2UUAO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uuaO00
4X62O 5LMNO 1IBLO 4JI8O 2DOSA 4DV6O 1YZBA 4OPHA 5H5NA 2UUAO 4LF6O 4X66O 5BR8O 5IT9N 4JI6O 1DK1A 4X64O 1KUQA 1HNZO 1A32A 4JI4O 2AGAA 4DV5O 4B3TO 4NXNO 4JI7O 4DV4O 3M8AA 4K0KO 2LW7A 1IBMO 4KHPO 4JI0O 1X59A 2UXBO 1XEQA 4NXMO 3O65A 1XMQO 4A5UB 4DUYO 1FKAO 2UU9O 4DR1O 4DR4O 3F5TA 4JI2O 2F4VO 4LF5O 1NS1A 1AB3A 1J5EO 4B3SO 3SDLA 1N34O 1G1XB 2FKXA 4OPAA 2E5LO 3J81N 1N32O 2UXDO 2UXCO 1HR0O 2UUBO 2UUCO 2JRIA 2ZM6O 2VQFO 4B3RO 4GKJO 4AQYO 3T1HO 4LFCO 3JAMN 4JI1O 4DV0O 1R1BA 1HNWO 1XNQO 5LMUO 4JI5O 4B3MO 5A2QN 4YY3O 1XNRO 2VQEO 3J80N 1N33O 2DJVA 4LFBO 2Z0AA 4DR6O 4DV2O 3R66A 3RT3C 4DR7O 4LF4O 1XMOO 4JI3O 1HNXO 4JV5O 1D2DA 4LF8O 4DR2O 5LL6Y 4LF7O 4DV3O 4DR5O 2N74A 2ZKOA 4YHHO 1I94O 5FLXN 4LF9O 5IWAO 4OX9O 3T1YO 1N36O 3J7AU 5BXZA 4DR3O 4JYAO 1FYJA 4DV1O 1R6TA 4LFAO 4DUZO 4X65O 4DV7O 4GKKO 1F7YA 2HHHO 1IBKO 1AILA 1FJGO 3OTOO 5BY1A
chains in the Genus database with same CATH superfamily
1M57B 1IURA 5KHIA 1TUEB 4DR2B 5EIBD 2G38A 4MVOA 3ZHQA 4E2LA 5AG2A 4W4LA 4LF9B 1K73W 2OCCB 4E4EA 4X64O 3N2KA 2BTOA 1N36B 1K4CC 2Y0PA 2DYRC 2QA4V 2A7WA 3DC5A 2DQ0A 3VQXA 1KD1W 2ZIMA 2YIBD 3AEIA 3K5NA 3FX7A 5LOVA 2B1GA 2D3OW 4XDJA 4OGQB 1MZEA 1BHAA 1YITV 4L8JA 4TT3G 2OTLV 1VQMV 3CWBH 4GX2A 4MVQA 3HKBB 4WFGA 2BE3A 1AP6A 5KUMA 3K5LA 2Y69B 4XBFA 1QVFU 3JASB 3QTCA 1KMIZ 3CRMA 1XUQA 3L70H 3GVMA 4Z2WA 2IU0A 3JATB 1F51A 1XL4A 3AK3A 3DXRB 4GKKB 2F1MA 1KU9A 3RVYA 4AI8A 1N8RW 2F66C 1R3KC 1NH2B 4D7TA 2XTAA 4TV8A 4U7OA 4DR6O 1URFA 3QO8A 5EC1C 3RT3C 1IZ3A 4K35A 4BAYA 5C93A 3ZHTA 3RGBA 5LL6Y 2DYSB 3TETA 4JPRA 4DR5O 4CS4A 2RCVA 3ZEDA 3QF7A 5FLXN 1JR9A 3T1HB 2QEXV 1FD9A 1S5LZ 2EJRA 4O4HA 5LA6A 1JJOA 2EZOA 1R6TA 1F7YA 2HHHO 4MTXA 2EIJB 1PNKA 4J11A 2YXLA 4LH6A 2PZSA 2F23A 3H1IH 5JQGB 2JGDB 4CH3A 2O57A 3FB7C 1N0JA 4LF6O 4FM2A 3H9VA 4I7ZB 3JAKA 3OMNB 1E79G 1F4NA 1VQPV 5B1AC 1FAFA 1WLEA 2YICA 1YTFB 4N21A 1MSWD 4YIOA 3AG3C 1IBMO 2WWWA 3JSNA 1ZAUA 3TJTA 2YS8A 1COWG 4DUYO 4DR1O 2LFRA 1GTOA 1Y74B 3SPCA 3ETEA 1Q6HA 4H0LB 1AR5A 4JGSA 3OM3B 5EYPA 2ARHA 3H1JH 4DV5B 2M6YA 3K9SA 3BHPA 4ZOLA 2DYRB 4G28B 5LHHA 4KHPB 3RFRA 1X4TA 1DLBA 2WA3A 3JYCA 1NI8A 3OTOB 4NXMB 1QU7A 4UVBA 4BIUA 4QE9A 1J95A 4LWSA 4MTGA 4DR4B 4RUEA 1KBHA 3S3XA 4X64B 1WB8A 2DJVA 2ZNIA 3W7SA 3ZMUA 4YXWG 3CYOA 1KECA 3EFFK 5B5EZ 2CTPA 1YJ9V 4GX5A 3ETQA 1H8HG 1S0VA 2HJDA 1Y6XA 2RMKB 3APQA 1AI7A 5GTIZ 3MDSA 1JA8A 4UCRA 3BPZA 5H2FZ 2EINC 3ZN1A 2DE0X 5JCOC 2ADPA 3OAAG 4IHJA 4QPKA 4DR7B 2BOCC 2E75B 3IGAC 1R3IC 1SC5B 5LMNO 1H38A 4J7ZA 3SYCA 1VQNV 3TXSA 1JJ2U 5EZYA 2KB1A 1JX9A 5LGUA 2XAHA 2HKOA 4LP8A 4B3TO 4YJ2A 5B1BC 4DR6B 5HFLA 2CDYA 1S5JA 3VQWA 3ETGA 4J9ZB 4UCSA 1Y76A 1UJWB 3L73H 4I0XA 2X6BA 2ITCC 4DR5B 3VQYA 2QKSA 2KSDA 4JYCA 3N2GA 5FNVB 1YF2A 3JARB 1G6UA 3QO5A 1NVPD 3CJHB 1GH6A 3ZMZA 1RFYA 2MK3A 2OT5A 1R6KA 5B1AB 2BSKA 1FXHA 1OCZC 2JRIA 2ZM6O 4EFBA 4B3RO 4IYIA 3AG3B 1KYOF 1QLEC 4JI1O 2ZDIA 1HNWO 1AVMA 1WA8B 2XOKG 4UFZA 3THOA 2PYLA 3LSSA 4PD4F 5CA1A 4UUJC 4FLTA 1M93A 5FPRA 2ZXWC 3WG7C 2CGOA 4JV5O 1IBMB 4K8XA 2XASA 4TWKA 4BIOA 2DWEC 1PNMA 4QNHB 1NR1A 2N74A 1P7BA 4CH5A 3UQ8A 2LQTA 3JD3A 4DYLA 4JYBA 4DUYB 3I55V 3LDDA 4NR1A 1FYJA 1W0JG 1YJNV 3BRCA 2JK5C 3OTFA 5JH7B 3FD9A 1Y4MA 2QJ1A 3ABTA 1YXBA 5DEDA 4X62O 3HKBA 4TV9B 3CSXA 4FLWA 1L0LH 3JASA 1Y67A 1O9HA 3IC7A 4DRXB 4Z1VA 5CB4B 4PELA 5KHHA 1WNSA 3K5MA 2X0LA 2Q68A 1OZ0A 1VQ6V 4LFAB 1AR4A 3JATA 5LYJB 4NXNO 2NN4A 2RJZA 3DXRA 1W2BU 3MAQA 1EN6A 2RDCA 1X59A 2EINB 2YXYA 1SZXA 3B8NA 1M1KW 3ABUA 2CGNA 3NR7A 1IBLB 4LR3A 5GTHZ 3OUFA 3L9DA 1BSMA 2H3OA 3ZHSA 2XAQA 3L72H 2ZE5A 3OGIB 1VF6C 4LF5O 1LNQA 5H9CA 1OCCC 3AK2A 1QR8A 3K79A 1EBOA 3ZN0A 1KKDA 5JJNB 2E5LO 1E1RG 1BHBA 2UXDO 3BABA 4I9WA 3WFVA 4PDVA 5B1BB 3ICXA 5D5PA 5LMNB 3KZIZ 3RYFB 4LFCO 3ZHVA 1XNQO 5A2QN 2CAZC 2QE7G 3X2QC 1H2MA 1BE3H 4DK0A 2V7QG 4AHCA 1AI6A 1AROP 2PGGA 5C8YA 4IYHA 4ZIBA 4PDMA 4B3TB 4JZ2A 5JQGA 3H1KH 4PA6A 3D36A 4LCUC 4DW0A 2XAFA 4DR2O 1SERA 2R9IA 1M9NA 2V1DA 4LF9O 1GMGA 5IWAO 2B1IA 2K9PA 1F4MA 1SQBH 1N36O 1OCZB 4R7CA 1N33B 2QKAA 1SQGA 4LFBB 1QLEB 1P4RA 4BW9A 3JSLA 4O2AB 3UT5B 4JI3B 1IXMA 3SPIA 1Y74A 4I55B 2JVDA 4DV3B 5L3EA 3KG2A 1Q86W 2LW1A 2XHBA 1B04A 2ZM6B 4B3RB 3H01A 4X66O 2ZXWB 3WG7B 3T1YB 1HNWB 3CCLV 3DGEA 2AGAA 3ETDA 4HNAB 4J7KA 3ZJZA 4P9OA 3AG2C 2WLJA 3DC6A 3UKMA 1SQFA 2QDOA 1IBKB 2A3QA 2LJ2A 5EK0A 2XUMA 1AP5A 1SS3A 1XEQA 5GONB 4MVSA 4JV5B 4GCZA 1CEZA 1F23A 1MSDA 5LP6C 3OR6C 4MVZA 2H8PC 3F7VC 1IVSA 2VWJA 5ITZB 4P30A 5LGNA 1YCIA 1Q3EA 4CC5A 3TK1A 1QHTA 3VQVA 2QM7A 4IHJB 1NH2D 4X62B 5J9PC 1MNGA 3T1HO 3BEHA 1SQVH 2P06A 2QGNA 1GAXA 1YI2V 2WLIB 4ASUG 1S3JA 5CA3A 4NXNB 4J7JA 3A2FA 4HAMA 2FMLA 1OCCB 1B3QA 4LF7O 2UXCB 4MVRA 3UO2A 4WFHA 4GKJB 1YHQV 2KKWA 2AHYA 3E35A 1YSCA 1GO3F 4WBNB 1T5EA 4LF5B 2JS3A 3B8MA 4GUNA 4PI2A 5K1XA 2Q7GA 3X2QB 3W7WA 4MVUA 4MS2A 4CH6A 4BW5A 2E5LB 1PV0A 5FNVA 4B08A 3JARA 3AG4C 2NNUA 4R50A 3ZRXA 1SKVA 5BR8O 3CJHA 3K58A 3RWRD 3BAAA 2AW9A 1JOYA 1DF5A 4PA3A 4I50B 4DV5O 2JDIG 2E3CA 3FB8C 5L3BA 3PN1A 5JVDB 4KHPO 2WLNA 4NXMO 4TSFG 1WA8A 4IIJB 4Q6GA 4J42A 5KMGB 2HJFC 3P3PA 2EZPA 2GDSA 4DR4O 5IWAB 3K57A 4G27B 1QLNA 4PA9A 3C3TA 1SQXH 3STLC 2ZNJA 2RN9A 4FLXA 3SPHA 4OPAA 3OT7A 5IYZB 1V55C 2BOBC 1VMGA 2OWOA 5EIBC 3WB0A 3AG2B 4X66B 4JTAB 3PJSK 1JFFB 4EFEA 1HP8A 3JD2A 4NTWA 5JH7A 5LP6B 3T1CA 3CPWU 4DR7O 4PJ0Z 4TV9A 4B3SB 2WAMA 4DRXA 5CB4A 2NLJC 4JTCB 1PM9A 3P32A 2DMXA 3ZMSA 3SYAA 4FJCC 3ASOC 5LYJA 3CP1A 4DV0B 4WCEV 2Q73A 3ZMTA 3CRCA 4LBEC 4DUZO 5JCOA 1NBMG 1P49A 4FZ1A 4MW8A 4GLXA 2YSUB 1VQ4V 4LF4B 1AILA 3RN4A 2P4VA 1VF5B 3ZMVA 1YIJV 3C90A 1SRYA 2PF4E 2N04A 2GHYA 5B1NA 2ITDC 5K1PA 2IJKA 1BCCH 2JJ2G 5LHGA 4KUMA 2PI5A 1H8EG 3CXHF 4JI0O 4ICGA 3RYFA 1WP7A 1IX9A 4UV8A 5C8YB 4LF7B 1D5AA 4X9QA 2XAJA 3CCRV 2HLDG 3AG4B 4TQFA 3CHXA 2CTQA 4GX0A 1UPGA 4JI4B 2HFEC 1EN5A 1XREA 2AHZA 4KXRA 1GM9A 3LDEA 4K0KB 3J81N 2RQ6A 3CB2A 2OIGA 2WLLB 2Y4UA 3FYIB 3TGUH 1VIBA 3G80A 2P5OA 1R1BA 1R73A 2UU9B 2QTSA 5BR8B 1QCEA 3FFQA 2IJJA 1U97A 3E8BA 2W6JG 1IXBA 4O2AA 3CE2A 3UT5A 1FFTB 4I55A 3CC4V 1VF7A 5LXTB 2IH3C 1N0NA 1I7FA 3LSUA 4I4TB 2JEXA 4HNAA 1H2SB 4LC1A 1ZSPA 5BXZA 3LDCA 3FB6C 1L0NH 1R3JC 4R8CA 4RUFA 4LFAO 3N27A 5GONA 4DV2B 3IJ4A 1S72V 4NTYA 2BTQB 1I5XA 3MD0A 3W7UA 1O9GA 1IBLO 2ZIOA 5IT9N 5ITZA 1CPYA 2A9HA 1OJHA 1PP9H 5TISZ 3L74H 3ZHUA 1SA0B 3HKEB 2JEUA 1K5SA 3ASOB 3HB3B 1PD3A 2LW7A 1AJQA 2B9ZA 2UXBO 1K9MW 3UM7A 3OFNG 1YVWA 1ENVA 4JI8B 4W4KA 5L3DA 2WLHA 4TQDA 1FKAO 2WLIA 3P3NA 5DN6G 4GX1A 2DN9A 1VF6A 4I9QA 1XDCA 2IH1C 1XILA 3E89A 4DUZB 4OXSA 3E22B 3ZIAG 3UO3A 3SDLA 3WU2Z 3ZHRA 4F6EA 4FLVA 2Q8VA 5CA0B 1NTZH 2ZE8A 1L8DA 2PUSA 1M4UA 5KX5B 3ASNC 4WBNA 2ZINA 1N33O 3OGCC 2A79B 4O2BB 4NB5A 4LFBO 4JAVA 4R6ZA 2BCCH 3OMAB 1KC8W 4FLYA 4JI3O 1HNXO 4NKGB 3CC7V 1ZX3A 4DV3O 2CUGA 4JI0B 2UUBB 2ZR2A 3SYPA 1NT2B 2GTSA 1ZTEA 3BY6A 3T1YO 4I50A 4RQFA 4MTFA 5KAIZ 3BA8A 2VQEB 2R9AA 1M56C 5JVDA 1XQ8A 5IE9A 4FFBB 4RO2A 1LR1A 1SF9A 1IBKO 4IIJA 3OUSA 5KMGA 1FJGO 2IU3A 5IYCO 2QSAA 4TOIA 1ZUQA 3E8GA 1YJWV 1BGYH 1P7GA 3FAVB 2YIDA 1I08A 4YHHB 4X20B 3OR7C 5CN0A 3W7XA 1Q6UA 1DK1A 2EJ7A 1TAEA 3G6BA 1WJZA 5IYZA 4DV1B 3U0ZA 1KQSU 2H94A 3CD6V 3K0GA 4QPJA 1SZTA 1JQ0A 4YIPA 4MSWC 1ZL8B 1JFFA 2Y0IA 2GSMB 5LP6A 4B7EA 4JI6B 2ZQMA 2IBZH 4X1KB 2YI9A 5IJ0B 1EM1A 3FB5C 1BZKA 1QVGU 2F95B 3BVOA 4JI7B 2XAGA 2FKXA 2Q69A 2OIEA 1K7DA 2UXCO 2CTWA 4U3JB 4WFAV 2GBOA 2PI4A 2CH7B 4GKJO 2DWDC 4DK1A 3DTUB 4UXNA 4JZGA 3RVZA 1FXVA 4YY3O 2FB5A 2ZCEA 5LBQA 1CXZB 2VRZA 1S76D 2ODMA 2LGQA 2WA4A 2Z5UA 5KA5A 1E1QG 1XMOO 1K8AW 2WSSG 3HKDB 4B7KA 1QNMA 2UXBB 3E86A 4MT8A 1OHHG 3CRQA 2E76B 2CTRA 1VQ7V 1BS3A 1W0KG 4JTDB 1XNRB 1K97A 1SQPH 2IM9A 3RYCB 5IJ9B 2PTMA 2GUZB 5BY1A 4RQEA 3SR2C 1Q90D 4DV6O 3F7YC 4OPHA 2Q5ZA 2P4KA 4PDRA 2ZT9B 1V54C 1M90W 5J2TB 3CEIA 3B77A 3A0HZ 4H33A 1GRJA 4KP4A 2P22C 2Y4TA 5JWPA 1XI1A 1NVPB 2WLLA 2WPDG 5EBMC 1OCOC 1M56B 1HNXB 2IJIA 4P2ZA 3G71V 2P6JA 4PA4A 2XT9A 4QIWF 1GM7A 3F5TA 4QE7A 1VQOV 5KLVH 3P30A 1Z2GA 2UXXA 2QWQB 5LXTA 3Q4HA 4UCTA 3CCQV 4B3SO 1N34O 3SYOA 2LFSA 4QJFB 2R70A 1Q43A 2Q7EA 4I4TA 1FJGB 4LH7A 2MW2B 5DM6V 2P7TC 1FXKC 1SETA 2ZE6A 4GT1A 2Q0AA 1H2GA 3U11A 3RYHB 4DV0O 1FPOA 2LP7A 4AILC 3RW0A 4CC6A 1NQTA 5DECA 3AG7A 1Q82W 2PY5A 2BTQA 2Q7HA 2YIBA 2OYQA 1GN4A 3ABMC 3K04A 3OMIB 4LF4O 5JJJB 4IT5A 2RNBA 4PI0A 1PNLA 3LUTB 4X1IB 4F6RB 2VQFB 1SA0A 3HKEA 5FL7G 2Q0OC 2EIKC 2X6AA 5LMUB 1PKXA 2QR4A 5A9GA 1VARA 1Z5VA 1ZWIC 3AG1C 4BR6A 1HDJA 4CBCA 3G4SV 2QWOB 2ILMA 3SYQA 4X1YB 1YZBA 1OV9A 3SPJA 2N05A 2ETNA 3E22A 4YY3B 1W59A 4JI4O 1KB9F 5CA0A 4HZ3A 2WLKA 3M8AA 4LNUB 4K0KO 3QO7A 2X7RB 1K34A 1XMOB 3K59A 5KX5A 3JALB 4ABMA 5L3FA 2KG7B 3GWOA 4O2BA 4YJ3B 2UU9O 4RAIA 1YTFD 1Q6IA 1QBZA 3RYIB 1FFXB 4UB8Z 4TUYB 2W0FC 2JS5A 1V54B 1IDSA 4X89A 3HR0A 4L87A 3A0BZ 1LUVA 4H37A 1OCOB 4DV6B 5KHGA 1M5IA 1DTOA 4FFBA 2QM8A 4PA7A 4FVMA 5KHJA 5GW7A 4U7NA 3FYEB 4DV2O 4NYKA 3DSQA 2A0LA 3FAVA 1D2DA 4UVAA 2HVKC 5BZBA 3CS5A 4P9PA 4X20A 4CS3A 4AQYB 3ZCCA 3ZS8C 1NU1H 2YEVB 1MG1A 3B4SA 5J2UB 1FXKB 3E8HA 1NR7A 4X65O 1N34B 1ZL8A 4DO2A 4JI8O 2HP8A 3ABMB 2DOSA 4KL1A 4X1KA 4F4LA 1V9PA 5H5NA 3T2MA 5IJ0A 4ZBMA 4UV9A 4XDLA 1WN7A 2IJHA 5D5QA 3QNEA 2QKCA 1BMFG 1GKFA 2XNDG 5KUKA 3I56V 4PHZA 1AR1B 1A32A 1H2KA 1BQ0A 5L3CA 2CE4A 1Q8IA 3GWKC 4FM0A 2EIKB 1PL0A 4U3JA 4DV4O 4NTXA 3A8TA 3JD1A 2CH7A 5L3GA 2D2CB 4BWAA 1S5HC 1AI5A 3AG1B 5HFMA 1QR9A 1NJIW 1GN2A 3K0DA 4IGGA 2YC0A 1XBLA 1HWYA 5KAFZ 2F4VO 4ZHQB 4ZKIA 1NS1A 3EVKA 2L6LA 3HKDA 1G1XB 1CP9A 2UUBO 2QWNB 1GN6A 1JCHA 5IYDO 2DW4A 4Z1MG 3JD4A 2JJ1G 1WPBA 1DGSA 3SJBC 3C3SA 1TA8A 2VQEO 4O4IB 3J80N 1RM1C 1BT8A 3RYCA 5IJ9A 4JI2B 2GUZA 2E74B 1GM8A 5CBGA 1US6A 4JASA 1XL6A 3ZRWB 1N32B 2FTKA 2DQ3A 1Q5OA 4YHHO 2JIZG 2Q9LA 5J2TA 1D5NA 3OW2U 4JI5B 4FFKA 1RSOB 4PDLA 1NTKH 1H2NA 3F5WC 3SJCC 4DV1O 3ZRSA 1XHZA 3R65A 1OCRC 1THZA 5H6RA 2HVJC 3HKCB 3CCUV 1DF4A 1AI4A 1BL8A 3Q4HB 3M7MX 2K1EA 2QTOA 3QG5A 4RWUA 2P90A 4O4JB 5CBFA 4JI6O 1RPRA 2AXTZ 3GB7C 1V55B 3SJQC 3MHSC 3I5DA 3B09A 2HR3A 4JI7O 1I5YA 5BMVB 4JAAA 3RYHA 3ABLC 1ZLZA 2AZ2A 4O4LB 2YDEA 5B3SC 1U96A 1TGOA 2EX3A 5E1AC 3CMAV 1R6NA 4JAUA 3IC9A 2W6IG 4X1IA 4X65B 2WLMA 4F6RA 3CX5F 1VEWA 2B5UA 3D3QA 1SESA 1K92A 2R9RB 4K3AA 3CCJV 2QWPB 3G67A 3NXSA 2OTJV 1XNRO 1G4YB 3JCUZ 4EKWA 3KCYA 1HW7A 4CZZA 1RPOA 2ZE7A 4ZI7B 3H1HH 1G8MA 4DV4B 1VQ9V 4X1YA 3H1LH 4XDKA 1XOUA 2IW5A 4I5SA 5JJEB 3APOA 4HBNA 1YDXA 1TUBB 2LGWA 2EIMC 3G6EV 4FK5C 4WFFA 1QQCA 4JYAO 4LNUA 5CBHA 3KCXA 2F4VB 1VQ5V 1EFRG 4DXWA 3JALA 2HG5C 1RM1B 2KG7A 3BCCH 4YJ3A 3OE7G 1ROPA 3AK1A 4FIPC 2YIAA 4U3FH 3CMEV 1N4CA 4EB6B 3RYIA 1FFXA 3O9OA 4TUYA 2AZ0A 3E8FA 1KUQA 2OCHA 1HNZO 2Q4PA 3ML0A 3M99B 1TVKB 3D8CA 1L1FA 2HHHB 1Z5WA 3STZC 2NR5A 1NTMH 3JAWB 3UCSC 4IL6Z 3LSQA 1OCRB 1Q81W 4FMTA 4A5UB 2ZD9A 4Q20A 4LF6B 5EBWC 3OEEG 1GK9A 1NZ6A 1Q7YW 2X6CA 1R3LC 4J10A 5IY5C 3SJAC 4G2KA 3CRRA 4KFMA 4CH4A 2LO1A 1LUWA 2ATKC 3N2KB 4D7SA 4FLUA 4HYOA 1HR0O 2YEVA 2ADQB 2UUCO 5LOVB 2VQFO 5J2UA 1FXKA 2GTAA 1H2LA 5FPOA 4GYCB 5LMUO 4DR1B 4B3MO 4CS2A 3TCUA 3D3IA 3T4DA 5KHKA 3ABLB 3ABKC 1PPJH 4C7UA 3R66A 5B3SB 3K9AA 3LNMB 2R72A 1VQ8V 4LF8O 1NKDA 2V4DA 2ZKOA 4FPPA 1I94O 3K3WA 3IFXA 1EN4A 4OX9O 3BA9A 2W0XA 2EILC 4J9YB 5EBLC 1K33A 4DR3O 1JVMA 2ZR3A 3JCZA 4TV8B 4DV7O 1MABG 3K06A 4DW1A 3B40A 4FM1A 3ZBHA 4UCVA 2UUAO 4ZHQA 1BQZA 5H6QA 5B1OA 1B6QA 2Y48A 3EXAA 3FKSG 4GZRB 3SGIA 2FL4A 5LA6B 4O4HB 1JPXA 2EIMB 3ASNB 3E83A 4X88A 3K03A 2GV9A 1EZJA 1XMQO 1K5QA 4O4IA 3MHHC 5EC2C 3CCEV 2QWRB 1MOFA 3SPGA 5E79Z 2PYJA 2A06H 1WB7A 1WP8A 3OEHG 4JF3A 5IYBO 4JYYA 4JYAB 3JAKB 5LGTA 5CMUA 3HPLC 3ZRWA 1J5EO 3JD0A 3WB2A 2JGDA 4H13B 4EEQA 3L71H 1RSOA 4AQYO 2ZDIC 2P67A 4H44B 2L35A 4D6TH 3B2EE 3HKCA 1WPXA 3CXCU 1KP3A 1M57C 1HNZB 3LNNA 1Y66A 2JGUA 4K8ZA 1K3EA 5EYPB 3EHBB 3OD4A 3CCMV 2OCCC 5IY5B 4O4JA 4ZOLB 3U10A 4FLZA 2Z3YA 4JI1B 3J7AU 4MTOA 2UXNA 1MMMA 4LWSB 1KKCA 5BMVA 2M7WA 2EBOA 3ABKB 4GKKO 2C2AA 4WFBV 1XHXA 2EULA 2Y69C 4O4LA 2YI8A 3QVNA 3T4ZA 1HR0B 2UUCB 3ZX6A 1AJNA 3CCSV 4UCOA 4BIZA 2VWKA 4B3MB 1ORQC 1VQLV 1FS0G 2CK3G 4NVPA 3W7TA 3ZRVA 2EILB 3KKYA 4J80A 1S77D 2YXHA 2Q67A 4N23A 4WF9V 1UFIA 4LF8B 2F93B 3O65A 1GN3A 1JMKC 5IDJA 1I94B 3BFRA 4OX9B 4ZI7A 4JI2O 1P84F 4DR3B 2DYSC 5KA6A 5EZYB 2F43G 3WB1A 1AB3A 1WAZA 3IAYA 4DV7B 1KP2A 4PV1B 1N32O 4YJ2B 4WFEA 1TUBA 4FZ0A 4UVCA 2Q6AA 5B66Z 1B06A 3JAMN 1PL4A 1Y76B 4JI5O 5F2VO 2UUAB 4I0XB 4J41A 2EIJC 2KQXA 4QGPA 4MW3A 3N2GB 2Z0AA 4UCUA 1AJPA 3CCVV 3D36C 3E2EA 1SQQH 1I0HA 4EB6A 2UXDB 5LHIA 4X8AA 2HEPA 3CC2V 3RBZA 4MVMA 1VQKV 1YEWA 2FYUH 1EZVH 1RP3B 2BSKB 3TXQA 1MZFA 2YUAA 1XMQB 4LFCB 3K08A 1XNQB 1VP7A 3VOUA 1TVKA 3K5OA 1K4DC 3CRAA 3VBBA 4UB6Z 2VS0A 3JAWA 3A0RA 2QM4A 3S3WA 5CA1B 1J5EB 1MA1A 3OTOO 3L75H
chains in the Genus database with same CATH topology
4X62O 5LMNO 1IBLO 4JI8O 2DOSA 4DV6O 1YZBA 4OPHA 5H5NA 2UUAO 4LF6O 4X66O 5BR8O 5IT9N 4JI6O 1DK1A 4X64O 1KUQA 1HNZO 1A32A 4JI4O 2AGAA 4DV5O 4B3TO 4NXNO 4JI7O 4DV4O 3M8AA 4K0KO 2LW7A 1IBMO 4KHPO 4JI0O 1X59A 2UXBO 1XEQA 4NXMO 3O65A 1XMQO 4A5UB 4DUYO 1FKAO 2UU9O 4DR1O 4DR4O 3F5TA 4JI2O 2F4VO 4LF5O 1NS1A 1AB3A 1J5EO 4B3SO 3SDLA 1N34O 1G1XB 2FKXA 4OPAA 2E5LO 3J81N 1N32O 2UXDO 2UXCO 1HR0O 2UUBO 2UUCO 2JRIA 2ZM6O 2VQFO 4B3RO 4GKJO 4AQYO 3T1HO 4LFCO 3JAMN 4JI1O 4DV0O 1R1BA 1HNWO 1XNQO 5LMUO 4JI5O 4B3MO 5A2QN 4YY3O 1XNRO 2VQEO 3J80N 1N33O 2DJVA 4LFBO 2Z0AA 4DR6O 4DV2O 3R66A 3RT3C 4DR7O 4LF4O 1XMOO 4JI3O 1HNXO 4JV5O 1D2DA 4LF8O 4DR2O 5LL6Y 4LF7O 4DV3O 4DR5O 2N74A 2ZKOA 4YHHO 1I94O 5FLXN 4LF9O 5IWAO 4OX9O 3T1YO 1N36O 3J7AU 5BXZA 4DR3O 4JYAO 1FYJA 4DV1O 1R6TA 4LFAO 4DUZO 4X65O 4DV7O 4GKKO 1F7YA 2HHHO 1IBKO 1AILA 1FJGO 3OTOO 5BY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 O;  5LMN O;  1IBL O;  4JI8 O;  2DOS A;  4DV6 O;  1YZB A;  4OPH A;  5H5N A;  2UUA O;  4LF6 O;  4X66 O;  5BR8 O;  5IT9 N;  4JI6 O;  1DK1 A;  4X64 O;  1KUQ A;  1HNZ O;  1A32 A;  4JI4 O;  2AGA A;  4DV5 O;  4B3T O;  4NXN O;  4JI7 O;  4DV4 O;  3M8A A;  4K0K O;  2LW7 A;  1IBM O;  4KHP O;  4JI0 O;  1X59 A;  2UXB O;  1XEQ A;  4NXM O;  3O65 A;  1XMQ O;  4A5U B;  4DUY O;  1FKA O;  2UU9 O;  4DR1 O;  4DR4 O;  3F5T A;  4JI2 O;  2F4V O;  4LF5 O;  1NS1 A;  1AB3 A;  1J5E O;  4B3S O;  3SDL A;  1N34 O;  1G1X B;  2FKX A;  4OPA A;  2E5L O;  3J81 N;  1N32 O;  2UXD O;  2UXC O;  1HR0 O;  2UUB O;  2UUC O;  2JRI A;  2ZM6 O;  2VQF O;  4B3R O;  4GKJ O;  4AQY O;  3T1H O;  4LFC O;  3JAM N;  4JI1 O;  4DV0 O;  1R1B A;  1HNW O;  1XNQ O;  5LMU O;  4JI5 O;  4B3M O;  5A2Q N;  4YY3 O;  1XNR O;  2VQE O;  3J80 N;  1N33 O;  2DJV A;  4LFB O;  2Z0A A;  4DR6 O;  4DV2 O;  3R66 A;  3RT3 C;  4DR7 O;  4LF4 O;  1XMO O;  4JI3 O;  1HNX O;  4JV5 O;  1D2D A;  4LF8 O;  4DR2 O;  5LL6 Y;  4LF7 O;  4DV3 O;  4DR5 O;  2N74 A;  2ZKO A;  4YHH O;  1I94 O;  5FLX N;  4LF9 O;  5IWA O;  4OX9 O;  3T1Y O;  1N36 O;  3J7A U;  5BXZ A;  4DR3 O;  4JYA O;  1FYJ A;  4DV1 O;  1R6T A;  4LFA O;  4DUZ O;  4X65 O;  4DV7 O;  4GKK O;  1F7Y A;  2HHH O;  1IBK O;  1AIL A;  1FJG O;  3OTO O;  5BY1 A; 
#chains in the Genus database with same CATH topology
 1M57 B;  1IUR A;  5KHI A;  1TUE B;  4DR2 B;  5EIB D;  2G38 A;  4MVO A;  3ZHQ A;  4E2L A;  5AG2 A;  4W4L A;  4LF9 B;  1K73 W;  2OCC B;  4E4E A;  4X64 O;  3N2K A;  2BTO A;  1N36 B;  1K4C C;  2Y0P A;  2DYR C;  2QA4 V;  2A7W A;  3DC5 A;  2DQ0 A;  3VQX A;  1KD1 W;  2ZIM A;  2YIB D;  3AEI A;  3K5N A;  3FX7 A;  5LOV A;  2B1G A;  2D3O W;  4XDJ A;  4OGQ B;  1MZE A;  1BHA A;  1YIT V;  4L8J A;  4TT3 G;  2OTL V;  1VQM V;  3CWB H;  4GX2 A;  4MVQ A;  3HKB B;  4WFG A;  2BE3 A;  1AP6 A;  5KUM A;  3K5L A;  2Y69 B;  4XBF A;  1QVF U;  3JAS B;  3QTC A;  1KMI Z;  3CRM A;  1XUQ A;  3L70 H;  3GVM A;  4Z2W A;  2IU0 A;  3JAT B;  1F51 A;  1XL4 A;  3AK3 A;  3DXR B;  4GKK B;  2F1M A;  1KU9 A;  3RVY A;  4AI8 A;  1N8R W;  2F66 C;  1R3K C;  1NH2 B;  4D7T A;  2XTA A;  4TV8 A;  4U7O A;  4DR6 O;  1URF A;  3QO8 A;  5EC1 C;  3RT3 C;  1IZ3 A;  4K35 A;  4BAY A;  5C93 A;  3ZHT A;  3RGB A;  5LL6 Y;  2DYS B;  3TET A;  4JPR A;  4DR5 O;  4CS4 A;  2RCV A;  3ZED A;  3QF7 A;  5FLX N;  1JR9 A;  3T1H B;  2QEX V;  1FD9 A;  1S5L Z;  2EJR A;  4O4H A;  5LA6 A;  1JJO A;  2EZO A;  1R6T A;  1F7Y A;  2HHH O;  4MTX A;  2EIJ B;  1PNK A;  4J11 A;  2YXL A;  4LH6 A;  2PZS A;  2F23 A;  3H1I H;  5JQG B;  2JGD B;  4CH3 A;  2O57 A;  3FB7 C;  1N0J A;  4LF6 O;  4FM2 A;  3H9V A;  4I7Z B;  3JAK A;  3OMN B;  1E79 G;  1F4N A;  1VQP V;  5B1A C;  1FAF A;  1WLE A;  2YIC A;  1YTF B;  4N21 A;  1MSW D;  4YIO A;  3AG3 C;  1IBM O;  2WWW A;  3JSN A;  1ZAU A;  3TJT A;  2YS8 A;  1COW G;  4DUY O;  4DR1 O;  2LFR A;  1GTO A;  1Y74 B;  3SPC A;  3ETE A;  1Q6H A;  4H0L B;  1AR5 A;  4JGS A;  3OM3 B;  5EYP A;  2ARH A;  3H1J H;  4DV5 B;  2M6Y A;  3K9S A;  3BHP A;  4ZOL A;  2DYR B;  4G28 B;  5LHH A;  4KHP B;  3RFR A;  1X4T A;  1DLB A;  2WA3 A;  3JYC A;  1NI8 A;  3OTO B;  4NXM B;  1QU7 A;  4UVB A;  4BIU A;  4QE9 A;  1J95 A;  4LWS A;  4MTG A;  4DR4 B;  4RUE A;  1KBH A;  3S3X A;  4X64 B;  1WB8 A;  2DJV A;  2ZNI A;  3W7S A;  3ZMU A;  4YXW G;  3CYO A;  1KEC A;  3EFF K;  5B5E Z;  2CTP A;  1YJ9 V;  4GX5 A;  3ETQ A;  1H8H G;  1S0V A;  2HJD A;  1Y6X A;  2RMK B;  3APQ A;  1AI7 A;  5GTI Z;  3MDS A;  1JA8 A;  4UCR A;  3BPZ A;  5H2F Z;  2EIN C;  3ZN1 A;  2DE0 X;  5JCO C;  2ADP A;  3OAA G;  4IHJ A;  4QPK A;  4DR7 B;  2BOC C;  2E75 B;  3IGA C;  1R3I C;  1SC5 B;  5LMN O;  1H38 A;  4J7Z A;  3SYC A;  1VQN V;  3TXS A;  1JJ2 U;  5EZY A;  2KB1 A;  1JX9 A;  5LGU A;  2XAH A;  2HKO A;  4LP8 A;  4B3T O;  4YJ2 A;  5B1B C;  4DR6 B;  5HFL A;  2CDY A;  1S5J A;  3VQW A;  3ETG A;  4J9Z B;  4UCS A;  1Y76 A;  1UJW B;  3L73 H;  4I0X A;  2X6B A;  2ITC C;  4DR5 B;  3VQY A;  2QKS A;  2KSD A;  4JYC A;  3N2G A;  5FNV B;  1YF2 A;  3JAR B;  1G6U A;  3QO5 A;  1NVP D;  3CJH B;  1GH6 A;  3ZMZ A;  1RFY A;  2MK3 A;  2OT5 A;  1R6K A;  5B1A B;  2BSK A;  1FXH A;  1OCZ C;  2JRI A;  2ZM6 O;  4EFB A;  4B3R O;  4IYI A;  3AG3 B;  1KYO F;  1QLE C;  4JI1 O;  2ZDI A;  1HNW O;  1AVM A;  1WA8 B;  2XOK G;  4UFZ A;  3THO A;  2PYL A;  3LSS A;  4PD4 F;  5CA1 A;  4UUJ C;  4FLT A;  1M93 A;  5FPR A;  2ZXW C;  3WG7 C;  2CGO A;  4JV5 O;  1IBM B;  4K8X A;  2XAS A;  4TWK A;  4BIO A;  2DWE C;  1PNM A;  4QNH B;  1NR1 A;  2N74 A;  1P7B A;  4CH5 A;  3UQ8 A;  2LQT A;  3JD3 A;  4DYL A;  4JYB A;  4DUY B;  3I55 V;  3LDD A;  4NR1 A;  1FYJ A;  1W0J G;  1YJN V;  3BRC A;  2JK5 C;  3OTF A;  5JH7 B;  3FD9 A;  1Y4M A;  2QJ1 A;  3ABT A;  1YXB A;  5DED A;  4X62 O;  3HKB A;  4TV9 B;  3CSX A;  4FLW A;  1L0L H;  3JAS A;  1Y67 A;  1O9H A;  3IC7 A;  4DRX B;  4Z1V A;  5CB4 B;  4PEL A;  5KHH A;  1WNS A;  3K5M A;  2X0L A;  2Q68 A;  1OZ0 A;  1VQ6 V;  4LFA B;  1AR4 A;  3JAT A;  5LYJ B;  4NXN O;  2NN4 A;  2RJZ A;  3DXR A;  1W2B U;  3MAQ A;  1EN6 A;  2RDC A;  1X59 A;  2EIN B;  2YXY A;  1SZX A;  3B8N A;  1M1K W;  3ABU A;  2CGN A;  3NR7 A;  1IBL B;  4LR3 A;  5GTH Z;  3OUF A;  3L9D A;  1BSM A;  2H3O A;  3ZHS A;  2XAQ A;  3L72 H;  2ZE5 A;  3OGI B;  1VF6 C;  4LF5 O;  1LNQ A;  5H9C A;  1OCC C;  3AK2 A;  1QR8 A;  3K79 A;  1EBO A;  3ZN0 A;  1KKD A;  5JJN B;  2E5L O;  1E1R G;  1BHB A;  2UXD O;  3BAB A;  4I9W A;  3WFV A;  4PDV A;  5B1B B;  3ICX A;  5D5P A;  5LMN B;  3KZI Z;  3RYF B;  4LFC O;  3ZHV A;  1XNQ O;  5A2Q N;  2CAZ C;  2QE7 G;  3X2Q C;  1H2M A;  1BE3 H;  4DK0 A;  2V7Q G;  4AHC A;  1AI6 A;  1ARO P;  2PGG A;  5C8Y A;  4IYH A;  4ZIB A;  4PDM A;  4B3T B;  4JZ2 A;  5JQG A;  3H1K H;  4PA6 A;  3D36 A;  4LCU C;  4DW0 A;  2XAF A;  4DR2 O;  1SER A;  2R9I A;  1M9N A;  2V1D A;  4LF9 O;  1GMG A;  5IWA O;  2B1I A;  2K9P A;  1F4M A;  1SQB H;  1N36 O;  1OCZ B;  4R7C A;  1N33 B;  2QKA A;  1SQG A;  4LFB B;  1QLE B;  1P4R A;  4BW9 A;  3JSL A;  4O2A B;  3UT5 B;  4JI3 B;  1IXM A;  3SPI A;  1Y74 A;  4I55 B;  2JVD A;  4DV3 B;  5L3E A;  3KG2 A;  1Q86 W;  2LW1 A;  2XHB A;  1B04 A;  2ZM6 B;  4B3R B;  3H01 A;  4X66 O;  2ZXW B;  3WG7 B;  3T1Y B;  1HNW B;  3CCL V;  3DGE A;  2AGA A;  3ETD A;  4HNA B;  4J7K A;  3ZJZ A;  4P9O A;  3AG2 C;  2WLJ A;  3DC6 A;  3UKM A;  1SQF A;  2QDO A;  1IBK B;  2A3Q A;  2LJ2 A;  5EK0 A;  2XUM A;  1AP5 A;  1SS3 A;  1XEQ A;  5GON B;  4MVS A;  4JV5 B;  4GCZ A;  1CEZ A;  1F23 A;  1MSD A;  5LP6 C;  3OR6 C;  4MVZ A;  2H8P C;  3F7V C;  1IVS A;  2VWJ A;  5ITZ B;  4P30 A;  5LGN A;  1YCI A;  1Q3E A;  4CC5 A;  3TK1 A;  1QHT A;  3VQV A;  2QM7 A;  4IHJ B;  1NH2 D;  4X62 B;  5J9P C;  1MNG A;  3T1H O;  3BEH A;  1SQV H;  2P06 A;  2QGN A;  1GAX A;  1YI2 V;  2WLI B;  4ASU G;  1S3J A;  5CA3 A;  4NXN B;  4J7J A;  3A2F A;  4HAM A;  2FML A;  1OCC B;  1B3Q A;  4LF7 O;  2UXC B;  4MVR A;  3UO2 A;  4WFH A;  4GKJ B;  1YHQ V;  2KKW A;  2AHY A;  3E35 A;  1YSC A;  1GO3 F;  4WBN B;  1T5E A;  4LF5 B;  2JS3 A;  3B8M A;  4GUN A;  4PI2 A;  5K1X A;  2Q7G A;  3X2Q B;  3W7W A;  4MVU A;  4MS2 A;  4CH6 A;  4BW5 A;  2E5L B;  1PV0 A;  5FNV A;  4B08 A;  3JAR A;  3AG4 C;  2NNU A;  4R50 A;  3ZRX A;  1SKV A;  5BR8 O;  3CJH A;  3K58 A;  3RWR D;  3BAA A;  2AW9 A;  1JOY A;  1DF5 A;  4PA3 A;  4I50 B;  4DV5 O;  2JDI G;  2E3C A;  3FB8 C;  5L3B A;  3PN1 A;  5JVD B;  4KHP O;  2WLN A;  4NXM O;  4TSF G;  1WA8 A;  4IIJ B;  4Q6G A;  4J42 A;  5KMG B;  2HJF C;  3P3P A;  2EZP A;  2GDS A;  4DR4 O;  5IWA B;  3K57 A;  4G27 B;  1QLN A;  4PA9 A;  3C3T A;  1SQX H;  3STL C;  2ZNJ A;  2RN9 A;  4FLX A;  3SPH A;  4OPA A;  3OT7 A;  5IYZ B;  1V55 C;  2BOB C;  1VMG A;  2OWO A;  5EIB C;  3WB0 A;  3AG2 B;  4X66 B;  4JTA B;  3PJS K;  1JFF B;  4EFE A;  1HP8 A;  3JD2 A;  4NTW A;  5JH7 A;  5LP6 B;  3T1C A;  3CPW U;  4DR7 O;  4PJ0 Z;  4TV9 A;  4B3S B;  2WAM A;  4DRX A;  5CB4 A;  2NLJ C;  4JTC B;  1PM9 A;  3P32 A;  2DMX A;  3ZMS A;  3SYA A;  4FJC C;  3ASO C;  5LYJ A;  3CP1 A;  4DV0 B;  4WCE V;  2Q73 A;  3ZMT A;  3CRC A;  4LBE C;  4DUZ O;  5JCO A;  1NBM G;  1P49 A;  4FZ1 A;  4MW8 A;  4GLX A;  2YSU B;  1VQ4 V;  4LF4 B;  1AIL A;  3RN4 A;  2P4V A;  1VF5 B;  3ZMV A;  1YIJ V;  3C90 A;  1SRY A;  2PF4 E;  2N04 A;  2GHY A;  5B1N A;  2ITD C;  5K1P A;  2IJK A;  1BCC H;  2JJ2 G;  5LHG A;  4KUM A;  2PI5 A;  1H8E G;  3CXH F;  4JI0 O;  4ICG A;  3RYF A;  1WP7 A;  1IX9 A;  4UV8 A;  5C8Y B;  4LF7 B;  1D5A A;  4X9Q A;  2XAJ A;  3CCR V;  2HLD G;  3AG4 B;  4TQF A;  3CHX A;  2CTQ A;  4GX0 A;  1UPG A;  4JI4 B;  2HFE C;  1EN5 A;  1XRE A;  2AHZ A;  4KXR A;  1GM9 A;  3LDE A;  4K0K B;  3J81 N;  2RQ6 A;  3CB2 A;  2OIG A;  2WLL B;  2Y4U A;  3FYI B;  3TGU H;  1VIB A;  3G80 A;  2P5O A;  1R1B A;  1R73 A;  2UU9 B;  2QTS A;  5BR8 B;  1QCE A;  3FFQ A;  2IJJ A;  1U97 A;  3E8B A;  2W6J G;  1IXB A;  4O2A A;  3CE2 A;  3UT5 A;  1FFT B;  4I55 A;  3CC4 V;  1VF7 A;  5LXT B;  2IH3 C;  1N0N A;  1I7F A;  3LSU A;  4I4T B;  2JEX A;  4HNA A;  1H2S B;  4LC1 A;  1ZSP A;  5BXZ A;  3LDC A;  3FB6 C;  1L0N H;  1R3J C;  4R8C A;  4RUF A;  4LFA O;  3N27 A;  5GON A;  4DV2 B;  3IJ4 A;  1S72 V;  4NTY A;  2BTQ B;  1I5X A;  3MD0 A;  3W7U A;  1O9G A;  1IBL O;  2ZIO A;  5IT9 N;  5ITZ A;  1CPY A;  2A9H A;  1OJH A;  1PP9 H;  5TIS Z;  3L74 H;  3ZHU A;  1SA0 B;  3HKE B;  2JEU A;  1K5S A;  3ASO B;  3HB3 B;  1PD3 A;  2LW7 A;  1AJQ A;  2B9Z A;  2UXB O;  1K9M W;  3UM7 A;  3OFN G;  1YVW A;  1ENV A;  4JI8 B;  4W4K A;  5L3D A;  2WLH A;  4TQD A;  1FKA O;  2WLI A;  3P3N A;  5DN6 G;  4GX1 A;  2DN9 A;  1VF6 A;  4I9Q A;  1XDC A;  2IH1 C;  1XIL A;  3E89 A;  4DUZ B;  4OXS A;  3E22 B;  3ZIA G;  3UO3 A;  3SDL A;  3WU2 Z;  3ZHR A;  4F6E A;  4FLV A;  2Q8V A;  5CA0 B;  1NTZ H;  2ZE8 A;  1L8D A;  2PUS A;  1M4U A;  5KX5 B;  3ASN C;  4WBN A;  2ZIN A;  1N33 O;  3OGC C;  2A79 B;  4O2B B;  4NB5 A;  4LFB O;  4JAV A;  4R6Z A;  2BCC H;  3OMA B;  1KC8 W;  4FLY A;  4JI3 O;  1HNX O;  4NKG B;  3CC7 V;  1ZX3 A;  4DV3 O;  2CUG A;  4JI0 B;  2UUB B;  2ZR2 A;  3SYP A;  1NT2 B;  2GTS A;  1ZTE A;  3BY6 A;  3T1Y O;  4I50 A;  4RQF A;  4MTF A;  5KAI Z;  3BA8 A;  2VQE B;  2R9A A;  1M56 C;  5JVD A;  1XQ8 A;  5IE9 A;  4FFB B;  4RO2 A;  1LR1 A;  1SF9 A;  1IBK O;  4IIJ A;  3OUS A;  5KMG A;  1FJG O;  2IU3 A;  5IYC O;  2QSA A;  4TOI A;  1ZUQ A;  3E8G A;  1YJW V;  1BGY H;  1P7G A;  3FAV B;  2YID A;  1I08 A;  4YHH B;  4X20 B;  3OR7 C;  5CN0 A;  3W7X A;  1Q6U A;  1DK1 A;  2EJ7 A;  1TAE A;  3G6B A;  1WJZ A;  5IYZ A;  4DV1 B;  3U0Z A;  1KQS U;  2H94 A;  3CD6 V;  3K0G A;  4QPJ A;  1SZT A;  1JQ0 A;  4YIP A;  4MSW C;  1ZL8 B;  1JFF A;  2Y0I A;  2GSM B;  5LP6 A;  4B7E A;  4JI6 B;  2ZQM A;  2IBZ H;  4X1K B;  2YI9 A;  5IJ0 B;  1EM1 A;  3FB5 C;  1BZK A;  1QVG U;  2F95 B;  3BVO A;  4JI7 B;  2XAG A;  2FKX A;  2Q69 A;  2OIE A;  1K7D A;  2UXC O;  2CTW A;  4U3J B;  4WFA V;  2GBO A;  2PI4 A;  2CH7 B;  4GKJ O;  2DWD C;  4DK1 A;  3DTU B;  4UXN A;  4JZG A;  3RVZ A;  1FXV A;  4YY3 O;  2FB5 A;  2ZCE A;  5LBQ A;  1CXZ B;  2VRZ A;  1S76 D;  2ODM A;  2LGQ A;  2WA4 A;  2Z5U A;  5KA5 A;  1E1Q G;  1XMO O;  1K8A W;  2WSS G;  3HKD B;  4B7K A;  1QNM A;  2UXB B;  3E86 A;  4MT8 A;  1OHH G;  3CRQ A;  2E76 B;  2CTR A;  1VQ7 V;  1BS3 A;  1W0K G;  4JTD B;  1XNR B;  1K97 A;  1SQP H;  2IM9 A;  3RYC B;  5IJ9 B;  2PTM A;  2GUZ B;  5BY1 A;  4RQE A;  3SR2 C;  1Q90 D;  4DV6 O;  3F7Y C;  4OPH A;  2Q5Z A;  2P4K A;  4PDR A;  2ZT9 B;  1V54 C;  1M90 W;  5J2T B;  3CEI A;  3B77 A;  3A0H Z;  4H33 A;  1GRJ A;  4KP4 A;  2P22 C;  2Y4T A;  5JWP A;  1XI1 A;  1NVP B;  2WLL A;  2WPD G;  5EBM C;  1OCO C;  1M56 B;  1HNX B;  2IJI A;  4P2Z A;  3G71 V;  2P6J A;  4PA4 A;  2XT9 A;  4QIW F;  1GM7 A;  3F5T A;  4QE7 A;  1VQO V;  5KLV H;  3P30 A;  1Z2G A;  2UXX A;  2QWQ B;  5LXT A;  3Q4H A;  4UCT A;  3CCQ V;  4B3S O;  1N34 O;  3SYO A;  2LFS A;  4QJF B;  2R70 A;  1Q43 A;  2Q7E A;  4I4T A;  1FJG B;  4LH7 A;  2MW2 B;  5DM6 V;  2P7T C;  1FXK C;  1SET A;  2ZE6 A;  4GT1 A;  2Q0A A;  1H2G A;  3U11 A;  3RYH B;  4DV0 O;  1FPO A;  2LP7 A;  4AIL C;  3RW0 A;  4CC6 A;  1NQT A;  5DEC A;  3AG7 A;  1Q82 W;  2PY5 A;  2BTQ A;  2Q7H A;  2YIB A;  2OYQ A;  1GN4 A;  3ABM C;  3K04 A;  3OMI B;  4LF4 O;  5JJJ B;  4IT5 A;  2RNB A;  4PI0 A;  1PNL A;  3LUT B;  4X1I B;  4F6R B;  2VQF B;  1SA0 A;  3HKE A;  5FL7 G;  2Q0O C;  2EIK C;  2X6A A;  5LMU B;  1PKX A;  2QR4 A;  5A9G A;  1VAR A;  1Z5V A;  1ZWI C;  3AG1 C;  4BR6 A;  1HDJ A;  4CBC A;  3G4S V;  2QWO B;  2ILM A;  3SYQ A;  4X1Y B;  1YZB A;  1OV9 A;  3SPJ A;  2N05 A;  2ETN A;  3E22 A;  4YY3 B;  1W59 A;  4JI4 O;  1KB9 F;  5CA0 A;  4HZ3 A;  2WLK A;  3M8A A;  4LNU B;  4K0K O;  3QO7 A;  2X7R B;  1K34 A;  1XMO B;  3K59 A;  5KX5 A;  3JAL B;  4ABM A;  5L3F A;  2KG7 B;  3GWO A;  4O2B A;  4YJ3 B;  2UU9 O;  4RAI A;  1YTF D;  1Q6I A;  1QBZ A;  3RYI B;  1FFX B;  4UB8 Z;  4TUY B;  2W0F C;  2JS5 A;  1V54 B;  1IDS A;  4X89 A;  3HR0 A;  4L87 A;  3A0B Z;  1LUV A;  4H37 A;  1OCO B;  4DV6 B;  5KHG A;  1M5I A;  1DTO A;  4FFB A;  2QM8 A;  4PA7 A;  4FVM A;  5KHJ A;  5GW7 A;  4U7N A;  3FYE B;  4DV2 O;  4NYK A;  3DSQ A;  2A0L A;  3FAV A;  1D2D A;  4UVA A;  2HVK C;  5BZB A;  3CS5 A;  4P9P A;  4X20 A;  4CS3 A;  4AQY B;  3ZCC A;  3ZS8 C;  1NU1 H;  2YEV B;  1MG1 A;  3B4S A;  5J2U B;  1FXK B;  3E8H A;  1NR7 A;  4X65 O;  1N34 B;  1ZL8 A;  4DO2 A;  4JI8 O;  2HP8 A;  3ABM B;  2DOS A;  4KL1 A;  4X1K A;  4F4L A;  1V9P A;  5H5N A;  3T2M A;  5IJ0 A;  4ZBM A;  4UV9 A;  4XDL A;  1WN7 A;  2IJH A;  5D5Q A;  3QNE A;  2QKC A;  1BMF G;  1GKF A;  2XND G;  5KUK A;  3I56 V;  4PHZ A;  1AR1 B;  1A32 A;  1H2K A;  1BQ0 A;  5L3C A;  2CE4 A;  1Q8I A;  3GWK C;  4FM0 A;  2EIK B;  1PL0 A;  4U3J A;  4DV4 O;  4NTX A;  3A8T A;  3JD1 A;  2CH7 A;  5L3G A;  2D2C B;  4BWA A;  1S5H C;  1AI5 A;  3AG1 B;  5HFM A;  1QR9 A;  1NJI W;  1GN2 A;  3K0D A;  4IGG A;  2YC0 A;  1XBL A;  1HWY A;  5KAF Z;  2F4V O;  4ZHQ B;  4ZKI A;  1NS1 A;  3EVK A;  2L6L A;  3HKD A;  1G1X B;  1CP9 A;  2UUB O;  2QWN B;  1GN6 A;  1JCH A;  5IYD O;  2DW4 A;  4Z1M G;  3JD4 A;  2JJ1 G;  1WPB A;  1DGS A;  3SJB C;  3C3S A;  1TA8 A;  2VQE O;  4O4I B;  3J80 N;  1RM1 C;  1BT8 A;  3RYC A;  5IJ9 A;  4JI2 B;  2GUZ A;  2E74 B;  1GM8 A;  5CBG A;  1US6 A;  4JAS A;  1XL6 A;  3ZRW B;  1N32 B;  2FTK A;  2DQ3 A;  1Q5O A;  4YHH O;  2JIZ G;  2Q9L A;  5J2T A;  1D5N A;  3OW2 U;  4JI5 B;  4FFK A;  1RSO B;  4PDL A;  1NTK H;  1H2N A;  3F5W C;  3SJC C;  4DV1 O;  3ZRS A;  1XHZ A;  3R65 A;  1OCR C;  1THZ A;  5H6R A;  2HVJ C;  3HKC B;  3CCU V;  1DF4 A;  1AI4 A;  1BL8 A;  3Q4H B;  3M7M X;  2K1E A;  2QTO A;  3QG5 A;  4RWU A;  2P90 A;  4O4J B;  5CBF A;  4JI6 O;  1RPR A;  2AXT Z;  3GB7 C;  1V55 B;  3SJQ C;  3MHS C;  3I5D A;  3B09 A;  2HR3 A;  4JI7 O;  1I5Y A;  5BMV B;  4JAA A;  3RYH A;  3ABL C;  1ZLZ A;  2AZ2 A;  4O4L B;  2YDE A;  5B3S C;  1U96 A;  1TGO A;  2EX3 A;  5E1A C;  3CMA V;  1R6N A;  4JAU A;  3IC9 A;  2W6I G;  4X1I A;  4X65 B;  2WLM A;  4F6R A;  3CX5 F;  1VEW A;  2B5U A;  3D3Q A;  1SES A;  1K92 A;  2R9R B;  4K3A A;  3CCJ V;  2QWP B;  3G67 A;  3NXS A;  2OTJ V;  1XNR O;  1G4Y B;  3JCU Z;  4EKW A;  3KCY A;  1HW7 A;  4CZZ A;  1RPO A;  2ZE7 A;  4ZI7 B;  3H1H H;  1G8M A;  4DV4 B;  1VQ9 V;  4X1Y A;  3H1L H;  4XDK A;  1XOU A;  2IW5 A;  4I5S A;  5JJE B;  3APO A;  4HBN A;  1YDX A;  1TUB B;  2LGW A;  2EIM C;  3G6E V;  4FK5 C;  4WFF A;  1QQC A;  4JYA O;  4LNU A;  5CBH A;  3KCX A;  2F4V B;  1VQ5 V;  1EFR G;  4DXW A;  3JAL A;  2HG5 C;  1RM1 B;  2KG7 A;  3BCC H;  4YJ3 A;  3OE7 G;  1ROP A;  3AK1 A;  4FIP C;  2YIA A;  4U3F H;  3CME V;  1N4C A;  4EB6 B;  3RYI A;  1FFX A;  3O9O A;  4TUY A;  2AZ0 A;  3E8F A;  1KUQ A;  2OCH A;  1HNZ O;  2Q4P A;  3ML0 A;  3M99 B;  1TVK B;  3D8C A;  1L1F A;  2HHH B;  1Z5W A;  3STZ C;  2NR5 A;  1NTM H;  3JAW B;  3UCS C;  4IL6 Z;  3LSQ A;  1OCR B;  1Q81 W;  4FMT A;  4A5U B;  2ZD9 A;  4Q20 A;  4LF6 B;  5EBW C;  3OEE G;  1GK9 A;  1NZ6 A;  1Q7Y W;  2X6C A;  1R3L C;  4J10 A;  5IY5 C;  3SJA C;  4G2K A;  3CRR A;  4KFM A;  4CH4 A;  2LO1 A;  1LUW A;  2ATK C;  3N2K B;  4D7S A;  4FLU A;  4HYO A;  1HR0 O;  2YEV A;  2ADQ B;  2UUC O;  5LOV B;  2VQF O;  5J2U A;  1FXK A;  2GTA A;  1H2L A;  5FPO A;  4GYC B;  5LMU O;  4DR1 B;  4B3M O;  4CS2 A;  3TCU A;  3D3I A;  3T4D A;  5KHK A;  3ABL B;  3ABK C;  1PPJ H;  4C7U A;  3R66 A;  5B3S B;  3K9A A;  3LNM B;  2R72 A;  1VQ8 V;  4LF8 O;  1NKD A;  2V4D A;  2ZKO A;  4FPP A;  1I94 O;  3K3W A;  3IFX A;  1EN4 A;  4OX9 O;  3BA9 A;  2W0X A;  2EIL C;  4J9Y B;  5EBL C;  1K33 A;  4DR3 O;  1JVM A;  2ZR3 A;  3JCZ A;  4TV8 B;  4DV7 O;  1MAB G;  3K06 A;  4DW1 A;  3B40 A;  4FM1 A;  3ZBH A;  4UCV A;  2UUA O;  4ZHQ A;  1BQZ A;  5H6Q A;  5B1O A;  1B6Q A;  2Y48 A;  3EXA A;  3FKS G;  4GZR B;  3SGI A;  2FL4 A;  5LA6 B;  4O4H B;  1JPX A;  2EIM B;  3ASN B;  3E83 A;  4X88 A;  3K03 A;  2GV9 A;  1EZJ A;  1XMQ O;  1K5Q A;  4O4I A;  3MHH C;  5EC2 C;  3CCE V;  2QWR B;  1MOF A;  3SPG A;  5E79 Z;  2PYJ A;  2A06 H;  1WB7 A;  1WP8 A;  3OEH G;  4JF3 A;  5IYB O;  4JYY A;  4JYA B;  3JAK B;  5LGT A;  5CMU A;  3HPL C;  3ZRW A;  1J5E O;  3JD0 A;  3WB2 A;  2JGD A;  4H13 B;  4EEQ A;  3L71 H;  1RSO A;  4AQY O;  2ZDI C;  2P67 A;  4H44 B;  2L35 A;  4D6T H;  3B2E E;  3HKC A;  1WPX A;  3CXC U;  1KP3 A;  1M57 C;  1HNZ B;  3LNN A;  1Y66 A;  2JGU A;  4K8Z A;  1K3E A;  5EYP B;  3EHB B;  3OD4 A;  3CCM V;  2OCC C;  5IY5 B;  4O4J A;  4ZOL B;  3U10 A;  4FLZ A;  2Z3Y A;  4JI1 B;  3J7A U;  4MTO A;  2UXN A;  1MMM A;  4LWS B;  1KKC A;  5BMV A;  2M7W A;  2EBO A;  3ABK B;  4GKK O;  2C2A A;  4WFB V;  1XHX A;  2EUL A;  2Y69 C;  4O4L A;  2YI8 A;  3QVN A;  3T4Z A;  1HR0 B;  2UUC B;  3ZX6 A;  1AJN A;  3CCS V;  4UCO A;  4BIZ A;  2VWK A;  4B3M B;  1ORQ C;  1VQL V;  1FS0 G;  2CK3 G;  4NVP A;  3W7T A;  3ZRV A;  2EIL B;  3KKY A;  4J80 A;  1S77 D;  2YXH A;  2Q67 A;  4N23 A;  4WF9 V;  1UFI A;  4LF8 B;  2F93 B;  3O65 A;  1GN3 A;  1JMK C;  5IDJ A;  1I94 B;  3BFR A;  4OX9 B;  4ZI7 A;  4JI2 O;  1P84 F;  4DR3 B;  2DYS C;  5KA6 A;  5EZY B;  2F43 G;  3WB1 A;  1AB3 A;  1WAZ A;  3IAY A;  4DV7 B;  1KP2 A;  4PV1 B;  1N32 O;  4YJ2 B;  4WFE A;  1TUB A;  4FZ0 A;  4UVC A;  2Q6A A;  5B66 Z;  1B06 A;  3JAM N;  1PL4 A;  1Y76 B;  4JI5 O;  5F2V O;  2UUA B;  4I0X B;  4J41 A;  2EIJ C;  2KQX A;  4QGP A;  4MW3 A;  3N2G B;  2Z0A A;  4UCU A;  1AJP A;  3CCV V;  3D36 C;  3E2E A;  1SQQ H;  1I0H A;  4EB6 A;  2UXD B;  5LHI A;  4X8A A;  2HEP A;  3CC2 V;  3RBZ A;  4MVM A;  1VQK V;  1YEW A;  2FYU H;  1EZV H;  1RP3 B;  2BSK B;  3TXQ A;  1MZF A;  2YUA A;  1XMQ B;  4LFC B;  3K08 A;  1XNQ B;  1VP7 A;  3VOU A;  1TVK A;  3K5O A;  1K4D C;  3CRA A;  3VBB A;  4UB6 Z;  2VS0 A;  3JAW A;  3A0R A;  2QM4 A;  3S3W A;  5CA1 B;  1J5E B;  1MA1 A;  3OTO O;  3L75 H; 
#chains in the Genus database with same CATH homology
 4X62 O;  5LMN O;  1IBL O;  4JI8 O;  2DOS A;  4DV6 O;  1YZB A;  4OPH A;  5H5N A;  2UUA O;  4LF6 O;  4X66 O;  5BR8 O;  5IT9 N;  4JI6 O;  1DK1 A;  4X64 O;  1KUQ A;  1HNZ O;  1A32 A;  4JI4 O;  2AGA A;  4DV5 O;  4B3T O;  4NXN O;  4JI7 O;  4DV4 O;  3M8A A;  4K0K O;  2LW7 A;  1IBM O;  4KHP O;  4JI0 O;  1X59 A;  2UXB O;  1XEQ A;  4NXM O;  3O65 A;  1XMQ O;  4A5U B;  4DUY O;  1FKA O;  2UU9 O;  4DR1 O;  4DR4 O;  3F5T A;  4JI2 O;  2F4V O;  4LF5 O;  1NS1 A;  1AB3 A;  1J5E O;  4B3S O;  3SDL A;  1N34 O;  1G1X B;  2FKX A;  4OPA A;  2E5L O;  3J81 N;  1N32 O;  2UXD O;  2UXC O;  1HR0 O;  2UUB O;  2UUC O;  2JRI A;  2ZM6 O;  2VQF O;  4B3R O;  4GKJ O;  4AQY O;  3T1H O;  4LFC O;  3JAM N;  4JI1 O;  4DV0 O;  1R1B A;  1HNW O;  1XNQ O;  5LMU O;  4JI5 O;  4B3M O;  5A2Q N;  4YY3 O;  1XNR O;  2VQE O;  3J80 N;  1N33 O;  2DJV A;  4LFB O;  2Z0A A;  4DR6 O;  4DV2 O;  3R66 A;  3RT3 C;  4DR7 O;  4LF4 O;  1XMO O;  4JI3 O;  1HNX O;  4JV5 O;  1D2D A;  4LF8 O;  4DR2 O;  5LL6 Y;  4LF7 O;  4DV3 O;  4DR5 O;  2N74 A;  2ZKO A;  4YHH O;  1I94 O;  5FLX N;  4LF9 O;  5IWA O;  4OX9 O;  3T1Y O;  1N36 O;  3J7A U;  5BXZ A;  4DR3 O;  4JYA O;  1FYJ A;  4DV1 O;  1R6T A;  4LFA O;  4DUZ O;  4X65 O;  4DV7 O;  4GKK O;  1F7Y A;  2HHH O;  1IBK O;  1AIL A;  1FJG O;  3OTO O;  5BY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...