1OCRB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 65
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ocrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ocrB02
4NB7A 1NPJA 3SBQA 4E9YA 1AIZA 1EZLA 1TEGA 1CUOA 1NICA 3T9WA 2OJ1A 2Y1AA 2XLLA 2HX9A 3CDZB 4DP7X 2H5UA 4E9VA 5AFAA 1JZHA 2W88A 3CVCA 2HRHA 2PCFA 4N8UA 1A4AA 2H3XC 2VW4A 1N68A 1TEFA 1SDDA 3NSYA 4DP2X 4GYBA 1AS6A 1I53A 4BXVA 1IKOP 1QHQA 2A3TA 2FQFA 2YXWA 4G7QB 3S3DB 2EIJB 1JZIA 4HAKA 3WKPA 4A2DA 1GS7A 4YSSA 5IY5B 3FQ2A 1JZGA 1PZCA 2XX0A 2YAEA 5TK4A 1AZUA 1AG0A 3EHBB 4A2EA 3X2QB 4K9JA 1T5KA 1JZFA 3AZUA 3ASOB 4BWWA 2MRYA 1XB8A 1CURA 3H56A 3SBRA 3TBBA 2VM3A 2XU9A 4AI7A 1IBZA 2XXFA 4KOCA 3DIVA 2JXMA 1AAJA 5B7FA 3IEAA 3V9CA 1AACA 5TK2A 1XB3A 1OCRB 3PAZA 1NPNA 5I5JA 4BDVB 1AS7A 4YL4A 1ZV2A 1KYAA 2J55A 1MZZA 2IH9A 4DP6X 2PPFA 4WTQA 2X87A 1BYOA 4YSPA 2HZHA 4UANA 1QNIA 5ANHA 2DWTA 4GP4B 1JZEA 3NJKA 3NP4A 5B1JA 2GIMA 5I5MA 2BHFA 4HIPA 4PAZA 3UAEA 1SF5A 2VSMB 4G72B 4G71B 2YAPA 4A2GA 2W8CA 3AW5A 2FQEA 3WNIA 3CVBA 2AFNA 1WS8A 2ZONA 3MBWB 5PCYA 1NTDA 2FJSA 3IN2A 3N55A 1AZRA 1KV7A 5AKRA 1J9RA 3NSFA 4DP5X 3FQYA 5D4IA 1NZRA 1PAZA 4CSZA 4P5RA 3H4HA 2QT6A 1SHXA 1OE1A 1IUZA 3PXLA 1ET7A 2XV2A 1GSKA 2IDTA 4YSEA 2Q5BA 3ZX1A 2I85A 3PLYA 2BWIA 1GR7A 1NINA 1V54B 4GP8B 2H47C 1CC3A 1A4CA 1BQ5A 3FSWA 1SNRA 2WO2B 2R7EA 1A8ZA 4QKTA 3HB3B 3FSAA 2YAFA 4DP9X 1AQ8A 4NAJA 1AZNA 2B08A 1DYZA 3NSCA 2OCCB 3T6WA 2GC7C 3UGEA 2X88A 3OMAB 2ZXWB 2E86A 1W6LA 3ERXA 3T6VA 1KDJA 2GC4C 2IAAC 3CVDA 1AANA 2R7EB 2ZOOA 3FU7A 1J9TA 2EILB 2IWEA 4M3HA 1W8EA 2XYBA 4X4KA 3BQVA 2CCWA 5B7MA 1NIDA 3RYMA 2XX1A 1WAEA 3KW8A 2IH8A 1ILSA 2BP8B 1M56B 2P80D 1GYCA 5B1JC 2IWFA 4JHVA 2BW5A 1ZPUA 3T6ZA 4F2FA 4FA7B 4PCYA 5B3SB 4A2HA 4WKXA 2XXGA 3GYRA 1DZ0A 2FNWA 2IWKA 2BZCA 2UX7A 2LLNA 2J57A 1L9QA 2WSDA 3QJUB 1RCYA 3OD3A 3S3CB 2N0MA 1HFUA 3IN0A 4E9TA 3NJMA 2CAKA 3WIAA 4RH4A 2BP8A 1V10A 2FQDA 4UAHA 1AG6A 1CYXA 3QJSB 4DP0X 4GP5B 5I6MA 3NJJA 3WG7B 2AZAA 4YVUA 3V9EA 4DP8X 1PLAA 2MTAA 2WO3B 4YSUA 3QJTB 1JERA 2UX6A 1X9RA 3X1EA 1ASQA 1W6WA 1BQKA 4HHGA 3NSDA 1L9RA 1J5DA 1BAWA 2FWLB 4F2EA 1VLXA 4BWTA 2OV0A 4JHUA 5F7BA 4A66A 4BK5C 4AKOA 1PNDA 1GW0A 2AANA 1TKWA 3GDCA 5I6OA 2VSKB 3JTBA 4E9WA 2DY2A 1WA2X 1AOZA 3MX0B 4EF3A 3PAUA 2YAOA 1AZCA 2EINB 3EH5B 4E9QA 1MDAA 4Q89A 2BO0A 1PLCA 1MZYA 4M4RB 3OMIB 1AR1B 4A68A 1TU2A 4DP1X 1ILUA 1E65A 2XUWA 3IBOA 1L9OA 1F56A 1HAWA 3D12B 1ETJA 3X1FA 4G7RB 1CYWA 1KDIA 4Q8BA 2FT7A 3H4FA 2TSBA 2VM4A 4KNUA 3ASNB 3QQXA 3QJQB 1KBVA 2YAHA 1OF0A 3S3BB 5EHFA 3FU7B 2CJ3A 3ABLB 4HCGA 2IDQA 2YXVA 1SFDA 2B3IA 2I7SA 4TXVB 3AG3B 2UXGA 4DPAX 2FT6A 2I7OA 2DYRB 2HXAA 2YEVB 1NWPA 4YSDA 5LDUA 5I6NA 8PAZA 1JXGA 4ENZA 3OM3B 4FAAB 3ZDWA 4QLWA 1M9WA 2PLTA 1NIBA 3AG1B 1WA0X 5AZUA 2NRDA 3S8GB 1PLBA 1YLBB 3WKQA 4KO9A 3NT0A 2UXVA 2FT8A 2DYSB 2VMJA 2IDUA 1SF3A 1NIAA 4AKQA 3AY2A 3FU8A 5D4JA 1PMYA 4DPBX 3FPXA 1PY0A 2GHZA 3PCYA 1E5YA 5I26A 4UF7C 2HLEB 1JOIA 3FS9A 1SHWA 2DV6A 5A7EA 7PCYA 4E9XA 3UABA 2J5WA 4W1TA 4YSTA 2FQGA 4ZK8A 2CALA 3UAAA 1GY1A 1N70A 4E9RA 2PP7A 3UACA 2EIKB 4BXSV 2AVFA 3ZBMA 3GXUB 2UXFA 3IE9A 5I5IA 4AKPA 2JFCA 4HALA 1BQRA 2DWSA 4KO5A 2PPDA 2Y69B 2XV0A 1SJMA 3NJIA 2XWZA 1OOWA 1BYPA 5B1BB 7PAZA 6PAZA 3QJVB 1M57B 1JZJA 2XV3A 3PPSA 4HZ1A 3ABGA 3NP3A 2IDSA 2YARA 4HHWA 2ZWNA 2HX7A 2P80A 2YAQA 3FSZA 4G70B 1L9PA 1A65A 2QDVA 2HX8A 1UATA 3FPYA 3L45A 1J5CA 4DPCX 3HEIB 4W9ZA 3TBCA 2GBAA 3UADA 5FC9A 5B1KA 1NWOA 5I6KA 1GS8A 1BXUA 1L9TA 1ZIBA 1PZAA 1RZPA 1PZBA 2PPEA 2VN3A 3S8FB 5I6PA 1IBYA 4HCIA 1JXFA 4GXFA 2PP9A 1NIEA 1PCSA 1ID2A 4AX3A 2RACA 5F7AA 4A2FA 1ZIAA 3U25A 2GSMB 5I28A 4KO6A 4NERA 1B3IA 4YVNA 3X1GA 1OCOB 1AS8A 2QPDB 3SQRA 3SBPA 2HRGA 1A4BA 3DKHA 1KCWA 1A3ZA 1V55B 3C75A 3CG8A 3AG2B 1E67A 1XB6A 1ZDSA 2BP0A 4YSAA 5B1AB 1J9SA 1JXDA 1HAUA 3EF4A 2UXTA 1L9SA 1GY2A 1RZQA 2PP8A 1URIA 3N2JA 2JKWA 1R1CA 3NJLA 3WNJA 3KW7A 2Q9OA 2CBPA 4YSOA 2EIMB 1WA1X 5I6LA 5B7EA 1QLEB 1E5ZA 3T71A 1OCCB 2BP0B 2BW4A 2TSAA 3X1NA 1FWXA 3ABMB 1X9UA 6PCYA 1JVOA 3FT0A 3EH4B 5D4HA 2BZ7A 3EH3B 4JKNA 3AG4B 3PAVA 3CDZA 2CUAA 4YSRA 4KOBA 1RKRA 2BWDA 1IC0A 4BWUA 4P5SA 2XVBA 1ET5A 1BXAA 1OV8A 1PNCA 3OQRA 1NDTA 3QJRB 3CZUB 4L0PB 4YSQA 3T6XA 1ADWA 4F7KA 2FTAA 4GY4A 4N4YB 1KBWA 4DP4X 3FQ1A 3QPKA 2VW6A 2GB2A 2YQBA 3FYEB 4KNTA 2GI0A 4KNSA 2PPAA 1BXVA 3OMNB 1NIFA 1OE3A 1ZDQA 1J9QA 3JT2A 4G7SB 3NYKA 3NJHA 3TASA 3DTUB 4MFHA 1AZBA 4E9SA 3G5WA 3ZIYA 1EHKB 4A67A 2PCYA 1KGYE 1SFHA 4BDVA 3TU6A 4AZUA 3WI9A 3FYIB 4CSPA 1KCBA 1MG2C 1ASPA 1XMEB 3ABKB 3NJGA 1GS6X 1SDDB 2IDFA 1E30A 5E9NA 3FU9A 5PAZA 4KO7A 1FFTB 4HCFA 2J56A 1PF3A 2YAMA 2QDWA 3FSVA 3NJNA 3NJFA 1WS7A 2VW7A 3BVDB 4YSCA 3X1BA 1OCZB 1FA4A 1BEXA 1MG3C 1OE2A 1JVLA 2AZUA 2QPEB 9PCYA 2PPCA 1ET8A 1ASOA 3TA4D
chains in the Genus database with same CATH superfamily
2K4AA 4H37A 2EKSB 3BW9B 3P4NA 3WUWG 1KY6A 4XE5B 3LPWA 4Q97A 3WU2Z 3FKUS 1R6KA 1BWWA 1EZLA 5GSRB 1J5IA 1U91B 3WIIL 3PWPE 4DV2B 1OEZW 1XZ0B 1EPFA 1HOCA 4LARH 1Z7JA 4OM1H 4QY8A 3L75H 4WY7L 4BSWA 3WE6A 4PJHF 1ZGLM 5F89B 4GJTB 1BQ0A 1PKXA 3ENEA 5DC2A 4P3DA 1FAFA 2K3HA 4NTWA 1OHHG 3ZO0A 3MLTB 2EYRA 4G8EB 1A6ZB 3HG1A 4I1NB 2VZVA 4JAUA 4G1EA 2SODB 4OKVB 4P9HC 3WN6A 2C3VA 4JDZA 4L3CA 4WJ5B 2H3XC 4BUHA 2CD0A 5DJDA 2D31A 4FZ0A 1TVBB 1H3PL 1ZX3A 5FV2A 3BP5B 5CNHA 2VS0A 2HVJB 1N3NB 1JHLL 2J72A 1R3LB 3CTTA 2PUSA 1IBLB 1IC7L 4IT5A 5LHHA 3TEXA 3IKCB 5LGUA 3BHBA 3AACA 2IQ9L 4IIQC 3US9A 3H42H 2H8PA 1YEIH 3C8KB 4UQ9A 1Q82W 5FW7A 1HKLL 3SDXE 1GN3A 1JZFA 2EDHA 4PM1A 1ECYA 4JK0D 3F6LA 5DFTA 1XB8A 3C60D 3HR0A 3HC3H 4DZ8A 3VXNA 5DJAB 4LPWA 3T1FB 4XN4A 1QSFA 3GMPB 2XXFA 3KR3L 1U8MB 4KOCA 4YDKL 5I6XB 1CD9B 1AAJA 1BBJA 5B7FA 4UAOB 1CDCA 4X7DC 4CMHC 1F4WH 3JTTB 4DOHE 4DQOL 4ZNCD 5LJYH 3BQUD 5CA1B 1CG9B 4TYUA 1AS7A 1WF5A 3C87A 4J3OD 5DXWA 1INEL 2V17H 3EFDH 5ECGA 4WFHE 1G7LA 1ODAA 1QEXA 5CUSH 1OKEA 3L73H 4GO8A 4KRPC 3QC5X 3NESA 5FPOA 2X2UA 5D7IF 3NFSH 1X5JA 2EDEA 1WBXB 2O57A 4PAZA 2A9ML 4HCRL 4AW7A 4ZMAT 2I07B 3MX0A 2XI9A 5DZ9A 3MFGB 3UJTL 2VH5L 2HLFC 2NT1A 2R4RH 2YRPA 3G5VA 2V9UA 1N59B 3BVNB 4M8UA 4YHKL 1MFDL 3QEGL 3P77B 2IG2H 2PWEA 4RAIA 4JKPH 4PRPA 1QYGH 5IFAH 3CXHF 4JN2A 1EK3A 2ADQB 4NQDD 4HXBL 5D4IA 1QKZL 3ZK0A 1J5OL 4AEHL 1VEMA 3CBKB 4OLWH 4XPTH 1YY8A 3B40A 3UBGA 4LSSH 1TJMA 3FTVA 3OD4A 3A4AA 4TS6A 5I0XA 3LS5L 3AJ7A 2E9GA 3D6GA 3RVTC 2J8HA 1Y18B 1KXVC 1RY7B 3AS0A 3TO2A 1A6AB 1QRNB 5JQ6L 2NPLX 2RH0A 2H47C 1T2JA 2JELL 3ULUC 3G6JA 4OF8A 3RBSA 3LEVL 1YJDH 4O5LH 5E8PA 4X4YA 4IKIA 3MJGX 3VFTA 5CEXA 1UOWA 3BKMH 1YNKH 4MDRA 4KK9D 4DETA 2FX7H 3PWLB 4AH2B 1F51A 4JGNA 4DP9X 5C1MB 3NSCA 4WFFA 5DRZA 2MK3A 5KSBF 4WW2C 3ERXA 1JG9A 4U6YA 1E9OA 3T6VA 4LGRB 3SCMB 4NZUH 2YIBD 3NXSA 5E1HB 1QEWB 4BGLA 2IH1A 3CHQA 3CVDA 3MREB 5DEJA 3TLRA 3MUHL 2ESVA 1W8EA 2XT1B 2H1PH 1O6VA 2Y7NA 3K1KC 4PGBA 3BQVA 4X4KA 4YL9A 4KZ0A 4WHTA 3OTOO 3HR6A 5BUGA 5IB1B 1O6TA 4YDLB 3T0EB 2VL5A 5B1JC 4GRMB 3HI5L 3VTMA 4F9PA 4KJPD 3SGEH 3EJTA 4TQ8A 3FQRB 1PNMA 1IGYA 3MLXL 4K8XA 4FLRA 4RFNB 4RGNB 3F65A 4GQRA 4IS6B 5IOKA 3TJEL 3NGBC 3MMEA 5E1AA 3GSXA 4YGAB 5LXTA 5IYBO 5GRJL 3ZDYF 2HP4A 3ZHVA 4EZJA 2HR3A 1F42A 5MENE 3RVZA 5FGCB 3IFNH 3WJMA 1AMYA 1ETZB 4WNQA 2O61B 3D4GA 2V8MA 1KB5H 4NO0B 2A79B 4QAMB 3F5WB 5F2FA 4NTYA 3C09B 3L1FA 1FZKA 1MLCA 2P5WB 4WUUB 2F58L 4XO3A 3B4NA 3WNOA 4UTAL 4H44B 1DEEB 2VWEE 5BRZD 1MHPH 3E8FA 4X9QA 1FDLH 1N9PA 2LV4A 5DJZA 3OC8A 3L95A 4UI2A 3K57A 1JERA 3D2UA 3PRZA 3ULVE 3T3PE 1F23A 1H15B 4A2LA 2BTQA 4WWPA 4J2QA 5HYSB 3RVYA 3RU8L 3M88A 3NCEB 3JWOL 4JQIL 4MA1B 4LF7B 4X83A 3JWNE 5CJBA 5TE4L 4NHUB 3V0HA 2XXCB 3W7WA 3CVIL 1S7QB 3QFGA 4FMVA 4LSUH 1QBZA 1GGUA 1NTKH 2J73A 4PQXA 1MJJA 4PWFA 2E0PA 1JJUA 3HUJF 3FFCA 5AZ2H 2HVKC 1H6EA 3BVXA 1I3RA 4OGAD 2XQYG 4XNUH 3HPLC 3CLWA 3QNYA 1IGTB 5C2UB 3EBIA 4A68A 4PJFE 1Q43A 2DN9A 5GONB 3MV8B 1E65A 2JJSC 2AK4E 1U21A 4H40A 4NSKB 4PJ5E 5E8OB 5EUOA 3VFRA 1WFJA 1EN6A 4F3FA 3HFFA 1V3KA 1SMDA 4N0RA 2APWA 5GGVY 1OWWA 3SOBL 4LP8A 1BF2A 2W91A 5AL0A 5DO8A 3C5SB 3MPCA 3A2FA 2BCKA 4CVUA 4UCTA 3D33A 4HS8H 4GAAA 1IJNA 3UTTA 2CJ3A 1I9JH 1FFNB 1PD6A 1EBOA 2LT9A 2R2BB 2BHUA 3UG3A 4ZTPL 3CC7V 5I18L 2DOCA 1DQLH 4PN6A 2IAMB 4XWOD 2Q8BH 3QUYA 2BOCB 5EC2C 1B06A 4HMCA 4UM9D 4XRCB 8PAZA 2NY3C 2OP4L 3G08A 4TUKL 3LHAA 4UVAA 3FTZA 3HZ3A 1G7HA 5LA6A 5I1LA 4GUPB 5ENWA 5TDPA 1MSPA 4NKIH 2Y5TA 4YHLH 1TENA 5EPMA 1A6VL 4TOIA 4JM2A 1PAMA 1E28A 32C2A 4N2MA 4M7KH 5AZUA 5BVPL 4PBXA 5LL6Y 4YIOA 1YMMD 1OZTG 5DJ2B 1CD1B 2EKSA 3BW9A 1ZLSL 2O1AA 2JEXA 1HHJA 2F1AA 5ADPL 1UACL 4G7YH 3CN4A 2CKBL 3EKCA 5AVYB 1F3DH 4PRAA 1DVXA 5L2KE 4KDTC 3TIEB 4ZS7H 3OKNB 2IDUA 4K2UH 1RZ8A 1J11A 3ZGIA 3OAYH 4FNTA 3LPOA 4ODWB 1IAOB 3CDYA 3IFOB 4RFEB 4U6HB 5EU5A 4Z18A 1OF2B 5C0GA 4LH6A 2Y06H 5CA0B 3A8TA 1NCBH 1TJGH 3E3QC 3NCFB 3HOGA 4HZAA 4PWJA 1U95B 4UB6Z 3CXDL 4JDEA 4AQ8C 3QVNA 4Z3FA 4R7LA 3P30H 4FXGC 1UCTA 1NFIA 1LNUB 4NZ8A 4ZW8A 4AGOA 3A5VA 1U58A 3DARA 1WAAE 4O02H 2XTAA 4TNGA 5D2NE 2K7PA 4JQXA 1KEGL 4O4HB 5GS3A 1LEGA 3N2GA 1SY6L 1EZJA 1XI1A 4WHDA 1S7SB 3MYZA 5DD3L 4ZD3L 4LOVA 3L4UA 1Y6XA 4PJCE 1HHGB 1Q9WA 3GGWA 2ZWNA 4KROB 4F33B 1OCWH 4AILC 3FFCD 2GSGA 3L5XL 4ODHL 2IFFH 4OAWA 4Y4HB 4PA7A 2IBZY 3GDBA 5D2LF 5AOJA 3S0PA 1J5CA 4OQTH 3F7VB 5CMAB 4PTTB 2R9HD 2UU9B 4NOBA 3PQYD 4R8CA 3AQZA 4HS6B 1A3LH 3C8HA 4XMVA 3B34A 4YQXL 4JO5A 2FYUH 1MF2L 8FABA 5KVDH 3POHA 3BRCA 1C5BH 5F96H 2WQWA 4OZIA 1ED3A 2IC2A 3L3GB 1IAMA 1NJ9A 2ZWYA 2QMKA 4LL4A 4MMXC 5M95B 4JVPA 3S8FB 2CPCA 1IBYA 1S76D 1MI5D 2VJ0A 2VLRE 3GXNA 3BPZA 1JXFA 2CK0H 4W93A 3IU3B 3BFQG 3MUY1 3RNKB 5LWYL 4CBCA 2Z1PA 1TTUA 1FE8H 4NQXA 4R4FL 5E2TL 4MRBA 3DKHA 4ZMNA 1WE5A 4CN1A 4DV6B 3LS4L 3IGUA 3D85A 3QO1B 1JF1A 3MJ8B 3Q5YA 4IL6Z 3Q2WA 1EN5A 2V7NA 2WYIA 3U4BH 4YHHB 2AV1A 1MVUB 2NY7L 2BNQD 2DYSC 3EF4A 3H54A 2WTRA 2J5LB 3WHE0 3NUKA 4MAYD 3VBBA 3JAKB 2F8XC 3IE4A 3RIFK 1LK3L 2XFXB 4N2IA 4NZJA 5ITZA 4Q9QL 1DF4A 3NJLA 4WV1B 2Q6AA 3BEHA 3LDCA 3EH1A 5C97A 1BG1A 2L8AA 3MV8E 1CGSH 2DQGL 2A6KA 3TYGL 5IFHH 5L7XL 2AI0L 4YHML 4WWKC 4PSRA 2FJFB 2QQLH 2KKQA 1USZA 2X4UB 5LAXB 5IJKC 2ARJA 1VF5B 4LHUG 4V1DB 5LGJB 5CP3A 4YSRA 3AG4B 5CO1A 2BC4A 4YS4A 4JRXB 1RKRA 1ES0A 5TH2A 5E9DE 3JALB 2XVBA 1RZGB 3FRUB 1BVKB 3MR9B 5KG9B 3F6IA 4YXLH 4OU3A 4YFLF 5I8EA 4AQOA 4YSQA 3INUH 3I02B 3RIAF 2IH1B 4Z7AA 4B3RO 3I85A 1GM9A 4K7PX 1BAGA 4FEIA 4X4XA 4PGBB 4XDLA 3DIFB 4JBSA 5ALBL 1KBWA 1CBVH 1JGLL 5DT1H 2ZIOA 4Z7NF 1LQBC 1G7PB 3L4TA 2DTMH 5C8YB 4XVTL 3SGIA 4JFQA 3BPOB 4TLTA 4WY7H 1FN4B 3HG2A 4X20B 2NXYC 1RMFL 3MUUA 2JKSA 3S37H 4I55A 4D6TH 5BVJA 5E1AC 4HV8B 5CLZA 3BQUB 4Z7NB 3QQ3B 1DBKL 5DURB 2VDLB 4ZZKA 1UKSA 1BMFG 4JREB 4AIOA 2R0LL 3ETDA 3OL2A 1IDSA 3LHPL 5LG1A 4UNVA 3CFKB 1TNNA 1IBKB 1KBGH 1IAII 1CDHA 5FYKU 2R69L 2X6CA 4JZNB 3RG1C 3SGJC 3T2OA 1MPAL 2GTAA 2XBTA 3QXVA 4TQEL 4HPHA 4G82A 4M1GH 4FG6D 1IC7H 4E36A 3K2IA 4RUEA 1FZMA 2JJTA 3GSRB 3B8NA 5KW9L 4HAMA 1TZIB 3JV6B 3OGCC 4YR6A 4XODA 2WWMC 2RQ8A 3FAVB 1EEQA 5C08E 1QSFD 2Y4SA 2P49B 3HKBA 3RHWK 1OE2A 2YN3A 2AHIA 2PNDA 2Q87A 4DZBA 5JOFA 5DUPL 5B3JE 1G1KA 3TA4D 5D1QA 1V3LA 3TN0C 1C12A 4CU6A 1NPJA 1ONQB 3PNRB 3P4OA 3KD4A 2NSQA 3FB6C 3LKRB 1EGJA 4WSJA 1SJHB 3OC5A 2F19L 1XR9B 3BWAA 4MXWL 2NNAA 4ONFL 4G8GA 3SE9L 1PNLA 4L4TE 1PL3A 1HL5A 1MCOH 3D06A 3GK8L 1NU1H 4FQHB 1WPXA 2ZE7A 2Q86A 4HBQA 4WCYH 4LDOB 5GJSH 4NNPL 3AADB 3NDZE 2DAVA 2HRHA 2PCFA 4FXTA 3TA3A 4B97A 1MNNA 1T7XA 5SWSD 2GBTA 4MAUH 4MVZA 3QSKB 2YUVA 2FRGP 5IBLD 4WF9V 1G7IA 1SUJA 1QHQA 1PZDA 2N01B 1T0NA 3GMNB 4P4RB 3CH8A 2UY6A 2YD3A 5AG9A 1BX2A 2BLFA 5F0LB 3RTLA 4AM0A 3JD4A 1C5DA 5FNVB 2VDKB 2UXNA 1QI5A 3AS1A 3BUBA 4MD5A 5CD5C 4BCZA 5AUMA 2GABA 5HHQA 2AQ1A 2XV6B 4JJOA 3FUDA 4HXBH 4N0CD 1SYVB 1NMBL 4AEHH 2DIBA 1PX3A 4R2GB 1OY3B 4XPTL 2ZR3A 1CFSA 1AYRA 3L3HB 4JCWA 2DDQL 4RFOH 4HK0B 2OSYA 3OR6B 4YBQC 4UDTA 3QRGH 4CH5A 3V9CA 1OZUA 3MLYL 1KJ3L 3VRLE 3CP1A 4JM2B 2ZD0A 4O4JA 4XGZB 5IFJB 4X64B 1NEZA 2Q7YA 3CIQA 2XZCH 2SEBA 4RDQG 4X6DB 1EAPB 2BVTA 4XPFL 1GAFL 3Q48A 2UXBO 1Y74A 1L0QA 3WFEL 1PY9A 5EBMB 1JMZA 1VGKB 3RYFA 2VDRB 3V5KB 1NM4A 1NAKL 3S36L 1NGQL 3QAZC 1VPOH 4OPAA 1E79G 1KZQA 3CUPB 3PWPA 1O9VA 4MA3A 4H1LA 2C1PB 3PHOB 4HISA 3ZPDA 4X7CC 3RURA 3PV6A 4NNYA 3JAWA 1D6EB 4PGCA 1T4WA 1WS8A 2ZONA 3PIQB 4GYCB 2H1PL 1KV7A 1XGPB 2H0FA 3C6EA 3CK0H 4P46C 4A7SA 3D4ZA 4K8RH 1XEDA 4N25A 1J9RA 1KNOA 4DP5X 5LVEA 1CPUA 4HEPG 4Z7IA 1DQQA 4KKCC 2A73B 2AS5M 1NANH 2WLIA 4GEIA 4XBGA 3BWUF 2NY5H 5I1EH 1IUZA 1M3JA 2QVFB 3PXLA 1U8CA 2ZIDA 1BBDH 1FVCA 3MLXH 3QUXA 4I77H 4G6MH 4X6FB 4AC4A 4IRSB 4DN4H 1FAIL 4O2EA 1ZE3H 2FEJA 3JWNC 4Q74A 2WB7A 2Z31B 1R3KB 1GZPB 1P2CA 1TYRA 1FFOA 1WEJH 4XWOC 4I1PA 2QSVA 1L5GA 5F8QC 5B3SC 1PZUB 4ZOBA 4NPYB 1SNRA 1F3DJ 1PP9H 2AW2A 1F02I 2OIEA 3OHXB 4DKFH 3GGWB 2ROXA 3CMEV 2A9HA 2H3NA 4F33A 5KS9E 1IKFL 3W2DL 4XMTA 5D9SB 1I8LC 3T4YB 2XVLA 3QULB 1PL4A 4Y16A 4JVUA 1S7WA 3UGEA 1KKDA 4LCYB 5AD0A 2ITDC 5LYJB 2VJXA 5BW7A 4JQIA 2ENJA 2NXZB 4K8RC 3NPSB 4JQIH 5FFLA 3B9KD 4Z7WB 1NUFA 3QWOA 4PJ9A 1ND0A 4RQQB 3HNVH 5SWSE 4F57H 4LSUL 2P6JA 3DGEA 4N87A 4XTRC 1RV6X 4N8PA 2HCZX 3X14A 1HINH 3OFNG 1KN4L 4OKVA 5C07E 5JQGB 4XXDB 3VG0L 3IM1A 4ZMLA 2KL6A 3BZ4A 3ZMEA 3S34H 2IJHA 3K04A 1E40A 4JFDD 2I60L 4LEOB 4A2HA 2B1HH 4IQHA 2DQUL 1Q86W 1RI8A 2VISB 3F12A 4HMDA 5I19L 2GY7B 5CBHA 1B0GB 1A5FH 1UB5B 1WWBX 5EU6D 1TSRA 1XF3B 3F85A 4FQIL 1NDMB 4NQSB 2X2HA 5LKNA 2EEXA 3AU1B 5IHHA 4GOSA 1G9EA 5DSCA 1BECA 3GLDA 4ZAKD 4ZKIA 1LLAA 2JKLA 4P23D 4WWNA 3MGAA 2R9IA 1GXEA 5DJ6A 3V9EA 4NQVB 5GGRB 4CS2A 2QHRL 3MD0A 5HDQH 4KUZL 4X7TB 3BGAA 4XI5D 5T1DH 2ZG2A 3NSDA 1CBJA 3G6DL 3ZHKA 4BFEA 1SM3H 3T09A 4ZFFB 4GKJO 1Z32X 2X6VA 3D8MA 2OV0A 4LQFH 2Y3NA 5LAXA 1R6TA 4XT1C 3IB4A 1GW0A 3CFMA 4X66B 2K45A 5I9QB 3U0PB 2AK1H 3OV6A 1I1CA 5AKVA 2L7QA 1MRDH 3Q6FB 1CXZB 1X4TA 4P2RE 2D3OW 4E9WA 2AK4A 4HFUL 3ARDA 4PJ5A 5D7LB 3N44F 4UOW1 1M90W 5EBLC 3EYQD 4DUWA 2FD6L 2UY7A 2IPUK 2OW6A 4DKEH 1H2MA 4I0CC 1R9FA 1X5MA 1QG3A 3RWIA 1HHKB 2BO0A 3I75B 5EEYA 2ZG1A 2R8SH 5IQMA 4FG4A 3HC2A 4M3JA 1ZLSH 2VJ8A 5H2FZ 3OAAG 1EANA 4CN6A 2W59A 2W60A 1ILUA 1C16A 1LMIA 2XUWA 3ETBF 4AQAB 5ADPH 1WC7B 1U8HB 1S4IA 2FX9L 3KL0A 5C8YA 1FORH 1KDIA 1A14L 1FO0B 1FJGO 3QPQC 4L8DA 1U93A 4BUQA 3GHEH 2PTMA 1G6RB 4OCYL 5HVGB 1KYFA 1TNMA 5F88A 4Y4HD 3CMGA 1BM3H 3IPEA 3VQMA 3H8NA 1WGOA 4M4RA 3WY4A 4YPGA 4IMLA 4HIIA 3ABLB 3U6XA 1GCYA 1P5UB 4N9OB 3G6JB 2K1EA 3BKCL 2BMKA 4MAYC 3UCSC 1WAZA 2BVQA 2Y69C 3FAWA 4KFZC 4LHQB 4N2DA 4PJ9C 4TXVB 4JYBA 4DCQA 5F1IB 2R4SL 2BK8A 1NC4D 2YEVB 2P4AB 3EOTH 3WKML 2N04A 2WXPA 3IDUA 1T7ZA 3AS2A 4O02L 3ZDWA 5JW4N 3KLDA 4LLYA 1VQ4V 1KCRL 4M7JL 2PLTA 4IIJB 4ILDA 3RGVD 4HZLB 5JZ7D 4AC2A 3WXVL 2NRDA 2OYMA 5AW2B 4ZOEA 4LLQB 3UYRH 3DX9A 1LVEA 5T1MB 3C08H 1JGDB 1T03H 4DV6O 2XTJD 2WKOF 4KO9A 2K78A 5E6ZA 3ZKXC 5I66B 1OT4A 4PLKC 2CIKB 2HLFD 3OR7B 1GGCL 1TMQA 1K5WA 2Z91B 5HDWA 1L1FA 3T0EA 4H8UA 3CSGA 4P2QE 1DCEA 1K3EA 2LVEA 3PHQB 3X12B 3MCG1 2N7BA 4B60A 5LOVA 2I5YL 2FWOB 2VSDA 3I2CH 3B9EA 4P3CL 3EYVB 4BSVA 4XB8A 4ASUG 3W37A 5J12C 5L3CA 4KKLC 3QO0B 4Q2ZA 5LP6A 1ETZA 3HMXH 1MNUH 1M71B 3UAJA 1UA3A 1T0NB 4M7LT 4OJCA 4V1DE 5KHHA 4K7FB 4ZAKC 4QIRA 5HHMD 5T3XD 3ZRFC 5J6HA 4X9FA 1XHZA 2BRRH 5HHME 3HRZC 1OOWA 1QPKA 4X5PA 2DKUA 4KHTH 1P1VA 3NCXA 1KB9F 4BIUA 4U49A 3H1HH 4EVNB 3LD8B 3O6FA 4G59C 1JYWA 4XN1A 1JZ5A 5ACZB 4JDTL 5A7BA 2IDCA 2IDSA 1A21A 2VDMB 4EQ3A 4L29A 5GISL 3TBYA 5ISZD 3VNYA 4Q9QH 2QDVA 4ZHQB 1Q1JL 4YZFF 3ZN1A 1V9PA 1EJOH 3NCYS 4A04A 1WSST 4WFED 4DPCX 4Y2NA 3B2PA 4DR3O 4C8XA 1YQVH 1M5IA 2BY2A 2KYIA 5IW1A 3QE5A 1YPZB 5GXBB 4F7EA 1CS6A 2NY3D 4NUJB 1WDAA 4KQ4H 4PFEA 1RIHH 3FN9A 4HJ0C 4FNLH 4PG9A 4QRTA 4ZMPA 3QA3B 1NMAL 1JGVL 5E8NB 4BSWB 4KJPC 3RTQA 1VF6A 3R06B 4YXLL 1ID2A 1BGXH 4J6RH 4A2FA 4JGJA 1D6EA 5CN2A 5J4MA 5DUBB 3WD5L 3D3IA 4WKZB 3HPJB 1ORSA 3E2HC 4LT7A 4X6CA 1L7IL 3D7PA 4G8EA 3HG1B 3KYNA 3OAYK 4NUGL 5DRNB 1KCUL 1V55B 1JGLH 1ML0A 1ZRUA 5DT1L 1LD9B 4BQCA 4HUMB 3W0WB 3U9UA 2XY2A 4XVTH 4HEMA 2QWRB 3FN0H 1IZKA 4KRNA 3S37L 1JP5A 4HIEB 4GFTB 1IIKA 1P9MA 2LQTA 3WTXA 3N2JA 4FNPA 2X9YA 1TFPA 3TVMB 3WFZA 2Q9OA 3WLBB 2AEQH 2QSTA 3NZHL 3HN3A 4F27A 3CHRA 5DD5H 1AI7A 1YECL 5B7EA 4PLJC 3QCTL 4KKPA 1EBPA 2GITB 4XP5L 4JFZH 4TOYL 3QG6A 4DN3L 3IFPA 5JW4M 4JFXA 2K4WA 3T1FA 1UVQA 3CN2A 2IAMD 2QQNH 4OI9A 4Y5XC 3KYOB 1U6AH 2BZ7A 3CN1A 5D70L 2VDLH 1K8DB 1F4XH 1EIBA 5A16B 2HAZA 1DJZA 3DVGA 3CD6V 4A63A 1QNZL 2X4RB 3NABL 3ZRVA 4LLDB 4KQ0A 3WY3A 4XCEB 5DECA 2QADD 4Z7WA 2E76B 4AV4A 4HKXB 3JSNA 5JO5A 2KG7A 4PP2A 4CU8A 4MQ7B 4JI3B 1RU9L 2J1KA 5FR3A 4FJYA 4DP4X 1CDYA 7CGTA 3IDMA 3MOAH 4LK4A 5HVFB 3V0WL 4AMXA 3DDFA 4NQDB 4I0XA 5JHDA 3VE0A 3V5DA 4OJDH 2F19H 2DMXA 1ZDQA 2R1WB 2E9JA 4X9YA 3GSVA 4CGUB 3PFUA 4FQJH 1MCOL 3UO1H 3DTUB 3P77A 3PWNA 2J1WA 1FPTH 4IMKA 4LCUC 3HCVB 4JM2D 4Z7QB 3SE4A 5IW6B 4NNPH 5CAYB 1QX1A 4AYMC 4AZUA 5F7KC 3N2GB 2AERT 1UYWH 4QE9A 1JRHH 3ABKB 4NRZB 3HG5A 4JPWL 5IVNA 4JYAO 5TDNA 3VSUA 4J3WA 1XREA 3AREC 1JVKA 4WW2A 4HJ1A 4K23H 2HLAB 5TTRA 2OMYA 2VDRL 3LKSA 3T1CA 2JGUA 4MVRA 2EP6A 3PDOA 3QH3B 2Z7WA 4ZUTB 3VFVA 3WS6A 4F7TA 5JORB 1S78C 2OXHB 4KXCA 1I3VA 2G2NA 3HE7A 3IDIA 4ZFOL 1JZ8A 1T22A 2F4VB 5M7QA 4I2XB 1ROCA 4MS2A 4IOFD 4EAEA 5G2NA 2Y9RT 4DV1B 2ITDB 1QSED 4WTZG 2DDQH 3ZR5A 2JCCF 2YA0A 1XAUA 1IBBA 4FXKC 4JZJC 1DR9A 5IHBA 2WNWA 3IGAC 5KLVH 1HHIB 3VNZA 3HI6H 4O4YL 3MLYH 1KJ3H 1DL7H 3SODB 2UWEA 2ZWKA 3TJPA 3MA9L 4RMTA 2XLLA 2QV2A 2W0FB 2YSSA 2VM9A 3UTQA 1GYAA 1A8JH 3APCA 1E4WH 1TVHB 2XKSA 3MBEA 4JCMA 4JO4H 4Y0GA 1OGAA 4KL1A 3U7AA 4OGAC 1AHWC 1KP2A 3P4MA 4OBSA 4S1SH 4PJ7F 5EC2B 2V4DA 1PU0A 4F92B 2C9PA 3EDFA 2DWEC 1MLBB 3QXTA 4OFYD 2WJ7A 4JCLA 2OMUA 4R5TA 5T3XE 2YFNA 4Y4FD 2HWZL 4U4IA 3STZA 1U3HC 2ZUSA 3T0VA 4K3EL 4UTBA 1HZLA 5H9CA 1AXIB 2QWPB 4CNIB 4WSGA 4MQXD 2CO7A 4YSSA 2AJYH 1P84J 3M17A 3IU4H 1PZCA 3NPSC 3RKPA 3L3IA 4A2EA 4DUYO 2YR3A 2LLLA 1EDHA 3AZUA 3QXAB 2XPGB 4DCQB 4LLUB 1G6RL 3T4AA 2AC0A 1VFOA 4B9IA 3KNBB 5T1LD 3TT3L 1B6QA 2BDNH 4NQEE 3LX9A 3N42F 2D7TL 1LO5B 2BXYA 4MDIA 2X41A 3JWDH 3OG4B 5EUKB 3L4ZA 5KJ7E 2IH9A 2E7BA 3QIUB 1BDYA 5J3HC 2NY3B 3CFBA 4URKA 4FG6C 3BO8B 1S7QA 2VC2L 4DKFL 2LVCA 2HFFB 2EDJA 4G1MB 3LQZB 1GM8A 2DQJH 1CB4A 1T6VN 1ZTXH 4JRYA 3MRMA 3SGEI 1XOUA 4M7LH 4F8PA 5FYJU 1AILA 1MXGA 5F3BA 1ZVSA 2QKCA 3WMQA 5KMGA 3SOTA 4GZRB 1JN6B 2HT2C 3VXRE 3W9DB 1FUNA 3ZE1B 1YMHB 1Y76A 2FWOA 3RDTB 4AZ8B 1SQPH 4LFAB 2IQ9H 5INCB 1DBBL 5G5DB 5KAFZ 1WZ1H 3ARBA 1QFPA 3P69A 4OCWL 2ADYA 4Z78B 1D2OA 1RP9A 4CSZA 4FYSA 4M56A 1KENH 1FFRA 3BWZA 4OCMC 2EXWD 3CPWU 3VXSA 1MFBH 2UV3A 3O9OA 3C5SA 3QDAA 4H88L 3S34L 3UOAB 5D8JL 3MLRL 1OTUD 4B95C 1ET7A 1WA8B 3TV8A 2OJEA 2IDTA 5DRXA 3K3WA 3AXLB 4XCYB 5I19H 1FLRH 1OM3L 5KVDE 1V7ML 2R56H 4ANXA 4OLZH 3WN5B 5FLXN 1RQ5A 4P23A 3RZWA 1M7DB 3CDGB 4Y5VA 3CVHL 3ETEA 1VHPA 4NUPA 3D07A 1EBAA 4HG4K 4P2OD 1KTLA 4CS4A 4OSUH 1XILA 3VXMD 5LDSA 1WHPA 1K5NA 3MO1B 4FQQA 4XZ4A 3GXTA 3Q2VA 3NZUA 2XN0A 5C0BE 4TSCH 4N90D 1AZNA 1Z9SA 2IXQB 1CVSC 3AG1C 1P1ZB 4XVUC 1BD2D 3RYCB 1E9QB 5EIIG 2DOSA 2CKBA 2OTWB 3KPRD 2IJKA 1FIEA 3FB8B 4QCIA 4KTYA 1T0MB 5B1AC 4AIEA 5HYSA 4OLXH 3LIUA 1RZJL 3WTYA 5FDWB 1J1PL 2XYBA 4YBLC 4GBXA 1OCZC 3I56V 2FYYB 5D1XB 4X62B 3U36A 2OZ4L 4IKLA 1SYSA 4WAFA 3V8OA 1S3KL 3BPCA 3M8OL 4GUOA 3TA3B 3D2TA 4RMQA 1XSKA 3RTQB 1DVUA 1VQ8V 3QO7A 2UUDH 2Q0ZX 4KUCD 3L3DB 3NK4A 4JHVA 2Z9TA 4OZHF 2IWGA 4ODWA 5J2UA 3IJSB 4PRIE 5B3SB 4XNYH 4AIXA 1IRAY 3S2CA 3GYRA 1SETA 4PHXA 1J95A 4WF7A 1UWEH 1E3FA 1MWAB 2BNRA 3ARQA 3DBXB 3PP4H 2G75B 1DQMH 1U9KA 1IZ3A 2GEEA 2V7HA 2PW2A 4GXUM 1EXGA 2N0MA 1MFCH 2PTTB 5C9KA 1U8OB 1YJDL 1CFTB 4MYPA 1A14H 3MUZ1 3S4SA 3WLWC 1U8JA 5IB5B 4ZTOL 1IGCL 1LE5A 1G9NL 3GHEL 5IR1A 1GSMA 2YPLA 5SWZA 3FCUB 4OCYH 2RR3A 3P02A 4YDJA 4AGNA 3QIBA 2ROYA 1BM3L 5C9JB 2DWYA 2DJMA 3K06A 5D72H 4RISL 2UZIH 3DHJA 4YSUA 4F5CE 1KXTB 1FG2A 2UX6A 4O4HA 2JKNA 4O2CB 4A7TA 2CZNA 2EACA 4TPRL 4WNSA 3BABA 2UZXB 1TA8A 4Z76B 4P59L 4ZMYA 4JO8A 3ZTCC 4JFXB 2QTSA 1SMAA 3D39A 1LGVA 4R2GD 1JK9A 1BM7A 4MTGA 3ISWA 5E7BA 5KHGA 4HIQA 2GJ6A 2UUDK 5A2IH 1COWG 5GSRA 4BH8B 5TE6H 1RJZB 1XZ0A 3GJEA 2XC8A 3HB3D 1N0XH 4LLDA 1TTCA 2LGQA 2PO6C 3I55V 5I17A 2Y5TB 3QBTB 3G5XB 4JMNA 3KS0H 5E5LA 3ULVL 1MCNA 2E74C 4PJAF 4TVPD 5IYZB 3GWKC 1HN1A 1T03L 2A74B 2VR5A 3FFCE 4FZ8L 4ACTA 4X66O 4IOSA 4YX2L 2VLME 3DUSB 4J6IA 5D1QD 3F3HA 5LUMA 1KB5L 4FHKA 2YA2A 4JFFD 1EERB 4PBDA 5C0EB 2BNQB 3AGVA 4LSVH 4ZX3A 4UTAH 1EX0A 3KGSA 1LDSA 4KVNH 3WTTA 4W9DC 3UP6A 4IYKA 5EIBC 5D1XD 3HG1E 2YXVA 2W5PA 1QFUL 1PLGL 3RU8H 3ZMSA 5E56A 1BVNT 2CLVA 3HMXL 3ZDZF 3UTOA 2V9RA 4TUOA 2E59A 3FT3B 1BD2E 5B3JF 4OFVA 2V9QA 4AUJA 3JCZA 4LLWA 1X5LA 1QUPA 5DZLA 2IU3A 3W11D 3T4YA 3VG9B 5DUML 3U2JA 1BHAA 2EUZA 3WIFB 1I1AA 4NR1A 3FQTA 1HI6B 3FRPB 4W6XB 1RP3B 4GS7C 4NAMA 3N04A 4KHXL 3ESVF 3O6KL 1N34O 1BEYH 3MV7B 4U2YA 3AG1B 1WA0X 3B2XA 5FFGA 2BNUB 2RTTA 4JDTH 3CCMV 3BA8A 4OCSL 2ZCLL 3PDGA 4E2OA 4LMQE 4RRPA 2OQJB 5ERWB 2X4SA 4QHUB 2ZCEA 4JI4B 3TWYA 3VXQB 3ZL4H 4XI5C 1NH6A 3WFDL 1E1QG 1F4NA 1T7VA 3UEZA 3QZPA 4HGWA 2ICCA 3N1FC 1YQVL 3P0VH 2XXMB 2ICES 3QNZA 5JQIB 4UIKL 2ED7A 3R1GL 2EDDA 2DWEA 4KQ4L 2RMNA 4UOW0 5DQJA 1X3DA 4FNLL 2Y4TA 1K8IA 4PIBA 5F93C 4QRRB 3BZFB 3WTVA 3Q01A 1KBHA 2JJTC 1OP5H 5CIPA 4RGNE 2OYPA 2YI9A 1G43A 2EIKB 2JGDB 2BXZA 4ZTEA 2NR6A 4X8JA 3NEOA 4JM2C 3JD2A 3D36C 2WIMA 3SPCA 2FKXA 3HZMA 3QIWC 5A43C 3N91A 4TUKH 1ZLVH 2WXRA 1SJMA 3DOSA 3GSNB 4Y1AE 1YSCA 1L3NA 1KCUH 1R5VB 4GPVA 4PV8B 1G7MA 4NTXA 2HH0H 2NY6D 3PS6A 3MKGA 1F97A 2AABL 4IGGA 3MJ8A 1F3JB 1U8IB 4FZ1A 3ABGA 4LVOB 3QNXB 3BPOC 2WUBL 3TV3L 2VB5A 4KJQC 4MGXA 1VADB 5HGHA 4RAVA 4PRIB 4YHPB 4WLCA 3UZQA 5CGMA 2Z7ZA 2M26A 4X8CA 1A65A 5IMLB 5IWLC 2XFXA 5ITZB 4K2UL 3RIKA 5DD5L 4XBEL 5JXED 1E9OB 4DZBB 1EZVX 4HAFA 5D4QA 2DYPB 4C58B 4QYAA 3LRHA 3GSUB 4FJZA 5TPWL 3ARFC 4Z7QE 5FDYA 4AVKA 1N32O 1GGBH 2ZF9A 5H35A 2EYTA 5D70H 2VDLL 4P9OA 3B2UC 4UM8B 3TF7C 2F6AA 4FYTA 3KDMB 3HUJA 2W38A 5IB1A 1IM9A 4F93B 1QNZH 4QXWA 1R3JA 3MJ9A 5GGUA 1CL7L 3KWTA 1P49A 4OT1H 2Y7MA 3ZRCC 4DGIL 2RN9A 3LSSA 3V6OA 4WFBV 4G7VH 5F9OL 5CBAB 5HYJE 5IV2B 5F88B 3SKMA 3VSVA 2F66C 1WFIA 4HLJA 5KYNA 1RU9H 2CGOA 1NCWH 4FQXC 1PKQB 5K33A 3MOAL 3CG8A 1J5EO 4KKAC 4ELKB 1SY6H 1XB6A 1OD9A 4N6RA 3QCVH 2GUZA 3P3PA 1U3HD 1YYML 4NI3A 5D7KE 1ZT1A 1GY2A 1ZL8B 5LBVA 4JFQB 4MQXC 3ZMVA 5KS9F 1E6JH 2WIIA 4TV8A 3DK2A 2CIIA 5HD8D 5ESAA 5E00A 1TUPA 2DQIL 2VLJA 3TX4A 3WN5A 4NM8H 3RVTD 2LAAA 1XX9C 4OQTL 2A9DA 1HXYB 1PVHA 5GS0H 2UUCO 3F7YB 4RAUB 1H8SA 1YTFB 2C9AA 1UJ3B 1YC7A 1EUTA 4XNXH 4YQXH 2LJ2A 5J5EA 2KUTA 4HXAL 2D0GA 1B3JA 5SX4H 1UD5A 5FUCE 3QTCA 2BVUA 1GGYA 2WUCH 5I66A 5MEOA 1VQOV 1ZEAL 2CGYA 1PD0A 4HC1H 2FR4A 3U4AA 3NFNB 4ZOCA 2Q7YB 3QJRB 1P7BA 1LUVA 5IFHL 1K4DC 2LLGA 2ZKOA 4R4FH 5KN5A 2PYEB 3HKBB 1C1EL 2C3HA 3CFCL 3F7VC 5ID1B 3RWRD 1BP3B 3W3BA 2UUAO 5ALCL 1F6LL 3QPKA 4GW5B 4PJFB 3PYCA 4Y9GA 5T1KD 2YQBA 2GB2A 1AQDA 5E8OA 1ACZA 3CSYA 3HC4H 3VCLB 3ARGB 2J71A 2HT3C 2E7DA 4W9KC 2X9ZA 2GTWB 2UXXA 1A7QH 4IRJA 1DL7L 4ADJA 1KGCD 4KNSA 2A4ZA 2XVKA 5IQ7H 5CCHE 5J2UB 5AAMA 2C9XA 3VQYA 1B4TA 2P46B 1S5IL 4P46A 4R0LB 2YPKB 4MFHA 2ZXEB 1IGIL 3EGDB 5FB8A 1VP7A 5CMUA 2YD1A 4F5CA 1TQTA 3DXRA 4M48H 4F1SA 1M9NA 4YXHL 1U3ZA 1QO3A 1UC6A 3G67A 4R3SA 4Y16C 5DMIH 1KJVA 1W2KT 4U3XA 2VXUH 5D96B 5A2CA 1MCPL 4M8QB 5EORH 1K9MW 5DJYA 3SGDH 4V11A 3CZNA 1AVAA 2GJ6E 2RGSA 1ZSDB 2R29L 3G08B 4NJ9L 3V0AC 1Q72H 2BFVH 1IEBB 3IU4L 4M5ZL 5T1JA 5IB3A 4J41A 1TF4A 1YUHA 1PD1A 3Q1SL 2YS4A 5HHQB 3GJFH 5IMOB 2DIEA 2B2XH 1G6RH 3DXAD 5EEXA 2ZXBA 1EZSA 1CBVL 1NBMG 1KQSU 2W0FC 2XJLA 3MNVB 4PJGB 3ZE0E 5HVWA 3TT3H 3OR6A 3GPEA 5DMYA 4CSTA 4DEPB 3Q2LA 3UTZA 1CLOH 3ZQXA 5TF0A 1AOHA 1WP8A 5T5NF 3SY0A 3I3EA 4CH4A 3VXPA 4AYFA 1EFXA 5D1QE 1Q6IA 5F3HA 4EB6A 1O7DC 5TDOA 1LEIA 5IYZA 4IK6A 3H0TB 2DQJL 2HJFA 1ZTXL 2AEOA 2B59B 3C5ZD 4Y2LA 3LHPH 2VW4A 2WZ5A 4M7LL 2BRQA 4ECNA 4GYBA 1BZ8A 4G8AC 1KD1W 4EEEA 1WISA 1QBMH 4LU5L 3TM6A 5CP7A 2YXHA 3R7QA 4XPHH 5HYQA 1I7ZB 4U1HB 3CVHA 1DFXA 3H1JH 4IK7A 4LF4O 4M1GL 2VR7A 4FPPA 4QOKB 3SDDC 1LR1A 4GSDH 1A1NB 4PGCB 5E9AA 3HHRB 3PY9A 3TONA 1URLA 1DBBH 3DV6B 1ZGLB 3KM1A 1R3HA 4H8VA 1YAIA 5C8JA 4Y9FA 3T2MA 1LEGB 2MH4A 3IGLA 3FKSG 3G9AB 3VACA 5E99L 4BWWA 1KENL 3TEYA 3ZRWA 3WTUA 4KJWD 2A73A 3ZY7A 3E86A 5D8JH 4YE4H 1ACYH 5D1XE 3WHXA 1FL5B 4X99A 4AI7A 4IBQA 3Q9PA 4UU9B 1YITV 4N2BA 4OIIL 3JYCA 3FUJA 5C09E 3UPRA 3IEAA 2JS3A 2ZPKL 5DI8B 5LCVA 4LRNL 4M1CD 1OCRB 2WWNA 3PAZA 3QR0A 3OW2U 1F4YL 4FI6A 4EZKA 5FYKL 1R3KA 3CCRV 3DJSA 3CVHH 2O93L 1KP3A 4UIMA 2F9BT 4XPAH 3SE9H 1BW8A 3GK8H 5HY9B 1FL3B 1XGUA 2V0AA 4U6XA 4YDLC 1I8MB 3ETGA 2CM5A 1XT5A 4TSCL 2WQVA 1S9WA 1MUJA 2FGZA 2VDQH 4NKGB 1DVFA 3L81A 3MRCB 1U8LB 1G0YR 1W91A 3VXUD 4RNRA 4JM4H 4PEEA 4PJFF 4MMYB 4OFQA 2YAPA 4BELD 4PJIE 1DQDH 3LZFH 4LLMA 5DEFB 1AZVA 3QAQA 1QAWA 3HE6A 4NQXB 3GM8A 3G5YB 3NIFF 2QSCH 5FM4A 1TJHH 1HOCB 4QY8B 3VUAA 3ZE2E 4LOUD 3IN2A 3MNWA 3WEXB 1E8ZA 4MVBD 3W7TA 1QA9B 2ZE5A 3Q7JA 1Q9KB 3BESR 2MPVA 1T5EA 1KYOJ 2AV1B 1SHXA 1G6RA 1SQFA 3DROB 3MV9B 4AYID 2VXQH 4AENB 3ILQC 4XNYL 2F53B 3QRGL 1E5UI 2OMYB 3ZRSA 4CBPA 2DMKA 1JPTL 4JI6B 1BJ1J 5EC1A 4ORGB 1SVBA 1UWEL 3PP4L 5FF6B 3ZQ9A 4L3EE 4UCRA 2H2PC 1N5AB 3H9ZA 2XZCL 2E75B 1IGCH 3UBXI 4BFNA 1OAKH 2C9SA 4JV5B 3RP1A 5I71C 4IIZA 1JX9A 4IGBD 2JB6A 5JLZB 1EVTC 1KYOK 4KHPB 3CX5K 3HUJE 1G4RA 5D7HA 4MWFA 3VFSB 2B08A 2EDRA 1DYZA 2UZIL 4FLHA 4AEIH 3OEHG 2F54A 1QZNA 2EE9A 4UVCA 2QADC 2E86A 1O9HA 3HBZA 1K5SA 1J8HB 4K94C 2UWEB 1BF5A 4ABWA 1QNMA 2GJZA 2G5BA 4NN7C 2XG4B 4W4OA 1IQWH 2FEDC 4MMZA 1NGYB 2XSKA 1E6OH 3APQA 4LRIC 1F4MA 1Y1UA 2WLKA 3CD4A 4AGPA 1WAEA 2Y0SA 2IH8A 2L6LA 2VN7A 2VR4A 3FO2B 2H8PC 1WJZA 3Q6FA 4HUXA 5J3HD 2DW4A 1JPEA 4I8DA 4AV0A 4Z5RB 4LF3A 3I9GL 1A7BA 5BVJB 4PCYA 5CBFA 4HV8A 1CZ8L 2VLJE 3CZGA 1QEWA 3UBXG 4DK6A 4CSSA 3UC0H 1QFWM 2C5DC 2Q3AA 2VE6A 4PA9A 1CICC 2YD2A 4KVPA 1L9QA 1N0LB 2VLRB 4PRBB 3WCYA 4QHPA 3FUMA 4EZMA 1RCYA 1Z5HA 4I9XA 2GK0B 2MCPL 1HH9B 1HX0A 2W0KA 4GKJB 4TVPH 3NVQA 2PI5A 1Q38A 1XGYH 1R3IC 4GP5B 4I1RA 3VWJD 1R6VA 2NLJB 1MCFA 5GRUH 4CJ1A 2AZAA 3Q9QA 2W92A 3T0WA 2AVGA 4JEGB 3TZVB 4ZAKA 3DSNB 4PJCF 2MTAA 1DP0A 4GW1B 1HS6A 2P8LB 4YC2B 3RE0A 2PWGA 3SKOB 5E6SB 2YRBA 3K2MC 3L9EA 4BWTA 3L9DA 2F5BL 3EDKA 4FQCH 4WFGE 2I24N 3CLFL 4XO4A 1M4KA 4FLTA 4QR7A 1S5HC 2WCGA 1LO3H 3LYRA 2J2ZB 1VFAB 4KRPD 1J12A 1ZT4B 2AF2A 1RSOB 3P4OB 4FYQA 1QR8A 3BRFA 3D39D 4GFXA 4R90H 1THCA 1AOZA 3UCQA 3G04A 3Q44A 5DGRA 5KJRH 2Z31C 2EUXA 3O6KH 4E41D 4J23A 1AZCA 1YEGL 2OTLV 2VXSL 3KGRA 3N1QC 3NJVA 4G6AD 4XH2A 3V0FA 3RPIA 1LP9B 3B2VL 4H8WL 3F6JA 3CZFA 1N8RW 3GBNL 1A5FL 1H6UA 4GIAA 4PG9B 4PY7A 3M45A 4QRTB 1X5YA 3QA3A 2ZAHA 3RYHA 3G6AB 4LSTL 4PW3A 3SCMA 3A67H 4A1RA 5G5DA 3BGFC 4G7RB 3FCTB 2P5EB 4B3EA 4ZBMA 1WBYA 4AXWA 5IVXF 5JNYA 1USQA 4X0NA 2VL4A 1F1DA 3QQXA 3BVVA 1JPSL 2ISDA 4I9WD 2CHXA 3FZUD 3B6SB 3DX8B 1X5ZA 3GMNA 3HMWH 3LIZH 4P4RA 4WHTB 1UB6B 1A3RL 3R1GH 4I0KA 5AAMC 3VW3H 2QVIA 1JXKA 4RMWA 4DR6O 5BV7L 2AJUH 2FB4H 3RW0A 5E6IC 4N8VA 1HDJA 5C7XH 1LO2H 1SM3L 1SYVA 4C4KT 4IS6A 4DWHA 2B3IA 5I1JL 1HCVA 2HHHO 2DQ6A 2P24A 4MMZC 5EO1A 5ICYB 1O7VA 1I5YA 3JVFC 4MS8C 2QSAA 5IEHB 3CC5B 4KMTL 3KWUA 4GQ9H 3RZCA 2AK1L 5D7JC 2E6QA 1WGVA 1MCQA 1U41A 2A6DB 2YQ3A 4WUKH 2ZKHH 5EG6C 1Z9SB 4QE7A 2VKWA 3ZSTA 2DQTH 3OKEB 5D2LB 2A6IB 3KPLB 2RCVA 2HH0L 4QRFA 4R50A 5HHNB 5EZYB 4OV5A 1QTYT 1BAFH 3QG6B 3MGOB 4K9EH 3T8XA 3DHUA 2R8SL 4L8SB 4MYWB 1H9DA 3OJ2C 4K3DH 2VRAA 4P07A 5C0IA 2WM0A 4E41A 3T1YO 1QZ1A 5D5PA 3U6XS 2HPOA 3FB7B 2FX9H 4CC6A 3VQWA 4H5SB 5AOMA 5F7YC 3U82B 4HOXA 5BCAA 2JMRA 1SF3A 2QQQA 2R0KL 4GUPA 1CD0A 1HNGA 2PYFA 1J8RA 4EKJA 3FU8A 1V54C 1DSFH 1NDGB 2O5ZH 3HZYB 3D0AA 1X9QA 2DMGA 4BKSC 1D5NA 3K0WA 5IW3A 4HJGA 4DO2A 1VQKV 5IOPB 1GGBL 1NTZH 4QAWA 2O6CA 2N05A 2VKXA 2BIPA 2IPTL 4N0YH 1QSEE 4PGDB 1WHOA 5A2JH 4YH6A 3S3XA 2CALA 1U8OA 1CL7H 1H5BA 3T08A 4DGIH 5B8CB 2O5YL 2QVKA 3SDDA 5TGBB 5EUOB 3WO4B 3EOTL 2NUTB 3WKMH 2DQ3A 2JJUA 4KQ3L 1IAOA 3IFOA 4I0PD 2XV0A 2ATPB 4NKMA 2ZUQC 3IMRA 2ZE8A 4KRMB 1BCIA 2B0SL 2FSEA 2N1TE 4P2OC 4WSKA 1JOYA 5FUOH 1KTDA 1JZJA 3ARVA 1YYMH 2ZX6A 3HAEG 3U1SH 1R3JC 3CFDB 4PJXB 3AUVA 4YDIH 4IOIB 3ZHNA 1WZAA 3D3QA 3C08L 5BV7B 4ABVA 4XP1H 4ZG1A 4JL1A 4DR4O 4OCNC 4EI5A 3WS3A 1Q0XH 1AD0B 2LOEA 2ZOWA 3J81N 1T22B 3MGTB 1JV5B 3S5LG 3UADA 5FC9A 3VAEA 4WO4D 4POZD 3MRBA 2B5IB 7FABL 1KFAL 3EOYG 3CV5A 2OWOA 3KYMA 1WH0A 3H3PL 4KI5E 2EXSA 2P8PA 4NGHL 4F7PB 2YD6A 2H6OA 1Q9WB 2G9KA 4G9DA 1SQXH 5F7DA 4DKAA 2WUCL 5JQGA 5FFOA 2WN2A 3FH7A 3RX8A 3MQIA 4BYHA 1UT1A 2JJ1G 1OV9A 1ZEAH 3H9SA 4LSRH 3WB2A 1FO0H 4OAWB 2ITCA 5JHBA 1XF2B 2X4RA 3WDJA 2MNWA 1DFBH 1T21B 3L3OA 4NERA 2AJXL 4ENED 4NC0B 2X6BA 2Y1YA 4GNKB 1R24A 4IIQA 4JY5H 3MA7B 3SJQC 1B0WA 5B4MC 5JPMB 1J5HA 2Y1VA 4H20L 5EC2A 3TBSB 3QDJA 3MRPA 1HNFA 5LGTA 3B7UX 4LF5O 1DTUA 4LF4B 1E2VA 4WFAV 2F7OA 3S35X 1CCZA 1HAUA 2CLVB 4O4LA 4JPKH 1SJEB 5ACMA 1NC2D 4P99A 1NEZG 3PHAA 2EVHA 5FO2A 1ZA3B 4MB1A 5J13C 5GISH 3KPTA 2QKIA 2O30A 3FD9A 3UTSD 4Q6IC 5GGRA 2Q8AH 3ZN6A 4Z77B 4M48L 5FF6A 2WKGA 2R1YB 5IF0A 2GSIA 4HEME 4JZOB 3HW7A 1EV2E 5G4MA 3T71A 3A23A 3RUGF 2ZP0T 3A6BH 4XO9A 4APXA 2UUBB 1WUNT 2HFTA 1MHEB 1J05B 5DMIL 1H2NA 1UXSB 2LW1A 3LSOB 2RCSL 2WLNA 3SO3C 1MCPH 2HJLB 5EORL 1JQ0A 3UBXA 5KYYA 1RIHL 2BIOA 3EH3B 1I3UA 2XBDA 2H6PB 3I3BA 1NMAH 1OD7A 1S9XA 3MCYA 4C57C 1VDGA 2LTQC 3ETSA 3KPPA 1BZ7B 1ET5A 2GUYA 5FM5O 2VZUA 3SJVA 1JZ6A 3ATFA 1BXAA 1JHKH 3F2LA 4P5TA 3Q1SH 2GSGB 3OTOB 12E8L 1AIFA 4JFEB 5EBGA 3VQVA 3BH4A 4NKOB 5BXFB 3BLPX 1I82A 2VQEO 2HFEB 4PU2A 4NXNB 4TSFG 2AKRB 2QV4A 3QDGB 1IGJA 1WC7A 2X4PB 5KSUB 1P4BH 4CADB 4KXRA 4OLVH 2ADGB 4CRPA 5F9WC 4QHMA 3RWEA 1AGEA 4AOFA 2P4VA 4O2AB 3GXMA 2UXCO 3ILPB 1DN2A 1D9KB 2WBWB 4JRYD 5G4OA 2ZAIA 3HZMB 4FQLH 1MQKH 2EDQA 1F11B 2ENQA 3IJHA 3MOQA 4NXNO 5ANMA 4NOFA 5INCA 4AYGA 3BCFA 4GRLD 4KXZI 1MY5A 3D30A 4UQBA 4Q9RH 2ZNWA 2DTSA 3DJRA 4QRRD 5CJOH 3GMQA 1I8IB 4OTXH 1NSNL 4OIBA 1HNZO 1KC5H 4FFYL 1MAML 1L7TL 1TQWA 3WNMA 2NSXA 2BOBB 3UT5B 4CGTA 4TUYB 4KKAD 1FBIL 1PF3A 5SWSB 2BZDA 1QSEA 4RCAA 2CTWA 5DZAA 1NTMH 1NC2B 4Y9EA 3B9KB 4R7DA 3GLZA 1L9MA 5C0ND 5EBMC 4YHHO 1BGYH 3VI3B 4P9ML 2BJML 4WW1B 4Y5VC 4I85A 3BKYH 1CLZH 3L2NA 5JW3L 1HIMH 2WLYA 4NN7B 4YIQB 5FXCH 4RX4D 3L3KB 3D8CA 3T4AB 3BVWA 2IGFL 3ZMTA 3O4LB 4DPRA 3OAZK 5K1PA 2W0PA 2QE7G 1OHQA 3HUJB 4IGBA 2FJHB 2WZPA 4J8RA 2J1YA 2PN5A 2C7UA 5AVRB 2F53D 5AW1B 3RVUD 4A7GF 4WK0B 4ZUWB 3QIWA 2BC4B 2F8IA 2YZ8A 4OFYA 2WXNA 4TRPH 1PTZA 1LEKB 2NDGA 3CZFB 2ITFA 2DYPD 1H2LA 4Y5YB 3RYHB 1KJ2A 2O6PA 3QIBC 5L2JA 1N7MH 1A4AA 3S8WA 1M3IA 5C3IA 3NSYA 5LP6B 1RK1A 4ANKA 1VCBC 4FM2A 3BAKA 3DX7B 5FM5M 4WZ9A 1ZHKB 4NFCA 5JWPA 2OTPA 4P5MA 1VACA 3D3VB 3OTFA 5EUOF 2QSCL 1JN6A 4DVRL 4C47A 1KXQA 3BLKA 2DBLH 4J11A 2G75A 2KC0A 4F9LC 3PL6A 2WXQA 3EYOA 3FONA 1KG0B 5F97E 4LXFA 1YNTF 1SKVA 2J20A 4MRCA 4TV9B 4FTVD 3SKNB 4LASL 3ARBB 3K6DA 1A4JA 2FECI 1PL0A 1JTPA 4ZI8A 4X8AA 3AUWB 1NLBH 3GBEA 3VX0A 3M6DA 4H1LG 3L4XA 4HNAA 3TBYB 3V7AE 4BZ1A 3HI6L 3ARZA 2CJUH 4OJAA 1NPNA 1MIML 5D5MB 5DU7A 2GTZA 3PGFH 2CLRB 3X11A 1ZV2A 2F5AL 5FYLD 3VWKA 1MMMA 2Y0IA 2PPFA 1E4WL 5IW1B 3H55A 3D39B 2ADIB 4M62L 4P4KC 2D2CB 1JK9B 4LGPB 5DQDH 2VDKH 5E4OA 3MN8A 3K08A 2EE2A 4GP4B 3CAFA 1BZEA 1JZEA 1T66C 3VFWA 1XIWA 2BIQA 4Y9CA 4NJAL 4BD4A 3CSYB 2QELA 1G4YB 1I3GH 2DI7A 4ZPTB 3F7LA 1P1ZA 4HT1L 4PYGA 5D1QB 4MTOA 4LPYA 5D71H 3E89A 2XZQL 3IJ9A 4MAZA 3UAFA 1FNEA 3HFML 5EO0A 4BZYA 2AFNA 2HUHA 4K3EH 1IQWL 1LWRA 3L9BA 4HJGB 5HI3C 1U4EA 5IOPA 2ATKB 1K3ZA 4MDJB 1BHGA 3REWA 3LSQA 2ZR2A 2P5WD 4WUUD 3ES6B 5J1AA 2WBJB 2R2CA 3N1GC 3S88L 2QT6A 4R4NC 1KT2A 4FJ6A 2EH7H 1KWKA 3L71H 2FBOJ 3EJRA 4RBPH 1OAYL 4KGJA 4ES9A 1SGKA 5JIPA 3C5ZC 2BWIA 4NO3B 2CO4A 3EXLA 4PJHB 5IM7B 5C2BL 2D7TH 2QA4V 4BIOA 1RH8A 3FHEA 2GV9A 4U3SB 4WHYH 2GAZB 4HULB 3STBA 1H3WM 4Y19D 3S96B 2WWMD 4R4BB 1OP4A 2HA1A 4RMBA 1M1SA 1SXZA 2XNAB 1X5FA 1J9CT 3FSAA 3GD1C 3QUXB 2NOYA 3VWKD 4Y88A 3Q8FA 3HE6D 3TN0D 4DK3A 1U92A 1NKDA 4G28B 4QRPE 3GRBA 2QPUA 2G60H 3BD3A 3M07A 1LJMA 2IGLA 1GTFA 4U1KB 3UBFA 2FJGA 2F5BH 4JKWA 5LQBH 5EULV 3U30B 2EIDA 2H41A 3PUUA 1BCCH 1LO3L 4RLDA 1WZ1L 2HJFB 1NEZB 2B59A 5MEQB 2XX1A 3KW8A 3WFVA 1M56B 1BSMA 1KLFA 5C07B 4N8VG 4LCYA 4RBPK 5AD0B 3MLRH 3MDJA 4KZCA 2A83A 2XRAL 3JVGA 4BFFA 3B2VH 1T7WA 3MA7A 3PWNB 1KEMH 2IWKA 3KPNB 1ZLDA 1OM3H 3F62A 1V7MH 2R56L 1KIRA 1H0DB 4EN3D 4OLZL 2AHYA 5HGDB 1FQ9C 5KVFH 2ZT9B 2R23A 4RH4A 1EZUA 2FQDA 1MFVA 3RVVC 3QS2A 2WGNB 1RLBA 4UCFA 4I0PC 2IQAA 1A7NH 4BW9A 1A3RH 4L5FE 4XCCH 4YNYA 4YVUA 3NZ8A 3PJSB 2D31B 5F0JB 3TYFB 4DP8X 4Z3EA 3L8QA 4PPTA 3UPRB 5E95B 4TQFA 3GTTA 2XWTA 2LP7A 5BV7H 2AJUL 4LFBB 1I5XA 2FB4L 3TFKD 1ASQA 1W6WA 2XPYA 5C7XL 2FAUA 3QNEA 4R97B 5J1TC 3EOAA 4O2EB 3A22A 4A6YL 2YXFA 4A66A 1UXSA 1O9GA 3T0EC 3WELA 4KMTH 4RWHA 4XCNB 5JDJA 1VB9A 3T3ME 2EINC 5GGQH 4FE9A 2L7EA 4TL4A 4I13B 3VGFA 5J2TA 2PXYD 2DQTL 3I6KA 3S2AA 3OHXA 3U4EA 1AHMA 1II4E 35C8L 4QHLB 4P5TB 2YAOA 3GMRB 3K58A 1QLNA 3UM7A 1WB7A 2JCWA 1VEWA 2KQNA 4L3ED 3CC2V 3HE6B 5FWRA 3EJYC 3FQNB 4U05A 3SDAC 2XWEA 2TAAA 4R7CA 3X1FA 1HYSD 2FT7A 1YEHH 3VXQA 1TZHA 1Q9KA 3AM8C 2VM4A 3H4FA 3MJWA 4NCC2 5HYSG 1CK0L 4WU5A 2ZTBA 1G9NH 3ARDB 5D7LA 3RRQA 3N50A 5BV7C 8CGTA 1A9BA 3P3TA 5HGBB 3F84A 5IV2A 5SX4I 3HHSB 4DQAA 3DX6A 4FJCC 4TM9A 3IJHB 5ANMB 1A02N 2CA3A 2XICA 1QFOA 5DK3A 1XMQB 1WN7A 3OXSB 1NC4A 2AQ2A 2KQMA 2EDKA 1L6PA 5GRXG 4K7PL 3V9FA 4ZNEA 3OZKA 4OVUA 5EZIH 5I75B 4DR3B 4J3UA 1ZT1B 5IHZB 1UXMA 4BE6A 2PO6A 2I9LB 2GJRA 4YHIB 2DKMA 2Z35B 4D0BB 3FK3A 2WANA 4KQ3H 4OCLC 2WYHA 3ZHRA 1DJGA 4GAJL 5HPMB 1RK7A 4MWFB 3UAJD 1WAPA 1J18A 5IBLC 5DCCA 4CH6A 1EEYA 5JPNC 1JA8A 4H26A 5FUOL 4PCSA 1NIBA 3BOVA 4U33A 4XNMB 2XG4A 1HQRB 4PYHA 3S8GB 3OKLB 1D5AA 3EBHA 5LBSH 3SZKC 1PLBA 4B5ZA 2GEQA 4YDIL 3B7SA 1Y6KR 3FO9B 4PMFA 2JJWA 4NO5B 4MJIA 1QD0A 3ATEA 2NW3A 3BJ91 3QK0A 4JFED 4QRQB 4QOKE 5T1KB 1U2YA 1NLDL 4F8TA 3INOA 4BGDA 3H1IH 4IBTA 4J8RB 2OAAA 2CRIA 2FL5B 3IFLH 1LHZA 3LV3B 3PWLA 4AKQA 4ZYKA 2EIZB 4DPBX 1IILE 3OLIA 3U46B 2XKNA 5CBEB 3SO5A 3Q0HA 4FLVA 1MCRA 3ABLC 4XCFL 1E5YA 5DRZB 1VQ6V 2OK0H 3L5IA 3MODH 5CN0A 1JOIA 5FECB 3TK1A 3FS9A 4PJFA 1KCVL 5B1NA 1UM5L 4U1GB 4TKWA 4P5TD 1MRCH 1JWMA 4XP9H 1NFDE 4AITA 3ULAB 4ERSL 1QFUH 4BIZA 1T5XB 5I0WA 4QRPA 1HH9A 5I15L 3HAEH 5I30L 3LIZA 4HLZG 1UZ8A 5ADOL 4BFOA 4BXSV 1BMZA 3KL3A 1U8HA 5CGTA 1DQJB 1ZV9A 1W80A 4GRLC 1S8DB 4C56A 2CDEB 3GNMH 2PPDA 3NIGB 3PNWB 1OAXL 3X17A 2ZZUT 4N2LA 3SDDD 4HFWA 4AM0Q 3NIDE 3EYOB 1BYPA 3FQRA 4IBYA 4V1DD 2EDWA 3IMBA 4FZEL 1HR0B 4PRPD 1XZWA 3EFOB 1EHNA 4ELKA 3PPSA 1ENVA 4DUZB 3FF8A 4OCSH 3JD1A 5DJYB 2PGGA 2A9NL 5E23A 1B04A 4KJWC 4DTGL 4G70B 4AIZA 2J2ZA 4PTUB 1BQUA 2IADA 5F71A 3OSKA 4ZMXA 3IVKA 5KVGE 3ZE2B 3FNKA 2OCFD 4RRPG 4B3VA 3T4DA 3CMAV 3QYMA 2X4OA 3O3AA 1XDCA 1OT2A 1NWOA 4PVMA 1UXWB 1GM7A 1BXUA 2Y24A 3MV9E 1DUZB 3VFWB 3AK1A 1H38A 2IPKA 1PZBA 5C0BA 2CRZA 2VN3A 3E3QE 3UTZB 4Q9CA 3LXAA 2FGWL 4FQ1H 1IL1B 1VZGA 1UCBH 3AMLA 1FNSL 2MPAL 3FTXA 3HAEB 4OLUL 4MCYA 3KL5A 4OLYH 5EO0B 4QF1B 4LEXL 5IHLB 3NFNA 3B6SA 3DX8A 1BQLH 2MJWA 3K0GA 3IGFA 1XSJA 3H0TA 4NP4L 3P3RA 2VQFO 1BOGA 3EFFB 3PWJB 1CF8L 3O0RH 3TIDB 4B9CA 2H7WA 1RZIB 2WVUA 4ICWA 3VXRB 4K71C 2DW5A 5L9DH 2TRHA 1GKOA 1OB1A 1QLFB 3ARGA 1KT2B 2GTWA 4IRJB 3VH8G 4CC5A 5DLML 1JDDA 5MP6H 5C9JA 3KCPB 4Q2ZB 3KW7A 3C60B 3EYFB 2J6EL 2DM7A 3GB7A 1WAAA 4CC0A 2EILC 3JV4A 1QUNA 1YY9D 4XP4L 4MSWC 2NZIA 5IVXA 1GGIL 2ZSVB 2A6IA 2CTRA 3KPLA 2BCKB 3QZNA 4FXKA 4FRWA 4JZJA 5HHXH 3IYLW 5AEAA 4BA8A 1C5CH 1LD9A 3T8MA 2WTPA 3QAZB 3G80A 3WKYA 2H2PD 2WNGA 3GZQA 3OWRA 2UXDB 5TPWH 1OWRM 1JVOA 1FL5A 2JTDA 1AY1L 4ZUUB 5EF0A 5I8KL 4CBZA 4LFAO 3BPNC 3LN4B 1M7XA 3B2EE 1YDPA 2ICWA 4JKNA 1IC0A 4JFDA 4ZDHB 4XMPL 2YSTA 4UBDD 4OZFH 2VUOA 3GI9H 1F6AA 4ZUSB 3RWGA 1SDYA 1XF5A 4DRXA 3T77A 1OV8A 5IKCB 1FJ1A 4PLKD 3OQRA 1NDTA 3CZUB 4QXUH 3HG4A 3ZUNC 1IM3B 1E0OB 4G9FA 2OR9H 3DIDA 2G4GA 1IBLO 3MUGB 5ECJE 1NOLA 4CA4A 2X4NA 2IGFH 3SPGA 1TT6A 2A74A 4OVVA 3ASOC 2BS9A 5JOEA 4G6JL 4RNRB 4X5WA 4DKTA 1W59A 4W6WB 4D9LL 3VI3E 1DJXA 5JR1L 1I1AD 5BPPA 2NUTA 3VD0A 1E6JL 2VR8A 4AMWA 4XN7A 5GS0C 3K3QA 4LVNC 3VXPB 5E6ID 1EHKB 1YHQV 3CXHJ 1J8SA 2UYLA 4NM8L 3OZ9L 3A6CH 4C83A 1YQ2A 1F18A 4U6HA 3GXDA 1ASPA 2KI6A 4MLSA 4TLKA 4D9RE 5CIPH 2Y22A 4XNXL 4LDLB 2D03H 1S7UA 2ZG3A 1EXUA 3GIVA 4XNQB 5I1AB 1K4CB 1LE5B 4KP4A 3TCTA 3FH5A 1AKJD 3GSQA 4G42B 4JE0A 5DS2A 3FSVA 2QDWA 2VDPH 3QR1A 2EE3A 4JM2F 4F6RB 3QPQD 4K0KO 1FHGA 3F01A 4HC1L 3HZVB 5GRZA 2O72A 3TGUH 1NFIB 4YSCA 3X1BA 4HLZH 3U0WH 3TCLB 3ML8A 3EOAB 3PG2A 2AZUA 1Z66A 1SERA 1IKNC 2BNUA 1ZSPA 4P2QB 1DBMH 2NY4B 4OGZA 2JB6B 5TJWK 1Q9OA 5JLZA 3P9LB 5HGAA 3IGKA 4D0DA 2MHAB 3BSZH 4NB7A 2E7LC 2H32A 4OUUB 2COQA 3EHBD 3IJ7A 3HC4L 1AIZA 4YBHA 4LKXB 2H94A 1EMTH 3BP7A 2X12A 5AW5B 1T7YA 4HJ0D 5K93A 1U3JA 2YD7A 4KZEH 1MIEH 4BQ6A 4MXQC 4JFEE 3GKZA 1FYTB 1AH1A 4F8NA 5EU4A 2HUEA 4GKSB 5CKGA 2VMCA 4XPGL 5L8JB 3FQNA 4WI0B 5DQDL 2L35A 6TAAA 3VM7A 4AMKL 1N68A 1MW3A 1W0WB 2JF1A 3TS8A 4NRYB 1XF1A 1IKOP 2ADJB 3S3DB 4G7QB 1NJ9B 4F80A 3L6FB 3D39E 3CPLB 3RYIB 1YEFH 3QQ9D 2FX8H 1O6SB 4I50A 3B7YA 5DEFA 5JIIA 1Q72L 3LKOA 2ORBL 4N5EC 3OKDB 1JWUB 1IGFH 1PY4A 3K0DA 2AJZA 5FLVA 2J8UB 4M5ZH 1AG0A 5IMMA 4H0HB 5GS1A 4UOQA 2OULB 4J7KA 3MLZL 4QPJA 3BX7C 3VYOA 3ORJA 1WB8A 3IC9A 2JJ2G 4ZMQA 1QBLL 4AW4A 1FNHA 3N1MC 4U3HA 3K8KA 5IQOA 3PP3H 5F0PB 1KTRL 4L3AA 4S2SB 1OAYH 2ZOUA 2K0RA 1Y6NR 4JFPB 4RAVB 4YHPA 2JK5C 5LXVA 5H8DA 3DSFH 1R75A 1QWHA 1NQBA 1UWXH 4XXCA 4CNIA 5I5JA 1AR1C 1Q94A 4UWQB 4A7GA 4YL4A 4POZC 3A4FA 2Q0OC 4N1EA 1MZZA 1FRGL 1IFGA 3VRLF 4OJFH 3JWNH 4PA3A 4UT6H 4WV1A 4JHBA 3DHMA 1JPXA 4N8CL 3C6LD 3VO0A 4MBOA 3VFSA 1MEXL 1UZ6F 3GBML 1Z6JT 4GMSL 4PJAE 1KV3A 4D9RD 5F6IB 5GGUB 1FNLA 1QBML 1MJ8L 4K07A 4YC2C 4N2KA 4OZGA 3WNIA 2Y72A 3ARBD 5EUKA 4PELA 2PXYA 2R72A 4GLRH 1RD6A 4L5FH 4N2HA 1BD2B 4WFGD 4M8VA 1QQDB 4YHYC 1ORQC 4NVPA 4G1MA 1S7VA 4HH8A 1S5HB 2EH8L 4N6RB 4P5RA 2FDBP 3ECBB 3H4HA 1XNRO 3N41F 2IH3C 1Q1PA 3GMQB 2XV2A 4FXLA 4GRMA 2GIXA 3UXFA 3QUMA 4E68A 1IVTA 4Z5RA 4F4LA 2DF3A 4TTDD 3SYCA 1VQPV 3CFIC 3BUYB 3STZC 3PLYA 4TUYA 1ODUA 1KGWA 4X20A 1KTKE 5IB2A 3MXVL 1AI1H 1Z5LB 3BSHA 4KDVA 3QIUC 5D93C 5EU3B 2GK2A 1N8ZB 4B0MB 4L1HA 3TPUB 1OP3K 4DIXA 2XN9B 4N85A 4PWHA 1TMCB 4LHUD 4JN1L 3EYUL 4YFLI 1A8ZA 1BZ9B 1V3MA 3RWCB 4OGQB 1YEEH 3S3WA 1YN7A 3KH3A 3K2UH 1BJMA 1PM9A 2OJEB 4JRLA 4PSPA 5DRXB 2B15A 1Y18A 4JGMA 3AXLA 4XCYA 3G5ZA 2GC7C 3V6OC 3O3BB 3OMAB 3UPCA 2IIJA 3L1OL 4NO2A 4J5VA 4N2FA 2C7UB 2X4OB 3B7RL 1TQBC 5L3DA 1I9IL 1FZMB 1M42A 4JREC 2HKHL 3L08A 4JFYB 2EDXA 4CVXA 2PABA 5DFWH 4PV9A 4U7SA 4D3CH 2ZUXA 3BD4A 4LSQH 4Z7OF 1UWGH 4CKVX 1SDAB 1ZANL 3F05A 4PDVA 1HEJC 2BSCA 3FT9A 1ZT4A 4HEPA 1GYCA 1JAEA 1DCLA 1MSWD 3B7TA 1O9ZA 4NDMB 2A99A 3FB8A 4UT7L 4TSAH 1J86A 3D69B 1XEQA 1IBDA 1RIUL 3GEFA 4R0LA 4FIPC 1Q0YH 1DZ0A 1EAOA 1Y07A 1T0MA 3IMVA 5F9AC 3FUIA 1BOGB 4MJ5B 4GKOA 3CFJA 4WJKB 3QJUB 4PGZA 2VZ3A 1I7RB 4UT9L 4J7JA 4GW4A 4UV8A 3TETA 3JCUZ 1J8HE 3SDDB 4DP0X 3PJSK 1JGEB 3L2MA 3K74B 2BFGA 2PCFB 5HHPB 2D0FA 1TAEA 1XQ4A 2A1WL 4HKZA 3X2QC 3P32A 3H6AA 4DV5O 1CJYA 2R70A 2WA3A 3EG9B 5AWNL 4DAGL 4F2MA 2QHLA 2DD8H 1A6TA 4I18C 5TFSL 1R5IA 3IBEA 5EZIL 4FXGA 5DRWB 2XAGA 3OKMB 1YJ9V 4CC4C 2BVOA 5DWUH 4BK5C 5KAQF 5MHSD 1R5WA 2F74A 3VFGH 1M7DA 3GDCA 3RVXD 2KLTA 1G87A 1IAIM 2MIZA 2ZCHL 1HJCA 5HHOE 4LPXA 5DJZB 2C8NA 1GZHA 2NX5A 4BZ1H 4XO5A 5HI5D 5MI0C 4EF3A 4J3BA 1VZIA 3V4UL 4GQPH 1QLEL 2Z7YA 3HLAB 1BYNA 2XAJA 4BEIA 5EN2A 5HJBA 5E9DD 1MZYA 2QADB 1CP9A 4X1IA 3IF1A 3O8XD 4I3SH 5LBSL 1CQYA 2L3BA 4HSAC 4R96A 5CB4A 4GKKB 3PQYA 4G6FD 4XBPA 4K9EC 1GPOH 2NXZD 1JVMA 1GRWA 4DVBA 3FB7A 4PJIB 1QR1A 1G9MC 4I48A 2J4WL 2IMNA 5DZNA 3FFCB 1NCCL 2CO6B 3QJQB 3W57A 3MFFB 1KBVA 4OD2A 5H4YA 1COBA 3VD4A 2V2WB 1QRNE 3N41B 1NA8A 1L4IA 3G5XA 4H13B 4RFEA 3SQBA 2CHNA 3ABUA 2IDQA 3EADA 1CXEA 4BZ2L 3MBXL 4L1DA 5H94B 1KY7A 1AC6A 1DN0B 3KMDA 1MCIA 3RUGB 3L5WB 4JG1H 5AAPA 1KIQB 2FT6A 4HK3J 3ZE1F 1E4XI 3LJ3A 3JBG7 5B8CA 1GKEA 1AGBB 2WA4A 2CH8A 2YUAA 1JF6A 1FG9C 2WLIB 2DLHA 1X44A 3F8UB 2DBJA 4Z77A 4FAAB 4XDKA 2ZSWB 2M7WA 5FA4A 3QJFA 3CH1A 5CJXC 4ICGA 2P5EE 3IPFA 3V4VA 2C34A 2VXSH 1MHEA 4Z3TA 3L3JB 4P2QA 2V33A 2VCOA 4X5XA 3MVSA 4FKEA 2DI8A 1G9HA 1Q9OB 4AG4L 4H0LB 3UMNA 1TQBB 3D5OF 4IM8A 2VQTA 2WZ0A 3N2KB 3A67L 1MUJB 1AGDA 2W80C 1EO5A 1G7QB 1DVFB 1J8HD 1IU1A 3OB0K 1MH5A 1NFDA 4GKNB 4FC3E 5DEGA 4J3TA 5IGXH 3E80A 2FZ3B 3FW6A 5BO1L 4HBCH 1CGVA 4B96A 3HMWL 2I9TA 1JV5A 1TVDA 3S36X 5CR1A 1S7WB 2HFEA 3VW3L 4GAYA 1OXYA 2Q2LA 4GKLA 3C2AL 2AKRA 3QDGA 2B4CL 5KYWB 1T2XA 2Z5UA 1IGJB 2Y25A 3ARTA 2AEIT 3CBRA 1M6OA 4DGVL 4E42B 3IDNA 3Q13A 5HDBF 4H2AA 1CGXA 2F1EA 4NIYE 5E6RB 2R23B 4LFHG 3MXWH 1CGWA 4FQ1L 3IRCA 2ADJA 4RZCB 4OLYL 4Y2DD 1L3WA 3ZBMA 3JUZA 2WZPD