2UUAO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 35
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uuaO00
4DV2O 2F4VO 2UUBO 2Z0AA 2FKXA 4LF6O 4JV5O 5LL6Y 1AILA 1N34O 2UXCO 1NS1A 4B3SO 1X59A 1HNXO 3M8AA 5A2QN 4DV6O 2UUAO 4LFCO 2UXDO 2E5LO 4JI6O 1HNWO 4X66O 3O65A 4K0KO 5BY1A 1R6TA 4LF9O 4A5UB 4X64O 2DJVA 1N36O 4DR6O 5H5NA 4JI0O 4DR5O 1F7YA 2AGAA 4JI8O 4LF5O 1I94O 4B3TO 4B3RO 4OX9O 4DR4O 4KHPO 1IBMO 2UXBO 1FYJA 2VQFO 4LFBO 2HHHO 2ZKOA 1A32A 2UU9O 3J81N 2JRIA 1IBLO 1N32O 3J80N 1XNQO 1HNZO 5BR8O 2LW7A 3SDLA 1XEQA 5LMNO 4DV1O 4DV7O 2ZM6O 2DOSA 4JI3O 3RT3C 1N33O 3J7AU 4GKJO 4DV5O 4AQYO 3F5TA 3OTOO 1KUQA 4DR7O 3JAMN 1D2DA 1IBKO 1FKAO 4JI1O 3T1HO 4DR1O 4NXNO 4DUYO 2N74A 4JI7O 5IT9N 4DV0O 4DV4O 5LMUO 5FLXN 4YY3O 5BXZA 4NXMO 1J5EO 4LF8O 4JI4O 4JI2O 4X62O 1R1BA 5IWAO 1DK1A 4LF4O 4JYAO 1G1XB 4DR3O 4OPHA 1FJGO 1HR0O 4DUZO 4OPAA 4GKKO 4JI5O 4YHHO 2UUCO 4X65O 4DV3O 1XMQO 3R66A 4LF7O 4LFAO 4DR2O 4B3MO 2VQEO 1XNRO 3T1YO 1AB3A 1YZBA 1XMOO
chains in the Genus database with same CATH superfamily
3TCUA 1VQ5V 1AILA 1AI6A 4NXNB 3BY6A 1CPYA 1UJWB 1MZFA 2Q7EA 1BMFG 3AK1A 3LUTB 3DSQA 1YITV 5F2VO 5K1XA 4RAIA 1PKXA 4TQFA 4Q20A 1KD1W 2CGNA 5IYCO 1JOYA 4CBCA 3SJCC 4UUJC 2NNUA 4DV2B 1N32O 1M57B 2YIDA 1YJNV 3EFFK 4NVPA 5JH7A 5FPOA 1KB9F 2WLNA 2A3QA 5DEDA 3AG1C 3CYOA 2QJ1A 4GKJO 5FNVA 4MTFA 5JH7B 3ASNC 2BE3A 3P30A 4FLYA 3ETDA 4GX0A 4ZBMA 1SRYA 4NKGB 1IVSA 4DR4B 1Y67A 1QVGU 5FNVB 1I5XA 1VQ9V 3I5DA 2UXDB 4RWUA 2QWPB 1Q7YW 2Y0IA 4LF8O 3ABTA 4QNHB 4JI4O 2YS8A 2BTQA 2E75B 3ABKC 1VQ7V 4OGQB 5HFLA 4UCOA 3SR2C 2GBOA 2X6CA 4P30A 1QQCA 4U7OA 1XUQA 4DRXA 1JJOA 3N2GA 3H1HH 2CE4A 3WB1A 2BTQB 4O4IA 1NU1H 2GDSA 4LFBB 3HB3B 1H2GA 1AB3A 4ICGA 4DW1A 2UUBO 2Z0AA 1LNQA 4DRXB 2DMXA 1HWYA 4MSWC 4U3JA 5LHIA 1DGSA 1FS0G 1AJQA 2K1EA 4K0KO 1AR1B 2PY5A 4WFGA 3RN4A 2Q6AA 2HKOA 3AK2A 1OV9A 4U3JB 2CTQA 1K34A 3ETEA 4U7NA 2IBZH 4DV3B 2WWWA 2AW9A 3FB7C 5JQGA 4JI7B 4G28B 4EKWA 3OFNG 3K79A 3CHXA 2Y69C 1GMGA 2Q5ZA 3ZEDA 1WP7A 1TAEA 1LUVA 5IWAB 5JQGB 4F6RA 5BR8O 2P90A 3CCUV 4EFEA 1U96A 2OWOA 2CAZC 3GWOA 1PV0A 4R8CA 4MT8A 1Z5WA 4DV5O 1E1QG 1BE3H 2IW5A 1GM8A 4F6RB 3AG3B 1QVFU 4N21A 2OTLV 5JCOC 3SJBC 4I5SA 4BIOA 5BMVA 3T1CA 4DR1O 4FLUA 3G80A 4JYBA 3ZX6A 3CEIA 1L1FA 5B3SC 2W0XA 4J9ZB 3A0RA 4UCVA 2R9AA 2PI4A 5BMVB 3ETQA 4X66B 5EK0A 1NZ6A 4DR3O 4J11A 4GX5A 5GTHZ 1SQXH 4X65O 2OCCB 4PA9A 1SQBH 4B3RB 3G6BA 1IBMB 4B3MO 1YJ9V 4PDRA 5KHGA 5DM6V 1W2BU 1BSMA 1NS1A 1HNXO 3KCYA 1KKCA 2VS0A 1HNWO 3CCVV 1GTOA 4X62B 4K8ZA 1SERA 1K3EA 5KUMA 2EIKB 4JI5B 2Y0PA 5C8YA 5B1BB 4MTGA 2JVDA 4LF7B 2CK3G 3HKBA 2UXBO 1CEZA 3HKCA 3K03A 5LGUA 1VQNV 3K58A 4O4JA 1MSWD 1EM1A 3J81N 2F4VB 5C8YB 4PA6A 4F6EA 5H2FZ 4MVUA 2ZQMA 3HKBB 1F51A 3HKCB 3VBBA 3E22A 1Z2GA 2ZE6A 2DWEC 5LMNO 4O4JB 2CDYA 1VQKV 3WB0A 3BEHA 2ILMA 1ORQC 1URFA 3E22B 1VF6C 3RW0A 2LJ2A 1IBKO 4DUYO 5CBFA 1G6UA 5FLXN 4MW8A 2PZSA 1PNLA 4J7KA 4NXMO 2L6LA 1B3QA 3UCSC 1R73A 1RPRA 2FTKA 4JAUA 3OT7A 1DK1A 3OMIB 1VQ6V 4DR6B 1VF7A 4DUZO 4GKKO 2IH3C 2R72A 4R6ZA 3F7VC 3CCJV 4JZ2A 2EIMB 1Q86W 1Y4MA 1XNRO 4FM1A 3EVKA 4PI2A 1AJNA 1M1KW 2Q7HA 3BVOA 3KZIZ 2CTWA 2PGGA 2P5OA 3ABLB 4I4TA 3AEIA 4TQDA 3ZN0A 1K97A 1ENVA 3ZN1A 1J95A 2MK3A 4WFBV 4X1KA 3ZHRA 3C90A 2NLJC 4I4TB 2WLMA 2YXLA 1F23A 3QO7A 1XREA 3L70H 1H2SB 3UQ8A 2ZR2A 5KLVH 3H1KH 5HFMA 2WAMA 3FYIB 1I94O 4X1KB 3LDCA 3TXQA 3ABUA 4Z1VA 2UXXA 2UU9O 1IBLO 4QE7A 1XNQO 4R50A 1M56C 2ITDC 4JF3A 1NTKH 4CC5A 4UXNA 5JJNB 1L0LH 2GHYA 2XUMA 2GSMB 1KKDA 5JWPA 1GRJA 3SDLA 1VQ4V 1VF5B 2E5LB 1BL8A 2UUCB 1EBOA 1Q5OA 1AROP 3CP1A 1AP6A 4G27B 4QPKA 2JDIG 4CH4A 4JI0B 4DR2B 5L3DA 4MVOA 3ZMTA 5EYPA 2KKWA 3D8CA 4JI8B 3B8NA 2Q73A 2A06H 3K06A 2OT5A 2RQ6A 1US6A 4MVQA 2A7WA 3OD4A 1THZA 4O4HA 3ZHSA 4P9OA 2PI5A 4I0XA 3ML0A 5EYPB 3OGCC 1GH6A 4I50A 5B5EZ 1R1BA 4GYCB 2XAJA 3CX5F 1SETA 1MSDA 2RJZA 1JMKC 4O4HB 3LSSA 1YI2V 2GTAA 1V9PA 4I0XB 4HZ3A 3ABKB 4TOIA 2QM7A 4I50B 1EN4A 4DXWA 3CCSV 3JCUZ 4GT1A 4JASA 4RQFA 1RM1C 2CH7A 2OCCC 4PDVA 1JCHA 3OUFA 3W7WA 5LHHA 2W6JG 4LBEC 4WBNA 5IJ0A 1N36O 2CH7B 1TUEB 4QIWF 1QLEC 4AQYB 3P32A 3CCMV 3SYCA 4B3TO 4J9YB 1XMQB 3K0DA 1MZEA 5LGNA 4AHCA 3HKEB 2ITCC 2EZOA 4WBNB 5LMUB 5IJ0B 4LR3A 3RYHA 2EIKC 2JGDB 2AXTZ 3A0HZ 1G8MA 2KQXA 3M7MX 3OUSA 5FPRA 4B3SB 4JYAB 1XEQA 2AZ0A 1MOFA 1WP8A 1SC5B 1Q6IA 4JI3O 2DN9A 2G38A 3PN1A 1K92A 3CS5A 3CCRV 3JALA 2L35A 3N2KA 4IT5A 2VRZA 1ZX3A 1XMOB 3JAKA 2A0LA 5CBHA 2Q67A 4DV0O 2VQFB 4BW9A 2XOKG 1NVPB 2HHHB 4CC6A 3ZHQA 1S77D 3DTUB 1WJZA 3CCEV 5LOVA 1QHTA 3JALB 3N2KB 1OCZC 3Q4HA 4K8XA 3JAKB 4JI2O 1VEWA 1T5EA 4P9PA 4LP8A 1AR5A 4QGPA 3RYIA 5LOVB 5KMGA 3BPZA 4MVMA 3G67A 3Q4HB 4LFAO 3C3SA 4D7SA 1VMGA 2DQ3A 3CCLV 4Z2WA 4IL6Z 2P67A 1KUQA 1Y66A 1E79G 3GWKC 5H9CA 1FPOA 2YEVA 5LHGA 4DV4B 1S5LZ 3BRCA 1QCEA 4RO2A 2ZDIA 4YY3B 2UUAO 1S72V 1QBZA 1HP8A 4YJ3A 1VARA 4KL1A 3CRAA 1EN6A 2YI9A 4CZZA 3ZMZA 4LF9O 4U3FH 1YF2A 4X64O 4LF4B 5H5NA 2YEVB 4IIJA 2JJ2G 2D2CB 3CJHA 3IC7A 4DR7B 4YJ3B 3UT5A 1S76D 2HVKC 1YHQV 4KHPO 4G2KA 3C3TA 2JIZG 4IIJB 3CJHB 3JD2A 4FLTA 3UT5B 4I9QA 1LUWA 4QE9A 4X88A 3K5LA 1HNZO 4CS4A 5JVDA 1AI7A 1I0HA 2Z5UA 4X8AA 1JQ0A 1N33O 1VF6A 4NB5A 1N8RW 1NH2B 5JVDB 5KA5A 5IYZA 1NJIW 3QO8A 2RDCA 5EC2C 1YXBA 3ZS8C 2ZINA 3OGIB 3K9AA 5EBMC 3TK1A 1R6KA 4DW0A 1NTZH 5B1AB 4FIPC 4FFKA 3LSQA 5IYZB 2OTJV 1PPJH 3RFRA 3QO5A 1NBMG 3JD4A 1Q81W 1QLNA 5EBWC 4GZRB 4QJFB 4ZIBA 2FKXA 2F1MA 2ARHA 3G4SV 2WLKA 4FLXA 1AJPA 3L71H 2UXDO 1I5YA 4MVZA 3DGEA 4R7CA 4LF8B 3O65A 5BY1A 3OAAG 2Y4UA 5LXTA 3AK3A 4JTAB 3OTOB 5LGTA 1XILA 2ZIOA 4YJ2A 3WB2A 4LF5O 3CRCA 2DQ0A 4J42A 5CA1A 1ZLZA 4FM0A 3FX7A 1GN6A 3STZC 3N2GB 4LFBO 5LA6A 2QKAA 4L8JA 2CGOA 1EN5A 4O4IB 4PELA 5LXTB 2ODMA 4FFBA 3CRMA 2UUBB 2YICA 3WG7B 1WNSA 2QR4A 4RQEA 4UV9A 2QTOA 3JARA 1H8HG 5LA6B 1M56B 4YHHB 2P4KA 4FFBB 1I7FA 2IH1C 4K0KB 5D5PA 4NTXA 1R3KC 4J7ZA 1Q82W 3W7SA 3SPJA 3IC9A 5IDJA 3L72H 3JARB 4CH5A 4UVBA 5C93A 3OE7G 4JI7O 5IT9N 3ZBHA 2JS3A 3IJ4A 4IYHA 4LH7A 5CA0A 3CMAV 4TUYA 5IY5C 4WFAV 3ASOC 2H94A 1NVPD 1BGYH 1PNMA 5IWAO 4MS2A 1W59A 2XT9A 1ZAUA 4RUFA 5B1OA 5BR8B 3BHPA 5CA0B 3X2QC 5LP6C 5CA3A 1P7GA 3OR6C 4TUYB 1SQGA 3R66A 1WPXA 4DV5B 1Q6HA 3MD0A 4GCZA 3LNNA 3U0ZA 2QA4V 4LF6O 4XDKA 2FL4A 3QNEA 3VQYA 3ZRSA 4H0LB 4DR1B 4B7EA 4B7KA 5IYBO 1L0NH 1H2NA 3EHBB 1GK9A 1YSCA 1AVMA 1RM1B 2QEXV 3VQXA 4X66O 1AI5A 2EIJB 1U97A 2B1GA 4JAAA 4DR3B 3B2EE 2M7WA 1Y6XA 1ZTEA 1HW7A 4B3RO 5K1PA 3CC4V 1XDCA 4UVAA 1QLEB 2ZNIA 2YC0A 1IBMO 4B3MB 1KQSU 3DC5A 2Q9LA 4ZOLA 1A32A 3J80N 3QF7A 4DYLA 1UFIA 2CTPA 2ZDIC 3OMNB 5EBLC 4W4KA 3ZMUA 2XNDG 3SYPA 3AG4C 1HR0B 1FJGB 3DXRA 4ZOLB 4DV1O 4JYCA 3G6EV 2QM8A 4UV8A 1HNWB 1XL6A 3HR0A 3NXSA 4X9QA 5KUKA 2WLHA 1V54B 2VQEB 1YIJV 1S3JA 2IJHA 3DXRB 1WLEA 5EIBD 4JI1O 3MHSC 2X6BA 3HKDA 5J2TA 2N74A 4E2LA 2UXBB 1NH2D 1FAFA 2HFEC 1LR1A 5EIBC 1RSOA 4IYIA 1FXVA 4ABMA 1UPGA 2HR3A 2UXNA 1YJWV 1IXMA 3HKDB 2Q0OC 5J2TB 2O57A 1GO3F 1B04A 3FKSG 3E89A 3VOUA 1OCZB 3B77A 5LMNB 4BR6A 2WA4A 1RSOB 5B1AC 2WLJA 2ZE8A 3CC2V 3CRRA 3NR7A 3B8MA 4I9WA 3OM3B 4JV5O 4DUYB 2ZE5A 1VQ8V 2RMKB 1H8EG 3KCXA 3CRQA 1X59A 3BAAA 4H33A 2LQTA 4LFCO 2QGNA 4NXMB 4JI6O 2OYQA 1K5QA 3K5MA 2R9RB 1OCOC 4DR6O 4O2AA 1EZVH 2WA3A 4DUZB 3CD6V 4GKKB 4NYKA 4UCTA 1FFTB 1K5SA 4BAYA 3JD3A 3T1HB 3AG2C 3MAQA 1COWG 1XNRB 3CMEV 2ZKOA 4Q6GA 4K35A 3RBZA 3BFRA 3FB5C 4HYOA 2JGUA 3BA8A 5KX5A 1M90W 4XDJA 2HJFC 1Q6UA 4QPJA 4FLVA 3CC7V 2ZNJA 1YDXA 5L3CA 1JFFA 3OEHG 2ZM6O 3LSUA 3CXCU 5KX5B 3J7AU 1Y74A 2YSUB 3F5TA 4PDLA 2F95B 3WG7C 1IXBA 4HNAA 1D2DA 3B40A 1I94B 1TA8A 1JFFB 1SS3A 4BWAA 1I08A 1Y74B 4EB6A 1VQOV 2UU9B 4DV6B 1V55B 1IBLB 4HNAB 3UO2A 2QWQB 1G1XB 3BABA 3U10A 2FMLA 5GW7A 2PTMA 2UUCO 4EB6B 4EEQA 3E8GA 4HBNA 3OR7C 1M9NA 4TWKA 4OX9B 1SQFA 1K9MW 2H8PC 4DR2O 2XAQA 2IU3A 2Z3YA 2QKSA 2FYUH 1RFYA 1M93A 1QU7A 2M6YA 1B06A 1Q43A 1N34O 1XBLA 5A2QN 1M5IA 4IHJA 3CSXA 2N04A 2K9PA 4CS3A 2GV9A 2CUGA 3E83A 5CB4A 2EZPA 3SPHA 1WN7A 4IHJB 3E86A 1NR7A 1W0KG 1XL4A 2DWDC 4WFHA 2EIJC 3W7XA 3G71V 5CB4B 1R3JC 1XQ8A 3F7YC 4LWSA 1R6NA 3FB6C 3IFXA 2ZXWB 4BIUA 3UM7A 3JD1A 4GX2A 3MDSA 1JPXA 4AILC 4Z1MG 1P49A 4MW3A 3FYEB 1W0JG 3H1JH 1N36B 3RT3C 2YIAA 4AQYO 2ZCEA 4LWSB 2E3CA 3JD0A 2LFSA 2QDOA 3T1YB 1JX9A 2VWJA 4YIPA 4B3TB 4CH3A 2QWNB 4UB6Z 4DK1A 5LMUO 1XI1A 5L3GA 5E1AC 1J5EO 1V54C 3RYHB 1KC8W 4PV1B 3WU2Z 1QNMA 5LP6A 4RUEA 4JYAO 4FZ1A 2GUZA 4DR5B 5IY5B 3ASOB 3THOA 4FJCC 1KP3A 4PI0A 1Q3EA 1PM9A 2MW2B 2P06A 3SPCA 2V1DA 1XHZA 3X2QB 5LP6B 1OZ0A 3LNMB 1XMOO 3H1IH 1M4UA 2C2AA 2JEXA 3H01A 4LCUC 2UXCO 2WLLA 1IZ3A 5EC1C 1WB8A 3P3NA 4E4EA 3TETA 1D5NA 4PA7A 4ASUG 3D36C 1CXZB 2ZT9B 3SJQC 4JI2B 4PJ0Z 3H1LH 4PHZA 3ZRWA 1MMMA 3BA9A 1KU9A 5B1NA 4FVMA 3JCZA 1F7YA 4H37A 2WLLB 1KECA 5AG2A 2E74B 2Q8VA 4LFAB 3D3IA 3RYIB 2WPDG 5KMGB 3T4ZA 3QTCA 2P4VA 3ZRWB 4LNUA 2LP7A 2H3OA 1FD9A 2R9IA 4LC1A 4MVRA 1SQQH 3L74H 3E2EA 5H6RA 3QG5A 1P7BA 1AR4A 3WFVA 2UUAB 4LNUB 3ZIAG 4DV7O 2EJRA 4ZKIA 3AG4B 4DO2A 2XHBA 4DR7O 2ZIMA 3JAMN 4IGGA 5LBQA 3ZJZA 4D6TH 4NXNO 1OCCB 5B66Z 2QM4A 4X89A 2OCHA 2EX3A 2QE7G 4ZI7A 4YXWG 1XOUA 1NT2B 2Y48A 1HNZB 4WF9V 3U11A 5D5QA 1NQTA 1VP7A 2JJ1G 1GKFA 3UO3A 3ZRVA 2P7TC 5JJEB 4ZI7B 2LFRA 3M99B 1V55C 1ZUQA 2LO1A 1N33B 3STLC 2YXHA 4H13B 1F4MA 1EFRG 1SQPH 4UFZA 1GM7A 3P3PA 4H44B 4DV2O 4JAVA 1N32B 3ZMVA 5LL6Y 3L73H 1X4TA 2F66C 3IAYA 1S0VA 1FXKC 3KKYA 1N0JA 3GVMA 1F4NA 3A0BZ 1CP9A 3UKMA 2RN9A 2AHYA 2XASA 1D5AA 3BCCH 3W7UA 1ZL8A 5ITZA 2XAFA 4O4LA 3A2FA 4GKJB 1O9GA 5GONA 1KYOF 1OCOB 1BHAA 4DR4O 1ZL8B 5ITZB 1O9HA 3S3WA 4O4LB 1YEWA 2B5UA 3ABMB 5GONB 1Z5VA 3EXAA 5E79Z 1NI8A 3K3WA 3AG2B 3VQWA 3H9VA 4JI4B 1N0NA 1Q8IA 5DN6G 2EINB 3APOA 4FM2A 2DYSC 4NTWA 2ADPA 1GN2A 5DECA 4WCEV 1BQ0A 3OTOO 1YTFB 3HPLC 3FB8C 2ZXWC 4LF5B 4YJ2B 2PUSA 1RPOA 3SGIA 4TV9A 1FFXA 2DE0X 4FLZA 5CA1B 5KHIA 3E8HA 3JYCA 5H6QA 5IYDO 3SPIA 4PA4A 2A9HA 3SJAC 3SYAA 1H2MA 2HVJC 4TV9B 1FFXB 1BQZA 4YHHO 3N27A 4XBFA 3SPGA 4DV3O 1JA8A 1MA1A 3K9SA 2JS5A 2XAGA 4GX1A 5KHJA 3FFQA 1BZKA 3CWBH 1R3IC 2YDEA 1H2KA 1FXHA 3L9DA 5GTIZ 4UCUA 5KHKA 3SYOA 3ZHTA 4WFEA 4B08A 4J7JA 4FK5C 3L75H 4A5UB 1TVKA 4I55A 3CXHF 1K73W 1R3LC 3D3QA 3JASA 4K3AA 2Q4PA 4NTYA 1TVKB 4I55B 3LDDA 4CS2A 4CH6A 2LGWA 4YIOA 2X0LA 2YI8A 1AI4A 4LF6B 3JASB 4NR1A 3JATA 4KFMA 2HJDA 2BCCH 3T2MA 3DC6A 5IE9A 2W0FC 1OHHG 4FMTA 3E35A 5CMUA 4X65B 3RVZA 3TJTA 1ROPA 1WB7A 3CE2A 3ETGA 2DYRC 3JATB 3O9OA 1MABG 4MVSA 1SZTA 1OJHA 1SZXA 1DF5A 5KHHA 4AI8A 1MNGA 5IJ9A 1PD3A 2NN4A 3OTFA 2DW4A 1HNXB 2PYJA 4DK0A 2B9ZA 1BS3A 2HP8A 4X62O 5IJ9B 4D7TA 3ZRXA 2E76B 1FJGO 1HR0O 1OCCC 1GM9A 4JI5O 1AP5A 4DV1B 1JVMA 2ATKC 1K33A 4LF7O 1BCCH 2QWOB 4PD4F 2CTRA 2BTOA 2VQEO 1RP3B 5CBGA 2PYLA 2F4VO 4JYYA 4JI1B 4W4LA 1MG1A 2V4DA 3D36A 1B6QA 1PL0A 2ADQB 4GUNA 2Q68A 3OMAB 3VQVA 2W6IG 4PDMA 2Q7GA 4X1YA 1QR8A 2AGAA 1VIBA 2BSKA 1P4RA 1IBKB 2EILB 3B4SA 2FB5A 4X1IA 1Q90D 1M57C 1HDJA 4X1YB 2KG7A 2WLIA 1VQPV 2XAHA 1PNKA 1WAZA 2BSKB 3JSLA 4JV5B 4HAMA 5JJJB 2D3OW 1N4CA 3IGAC 2HG5C 4X1IB 2KG7B 2QKCA 4LFCB 1Y76A 1PP9H 4JI6B 2WLIB 1EZJA 5J9PC 3ABMC 4TT3G 1E1RG 2ZE7A 4UVCA 2YUAA 4O2AB 2EINC 1Y76B 3B09A 3JAWA 1FKAO 3T1HO 1GN3A 2YIBA 1YTFD 1OCRB 3RYFA 2LGQA 4X20A 1H38A 1WA8A 5L3BA 2X6AA 3JAWB 2V7QG 3OEEG 2B1IA 3I56V 1KP2A 4KUMA 2AZ2A 3K0GA 2NR5A 2PF4E 3ZHUA 3OW2U 2IM9A 3RYFB 4X20B 3A8TA 1WA8B 2ZM6B 3AG7A 1TGOA 2BOCC 1VQMV 3KG2A 5KA6A 4J80A 4KXRA 2GTSA 4FLWA 2EJ7A 1YZBA 4FPPA 1YCIA 3T4DA 1PL4A 1XNQB 5BZBA 1FXKA 1L8DA 2Y4TA 1QR9A 3CB2A 1IURA 1S5JA 3M8AA 3CPWU 4DV6O 1KBHA 4UCRA 2E5LO 5LYJA 4I7ZB 4TV8A 2XTAA 4O2BA 1WPBA 2WSSG 1FXKB 1S5HC 2DJVA 4JI0O 2P22C 1NKDA 4LH6A 2X7RB 4JZGA 4JI8O 1DLBA 5LYJB 4OX9O 4ZHQA 2IJKA 4TV8B 4UB8Z 2LW1A 4O2BB 2KB1A 1FYJA 1GAXA 1YVWA 1SESA 1SA0A 3AG1B 3SYQA 1SF9A 1ZSPA 2JRIA 2F23A 3ASNB 3I55V 2KSDA 4J10A 3E8FA 4ZHQB 1N34B 1K4DC 2LW7A 5L3EA 2IU0A 2ETNA 1SA0B 4JTCB 3K59A 3AG3C 2QSAA 3RWRD 2F93B 2DYSB 1IX9A 1K8AW 1K4CC 3RGBA 1ZWIC 2N05A 4EFBA 2EBOA 4XDLA 2OIGA 4MTOA 1P84F 2RNBA 4FZ0A 2HLDG 1GN4A 1NTMH 2VWKA 3S3XA 4L87A 3RVYA 1BHBA 1JR9A 2F43G 2A79B 4J41A 3HKEA 2QWRB 1XMQO 1XHXA 4UCSA 5J2UA 2Q0AA 3K5NA 2HEPA 1G4YB 3T1YO 2JGDA 3FD9A 4KP4A 2BOBC 2RCVA 5KAIZ 2QTSA 4N23A 5J2UB 3PJSK 3R65A 1KMIZ 4B3SO 2ZD9A 5FL7G 2R70A 3K57A 3K5OA 1J5EB 3CCQV 1R6TA 5B1BC 3QVNA 3ZCCA 2JK5C 3GB7C 4JI3B 2Y69B 3RYCA 4DR5O 1DF4A 2GUZB 3JSNA 4MTXA 3LDEA 5JCOA 4DV0B 2VQFO 4C7UA 2HHHO 3RYCB 4PA3A 5EZYA 2ZR3A 5TISZ 4BW5A 2Q69A 3MHHC 2AHZA 2IJJA 4WFFA 2UXCB 3K08A 2EILC 3F5WC 5CN0A 3FAVA 1K7DA 4F4LA 1IDSA 5EZYB 1VQLV 5B3SB 1BT8A 2DOSA 1H2LA 1SKVA 2P6JA 4JTDB 4P2ZA 1SQVH 3FAVB 2DYRB 3ICXA 4DV4O 4OXSA 3TXSA 3W7TA 3ZMSA 4YY3O 4GLXA 4TSFG 2JEUA 5BXZA 3TGUH 3K04A 2YXYA 4LF9B 4X64B 2EIMC 1TUBA 3ZHVA 4LF4O 4JGSA 5L3FA 1DTOA 4OPHA 4JPRA 4OPAA 1NR1A 2IJIA 4BIZA 1OCRC 3APQA 2YIBD 2OIEA 4DV7B 3E8BA 3ABLC 5KAFZ 4KHPB 2EULA 5A9GA 1TUBB 1JJ2U
chains in the Genus database with same CATH topology
4DV2O 2F4VO 2UUBO 2Z0AA 2FKXA 4LF6O 4JV5O 5LL6Y 1AILA 1N34O 2UXCO 1NS1A 4B3SO 1X59A 1HNXO 3M8AA 5A2QN 4DV6O 2UUAO 4LFCO 2UXDO 2E5LO 4JI6O 1HNWO 4X66O 3O65A 4K0KO 5BY1A 1R6TA 4LF9O 4A5UB 4X64O 2DJVA 1N36O 4DR6O 5H5NA 4JI0O 4DR5O 1F7YA 2AGAA 4JI8O 4LF5O 1I94O 4B3TO 4B3RO 4OX9O 4DR4O 4KHPO 1IBMO 2UXBO 1FYJA 2VQFO 4LFBO 2HHHO 2ZKOA 1A32A 2UU9O 3J81N 2JRIA 1IBLO 1N32O 3J80N 1XNQO 1HNZO 5BR8O 2LW7A 3SDLA 1XEQA 5LMNO 4DV1O 4DV7O 2ZM6O 2DOSA 4JI3O 3RT3C 1N33O 3J7AU 4GKJO 4DV5O 4AQYO 3F5TA 3OTOO 1KUQA 4DR7O 3JAMN 1D2DA 1IBKO 1FKAO 4JI1O 3T1HO 4DR1O 4NXNO 4DUYO 2N74A 4JI7O 5IT9N 4DV0O 4DV4O 5LMUO 5FLXN 4YY3O 5BXZA 4NXMO 1J5EO 4LF8O 4JI4O 4JI2O 4X62O 1R1BA 5IWAO 1DK1A 4LF4O 4JYAO 1G1XB 4DR3O 4OPHA 1FJGO 1HR0O 4DUZO 4OPAA 4GKKO 4JI5O 4YHHO 2UUCO 4X65O 4DV3O 1XMQO 3R66A 4LF7O 4LFAO 4DR2O 4B3MO 2VQEO 1XNRO 3T1YO 1AB3A 1YZBA 1XMOO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 O;  2F4V O;  2UUB O;  2Z0A A;  2FKX A;  4LF6 O;  4JV5 O;  5LL6 Y;  1AIL A;  1N34 O;  2UXC O;  1NS1 A;  4B3S O;  1X59 A;  1HNX O;  3M8A A;  5A2Q N;  4DV6 O;  2UUA O;  4LFC O;  2UXD O;  2E5L O;  4JI6 O;  1HNW O;  4X66 O;  3O65 A;  4K0K O;  5BY1 A;  1R6T A;  4LF9 O;  4A5U B;  4X64 O;  2DJV A;  1N36 O;  4DR6 O;  5H5N A;  4JI0 O;  4DR5 O;  1F7Y A;  2AGA A;  4JI8 O;  4LF5 O;  1I94 O;  4B3T O;  4B3R O;  4OX9 O;  4DR4 O;  4KHP O;  1IBM O;  2UXB O;  1FYJ A;  2VQF O;  4LFB O;  2HHH O;  2ZKO A;  1A32 A;  2UU9 O;  3J81 N;  2JRI A;  1IBL O;  1N32 O;  3J80 N;  1XNQ O;  1HNZ O;  5BR8 O;  2LW7 A;  3SDL A;  1XEQ A;  5LMN O;  4DV1 O;  4DV7 O;  2ZM6 O;  2DOS A;  4JI3 O;  3RT3 C;  1N33 O;  3J7A U;  4GKJ O;  4DV5 O;  4AQY O;  3F5T A;  3OTO O;  1KUQ A;  4DR7 O;  3JAM N;  1D2D A;  1IBK O;  1FKA O;  4JI1 O;  3T1H O;  4DR1 O;  4NXN O;  4DUY O;  2N74 A;  4JI7 O;  5IT9 N;  4DV0 O;  4DV4 O;  5LMU O;  5FLX N;  4YY3 O;  5BXZ A;  4NXM O;  1J5E O;  4LF8 O;  4JI4 O;  4JI2 O;  4X62 O;  1R1B A;  5IWA O;  1DK1 A;  4LF4 O;  4JYA O;  1G1X B;  4DR3 O;  4OPH A;  1FJG O;  1HR0 O;  4DUZ O;  4OPA A;  4GKK O;  4JI5 O;  4YHH O;  2UUC O;  4X65 O;  4DV3 O;  1XMQ O;  3R66 A;  4LF7 O;  4LFA O;  4DR2 O;  4B3M O;  2VQE O;  1XNR O;  3T1Y O;  1AB3 A;  1YZB A;  1XMO O; 
#chains in the Genus database with same CATH topology
 3TCU A;  1VQ5 V;  1AIL A;  1AI6 A;  4NXN B;  3BY6 A;  1CPY A;  1UJW B;  1MZF A;  2Q7E A;  1BMF G;  3AK1 A;  3LUT B;  3DSQ A;  1YIT V;  5F2V O;  5K1X A;  4RAI A;  1PKX A;  4TQF A;  4Q20 A;  1KD1 W;  2CGN A;  5IYC O;  1JOY A;  4CBC A;  3SJC C;  4UUJ C;  2NNU A;  4DV2 B;  1N32 O;  1M57 B;  2YID A;  1YJN V;  3EFF K;  4NVP A;  5JH7 A;  5FPO A;  1KB9 F;  2WLN A;  2A3Q A;  5DED A;  3AG1 C;  3CYO A;  2QJ1 A;  4GKJ O;  5FNV A;  4MTF A;  5JH7 B;  3ASN C;  2BE3 A;  3P30 A;  4FLY A;  3ETD A;  4GX0 A;  4ZBM A;  1SRY A;  4NKG B;  1IVS A;  4DR4 B;  1Y67 A;  1QVG U;  5FNV B;  1I5X A;  1VQ9 V;  3I5D A;  2UXD B;  4RWU A;  2QWP B;  1Q7Y W;  2Y0I A;  4LF8 O;  3ABT A;  4QNH B;  4JI4 O;  2YS8 A;  2BTQ A;  2E75 B;  3ABK C;  1VQ7 V;  4OGQ B;  5HFL A;  4UCO A;  3SR2 C;  2GBO A;  2X6C A;  4P30 A;  1QQC A;  4U7O A;  1XUQ A;  4DRX A;  1JJO A;  3N2G A;  3H1H H;  2CE4 A;  3WB1 A;  2BTQ B;  4O4I A;  1NU1 H;  2GDS A;  4LFB B;  3HB3 B;  1H2G A;  1AB3 A;  4ICG A;  4DW1 A;  2UUB O;  2Z0A A;  1LNQ A;  4DRX B;  2DMX A;  1HWY A;  4MSW C;  4U3J A;  5LHI A;  1DGS A;  1FS0 G;  1AJQ A;  2K1E A;  4K0K O;  1AR1 B;  2PY5 A;  4WFG A;  3RN4 A;  2Q6A A;  2HKO A;  3AK2 A;  1OV9 A;  4U3J B;  2CTQ A;  1K34 A;  3ETE A;  4U7N A;  2IBZ H;  4DV3 B;  2WWW A;  2AW9 A;  3FB7 C;  5JQG A;  4JI7 B;  4G28 B;  4EKW A;  3OFN G;  3K79 A;  3CHX A;  2Y69 C;  1GMG A;  2Q5Z A;  3ZED A;  1WP7 A;  1TAE A;  1LUV A;  5IWA B;  5JQG B;  4F6R A;  5BR8 O;  2P90 A;  3CCU V;  4EFE A;  1U96 A;  2OWO A;  2CAZ C;  3GWO A;  1PV0 A;  4R8C A;  4MT8 A;  1Z5W A;  4DV5 O;  1E1Q G;  1BE3 H;  2IW5 A;  1GM8 A;  4F6R B;  3AG3 B;  1QVF U;  4N21 A;  2OTL V;  5JCO C;  3SJB C;  4I5S A;  4BIO A;  5BMV A;  3T1C A;  4DR1 O;  4FLU A;  3G80 A;  4JYB A;  3ZX6 A;  3CEI A;  1L1F A;  5B3S C;  2W0X A;  4J9Z B;  3A0R A;  4UCV A;  2R9A A;  2PI4 A;  5BMV B;  3ETQ A;  4X66 B;  5EK0 A;  1NZ6 A;  4DR3 O;  4J11 A;  4GX5 A;  5GTH Z;  1SQX H;  4X65 O;  2OCC B;  4PA9 A;  1SQB H;  4B3R B;  3G6B A;  1IBM B;  4B3M O;  1YJ9 V;  4PDR A;  5KHG A;  5DM6 V;  1W2B U;  1BSM A;  1NS1 A;  1HNX O;  3KCY A;  1KKC A;  2VS0 A;  1HNW O;  3CCV V;  1GTO A;  4X62 B;  4K8Z A;  1SER A;  1K3E A;  5KUM A;  2EIK B;  4JI5 B;  2Y0P A;  5C8Y A;  5B1B B;  4MTG A;  2JVD A;  4LF7 B;  2CK3 G;  3HKB A;  2UXB O;  1CEZ A;  3HKC A;  3K03 A;  5LGU A;  1VQN V;  3K58 A;  4O4J A;  1MSW D;  1EM1 A;  3J81 N;  2F4V B;  5C8Y B;  4PA6 A;  4F6E A;  5H2F Z;  4MVU A;  2ZQM A;  3HKB B;  1F51 A;  3HKC B;  3VBB A;  3E22 A;  1Z2G A;  2ZE6 A;  2DWE C;  5LMN O;  4O4J B;  2CDY A;  1VQK V;  3WB0 A;  3BEH A;  2ILM A;  1ORQ C;  1URF A;  3E22 B;  1VF6 C;  3RW0 A;  2LJ2 A;  1IBK O;  4DUY O;  5CBF A;  1G6U A;  5FLX N;  4MW8 A;  2PZS A;  1PNL A;  4J7K A;  4NXM O;  2L6L A;  1B3Q A;  3UCS C;  1R73 A;  1RPR A;  2FTK A;  4JAU A;  3OT7 A;  1DK1 A;  3OMI B;  1VQ6 V;  4DR6 B;  1VF7 A;  4DUZ O;  4GKK O;  2IH3 C;  2R72 A;  4R6Z A;  3F7V C;  3CCJ V;  4JZ2 A;  2EIM B;  1Q86 W;  1Y4M A;  1XNR O;  4FM1 A;  3EVK A;  4PI2 A;  1AJN A;  1M1K W;  2Q7H A;  3BVO A;  3KZI Z;  2CTW A;  2PGG A;  2P5O A;  3ABL B;  4I4T A;  3AEI A;  4TQD A;  3ZN0 A;  1K97 A;  1ENV A;  3ZN1 A;  1J95 A;  2MK3 A;  4WFB V;  4X1K A;  3ZHR A;  3C90 A;  2NLJ C;  4I4T B;  2WLM A;  2YXL A;  1F23 A;  3QO7 A;  1XRE A;  3L70 H;  1H2S B;  3UQ8 A;  2ZR2 A;  5KLV H;  3H1K H;  5HFM A;  2WAM A;  3FYI B;  1I94 O;  4X1K B;  3LDC A;  3TXQ A;  3ABU A;  4Z1V A;  2UXX A;  2UU9 O;  1IBL O;  4QE7 A;  1XNQ O;  4R50 A;  1M56 C;  2ITD C;  4JF3 A;  1NTK H;  4CC5 A;  4UXN A;  5JJN B;  1L0L H;  2GHY A;  2XUM A;  2GSM B;  1KKD A;  5JWP A;  1GRJ A;  3SDL A;  1VQ4 V;  1VF5 B;  2E5L B;  1BL8 A;  2UUC B;  1EBO A;  1Q5O A;  1ARO P;  3CP1 A;  1AP6 A;  4G27 B;  4QPK A;  2JDI G;  4CH4 A;  4JI0 B;  4DR2 B;  5L3D A;  4MVO A;  3ZMT A;  5EYP A;  2KKW A;  3D8C A;  4JI8 B;  3B8N A;  2Q73 A;  2A06 H;  3K06 A;  2OT5 A;  2RQ6 A;  1US6 A;  4MVQ A;  2A7W A;  3OD4 A;  1THZ A;  4O4H A;  3ZHS A;  4P9O A;  2PI5 A;  4I0X A;  3ML0 A;  5EYP B;  3OGC C;  1GH6 A;  4I50 A;  5B5E Z;  1R1B A;  4GYC B;  2XAJ A;  3CX5 F;  1SET A;  1MSD A;  2RJZ A;  1JMK C;  4O4H B;  3LSS A;  1YI2 V;  2GTA A;  1V9P A;  4I0X B;  4HZ3 A;  3ABK B;  4TOI A;  2QM7 A;  4I50 B;  1EN4 A;  4DXW A;  3CCS V;  3JCU Z;  4GT1 A;  4JAS A;  4RQF A;  1RM1 C;  2CH7 A;  2OCC C;  4PDV A;  1JCH A;  3OUF A;  3W7W A;  5LHH A;  2W6J G;  4LBE C;  4WBN A;  5IJ0 A;  1N36 O;  2CH7 B;  1TUE B;  4QIW F;  1QLE C;  4AQY B;  3P32 A;  3CCM V;  3SYC A;  4B3T O;  4J9Y B;  1XMQ B;  3K0D A;  1MZE A;  5LGN A;  4AHC A;  3HKE B;  2ITC C;  2EZO A;  4WBN B;  5LMU B;  5IJ0 B;  4LR3 A;  3RYH A;  2EIK C;  2JGD B;  2AXT Z;  3A0H Z;  1G8M A;  2KQX A;  3M7M X;  3OUS A;  5FPR A;  4B3S B;  4JYA B;  1XEQ A;  2AZ0 A;  1MOF A;  1WP8 A;  1SC5 B;  1Q6I A;  4JI3 O;  2DN9 A;  2G38 A;  3PN1 A;  1K92 A;  3CS5 A;  3CCR V;  3JAL A;  2L35 A;  3N2K A;  4IT5 A;  2VRZ A;  1ZX3 A;  1XMO B;  3JAK A;  2A0L A;  5CBH A;  2Q67 A;  4DV0 O;  2VQF B;  4BW9 A;  2XOK G;  1NVP B;  2HHH B;  4CC6 A;  3ZHQ A;  1S77 D;  3DTU B;  1WJZ A;  3CCE V;  5LOV A;  1QHT A;  3JAL B;  3N2K B;  1OCZ C;  3Q4H A;  4K8X A;  3JAK B;  4JI2 O;  1VEW A;  1T5E A;  4P9P A;  4LP8 A;  1AR5 A;  4QGP A;  3RYI A;  5LOV B;  5KMG A;  3BPZ A;  4MVM A;  3G67 A;  3Q4H B;  4LFA O;  3C3S A;  4D7S A;  1VMG A;  2DQ3 A;  3CCL V;  4Z2W A;  4IL6 Z;  2P67 A;  1KUQ A;  1Y66 A;  1E79 G;  3GWK C;  5H9C A;  1FPO A;  2YEV A;  5LHG A;  4DV4 B;  1S5L Z;  3BRC A;  1QCE A;  4RO2 A;  2ZDI A;  4YY3 B;  2UUA O;  1S72 V;  1QBZ A;  1HP8 A;  4YJ3 A;  1VAR A;  4KL1 A;  3CRA A;  1EN6 A;  2YI9 A;  4CZZ A;  3ZMZ A;  4LF9 O;  4U3F H;  1YF2 A;  4X64 O;  4LF4 B;  5H5N A;  2YEV B;  4IIJ A;  2JJ2 G;  2D2C B;  3CJH A;  3IC7 A;  4DR7 B;  4YJ3 B;  3UT5 A;  1S76 D;  2HVK C;  1YHQ V;  4KHP O;  4G2K A;  3C3T A;  2JIZ G;  4IIJ B;  3CJH B;  3JD2 A;  4FLT A;  3UT5 B;  4I9Q A;  1LUW A;  4QE9 A;  4X88 A;  3K5L A;  1HNZ O;  4CS4 A;  5JVD A;  1AI7 A;  1I0H A;  2Z5U A;  4X8A A;  1JQ0 A;  1N33 O;  1VF6 A;  4NB5 A;  1N8R W;  1NH2 B;  5JVD B;  5KA5 A;  5IYZ A;  1NJI W;  3QO8 A;  2RDC A;  5EC2 C;  1YXB A;  3ZS8 C;  2ZIN A;  3OGI B;  3K9A A;  5EBM C;  3TK1 A;  1R6K A;  4DW0 A;  1NTZ H;  5B1A B;  4FIP C;  4FFK A;  3LSQ A;  5IYZ B;  2OTJ V;  1PPJ H;  3RFR A;  3QO5 A;  1NBM G;  3JD4 A;  1Q81 W;  1QLN A;  5EBW C;  4GZR B;  4QJF B;  4ZIB A;  2FKX A;  2F1M A;  2ARH A;  3G4S V;  2WLK A;  4FLX A;  1AJP A;  3L71 H;  2UXD O;  1I5Y A;  4MVZ A;  3DGE A;  4R7C A;  4LF8 B;  3O65 A;  5BY1 A;  3OAA G;  2Y4U A;  5LXT A;  3AK3 A;  4JTA B;  3OTO B;  5LGT A;  1XIL A;  2ZIO A;  4YJ2 A;  3WB2 A;  4LF5 O;  3CRC A;  2DQ0 A;  4J42 A;  5CA1 A;  1ZLZ A;  4FM0 A;  3FX7 A;  1GN6 A;  3STZ C;  3N2G B;  4LFB O;  5LA6 A;  2QKA A;  4L8J A;  2CGO A;  1EN5 A;  4O4I B;  4PEL A;  5LXT B;  2ODM A;  4FFB A;  3CRM A;  2UUB B;  2YIC A;  3WG7 B;  1WNS A;  2QR4 A;  4RQE A;  4UV9 A;  2QTO A;  3JAR A;  1H8H G;  5LA6 B;  1M56 B;  4YHH B;  2P4K A;  4FFB B;  1I7F A;  2IH1 C;  4K0K B;  5D5P A;  4NTX A;  1R3K C;  4J7Z A;  1Q82 W;  3W7S A;  3SPJ A;  3IC9 A;  5IDJ A;  3L72 H;  3JAR B;  4CH5 A;  4UVB A;  5C93 A;  3OE7 G;  4JI7 O;  5IT9 N;  3ZBH A;  2JS3 A;  3IJ4 A;  4IYH A;  4LH7 A;  5CA0 A;  3CMA V;  4TUY A;  5IY5 C;  4WFA V;  3ASO C;  2H94 A;  1NVP D;  1BGY H;  1PNM A;  5IWA O;  4MS2 A;  1W59 A;  2XT9 A;  1ZAU A;  4RUF A;  5B1O A;  5BR8 B;  3BHP A;  5CA0 B;  3X2Q C;  5LP6 C;  5CA3 A;  1P7G A;  3OR6 C;  4TUY B;  1SQG A;  3R66 A;  1WPX A;  4DV5 B;  1Q6H A;  3MD0 A;  4GCZ A;  3LNN A;  3U0Z A;  2QA4 V;  4LF6 O;  4XDK A;  2FL4 A;  3QNE A;  3VQY A;  3ZRS A;  4H0L B;  4DR1 B;  4B7E A;  4B7K A;  5IYB O;  1L0N H;  1H2N A;  3EHB B;  1GK9 A;  1YSC A;  1AVM A;  1RM1 B;  2QEX V;  3VQX A;  4X66 O;  1AI5 A;  2EIJ B;  1U97 A;  2B1G A;  4JAA A;  4DR3 B;  3B2E E;  2M7W A;  1Y6X A;  1ZTE A;  1HW7 A;  4B3R O;  5K1P A;  3CC4 V;  1XDC A;  4UVA A;  1QLE B;  2ZNI A;  2YC0 A;  1IBM O;  4B3M B;  1KQS U;  3DC5 A;  2Q9L A;  4ZOL A;  1A32 A;  3J80 N;  3QF7 A;  4DYL A;  1UFI A;  2CTP A;  2ZDI C;  3OMN B;  5EBL C;  4W4K A;  3ZMU A;  2XND G;  3SYP A;  3AG4 C;  1HR0 B;  1FJG B;  3DXR A;  4ZOL B;  4DV1 O;  4JYC A;  3G6E V;  2QM8 A;  4UV8 A;  1HNW B;  1XL6 A;  3HR0 A;  3NXS A;  4X9Q A;  5KUK A;  2WLH A;  1V54 B;  2VQE B;  1YIJ V;  1S3J A;  2IJH A;  3DXR B;  1WLE A;  5EIB D;  4JI1 O;  3MHS C;  2X6B A;  3HKD A;  5J2T A;  2N74 A;  4E2L A;  2UXB B;  1NH2 D;  1FAF A;  2HFE C;  1LR1 A;  5EIB C;  1RSO A;  4IYI A;  1FXV A;  4ABM A;  1UPG A;  2HR3 A;  2UXN A;  1YJW V;  1IXM A;  3HKD B;  2Q0O C;  5J2T B;  2O57 A;  1GO3 F;  1B04 A;  3FKS G;  3E89 A;  3VOU A;  1OCZ B;  3B77 A;  5LMN B;  4BR6 A;  2WA4 A;  1RSO B;  5B1A C;  2WLJ A;  2ZE8 A;  3CC2 V;  3CRR A;  3NR7 A;  3B8M A;  4I9W A;  3OM3 B;  4JV5 O;  4DUY B;  2ZE5 A;  1VQ8 V;  2RMK B;  1H8E G;  3KCX A;  3CRQ A;  1X59 A;  3BAA A;  4H33 A;  2LQT A;  4LFC O;  2QGN A;  4NXM B;  4JI6 O;  2OYQ A;  1K5Q A;  3K5M A;  2R9R B;  1OCO C;  4DR6 O;  4O2A A;  1EZV H;  2WA3 A;  4DUZ B;  3CD6 V;  4GKK B;  4NYK A;  4UCT A;  1FFT B;  1K5S A;  4BAY A;  3JD3 A;  3T1H B;  3AG2 C;  3MAQ A;  1COW G;  1XNR B;  3CME V;  2ZKO A;  4Q6G A;  4K35 A;  3RBZ A;  3BFR A;  3FB5 C;  4HYO A;  2JGU A;  3BA8 A;  5KX5 A;  1M90 W;  4XDJ A;  2HJF C;  1Q6U A;  4QPJ A;  4FLV A;  3CC7 V;  2ZNJ A;  1YDX A;  5L3C A;  1JFF A;  3OEH G;  2ZM6 O;  3LSU A;  3CXC U;  5KX5 B;  3J7A U;  1Y74 A;  2YSU B;  3F5T A;  4PDL A;  2F95 B;  3WG7 C;  1IXB A;  4HNA A;  1D2D A;  3B40 A;  1I94 B;  1TA8 A;  1JFF B;  1SS3 A;  4BWA A;  1I08 A;  1Y74 B;  4EB6 A;  1VQO V;  2UU9 B;  4DV6 B;  1V55 B;  1IBL B;  4HNA B;  3UO2 A;  2QWQ B;  1G1X B;  3BAB A;  3U10 A;  2FML A;  5GW7 A;  2PTM A;  2UUC O;  4EB6 B;  4EEQ A;  3E8G A;  4HBN A;  3OR7 C;  1M9N A;  4TWK A;  4OX9 B;  1SQF A;  1K9M W;  2H8P C;  4DR2 O;  2XAQ A;  2IU3 A;  2Z3Y A;  2QKS A;  2FYU H;  1RFY A;  1M93 A;  1QU7 A;  2M6Y A;  1B06 A;  1Q43 A;  1N34 O;  1XBL A;  5A2Q N;  1M5I A;  4IHJ A;  3CSX A;  2N04 A;  2K9P A;  4CS3 A;  2GV9 A;  2CUG A;  3E83 A;  5CB4 A;  2EZP A;  3SPH A;  1WN7 A;  4IHJ B;  3E86 A;  1NR7 A;  1W0K G;  1XL4 A;  2DWD C;  4WFH A;  2EIJ C;  3W7X A;  3G71 V;  5CB4 B;  1R3J C;  1XQ8 A;  3F7Y C;  4LWS A;  1R6N A;  3FB6 C;  3IFX A;  2ZXW B;  4BIU A;  3UM7 A;  3JD1 A;  4GX2 A;  3MDS A;  1JPX A;  4AIL C;  4Z1M G;  1P49 A;  4MW3 A;  3FYE B;  1W0J G;  3H1J H;  1N36 B;  3RT3 C;  2YIA A;  4AQY O;  2ZCE A;  4LWS B;  2E3C A;  3JD0 A;  2LFS A;  2QDO A;  3T1Y B;  1JX9 A;  2VWJ A;  4YIP A;  4B3T B;  4CH3 A;  2QWN B;  4UB6 Z;  4DK1 A;  5LMU O;  1XI1 A;  5L3G A;  5E1A C;  1J5E O;  1V54 C;  3RYH B;  1KC8 W;  4PV1 B;  3WU2 Z;  1QNM A;  5LP6 A;  4RUE A;  4JYA O;  4FZ1 A;  2GUZ A;  4DR5 B;  5IY5 B;  3ASO B;  3THO A;  4FJC C;  1KP3 A;  4PI0 A;  1Q3E A;  1PM9 A;  2MW2 B;  2P06 A;  3SPC A;  2V1D A;  1XHZ A;  3X2Q B;  5LP6 B;  1OZ0 A;  3LNM B;  1XMO O;  3H1I H;  1M4U A;  2C2A A;  2JEX A;  3H01 A;  4LCU C;  2UXC O;  2WLL A;  1IZ3 A;  5EC1 C;  1WB8 A;  3P3N A;  4E4E A;  3TET A;  1D5N A;  4PA7 A;  4ASU G;  3D36 C;  1CXZ B;  2ZT9 B;  3SJQ C;  4JI2 B;  4PJ0 Z;  3H1L H;  4PHZ A;  3ZRW A;  1MMM A;  3BA9 A;  1KU9 A;  5B1N A;  4FVM A;  3JCZ A;  1F7Y A;  4H37 A;  2WLL B;  1KEC A;  5AG2 A;  2E74 B;  2Q8V A;  4LFA B;  3D3I A;  3RYI B;  2WPD G;  5KMG B;  3T4Z A;  3QTC A;  2P4V A;  3ZRW B;  4LNU A;  2LP7 A;  2H3O A;  1FD9 A;  2R9I A;  4LC1 A;  4MVR A;  1SQQ H;  3L74 H;  3E2E A;  5H6R A;  3QG5 A;  1P7B A;  1AR4 A;  3WFV A;  2UUA B;  4LNU B;  3ZIA G;  4DV7 O;  2EJR A;  4ZKI A;  3AG4 B;  4DO2 A;  2XHB A;  4DR7 O;  2ZIM A;  3JAM N;  4IGG A;  5LBQ A;  3ZJZ A;  4D6T H;  4NXN O;  1OCC B;  5B66 Z;  2QM4 A;  4X89 A;  2OCH A;  2EX3 A;  2QE7 G;  4ZI7 A;  4YXW G;  1XOU A;  1NT2 B;  2Y48 A;  1HNZ B;  4WF9 V;  3U11 A;  5D5Q A;  1NQT A;  1VP7 A;  2JJ1 G;  1GKF A;  3UO3 A;  3ZRV A;  2P7T C;  5JJE B;  4ZI7 B;  2LFR A;  3M99 B;  1V55 C;  1ZUQ A;  2LO1 A;  1N33 B;  3STL C;  2YXH A;  4H13 B;  1F4M A;  1EFR G;  1SQP H;  4UFZ A;  1GM7 A;  3P3P A;  4H44 B;  4DV2 O;  4JAV A;  1N32 B;  3ZMV A;  5LL6 Y;  3L73 H;  1X4T A;  2F66 C;  3IAY A;  1S0V A;  1FXK C;  3KKY A;  1N0J A;  3GVM A;  1F4N A;  3A0B Z;  1CP9 A;  3UKM A;  2RN9 A;  2AHY A;  2XAS A;  1D5A A;  3BCC H;  3W7U A;  1ZL8 A;  5ITZ A;  2XAF A;  4O4L A;  3A2F A;  4GKJ B;  1O9G A;  5GON A;  1KYO F;  1OCO B;  1BHA A;  4DR4 O;  1ZL8 B;  5ITZ B;  1O9H A;  3S3W A;  4O4L B;  1YEW A;  2B5U A;  3ABM B;  5GON B;  1Z5V A;  3EXA A;  5E79 Z;  1NI8 A;  3K3W A;  3AG2 B;  3VQW A;  3H9V A;  4JI4 B;  1N0N A;  1Q8I A;  5DN6 G;  2EIN B;  3APO A;  4FM2 A;  2DYS C;  4NTW A;  2ADP A;  1GN2 A;  5DEC A;  4WCE V;  1BQ0 A;  3OTO O;  1YTF B;  3HPL C;  3FB8 C;  2ZXW C;  4LF5 B;  4YJ2 B;  2PUS A;  1RPO A;  3SGI A;  4TV9 A;  1FFX A;  2DE0 X;  4FLZ A;  5CA1 B;  5KHI A;  3E8H A;  3JYC A;  5H6Q A;  5IYD O;  3SPI A;  4PA4 A;  2A9H A;  3SJA C;  3SYA A;  1H2M A;  2HVJ C;  4TV9 B;  1FFX B;  1BQZ A;  4YHH O;  3N27 A;  4XBF A;  3SPG A;  4DV3 O;  1JA8 A;  1MA1 A;  3K9S A;  2JS5 A;  2XAG A;  4GX1 A;  5KHJ A;  3FFQ A;  1BZK A;  3CWB H;  1R3I C;  2YDE A;  1H2K A;  1FXH A;  3L9D A;  5GTI Z;  4UCU A;  5KHK A;  3SYO A;  3ZHT A;  4WFE A;  4B08 A;  4J7J A;  4FK5 C;  3L75 H;  4A5U B;  1TVK A;  4I55 A;  3CXH F;  1K73 W;  1R3L C;  3D3Q A;  3JAS A;  4K3A A;  2Q4P A;  4NTY A;  1TVK B;  4I55 B;  3LDD A;  4CS2 A;  4CH6 A;  2LGW A;  4YIO A;  2X0L A;  2YI8 A;  1AI4 A;  4LF6 B;  3JAS B;  4NR1 A;  3JAT A;  4KFM A;  2HJD A;  2BCC H;  3T2M A;  3DC6 A;  5IE9 A;  2W0F C;  1OHH G;  4FMT A;  3E35 A;  5CMU A;  4X65 B;  3RVZ A;  3TJT A;  1ROP A;  1WB7 A;  3CE2 A;  3ETG A;  2DYR C;  3JAT B;  3O9O A;  1MAB G;  4MVS A;  1SZT A;  1OJH A;  1SZX A;  1DF5 A;  5KHH A;  4AI8 A;  1MNG A;  5IJ9 A;  1PD3 A;  2NN4 A;  3OTF A;  2DW4 A;  1HNX B;  2PYJ A;  4DK0 A;  2B9Z A;  1BS3 A;  2HP8 A;  4X62 O;  5IJ9 B;  4D7T A;  3ZRX A;  2E76 B;  1FJG O;  1HR0 O;  1OCC C;  1GM9 A;  4JI5 O;  1AP5 A;  4DV1 B;  1JVM A;  2ATK C;  1K33 A;  4LF7 O;  1BCC H;  2QWO B;  4PD4 F;  2CTR A;  2BTO A;  2VQE O;  1RP3 B;  5CBG A;  2PYL A;  2F4V O;  4JYY A;  4JI1 B;  4W4L A;  1MG1 A;  2V4D A;  3D36 A;  1B6Q A;  1PL0 A;  2ADQ B;  4GUN A;  2Q68 A;  3OMA B;  3VQV A;  2W6I G;  4PDM A;  2Q7G A;  4X1Y A;  1QR8 A;  2AGA A;  1VIB A;  2BSK A;  1P4R A;  1IBK B;  2EIL B;  3B4S A;  2FB5 A;  4X1I A;  1Q90 D;  1M57 C;  1HDJ A;  4X1Y B;  2KG7 A;  2WLI A;  1VQP V;  2XAH A;  1PNK A;  1WAZ A;  2BSK B;  3JSL A;  4JV5 B;  4HAM A;  5JJJ B;  2D3O W;  1N4C A;  3IGA C;  2HG5 C;  4X1I B;  2KG7 B;  2QKC A;  4LFC B;  1Y76 A;  1PP9 H;  4JI6 B;  2WLI B;  1EZJ A;  5J9P C;  3ABM C;  4TT3 G;  1E1R G;  2ZE7 A;  4UVC A;  2YUA A;  4O2A B;  2EIN C;  1Y76 B;  3B09 A;  3JAW A;  1FKA O;  3T1H O;  1GN3 A;  2YIB A;  1YTF D;  1OCR B;  3RYF A;  2LGQ A;  4X20 A;  1H38 A;  1WA8 A;  5L3B A;  2X6A A;  3JAW B;  2V7Q G;  3OEE G;  2B1I A;  3I56 V;  1KP2 A;  4KUM A;  2AZ2 A;  3K0G A;  2NR5 A;  2PF4 E;  3ZHU A;  3OW2 U;  2IM9 A;  3RYF B;  4X20 B;  3A8T A;  1WA8 B;  2ZM6 B;  3AG7 A;  1TGO A;  2BOC C;  1VQM V;  3KG2 A;  5KA6 A;  4J80 A;  4KXR A;  2GTS A;  4FLW A;  2EJ7 A;  1YZB A;  4FPP A;  1YCI A;  3T4D A;  1PL4 A;  1XNQ B;  5BZB A;  1FXK A;  1L8D A;  2Y4T A;  1QR9 A;  3CB2 A;  1IUR A;  1S5J A;  3M8A A;  3CPW U;  4DV6 O;  1KBH A;  4UCR A;  2E5L O;  5LYJ A;  4I7Z B;  4TV8 A;  2XTA A;  4O2B A;  1WPB A;  2WSS G;  1FXK B;  1S5H C;  2DJV A;  4JI0 O;  2P22 C;  1NKD A;  4LH6 A;  2X7R B;  4JZG A;  4JI8 O;  1DLB A;  5LYJ B;  4OX9 O;  4ZHQ A;  2IJK A;  4TV8 B;  4UB8 Z;  2LW1 A;  4O2B B;  2KB1 A;  1FYJ A;  1GAX A;  1YVW A;  1SES A;  1SA0 A;  3AG1 B;  3SYQ A;  1SF9 A;  1ZSP A;  2JRI A;  2F23 A;  3ASN B;  3I55 V;  2KSD A;  4J10 A;  3E8F A;  4ZHQ B;  1N34 B;  1K4D C;  2LW7 A;  5L3E A;  2IU0 A;  2ETN A;  1SA0 B;  4JTC B;  3K59 A;  3AG3 C;  2QSA A;  3RWR D;  2F93 B;  2DYS B;  1IX9 A;  1K8A W;  1K4C C;  3RGB A;  1ZWI C;  2N05 A;  4EFB A;  2EBO A;  4XDL A;  2OIG A;  4MTO A;  1P84 F;  2RNB A;  4FZ0 A;  2HLD G;  1GN4 A;  1NTM H;  2VWK A;  3S3X A;  4L87 A;  3RVY A;  1BHB A;  1JR9 A;  2F43 G;  2A79 B;  4J41 A;  3HKE A;  2QWR B;  1XMQ O;  1XHX A;  4UCS A;  5J2U A;  2Q0A A;  3K5N A;  2HEP A;  1G4Y B;  3T1Y O;  2JGD A;  3FD9 A;  4KP4 A;  2BOB C;  2RCV A;  5KAI Z;  2QTS A;  4N23 A;  5J2U B;  3PJS K;  3R65 A;  1KMI Z;  4B3S O;  2ZD9 A;  5FL7 G;  2R70 A;  3K57 A;  3K5O A;  1J5E B;  3CCQ V;  1R6T A;  5B1B C;  3QVN A;  3ZCC A;  2JK5 C;  3GB7 C;  4JI3 B;  2Y69 B;  3RYC A;  4DR5 O;  1DF4 A;  2GUZ B;  3JSN A;  4MTX A;  3LDE A;  5JCO A;  4DV0 B;  2VQF O;  4C7U A;  2HHH O;  3RYC B;  4PA3 A;  5EZY A;  2ZR3 A;  5TIS Z;  4BW5 A;  2Q69 A;  3MHH C;  2AHZ A;  2IJJ A;  4WFF A;  2UXC B;  3K08 A;  2EIL C;  3F5W C;  5CN0 A;  3FAV A;  1K7D A;  4F4L A;  1IDS A;  5EZY B;  1VQL V;  5B3S B;  1BT8 A;  2DOS A;  1H2L A;  1SKV A;  2P6J A;  4JTD B;  4P2Z A;  1SQV H;  3FAV B;  2DYR B;  3ICX A;  4DV4 O;  4OXS A;  3TXS A;  3W7T A;  3ZMS A;  4YY3 O;  4GLX A;  4TSF G;  2JEU A;  5BXZ A;  3TGU H;  3K04 A;  2YXY A;  4LF9 B;  4X64 B;  2EIM C;  1TUB A;  3ZHV A;  4LF4 O;  4JGS A;  5L3F A;  1DTO A;  4OPH A;  4JPR A;  4OPA A;  1NR1 A;  2IJI A;  4BIZ A;  1OCR C;  3APQ A;  2YIB D;  2OIE A;  4DV7 B;  3E8B A;  3ABL C;  5KAF Z;  4KHP B;  2EUL A;  5A9G A;  1TUB B;  1JJ2 U; 
#chains in the Genus database with same CATH homology
 4DV2 O;  2F4V O;  2UUB O;  2Z0A A;  2FKX A;  4LF6 O;  4JV5 O;  5LL6 Y;  1AIL A;  1N34 O;  2UXC O;  1NS1 A;  4B3S O;  1X59 A;  1HNX O;  3M8A A;  5A2Q N;  4DV6 O;  2UUA O;  4LFC O;  2UXD O;  2E5L O;  4JI6 O;  1HNW O;  4X66 O;  3O65 A;  4K0K O;  5BY1 A;  1R6T A;  4LF9 O;  4A5U B;  4X64 O;  2DJV A;  1N36 O;  4DR6 O;  5H5N A;  4JI0 O;  4DR5 O;  1F7Y A;  2AGA A;  4JI8 O;  4LF5 O;  1I94 O;  4B3T O;  4B3R O;  4OX9 O;  4DR4 O;  4KHP O;  1IBM O;  2UXB O;  1FYJ A;  2VQF O;  4LFB O;  2HHH O;  2ZKO A;  1A32 A;  2UU9 O;  3J81 N;  2JRI A;  1IBL O;  1N32 O;  3J80 N;  1XNQ O;  1HNZ O;  5BR8 O;  2LW7 A;  3SDL A;  1XEQ A;  5LMN O;  4DV1 O;  4DV7 O;  2ZM6 O;  2DOS A;  4JI3 O;  3RT3 C;  1N33 O;  3J7A U;  4GKJ O;  4DV5 O;  4AQY O;  3F5T A;  3OTO O;  1KUQ A;  4DR7 O;  3JAM N;  1D2D A;  1IBK O;  1FKA O;  4JI1 O;  3T1H O;  4DR1 O;  4NXN O;  4DUY O;  2N74 A;  4JI7 O;  5IT9 N;  4DV0 O;  4DV4 O;  5LMU O;  5FLX N;  4YY3 O;  5BXZ A;  4NXM O;  1J5E O;  4LF8 O;  4JI4 O;  4JI2 O;  4X62 O;  1R1B A;  5IWA O;  1DK1 A;  4LF4 O;  4JYA O;  1G1X B;  4DR3 O;  4OPH A;  1FJG O;  1HR0 O;  4DUZ O;  4OPA A;  4GKK O;  4JI5 O;  4YHH O;  2UUC O;  4X65 O;  4DV3 O;  1XMQ O;  3R66 A;  4LF7 O;  4LFA O;  4DR2 O;  4B3M O;  2VQE O;  1XNR O;  3T1Y O;  1AB3 A;  1YZB A;  1XMO O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...