1OCRB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
b'MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ocrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ocrB02
1JXDA 4CSZA 2GI0A 2EIKB 1OOWA 2TSAA 1WA0X 1SHXA 7PCYA 4E9WA 6PCYA 4BWTA 1BXAA 3H56A 4ZK8A 5I6LA 3NJNA 3TA4D 3NSYA 3FPYA 4DP5X 4BDVA 1GW0A 3NJMA 3FSZA 1NINA 3ABMB 1MZZA 4YSAA 5I6PA 3PPSA 1KV7A 4DP6X 1MZYA 2XXFA 4YL4A 3FYEB 2BP8A 2FQDA 2BO0A 3UGEA 4YSSA 5ANHA 3NJJA 5E9NA 2VN3A 1CYXA 1NIEA 4DP0X 4BWWA 1XB3A 4DP9X 1W8EA 1BXVA 2I7OA 1PY0A 2FNWA 2XV2A 1PMYA 1HAWA 3NSDA 2IWEA 3ASNB 2I7SA 3CDZA 4BXVA 4HIPA 3ABGA 2XLLA 1PZAA 3CVBA 1L9PA 1BXUA 1KBVA 5AKRA 1SF5A 1V10A 2HX7A 4RH4A 2YAFA 4E9VA 3EHBB 3QPKA 1JVLA 4YSRA 2BW4A 1GS6X 2OCCB 1L9SA 5I6MA 1J9TA 4YSEA 1GYCA 3N2JA 1WS7A 2Y1AA 3BQVA 4FAAB 3NP3A 2PCFA 5D4IA 1OCZB 5PCYA 4DP7X 2PP9A 1ASQA 3GXUB 1HAUA 1BAWA 4G7QB 4W1TA 2FT7A 2I85A 2PPFA 4NAJA 2J55A 3FU8A 4DP2X 4EF3A 3TU6A 4E9RA 1NICA 4HZ1A 3FU7A 2MRYA 2ZWNA 2PP7A 1AANA 2HX9A 1KCBA 2P80D 3S3BB 1JXFA 1DYZA 4HCGA 1WA1X 4E9XA 2BZCA 4GP5B 1JZGA 3NJHA 1KDJA 1AZUA 1GY2A 1YLBB 3RYMA 3OMIB 2UXGA 1SFHA 4YSCA 1R1CA 2UXVA 2IDQA 4A2EA 3AG4B 1TKWA 2BP0B 2XVBA 1JZIA 3NJFA 2OV0A 4KO9A 3T6XA 1BQRA 4DP4X 4MFHA 3S3DB 1NIAA 4YVUA 1ZPUA 3UABA 1BQKA 4JHVA 3WIAA 2IDSA 4UF7C 1XMEB 2QT6A 2RACA 2IWFA 5I5IA 4BDVB 1AS8A 5TK4A 2YAQA 1AOZA 1BQ5A 4A68A 2P80A 1ETJA 2DYRB 2Y69B 1NPJA 5B1BB 2LLNA 1QLEB 1QNIA 4P5RA 3X1NA 2BP8B 3QJVB 2EINB 2FWLB 3GDCA 1W6LA 1L9OA 3T6VA 1E67A 2JKWA 4G7RB 2XUWA 2GSMB 1IBYA 1JZJA 3EF4A 3X1EA 2HX8A 2NRDA 1GY1A 2ZONA 4AI7A 1PAZA 3IN0A 1AQ8A 3WKPA 3FSAA 3CDZB 3PAUA 3AG2B 2IH8A 2WO3B 3NP4A 4KO5A 5LDUA 5FC9A 3DTUB 3NYKA 1V54B 3L45A 1N68A 5IY5B 1OCCB 2UX6A 3FSWA 4KNTA 2VM4A 1IC0A 5B1KA 3X1GA 3AY2A 2UX7A 4F7KA 2VW6A 1OCRB 2PP8A 1ADWA 3S8GB 1NPNA 4GP4B 1CC3A 2W88A 4A66A 2DV6A 3S3CB 2IH9A 1GS7A 2H3XC 1AZCA 2XV0A 3FYIB 5B1AB 3T6ZA 4KOBA 2FT6A 4F2FA 3QJUB 1ID2A 5D4HA 1ET7A 3OM3B 1TEFA 1J9RA 3FSVA 1NTDA 3D12B 4YSOA 3AG3B 2Q9OA 2R7EA 5B7MA 2HRGA 3C75A 4HHGA 1J9SA 3ZIYA 1OE3A 3EH4B 2VW4A 3NSFA 4G7SB 3HEIB 3FU7B 5B1JA 2ZXWB 3PCYA 2FQGA 1N70A 1PF3A 2PPCA 2EIJB 3FPXA 1PZBA 1GS8A 2XU9A 1NDTA 1CUOA 2A3TA 3TBCA 2QDWA 3NSCA 1PLCA 2EIMB 3QJSB 4YSPA 4AKPA 2UXTA 1M9WA 2VMJA 4K9JA 1J9QA 3MX0B 1CYWA 2HRHA 2AANA 3WNJA 3GYRA 1BYOA 1FWXA 1AS6A 3NJKA 2X87A 4YSUA 4JHUA 5I5MA 4GY4A 1AS7A 4AKOA 1KBWA 2E86A 3T71A 1E30A 1AZNA 3V9EA 4HAKA 3FT0A 3H4FA 5AZUA 3T6WA 3PAZA 1BEXA 4TXVB 2QPEB 3N55A 4F2EA 3FQ2A 1IUZA 1M56B 4L0PB 1KYAA 3IN2A 3OQRA 4A2GA 7PAZA 2FT8A 4KNUA 9PCYA 3TBBA 3V9CA 1RCYA 3FS9A 3KW8A 3JT2A 3FQ1A 3ZBMA 2IWKA 2PLTA 3KW7A 3AZUA 1J5CA 3X2QB 2GBAA 3IEAA 4GYBA 2GC4C 4HALA 4GP8B 3SBPA 1KCWA 2AZUA 2OJ1A 3X1FA 2DYSB 4N8UA 2J5WA 1ILUA 4KO6A 2J56A 1RZPA 3WNIA 1A4BA 2XX0A 2GIMA 1I53A 2YAPA 3EH3B 2JFCA 4WTQA 5I6KA 2YAEA 5I28A 3OMNB 4DPBX 1M57B 4KOCA 1UATA 1AIZA 4Q8BA 2N0MA 2IDUA 3TASA 2YARA 2QPDB 4DP8X 2W8CA 3QJQB 3FU9A 4DPAX 2FQEA 1E5ZA 1MG2C 2TSBA 1IBZA 1ZV2A 5I5JA 3QQXA 4E9QA 1JZHA 2XXGA 1EZLA 6PAZA 1MG3C 1SDDA 3UAAA 1A8ZA 2DWTA 2AVFA 1J5DA 1L9TA 2GB2A 3AG1B 1W6WA 1ILSA 2BW5A 1X9RA 2VSMB 4YSDA 4FA7B 2UXFA 1OF0A 2EILB 2QDVA 1HFUA 2CUAA 4UANA 8PAZA 2R7EB 1JZFA 1PNDA 4HHWA 4M4RB 2CCWA 3QJTB 3FQYA 5F7AA 1ZDQA 2JXMA 3ZX1A 4WKXA 3SBRA 3H4HA 2WO2B 3NJIA 1WS8A 4QLWA 2IDFA 4AKQA 1NIDA 1PLBA 4P5SA 3G5WA 2YAOA 1ZIAA 3ZDWA 3JTBA 1GSKA 2BZ7A 3DIVA 2YEVB 3DKHA 4NERA 2IDTA 3NJLA 4KNSA 5I26A 4E9TA 3AW5A 3PLYA 4N4YB 4HCFA 4Q89A 1T5KA 2GHZA 3U25A 3UACA 2ZOOA 1JOIA 1AR1B 2VW7A 4GXFA 2PCYA 1AG6A 5I6NA 2YAMA 3CVCA 3CZUB 2B3IA 1FA4A 4PCYA 5TK2A 1GR7A 1EHKB 1B3IA 4DP1X 3UAEA 3PXLA 2XYBA 3S8FB 1PNCA 2MTAA 1NWPA 2YQBA 3X1BA 2PPDA 4BXSV 4UAHA 4BK5C 1BYPA 1JXGA 1PCSA 4YSQA 1CURA 2PPEA 4DPCX 1XB6A 2FQFA 2X88A 1DZ0A 4W9ZA 2H5UA 2CALA 4G72B 4G70B 1E5YA 4A2HA 2B08A 2FTAA 4NB7A 4X4KA 1AG0A 1E65A 1SHWA 1SFDA 1V55B 1X9UA 5B7FA 2XX1A 1URIA 1NIBA 4AZUA 1FFTB 3HB3B 1ZIBA 3OMAB 1SF3A 2VSKB 4A2FA 4E9YA 1NIFA 4G71B 3ABLB 4YVNA 2FJSA 5B1JC 2BHFA 5A7EA 2WSDA 1OE1A 4PAZA 1JZEA 1ET8A 2XV3A 2H47C 3PAVA 2VM3A 2AZAA 2BWIA 1SJMA 4M3HA 3CVDA 1A3ZA 4QKTA 2AFNA 1MDAA 1PLAA 4AX3A 2CBPA 1PZCA 3ABKB 5F7BA 4A67A 1SDDB 1RKRA 1ASPA 2HXAA 1A4CA 1IKOP 3IBOA 1AACA 3UADA 3IE9A 4CSPA 1SNRA 3ERXA 3T9WA 2CAKA 1F56A 1WA2X 2J57A 1TU2A 3WKQA 5D4JA 1AZBA 2HLEB 3OD3A 5AFAA 5B7EA 1A4AA 1AAJA 2GC7C 1ASOA 4KO7A 1A65A 2DY2A 2XWZA 5I6OA 2HZHA 1VLXA 3EH5B 1OV8A 2YAHA 3NJGA 3NT0A 1L9RA 2BWDA 1OE2A 3QJRB 3CG8A 5PAZA 2IAAC 1WAEA 1AZRA 1L9QA 3WI9A 1QHQA 1OCOB 1XB8A 4A2DA 4BWUA 2YXVA 4HCIA 3SQRA 1JVOA 1RZQA 2CJ3A 4YSTA 4JKNA 3WG7B 1JERA 2Q5BA 4ENZA 3MBWB 1KGYE 1ZDSA 5B3SB 2YXWA 1NZRA 3SBQA 1KDIA 2DWSA 1NWOA 4E9SA 1TEGA 2PPAA 1ET5A 5EHFA 2BP0A 3BVDB 3ASOB
chains in the Genus database with same CATH superfamily
2ADFL 2GI0A 2GYSA 2ENQA 3NZHL 4JG1L 3M7FB 2YPKB 4FPPA 3ARBC 3K0DA 4XN8A 2E7BA 1HNWO 1JF5A 1KFGA 2PTUA 3QPXL 1K5WA 4YJ2A 3H56A 1FH2A 3NJNA 3QEGL 3MRDA 1YCSA 1CD8A 3MO1A 2F53B 4OFYD 1HHIB 2PTMA 1XGUA 4N8VB 3S35L 3RNKA 3K46A 1N6QL 5ANMA 4IS6B 5ICZB 3K80A 1JL8A 2AJXH 3BLPX 2WBWB 3DXAE 4JDTL 5KSAB 4JJOA 4YL4A 3TZVA 1NFDB 5IT2H 5ITZA 1EIBA 2B2XL 4NO3A 4XNUH 2EJ7A 5IWLA 4PJ7A 1IQDB 2ARJB 2VDOB 2VLRD 4L2YA 5E9NA 3RHWF 5LDSA 4XAWL 5GJSL 2OL3A 5L3BA 4PRHE 5H94B 4R5TA 4CKVX 2BXZA 4FFBB 1S0VA 1MRFH 3DHPA 4M8RA 1GTOA 5CU9A 1W16A 1UD8A 1MCCA 2WJ7A 2X70A 2YMXH 3NA9L 3NG5A 3QIUB 1PMYA 1XEUA 5EBWB 1W2KT 4OM0L 1E4XH 4AYEC 1R3IL 3W11D 4XXDB 4NQEE 1MOEA 2J4WL 2X42A 4B97A 3PN1A 4NXMO 3S3PA 1L9PA 1GM9A 2BOCC 5KTEH 3PJSB 1MFVA 2Q6AA 5HFMA 4O00A 1W59A 1OXYA 1JVLA 3QPKA 1DCLA 4M29A 4HULB 4J27A 3W9DB 3QORB 3VD7A 4OQTL 5EU3A 3PP3K 2OSLA 2XTJE 1IXMA 3QUXD 5KJ4A 1MWAH 43CAA 1E8XA 4L9LA 4FNTA 4XVSL 4NBXB 3H1ZA 1E0OB 3KH3A 4FAAB 1J05A 4ELMA 2WQWA 3OKMA 5C2UB 1LR1A 2HN7A 2DN7A 3CHQA 4OJYA 5PCYA 3CDGA 3FB7B 1IGYB 4FG6C 3ZGIA 5FYLE 3IXTB 4Y16D 5J1TC 4FABH 3SGDH 3AACA 4HUKB 1MAJA 2Q5ZA 4MA1B 1EUTA 1TVHA 3RLSA 1RP3B 1ZT7B 4UTBA 1BCIA 4HFUL 2SEBA 1HCFX 1N7MH 1ZWIC 1SUJA 2J55A 3GHEL 3IMRA 4J3TA 4V2BA 4YDLC 4E9RA 4HZ1A 2DQEL 2BS8A 3M86A 4GQPH 4W9EC 1MCLA 4N24A 4X7TB 4PLJC 2ALAA 4UZUA 4BCYA 4N6RB 3KS0J 1RSOB 4MA3A 3N27A 1S7SB 3PNRB 3F3HA 4M8QB 2DLHA 5KG9B 1FYHB 2RFXA 4YDMA 4DAGH 3UC2A 4ERSL 1PIGA 3C5SB 4LLWA 3TJHC 3UCQA 4CGUB 2QFRA 4TOIA 3RGBA 2CBOA 4IHJA 4J23A 4A7VA 2MNWA 2YSTA 3QZNA 4ESKA 2Z9TA 1MG1A 4PLKD 3N43B 4YVUA 5LBSH 3MKKA 2XZCH 1AYRA 2A4CA 3CFQA 3L5JA 1EDHA 3GJFH 5EIQA 4YJ2B 1WIPA 4NIKB 3MACH 5I66A 1JUFA 3MRDB 3MO1B 2VXQL 2LLGA 4P07A 5FYKH 5TK4A 1XGUB 3PHAA 4TQ8A 3RNKB 1R3KA 5ANMB 4NYKA 2R2EA 5B3JE 4P48A 1BG9A 3HZVA 2OZNA 3TZVB 1J5IA 1VF5C 4MW8A 2LW3A 4H20L 5ITZB 1URLA 1FNHA 3QJVB 4K7PY 4LSVH 4GG6F 4NO3B 3FQRA 1JHKH 5GS0H 4PJ7B 1X5IA 4JFHE 4Z7OF 3CU1A 2KDGA 2XUWA 4J1UA 2GSMB 2OL3B 2OR9H 5L88H 3AS3A 2E8ZA 1DFBL 2X70B 3AT0A 1R4XA 2QLVB 1RHHA 3WBDA 1PW3A 5FPOA 3LPOA 3EFDH 3SKNA 3REVA 4PCSA 3EYSL 1OKEA 3MJ7A 4PJFE 3DTUB 1OAQH 3CLFH 1QWHA 2PWFA 2QPFA 5EZLA 2PZSA 1V54B 3RY4A 2G60H 2DW4A 4ZO6A 4IRZH 5CGYC 5IBLC 3FN0H 1EHXA 5EORH 5EU3B 4H0HB 4PVLA 1GW6A 2OSLB 2QQNH 4F2ME 2PP8A 5AW6B 1NPNA 43CAB 1MCOL 4L9LB 4YXHH 3DA0A 1J05B 4ELMB 3T2MA 3OKMB 3ESPA 2R56H 2HN7B 4M6OL 3CDGB 5JO5A 2FECI 3LRKA 5D7IB 4NN6B 3V4PA 1NCCH 5BUAA 4U7MA 1G9EA 3LKRA 2WQ8A 5GISH 5ICUA 2UY6A 1TVHB 2XSKA 3R7QA 3W56A 5I1AA 1HKFA 1DVZA 4OLXL 5AW3B 2HFEA 2VDRB 3ARQA 3BZFA 3O2WL 2SEBB 3QJHA 3WUZA 2ETWA 4D2NA 3ULUH 5KVEL 5IREA 4JE4B 4FYSA 1JNJA 4K23L 4MA3B 4DK6A 3C90A 2GFBA 3CXDH 5EUOF 2P06A 2Y7SA 2JJWA 1K7DA 1YEIH 1Y1UA 1GZHA 3DSNA 4XO9A 2RFXB 4WHDA 4DKEL 5KANI 1KBHA 4LLWB 1FORL 3QWNA 4LLYA 4WEEA 3QUYD 4IHJB 3ASOC 1B9ZA 2WWNA 2AEIT 4N23A 1MCRA 3WNJA 2NY1C 3MU3A 3GYRA 1AS6A 2MHAA 5C9KA 2EVGA 5T1LA 3CX5F 2KKQA 4PHZA 1GGUA 1AS7A 1VJSA 2QVFB 3HB3D 4ZO9A 4JRFA 5I66B 1JUFB 3FT0A 1CBJA 1MCDA 2BJML 5JOPE 1DJXA 1OGAA 2XCMC 2WLKA 1R3KB 1WBXA 2CG9X 2Z1KA 4AGOA 2R2EB 3VXUD 4B3EA 5CEZD 1KEGH 2WNWA 1H8SA 3HZVB 3CH8A 1BIHA 3TBBA 1R24A 2VH5H 3RX8A 3FS9A 4P04A 3LB6C 4J1UB 1OTUD 1MDTA 1TQCC 3IM1A 4WO4D 3VXNA 3H6JA 3VMOA 4KUCF 3X12A 3RFZA 3GTNA 4JW3A 1MWOA 1DE4A 5A9GA 4XB7A 4Y5YA 5KVFH 2Z92A 9CGTA 1BVNP 1DQDH 2OJ1A 3HG1D 2DM2A 5ITFA 4N8UA 1HN1A 1RHHB 3L1GA 4DR7B 3F04A 2AZ0A 3SKNB 4X83A 2XPGA 3REVB 2XX0A 3VG0H 3ZKSD 4UOZA 3MJ7B 2JJSC 5IFAH 3W82A 4PJEE 5EZLB 1OHQA 1OLLA 3RYIA 1ZS8A 4FTDA 2VXVL 2C9XA 2UUDH 1USQA 3TCLA 3W0WE 1AIZA 1LUVA 1FZOA 2C3WA 2R69L 3RW0A 1Q6UA 2QZQA 1NFAA 4PW3A 4ZPTA 4OB5H 3J8F7 4OZIF 4XP5H 4TSCL 2Q9LA 1MW0A 1OP3H 1JZ4A 1FGVL 1WSST 2A79B 1WEJH 2BY3A 3QQXA 5BRZA 4JFFD 1FG9C 3WLWC 4TUJA 2MPVA 3WY1A 3P54A 4ZBMA 2EH7L 5MI0B 5JO5B 1I8IA 1WFOA 3V4PB 3TH2T 3LKRB 3AG1B 3GXMA 2BY0A 1X9RA 2WBJD 2UY6B 2WXRA 3FO0H 3D8CA 3C8KA 2VQEO 1CTOA 5DHVA 1D5IH 5I1AB 3U7AA 1IZ3A 3BZFB 4RUEA 5D2NE 5T3XL 2A1WL 2BSTA 1NCAH 1E5AA 3O9WC 3I50H 4FFVC 3OGCC 1YNLH 4M03A 4YHNB 1WS8A 5AB0A 5LLIC 2EDJA 1KD1W 1HINH 5E4AA 1KZQA 2GFBB 3TURA 1UZGA 5JCOC 4PJIF 4RAVA 3DSNB 2N7AA 1KTDA 3DKHA 4LLYB 4NERA 2Q7EA 1W0KG 3QIBC 3S34H 2YD6A 3JTTA 3DXRA 4HCFA 4Q89A 1J1PH 3KPLA 4ONFH 2NUPA 3NCJL 3GRWL 2C8NA 4QTHA 3AK2A 1PJ9A 2MHAB 4X8GA 5T1LB 1AR1B 3IMSA 3I5DA 1CLVA 4FFZL 5A7BA 3MLXH 4ZT1A 3M8AA 1A7RH 1FE8L 5LL6Y 2BOCA 4CUCA 2YUZA 3KGTA 4PCYA 1UASA 5IB4A 4DV6O 5FYJU 2LFGA 4X5RA 3VFRA 1DDHA 3QDGA 4TQEL 1MF2H 4DVRL 1COWG 2A2QT 4M1DL 2GY5A 4G8GD 2R9IA 4FERA 1OJHA 2VNCA 1EFRG 1OGAB 3V6OE 2J72A 1WBXB 2EKSA 5FKPA 3WHXA 1AZVA 1HKLL 2M2DA 1T5EA 3B2VH 1ENVA 1CIUA 1RI8A 4NIYE 4UAHA 2NR6D 4Z76A 1UUSA 3JZ7A 1YY8A 1IIKA 1B2WH 4BZ1L 1R24B 1DZ0A 1DGSA 2WLMA 1N0LA 5FGCB 5IJBC 5A6LA 2Y1ZA 2G4EA 3VXNB 3X12B 5EIVA 2GK0A 3RFZB 1DE4B 1F2QA 1V55B 4FQQA 4Y5YB 2Z92B 5D5PA 2JKTM 3IPBA 2EACA 4AL8H 4LLVA 5ITFB 1NIBA 5KMGA 2XPGB 4ZS7H 4A2FA 5DGRA 5B1JC 1FNSH 5C6TL 4PAZA 4I3SL 4NN7C 3RYIB 1ET8A 1ZS8B 1NJ9A 3U0PA 3TCLB 2QQLH 4LF8O 1TEYA 2ROXA 2Y0PA 1K92A 1FZOB 2JCCE 4FLRA 1WHOA 1A6WH 1VQ8V 3GSNA 2BSED 4ZPTB 2EDFA 5EZIH 1PKQE 1UQSA 2B8OT 2JKIS 3CGTA 4Q6GA 1YIJV 3EJYD 2AFNA 4TUJB 2AJZA 2CBPA 5DYFA 3BUDA 2H3OA 2IBGA 5IGXL 5I9QC 1QLFA 4NZTL 2C4FT 4PH8A 1I8IB 1KPUB 4JZOA 3NK3A 5D71H 4YLQT 5BVPL 4L1SA 2WZAA 4WU5A 2BIQA 1XNRB 4BW5A 1TZ8A 3C8KB 5DHVB 3BSGA 1DJYA 1QHPA 3TN0D 2F54A 1DQLL 5ADPH 2ZIMA 2NY6C 5D4JA 2WZ6A 1IO4C 2BSTB 3WNPA 4XBEH 1X7TA 3IRPX 4U33A 3B1TA 4QOKA 1YEDA 2B77A 4YIOA 2F9BT 1MRCH 5C0RL 3C6SA 4KITB 1PZUB 2WSSG 2GBOA 5J9PC 5H8DA 4LO9A 4A04A 3SOBL 2ICWA 1JQ0A 2E9IA 1RL1A 2IMMA 1UXWA 1UCTA 4JI1O 4RAVB 2NNUA 1S2EA 3BA8A 3E8VA 1KTDB 3LZOA 5HYJD 5DVOA 2DWXA 1NM9A 1UXLA 1ZSPA 4I9WA 1AZRA 3FO2A 4YY3O 4N1CA 5BOPA 2V7QG 3JTTB 3DXRB 3KPLB 2YD8A 2NUPB 3O6KH 4QTHB 4J42A 3KWVA 2M83A 2WXHA 4CW1A 2YXVA 2A9NH 1XGZA 2BOCB 4IKKA 1YQVH 2XWBA 2BP5M 4ZFGL 4X6CF 5IB4B 1VACA 5H6RA 1JRHL 2WMPA 3HS0C 4KK6C 3VFRB 1DDHB 2QKAA 3QDGB 3B9DA 2KG7A 3MJWA 4KFZC 2WC7A 1CGSH 4KNQA 4C58B 2EEDA 4X65O 4NO5A 1TTUA 2NYYC 3WHXB 5FKPB 2MEJB 2YSUB 4CBPA 4GUCA 1IM9A 1J5EB 1NKGA 2EEBA 4R7CA 4Z76B 2FWOA 4POYA 1WFUA 5GGQH 2BX5A 1OOWA 1YY8B 1G1OA 3H9YA 2H0PA 1D7CA 3FFDA 2LOEA 4ELDA 2AK4D 3OV6A 4JUSA 3RTQC 3O11A 1D5ZA 1N0LB 2MKLC 2OK0H 2G3NA 4Z3FA 2GK0B 3FT2A 2WV3A 1HESA 3NSYA 4LVNC 2MOQA 2VTFA 1WH0A 4FQQB 4C56D 1JZ3A 4MVQA 3OEHG 1NINA 3CQQA 4LLVB 1YEKL 4P8QA 3WFDL 2DDQL 4YDLB 1KIQA 1U3YA 3A67L 1FNAA 5KMGB 3PPSA 4QIWF 1BEYH 1LEKA 3WNKA 3EXAA 1WLHA 4MQXC 2HT3C 5EO0A 4HUNB 5E6SB 1NJ9B 4QHPA 3HZYA 3U0PB 3NZSA 4KP4A 4RUFA 3GMLA 2FJFA 2CLZA 1S7VA 1INDH 3TO2A 3FU0A 3GSNB 2BVQA 1UQSB 4BWWA 3HNSL 4JAUA 1FGNH 1QSEA 2E9WA 3BE1H 4WWKA 2AJZB 2N01B 3CLEL 2FZ3A 2V2TA 3V0AC 4MLSA 4QPKA 1QLFB 2C34A 4BFFA 3IAYA 2EP6A 4Q7DA 4JZOB 1PFOA 4P5TC 4RBPK 3ZMRA 3T65A 4WU5B 2CO7A 4CNIB 4XCEA 1DHKA 2JKNA 2F43G 1X5JA 2X12A 2ID5A 2VR4A 3FT4A 1PY9A 2F54B 2WIIA 2GAZA 4C7UA 1T6WA 3UMTA 3BEWA 3IDJA 3KG2A 1EWHA 1WS7A 4QOKB 2EXYD 1YEDB 2BFGA 1VF5B 3R06A 3C6SB 1BM3L 5HGDA 4EQ3A 2HHHO 4U7SA 2ICWB 3JSLA 4KGLA 4P46D 4FQPA 1UXWB 2MCMA 3ZMUA 2C3XA 2IPUG 1Q1JH 2L35A 2CA3A 1CVRA 4RGOH 3OJ2C 4R5VA 2BNQA 4AEHL 3T3PF 3FO2B 3QDHA 4FG0A 5DCCA 1I8KA 4X9HA 2F5BL 2ZNIA 3FU8A 4JKWA 3TU6A 1R0AH 3RL1A 5HXMA 3W7XA 1U3HC 4CW1B 2JJSA 4N20A 4KUMA 5B8CB 4Q6YA 2C9RA 1MFAH 1UA7A 2VRKA 3ZN0A 2XWBB 5IYDO 1VACB 5FUCC 1PZSA 3HNTL 2WMPB 1GN6A 1P1ZA 2NQDA 3EXJA 4NQDD 4B9IA 5C09E 4HOZA 2KG7B 3SYQA 2EDLA 1UA6L 2PCXA 3C60C 3LQAC 5I1EL 3K4ZA 4NO5B 1G1XB 2KUTA 5HI4C 1IM9B 3TT3H 4Q4EA 1E7UA 2VDNB 1BQRA 2IBZH 2FWOB 3M45A 4IK7A 3UG5A 5J11C 2OKMA 3A0OA 4FXKC 3FFDB 3S3DB 2VDPL 3OPZL 3JSNA 3O11B 1D5ZB 1BQKA 2IQAA 5JQIB 1DFXA 5I75C 1U8OA 3FT2B 3HE7D 3K06A 3LX9A 2PW2A 3U9PH 1JX9A 1HH6A 3O9WA 1KIQB 3OGCA 2A06H 1XH2A 2R59A 4YDJA 3ARRA 2JGUA 1LEKB 1NMAH 2Y36L 4P5RA 5EO0B 1A64A 3BEVA 2FWLB 2GTQA 3HZYB 4FG4A 4KK8C 5JCOA 3GMLB 2E7DA 2CLZB 1S7VB 2FJFB 4G7RB 2JKWA 3TO2B 3ZZ1A 2IALA 1FHNA 1CYGA 2ZP9A 2DN9A 5FV2A 1TJHH 1ADQA 1QABA 1QSEB 3KDMA 4FQLH 1Q3EA 4Z7NB 3LHPL 4M62L 4WWKB 4HVBA 3BVWA 1GK9A 2FZ3B 3LRLA 4IU2A 1F58L 4JO4H 4ZX5A 2V2TB 2FHBA 4F9PA 1VB9A 3BGAA 1XMQO 2AW9A 3RVYA 3D85A 1CTMA 4QRPD 2J20A 3T65B 3VRLF 2CO7B 4N26A 4XCEB 3H55A 3VD2A 3NRFA 3FT4B 2WIIB 3FSWA 1IC0A 1UKTA 2XJLA 1I9IH 2VRQA 3BEWB 3QZLA 4WFEE 4H8VA 2V8MA 2ZWYA 1CI5A 5CEZH 3R06B 1GO3F 1KCRL 4A7GA 5HGDB 3V52L 2ZDIC 2PR9A 4HEPG 4LCCA 4PWEA 4WVRA 3HC3H 3K6SA 3PYCA 5JTWA 1IRAY 4NI6A 2ZE5A 1TQCB 1DVUA 1S7RA 3K08A 1FNGA 1E5UI 4LFAO 1C9SA 2EEAA 2XAFA 2BNQB 1B88A 2JKRM 4YSOA 4E2LA 3JWNH 1X6NA 1HIML 1IGMH 5I1GH 1I8KB 2CKBL 3NUKA 4M4RA 1OE3A 3RL1B 2J88L 3ARDB 3QEQB 5B1JA 2F2HA 5IMLA 4J3OF 1MFEH 3OF6D 2PABA 3IWVA 2K78A 2F08A 4HPOL 1IEBA 1P1ZB 2FL5A 5EPMA 3HMWH 3EJJX 3KBFA 2VAAA 2EIBA 3GJFK 2VUYA 4DR5B 2UXTA 3ARUA 5KLVH 1FL6A 3SE4C 1VSCA 2IF7A 1LVEA 1WWWX 2AANA 4MZ2A 5DZOA 1FWXA 4I4TA 3MV7A 3BWSA 2X4QA 2ED7A 5D5ME 3VW3L 1PPIA 2Y23A 3TJPA 1BPVA 4X50A 5FGSA 4PRIA 3NEOA 1OAYL 2IQAB 4J4PA 1GIGL 1QFPA 4Z3HA 5IWAB 1E30A 3ZVVA 3D69A 3D3VE 3N9GL 4UT7L 4WY7H 2PW2B 3BVOA 1HH6B 4NENA 3O9WB 1GHFL 4UTCA 3OGCB 3ZL1A 3OTOO 4YDJB 1KACB 4PRPE 5F1IA 2HT2C 1DBAH 4OY9A 5A3IC 5C70A 5J9PA 5JA9A 1UKSA 2X6VA 3BEVB 4HJGA 4ACTA 4XP6L 4TPRH 2BLFA 4XVOA 5D1QA 5JQ6H 4FFKA 1RCYA 3MTXA 3B5HA 3KLLA 5B39B 4M1CC 2L7JA 1S78D 2IALB 4JDZB 4KKCD 5JIQA 2EADA 4K0KO 4LCWD 4QTIH 1UM4H 1BD2E 5F93C 2BPBA 2J6EL 3T0WA 3GZKA 1K8DA 1PD3A 1NBVH 3CSPA 3N1GC 4IU2B 1SQMA 2OBGA 1A1NA 2V5TA 3DO3A 4GRWB 4N2DA 5F0JB 4D0BA 1RZPA 5E0QA 3OAUH 3WNNA 5LN8A 4FP8L 4J11A 3HS0A 4BAYA 1JTTA 2WGNB 3GMOA 3V6BR 1D6EA 2DLEA 1VZHA 4AHCA 2WNGA 4AWJC 3H9SA 5KUKA 4JTCB 3FU9A 3KHOA 4Z7UB 4KKLC 2AGJH 3BUYA 1IBZA 2QKSA 3RGVC 2B4CH 3GJEA 4UCFA 2NXYC 1AYOA 2ZP8A 4H88H 4LCCB 1MFBL 4WK4B 3ARGA 1FSKB 4EBQL 1BECA 1QVGU 1PL3A 3Q43A 2P44B 3RTQA 4FA6A 3K6SB 1R6NA 1S7RB 4JM4H 4K4KA 5E2UH 1FNGB 2LU3A 4TV3A 2GUYA 5SWQA 1J12A 3MGTA 2JKSA 3DJ9A 4M4RB 1US6A 1OPOA 1Y74B 5D6DC 1BFOA 5LB1A 3QJTB 1I4FB 1UCBL 5C0NC 4KPHH 2XJKA 3LS4H 35C8L 4I0CC 4XBPA 5IMLB 3MI6A 2WO2B 1CXZB 2AXGA 5C7XL 4NN7B 1IZJA 4RMTA 3KBEA 5DMGC 4ZFZB 4UCTA 2VR8A 4OJEH 1FXHA 3ZMTA 1IEBB 2FL5B 4GSRA 4R83A 5EPMB 4DV2O 3MBXL 5BNXD 3VMPA 4OF0A 2VAAB 1EK3A 1AD9A 2CM6A 2M7WA 1TO4A 2BZ7A 3LDBC 4Q74A 1SXCA 4MJ2A 3O8XD 4W9KC 3RAJL 1FL6B 4BJLA 2WSKA 5FO8A 1ZJBA 5IB5A 3PXHA 5IJ9A 1N2RA 4GO8A 4MVBC 4KKBC 3BT2L 1WP6A 4I4TB 2D0GA 2F1MA 2F58L 3MV7B 4PJAA 5I9QB 2X4QB 3V0GA 3GBDA 2QM4A 1A9EA 5L2KA 4P5TA 2G75A 1Q72H 2YAMA 3BJLA 1SRDA 2B3IA 4PRIB 5EA0L 3RWGA 3TFKC 3GBEA 4QRQA 3I6SA 3L73H 2ZX8A 2D31A 2YD4A 4EE2A 3DJRA 1QSFE 3MBWA 5E0FA 3D69B 4I18C 2NY6B 1KN4L 2NY3C 1PLGH 3P4LA 1GAFL 4NENB 2CIKA 2R29H 5GGRA 2FLMA 4DPRA 2Y7NA 3LSUA 4RX4A 3RVUD 3QJXA 5F1IB 5CJQL 4BK5C 1DN0A 5J9PB 2CHNA 5EK0A 5TH2A 5EBMA 4HJGB 2X5PA 4FULA 3U30B 3HG0A 5D1QB 3FN9A 2ENPA 3R4RA 4B7KA 1F41A 4B7EA 2XETA 5FX3A 3X14A 2LAAA 5D96C 4A2HA 1OSYA 1UGNA 3GI9L 5FFLA 4D3CL 2B3RA 2B39A 2WAQA 4DV4O 1I9RH 1K8DB 1YZBA 1OSEA 2D7TL 5LWYL 4AZUA 1U3HA 2OZ4L 1L0XA 4JI2O 1A1NB 1LD9A 1Q0XL 4D0BB 1OP3K 5IFAL 3UZVA 4EI5C 4AQOA 3NACH 3VH8G 1P53A 4NQCA 5F1KC 1B0RA 4KTYA 1A21A 1KENL 3EW3B 4JNXA 1HNXB 2YOAA 2EVIA 4LHUD 3HLKA 4ZOAA 2QTEA 2P5WD 2XQBH 3GMOB 5C07D 1P84F 1NGXA 1D6EB 1UM6H 4MGXA 3VO0A 3C60A 4BFKA 1JRHI 3VGDA 3H9SB 4CADA 3VDAA 2Y4SA 2R83A 2ESVD 5CMUA 2DW5A 3BUYB 5FUZH 3MA9L 2CZNA 3Q8AA 3K6DA 3WKYA 3QRGL 1GGBH 4ZMNA 3GJEB 1F51A 4E9YA 3VRJA 1MDAA 4ALAC 1PLAA 2PXYD 1QPKA 1D2DA 5KA6A 3ARGB 3OR6C 4FXLA 3AEIA 3RTQB 1CO1A 3BRGC 4XNDA 1S3RA 3VXMD 1JN6A 3MBEC 4LVNB 4BIOA 1JPEA 2YMTA 4YNYA 5EU6E 1ZMYA 1GKEA 5SWQB 3H1JH 2OULB 3MGTB 4FQJL 5HHVL 5FGBC 3K03A 3RWDA 1BFOB 1H3WM 3H53A 4Y9EA 4G2KA 5CD5D 2QHRL 3DGEA 4XBPB 1AAJA 3BPZA 3NAAH 3EOTH 3UAJD 1OAXL 2AXGB 3OHXC 1E28A 1A65A 1L5GA 4S1DD 2XWZA 4PV1C 3N44B 4EN3D 3FO1A 2YAHA 5J1AA 5JIIA 1XF4A 2CUHA 2XOKG 7FABL 1AD9B 1X5MA 2ITEA 3L2MA 4EOWL 4ONGL 1ZKAA 1MSPA 4UQAA 2AEOA 1IV8A 2JQZA 3LUTB 3D4CA 3QUMA 1YI2V 2IH1C 1G94A 1M7IA 3K6IA 4XMLL 2J3SA 4NQSA 5GRVL 5IB5B 5FO8B 5IJ9B 2X0LA 1N2RB 2ZXQA 5HYSA 1CXKA 1IGFH 4FNLL 4AQAA 3UO1L 4PJAB 1QLEL 1CGVA 4TRPH 1A9EB 4BWUA 4HZLA 5L2KB 4P5TB 2G75B 4UTAA 2DLFL 3RWGB 1N36B 3UFIA 2X6UA 3NEXA 2CJ3A 2VZOA 1XVSA 3T0BA 2EE0A 4JRXD 2XZAL 4QRQB 5DA0B 3VE0A 2D31B 4ES8A 3MBWB 3NQIA 1SKVA 1CB4A 4PQXA 2YLHA 4X1KA 1O6SA 4W6WB 1J0IA 5FWRA 3W57A 2CIKB 5IVXE 5GGRB 3APFA 1UXMA 2LU7A 2QBWA 1R9FA 3NCYP 1DN0B 1KOAA 3CZFA 5TH2B 5KJ7E 5EBMB 1SVZA 3CVIL 2BY2A 3J7HA 5EYPA 3QFGA 1N0JA 2KPWA 1UWFA 5CILL 3FF8A 5FDWA 4ONHA 3X14B 2DM4A 4PV9A 3AMLA 1DL7L 1M3JA 5TE7L 2OI9C 2OMNA 3N5AA 4LF7B 5I6LA 3DBSA 3FU6A 2N1KA 4JI0O 3PL6C 3F7LA 4UQ3A 1U3HB 1S77D 2C26A 1LD9B 4MXQC 5GTHZ 3S3WA 3UZVB 5I1HL 4NQCB 2CE4A 1B0RB 5KSBA 2B1AL 2YN5A 2BP8A 3NIDB 2YR3A 2YGQA 1YYMH 2JRIA 5AOLA 5ANHA 1NGXB 4NWTH 1DO5A 3C60B 1U2YA 4A55A 3TTSA 5BS0A 4R7NA 4RGMC 1OCWH 1Y6NR 4LE8A 4CADB 5B3JF 1CLCA 2WOBA 3SGJC 4DP9X 2IDCA 1BZ9A 3SE4A 3EGXA 4YS4A 2CGRL 4YHML 3U2JA 3VRJB 5J11B 4QCIA 3OAYH 4OZFA 1BS3A 2Z3YA 4EB6A 5AB1A 4KVCH 2DOCA 4BXVA 3QCTL 4TS6A 5BV7H 3HKZA 2C3HA 1AKPA 4F8OA 3QQ9C 2Y2TA 1JN6B 3DI2B 4I2XE 2XICA 5CP3H 4E9VA 1A7OL 4F7MA 1YEHL 4YNYB 3WG7C 2JGDA 2FJUB 3UTTE 2ZKMX 2JB6A 4P2CG 3L74H 3RWDB 5F3BA 1E4WL 1NGWA 3THOA 2G5BA 4PJFF 4AG4L 2Q0OC 3S37L 4JGNA 5GGVL 4KI5C 3S5LA 4IOSD 1E28B 4S0SD 1H9VA 4OGZA 1L5GB 3L7EA 3S0PA 1ZSHA 4GX2A 3FZUD 3SY6A 3FO1B 3LN5A 2NXZC 5J1AB 2WK2A 1XF4B 4M43H 1CXEA 4R26L 4FZ1A 1ZVYA 4PBXA 5MEND 1H3TA 4N6QA 3M07A 4MB4A 4OQ1A 4JHWH 2HJDA 2X28A 3QUMB 1QWNA 4OCXH 4LSRL 3SJVB 1M7IB 3H85A 4NQSB 5IQMA 2BRQA 2K0RA 4XNXH 2PPFA 4NAJA 4JPKL 4AQAB 3D2TA 2NY5L 4OZ4A 4AEEA 2FGWH 1RUMH 3LEVL 2YO3A 4HZLB 2ZUQC 1SQBH 4YUEL 3MHHC 2H45A 2VC2B 3QQDB 2D0FA 4QHKI 5H5NA 4I0XB 3PWJA 5MEQA 5C0FB 3P3NA 1KIRA 2DMBA 1ECYA 2GW5A 1Z7JA 2HH0L 3DDFA 3VE0B 1FF5A 1HH9A 4JLRA 4UQIM 5I71C 32C2A 4X1KB 1O6SB 1AE6L 2A0LD 3OMIB 3ES6A 3ZCCA 1NZ6A 4NZDA 2XACC 1DBBH 5DURD 5JXAL 3RGVA 3L5WB 5DQDH 4GAYA 1A4JA 3JASA 1I8AA 1LWHA 1CXIA 2R9HD 3RBGA 3V0EA 2WO4A 2XRAH 3CZFB 3IDYC 4B53A 1XUQA 3TGUH 4NXNB 1MAML 1V7NL 4H8PA 5JIKA 3VFPA 3QXAA 4F7TA 4XMTA 5EYPB 2GQHA 5FDWB 1U6AL 2KHAA 1ZPUA 4ONHB 4XNMA 4PV9B 2OMBA 3CMOH 5C0JA 1NAKL 4KUZL 4X6DA 3ZKMD 1X5YA 4WJKB 5I6XC 1G4MA 3E22A 5E8NA 1DBKH 1L3WA 4UQ3B 1I08A 5CGBA 4I8DA 3AVEA 4TULH 2ZCLH 4K8ZA 5DD3H 1NJIW 2P80A 4DGYL 4ZI8A 2L04A 3ZRSA 1XAUA 5A2LH 5KSBB 3U6XA 2BP8B 2H2PC 2Q76A 2ZG1A 4RDBA 1BBDH 2NZ9D 4AYSA 4JJHA 1NL0H 4XN1A 1TJIH 5FXCH 5BS0B 4R7NB 4OLVH 5G5DA 1E9OA 3SGKA 3X1EA 4UI2A 4IM8A 4XGZA 1IT9L 3RDTC 1BZ9B 5CINL 3EGXB 3LD8C 2QKIC 1IQWH 1AFVH 1IU1A 2HG0A 2P48B 3QGVA 4QCIB 3BT0A 3MLSH 2VQFO 4OZFB 5FHBH 4EB6B 1J1XL 3OLDA 2W07A 4YHKH 4OTXL 3SZ6A 5E99L 5BQ7A 5I23A 3CDFA 2PF6A 3IFXA 4R50A 2W0XA 2DH3A 3OFNG 4F7MB 3DIDA 5HJBA 1R5IA 1N32O 1N68A 4I18A 4Y5VC 3SKUD 2IANE 3A6BL 1F3DJ 2Q7AA 2DTMH 2JB6B 3BAXA 4I9QA 2VO5A 4Y19D 3JATA 1MCPH 4YIPA 1NGWB 5F3BB 2G5BB 1H8OA 2VW6A 4TM9A 4MX7A 4PJEF 4BK5A 5J89A 1NAML 1CZ8L 4QYOA 3S5LB 1GS7A 1YPZA 5DA4A 5DR5L 3SDDD 1KC5H 3L7EB 1HVXA 1XAKA 3LN5B 2Y1VA 3ULAB 1G1YA 4POZC 1HCZA 2YRLA 3NCWA 5D4HA 4DUYO 3ZIAG 2ICEC 4PLOB 4QEGA 5AZEH 1AH1A 4FI6A 3ZE1B 4ZW8A 3K0GA 4NUQA 5ACMA 4PBDA 2NZIA 1AO7A 3C08L 3GB7C 2Z7YA 2A6IA 2LO1A 3AK3A 2VZ1A 4OZ4B 5JXEC 4EI5A 3F7YC 1EA9C 2FAUA 3FQNA 1ZTEA 3IS0X 4LOVA 5HBBA 3WN5C 2XA3A 3KH4A 2ZJSL 3FPXA 3PWJB 4LFHG 1I9JH 4JB9L 4NM8H 5MEQB 1KIRB 2F53E 1DJGA 4QT5B 1F4WL 1HH9B 4JLRB 2YGOA 2QJ1A 4BD4A 2HRPL 3UCRA 3L6FA 3ES6B 5T1KD 2YEVA 3A6CL 3RGVB 4GAYB 4W9IC 2F19L 1A4JB 3JASB 3U1PA 1BMZA 1CYWA 5J3HD 3LIZA 2YC1A 2NXYB 5DC0A 3RA7H 2XVLA 3MGOA 1Q86W 2EEFA 2YWYA 3OR6A 4JRYA 3VFPB 4F7TB 3HKEA 1BZKA 4G6ML 1PV0A 1YJDC 4JPVL 1WPBA 3RYHA 5DXWA 4E9LA 1N67A 4XNMB 1Q9WA 1GKFA 2JF1A 3T71A 1RY7B 3BXNA 3L08A 2AQ1A 4X6DB 5C0JB 1D5RA 4WSJA 2W9EL 4G2AA 3QI9A 3MODL 2YXLA 3E22B 5E8NB 3BLBA 1MJ7L 2XN9A 1J0HA 2ITDC 2D03H 2Q8AH 3IRCA 5F6HI 3SB3A 5AVVB 2CCVA 1IUZA 4DR4B 3OHXA 4IBVA 1A6AA 2OR7A 2X3CA 3JWDL 1SM3L 15C8L 2Q76B 3WFCH 3MOAL 1RUQH 1VRSA 3D9AH 1QLNA 3K5MA 4U7OA 2B15A 4XPAH 3KW8A 2YIBD 3LDBB 1E79G 1BL8A 3FFCA 1NPUA 5G5DB 1L6ZA 1E9OB 5G2NA 1WB7A 4XGZB 2IH1A 4BZ2A 5KHJA 3A47A 1I94O 4JI5B 2Q8VA 4ZMOA 1WNSA 1FZMA 3WIHH 1RULL 3EFFA 4WGWB 2FD6L 3KYKH 1LMKA 2J5WA 3L9BA 2Q2EB 3QUZC 4M8VA 3ISRA 2W07B 5SWSE 2ORBL 4PWJA 1I53A 3ILPA 1VENA 5BQ7B 4D8OA 4OD3H 4F1ZA 2EXTA 3SKJH 1LK3H 4MJID 3O6LL 1R5IB 1ZHLA 3R18A 4I18B 1RUKH 3UAFA 1N6VA 2GIYA 2FMLA 4H44B 3JATB 1JHLH 3F01A 2YLKA 4JK0D 2EIMC 2ZQKA 1JTPA 4MX7B 1BQ0A 5FKAA 1GGCH 4QYOB 2TRYA 1YPZB 1TTAA 3L2NA 1KGUA 2JCCF 2EYSA 4L4TA 2GITA 4L1LA 3HE6C 5D96B 1GOHA 5FYJE 1JK8A 3PL6A 4PRAA 3GSUA 1IAIL 1MH5A 1YC7A 2FBOJ 4UANA 8PAZA 3PDOA 2A6IB 3IGLA 4BFOA 1RLBA 2YPLD 3RPKA 4EI5B 3FQNB 5F8RC 2V9RA 4KQ4H 5DHDA 4Y9BA 3V4LA 4ZKIA 3H1IH 4GKOA 4ZTPH 4AC4A 5T3XD 2YAOA 2WVSA 2ZIOA 3B9KA 4X62B 3ARVA 1N5AA 3GXFA 3L6FB 2DYPA 5IESH 3GVMA 1BPLB 1IBKO 4IDJL 3SGJA 2YEVB 3QG5A 2JKLA 4NUGL 3AW5A 1XIWD 3FTGA 2YC1B 3FH7A 3HJEA 3UACA 3MGOB 3EYUH 4PJ7E 3OR6B 4JRYB 2DYSC 1JOIA 3HKEB 1H3PH 5E1QA 4A2LA 1AKJA 3HZ3A 1UD2A 3RYHB 3GKWH 2NCEA 2V7HA 1U4EA 1J10A 1N19A 2VLME 4NZRL 1Q9WB 3WS3A 4M7KH 3BXNB 3IDUA 5EOCJ 3E8UH 1QRNE 2QQKH 2F61A 5JW4Q 3S88L 4R2GD 3QI9B 1B3IA 2PI4A 1TPXC 2XN9B 1OT2A 4F3FA 5B1BC 5C3LD 4NQUA 4XX5A 3OHXB 4OIFA 1VQ7V 1A6AB 2XVKA 4PV1B 5DU7A 1WZ1H 1JXGA 4LSDA 1BGXH 2H6PA 2X4TA 1GCFA 2IOIA 2Y06L 2VDMH 3FFCB 1CLYH 2AQRA 1SEQL 2IH1B 3APMA 4LRNH 1KB5A 3U9UA 1KCLA 3Q9PA 5EBLC 1G7LA 4YXLH 3U1SH 1FZMB 3M8OL 4ELME 4JY5H 1YN6A 3D8MA 3EFFB 1U21A 1MVFA 1VFOA 1AY1H 4Q9RL 3OMAB 1T2JA 1DLBA 5J0BA 4LF9B 2ZM6O 5D7IE 1XI1A 3ILPB 4YVNA 5DO8A 5E8OA 3S36H 4G6AC 4MB5A 1E4JA 2X0VA 3FCBA 1X9LA 5IBTL 2XV3A 3J80N 1ZHLB 3CMAV 4FM0A 3E6FA 2VM3A 2IU0A 2VXSL 3BY6A 3EYFA 1G84A 1KJ2A 2VJXA 3CXHK 1BZ8A 3UXFA 1I85C 2A77H 2ADGA 5FKAB 4LDCA 4CU8A 1DJZA 2UXCO 3NDZE 3O2VL 4QKTA 3H6AA 1ZHNA 4QMEA 5AZ2H 5L2JB 1I7RA 2H8PA 1EGJL 3DNKA 4O58H 5F88A 4N0CD 2EYSB 2FWSA 4L4TB 2GITB 1WF5A 2X9YA 4U1JA 5L4MA 3G9AB 3E6HA 1R47A 4U1SA 2OI9B 3MNVA 3GRGA 4CSPA 1A9BA 1JK8B 3PL6B 4PS4L 4PRAB 2ADFH 5EU7E 4X2UA 1JK9A 3GSUB 3ZHVA 1MH5B 1QW9A 2FE0A 5D7LD 3NZHH 1JFHA 3PDOB 4H1LA 4JG1H 4Y2DA 1GYUA 2RIKA 2A7WA 4ZW6A 4JFHD 4IYHA 1Q9LA 3QPXH 2RCVA 1GKOA 1WV7T 2OQJA 4JRWA 3WU2Z 5CJ8A 3QEGH 3NK4A 1IVLA 2W6IG 2PTVA 5AL8A 3S35H 1L7IL 4HT1H 4DOHE 3B9KB 4RGMB 1N6QH 1N5AB 3RHWK 2DYPB 4JDTH 3BFRA 2CU9A 4OD2A 5HGAA 1OAJA 3RDTA 1Q90D 1KTRL 4LVOC 3HIZA 2QKIA 3A4AA 2Q7NA 2B2XH 4D6TH 1TQUA 3FTGB 1JJOA 3WI9A 3CC5A 4FNPA 1PYWA 5CA3A 2JLPA 1EFQA 3QDMA 4FD0A 3FO9B 4HBNA 4N68A 1MCSA 1AKJB 2BNRD 3KEDA 3OXSA 4XAWH 5GJSH 4D9LL 4XMXA 4HWEL 4APQC 2CR0A 4F37F 2V7HB 1BZ7A 3WS3B 1U2CA 4Y5VA 3WG7B 1MQ8A 3NA9H 2AHZA 4OM0H 3ZMNA 1R3IH 4DYLA 3TEZA 2J4WH 4F3FB 4IMKC 1H8NA 1LK2A 3MV8B 2IBBA 3TF7C 4NDMA 4GW1A 4PDRA 3DETC 2V4LA 4KQ3L 2EIKB 2NXZB 5E08L 1CICC 3AITA 4OQTH 1SHXA 3MUY1 2H6PB 2X4TB 4LQFL 2GTZA 2HVKC 2O61A 4IGGA 5MEPA 2ICEA 3X2QC 4TLTA 4O2AA 4F15B 2Z4TA 2BSKA 1WISA 4XVSH 1KB5B 3U9UB 1G7LB 3GB7A 3SDAD 1KG0A 1ULVA 3RZCD 3ULUC 1YMME 3CZSA 3NJMA 1YN6B 1QO3A 3FSZA 4GZRB 2X4PA 1F6LL 1XHXA 3F7YA 1N8RW 5FB8A 2ZUQB 1KV7A 3WN5A 3SPHA 3LOWA 3AJ7A 3N0PB 5E8OB 5CZXC 4AQ1C 4HFUH 1LO3L 1W91A 4YSSA 5C08A 5EU5A 5G4OA 3BIAX 3E6FB 4XWOD 3EYFB 2DQEH 1KJ2B 3EGDA 3KHQA 3FT3A 3BUBA 1HNYA 2ADGB 2OMUA 5FO7A 1EM1A 4ODVL 1ZHNB 3IDYB 5DS8A 4ABWA 1I7RB 5ERWA 2H8PB 5HHQA 2WZ0A 5F88B 4U1JB 4LEBA 4LF4B 1FXKC 2ZKXA 3FT1A 3E6HB 4N85A 4PS7A 5JOPD 4U1SB 2ZF9A 3MNVB 5D70L 1SF5A 3BH9A 4RH4A 3ZE2E 4UM9A 4XO8A 1A9BB 3RX7A 5I6XB 3CAFA 1WWCA 2CDFA 1TOXA 4R4NC 1JK9B 1ZK5A 3J07A 4B9ZA 1GS6X 2OCCB 1SXSA 2W91A 2ITDA 2P43B 2ZWLT 4H1LB 4KXCA 2AJ3A 5L3EA 2QV4A 4ODWA 1Q81W 1EAQA 2HKFL 4MRCA 4U2ZA 3VU2A 2R51A 4OSUL 4RLDA 1Q9LB 2P5EA 3D05A 1MLCA 2OQJB 4MS8C 4HJ0D 1QVFU 3ROOA 2H26A 2VXQH 3MLZL 5D4IA 5TFSL 3JAWA 2D7PA 5C0AD 4B0MB 3B3BA 5HY9A 1OGAE 1ODAA 4BQ6A 4GI8A 4JI6B 3HS9A 5LMNO 4IGBA 1EMTL 3U11A 1XCWA 2NCMA 3PQYD 4OD2B 5HGAB 3RDTB 4H20H 2QKIB 4UZSA 3WTUA 2ZWZA 4NSKA 3CC5B 1PYWB 3QUZA 2Q86A 4UT9A 3BESR 3QDMB 5FOBA 3OXSB 1IXBA 1HR0O 5D1XC 3UJIL 3O6ML 4Y7MA 5I2IA 1BZ7B 3TESA 4Y5VB 3P9MA 1DFBH 4EZMA 5CR1A 3QYMA 5FYJL 5KAQF 4MMXC 5E2WL 5HI5C 3NABL 2C3VA 1E9PA 1XHHA 2Q68A 4H8UA 3EYSH 4MASA 5IG7A 2VMFA 1F1DA 2P1YA 5JPNC 1KXHA 1WTGT 4BFJA 1LK2B 3VUAA 3MX0A 3MFFA 4XAKD 25C8L 4LSPL 4NDMB 3ARBD 4DK5A 4GW1B 1FFOA 3OGOE 4YPGA 2VLJB 2FSEA 5CCGE 3KL0A 2GABA 1BREA 3HE6A 4MFHA 3UO8B 2GTZB 1N26A 2O61B 5MEPB 2ICEB 2FEDC 4W9DC 3WO4C 4O2AB 1MCOH 2BSKB 2EXSA 3OAZH 1TLKA 2HRLA 5F7EL 3DPDA 3GB7B 2RCSL 3VWKD 5I5IA 5CIPA 4BIKA 1QO3B 4M6OH 2Z0UA 2X4PB 5D5MF 3F7YB 3TONA 1I0HA 4WI8A 1W80A 5FB8B 3EO9L 4UVCA 4HIJA 3K1DA 1DSWA 4P4KD 1Q94A 3OAYK 4OLXH 3QWQB 3PU7A 2CH8A 4JPSA 3O2WH 5BZWA 5C08B 5EU5B 1HCVA 2Z7WA 5KVEH 4XN4A 3EGDB 1GYWA 4ZUWA 3FT3B 4TWKA 5FO7B 2OMUB 1O0VA 4A6YL 4K23H 5K33A 4OCRL 5DS8B 5HHQB 5ERWB 4OIAA 3LPGA 2J8OA 4DKEH 1OSPL 4BKTC 5LDUA 2WLYA 1FORH 3CX5K 3RI5F 3BH9B 5IHHA 3INOA 3IVKA 4UM9B 2HT4C 5CBHA 1MWAA 2CDFB 5SWZA 5HJGA 2V7NA 3WHE1 2MQCA 3ZMEA 1NU1H 2ITDB 4ODWB 3L4CA 2AJ3B 5I1DA 2X89A 4JYCA 2E47A 1X5FA 3RNQA 2P5EB 1MLCB 1Z9PA 3OUFA 4LCIL 4A7QA 4CU7A 2IH9A 4W6YB 4ZO8A 3RVWD 3IB4A 2H26B 3FYIB 3JAWB 3QDGE 4UOW0 4KDVA 4PG9A 3VXSE 5HY9B 3ZU8A 1UH2A 3DYPA 3U48A 5ID0A 4DR6B 4IGBB 4CGTA 4AL8C 1XF2A 3QR0A 1KGCE 1OQXA 5DEFA 5EBLA 4ZUUA 3MLRL 3WMQA 4L3AA 4ABQA 2EC9U 2Q9OA 2R7EA 4NSKB 2X6MA 5JJJB 3QUZB 2Q86B 1A6VH 4L5FE 4PLJD 4MD5A 2ZUTA 5FOBB 4NKIL 4DUWA 5HHOD 2QR0A 3BKJL 2IGLA 3GWOA 2FQGA 2PPCA 5I2IB 4ENED 3EJPA 3DC0A 3P9MB 3HVDA 4LVHC 1JGVL 1NH2B 3VAEA 4J39A 3W2DL 1GOFA 4L05A 1PG7W 2C3VB 1E9PB 3OHMB 1I85A 2BSDA 2BIMA 2WWMC 2EIMB 5IG7B 5I1KL 1HXKA 5HGHA 3QJOA 4KWUA 5LBSA 3K6NA 3QB7C 5HYSB 3MX0B 3MFFB 2GCYA 2VXVH 2Q3ZA 1DUZA 1UUNA 1Q8MA 5A16A 3GJFA 1P69B 1FFOB 4YDNA 2R69H 2DQIH 1XWVA 4YPGB 2FSEB 4AY0A 4BSJA 5J7CC 1S9VB 3HE6B 1M7XA 4LP4A 3JD3A 3F6JA 2HFFA 4TSCH 5E5RB 2AZ2A 5F7DA 3K71A 1FGVH 1GJIA 1OTSD 4DJMA 2TRHA 1B9KA 2AAVA 3FF7A 4DO5A 4W9LC 4DK0A 4P9ML 1NKOA 5CIPB 1NUDA 2EH7H 3H8NA 3AGWA 4A38A 2R2CA 3IKCA 4F2EA 3N85L 4HIJB 1OCRC 3UYPA 2CQVA 3FUJA 1FFPA 5HSFA 1Q94B 2EDXA 4A2GA 2WB7A 2ZUSA 1BW8A 2UZYA 4NQTA 5BZWB 1YAIA 5T3XH 2K7PA 1UA3A 2A1WH 3P32A 2DS4A 2Y6TE 5EEUA 1JFQH 1MCIA 4XT1C 4QOKE 4TT3G 4ZUWB 2R72A 2C4XA 3IEAA 5LO7A 3W11C 2A9HA 4N2FA 3AG3C 3ASNC 1YHQV 3O0LA 2DYSB 4PLNC 2UVFA 3ZKND 3D48R 3VFUB 3P9LA 2YIHA 4TL4A 4APQA 3WNIA 3PDGA 2LQTA 4IRZA 4XRCA 4Y1AE 3QEHA 3RKDD 3IVKB 1X4ZA 3IJEA 4I9WE 1NC4A 5I6KA 1MWAB 3HR5A 4E5XA 5C6PB 3NCJH 1TPXB 2QSVA 3GRWH 3QUXC 5SWZB 3VWJD 2V7NB 4ACPA 1CT8A 3TASA 1BF5A 4FFZH 2BOLA 3Q5TA 4IMKA 1U8LA 1FE8H 4AIOA 5I1DB 1EZUA 1V3JA 4U6YA 5DJZA 2E27L 3B5TA 4TQEH 4E9QA 1CICA 1NBYA 4Y16C 3UJJL 4M1DH 3BKML 4DVRH 3DX9A 1KYFA 1SDDA 2HVKA 4N5UA 4PG9B 5D2LA 2FLBT 5KYUA 4W9FC 5ID0B 2WXNA 3RIAF 2Q3XA 3KVDD 4J7KA 1HKLH 1XF2B 4Y4FA 1E1RG 2ADQB 5DEFB 5EBLB 1NANI 5HGBA 3JD0A 2B0SL 1MW3A 2WAMA 4BZ1H 2R7EB 4WQOA 4RWUA 5GRJL 3C8HA 4K55A 3LMJL 3BMVA 3FQYA 1MMMA 1JJUA 1FHGA 3A4EA 4MD5B 3SDXA 1D7BA 4DERA 1FN4A 3F7KA 2QR0B 5LQBL 1HQRA 4I1PA 4AQ1A 1WFJA 3UDWC 4ZW5A 2G3MA 2B59A 4FADA 3L8QA 2OXHA 1IM3D 4N8CL 5DLLA 4QJ4B 3ATEA 2QKCA 1HZHL 3B8SA 3V0VA 5HGHB 5C6TH 3FMGL 1N12A 4RMWA 2WLNA 3ZHKA 4I3SH 4PLKC 1T80A 4LLUA 2GCYB 4Z6AT 1N33O 1DUZB 5A16B 3W5MA 3GJFB 2ZOOA 1FXKA 1KT2A 2NLJC 4S1QL 3BD5A 3MAQA 2DJ4A 1HWGB 2E3CA 1SOKA 2HFFB 2AQQA 2J1ZA 3KGUA 4HKZA 5F7DB 3K71B 2JNZA 3B3IB 4E0RA 3F7PC 5EU4A 1M05A 1QSEE 4Z7NE 2B7DT 3FHAA 1EHKB 3Q48A 3RB5A 2JS3A 4P59L 4MXWL 5D7JD 5IGXH 3QIWA 1O9ZA 4NZTH 2MFNA 3Q8BA 4GX0A 3QW9A 4AEFA 3E3QE 3IKCB 3GUTA 5BVPH 2WKOF 3UYPB 2J43A 2HJFC 2WXIA 4HCRL 3F7QA 1FFPB 3LSSA 1QSZA 4QJ5B 1PD1A 1DQLH 4DPCX 2UZYB 5ALBL 1DCEA 4HU8A 2CALA 1QA9A 1AI7A 4AJ0A 5IVXF 3A4DA 3CRMA 1C12A 3TCXA 4LVOB 4JG5A 4Y9GA 3CHSA 4NTYA 2ZCKL 4HD9A 2ZKOA 4J6RL 2A38A 1DJIA 2K45A 3SOBH 2NTSP 4DGVL 1UPGA 3RJDA 3VH8A 3P9LB 5EWIL 5D1XA 4MTFA 3CQPA 2PUQT 3HAEG 4APQB 3LRSA 4XPGL 4ZHQA 2Z6FA 4XRCB 1XTMA 4LDLB 5A7EA 4CSTA 2MW2B 3QEHB 2BNQE 3IJEB 1NC4B 4LU5L 3GSOA 3EJZD 3HR5B 4MMXA 4E5XB 5DEDA 2B16A 2LT9A 1T4KA 3ESMA 4UCSA 5HVHC 1CT8B 3VFNA 3M7MX 5JPNA 3BVVA 3G5XA 3QEQE 2G30A 1U8LB 5D9SA 4XMZA 4ZFGH 4U6YB 5DJZB 1CFMA 1JRHH 2C9VA 1YSCA 1YEEL 4LF5O 1CICB 1NBYB 2VYRE 3VNYA 3DX9B 5EV7A 1SDDB 2HVKB 5D2LB 1T4WA 3QZOA 2YD5A 3Q1SL 4MDIA 5HHME 5KYUB 2R2HA 2R9AA 1G9NL 3IDXL 1NQBA 4RESB 4Y4FB 3VGAB 5HGBB 3AWGA 5D93B 1ZVNA 2CAKA 5HVFB 4FFVD 3HZMA 2WQAA 2EDNA 5K1JA 3N1MC 3Q6GL 3SDXB 2ZXWC 5C0EA 1FN4B 1OTTD 1Z5YD 1HQRB 4LHUG 4OAWA 3GKZA 4AQ1B 1QU7A 5DVKA 3Q4HA 1BOGA 2DY2A 2B59B 2YRPA 5B1CA 4URTB 2QPUA 1YEKH 2CTQA 4K94L 2BSSA 2DDQH 3WFDH 3ZL2A 3QUYC 2OXHB 2BWDA 5J5EA 1KLGA 3V0VB 5EF3A 3BAWA 1H2LA 4TQIA 3IT8D 4LLUB 4JZGA 5CB4A 3L3IA 1EO8L 1S5JA 1USZA 5ELIA 3FXIC 1OIOA 1P7QD 2X4RA 1FXKB 1KT2B 1U95B 3GXIA 5M7QA 4A2DA 3BUTA 3HB3C 4TNVF 1A1MA 5BMVA 5KA5A 2CK3G 3NH7L 3HNSH 4HKZB 1K73W 1BAGA 4E0RB 1WP7A 5JH7A 5EU4B 1FJGB 5BR8O 3UIZA 1M05B 1MHCA 5GS3A 4HW6A 2UUAB 3CLEH 1ECZA 4L87A 3P1VA 3QIWB 4GRWE 4ZYKA 1Z66A 4MAYD 3DVNA 3R7RA 3GUTB 3AG7A 2AXJA 5EHFA 2WVUA 1KCVL 5I18L 4X88A 1L0PA 1KTBA 4CVUA 1OTUC 4PIBA 1DJSA 4WO4C 1OP5H 1QA9B 3JWNC 4Z7UE 4OU3A 1C12B 1WWBX 2I27N 1KIPA 3D39E 1CXFA 1BM3H 4XPHL 1CBVL 3PPEA 4G9DA 1CL7L 3UP1A 2KQXA 1T7ZA 3D4GA 4BDVA 1L0YA 2X9WA 4TVSa 2F18A 2NPLX 3VH8B 4NC1E 5D1XB 1N0XL 3SYAA 5SX5H 4GB9A 4DV5B 1ZLSL 1RK0A 1SXZA 3LRSB 4ZHQB 3QZWA 4FL4C 4YHYB 1IFHL 3MZTA 2XPYA 2FQDA 3GSOB 3ENEA 4MS2A 2F5BH 4MMXB 1T4KB 1KUMA 4AIEA 2NY4D 2OMTA 3VFNB 2IXQA 3QXVA 5JPNB 1NIEA 3G5XB 5D9SB 2Z0AA 1OALA 3GMQA 1NLBL 1J1OL 3HNTH 3L16A 2VDQB 2FNWA 5C8JB 4ZS6C 5CBGA 4BQ9A 3BPNC 2NYZA 5T1MA 1UA6H 5I1EH 2QGDA 4HIPA 2WBJC 4H4NA 3WO4B 1KIUA 4MDIB 4OFYA 1W0JG 3LV3B 1UFIA 1KBVA 4WO0A 2R2HB 3TBWA 2ZCHL 3B83A 3IFLL 4P5KA 3EHBB 4EKXA 4F8TA 4PJ5E 2OIGA 5KSUA 4XP1L 4F24A 4YSRA 3TM6A 3ZE0E 1LYQA 3HZMB 3BDXA 3MV7E 5IFHL 5L8JB 1THZA 2VDPH 5I6MA 3OPZH 4OGXL 1U33A 4YSEA 5C0EB 2EDOA 2GJ6D 4QNPE 3ROLA 2VLRA 3IKKA 4OAWB 1NC2B 4NYLA 2YGNA 3Q4HB 2KLTA 1BOGB 3BKYL 1BD2D 1FC2D 3OEEG 1RP9A 2X2YA 3PNWA 3WFZA 4F1SA 3MCLL 4ZAKD 2O5NA 2BSSB 5LBGA 3CSBA 2XNDG 1G0XA 5DRNA 1S8DA 1SQFA 4GT7A 3TC9A 2AF2A 1KLGB 4J3SA 2Y36H 1H6FA 1K5NA 1BQHG 2RMNA 2DQ6A 3PY9A 2I85A 4XR8C 4B41A 2W38A 5D1QE 2G0KA 2X4RB 4G43A 3ABMC 2WN2A 4JFOA 1A1MB 3FU7A 5BMVB 1A22B 3RVZA 2ZKHL 5JH7B 1F11A 4N2NA 1UB5A 4MNQD 1QTPA 2ICCA 1MHCB 3GMRA 3LHPH 3QUXA 4M62H 5E5MA 4OF5A 1F58H 3NJHA 5CR8A 1SHSA 2J6WA 3KYAA 2B4CC 5AVUB 3LSQA 2N1TE 5E95B 2IVFC 1SFHA 2NR6C 4ZYKB 3DVNB 4PJCA 2R0ZL 2EIEA 3QPQC 2XASA 3NJFA 4U6HA 4U7NA 1YNTF 2DEXX 4Y16A 5CWSA 3MSPA 2YXHA 5AW9B 5B4MD 5MEOA 4FTVE 2L4OA 1U3NA 4UT6L 3STLA 4BE5A 1YEIL 3BP5A 5J13B 1JGIA 1KIPB 1KCRH 1WIUA 4GAFB 4G9DB 2XZZA 3V52H 5AENA 1ND0A 1VIWA 1KCSL 4FS0A 1FZKA 4BDVB 2GKIA 3KPRD 1NCDH 2FEEI 3MUZ1 1AOZA 4YJ3A 4MQXD 4TF4A 4WEUD 1RK0B 3QZWB 3UDWA 3OAWA 4LK4A 3X1NA 4LVHB 1HIMH 3GM8A 2D3VA 5BOZG 5AVQB 2CKBH 1TCMA 1AJNA 2QTSA 2J88H 1WRFA 1H2SB 2OMTB 2IXQB 3BSZL 3EJYC 2AHYA 4A37A 3GMQB 1OZ0A 2WY3B 4HPOH 2ZT9C 2FATL 2WNXA 1EVUA 4GXUM 2NLJA 3B77A 3WKPA 1I3GL 5T1MB 1YQ2A 3IC9A 1OARL 3DJZA 3MYZA 4B9PA 3T0EE 4PJXE 1KIUB 3TBWB 4PGZA 3BVNA 4P5KB 3TN0C 1Z5LA 3NYKA 5KSUB 1QLRA 4NUJA 1PZ2A 4XPFL 3NN8A 1EQWA 3GTVA 1BJMA 2A73A 4PJAE 5I73C 5KVFL 3BRDA 3QK0A 3WNMA 3VW3H 1S5IL 2IV9A 1OCRB 1MCWW 1OAYH 2V17L 1A25A 2JJ1G 1GIGH 2HJFA 3WELA 5AVWB 2DV6A 8FABA 3ROLB 2QLYA 2W60A 2VLRB 2H3XC 4NYLB 1TUBA 2BH0A 2R0WL 4M9OA 2BFVL 5L9DL 3PNWB 4UT7H 3N9GH 4YDVB 4JPWL 1OOAA 1GHFH 3AU1A 3ZHFA 3RVVC 5DRNB 1S8DB 4KZ0A 3A0BZ 2WVTA 4JFDD 4B3SB 1PZDA 1K5NB 4OIBA 3MKGA 2AERT 2KMWA 1DVFA 4TNFA 3AG3B 4XP6H 3WS6A 1TETL 2D7NA 4HHGA 5T1DL 3OG4B 3LRMA 4JFOB 3FU7B 4Z1VA 1NKRA 1SQ2N 2P7TA 1F11B 2J6EH 1UB5B 4U3SA 1HEHC 3APNA 3GMRB 3QUXB 5E5MB 5E8EA 2FLRT 3TBCA 3N43F 1PD0A 1JA8A 4Q6IB 4XCCL 1GM8A 4DESA 2HPOA 2WBXA 2HAZA 4G11A 3PS6A 3V0HA 3OAZK 1Q9OA 3F7VC 4FP8H 1QI4A 2YC0A 4K9JA 3N1QC 1HHKA 3NIDE 4PJCB 5EC1C 1HL5A 4U6HB 4Y16B 5CWSB 2Q7YA 5MEOB 4BKSC 4IYKA 2BY1A 3STLB 4JHUA 3BP5B 2XQYG 3IWUA 4N8VG 3H3PL 2MQ0A 4IBTA 2LVEA 4X9IA 1VEWA 5E9DD 5LNGA 1CDGA 1ND0B 2ZF8A 1Z9MA 4J2QA 1FZKB 3HS8A 4PJ7F 1MFBH 4EBQH 4K8XA 3U4KA 5JMOC 4Z7WF 4YJ3B 1A3QA 3L3HA 3LNMB 4XZUA 4GLRI 2QWNB 2YD3A 1XSOA 1A66A 4OF6A 1MFNA 4K7PX 3PWVA 1AC0A 3QUYA 2YEZA 3ULSA 4YO0A 1UCBH 35C8H 1E42A 1JE6A 5IJDC 5C7XH 5AQ0A 3FU5A 4UV9A 4BFBD 5GSVA 2O30A 3VGBA 5C0BE 1HSBA 4H7VA 4S10A 3MBXH 2XWDA 4U05A 3GLEA 1XILA 2D3OW 3HKCA 1UG9A 1XFPA 1UH4A 2NLJB 3BYYA 1IX2A 3EYVA 2WWKO 4QRAA 4QRRD 5CEYA 3X17A 2COVD 3NCYS 1A4BA 2UU9O 3UG4A 2YD2A 3NJXA 3RAJH 3I75B 3BVNB 1NLDL 4X6EA 3SJVE 1Z5LB 2NUTA 3KPNA 4KHXL 1QLRB 4ELMF 4NUJB 4JVPA 3BT2H 2Q3AA 3VXUA 3NN8B 3JAKA 2F58H 5L6YL 4GEIA 3EBIA 1P6AB 2A73B 4NLHA 5D7IF 5EA0H 1HZLA 3A0RA 3SCMD 1Q6HA 1WC7A 4E4EA 8FABB 1MG2C 5ISZD 2HJFB 4WUUA 1L6PA 4X4MA 2W60B 2VWEE 2XI9A 4P46C 4NAQA 1TUBB 1HYSD 4JAAA 3AY4C 4WO4A 1KN4H 4TUOA 4H37A 1GAFH 2BVPA 4P57A 4CSSA 3AU1B 1PNKA 2WWKT 2J1WA 4LESA 1H2KA 2DWTA 3W1ZA 1A3RL 2XXCB 3HG1A 4K7FA 5AVYB 5CJQH 2VLKD 2UXFA 1OF0A 3T2PA 1DVFB 1XL4A 5HDQL 3E38A 1JPGA 3DSQA 1XSIA 4DR2B 4FF9A 4LCVA 5F7AA 3ZX1A 4AQ8C 4MTGA 1YN7A 4RGND 3H4HA 5CO1A 3GI9H 2DZEA 3NJIA 3R19A 4D3CH 2DB8A 2P7TB 4YC2C 4U3SB 2D0HA 1TT6A 4LL1A 1BQLL 2D7TH 1ZIAA 5E8EB 4FVMA 2CO1A 2OZ4H 1DQVA 1P84K 3B37A 1X4TA 4IOFD 4JFFA 1U8PA 4XNQA 4Y2LA 5LA6A 5GGUA 5BO1L 4N2EA 3QO7A 1Q9OB 1KENH 2NN4A 1CXLA 5F0LB 1HHKB 3KLQA 1KP3A 4W4LA 1W9XA 5BV7C 2GHZA 5F7LB 1CI3M 2Q7YB 2WBJA 3CH1A 5BS0E 5I6NA 5LGYA 5GRZA 3O3UN 3HE7C 3MA9H 4IRSD 4F92B 4DV7B 1E27A 3QRGH 1I7FA 1I3RA 1PTZA 5TF0A 1R33A 4K5NA 4KRPD 4ZNEA 2JCWA 1F00I 4U4IA 4MSWC 1F42A 4K71C 1X44A 1GYVA 5HP5A 1X9QA 3L3HB 4GXUN 2Q67A 4XZUB 3CD4A 1G1KA 4JI7B 5F7MC 4GPVA 1S9WB 2XWCA 1XXFC 2CKNA 3PWVB 4FQJH 5HHVH 3TIEA 3ULSB 3QUYB 2YEZB 4OLZL 4G72B 5DFVD 2QHRH 4O02L 5E6YA 4YH6A 4ZMLA 3O9OA 3ZRCC 2UXDO 5GSVB 2RQ8A 1HSBB 3T2LA 3HKCB 1FFTB 3HB3B 7FABH 5CEYB 2XV6B 3RRQA 4EOWH 5IIEA 4ONGH 1L8DA 2XIBA 4Y88A 2QTOA 3QP3A 2JJVA 5KVGL 1SXAA 3K6FA 4G8GA 1OGPA 4XMLH 3ZE1E 4X6EB 2NUTB 3KPNB 1WK0A 4PJDA 3MHSC 4WFAV 3VXUB 3WL9A 4FNLH 3JAKB 3UO1H 4AM0Q 1QLEH 2AZAA 4XMPL 3CPWU 1D5XA 3QS3A 2NR6A 5CA0A 2DLFH 5MHSE 1LO2L 1WC7B 2ENJA 2ZXGA 3RWHA 4WUUB 2XZAH 3V0IA 4DQAA 2V6HA 2AMGA 3UCSC 4LWSA 1FH5L 2L7EA 5I74B 4NZJA 3JD1A 4WO4B 4A67A 4TUOB 4P57B 1PEZA 3KKYA 5AYQA 5JIMA 4QI3A 1IKOP 2H6OA 4K7FB 1R5VA 3T9WA 5C0ND 2YHGA 5CBFA 1VFMA 1Q4NX 1JPGB 3CVIH 4K3EL 5L7XH 1CL7I 4NBYB 2ZNXA 4KKAD 1QBZA 2A6KA 1AZBA 1Z5WA 3H7LA 5CILH 4JQXC 3ZEDA 4FL4B 1DL7H 1YEGL 5TE7H 4PGBA 1YN7B 3CVHL 3ZE2F 5HJDA 5CUSL 4X6DE 2BSEA 2PWEA 2IFFL 2OCJA 3HBZA 3VGFA 3MUJA 3NT0A 5IYCO 4YFDB 3CB2A 4MNGA 4XNQB 5GGUB 4JFFB 4WNJA 1U8PB 5I1HH 2B1AH 4NCC2 1K4DC 1YITV 2V4DA 1MI5D 2QJDA 1O7VA 3BPNB 5K9OA 1J0ZA 1OCOB 1F4AA 2VS0A 2AJUH 4KXZI 4NPJA 2IAND 2WBJB 3CH1B 4JI8O 3FCGA 3GHBL 1K34A 1TYRA 4AM0A 4TTDD 3BZ4A 1RZQA 2IFGA 4QUOA 2CGRH 2R29A 1E27B 4YHMH 4B3RB 1I3RB 1PD6A 1NCGA 2NY3D 2Y9RT 4CAGA 1I1FA 2ALWA 6CGTA 1JXKA 1GH7A 2YPVL 3QCTH 2PY5A 3K1KC 4LH7A 1QG3A 4WFBV 4HUCA 3K04A 4XN7A 1A7OH 2P67A 1KYOF 1BQZA 1YEHH 3BVDB 1GZPA 2ICWI 1GZQA 3VSQA 3ARYA 3TIEB 5HYJA 3EADA 3SOTA 4KKCC 4XE0A 3ABKC 1DVXA 1E4WH 4R9HA 5ABAA 4AG4H 4GW5A 4FQIL 3S37H 3ZTCC 2APWA 5D5QA 4L2LA 5GGVH 4F58L 1HILA 1RM1C 5FWQA 2N56A 1XF1A 1VMGA 4X0KA 3CFKA 3O3DA 3FSOA 4MZIA 3ABMB 5ID1A 1JGUL 4R26H 1JZ6A 1T7XA 1TSRA 2ZNJA 1ZLDA 3IAGC 1IC1A 3KXFD 4AGNA 2NT0A 2QGBA 3FCTA 4G8GB 4LSRH 3ETEA 4DR3B 1Z3GL 3HLAA 4O51A 3L54A 2WKLA 1PY4A 4PJDB 3WL9B 4TVUA 4JPKH 1FO0L 2NY5H 4ZFOA 4GKJO 1F45A 1XH0A 4G8IA 4HOWA 3LEVH 1D5XB 4YUEH 2DD8L 3CQFA 3F7VA 3RWHB 1JBJA 5EC1A 2HH0H 3QJFA 1FKAO 4PU2A 4LWSB 3UT5A 3KPQA 4N87A 5C3IA 1JPXA 1RFYA 1AE6H 2I7SA 4C56A 5JXAH 4OJFH 5AKRA 3WKML 1DVSA 5I1LA 1IAIM 3V4VL 2ITCC 1R5VB 1V7NH 1MAMH 2OFQA 3DWTA 3MRCA 4S2SA 2J73A 5JORA 4JRYE 1GM7A 1U6AH 2A6KB 5DRXA 4R84A 4XC1L 3QORD 2V37A 4PGBB 4NP9A 1ZJAA 1NAKH 4KUZH 5INCB 1O75A 4UM8A 3NESA 2GEEA 5MP6L 1MPAL 5I30L 4R7VA 4UINL 5KN5A 2XN9E 2CDGA 1L7TL 1UWXH 3Q7JA 3OC5A 4YHOL 3O8XC 4DGYH 4G8AC 1SBBA 1K5QA 2IAMD 4A7SA 5SWSD 4HG4J 4W1TA 1I9IL 1TJGL 2ZT9B 2DF3A 2FT7A 1YVLA 5IHUL 2HLFD 5K9OB 4PR5A 1TGOA 3L13A 4N0UE 1F3JA 3ZHQA 5F6IC 1T3FA 2R0KH 1QX1A 3O3BA 4KV5E 4AM0B 1RZ7L 1IT9H 5JOFA 3BZ4B 3EKCA 2DQGL 1EJOL 1PAMA 3BDYL 3DYOA 5CINH 4CJ0A 1GOGA 2DQMA 1WUNT 3VTMA 1AANA 1DYZA 1I1FB 3B6SA 4NHUA 4PBWD 1VF7A 1LQSR 1J1XH 3GRBA 1JZGA 3NCEB 1G7IA 3RVUC 1HT6A 4OTXH 1H2NA 1MFDL 1ETA1 5KVDE 4PWIA 5E99H 1KBPA 1MFMA 2JTYA 2YFOA 4MA7L 1UZ6F 4UU9B 3HBPA 3T3MB 2UXVA 4P46A 5FYJD 5GZOD 2JQAA 4H33A 1GZPB 1R46A 3AY4A 3A6BH 2K8MA 4DP4X 4TL5A 5J6GA 1UOVA 5HYJB 3Q8FA 2HCZX 5SX5K 4HAFA 1RPRA 5E6RB 4GW5B 2O26U 1F8TL 1NAMH 3DV4A 1CZ8H 1HILB 2IDSA 5D1ZI 5DR5H 4X0KB 1XMEB 2F6AA 3QCUL 3JARA 3O3DB 3FUKA 1QD0A 5ID1B 3BCCH 5E6ZA 4AQ8A 3UBXG 5HDOA 4NQDA 4DN3L 5CN0A 1A7BA 3QUGA 5GZNC 5AKSA 3FCTB 3HLAB 4O51B 3TZVD 3C08H 3II2A 2ITFA 3PWPD 5E6ID 2WLJA 3GDCA 4ZFOB 2GG1A 1E67A 4G8IB 5SV4A 4X9BA 1AROP 2ZUWA 1JZJA 3F7VB 2E75C 2UUBO 2PXYC 2ZJSH 3LPWA 5CS7A 3AMKA 4JB9H 4U1KA 5EC1B 2VLMD 3IPFA 3QJFB 4JN2A 2GTSA 4OGYL 4F9LC 1F4WH 3ME0A 3UT5B 1QRND 1T0NA 3KPQB 5CP3A 5AOJA 1IE4A 1HXMA 2HRPH 3O6FD 4B9CA 1F97A 3A6CH 4C56B 3HE7A 5BW7C 5JQ6L 3CWBH 3TV8A 2F19H 1KGXA 5I1LB 3VQVA 4QRUA 4JV5B 1FFNA 4MSWA 5CD5C 5JORB 3MRCB 2H94A 4S2SB 3BAAA 2GK2A 4G6MH 5DRZA 2G5RA 3UAJC 5DRXB 3V55A 3AY2A 3FKSG 3BWAA 4S1DC 3PABA 1FJ1A 4EN3C 4UM8B 2W9EH 1AZCA 5GS1C 3L5IA 2RJZA 4OCSL 3MODH 2VRZA 1M9SA 5JW5A 1D5BA 1MJ7H 3ETQA 5KN5B 2CDGB 1LM8V 3N50A 4QE7A 3VI3A 1M42A 2OLDA 1N34B 3QO5A 4KI5E 4UAOB 1ET7A 3MV9E 5TISZ 2E7LC 3JWDH 1CE1L 4LP8A 1SM3H 15C8H 3GXTA 3MOAH 4LMQE 4JUTA 4RAIA 4LSTL 5B7MA 3EVKA 4Z7OB 3HFML 3AT8A 2HJLA 1T04A 1VADA 1XZWA 4FLZA 1P6FA 4PR5B 1MEXL 4QRPA 4PA7A 1F3JB 3EH4B 3S5YA 1A7QL 4X6FA 1T3FB 4A7TA 3HEIB 5JR1L 1NFKA 5DLML 1C7TA 4Y0GA 2Y69C 1B04A 5JOFB 4AW4A 3HI5L 3HUJE 2X38A 5LVEA 3UERA 1RULH 5E2UL 4GBXD 3ZR6A 1KC8W 2FD6H 4HC1L 2UXNA 2P26A 3B6SB 4NHUB 2FUQA 5AW8B 5ILTL 3Q2VA 5LAPA 3I2CL 2QZ5A 1G7IB 4G7VL 2ORBH 3L95A 1FYJA 3U0WL 4ADJA 1GGIL 1OW0C 4N2IA 1AXTL 5J2UA 4JR9H 4P46B 1NH6A 3O6LH 2LAGB 4OFQA 4GX1A 1QVOA 2G2PA 5J6GB 4NPYA 1KSRA 2ARWA 2HKHL 4S1SH 2XTAA 3AXLA 5I5MA 4J3BA 2F7IA 3WJJC 4IBZA 1QZNA 3DV4B 1TXKA 1JZ5A 3K58A 4GIPD 4OFKA 2V5YA 1RFDL 4PWGA 3JARB 2P22C 3OF6A 3GBNL 2I24N 3RWEA 2WXKA 1BEXA 4JQXA 3BJ91 3UL4A 1QR4A 2H2PD 1RPKA 2FX8L 4MZRA 4Z7NF 2LTQC 3OQRA 1IAIH 5KAFZ 3K2UL 3PFUA 4KNUA 4B27A 4GKZA 4RRPM 1G9HA 3EOYG 3APOA 2CE6A 1K4DA 5KBLA 4KXDA 4U1KB 4N5ED 3CC4V 1MVYA 2MMXA 4JN2B 5BV7B 3U46A 4DO4A 4KZDL 3ME0B 4PJIA 1T0NB 5GGTL 2QWQB 1KCUL 4NNPL 1HXMB 5J4MA 1JVMA 4G3YL 3MV01 2WXQA 4IDJH 3HE7B 2WNKA 3CRCA 3VFMA 4NQQA 3K7UA 4NUGH 4QRUB 3TP4A 3AC0A 4F8QA 5K9JL 1FFNB 1URFA 4MSWB 4Q14A 4XO4A 4A5UB 1VPOL 3MDJA 2BMKA 4K71B 4M7JL 3MRRA 3QDME 3RY6C 2R39A 4GRLD 4IYIA 5DRZB 3P69A 3BWAB 4NZRH 5CLTA 3FJTA 3PABB 1FJ1B 3FZUC 4R0LC 3PP3H 3S88H 3CXFA 1G6VK 3U4AA 1H5BC 1LDPL 3VQWA 4KI1A 1B6UA 1D5BB 1MG3C 4LCWA 1YMMD 5F96L 5JW5B 2WXFA 3K74B 3VI3B 3ZJZA 1XH3A 3RVTD 3C5ZD 4N3UA 1VDGA 1CLOL 1S46A 3WGUB 5JXED 2N0KA 3FRPG 4G6KL 4WTZG 2VLJE 3U9WA 4NC0B 2HJLB 1T04B 1VADB 4QRPB 3BN9C 5D7KE 2Y06H 1QFUL 2VR3A 4X6FB 5DECA 2JVUA 5AKTA 2VJ8A 3N0AA 4BYHA 4IIZA 1G7HA 1SEQH 4QLWA 3KVQA 5IQOA 4XNAA 4YHPA 3BW9A 3M8OH 4W4NA 2A6DA 2EDHA 2A0LC 1TITA 4Q9RH 3QBTB 1V7ML 1JD7A 2R9HC 4K07A 3L95B 3DIVA 4J3VA 3MAWA 1G6UA 2E6QA 2XKNA 8CGTA 5IHZA 4K35A