1OCRB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ocrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ocrB02
4GXFA 1SHWA 1WS8A 3CVDA 4DP6X 2DY2A 4HCFA 1L9TA 1NTDA 1QNIA 2UXGA 3T6XA 3JTBA 4KOCA 1SF5A 4Q89A 5B1JA 2XV2A 4BDVA 1ASPA 2J55A 2IWEA 1BQRA 1NIDA 4A2EA 1SNRA 2IWFA 2CJ3A 1I53A 1T5KA 2XVBA 5F7BA 4DP5X 4YL4A 3UGEA 1XB8A 3GXUB 3NJGA 3QJUB 3WNJA 7PAZA 4AZUA 3T9WA 1AOZA 3S8FB 2CBPA 4HHWA 1OE1A 3HEIB 2DWTA 5B1KA 1J5CA 1AAJA 1URIA 4KO9A 3PAUA 3NT0A 4WTQA 4DPBX 1PLAA 2VSKB 4YSUA 4F7KA 1CUOA 1BEXA 2P80A 3OD3A 1FWXA 4BK5C 3V9CA 2GBAA 3OMIB 3WIAA 2PPCA 2PPFA 2XX0A 2Y1AA 3PXLA 2XV3A 4YSSA 2VSMB 1A8ZA 3IE9A 4ZK8A 1DYZA 1OE3A 3S3CB 1X9RA 4KNTA 3NJKA 2ZXWB 2B3IA 1JVOA 1AZRA 1PLCA 1CURA 2BW4A 5B1BB 5TK2A 4A2HA 1GS7A 1QHQA 2YXVA 2QPDB 1PZBA 3QJQB 1V54B 5I5IA 1CYXA 4WKXA 3WKQA 1MZZA 3ABKB 3CVBA 5A7EA 2GB2A 3SQRA 2JXMA 4M4RB 4HIPA 4W1TA 3PPSA 3QJTB 5B7MA 5FC9A 5E9NA 2UX7A 3QJRB 3EH3B 2E86A 4GP4B 4NERA 1KBWA 1ASQA 5I5JA 2BWDA 2FQDA 4E9VA 4G70B 1AG6A 3JT2A 4HAKA 5F7AA 3DTUB 1RKRA 2GC4C 4BXVA 1WA0X 4KO7A 4A2FA 6PAZA 4GYBA 4HZ1A 3UABA 1FA4A 3FT0A 2CUAA 2HX7A 1E30A 2UXFA 5B7EA 2XXFA 3SBRA 2PCFA 3NJMA 1JOIA 2FNWA 2WO3B 3TASA 1OOWA 3RYMA 1A65A 2A3TA 1AACA 1ADWA 1KBVA 4G71B 2HXAA 1NPJA 2MRYA 5I6KA 2AANA 2FQGA 1IUZA 1NPNA 4A66A 2R7EB 1ZDSA 3MX0B 1ILUA 2J56A 1YLBB 2FQEA 1AZNA 2QDWA 3X1BA 1BXAA 5D4IA 4JHVA 2BP8B 3ERXA 2IH8A 5D4JA 5EHFA 1IC0A 4N4YB 3AW5A 1CC3A 3KW7A 4HALA 1GYCA 1ILSA 2PCYA 2BP8A 4A2DA 3X2QB 1CYWA 5I28A 2YAPA 4UANA 4YSEA 2YAEA 1E5YA 4GY4A 3NJLA 2WSDA 2HRGA 3FPYA 3SBQA 2FQFA 1KYAA 4TXVB 1A4BA 1ZPUA 2Q9OA 3NSYA 2GC7C 1NINA 4A67A 3CG8A 2H3XC 3SBPA 3WI9A 5TK4A 1BQKA 1OCCB 2PP9A 4NB7A 4G7SB 2HRHA 4YSOA 1ET7A 2PPAA 3FQ2A 1PNCA 4BWTA 3QQXA 2UX6A 1W6LA 1AZCA 1ASOA 4NAJA 2ZWNA 1N70A 1PF3A 3ZX1A 5I6MA 2EIMB 2I7SA 1OCZB 1WAEA 3FPXA 3BQVA 3X1GA 4YSCA 3OM3B 2GHZA 1KCBA 1SDDB 3DKHA 3AG2B 4PCYA 1OV8A 2H5UA 2J5WA 3IN0A 1SFDA 1SDDA 1MG2C 3T6WA 5I26A 3H56A 1ZV2A 1PAZA 1BQ5A 1HAWA 3H4HA 4UAHA 2PPEA 2FT6A 2FWLB 2TSAA 2EIJB 1RZQA 5AFAA 4CSZA 2BHFA 1SF3A 1SFHA 1SJMA 5IY5B 4G7RB 4YSRA 1OE2A 1IKOP 2XXGA 2Y69B 2JKWA 2GI0A 2YAHA 1BXUA 2MTAA 4MFHA 3H4FA 1R1CA 2BWIA 2CAKA 4P5RA 3ZBMA 1AQ8A 1AANA 3ABMB 1XB6A 2EINB 3UADA 4ENZA 1KDIA 3NP3A 3TA4D 1JXGA 4E9XA 4UF7C 3S8GB 3X1FA 3T71A 1TKWA 3FSAA 2AVFA 2XLLA 2X87A 1L9RA 1E67A 1JXDA 3PLYA 4DP9X 4G7QB 1WA1X 4G72B 3T6VA 2IDTA 4QKTA 2HZHA 2AZUA 3UACA 4N8UA 3FS9A 3FSVA 2RACA 3HB3B 2VM3A 3NJFA 4W9ZA 1M9WA 5AZUA 2YAOA 1RZPA 4DP7X 3OMNB 2YEVB 1PZCA 1BYOA 1TEFA 3AZUA 1B3IA 1BAWA 5B7FA 1J9RA 3N55A 2VN3A 2OV0A 4F2FA 3FU8A 4KNSA 3EF4A 4BWUA 5I6LA 1OF0A 4KO5A 1KGYE 2PP7A 2PLTA 3NSFA 1OCRB 5B1JC 3DIVA 4YSPA 3IEAA 4GP8B 1AS7A 1JZIA 5PAZA 2VMJA 2IDQA 3FYEB 4P5SA 2B08A 4JHUA 4YSQA 3NJIA 5B3SB 3G5WA 3OQRA 1HAUA 5ANHA 2R7EA 2IDSA 2I85A 2QPEB 3TU6A 3FU7B 4FAAB 2XUWA 3PCYA 2YAMA 3ASOB 1ID2A 1M56B 4E9WA 2GSMB 3NP4A 4KO6A 1M57B 1HFUA 1NIEA 2AFNA 2FTAA 5I6NA 1V10A 1GY1A 5I5MA 3NJNA 1BXVA 1PLBA 2ZOOA 3FSWA 1KCWA 3C75A 2EIKB 1A4AA 2CALA 2NRDA 3QJSB 3IN2A 2UXTA 4JKNA 2YAFA 1J5DA 5I6PA 2BP0B 6PCYA 1ZDQA 4PAZA 9PCYA 1VLXA 1F56A 1OCOB 2BZCA 3MBWB 3BVDB 2OJ1A 1BYPA 2AZAA 1E65A 1AR1B 3PAZA 4QLWA 1AZUA 1X9UA 3UAAA 1JZGA 2CCWA 2IAAC 3WNIA 1AS8A 3X1NA 1PY0A 4M3HA 4Q8BA 3WG7B 2X88A 4HHGA 2YARA 3FSZA 3S3BB 1A4CA 3L45A 2OCCB 1JERA 4BDVB 1NIFA 1N68A 4YVUA 2VW4A 1MG3C 2XWZA 3CVCA 2XYBA 3QPKA 2IDFA 3V9EA 8PAZA 3OMAB 2W8CA 4L0PB 4E9QA 2DYSB 2VM4A 2FJSA 2WO2B 1EZLA 1AIZA 2BW5A 4E9TA 3ASNB 1NZRA 1TU2A 4YSTA 1NDTA 3KW8A 3AG3B 4DP2X 4AKOA 1WA2X 1UATA 4E9YA 1IBYA 3TBCA 3FYIB 1AZBA 3AY2A 2ZONA 2EILB 1J9SA 2YQBA 1WS7A 2TSBA 3ZDWA 1W8EA 2J57A 2Q5BA 2IWKA 2W88A 4DP1X 1ZIAA 1V55B 2FT7A 4AX3A 2I7OA 3WKPA 3CDZB 1L9OA 3X1EA 1GS6X 3NJJA 1IBZA 2BO0A 1KDJA 4AKPA 4BXSV 1MZYA 3CDZA 1EHKB 3S3DB 1FFTB 4BWWA 1ZIBA 1J9QA 1MDAA 2HLEB 2N0MA 1JVLA 3U25A 1L9PA 3GYRA 2FT8A 3NJHA 1L9QA 4DPCX 2QDVA 1A3ZA 4FA7B 1PCSA 1SHXA 4X4KA 3ZIYA 4E9RA 4YVNA 2QT6A 1NIBA 3NYKA 2JFCA 1AG0A 1ETJA 2VW6A 1GR7A 1L9SA 3FU9A 4AI7A 5B1AB 2IH9A 3UAEA 4AKQA 3TBBA 5LDUA 1PNDA 3FQYA 2YXWA 3CZUB 1PZAA 5AKRA 2YAQA 3PAVA 1JZEA 4DPAX 4A68A 2XV0A 1GSKA 3NSCA 4YSDA 1NIAA 3AG4B 1NWOA 2UXVA 1W6WA 1RCYA 1J9TA 3D12B 1NICA 4HCGA 4RH4A 2GIMA 3T6ZA 5PCYA 4EF3A 2P80D 3FQ1A 3QJVB 3NSDA 5D4HA 2VW7A 1QLEB 1PMYA 3ABLB 1E5ZA 3AG1B 7PCYA 4GP5B 3FU7A 2XU9A 3EHBB 1GW0A 4KNUA 1KV7A 1ET5A 4HCIA 2HX8A 2DV6A 1XMEB 2IDUA 4KOBA 4YSAA 1JZHA 1JXFA 1GS8A 3ABGA 1JZJA 2H47C 3EH4B 4A2GA 4F2EA 1AS6A 4DP0X 2HX9A 3IBOA 2BZ7A 1NWPA 2XX1A 1DZ0A 2BP0A 1XB3A 4DP4X 1TEGA 3EH5B 1GY2A 3GDCA 4CSPA 1ET8A 4K9JA 4E9SA 2DYRB 1JZFA 4DP8X 3N2JA 2PPDA 2PP8A 5I6OA 2LLNA 2DWSA
chains in the Genus database with same CATH superfamily
3QUZA 4HEPA 4X9QA 4MJIB 4WENB 3ABKC 4O4JB 3F12B 3BLKA 3MRCB 4K8RH 1PNLA 2ESVD 4DR7B 3HJ0A 5ISZD 2IV9A 4KOCA 1S7XB 5FK9A 2DQJH 3F3HA 3CFUA 1ZT4B 5EO0A 1CCZA 3A4DA 2P4KA 3LZFH 3OKKB 1XBLA 3UBGA 1FGNH 3MRKA 1QSED 1BWWA 2CJ3A 3ZKQD 4OLVL 3FRPA 2BSSB 5I17A 4P2YA 1I3GH 3BGFC 1U92A 3WTSA 3L3OC 2DQFB 4RAUA 2OIEA 4YL4A 3BAAA 4XOEA 3VM7A 1ZHLB 1FYTE 1CL7H 1N59A 3SGIA 1QVOA 1R3KB 2NR6C 5I15L 3A6CL 3KAAA 3HEIB 3U4EB 3TO4B 3TBSB 2D03L 4KO9A 4C83B 1A7QL 1G8MA 4PRBA 5I1AA 2LU5A 1G6RA 2BY2A 1F2QA 3QEUB 2J8UA 4R5TA 4ECNA 2F95B 5C0DA 1TENA 2BIPA 1Z9OA 3N40P 3FO1B 4GIPD 4OFYA 1TR7A 3E86A 2VR6A 3DX7A 5DI8B 4ZZFA 1XWVA 4YXKH 3Q2VA 4FNQA 4PJXF 2IH3C 1LK2B 2EEDA 3CDFA 3PWPE 2WNKA 5LP6A 1WN7A 3GHEH 4AG4H 2ZX5A 3DA0A 4F2MA 5L88L 2Y4TA 1ANUA 1EV2E 4PJHE 1MCSA 2AGJH 5C0EA 3LMJH 3DUUB 3QORA 1IBLB 4UMSA 1AZRA 1PLCA 3AAZA 4DV2B 1F4HA 5ENWB 3T1WA 5E70A 3RWEB 3W38A 2X4QA 3FUIA 5D9SB 3C90A 3W7UA 5IOKA 3UL4A 3CVHL 3AB0B 5EIQA 3RL2A 4UOJA 4M7KH 1PPIA 4DR1O 4DR2O 1FNFA 4ODTH 4Y1AB 3VXUE 3WIIL 2WLJA 2F7RA 4YR6A 5EORH 4U6XB 4WEEA 1GM8A 3G6AB 3JARB 4DRXA 1B0GB 3IJ4A 4XH2B 3R4DA 2E7LC 3X3GL 4Y1SA 1A1MA 1O6SB 4TLKA 5IW6B 1KBWA 3QEQD 4DO4A 2EVGA 2WQSA 4LCYA 2EICA 3ZMEA 4O4IA 4YO0B 2A1WH 1TEYA 3CHQA 5GS0H 1DQQB 2FGWH 2VLKE 1J0KA 4X5RA 5BZWB 5FDWA 2UY7B 3GZOA 3A0HZ 2ESVA 3D33A 2D3JA 4JR9L 4GQ9L 4FFVC 3KM2A 1PZ5A 5F6HI 4H20H 4L23A 1RIUH 4J4PA 4YDKH 1OLZA 1CLCA 4NP4L 2A3QA 1L4IA 5KVFH 2KZWA 2EYRB 2N01B 1OOWA 1B0WA 3L4VA 4BZYA 4OZIE 1QSEA 1Q4NX 3LDCA 1BGXH 2HXAA 3EYOB 4QHMA 2LAAA 1ORSA 3DSQA 3X3FH 3OKMA 4GRLC 2KLTA 2YHGA 4L5FE 4WTWA 3RWJB 4PGDA 3SDCB 4Z76A 5LAXB 5H94B 4IRSC 3SCMA 4UT6H 5K59F 3PDOA 3JV6A 3HOGA 3QI9A 4M7JH 4MA8L 3ZT6A 3NEOA 4YC2B 1OF2B 2VQ1B 3OGCC 4OZHF 2EUVA 4N1EA 4FQPA 1A32A 5CINL 3WFEL 4AMKL 3VGAB 4ONHA 1R5VA 4N2GA 5LBSA 5I0VA 2XN9B 4CA4A 1RLWA 5CB4A 3V4PH 1K6QL 4Y4HD 5DK2A 1QBAA 4JGMA 4CS4A 2AVGA 5EOTB 1KY7A 1ORQA 5KZCD 4B53A 1N0XH 1JS4A 3ZL4H 4M7LT 2YLHA 1V3MA 5BXZA 3MO1A 4JI2B 2YD8A 2YI9A 5CEZE 1ADQA 1HU8A 1NUNB 3MACH 5C86A 2ZAGA 1BG9A 4YGAB 2GC7C 2ADJA 3TEZA 4HDIA 1P2CA 1WCBA 5CA0B 3SBPA 1SERA 5CIPH 2PP9A 4RSYA 1QRND 3MXWL 4JHWL 3P4OB 1R19A 2NY3D 2NY5L 1O9VA 4HHAA 1RU9L 2DWEC 1Y6XA 4TVSa 4N2DA 1LILA 4NDMB 5FKPA 1W0YT 3GGWA 2WINB 4JFXB 1L0NH 5LA6A 1BW8A 4P23A 3TH4T 1WAEA 2VDLL 1FNAA 2EABA 2BRRH 3B3IB 3WDJA 1FFXB 1ZHBB 2P5WB 3DKHA 1L5GA 5CSBA 3KJ6L 4PJCF 4EFBA 1YUHB 1UD5A 4QGTA 3SKJH 1NEPA 4NQQA 4PR5A 4JO3H 3OLIA 5SWZD 3ZTJG 3ZDXF 2J5WA 1SS3A 2F18A 5A6LA 32C2B 3K71A 3FFOA 4MZ2A 2FJHB 3KBPA 5D96C 5IT2L 2BCKB 1EO5A 2XG5A 1X5AA 2IOMA 2B1HL 2ZCLH 4HOZA 1NI8A 2OMXA 1BQ5A 4YPGA 5DM6V 2F0CA 1QEWB 3RX9A 4XPBH 4YDNA 1IGJB 3BAEH 1ECZA 1GOFA 2EIJB 1CDHA 3QNZA 4I13B 3CCEV 4GAYA 4XP4H 2JJ2G 3JSNA 3QEGL 3T3PE 5CD3B 5JQHC 3ZZ1A 2PWHA 2LU3A 4W68A 4X4MA 5KYYA 3VFGL 4KZEH 1GOHA 1G9HA 5BO0D 2XZAH 2ODMA 3CSXA 3IJEB 5C0BA 1MRFL 1MN4A 2VAJA 3SSGA 5I75B 3GMPA 3QS2A 1SESA 3LZQA 4ZFZA 1T0NA 3ALWA 1AQ8A 5TE6L 3PGFL 4XCFH 5B4MD 1SGKA 2J73A 3LHPH 4YH6A 3OXSA 2AQTA 3IMSA 5HDQH 1K8DB 3BKML 3BPCB 3QFJA 3HZMB 4YBQD 3DYMA 1I85C 2X87A 1L9RA 2VXQH 4PRNA 4BFRA 5J9PB 1ED3B 3SE3A 4NQDB 5CZVL 4HEME 4Y7MA 3PWLB 2D4DA 1CGVA 1A1OA 1XCWA 3OKLB 5GGUA 2PUSA 3AREB 4FJCC 4R96A 2VDRH 3BVTA 4UZGA 4M4RA 2B16A 1QWUA 1NGYA 2F54D 1S72V 1B6UA 1T2JA 5JXED 3OR6B 1JAEA 1FHNA 4HIHB 2JK5A 4LLDB 4M43H 4MYWB 5F1IB 5EBLC 3Q6FB 4JRXE 4AYDC 4BIKA 1LO4H 4ISVB 2EJ7A 1F6AA 2QADD 4U6YB 1T66C 3WL9A 3FJTA 3V0VA 4PDVA 4JO2L 1XIWB 2V7NB 1M42A 2G75B 3IU3A 4KJPC 3T08A 1S7UA 5TH2B 3I3EA 1C5CL 2R1XA 3HAEB 3QUML 4PU2A 1C16A 4FNPA 2W9DL 4IKNA 2IBGA 4UTBH 2VDPH 4OGYL 3O9WB 4LSTL 1KBKA 5A9GA 2VLJB 3CSGA 3EYVA 3G5WA 4FXLA 3I85A 4OD3H 5GGVH 5TD4A 4ZMWA 3BW9A 1FFNA 1XT5A 3AS0A 4JQVC 2A2QT 4PJ8C 4P2QA 3QZBA 3Q3GA 3QHZH 2AITA 3TU6A 2PW1B 5KANG 4TQDA 3EGXA 1Q8IA 1D9KC 2H26A 4G28B 2A6DB 2BOBB 1SA0B 3OD4A 4JZGA 2FHCA 4DV4O 3E3QE 5JOFA 1MFCH 2IMNA 2B5UA 4KMLB 4MDRA 3VVVA 4FKEA 2H6PA 2EADA 1CGSL 4BW5A 5I30L 2DQIL 3OKYA 2P8MA 4U1HA 4MAYD 3UTTA 3QIUC 2R2CA 3NJXA 5T3XE 4FQJL 2ZCEA 5F9JA 1JGIA 1UWFA 4JKNA 4LE8A 2WZAA 3HZKA 4O2CA 3PJSK 5AVRB 1VKXB 3W7TA 4PJ9C 4ZO8A 1UXSA 1LP9F 4G42B 5DC9B 4BE6A 4UVBA 1OWWA 4PGEA 1MAMH 4LQFL 2YBRB 4KDVA 2IU3A 4QLWA 1F4WH 2H4EA 3ZT7A 1LVEA 4CU8A 2DQCL 3MV9B 4FQIH 1DVFA 1MFNA 1WWBX 3U6RA 4I8DA 4HJGA 3O2WL 4GI9A 4JHAH 5CBEA 3WB2A 4PH8A 4F37K 1H2GA 2X88A 4KUMA 3K4ZA 4RIRB 1A14H 1NIFA 2F54A 2LLLA 2ALWA 3MRJB 5D1ZD 4YVUA 3WN5B 3ZHSA 5TQ0H 5JHLA 3QZMA 3MA7B 4IKLA 4HZLB 5FHBL 3P40A 5JXEA 1QUNA 4XNMA 1FVCA 2ZG2A 4Y1TA 5CEYA 4X6DE 3AM8C 3MV11 3EJZD 5FGCB 4K7PX 2K8QA 5CFHA 3D85D 4ZOEA 2E47A 3QUYB 4NNPH 2WNWA 4JCLA 3KWXA 2H8PC 1FSKC 3V0DA 4FTVE 3FQWB 5L8KB 2NYYC 5JQIB 1ZTXH 1ZT1B 2ZX7A 2Q7GA 2AP2A 3N41F 4OKVA 4XO3A 2F9BT 4E41B 3LQZB 1AZBA 3K57A 4Z2WA 3ZDWA 5BR8B 4RZCB 5FNVB 3NN8A 4A7GA 2E7BA 1QTSA 4D7BA 3JCUZ 4JPIA 5BW7C 4UQDA 4S0TD 3RY6C 4ZSOE 1JNHA 1NOAA 5KSAD 2YMXH 3RE0A 4H44C 1KWKA 5JIQA 4LPXA 3V4VB 4A1RA 4KQ0A 5IWLC 3MLZH 3MLXH 4WFED 5TPWL 4X0KA 1OAXL 5CO1A 5IESL 1HW7A 2AHIA 1WVZA 4RNRB 5D2NE 3O4LA 4IIQC 2UXBB 1ZIBA 4QTHA 2EEFA 3BZDA 3MLVL 1N0LA 5DVKA 3TL5A 4MAYA 2A6IB 2X89A 5EIIG 1J8SA 1DJGA 1MXGA 1SEBB 3VXMB 3G08A 4N0FA 4GX1A 4WTZG 4I18B 1SQPH 5E00B 1X5LA 3KPMA 3VFRB 5HVHC 4B3SO 1XGQB 2JFCA 1ZLUK 2ZWZA 4C4BA 2VDKL 1ZLVH 3MRRB 2VW6A 1SBBA 4NLHA 4NENA 5IW1A 3DV4A 1H8EG 5ICUA 4XWGH 1K85A 3CFBB 4W9IC 1UM6H 5I16B 4NJAH 5DJXB 2Q2EB 4UQ3A 1ZE3H 3DVNA 1AHKA 1E4WH 3VFWB 3WEOA 1ZMYA 1ICTA 1R17A 5KVEL 4MLIA 3WJLA 1R3JC 2QQNH 2NNRA 3PHQA 1KIUA 4O2BA 1HNXB 2Z0UA 1U8NA 2CKNA 4N90D 3TCXA 1OANA 1RMFL 4YSDA 1JGVL 1NIAA 4XPHH 2LABA 1S9XB 3D85A 5C6WH 2WZ5A 2VDOL 1UH2A 3LS4H 1A7BA 4JPWL 2P80D 1ZUQA 3BKJL 4H25A 3BJ91 1H6FA 1BEYH 2M7WA 3EYSL 3OEHG 4H0IA 4H40A 1E5ZA 3QCUH 4FCAA 1NBVH 4FXGA 2BVQB 3FU7A 2FX8H 2YFOA 4O02A 2F23A 1ZEAH 4GPVA 1W8OA 2JVDA 4U1KB 4APQB 2YFNA 5IJ0A 4HUVB 1PW3A 2A73B 1F90H 2MHAA 2J1ZA 2WYIA 2XG4A 3TT3H 2CJSA 5DK0A 5DD0L 3N50A 4WF7A 2XVLA 4Z3GA 3ABGA 2RMKB 5L3EA 1IAIM 5KSAA 3SE9H 1DJZA 2A6KA 5MEQA 1WIOA 1TITA 3P4NA 2Q67A 3TJHC 1W0WA 3BH4A 5EZYA 4ABQA 3EJTA 1KENH 4QAWA 3A24A 4HU2A 4KPHL 4EI5C 2IH1A 1FORL 4PI2A 3HCVA 4EO5A 4YHLL 1E6OL 2CCLA 2ZSVA 3U36B 4PJDE 2G9HB 4HGWB 3CH1B 5C08E 4QHKJ 2QEXV 3W9EA 4Y2NA 4EUPG 4GXFA 1P5UB 1PQZA 4DP6X 5I74C 4L9LB 2DQEH 2F53E 3O65A 4HCFA 4PV1C 1HIML 2UXGA 1Q38A 4ZTEA 3VH8G 4ACTA 1CD1A 4YHML 3BOVA 4J23A 5I1KH 3IDIA 4Q89A 4AXWB 1I94B 1EEYA 4DJMA 1A7RH 3GWKC 3MJ9A 1MLCA 5D7HA 3BP7A 4XMVA 3VAEA 5AOIA 5B1CA 1B0RA 1N4CA 4NXMO 2NR6D 1T5KA 2AJSL 4UDUA 2APBA 3NMEA 4PJFA 2EO9A 2R0ZH 3E38A 1XF1A 2BNRE 2CDGB 3WGUB 1I4FA 4WRLA 4GG6B 1WTLA 2CUGA 3P2DA 1CLZL 1EO8L 2QPSA 3G04A 2HLFC 3G3LA 4KKAC 1ITBB 4YNYB 5T1MB 3GKWH 2VSKB 2A7BA 4XBMA 1JWUA 3T0EE 4TULL 3WIHH 4UOZA 2OM5A 3U4BL 1OP3K 2EH8L 2DIBA 3VXRD 4WI3A 3UC0L 2XAHA 4DWHA 3GBML 1JXKA 2ITCA 4HF5H 2P80A 2H2PC 2XWBA 2GBAA 3OMIB 3JTTB 3K46A 3QHTC 1A9EB 2ICEB 3PUUA 3QJFB 1NZ6A 4ODSL 4YE4H 2A06H 1E43A 4J1UA 4XBFA 1JFFA 4JQXA 1FXKC 4X64B 3P4MB 3TGUH 1X9RA 5LBVA 1YCIA 1JNJA 1JHLH 2CCVA 4ZQKB 5DEDA 3G4SV 1YMHA 4U2ZA 4XPFL 3RZCD 1S3RA 3NFSL 1BSMA 2CKBB 1JV5B 4LP5A 4CMHC 4LCWD 1GGIH 3H9SE 4Q6IB 4YHYC 3UT5A 1FZKA 1OAZH 3DMMB 1YEKL 3HKFA 4IBSA 1S3KL 5AB1A 2YD9A 3ZR5A 5C0CD 2HAZA 3DSNB 4P5TD 4JY6B 2ZD0A 3CZGA 2F5BL 3MV7A 4KZCA 3VG0L 5DHDA 3O41B 4OF7A 5SWSE 2MKWA 4K94H 4ANXA 4JFZL 5IB5A 3BE1H 1XH3B 2OL3H 4BXVA 2Y07H 4OAWA 4BUQA 3APNA 2ROYA 3S97C 4TOIA 3BVUA 4F8NA 3JWOC 1CFQB 3LZLA 1KFGA 1WAPA 4GRLD 4RFEA 3SBRA 4PUBL 5DRZB 3L3OA 3L1EA 4GAAA 1U2HA 1SF9A 4IRSD 5KBKA 3ULUF 3TONA 1OCZC 4X98A 1WFNA 2NR6A 1NPJA 3D07A 2FH8A 2MRYA 3JUZA 5AYQA 3OX8A 2DMGA 4LGRB 3HKBB 4R8WL 3QUXB 3MJ8B 1KULA 5B21A 3ZHDA 1VA9A 3LYRA 4H26B 3P0VL 4HJ0C 1NEZG 1BFTA 3LIZH 1AZNA 3VWJC 4FLVA 5DHVA 4GBXB 4B97A 1DJYA 1AI6A 3IKKA 3MRPA 1SQXH 1R34A 2JRIA 1EJ6A 5EOQH 3ARDB 3OE7G 3SD5A 5D6CA 4OCRH 1JMXA 5HDBB 3CFJA 3LKNB 1KLUA 4IBTA 3DROA 3WFCL 1MCHA 2OTPA 2Z8RA 3PGCB 4KKLC 1Q86W 3LQMA 4QIRA 4X5LA 5DXWA 5IQ7H 1E9QA 4ZYKA 3NIFE 1TUPA 2FR4B 2YAEA 2V3EA 3BWUF 3H9HA 1BD2E 5GSRA 1QFUH 3NJLA 2GJZA 3FPYA 2ZIOA 4RAIA 4EJ1C 4RESB 4DFHA 1KPUA 4WTZA 2JJUA 5MHSD 3WHXA 1GGCH 2WBXA 3LNEA 2WN3A 4X7SL 2P46B 4YHOL 2FK9A 5GJTH 3R7QA 4LEXH 1NINA 4DGVH 3E83A 4HT1H 3RZCA 2F68X 4GAFB 3E8FA 1WFUA 4ZOAA 1ZS8B 3DJRA 4KVPA 3H53A 1VFBB 1NDMB 4JRWA 4TUYB 4MTFA 3C3TA 2GAZA 3BPOC 4LCWA 4I2XA 4NFCA 1N18A 3GI9H 1ZL8B 1B88A 3KYNA 4I9XA 3LQAL 1GL4B 5C0JB 3JUYA 3VFVA 2Y36H 4HK3N 3V4VH 3MU3A 1J88A 1YJDH 2ZWNA 4N3TA 4P5TA 1JGLH 1G0DA 4LCCC 5BVPH 2BHUA 2J20A 2DLFL 1PS3A 4F92B 4ETYA 3QQDB 1G7IB 4YWGH 1KU9A 1G7HB 3QWNA 3AG2B 3BSZH 3CVHA 4WK2B 1NCDL 3BEVB 2EP6A 2ITEA 5DVPA 1XV8A 1YEDB 2NNUA 2ZUSA 5D5MA 5EDXA 1INDH 2G0LA 4U1MB 4JTAB 2B0SH 4FXTA 4CJ0A 1SFDA 5E1AC 1I9JH 4LVOB 3MREA 1JF1A 4ONOA 2F19L 3BRGC 3FB5C 3NFNA 2HKAA 1FYTB 1BFSA 2CHDA 3QXDA 1IQWL 4QI3A 2J8UE 5IK3A 5KVGH 4EZLA 4KV5E 4XR8C 4WU5A 5EZJB 1JNNL 1RZGA 1RZQA 5KBDA 4CC6A 3K6FA 3TF4A 5H9CA 1JUFB 4C54A 3GMNA 2NXZB 3L71H 4HBQA 4X5WA 1R6NA 5C0AD 2R4RH 1QZ1A 4LF8O 4HJJH 4M5YL 4OLZH 1RPUA 4YLCA 2RAMA 1OE2A 3VQ2C 2PO6B 3PWPB 4MFHA 1WC7A 3EG9A 5F8RC 3WNOA 4X6FB 3UMTA 3WTYA 4F7MB 3V6OC 3RJDA 4HUKB 4NRZB 3RJOA 4YXLH 3APCA 3OB0K 3CFDB 1AFVH 4P04A 3UJJH 2XT9A 1MLBA 1JXGA 1EUTA 3N0PB 3SPVA 4ZTOL 1TSHA 2BSTB 3DX8A 2YEZA 3D3IA 4JV5O 5JCOC 2AVFA 2YUVA 4LF4O 3B8SA 4PPTA 2V2XA 2YIDA 1YYLL 5I76B 3LSUA 3U9PH 4YHHO 3LPWA 2IDTA 3R1GL 2BOCB 3VXUB 2K9PA 3DC6A 2HZHA 3GS0A 3IXTB 4Q0XL 3C6EA 5BOPA 1IEHA 3JVGC 3H1HH 2F7QA 2NR5A 1T66D 5J56B 5E08H 3L70H 1T21A 2UXNA 1M9WA 2NQDA 4G6KH 1KN2L 3SKNA 3F7YC 4DR3O 3VH8A 2DWEA 3VRJB 4KJPD 3QWOB 5AG9A 3ZRXA 4MJ4A 1G5GA 4X5XB 1RK1A 2W9LA 1ZHNB 2FBRA 3VI4E 2BPBA 4GW1B 4XCCL 4AH2A 3A22A 4ELKB 5C97A 2ESVE 4LLYB 5ISZE 3EDKA 3LRLA 1XEDA 3SKOB 4DR1B 5I1EH 3T65B 3WG7C 1X4ZA 4L87A 2WVUA 4KO5A 2ADYA 3N85H 3OXRB 4NPYB 2GK0B 5JPNA 1OCRB 1QSEE 4KY1H 4P5KA 2ZXQA 4X6EA 1DBMH 4G80B 3P9MB 4DAGL 4XC1L 4M93C 4PJ8D 5PAZA 1XF2A 2PTTA 1R3IL 4QHKI 4JFED 4OZIB 3NJVA 2E5EA 3FB7B 4X88A 2EECA 3EYQC 2X70B 2ZKXA 1RSFA 2ATKB 4ATTA 1GGTA 1YNTB 4J3OG 4PGZA 3QQ3B 4R0LA 2DQ0A 3DC0A 1TLKA 3BRFA 4RGMC 1I1FA 1SBSH 3GO1L 3L9EA 2OSXA 1XF4A 3ETTA 1CXEA 3QIUD 4WWOA 2OQJB 4CW1A 4PW3A 2BSDA 3RYCA 3HBGA 5E8EA 2VE6B 3UQ8A 4M1CC 43CAA 2W07A 5I6NA 3B5GA 2COQA 4PJ9D 4ZW3A 1JPGA 5I1IL 1INEL 3KPPA 4BZ2L 4G6JL 1U3NA 2QQKH 2AJ3A 3BFOA 2Z31B 4BE5A 1CFTA 3B3BA 3WEXB 3F7KA 3CP1A 4PB0L 3BP5A 1RI8A 1ZDQA 2IFFL 3QDJA 3WXWH 3SDAC 3ZX6A 1N0JA 3TXSA 5EBWB 3UDWC 5HHMB 2UZIL 3FCSB 2MMXA 2YSSA 3EGSA 4R5VA 2WC7A 4U0QB 4PJAB 4R4BB 1Q9WB 4R4NC 2E4TA 5JUEL 4UV7L 1NKDA 4NUJA 3FSZA 4KVCH 1A4CA 4DN4L 3SOTA 4DK6A 1MCLA 5AW8B 2D73A 1OO2A 2NZ9D 3L54A 1QG3A 4QRPB 5C2BH 1BOYA 1HWYA 3CBJB 4FFYL 1BQHA 2C26A 3QEQE 3VMPA 1QO3B 3KR3H 1QBLH 3QNYB 1EAOA 5DD6A 1HH6A 4WKZB 4E9QA 2GTAA 5CBFA 3WUWG 1LWJA 3CH8A 5AOJA 4ODUA 3KBEA 3IGLA 4HK3J 4QD2E 3QDGA 4DV3O 2CKBH 1EAQA 1P4LA 1R24A 2NY2C 4GAJL 1TZIA 4HSCX 4UT7L 5SX4I 5F3BA 5E2TH 1I7ZA 1K4DA 4GG6F 4TSCH 2RFXB 1Z5LA 4AGPA 3CUPA 3VWKB 1NEZA 1A6AB 4DO2A 1TGOA 1T7ZA 4JYCA 2QKIB 1UB5B 5BUGA 5EF0A 5F88A 4ZX5A 3ZE1B 1BLNA 2VQ4A 1ZGLB 1F4YH 1BZ8A 5I19L 3LVEA 4U1IB 4PA4A 3B2VL 3GI8H 1IE5A 3MV01 5IHHA 2LVEA 4GQZA 4GSUA 3A4FA 2D2OA 2W88A 3MRNA 4DP1X 2VC2L 3WKPA 3H6JA 1KCVH 1ZSPA 1PY9A 4FQLL 1UKSA 3FHAA 3KGSA 4CL7A 1MFDH 3BZEB 3QUMA 5DZNA 4MW3A 3QIUA 5IB2B 1CT8A 2AV1A 2WANA 1WV7T 1A3LH 2H0PA 3O3BA 2VMFA 3EUDA 4GQQA 4ZPTA 3KE0A 1Y74A 1YQVH 3QQ9C 2R59A 4NWUH 3VGFA 2KSDA 3QFJE 2ICWJ 2QMJA 1L9MA 1RULL 4F9PC 4M8UA 3OTFA 4PJBA 4PJ7B 5BXFA 5IFAH 3M7OA 3K06A 2AJZB 2ZAHA 4WW2B 2W38A 1NM4A 1RPOA 2LJ2A 3HZYA 1B2WL 3LNHA 4GSDH 5D7IB 1EJFA 1SYSB 1XCQA 4RWHA 1NIBA 3JASB 4LL1A 5H37G 3DO7A 2AK1H 2NW2B 1OP9A 3CRMA 3O6KL 1TYRA 1UM5H 3FUHA 4HS6B 4ZMNA 3BISA 4NXKA 1QRNE 1K5SA 2JB5H 4LC1A 1FJ1B 2QFPA 3KLQA 3UJTL 3ESNA 4NO0D 5FXCH 5ITZB 4R2GC 4BGDA 1CXIA 1J7VR 1SY6H 1RZKC 1CFSA 2OCCC 1TQWA 1KP3A 2JJTC 4K2UH 1L3NA 2IH9A 4LNRA 5TGBB 1KTLB 1EXUB 3AM8A 4QPEA 4B5EA 3PGDA 3UAEA 4JFFD 4POYA 2UUBO 1KB5H 3FB6A 4J3OD 4JPKH 3TV8A 2DYSC 3CCLV 3CC1A 3MLSL 1D5ZB 4IBZA 4NCC2 4U1NB 1CR9H 3CDGB 4LR3A 5SWZE 1PZAA 2TRHA 3EH2A 3KLLA 1YC8A 2Q69A 4ANWA 1GSKA 3ARWA 1NC4D 2DIJA 4M61B 4J7JA 1NWOA 3D12B 4DW1A 2B4CL 4EB6B 1NCTA 4RH4A 4BA8A 5IBUB 4MD4A 4EF3A 4CVUA 1QLEB 3ECBB 1SYVB 3ARGA 4ZAKA 1CE6B 1R73A 5EZLA 2R2BB 5EUOB 3RI5K 4J28A 2OJZH 3GBNH 3K6OA 3VGDA 2C34A 2CXKA 3AWFA 3SYOA 3RG1C 2W9EL 3C2AL 3TJHD 1NCAL 2HJLA 2Q20A 3C87A 3NABL 4RO2A 4XHQA 4HCIA 1EDYA 1CD0A 4IMKC 4CAGA 4LFAO 5E1HB 3D9AL 1RUAH 3CN2A 4N0RA 5DQJA 1BV8A 1IM9B 2DS4A 4PP1C 3ZZQA 5E8NA 4X4YB 4RVBA 3KBHE 2ZE0A 3L95A 4BYHA 2ZXCA 4G8IA 3VSVA 4KZDH 1AS6A 3IBOA 4MMXA 4TKWA 5DMGD 2K1EA 5T1LD 3QCVL 5KN5A 5KVMC 1RZ8A 4RISH 5I24A 3ILDA 4IJTA 4GKNA 3NACH 2A38A 2FL4A 4TOYH 1X44A 3CCHB 3GDCA 4MZRA 5C0RH 4D2NA 4HWEL 4ONFH 1H2SB 1T6WA 3VXSD 5F97E 4E9LA 5C8JB 1FVEB 1PZSA 2RQ8A 2LLNA 2DWSA 2X1XR 2QSCH 1WS8A 4KXZH 2F54E 3ZSSA 4DKAA 2CGNA 5KX5B 1IM3B 1OZUA 4TNWK 1QNIA 1GAFH 1J5EO 4TVPD 5FFOA 2ZOTA 2MCPH 4I5BA 3MLYL 1WP6A 2IWEA 3HI1B 1RIVL 2ED6A 4NS0A 4NO0A 3U9UA 1UCBH 2HLFD 1NSNH 2Q7YA 4KKAD 4X6DB 3VI3A 1AXTH 2AQ3A 4XVJH 1JHKH 3SJAC 4Q9CA 4UM8B 4HNAA 5EA0H 3OJMB 4JFFA 4M48H 1UOLA 1O9HA 3W0WD 4FTVB 2CBPA 2ZF9A 4TNEA 1MHPH 2IOIA 5HHXL 3L4TA 4G8FB 3HE6A 3SEPA 2G4EA 1NC4A 4K3GA 4X2UA 4IHBA 4N26A 5D7JB 5B39G 1UA6H 2DQ6A 5I0WA 2A79B 1ZLDA 5IP4A 1F58L 2WXPA 3RL1B 4HXAH 1MH5B 2Z93A 4ZSOB 4E5XB 1AXSB 1KLFA 3QHFL 5HI4C 2V17H 4KROC 3WO3B 2DQUH 3STLB 4CUCA 3EDJA 1FGVH 5EYPB 1YMMD 3EOBB 5DRNA 5AEAA 4BKSC 1CD9B 3U1SL 4S0HA 2B3IA 1AQDA 3VXOA 1NDGA 1CURA 1D6VH 5D2NB 2ZSWB 4ZUUA 5B38A 2Q6WA 2J2ZA 1KCSL 4QRTB 4PY7B 2MCAA 3QJQB 3VXTB 1V54B 1Q1PA 3N6YA 3ROLB 4WKXA 5F7UA 4QNHB 1JFHA 4PS8A 3RNKB 4B9YA 4D0BA 3WXVL 4CNIB 3GQFA 3FQUB 3MCYA 3A4EA 4LZKA 5EU3B 5HI3C 5T1LA 3SQRA 1KB3A 2R1WB 1GKOA 2XC8A 5AYUH 3QJTB 1CGYA 4NGHH 5B7MA 4IS6B 2JELH 3K74B 2DQDH 3DO3A 5T8IA 2MTPA 3M1BB 5JNYA 2VOTA 2F5AL 1Q9OB 2J3SA 3VXSA 4LHQB 4JAAA 4LESA 4KXAA 5JHBA 2QKAA 3P2BA 6PAZA 3DIFA 3DK2A 1VMGA 4NTXA 1CJYA 2A9DA 5JW4N 3D2UB 3IJ8A 1LE9A 1RK7A 1FH5L 2BE3A 1XR9A 4E68A 2N7BA 1C12B 5EEVA 4IGBC 4ODVH 4RMTA 4JY5H 4KJYB 2C3XA 2FNWA 4B3SB 3MRHB 4FNLH 4HKJB 2Z0AA 3Q4HA 2FTKA 2A3TA 3RYMA 5AG8A 3W39B 4AIZB 1QTPA 3B9AA 4HH9A 3WV0A 4RWYH 4OZIF 3FNKA 3FQNA 5HGGS 3LN5B 4HA1A 4K23H 4LCUB 4TLUA 2WQWA 4LPCA 15C8H 1Q90A 1ILUA 1AO7B 1I7RB 1YNTF 1GIGH 4TV3A 1NC2A 2NY4D 4PGCB 5DJDB 4KKLD 3W0WA 1VERA 5LQBH 1RD6A 4FA6A 3H2WA 1T5EA 1FGNL 4CC5A 3B34A 3FTWA 1FBIL 4UCRA 1JPFA 5DUMH 4BQ8A 1N5YH 2R56H 1CC3A 1SMOA 3BAJA 1INQB 1GYCA 2AMGA 3CHPA 1HHKA 2VJXA 4O2AA 5F9WC 5AZ2L 3RTQA 3X2QB 1DEEB 2Q73A 3HNVH 2AJVH 1CU4L 4LH6A 1D6EA 2JSFA 4WFEE 1R5WB 3MUZ1 4MDJB 2Z5UA 3ZW3A 1E4XI 5E95B 2WQAA 3D18A 4KKPA 3G5YA 2R4SL 3LZPA 1YMMA 3P02A 4JBSA 2IF7A 2HJKA 4LF3B 1KPVA 1QA9A 2J88H 4FQ2H 1Z32X 1SRYA 3QZNA 3IC7A 2VIRA 4K8RC 2AAVA 2NNFA 4L3CB 4DCQB 2AV7B 1PFCA 1D7BA 2HG5C 1J05A 4WQOA 3RIAK 5F1KC 1Q9LA 5AVTB 3C5ZD 1FNGB 4X20B 4PJAF 1KFAH 3WI9A 4AITA 4UUJB 1LWRA 4JO4L 5C08B 3C6SB 4B08A 1AR5A 3FQRB 3PNRB 2PABA 2DKSA 1QFHA 3W5MA 2WLLA 4JKWA 4P9ML 1FL3B 2ICWI 4XE0A 2VLLB 4QRRD 2YDEA 1P84K 3T8XA 2KQNA 2BMKA 3U2JA 4RGND 3QAZB 4PJFE 3BD4A 5AW2B 5KSBA 2J72A 4ODTL 2I9LB 3GLEA 3P77A 2NCEA 4RFNB 3B77A 4PHZA 1I8IA 1HI6B 4KZ0A 4KMQA 3GMOA 3PE9A 4JI7B 2WN2A 3H1LH 4KVNH 4X65O 2Y7NA 1PAZA 2AW2A 4N90E 4WO4C 2FUQA 1J1OH 1U2CA 5ID0B 3C8KA 1HOCA 4A6YB 1TTUA 3EO1A 4X80H 4N22A 5AFAA 4BH8A 1DL7H 4KQ3H 2UYLB 2A1WL 1UD4A 4M7LH 5D7EA 1HHIB 1GGYA 3T0EB 1SFHA 5GS0L 3CCQV 2FGWL 4JM4H 5HJBA 1YVLA 2VQFB 2UZXA 4YSRA 3KLAB 3CDCA 4OCSH 1RIUL 1E6JL 4WV1C 4BD4A 5JIDA 5KVFL 4F15C 4WI5A 1E50A 1KC5L 1TZAA 3IFXA 2C9QA 1AANA 2ZUVA 2JKJA 2UU9O 5INCB 2X6AA 3CMOH 4Y16A 3EZ8A 3B43A 4CVXB 1S9YB 4F91B 4KQ4L 3L4ZA 1MHHA 1NKRA 4JJHA 3DI3B 4W81A 3NVQA 4D9LH 4M7JL 1WICA 1J0HA 2X4NB 2HA1A 4PJ7F 2CO6A 2XIBA 1JXDA 4G7QB 2YGQA 4WW2F 4G82A 5GS0C 5E0QA 3V8OA 4Y19A 5CF3A 3MV7E 5LXGH 1ZA3A 1NBZB 2D7TH 3F7VB 3FO2B 5K69A 1Z66A 2X0VA 3K03A 4FNTA 1GMGA 3CPUA 4FP8H 3OPZH 5EBGA 5ICXB 1OCCC 3C5ZA 2E8YA 4YJ2B 4N2IA 4QXUL 3DJZA 2GJJA 5DMKB 5FCUL 2FSDA 2XRAL 5DUBB 2Q8AL 5C6TL 1YEGH 5HYJB 3MACL 5CZXD 4EN3A 5I6LA 1MVUA 3K81A 4XMKL 4NQXA 4NP9A 4QRRA 3OFNG 5JQGB 1HH9B 5F2VO 4JDTL 4Q14A 4AW4A 4NZ8A 3GSNH 4LVHB 4UCUA 1Y76A 2O6FA 5SX4H 4DEPB 3KLHC 5GGVY 4FLWA 2WOYA 4JZJB 4XN8A 4PP2B 1TQBB 3U6XA 3VFOA 4OJCA 4M1CD 2I26N 4MSWA 1TUBB 2XXCB 4NQVB 5CGYC 3ZQ9A 1J8RA 5FYJH 2BRRL 2Y2WA 4F7PA 5HJ3B 1L3WA 3L2LA 1TF4A 2CUIA 5LGNA 1XX9C 5DLMH 1CDJA 4MZ3A 4JO3L 4PWGA 3K2UL 5GS1C 4BQ9A 1BXVA 4NAQA 1VQNV 3PL6B 3V6OA 1KCWA 3ZUCA 2HJFB 3SDAD 2NNCA 1R0AH 2ICWB 3CNKA 3FONA 1PZ2A 3L9RB 1AKJB 4YUEH 1BD2B 4F7TA 5LG6A 4P48A 2CBQA 2YAFA 1J5DA 4D9QD 4HUNB 4R4ND 4Y4FC 2HFEA 1K7DA 1AGCB 5DZ9A 3NCBB 4AL8H 1IBFA 4XAWL 3QARA 4OCWL 3K72B 3JD3A 3HMXL 3FAWA 4KZEL 1CFMA 4LCWE 4I2XE 2GI7A 4I0PB 2CK0H 3I2CH 4TN9A 3QUZB 3QO7A 3RIKA 3U7WH 2A9BA 1K3EA 5C0CE 1KTCA 3TPKA 3TFBA 2K4AA 4FI6A 4FJYA 4XCFL 3KG2A 3DI2B 4WVRA 2YXLA 5FK9B 5IJDC 5EO0B 4HGMA 4XN5A 5DO2C 5E5MA 4I3GA 1XUQA 1TXKA 5HDQL 3MRKB 3A0BZ 2OP4L 5D5ME 1OK8A 4PLOB 5JYLA 4IRZA 2VXQL 3FRPB 5I17B 1WAAA 3KCWA 1J95A 2FATL 4JRYD 1U92B 3TESA 1U2YA 4RAUB 3KLDA 4X6DF 5CILH 5D7KD 2VDRL 3VD2A 1TU2A 2YD0A 3P3RA 1N59B 1QVOB 3ZHKA 3T0VA 2RTTA 4W9GC 4PRBB 4FLSA 4M6AA 3VG9C 5I1AB 1G6RB 5TE4H 4IIZA 2J8UB 5C0DB 1I08A 1MJUL 3QDMA 4BK8A 5FV2A 1U4FA 1CIUA 2J57A 2V37A 4WNSA 4D8PA 3DX7B 4C56D 3NXSA 5K39A 2QZ5A 4FLHA 4LBEA 1KYFA 3IPEA 4W9EC 3P0YL 5LP6B 3TVMA 5LHIA 1D5XA 1JF5A 5I0DA 4F2MB 1S7QA 4BXSV 1S5LZ 4DUZB 4PYGA 4DQAA 1MZYA 5C0EB 3QORB 4N86A 1OSZA 3AAZB 2Q8BL 2VDPL 3EJRA 2X4RA 4LSQH 5IT9N 4XMPH 2X4QB 3V0EA 1PTZA 4OD3L 4DV6B 3SDAA 2HT3C 4N8PA 1YSOA 3RL2B 2BTOA 2OMVA 5JYMA 3QHZL 1L9QA 3ARYA 4KH2A 4AHCA 4OCYH 3BGMA 4YR6B 3RVZA 5IGXL 5MHSE 1KN4H 1WG3A 2XKSA 4R2GD 5T5FH 4K9EH 2R2HA 3CHRA 1I1AC 3OZKA 4Z0BH 1A1MB 4CVZB 2NUTA 1GN2A 1N9PA 5C7XL 2CH8A 4BZ2A 4MA1C 2M1KA 4LCVA 1GR7A 4ZS7H 5GQBA 4HFWA 4LCYB 2DTSA 1KEML 4O4IB 5FYLD 2ITDA 2K70A 4JV5B 3MHHC 3GS4A 3RVTC 4LF4B 2ATPA 4GO6B 3ZKMC 4GKJB 1M7IA 5FDWB 4AI7A 3QF7A 5DR5H 5IOPA 4YHHB 1PZ5B 4JYAO 2XJKA 1B6DA 2E9GA 1F4WL 3CU1A 1JNLL 4BHUA 4ZO6A 1THCA 2K1MA 1QSEB 2F1AA 2WTRA 4DR3B 4JHAL 1ORSB 1EZVH 3FQTA 2CHXA 3OKMB 2CGRL 5AOLA 2XV0A 2GEEA 4RQFA 3BZ4A 4PGDB 4Z76B 3VGHA 2Y3NA 1J9TA 2D7QA 5ALBH 3SCMB 4UV4L 3BI9X 3PDOB 3JV6B 1OHHG 1QFPA 3QI9B 1A14L 5DU7A 2CNZA 2GG1A 1PMYA 4FFYA 1VACA 1JGDA 1R3KC 1GW0A 5C0AE 3TO4C 1R5VB 2DM3A 4J7RA 1LDPH 4NNPL 5CB4B 4C56A 3CTTA 2JS5A 2YRBA 1GS8A 1ORQB 1KKCA 1QW8A 3BAXA 1FP5A 1KBGH 1ZTXL 4HZ3A 1JYNA 1HCZA 2ZYSA 3MO1B 3SJCC 2PYLA 1JN6A 1L1FA 1Z3GL 3IS1X 2AJUH 5HHVL 2VZUA 2Y5EA 4Q56A 4CH4A 3CWBH 3L17A 2ADJB 4A6YH 4LLUA 5DZOA 4HDIB 1P2CB 1WCBB 4CSPA 3KEDA 1LO2H 4QRAA 5JJJB 1GW6A 1FRGH 3WIFA 4N2HA 2DYRB 5EN2A 3GSRA 1F1DA 1BREA 1NUGA 4G7YH 4DP8X 3OWEA 2PPDA 4YMPA 4GW5A 1BZ7A 4PJDF 1KWGA 3SDXA 4HHAB 4RWUA 3AB0C 2EVJA 3EJQA 3N1PC 4MQTB 1W16A 2V9TA 5FKPB 3WELA 3GGWB 5K5YA 4I55A 2M26A 5LA6B 2CGZA 2AEPH 4P23B 3FQXA 1L5GB 2VS0A 2XHNA 3LCYA 1NIDA 4W9KC 4PR5B 3L3KA 4WWNA 5D5PA 3V0WH 1GM9A 2EDQA 2I07A 3QPXH 2NSMA 3K71B 1N26A 4XE5B 3PWJA 4GAGH 3RDTA 3ZZSA 1N33O 4DP5X 3DURA 2XG5B 2O4EA 2XWDA 2YO3A 3WNJA 2WBJA 2OMXB 4YPGB 2Y0PA 1MG1A 4IYHA 3T3ME 5J1TC 2FKXA 1Q6HA 2R29H 4JFEE 3QNZB 3T09A 4ASUG 4M5ZH 4P5MA 1ZSHA 2WQXA 5HI4D 4MT8A 4JFQA 5EWIH 5I0ZA 5DUPH 3IFLL 1UM6L 2V7HA 4LBAA 4QEGA 2WXKA 1NANI 5KYYB 1LO3H 4L8DA 4DV3B 3BEHA 5LBQA 3SDCC 5F1NA 3DVFA 2H6UA 4IBQA 5C0BB 3UPCA 2QQNL 1N64H 3FTUA 3GMPB 4YSSA 4Z7WA 3BWZA 1MFEH 4ZFZB 1T0NB 1MCBA 4HX1A 4UDTA 4KNTA 1XGRA 1U21A 4XPHL 4YC2C 1M7XA 3OXSB 3AK1A 2BW4A 1UCTA 2VR5A 4KTDL 3DK0A 5HI3D 3QFJB 3VGAC 2P5PA 4XN7A 1BCIA 2E0PA 1BEYL 4PRNB 2GY5A 4AE1A 1NBVL 3GSUB 3K6DA 3CVBA 1A1OB 3GPSA 2QVMA 5GGUB 5KTEH 1I9EA 4R96B 1A6VL 4X0NA 4MRBA 1ZE3C 2J1YA 4M4RB 3J2PA 4UOW0 5JW4R 1MSDA 1NGYB 3QQNA 1FXHA 4OUOA 1JMKC 1LK3L 1SXBA 1CF8L 3ARVA 5HYSG 4MNHA 1ZGLP 2RB8A 2FZ3A 4AY0A 3EDEA 3GJFB 3MNWA 2JK5B 4N8VG 4LEEA 4UV8A 4LFCO 5GISH 4CC4A 2J1XA 3N04A 1F6AB 3QBTB 4IGBD 1CLYH 1UOWA 2JTYA 3DUHA 3LJ3A 4RGOL 3WL9B 1JPXA 1RKRA 3V0VB 4PG2A 5KAQG 3D36A 1KENL 3N42B 3EOYG 5LOVA 3IU3B 1S7UB 3UABA 3G6JA 1GYWA 1P84J 3QUGA 4MNGE 4XP9H 4B9IA 1DFBL 4WJ5A 3KWTA 1XILA 5H4YA 2R1XB 4KJQC 4QYOA 4UOW1 1VQLV 3K79A 1C16B 1SUHA 1CDYA 3F6JA 1N8ZA 2VDNB 4WO0A 4CBZA 3QYNA 3B2PA 3QG7H 4Y9CA 4KJWC 4ZMLA 2LFSA 1US6A 1IRAY 4G71B 3MLUH 2CE4A 2C3VA 5K9OA 2ED7A 4GMTL 5ITBH 5J8OA 3EYVB 1P1VA 3BW9B 3IBEA 1FFNB 1TTAA 1WBXA 5CA3A 1L0PA 2H1LM 2M8XA 3KPRA 5FKAA 4CMMA 1CO1A 4K3JH 2E3VA 4P2QB 5I1KL 3W1ZA 5E2UL 4PA9A 3EGXB 4LWSA 1JD9A 2H26B 2N1TE 2UUBB 2BP8B 5JOFB 1A66A 1HQ4A 4K7FA 2XSKA 5TFSL 2AAAA 2RGSA 1MCOH 3O81A 1G0XA 2H6PB 4PLKC 2EDNA 1KJ3H 2EIJC 3BIBX 3DBXA 2D7MA 2YZ8A 3AU1A 3K08A 5FUCC 2P8MB 4U1HB 3UTTB 4UINL 4A55A 3UROR 3BDYH 4K8RD 2F4VO 2YS4A 5L8LB 4LKCA 1E42A 3HZKB 2WQ8A 4MJIE 4O2CB 3S35L 3V0IA 4HKXA 4EIZC 1UXSB 3MGOA 2KPNA 3BKYL 3SBQA 1G6RH 1H8SA 3EGDB 4BFIA 5I75C 4HWNA 4R6ZA 2XWTA 1OP3H 1XDCA 2EAEA 1IL1A 2Z0BA 4I0CC 1DVFB 3U6RB 4PRDA 4HJGB 4KTEH 4C4KO 1ZLSH 4E2LA 2ZXBA 4RRPG 4YE4L 3SGKC 3C2SA 4J3WA 5FGBA 4EZKA 5J9PC 2B77A 1MFAL 4MHHI 2OR8A 2VN5A 5G4OA 2WXMA 1JHLL 4PTTA 4ES8A 3ETGA 3ARPA 3AREC 4MD5A 2EIMB 1Q72H 3BXNA 4K35A 2EEAA 1QUNB 3RWFA 2AABL 4Z7QB 3TFKD 4XNMB 1FVCB 4AVIA 5CEYB 1ZAUA 1KNOA 2QADB 3R18A 4NC0B 5FS5A 4IGBA 1SLXA 4L1LA 3OR6C 1GGIL 4WO4D 1BL8A 3H42L 5E1IA 3IGFA 4S1QH 4JFFE 1SPDA 2ZKHL 4IQHA 5I8OL 3SPCA 3TF7C 5AVUB 5C9JA 2WP3O 2XY1A 3BGAA 4MS8C 1XIWC 2Q86A 4OKVB 2JI1A 4X7TA 4K94L 1J5EB 5CAYB 2PPEA 2P4AB 4OT1H 5DJCA 3IXAA 2J8UF 2OL3L 4JHZA 4KV5F 5IJCC 2Y07L 5ITFA 3NN8B 4PRHA 4JPIB 5KVEE 4IHJA 1KTBA 1MHCA 5KJ7E 4G7RB 1JNHB 4EMZA 3O9WC 5EU6A 5AZEH 2OK0L 1FG9C 3MUHL 4LVNB 2VLRA 1HL4A 2IBZH 2RALA 3TJPA 4WJKB 3ZK0A 3H4FA 4L4VD 4FXKA 4X0KB 4LLWA 1JGEA 1NGXA 2GSGA 3ZUNC 2OTWA 3RVWC 3O4LB 1X5MA 4QTHB 4HW6A 1L0LH 2BOBC 1Q0XL 2MFNA 5EC2A 5GS0D 3P3PA 4DVBA 1N0LB 5JOEA 4MAYB 3K5OA 3H7LA 4E9XA 3S8GB 3KXFD 1CDBA 1TO5A 3P2TA 3ZTNH 5CN1A 4S2SA 5E4AA 3F7PC 1E67A 1AZVA 1C7TA 1W72H 3G08B 4N0FB 3Q5OA 2BINA 3M46A 1KCLA 3IPBA 1U96A 3KPMB 5FWQA 3UG3A 4HYTB 3B2DC 5FCSH 2A0LC 3WJMA 4J41A 3BPNB 3VXSE 5IQ7L 4N6RA 3VQYA 4H0LB 1FQ9C 4GXUM 4NENB 3DV4B 5GHWH 5AVVB 5B7FA 3O6FC 4WTXA 3RVVD 4DV5O 3R65A 4UQ3B 3DVNB 4L3ED 3KLHD 1OJHA 4TVPE 2DH2A 4QAMB 4OFKA 4P46D 1YG9A 1GYVA 5GJTL 2EDWA 1E4HA 1HHHA 3PHQB 4O2BB 3KL0A 4L1HA 1U8NB 2GITA 3HRZA 1AS7A 1JZIA 5CGYD 3RFRA 1PSKH 5TDOA 3KD4A 3ZMVA 2CIIA 3D85B 3GI9L 3NZSA 1GO3F 3AMKA 5CLYA 2DD8L 5DO8A 3NJIA 2EBOA 4H25B 3W0WE 1YJDL 2AQRA 3OAZH 4UM9A 3QZPA 1D5NA 2CMRH 2D3NA 1M9SA 2JJWA 4J42A 4FXGB 2O1AA 1DVZA 3FU7B 4O02B 2XUWA 4OGQB 1JTTA 3HIZA 2FB5A 2YAMA 1VCBC 4Q9RL 5KYWA 5IJ0B 1GSMA 2LU7A 2MHAB 1V10A 3BVWA 3QA3A 4KI1A 5B3NA 1KIQA 2BVEA 2B0SL 2XG4B 4Y4FD 5DK0B 1A4AA 3ZSTA 3RDTC 5KSAB 2A6KB 4HIIA 5MEQB 2R69H 5K9KA 3P4NB 1YMME 1W0WB 2UXTA 5EZYB 5KVGL 3FCTA 2R0KL 4HLZH 5KA5A 2DF3A 6PCYA 1HL8A 1FNLA 1HCVA 1SOQA 2XTJB 3NZHL 2ZQMA 2IH1B 4DW2L 1YJDC 3HCVB 4JL1A 1RFDH 2OWOA 4XC3L 3AY4C 4HJJL 1MF2H 5HYSA 1S3JA 5J06A 4IKJA 3WHE0 2ZSVB 1DGSA 3KXFA 1ML0A 5T3ZL 3FW6A 4D3CL 5DO2D 3MRDA 2ZCKL 4N8VA 2C8NA 2ZXEB 3W9EB 3EF7A 3FO9A 1PQZB 1AIFA 5F7HA 3IDYB 1CD1B 3RRQA 2YIAA 1SJVA 1QRKA 3IDIB 4I3SH 3TIDA 1EEYB 4I18C 3UJJL 1MLCB 1N68A 3QJOA 3BP7B 1Y07A 4EBQH 1VRSA 2XWZA 1NBQA 5KSBE 3CX5F 1B0RB 4PJGA 1Z9SA 2ZOWA 3K9SA 4OJDH 3UYPA 4UDUB 1UD3A 3HZ3A 3V7AG 1NBYA 4PJFB 2CK2A 3ILPA 3KL5A 5DJAA 3VUAA 1SVZA 4L3EA 1I4FB 4FZ8L 4H8UA 4V2CB 3WFBH 4P46A 1UQSA 2YSTA 4OI9A 3A6BH 1X9LA 1TETH 3LNIA 3W2DH 1G7QA 1SDYA 1WAZA 1NQBA 2RHEA 3PIQA 1VQ9V 2D2CB 1JWUB 3EXAA 2CWRA 3EFDL 3GJFH 3CFCH 4W6WB 5DJ0A 2ITCB 2XWBB 5I1EL 3L72H 3EIFA 2CNYA 1V55B 2H3KA 4GH7B 1Z2GA 3M99B 4HAMA 2O5XL 4AUYA 3N85L 5KG9A 2ODIA 2OR9H 1UT9A 1DCLA 1BVKA 4Y4KA 4J1UB 2HT3D 1JFFB 3GWOA 1TQSA 4X50A 1FFRA 4JN1H 4AKPA 2WBKA 4X65B 2EIBA 1FIGH 4I9WD 3FUJA 1YMHB 1FFTB 4WUUA 2Y7LA 4Y4FA 1QYGH 1RPQA 1IZKA 2BVYA 3TWCL 4APQC 3U25A 3CZJA 1AC6A 4DR5O 1K9TA 3UT5B 1FZKB 3DIDA 3LEVL 4RRPA 5EU7E 3PXHA 1KEGL 4WBNA 2NZIA 4G2KA 1UFGA 3CPLA 4P9HH 3MV7B 3RVTD 1TCMA 3FB8A 5F7EL 2Y0SA 1AG0A 1YEHH 4BQBA 3WB1A 2UU9B 3MV8A 1BAGA 2EC9T 1M4UA 5IB5B 4AGOA 3ZN0A 3U2SA 3LZOA 4OAWB 3MQIA 2PCXA 1U93A 3INUH 3O0RH 1JYWA 4LP8A 2WB7A 3FU9A 4W4NA 2R0WL 1G87A 2YC0A 4LCIL 4LIQH 4G9FA 3WXWL 5IG7A 4RFEB 3B7TA 2QJ1A 4QRRE 3VQ1C 3G80A 4UYQA 1P5UC 3QVNA 3HMXA 3QFDA 4L9LC 1NEUA 4LQ1A 2N4IA 4RGNE 3WGVB 5J12B 2QR0A 4X98B 1U3HC 4HUCA 1BAFH 4QTIH 3OX8B 1MIMH 4DKFH 4XNUH 3CFKA 3WJJC 1XBDA 4FJ6A 4W70A 2UXVA 2X4TA 1XHXA 1CQKA 2GIMA 3S35X 3T6ZA 3TO4D 4F20A 1U3YA 5DHVB 5IB1A 2MOQA 3OAYK 1BVLA 3MRPB 1K5QA 1NANH 2LLGA 5JHLH 4P0DA 3MUJA 2B2XH 4CC0A 2VXQA 5D6CB 3L48A 3UMNA 3CFJB 4KNUA 3V6OE 1KLUB 3DROB 1M1KW 3GFUA 4G43A 1TO4A 2BDNL 4LF5O 5E2TL 1E9QB 1YN6A 4FHBD 4XNZB 4ZYKB 3D2TA 4TSCL 1URLA 4J27A 3H9HB 4G83A 3ZO0A 1C5BH 2FJUB 5GSRB 2WHVA 1RUMH 3UYRL 2GJZB 4QJ5B 1OAYH 5I5RA 2Y0IA 4FC3E 1FYHB 1KPUB 1JV2A 2ICEC 3IMUA 3WHXB 3K0WA 3GI8L 1OPGL 3TBTA 3RZCB 5KLVH 4Y1AD 1U91B 4YFLF 1VB9A 2ZM6O 1VQ8V 1CD8A 1WF5A 2GAZB 2L04A 1AP2A 2X41A 4F7CA 3KYNB 4IBYA 1LHZA 2YGNA 4X8AA 1XZWA 1MSPA 2KDYA 3KPTA 1B2YA 4KKBC 5LGTA 4IEFA 3CSBA 3VFVB 5C0NC 1HDMB 2O6PA 4OM0H 2Y3AA 4P5TB 4Q6IC 3RQ3A 3N5AA 3PWUA 1FN4A 3DMMC 3BUYA 2EXTA 3OSVA 2VYRE 4PS3A 3CVHB 5B1NA 3QRGH 3RW0A 1E4KC 1MXDA 5E23A 5TF0A 5D5MB 3QB7C 5IFAL 5ILTH 4QNPE 5ABZA 4YX2H 3CRAA 1LMKA 2XA8L 1WFJA 1BYNA 3ZMUA 1GZQA 3ARBA 4M9PA 4C59B 1MNUL 1E8ZA 2H7WA 1JF1B 1G4MA 3MREB 5E2WH 3FAVA 4U7OA 3QJUB 1U8PA 1Y0LA 3NFNB 3QXVA 3QXDB 4XTRC 2AK1L 2BVPA 2OX5A 4L8JA 5IK3B 5LN4A 3T9WA 1UM5L 4WU5B 3SDCD 4G7VH 1RZGB 4AI8A 1AAJA 3DXAA 1MVYA 3NTCH 5HVGB 5IJKA 3GMNB 4P49A 4X5WB 2BJML 3EJSA 2IIJA 5HTSA 4K2UL 4A7GF 3V0GA 3H1ZA 5DEGA 1DJHA 3OLDA 2RH0A 1KB5L 3QUXC 3MAQA 1DF4A 2XX0A 2XZQH 5KJ4A 1WC7B 3A5VA 3EG9B 3K80A 1LO0H 4P2CG 1RM1B 3J80N 1KXQA 4XPTL 1I5XA 1MQKL 1OE3A 1TG8A 4MGXA 3IT8D 4GBXC 1PX8A 2PR9A 3SODB 5K9QI 1I8KA 1MLBB 1VFOA 1B9KA 3SPVB 3Q2CA 3DX8B 1L0XA 2YEZB 4XGZA 5DA0B 2V2XB 5B8CA 4F8PA 3WKQA 3SPGA 3HC0A 4D9QE 3IDGA 2V2WA 3GBNL 3MRIA 1Q0EA 1QZNA 5BMFL 4YY3O 1WBYA 2V8LA 1OY3B 4HIPA 1T21B 1MFVA 3SKNB 3VH8B 1FYJA 1BLIA 2DWEB 4TPRH 5FC9A 1KELH 2UX7A 3QEHA 3QJRB 3WNKA 1RK1B 1RUAL 3S0PA 4J3BA 2RNBA 4KJQD 1UXWA 4AH2B 2FQDA 3GIZL 5GGQH 5E2VH 4KJWD 4KZDL 3ZHRA 4GYBA 4EKWA 1OTSC 4HZ1A 3ZIMA 1O6SA 3QIBC 4TSFG 1G4RA 5CR1A 5JPNB 4P5KB 2O6EA 5DQDH 5C0RL 4JRYE 4E4EA 4ONFL 4J7KA 4NQED 1XF2B 2PTTB 1J0ZA 1F6LL 4H5SA 2AHZA 1AACA 1D5MA 5L9DL 4R7CA 5D7KE 3KYKH 4EAEA 3WKNA 4XP6H 4TRPH 3AG2C 1F11A 4NKOA 3LKRA 2VXUH 4R0LB 4K5PA 3D4CA 2J56A 4PLKD 2CR6A 1I1FB 3AGWA 1MKFA 3EYOA 2UUAO 1XF4B 2E9IA 2EH7H 2VDLB 2P43B 4CW1B 4LVOC 4MX7A 1UACL 1SETA 3RYCB 3P9WB 4MD0A 5E8EB 43CAB 4NWTH 3ZYZA 2W07B 4NX0A 4C56E 2ZZUT 4NZDA 1J5HA 4KH9A 4L1SA 1O7DE 1JPGB 1RJCA 3DHJA 1AROP 3T1CA 3KPPB 1CB4A 4F93B 4AEHH 5EA0L 2AJ3B 2WXQA 4UANA 1CFTB 4M48L 1UWEH 5DYOA 4ZBJA 2MNWA 4XBPA 3BP5B 1MHPL 1TJHH 5L2KA 2QBWA 2PO6C 4F6RA 2IGLA 3QDJB 4PJ5A 2JKNA 1YYCA 5CN3A 2PTVA 5CJQH 1DZBA 3ZHNA 3K91A 2PYJA 2J5LB 1HR0O 2YSSB 3EGSB 5ALCH 3T4DA 4LFHG 3BSGA 2QVTA 3RLSA 4FYQA 4CKVX 3NESA 4OFVA 4EDWH 5IJBC 2DWYA 4NUJB 5CJ8A 4QXTA 1FGVL 1E9OA 4TL4A 2XAGA 1ZTEA 3O8XD 3UBHA 1AZCA 3QJZA 4TNWF 5F6IB 3O3DA 1BQHB 1QFWL 3SGJC 1D6VL 2BOCC 1O6VA 2P7TA 5DD6B 2YKKA 1VP7A 1HH6B 5IV2A 1QSZA 3CN4A 3X1GA 1TFPA 1RUQL 5FYLE 4ODUB 1XSKA 4X5QA 4KK5C 4PCYA 1WGVA 3QDGB 2CTQA 1P4LB 1R24B 3BH8B 2X1QA 4PJFF 4CRPA 1TZIB 3IN0A 5F3BB 3IJ7A 1I7ZB 1K4DB 4IRZL 2AQPA 1ZHBA 5F96H 1Z5LB 1IVTA 1TQCC 3CUPB 2EE3A 3H56A 1S7SA 3BH9A 1F3DJ 2JELL 2DQDL 1Y66A 3TK1A 3BO8A 5F88B 3O9WD 1BLNB 2FX7L 1IQDA 32C2A 3FT4A 4NQEA 2VLJD 2XFXA 4AIXA 2C2AA 2FJHA 3N43F 2N04A 2RJZA 1OCRC 1TVKA 4HPYH 4YQXH 4XPGH 2B1AH 3OLEA 2HFGH 2VXTH 1T7WA 3FTYA 3JZYA 3MRNB 4L0YA 4YDZA 4DUWA 3FUFA 5IY5B 2F8XC 3RVWD 1PEZA 3BA9A 3WMQA 4A7VA 1CBVL 3FB7C 1TZ8A 4Z7WE 1GKFA 4DUVA 3QUMB 2VXSH 5F7FA 3QIUB 1CT8B 5IM7A 2AV1B 4FNLL 2MTAA 2CJUL 1OD7A 3O3BB 4ZPTB 4QRSA 1Y74B 3MBXL 2NY6B 4HKZA 2KBGA 5HYEA 3NCXA 3NCYS 15C8L 4K0KB 3L4XA 4M29A 4PJBB 4X7EC 3TV3L 5BXFB 1GIGL 2A0LD 2HKFH 3AITA 5FYKU 3QPQC 3CFMA 5DHVH 4ATWA 2Z31C 4ICXA 1XCQB 3O6FD 1LLAA 4HH8A 4UQ9A 3MV9D 5FLUA 5HPMA 3SGKA 3DO7B 3D0VA 2RACA 3QWRD 4I85A 4OLVH 1X5FA 3HNVL 3B9VA 2Q68A 2AJVL 5EBWC 4KU1A 3UIZA 1HXKA 2FDBP 8FABA 3K5NA 1J9RA 3PP4L 3G6JE 4LNRB 1HHGA 3A6CH 3PGDB 3O8XA 2J71A 4FQ2L 4GUOA 5HGHA 3FB6B 1JD7A 4FYSA 4MXVE 4X9GA 5AOKA 1DBKL 4YIPA 5B1JC 4Y5YA 1YEWA 3IEAA 3LOWA 2V7NA 3FZUC 3FTSA 4K7PH 4UYPA 1J87A 4LFCB 4MMZA 4MD4B 4AYSA 1EA9C 4FFWC 1V27A 2EYSA 1MFMA 3ARGB 3DHMA 4WWKA 4E41D 4ZAKB 4ZW8A 5EZLB 3MX0A 3MAWA 4KMTL 4Z3FA 4KX7A 4AEFA 4WI0A 1ZV5A 3VWKC 1THAA 2YOCA 2HJLB 1M57B 1HFUA 4H8VA 4IYIA 4KO6A 5KYNA 3CVHH 2FTAA 3D05A 1T5XA 4AQAA 1OGAA 1PLBA 2PW1A 3BVNA 3H3BC 5DQJB 1Y4MA 1NGQL 1DANU 5IUSA 5E8NB 4LFHD 4KVNL 1NJ9A 2JNZA 3IJHA 3L95B 3H01A 4G8IB 1EPFA 2PF6A 3S6CA 4F8TA 1UTDA 1KXVA 4HCRH 4MMXB 3S4SA 5KN5B 5ACMA 1RZ8B 3HNSH 4HIQA 4GKNB 2OL3A 2I69A 1RAMA 2KKWA 1P53A 4M7LL 2X1PA 4WI8A 3RIAF 3VXMD 2AK4A 3ZMZA 3WNIA 2YN5A 2A0LA 4J8QA 4G42A 1HEHC 4OCSL 2XBZA 2WSKA 3WTTA 4NP4H 3O6FA 1IX9A 4WW2C 5F1OB 3WE6A 3U79A 2D31B 4ZIBA 3VSQA 4I5BB 1P84F 1MG3C 1WHOA 2X5PA 2NW3A 4ZMZA 1CTNA 4NO0B 3V6FA 3U9UB 1SZXA 3GLAA 1A5FH 2Q7YB 5D5MF 3T4YB 4ODXA 3NFPA 3VI3B 4MA8H 3BWAA 4LNVA 4JEGB 4HNAB 2BP3A 4JFFB 4K5OA 1C08A 1YEJH 2WZPD 2EVFA 4DR6O 5D1XA 4OI7A 2VDKB 5E8DL 3WFEH 2AXGB 3OPZL 1N34O 2V8MA 3J07A 4OGXH 4TUKL 1UT1A 2C3WA 2WNXA 3HE6B 4M7ZB 4Z3JA 2FMLA 2DBJA 4XN1A 1NC4B 1K6QH 2YQBA 2HSIA 3Q01A 3PQYB 3ARSA 2DW5A 1YEGL 3MA9L 1ZS2A 3OKDA 5J11B 2Q5BA 2NYZA 4HJIA 4JCMA 4MVMA 3KWWB 5KYUA 2Z93B 2QE7G 3IMWA 1KLFB 1YIJV 1L9OA 1OLLA 4FTDA 4BUHA 3H6AA 5JA9A 4ZS6C 4APQD 1IBMO 3GSNL 1R46A 1QLEC 1EGJL 2CG9X 5DRNB 3FO0H 2QSQA 1E2VA 3IWUA 3VXOB 1AQDB 1ZRUA 1NDGB 3WS6A 3EO0A 2ZDIA 3FU6A 4ZUUB 5E5UB 5B38B 2VDOB 2J2ZB 4YLBA 5J1AA 2Z9TA 2Q6WB 3ZKND 2CU9A 2LAGB 4QXGL 2NY5H 1RHHA 3JALA 3AY4A 3GIVA 4OZGA 3W9DA 4RMVA 3ILEA 4D0BB 5KYXA 3HS0A 1N6QH 2Y2YA 2OMNA 2VDLH 4NLAA 4C58B 2BM3A 1SHXA 4X89A 2Y7SA 4IK7A 3T2OA 1RURL 5C3IA 4M56A 2VDML 3KJ6H 3T4AA 1AD9A 5I74B 4AM0A 1MAKA 2Y9RT 1QFWM 2HLAA 5JNYB 5LLIC 5M7QA 4I18A 2YXYA 4OCMC 1KB9K 3BABA 2B1HH 3DIFB 3QO0A 1PGRB 4KAQH 2Y4UA 1U3HD 1FG2A 4FN0A 1LE9B 4WF9V 2ARJQ 2Q76A 1G43A 3P30L 4TLTA 3NA9H 4AL8L 2Q9LA 2EE2A 3FX7A 3TNMA 4FEMA 1W59A 3QUHA 3BLBA 3QEGH 2VR8A 2ZWKA 3Q4HB 4L8SC 2YD7A 2CK0L 4HH9B 1HSBA 2MK3A 3VFGH 3S34L 5D2LA 4PVMA 3FQNB 1MRFH 2D0FA 5CCKH 2WIMA 4DV5B 3AG3C 4KX9A 4NC1C 3QJVB 1NC2B 4KL1A 3W0WB 3PGFH 2W0XA 3T77A 5K59E 2GIXA 1CTOA 1E8WA 1JPFB 4GOSA 1IAIH 3AS3A 1KC8W 3TTSA 3UO8B 3RTQB 5BOJA 2KKQA 1HHKB 4AL8C 4O2AB 4WSKA 1F8TH 2FLRT 3CEIA 5CZVH 5J6SA 1CMOA 5TDPA 3C6LA 1JJOA 1OM3H 2VZOA 5D7JC 3SGDH 1D6EB 3ULAB 4I50A 3BX7C 4L4VE 5E6UB 2H3NA 3D18B 4RQEA 1MJ7L 2ZUUA 3G5YB 1E2WA 2VRQA 1YMMB 3BEWA 3DRQA 4QOKA 4UAOB 2HJKB 1KPVB 1QA9B 4Z3HA 1BIIA 4CH5A 2VIRB 2XX1A 3PP3K 3VXQA 3IGAA 3STLC 4KKBD 1J05B 3KXFE 4LEBA 4A7SA 2DICA 4X83A 1J5IA 1Q9LB 5M95B 3HVDA 4JO2H 1WDAA 4PTUB 4KUZH 4RDBA 5D2NC 5KVFE 1NLBL 4RX4D 2IAND 1J10A 4PELA 4ERSH 3NPZB 1D2OA 2I60H 4AYFA 1C5CH 1WZLA 1QR9A 1V54C 2X2JA 3QUMH 2AXWA 2W9DH 2WLLB 2PI5A 2OCFD 2APXA 4PJGE 4NNYA 3T8XB 3ZGIA 4LSTH 5KUMA 4BM7A 1VJSA 3RT3C 2BMKB 1U4EA 1UEYA 4XTRD 4UILH 5KSBB 4A2EA 1A1NA 4L3EE 1YHQV 2IADA 3GSXA 3P77B 1PL4A 1SQBH 1ACXA 2I32A 4OCYL 4PMFA 1U3HA 3DETD 4UBDD 1EAPA 3LRGA 3GMOB 4MRCA 1N19A 3GXUB 4Z0BL 5C3TA 4DK5A 1XXFC 3S8FB 1L0QA 3C8KB 3N27A 4TL5A 4HHWA 1OE1A 1HOCB 3QUXD 3EO1B 3VTTA 3T3MF 2V3FA 5I30H 3NT0A 4BH8B 3RFZA 2ZG3A 4FQJH 4FLYA 4HK0A 5EEZA 4P4RA 4GBXD 2BVUA 3KPNA 4FD0A 2UZXB 2YUZA 3SQOH 2NY4B 4M8VA 3B7UX 4LCUC 4LQFH 2P9RA 2FH6A 4B27A 3DBSA 2WO4A 3MKKA 3ATEA 2GUOB 2XV3A 3I9GH 5HP5A 4UCFA 1BM3L 2DQCH 1YEEH 1CVSC 1FL6A 2XOTA 2ZX9A 4Y16B 4Z5RA 3E8BA 1MJJA 3O2WH 3OTTA 4K9EC 5ALBL 1MHHB 3QJFA 4UQEA 2A9HA 5F2FA 2YXVA 5G4NA 3UBXG 2CO6B 1SJHA 4ZO9A 4JE4B 1XL6A 3X2QC 2V2TA 4LAJH 4Y19B 4CN1A 4JM2A 1XH2A 1ZA3B 4HWUA 5EG6C 4BH7A 4ZFQA 1OXYA 1FI8C 1LDPL 3SZ6A 1OTSD 4HPOH 5DD3H 2ZYHA 5E9AA 3QIBD 3C5ZB 3VD7A 2Y6TE 3F58L 2ZNIA 1TZGH 2IANA 1KBGL 1D3CA 1CDCA 5EDSA 2W0LA 1LEGA 1ZWIC 2X05A 4HETA 4ZD3L 4AMWA 1EXHA 3DOIA 1KJ2L 4QXWA 5E79Z 1F42A 1KCKA 4EN3B 4ONGL 1MVUB 4FMVA 1I75A 3U7YH 1FA4A 4NQXB 4QRRB 5LHGA 3H7BA 3CQPA 1Y76B 1NFDA 4RGNB 4UQBA 2JE8A 2E4FA 2KH2B 4G7YL 1MW0A 4N2MA 4ODWA 4FGMA 3T0DA 5I6KA 1AGDA 3VFOB 1WP8A 4MSWB 5GZNC 1OP4A 2CLRA 3LH2L 5KEZA 4PGJA 5TPWH 1T7VA 4RFNC 1OAXH 5IESH 6TAAA 4F7PB 5F0JB 2W91A 3L6FA 1R6VA 1A02N 2RR3A 4JHVA 4Q4IA 1H2KA 3QIWA 4UTAL 2G5BA 2VLMD 3QPXL 5CJ5A 1ZXQA 4GAGL 4HJUA 2PO6D 5EUKA 4BHUI 3PWPD 4Q58C 3FONB 2XN1A 3NOIA 3T0EC 1K3ZA 2YAPA 1BFVL 1OTUC 3P3TA 2YI8A 2YSUB 3M17A 4F7TB 1FH2A 4KKCC 3ULVH 4I9WE 2W60B 4MVBC 2HFEB 5IQNA 4X9YA 1IGTA 1WZKA 1XGYH 5EWIL 1GYAA 2FR4A 2O61A 4F58L 1SY6A 1ZX3A 2CTPA 1FZMA 4NBZB 4YS4A 5LYJA 3N1FC 1EVUA 4W9LC 1LO3L 4XB8A 4DR7O 1LNQA 4DK1A 4PV8A 4YPJA 3UPAA 5ICZA 4ELMA 3AUWB 3VXUD 1I9RL 1KB5A 5IJ9A 2HUHA 2ROXA 3K6IA 4LF5B 4G1EA 4XXWC 3WTXA 3F62A 2Z7WA 3I02A 4DV0O 1KGJA 3DTDA 4B9PA 4F27A 2DMBA 3HNTL 4KK5D 4BQCA 3LX9A 5FFLA 5H6QA 1BF2A 4FG6C 5E5MB 2GTWA 2LU4A 3CVIL 3NZ8A 5FM4A 4DV7O 3WNMA 3QIBA 3F7VC 4MA7L 2NXYB 3ZYJA 1SDDB 3HHRB 2ZE6A 1UZGA 2V9UA 4W9CC 4KTYA 2R2EA 1SXCA 4V1DA 3EYSH 4M93B 5KTEL 2H5UA 2ZM6B 3CCJV 3MXVL 2HHHO 7CGTA 4ZNEA 1TU2B 2QM8A 2QM4A 1ZA6A 5F3FA 1YAZA 4NSKA 5E9DA 1IC4H 3QC5X 4J3OF 3BEVA 1II4E 5BQDA 1YEDA 4NFBA 1MJ8H 2XPGA 5GISL 3L7FA 3QDMB 1I3RA 2Z35A 3SQBA 5J6GA 4BFJA 2M6YA 4D8PB 4LVHC 2MQCA 5EO9A 4X66B 2X53A 3T2MA 3UO3A 1BZEA 4DEPC 1FL5B 3GHBH 2IBZY 2KHAA 1IBLO 4JZJC 5K39B 4DV2O 1TQBC 4LBEB 4R84A 5G5DA 4UVCA 2QSAA 3L9YA 3MI6A 3TVMB 2FO1A 1D5XB 3W56A 4HMEA 1E7UA 3HZVA 5J89A 1S7QB 1FORH 4FQCL 3B5HA 2YAHA 5J7CC 2I5YH 2YD6A 4JANA 3MOAH 1E6OH 5JIPA 4B3MO 1OSZB 2X4RB 3KBFA 3QPQD 5INDA 4MKTA 2NTSP 3C5SA 4F6EA 3GXMA 2LFEA 3UADA 3SDAB 1KPRA 3FN0H 1DVSA 2H6OA 4UB0H 5CZRA 2GV9A 2LTQC 2OMVB 3QK0A 5ABAA 3DHUA 3VX0A 4F7MA 1S4IA 1HIMH 3PL6C 4W4LA 4YHMH 3BGMB 2HJFC 1P9MC 1R3LC 3OKEA 3QAQA 5HHMD 4CH6A 3ARTA 3T6VA 1IAKA 4N2BA 3UJIL 4F33A 1MCOL 1LTXA 3MLPA 3B5TA 4U3SA 4N8UA 2R2HB 1KJ3L 3TOPA 4N2FA 2NUTB 2AJSH 4J6RL 1KT2A 2BY0A 4G3YH 4ODBD 4CZZA 3CMEV 4GW4A 1ZTXE 4FDWA 4HFWB 1BAWA 1TNMA 3V7AE 2ITDB 1GC1L 3TZVA 3IKCA 4F80A 1T1ZA 2ATPB 4HIXL 3CU7A 1M7IB 4QRPD 1CLZH 1HSAA 4I0PC 4PM1A 5FW7A 1UXLA 3FZUD 3FU8A 5IOPB 4KNSA 3QUZC 1VFMA 3WN6A 3EF4A 3WDHA 4BWUA 3EBAA 4TULH 3VFNA 3U4BH 4KK9C 4FFWD 2HFTA 2PGGA 2WTRB 1TCRA 4KHTL 4KTEL 1K73W 3FQTB 3UC0H 1OV9A 4AIEA 2GUYA 3GBMH 4HOXA 4A37A 2AS5M 1DN2A 3DV6A 3BZ4B 1KUMA 1KJVA 4XBEH 5C9KA 1H6EA 1KACB 5LXTA 3VWKD 3SE4A 1CE1L 4YHZH 3LKQA 1KP2A 4G80A 5F7WC 5BZDA 1VACB 5IREA 1JGDB 2IDSA 1Q72L 3FD9A 4LO9A 1D5RA 5EOCH 1G7LA 2FIKA 3T2LA 4XPFH 3V4UL 2HTLC 3NFSH 4XNXH 2Z6FA 3QQ3A 1F00I 3JAKA 4U1LA 4C56B 2OFQA 2K3TA 3Q8BA 1K92A 3DHPA 3KS0J 3NCJH 4P2RD 3GMMA 1YEKH 1YY9D 3IJSA 2WLMA 1TJGH 5C09B 4MA3A 3ZTEA 4J80A 3UBXA 1KGXA 1JN6B 2E74C 1BHBA 3IS0X 3UEQA 3DSFL 4OGAC 3VG0H 2UUAB 1EDQA 2WSPA 4YEFA 5LP6C 1MZEA 3U83A 1H9DA 4E5XG 4LLUB 3OB8A 3S5LA 1E65A 2IVFC 4JAUA 1AZUA 3WIFB 2VC2B 4NRYA 5AZEL 5M94B 1SMDA 5EN2B 3GSRB 3D25A 4GW5B 1G9ML 1BZ7B 4PUBH 3SDXB 4I0XA 5SWQA 3EJCA 5FUOL 1FDLL 3P69A 3ULSA 4I55B 5AW5B 2WVVA 2WV3A 4NT6A 3M07A 2OCCB 1JERA 4YBHA 3FQXB 4ZHQA 4R4BA 1XGPA 2YRLA