 5ECJE 3U4AA 1EZVH 1AJNA 2BNRA 5BR8O 1GS6X 3DGGA 4LR3A 5E79Z 3NIDB 1N5YL 4B9YA 2DWDC 1N2RA 1Q86W 3K91A 3QHZL 1KEGL 3ULVE 4YL4A 4EIBA 4IMKA 4UT7L 1SQMA 3FO0L 4PB0H 2DQ3A 3IMSA 3OGCC 1IBHA 4FEIA 4FQ1H 3B8MA 4LRIC 4F37F 2E5LB 1A2YA 1IGYB 4U3FH 1M90W 1SDDA 1YNKH 4IOIA 3LS5L 3GM0A 3A3YB 4D6TH 3T65B 3CFUA 4DR3B 2BCMA 2F5BL 5GIRB 2HRPL 3SDXB 2BOLA 1WBXA 2R4RL 4UCFA 3BPNC 2CH7B 4O4HB 4FQJL 3PQYE 4GIAA 4KXRA 1TITA 5IVNA 3MJ8B 4KRNA 3BAEL 5GTIZ 3NCWA 1TAEA 4DF9A 1DLHB 2NQDA 5EUOF 2V7QG 2Y0IA 1G7IB 1M4KA 4X99B 5I0DA 4IBUA 1GK9A 4FNLL 2YBGA 3VWKB 5IW1A 4GRWH 1IU1A 1TTGA 5INCA 1VF6C 3GO1L 1MSDA 1F90L 3KPMB 3GSNH 2HJFC 3ECQA 1E4XI 4K23L 5DGQA 3K9AA 3C60D 3CCHB 5HHOD 1MVUB 1FVDA 2OULB 1A7BA 4FDWA 4K7PY 3LQZB 4Q20A 3HMXH 2YRZA 4WK0B 4YQXL 5LHGA 4HXBH 3NTCH 3KAAA 3U36B 3CC5A 3UGEA 3HNSH 1OCCC 1I7ZA 2B1HH 3UTPE 3VVWA 2XBTA 3QYMA 2JMRA 1FBIL 3ARGB 3OV6A 3WJMA 2YPLB 1JV2A 2R1YA 2EYRB 4R6ZA 1OHZA 1WJ3A 4UT6L 5DHYB 2K6WA 2VISA 3CFMA 4HWBA 2P5OA 2DICA 4PLJD 2ZX9A 4UV7H 1CU4L 3WHE0 3Q6FB 4IDJL 3V9CA 5A3ID 3TIEB 1ZLVH 3K2MC 3P4NB 3V0IA 4KVPA 3IGUA 5EMYA 3I6SA 2P1YA 2EE6A 4WUUB 2ARJB 3ZX1A 1UQSB 4PS4L 3TBYA 3C5XA 3IMUA 4P8QA 2WVSA 4EQ2A 1ZV5A 1OTUD 3HZVA 3DC5A 3S5LA 4P9PA 1MRCH 3G3LA 4F9LA 5J3HD 1T1XA 1KYOJ 5ADOH 3UTSE 3RL1A 3NIFB 1TTCA 4J8RA 4PWGA 1UM6L 2H32A 3QE5A 3ARVA 1VGKB 1NFAA 2DYRB 4XI5D 3AM8C 2B8OT 3IFLL 1U8HA 2DYPA 5GHWH 5I1CH 1F4WH 2N4IA 3M86A 3N9GH 3QEQD 1IE5A 4TKWA 3UTZB 1LMKA 2BNQD 1INDH 3Q01A 3CBRA 3VWKC 1AKPA 1BBJB 5I76A 3VFOA 2ZWNA 4ZSOB 2BTQA 5TK4A 4XZ4A 2WB7A 4IGGA 2WWMC 2Z6FA 1NMAH 2WNGA 4XP4H 4F92B 1WO2A 4EFBA 3FONA 3UAFA 4EBQL 3NCFB 1ZT7A 1D2DA 3X1NA 2VZOA 2Y1AA 3VTMA 4APXA 1TLMA 2VQUA 2J8HA 2DJMA 1D9KA 1X5FA 4LCVA 4UQCA 3FFOA 2WO3B 2O5YL 1B4JH 4EAEA 3VFRA 2NY7H 1R6NA 3FCUB 2FX7H 3LOWA 3ARGC 1QHTA 3TGXA 1YN6A 4HVBA 4WWPA 1F4AA 4JI8O 4OD1L 1FC1A 4B7KA 2CNZA 5JQ6H 3LZFL 1A7NH 4ZOBA 5LMNB 1JVLA 4JAMB 2W9LA 2NY3B 1TVKA 3NESA 3DA0A 5J1AB 3QJOA 4UNTA 4XC1H 1TUBA 3QP3A 3NP3A 1I1CA 4Z76B 4TN9A 4GX2A 3LZLA 5J6HA 2IFFH 3DROB 1WAAA 3DX9A 2LU5A 5GTHZ 1JRHH 1WICA 3SJQC 5I18L 1E7VA 1LO4L 1WLEA 2BS8A 4OZIF 1JWUB 4NZRH 3VYOA 1RUMH 2VL4A 1Q0XL 4IU3A 3DX8B 2H9GA 2R59A 1T1ZB 1JYNA 3NJXA 5DD1L 3T2PA 4D7PA 4DV6O 2MKWA 4G82A 4LCCA 1E1RG 2FQEA 3ARED 2LGQA 3A0BZ 1RK1A 1WS8A 3EUDA 5EV7A 2E7LA 1AI5A 4NTYA 3GMLA 4N85A 4WKZA 1C1EL 1FRGL 2H6PB 1A1OA 3TEXA 4MA8H 5CZVL 5KYUB 3BGAA 3GD1C 1TTAA 1WWWX 3G71V 2QMJA 3H7LA 2IPTL 5E4AA 4X8JA 4OF7A 4XOAA 3ROOA 2X4SB 4L8BB 5ICZA 3WFZA 4BRJA 2I07A 4XO9A 1QATA 5HJ3B 4KROD 1CFQB 5AKTA 5E1HB 2PMZA 3A67H 1KC5H 4J3WA 4HPHA 1MHHB 1KJ3H 4N25A 2UZIH 3N2KB 3KCYA 1CF1A 4QXVA 2GEEA 3RVTC 1CDIA 1R46A 3CIQA 4N0FB 3J80N 3K0DA 4HBNA 2MPVA 3P9MA 3BD4A 5CSBA 3MNWB 3UX9B 3BP4A 1N5AB 4AGQA 3SHSA 5A2FA 5J56B 1M7DA 4NWUH 4I0PB 1AD9A 1G9MC 1SJHA 1HEZA 3BCDA 1JPFA 5DHVA 1LL1A 4ABVA 2ARJQ 2NY3C 1PCSA 3TXSA 1S9VA 1YUHB 2Y5TB 3OKOB 4U7MA 1WCBB 3ZT5A 1PD6A 4PJHE 3MBEA 5EO9A 3TA3B 1VFOA 1OO2A 1E79G 3FCTB 2TRYA 2FLMA 4MHHI 1XCQA 4OX9O 5AOKA 3JTBA 2EDOA 5TDPA 5BJTA 4FF9A 3CFBB 4IBWA 3KPQB 2JTDA 5B1CA 5JLZA 1FIEA 1QKZL 4M00A 2B3RA 5TJWK 3KCPB 2ARWA 1JUFB 3ALWA 5KA6A 2EE9A 5BCAA 4TNVK 4H0GA 2X4RB 4HKJB 2VLRA 4P2RA 4D7BA 3DIFB 1R1BA 1WIOA 3VX1A 4Z3HA 1P1ZA 3FTGB 3TO4B 1TTFA 1NBMG 2NUPA 3HG0A 4NKIH 3T2LA 3G6DH 3LS4H 4K9JA 1RAMA 4DGVH 3H42H 1NAMA 5FA4B 2VDOB 2OSYA 3CTTA 4H8PA 3O3EB 3ZDZB 5E1AC 1CTOA 1A6PA 1L3WA 2XWTA 3GIZH 3HMWL 1ZT4A 3NACH 4NKQB 3CJJA 3GS0A 3LZQA 1RLWA 3QS2A 1N8ZB 4J11A 4PJ6A 5F89B 2Y4TA 1O7DC 3N1PC 4GOSA 3WEOA 2V2TA 2A7BA 3GS7A 3KPLA 3QUKB 3B8NA 3KG2A 1AZUA 4XMKL 5GRVL 2I60H 5CEXB 1RMFH 4OU3A 4HBCL 3WLBB 3RBGA 3RBSA 1PKQA 1G1KA 3MRGA 1O6VA 3Q43A 4X50A 1MI5B 2DV6A 2J1YA 3FN0L 3F2LA 4I0PC 4LEXL 3ZE1F 4WFHD 5KS9F 1TVBB 4UB0H 2L04A 4LCIL 1NH6A 2PWDA 2LE9A 2JK5B 3WS3A 3SPJA 1Z6JT 1DQTA 1KY6A 1MMMA 3HR0A 1FNAA 3SJVA 3EOTH 3BDYL 2R2BB 3D3IA 3AABA 4ZUWB 3CRRA 1F1AA 2HVBA 5FO7B 1SQFA 1THZA 4E9XA 3P54A 4H1LH 5JUEL 4PV8B 2ICES 3RUGF 2FZ3A 5H8DA 3I6KB 5CA1B 1UD5A 1D5AA 2NW2B 5C0JB 5KSBB 4TTGA 5BQDA 2A5UA 3B9KB 3QDGA 5DR5L 4ZPVB 1C8QA 5EZYB 2BHUA 2G9HA 4LOUD 1OW0A 1T5XB 3RX5A 1BLNA 2YPVA 4LVOB 3BEVB 1UFGA 5J1SC 2C3WA 5EO1B 5IROC 4U1SA 3ZE2F 1F2QA 4A04A 1U42A 1QBML 1B2WL 3CFQA 2VR8A 3QWOA 3ESMA 1U8OA 5D7HA 4RUEA 2WY3B 2DL9A 3BXNA 1R3KC 4R4NC 3TO4C 4XB3A 5EBMC 2XRAL 4PBWD 4GW1A 3TO2A 5GQBA 1KLUB 3KYMA 1HP8A 5JQGB 3HLKA 4G9FD 5HYJA 3N1FC 3D85D 1EA9C 5T3ZH 4E5XG 4X20A 3F8UB 4ZTEA 4AVHA 4YHYB 3DGDA 4N9GB 5JIIA 1CURA 2GCYB 4NQUA 5D1QA 3B9AA 4PCKA 5KUMA 3FT4A 1ZLWK 1MCJA 1CYXA 2YK1H 1P0SE 1MCOH 5DUBB 1VADA 5FIEA 4G7VH 4DO6A 1CGTA 3D0LB 4V2BA 2H2SC 3IGFA 3SJCC 2YXMA 3QXDB 3WJJC 4PYGA 4JFXA 3D2UA 4QKTA 4ZYKB 1NUNB 2IV8A 1S9WA 4MKTA 4FXKB 2ESVA 2BZCA 4MMZB 1VACB 1OCOB 2DMGA 1IL1B 2H6UA 3MACL 4PJXA 4WWOA 4MTGA 1S9XB 3UO3A 2DJ4A 3ZQ9A 2CBQA 5LBVA 1S0VA 3MV11 4WHCA 5HY9A 3KJ4B 1BOGB 2IAMB 2NDFA 4MDIB 4O5LL 4S1RH 5EBLB 1A6WL 1Q0YH 4ONFH 5TH2A 3WJLC 1FL5B 1SOQA 5I30L 3VXQB 1WA2X 1ZWIB 4UV8A 2HFEB 1R24B 1VZGA 1JP5A 1I3GH 1RJYA 1JRHI 2R0KH 2BPBA 3DXAB 5FLXN 2P24A 1T7WA 4FHBD 2VLMD 1HSBA 1O75A 3CPWU 3EJYC 3FTSA 2IM9A 3H7BB 4KTEL 4MASA 4NBXB 4NENA 1KPUB 5IWAO 5C6TL 3TJEL 5H2BB 4LC1A 4KXAA 5GRUH 2EC9U 4LVOC 5C07A 3VNZA 2N0MA 1JXGA 4M5ZH 1OSPH 4IIJA 4JHUA 2ZONA 2G0KA 2FECI 1SDAB 2F4VO 1LO2L 2CO7B 4Z7VF 1NLBL 3T6WA 3T3PE 4OPHA 1MA1A 2DI9A 4BCYA 4DKFH 1KGJA 3MNVB 4PV9A 2F93B 1INEH 4YJ3B 1W72H 4GSDH 4EN3A 1YEGH 2HT3D 4IIQB 5M7QA 3U6RB 2QM8A 3SKMA 3W7SA 4FQXA 3KPPA 4ZS6C 1XCWA 3F7YB 3QFDB 4XWOD 2CCVA 5ALBL 5LBSA 1UYWH 4YHYC 5IEKB 4UOW1 3RYFA 4QNHB 3NAAH 3L45A 3ME0A 2XN9B 3MRIB 3MX0A 3MNZA 4NC2B 3LDCA 1HH6A 3G7TA 3K80A 4IKIA 3VG9B 1XR8A 1UC6A 3WS6A 4D9RD 2O61A 4CBPA 5B39A 3TF4A 3BVDB 4LH7A 4XP6H 3DXRA 1ITBB 8CGTA 3APOA 4JFSA 3D2TA 2VT0A 2DWDA 3GJFB 5H94B 4LKCB 2NXZB 5B66Z 1Z9NA 3J81N 2YUVA 5IWLA 4FI7A 4MNHB 1O9HA 4NKMA 2AXHA 3WIHA 1JZ2A 2YFNA 4LRIA 3SBWC 1DQJB 2NY5L 1L7TL 2BJML 2CPUA 3HN5A 32C2B 3GWOA 5I1EL 3KL3A 3WN5A 1OK0A 1AGCB 4NO0A 5EFIB 4HQQH 4WW2F 5F2FA 5LGKA 1B9ZA 2NNAB 2NZIA 4PJIF 2IAMC 2VAAA 3G6JE 4MWFB 3RYCA 3VW3H 2GTZA 1ZWIC 4JI6O 3L3IA 3MREB 3QXWA 4FXGB 4BA0A 4IOSD 5JIMA 1CL7L 1EEQA 5I8EA 3QEUB 3ULUF 2EJRA 1EIBA 3GJEA 4WCYH 1G6RL 1S6NA 3T08A 5FW6A 3IFOA 4Q0XL 2X28A 3KPSB 3QUGA 1B6UA 1XB8A 1VF6A 5J2UA 4CMMB 3VBBA 2R1XA 1KYOK 4UDUA 1E8YA 4PAZA 2HJFA 1FL6A 4P5TC 4OUUA 1AJ7L 2V7NA 5BNXD 2K0RA 1OGAA 2LFEA 4UXNA 2Y3AA 4IU2B 4Y7MA 1R3IC 1WBYB 3OAZK 5CMAB 4AENA 3OXSA 1ZD6A 4X66O 5T3ZD 3OJDA 4DW2L 1U92A 4AMKL 4D7TA 5C0CA 2VXTH 3F7YC 4CSTA 2PP8A 2E9GA 4AQ8A 3F12B 3E80A 4K3JL 4KV5F 1EVTC 4NC1C 5HHME 2W59A 2R2EB 4HHAB 1KFAH 3DX6A 3VG9C 1K97A 1EZJA 1EDHA 4CC1A 1MUJB 4PVMA 4MJIA 4X9HA 4Y8AA 1PTZA 3T2OA 3VMNA 3VD1A 3SB3A 4AQZA 1I94O 4Y2LA 2VO8A 1OP5K 3R7RA 3K6SB 4OVUA 4LPUA 2PO6D 2XPYA 4GKKO 3IDYB 4WSJA 3REWB 5FGCB 2H1PH 2CBTA 4NQTA 4O02B 5ESAB 4KKAD 4L3EB 4QYOA 2GBUA 3ZE0E 1KN4L 3MRPB 2C2AA 1IGYA 2VLJB 1ORSB 3ELAT 3DRTA 3H1HH 1ML0A 3T65A 5DA4A 5SWZE 1TZAA 3TWYA 2P5WE 5GIRA 3AQYA 2A6KB 4OCSH 2VR4A 4ES9A 3AGVA 5D96B 4Y4HD 5FF6B 3SDXA 4CZZA 3MXVH 2P28B 3O6MH 4BQ8A 3AM8A 2CH7A 1CFBA 4FXGC 4NN7B 4O4HA 4X62B 1LYQA 4AQ1B 5I15L 4UM9D 1CF8H 2QSQA 2CDEA 3ZTNH 5EOCH 5CJ8A 4QD2E 3E7JA 3FO9A 3Q4HB 4LEEA 1IM3A 2GAZB 4R96B 1KPRB 4LCWA 5CLXA 5FM5M 3VQLA 2EVHA 2IBZY 3VWKA 1BVNP 1KB5B 4YXHH 3SKJL 4D0BB 4OLVL 1BZDA 1MFVA 2DQTL 3JZYA 3R0NA 2AV7B 4XP9L 5G55A 3KPMA 3CS5A 5DS2A 4FG6D 3Q1SL 3CCHA 4YJ2B 3EKCA 4AYBA 4DR2O 2XTJB 3IJEA 2CTPA 3U36A 4WTZG 3FFDB 2QLYA 4AGNA 3K5RA 3SYCA 4QHLB 1L3NA 4ZDHB 2FO8A 1HWWA 4PJBE 3RWEB 4QHMB 2ZM6O 2JB6B 2X1PA 3SOBH 1FSKB 1HTYA 4PLNC 3ARGA 4OLEA 4FFTA 1GMGA 3WNNA 1BMFG 2AEIT 4WNSA 4F7TB 1XSOA 3GZQA 2HKHH 4K7PH 2EYRA 1LO0H 1IAIM 4HIJB 2ETNA 4XVUD 1H3WM 4JFDE 4UWQB 1XF5B 3LYRA 4OGXH 4Q4IA 3U2IA 2CUAA 1TCMA 3Q6FA 3TIEA 3VSUA 1HXYB 2V0AA 3P4NA 5HGGS 4KU1A 2JRIA 1VEMA 4P0DA 2ARJA 3O9WD 4WUUA 4DV7O 1UQSA 2FB4H 3QAZB 4GI8A 4PJFA 3VU1A 3PXJA 1DVZA 3U9PH 3SDDB 4ZQKA 2A6IB 3CSTA 4MTMA 2Z64C 4IBTA 5IHZB 5DRWB 1YAZA 4ZT1A 1OAQH 2E9JA 2NCEA 2P6JA 3G4SV 1VGKA 4FLOA 3O8XD 2BSDA 3EYFB 5B4MD 3ARYA 4ECNA 1CGSL 1IGMH 4NN7C 4YHLL 2FNWA 3L4YA 4TSCL 4MJ6B 4AQ1C 4YSCA 2H2PD 5I19H 3GSWA 4A2FA 3WKNA 3V10A 1PJWA 2EDNA 4S1QH 1L9NA 3UTZA 4K3DH 1UA7A 3EBIA 5DQ9A 5J13B 3L9BA 1FFTB 2XA8H 1XF2A 2DOCA 1BBJA 1J5EO 4RGMB 4ZSOA 3LNEA 3QCTH 1UGKA 2VDNB 1ZMYA 1FG9C 1LK3L 3KL0A 3QXVA 2MTPA 3MRCB 2DQ0A 2XTJC 1MWAH 2FBRA 3D39A 1NSNL 4GMSL 1NOAA 1TQBB 2C5DC 2VDKL 5CA3A 3MRBB 2XQYK 1BFVL 3GI8H 4ZMTA 4KP4A 3PHQB 3N27A 3TNMB 3X11B 4XWGL 1S5HB 4ICGA 1G9HA 3MLYL 4G6JL 5DEGB 5JA9A 3K06A 2F8VA 3L5JA 1KYUA 3NSFA 4M6MH 2DAVA 1G6VK 4RIRB 5LL6Y 2CUMA 4JCMA 5HI3D 4JAMA 3W1ZA 1DBKL 1GHFH 4L4JA 4GY4A 5J1AA 3RFZB 1DO6A 3UADA 1HNGA 3P0GB 1ZIBA 5MHSE 3AK3A 1PFOA 3N44F 4Z76A 1IBKB 2RMKB 1H2KA 4XCCH 5CBAB 1FWXA 1US6A 4NOBA 1JYWA 2ZQMA 3DROA 2E74C 4NYLB 2XVLA 4MA3A 4MLSA 4B3SB 2HB0A 1HHGB 2VXUH 2IADB 3SDDC 1GIGL 4B9FA 2HH0H 1BHGA 1JWUA 4N8CL 4NQEB 1FYHB 4OM1L 5B1KA 3CQPA 1AJQA 2NSMA 3KWVA 1U3JA 3B5HA 5F9JA 4F7MB 1T1ZA 4P2QD 3LZOA 4R7XA 4EZKA 2WUCH 1AS8A 1JN6B 5F0JB 4OIIH 3FUDA 4XMLH 1CG9B 4PJGF 4HK0B 3RY6C 4IRSB 2GITB 2VDRL 2H1LM 4U31A 5FPOA 4LSRL 1QTPA 1E1QG 5EUOE 4HALA 3WTUA 1IKNC 3BKJL 4FQCL 1BJMA 1SGKA 3AW5A 5C7ZA 4XMTA 2XETA 1OT2A 5FKPA 2OZ4A 4RGMC 1VB9A 4L8BA 5PCYA 2PTUA 4WWKB 3WFBL 3ABLC 1KCVL 1JXDA 3FAWA 3QFJE 1UOWA 5HJ3A 3JWDL 1J5CA 4WFGE 3P3TA 3VXTB 5LXGL 1DBML 4OF6A 4FLTA 3QDHA 1MHHA 3O2VL 1DK1A 2HRGA 3N2KA 1M3IA 2EJ1A 1TQBC 3TURA 2KZ1B 1Q6IA 5DC4B 3HPJA 1JGLH 3KE0A 2ZCKH 3QSKB 4N0FA 5E56A 3TH2T 3TZVB 4JFZH 5L6YH 2CO6B 2NYYC 2O6CA 3BE1H 4HIXH 5DI8B 1B3QA 3P11H 4YR6B 1S5HC 1N5AA 3II1A 4PH8A 5T33L 4I0PA 1LUVA 2X6BA 9CGTA 2WZ5A 3B7RL 3V6OE 4PVLA 4HWBL 4E0RB 1VFBB 3NPSB 4R4FL 3ZZLA 3DI3B 2R2HB 4IYKA 1YUHA 2Y5TA 2WA4A 1JGDA 1PZCA 1WCBA 3GKWL 3L48A 1RP9A 1F8TL 1XF4B 2GTWB 4P04A 3UCQA 2DQDL 2M8XA 1EJ6A 1N5YH 3PDDA 1YEDB 3LKRB 4PRPE 5JORB 1EUTA 4WK2B 4DKEL 2APSA 3JAWB 3CFBA 4PA4A 4QHKJ 3QHZH 3KPQA 3OJMB 4XGZB 4UT7H 2ZUTA 2PCPB 4XP5L 1ZSHA 2GJ6D 2KI6A 4ZMZA 2HX7A 2AF2A 5PAZA 5I9QB 5DFVC 2NTFB 3Q2WA 3KCPA 4R8WL 5IJDC 1EEZB 1JUFA 3LS5H 4OD2B 4FS0A 4JPRA 2F5BH 2HRPH 2BVOB 4TQPA 5IROA 4HKJA 4E9YA 1DQLL 5DJ6B 4YAQA 1N34B 2R4RH 3V0WL 1KCWA 1EO8L 2DTSA 3GBMH 3RTLA 3R06B 5DD6B 4FQJH 1J12A 1KGIA 2ALAA 1CD8A 2ZKWA 3TO4A 3W9DB 5FLUA 1HAWA 4J23A 3B5GA 1TA8A 5IDJA 4W9HC 2CHNA 3E1ZA 1AVAA 5JHMA 5CD3A 5E8DL 1E6OL 2WN3A 5G4NA 1GKOA 4HETA 4X1IB 1NM4A 4DV5B 3CSPA 1QAWA 2BY0A 4FNLH 3O3EA 3QIWD 4PRNB 2WXJA 3V4VB 2IVFC 3MV8A 4GLRH 1XSJA 1N8ZA 2XVBA 2FHCA 5F89A 3TU6A 4LF7O 1PQZB 5JPNB 3FCSB 3LXBA 4WNQB 3ULVC 1AB3A 3IEAA 2C1PB 3QUKA 5CEXA 4N28A 3QORB 3ETDA 1YVWA 4LEBA 1JZ3A 3L9EA 3DJSA 4YQXH 3ASOB 4Y4KD 3WJJA 1NAKL 2QQLL 4P23C 5KVGH 1DBJH 2P06A 4IOFD 3UTSB 4LVEA 1WPBA 1U2CA 4JO1L 4M7LT 1TVBA 1GPOL 2QPUA 4A39A 1FBIH 2JK5A 3RYHA 4QCIB 4Y2NA 5KN5B 3C12A 3BD5A 3WFDH 4F7PB 1ZE3H 2KLRA 4UT6H 2N01B 2R2BA 2WUBL 4BK5C 4ZI8A 4MA1B 4ZUWA 1IGIH 4E9WA 4IDJH 3QQ4B 5EORL 1S7SA 2IMMA 5FO7A 2JF1A 3D1MC 3GXNA 2J8OA 1LO5B 4PV8A 4YUEH 4GKLA 4OZIE 3SYPA 4LU5L 3WJLA 3F58H 3I6KA 4UT9H 2OMUB 4DKAA 5CA1A 1OP9A 4G8GE 4ODXB 2NW2A 2VR3A 2XN2A 5ENWB 1BZKA 4DPBX 5C0JA 3WKQA 5I9QC 5KSBA 4WI2A 1L0LH 3L1EA 5AW3B 4FZEL 3ZIAG 1EUUA 3L4CA 4ONHB 4ZPVA 3LPWA 3ZDYB 2K1MA 4G28B 5EZYA 4A38A 3WTSA 2K70A 3ULSB 1T5XA 4IS6B 5JZ7C 2OTWA 3BEVA 3G5ZB 4NZUH 4FM0A 1R3LB 1UM6H 5EO1A 4KH2A 2DOSA 4PEEA 4Z23A 3ML8A 4Y16B 4KZEL 1NL0H 1VQ8V 3IFLH 4JI5B 2PPCA 3G6AB 2QTSA 2VZ1A 4P2OD 5AVVB 4HIQA 1JYVA 1OF2B 4ETYA 4NVPA 5JQGA 4HMDA 2VDLB 1U3NA 2BSEA 5AKSA 3TXQA 1LP9F 2JTYA 5HJDA 5TPWH 4X65B 4QAWA 3S5LG 2VXSL 3GRWA 5DJZB 2GCYA 5F7UA 4L29A 1ENVA 5JOPE 2CO3A 2EDBA 1U4FA 5D4HA 1QHPA 4DP6X 3HKDA 1AC6A 1H8SA 4HYOA 4I50B 2OMNA 3LKSB 1MFAH 3MDJA 5FYKU 3QORC 1OZ0A 3ZHDA 4EBQH 4ZMAT 4ZFQA 3DJRA 4XMUA 3W7WA 3D0LA 5DURD 5GRZA 5FEBA 3CDYA 3ASOC 3Q2NA 3LIUA 5I6NA 5IB3B 3QXDA 3VFSB 4L1BA 3AMLA 5CN3A 4ZYKA 5F96L 3TN0D 2KLSA 4MMZA 1VACA 4MTXA 5DUML 3LEXB 2K78A 3SBWA 1KIUB 4OD1H 4PD4J 4AIZB 1IL1A 4ORGB 2IDTA 2QZQA 4ZX4A 1CDJA 3LZFH 1S9XA 2CKBB 4MA1C 2P47B 2ZF8A 4ZHQB 3SE6A 5J1TC 1OK8A 3RKDC 3AS1A 2GV9A 3B2EE 2IAMA 4MDIA 5EBLA 2XTLA 1AGFA 3X1FA 3QCVL 2FYUH 2UUAO 3VXQA 1HOCB 1ZWIA 3B3BA 1ZLDA 2QFRA 1R24A 3LKPA 5E08H 3DXAA 5LP6B 5I18H 1LO4H 1ZGLB 4IRZH 4J7KA 1F4YL 5TISZ 1KPUA 4JYYA 1Q0XH 3F7VB 5IBLC 1R3LC 1UWXH 3QZBA 2B4CC 4F7EA 5DD1H 1QW8A 3LB6C 2E86A 3N55A 5GGUB 2CO7A 1AZNA 3AACA 5F7KC 1VGEH 1JS4A 1Z9SA 3MNVA 2PGGA 1XIWD 5HJGA 5CZVH 5L7XL 1FRGH 1OSEA 1IEBB 1NAML 2VABB 5EEXA 2IPTH 2CMRL 3DX0A 3F7YA 3L3KA 3QFDA 4NPKA 5E8NB 2DQCL 1N59B 5AZ2H 3KWUA 4AGLA 5IEKA 4Z2WA 1KT2A 2XN9A 3MRIA 4PJHB 5DK0B 5SX5K 3B9EA 2OV0A 3QEGL 5D72L 4WFAV 1FJ1B 1KXHA 1U8KB 4N0UA 5KBNC 3CN2A 2BWQA 5T3XL 2M83A 5CN1A 4CSPA 2XTSA 1S2EA 4JRYE 1DJWA 5ERWB 4FMTA 4HCRH 4APQB 3MHZA 3GJFA 4P46D 1OGSA 2IFGA 1H5BC 3KCWA 4RDQF 3ZE1E 5CCGE 4NI3A 1AHWB 2GABA 2HCZX 1F42A 4JZNA 4MNHA 4KWUA 4IBYA 5DO2C 3GS4A 2PUQT 1G9NC 2GY7B 4BEIA 1I75A 1E9QA 4FJ6A 1DQJA 4NT6B 4LF9B 3EYOA 2AW9A 2J5LC 1DQKA 1V8HA 5GZNC 4OR1A 1Z3GH 5GONA 1AGCA 2ZXWB 1MAML 3VFVB 1KXQA 4E41E 5EDSA 2MNJB 2MOQA 3RUGE 1FYTB 3E22B 2QVKA 4HLZG 2WBXA 4MAYB 1JHLL 3CK0L 1L9TA 4FXGA 3SGKC 5C9JB 5HYFA 4G6KL 4NLHA 2B1GA 4PJ5D 4PD4F 1I3VA 1WNSA 1X5LA 4QTHB 2OMBA 3NCMA 5F9AC 2A9NL 4CVZB 4EE2A 4JZ2A 1LQBC 3DSFL 3ZUCA 3HE6D 2GK2A 1QKZH 3F7VC 2YPVL 1F13A 4JK0D 3ZE2E 3KPSA 4DKTA 1OPOA 2ZNXA 1A3QA 4OGYL 1FP5A 4CMMA 3QIBB 8PAZA 4TSBH 4BKTC 3EYQC 2MMXA 4KPHL 4HJTA 4L8JA 3BSHA 1DBBH 4OTXH 4HK3N 5GSRB 2J73A 1W0VB 4IU2A 1MG3C 5G5DB 1WBYA 2F08A 1EHLL 3B83A 4DR4O 3FRUB 2Z3FA 3OMAB 3KXFE 3O2DA 1CGVA 5JCOC 1HNYA 2D7NA 2XNAB 5E2VL 4KKCC 1NCOA 3AFLA 4GSRA 4YSEA 2R2EA 4AGOA 4AIXA 3HMWH 4ONGL 1F45A 4ZUVB 5IHLB 3IE4A 3LH8A 1SNRA 1N70A 4G6ML 4MMXB 4B3VA 2ZX8A 2QKIB 5HFLA 1S7RB 3UBHA 2VXQA 2EQDA 4APQC 1CR9L 4XMKH 3SDAC 1RJCA 3K6SA 4X7SL 5EZOL 3IGLA 1L9QA 5KSUB 5JQIB 3REWA 2LU7A 4F91B 4O02A 3KS0J 4YDVB 4NQDE 5HI4D 4H44B 4L3EA 4ZRGA 3TX4A 4E9QA 3PWPA 3BZ4B 4QE7A 2HTKD 1ORSA 4ISVB 4LL9A 3MLVL 4JPKL 5KW9H 2QKSA 5IE9A 2DM7A 1VQ6V 2IOMA 2A6KA 1TUPA 3BDYH 5FF6A 4I7ZB 4HZ1A 3VXNB 4MAYC 4Y4FB 4L3CA 2E3CA 1F4XL 2AP2A 1HQ4B 3CFKB 4AQ1A 3BAKA 1JXFA 5TF0A 2YA0A 5JUEH 4BWTA 4XBMA 4LLQB 3Q4HA 1QRNE 5I1LB 4U3JB 4R96A 2ITCB 2CPCA 1KPRA 1YNTA 5EUKA 1KCBA 2HLAB 3SGEH 1E43A 3NSXA 1N3NB 4D0BA 3JWNG 4Z7VE 3PAZA 3QIBC 2AV7A 1PG7X 2RFXB 4LP5A 4AYGA 1BG9A 1SLUA 3OKNB 4PJ7B 4L4TD 5F1OB 4YJ2A 3K1KC 3RDTB 1QBMH 3VXUD 1WPCA 2JCWA 4TULH 5FFLA 4Y9FA 5EIVA 1I9RL 3FCGA 3EDEA 2IBZH 4JG0L 2XRAH 3TJPA 2B5UA 4FKHA 4WUKL 5LBSL 5K9KB 4PY7A 4ZDHA 1E90A 4QHMA 2A9AA 1O9ZA 2JB6A 2VDQL 5MEQB 1QPXA 4DV0O 4K8XA 4F7TA 3DX1A 4ADGA 3CMOL 1CFVH 2W9DL 3I2CL 1YJ9V 4HIJA 2HLFD 2X09A 4XMZA 3T6VA 3KCXA 2WBJB 4MMXC 3U0TB 2QKIC 3DJTA 3UG5A 1XF5A 2IPKB 3SYOA 2Z4TA 3EFFB 1LHZA 4GFTB 4I48B 3ZO0A 1IZ3A 3J7HA 4XN5A 2CK2A 4DFHA 1HXYA 1P4IL 5BMVB 4QMEA 4LEOB 3P3PA 5C0BB 3IDUA 5CEZH 4OFKA 1ECZA 2B1IA 4E2LA 4NXMO 2V6HA 2ZOUA 2A2QT 3WIHL 4H44C 5KHGA 1B3JA 5E8EB 1VQMV 4PA9A 3UEQA 3WNJA 3NCJL 3OJ2C 4QRFA 4YHKL 2X0WA 3SDDA 3IBOA 1Q94A 3JVGC 4PTTB 2UXVA 3MLWL 4PJIE 1RK0B 2V8MA 3FT3B 4QRPE 1Z3RA 2YUAA 2XV6B 2OYQA 1F5WA 3EYFA 1DBAL 4Y4FC 2EINB 2EDWA 3RY6A 1NPNA 3I74A 4YN3A 3S98A 4ZO6A 4MJ6A 1PD1A 5ETUB 4EUPH 1QO3B 1M9SA 2AAVA 3IXAB 4V1DD 5I30H 3ULUE 1NICA 5AB1A 4KDWA 5TDNB 2WSDA 3ZTDC 1IKNA 5F7FA 2ITCC 1V10A 4EPSA 4KTEH 3H9SD 5BUGA 3D51A 4G6FD 4ZOAA 1XT5A 3TJEH 3WSQL 1ZXQA 3BHPA 1F58L 3GLAA 1DFXA 1IBFA 3VGFA 1QUNB 2EYTB 2C9AA 2GVYA 3OB0K 4R97B 2D2CC 4YSUA 5D6DC 1XCTB 4LWSA 1ZHKB 2QPDB 3MRCA 3S37X 4MW8A 4Z0BH 5CJBA 2XXGA 4YSAA 1LO2H 5L4MA 2EEBA 5DJ8B 5J11B 3VD4A 2PYEE 3MRBA 2Y7NA 3TEZA 3PHAA 4KV5E 2DQHL 3PHQA 1MCLA 4N21A 1BEYH 3X11A 1A7OL 4OLUL 4YHHO 1S5HA 5DVPA 5AVWB 3QI9D 5ALBH 1PAZA 3ZKXC 4GI6A 2IMNA 4Q89A 4LBEB 4LBAA 2JI1A 4MSWB 4N24A 4OD3L 1J5OH 1JZIA 3G6JB 1CI5A 4KNTA 2WXGA 3DBXA 2CRZA 4GO9A 2CCLA 1IQWL 4YDKL 3L3JA 5D7SL 4ZUSB 2PWFA 3FO2A 1OCWH 3C2AL 2Y06L 3FNKA 3L7FB 5CBAA 1HCVA 3DLQR 1JZ7A 4NYLA 1I1AD 5C92A 1C9SA 2IADA 3S36X 4EQ3A 3IJSB 4I3RL 4NQEA 3QUZD 1U91B 5KAQG 1MWOA 1RJZA 3LH9A 3QJHA 3UTTE 4FYSA 3CCLV 4A37A 3OWEA 2ARHA 2NY5H 2YS8A 1L7TH 4PJAA 4F7MA 1CLZL 4ANKA 2GB2A 4GRLC 3MV7A 2VDPL 4K15A 1JN6A 5I1EH 3QRFM 4NQQA 4HK0A 3NPZB 4QNPF 2OM5A 2GITA 3MLSL 1WWCA 5B8CB 3MDSA 1OALA 4X9YA 1OD9A 5B39G 5G4OA 2Q10A 1XF3B 3RJDA 3ABZA 1A7RL 4I13B 4XVSH 2XT1B 2TSBA 3PG2A 2UX7A 2IJKA 1ODAA 4ODSH 5AVQB 1G6RH 3L3GB 3QIUB 4HEME 4OZHB 4Q0XH 4DPCX 1LE5B 2R0LL 2YWYA 1FGNL 3VXTA 4EDXA 1BP3B 4WO4D 2UXNA 5J11C 1H8HG 2C9VA 1GYCA 1A3LL 1JERA 2A6JB 2K6ZA 5FWRA 3WLWC 4A2EA 5TTRA 1X5XA 4R6UA 2EEXA 3TZVA 5KYYA 4XMVA 4JFOB 3MGTB 1F2XK 4WSKA 5TDOB 3RRQA 3VGDA 1BF8A 4AC2A 3HHSB 3K5OA 3GTTA 4YR6A 4AMKH 4ES8A 1RPQA 2XI9A 4NM8L 1IKOP 4K3JH 4LBEC 4MSWC 4JJ5B 5GRWA 1QZ1A 4E0RA 1REIA 5AWNH 1VFBA 1XGRA 2R2HA 3D06A 5FYLE 5L3FA 5I75B 2YD9A 1UCTA 5CEZD 5JXEC 1JL8A 5CEYA 1XF4A 2GTWA 3PQYA 4HJGB 4BK5A 3HA0A 3KBHE 1YEDA 5JORA 4NUGL 2VN5A 2ZSWB 4UNIA 3VNYA 3EJRA 4IHOB 1CVSC 3JAWA 4P4RB 1CXHA 3C6LC 3FHAA 4N5EC 1BM3L 2PCPA 3U30C 4DVRL 3U0PA 5EIIA 2QV4A 1KN4H 4WEEA 1JNJA 5T5NF 1K8DB 4AUUA 4BE6A 3BQUB 1SXSA 2IBBA 1RZGB 1FFPA 3IDXL 4JFED 4PGJA 2XQ0A 3LHPH 4NM4L 1RUPH 1CE1L 5B8CC 2AZ0A 5E5MB 4PD4K 5DJ6A 3LQAC 1IFRA 5CWSB 1XZ0B 5KZCD 1U6AL 3NQIA 3R06A 2CO1A 1RUAL 4LFHG 3VD3A 3E2EA 2F54E 4A68A 5I15H 1NMBL 5EHFA 5DVNA 4KHPO 3W9DA 6FABL 1I8AA 2R4SH 2CHXA 4KVCH 4HSQA 2NY6D 3E8BA 2V5RA 4X1IA 4TL5A 3JT0A 3SKOA 1P7QD 3V4VA 3IKCB 4ZW3A 1XMOB 4OLVH 2BM3A 2UXBB 2Q76B 1FCGA 3NMEA 4FYQA 3FUHA 1GGBL 3FCSA 3D8CA 3Q1SH 4WNQA 4G7YH 3MKKA 2C1PA 4OZGF 2NY4C 4RNRB 1LNUB 3QORA 3ZSSA 3CHOA 1TKWB 1TPXC 3IYLW 1FVEB 5CR1A 4HFUH 4ZUTB 3JYBA 4YBLB 2ZUSA 4DN3L 3NYKA 3UTSA 2IDUA 1QCEA 3ZR6A 1G9ML 4MRCA 3NXSA 4LPYA 3GYRA 1L7IL 1T21B 4QCIA 5LN4A 5CP7B 5KN5A 4MD4B 4LNUB 4PWKA 3UYOD 5I75C 4I3SL 4F7PA 3DRQA 2B77A 3QDJD 2Z65C 3X1GA 5FW8A 5F9OH 3QQ4A 2CDYA 4RQFA 2E5EA 2DQEH 5F1IB 3IFNL 3D8MA 4X4XB 1KB3A 1LO5A 5GGSA 1MDAA 1NJIW 1IKFL 2ZE0A 1MCKA 2OMUA 3DYOA 4ODXA 1OE2A 1N4CA 4J6RL 3BUBA 4ONHA 4PJGE 1L8DA 3MRKB 3P4OB 3RVXC 4L4VD 3TVMD 1SYVA 1H3XA 1R3LA 1UXLA 2EH8L 2WLNA 4XHJD 4Y16A 4KXBA 4QRUB 1CGSH 1WPXA 1EFXD 1NC2B 3ETEA 1BXAA 4MJ5B 2X4UA 2R7EA 1A22B 4M93B 5CBGA 5GGQL 2OZ4L 2YXFA 5F7WC 3SDCD 2AABL 2DL2A 2ZE8A 1GZQA 3IWUA 2WVVB 2PETA 3D48R 3ARDB 1RJLB 4N0RA 5DJZA 2H3XC 5J6GB 1TJMA 1URZA 2FX9L 4KQ4L 4NNXB 1YMMD 5D7KD 5D8JH 3BCCH 2FWOA 3UROR 4JLRB 1K8AW 4I50A 1GGCL 1T04B 2B3IA 2R9AA 3ILPA 3LKSA 4ODVL 1A64A 2R56L 1AQKL 3ARBD 3GTNA 3VFSA 2EDQA 2VDKH 4M56A 1B4TA 3CPUA 1BFVH 2VH5L 3FKUS 2EKSA 3ESOA 2ZKMX 4U6XB 4L37B 1UH4A 4XWGH 3ZL2A 1I3RB 1KG0B 2X89D 3IE9A 4X4KA 3LEXA 4G6JH 2YGOA 1VCAA 3CZEA 4AIZA 4BQ9A 3SJAC 2IO5A 4ORGA 2ZNJA 4Q6KA 4D3CL 5JW5B 5GZNA 1Q1JL 1TLKA 3KYNA 1AILA 1DBKH 3A6CL 5DMGC 3QDME 2N0KA 4LLMB 4E36A 3H9YA 3KM1A 4KQ0A 5LQBH 1HILB 4B97A 1U33A 2ORBL 1BREA 1XX9C 5LYJB 1HOCA 5GZOC 3SGKA 3VM7A 1KD1W 3ZHVA 5LP6A 1GIGH 1JHKH 3U0PB 3QFJB 4BAYA 3QQ3A 5IJVB 4OM1H 4HXAL 4MCYA 2XBZA 3F7VA 4UIKL 5T1MB 1JFHA 1GW6A 4RAUA 5D1XD 1E8XA 1LR1A 1EVUA 1N8RW 4LHUB 5GGUA 3V95A 4YFEA 2VDRH 3WGVB 4WI4A 3HPLB 4LSRH 2KQMA 3FB8B 5FM8A 3H1LH 1BMWA 1CL7I 3BKJH 3SYQA 2VDOL 4FQCH 4M62L 1S5IL 4PU2A 1M7IA 5E8NA 3ARDC 1IXBA 5JCOA 1N59A 3NFNB 5KBPA 1R33A 5F3BB 3FKSG 5BV7C 1XDTT 1J1PL 4Y5VB 1F97A 4PJHA 1KCVH 4XT1C 5DK0A 2HTLC 2NW3B 2DBLL 2J6EH 2VLKD 1FJ1A 2FD6L 1U8KA 4I4WB 3RWIB 4PRPB 1X7QA 3K8KA 3O2VH 1IBBA 1UM4L 4PJCF 1I8KB 1JHTB 4ODTL 5ERWA 4APQA 4EIUA 1EBOA 2WWOA 2IWFA 3SDAA 3F01A 4X9QA 3MRMA 5E9DD 2CLRB 2D7TL 4L9DA 4IGBB 4PJ9D 2EZPA 1QRKA 3QHFL 5TQ2L 5T33H 1LO3H 1AR1D 3NIGF 2WPDG 4ZMNA 2QHLA 2CR3A 1C5CL 4L8SC 4HWBH 1IQDB 4R4FH 1AOZA 2AK4D 3BN9C 3VFVA 2HWZL 1WBZB 3GKWH 5CR8A 1Z5WA 1PGRB 1F8TH 4K5PA 1JNHB 2XSKA 1DUYB 2DQDH 1YPZF 4MAYA 2CIIB 4KI1A 5FX3A 4C47A 5DDHB 5C9JA 4NXNB 2ZCLL 4DKEH 3GHEL 2WLHA 1GJIA 4QTHA 3FTZA 4CVZA 2ZPKL 5FPIA 4L8DA 2Y69B 4XP5H 3ZN1A 4LNRB 2PTMA 3GTVA 5LGNA 3UG4A 2MOGA 4KMTH 5I5JA 2WXKA 4LQFH 4R8WH 4HW6A 1MVFA 4S0HA 5D9SB 3QIBA 2YQBA 1MCDA 3VFNB