3O9OA

Crystal structure of gbs1074, an esat-6 homologue from group b streptococcus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
92
structure length
92
Chain Sequence
IKLTPEELRSSAQKYTAGSQQVTEVLNLLTQEQAVIDENWDGSTFDSFEAQFNELSPKITEFAQLLEDINQQLLKVADIIEQTDADIASQIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein gbs1074
publication title The homodimeric GBS1074 from Streptococcus agalactiae.
pubmed doi rcsb
source organism Streptococcus agalactiae
total genus 41
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3o9oA00
3TXQA 4I0XA 3G80A 2VRZA 4LWSB 2KG7A 2AZ0A 3ZBHA 1WA8B 3FAVA 3Q4HB 3GVMA 4I0XB 3OGIB 2VS0A 3GWKC 2DE0X 2KG7B 4GZRB 3TXSA 4LWSA 3FAVB 4ABMA 3O9OA 3HR0A 3FD9A 2AZ2A 3Q4HA 1WA8A 2B9ZA
chains in the Genus database with same CATH superfamily
1J95A 3K9AA 3TCUA 1FFXA 3DXRB 5C93A 3ML0A 1VQNV 4ICGA 2Y48A 2UXDO 3SPHA 2W0FC 3A0BZ 3ETDA 3UCSC 1F51A 5KHJA 1B04A 3OE7G 3SJQC 3EVKA 1N36B 1IVSA 1W0KG 1TUBB 4FFKA 4AILC 5HFMA 3LSSA 1X4TA 4DUZB 2YC0A 4PDMA 3IGAC 4F6RA 3OT7A 4HNAA 2WLLB 3Q4HB 1FJGO 4GX0A 4AQYB 3P3PA 3BCCH 1RM1B 2YIBD 2XHBA 4JZ2A 4QPKA 2F66C 4ZKIA 2YXLA 1BCCH 3F7YC 1GRJA 1CP9A 2OIGA 5IYZA 1XHZA 2FKXA 2QM8A 5LHHA 5EC1C 1FS0G 2JS5A 4DR6B 2WLIB 2PTMA 2EIJB 3WG7B 3OD4A 2N05A 4N21A 4JI5O 4DRXA 2ZDIC 3HKDA 2EILB 3ZN1A 2JEUA 2F4VO 4B3SO 2BOCC 4FFBB 2QTOA 2UXCB 5H6QA 1VQ7V 1NTZH 4K0KO 1WN7A 2A06H 4UCUA 2CGNA 1BHAA 3SYPA 1EFRG 2EIMB 2DYRB 4PV1B 4RUFA 1Y76B 1S3JA 4I55A 1XOUA 4X9QA 3ZRVA 2P6JA 3IJ4A 4YJ2B 1L8DA 2LP7A 2UXDB 3FKSG 2ZXWC 1NU1H 3G6BA 1M93A 2HEPA 1U96A 2BSKA 3VQWA 3X2QC 1Y4MA 2AZ0A 4FLVA 3B4SA 1K8AW 3MAQA 1MSDA 2E76B 4FLTA 2W0XA 2ZM6O 3JSNA 1YIJV 3AG4B 1GM7A 3G67A 3WFVA 3OEEG 1VF5B 3ZN0A 1FJGB 1SA0B 2KSDA 2R72A 1FXVA 1CPYA 1NH2B 4G28B 4MTGA 5LHIA 4DW1A 1K92A 2F95B 2H3OA 4I9QA 2CH7A 5D5PA 1FAFA 4R50A 4JTCB 3P3NA 2JVDA 2GUZB 4MW8A 1XUQA 3J80N 2QEXV 1HW7A 3TJTA 4JI5B 3CCJV 4YIOA 1N34O 5EBLC 2Y69C 2F4VB 3CC2V 4B3SB 5LXTA 2Q7GA 5IJ9A 4BIUA 2OCHA 1XI1A 4NKGB 3ABMB 1AP5A 4K0KB 1JOYA 5JQGA 1R1BA 2QR4A 3ASNB 4J11A 3H1LH 1XDCA 3DGEA 2FB5A 3W7XA 4CS3A 3RT3C 3ASOB 1N33O 3T2MA 4JI8O 3EXAA 4DK1A 2AW9A 1D5AA 1K34A 4JI2O 3UO3A 5FL7G 4FZ0A 4WBNB 3QO8A 3DXRA 3OR6C 3R65A 4YJ3A 1XNRO 3CRCA 1B06A 1NVPB 3AG3B 2ZM6B 2VWJA 4IL6Z 3BA9A 3K0GA 4KP4A 1MA1A 1K3EA 1SQXH 1RPOA 3K03A 3ZBHA 1W0JG 2V1DA 3P30A 3ZHUA 2IM9A 3I56V 2DWEC 3HKEA 3B2EE 2IU3A 2WLNA 3T1HO 5C8YA 2HJDA 1N4CA 3FX7A 3K58A 2QA4V 2WLLA 1K4DC 5GW7A 3K08A 1N34B 1YSCA 1PNKA 1KBHA 5JCOC 3MHSC 1VQMV 2HKOA 1OCCB 2LQTA 1AB3A 3U10A 2QWPB 5H6RA 1IBKO 5KAIZ 3W7WA 4OPAA 4IYHA 4UXNA 3ETEA 2DYSB 1NR1A 4OGQB 3W7SA 5LYJB 4TSFG 1GO3F 4IYIA 3ZJZA 3SPCA 3JD4A 4O2AB 1YJNV 1US6A 4CH6A 2EX3A 4FFBA 1BHBA 2XAHA 5JJEB 1N33B 1VP7A 4JI8B 3QNEA 4XDJA 2WLMA 3JAKB 2OYQA 4Z1MG 2EZOA 2CAZC 4DW0A 3S3XA 4JI2B 1RSOA 4CH5A 2VQFB 4FLWA 3CRRA 3FFQA 1V54B 1QCEA 1XNRB 3NR7A 4YJ2A 4TOIA 4RUEA 3RYFB 4J7ZA 2OT5A 1RP3B 5CA0B 4FLZA 5LMNO 3TXSA 1H8EG 5IT9N 3ETQA 3T1HB 1XMQO 3ZS8C 4JPRA 3SPIA 4MSWC 2PI4A 3RW0A 4JI3O 1KKCA 4JYYA 4MVOA 3CCQV 1IXMA 1YITV 1SA0A 5CB4A 1BS3A 1I0HA 1J5EO 1DGSA 5LOVB 1VQLV 4CZZA 4IT5A 5KX5B 2GBOA 2XNDG 4LNUA 1GN2A 4I4TA 4O4IB 1NT2B 4C7UA 2V4DA 1YHQV 2UXBO 2Q67A 2WLKA 3HKBB 2RCVA 1IX9A 4NTYA 5H2FZ 4DV5O 1QQCA 2GUZA 2ZR2A 4DR5O 4FLXA 2PYJA 2R9IA 5JWPA 3SJCC 3CP1A 1FFXB 1D2DA 1V55C 4RQEA 3JD3A 3UT5B 2ZKOA 5LBQA 1QNMA 4WFEA 4BW5A 2Q6AA 2X0LA 4J80A 1RPRA 4DV0B 2CDYA 1TUEB 2HHHO 1IZ3A 2B1GA 4I5SA 3K5OA 2YXYA 5IWAO 3D8CA 4F6RB 2X6CA 4HNAB 5KMGA 2PGGA 1T5EA 4O4LB 1YF2A 2QSAA 4J42A 5LMNB 4QJFB 1G4YB 1YTFB 5EZYA 1S0VA 1SZXA 1PD3A 5IYZB 1XMQB 1OJHA 2Q7HA 4O4HB 3APQA 1M9NA 4OXSA 4JI4O 3RYIB 3ABTA 2KQXA 4JI3B 4W4KA 4X89A 2ADPA 4DRXB 1PM9A 1J5EB 3CSXA 2CTQA 5KHIA 3G6EV 5DN6G 1R3LC 2YXHA 1R3KC 3CHXA 5CA1B 1XHXA 1AP6A 3MHHC 5JVDB 1N0NA 1QLEC 1V55B 3TGUH 2EBOA 2X7RB 4FIPC 2YIDA 4MVZA 1Q7YW 3FAVB 4DR5B 2E75B 2WAMA 5IY5B 2ZE6A 4X1IB 4LH7A 2OWOA 4NTWA 1R3IC 1QVGU 5LGUA 3FYEB 1FPOA 4PI0A 4QPJA 1AVMA 3K0DA 1JFFA 3SPGA 1MMMA 2Y4UA 5LYJA 2HHHB 1ZWIC 4HYOA 5KHHA 4O2AA 4JYBA 5LHGA 3CEIA 4R6ZA 5IWAB 3G80A 2Q69A 4O4JB 1F4MA 4LCUC 2HVJC 2P4KA 5CBFA 4UUJC 1I5YA 1VIBA 5KAFZ 4TT3G 1S5LZ 1JPXA 3TETA 1Q3EA 5AG2A 2F43G 3LNNA 2YEVA 4JI4B 4F4LA 5DM6V 4J41A 2DMXA 2ITCC 1H38A 3B77A 4B7KA 3OAAG 5LMUO 1HNZO 1NJIW 3RWRD 1SS3A 4UCTA 1AJNA 1SQGA 4TV8B 5IJ9B 1G1XB 1QVFU 1RM1C 2IU0A 5HFLA 2CTPA 2ZR3A 3GVMA 1S77D 4KXRA 4UV8A 2AXTZ 2F23A 2QWOB 1K97A 5JQGB 2VWKA 4QE7A 4JI1O 4LP8A 4DR4O 4LF8O 3CXHF 1I94O 5LA6B 5E1AC 1JCHA 1IBMO 3WG7C 3BABA 2JDIG 3O65A 1EN4A 2EILC 2Q9LA 1R6TA 2AHYA 2LW1A 2B9ZA 1JJOA 5KA5A 2KG7A 4YJ3B 3UT5A 3DC6A 4GUNA 5IYCO 4JI6O 2CUGA 2XAJA 1TAEA 4B3RB 2EIMC 2DYRC 3T1CA 1AR4A 3BAAA 1GN6A 3HKEB 4FJCC 1JR9A 5K1PA 5C8YB 5KUMA 4MS2A 3D3IA 4PA6A 5EC2C 1FXKB 2XOKG 3GB7C 2UUAO 4LFCO 2XAGA 3I5DA 1NKDA 5LMUB 4O4LA 1O9GA 2EULA 1F7YA 2QTSA 1HNZB 4RO2A 4TQFA 3L73H 1GM9A 1CXZB 1PP9H 3AG4C 2BCCH 1IXBA 3BHPA 4O4HA 2DOSA 4K8XA 2K9PA 3RYIA 3BPZA 2HP8A 1SZTA 1WPXA 5B1BB 1HDJA 1N32O 1HP8A 1JX9A 2Y4TA 2YSUB 1R73A 1VEWA 4JI1B 3C3TA 4LF8B 2JJ2G 4DR4B 3D36A 2JIZG 2ZIOA 5CA1A 1I94B 2B1IA 3H01A 1NH2D 5JVDA 1IBMB 2C2AA 4FMTA 4B7EA 1P49A 1GN4A 1Y6XA 4KHPO 1SQPH 1H8HG 3N2GA 5TISZ 4LFBO 4X64O 3FAVA 1RSOB 2IJJA 3J81N 1EBOA 3IFXA 3ABMC 1CEZA 4X1IA 5IYDO 3JALB 2WLHA 1AI4A 4JI6B 1MABG 3ASNC 4H44B 2EINC 4YHHO 2E74B 3ASOC 1Q81W 5K1XA 4X8AA 3MD0A 1WP7A 1MOFA 2OTJV 1W59A 1COWG 1M5IA 2DE0X 2OCCC 4H37A 3WB2A 2AGAA 3K04A 4XDLA 4O4JA 4JYCA 2LO1A 2UUCO 2UUAB 5CB4B 4LFCB 1DLBA 4P9OA 5BY1A 1GN3A 3UKMA 3AG3C 2G38A 4MW3A 1AILA 3RVYA 3W7UA 4JTAB 4LNUB 3E8BA 4I4TB 2HFEC 4GKKO 2DN9A 2AHZA 2VS0A 3ABKB 1UJWB 1NVPD 3AK3A 3QO7A 4ABMA 2IH3C 1N32B 3CCRV 4PD4F 3A0RA 4LH6A 3CRMA 1LUVA 3RN4A 1MNGA 3B40A 4TV8A 1H2NA 1I5XA 2HVKC 1AROP 4PELA 4ZHQB 1HNWO 3E35A 1XBLA 1XQ8A 2NNUA 3WB1A 4KHPB 1OCCC 4J9YB 4LFBB 4JASA 3BA8A 4IHJA 4X64B 1E1QG 1Y66A 3ABUA 2P5OA 1M56C 4ZIBA 2EINB 3SYCA 1NTKH 5LA6A 1L1FA 2V7QG 4JI0O 2H8PC 2DYSC 2Y0PA 4OPHA 1GH6A 1XL4A 5KMGB 1HNXO 2B5UA 4Z1VA 3THOA 2OIEA 2OCCB 3EHBB 3K9SA 1M90W 3JAMN 5L3BA 5EZYB 4NXNO 4P2ZA 1FD9A 2IH1C 2LFRA 4NR1A 4CC5A 1L0LH 3ABLC 2VRZA 2K1EA 2KB1A 3U11A 5EBWC 2UUCB 4GKJO 2L35A 2M7WA 4FK5C 1V54C 1YZBA 2ZINA 3J7AU 5EIBC 2FYUH 3CCSV 2DJVA 1BSMA 3LUTB 3JASB 2PY5A 1Q82W 4GKKB 1VQOV 4EFBA 1FXKA 5EIBD 5H9CA 4QNHB 3UQ8A 2YIAA 4PDRA 1NR7A 4HZ3A 4QIWF 2N74A 1Y67A 4BW9A 5LP6A 3CRAA 2A7WA 1X59A 4K3AA 1M56B 1KC8W 3OUFA 1M57B 1HNWB 2XT9A 1VQ8V 1JFFB 4B08A 1K33A 4KFMA 3AG7A 3E8HA 5L3EA 1FKAO 4WFGA 3ZHVA 4X65O 1XEQA 3ICXA 2PUSA 1WLEA 2Z5UA 5LL6Y 4JI0B 3JD0A 4GZRB 3F7VC 3ABLB 3A2FA 1HNXB 3CC7V 1ORQC 4GX2A 3KG2A 4I0XA 4UVAA 2IW5A 4UB6Z 4NXNB 3KZIZ 2KKWA 2QM7A 1SF9A 3ZX6A 1JVMA 1K9MW 2WA4A 2PI5A 3JALA 1MZEA 2YEVB 1AI7A 3CX5F 3SJBC 1AJPA 4PA9A 5E79Z 3B09A 3RGBA 4GKJB 2XAFA 1KP3A 2P67A 1SC5B 4B3MO 5EK0A 1AR5A 1Q90D 2RNBA 4PHZA 2LW7A 3CCLV 5CBHA 4WFHA 4ZBMA 1K73W 3JD2A 1PPJH 4DV1O 4PA7A 4EFEA 4DYLA 3K5LA 3FB7C 1H2GA 1PL4A 4RWUA 1R6NA 4N23A 2HLDG 2Q73A 3G71V 1YTFD 3VBBA 5IJ0A 4BIOA 1IBKB 3BY6A 3DC5A 1VQKV 1SKVA 1MSWD 2KG7B 4LFAO 2VQEO 5CN0A 4X65B 3VOUA 2ZDIA 3JCUZ 3OUSA 4JZGA 1FFTB 5J2TA 2QGNA 4ZHQA 2MW2B 1OCRB 5IY5C 4WF9V 5A2QN 1ZSPA 5L3DA 2ZE7A 1S72V 3K59A 4LF5O 4JAUA 3E86A 4X1KA 3FB6C 2Q7EA 4JF3A 1QBZA 3L70H 3SDLA 2QWQB 3EFFK 1ENVA 4WCEV 4I9WA 4DV4O 2D2CB 3E83A 4NXMO 4DV7O 1OV9A 2EIKB 3OR7C 4XBFA 1N8RW 2A3QA 3GWOA 4B3MB 2FMLA 2Y0IA 2YI9A 2ZD9A 3NXSA 2W6IG 5JJNB 5DECA 1B3QA 2PZSA 3VQYA 4DV2O 1V9PA 2WLJA 3QO5A 3OMAB 4X20B 2YUAA 4DV1B 1E79G 5GONB 2ETNA 1DTOA 3JASA 4FPPA 2YDEA 4MVRA 2UXBB 5CA3A 1DF4A 4DV5B 3N2GB 3VQXA 1YI2V 1GK9A 4ZOLB 4LF6O 4GCZA 2GSMB 2JGDB 4I50A 4LFAB 2VQEB 5B1OA 3AK1A 4FM1A 1QLNA 3E22B 4G27B 3JSLA 4MVUA 4IIJB 2EJRA 5B5EZ 4JAAA 2RMKB 2QDOA 1AJQA 2BE3A 1VF7A 4UFZA 4LF5B 3RYHB 3TK1A 2A79B 2ARHA 3AK2A 3QG5A 3SYOA 4OX9O 1SQQH 2R9RB 3HKCA 4R7CA 1E1RG 1OCOC 4PA4A 4TUYB 1TGOA 1BE3H 4NXMB 4CH3A 4DV7B 3W7TA 5BXZA 3SYQA 1H2LA 5LGNA 1AI5A 4E4EA 3SPJA 4J10A 3JYCA 1BMFG 3CE2A 2RJZA 4LWSB 2PYLA 3PJSK 4NB5A 2NR5A 1UFIA 3H1JH 3OMIB 3ZMSA 4DV2B 3CB2A 4BR6A 2QKCA 1OHHG 5IE9A 1FXKC 2IBZH 1IDSA 3JAWA 1THZA 2BTOA 1XILA 2EZPA 1BT8A 2Q0AA 5LP6C 1BZKA 1ZAUA 4IHJB 1I7FA 3M99B 4LF6B 2YICA 4U3FH 2ZNJA 3UO2A 4LF7O 1Q6IA 3AG1B 3PN1A 2QKAA 5B1BC 1Q6UA 1I08A 1B6QA 1P7GA 1KU9A 3FD9A 5EYPB 4GLXA 4L8JA 5KA6A 2ODMA 4DO2A 3OW2U 1OCOB 1JA8A 3RFRA 2DQ0A 2X6BA 1VF6A 4OX9B 3T4DA 3IC9A 1Z5VA 1IURA 2N04A 3ZRWA 2BTQA 2ZQMA 5ITZA 4D6TH 5B66Z 4ASUG 1ZLZA 2JS3A 1G8MA 2E3CA 3OTFA 3CWBH 3ZMZA 4JI7O 4CBCA 4X88A 3HB3B 4CH4A 2RDCA 3E2EA 2P22C 2PF4E 3L74H 5DEDA 1GAXA 2H94A 4MTOA 5LP6B 5A9GA 4TWKA 3ZMUA 1KUQA 3BFRA 3OTOO 4O2BB 4NTXA 4Q20A 5BZBA 4EB6A 4U3JB 2X6AA 1QU7A 5F2VO 2UU9O 2P06A 3CCUV 3K79A 1NQTA 4MTXA 1YXBA 4UCSA 4X20A 3F5TA 2JGUA 4RAIA 1GKFA 1K5SA 1FYJA 5GONA 3ABKC 3CJHA 4LF7B 4AI8A 3OM3B 4TV9B 1VQ5V 2L6LA 1ZL8B 3FYIB 1U97A 2WSSG 1Q86W 2UUBO 4X66O 2NLJC 1QR8A 2GV9A 1EM1A 4ZOLA 4I0XB 4BAYA 3STZC 1G6UA 2JGDA 1GM8A 1WJZA 5L3GA 2ILMA 2AZ2A 5D5QA 4BIZA 1XMOO 2R70A 2HR3A 1VQPV 2JK5C 2LGQA 3E22A 2P7TC 3ZHTA 4IIJA 2RQ6A 2XTAA 4X1YB 4U7OA 4UCRA 4QE9A 2Q0OC 4MVQA 4D7TA 3RYHA 4E2LA 3LNMB 2OTLV 4DR3O 1WB8A 4JI7B 4UVBA 3QF7A 1Q6HA 4DR7O 3L72H 3SGIA 4TUYA 2CTRA 2QM4A 2MK3A 5J2UA 3ZEDA 4MVMA 3WB0A 3D3QA 1DF5A 3A8TA 5B1NA 3OTOB 5IJ0B 5FLXN 1YJ9V 1DK1A 3KKYA 1SQFA 3BRCA 4LWSA 2UU9B 3M7MX 2IJHA 1D5NA 5KHKA 3UM7A 3CYOA 5JH7B 5FPRA 1KMIZ 5J2TB 1KP2A 3OMNB 4DV3O 3R66A 4WFBV 2UUBB 4X66B 3RYCB 1Q5OA 3LDEA 3N2KA 1FXHA 4ZI7A 3CCMV 1S5JA 5LGTA 1XREA 1M57C 4IGGA 1JMKC 3LSUA 4X1KB 3L75H 1XMOB 3N27A 5EYPA 3K06A 4J9ZB 2ZXWB 2DWDC 1R6KA 4YHHB 3DSQA 1K4CC 1Q43A 3X2QB 4HAMA 1OZ0A 2F1MA 4JYAO 2GDSA 5GTIZ 2Q8VA 1SESA 4GX5A 4H13B 4DR3B 1HWYA 1ZUQA 2A0LA 1GMGA 4DR7B 1N0JA 4PDVA 2VQFO 1H2SB 1KKDA 4B3TO 1URFA 1IBLO 3H9VA 3QTCA 1PNMA 5CMUA 3KCXA 3AEIA 4GT1A 4I7ZB 1EN6A 2CTWA 2ZNIA 4GYCB 4MTFA 1UPGA 1ZTEA 1P4RA 1R3JC 1BQ0A 1TUBA 3OGIB 4G2KA 3MDSA 4I50B 4R8CA 2O57A 3GWKC 1F23A 3L9DA 1YJWV 2NN4A 3DTUB 3ZHQA 4O2BA 4K8ZA 2Y69B 2RN9A 3CS5A 4PJ0Z 4U3JA 1SQVH 3Q4HA 4LR3A 2HJFC 2ZIMA 4Z2WA 4MT8A 4DV3B 4WFFA 2DW4A 3ZMVA 1WAZA 3LSQA 4QGPA 2XAQA 4HBNA 4RQFA 1VQ4V 4DR1O 3H1KH 4TV9A 4K35A 1KQSU 1F4NA 2WLIA 3CXCU 1ZL8A 3OEHG 3HKCB 1TVKB 2CGOA 4JAVA 1WP8A 3ZRXA 3HPLC 3AG2C 4PA3A 4DR2O 1XNQO 3ZMTA 1VF6C 2P90A 1WA8B 4A5UB 2ADQB 4JYAB 1OCRC 4LBEC 1H2KA 4KUMA 1SRYA 2YS8A 2LGWA 4DV0O 2Z3YA 2UXNA 1SQBH 4J7KA 2JJ1G 1EZVH 2Q68A 1JQ0A 3LDDA 3QVNA 1OCZC 2CE4A 4X1YA 1KB9F 4UVCA 5IDJA 4TQDA 1Y76A 3VQVA 3I55V 4B3TB 3JAWB 2LJ2A 4P30A 1S76D 1IBLB 2ZE5A 2R9AA 2FL4A 1KECA 3KCYA 3T1YO 3JATB 2YIBA 1K5QA 3CRQA 2EIKC 3K57A 3E8FA 1JJ2U 3C3SA 3JD1A 3K5NA 4YXWG 1VARA 5KHGA 3TXQA 2E5LO 5FNVB 2BOBC 2XASA 1W2BU 3K3WA 1BQZA 2WWWA 5BR8O 3CCVV 1Y74B 4PI2A 1NBMG 3F5WC 3D36C 1S5HC 2WPDG 5BMVB 3FB5C 1NTMH 1MG1A 4DV6O 1VMGA 3P32A 3ZHRA 3RVZA 4FLUA 5JH7A 1PV0A 1HR0O 1KD1W 3B8NA 4DR1B 3AG2B 3JARB 3T4ZA 2D3OW 3A0HZ 3OGCC 4LF4O 2HG5C 1P84F 3ZRWB 1ZX3A 4NYKA 2DQ3A 2BTQB 3ZIAG 3RYCA 3IC7A 5ITZB 5J9PC 1OCZB 5FPOA 5KUKA 4DR2B 1XNQB 1EN5A 3SR2C 4UB8Z 4GX1A 3CCEV 3H1HH 4NVPA 3CMAV 2Q5ZA 1P7BA 1VQ9V 2ZE8A 3SYAA 3ZRSA 1LUWA 3ETGA 4JGSA 2A9HA 5L3CA 2JRIA 4P9PA 4EB6B 1PNLA 1EZJA 1O9HA 3T1YB 2JEXA 2LFSA 3ZHSA 4DK0A 5EBMC 3OFNG 4LF9O 1YEWA 3M8AA 4WBNA 1L0NH 3K5MA 4DUYO 3RBZA 2WA3A 1BL8A 1H2MA 3S3WA 3CJHB 4CS2A 4YIPA 1PKXA 2E5LB 1NS1A 3IAYA 3E8GA 5GTHZ 1AI6A 2Q4PA 2QWRB 4DXWA 5BR8B 1GTOA 4EEQA 3SJAC 1BGYH 4PDLA 3E89A 3HKDB 2YI8A 1KYOF 4AHCA 4DV6B 4UV9A 2ITDC 4YY3O 1HR0B 3U0ZA 2F93B 1SERA 3H1IH 3JCZA 1ROPA 4X62O 4LF4B 1K7DA 2IJKA 3AG1C 3WU2Z 1RFYA 4JV5O 3O9OA 4I55B 3BVOA 4FVMA 4F6EA 4UCOA 4FM0A 3BEHA 1XL6A 4KL1A 2BSKB 5B1AC 3CC4V 1TVKA 4EKWA 4FM2A 1Z2GA 3CPWU 4DV4B 5J2UB 2FTKA 2QKSA 1NZ6A 5B3SC 1AR1B 1QR9A 1PL0A 4J7JA 3ZCCA 2EJ7A 4FLYA 1WA8A 4CS4A 3C90A 4U7NA 3B8MA 4B3RO 1QHTA 1WB7A 3JAKA 2GTAA 1NI8A 2CK3G 3APOA 1N36O 3G4SV 4MVSA 1M1KW 4LF9B 1Q8IA 5KLVH 4FZ1A 4DUYB 1YDXA 2ZCEA 5H5NA 4DUZO 4CC6A 2M6YA 3FB8C 2CH7B 2GTSA 4H33A 3RYFA 5IYBO 4AQYO 3JATA 2GHYA 5CA0A 4WFAV 1QLEB 1YVWA 4LC1A 1LNQA 1YCIA 4W4LA 2IJIA 5L3FA 3N2KB 4ZI7B 1A32A 1VQ6V 2ATKC 1WNSA 5LXTB 2QJ1A 5JJJB 4L87A 2ZT9B 1WPBA 5FNVA 4YY3B 2QE7G 2W6JG 5JCOA 4DR6O 1LR1A 2P4VA 2XUMA 3HR0A 3CMEV 4X62B 1Y74A 3STLC 3CD6V 3LDCA 2Z0AA 3L71H 2QWNB 5BMVA 5CBGA 4JV5B 5B1AB 5LOVA 1M4UA 5KX5A 4XDKA 4O4IA 4Q6GA 2EIJC 1Z5WA 4BWAA 5B3SB 1TA8A 3HKBA 3JARA 2UXCO 4JTDB 1SETA 4H0LB 4D7SA 4UCVA 1MZFA 2UXXA
chains in the Genus database with same CATH topology
3TXQA 4I0XA 3G80A 2VRZA 4LWSB 2KG7A 2AZ0A 3ZBHA 1WA8B 3FAVA 3Q4HB 3GVMA 4I0XB 3OGIB 2VS0A 3GWKC 2DE0X 2KG7B 4GZRB 3TXSA 4LWSA 3FAVB 4ABMA 3O9OA 3HR0A 3FD9A 2AZ2A 3Q4HA 1WA8A 2B9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TXQ A;  4I0X A;  3G80 A;  2VRZ A;  4LWS B;  2KG7 A;  2AZ0 A;  3ZBH A;  1WA8 B;  3FAV A;  3Q4H B;  3GVM A;  4I0X B;  3OGI B;  2VS0 A;  3GWK C;  2DE0 X;  2KG7 B;  4GZR B;  3TXS A;  4LWS A;  3FAV B;  4ABM A;  3O9O A;  3HR0 A;  3FD9 A;  2AZ2 A;  3Q4H A;  1WA8 A;  2B9Z A; 
#chains in the Genus database with same CATH topology
 1J95 A;  3K9A A;  3TCU A;  1FFX A;  3DXR B;  5C93 A;  3ML0 A;  1VQN V;  4ICG A;  2Y48 A;  2UXD O;  3SPH A;  2W0F C;  3A0B Z;  3ETD A;  3UCS C;  1F51 A;  5KHJ A;  1B04 A;  3OE7 G;  3SJQ C;  3EVK A;  1N36 B;  1IVS A;  1W0K G;  1TUB B;  4FFK A;  4AIL C;  5HFM A;  3LSS A;  1X4T A;  4DUZ B;  2YC0 A;  4PDM A;  3IGA C;  4F6R A;  3OT7 A;  4HNA A;  2WLL B;  3Q4H B;  1FJG O;  4GX0 A;  4AQY B;  3P3P A;  3BCC H;  1RM1 B;  2YIB D;  2XHB A;  4JZ2 A;  4QPK A;  2F66 C;  4ZKI A;  2YXL A;  1BCC H;  3F7Y C;  1GRJ A;  1CP9 A;  2OIG A;  5IYZ A;  1XHZ A;  2FKX A;  2QM8 A;  5LHH A;  5EC1 C;  1FS0 G;  2JS5 A;  4DR6 B;  2WLI B;  2PTM A;  2EIJ B;  3WG7 B;  3OD4 A;  2N05 A;  4N21 A;  4JI5 O;  4DRX A;  2ZDI C;  3HKD A;  2EIL B;  3ZN1 A;  2JEU A;  2F4V O;  4B3S O;  2BOC C;  4FFB B;  2QTO A;  2UXC B;  5H6Q A;  1VQ7 V;  1NTZ H;  4K0K O;  1WN7 A;  2A06 H;  4UCU A;  2CGN A;  1BHA A;  3SYP A;  1EFR G;  2EIM B;  2DYR B;  4PV1 B;  4RUF A;  1Y76 B;  1S3J A;  4I55 A;  1XOU A;  4X9Q A;  3ZRV A;  2P6J A;  3IJ4 A;  4YJ2 B;  1L8D A;  2LP7 A;  2UXD B;  3FKS G;  2ZXW C;  1NU1 H;  3G6B A;  1M93 A;  2HEP A;  1U96 A;  2BSK A;  3VQW A;  3X2Q C;  1Y4M A;  2AZ0 A;  4FLV A;  3B4S A;  1K8A W;  3MAQ A;  1MSD A;  2E76 B;  4FLT A;  2W0X A;  2ZM6 O;  3JSN A;  1YIJ V;  3AG4 B;  1GM7 A;  3G67 A;  3WFV A;  3OEE G;  1VF5 B;  3ZN0 A;  1FJG B;  1SA0 B;  2KSD A;  2R72 A;  1FXV A;  1CPY A;  1NH2 B;  4G28 B;  4MTG A;  5LHI A;  4DW1 A;  1K92 A;  2F95 B;  2H3O A;  4I9Q A;  2CH7 A;  5D5P A;  1FAF A;  4R50 A;  4JTC B;  3P3N A;  2JVD A;  2GUZ B;  4MW8 A;  1XUQ A;  3J80 N;  2QEX V;  1HW7 A;  3TJT A;  4JI5 B;  3CCJ V;  4YIO A;  1N34 O;  5EBL C;  2Y69 C;  2F4V B;  3CC2 V;  4B3S B;  5LXT A;  2Q7G A;  5IJ9 A;  4BIU A;  2OCH A;  1XI1 A;  4NKG B;  3ABM B;  1AP5 A;  4K0K B;  1JOY A;  5JQG A;  1R1B A;  2QR4 A;  3ASN B;  4J11 A;  3H1L H;  1XDC A;  3DGE A;  2FB5 A;  3W7X A;  4CS3 A;  3RT3 C;  3ASO B;  1N33 O;  3T2M A;  4JI8 O;  3EXA A;  4DK1 A;  2AW9 A;  1D5A A;  1K34 A;  4JI2 O;  3UO3 A;  5FL7 G;  4FZ0 A;  4WBN B;  3QO8 A;  3DXR A;  3OR6 C;  3R65 A;  4YJ3 A;  1XNR O;  3CRC A;  1B06 A;  1NVP B;  3AG3 B;  2ZM6 B;  2VWJ A;  4IL6 Z;  3BA9 A;  3K0G A;  4KP4 A;  1MA1 A;  1K3E A;  1SQX H;  1RPO A;  3K03 A;  3ZBH A;  1W0J G;  2V1D A;  3P30 A;  3ZHU A;  2IM9 A;  3I56 V;  2DWE C;  3HKE A;  3B2E E;  2IU3 A;  2WLN A;  3T1H O;  5C8Y A;  2HJD A;  1N4C A;  3FX7 A;  3K58 A;  2QA4 V;  2WLL A;  1K4D C;  5GW7 A;  3K08 A;  1N34 B;  1YSC A;  1PNK A;  1KBH A;  5JCO C;  3MHS C;  1VQM V;  2HKO A;  1OCC B;  2LQT A;  1AB3 A;  3U10 A;  2QWP B;  5H6R A;  1IBK O;  5KAI Z;  3W7W A;  4OPA A;  4IYH A;  4UXN A;  3ETE A;  2DYS B;  1NR1 A;  4OGQ B;  3W7S A;  5LYJ B;  4TSF G;  1GO3 F;  4IYI A;  3ZJZ A;  3SPC A;  3JD4 A;  4O2A B;  1YJN V;  1US6 A;  4CH6 A;  2EX3 A;  4FFB A;  1BHB A;  2XAH A;  5JJE B;  1N33 B;  1VP7 A;  4JI8 B;  3QNE A;  4XDJ A;  2WLM A;  3JAK B;  2OYQ A;  4Z1M G;  2EZO A;  2CAZ C;  4DW0 A;  3S3X A;  4JI2 B;  1RSO A;  4CH5 A;  2VQF B;  4FLW A;  3CRR A;  3FFQ A;  1V54 B;  1QCE A;  1XNR B;  3NR7 A;  4YJ2 A;  4TOI A;  4RUE A;  3RYF B;  4J7Z A;  2OT5 A;  1RP3 B;  5CA0 B;  4FLZ A;  5LMN O;  3TXS A;  1H8E G;  5IT9 N;  3ETQ A;  3T1H B;  1XMQ O;  3ZS8 C;  4JPR A;  3SPI A;  4MSW C;  2PI4 A;  3RW0 A;  4JI3 O;  1KKC A;  4JYY A;  4MVO A;  3CCQ V;  1IXM A;  1YIT V;  1SA0 A;  5CB4 A;  1BS3 A;  1I0H A;  1J5E O;  1DGS A;  5LOV B;  1VQL V;  4CZZ A;  4IT5 A;  5KX5 B;  2GBO A;  2XND G;  4LNU A;  1GN2 A;  4I4T A;  4O4I B;  1NT2 B;  4C7U A;  2V4D A;  1YHQ V;  2UXB O;  2Q67 A;  2WLK A;  3HKB B;  2RCV A;  1IX9 A;  4NTY A;  5H2F Z;  4DV5 O;  1QQC A;  2GUZ A;  2ZR2 A;  4DR5 O;  4FLX A;  2PYJ A;  2R9I A;  5JWP A;  3SJC C;  3CP1 A;  1FFX B;  1D2D A;  1V55 C;  4RQE A;  3JD3 A;  3UT5 B;  2ZKO A;  5LBQ A;  1QNM A;  4WFE A;  4BW5 A;  2Q6A A;  2X0L A;  4J80 A;  1RPR A;  4DV0 B;  2CDY A;  1TUE B;  2HHH O;  1IZ3 A;  2B1G A;  4I5S A;  3K5O A;  2YXY A;  5IWA O;  3D8C A;  4F6R B;  2X6C A;  4HNA B;  5KMG A;  2PGG A;  1T5E A;  4O4L B;  1YF2 A;  2QSA A;  4J42 A;  5LMN B;  4QJF B;  1G4Y B;  1YTF B;  5EZY A;  1S0V A;  1SZX A;  1PD3 A;  5IYZ B;  1XMQ B;  1OJH A;  2Q7H A;  4O4H B;  3APQ A;  1M9N A;  4OXS A;  4JI4 O;  3RYI B;  3ABT A;  2KQX A;  4JI3 B;  4W4K A;  4X89 A;  2ADP A;  4DRX B;  1PM9 A;  1J5E B;  3CSX A;  2CTQ A;  5KHI A;  3G6E V;  5DN6 G;  1R3L C;  2YXH A;  1R3K C;  3CHX A;  5CA1 B;  1XHX A;  1AP6 A;  3MHH C;  5JVD B;  1N0N A;  1QLE C;  1V55 B;  3TGU H;  2EBO A;  2X7R B;  4FIP C;  2YID A;  4MVZ A;  1Q7Y W;  3FAV B;  4DR5 B;  2E75 B;  2WAM A;  5IY5 B;  2ZE6 A;  4X1I B;  4LH7 A;  2OWO A;  4NTW A;  1R3I C;  1QVG U;  5LGU A;  3FYE B;  1FPO A;  4PI0 A;  4QPJ A;  1AVM A;  3K0D A;  1JFF A;  3SPG A;  1MMM A;  2Y4U A;  5LYJ A;  2HHH B;  1ZWI C;  4HYO A;  5KHH A;  4O2A A;  4JYB A;  5LHG A;  3CEI A;  4R6Z A;  5IWA B;  3G80 A;  2Q69 A;  4O4J B;  1F4M A;  4LCU C;  2HVJ C;  2P4K A;  5CBF A;  4UUJ C;  1I5Y A;  1VIB A;  5KAF Z;  4TT3 G;  1S5L Z;  1JPX A;  3TET A;  1Q3E A;  5AG2 A;  2F43 G;  3LNN A;  2YEV A;  4JI4 B;  4F4L A;  5DM6 V;  4J41 A;  2DMX A;  2ITC C;  1H38 A;  3B77 A;  4B7K A;  3OAA G;  5LMU O;  1HNZ O;  1NJI W;  3RWR D;  1SS3 A;  4UCT A;  1AJN A;  1SQG A;  4TV8 B;  5IJ9 B;  1G1X B;  1QVF U;  1RM1 C;  2IU0 A;  5HFL A;  2CTP A;  2ZR3 A;  3GVM A;  1S77 D;  4KXR A;  4UV8 A;  2AXT Z;  2F23 A;  2QWO B;  1K97 A;  5JQG B;  2VWK A;  4QE7 A;  4JI1 O;  4LP8 A;  4DR4 O;  4LF8 O;  3CXH F;  1I94 O;  5LA6 B;  5E1A C;  1JCH A;  1IBM O;  3WG7 C;  3BAB A;  2JDI G;  3O65 A;  1EN4 A;  2EIL C;  2Q9L A;  1R6T A;  2AHY A;  2LW1 A;  2B9Z A;  1JJO A;  5KA5 A;  2KG7 A;  4YJ3 B;  3UT5 A;  3DC6 A;  4GUN A;  5IYC O;  4JI6 O;  2CUG A;  2XAJ A;  1TAE A;  4B3R B;  2EIM C;  2DYR C;  3T1C A;  1AR4 A;  3BAA A;  1GN6 A;  3HKE B;  4FJC C;  1JR9 A;  5K1P A;  5C8Y B;  5KUM A;  4MS2 A;  3D3I A;  4PA6 A;  5EC2 C;  1FXK B;  2XOK G;  3GB7 C;  2UUA O;  4LFC O;  2XAG A;  3I5D A;  1NKD A;  5LMU B;  4O4L A;  1O9G A;  2EUL A;  1F7Y A;  2QTS A;  1HNZ B;  4RO2 A;  4TQF A;  3L73 H;  1GM9 A;  1CXZ B;  1PP9 H;  3AG4 C;  2BCC H;  1IXB A;  3BHP A;  4O4H A;  2DOS A;  4K8X A;  2K9P A;  3RYI A;  3BPZ A;  2HP8 A;  1SZT A;  1WPX A;  5B1B B;  1HDJ A;  1N32 O;  1HP8 A;  1JX9 A;  2Y4T A;  2YSU B;  1R73 A;  1VEW A;  4JI1 B;  3C3T A;  4LF8 B;  2JJ2 G;  4DR4 B;  3D36 A;  2JIZ G;  2ZIO A;  5CA1 A;  1I94 B;  2B1I A;  3H01 A;  1NH2 D;  5JVD A;  1IBM B;  2C2A A;  4FMT A;  4B7E A;  1P49 A;  1GN4 A;  1Y6X A;  4KHP O;  1SQP H;  1H8H G;  3N2G A;  5TIS Z;  4LFB O;  4X64 O;  3FAV A;  1RSO B;  2IJJ A;  3J81 N;  1EBO A;  3IFX A;  3ABM C;  1CEZ A;  4X1I A;  5IYD O;  3JAL B;  2WLH A;  1AI4 A;  4JI6 B;  1MAB G;  3ASN C;  4H44 B;  2EIN C;  4YHH O;  2E74 B;  3ASO C;  1Q81 W;  5K1X A;  4X8A A;  3MD0 A;  1WP7 A;  1MOF A;  2OTJ V;  1W59 A;  1COW G;  1M5I A;  2DE0 X;  2OCC C;  4H37 A;  3WB2 A;  2AGA A;  3K04 A;  4XDL A;  4O4J A;  4JYC A;  2LO1 A;  2UUC O;  2UUA B;  5CB4 B;  4LFC B;  1DLB A;  4P9O A;  5BY1 A;  1GN3 A;  3UKM A;  3AG3 C;  2G38 A;  4MW3 A;  1AIL A;  3RVY A;  3W7U A;  4JTA B;  4LNU B;  3E8B A;  4I4T B;  2HFE C;  4GKK O;  2DN9 A;  2AHZ A;  2VS0 A;  3ABK B;  1UJW B;  1NVP D;  3AK3 A;  3QO7 A;  4ABM A;  2IH3 C;  1N32 B;  3CCR V;  4PD4 F;  3A0R A;  4LH6 A;  3CRM A;  1LUV A;  3RN4 A;  1MNG A;  3B40 A;  4TV8 A;  1H2N A;  1I5X A;  2HVK C;  1ARO P;  4PEL A;  4ZHQ B;  1HNW O;  3E35 A;  1XBL A;  1XQ8 A;  2NNU A;  3WB1 A;  4KHP B;  1OCC C;  4J9Y B;  4LFB B;  4JAS A;  3BA8 A;  4IHJ A;  4X64 B;  1E1Q G;  1Y66 A;  3ABU A;  2P5O A;  1M56 C;  4ZIB A;  2EIN B;  3SYC A;  1NTK H;  5LA6 A;  1L1F A;  2V7Q G;  4JI0 O;  2H8P C;  2DYS C;  2Y0P A;  4OPH A;  1GH6 A;  1XL4 A;  5KMG B;  1HNX O;  2B5U A;  4Z1V A;  3THO A;  2OIE A;  2OCC B;  3EHB B;  3K9S A;  1M90 W;  3JAM N;  5L3B A;  5EZY B;  4NXN O;  4P2Z A;  1FD9 A;  2IH1 C;  2LFR A;  4NR1 A;  4CC5 A;  1L0L H;  3ABL C;  2VRZ A;  2K1E A;  2KB1 A;  3U11 A;  5EBW C;  2UUC B;  4GKJ O;  2L35 A;  2M7W A;  4FK5 C;  1V54 C;  1YZB A;  2ZIN A;  3J7A U;  5EIB C;  2FYU H;  3CCS V;  2DJV A;  1BSM A;  3LUT B;  3JAS B;  2PY5 A;  1Q82 W;  4GKK B;  1VQO V;  4EFB A;  1FXK A;  5EIB D;  5H9C A;  4QNH B;  3UQ8 A;  2YIA A;  4PDR A;  1NR7 A;  4HZ3 A;  4QIW F;  2N74 A;  1Y67 A;  4BW9 A;  5LP6 A;  3CRA A;  2A7W A;  1X59 A;  4K3A A;  1M56 B;  1KC8 W;  3OUF A;  1M57 B;  1HNW B;  2XT9 A;  1VQ8 V;  1JFF B;  4B08 A;  1K33 A;  4KFM A;  3AG7 A;  3E8H A;  5L3E A;  1FKA O;  4WFG A;  3ZHV A;  4X65 O;  1XEQ A;  3ICX A;  2PUS A;  1WLE A;  2Z5U A;  5LL6 Y;  4JI0 B;  3JD0 A;  4GZR B;  3F7V C;  3ABL B;  3A2F A;  1HNX B;  3CC7 V;  1ORQ C;  4GX2 A;  3KG2 A;  4I0X A;  4UVA A;  2IW5 A;  4UB6 Z;  4NXN B;  3KZI Z;  2KKW A;  2QM7 A;  1SF9 A;  3ZX6 A;  1JVM A;  1K9M W;  2WA4 A;  2PI5 A;  3JAL A;  1MZE A;  2YEV B;  1AI7 A;  3CX5 F;  3SJB C;  1AJP A;  4PA9 A;  5E79 Z;  3B09 A;  3RGB A;  4GKJ B;  2XAF A;  1KP3 A;  2P67 A;  1SC5 B;  4B3M O;  5EK0 A;  1AR5 A;  1Q90 D;  2RNB A;  4PHZ A;  2LW7 A;  3CCL V;  5CBH A;  4WFH A;  4ZBM A;  1K73 W;  3JD2 A;  1PPJ H;  4DV1 O;  4PA7 A;  4EFE A;  4DYL A;  3K5L A;  3FB7 C;  1H2G A;  1PL4 A;  4RWU A;  1R6N A;  4N23 A;  2HLD G;  2Q73 A;  3G71 V;  1YTF D;  3VBB A;  5IJ0 A;  4BIO A;  1IBK B;  3BY6 A;  3DC5 A;  1VQK V;  1SKV A;  1MSW D;  2KG7 B;  4LFA O;  2VQE O;  5CN0 A;  4X65 B;  3VOU A;  2ZDI A;  3JCU Z;  3OUS A;  4JZG A;  1FFT B;  5J2T A;  2QGN A;  4ZHQ A;  2MW2 B;  1OCR B;  5IY5 C;  4WF9 V;  5A2Q N;  1ZSP A;  5L3D A;  2ZE7 A;  1S72 V;  3K59 A;  4LF5 O;  4JAU A;  3E86 A;  4X1K A;  3FB6 C;  2Q7E A;  4JF3 A;  1QBZ A;  3L70 H;  3SDL A;  2QWQ B;  3EFF K;  1ENV A;  4WCE V;  4I9W A;  4DV4 O;  2D2C B;  3E83 A;  4NXM O;  4DV7 O;  1OV9 A;  2EIK B;  3OR7 C;  4XBF A;  1N8R W;  2A3Q A;  3GWO A;  4B3M B;  2FML A;  2Y0I A;  2YI9 A;  2ZD9 A;  3NXS A;  2W6I G;  5JJN B;  5DEC A;  1B3Q A;  2PZS A;  3VQY A;  4DV2 O;  1V9P A;  2WLJ A;  3QO5 A;  3OMA B;  4X20 B;  2YUA A;  4DV1 B;  1E79 G;  5GON B;  2ETN A;  1DTO A;  3JAS A;  4FPP A;  2YDE A;  4MVR A;  2UXB B;  5CA3 A;  1DF4 A;  4DV5 B;  3N2G B;  3VQX A;  1YI2 V;  1GK9 A;  4ZOL B;  4LF6 O;  4GCZ A;  2GSM B;  2JGD B;  4I50 A;  4LFA B;  2VQE B;  5B1O A;  3AK1 A;  4FM1 A;  1QLN A;  3E22 B;  4G27 B;  3JSL A;  4MVU A;  4IIJ B;  2EJR A;  5B5E Z;  4JAA A;  2RMK B;  2QDO A;  1AJQ A;  2BE3 A;  1VF7 A;  4UFZ A;  4LF5 B;  3RYH B;  3TK1 A;  2A79 B;  2ARH A;  3AK2 A;  3QG5 A;  3SYO A;  4OX9 O;  1SQQ H;  2R9R B;  3HKC A;  4R7C A;  1E1R G;  1OCO C;  4PA4 A;  4TUY B;  1TGO A;  1BE3 H;  4NXM B;  4CH3 A;  4DV7 B;  3W7T A;  5BXZ A;  3SYQ A;  1H2L A;  5LGN A;  1AI5 A;  4E4E A;  3SPJ A;  4J10 A;  3JYC A;  1BMF G;  3CE2 A;  2RJZ A;  4LWS B;  2PYL A;  3PJS K;  4NB5 A;  2NR5 A;  1UFI A;  3H1J H;  3OMI B;  3ZMS A;  4DV2 B;  3CB2 A;  4BR6 A;  2QKC A;  1OHH G;  5IE9 A;  1FXK C;  2IBZ H;  1IDS A;  3JAW A;  1THZ A;  2BTO A;  1XIL A;  2EZP A;  1BT8 A;  2Q0A A;  5LP6 C;  1BZK A;  1ZAU A;  4IHJ B;  1I7F A;  3M99 B;  4LF6 B;  2YIC A;  4U3F H;  2ZNJ A;  3UO2 A;  4LF7 O;  1Q6I A;  3AG1 B;  3PN1 A;  2QKA A;  5B1B C;  1Q6U A;  1I08 A;  1B6Q A;  1P7G A;  1KU9 A;  3FD9 A;  5EYP B;  4GLX A;  4L8J A;  5KA6 A;  2ODM A;  4DO2 A;  3OW2 U;  1OCO B;  1JA8 A;  3RFR A;  2DQ0 A;  2X6B A;  1VF6 A;  4OX9 B;  3T4D A;  3IC9 A;  1Z5V A;  1IUR A;  2N04 A;  3ZRW A;  2BTQ A;  2ZQM A;  5ITZ A;  4D6T H;  5B66 Z;  4ASU G;  1ZLZ A;  2JS3 A;  1G8M A;  2E3C A;  3OTF A;  3CWB H;  3ZMZ A;  4JI7 O;  4CBC A;  4X88 A;  3HB3 B;  4CH4 A;  2RDC A;  3E2E A;  2P22 C;  2PF4 E;  3L74 H;  5DED A;  1GAX A;  2H94 A;  4MTO A;  5LP6 B;  5A9G A;  4TWK A;  3ZMU A;  1KUQ A;  3BFR A;  3OTO O;  4O2B B;  4NTX A;  4Q20 A;  5BZB A;  4EB6 A;  4U3J B;  2X6A A;  1QU7 A;  5F2V O;  2UU9 O;  2P06 A;  3CCU V;  3K79 A;  1NQT A;  4MTX A;  1YXB A;  4UCS A;  4X20 A;  3F5T A;  2JGU A;  4RAI A;  1GKF A;  1K5S A;  1FYJ A;  5GON A;  3ABK C;  3CJH A;  4LF7 B;  4AI8 A;  3OM3 B;  4TV9 B;  1VQ5 V;  2L6L A;  1ZL8 B;  3FYI B;  1U97 A;  2WSS G;  1Q86 W;  2UUB O;  4X66 O;  2NLJ C;  1QR8 A;  2GV9 A;  1EM1 A;  4ZOL A;  4I0X B;  4BAY A;  3STZ C;  1G6U A;  2JGD A;  1GM8 A;  1WJZ A;  5L3G A;  2ILM A;  2AZ2 A;  5D5Q A;  4BIZ A;  1XMO O;  2R70 A;  2HR3 A;  1VQP V;  2JK5 C;  2LGQ A;  3E22 A;  2P7T C;  3ZHT A;  4IIJ A;  2RQ6 A;  2XTA A;  4X1Y B;  4U7O A;  4UCR A;  4QE9 A;  2Q0O C;  4MVQ A;  4D7T A;  3RYH A;  4E2L A;  3LNM B;  2OTL V;  4DR3 O;  1WB8 A;  4JI7 B;  4UVB A;  3QF7 A;  1Q6H A;  4DR7 O;  3L72 H;  3SGI A;  4TUY A;  2CTR A;  2QM4 A;  2MK3 A;  5J2U A;  3ZED A;  4MVM A;  3WB0 A;  3D3Q A;  1DF5 A;  3A8T A;  5B1N A;  3OTO B;  5IJ0 B;  5FLX N;  1YJ9 V;  1DK1 A;  3KKY A;  1SQF A;  3BRC A;  4LWS A;  2UU9 B;  3M7M X;  2IJH A;  1D5N A;  5KHK A;  3UM7 A;  3CYO A;  5JH7 B;  5FPR A;  1KMI Z;  5J2T B;  1KP2 A;  3OMN B;  4DV3 O;  3R66 A;  4WFB V;  2UUB B;  4X66 B;  3RYC B;  1Q5O A;  3LDE A;  3N2K A;  1FXH A;  4ZI7 A;  3CCM V;  1S5J A;  5LGT A;  1XRE A;  1M57 C;  4IGG A;  1JMK C;  3LSU A;  4X1K B;  3L75 H;  1XMO B;  3N27 A;  5EYP A;  3K06 A;  4J9Z B;  2ZXW B;  2DWD C;  1R6K A;  4YHH B;  3DSQ A;  1K4C C;  1Q43 A;  3X2Q B;  4HAM A;  1OZ0 A;  2F1M A;  4JYA O;  2GDS A;  5GTI Z;  2Q8V A;  1SES A;  4GX5 A;  4H13 B;  4DR3 B;  1HWY A;  1ZUQ A;  2A0L A;  1GMG A;  4DR7 B;  1N0J A;  4PDV A;  2VQF O;  1H2S B;  1KKD A;  4B3T O;  1URF A;  1IBL O;  3H9V A;  3QTC A;  1PNM A;  5CMU A;  3KCX A;  3AEI A;  4GT1 A;  4I7Z B;  1EN6 A;  2CTW A;  2ZNI A;  4GYC B;  4MTF A;  1UPG A;  1ZTE A;  1P4R A;  1R3J C;  1BQ0 A;  1TUB A;  3OGI B;  4G2K A;  3MDS A;  4I50 B;  4R8C A;  2O57 A;  3GWK C;  1F23 A;  3L9D A;  1YJW V;  2NN4 A;  3DTU B;  3ZHQ A;  4O2B A;  4K8Z A;  2Y69 B;  2RN9 A;  3CS5 A;  4PJ0 Z;  4U3J A;  1SQV H;  3Q4H A;  4LR3 A;  2HJF C;  2ZIM A;  4Z2W A;  4MT8 A;  4DV3 B;  4WFF A;  2DW4 A;  3ZMV A;  1WAZ A;  3LSQ A;  4QGP A;  2XAQ A;  4HBN A;  4RQF A;  1VQ4 V;  4DR1 O;  3H1K H;  4TV9 A;  4K35 A;  1KQS U;  1F4N A;  2WLI A;  3CXC U;  1ZL8 A;  3OEH G;  3HKC B;  1TVK B;  2CGO A;  4JAV A;  1WP8 A;  3ZRX A;  3HPL C;  3AG2 C;  4PA3 A;  4DR2 O;  1XNQ O;  3ZMT A;  1VF6 C;  2P90 A;  1WA8 B;  4A5U B;  2ADQ B;  4JYA B;  1OCR C;  4LBE C;  1H2K A;  4KUM A;  1SRY A;  2YS8 A;  2LGW A;  4DV0 O;  2Z3Y A;  2UXN A;  1SQB H;  4J7K A;  2JJ1 G;  1EZV H;  2Q68 A;  1JQ0 A;  3LDD A;  3QVN A;  1OCZ C;  2CE4 A;  4X1Y A;  1KB9 F;  4UVC A;  5IDJ A;  4TQD A;  1Y76 A;  3VQV A;  3I55 V;  4B3T B;  3JAW B;  2LJ2 A;  4P30 A;  1S76 D;  1IBL B;  2ZE5 A;  2R9A A;  2FL4 A;  1KEC A;  3KCY A;  3T1Y O;  3JAT B;  2YIB A;  1K5Q A;  3CRQ A;  2EIK C;  3K57 A;  3E8F A;  1JJ2 U;  3C3S A;  3JD1 A;  3K5N A;  4YXW G;  1VAR A;  5KHG A;  3TXQ A;  2E5L O;  5FNV B;  2BOB C;  2XAS A;  1W2B U;  3K3W A;  1BQZ A;  2WWW A;  5BR8 O;  3CCV V;  1Y74 B;  4PI2 A;  1NBM G;  3F5W C;  3D36 C;  1S5H C;  2WPD G;  5BMV B;  3FB5 C;  1NTM H;  1MG1 A;  4DV6 O;  1VMG A;  3P32 A;  3ZHR A;  3RVZ A;  4FLU A;  5JH7 A;  1PV0 A;  1HR0 O;  1KD1 W;  3B8N A;  4DR1 B;  3AG2 B;  3JAR B;  3T4Z A;  2D3O W;  3A0H Z;  3OGC C;  4LF4 O;  2HG5 C;  1P84 F;  3ZRW B;  1ZX3 A;  4NYK A;  2DQ3 A;  2BTQ B;  3ZIA G;  3RYC A;  3IC7 A;  5ITZ B;  5J9P C;  1OCZ B;  5FPO A;  5KUK A;  4DR2 B;  1XNQ B;  1EN5 A;  3SR2 C;  4UB8 Z;  4GX1 A;  3CCE V;  3H1H H;  4NVP A;  3CMA V;  2Q5Z A;  1P7B A;  1VQ9 V;  2ZE8 A;  3SYA A;  3ZRS A;  1LUW A;  3ETG A;  4JGS A;  2A9H A;  5L3C A;  2JRI A;  4P9P A;  4EB6 B;  1PNL A;  1EZJ A;  1O9H A;  3T1Y B;  2JEX A;  2LFS A;  3ZHS A;  4DK0 A;  5EBM C;  3OFN G;  4LF9 O;  1YEW A;  3M8A A;  4WBN A;  1L0N H;  3K5M A;  4DUY O;  3RBZ A;  2WA3 A;  1BL8 A;  1H2M A;  3S3W A;  3CJH B;  4CS2 A;  4YIP A;  1PKX A;  2E5L B;  1NS1 A;  3IAY A;  3E8G A;  5GTH Z;  1AI6 A;  2Q4P A;  2QWR B;  4DXW A;  5BR8 B;  1GTO A;  4EEQ A;  3SJA C;  1BGY H;  4PDL A;  3E89 A;  3HKD B;  2YI8 A;  1KYO F;  4AHC A;  4DV6 B;  4UV9 A;  2ITD C;  4YY3 O;  1HR0 B;  3U0Z A;  2F93 B;  1SER A;  3H1I H;  3JCZ A;  1ROP A;  4X62 O;  4LF4 B;  1K7D A;  2IJK A;  3AG1 C;  3WU2 Z;  1RFY A;  4JV5 O;  3O9O A;  4I55 B;  3BVO A;  4FVM A;  4F6E A;  4UCO A;  4FM0 A;  3BEH A;  1XL6 A;  4KL1 A;  2BSK B;  5B1A C;  3CC4 V;  1TVK A;  4EKW A;  4FM2 A;  1Z2G A;  3CPW U;  4DV4 B;  5J2U B;  2FTK A;  2QKS A;  1NZ6 A;  5B3S C;  1AR1 B;  1QR9 A;  1PL0 A;  4J7J A;  3ZCC A;  2EJ7 A;  4FLY A;  1WA8 A;  4CS4 A;  3C90 A;  4U7N A;  3B8M A;  4B3R O;  1QHT A;  1WB7 A;  3JAK A;  2GTA A;  1NI8 A;  2CK3 G;  3APO A;  1N36 O;  3G4S V;  4MVS A;  1M1K W;  4LF9 B;  1Q8I A;  5KLV H;  4FZ1 A;  4DUY B;  1YDX A;  2ZCE A;  5H5N A;  4DUZ O;  4CC6 A;  2M6Y A;  3FB8 C;  2CH7 B;  2GTS A;  4H33 A;  3RYF A;  5IYB O;  4AQY O;  3JAT A;  2GHY A;  5CA0 A;  4WFA V;  1QLE B;  1YVW A;  4LC1 A;  1LNQ A;  1YCI A;  4W4L A;  2IJI A;  5L3F A;  3N2K B;  4ZI7 B;  1A32 A;  1VQ6 V;  2ATK C;  1WNS A;  5LXT B;  2QJ1 A;  5JJJ B;  4L87 A;  2ZT9 B;  1WPB A;  5FNV A;  4YY3 B;  2QE7 G;  2W6J G;  5JCO A;  4DR6 O;  1LR1 A;  2P4V A;  2XUM A;  3HR0 A;  3CME V;  4X62 B;  1Y74 A;  3STL C;  3CD6 V;  3LDC A;  2Z0A A;  3L71 H;  2QWN B;  5BMV A;  5CBG A;  4JV5 B;  5B1A B;  5LOV A;  1M4U A;  5KX5 A;  4XDK A;  4O4I A;  4Q6G A;  2EIJ C;  1Z5W A;  4BWA A;  5B3S B;  1TA8 A;  3HKB A;  3JAR A;  2UXC O;  4JTD B;  1SET A;  4H0L B;  4D7S A;  4UCV A;  1MZF A;  2UXX A; 
#chains in the Genus database with same CATH homology
 3TXQ A;  4I0X A;  3G80 A;  2VRZ A;  4LWS B;  2KG7 A;  2AZ0 A;  3ZBH A;  1WA8 B;  3FAV A;  3Q4H B;  3GVM A;  4I0X B;  3OGI B;  2VS0 A;  3GWK C;  2DE0 X;  2KG7 B;  4GZR B;  3TXS A;  4LWS A;  3FAV B;  4ABM A;  3O9O A;  3HR0 A;  3FD9 A;  2AZ2 A;  3Q4H A;  1WA8 A;  2B9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...