1OCRB

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ocrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ocrB02
2BP0A 4YSEA 2XYBA 1PZCA 1RZQA 2XXGA 1V10A 3BVDB 3QJQB 4BXSV 4A2GA 5D4HA 3WNJA 5I6MA 3X1EA 4CSZA 3ERXA 1UATA 4ZK8A 2IDFA 2HRGA 1OCCB 1SDDA 3AG3B 1GR7A 4A2EA 2J55A 3PCYA 3NSDA 3TASA 3AG1B 4M4RB 2AZAA 2VW6A 1CUOA 3TU6A 3S3CB 3AG2B 1TU2A 1V54B 2XWZA 3NJMA 4AKQA 4DP8X 1OE1A 1WA0X 5B3SB 3OD3A 5B1BB 1ET8A 3TBCA 3ZDWA 2FQDA 3FSAA 5I5JA 2CCWA 4YSSA 3CVDA 4HHGA 3WKPA 1NZRA 2CALA 2UX6A 2XV2A 3T9WA 2VM3A 4BWUA 5LDUA 2PP9A 2EIKB 2BP8B 3G5WA 1AS7A 2BWIA 4TXVB 5B1AB 4E9YA 1R1CA 1WS7A 3FS9A 2MRYA 1SF5A 1JOIA 5D4IA 4E9WA 1NTDA 3OQRA 2LLNA 2AVFA 4G7SB 4FAAB 4AKPA 1GY1A 5FC9A 4BWTA 3OMAB 3ZBMA 2YAFA 2P80D 3OMNB 3FYEB 1AS6A 2XU9A 2PLTA 2YARA 4EF3A 1BYOA 5I28A 5AKRA 1ASOA 1IBZA 1OE2A 2GIMA 1CYWA 3CVCA 4G72B 4BDVB 1KBWA 2GC7C 3BQVA 2P80A 5B7MA 4WTQA 3NJKA 1AACA 4YL4A 2UX7A 2TSAA 1J5CA 3WIAA 3PAVA 2DV6A 4NERA 4UANA 4QKTA 4KO6A 3S8FB 4BK5C 1BXVA 1E67A 3WG7B 3SQRA 1KYAA 2HRHA 8PAZA 5I6KA 1CC3A 3FU7B 3FPXA 5F7AA 1L9TA 1I53A 1AAJA 3FPYA 4YVUA 1E5ZA 1NIDA 2YAQA 1ZV2A 5I6PA 1JZGA 3KW7A 3FYIB 2HXAA 3EH4B 4G7QB 1L9QA 1N68A 1SHXA 1ZIAA 2YQBA 3NSFA 4P5RA 4A2HA 5B7FA 2BO0A 3JT2A 1ID2A 1OCOB 3DKHA 3NP3A 1BXAA 1AANA 3NSCA 1FA4A 4KNUA 2CBPA 1W6WA 3X1GA 1ET7A 2VMJA 1PNCA 1KGYE 2JFCA 2PP8A 3WKQA 3FT0A 5PCYA 4L0PB 1AS8A 2E86A 1FFTB 3T6XA 3UAEA 2YAEA 5B7EA 2PPEA 2Y1AA 2GBAA 3PAZA 3QJUB 2IWFA 4KOBA 2R7EB 2BZ7A 1WA1X 3QJRB 4DP2X 2ZWNA 5A7EA 2XX1A 1AZNA 1MZZA 1OOWA 4E9QA 4K9JA 4UAHA 2EINB 1PNDA 2GC4C 2WO2B 3ZX1A 3UAAA 4BXVA 1IUZA 1PY0A 1KV7A 3IN2A 4YSCA 1JXGA 4DP0X 5I6LA 1SFHA 1M56B 1J9TA 1NDTA 3NJLA 3T6VA 3T6WA 2A3TA 7PCYA 2IDUA 2H47C 5B1JA 3QJTB 3PXLA 1BEXA 1AZRA 1AR1B 4N4YB 4GP4B 2Y69B 1RCYA 4YSOA 3JTBA 1CURA 3NSYA 2I85A 1AZUA 4A2DA 2Q9OA 3AW5A 3N55A 1X9RA 2YXVA 3CDZB 2YAPA 2UXVA 2RACA 1JZHA 2DYSB 3EF4A 3ABMB 4RH4A 2CAKA 1PMYA 2VSMB 1NPNA 2AFNA 2FQGA 2I7OA 2CUAA 3TBBA 3WI9A 2NRDA 1JVLA 1MG2C 4KO7A 3V9CA 1SFDA 2GB2A 2YAMA 3ASOB 1YLBB 3CG8A 3GXUB 4PCYA 2PPDA 2B08A 2J57A 3V9EA 4YSPA 3AY2A 2YXWA 3NJIA 1PLCA 1QLEB 1L9OA 1NINA 1ASPA 1NWOA 1PAZA 3L45A 4A68A 4E9RA 2EIMB 1ADWA 4G7RB 5F7BA 1PCSA 2XXFA 1BYPA 5TK4A 1F56A 2BP0B 5I6OA 1E5YA 2IWEA 3U25A 3ABKB 4DP9X 2ZXWB 3WNIA 4Q8BA 1PLBA 3D12B 4DPCX 1B3IA 3UABA 2FJSA 1SDDB 5D4JA 1A4BA 2VM4A 9PCYA 1KDJA 2OCCB 1IBYA 1SNRA 1JZFA 1QHQA 1ETJA 1GW0A 1WAEA 1VLXA 3MBWB 1NIAA 1KCWA 2B3IA 1EHKB 2HX9A 4KO5A 1SHWA 3X2QB 4GYBA 4E9SA 3N2JA 2WSDA 1CYXA 1OCZB 5I6NA 3QPKA 3GDCA 4HCIA 2PCFA 4DP4X 3EH3B 1QNIA 4A2FA 2XUWA 1TEGA 1KDIA 2QPDB 2XV0A 2UXGA 1SJMA 4CSPA 1ZDSA 3S3DB 3S8GB 2CJ3A 1NPJA 2QDWA 3MX0B 3NT0A 4E9XA 1JVOA 4Q89A 2QT6A 1V55B 1BQ5A 1TEFA 4YSDA 4G70B 3SBRA 1L9PA 1KCBA 1E65A 1J9SA 3S3BB 2OJ1A 3UGEA 3EHBB 2IH8A 1NIEA 5AZUA 1GSKA 1A65A 4HCGA 1M57B 3PAUA 1IKOP 1RZPA 1JZIA 1PZBA 4YSQA 2IDTA 1A3ZA 1J5DA 3C75A 3NJNA 2J5WA 3DIVA 1OV8A 4QLWA 1WA2X 3QJVB 4DPBX 1MG3C 4JHVA 1BQRA 1NIFA 2PP7A 1NWPA 2BP8A 4F2EA 2PPCA 4A66A 5IY5B 3KW8A 4W1TA 2YAOA 4GY4A 3TA4D 1ZIBA 3NP4A 4NAJA 1GS7A 2EILB 4ENZA 4MFHA 5TK2A 4HIPA 1IC0A 3RYMA 2FQFA 2Q5BA 3FQ2A 1OF0A 1JZEA 1W6LA 1A8ZA 3CZUB 4AKOA 4AX3A 2FQEA 3NJGA 3NYKA 2JKWA 3FU9A 3ASNB 4JHUA 4M3HA 3NJFA 1ET5A 3QQXA 5EHFA 4AZUA 2BWDA 4F7KA 1KBVA 4BDVA 4AI7A 2YEVB 2HZHA 2XX0A 2FT6A 2AANA 4HAKA 4YSAA 3H4HA 3IEAA 2IWKA 3DTUB 1PLAA 1XMEB 2FT7A 3SBPA 3UADA 4KOCA 2AZUA 2TSBA 4GP8B 2QPEB 2BW4A 2ZONA 2H5UA 1MZYA 3FQYA 4W9ZA 3CVBA 3FU7A 1HAUA 1XB8A 3FSWA 3ABGA 4GP5B 2UXTA 1RKRA 1ILUA 4YSTA 4G71B 4N8UA 2FTAA 2GSMB 1AG0A 4JKNA 4KNSA 4X4KA 1AQ8A 2IH9A 4YVNA 1OCRB 3FSVA 1NIBA 4KO9A 4YSRA 1GY2A 3OMIB 2X88A 2VW7A 2J56A 3UACA 2FT8A 2OV0A 1ILSA 1ASQA 1A4AA 3IE9A 3AG4B 2HLEB 4DP1X 1AG6A 1JXDA 2HX8A 1SF3A 1BXUA 2IDSA 1E30A 1GS8A 2BW5A 2X87A 4WKXA 6PAZA 1GYCA 4P5SA 1PZAA 2VSKB 2WO3B 1M9WA 2BZCA 2R7EA 3EH5B 5E9NA 4HZ1A 1BAWA 2HX7A 4YSUA 1J9RA 3NJHA 1X9UA 3IN0A 1T5KA 1XB3A 2DYRB 1L9SA 4F2FA 1DYZA 2XV3A 2W88A 3FU8A 5ANHA 3QJSB 1AOZA 5AFAA 4A67A 1ZPUA 4DP7X 1GS6X 1JERA 2IAAC 1L9RA 2MTAA 2EIJB 2IDQA 2XLLA 1AZCA 2DY2A 5I5MA 3T71A 2GI0A 2JXMA 2YAHA 1PF3A 5B1JC 4E9VA 3H56A 3AZUA 3HEIB 3HB3B 3NJJA 3GYRA 2PPFA 4DP6X 1ZDQA 1N70A 4GXFA 1XB6A 1JZJA 4HHWA 2GHZA 1EZLA 3ABLB 2I7SA 1J9QA 3IBOA 2VN3A 5B1KA 3H4FA 4FA7B 2FNWA 4KNTA 2XVBA 2H3XC 3CDZA 1JXFA 3X1NA 5PAZA 3PLYA 6PCYA 2FWLB 1OE3A 5I26A 4PAZA 1BQKA 1MDAA 2DWTA 4HALA 1A4CA 1AIZA 2QDVA 3X1BA 2W8CA 3SBQA 5I5IA 3T6ZA 2PPAA 4DP5X 2PCYA 2UXFA 4NB7A 7PAZA 4E9TA 2BHFA 1WS8A 3FQ1A 1NICA 4UF7C 1HFUA 1URIA 2DWSA 1TKWA 1W8EA 2VW4A 2ZOOA 3ZIYA 3X1FA 1DZ0A 4BWWA 4DPAX 3PPSA 2N0MA 3FSZA 4HCFA 1AZBA 1FWXA 3OM3B 1HAWA
chains in the Genus database with same CATH superfamily
4HNAB 4DHLA 3FC8A 4L4TE 3BAXA 1F42A 5IVXE 4QRRD 2EVIA 3HKBB 2Q0OC 2D9QB 2H6UA 1JGUH 2H2PC 4PJHA 5D4HA 5SX5K 4Q6KA 3SKMA 2MCPH 1OCCB 2CR6A 1SDDA 4MAYB 3NZ8B 1NPUA 4MTFA 4KUZH 2A2QT 2AC0A 1KIUA 3BZDA 1XTMA 4X5PA 5AW9B 2BK8A 2ZNXA 3L5HA 3OLDA 4R8WH 1PLGH 4I87A 2UU9O 2WZ0A 3FU3A 1KN4H 1D6EB 3KVPA 3L1FA 3L4TA 3MZTA 3N91A 4OZHB 4RBPH 3L7FB 1G4RA 1P4IL 3A6BL 2X4OB 3QB7C 1KLGB 3ZDXB 4FFZL 5E4EC 4UAOC 1J8HA 3H42L 3P4LA 4HSQA 1PSKH 4UBDD 2XNAA 5J6SA 2R9HD 1KUQA 2H1PH 2VLRE 3CMOL 1AR4A 3QDMA 4FQXD 4L37B 4CMMB 3SE9L 3ZBHA 1JAEA 1W15A 5LMUB 2CNYA 3LOWA 3KBPA 1K3EA 2AABH 3B9DA 3VDCA 1T4KA 4NDMB 4WUUB 1V9PA 2WINA 4YAQB 4X7DC 2DQFA 3A0OA 3H7LA 4HEME 4NBYB 1G8MA 1IC1A 3UT5B 4ISVB 1FPTL 4JDEB 1Q94A 2ZYRA 4QKXB 4YLBA 3AG3C 2OMTB 3AQYA 3WL9A 2G9HB 2CMRL 2CR3A 5CD3B 3B2UD 1DBML 4Q9CA 1UPGA 2E74C 4JFUA 3REVA 3W37A 3WEMA 4JHWL 2VR9A 1RUPH 1HDMA 4GAYA 3ALWA 3KPQB 5DO2C 5DJYA 3OMAB 3ZQ9A 3LSUA 3L9RA 3UDWA 1JPST 3BW9B 4C4KO 5ERWB 1R1BA 4JPIB 4XNUL 1DQDH 2K8MA 4LGRB 4LLWA 2WNGA 4ZMWA 3W39B 1FVDB 1DVFD 2WGNB 4I88A 5B1BC 1QSFB 4JM2C 2JJSA 1M7IB 4IBZA 2X4SB 4HCRA 2QSCL 5KZCB 1PL4A 5C9JB 1KB9F 5E5LA 3H9SA 1KT2B 1YJDH 4NCDA 2DMGA 1EVTC 3ZE0E 1EWHA 2DF3A 4JKWA 3RX7A 1CDYA 4JANB 2BIPA 4PJ5A 3B9AA 4ZTPL 4YZFF 3U4KA 1SJVA 4QWWD 1NMCC 4WLCA 3FO1A 5FYKE 5ITFB 3ZKND 2C3GA 3APOA 2IDCA 3QUZC 2LW3A 4L8BB 4OZ4B 3QQDB 3ARDC 2EDJA 3O3DA 3C8HA 1KYAA 3FUJA 4ELKA 5LXGH 1PZ2A 5F7AA 1RPKA 4N5EC 2MHAA 2OL3H 5EIVA 2BIHA 1KC5L 4F7MB 4P2RA 3Q1SL 1KBBA 2YQBA 4AVKA 1VKXA 2UUBB 4NOBA 4XPGL 3OUFA 3MCYA 5KVDL 4GUPA 1SY6H 1EK3A 3DKHA 3OX8A 1QX1A 4KL1A 3ASWA 5D2NC 4DV1O 4BR6A 1LO0L 1UA3A 1BG9A 1IV8A 1P6FA 3J80N 4UCUA 2QGEA 2C9QA 1FFTB 5ENWA 3FTSA 1SA0B 4V2CB 3TX4A 3P30H 1FAKT 4UB0L 4YX2H 2LAAA 1A2YA 3GFUA 2XC8A 3W5MA 1V27A 4POUB 4BHUI 2IWFA 2IU3A 2E27L 4IU3B 1E6OL 2LU3A 4BWAA 4FI7A 5A1AA 3CFKB 3ARFB 3QH3B 4HJUA 4NYLB 5KYWB 1BFSA 3PV6A 1ORSA 3QCTH 4OSUL 1TO5A 2GHYA 2Y6SC 4BXVA 5ID1B 3PWVB 2HFFB 3N5AA 3VQ2C 1A6VL 2MJWA 4XXDA 3EOBB 1KBKA 4WO4D 3BGAA 5LXTB 1Q8MA 4ZNEA 3QT2A 2LU4A 3J2PA 3C5SA 4BFIA 3MGTB 5HHVL 2JXMB 3PXLA 2CLRB 5GRVL 5F1SA 2WQXA 1AR1B 1BHAA 3OBAA 4NUJB 5FFOA 3QFDB 1YC7A 5DM6V 1BVKA 4QT5A 2LO1A 2EO9A 2Q20A 3OGCB 5D93C 2F74A 3QCUH 3KXFB 4WFFD 4B9CA 3U1PA 2O6CA 1RJLA 2UY6B 1NCTA 3CQFA 1H2LA 3W9EA 2Q5ZA 2LABA 2P47B 3A24A 4XMWA 3SDAA 4FLZA 4K3DH 5CR1A 1L0XA 3E8BA 5L3BA 3STLA 1FNEA 1I1YB 4FD0A 2A6JA 4PGCB 2AFNA 5DD3H 4LPYA 1PQZB 2ZX8A 1N10A 4L3CB 5K1PA 3HI5H 3MHZA 4KO7A 4D9LH 2J4WL 1S7QA 1AGFA 1MHCB 1VFAA 3GXUB 3Q6FA 3RJDA 4AEFA 3MZGB 4AW4A 4FKEA 4WW1A 5LAXB 3ARZA 2YEQA 1GGUA 2WA3A 4N1CA 4BQ8A 3KBHE 2ERJC 4R4ND 3HZVA 1CE1L 5KW9H 4NENB 1CFVH 2E6PA 5HYFA 3FBQA 2VN4A 5F1IA 3VE0A 3LAFA 2YI8A 2VERA 3QUYC 3VI3F 3GC3A 4UNUA 3BUQA 3GXDA 4XP6H 5FGBA 2X7LB 3CLEL 2VLKE 3MDSA 3S5LB 2OMZB 1VQLV 2XA8H 2NSXA 5GS2H 2ZXQA 4L4VD 4ZOCA 1W72L 1JMXA 1KB3A 4NHUA 3IJSB 2VMDA 4R84A 3S96B 2BIMA 1AGEB 3O6MH 1W59A 2GJ6A 4CU6A 3CUPA 4CKVX 5DJ8B 4M8UA 2VN6A 4WF9V 2YN3A 4WKZA 4JJHA 1MFBH 1Z3RA 2R69H 3WGUB 5ALCL 3GJEA 3IAQA 4JHAH 1QHQA 1ETJA 2LGNA 1BEYH 3CK0L 2ZOKB 5F3BA 3BPLC 3UTQB 2B3IA 4BKTC 1XNQB 2OXGA 2QVKA 3T4YA 3U1SL 2QSTA 2ZPKH 3S3XA 4HKJB 4Z7QB 3D9AL 4ELMA 3MJ7B 3AWFA 1MXDA 2H8PB 1OPOA 4PU2A 4YMPA 2IJHA 1OP3K 4YHLL 3GDCA 5JHLA 1DJHA 1EO5A 3PJLA 2O61B 2APFA 4M5ZL 2RCVA 2QADB 5IZ7A 1LE9A 5TISZ 4I85A 1U91B 3PYCA 1GCYA 1ZEAH 2QPDB 1LR1A 1SF9A 1K8DB 4HLZG 3AACA 5D7HA 2VH5L 5C0JA 2CJ3A 2IOMA 3NT0A 4MDIB 1P7GA 3HC2A 2ZIMA 3GIVA 4HH9B 1MRCH 4UILL 4MJ4A 4AYSA 3FTYA 3OAUL 3SE8H 3SYQA 3DYMA 4NXKA 3LNMB 3APMA 3FQNA 2GTZA 1VFOA 2DI8A 5CJQL 3EOTL 1QBZA 2YUZA 5KBNC 3VG9C 4AQ1A 2IH8A 1UD4A 3QARA 3TVMD 3WKMH 4TPRH 3GSNH 4HUUA 2L7UA 3EYSH 1KWGA 1FIGH 3NGBC 4QNHB 4LLDB 4U6HA 4EN3C 4IKLA 4Y9FA 2DTML 3VI4F 5DMGD 1YYML 2HFGL 5DMKA 5DR5L 3NJNA 3DSNB 3CPLB 3DRQA 4UQDA 5AOKA 3AREC 4PA9A 1Z2GA 1NCBH 1N7MH 4X7CC 2PP7A 1HN1A 3DLQR 3QUMH 4Y1TA 5CD5D 2CRMA 1GGIH 3MJWA 4X83A 4H4NA 3S37L 1MABG 3EYVA 2F8VA 3HNTL 4L1LA 4YBLB 3ESNA 1NTKH 4MSWC 2GBTA 2O5ZH 2DWDA 4AJ0A 4ENZA 2NY6C 3FQ2A 3T1FB 1JZEA 2AVGA 1W6LA 3FN9A 5KMGA 5FO7A 5EO0A 1MREH 4ES9A 1YG9A 3RVUD 1AI4A 4ZTOL 3NYKA 1NBZB 1N64L 2B59A 3NK3A 4X80H 1XCWA 4QTHA 3ZXAC 2XWTB 3NJFA 2UZPA 1DSWA 2BWDA 2W0XA 4H7VA 1SOSA 4OJYA 2XX0A 3R4RA 4NO2B 3S88L 1W0JG 4PJ7F 2P22C 4OFIA 5EZOL 5EDSA 4MVUA 2ROYA 1JGIA 3IS1X 4KV5E 5C7ZA 2OAAA 2X89A 4IS6A 4ABVA 2FWSA 4J80A 2VMFA 1I8IA 3EFFB 2J20A 1E27A 3FT9A 2X05A 3B9KA 3SQBA 4IBWA 2NZIA 1OTSC 3IVKA 4B41A 5IWLC 1THCA 4HJEA 1IGCL 2H7WA 4JI0O 1K34A 2DQMA 3F64A 4PLNC 3LNEA 2PWGA 2V5MA 3EIFA 4PV8B 2WJ5A 3M1CA 1O6VA 5IB3A 3AS2A 3O6KL 1IBMO 3TBSA 4PJGF 3DV6B 1JF1B 3VW3H 3CP1A 2NX5E 4B96A 5DEFB 3BE1H 4JKNA 5E7BA 2CG9X 2H2SC 3L3HB 4KQ3H 1LDSA 4UT6L 1YTFB 3CNKA 4YSRA 3D33A 3ZMVA 5KSAC 3QI9C 4JJ5A 2OQJA 5D96C 4R26L 1A6TA 5FWRA 5C08B 4LCWB 3WEXB 1AIFB 4KTEL 1XILA 4PBWD 3GDBA 1J1OH 5FB8B 2FEDC 4HKBB 2A0LD 2X6UA 3WDHA 1CE6A 2HLFC 3QDGD 4KVCL 5IYBO 2R2CA 4Z7OE 2F54B 3ILEA 4I77H 4L8DB 2PWHA 4N28A 5DT1H 4B97A 4F9LC 2Y0SA 4YLQT 2R7EA 3ZJAA 2EZOA 3NN8B 4HJ0C 3CS5A 4DK6A 2VDMH 2HHHB 3ZHLA 4NNYA 4K35A 3PNRB 3AU1A 4FEMA 3SDYL 3WBDA 4E5XB 1XSOA 2AK4D 2R29L 4EPSA 1S4IA 1HDJA 5FOBB 3L3GA 4LPTA 2AITA 4IIQC 2CTWA 2YQ3A 2DM2A 4KZCA 4LLQB 4W9EC 4H26B 3CE2A 2V17L 3L3OA 1CK0L 5CR8A 5DS8B 1E28A 1FC1A 3PFQA 4XPFL 5L8LB 3SCMB 4X42A 1M1KW 1VGKB 4YHIB 5J1SC 3OSVA 2BFVL 1JNNL 2OI9C 2ZCHH 3U30B 1S5HC 1H9VA 4ZUTB 1NKGA 4BFEA 2HKAA 2K45A 4RZCB 1KB9J 1IAOA 2VWKA 3IU4H 3K2IA 3QP3A 3EDDA 4F33B 1OM9A 4PRPE 3SQOH 3O9OA 3E86A 1I9EA 2N1KA 3HKCB 1NOLA 4DP6X 1B6UA 1T21A 4MVBD 4ZNCD 2HCZX 3BSHA 3OKNB 2E5LB 5MERB 1EZLA 3V6OC 4XNYL 2N7SA 1C08A 2UZYB 2YA1A 2APWA 4ETQB 4AK1A 3DHMA 5DRZB 1GTNA 5B21A 3BA9A 4IKIA 4MNGE 3F7PC 1C12B 1J1XL 4XC1L 5AW7B 1BD2B 1WICA 4GRWE 5I26A 3PQYD 3VGAC 4AY0A 4HALA 3CXHF 2BC4A 4G1MA 4YXLH 1WFTA 3QIUA 9CGTA 1H2MA 1EHAA 1IC5H 3MV9B 4PJIB 4BCZA 3SBQA 3T04D 3T6ZA 1E8WA 5DI8B 5LMNB 2IQ9L 1JK9A 2L7JA 4GKJB 3NCXA 4HGMA 2JK5A 2NNRA 3QXWA 4JFDD 5L0QB 1JE6A 1MFEH 2ZUTA 4EXKA 5FNVB 1AOHA 2JELL 2F7IA 4NRZB 4OFVA 2YMTA 1IJ9A 1F3JA 5JTWA 3FSZA 1EBAA 1WBXA 2NR6D 3KBFA 3M8OH 2A6IA 3Q6GH 2LW1A 2AJVL 1LO2H 2GG1A 1OZ0A 2P5WD 3N9GL 3NRPA 1KB5H 4NZDA 5IFJA 4U6XA 2QE7G 3TZVC 3VSVA 1D6VL 1MCEA 2ENQA 3P69A 4HAGA 3QHZH 4EJ1C 5FPOA 2ADGA 1X5YA 1PZCA 2XXGA 3EYOA 1ZV9A 4WQOA 1OPGL 1E5AA 5J89A 3D39A 1HHJB 2E8ZA 1RZFH 3EOYG 2KDGA 3MUHL 2OULB 1PFCA 4YHMH 2HRGA 1LUWA 4FNUA 5E9DE 1GR7A 2FJGB 2Z31A 4NO3A 2UU9B 1LEGB 4K5MA 1TTUA 3FO0H 1CDBA 1CFNA 1ZAGA 4JKPL 5KA5A 4N9GB 4NN7C 3OHXC 1MCOL 4YDLB 1DSFL 5DHDA 1B9KA 4G8FB 4KKQA 4LVHC 3FB8B 15C8H 3LNDA 3JASA 2G2PA 3TBWB 2BCMA 3EYUL 2FNBA 4LRIC 3V4UH 2UXNA 4FG6C 3U9UA 1EAPB 5I71C 1H2NA 4NQCE 3FSAA 3HZYB 4XDLA 4G8GA 3KYNA 4YBQD 4R4FH 4EZJA 1H5BB 3UL4A 2Z92B 1NEUA 4BH8A 5AG9A 3BUYA 4K7FB 5B1OA 3V4PL 3BJLA 1W80A 5AB1A 3VRLE 4HFWA 4QO1A 2Z64C 1QR4A 1NFDB 2O4EA 4LPXA 2BVPB 4MJID 2YSUB 4PS8A 4UU9A 3TIDA 3KR3H 3OQRA 3BEWA 4L8CA 2JTDA 5CBHA 1LNQA 3CV5A 1XCQA 4U3CA 1MWAL 5LBSL 4FAAB 5I8OL 4N9OB 2DQTL 3P3RA 2YD3A 3U46B 5LGKA 2BSTA 4JO5A 2GYSA 1KPRB 2EC9T 3O2VL 4RAUB 4PA6A 4ZO9A 3O41B 4PRHE 1L9MA 2ENSA 4ZMYA 5IQOA 4KJWC 2E8YA 3VRIA 2DEWX 3WELA 3RIFK 5KHGA 1X7QB 4Y88A 5E4IA 1S7WB 4P46A 3VWJD 5BRPA 1JYXA 3JZYA 1I1AD 3OXRB 2EICA 3W57A 2NY5C 4ASUG 1I8KA 3H6AA 3HKZA 3GINA 3S98A 4WWKB 4AYGA 1BMFG 4NFCA 5ECGA 2DJ4A 4P23B 4PS3A 3ME0A 3MTRA 1GM8A 4O5LL 2GV9A 4WHTB 4YJ2A 4JQVA 4GRLB 5JNYA 4ZXBD 3BIKA 3TN0B 2EZ0D 5JYLA 5JQIB 4PJ9D 3E35A 4QRRE 4WV1B 4ODXB 1YNTB 4PIBA 1G0DA 1MAJA 1OCWL 5FYKL 5KTEL 4R7DB 2F1MA 3F7KA 1K4CA 2VDPH 5AVRB 2XCMC 2E9WA 5CGMA 1NC2D 2W5PA 4FLOA 2DM3A 5F7EH 5JW5A 2VGLM 2YAQA 2JI3A 4PJ8B 2OIEA 5K39B 1HR0O 2K9PA 1BS3A 4X6EA 2KLSA 5IMLB 2FBJH 3FKSG 3TO4D 1Z0MA 1L5GA 1H9DA 2FWOA 2LHAA 4DV1B 3CFCH 1XXFC 5B7FA 4J6RL 5LJYH 1YEJL 3BPCA 4NKQB 5ADOH 1KCUH 4UTAH 4N87A 3Q2LA 1QI4A 2C3WA 4TS6A 2RIKA 1NVPD 1J86A 1ND0A 1XV8A 5CZKA 1IURA 3G7TA 4U1IA 4ZSOA 2EIEA 3CC4V 2AQSA 3STZC 3ATFA 5I1KH 4K8RH 1KV3A 2OP4L 6CGTA 4KKLC 3PHQA 4XGZA 5F9WC 4HIJB 1BMGA 1U8QA 1P7BA 5LGHL 2HJKA 1XH2A 1VSCA 2MK3A 3FH8A 4QHPA 1KJVB 5DQ9B 1SN5A 2F19L 1HXMA 2WANA 3T0VA 1JFHA 3IDMB 1BZ7A 1TVBA 2V1DA 1NC4D 4NQXB 5F6HJ 4Y2DA 5DRWA 5EPMB 3CZFB 4RDBA 4BFOA 1UFIA 2WCGA 4ZS7L 3W3BA 2EH7L 5I1EL 1V7MH 1IARB 4WBNA 1RIUL 2B1AL 3D30A 2EYSA 1J7VR 4YXKH 3TT1H 3FFDA 1GN3A 1HINL 2DL9A 3MDJA 4DN4H 3VSQA 4CILA 1BX2A 5ISZD 1YY8A 2FJUB 1YEGL 4BFFA 4NN6B 3IPBA 2XBDA 3LSOA 2A73B 3B40A 3WFDH 5I0XA 3GNMH 3MRQB 4NFDA 3G71V 2M83A 3UC0H 4N4YB 1P5UB 2EIZA 4DZ8B 2KUTA 4XCCL 4AG4L 3QZPA 4YSOA 5BMVA 1CURA 1A4KB 1H8EG 5IJKC 4CVXA 1RJCA 4ODBD 5KYUA 3UTTB 5JXAH 1ZUQA 3CB2A 1BJ8A 1CL7L 1Y6XA 5C0AB 2YAPA 1E4XL 5F9JA 3O6FC 5IJ9B 1ZHLA 2HN7B 4KRMB 3RI5F 4JGUA 5E2VH 3IAGC 2WTPA 4OGXL 3R06A 2FUTA 3UIZA 4AQEA 3RFZA 4BZ2H 2JRIA 1GIGL 3ZKXC 3A22A 4D0CB 4KAQH 2HVKB 4DV3O 2IH1B 3EJPA 4IU2B 1JPTL 5LLIC 1M56C 2NRDA 4GI6A 4LNUA 3UYPB 5GZOC 2WUBH 4W6YB 2VDKB 1K5NA 4ONGL 3L72H 3P4OA 1P1ZB 2VABB 4QRQB 4TTDC 1NINA 1WG3A 3FONB 4JFWA 1EFXB 1E4XI 1SQPH 2ADJA 2EYTA 2J3SA 3SPCA 3CFTA 3ML8A 4G7RB 4U3SB 4EFBA 2FB5A 1XGQB 5B39G 1N6UA 2XXFA 1T89A 2DQ0A 1LL1A 4LF8O 4NZFA 1EO7A 3UAFA 1E4JA 4B9FA 5JA8B 1HHKA 2OZ4L 3OSKA 4FFYH 1IAKA 2J88L 1JJOA 4BUHA 2PZSA 4I3SH 5GGRA 1MG1A 2Y0IA 1U8PA 2ICEC 2AAVA 5IBLC 3GHEL 4CADB 1XUQA 5FYKU 5D1ZB 3GSVB 1NGXA 1P5VA 1KDJA 4Y9GA 3ASOC 3U4BL 4D9LL 2PY5A 4X7FC 1JZFA 2B0SL 2GIXA 1GW0A 4LIQH 5CJOL 2QWQB 1T7ZA 2GJJA 5AOJA 2ZOUA 1Q90A 1P4RA 1VZGA 4YK4C 3RGVA 4ZG1A 5KLVH 4E9LA 3N0PB 1HQ4A 3IKCA 1AJQA 4LEXL 4MHHI 1GOGA 3N0AA 4U1GB 3FRPA 5IB4A 2EIMC 4CC1A 2VAAA 4NPYA 3EH3B 4KXZI 4DO4A 12E8L 43C9A 1TQSA 5GGVL 4EIZC 3LDBC 2F8OA 4HKZA 3U0TB 4X6DF 1MLCA 3OKMA 4WFFE 4DQOH 2G2RB 2Y22A 1TQWA 4Y4HC 3PV7A 3GKWH 3ULVH 3D5OF 4LLYA 2CM5A 4GAGH 2NYZA 4UTBL 2HWZL 5CZXC 5C2UB 1KCVL 3EYFA 5A16A 2A1WH 3FQWA 4HEPA 2AZ0A 4FQLL 1OT2A 3EXAA 2VR6A 5TF0A 4EDWH 4M61B 2EDKA 1RZKL 1US6A 4NP4H 4TQEH 3EHBB 4NBZB 4XB8A 4GAFB 4UDTB 1NIEA 4LNRA 3RY6C 4MTOA 1AFVH 3O81A 4HSCX 4HCGA 4ADGA 3NPZB 2MKWA 4KI1A 1IKOP 2V5SA 5LHHA 1K3IA 5GGTA 1TTCA 1OP4A 2JJ1G 3RYIA 1OV8A 1IKNC 4S1RH 5I75B 5H37H 3ZL1A 2FK9A 4W9DC 3D7PA 3EH2A 4ZO7A 3VD5A 3RURA 1HYSC 1XSJA 1MFUA 3IJHB 5SWQB 2ARHA 5BO1L 4W1TA 5A9GA 3OXSA 3GMOA 5CJ8A 4L4VE 4A6YA 3IU3A 4O2EA 3NAAL 1Q6HA 2HJFA 2VLLB 3PGFL 4OD1H 1TG8A 5JLZA 3CMAV 2GJRA 3ILQD 1O6TA 3T0EB 3FCUB 4XRCB 2V2TA 1MFMA 3L3JA 1WISA 1MRFH 3TEWA 4AENA 5EIBC 3AU0A 5LGUA 5E00A 3FB5C 4OZGB 5HPMA 1THZA 4MB5A 1DQLH 1TQBC 2ZF8A 3DJSA 2CBQA 4R6ZA 4FK5C 3CHOA 4IGBA 2JCCE 3EGXB 2CSPA 3AT0A 1WBYA 1QLNA 4NZRL 2XAJA 3SDCD 1ZLDA 4YY3O 3AJ7A 3S9DB 3MFGB 2FO8A 2G3XA 3IEAA 4XBGB 1A25A 3MRDB 5DZNA 4GG6B 4JI0B 1J05A 2OPCA 1UVQB 4FP8L 1SESA 4KOCA 2DJSA 1VFMA 1ZLVH 5M95B 3NCBB 2VLJB 1GYAA 1OZTG 4KJQC 4A7GA 1CLZH 1TENA 1IBMB 3OWRA 3U7YL 1LE5A 2R27A 3CVBA 2DQEL 4XCNB 4Z1PA 3HZMA 5F1NA 5DHVH 5CBAA 3VU1A 1JPFA 2I9LA 3VH8G 1A02N 1TJIL 4XP9H 4XX1E 3DPBA 4FC3E 1AG0A 1KTJA 2HMID 4Z1VA 2AKRB 1JPSH 4PQXA 3GB7A 5IB2B 1QUNA 2ADPA 4I3GA 5D7KD 1LP9E 3V79C 1I1CA 4K5PA 5E6IB 4R6UA 3Q8EA 4XCEA 2NNXA 3DBXB 2AHIA 1ZHNA 2X09A 3AB0C 3BVOA 4PW3A 3SJVB 2AXFA 3MLVL 5KN5A 1HESA 1IVLA 4AEEA 3ZE0F 1D2PA 5B3JE 4LRNL 1GS8A 3TCLB 4RGMC 5MEPB 3LZPA 3RWIB 2VZ1A 2XN0A 4UV7H 1E9OA 1LWJA 4WW2A 1DBJL 4XNQB 4OF0A 5AVQB 4TKWA 3SKJL 3GXTA 2GW5A 1FV1B 4ZOLB 2P06A 4U7OA 3NCCB 4GXUN 4P48A 2XTJC 2LGWA 2WLKA 1ZPLA 4OM0H 3TEZA 1NCCH 3R18A 1UZ6E 5D7JB 5JIDA 1U9KA 4EI0A 4OPHA 2FX9L 3GF8A 3L3DA 4GMSL 2XV3A 4P5TC 4L0ZA 5D1XC 4FXGB 2OBGA 3NPSB 2ADIB 3LH2H 3F7VC 3GBML 3JTSB 5I8CB 4O4IB 3IXTA 1IZJA 4M1GH 2OL3A 2FGWH 3OF6A 1K9TA 4HX1B 1I3GL 3FQUB 3HPLA 4F7EA 3TFKC 1KXTB 4FYTA 1UADC 3HEIB 4MB4A 1SY6A 2ESVE 2PPFA 2BVOA 4DAGH 3NFPA 3QJHA 4JFVA 1KCRL 4QF1A 1N6QL 1SXNA 4P2OB 3FRPG 3BQUD 3H2QA 1QR8A 1IKFL 3RVVD 3CFEA 3EOAB 3EBHA 3QIWA 4GQQA 2VXQL 1HILA 1E79G 3L2MA 2DYRC 3X1NA 1A7PL 4MMZB 3P30A 2C9AA 1J88A 3K5OA 2Y24A 2G75A 4OIIH 5A6LA 2E76C 4ZX6A 5JIKA 4CBZA 1XQ8A 1GZQB 2FHCA 4XPAH 2OIGA 1DBBL 2XXMB 4M03A 2W6JG 4O4JB 4HJTA 4CU7A 4BIUA 1CVRA 4CW1B 1F3DJ 5DWPA 1S9XA 5AG8A 1N4XH 1NUGA 2BOBA 5D70H 4R5TA 1TAEA 4EUPH 3LEXB 4UF7C 4ZFZA 4N0UA 5C07D 2WVVA 1W8EA 5CKAA 5J6GA 1KEGH 5FKAA 3T2LA 4BWWA 2N0MA 5HGAA 1A1NA 4ZFOB 3ZL4H 1NFKA 3DOHA 2DQDH 3QDGE 3S34H 3FCTB 4YPGA 2QM4A 1FFXA 4UQ2A 1RK1B 2AW9A 4ABWA 2MEJB 3K0WA 4L4TB 2YIHA 1Y74B 4AIZA 1BM7A 5EUKA 1R5IA 1XNRO 4EIUA 2MOQA 1D5XB 3LPFA 2AK4E 2W38A 1Q0YL 2C9SA 5D6DC 5BZWA 1IGIL 3D0VB 4QXWA 3BXNB 1OGTB 4LT7A 4S11A 1K85A 3T65A 3GZPA 3VD3A 5BY1A 4H20H 4JG1H 3MBWA 5KVEE 2DDQH 4M62L 5D7IF 2J1KA 4OD2B 4UM9D 1V54B 1WF5A 2HTLC 4N1HB 4CNIA 3GBNL 2I5YH 2CAZC 5B4MC 4P9HC 4GKSB 1HHIB 5HHNA 1AGDA 3RA7L 3L4VA 3TT3H 3SZ6A 4DWHA 3BLPX 1UA6L 3QDAA 4FTVD 3RTQA 5JQGB 1I1FA 2UX6A 2R0ZH 1O7VA 2VM3A 4ZI7A 3BDYL 4D8PA 5EU5A 1Q9KB 1MPAL 1M7UA 3K6IA 4MNHA 1DVTA 3QWOB 2FVNA 5D5QA 1G87A 1BG1A 1CIUA 2W0FA 3PL6A 3TPUA 1MCQA 3TA3A 4YJZL 1QW8A 3WLWD 3KDMA 4MAUL 3UBXI 1UYWH 4P4KC 1T0MA 4KRPD 4AI8A 1OGPA 3WMSA 3UTOA 2DWEB 4P5MB 3PJNA 4L9LC 2SODB 3HE7C 1YUHB 4N86A 4JFDE 2FATH 2K6WA 3P9MB 1TVKB 1UD3A 3FB7A 1KIRA 3L8QA 5D1QC 5AAMC 4ZFFB 2A83A 2FH6A 4PCSA 4UQCA 3H1KH 2XKSA 2R69A 3S35L 4PJXE 3W7WA 2ZXDA 4L2LA 5G55A 3LZLA 4OV5B 1EH9A 1KBWA 4ODHH 4KZDH 3WTVA 4HJSA 5MEQB 1P9MA 4FLSA 2P5WE 3PGCA 3Q3GA 2HP4A 5LGYA 1O6SA 2ED7A 2K7QA 1NCWL 4LEBA 4X6BB 2WZPA 3D0AA 1TJHL 3QNEA 1Z9LA 1X59A 4KO6A 1XX9C 4HIIA 4QUOA 4UVAA 4XMZA 1WD9A 2P5ED 3KH3A 1J9CT 3NCEB 1A8JH 1RUKL 5BVJA 4UWQB 5HJDA 1TTBA 3BP7A 1BXXA 4LBEB 4DGVL 2BCKA 5KVFE 3TYFA 4PJCA 4ODWB 4XTRC 4JGNA 3Q4HB 3H3PL 2Q76B 3QZLA 2EEAA 2HJDA 5CSGA 4LSSL 3RBGA 1H3PH 4LAQH 1XBDA 5E1IA 3DK0A 1EDYA 3CN1A 4FLHA 3GI9H 2YQ2A 3HE6B 4GLRH 4Y0GA 1J5OH 1TJXA 1OCOB 3HRZB 3L9BA 3VWKC 1ODAA 4C57C 5D9SA 1FJGO 3NSCA 4XCFH 3TBVA 2CBPA 1IEBA 4W4KA 1MFDH 2A9CA 2VMJA 3P3TA 3P4NA 4OIFA 4XNMA 1KGYE 4TSCL 3X11B 3WKQA 3KPLB 5LGTA 5FUOH 3GSNA 4G9FE 1GJIA 3E8HA 2P7TB 5F0LB 5ITBH 1UZ8A 5EN3A 4XPTH 4AUYA 2ZKHL 1IGTA 4TSBL 1DVYA 1T0NA 4UTCA 1VADB 4AOFA 4YR6A 1N9PA 5TE6L 5F88A 5E1GA 4MJIE 2EUWA 4B7LA 1AD0B 1N5YH 2YBRA 4MMXB 4I55B 4MD0A 1HXYA 1KIPA 3QUMA 3LVEA 3UJIH 2NZ1A 3RW0A 2BLFA 2VITB 1CVSC 1A6UH 1DBKL 1MZZA 2W9EH 4ZPVB 5EZLA 5LBVA 5A2CA 2E75C 1QLFB 4UAHA 3KPOB 3PUUA 3ARGB 4F15C 4QOKB 4TQ8A 1TCRA 2Z31D 4Y9BA 1GN6A 2W9DL 5SWSD 4NR1A 1YIJV 1OGAB 5KSBE 5E2WH 5FKPA 4YHHO 1SFHA 4A39A 4OCRH 2BS8A 4M48L 3IDGA 4OI8A 1KIQB 4BA8A 3T6VA 5C0CA 3GSRB 2UWEE 1JD9A 4Y19A 1SM3H 4KV5F 3QWRD 4Y2OA 4HUCA 4JB9H 3FCSB 4ZAKD 1C8QA 4QRUB 3EJZC 4QXTA 1S5JA 1TZIA 5KS9A 1EEUA 3T4AC 1RCYA 2GSGA 1SUJA 4TL5A 1AZUA 1XEDA 1JWMB 5C0ND 2AZ2A 5IIEB 4OJDH 1D5MB 2LLLA 3JVGC 1M7IA 3L9EA 4B0MB 1TOXA 2VZUA 3CQPA 2UV3A 4H5SB 5SX4I 3US1A 4PR5B 4DV3B 1Z0NA 3BI9X 3K2MC 3FFCD 2DQHL 4N2HA 2JGDA 1JR9A 1FS0G 1OK8A 3LN9A 1CGVA 1XTLA 4QYOA 3QFJD 4GW4A 3W0WA 2Z65C 1SGKA 1MZFA 1QEWA 2JB6B 3GSOB 1AP2A 3PDOB 1MG2C 1MLBB 4PD4K 2CNZA 4PG9B 3I9GH 4PCYA 2B2XL 2CRIA 2Y6SD 1VCBC 3I02B 1AR5A 4XAWL 1JJUA 3HG0A 4WFED 4OCYH 4NEHB 3NJIA 1DVZA 4MX7B 4LF8B 4JTCB 4Z7OF 1AI5A 1QFWM 4A37A 1M05A 2LFSA 3PPEA 1D7FA 3DXAD 2NY3D 4CZZA 1ITBB 3IGAC 1PAZA 3CFBB 4IQHA 5CGYD 4AE1A 5HY9A 5I0ZA 2RB8A 4I9WD 5EU4A 1ZHKA 2Z3YA 5CSZB 3LKNB 3RDTA 2ZSVB 3REWB 4A7UA 2IWEA 5L2KA 3O0RH 3W9DB 4ODTH 2UUCO 4Q0XH 2NTFB 3ABMC 3ZTNL 3NIDF 2FMLA 4LARH 3N42B 2O5YH 3TIEA 3WFHA 1N5AA 2X4TA 5AVZB 1MQKL 2CD0A 5GGUB 5HDQL 1WTLA 1SEQH 4OGAD 2EH8H 2WKOF 5DURB 3T3PE 5E8PB 4DW2L 1CGXA 4OLYL 1EGJH 1A7QH 3NABL 2OCCB 2DQUH 5D55A 1WAEA 1J87A 1JDAA 1RZGB 1AI6A 3FKUS 4W9LC 5ISZE 1EHKB 2VUKA 1FGNL 5EEVA 5HI3D 1JGVH 1EMTL 5KYXA 4W4OA 1G6RB 2MCG1 2RJZA 4E9SA 4ONHB 5D7LB 2V4DA 2D7OA 2EDTA 5I6NA 1QSEB 2ITDC 4GUCA 4YOKA 3ZYOA 1ZVHA 3E2HB 1QFWL 5HFMA 1QNIA 2BOCB 4H1LG 4KDVA 5DVLA 3SDXA 3SKOA 3G5XA 5ICZA 1U8JA 5DVPA 4A2LA 1AI1L 3WYRA 3FFOA 3DUHA 5IYZA 2UXGA 1AD9B 2C5DC 1CO1A 2DM7A 4Z3EA 1K5WA 2CQVA 4Y4FA 1KY7A 1GGCL 1NCJA 3O2DL 4GRWF 2WXMA 1ROWA 4HWNA 1ICTA 4Y5XB 4E9XA 4XC3H 1JNLL 2R0KH 3CVHH 1CLCA 1I1RA 4WGVB 2ETNA 3IJ8A 3E83A 1L9PA 3FHEA 4N0CC 2X4RB 1HWGB 1K6QL 5T3ZH 2XVLA 2A74A 4A2MA 2YKKA 2Y48A 4WDIA 2NNAB 4DTGL 4HP5A 4CVUA 2X4NA 2OJ1A 2FHBA 1SEBA 4MS8D 2CPUA 3ES6A 1TO4A 1WT5A 3B2VL 4IM8A 1QFWI 1SVZA 3H9ZA 3FU0A 2E9JA 3B34A 2H6PA 2PYFB 4QDGA 1SMOA 1JZIA 1OSZB 5ABZA 1KBGL 4I18A 5IREA 1AKJD 2IFGA 2WZAA 3CSBA 3LIZH 3P32A 4IRSD 3E22B 2CUHA 1C16B 4DCQA 2ZTBA 4RWYH 2CO3A 4PSPA 5GXBB 1X44A 4C47A 3A0HZ 3K9AA 1ZS8B 1NH2D 3P0VH 5I15H 2NY0D 2NXZC 4MA1C 3EO1B 3BH8A 5CLYA 1JFQH 3KPNB 5BJTA 3QG7H 5KVGH 4EFEA 5TK2A 4AYMC 4YDJB 2Z8SA 1IC7H 1KTDB 1A8ZA 4AYFA 3US0A 2RQ6A 4OF7A 1RK0B 4LEOB 1FHNA 5D5MF 5HDLA 1I9IL 5ESVA 5HJ3A 2J1ZA 5EHFA 1Z3GL 2AEQH 2JI2A 1QQDA 4N26A 1YMHB 3WSQL 3BFRA 4PREB 5EYPB 2ICWI 3BO8B 3KPPB 4APXB 3FU5A 2OJEB 3K2KA 3O4OC 3L7EB 1BZEA 1XWVA 4OKDA 4XOCA 4X2UA 1IB5A 1XMEB 1IM9D 1VF6C 2A7BA 3RG1C 2J6WA 5KSVA 4OCXL 4XBPB 3VRLF 1LD9B 2ODHA 5DJXB 2UUAO 2CKBH 5GSVB 3GS0A 4TUOB 2C4FT 3WN5C 3VFRB 2Q3XA 1QR9A 1FVEA 4N25A 1D3CA 1JA8A 4F7CB 1RY7B 4DVBB 2NX5B 1E9QA 4PVNA 3P3NA 1NDGB 2P8PB 3DJTA 4CS4A 4NQQA 1GSMA 1D9KB 2IH9A 4MNQD 2ZT9C 3G6AB 3C90A 4NRYA 4ZX4A 4ZOEA 2ARJB 4I0PC 5INDB 4FQJL 3TV3H 3FO2A 2ZOTA 2FGZA 4PJBA 4MZIA 3VSTA 1S8DA 3BVNA 2OV0A 1HE7A 5IF0A 3O3AA 4S1DC 3I75B 4WK2B 2ZD9A 1MHEA 2NN4A 4BQ6A 2IXQB 4F57H 2HVKC 1VQMV 1KFAL 1NMBH 1G9ML 3DURA 4I1NB 1NGWB 5FGCB 2XWJB 4Z5RB 1L7TL 5BS0D 1FYHB 3KPSA 3NBNA 1CWVA 4GKZA 3P9LB 4Q52A 2C1OB 3U7WH 1KBHA 2JJTC 5MENB 3OR6C 2V5YA 1IDSA 4M29A 3IN0A 5C2BH 4M6NL 4NC0B 4DK0A 1VACA 3HCVA 5FA4B 4Y5YA 5HTSA 5E08L 4HUKB 1A7RH 5E1AB 1DYZA 1OM3L 3CDGA 4NJ9L 2GFBB 1YECH 5HGGS 3W1ZA 3O9WD 3FUMA 4PB0H 2Z9TA 4O4YL 1QRND 3DWTA 3KJ6H 5G2NA 5J9PB 5CJBA 1JERA 3FXIC 1CF8L 4O02B 1YEEL 5LGJA 1M3IA 5IG7B 1TYEB 3DXRB 3CXDL 2WN2A 4TV8A 5HYJB 5AWNH 4C56B 1J18A 5BPPA 4Y4KB 4R90L 3MRPB 4Z0BH 4WU5A 4Z7UB 3RAJL 4FQ1L 4Z7WA 4EEEA 5TH2A 4UTAA 3LQZB 5IFAH 1CICC 2OJZH 4NNPH 4R7NB 1IGML 5GONA 3BSGA 2H1LM 4IBYA 5TQ2L 3ABLB 3I6SA 3KL0A 4TUJB 2BY1A 3H4FA 1YPZA 1QNZL 1SOQA 2FNWA 3VFSB 5FO8A 3IMVA 2BNUB 1NMAL 1P7QD 4MNGB 3S48A 1XMWA 1AGBA 1PBYA 1S78D 3IDYB 1MDAA 2VXTL 4FA8A 1MHPH 4R8CA 1KP2A 3CN3A 4TUKL 4FHBD 1SMAA 1G1CA 4R3SB 3VFTA 1F86A 3PWPB 3PWLB 3SE4C 5BRZB 3MRMA 2RCSH 5IR1B 2NY5H 4YQXH 1JWSB 5D7KE 3M88A 4IYHA 3DMMB 3L5XL 3FQ1A 1NICA 3DSFL 3BISA 5AZ2L 2VW4A 1TKWA 4M7ZC 3P4MB 2MSPA 3X1FA 5HHOD 1G7LB 2E9GA 4XB3A 3RWJA 1QBML 2KL6A 3BIAX 1PP9H 1Q5OA 1ZA3B 3E1ZA 1IGJB 1S7UA 1N8RW 2Z6FA 1OOAA 1XNRB 1FL5A 3C6LB 2N59A 4IMKC 1Q6IA 4I9XA 1NTMH 4PJEE 3DROA 5KJ7E 4R96B 5CILH 4MVRA 2BNRD 3QJQB 5C08A 2YWZA 2P90A 2XT9A 1Q72L 3FFQA 2JJWA 1NAKH 4Z78B 3Q8BA 4KKCC 3FULA 2Y2TA 1ZY9A 1RU9H 1XMQO 1QD0A 1DHKA 2N7AA 4F7TB 2IDFA 3SKNB 4N0YL 1ACXA 3M7MX 4ONFL 1GTOA 5LOVA 3ZDYE 4CRPA 3MC0A 2PW2A 2K7PA 5C09D 4G1EB 1FAFA 1RZ7H 4EN2A 3JWNG 5KVEL 1B2WL 2AZAA 1S9YA 4DO5A 3BMVA 4APQC 3S5LG 4BZ2A 3RN4A 5EC1C 4U4BA 1R33A 3CX5J 3HFML 4LH7A 4LSUL 5JHDA 4TQHA 4F8PA 3KGSA 3ZHNA 1ZSDA 1WJZA 5HGBA 2QVMA 4NQCB 4RVBA 5C0BD 2LGQA 4O58H 4W6XB 2IH3B 5I5JA 3D25A 3ECVA 3V8CA 3CVDA 1SQGA 3E38A 1JYWA 3I6KA 1INQB 1RSFA 5HSFA 1PX8A 3ULUD 1J1PH 1GYUA 2ZX7A 3MX0A 3QISA 2OTLV 2BP8B 3PF2A 2XQYA 1AS7A 3QORA 2WWWA 2Y07H 1FXKA 4D9RD 1FYTD 2AV7A 3UTSA 1JV5A 1PW3A 1QO3B 2K78A 5HHQA 1NLBL 4HQQH 4WJKB 3KD4A 3VXQA 4ZPTB 2RFXB 3TONA 4DW1A 5L4IA 3DX6B 1FORL 1JD7A 3OAWA 5AW4B 1BZOA 4U0RB 2YAFA 2O5XL 3ZTCC 5CA3A 3FO9A 4FFYA 5DMJB 1XO8A 4N8PA 1J0JA 2VAJA 4KGJA 1HW7A 2AEOA 3ZO0A 1HOCA 2WCPA 5C07E 5TDOA 3CZJA 2XQYK 5GPRA 3DX1A 4YDNA 1U8CB 3LS5H 1QFUL 3E80A 3GTNA 3T0AA 4AGOA 2K1EA 2AGJH 1V5JA 4GAJH 3QNYB 4LKXB 4LSVH 5HGDB 5B7MA 1OWWA 4QR7A 3TJEH 5JPMA 3MO1B 4JQIL 4X4YB 3NCYP 3S8FB 3N40P 5TF1H 3O3BA 1OWRM 5SWZA 1YEIH 3FU7B 3FPXA 5AL0A 2X6BA 4W9IC 3CCEV 4V2BA 5KVFL 2VXVH 3SYOA 3N06B 2WAMA 1HEZB 2VXUL 3GSUA 2AK1L 2NXYC 3JATB 3U4EB 4YXWG 1FJGB 1H8OA 4NZTH 4HDIB 4P5RA 3ZDZE 4F2ME 3SPGA 1DANU 1HH6B 1P7KA 2PYEB 4MJ2A 3OJDB 2KZ1B 3U6XS 1ULVA 4ZS6C 1CZ8L 1ZWIA 4EVNA 4KJWD 5E6YA 43CAB 4MS6A 3X1GA 2VOTA 1W0KG 1TUPA 1VQKV 3WTXA 4DEWA 2QQLL 1OSEA 1Q38A 3HR5A 3D48R 4F93B 1TR7A 1KTBA 4E0RB 2CO6A 3IJ9A 4N8CL 1ZVSB 1WCBB 3WXWL 4EZKA 3MRRB 4FTVE 1FE8H 1ZAUA 1IRAY 2WSKA 2WYZA 3OTFA 4EDWL 3Q06A 1QHTA 4GBXD 4KOBA 5DHMC 4LLUA 5H37A 5T1KD 1YEHH 4BJLA 3BSZH 4WNSA 2QVIA 1S7XA 3AK2A 3IMWA 3FQ4A 3AT9A 2YPLD 5ICXA 4BCYA 4YHHB 4JY5H 1S7RB 3C60A 3CCSV 1EAOA 3UAAA 1IUZA 1LO4L 1PY0A 3ZZSA 1A3LL 3MBXH 1ORQC 4YSCA 3A6CL 2KG7B 2JCCF 2OMNA 3E6FB 4DV6O 2F53B 3TNMB 4DJMA 4EO5A 5I6LA 3LZFH 1PL3A 5FDYA 4KK8D 3T6WA 4P5KB 2Q10A 3DIDA 4KZEH 5F7KC 4QXGL 2H32H 5FXCH 5BZDB 2HRPH 2QEJA 2X2IA 5KBKA 3C5XA 5DU7A 1D5BB 1KCLA 4QNPE 4PV1C 3C2SA 3HS0A 1NDMB 4HGWB 4RMRA 3ETBF 4WFBV 2FECI 2MPAH 1U8LB 2VQTA 3MBEA 3JTBA 3NZHL 2OWOA 4UOW1 5IT9N 4OGQC 3BP4B 4LOUD 2P5EE 4QAMB 2OTPA 3G6JE 3HS8A 4CS3A 3GIZL 5FX3A 2BNQD 1AP5A 4ENED 4NQDB 5F9DC 5IEKA 3JAWB 2LV4A 2DD8L 5D2LE 1UXWB 1FH5L 1T20B 2DYSB 2IANB 3IT8D 4X9BA 4PUBL 2UXDO 2QLVB 3G04A 1CT8A 2FZ3B 4YO0A 5E2TL 2H3NB 4DEPB 4CVZA 3QUXB 4RO2A 1KGIA 1PKQB 2BERA 3HUJA 3TN0A 1LP9F 4NC1E 2WQAA 2PWDA 3B2MA 2H26B 1SPDA 4K3GA 1CD8A 4IEFB 5CSBA 4TUYB 2VDNB 4R5VA 3WD5L 1LO5B 2WYHA 2YXLA 3O8XA 4E5XG 2BSRB 5GJTH 3ZHQA 3BWUF 3E6HA 3C5ZB 3PABA 1ZLVK 1D5RA 4QRPD 2R56H 4NKOB 1YCIA 3HN5A 3M1BB 4ZUWA 3VQMA 3VVVA 4LK4A 4IRJD 4UUJB 1RVFH 2DQGL 1L4IA 1ASPA 1KXVA 1BLNA 3WNMA 1HNZO 2H0JA 4FKKA 4KROC 5A2AA 5CLWA 3F62A 2GUZB 2PI5A 2DBLL 4CAGA 3N43B 3SO3C 3QEHB 1M5IA 1HZKA 3DSQA 1B0RB 1UURA 1UZ6F 3QIBC 3G5VB 1XGUA 2PNDA 2ZXWB 3I55V 4JFFB 4PJDB 1H8LA 4S1QH 2Y5TA 4I50B 4DPCX 5HDRA 5K1NA 4Y16B 2YUWA 4MJ6A 4OR1A 3FQRA 3TC9A 2VM4A 3HG1A 5HVHC 3HMXL 4MKTA 5SWSE 2NCMA 3NOIA 5KYYB 4MRCA 2HVJB 3GMQB 5CFHA 4PDRA 4XOAA 3OKLA 2A06H 5BW7C 4YNYA 1D2DA 4JZNA 3OT7A 1J8RA 4RQQB 3S3WA 1H6TA 3LEYH 1CD1B 5BOPA 1OCZB 1UKQA 4LVEA 1EJOH 4F27A 2V9TA 4MXQC 2IGFH 4FLYA 4PY7A 2K6ZA 3NK4A 1A1MB 4L87A 4MAYD 1ZOXA 3FOLB 5J13B 3Q5YA 3V55A 1UM5L 5E94A 2VDQL 4L2YA 4JR9H 1PDKB 1WWWX 4JYBA 4GSDH 2HKFH 4PP1C 3QR1A 3ZYJA 3C8KB 3FFCE 1TEFA 2JTYA 2QGDA 3UAJD 5DMYA 3HG5A 1S9KC 1DQML 2NNUA 3EUDA 3QJFB 5L9DH 3QFJE 3QXAB 1KWKA 1QAWA 2WBJB 3MA7A 4L3EA 4TVUA 1SZNA 3K6SB 4GQPH 5JDSB 1U97A 3X2QC 1K8AW 1WBZA 4WUUD 1EJ8A 4JM2A 1MQ8A 2BIIA 2JJ2G 3K74B 4WFEE 3RWHB 3UM7A 4Y9EA 4EUPA 1RHFA 2XG5B 2VDOH 1Z5LA 3HPJB 3B3IB 4ES8A 4JO1H 4D0CA 5AW8B 1WA2X 3DXAE 5E8DL 5LP6C 1MG3C 3D4CA 5ELIA 2CHXA 1NBVL 1DTUA 3NQIA 1NAMB 3EYQD 4HS6A 2K4AA 3RWEA 2E9IA 3MA9L 3QUZA 3P2TA 3N2GA 4TLSA 3ARDA 1WFIA 3WFBH 1ZIBA 1XIWB 3POCA 4Z0XA 1QSFD 1T1ZA 1MUJB 2KLRA 4AGNA 1I0HA 4G7VL 5C8YB 2EILB 5KZCD 5T33H 3E7JA 1BF2A 4X7TA 3LKPA 2L7QA 3AITA 3OZ9H 5I1CL 3AXLA 4U3FH 4P8QA 4KK9D 3EFDL 5D71L 1LK2A 4XO4A 5ILTH 3FL7A 5FCUH 4TSAL 4HWZB 4BKLB 4MTGA 1NANI 2G0KA 1AQMA 1T5WB 4B3VA 5KG9B 3PXJA 5D2NA 5FYJD 3D6GA 4BZ1L 5EO9A 2DYPB 3DGEA 2B5IC 2UUAB 4OQTH 5DECA 2AJXL 3MNWA 3ZTJH 4GUOA 3SDDC 2TSBA 3BOVA 2WTRB 1NGYA 3IDNA 1IILE 3FDWA 4I4WA 3G3LA 3FQYA 2YI9A 25C8H 1C5DA 1N59A 3HAEA 1E50A 3R0MA 4IHOA 1XB8A 5FWQA 4P2AA 2Q6AA 3VXRB 4FFVC 3ZCCA 4M43L 1G7HB 4MCYA 4UMGA 3IDXL 3TNNB 2BX5A 1S3JA 5AVYB 4F8NA 3H55A 5JVDA 1W0VA 2VB5A 1WP6A 32C2A 4M7LL 5JORB 4PVMA 5KUMA 1ERNA 2JIXB 3NCWA 4NJAH 3L08A 4N3TA 2DKSA 3DX9B 5AQ0A 3JD0A 2VW7A 4PJXF 4P2YA 1PVHA 4PJ6A 2IC2A 4PLKD 2XJLA 3RVWD 3MTXA 1G6UA 5DZJA 3US9A 1DVQA 1SXZA 3MOBL 2XIBA 3ARFD 4GO8A 1CFTA 5K1XA 1FFNB 1GYCA 2A9BA 1FLRL 4LDCA 3ROLB 1VF5C 2CTPA 2E4FA 3ISRA 2VRKA 2MMXA 3K6OA 4M5SA 4JN2A 2DPKA 2IPTH 3DPDA 4G2KA 4OVVA 5D6CA 3BUDA 3LPGA 2VXSH 2WBWB 4F2FA 4NRXB 2GDSA 4Y5VB 2CPCA 3WXVL 1WV7T 1RIVL 3EO0A 2NZ9D 3GUFA 1BVNT 4W9FC 5DYOB 4DKFL 4B50A 1KXQA 1AR1D 2AQNA 4A67A 2Q7NA 4TOYL 2FR4B 2CTQA 3V5KB 4P9HH 5DFVC 1BMWA 3MXVL 5AVUB 4I0XA 1V8HA 2EXWC 4X5XB 3QRLA 4KX7A 2OKMA 2B3RA 3KXFD 5I5MA 1T1XA 3QQ9C 3FQXB 5B1JC 2DEXX 5EU6B 2ESVB 5E2UL 2Y1YA 2X9YA 3QUYA 4I2XE 3MRGB 2CCLA 3IFNL 4WU7A 3KL5A 2GK2A 4MJ5B 5GISH 1SOXA 3MJ9L 4FQQB 3VO0A 1D5IH 2XAFA 5A2QN 3VQXA 5C8JB 3EFOA 1KMGA 3L4ZA 1ED3B 4QXVA 5CBEA 5ABDE 4GG6A 2WLIA 3CCUV 4XZ4A 1NBCA 3JSSA 5J2TA 3DETC 3FN0L 4C58B 3MCKB 4MW8A 4MNQE 1MW0A 5KSBF 1ZA6A 2Z7ZA 1TQCB 1WZAA 3Q44A 4I5BA 1WS8A 2H6OA 2OFQA 4L1SA 2UWEF 4Z2WA 5IVOA 1MJJB 4HUVA 5EEWA 3SY6A 4X7SL 4U1NB 4OFDA 1CTMA 3GZQA 4U49A 2LFGA 7FABL 4Z95L 5HHPB 2W94A 4X20B 4JZGA 1RZKC 3SB3A 2ICWJ 1BVOA 1CN4A 5AAPA 5IQ9A 1T3FA 1U30A 5GRXG 3GMMA 3HMWH 4IT5A 3RGBA 5BS0E 1XMQB 1AQDA 1OSPH 4ETYA 1BBDL 3GMRB 3BVDB 1ROCA 4G43A 3RWCB 1WRFA 1IQDA 3GT6A 2X3BA 4FXLA 2QQNL 4JFZL 1GZHC 1RHHA 3PWNB 3RL1B 4F37K 5E99L 4P57A 3IFPA 4G6KH 3SEPA 4J4PD 2W1NA 3D87B 3T77B 4V33A 5GGVY 3PWJB 2G3MA 4P2ZA 3GSQB 3K6NA 4DKTA 1QRNE 3JTTB 4PWGA 5C3LD 3HVDA 3VYNA 2QADD 4FLQA 1WP7A 3MLXH 4WTZA 3B4SA 4ANXA 1CBVL 2JEUA 4ZDHB 1S7VA 4OTXH 1A5FL 1BQSA 4PRDA 1FKAO 3QEUB 5BZBA 2PXYC 1N6VA 2ZXEB 1T03H 4IKJA 4EN3A 5FFLA 1KGXA 3CPUA 4QXUH 3RYCA 3BD3A 2F08A 2IAMC 1HCVA 2FH8A 1ET8A 2W0PA 3ETBJ 2HG5B 2JMRA 3QRGL 4CUCA 2C9XA 2KI6A 4W9JC 5DJ2B 4UT7H 5DQJA 2C7UA 4P30A 5IT2H 3O11B 3JTSA 1NJ9A 4A7QA 3AREA 3S5ZA 4OI9A 2VC2L 2IOIA 2JLPA 2PP9A 1JVKA 1Q4NX 3DO7B 4EI6A 4NP9A 1I94O 5F0PB 4FJ6A 4G5ZH 3HAEG 4MSWA 4Y8AA 2KMWA 3AAZA 5KJRL 2FSEB 1EEZB 4XI5D 1SQVH 3U83A 3T3PF 4WWPA 3LYRA 2CCVA 5DJDB 3MHSC 2WB7A 5LWYH 3QEQB 5FA3A 2I60L 3IFOA 4U7SA 2A5UA 2GAZB 5LCVL 1AS6A 2EEDA 2PLTA 2HKHL 2XU9A 3KPMA 4XMLH 1SZXA 3V5DA 4OKVB 5J12C 3V0GA 3WNOA 2GIMA 4M5YL 1P2CB 1EGJA 5T1LB 5HHOE 3T1HO 3OKKB 4BDVB 3APNA 1N0LB 2K3TA 4J28A 1Z6JT 1G7PA 3TEUA 3NJKA 1U8NA 3ZRCC 3MLYL 3Q9QA 3BPOB 1SRYA 1ZGLM 3P54A 3CWGA 4F7PA 1FFOA 5I1AB 2F18A 4FNLL 2EIKC 3ULAB 1WPXA 2ITCC 4NERA 2WTOA 2IJIA 2BNRE 4LL9A 4X6CE 4EE2A 5JUEH 4FE9A 4JLRA 5E9AA 1E67A 5GGSY 2NY4B 2ZUUA 4JDVA 5EFIB 3T8VA 5BVPL 2HRHA 1CFSA 2V7QG 1R3LB 5D8JL 2B7DT 3QVAA 1YI2V 1I53A 3BAKA 4ACPA 2BSSB 5KWYC 3GLZA 4PYHA 1QI3A 5C09E 3WEAA 4XNBA 3PN1A 1BQZA 4G7QB 5CXPA 4MCZB 1QABA 4ZFGL 1M7DA 2V9QA 4A2HA 1HJBC 2BMKA 2AV1B 1MVFA 3OFNG 4IOFD 5KSAA 3QI9A 5EBLB 2RHEA 3F7RA 1KLUA 4HIEB 5DJ6B 4CBPA 2D2OA 4BH7A 4KXBA 3ZE1E 1P4IH 3A6BH 3BXNA 3LZNA 5C0BE 3SD5A 4FFZH 3U36A 3H2WA 3DVGA 4L0PB 5I19L 3H42H 3KLAA 1EVUA 1QR1B 4G9FB 1F4XL 1NGZA 3MJ8B 1R3KC 1KJ2B 1SLUA 4F9LA 1DO5A 3CMOH 2R70A 2Z7UA 2PO6C 3ESUF 3SE9H 3ULUE 1GH7A 5GGQL 1A0QL 3BWSA 1YTFD 3LIZA 4J8QA 4D9RE 1JV2A 1X4XA 1FYTE 4WAFA 4JPWL 3DTXB 4LCWD 2WXGA 4PJFA 4DP2X 5IROD 3V7MA 4ZOAA 3W7UA 4IIQA 4PCKA 4HPHA 1FPTH 2EE6A 1OOWA 3JAMN 5HYIA 1G5AA 3O3EB 3DX7B 3ET9F 2CMRH 4DV6B 5FS5A 5DVKA 1DBMH 4XVJH 3ZX1A 8CGTA 2F54D 2BS71 4JHWH 3LXCA 3APDA 5DD0L 2VE6B 2HT3C 2WC7A 3BVWA 3LD8B 3QZBA 5KOVC 1IX2A 1S5HA 3DVFA 3A8TA 4XNUH 4GQ9L 3W5NA 2WLLB 3MAWA 3F7YC 3NR7A 1UOKA 3IETB 3NEXA 4AIXA 4GT1A 3UH8A 1Z9SA 4DR6O 2DLTA 1LILA 2QSCH 1F8TL 1AZRA 2DWEA 4UV8A 1JGEB 1M71B 1RZJL 2KERA 4LHUB 4N2KA 3V6OA 4BYHA 4K3HA 5L2JA 1RURL 4X98B 1FAIL 2F58L 4W9GC 5CMAB 1R3HA 2VM9A 3SCMD 5A3IC 4PBVC 3H01A 4XO5A 4HKXB 4A2DA 1AXSA 4I0KA 3UPRB 3BZEA 2UXDB 1X9RA 4ZTPH 2Q7GA 2P24A 2J8UA 4OCWL 1BOGB 5IMOB 1UB6A 3NDZE 2N74A 2Q6WB 3K72A 4RAVA 3PGDB 1DEEA 2CKBA 3OG4B 3B1UA 3MLTA 4WFHD 5I73B 2G5RA 3PHSA 5F70A 3EG9B 4F3FA 1X4YA 4JO2L 3VRJA 4PV9B 2G9KA 2LU5A 1KC5H 3DVNB 1YDPA 3EZ8A 2ZICA 5FLVA 5FOJA 3Q1SH 2AEPL 3V9CA 4XN2A 3CG8A 2Q7YA 4HPOL 3OW2U 1DLFL 2B08A 4XPGH 5EUOE 4ZHQA 1TF4A 3VXUB 5KVDH 1HNZB 4NX0A 3WJLC 3MV8A 4TUUA 1R73A 1BD2D 1FBIL 3FB6B 4X9GA 4OCSL 1LO0H 2EYRB 5IE9A 3CCQV 2QWRB 4JGSA 3MV9D 1NCIA 5F93C 4A68A 3TZVA 1IE4A 3HKEA 2GBVA 3BEVA 3MPCA 3D50A 3OKOB 4ZMLA 2IV8A 5BNXD 1IIIA 5M94B 4UB0H 4M1CC 1J8KA 4PJAA 5AW3B 1SHSA 4PJHB 3ZMZA 4DP9X 4XMVA 2Q4PA 3WTUA 4FLVA 3SKMB 2E27H 5GHWL 1E6OH 1MCKA 2YPLE 1FL3A 4HT1L 1RJZA 4P05A 1SDDB 3HIZA 1FZKA 4A5UB 3V0JA 1BM3L 1PG7X 4NUPA 1YEFL 3OHXA 2PTUA 2XQ0A 4OSUH 1KIUB 3W11D 2ZSWA 3VXPA 2BSEA 1JXKA 4IBVA 1A6VH 1RUQL 1UWGL 1FRGL 3U0PA 4MB1A 1UD6A 4LRIA 3LS4L 1XI1A 3SYPA 1J8HB 4HD5A 3MNDA 4J5VA 1EAJA 2XNAB 2EVHA 4UFZA 2LTQB 5HHVH 1XZ0A 4PRNA 3QDMB 3CBJB 4CKQA 3SOTA 1F00I 1HNFA 2HJLA 4JFEA 1YY9D 3DECA 1ZDSA 1MCFA 1T4KB 3VSUA 2WINB 4WEBL 2DQFB 4NKMA 1EA9C 2D2CB 3I9PA 1JGDB 3UO8B 2QT6A 2J1WA 4B9JA 1WB7A 4IHJA 1VQPV 1Q94B 4H37A 1WGVA 5IHUL 1F4NA 1BQ5A 2CUMA 3WL9B 3BCDA 1KCBA 4NT6A 1QWUA 3REVB 4LFBO 1HDMB 4F80A 4GAYB 5EA0L 4XHJD 5CCKL 5DJYB 4GKLA 4F9PC 2VDLB 3CN4A 3MLSL 1UH3A 3BCCH 1I3UA 3L3IB 3L9RB 3VUAA 4JUTA 5K9OA 1GMEA 4UVBA 1GN4A 4F5CE 5KBLA 2J4WH 5EK0A 1UJ3C 2CZNA 1M57B 4K0OA 4QRPE 4E41A 3B3BA 3LZRA 1A3ZA 3C75A 3JD4A 5B8CC 1UJWB 3H9SB 1GOHA 4QLWA 5EOTA 4PJEF 1O9HA 1CE1H 1E43A 1M53A 3B09A 1CGWA 5KAQG 2CHDA 4UBDC 4V1DA 4PJ5B 2QKIC 2R9HC 5DA4A 5HYEA 3CLEH 3F84A 1S72V 3FO1B 2N3JA 4FQXC 1V55C 2AQPA 3ZDYF 3NA4A 3O3DB 4QPEA 1U8KA 1U6AL 4ELKB 1MELA 3MGOA 4XX5A 1W72H 1Q9OA 3RYMA 4WWKD 5F71A 3BVTA 2E7DA 3BAYA 4P23D 2MHAB 4LCUC 2VRQA 3WO4C 1PKOA 4P2RB 5B38A 4GRLD 3WLBA 3REWA 3K0DA 1WFJA 3TN0D 2H3OA 4X89A 1EV2E 3B2UC 1VKXB 1OD9A 4KKBD 5ALCH 2BVEA 2CGYA 3GKZA 4GUPB 4KQ4L 1H3GA 2BH0A 3CK0H 2YICA 1IGYA 2WXOA 5F9AC 3OX8B 1WZKA 4H25A 3STZA 2HP8A 3U1SH 1BAFL 2C4XA 4Z7VA 2VQ1A 3D9AH 3IJEA 3DTUB 3OR7C 3OHMB 5DS2A 1RLBA 4KHTL 4PJ8D 4YHLH 2QWNB 5ENWB 1DVFC 2BHZA 3RPIA 2WSSG 4NYKA 3MV7A 4MDRA 4EI5C 4M5ZH 3WU1A 3PG2A 5FW6A 3KCXA 4X1YA 5L8JB 4AILC 2Y7LA 1A2YB 4OZHE 1JHTA 3ZMNA 1KGUA 3PAYA 3NJVA 4XN5A 4JAUA 3ZDXE 3UO1L 2VH5H 1RKRA 1ILUA 4ATTA 2RJMA 2FTAA 1YVLA 2BHYA 1U3HC 1T22A 4UILH 4B3MO 3MRNA 4QWWC 5F0MB 1XL4A 3OAUH 3ZKNC 3FCBA 1B0GA 1ORSB 4FNSA 2D9CA 4HS8L 4HUNB 2VL4A 2Y4TA 4N2DA 4KO9A 5L3GA 4UQIM 4WUUE 1NLDL 2YXMA 5CJQH 1FNSL 3EOTH 1GMIA 1IFHL 2R2EA 4JZOA 3UACA 2EJ1A 2FT8A 5CU9A 1V7NL 3OD4A 4RMSA 1HZHL 2XDHA 4DZBA 2GY5A 4ABUA 1F3DH 3C5SB 4BFIB 4NTWA 3QXUA 2G0LA 3TETA 2BW5A 2DTMH 3UBHA 1PNMA 5DMIL 1YYMH 4DUWA 1PZAA 2HFGH 2O26U 1XEUA 3OPZL 5DR5H 5IJKA 4O2BA 1BVKB 4OLZL 1PEWA 1BAWA 3AUVA 3GRBA 4QT5B 3ZHVA 3BWZA 4AM0A 1X9UA 2F74B 3KDPB 1ZTXE 4FOMA 4CBCA 1OHZA 2ZE5A 1QSFE 1XB3A 1RJLB 3O6FA 3S37H 3HNTH 1ZXKA 3WO3B 3W9EB 1ZS2A 3UP6A 3SDAB 4X4ZA 2DQCL 1QEXA 3FU8A 4UYQA 3STLB 5C6PB 1FNEB 2A6DA 3RIAK 3VFUA 4RAHA 3ZDZF 1OW0C 1ZPUA 4DQAA 2A6JB 1WEJL 4I5SA 2Z8WC 2IAAC 2XFXA 1DVUA 5IBTL 4JY4A 3W0WE 5GZOA 4LSTL 2IDQA 2Q3ZA 4OJCA 4U1MA 4NQEA 1S7QB 4PRAA 3UTTD 1N64H 1XGRA 1AGFB 3RU8L 5FEBA 1VFAB 1ODUA 3Q6FB 4IKNA 5FYJE 2Y23A 4XZUA 5C0AD 4WW1B 2BHUA 3HB3B 4J3SA 3O2WL 3S88H 4ERSL 5EZOH 1JZDC 1T2XA 3HZVB 1JZJA 2NY1B 1RUAL 4WO4C 3SE3A 3TOPA 2CBTA 4ZMVA 3GUTA 3CRMA 2P26A 3VE0B 5F1IB 1FLTX 4MD5A 1OARL 4LGSB 3MRIA 1Q43A 1OCZC 1LQSR 3PLYA 1PIGA 4BRVA 1OE3A 1F45A 1ZSPA 2DWTA 4G3YL 1IGCH 4FMVA 2X42A 4NHUB 1I8MA 2QSAA 3SKUD 3GWOA 3KCYA 3TP4A 2ICEA 3L54A 2GJ6B 3O6KH 3BSZA 3CUPB 2E59A 3GMLA 1YAZA 4WKZB 2PPAA 3WHXA 1M2OA 4DP5X 1EFXD 4NB7A 3N44B 7PAZA 4X9HA 3T6QC 4O2CA 5DZ9A 1H8NA 4CU8A 1OQOA 3GJEB 2ODMA 4B7KA 3S37X 3ARRA 1AHWC 4UT6H 1AYRA 1AGCA 5F3BB 1XMOO 2OXGB 3T4YB 4QNPF 2IADA 2NW2A 4R26H 4KTEH 4N22A 4ELMB 1BVLA 2WXPA 4HUXA 2BRQA 2YJLA 1L9NA 1ZT1A 1AMYA 2H32A 3B83A 4KVCH 3UIYA 5D1ZD 4LVNC 3G6JF 1BMZA 1LE9B 4Z7NF 2CH8A 3KLDA 2WUCL 4R4NC 4Y4HA 1T66D 3QRFM 5D2LF 3WY2A 5C0JB 5E6UB 1SLXA 4R4BA 2M7WA 4U33A 5ABAA 4EB6A 3GIVB 3I84A 5CO1A 3SDYH 4A2EA 2R29H 1R24A 4Y7OC 1NCDL 5CBGA 1R34A 1X5LA 4JHBA 4RESB 4P3WA 3FQNB 2GTZB 2V17H 1XOUA 2YD6A 1CK0H 4XPFH 2AGAA 1TU2A 2Z3FA 3RY6A 4LFAO 4RDQG 3KXFE 1OE1A 2K9FB 4AQ1B 1IBBA 2BFVH 5I9QB 1JNNH 3DVIA 2EDYA 1S6NA 4HIHA 4HUUB 5ANMA 5TD4A 1ZKAA 2Z0AA 4U6HB 4WTWA 1P4LA 1U41A 1IKNA 2EDDA 2WQRA 4HHGA 4WJ5A 1UZGA 1O0VA 5DMKB 1I94B 4HHAA 4LSRL 2V33A 2FEJA 3LXUX 3DRQB 3V4VL 5L4JA 1GMGA 3KZ8A 1U8HA 4KTGA 4XNYH 4XXWC 3EHBD 2R2HA 4AMWA 3GMPA 3EYVB 1JOIA 4HJGA 5LHIA 1RI8A 3T0XA 2BDNL 4KRNA 1J1XH 4XC1H 2DWDB 3SY0A 1TPXB 3MRHA 4QHUA 4BFKA 4O4HA 4PSRA 1UC6A 3FB5A 5KMGB 3JWNE 3T1HB 3MREA 4JL2A 5EO0B 1MFAL 5FO7B 5I28A 2IQ9H 1O7DE 2B59B 4XR8C 3ZHTA 2ZJSL 2A3QA 4QTHB 1G1KA 1ETZA 1RZ8A 3PIQA 4ADIA 1UD8A 3HN8A 4HWEL 2JELH 4PY8I 1PZ3A 1I75A 1ZJBA 2QQQA 2XJKA 3MOAH 2UX7A 2TSAA 4L05A 3BUBA 3T0ED 2LFRA 3EJTA 3TVMC 2AJVH 1I3VA 3ZZLA 4AL8L 4IS6B 3EXLA 1C5CL 1I8IB 3ZU8A 1XDTT 1E27B 1ES0A 4UZUA 3N9GH 3B9KB 1N33O 1OKEA 4NKDA 5B1AC 3F6LA 5CUSL 3SQBB 3UZEC 4BK5C 5DMGC 5J06A 2APVA 1D6VH 3IVKB 2X0LA 3WG7B 3BGFB 2B14A 5E6RB 2LFEA 1DZBA 2CK0L 5JQ6L 1OPGH 4Z7QE 1G9MC 4FXKC 1IM3A 4GX1A 1E5ZA 3SJQC 3TTYA 5IB3B 4KWUA 5CD5C 4PFEA 3TBSB 2Q68A 3H3KA 5CA1A 2X4QA 2P8LA 4G6AD 2HXAA 3EH4B 1YNLL 4XAKD 2QDOA 3KKYA 1F2XK 3FHQA 2B77A 4JPQA 1AP6A 5GZND 3UYRL 3IWVA 4JKPH 2X6AA 1V3LA 2VLJD 4UV4L 4G2AA 3BPNC 1V05A 1MCOH 1ZANL 4JJ5B 1DSFH 3P9WB 2OQJB 4JAMA 1A6TB 5CLXA 2O30A 2F4VO 2OX5A 4WTXA 4OT1L 5J1TC 4NWUL 3V0VA 3G6DL 3ZRXA 2HT2D 2N01B 3EYUH 5GS3A 1KGCD 3ILPA 1CE6B 4GS7B 2WWNA 2YAEA 1LMIA 3ETSA 3TWYA 1IQWL 2XAQA 4TTGA 4I9QA 4RISL 4FMTA 2XKNA 4LWSA 4F8LA 3DHUA 3ULUL 3IGKA 3ZS8C 3LDEA 1FG2A 2R7EB 5HDWA 4MW3A 4FLTA 3V4PH 3BYTA 4F58L 1GW6A 5E6ID 5DJZA 3OLIA 4W81A 1BPLB 4DEUA 2ZWNA 1PV0A 2F8XC 3AU1B 2XX1A 1AZNA 2LVCA 4N2BA 1U21A 1MF2L 3SJVD 1H15A 4C83A 3L3GB 1U8MA 1A6PA 2QMJA 4HETA 5F7DA 4OF6A 4P5TA 1UWEL 4LP8A 4NKGB 1FNGB 1PNDA 2AQ1A 2MKLC 3IRPX 4U2ZA 4UT9L 1MWAH 5D1XA 5LBSH 3T09A 5I8OH 1BIIA 3L3OB 3NA9L 3E8FA 3F7VA 4RGNE 1E28B 3ZRVA 3O2VH 1IBDA 4DR6B 2F5BL 1EJFA 2PCXA 2A3TA 2XHNA 1HNXO 4MBRA 1KYDA 3CC5A 1IAIL 1SOKA 4ZPTA 4DR1O 1IAOB 1LDPL 5D7JD 1BEXA 1XF5B 4L3AA 2EUXA 2JF1A 2EDFA 3H0TA 3RZCB 3TK1A 3VG9B 3V52L 2IBGA 5K9KA 1T21B 2MNUA 1FO0A 1NEPA 3BZ4A 3QZWA 4MXVE 4O5LH 3K0YA 2A0LC 2H0FA 3VG0L 4OQTA 2WY3B 5E8OA 1A9EA 3WUWA 4HBNA 5CMUA 3QJOA 3VAEA 2W81C 1OCWH 5FYKH 3RUGA 2X3CA 5AENA 3CIQA 5KTEH 1IO4C 2ZDIC 5EBMC 1NUDA 3KGTA 4YEFA 5HYSA 4L1BA 3WIIL 2BC4B 3N1GC 3PUCA 4G1MB 2AP2A 2FQGA 2DLEA 3QIUB 1IAII 1OVZA 2D4FA 4P2OD 4JASA 1N36O 4DH2A 2VNCA 5E8EA 4E2OA 5DD6A 5BV7B 1JK9B 1T6BX 4FHJA 3ZHUA 1F7YA 2JK5B 2PPDA 4XMKH 2J57A 4J6RH 1WD8A 2CGOA 1YEJH 4XE0A 1A7BA 5G5DA 5IW6A 1KB9K 3AY2A 4F37F 1VMGA 4TQDA 1VRSA 1F3JB 5CLZA 1Z9MA 1KTCA 4FM0A 1QLEB 1L9OA 1WBXB 1X3DA 1X5HA 2A6IB 2COQA 1T0PB 2F1AA 2QWOB 3B5TA 3ZN6A 3KLHD 2KQXA 1NCNA 4W6WB 5IQNA 4OGZA 2WZ6A 3W7XA 3WY1A 5DRXA 2GVYA 4U6XB 5IFJB 3WY4A 5LGHH 1BIHA 1ZL8A 2ADGB 2ARJQ 1DQQA 3EYOB 5C08E 4LCWE 1OK0A 4XP4L 4MVBC 5D6DA 3D39B 2F19H 3EJUA 1U93A 4H0LC 4H8WL 3S3PA 3IDIA 3ZSSA 3FN3A 2W0KA 5AL8A 4NO3B 4W68A 2F54E 2FHFA 4ZS7H 1CFNB 3QYMA 4OZIA 2CLVA 2EH7H 2PKDA 3E1F1 4L4TD 4RMQA 5I1EH 1RIUH 2B1AH 5HJBA 1WB8A 4OBSA 1SHWA 2CA3A 4QY8A 4KJYA 1Z5WA 3FAVA 4BRJA 1H19A 1HINH 4LF3A 1ACZA 3UZQA 3JASB 1YEGH 3MCG1 3E0GA 3QO1A 4QRAA 3BAEL 3U9UB 4P9ML 5LNEA 1HWWA 4G8GB 3KYNB 1UCTA 3AQZA 3KPRA 2XV0A 5FHBL 4BH8B 4XCCH 3BUYB 4AG4H 2NR6C 1SDYA 5LB1A 2EC9U 2CRZA 4PTTA 4D7BA 4HOWA 1QRKA 1GXEA 1YEWA 1VQNV 1JVOA 4HFWB 4QO1B 5TE7L 4LFBB 3S4SA 4UU9B 1CL7H 3ZX6A 3TIDB 2Y25A 4WFHE 1E4XH 3BEWB 3KLQA 4L8CB 3IMTA 4KMLB 3FZUD 3PY9A 1XCQB 4P4KA 4HZLA 4JFYA 2VDRH 1SUHA 4OGXH 4QYAA 5E5RB 3V7AG 3DA0A 3BP4A 2BSTB 2MQ3A 4L9LA 4CJ0A 3F04A 3HE7A 4R7LA 1GIGH 5E8NA 1FYJA 3HN3A 2HR3A 4X8JA 1N0JA 3CZSA 3VRIB 5D1QA 5AAMA 1JPTH 3ZHDA 1GSKA 3D1MC 5I74B 3C87A 5GTIZ 3L9DA 4P46B 4F8TA 2Q7EA 3C3TA 1BD2E 1B4RA 4ACTA 4ONGH 3J07A 1I8KB 4NI3A 1J5DA 4XOBA 4ZFQA 4OGYL 2ZUQB 3P3UA 1SXCA 2G3NA 1L3WA 1A6AA 3K5RA 2NDGA 3MV9E 4PJIE 4JHVA 3ME0B 3D0LA 5DUBA 4F2EA 3B7SA 4YJ2B 3UYOD 5JNYB 2PPCA 4UT9H 1S3KL 1MI5A 3BIKB 3L6FA 2VT0A 5DWUL 2BRRL 3GJFH 4MXWL 1MNUL 3C5ZA 1L6XA 4X4XA 3NP4A 3D3VA 2YIBA 4YBQC 2DMKA 1T04A 1DE4A 1K4CB 1ID5I 4H33A 4AEIL 3VXTA 5BUPA 1IEAA 1EEQA 5EO1A 2L7EA 2B39A 3VI3A 2OZ4H 3DARA 3N41B 3MUY1 2J88H 1ONQA 5JW5B 1JZ5A 1FN4A 3MQIA 4JGJA 4U6TA 4AX3A 2BP5M 3GHEH 4X6EB 5D5MB