1OCRB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 65
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ocrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ocrB02
2B08A 3H56A 1BXAA 2IWEA 4HAKA 5D4HA 3ZBMA 3OQRA 1RZPA 3X1EA 1J5DA 2B3IA 3ABLB 1JXFA 2P80A 1NIAA 3FSAA 4FA7B 3G5WA 4JKNA 2ZOOA 1GY1A 3QQXA 1E67A 2HRHA 1KBVA 3FYEB 2J57A 1ADWA 3ZDWA 1NPJA 3OM3B 1AACA 4RH4A 4Q8BA 1A3ZA 1GS8A 4HHWA 2XX1A 2BZCA 4HIPA 1WA1X 3EH4B 2VM4A 4BXSV 1NIFA 2BP0B 2NRDA 2OV0A 3X2QB 1ET8A 2FQDA 2PPDA 2YXVA 3AZUA 4KNTA 2WO3B 3PAZA 1SNRA 2H47C 3ASOB 3AG2B 2AZAA 1RKRA 4BDVB 1ASOA 1N68A 3PLYA 3QJVB 1N70A 2HX9A 3FS9A 1J5CA 1ZIBA 1BXUA 3AG4B 1NIEA 3X1NA 3KW7A 1OE2A 3S3CB 1ZIAA 2HX7A 1XB3A 1VLXA 2E86A 3V9EA 5E9NA 5EHFA 1L9RA 2H3XC 1CUOA 1JZFA 2FQGA 4E9WA 3NT0A 1WS7A 3FSVA 4G7QB 4L0PB 4DP2X 6PAZA 2CBPA 1EHKB 2IWFA 3FT0A 1AG0A 3AY2A 3T71A 4M4RB 5B3SB 2MRYA 4WKXA 3ZIYA 2GSMB 4CSPA 3HB3B 3NSYA 5TK2A 5I5MA 2BZ7A 3AG1B 2PP8A 4N8UA 1L9SA 2JKWA 2I85A 2BW4A 1L9QA 1FWXA 1HFUA 3ABMB 1JZGA 4E9VA 4YVNA 2GC7C 4KOCA 1AAJA 1ETJA 1R1CA 5PAZA 5I6KA 3NJHA 1TU2A 1SDDA 5B7EA 3EH3B 1AQ8A 1CC3A 1RZQA 2EIMB 4W9ZA 4ENZA 1JZJA 1M56B 3OMAB 2XWZA 2AANA 1GSKA 2PP7A 3PAVA 4QLWA 3FYIB 3QJUB 3NJJA 2GHZA 3DIVA 2IH9A 1A65A 2J56A 3KW8A 2EIJB 1JXDA 3BQVA 1EZLA 2CUAA 3SBRA 1I53A 1SHWA 2WO2B 2QDVA 3T6ZA 7PAZA 3T9WA 3AW5A 2UX7A 1AANA 2TSAA 1MZZA 3SBQA 6PCYA 2Y69B 2YAFA 3IN0A 2CJ3A 1IUZA 4G70B 3S8FB 4F2FA 1A4CA 3UABA 4ZK8A 1KDJA 1AZRA 1NIDA 1W6WA 1KCBA 4KO5A 5D4IA 4AI7A 4PAZA 2OCCB 2X87A 1W6LA 2XYBA 3NP3A 3U25A 4HHGA 4E9TA 3TASA 2RACA 2DY2A 2IAAC 4G71B 4GY4A 4A2FA 1V54B 5B1KA 4YSDA 1JXGA 2EINB 2IDFA 5PCYA 4KNSA 3DKHA 5I6NA 1ZV2A 7PCYA 3QJSB 2CAKA 4JHVA 4A68A 1WS8A 1BAWA 4HCGA 2YQBA 2FQFA 1MZYA 3T6XA 3WKQA 1SJMA 4HCFA 2PPEA 3V9CA 5AKRA 2W88A 5I5IA 1OOWA 1CYWA 3DTUB 1A4AA 3FSZA 4GP4B 4A2HA 4BXVA 2N0MA 2Q9OA 3CVDA 4UF7C 3S8GB 3FU7A 1J9SA 1AIZA 4X4KA 1NINA 5B1JA 2XV0A 3CDZB 1PNCA 3C75A 1GS6X 2GBAA 1MG2C 2HRGA 2BO0A 2TSBA 1WA0X 1J9RA 2VSKB 2OJ1A 1PZBA 4YSAA 3GXUB 1ET7A 3L45A 2PCYA 4G7SB 4KO9A 4F2EA 3FU8A 4DP1X 1E5YA 2JXMA 4KOBA 2CALA 4F7KA 3CZUB 2EILB 1OCCB 4K9JA 1GS7A 2I7OA 2W8CA 3WIAA 4DP6X 4YSCA 1PCSA 1QLEB 2VW4A 1SDDB 2HX8A 3JTBA 4YSSA 8PAZA 2BW5A 2PPCA 3ZX1A 3WNJA 1PMYA 4BK5C 1J9QA 4A66A 4DP0X 1PZCA 2MTAA 4E9RA 5I6MA 5AZUA 1IKOP 1OF0A 3ASNB 3OMIB 3H4HA 3QPKA 2AVFA 3NSCA 5IY5B 1MG3C 2R7EB 1OE3A 2Q5BA 3GDCA 3TBBA 1NZRA 5A7EA 1IC0A 2GI0A 2GC4C 1OCOB 2XX0A 4DP4X 2UX6A 1OCRB 3D12B 3N55A 3WG7B 1L9OA 4GXFA 2IDTA 1X9RA 4P5SA 1QHQA 3UADA 1PY0A 3S3BB 4BDVA 1AZNA 1NPNA 4UANA 5B1BB 4GP5B 2IDSA 4E9YA 5B7FA 1JVLA 1NIBA 3UAAA 1JZHA 1WAEA 2ZONA 2UXVA 5B1JC 3S3DB 2FQEA 2VN3A 2Y1AA 2FWLB 2R7EA 5I6OA 1FA4A 3PXLA 2EIKB 4YVUA 3X1BA 3ABKB 2XV3A 2UXTA 4AX3A 5I6LA 5AFAA 9PCYA 1F56A 1L9PA 1JZIA 3FU9A 1OE1A 1ILSA 1JERA 3NSFA 4HCIA 1AS8A 3X1GA 2YAQA 2FT6A 4DP9X 3NJIA 2CCWA 1PAZA 4N4YB 2WSDA 1PZAA 4BWUA 3SBPA 5B1AB 4DP5X 1KDIA 2FNWA 2PPFA 1GW0A 1PF3A 4KNUA 4AKPA 4YSUA 1URIA 3MX0B 5I26A 4NAJA 3MBWB 2QDWA 1DYZA 3QJTB 3SQRA 3T6VA 4GP8B 2XVBA 3JT2A 4W1TA 2FJSA 1KBWA 2BP0A 2VW7A 2PPAA 2DV6A 3GYRA 3N2JA 3PAUA 2BWIA 2PP9A 4G72B 1ZPUA 3FU7B 3IE9A 3IN2A 3NP4A 2XU9A 1AG6A 3PCYA 1UATA 1JZEA 4DP8X 1V55B 2YAPA 3WKPA 3NYKA 4YSOA 2HLEB 2YAOA 1W8EA 3TA4D 2GB2A 4A2EA 2PLTA 2FT7A 3UACA 4YL4A 2J5WA 1KGYE 3NJKA 1YLBB 3X1FA 4E9QA 1L9TA 4EF3A 3UGEA 2XV2A 2J55A 1AOZA 1TEGA 3EF4A 3FSWA 4E9XA 4KO6A 5F7AA 5FC9A 2VM3A 5ANHA 2IDUA 1QNIA 4NERA 3AG3B 2IDQA 2YAEA 1A8ZA 4WTQA 1AZCA 1SHXA 1SF3A 1NWOA 4A2GA 4QKTA 1NTDA 4KO7A 1WA2X 2H5UA 1TKWA 1AS6A 1KCWA 4E9SA 1CURA 3T6WA 1PLCA 3PPSA 4YSRA 3FQ1A 2VSMB 1OV8A 1ET5A 3OMNB 2YXWA 2BP8A 2UXGA 4AKQA 1X9UA 2DYSB 4M3HA 2DYRB 3BVDB 3IEAA 3RYMA 2HZHA 1GY2A 1E65A 3EHBB 1FFTB 1PNDA 1ZDQA 1SFHA 2DWTA 4YSTA 3TBCA 1J9TA 2FTAA 1M57B 3UAEA 4DPAX 5B7MA 1SF5A 1OCZB 1BQRA 1B3IA 2YAMA 1AZBA 5LDUA 4UAHA 1ID2A 3ERXA 1KV7A 1IBZA 2PCFA 4DP7X 2GIMA 5D4JA 1JVOA 4BWTA 1AR1B 2XLLA 1ILUA 1XMEB 1BEXA 2YARA 3NSDA 2BWDA 1XB6A 3FPYA 1PLBA 4HZ1A 3WNIA 1AS7A 1HAWA 4Q89A 3NJNA 5I28A 3NJMA 3WI9A 1PLAA 5F7BA 1GR7A 2FT8A 1A4BA 1IBYA 3FQYA 4P5RA 4CSZA 4YSQA 3HEIB 2ZXWB 1MDAA 3CVBA 2DWSA 2BHFA 1AZUA 1NICA 1V10A 2QPEB 3QJQB 5I6PA 5TK4A 2JFCA 1ASQA 4AKOA 2UXFA 2LLNA 3H4FA 3NJGA 1M9WA 2VMJA 2YAHA 1BXVA 2I7SA 3ABGA 1GYCA 3CG8A 3TU6A 1SFDA 1XB8A 3FPXA 1BYOA 4MFHA 2QPDB 1BQKA 1RCYA 1ASPA 2QT6A 1KYAA 4FAAB 2BP8B 1JOIA 2A3TA 2IWKA 3QJRB 4YSEA 3NJFA 3EH5B 1E5ZA 3NJLA 2XXFA 1NDTA 2X88A 1E30A 3CDZA 3IBOA 2P80D 1T5KA 3FQ2A 5I5JA 3CVCA 1NWPA 1DZ0A 2AZUA 1HAUA 3OD3A 4G7RB 1BQ5A 4A2DA 2YEVB 4AZUA 1TEFA 2XXGA 1BYPA 4GYBA 1ZDSA 4DPCX 2VW6A 4BWWA 4YSPA 2IH8A 1CYXA 2AFNA 4PCYA 4A67A 4DPBX 4TXVB 4NB7A 2HXAA 4JHUA 4HALA 2ZWNA 2XUWA
chains in the Genus database with same CATH superfamily
4I9XA 2BFVH 3A4FA 3L3OB 3OQRA 2XVGA 1MWAH 1DQDL 1IAIH 4KXBA 4Y16A 5TTRA 3GINA 3U0WL 3EO1A 5CSGA 4C83B 1SXAA 1UXLA 2NNAB 2DQIH 3ZYIA 4FA7B 4RIRA 4HWEH 3WN6A 3HKBA 3VD3A 4LFAB 4J4PA 1GY1A 1MI5A 4L1SA 1IAKA 4F8OA 2WLHA 4WTXA 2Q8BL 5E4AA 1FXKC 2FL4A 4HDIA 3SQOH 2Q7YA 1RUQL 1YEKL 2HKFL 4YC2C 3V4VL 3IKCB 1FG2B 4Z76B 5J6HA 1SUJA 1CFNB 5CU5A 4B6ZA 4XPGH 1MSPA 3PGFH 5L6YL 1R24B 5AVSB 3QG5A 4P46D 4IL6Z 2IPKB 1S9VA 2YC1B 3PNRB 3ARZA 5F9JB 2IJHA 3U11A 3CN3A 4FDWA 4B3SB 3TIEB 3GRWL 1N8ZA 1JFFB 1C1EH 4WO4C 5JXAL 5K9OB 2E47A 4GJTB 1JMXA 4QPEA 1GO3F 2YXVA 1JOYA 1GGBH 3CRCA 4N2FA 1XSIA 1OEZW 1SXCA 3W5MA 5IT9N 1MZEA 1MHHB 5IVXB 3VI4B 1ZLSL 3TXAA 2LGQA 3GJEA 3EYOA 3VUAA 4AQ8A 1CXHA 5KG9B 1NTZH 3O6KL 4ZJ9A 4APQB 3L1OH 3AG2B 2O1AA 3O6FA 1A4JB 3CFJB 3BZ4B 2DEYX 1NVPD 2HH0H 1QBBA 3ARQA 4N2KA 5A3ID 5I1GL 4FQ1L 3IGKA 1URZA 4L1HA 3VMOA 4WFEA 4J8QA 4JJOA 1XV8A 3VI3E 5A16A 3ZIAG 1Q6UA 1WVZA 2F1EA 3V9EA 1OSYA 1OP3K 1MFBL 3SCMA 5ABAA 1CUOA 4I55A 2A2QT 2JKLA 3KH3A 2E5LO 5DVOA 2QTOA 4DP2X 3FT0A 3T71A 3BN9C 1JWSA 2F53A 2HKHH 3QIBB 4Z7NE 5B3SB 2BHYA 3LS5H 4BHUA 1C7TA 2NY3D 1R47A 4Y4HA 1MCQA 1UOKA 4EIBA 3HRZC 1P7HL 3TJHC 2EDOA 2Y7NA 4OF3A 5GHWH 4FULA 4O00A 5IQNA 3BT2H 3ZEDA 1HE8A 3Q3GA 1WV7T 4LR3A 2X44D 1NUNB 1K5QA 3ICXA 5IHHA 1ZSDA 4RZKA 4WWKD 2CHWA 3AREC 3MU3A 2FRGP 5HGDB 3EO9L 4WO4D 3QDJB 4R84A 1ORSB 1ETZA 4IM8A 4WTZG 4HWBH 1K4CA 1T6WA 4KY1L 4J11A 5IBUB 4AW4A 5F8QC 3PNWB 1N6QH 3PGCA 4XAWH 3GRGA 5C0BB 5T3ZH 2JKRM 2RH0A 4O02H 5BRPA 5FM8A 2JQZA 1Q72L 1Y7VA 2J56A 2ZYIA 4ZFGH 3IGAC 2GCYB 3OKOA 2K8MA 3EJSA 4OD2A 4X9GA 4N2OA 1BBDH 4IBQA 3K0GA 3QEHB 3L4CA 5DS2A 1VFUA 1QPPA 3L3HB 4HMDA 1CFNA 3JCUZ 2QPFA 1U95A 2R29H 1GPOL 3KWVA 4ABUA 4ADJA 4DK1A 3GSVB 4KO5A 1AJ7H 4M8QA 3U1SH 5CZVL 4X89A 5EZIH 4Q4IA 3NP3A 4E9TA 4Q4EA 4U3HA 1SN0A 4QHNB 2HKOA 3TCXA 5B4MD 3OGOE 4XGZB 1QFWL 2E7HA 2BMKA 1BV8A 1GAXA 1CU4L 4NWTH 5GGTL 5BMVB 4WSGA 1OP4A 1KIUA 2D4DA 1ZWIC 3ETSA 1QRNA 4PJ7A 1RK7A 3B2UD 3M1OA 1AXTL 4QHLB 4MCZB 2BCKA 3GKWH 4RQQB 3UBXG 4JRYD 5FDWA 1BLIA 3BVTA 1C5DA 1Q9KB 5BOZG 1I5XA 5DJCA 3U9WA 2H8PB 2B1AH 4GSDH 1ROPA 2D7OA 5AKRA 2GEQA 1YEEL 4FNUA 2QKIB 3OLIA 2YGOA 1B88A 4UQIM 2EC9U 2QEXV 3H42H 4KQ3H 4BXVA 4IBZA 4HUUA 1DQTA 4UF7C 4UTBH 2WLYA 4FNLL 4LBAA 1IBGL 4RFEA 5D5MA 1XIWC 4YIQA 4GBXA 3ZN0A 2XV0A 1NFDE 3CDZB 4KX9A 4GI9A 4AJWA 4UI2A 3TEZA 2PR4H 4JZNA 5AW6B 4MNGB 4JFWA 4JPWL 1QNZL 2UZIL 4I50A 4OZIE 4IGGA 1R5WB 2ZCHH 1P7KA 3MV8D 3SE6A 5A2QN 3OGCC 3L45A 3BISA 4P46C 1QRNE 3FNKA 2VXQA 4MA3B 4DP1X 2JXMA 2V2WA 3FQTB 4HS6A 3LZFH 2AW9A 4WI5A 4FXGC 5GRJH 1HKLH 3QNZA 2UZIH 1JDCA 1KIQB 5C08E 1WP8A 1CWVA 4N5UA 5I0VA 5ITFA 5GSRB 4Y9BA 3U2SB 1MHCA 2WZPA 1L5GA 1U8PB 5LBSA 4UTBL 1OZUA 4HUWA 2MTAA 2WLZA 2Z0BA 4HNAA 1A32A 4HZAA 3PABB 4LDCA 5I1JL 5BZWB 2EYRB 1QKZL 4J10A 3PYCA 3SO3C 4AIEA 4FXGB 4TLUA 4N20A 3ECBB 3KEHA 5LNDA 5CZKA 3NSCA 1M71A 3E3QE 3WN5C 4BFEA 4JO2H 5DI8A 5A2JH 4NOFA 1T3FB 1OCRC 4MVRA 1SLUA 1SQMA 5D2NC 3U36A 4OF0A 3E1ZA 2QLVB 2H0JA 4LCIL 1Z3GL 3HMXH 4JMNA 4XN1A 5JJNB 2CGNA 1MEXL 2AGJL 3JV6A 3VSUA 2NXYC 4O4HA 3MLSL 3OTTA 4BR6A 2DQEH 1NQBA 1GYAA 4GEIA 3H85A 3K5LA 2JNZA 3CHSA 3IDGA 4AWJC 3BP6A 4TPRL 2GTSA 2XI9A 1U91B 3O45B 4AV4A 1JL8A 4X6EA 5B1BB 4GO6B 4GP5B 4UQDA 4PJGF 2NQ3A 1OIOA 1EZJA 4ZOBA 4TRPL 3VXRD 1HNZB 1X7TA 4XZUA 1G1CA 2GJRA 4HSAC 4WHTB 2VRKA 4ZDHB 3VI4E 1BQ0A 3BUPA 3QQDA 1AFVL 4H13C 1VCBC 5K39A 4MTOA 1WCQA 3Q8AA 1S3JA 4JPKH 3EZJB 3CFQA 1RPQA 3CVHA 3G08A 3OZ9H 3T09A 2BNRB 4OLWL 4ZFGL 2E7BA 1JZIA 1Z5WA 4AEHH 4JZGA 4JDTL 1CXIA 5GSRA 3F7VA 2IANA 3HC4H 2GIYA 1AFVH 3OT7A 3O3BA 1O5DT 4XXDB 1PAZA 3UZVA 4WFED 3K46A 1CTMA 4N0UE 4Z7NB 4X42A 4W70A 3R8QA 1QTYT 4NAJA 3EXLA 3VFSB 2QDWA 5J1TC 3MRKB 3OV6A 2JJ2G 3MV7B 4KKAD 5EPMA 2FUQA 1E6JH 2V8LA 5HI3C 3OEEG 2F19L 3NFPA 4L5FL 4JFFB 5F2FA 3Q06A 4TNVK 5BRZA 4LVNC 4OCSH 2HT2D 1GH6A 2QJ1A 2Y7QA 4B5ZA 2J73A 4RFOH 4Z3GA 5IVNA 3TA3C 4H20H 1PD3A 2XWCA 4L3EA 3CTTA 3TEUA 3L5JA 1SMOA 2H26A 1OW0C 1IGMH 2CUGA 2R0KL 4KKRA 4M6OL 7FABH 4LPXA 3HZYB 3LNIA 5DVMA 3JWNH 2QGNA 1ZLUK 4BELD 1RZJC 4V2BA 4LAQH 1QBML 3OKNA 3LSSA 1JZ5A 5FR3A 5IUCA 1RL1A 1VP7A 1E8YA 4Y2DB 3WJJA 3C2AH 1O75A 3IKKA 2WXGA 1UXWA 2NY6C 3SJCC 1A3LH 1NCUA 2VZ1A 5DJ0A 4PGEA 4EF3A 3JAWB 4XX1G 4BQ9A 2HR3A 3CFUA 1UD5A 3O9WC 5CGYD 2P48B 1XT5A 1ZLWH 4PJAA 3PP3K 2BTQA 1DVXA 1B2WL 4XP4H 3KPLA 2DLTA 3CN0A 1PSKH 2FL5A 1MCFA 1L3WA 2OI9B 3H3PH 2HTKC 3D30A 5F3BA 4KY2A 5JORA 2J1KA 3BKJL 1OQOA 4NQDB 2WQAA 3BO8B 2RNBA 4EAEA 1PKOA 5I1JH 1YEGH 1TKWA 3NIDE 4OV6F 1WHOA 5E1HB 5IZ7A 4YBLB 1XEDA 1KCWA 2C7FA 4XO8A 5AG2A 3KGSA 4APQC 1IE4A 1OV8A 3NOIA 4JDVA 2EIBA 4FFWC 5EF2A 2OW7A 3DGEA 3EFOB 4NSKA 4ZX3A 4GCZA 1WUNT 4N25A 4ENED 4O4IB 3OKEB 4FQJL 3PHOA 1JJOA 1CR9L 2EDFA 5HDBF 3HFMH 1GZQA 3VW3L 1WC7B 4UXNA 4MQXD 3RRQA 5B3JE 4Y4HC 2WXNA 3RVVD 5AD0B 3IFLL 4JI5O 2ZDIA 1N2RB 4OJEH 4JYAO 4XHJD 4M4PA 4YJZL 1EAPB 5E00B 3ZRWA 3OC5A 2XPZA 1SJEB 1UOVA 3GBNH 3WIHH 3T3ME 2Z5UA 1WPCA 5HYQB 3HJ0A 5I1DA 2DM4A 5M7QA 2YAMA 1AZBA 1GZQB 1IBKB 4LARH 4PJCB 1DLFH 2BY0A 2XTSA 3GXPA 3BZEB 3HUJF 4X6CE 1KTJA 2G2RB 1KXVC 3IWVA 3RDTD 4GKOA 4QXGH 3FN9A 2COVD 2A7WA 3MLUH 1N36B 1FVEB 2D3NA 3T2MA 3FAVB 2F15A 2JB5L 4J7JA 3D52A 4Y16D 1RULH 5T8IA 3U79A 3WNIA 3ME0A 1N64L 4H0HB 2VB5A 1VDGA 2IH3A 4X6DA 1NGZB 4DO4A 1ZL8B 5F7WC 3R7RA 3TIDA 4AQ1A 4CN1A 4KVCL 4B3SO 5CLTA 4A7SA 1D9KA 1Z0NA 4KRPC 5MEPB 2JV6A 3VFVB 2HKAA 4G6KH 4B0MB 2V2TA 5HGBB 4BBWA 3B9EA 4MAYB 5D1XD 5CFAA 1NEZB 3H1HH 3ZYZA 1HHIB 3VXSA 4HT1H 4YLCA 3UBXI 4F7PB 4W9CC 1Q3EA 4ZO8A 4IIQB 4A55A 2YRBA 1ULVA 3FTUA 4EZJA 5H94A 2PKDA 2K9PA 2GPZA 5I2IA 1BYOA 5IVXA 5J06A 2QPDB 1OAQH 4YJ2B 4EI5D 1F02I 4NM8L 4LLMB 4G6FB 3IFOA 4YGVB 3D6GA 1GGCH 1QWNA 5FEBA 2B8OT 2EE9A 3RVUD 3RWRD 4F4LA 4MMXB 1NCTA 4AYDC 1VADA 1Y07A 5AVRB 5H6QA 4Z2WA 4I1NB 3MROB 2VKXA 5ICZA 2CHZA 4IEFB 3LRSB 4L3ED 2Y4UA 2XA8H 2CMRL 4H0IA 4PJHB 3UEZA 4FYQA 5E2VH 3QO5A 4UBDC 4CH4A 3SE3C 4J3UA 4XRCA 3ZE0E 3GO1H 3DX6B 2WLIA 1GHFL 4MW3A 3MUJA 2IH8A 3A6BH 2AFNA 2OL3H 2NZ1A 2RFXA 2XZCL 3WFHB 1NLDL 1VFAA 4DPBX 3ZHRA 4UQAA 1JYNA 1JYXA 2EUXA 2B4CH 3I6KA 1VEOA 5AB2A 2AP2A 3H56A 2IWEA 1HL9A 2OLDA 3M1CA 4U6TA 4C55A 1FVDA 4NO5B 1DJYA 2BOLA 2Y5EA 1JGDB 2B3IA 1BQSA 2FH8A 1SLVA 1FNEB 2ZIMA 2QKIC 4KTEH 1L9MA 2NY0B 5TF1L 4OLUL 1VQOV 1QBLH 1LDPL 3EYVB 2AKRA 3OPUA 5EZYB 4CVXB 3DO7B 1OD9A 4YXHL 4AQ1C 1I0HA 3G04B 4JKPL 4LO9A 3O3EA 2AXTZ 1IM9B 2DBLL 2ADFH 1KXTA 2OR7A 2X89D 3HAEB 1UUSA 5IHZA 3MDSA 3BEWB 2N59A 4ZAKD 1RVFL 3UQ8A 1BL8A 4PV9A 2UZYB 2ZX5A 3KWUA 3BAIA 3X3FL 5I18L 1VHPA 3EH4B 3Q5YA 3V8CA 2VM4A 3QR0A 2FWOA 4LH6A 4Q52A 3E2HB 1VADB 1B6QA 1INQA 1QASA 4AH2B 3IAYA 2PPDA 1IQDA 2JIXA 2VXQH 3ARDD 4FJCC 3CXDH 2CO7B 1E50A 3HPLC 4YHPB 3FF7A 4M6OH 4PA9A 4PBVC 1KB5L 1M1XA 5T5NG 2WO3B 2OCCC 3PAZA 1O6TA 5E24E 5FUZL 4FZEL 3B8NA 1XCWA 4MYWB 3DX0A 4NHCH 3EH1A 5CA0A 1LO2L 4KHPB 4PRIB 2Q5ZA 5C0RH 3TEWA 2CKNA 2RJZA 5J6GB 1IGTB 1J8HB 2OMYB 2UZXA 4J3BA 5IJBC 3PLYA 1N8OE 3GM0A 3TXSA 4NZUH 3VFVA 1FV1A 1W15A 2E7CA 3TEXA 1ZIAA 5HPMA 2CGOA 4PM1A 4MJ2A 3DA0A 1Z6JT 4R96B 4KXRA 1IBLB 5JHDE 4Z7VA 1CBJA 2IGFL 2VJ0A 2VITA 5E9DB 1YXBA 3P32A 2Z3FA 4HHAA 4AL8H 4UT6L 1AG0A 1OGAE 4O2CA 4U6YB 1TVBB 1FNGA 5KBLA 3QFDA 1JGUL 3IPFA 3OJVC 4WENB 4XMTA 5KTEH 2Z3YA 5F3HA 3WHE0 4R2GD 3V5HA 3TVMD 1YMHB 2QM8A 4GAGL 3W2DL 4YDLB 1BXXA 5CGBA 3Q4HB 1S7WB 2G2RA 4XPAL 1KELH 1ICTA 2G0LA 3R19A 2FJGA 3VI3B 3A4EA 3ABMB 2Z65C 4UIKL 5L4JA 4J3OD 5T3XD 4JLRA 2A6KA 4LH7A 1ZD6A 3A6CH 1R1CA 2NY7L 1WIUA 3WSQL 1F4YH 2Q6AA 1GZPA 1SDDA 1TJGH 3DPBB 3F64A 3HS0C 1YJNV 1H5BA 1Z9PA 4ZS7L 4GAGH 1CC3A 2EDNA 3VTAA 3D85D 1DN0B 3C5ZA 3V4VH 2Q0AA 4U0RC 2IFGA 2P28B 3EJTA 3PAVA 5C70A 4NRXA 2JXMB 4O4IA 2WINA 2VDOH 3WNKA 2ZXCA 4ZIBA 3O8XC 3MV7D 1R17A 4KKCD 4Z8FH 4QRTA 3HE7B 2ROXA 1RIUL 4PRHA 1B0GB 4E41A 3AT9A 4N6RB 4WO0A 5HGAA 1SGKA 3BDBA 4EUPG 4AIZB 3CSYB 1AANA 1FH5L 3FB5A 5JHLL 2ZXEB 3CRQA 1X5YA 3BP7A 1FN4A 2UXXA 1FYJA 4S2SA 3P0YH 3CH1B 5DD1H 1UT2A 4FLUA 3FUHA 1ENVA 4G6AC 4D9QD 2VN6A 2D3JA 1MFEH 2CRIA 3I02A 4JFHD 3SN6N 4YK4C 2FL5B 3NCYS 4HJGB 1XGQB 1W6LA 2GFBA 1NBVL 1CFMA 2ZPKL 4W9GC 5BJTA 2NR6C 2Z9TA 1QTSA 4ORZC 4PLKD 5GRVL 2ARJQ 2DQCL 1RUAL 1T2QH 4GRWF 2NY2D 1OGPA 2G2NA 2XA3A 2GITA 5DC0A 2NOYA 4WIQA 3OAAG 3RGVA 5CEZE 4J5VA 5I6NA 4MGXA 2CAKA 4DZBB 1NTKH 2EH7H 4HCGA 3RX7A 1JHKL 5IROC 5C0AE 3NQIA 3K4ZA 4ZO6A 4AGNA 2IV8A 3IU3A 3KL3A 2VR3A 4KXZH 3EOTH 3H9HB 1VF6C 4R0LA 3TN0B 2G5UA 5LHGA 3MJ9L 4H25A 4DV3B 3V6ZB 3ABLC 1WFUA 5AYQA 3FQWB 4R7NA 1KECA 2H6PA 4LPUA 3H9HA 1H2KA 2N1KA 3BFQG 3D07A 1PNCA 1VERA 3QG7H 3W39B 2QBWA 5AG8A 1WJ3A 3A0RA 2IH1C 3L6FA 5TE4H 1AD9A 1G5AA 2WBWB 4GKNA 1S7SB 3L3GB 4OR1A 4PRPE 1BQHA 1A0QL 3E2HC 2HJFC 2Q67A 1WA0X 2NTFB 4GSRA 3VRLF 5K59E 4MVBD 2D3OW 3A4DA 1T1WB 2BOCC 1IT9H 2O5ZH 4LC1A 4P4RA 5CR8A 1RM1C 1K4CB 1ZVNA 4NTWA 3EOAA 5EDSA 1GS7A 1G94A 1YEHL 1G7HB 4LHUD 2BVQB 2R29A 4BK5C 3BGFB 4NOBA 5FYJL 2WYTA 3DUHA 4UV9A 3OL2A 1RUMH 3CJJA 5AKVA 1JNNH 2OCFD 3EJYD 4EQ2A 5DRWA 1YJWV 3EJZD 4ZUVA 4JO1L 1A02N 3X14B 2E5LB 3OR6C 1C5BL 4A6YA 2NXYB 4G9FE 3HZ3A 1SXZA 4NKDB 2O30A 2XG4A 1E2ZA 4HD5A 4HHAB 3NAAH 4N2AA 4WJG3 1HC1A 3Q2LA 4GLRH 2BHUA 1P49A 1UCBH 3TEYA 3I2CH 2RQ8A 3HHSB 4JO4L 5JMOC 3D8MA 5DD0H 4GKSA 3BWUF 4N90D 4IHOB 4NLAA 3T8MA 1QR1B 4WFAV 2BP5M 3ECUA 4BUGA 4D94A 5IY5C 1TUBA 1S7QA 3JV4A 4JFXA 4A7GF 5EMYA 4RMUA 3WBDA 4RGMB 1UURA 2X40A 3C09B 5DC4B 2OYKA 2DI8A 1IBKO 4HIQA 4AEFA 4NTYA 2C4XA 1JNNL 1RUML 3BD3A 3O6FB 1GXEA 4Y5YC 4XTRC 1CXFA 3QJHA 1XMOO 1YDPA 3AREA 3ZKMC 2PW1B 4HJSA 4ZQKB 3KYNA 3LPWA 2QM4A 2A9BA 1VIBA 5GZOC 2I32A 3MNDA 5GZNC 5MP6L 2ADGA 2IPUK 1I7TA 1KF9B 1YPZE 2Q6WB 4IIQC 1TNNA 3S88L 4BFNA 1JHTB 3VRIA 4MBRA 4PJIA 1MNUL 2XPGA 4N8VA 5DMIH 5D93C 5TFSL 5I8CB 4Q6IB 2R2CA 4E9RA 2FBRA 5EZPA 1UB5A 2XOTA 3BPZA 4R96A 4EKXA 1R3JB 3CC5A 5KYUB 3MFFA 1WZLA 1KKCA 3IKCA 4KRPB 1O0VA 5E1AA 5E4OA 4AJ0A 4WKZA 2YPKB 3LVEA 4CDHA 5MERA 1RJCA 4Y4FA 3BIAX 3BJ91 5DWPA 4J41A 1H8OA 5C6WH 4OFYD 2CR3A 2OMYA 1V3JA 4X65O 3KPOB 3N06B 4TUYB 2MCG1 3B9DA 1R0AH 4YY3B 3MRLB 1BZ9A 4GQ9L 3ZRFC 4BHUI 1N8RW 4OLXH 5EU6B 4DEPC 3DX4A 1ORQA 2IAMB 1YYMH 2VWKA 2P26A 5ADOH 2YS4A 3RFZB 3VQXA 4DV4O 2X3CA 3NK3A 4MXQC 3PJSA 1I7ZA 2J5LB 2NX5E 2DM2A 5KSUB 5I1GH 1EBOA 2AJZB 3LEVL 1CFVL 3O8XB 4NKMA 3CNKA 3VTTA 4JN1L 2O72A 4FXKB 1YF2A 3VVVA 1SZNA 5LBVA 3VD2A 1MI5D 4X7TB 4L4VB 5ACZA 5HBBA 1HHKB 1R75A 3ULVF 1XX9C 5LYJB 1Q38A 4ZFOB 1UA3A 1TTFA 1U3ZA 1FO0A 2Q0ZX 5KYWA 1V7ML 5BUAA 2YDEA 2ENYA 1TPXB 3CHRA 3ESOA 4LNUB 4IRZL 3MRIB 1RZFH 3J7AU 2GB2A 4G43A 5KSUA 3ABMC 1VACA 4Q97A 5IOPB 2IADA 4ALAC 4Z78B 3C8HA 3K6SA 5T1MA 1MUJA 2QM7A 5ADPH 2F8VA 3K5OA 4AXWA 4Z77B 3EF4A 1LWRA 2CKBL 3MRPA 2EDHA 5HDLA 2X10A 5JUEL 4XPBL 4JN1H 2BC4B 5HYEA 2WMPA 2XQBL 2DWEC 4M1GL 1U2YA 1N6VA 3SY6A 3SDDB 1KZYA 2ALWA 4PWJA 1YMME 3VFGL 5MEPA 1HWWA 3MA9L 4O5LH 3PHQA 4O2FA 3IFPA 1IGJB 1MDTA 35C8L 1VJSA 4UUJA 1NTDA 5EBWA 2ZT9C 3GGWA 4AQEA 1F3RB 1UWGL 2XHNA 2H5UA 3M86A 4LSVH 5AYUL 3O6LH 1HXYB 3NA9H 5CEYB 3ZE2B 3DGGB 5I15H 1NLDH 2CTRA 1KFAH 3FQ1A 5C0DA 3VQ1C 3QCUL 1PX4A 1M93A 2LGWA 3E9UA 2CD0A 4ICGA 1J12A 2EULA 4ODTH 4QNPF 5SWZA 3RGBA 1HCFX 1NCCL 1UM6H 3F05A 3DXAE 4YXKH 1RURL 4MWFB 5E6RB 4AQZA 5KSAB 4XT1C 2H9GB 3JD3A 2XVKA 1R3JC 4JFQB 4S0SD 1Y1UA 4QXVA 3IDMA 1NBCA 2NY5L 3BIKB 1NEZA 1BWWA 2FTAA 3AU1B 4P9ML 1AIFB 1CD1B 1X9QA 2G9KA 4IHBA 3P77B 5DMGD 4DR4B 5DCCA 2QADB 4ZFZB 5J57B 3L3DA 1WGOA 3F8UB 5DHXB 4UZSA 4GBXC 4L9DA 3KGRA 4UAHA 1I8KB 2MPAH 1JI1A 3FB7C 1JWMA 2C34A 3QUMB 4LL9A 4XO9A 3TIDB 3ETDA 4AQ1B 1PZUB 2R8SL 1BSMA 2B3RA 4UCUA 1ESOA 4W4NA 5C0ND 4RAHA 5SX5H 3VGGA 2YMXH 3LDBB 4BWTA 1USQA 2WUCL 3DLQR 3EJCA 4FL4B 4ELMF 3QDMB 3QISA 1BWMA 2YARA 3VACA 4R6ZA 4HK0A 5JIIA 5JW5B 4JO5A 4PJ5D 3ZW3A 4CGUB 4TNWK 2IQAA 5DZOA 1FZMB 4G27B 4GXVH 1BMWA 4Z7QE 3TH4T 5FNVB 1LP9E 4B3RB 3QUMA 1X5HA 2WWNA 3KLHD 1C5BH 3FH7A 3MJWA 3WTSA 3I55V 3MV11 4X1YB 3GXTA 4QDGA 1WIOA 5I1DB 3WB1A 4NQEB 4RMSA 4Z7WA 3IDXH 3D34A 3QNYB 1EJOH 2D31A 2BHFA 5BVPH 5TK4A 1EZSA 2EQDA 1G1OA 1JYVA 4JI1B 1FO0L 3FFCE 1FQ9C 3MJ8B 5A2KH 3QEUB 4BQBA 3MODL 4BD4A 3UZQB 4LEBA 4MW8A 5DLMH 1OM3L 4ZI8A 2P46B 3NIFB 4CBCA 1IGCL 4MFHA 4FAAB 1EN6A 3G5YA 4P2QD 1P84K 1LEGA 4HISA 2F43G 3VQWA 1DCLA 2OJEB 3GBNL 4YSEA 1VQ6V 5EEVA 4Y2DA 1Z5LA 4OLUH 3VH8A 3CK0H 2H41A 3Q9QA 3RZWA 5EU3A 3BO8A 1H8LA 3CVCA 1HNXB 5FYKE 3ORJA 1FG2A 4Z76A 2KHAA 4UM8A 3S4SG 4L8SA 2O57A 1WZKA 1Q6HA 1LO4L 3WUWA 3V0IA 4NUGL 3WY3A 3VXUA 4X6CA 4PDRA 4A2DA 4LPTA 2R1YA 4F27A 3CC2V 1BYPA 1Z2GA 1T0OA 3FONA 2CCVA 3MYJB 4U1JA 3TT1H 4NUMA 4DQAA 4PCYA 3AS0A 3L48A 1ZA3A 2I25N 4P9HH 4KH2A 4NB7A 4HOZA 4JHUA 4GBXD 4AQYB 1TMCB 2W1NA 3MAWA 4HAKA 1NKDA 4BFIB 1T0NA 2F7QA 1VPOH 3VFSA 4PGEB 5DJ0B 3L3OA 5IHBA 3F7YC 4DR7O 3MJ7B 3Q6GH 1CCZA 1YDXA 4NZRH 3NIDB 3LKOB 1LE5A 1NIAA 5HJGA 4C56A 2GITB 4DOHB 5KWYC 2JEUA 2VR4A 3C08L 3QQXA 4V1DD 2DMCA 4CBPA 3DROB 5EUKB 2HRHA 3OHXA 1CFSA 1IAOB 5C09B 3VD5A 4ZPVB 3E6HA 4FQPA 3VB9A 1QA9B 3K2KA 2A99A 3NRFA 4P3DB 3PL6A 2VC2B 4P46A 1Q0YL 5C8YA 4WGWB 4LLVA 3VFGH 2ERJB 5IVZB 4JR9H 2BP0B 2GAZA 5D7JA 4RMRA 2VDMH 4B3TB 5EU6D 1XCXA 3RFZA 2EKSB 3DXAA 1A7QH 1FRGH 4N2LA 2YD4A 5EZLA 3RVXC 2BVYA 3RX5A 3AUVA 1AD0A 3L4XA 1YI2V 1RK1B 2WM0A 4F3FA 5MHSD 5FF6A 5HYJB 4NO2B 5HDRA 3II2A 3VXMB 2HLFD 4YBLC 3RN4A 4MCYB 2PYED 4TN9A 3WE6A 1B6DA 1JBJA 1JSYA 3IDGB 4XE5B 1MIML 4FQ2L 1HL5A 1XGTA 2XCMC 3FUMA 4O4HB 3KLLA 1G6UA 4XCFL 1MCLA 5IJ0B 2OMUA 3BVOA 5E7BA 3RYCB 1JZFA 1E9OA 3QXUA 1Y76A 4QCIA 5DJXA 3AACA 4GT7A 5EO1B 2BSDA 4G7QB 4NQCA 2P5WD 4HEPG 3CDGB 3L72H 2YLHA 4DO5A 3WIFA 2BIQA 3INUL 1HYSC 3P9LB 5F6HJ 1GIGH 1KYDA 5KSAC 5GS0L 1KC5H 5EO1A 4U1LB 2BW4A 1FAIH 2V2XB 4HNAB 1H3TA 1AE6L 4MTFA 1KXQA 2OMUB 4HU2A 5GZNA 3MGOB 4WI2A 3GI9L 3B56A 2QWNB 4X8JA 4DVRH 4V1DE 1D5ZB 1I8LC 2OYMA 1WT5A 1FJGB 5CB4B 4ZUUB 1DJHA 1XR8B 4MD4B 1J11A 5J1SC 1A2YA 3EBIA 2KI6A 4ENZA 4MB4A 2HJKB 1M56B 3QT2A 3ULSB 4XO4A 2I26N 2JQMA 1TJHH 1DE4B 4X5PA 3QQNA 3QEGL 5G4NA 5K9KA 4NAQA 3BQVA 3MV9D 1E1RG 1NCAH 1M71B 1WA8A 1XTMA 5GGQH 2E7LC 1J86A 2VLJA 1YA5A 3Q8FA 3EXAA 5IREA 4Y5VA 4J3WA 4GSXA 1Q90A 5DMYA 4WFFE 3G5XB 2XAJA 3PS6A 1A3LL 1UA6L 4ZK8A 1DLBA 2OX5B 3CCHB 1K5SA 3U9UB 2CGZA 3TBSA 1KCRL 4ZPVA 1MFMA 4DR2B 1TMQA 2E3VA 1SVBA 4JF3A 2HPOA 2PR9A 4X65B 3UYPB 2AQ2A 1RZJH 3VSVA 4MMYA 5KSAD 2YKLL 4P5MA 5FB8A 1WAAF 4K23L 1AMXA 2RTTA 3ZRCC 4XMVA 4NDMB 3HAEG 5PCYA 1T89A 3UO3A 3IAGC 4NVPA 3H0TA 4PJIE 3W9DB 4RFOL 5EU7C 3BEVA 3IDNA 3L4ZA 5I30L 2UUAO 3QDHA 3QIUD 4AJYV 1NCJA 4FVMA 1DUZA 1XH0A 1MZYA 3ZMZA 1NA8A 4GFXA 3O4OB 4JRLA 2WC7A 2ENPA 1WE5A 2M26A 4PI0A 1BFVL 1J8SA 4R97C 5B39B 2F58L 5JPNB 2JJTA 2Q9OA 2YMOA 4JZJB 5DZPA 5KYYB 2QDOA 2HG5A 3WNPA 2XBZA 3SGIA 3UDWA 43CAB 3P0GB 4UV4H 1RZIB 2Y72A 1A66A 4OD2B 5GS3A 1TTRA 1AHWC 2V1DA 1ZTXE 4FRWA 4I0PD 1IVTA 4C4KO 2BVPB 2ITCC 4IBUA 3DSNA 5TDNB 1XF1A 2KPWA 3TBTB 2FUTA 5ENWA 3QO7A 4R4ND 4QE7A 3FD9A 2DLEA 4CS4A 5BMVA 3BPLB 4CN4A 3ZMEA 1IL1A 3PWLB 4GIAA 5J3HC 5KOVC 4KKZA 3WKMH 4JANB 1FG9C 4YC2B 4CRPA 4XGZA 5A9GA 1ZMYA 4R7VA 4OLYL 1ETZB 1UWGH 5KMGA 5DHVA 3R1GH 1GZHA 1D9KB 1R3KA 2VKWA 2OQJA 2WXJA 4NB5A 3KLQA 3MOQA 4O51A 2Z7YA 3GS0A 4DV4B 1X5IA 5DEFA 2E8YA 1YNLH 4BFBD 5I6MA 5AZUA 1BZQK 1JPTL 1SPDA 3C09C 1KLFA 3K5MA 4RGMC 4RWYL 3RNKB 5KBDA 2R7EB 1SQQH 1SY6L 4NNPH 2P1YA 5GXBB 3IXAB 3EO0A 3PWPD 4IKNA 3INOA 3LPOA 3ZKND 4N0CD 15C8L 4NS0A 2VQUA 3EFFA 3MNWA 1AMYA 2NZ9C 5AZ2L 2GVYA 4KKNA 3NRPA 1JF6A 3DO4A 4MZRA 1BVLA 1PEZA 5E6IC 4HQQH 3ARWA 1DBBH 2YFOA 3DPBA 5HTSA 1OALA 1IEBB 1DJSA 3CDYA 3ILDA 1N5AA 1QWHA 1RUAH 1T2QL 1GM7A 2UXCO 1R5VA 2BNRD 5BW7A 1ZTXL 3T0BA 1JZHA 4RGND 2UXVA 2X4TA 2ZX6A 3L9RA 4FLQA 4XCYA 4S1QH 4BFOA 1OVZA 2DJ4A 5IT2H 1C12A 1U21A 2C2AA 2ZQMA 1WIPA 4NUJB 5D7LA 1MAMH 4AITA 3SYPA 5K93A 5CCGE 1ZWIB 4L8CA 2Y6SC 2F19H 4L5FH 3BVVA 3QDGB 1LEKA 4AENA 3SCMB 1P6WA 1IBFA 4KROB 2YGVA 4Q2ZA 3DC5A 1ZK5A 3CLFL 2NDFA 3LQAL 4IMKC 1I7RA 5FYJU 1EANA 3FFQA 4GG6A 2DYRC 2EXWD 4AYMC 1R3IC 4GI8A 1SZXA 5I24A 2LO1A 5LL6Y 1GZHC 1CF8H 1FL3A 1VKXA 2FK9A 3NIFF 1U92B 2WQWA 2AQPA 4OZHB 3X12B 4C47A 3QEQE 2PPFA 4GI6A 4KNUA 4AKPA 3BAWA 1SM3L 2PW2A 3KWWA 3WO4C 2BH0A 3E22B 1JPFB 1N34O 1ZTEA 3FH5A 4K71B 1I3RB 4AC4A 1RJLA 1E9QA 1HEZA 2EACA 4W1TA 4LAJH 3F62A 1EO7A 1FYTE 2PPAA 2YXHA 4KKQA 3GMQB 4GZRB 4G43B 2AQ1A 5HVHC 3O2DH 4IW4C 5CF3A 1TCRB 1JS4A 4U7SA 3FU7B 4N0FB 2E9WA 2N4IA 5JJEB 5BZXA 2WBJC 1NDMA 3R4DA 5B66Z 1IEAA 2YD3A 3LJ3A 4OCLC 4WFGA 4XDLA 3GIZL 4YHNB 1R3HB 5JIMA 2LQRA 3O3EB 2AV1A 1IIKA 1J0HA 4YSOA 4ZW8A 1S9XA 3O8XA 4NKMB 5E79Z 2C1OA 5HDOA 1DUZB 3GRBA 4FFYH 3UACA 5HHOB 1RIHL 3NCBB 1JZ7A 5CZVH 3U1SL 4XP1H 1ZHKB 1MRCL 3AXLB 3ATAA 3K8KA 2OP4L 5IW1A 4E9QA 4UT9H 2RAMA 4KZEL 3QO1B 1CD8A 4F5CA 2N04A 2B9BA 3BE1L 3MCLL 4HJJL 4ZMOA 3E8VA 4JFDD 1GN6A 3OEHG 1A6TB 2UUDK 4JAAA 3QXDA 4MSWA 4DVBB 4XP5L 3UTTE 5HYSA 4NQSA 4HMCA 4BK4A 1AKJA 3O3UN 5I6XB 3FHEA 4PRNA 3ETBF 1HWYA 4N21A 1I9RL 3PJSK 4NN7C 5IIEB 4GG6E 1F90L 2VLRE 5EEXA 2V0AA 2WXPA 3PP4L 5D7KE 5IDJA 2ICWB 1UADC 2Q8AL 2YUXA 4GRLA 5F9OH 5T5FL 4EN3B 5CBHA 2UY6A 3PFQA 2DLHA 4XPTH 4E9SA 3PPSA 1SXBA 3L3IA 5FYKL 3VU1A 1PIGA 4DNLA 1AGDB 4PV8A 5FDYA 4UDUA 4P2RE 4P9HL 1F18A 4DR5B 4KMTH 5E1IA 1KJ2H 3KPSD 1K9TA 4KI5E 4Y2DD 4YDLC 3RPIB 3S37H 4W4OA 4F6RB 3RIAK 3LEXA 1GY2A 2VN4A 2Y7LA 3RTQA 3QCVH 2VQEB 3ARGC 3K6IA 5FUCE 2A83B 1T5WB 5JXED 4MAYA 1K6QH 2WWKT 1KULA 4OZGF 4H13B 1RK0A 3QRLA 3L5XL 2VQFB 2RMNA 3OSKA 5ITBL 5JJJB 4S1DD 1U3HB 3EKCA 3U48A 3ARXA 4CVWA 3FUFA 3BABA 3RPIA 5FGSA 4DEWA 2B7DT 2IOOA 2IAMC 2VDRL 3HBQA 5SWSA 2IG2L 2B1IA 3SDCB 4YHMH 1XMEB 3DX1A 4AOFA 1DDTA 5EU5A 3V8OA 4O02B 4JI7B 3F65A 2OTPA 4XPFL 5CAYB 4QCIB 3NJNA 3RKDD 3EG9A 2X2HA 4FQLH 1PFCA 1KN4L 1RHHA 4I0KA 3IYLW 3ZL1A 3E86A 3E6FA 4Y2OA 2IQ9L 1CVRA 1GGTA 1D9KD 4YSQA 5IP4A 3IFNL 2X6MA 3AM8C 4E9LA 3NA4A 1DN2A 1EZUA 2E4FA 2UXFA 4JYBA 4OIIH 1EEYB 2KG7B 2E9BA 3UTSB 4NO2A 3SCMD 2WTRB 2HKFH 4TNEA 3HB3D 1QPKA 4G6FD 4XODA 1FLTX 1CYGA 1BVOA 1KCUL 3AXLA 4JFEE 4OBSA 1E28B 1KIPA 4J9ZB 2V5TA 2K6WA 4IRJA 2YC0A 2DF3A 2W9DL 4X98B 3O6FC 4FLXA 4ONHB 5H5NA 5JIPA 2X88A 2P80D 1TKWB 1UWXH 4IKLA 4XN2A 1THCA 1IKNA 4LVEA 4LASL 3MNMA 2OXGB 2NN4A 3WTYA 2X4UB 3K5NA 2YMXL 3P0VH 1W0YT 1IM3B 1F4WL 4LFAO 1JN6A 1RP8A 1VGKA 2LTQB 2QZ5A 5DJYB 5I8EB 4H25B 4GKZB 3JWOL 4GX1A 4P59L 1Z7JA 4R0LB 2ZOKA 4JG5A 1ZDSA 4DPCX 1KTDB 3P9WB 1NMBL 1Y6NR 4QXUL 4PVNA 2DS4A 4KK8C 3M7OA 1X5MA 4NN6B 4QLRA 4U3JA 3Q9PA 5KZCD 4HALA 1NBZB 5JQGA 1XDTT 4O2AB 1RJLB 1F4WH 4DCQB 2XPYA 4JRXB 5DQDL 3HKEA 1JTPA 1KJVB 2R0WH 1MCCA 1FC2D 5FLUA 5EIIB 1K33A 1RURH 1LK2B 3HG4A 5D1ZI 4Y88A 4KKBC 5KHKA 2NR6A 4GYCB 1M7XA 3CQQA 5JW4R 1LILA 1HH6B 4NKQB 3FYEB 4P2YA 4A7UA 3TWCL 1MNGA 4JGSA 4MTXA 4AQ8C 4POYA 1I82A 2XWTA 3K1KC 4RH4A 1GS8A 4I0XB 4FS0A 4TV8A 2VXTL 4HHWA 4YJ3B 3GB7A 3T0WA 1QG3A 1QLRB 4GO8A 4NQVA 2BOCB 2WIIB 2EINC 3RX9A 3ESUF 2WPGA 1OANA 4QHUA 2BRRH 2PO6A 2YWYA 2A9NH 2NRDA 4X98A 4K2UH 3FN0H 5H4YA 4OGAC 1C8PA 4DUYO 2JH2A 3SSGA 1GMEA 1S7UB 5IB4A 3IDIB 1ZEAH 5K33A 4APXB 1CIDA 5I6XC 5JUEH 3U4BH 5IQMA 4DK0A 2X53A 2X4TB 4XCYB 5GW7A 4HP5A 1V7MH 4PWHA 4YE4L 1NBMG 3ASOB 2DMBA 4WU7B 3SE4A 1CBVL 1G7MA 3MACH 1A22B 1PQZA 4LSRH 2AXGA 3O2WL 3QNEA 4QXGL 2WVUA 3D0VB 3SDCC 1H5BB 4PJ9A 3FS9A 5F7FA 4GW1B 3AG4B 4U6XB 2FECI 1E9PB 1YMMD 3FBKA 1BD2A 3QUKA 4IRZA 1RVFH 4KKLD 4MXQD 5ID1A 4PW4A 3S3CB 1L6ZA 3PDDA 5CCHE 3TESA 4P9OA 2CO1A 4JRYB 5E9NA 4L4JA 4BSVA 2W0LA 3AG3C 1CGXA 3FB6C 1CDYA 1XCQA 4OT1H 4F57H 5LXGH 1XGYL 5C0NC 1S9WA 2G30A 2WLKA 3P4OB 4Y4HB 1OAZL 3ZBHA 2UZPA 2A9CA 4GKLA 4M4RB 5HVGB 1EJ8A 3HLKA 3IVKA 2WANA 2BSEA 1W16A 3EGSA 3QO0B 1QATA 1NCGA 2PYEE 1OP5H 3N85L 1S2EA 3P4NB 1B2YA 4Y89A 3LS5L 3WE1A 1U91A 2C3HA 2CPUA 3K71A 4GQ9H 3PWJA 4MDJB 3U82B 2FJHA 3LS4H 3UYRH 3U0TB 2FX7L 2VQTA 3H54A 3P77A 4JFVA 3LIUA 1M2VA 1PCXA 4MS6A 3HB3C 3HOGA 4ZFFA 1HHJA 4Y9CA 5C0FA 4M02A 5J6GA 4PGJA 4LEOB 3A0BZ 3ETEA 2DJSA 3S88H 3KBEA 4WI0A 4FFVD 4IMKA 2WNGA 1XGYH 3GSRA 3PWVA 1IAII 4XWGH 3N50A 3UTTB 1A65A 1KIRB 1PLGH 3FCTB 3MACL 2W6IG 3RZCC 1E4WL 5TDNA 3ZO0A 1ANUA 5DI8B 2YQGA 1XH3A 3QZWG 1V3LA 5ICXA 2JK5B 3O9WB 3T9WA 4NNXA 3BQUA 5F7LB 1MOEA 2HJLA 3PABA 4R90H 3HI5L 3C3TA 4FP8L 4KK6D 3I6LD 3BVWA 4HOWA 5INDB 5IQ7H 4CH5A 3GGWB 4QRUA 1D5MA 4L1DA 4I9WA 1MKFA 3O6KH 1JRHI 2NY6B 3VG9B 2O93L 3HAEA 4HS8L 4YHIA 3QJXA 4NJAH 5D4IA 4RMWA 4WY7L 4DESA 5AAPA 2R1XB 3SDYL 4BGLA 3TASA 4PD4J 1M6OB 1I9JH 2OSYA 4MA8H 4DKDC 1QFPA 2XZQH 1E90A 4PWKA 4DV0B 3HJEA 1QFHA 4OB5L 4YWGH 4KNSA 3DKHA 1Z3RA 3I3DA 1MVFA 5IMKB 3IM1A 3V4VB 2W80C 3K6SB 4I50B 1YEKH 2ZKHL 1PS3A 1HQ4A 2K70A 4G8IB 2BJMH 4LVNB 4NP4H 4YHKL 4JZ2A 4BSWB 5EBMA 1YECL 4GG8A 2ZINA 3SJVA 5CA3A 4FCHA 3ZDZE 3ES6B 3MI6A 3B8SA 4HCFA 4P5TB 2GBUA 4GUPA 4Y5YB 4ZZKA 5FYLD 5IB1A 3KZIZ 2FBJL 2YBRB 3QUYC 3BUYA 1CYWA 2O5XH 4JQVA 4XOCA 5HGHA 3D3VD 3MRBA 4F7TB 3T2OA 1ID5I 3SKOB 5GS1C 2J8UE 2QQQA 4PWGA 2GJ6D 5JIHA 1FJ1A 1OQXA 3ARTA 3FU7A 2DIEA 3ZMVA 1J9SA 4Z1PA 5LDSA 2H32A 2HG0A 3KPRA 1BFTA 1GS6X 4XXCA 4PG9A 1P7QB 2MOVA 4YHYB 2Y3NA 4HUVB 2BVOA 2C3WA 4UT7L 4WZ9A 1CFQA 1UPGA 4HKBA 2CO2A 4NX0A 1F97A 2NUPA 2B15A 4ZMVA 4YSAA 3AWEA 1ET7A 1ZTMA 2F8IA 2HMIC 2I9LB 1XAUA 4B7LA 1Y4MA 2CK0L 2XASA 4WGVB 3OR6B 5EBWC 3VWJC 2BMKB 4M7JL 1XNRO 1HHJB 1JDDA 4C56E 1AXIB 5IT2L 2GTAA 1QLEB 3PF2A 2PTUA 4QTHB 5I8OL 3C9NB 1U96A 2V7NA 3EGDA 1X44A 3W11C 4MDJA 3QUZC 4WI6A 2NY4B 3JAKA 3CLWA 1NAKH 3IWUA 2FB5A 5IESL 3QEHA 4WU5B 5KVEH 4AT6A 2ZYRA 4XP4L 2DKMA 2VJXA 4M48L 2CH7A 1IGCH 1VFBB 4IKJA 4M5TA 4PRDA 3HZVA 4Y1AA 3UT5B 3EF7A 3VWJB 1MG3C 1E8XA 5E6IB 5DK2B 3WIFB 3DMMB 3CP1A 1AO7A 2IAMD 4HFUH 4HUCA 4F9PC 4KITB 3FO9B 1GM8A 1AC0A 1MFCH 3U2JA 2JB6A 3SGKC 2YRZA 1SC5B 5ISZB 3EOBB 2QQKL 2F4VB 4JRYA 1YY8A 3SEPA 3M8OH 2ZXDA 5ITZB 3SGEI 3N55A 3CC1A 3OKLA 1A6WL 2E27L 5EOQL 1ORSA 3K2UL 1TUBB 1S7QB 1N2RA 3JV4B 4WFGD 3NFNB 3ZRSA 4JKWA 4WJ5A 5DJ8B 4ZTOL 1KCLA 5EF0A 3V0AC 1WC7A 2VERN 3FAXA 1UT1A 4IK6A 4M8RA 5KSBF 1LQBC 4GRWB 5GZOD 2YUVA 2KKQA 1R19A 3RPKA 4K5LA 2HRLA 1XIWA 5AB1A 1KTLB 1MCOL 1KLGB 5DMKB 1F2XK 5E99L 4WNQA 2FQEA 1HVXA 3QVNA 1HI6B 3MLPA 5C71A 5FO8B 2F53B 4P2QA 2DM3A 5C0CB 1KPVB 3NEEA 3SE8L 3SODB 4LF6O 4FNQA 4CSTA 2P8LB 2X2YA 2JCCE 4UU9B 4YVUA 3EDKA 3ZTJG 5E8EA 4IOFC 3L9DA 2W59A 4OCYL 3G6EV 3F6LA 4MSWC 2YPLD 2NY7H 3NZUA 5DMJB 4DGYL 7CGTA 1GMIA 4OI8A 2VWJA 3NSFA 2ZD0A 4BFGA 1NAMA 4N1CA 1AS8A 2CM6A 4I4WA 1KMIZ 1Z9SA 4A7QA 1GIGL 2WZPD 1YMMA 1ZE3C 2F1BA 2XTJD 1PL0A 2CCWA 1UZ8B 4HYTB 1ACYL 4M6MH 5TDOB 4EN2A 2W95A 4IQHA 4LQFL 1LP9B 3T3PE 3ZS8C 1FE8L 2OJZL 4YSUA 5AENA 4JASA 4CADB 5F88B 4LMQI 1N4CA 5J13C 3SQRA 5C0AD 3T6VA 3LNHA 3CN1A 5JQGB 2ICEA 5DURD 5CBAB 4G82A 4EE2A 3MBED 3DGDA 4ODHL 3RDTB 4F58L 3MA7A 3CHQA 3WLBB 3CE1A 4LXFA 4NZUL 3MXVL 2VAJA 4LCWE 2X4PA 2YGQA 1HYSD 5BV7B 2ZR2A 2XWTB 3VFTB 1I9JL 4WW1B 3FT2A 3V4LA 5LMUO 4QF1A 4K4KA 4MZIA 1RZKH 1NZ6A 2Q7EA 4Z7UB 1J0JA 1ZV9A 1W8EA 5KSVA 4JREC 3I50L 3OTOO 4J39A 3HUJB 1ZLEA 3K72B 3E2EA 4NJAL 2NMSA 1KG0B 3N3EA 3OLDA 2UU9B 4IGBD 4UOJA 3U6RA 4B5EA 4K9EH 4NC1C 4J12A 2BNQA 4P23B 2IH3C 1WDAA 3OG4B 4JAMB 5JIQA 5F1IA 1E4WH 5EN2A 1FL5B 2Z31B 4NM4L 4K0KB 3DX3A 3MXVH 2WGNB 3UZVB 2IDUA 1JGVH 2VDRB 4MMYB 4HX1A 1YMMB 2IDQA 2YHGA 4JG1L 4BV1A 3W0WE 5I71B 1RI8A 4G59C 2J5LC 3QNYA 2DMXA 4DH2A 4N9OB 3AABA 5I18H 4P2OC 3RFZC 4QRSB 2H1LM 1M56C 2AZ0A 3U7AA 2A4EA 5F89B 5I16A 2EDJA 3JZYA 1K4DB 1BLNB 1UWEL 3BP7B 3HS8A 4L29A 4WHDA 1K34A 3TPUB 4S1RH 3GJFA 1DQMH 2W60B 2DQMA 1KPVA 1SYVA 3QFGA 4IYHA 4RFNB 5IJ9A 1GSMA 1K9MW 1UC6A 4JY5L 4OPAA 2JI3A 1BAFL 1EV2E 3H3BC 1OLLA 4Y4KD 2C3GA 2I9TA 5KOMC 4Q56A 2ICEC 3GWKC 4CU8A 4PGZA 1KT2B 1PGRB 3VFPB 4V2CB 1S3RA 2UUBB 1MHPH 3FX7A 1N5YH 1CD1A 4GB9A 1G84A 2WYIA 3V2AR 1UTDA 4F57L 3LEYL 1BQRA 2LT9A 1TG8A 3BLKA 3QK0A 3UX9B 4MA1B 1MHEB 4BM7A 2NT1A 3FUIA 3ILEA 3EG9B 4F15C 5LGKA 4QY8A 4YDIH 4YXLL 4ODBD 5INCB 1F51A 4UVAA 4JO3H 3ZL4L 1U3YA 4DIXA 4ZMPA 3AY4A 3CZSA 2JQAA 15C8H 5KLVH 3T0AA 3WFBH 3U4BL 4BKTC 1RJYB 3MHZA 2EYRA 3HG0A 3C6SB 3F58H 4YE4H 5CEYA 2HJDA 4TVPL 2QSTA 4R3SB 1U3HA 4UUJB 2QFPA 2QSCH 2NUTB 2WV3A 1EFXB 3QWOB 5KN5B 1IZ3A 3RWFB 4YL9A 1WF5A 1RK0B 4HUKB 3ZMSA 3HKCA 3EGXB 3LSOA 5FKPA 3WEOA 1NICA 3A24A 2AXFB 2IMMA 4YH6A 5I6PA 2CH8A 1AQDB 1GCFA 2LLNA 1MAKA 2X6UA 3DI3B 5LGHH 4AYSA 4EEEA 4HS3B 3DK0A 2IOMA 3WL9A 1A6TA 1M7DA 2AJVH 1RPRA 3C6LD 3HIZA 1JP5A 3FCGA 5CJ8A 2DQHH 2JCWA 4OPHA 4Z78A 4MB1A 4WWKC 2X4SA 4MXVF 4ZKIA 4C8XA 1P7QA 4M1CD 5LMNO 2HUHA 1OGTB 4IRSB 2WZ6A 3CU7A 3RVVC 4DZ8B 5F70A 2AAVA 4XHJC 1CICA 1QI3A 3F5WB 4OLYH 2X05A 5C3IA 4B9PA 2DQJL 1AOHA 3OD3A 1KXTB 3R0NA 4H8WL 5DT1H 4YXKL 1MCBA 4YDIL 4AVIA 4O2BB 2HFFA 1DVSA 3WFEL 1J7VR 3G04A 3K59A 3HNTH 2R59A 1N19A 1ZT1A 2RGSA 3NFSH 1OCOC 4PGCB 2MK3A 5J89A 4G6MH 5IJCC 3WIHL 1YZZA 4X1KB 3MRHA 3TZVA 2JVDA 1TYEB 1NCNA 3H53A 3QEQD 5I23A 4BSWA 3BH9A 5EOTA 5IB5B 1HXKA 3LNGA 3FUNA 4UIMA 4QXUH 4UVCA 1NMAH 3SJAC 2RD0A 2KLRA 5I1IL 3FU3A 1JXFA 2BSED 2GBVA 4HJIA 4L2LA 3GZPA 2JJ1G 1FKAO 1ZY9A 3GC3A 4LF6B 1OM9A 3STZB 3TURA 3DGCR 3ROOA 5BVJB 1M6OA 4LZKA 4D3CH 2CAZC 1ZHBB 1JNLL 1MCJA 3KJ4C 3F12B 1E6OL 4LL1A 3TWYA 1D3CA 1UD6A 4PYHA 5LCVL 3QQ4B 1OSPH 1U8LB 4ECNA 1TENA 5LOVA 1ZVHA 1T89C 4TUJA 5JR1H 1ERNA 4HW6A 1A6ZB 5INDA 4AENB 3IFNH 2VDKL 5D6CA 1XREA 3OKDA 4PIRF 3OGCB 1SQ2N 4KJPD 1HZHL 1ZWIA 1O9ZA 4NNXB 4P0DA 1Z5LB 4Y1AE 1CO1A 4U6HB 3KPPB 4Z7QB 3JSLA 2WSPA 5KJ7E 4U1KB 1FNSL 1EM1A 3RVTD 3N9GL 5BMFL 1BJ1H 2X6CA 3FCTA 4X80L 2DL2A 1J18A 4XDJA 2GG1A 4XPFH 3D06A 5E9DD 4PP1C 5H94B 5C0BA 2YXLA 5I2IB 3JV5A 1X7QA 3L16A 5JNYA 1UZ6E 3PDOA 3ZZ1A 1J05A 4EN3C 1FL3B 3E80A 3OJDB 5F9WB 5GGQL 4Z3JA 2Q73A 3HG3A 5AVZB 4U2ZA 2H8PC 3KH4A 4ETQA 2A3QA 2VDRH 4WO4A 1Q9LA 4PJBE 5A6LA 3QCTH 3CXFA 5I19L 1CF1A 5LGJB 1PFOA 1ECZA 2OTUA 4Y19D 1ZL8A 3KPNA 3LNEA 4PBDA 3ME0B 5T1LD 2X4OB 1S3KH 4NQCD 2VWEE 2XG4B 4OD3L 3FAVA 4WKXA 2MRYA 1FSKB 4ASUG 4J6RH 4LLWA 5D6DA 4OJFL 3S37L 5ABDE 3S3JA 4H5SB 2XV6B 3A23A 2AQRA 5CKGA 1BZEA 2ZP0T 4PTUA 4PBXA 1R5VB 1HFUA 2DI9A 1UASA 4HOMA 2YD2A 2YUAA 2LW3A 1ED3B 4FQXC 5CEXA 4HJ0C 5A16B 4L8DA 1WFIA 3QIWB 3GSNH 2VLRA 3Q6FA 4G1MB 4RGOH 4ZBJA 4DGIL 5I6KA 4DHLA 1G7LB 3EH3B 2P22C 4XPAH 3TK1A 3MLXL 1KNOB 1KJ2L 4HZLA 1J05B 3CFKB 4KRMB 1N10A 4G28B 3BX7C 4J3OG 5E51A 3TBWA 3FBQA 3RL1B 3VFOA 1T7YA 5HHQA 3CMAV 2GHZA 1E0OB 2OFQA 3ILQC 5E5UB 5E5LA 3AK2A 1X4ZA 3MV9B 3NEOA 2KLTA 4LLUB 4JRXE 4LF3B 3I9PA 3T6ZA 1EBAA 4U1NB 4H8UA 1YJ9V 4LCCC 4DKTA 8FABA 1DQKA 3V79C 5C07D 1HKFA 2VXSH 2CKBA 2WQ8A 1A7RH 5EIBD 1M3JA 2BNQE 2H6PB 1IILE 3VD4A 1A4CA 4OI7A 1JDAA 1MRCH 1QP1A 1J87A 3FOMB 1R3KB 3ZDXE 5IFHH 4UMGA 5CIPH 3N43F 2FE0A 2VLKA 5EC1A 4EUPA 3RHWK 2FSDA 3GKZA 1IX2A 4FGMA 2HTLD 4NT6A 5FGBA 4FNRA 1PKXA 5BV7C 5E2TL 2BXZA 3P4MB 4L8BB 4XNUH 4N0UB 4X99B 3O2DL 4QTFA 5C0EA 4NQCE 4F58H 3NGBC 2UYLA 4JFED 1A6AB 4OTXH 1JGEB 4QRRB 5D7LE 4A68A 3ULUC 1BM7A 3AXHA 3VFRB 4RBPH 5IR1A 4OZFH 2FQFA 4QO1B 5E2WL 4X1KA 1F4NA 2HVJC 3OKNB 3TZVB 4AEEA 3TV8A 4CMMA 4G7YH 3WHXA 1DJGA 1ZLWK 3RUGF 4JO2L 3Q2NA 5FFLA 5CGYC 5DWUH 1DZBA 1CP9A 3I84A 4R5TA 1GM9A 4UB8Z 12E8H 1WBYA 3KPQA 1KCVL 1II4E 1NBYA 4GUPB 3LRHA 3LRGA 3D85A 5F6IB 4X4KA 4I0PC 4KDTC 5GZOA 2GBAA 3EZ8A 3LRMA 1WA8B 1BMGA 1GOHA 1MWAB 2EIDA 3ULAB 2HRGA 4WFBV 4P4KB 3MV7A 1XVSA 3MREA 5GRJL 5DXWA 3T1HO 3IS0X 2E7MA 4WTZA 4HMEA 4F2EA 4FTVE 5DZNA 1PX8A 3APCA 1ZT4A 5LLIC 3GBMH 5CCJA 3C6LB 1VCAA 3J27A 5TGBA 2EILB 3B4NA 2A73B 2Q0OC 1W2KT 1QLEH 5CB4A 3L8QA 1D5BA 4JHWH 3VI4F 2J72A 3MRJA 3I56V 1DJWA 4PJXE 1BCIA 4Q74A 2WZ5A 2AMGA 3WNJA 2EDYA 3WIHA 5A40E 5SV3A 1HNWB 2YQ2A 1PNKA 1VQKV 3K03A 1AXTH 2P5WE 2JKSA 3RY6C 1NGPH 5I8CA 1OF0A 2DPKA 4X88A 5GGUB 1E40A 4I5BB 3SY0A 4W9FC 2BZDA 1AXSB 4LHUG 5CGTA 3CWBH 2ZXQA 1QLFB 3RURA 2NY3B 2XZZA 4G83A 3QFDB 2XAQA 5LJYH 3J81N 1JJUA 1IC0A 3MR9B 1FFXB 1QNMA 1CDUA 4GMSL 3RUGB 2XN9B 4ALAL 5AAWA 4MXWL 5HSFA 4FEMA 4M1DL 5J12C 4X6EB 3B7TA 2C1PB 1PZ5A 2PYFB 2WTOA 4Y5XA 1DSFH 1OK8A 1MVYA 3WG7B 4KVCH 1F6AB 1LDPH 1L9OA 4WDIB 4ZUUA 1FV1B 2IDTA 4WQOA 4AZ8A 4LT7A 2NNUA 3QHZH 4I8DA 1NANI 5H35B 4A6YL 1XHXA 2EZPA 3PWJB 1YNLL 2C1PA 3SDAD 4PJAF 4PHXA 1PZSA 2WAHA 2WUCH 2BSTB 3TT3L 5J7CC 4F33A 5C09E 5T3ZD 2FJFA 4P2CG 5JO5B 2H1PL 4N2CA 3VXRA 3S3DB 4UT9A 1H8EG 3VGAB 3N1PC 1C7SA 1IZKA 1IGYA 2YMTA 1ECYA 2ZP8A 4LSTH 1W8OA 2ZD9A 4QT5B 2FWLB 1MRFH 4NKDA 1INQB 4YO0B 5JYLA 3QWRA 2OMWA 5KHJA 2GAZB 3LB6D 4FTDA 4K5OA 4OF5A 2ZUSA 4M03A 3SY0B 2BVTA 5TQ0L 3ABKB 1XCQB 5C8YB 5FOBA 4I5SA 5MENA 4JNXA 3QZPA 4LVHB 2Y36L 2B0SH 1ILSA 3BEWA 2FO8A 1ZGLB 4Q0XL 3ZDZB 3IU4H 2R2EB 3E6HB 5CBFA 2IAND 2PI4A 3X1GA 3L71H 2VLKD 4U1IA 2P5PA 4LNRB 7TAAA 3NJIA 1XF2A 4Y1TA 5J5EA 1HXMA 3UC0L 1BGXL 2BS8A 3B8YA 3T08A 5MI0C 5B1AB 2PYJA 3JWOH 1KDIA 4HGMA 4TQHA 3U10A 3HC0A 3AMKA 3P11H 4P23A 4JPIB 4BIUA 3LH9A 3HMXA 4Z5RB 2VS0A 3X3GH 4WEUD 4DV2B 1EO8L 1PL4A 4N2MA 3L6FB 4ATTA 2ZUYA 3LH8A 3V0FA 2OWOA 3GK8H 3C60A 2BWIA 4NI3A 1NJ9B 4RFEB 3GXFA 1T6BX 3FONB 2QTEA 3MCKB 1JUFB 2HRPH 4LDEB 4PJFB 4NXKA 4UAOC 5D70L 3K2MC 4O4YL 4QRQA 5B8CB 2G60L 4I0XA 3VXUB 2EDKA 5EEWA 5C9KA 3TGXA 1DBMH 2E76B 5C7XL 4IEFA 2X4PB 1I8IA 3EBAA 3WB2A 1E3ZA 2R2BA 4L4TA 1SS3A 3DVGB 3QZMA 4QR7A 1D5NA 4TUOB 3TA4D 2Q8VA 2EXSA 2W07A 3ARED 4QO1A 1M42A 4OJYA 1KYUA 4QHLA 2VR6A 3CJHA 3LIZH 1MFEL 4N26A 1OAXL 4EPSA 5CSZA 1L9TA 3DC6A 4Q20A 1TITA 4LPCA 3WDHA 3M07A 2CDEA 3CFDA 3WS6C 2E76C 3WLWD 3C5XA 1HU8A 1TEGA 2DOCA 5TDPA 3VVWA 2R0ZH 2RQEA 3NIGF 4C7UA 5IVXF 3RI5F 1V27A 3VGDA 1DP0A 3OR7B 3NBNA 2YI8A 2FYYB 5E56A 1Q1JL 1Z9SB 3EFDL 4KPHL 4EOWH 2XWEA 4PP2B 5K1NA 2I27N 2IF7A 1JG9A 1S7RA 4L8SB 3T1YO 3I02B 4X9QA 3E3QC 4PLJC 4W9KC 4RETB 4DKEH 1BD2D 4OLXL 4Z1VA 2MHAA 2UWEE 4UQ9A 2K9FB 4MYPA 2GUYA 3CH1A 3KS0H 1T4KB 1T7XA 4HWZA 1LEKB 1NGYB 2IH3B 3FB5B 1ONQA 3ZHTA 2VQEO 4I77H 2QTSA 4QRRE 5D7LB 1CF8L 3REVA 3M46A 5A2IH 5IFJA 1OARL 4ANWA 4LOUC 2MEJB 4A2MA 1HX0A 5CWSB 4YR6B 2UV3A 4DKEL 1BQLL 1S7TB 3HG1B 3QUXC 1H3XA 4QOKB 4AV0A 4GKKB 1TYJA 2RN9A 2CMRH 2GW5A 3BP5B 3HMWL 1TETH 3W2DH 2DQDH 3QEUA 4PPTA 3BEHA 1TLKA 2P45B 4LVHC 4UT6A 1JGVL 1S5IH 5D6DC 5F3FA 3CCJV 3V4UL 4U1SB 5FA4B 5KJRL 1SF5A 1BVLB 3U1QA 1OCZB 1GCYA 1LNQA 3QIWA 4PJDF 4FXLA 1FORL 3ZGHA 4D9LL 4J8RA 3VG0L 1CPUA 2FJGB 1MN4A 4ES8A 2C9UA 3OZKA 1V7NL 1AGEB 4GH7B 4Z7UF 2ATPA 1ILUA 5GS2D 5L2KD 3GD1C 2AEQH 2VDNL 2CO3A 1V9PA 2YIBD 4WUUB 1L7IL 4CW1B 3SYOA 2ZCKH 1F1DA 3HE6B 5DFAA 1LDSA 2H94A 2XTJC 4K9EL 2Z7UA 4F8LA 2D2CC 5HI4C 3AU0A 3M1BB 1TQCB 5HFLA 3UPAA 2VJ8A 4JUTA 5ESQA 2ITDB 4KZDH 3OSVA 4EZLA 2PWDA 2BIOA 4JKMA 5IB2B 4LCWB 4J42A 2NY1B 4MXWH 4MXVE 4RUFA 4G1EB 4PJAB 1KC8W 5F1KC 1Z2KA 3RTQB 1BXVA 2Z7WA 1LP9F 2VMDA 5KA5A 3MRDA 1QX1A 1LUWA 1MY7A 1NMCC 5I76A 4ZFOL 5FO7A 4JFEB 3WEMA 2WP3T 5L8LB 4GKJB 4QRPB 3NCMA 4JQIH 1UXWB 1YEDA 3DRTB 3MNVA 2CJUH 4JFOA 2I5YH 1NL0H 2BCCH 4YEFA 3PIQA 5DMGC 4WNSA 1BCCH 5GS0C 2DQUH 2R69L 4FG4A 3SYCA 2VIRA 2XKUA 2IG2H 4R4FH 3ISYA 4J7RA 3ZE0B 2JJSA 5FECB 3BPOC 2B4CL 4D8OA 2LW1A 1MVUB 5FGRA 4H4NA 4I18C 4X6FA 3F12A 1TEFA 1ITCA 4CVXA 1JPEA 1J1PL 1VF5C 5AB9A 1CLYH 4OZIA 3X13B 1LE5B 1I1AC 4QIRA 2VQ1A 1UZ6F 3IF1A 3ZZSA 4OM1H 3D3IA 3WO3B 3PPEA 3VFMB 2JE8A 4QJ4B 5IKCA 3DMMC 5CIPB 1B0WA 3DVNB 3DUUB 3ZN6A 5KSBB 1CXEA 2A9AA 1FVDB 2FR4A 5IHLB 4LSQL 4LSUH 4WWPA 1JHKH 2MQ3A 3SPVB 1J5DA 1IRAY 3FQXA 4MJ5A 3DIDA 5I19H 4NDMA 4TUYA 5IKCB 2QE7G 1SOKA 3T0EA 2E27H 4HLEA 4ZHQA 1UXSB 3EYFA 2NR6D 5GZND 3X13A 4PGCA 3Q5TA 4FFZL 4KVNH 4KTGA 2F7PA 3ROLB 4U1IB 2FYVA 2VLMD 2IANB 2O5YL 3QFJA 4RMQA 4U1MA 2O6DA 1AACA 1O7VA 2AJUH 5ACZB 4HUNB 5KAIZ 2FD6L 1SQVH 2BZCA 4MVZA 3B5HA 4X7EC 4N0FA 1UB5B 1OPGL 3IJ7A 4FXKA 1PPIA 4HJ1A 5FLXN 4XZ4A 3S36L 3D25A 1ZCRA 1NIFA 1WISA 2JK5A 1GOFA 3MNVB 3E38A 4PJIB 3RY5A 1FVCA 1XHHA 3MODH 2QGEA 4TQEL 4ETYA 4KNTA 1TQBB 3RY6A 1OTTD 1WO2A 3V7AG 4AYFA 2PW2B 4DR5O 3KWWB 4X5XA 1JZDC 2O6PA 3OD4A 4F7PA 4EIUA 2HLFC 4OZFA 2P6JA 3OAYH 4UQ2B 5H2BA 3KPOA 2H6OA 1IAIM 1J95A 3ESMA 4FFZH 3WV0A 4TVUA 3SJVE 4MD4A 2DQTL 1K4DC 3CPLB 5IESH 1G9ML 3SDDD 3QH3B 3K9AA 3OTOB 4I88A 4X5QA 4UQ3A 2DDQL 4JFSA 2ZUQC 2H0EA 3VGEA 4DK5A 2EIJC 3RPBA 3HZKB 5EHFA 1QSEA 4FFBB 2DWEB 5DDHB 1B3JA 1MA1A 5KBMA 2XYCA 1I3UA 2VSCA 3APMA 1WS7A 3NT0A 5KJRH 2ZG3A 2J7LA 3CSGA 5LQBL 1KJ2B 1UD8A 2QQNH 4M3JA 4UB0H 3KLSA 3ZIYA 1T3FA 5GRUL 3VG0H 2F9BT 4HZ3A 4BCYA 2E6PA 5DJDB 1V54C 5E1QA 1HHHB 3EOYG 4JI7O 1N32O 4HH9B 1GL4B 3L7FA 2NYYD 3PV7A 4D7SA 3AREB 2FIKA 3V4UH 1C5CL 3ZMNA 4LESA 1J8RA 1S5IL 2VTFA 3GMRB 5DT1L 3ARFC 1WFNA 3QGVA 3UO1L 4BFJA 4HOXA 1YO4A 4EI5C 5DUBA 2RALA 2OZ4A 5AOJA 3SDXE 3ARPA 1NCWH 4OLZL 1WFTA 4Y19E 1KB3A 2AXGB 4OF6A 5EDXA 3WB0A 1IKFH 4XNDA 1G7MB 4HIEB 4ZSOE 2PP7A 4RRPA 4UM9B 5HHPA 1EHAA 3NJJA 4J80A 1H3GA 1INEH 2WUBL 4X8XA 2M7WA 3KW8A 1SF9A 4HC1L 4JI4B 3NCWA 1FLRL 3L3GA 2V9UA 4BFFA 3AK3A 5JOPD 2WO2B 4NP4L 3UM7A 3IXTB 1G9MH 2CK3G 5D96B 3JD0A 1UB6B 1RLWA 2IV9A 2UX7A 4RQFA 2WXKA 1MZZA 3HC2A 2IGLA 3GHBL 2VXQL 1JNHB 4JM2D 1IC7L 4G70B 3GB7B 3KR3H 4OJCA 2SEBA 4PCSA 5DO8A 3KPQB 3IPEA 4QJFB 1W2BU 2ZAIA 2XZQL 2CNYA 3Q43A 4WVRA 2EO9A 3GIVB 1PDKB 2HWZH 3APOA 2P49B 3DOSB 2JKIS 4LOVA 1O7DE 4H40A 2BTQB 3BFOA 2YR3A 5LBSL 2YD9A 1FUNA 1GGBL 2Z35A 4OX9O 4JFPB 4P4RB 4XVTL 3QDGE 2UWEA 2WXOA 1LMIA 3CBRA 3FTSA 4B95C 1QBAA 2BNQB 4X5WB 3TA3B 4XNXL 5IW6A 5AZ2H 3QJSB 1OHHG 3DETD 4UAOB 4UZGA 4ADIA 4LVOC 3V95A 4Z0XA 2BVPA 2VDOB 1U4EA 2YIBA 3F7VC 3BKMH 2YQBA 3AK1A 3K6NA 2GJJA 2ITCA 4EUPB 3FHQA 4FG6D 1I8IB 4K71C 5JW3H 2BM3A 2FVNA 3DHMA 3R18A 4XBEL 1DJZA 3MZTA 5TF1H 5T3XE 3N40F 1KJ3L 1OOWA 2K45A 1EGJA 4YDNA 3V6ZA 3K6FA 1NCIA 3DSQA 3VTMA 2ZE0A 2J1ZA 4QYOA 5FUCC 3L3KB 4J27A 2GK2A 3MCKA 2QPSA 4HKXA 1TVHB 3GI8H 4B9IA 4RDBA 4U1NA 5KYXA 1MZFA 2HTKD 4HPHA 2GKIA 4LLUA 3KYOB 1L6XA 2IALA 5FCUH 1WZAA 4G8GA 3UO2A 1S8DA 3GUTA 3SCMC 1UA7A 5CP3H 5I66B 2LVCA 1FAIL 1OD7A 1SESA 3UZQA 4W4KA 2KG7A 3L9YA 1PU0A 2HA1A 4G7VL 1IFHL 5EG6C 3BA9A 2FX9L 1UZ8A 2JLLA 2NW2A 4NN5B 4PP1D 4DP6X 1FAFA 3HVDA 4D9QE 4NRZB 4I4WB 3QDJA 1BFOA 3WTVA 2WA3A 1BZ7A 3ZHSA 1LJMA 1X4YA 5BV7H 5DMIL 1BDYA 4KJYA 3G5XA 1LR1A 4ONGL 2NY0C 1XR9B 3CHOA 4N5EC 3JTSB 4NR1A 3CVHB 3G08B 1EZVY 5IHWA 3HI1B 4NQTA 4JYCA 3MC0A 4F8QA 2A9NL 3K2IA 5E94A 5ERWA 3FQRA 4O2EA 4Y1AD 3RW0A 2OMWB 3HHRB 4E41B 5KVEE 5EU5B 4AQYO 2V8MA 4AC2A 2CGRL 4BE5A 2P24B 4HIJB 2FYUH 1NZRA 3TBBA 3L5IA 5GGRA 5BVPL 5C8JA 3HE7A 1MCWW 4XMZA 5JR1L 3C2SA 4OLVL 2FO4A 3L5WA 3V0HA 2XN0A 3MXWH 1OV9A 3ULSA 2VXUH 2P8PA 5DS8B 3JT0A 4FMTA 4JPVH 2DTML 4X62O 5HHNA 2ICWJ 1Z5HA 2VDML 4K3HA 2ENSA 2ZWKA 3LZPA 1NBQA 3QW9A 1RIVL 3I2CL 2VAAA 4JO4H 1RU9L 1QHQA 3CXCU 1EO8H 1FIEA 3OB8A 4ONGH 5C2BL 4Q6KA 2YKLH 4Y5XB 2FLBT 5ITZA 4PRID 4M8UA 3V0DA 3PDOB 3K6OA 5CHNB 5GGSB 4UANA 2Q9LA 3HW7A 4LBEB 1XGZA 1YMHA 5TE6L 3VGFA 5DJDA 1FORH 3LCYA 4IGBB 3P9LA 4JFTA 3P9MA 2VMFA 3D2UA 3BWUC 4UDUB 4OIBA 5K1JA 1M5IA 2IFFH 1D2DA 3I6LE 2EIKB 3MV01 3VWJA 1YC7A 5DJAB 5B38B 4PMFA 3N1GC 4TUKL 3AC0A 2NY1C 1FH2A 4O9HL 4DRXA 3EJPA 1L9PA 3SD5A 5F7UA 1JWUB 1U8PA 5LOVB 1CGUA 1UD3A 3HMWH 1H2LA 1L5GB 3PHQB 4HCIA 1KN2H 3Q2WA 4P4KC 5TQ0H 3QNFA 3QFJB 3T3MB 1XGRB 1VGEH 4ZMQA 3CFTA 5IJKC 3LHAA 3TH3T 3U0ZA 3MJGX 3QG6A 3MLYH 2DQHL 3QFJE 3JUYA 2WXIA 5HYSB 2P9RA 1OGAB 1E3FA 2A74A 1NUGA 2CNZA 1I1FA 1PJ9A 2BIPA 2PCXA 4DO6A 1ZV5A 1J0ZA 4BIOA 3SKJL 1UWEH 4LCUC 4DERA 3JT2A 3RA7H 1H9VA 2NZ9D 1VFAB 1KZQA 2CBMA 2NQDA 4FQXA 2DAVA 1CFBA 2BDNL 2J20A 4X9BA 1ZHLA 4I4TB 3AJ7A 5C07E 3RGVC 1ITBB 2WLIB 3FOLB 4N2HA 3T77A 1IX9A 2H4EA 5I0WA 4EDWL 5GTIZ 1AG6A 4JG1H 3PCYA 3DURB 1AZZC 1BVNP 1QBMH 1U93A 5AW3B 3K8MA 2DQCH 3ML8A 3WTUA 1JNJA 1F58H 2F68X 4XCFH 1A6PA 3IJSB 1TJXA 3PIQB 2LLLA 4OM0L 4IRSA 3US9A 1KEGH 3JASB 3SJVB 2X1WL 5AWNL 2XNDG 4Z7WF 3V0EA 1E9QB 1QAWA 4Y2NA 2PF4E 1G7IA 2D7NA 4U33A 3MRGA 3UGEA 1MF2L 5JHLA 4OZGB 2HVBA 4ODUA 4Y2LA 4XC1H 3RIAF 1F45A 1OGAA 4IRJD 5IG7B 2ARHA 4OVVA 2OI9C 4OGYL 2V5SA 4PJHE 3LSOB 2AHYA 3MRCA 2I60L 2OR9H 3EDFA 4H8HA 3GSVA 1QVGU 1I94O 2ZCLL 1Q0YH 1J0IA 1W80A 2AJYL 2K3TA 1MSWD 2ZKYA 1JTTA 2AK4A 3BAEL 1XMQO 3FUKA 1MFDH 4Q2ZB 5AKSA 4D0CA 1KTCA 3CGTA 1PP9H 3ZTNL 1OZTG