2UUAO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 35
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uuaO00
5BXZA 5LMNO 4JI5O 1N36O 4LF7O 1AB3A 5IWAO 2AGAA 3O65A 3J80N 4B3MO 1HNXO 2UUBO 4GKJO 1AILA 4JI7O 4DV3O 1YZBA 3J81N 4LFBO 4JI8O 3R66A 2JRIA 4LF8O 4JYAO 1J5EO 2DOSA 4DV6O 4LF6O 4X66O 2ZM6O 4X64O 1FKAO 1A32A 1N32O 4OX9O 4JI0O 4DV0O 2LW7A 1X59A 4DV2O 5LMUO 4DUZO 4DR1O 5LL6Y 5A2QN 3OTOO 4DV4O 1IBMO 4OPHA 1XMQO 4DR2O 4K0KO 1HNWO 2UXDO 2VQFO 3T1HO 2UUAO 4DV5O 4YHHO 4LFCO 2ZKOA 5BR8O 2N74A 2F4VO 3SDLA 3JAMN 1G1XB 2E5LO 3J7AU 1IBLO 4LF4O 4B3RO 4JI1O 2UXCO 1I94O 4JI4O 4DR6O 4A5UB 5BY1A 1F7YA 4JI3O 5FLXN 5H5NA 4JI6O 5IT9N 4KHPO 4YY3O 4LF5O 4AQYO 3RT3C 1R6TA 4DV1O 3M8AA 4NXNO 4DR7O 1FYJA 4X65O 4DR5O 2HHHO 4DUYO 1XMOO 4LFAO 1DK1A 1XEQA 3T1YO 4NXMO 1FJGO 4GKKO 4B3SO 1IBKO 2UXBO 1NS1A 2UUCO 4DV7O 1HNZO 1XNQO 4OPAA 4DR3O 4DR4O 4LF9O 2DJVA 1HR0O 4B3TO 2VQEO 1N33O 3F5TA 4X62O 4JI2O 1D2DA 1R1BA 4JV5O 2UU9O 1KUQA 2FKXA 1XNRO 2Z0AA 1N34O
chains in the Genus database with same CATH superfamily
3R65A 4YXWG 1Q6UA 1RPOA 4HZ3A 3O65A 4GZRB 5EIBD 4BW5A 3ASOB 3TETA 1BQZA 3K5OA 2EJ7A 2BE3A 3ZRVA 1AR1B 4ABMA 2V7QG 2Y69C 4JGSA 4UVBA 1X4TA 2WLLB 2YIAA 4UXNA 4G28B 2FTKA 1TUBA 3OEEG 1SKVA 2YEVA 2P6JA 3SPGA 2ZNIA 3UKMA 4LH6A 1RSOB 3GWOA 1US6A 2ADQB 3CSXA 2UXXA 1P4RA 3QO7A 2ZE7A 2LJ2A 5IJ9B 2JGDA 1H8HG 4GKKB 1GKFA 3CCMV 3IFXA 4XBFA 5CA0A 4MTXA 2K1EA 4ZOLB 1OCOB 3DC5A 2XT9A 1H8EG 4FLVA 2JJ1G 2ZKOA 3ZMUA 4K3AA 1GH6A 2IJIA 1VP7A 4PELA 3JAMN 1IXBA 3WG7B 5JH7A 1NBMG 1V9PA 4F6RB 5IJ0A 1TUEB 4WBNB 2WLKA 3JD2A 2UUBB 3JATB 1OCCB 2X7RB 4B3TB 1M1KW 4J10A 3BY6A 4JZ2A 2M7WA 4CS3A 4PA4A 4ZOLA 1IBMB 4K8XA 4LFCB 3JALA 2UXDB 4X88A 2ZDIC 3ZIAG 2WPDG 1E79G 4FLYA 4B7EA 1SZXA 2LGQA 3AG4C 2YS8A 3WG7C 1BZKA 4JAAA 4X62O 1K33A 4PDRA 2GUZB 2HLDG 1QLEB 1XNRO 1GM8A 2Z0AA 4U7NA 1VQ7V 1I5YA 2RNBA 4GX5A 3BABA 5LYJB 4HNAB 5CBGA 5CA3A 2WLHA 4LF5B 3N2GA 5LXTA 1W0JG 4FLWA 1WAZA 1OCCC 2IH1C 1SC5B 2Y48A 2ZM6B 3FD9A 3H1HH 5IY5C 3H9VA 5F2VO 2X0LA 3U11A 1VMGA 3TXQA 5J2TA 2IU0A 4PA9A 2QWOB 2O57A 4JTAB 1FKAO 1MABG 2LFSA 4DV5B 1M4UA 4I0XB 4I4TA 1GN4A 2BTOA 2D2CB 4QPJA 3JD4A 4F6EA 5LMUO 3CC7V 5K1PA 3LNMB 2H8PC 4ZIBA 5CA1B 1GAXA 2CTPA 1NVPB 3SPIA 1K4CC 4NVPA 3S3XA 5LA6B 1JMKC 1S72V 1P84F 1Z2GA 2QKSA 1SQBH 2UXCO 4LF8B 1IXMA 2JDIG 3IC9A 3ZHUA 5LMNB 3JAKA 3VQYA 1I08A 3AK3A 4KXRA 2QDOA 3BVOA 3RGBA 5JJEB 2QM7A 3AK2A 2YIBA 2ITDC 2OCHA 4DV1O 3RYIA 1FYJA 2AXTZ 3C3TA 4O2AA 3T1YO 2ZR3A 4NXMO 1I94B 2OT5A 1ENVA 1U96A 2HFEC 4XDJA 4NR1A 1NQTA 2D3OW 1K9MW 2VQEB 4PHZA 4DV0B 1THZA 4PI2A 1ZL8A 2Q0OC 3RVYA 3D3QA 4O2BA 2Q7GA 5KLVH 4GT1A 3J80N 3NR7A 2AZ0A 5LHIA 3K03A 2ZE8A 1JX9A 4I9QA 2F95B 5B1NA 1R3LC 4BAYA 2X6AA 3CWBH 4K0KB 4LFBB 5C8YA 2F1MA 5IYZA 3CJHB 3ZN1A 3JARB 4IHJB 1FFXB 2P90A 1KQSU 4UCSA 5B5EZ 1D5AA 1N8RW 2XAHA 1F23A 3OM3B 1OCZC 3S3WA 3FFQA 3CCRV 3A8TA 3HKDB 1N0JA 1YF2A 1R3KC 3CX5F 1S5LZ 4DYLA 4IIJB 4LF6B 4DR2O 2NNUA 4DK0A 1RM1B 1IBKB 1Y74B 3STZC 1AR5A 4UCUA 3E8HA 1K5QA 3ABUA 4I0XA 3SJQC 1QU7A 4I4TB 4C7UA 3J7AU 1CPYA 1Y76B 3ZMSA 1VEWA 4JI3O 1MOFA 2YIBD 3AG2C 2R70A 5DEDA 2XHBA 1SETA 4BIOA 1T5EA 2NN4A 5EIBC 5KUMA 3ASNC 1XDCA 2YI9A 4B3RB 3OTFA 2PGGA 4DUYO 4MW3A 1P49A 2QJ1A 3CJHA 1PD3A 1MSDA 1W0KG 1YJ9V 4EEQA 5BR8B 2ZXWC 5GTIZ 3FB7C 1R6KA 3QNEA 1SZTA 1YJWV 1PL0A 3CRRA 1GN3A 3QG5A 1SA0A 3K79A 4JF3A 4TQFA 5DM6V 3BA8A 4X1KB 2UXBB 2YI8A 2E75B 3U0ZA 4FPPA 1PNKA 1PKXA 4X20B 4DRXB 2JK5C 3VQVA 1NZ6A 4FM0A 3F5WC 4TV8B 3ETEA 2VRZA 2EIKC 2QWPB 4X66O 4FMTA 1WLEA 1YVWA 3RYHB 3LSSA 3RYCB 1XI1A 3EHBB 4JI0O 4DV0O 3WB2A 4I5SA 4FLZA 1Q5OA 3MAQA 1O9GA 3K0GA 4DV2O 4LF9B 5LL6Y 1AI6A 5EZYB 2E74B 4PD4F 2WLLA 3T2MA 4N21A 3ZRSA 2W0XA 3CXHF 4LF4O 2EZPA 4DV1B 4FJCC 5GONB 1PP9H 4O4IA 2YXHA 2V1DA 2AZ2A 1I7FA 4DRXA 4EFEA 1K4DC 1EN6A 1OZ0A 1NKDA 4NXNO 5EBLC 2ETNA 4GCZA 4DR5O 2JEUA 1NTMH 1SF9A 2GTSA 2EX3A 4MT8A 3ZRWA 4MVOA 4Q6GA 4CS4A 4ZHQB 4ZI7B 1N4CA 3ZJZA 4FFBA 1EBOA 3W7WA 3HKBB 1DGSA 3BFRA 4OPAA 1L0LH 3SYOA 4X9QA 3ZX6A 1XL6A 2Q5ZA 1DF4A 2PI5A 4LH7A 3G6EV 4UCTA 2YDEA 1YIJV 3JCZA 1FJGB 4H13B 1Q6IA 1TVKB 1XMOB 2ZT9B 4P30A 2FKXA 5JQGB 4DR7B 5L3CA 4MVQA 5IWAO 3E8FA 3P32A 3IJ4A 4H0LB 2LP7A 1KP3A 1L8DA 3DGEA 3B09A 4FK5C 4NTWA 4ZHQA 5LGTA 3B8MA 3SGIA 1IURA 2QWNB 5J2UA 3RYHA 1N36B 1XNRB 1VARA 3H1KH 5A9GA 3H1IH 4X64O 2RQ6A 1JR9A 1K34A 1JA8A 4CH4A 4JAUA 1F51A 2DWDC 3K9SA 4QNHB 1CP9A 1QQCA 3SJBC 1KYOF 5J9PC 3DXRA 3OE7G 2CH7B 2P22C 2X6BA 4DXWA 2PI4A 1YEWA 5LHGA 5ITZB 1FS0G 4QIWF 3L72H 2CGOA 2Q8VA 1YTFD 1KKCA 3OAAG 3ABMC 4E4EA 1NTZH 1VQPV 1CEZA 4KL1A 3TGUH 4MS2A 1S76D 3JYCA 5B3SC 4CBCA 4B3SO 5LGNA 1TUBB 1QHTA 2ILMA 5CB4A 1XNQO 4JV5B 4FFBB 5CBFA 1PV0A 4MW8A 3KG2A 5L3GA 1QR9A 5KAIZ 2VQFB 1HNZB 1L0NH 3G67A 2CGNA 4J11A 1EZJA 3OTOB 5C93A 4JV5O 1ZSPA 3OMAB 3THOA 1XOUA 2CE4A 5FNVB 2C2AA 3LSUA 3CS5A 3M7MX 2F43G 4Z1VA 3E22A 3WU2Z 1Y67A 4I7ZB 2UXCB 2H3OA 1J5EO 3CCQV 1WB8A 3DSQA 1BGYH 4JASA 3D36C 3AEIA 4UVCA 1MZFA 4PDVA 3IGAC 4H37A 5H6QA 2IBZH 1XNQB 1KP2A 2XAQA 2ZIMA 4MTOA 4P9OA 1HR0B 3L71H 1AI4A 2EILC 3E83A 1IDSA 4RUFA 1GMGA 3CEIA 3JSLA 1UJWB 3FB8C 1BHBA 5BMVA 2WLIB 3HKCB 3E22B 4NB5A 4DV5O 2PTMA 2CH7A 2EIMC 2HHHB 2YSUB 1SA0B 1IBLO 4GKJB 3GVMA 1MNGA 3W7TA 1SQVH 4JI4O 1Q43A 5EBMC 1W59A 5FPOA 1S5HC 2R72A 2A7WA 3E89A 1NU1H 3VQWA 4LF5O 2CTRA 1R6TA 4P2ZA 5KHIA 2PYLA 1OCRB 3CCLV 1WP7A 3G80A 3RBZA 2UU9B 5B1AB 4AILC 4GX2A 4LNUA 2XAGA 2B1IA 4JI4B 5JVDB 1LUWA 2HVJC 1H2MA 4EB6B 4DV7O 5IYDO 1FXKA 1K5SA 4QPKA 3ZHTA 4PA7A 5IYCO 1OCZB 2HKOA 1VIBA 3F5TA 3EFFK 1U97A 4HAMA 1S5JA 3FAVB 2UUBO 1KC8W 4MVUA 4GKJO 4DR5B 4NXNB 1AVMA 4D6TH 2Z3YA 4DK1A 5CB4B 4XDKA 2QEXV 2ZE6A 5E79Z 1VQ9V 4ASUG 3WFVA 3K9AA 2FMLA 1SQPH 2LW7A 4UV8A 4X1KA 4MTFA 5LP6C 3UO3A 5A2QN 3C90A 3OTOO 3CXCU 3IAYA 2QSAA 4LCUC 5L3DA 2ARHA 2H94A 2CTQA 4IHJA 3BA9A 2VQFO 1QLNA 2XUMA 3L9DA 2YIDA 4I9WA 4DV2B 5LGUA 3ZHRA 4J9ZB 2W0FC 2F66C 4WFBV 1QNMA 2EINC 2NR5A 1B04A 5KMGB 3N27A 3K57A 3CYOA 3JD3A 3ETDA 3IC7A 4LR3A 4HBNA 1NT2B 2IW5A 5JH7B 3Q4HA 2E5LB 4TSFG 4X20A 2WSSG 5J2UB 2L35A 3EVKA 2UUAB 3B40A 2UXBO 4DW1A 2OCCC 3B77A 1ZTEA 3HR0A 1H38A 2P5OA 5KHGA 2QE7G 4UVAA 1H2KA 4K8ZA 3LSQA 2Q0AA 2ZD9A 3LDDA 2EINB 1BL8A 3OGCC 4RQEA 2NLJC 4JYBA 1FPOA 1JPXA 1Q82W 4WFGA 4DV3B 2BSKB 4JI6B 3K3WA 3T1CA 2EJRA 2P4KA 3AG3C 4K35A 4W4KA 1EM1A 2V4DA 4BIUA 3OW2U 5CA1A 4TUYB 3AG4B 3DC6A 3NXSA 2PZSA 2MW2B 1N0NA 2CUGA 3W7SA 4I50A 5IJ0B 1BQ0A 1Q3EA 2X6CA 1KMIZ 5E1AC 4IIJA 1H2SB 4X64B 4CS2A 4DUYB 1PNLA 4DR2B 2DYSC 3HKDA 2L6LA 2Q6AA 3OR7C 4TUYA 3JAWB 4YJ3A 3APOA 3FKSG 3L73H 3K59A 4U3FH 3ETGA 1YTFB 3I56V 1Q8IA 3RYIB 5CA0B 5GTHZ 5BY1A 2JGDB 4CC6A 1LUVA 2K9PA 4UCOA 1MG1A 4NTYA 2XAFA 3M8AA 2B1GA 4BIZA 3GB7C 1JVMA 1M9NA 3X2QB 2XOKG 3MDSA 1PL4A 4UB6Z 2F4VB 2DYRB 4YIPA 1RFYA 4WFHA 3T4DA 1HNWB 2DQ3A 3CPWU 4EKWA 3UM7A 4FM1A 1K92A 3T4ZA 4MVSA 3DXRB 3ABTA 2QWRB 3HKEB 5EYPB 1WN7A 2JS3A 3HB3B 2Y4UA 4DUZB 2JGUA 2OTLV 1DF5A 3K06A 1O9HA 2DN9A 5J2TB 3CMAV 2VQEO 1MA1A 1WA8A 3CE2A 1WJZA 4JZGA 1NH2D 1N34O 4FLXA 5LBQA 5GW7A 3Q4HB 2AGAA 1P7BA 4Q20A 2AW9A 1KB9F 4LF4B 3CCSV 5LOVB 1AILA 3I55V 1M57C 3AG1B 2JJ2G 5BMVB 3BRCA 1Y4MA 2JRIA 2KKWA 2Q7HA 3ZN0A 1PNMA 4JYAO 1ZX3A 2DOSA 1HDJA 2EULA 2OIGA 2ADPA 3CC4V 4KFMA 2GUZA 3ZEDA 5LXTB 4W4LA 3F7VC 1A32A 1RPRA 4LC1A 1WPXA 4O4JA 3CRQA 5IY5B 3OD4A 5KX5A 1SQFA 1JOYA 4DUZO 3CMEV 2CAZC 5B1OA 2ITCC 4UV9A 3HPLC 1HNWO 2WLMA 1D5NA 1YDXA 2BOCC 5BR8O 2YXLA 2F4VO 2ZXWB 3LDEA 3QVNA 1UPGA 4LWSA 1NR7A 3ZRWB 2XAJA 4A5UB 1S77D 3RWRD 4YIOA 1R73A 4I55B 4R8CA 2DQ0A 1L1FA 1AROP 1ZAUA 3AG2B 2KG7A 3ZS8C 1E1QG 2OIEA 4PV1B 1MZEA 1K97A 3E8GA 4GX0A 1AP5A 3RN4A 4WCEV 1QVGU 5L3EA 4JYYA 2IM9A 3JARA 1BMFG 3W7UA 3E8BA 4GUNA 3UQ8A 2Y4TA 4UB8Z 4DR3O 3SYPA 3ZHQA 5FPRA 2AHYA 4U3JB 3QF7A 2Q9LA 2EILB 3O9OA 5EK0A 4FFKA 2QKCA 1COWG 5KHKA 1R1BA 4PJ0Z 2UU9O 3FYIB 2JS5A 1FXKC 2ZQMA 2OYQA 4ZBMA 3P3PA 1AB3A 4OGQB 5L3BA 3WB0A 4DV3O 3J81N 4LFBO 1TA8A 3WB1A 1XILA 4QE9A 2GBOA 4JYCA 5BZBA 3CD6V 1R3IC 4LF6O 3N2KB 1IBLB 2QM4A 2OWOA 1XQ8A 2EIKB 2B9ZA 1Q7YW 1N32O 4RO2A 1M56C 1OCRC 4TT3G 1NVPD 3ZMZA 5B1AC 5HFMA 2QKAA 4Z2WA 1IBMO 5D5QA 4YJ2B 1K8AW 3OEHG 4OPHA 5IE9A 4K0KO 4X8AA 1K7DA 4CZZA 1MMMA 1BCCH 3PJSK 1G1XB 2E5LO 3ABLB 4O4HB 2Q7EA 4FZ0A 2QWQB 1I94O 4N23A 1G8MA 4G2KA 1BS3A 1JQ0A 3UCSC 1SQGA 3BAAA 4FVMA 2HR3A 2Q67A 1HNXB 3CHXA 1S3JA 4AQYO 4J80A 1Y74A 4PA3A 5B66Z 1QR8A 3ASOC 1BSMA 4CH6A 1Q90D 1Y76A 2DE0X 1VQ8V 4GKKO 3KZIZ 3L74H 1EN4A 1Q6HA 3AG7A 3BPZA 1HNZO 3LUTB 4F6RA 3ETQA 3OUSA 4DR4O 2A9HA 4CH3A 4B3SB 1QBZA 2WLNA 1I5XA 1VQOV 5BXZA 5LMNO 2E76B 3TXSA 2VS0A 3OGIB 4IYHA 2Q69A 1YJNV 3OMNB 4MVZA 3B2EE 2ZDIA 5EC1C 1GM9A 5LA6A 3HKBA 4MVRA 2ZM6O 4E2LA 1R6NA 1AP6A 1FD9A 5H6RA 2BOBC 4AI8A 4R7CA 2N04A 5LHHA 2YXYA 1OHHG 3RW0A 2BTQB 1XMQB 3QTCA 1Q86W 2DWEC 3BEHA 2Y69B 4O2AB 2FYUH 3JASB 2N74A 1HW7A 2A0LA 3K5MA 1XBLA 5LYJA 4H44B 5DECA 4NKGB 3F7YC 1F7YA 1AI7A 3U10A 3JSNA 4RAIA 2G38A 4KHPO 4KHPB 2ZINA 2IU3A 3SPJA 1F4NA 3CB2A 5EZYA 3CP1A 1VQ6V 1QLEC 2YUAA 4YHHB 3CCUV 3RT3C 5IWAB 4B7KA 4JTDB 1TVKA 3KCYA 4DR7O 2GTAA 1GTOA 4JI2B 1ZLZA 1OCOC 1XMOO 4O2BB 1XEQA 4Z1MG 1HWYA 1FJGO 1AJQA 1QVFU 1LR1A 1Z5WA 4TV9A 2UUCO 2LQTA 2QGNA 3A0BZ 2FB5A 4BW9A 3K08A 1YSCA 1E1RG 4UCVA 2QR4A 1SS3A 1HR0O 4J9YB 4B3TO 3UT5A 1YHQV 1D2DA 4X1IA 5JCOC 3G71V 3JATA 4LBEC 1ZUQA 1YXBA 1OV9A 4J41A 4LWSB 2A06H 2P06A 1J5EB 2R9AA 4UUJC 1KKDA 3FAVA 3JAWA 4YJ3B 3CRCA 5B3SB 5JJNB 3E2EA 5D5PA 3HKEA 5EYPA 1PM9A 3AK1A 1W2BU 1EN5A 2CTWA 3H01A 1N33B 1UFIA 2XASA 4RWUA 1NI8A 1XHZA 4F4LA 3ZRXA 1ORQC 2R9RB 4ZKIA 4HYOA 3RYFB 1LNQA 1GN6A 5IJ9A 4DV4O 1FAFA 3T1HB 3K04A 1XL4A 2A79B 2KB1A 3W7XA 1FXVA 2Y0PA 5H9CA 4FLUA 2EIMB 2IH3C 1BHAA 3JASA 1F4MA 4J7JA 1TAEA 5JJJB 4JI1O 5CBHA 4FM2A 1M90W 4DR6O 1KBHA 5LOVA 3M99B 1VF6C 2BTQA 2W6IG 1P7GA 5L3FA 2QA4V 2EIJB 2HG5C 2WA3A 3JD1A 3SJCC 1GK9A 4FLTA 1VQNV 4TOIA 3APQA 2XNDG 1EFRG 2UUCB 2P67A 2VWKA 2DJVA 4LNUB 4PDLA 2EBOA 4JI2O 5JCOA 4MTGA 1KUQA 1DLBA 3SJAC 3JALB 5KHJA 2AHZA 1SESA 4DW0A 1N36O 4LF7O 1V54C 4G27B 3ZHVA 2KQXA 3A2FA 4L87A 1V55B 3VQXA 3H1LH 1Z5VA 2PY5A 1GO3F 2MK3A 2E3CA 2P7TC 4JI3B 3ICXA 2WLJA 4UCRA 5K1XA 2LFRA 2GSMB 2QM8A 4OX9O 2ODMA 1X59A 2ZR2A 1GRJA 3TCUA 2UXNA 4DR1O 2JVDA 3LDCA 1H2GA 2W6JG 3EXAA 4O4IB 2QTSA 2ZNJA 1V54B 4D7SA 3LNNA 4NYKA 4CH5A 5B1BC 3OR6C 3SDLA 2OCCB 1J95A 3QO5A 4AHCA 1KU9A 4CC5A 4U3JA 2HEPA 4RQFA 1QCEA 3FB6C 4FZ1A 1FXKB 1NTKH 5FLXN 5LP6A 1VQ4V 1SERA 5KAFZ 3MHHC 1S0VA 2F93B 2GV9A 4R50A 3D3IA 2EZOA 4JI7B 4X65O 3ABLC 3RYCA 3KCXA 1BE3H 1M5IA 2WWWA 3SYCA 4LFAO 1RSOA 1RM1C 3STLC 4DO2A 2M6YA 3K5LA 1WA8B 2DW4A 4DR4B 3AG3B 4MVMA 1SQXH 1K73W 2Q73A 4LF9O 1YCIA 3CC2V 1H2LA 4JI0B 1WNSA 3T1YB 4NXMB 1KECA 1AJPA 1VQMV 4J7KA 1SQQH 4X66B 4MSWC 1IVSA 3ASNB 4AQYB 5CN0A 2N05A 1EZVH 4LFAB 1HNXO 4WF9V 1SRYA 4JI7O 1YZBA 2BCCH 1AJNA 5KMGA 3FX7A 3JD0A 1WPBA 2WAMA 4LF8O 3DTUB 3OT7A 1BT8A 1JJOA 5KA5A 1N34B 4DV6O 2HP8A 4R6ZA 4IT5A 2Q68A 1MSWD 1NR1A 3K0DA 5C8YB 2A3QA 2HVKC 4GLXA 5ITZA 3ZMTA 1ROPA 5JQGA 1G6UA 1H2NA 1XUQA 5KA6A 3CCEV 4X89A 4IL6Z 3H1JH 3TK1A 4UFZA 4X65B 1JJ2U 3ZBHA 2DYSB 4P9PA 1N32B 3D8CA 1K3EA 2YICA 3MD0A 4B3RO 2DMXA 4FIPC 1JFFA 3QO8A 2JIZG 3G4SV 3MHSC 4JI5B 5KHHA 3UT5B 3N2GB 4YY3O 1IX9A 2FL4A 2HJDA 4I50B 5IDJA 2EIJC 3TJTA 4WFEA 3CRAA 2GDSA 3X2QC 4X62B 4DR1B 4U7OA 2B5UA 1IBKO 2F23A 3RYFA 3ABKB 3OUFA 3ZCCA 4BR6A 4DR3B 3GWKC 3KKYA 4IYIA 3OMIB 1R3JC 3BCCH 4LP8A 1TGOA 1B6QA 3ZHSA 4JTCB 4H33A 3SYQA 1CXZB 2RJZA 4TV8A 4BWAA 5DN6G 4YY3B 1XHXA 4J7ZA 4JI5O 1NJIW 5KUKA 2WA4A 3I5DA 1NH2B 3K58A 1V55C 1GN2A 2VWJA 2DYRC 2Z5UA 1HP8A 1M57B 1M93A 3AG1C 4EFBA 3UO2A 2LW1A 1ZWIC 4OXSA 2IJKA 4PDMA 3SR2C 3B4SA 3ABMB 2WLIA 2OTJV 2RDCA 3ABKC 1AR4A 4JI1B 2KSDA 3E35A 3JAKB 1RP3B 3SPCA 3C3SA 4XDLA 4IGGA 2RMKB 4QGPA 2IJHA 4HNAA 4GX1A 2BSKA 4DV6B 3T1HO 2UUAO 4JAVA 4TV9B 2LGWA 2JEXA 1OJHA 5JVDA 4X1YB 4YJ2A 4JYAB 2R9IA 5EC2C 4DR6B 2IJJA 1JFFB 3OFNG 3RFRA 3P30A 3CRMA 2ZCEA 5FNVA 2LO1A 1Q81W 1PPJH 1ZL8B 2CK3G 3B8NA 5IYBO 2RCVA 4NTXA 3RVZA 4ZI7A 3FB5C 4DV4B 3A0HZ 3PN1A 5JWPA 3VBBA 2KG7B 1DTOA 2PYJA 1NS1A 3CCVV 5FL7G 2CDYA 3HKCA 5GONA 5LMUB 2Q4PA 1G4YB 2Y0IA 4PA6A 1M56B 4TWKA 1B06A 1N33O 3L70H 3BHPA 3P3NA 3SYAA 5AG2A 1VF5B 3D36A 1GM7A 3G6BA 3L75H 4OX9B 4B3MO 3VOUA 4QE7A 2ZE5A 1I0HA 4JI8O 3R66A 5LP6B 4WFAV 4L8JA 2XTAA 1VQ5V 2YC0A 1WP8A 1VQKV 5EBWC 5CMUA 1XREA 1Y6XA 4QJFB 1FFTB 1VF7A 1YITV 2YEVB 2GHYA 1JCHA 4D7TA 4J42A 1VF6A 2PUSA 2ATKC 2RN9A 4DV7B 4WBNA 2P4VA 1XMQO 2UXDO 4O4LB 4TQDA 4YHHO 4LFCO 1FXHA 1WB7A 4X1YA 1FFXA 1KD1W 5IYZB 4PI0A 1IZ3A 5H5NA 1YI2V 4JI6O 4LF7B 5IT9N 4JI8B 3E86A 1B3QA 4O4JB 4WFFA 1Y66A 4EB6A 4B3MB 5KX5B 4O4HA 5B1BB 4KP4A 1AI5A 4B08A 2PF4E 2HHHO 4GYCB 3CCJV 1DK1A 5H2FZ 4O4LA 3FYEB 3JCUZ 4RUEA 2HJFC 1VQLV 4JPRA 3ZMVA 3A0RA 4I55A 3K5NA 2QTOA 3SPHA 2ZIOA 4ICGA 1URFA 3ML0A 3N2KA 4X1IB 5HFLA 4KUMA 5TISZ
chains in the Genus database with same CATH topology
5BXZA 5LMNO 4JI5O 1N36O 4LF7O 1AB3A 5IWAO 2AGAA 3O65A 3J80N 4B3MO 1HNXO 2UUBO 4GKJO 1AILA 4JI7O 4DV3O 1YZBA 3J81N 4LFBO 4JI8O 3R66A 2JRIA 4LF8O 4JYAO 1J5EO 2DOSA 4DV6O 4LF6O 4X66O 2ZM6O 4X64O 1FKAO 1A32A 1N32O 4OX9O 4JI0O 4DV0O 2LW7A 1X59A 4DV2O 5LMUO 4DUZO 4DR1O 5LL6Y 5A2QN 3OTOO 4DV4O 1IBMO 4OPHA 1XMQO 4DR2O 4K0KO 1HNWO 2UXDO 2VQFO 3T1HO 2UUAO 4DV5O 4YHHO 4LFCO 2ZKOA 5BR8O 2N74A 2F4VO 3SDLA 3JAMN 1G1XB 2E5LO 3J7AU 1IBLO 4LF4O 4B3RO 4JI1O 2UXCO 1I94O 4JI4O 4DR6O 4A5UB 5BY1A 1F7YA 4JI3O 5FLXN 5H5NA 4JI6O 5IT9N 4KHPO 4YY3O 4LF5O 4AQYO 3RT3C 1R6TA 4DV1O 3M8AA 4NXNO 4DR7O 1FYJA 4X65O 4DR5O 2HHHO 4DUYO 1XMOO 4LFAO 1DK1A 1XEQA 3T1YO 4NXMO 1FJGO 4GKKO 4B3SO 1IBKO 2UXBO 1NS1A 2UUCO 4DV7O 1HNZO 1XNQO 4OPAA 4DR3O 4DR4O 4LF9O 2DJVA 1HR0O 4B3TO 2VQEO 1N33O 3F5TA 4X62O 4JI2O 1D2DA 1R1BA 4JV5O 2UU9O 1KUQA 2FKXA 1XNRO 2Z0AA 1N34O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXZ A;  5LMN O;  4JI5 O;  1N36 O;  4LF7 O;  1AB3 A;  5IWA O;  2AGA A;  3O65 A;  3J80 N;  4B3M O;  1HNX O;  2UUB O;  4GKJ O;  1AIL A;  4JI7 O;  4DV3 O;  1YZB A;  3J81 N;  4LFB O;  4JI8 O;  3R66 A;  2JRI A;  4LF8 O;  4JYA O;  1J5E O;  2DOS A;  4DV6 O;  4LF6 O;  4X66 O;  2ZM6 O;  4X64 O;  1FKA O;  1A32 A;  1N32 O;  4OX9 O;  4JI0 O;  4DV0 O;  2LW7 A;  1X59 A;  4DV2 O;  5LMU O;  4DUZ O;  4DR1 O;  5LL6 Y;  5A2Q N;  3OTO O;  4DV4 O;  1IBM O;  4OPH A;  1XMQ O;  4DR2 O;  4K0K O;  1HNW O;  2UXD O;  2VQF O;  3T1H O;  2UUA O;  4DV5 O;  4YHH O;  4LFC O;  2ZKO A;  5BR8 O;  2N74 A;  2F4V O;  3SDL A;  3JAM N;  1G1X B;  2E5L O;  3J7A U;  1IBL O;  4LF4 O;  4B3R O;  4JI1 O;  2UXC O;  1I94 O;  4JI4 O;  4DR6 O;  4A5U B;  5BY1 A;  1F7Y A;  4JI3 O;  5FLX N;  5H5N A;  4JI6 O;  5IT9 N;  4KHP O;  4YY3 O;  4LF5 O;  4AQY O;  3RT3 C;  1R6T A;  4DV1 O;  3M8A A;  4NXN O;  4DR7 O;  1FYJ A;  4X65 O;  4DR5 O;  2HHH O;  4DUY O;  1XMO O;  4LFA O;  1DK1 A;  1XEQ A;  3T1Y O;  4NXM O;  1FJG O;  4GKK O;  4B3S O;  1IBK O;  2UXB O;  1NS1 A;  2UUC O;  4DV7 O;  1HNZ O;  1XNQ O;  4OPA A;  4DR3 O;  4DR4 O;  4LF9 O;  2DJV A;  1HR0 O;  4B3T O;  2VQE O;  1N33 O;  3F5T A;  4X62 O;  4JI2 O;  1D2D A;  1R1B A;  4JV5 O;  2UU9 O;  1KUQ A;  2FKX A;  1XNR O;  2Z0A A;  1N34 O; 
#chains in the Genus database with same CATH topology
 3R65 A;  4YXW G;  1Q6U A;  1RPO A;  4HZ3 A;  3O65 A;  4GZR B;  5EIB D;  4BW5 A;  3ASO B;  3TET A;  1BQZ A;  3K5O A;  2EJ7 A;  2BE3 A;  3ZRV A;  1AR1 B;  4ABM A;  2V7Q G;  2Y69 C;  4JGS A;  4UVB A;  1X4T A;  2WLL B;  2YIA A;  4UXN A;  4G28 B;  2FTK A;  1TUB A;  3OEE G;  1SKV A;  2YEV A;  2P6J A;  3SPG A;  2ZNI A;  3UKM A;  4LH6 A;  1RSO B;  3GWO A;  1US6 A;  2ADQ B;  3CSX A;  2UXX A;  1P4R A;  3QO7 A;  2ZE7 A;  2LJ2 A;  5IJ9 B;  2JGD A;  1H8H G;  4GKK B;  1GKF A;  3CCM V;  3IFX A;  4XBF A;  5CA0 A;  4MTX A;  2K1E A;  4ZOL B;  1OCO B;  3DC5 A;  2XT9 A;  1H8E G;  4FLV A;  2JJ1 G;  2ZKO A;  3ZMU A;  4K3A A;  1GH6 A;  2IJI A;  1VP7 A;  4PEL A;  3JAM N;  1IXB A;  3WG7 B;  5JH7 A;  1NBM G;  1V9P A;  4F6R B;  5IJ0 A;  1TUE B;  4WBN B;  2WLK A;  3JD2 A;  2UUB B;  3JAT B;  1OCC B;  2X7R B;  4B3T B;  1M1K W;  4J10 A;  3BY6 A;  4JZ2 A;  2M7W A;  4CS3 A;  4PA4 A;  4ZOL A;  1IBM B;  4K8X A;  4LFC B;  3JAL A;  2UXD B;  4X88 A;  2ZDI C;  3ZIA G;  2WPD G;  1E79 G;  4FLY A;  4B7E A;  1SZX A;  2LGQ A;  3AG4 C;  2YS8 A;  3WG7 C;  1BZK A;  4JAA A;  4X62 O;  1K33 A;  4PDR A;  2GUZ B;  2HLD G;  1QLE B;  1XNR O;  1GM8 A;  2Z0A A;  4U7N A;  1VQ7 V;  1I5Y A;  2RNB A;  4GX5 A;  3BAB A;  5LYJ B;  4HNA B;  5CBG A;  5CA3 A;  2WLH A;  4LF5 B;  3N2G A;  5LXT A;  1W0J G;  4FLW A;  1WAZ A;  1OCC C;  2IH1 C;  1SC5 B;  2Y48 A;  2ZM6 B;  3FD9 A;  3H1H H;  5IY5 C;  3H9V A;  5F2V O;  2X0L A;  3U11 A;  1VMG A;  3TXQ A;  5J2T A;  2IU0 A;  4PA9 A;  2QWO B;  2O57 A;  4JTA B;  1FKA O;  1MAB G;  2LFS A;  4DV5 B;  1M4U A;  4I0X B;  4I4T A;  1GN4 A;  2BTO A;  2D2C B;  4QPJ A;  3JD4 A;  4F6E A;  5LMU O;  3CC7 V;  5K1P A;  3LNM B;  2H8P C;  4ZIB A;  5CA1 B;  1GAX A;  2CTP A;  1NVP B;  3SPI A;  1K4C C;  4NVP A;  3S3X A;  5LA6 B;  1JMK C;  1S72 V;  1P84 F;  1Z2G A;  2QKS A;  1SQB H;  2UXC O;  4LF8 B;  1IXM A;  2JDI G;  3IC9 A;  3ZHU A;  5LMN B;  3JAK A;  3VQY A;  1I08 A;  3AK3 A;  4KXR A;  2QDO A;  3BVO A;  3RGB A;  5JJE B;  2QM7 A;  3AK2 A;  2YIB A;  2ITD C;  2OCH A;  4DV1 O;  3RYI A;  1FYJ A;  2AXT Z;  3C3T A;  4O2A A;  3T1Y O;  2ZR3 A;  4NXM O;  1I94 B;  2OT5 A;  1ENV A;  1U96 A;  2HFE C;  4XDJ A;  4NR1 A;  1NQT A;  2D3O W;  1K9M W;  2VQE B;  4PHZ A;  4DV0 B;  1THZ A;  4PI2 A;  1ZL8 A;  2Q0O C;  3RVY A;  3D3Q A;  4O2B A;  2Q7G A;  5KLV H;  4GT1 A;  3J80 N;  3NR7 A;  2AZ0 A;  5LHI A;  3K03 A;  2ZE8 A;  1JX9 A;  4I9Q A;  2F95 B;  5B1N A;  1R3L C;  4BAY A;  2X6A A;  3CWB H;  4K0K B;  4LFB B;  5C8Y A;  2F1M A;  5IYZ A;  3CJH B;  3ZN1 A;  3JAR B;  4IHJ B;  1FFX B;  2P90 A;  1KQS U;  4UCS A;  5B5E Z;  1D5A A;  1N8R W;  2XAH A;  1F23 A;  3OM3 B;  1OCZ C;  3S3W A;  3FFQ A;  3CCR V;  3A8T A;  3HKD B;  1N0J A;  1YF2 A;  1R3K C;  3CX5 F;  1S5L Z;  4DYL A;  4IIJ B;  4LF6 B;  4DR2 O;  2NNU A;  4DK0 A;  1RM1 B;  1IBK B;  1Y74 B;  3STZ C;  1AR5 A;  4UCU A;  3E8H A;  1K5Q A;  3ABU A;  4I0X A;  3SJQ C;  1QU7 A;  4I4T B;  4C7U A;  3J7A U;  1CPY A;  1Y76 B;  3ZMS A;  1VEW A;  4JI3 O;  1MOF A;  2YIB D;  3AG2 C;  2R70 A;  5DED A;  2XHB A;  1SET A;  4BIO A;  1T5E A;  2NN4 A;  5EIB C;  5KUM A;  3ASN C;  1XDC A;  2YI9 A;  4B3R B;  3OTF A;  2PGG A;  4DUY O;  4MW3 A;  1P49 A;  2QJ1 A;  3CJH A;  1PD3 A;  1MSD A;  1W0K G;  1YJ9 V;  4EEQ A;  5BR8 B;  2ZXW C;  5GTI Z;  3FB7 C;  1R6K A;  3QNE A;  1SZT A;  1YJW V;  1PL0 A;  3CRR A;  1GN3 A;  3QG5 A;  1SA0 A;  3K79 A;  4JF3 A;  4TQF A;  5DM6 V;  3BA8 A;  4X1K B;  2UXB B;  2YI8 A;  2E75 B;  3U0Z A;  4FPP A;  1PNK A;  1PKX A;  4X20 B;  4DRX B;  2JK5 C;  3VQV A;  1NZ6 A;  4FM0 A;  3F5W C;  4TV8 B;  3ETE A;  2VRZ A;  2EIK C;  2QWP B;  4X66 O;  4FMT A;  1WLE A;  1YVW A;  3RYH B;  3LSS A;  3RYC B;  1XI1 A;  3EHB B;  4JI0 O;  4DV0 O;  3WB2 A;  4I5S A;  4FLZ A;  1Q5O A;  3MAQ A;  1O9G A;  3K0G A;  4DV2 O;  4LF9 B;  5LL6 Y;  1AI6 A;  5EZY B;  2E74 B;  4PD4 F;  2WLL A;  3T2M A;  4N21 A;  3ZRS A;  2W0X A;  3CXH F;  4LF4 O;  2EZP A;  4DV1 B;  4FJC C;  5GON B;  1PP9 H;  4O4I A;  2YXH A;  2V1D A;  2AZ2 A;  1I7F A;  4DRX A;  4EFE A;  1K4D C;  1EN6 A;  1OZ0 A;  1NKD A;  4NXN O;  5EBL C;  2ETN A;  4GCZ A;  4DR5 O;  2JEU A;  1NTM H;  1SF9 A;  2GTS A;  2EX3 A;  4MT8 A;  3ZRW A;  4MVO A;  4Q6G A;  4CS4 A;  4ZHQ B;  4ZI7 B;  1N4C A;  3ZJZ A;  4FFB A;  1EBO A;  3W7W A;  3HKB B;  1DGS A;  3BFR A;  4OPA A;  1L0L H;  3SYO A;  4X9Q A;  3ZX6 A;  1XL6 A;  2Q5Z A;  1DF4 A;  2PI5 A;  4LH7 A;  3G6E V;  4UCT A;  2YDE A;  1YIJ V;  3JCZ A;  1FJG B;  4H13 B;  1Q6I A;  1TVK B;  1XMO B;  2ZT9 B;  4P30 A;  2FKX A;  5JQG B;  4DR7 B;  5L3C A;  4MVQ A;  5IWA O;  3E8F A;  3P32 A;  3IJ4 A;  4H0L B;  2LP7 A;  1KP3 A;  1L8D A;  3DGE A;  3B09 A;  4FK5 C;  4NTW A;  4ZHQ A;  5LGT A;  3B8M A;  3SGI A;  1IUR A;  2QWN B;  5J2U A;  3RYH A;  1N36 B;  1XNR B;  1VAR A;  3H1K H;  5A9G A;  3H1I H;  4X64 O;  2RQ6 A;  1JR9 A;  1K34 A;  1JA8 A;  4CH4 A;  4JAU A;  1F51 A;  2DWD C;  3K9S A;  4QNH B;  1CP9 A;  1QQC A;  3SJB C;  1KYO F;  5J9P C;  3DXR A;  3OE7 G;  2CH7 B;  2P22 C;  2X6B A;  4DXW A;  2PI4 A;  1YEW A;  5LHG A;  5ITZ B;  1FS0 G;  4QIW F;  3L72 H;  2CGO A;  2Q8V A;  1YTF D;  1KKC A;  3OAA G;  3ABM C;  4E4E A;  1NTZ H;  1VQP V;  1CEZ A;  4KL1 A;  3TGU H;  4MS2 A;  1S76 D;  3JYC A;  5B3S C;  4CBC A;  4B3S O;  5LGN A;  1TUB B;  1QHT A;  2ILM A;  5CB4 A;  1XNQ O;  4JV5 B;  4FFB B;  5CBF A;  1PV0 A;  4MW8 A;  3KG2 A;  5L3G A;  1QR9 A;  5KAI Z;  2VQF B;  1HNZ B;  1L0N H;  3G67 A;  2CGN A;  4J11 A;  1EZJ A;  3OTO B;  5C93 A;  4JV5 O;  1ZSP A;  3OMA B;  3THO A;  1XOU A;  2CE4 A;  5FNV B;  2C2A A;  3LSU A;  3CS5 A;  3M7M X;  2F43 G;  4Z1V A;  3E22 A;  3WU2 Z;  1Y67 A;  4I7Z B;  2UXC B;  2H3O A;  1J5E O;  3CCQ V;  1WB8 A;  3DSQ A;  1BGY H;  4JAS A;  3D36 C;  3AEI A;  4UVC A;  1MZF A;  4PDV A;  3IGA C;  4H37 A;  5H6Q A;  2IBZ H;  1XNQ B;  1KP2 A;  2XAQ A;  2ZIM A;  4MTO A;  4P9O A;  1HR0 B;  3L71 H;  1AI4 A;  2EIL C;  3E83 A;  1IDS A;  4RUF A;  1GMG A;  3CEI A;  3JSL A;  1UJW B;  3FB8 C;  1BHB A;  5BMV A;  2WLI B;  3HKC B;  3E22 B;  4NB5 A;  4DV5 O;  2PTM A;  2CH7 A;  2EIM C;  2HHH B;  2YSU B;  1SA0 B;  1IBL O;  4GKJ B;  3GVM A;  1MNG A;  3W7T A;  1SQV H;  4JI4 O;  1Q43 A;  5EBM C;  1W59 A;  5FPO A;  1S5H C;  2R72 A;  2A7W A;  3E89 A;  1NU1 H;  3VQW A;  4LF5 O;  2CTR A;  1R6T A;  4P2Z A;  5KHI A;  2PYL A;  1OCR B;  3CCL V;  1WP7 A;  3G80 A;  3RBZ A;  2UU9 B;  5B1A B;  4AIL C;  4GX2 A;  4LNU A;  2XAG A;  2B1I A;  4JI4 B;  5JVD B;  1LUW A;  2HVJ C;  1H2M A;  4EB6 B;  4DV7 O;  5IYD O;  1FXK A;  1K5S A;  4QPK A;  3ZHT A;  4PA7 A;  5IYC O;  1OCZ B;  2HKO A;  1VIB A;  3F5T A;  3EFF K;  1U97 A;  4HAM A;  1S5J A;  3FAV B;  2UUB O;  1KC8 W;  4MVU A;  4GKJ O;  4DR5 B;  4NXN B;  1AVM A;  4D6T H;  2Z3Y A;  4DK1 A;  5CB4 B;  4XDK A;  2QEX V;  2ZE6 A;  5E79 Z;  1VQ9 V;  4ASU G;  3WFV A;  3K9A A;  2FML A;  1SQP H;  2LW7 A;  4UV8 A;  4X1K A;  4MTF A;  5LP6 C;  3UO3 A;  5A2Q N;  3C90 A;  3OTO O;  3CXC U;  3IAY A;  2QSA A;  4LCU C;  5L3D A;  2ARH A;  2H94 A;  2CTQ A;  4IHJ A;  3BA9 A;  2VQF O;  1QLN A;  2XUM A;  3L9D A;  2YID A;  4I9W A;  4DV2 B;  5LGU A;  3ZHR A;  4J9Z B;  2W0F C;  2F66 C;  4WFB V;  1QNM A;  2EIN C;  2NR5 A;  1B04 A;  5KMG B;  3N27 A;  3K57 A;  3CYO A;  3JD3 A;  3ETD A;  3IC7 A;  4LR3 A;  4HBN A;  1NT2 B;  2IW5 A;  5JH7 B;  3Q4H A;  2E5L B;  4TSF G;  4X20 A;  2WSS G;  5J2U B;  2L35 A;  3EVK A;  2UUA B;  3B40 A;  2UXB O;  4DW1 A;  2OCC C;  3B77 A;  1ZTE A;  3HR0 A;  1H38 A;  2P5O A;  5KHG A;  2QE7 G;  4UVA A;  1H2K A;  4K8Z A;  3LSQ A;  2Q0A A;  2ZD9 A;  3LDD A;  2EIN B;  1BL8 A;  3OGC C;  4RQE A;  2NLJ C;  4JYB A;  1FPO A;  1JPX A;  1Q82 W;  4WFG A;  4DV3 B;  2BSK B;  4JI6 B;  3K3W A;  3T1C A;  2EJR A;  2P4K A;  3AG3 C;  4K35 A;  4W4K A;  1EM1 A;  2V4D A;  4BIU A;  3OW2 U;  5CA1 A;  4TUY B;  3AG4 B;  3DC6 A;  3NXS A;  2PZS A;  2MW2 B;  1N0N A;  2CUG A;  3W7S A;  4I50 A;  5IJ0 B;  1BQ0 A;  1Q3E A;  2X6C A;  1KMI Z;  5E1A C;  4IIJ A;  1H2S B;  4X64 B;  4CS2 A;  4DUY B;  1PNL A;  4DR2 B;  2DYS C;  3HKD A;  2L6L A;  2Q6A A;  3OR7 C;  4TUY A;  3JAW B;  4YJ3 A;  3APO A;  3FKS G;  3L73 H;  3K59 A;  4U3F H;  3ETG A;  1YTF B;  3I56 V;  1Q8I A;  3RYI B;  5CA0 B;  5GTH Z;  5BY1 A;  2JGD B;  4CC6 A;  1LUV A;  2K9P A;  4UCO A;  1MG1 A;  4NTY A;  2XAF A;  3M8A A;  2B1G A;  4BIZ A;  3GB7 C;  1JVM A;  1M9N A;  3X2Q B;  2XOK G;  3MDS A;  1PL4 A;  4UB6 Z;  2F4V B;  2DYR B;  4YIP A;  1RFY A;  4WFH A;  3T4D A;  1HNW B;  2DQ3 A;  3CPW U;  4EKW A;  3UM7 A;  4FM1 A;  1K92 A;  3T4Z A;  4MVS A;  3DXR B;  3ABT A;  2QWR B;  3HKE B;  5EYP B;  1WN7 A;  2JS3 A;  3HB3 B;  2Y4U A;  4DUZ B;  2JGU A;  2OTL V;  1DF5 A;  3K06 A;  1O9H A;  2DN9 A;  5J2T B;  3CMA V;  2VQE O;  1MA1 A;  1WA8 A;  3CE2 A;  1WJZ A;  4JZG A;  1NH2 D;  1N34 O;  4FLX A;  5LBQ A;  5GW7 A;  3Q4H B;  2AGA A;  1P7B A;  4Q20 A;  2AW9 A;  1KB9 F;  4LF4 B;  3CCS V;  5LOV B;  1AIL A;  3I55 V;  1M57 C;  3AG1 B;  2JJ2 G;  5BMV B;  3BRC A;  1Y4M A;  2JRI A;  2KKW A;  2Q7H A;  3ZN0 A;  1PNM A;  4JYA O;  1ZX3 A;  2DOS A;  1HDJ A;  2EUL A;  2OIG A;  2ADP A;  3CC4 V;  4KFM A;  2GUZ A;  3ZED A;  5LXT B;  4W4L A;  3F7V C;  1A32 A;  1RPR A;  4LC1 A;  1WPX A;  4O4J A;  3CRQ A;  5IY5 B;  3OD4 A;  5KX5 A;  1SQF A;  1JOY A;  4DUZ O;  3CME V;  2CAZ C;  5B1O A;  2ITC C;  4UV9 A;  3HPL C;  1HNW O;  2WLM A;  1D5N A;  1YDX A;  2BOC C;  5BR8 O;  2YXL A;  2F4V O;  2ZXW B;  3LDE A;  3QVN A;  1UPG A;  4LWS A;  1NR7 A;  3ZRW B;  2XAJ A;  4A5U B;  1S77 D;  3RWR D;  4YIO A;  1R73 A;  4I55 B;  4R8C A;  2DQ0 A;  1L1F A;  1ARO P;  1ZAU A;  3AG2 B;  2KG7 A;  3ZS8 C;  1E1Q G;  2OIE A;  4PV1 B;  1MZE A;  1K97 A;  3E8G A;  4GX0 A;  1AP5 A;  3RN4 A;  4WCE V;  1QVG U;  5L3E A;  4JYY A;  2IM9 A;  3JAR A;  1BMF G;  3W7U A;  3E8B A;  4GUN A;  3UQ8 A;  2Y4T A;  4UB8 Z;  4DR3 O;  3SYP A;  3ZHQ A;  5FPR A;  2AHY A;  4U3J B;  3QF7 A;  2Q9L A;  2EIL B;  3O9O A;  5EK0 A;  4FFK A;  2QKC A;  1COW G;  5KHK A;  1R1B A;  4PJ0 Z;  2UU9 O;  3FYI B;  2JS5 A;  1FXK C;  2ZQM A;  2OYQ A;  4ZBM A;  3P3P A;  1AB3 A;  4OGQ B;  5L3B A;  3WB0 A;  4DV3 O;  3J81 N;  4LFB O;  1TA8 A;  3WB1 A;  1XIL A;  4QE9 A;  2GBO A;  4JYC A;  5BZB A;  3CD6 V;  1R3I C;  4LF6 O;  3N2K B;  1IBL B;  2QM4 A;  2OWO A;  1XQ8 A;  2EIK B;  2B9Z A;  1Q7Y W;  1N32 O;  4RO2 A;  1M56 C;  1OCR C;  4TT3 G;  1NVP D;  3ZMZ A;  5B1A C;  5HFM A;  2QKA A;  4Z2W A;  1IBM O;  5D5Q A;  4YJ2 B;  1K8A W;  3OEH G;  4OPH A;  5IE9 A;  4K0K O;  4X8A A;  1K7D A;  4CZZ A;  1MMM A;  1BCC H;  3PJS K;  1G1X B;  2E5L O;  3ABL B;  4O4H B;  2Q7E A;  4FZ0 A;  2QWQ B;  1I94 O;  4N23 A;  1G8M A;  4G2K A;  1BS3 A;  1JQ0 A;  3UCS C;  1SQG A;  3BAA A;  4FVM A;  2HR3 A;  2Q67 A;  1HNX B;  3CHX A;  1S3J A;  4AQY O;  4J80 A;  1Y74 A;  4PA3 A;  5B66 Z;  1QR8 A;  3ASO C;  1BSM A;  4CH6 A;  1Q90 D;  1Y76 A;  2DE0 X;  1VQ8 V;  4GKK O;  3KZI Z;  3L74 H;  1EN4 A;  1Q6H A;  3AG7 A;  3BPZ A;  1HNZ O;  3LUT B;  4F6R A;  3ETQ A;  3OUS A;  4DR4 O;  2A9H A;  4CH3 A;  4B3S B;  1QBZ A;  2WLN A;  1I5X A;  1VQO V;  5BXZ A;  5LMN O;  2E76 B;  3TXS A;  2VS0 A;  3OGI B;  4IYH A;  2Q69 A;  1YJN V;  3OMN B;  4MVZ A;  3B2E E;  2ZDI A;  5EC1 C;  1GM9 A;  5LA6 A;  3HKB A;  4MVR A;  2ZM6 O;  4E2L A;  1R6N A;  1AP6 A;  1FD9 A;  5H6R A;  2BOB C;  4AI8 A;  4R7C A;  2N04 A;  5LHH A;  2YXY A;  1OHH G;  3RW0 A;  2BTQ B;  1XMQ B;  3QTC A;  1Q86 W;  2DWE C;  3BEH A;  2Y69 B;  4O2A B;  2FYU H;  3JAS B;  2N74 A;  1HW7 A;  2A0L A;  3K5M A;  1XBL A;  5LYJ A;  4H44 B;  5DEC A;  4NKG B;  3F7Y C;  1F7Y A;  1AI7 A;  3U10 A;  3JSN A;  4RAI A;  2G38 A;  4KHP O;  4KHP B;  2ZIN A;  2IU3 A;  3SPJ A;  1F4N A;  3CB2 A;  5EZY A;  3CP1 A;  1VQ6 V;  1QLE C;  2YUA A;  4YHH B;  3CCU V;  3RT3 C;  5IWA B;  4B7K A;  4JTD B;  1TVK A;  3KCY A;  4DR7 O;  2GTA A;  1GTO A;  4JI2 B;  1ZLZ A;  1OCO C;  1XMO O;  4O2B B;  1XEQ A;  4Z1M G;  1HWY A;  1FJG O;  1AJQ A;  1QVF U;  1LR1 A;  1Z5W A;  4TV9 A;  2UUC O;  2LQT A;  2QGN A;  3A0B Z;  2FB5 A;  4BW9 A;  3K08 A;  1YSC A;  1E1R G;  4UCV A;  2QR4 A;  1SS3 A;  1HR0 O;  4J9Y B;  4B3T O;  3UT5 A;  1YHQ V;  1D2D A;  4X1I A;  5JCO C;  3G71 V;  3JAT A;  4LBE C;  1ZUQ A;  1YXB A;  1OV9 A;  4J41 A;  4LWS B;  2A06 H;  2P06 A;  1J5E B;  2R9A A;  4UUJ C;  1KKD A;  3FAV A;  3JAW A;  4YJ3 B;  3CRC A;  5B3S B;  5JJN B;  3E2E A;  5D5P A;  3HKE A;  5EYP A;  1PM9 A;  3AK1 A;  1W2B U;  1EN5 A;  2CTW A;  3H01 A;  1N33 B;  1UFI A;  2XAS A;  4RWU A;  1NI8 A;  1XHZ A;  4F4L A;  3ZRX A;  1ORQ C;  2R9R B;  4ZKI A;  4HYO A;  3RYF B;  1LNQ A;  1GN6 A;  5IJ9 A;  4DV4 O;  1FAF A;  3T1H B;  3K04 A;  1XL4 A;  2A79 B;  2KB1 A;  3W7X A;  1FXV A;  2Y0P A;  5H9C A;  4FLU A;  2EIM B;  2IH3 C;  1BHA A;  3JAS A;  1F4M A;  4J7J A;  1TAE A;  5JJJ B;  4JI1 O;  5CBH A;  4FM2 A;  1M90 W;  4DR6 O;  1KBH A;  5LOV A;  3M99 B;  1VF6 C;  2BTQ A;  2W6I G;  1P7G A;  5L3F A;  2QA4 V;  2EIJ B;  2HG5 C;  2WA3 A;  3JD1 A;  3SJC C;  1GK9 A;  4FLT A;  1VQN V;  4TOI A;  3APQ A;  2XND G;  1EFR G;  2UUC B;  2P67 A;  2VWK A;  2DJV A;  4LNU B;  4PDL A;  2EBO A;  4JI2 O;  5JCO A;  4MTG A;  1KUQ A;  1DLB A;  3SJA C;  3JAL B;  5KHJ A;  2AHZ A;  1SES A;  4DW0 A;  1N36 O;  4LF7 O;  1V54 C;  4G27 B;  3ZHV A;  2KQX A;  3A2F A;  4L87 A;  1V55 B;  3VQX A;  3H1L H;  1Z5V A;  2PY5 A;  1GO3 F;  2MK3 A;  2E3C A;  2P7T C;  4JI3 B;  3ICX A;  2WLJ A;  4UCR A;  5K1X A;  2LFR A;  2GSM B;  2QM8 A;  4OX9 O;  2ODM A;  1X59 A;  2ZR2 A;  1GRJ A;  3TCU A;  2UXN A;  4DR1 O;  2JVD A;  3LDC A;  1H2G A;  2W6J G;  3EXA A;  4O4I B;  2QTS A;  2ZNJ A;  1V54 B;  4D7S A;  3LNN A;  4NYK A;  4CH5 A;  5B1B C;  3OR6 C;  3SDL A;  2OCC B;  1J95 A;  3QO5 A;  4AHC A;  1KU9 A;  4CC5 A;  4U3J A;  2HEP A;  4RQF A;  1QCE A;  3FB6 C;  4FZ1 A;  1FXK B;  1NTK H;  5FLX N;  5LP6 A;  1VQ4 V;  1SER A;  5KAF Z;  3MHH C;  1S0V A;  2F93 B;  2GV9 A;  4R50 A;  3D3I A;  2EZO A;  4JI7 B;  4X65 O;  3ABL C;  3RYC A;  3KCX A;  1BE3 H;  1M5I A;  2WWW A;  3SYC A;  4LFA O;  1RSO A;  1RM1 C;  3STL C;  4DO2 A;  2M6Y A;  3K5L A;  1WA8 B;  2DW4 A;  4DR4 B;  3AG3 B;  4MVM A;  1SQX H;  1K73 W;  2Q73 A;  4LF9 O;  1YCI A;  3CC2 V;  1H2L A;  4JI0 B;  1WNS A;  3T1Y B;  4NXM B;  1KEC A;  1AJP A;  1VQM V;  4J7K A;  1SQQ H;  4X66 B;  4MSW C;  1IVS A;  3ASN B;  4AQY B;  5CN0 A;  2N05 A;  1EZV H;  4LFA B;  1HNX O;  4WF9 V;  1SRY A;  4JI7 O;  1YZB A;  2BCC H;  1AJN A;  5KMG A;  3FX7 A;  3JD0 A;  1WPB A;  2WAM A;  4LF8 O;  3DTU B;  3OT7 A;  1BT8 A;  1JJO A;  5KA5 A;  1N34 B;  4DV6 O;  2HP8 A;  4R6Z A;  4IT5 A;  2Q68 A;  1MSW D;  1NR1 A;  3K0D A;  5C8Y B;  2A3Q A;  2HVK C;  4GLX A;  5ITZ A;  3ZMT A;  1ROP A;  5JQG A;  1G6U A;  1H2N A;  1XUQ A;  5KA6 A;  3CCE V;  4X89 A;  4IL6 Z;  3H1J H;  3TK1 A;  4UFZ A;  4X65 B;  1JJ2 U;  3ZBH A;  2DYS B;  4P9P A;  1N32 B;  3D8C A;  1K3E A;  2YIC A;  3MD0 A;  4B3R O;  2DMX A;  4FIP C;  1JFF A;  3QO8 A;  2JIZ G;  3G4S V;  3MHS C;  4JI5 B;  5KHH A;  3UT5 B;  3N2G B;  4YY3 O;  1IX9 A;  2FL4 A;  2HJD A;  4I50 B;  5IDJ A;  2EIJ C;  3TJT A;  4WFE A;  3CRA A;  2GDS A;  3X2Q C;  4X62 B;  4DR1 B;  4U7O A;  2B5U A;  1IBK O;  2F23 A;  3RYF A;  3ABK B;  3OUF A;  3ZCC A;  4BR6 A;  4DR3 B;  3GWK C;  3KKY A;  4IYI A;  3OMI B;  1R3J C;  3BCC H;  4LP8 A;  1TGO A;  1B6Q A;  3ZHS A;  4JTC B;  4H33 A;  3SYQ A;  1CXZ B;  2RJZ A;  4TV8 A;  4BWA A;  5DN6 G;  4YY3 B;  1XHX A;  4J7Z A;  4JI5 O;  1NJI W;  5KUK A;  2WA4 A;  3I5D A;  1NH2 B;  3K58 A;  1V55 C;  1GN2 A;  2VWJ A;  2DYR C;  2Z5U A;  1HP8 A;  1M57 B;  1M93 A;  3AG1 C;  4EFB A;  3UO2 A;  2LW1 A;  1ZWI C;  4OXS A;  2IJK A;  4PDM A;  3SR2 C;  3B4S A;  3ABM B;  2WLI A;  2OTJ V;  2RDC A;  3ABK C;  1AR4 A;  4JI1 B;  2KSD A;  3E35 A;  3JAK B;  1RP3 B;  3SPC A;  3C3S A;  4XDL A;  4IGG A;  2RMK B;  4QGP A;  2IJH A;  4HNA A;  4GX1 A;  2BSK A;  4DV6 B;  3T1H O;  2UUA O;  4JAV A;  4TV9 B;  2LGW A;  2JEX A;  1OJH A;  5JVD A;  4X1Y B;  4YJ2 A;  4JYA B;  2R9I A;  5EC2 C;  4DR6 B;  2IJJ A;  1JFF B;  3OFN G;  3RFR A;  3P30 A;  3CRM A;  2ZCE A;  5FNV A;  2LO1 A;  1Q81 W;  1PPJ H;  1ZL8 B;  2CK3 G;  3B8N A;  5IYB O;  2RCV A;  4NTX A;  3RVZ A;  4ZI7 A;  3FB5 C;  4DV4 B;  3A0H Z;  3PN1 A;  5JWP A;  3VBB A;  2KG7 B;  1DTO A;  2PYJ A;  1NS1 A;  3CCV V;  5FL7 G;  2CDY A;  3HKC A;  5GON A;  5LMU B;  2Q4P A;  1G4Y B;  2Y0I A;  4PA6 A;  1M56 B;  4TWK A;  1B06 A;  1N33 O;  3L70 H;  3BHP A;  3P3N A;  3SYA A;  5AG2 A;  1VF5 B;  3D36 A;  1GM7 A;  3G6B A;  3L75 H;  4OX9 B;  4B3M O;  3VOU A;  4QE7 A;  2ZE5 A;  1I0H A;  4JI8 O;  3R66 A;  5LP6 B;  4WFA V;  4L8J A;  2XTA A;  1VQ5 V;  2YC0 A;  1WP8 A;  1VQK V;  5EBW C;  5CMU A;  1XRE A;  1Y6X A;  4QJF B;  1FFT B;  1VF7 A;  1YIT V;  2YEV B;  2GHY A;  1JCH A;  4D7T A;  4J42 A;  1VF6 A;  2PUS A;  2ATK C;  2RN9 A;  4DV7 B;  4WBN A;  2P4V A;  1XMQ O;  2UXD O;  4O4L B;  4TQD A;  4YHH O;  4LFC O;  1FXH A;  1WB7 A;  4X1Y A;  1FFX A;  1KD1 W;  5IYZ B;  4PI0 A;  1IZ3 A;  5H5N A;  1YI2 V;  4JI6 O;  4LF7 B;  5IT9 N;  4JI8 B;  3E86 A;  1B3Q A;  4O4J B;  4WFF A;  1Y66 A;  4EB6 A;  4B3M B;  5KX5 B;  4O4H A;  5B1B B;  4KP4 A;  1AI5 A;  4B08 A;  2PF4 E;  2HHH O;  4GYC B;  3CCJ V;  1DK1 A;  5H2F Z;  4O4L A;  3FYE B;  3JCU Z;  4RUE A;  2HJF C;  1VQL V;  4JPR A;  3ZMV A;  3A0R A;  4I55 A;  3K5N A;  2QTO A;  3SPH A;  2ZIO A;  4ICG A;  1URF A;  3ML0 A;  3N2K A;  4X1I B;  5HFL A;  4KUM A;  5TIS Z; 
#chains in the Genus database with same CATH homology
 5BXZ A;  5LMN O;  4JI5 O;  1N36 O;  4LF7 O;  1AB3 A;  5IWA O;  2AGA A;  3O65 A;  3J80 N;  4B3M O;  1HNX O;  2UUB O;  4GKJ O;  1AIL A;  4JI7 O;  4DV3 O;  1YZB A;  3J81 N;  4LFB O;  4JI8 O;  3R66 A;  2JRI A;  4LF8 O;  4JYA O;  1J5E O;  2DOS A;  4DV6 O;  4LF6 O;  4X66 O;  2ZM6 O;  4X64 O;  1FKA O;  1A32 A;  1N32 O;  4OX9 O;  4JI0 O;  4DV0 O;  2LW7 A;  1X59 A;  4DV2 O;  5LMU O;  4DUZ O;  4DR1 O;  5LL6 Y;  5A2Q N;  3OTO O;  4DV4 O;  1IBM O;  4OPH A;  1XMQ O;  4DR2 O;  4K0K O;  1HNW O;  2UXD O;  2VQF O;  3T1H O;  2UUA O;  4DV5 O;  4YHH O;  4LFC O;  2ZKO A;  5BR8 O;  2N74 A;  2F4V O;  3SDL A;  3JAM N;  1G1X B;  2E5L O;  3J7A U;  1IBL O;  4LF4 O;  4B3R O;  4JI1 O;  2UXC O;  1I94 O;  4JI4 O;  4DR6 O;  4A5U B;  5BY1 A;  1F7Y A;  4JI3 O;  5FLX N;  5H5N A;  4JI6 O;  5IT9 N;  4KHP O;  4YY3 O;  4LF5 O;  4AQY O;  3RT3 C;  1R6T A;  4DV1 O;  3M8A A;  4NXN O;  4DR7 O;  1FYJ A;  4X65 O;  4DR5 O;  2HHH O;  4DUY O;  1XMO O;  4LFA O;  1DK1 A;  1XEQ A;  3T1Y O;  4NXM O;  1FJG O;  4GKK O;  4B3S O;  1IBK O;  2UXB O;  1NS1 A;  2UUC O;  4DV7 O;  1HNZ O;  1XNQ O;  4OPA A;  4DR3 O;  4DR4 O;  4LF9 O;  2DJV A;  1HR0 O;  4B3T O;  2VQE O;  1N33 O;  3F5T A;  4X62 O;  4JI2 O;  1D2D A;  1R1B A;  4JV5 O;  2UU9 O;  1KUQ A;  2FKX A;  1XNR O;  2Z0A A;  1N34 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...