4X66O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x66O00
3RT3C 4X65O 2HHHO 5IWAO 5BY1A 2FKXA 4B3RO 2AGAA 4JI0O 4JI3O 4X64O 3OTOO 4DV3O 1X59A 4X66O 4DV6O 4LF5O 4LF9O 5BR8O 5LL6Y 2UXBO 2Z0AA 3J80N 2VQEO 1IBMO 1AILA 2DJVA 1FYJA 4JI1O 1HNWO 4DV7O 4KHPO 5H5NA 2VQFO 4B3MO 3SDLA 2ZM6O 5IT9N 4GKJO 4LF7O 5LMUO 4DUZO 1N34O 1J5EO 4JYAO 1A32A 4B3SO 1R6TA 1I94O 3R66A 4DUYO 4JI8O 1N32O 1IBLO 1XEQA 1IBKO 2F4VO 1F7YA 4LFAO 5BXZA 2DOSA 3F5TA 4B3TO 4JI4O 1KUQA 4JI5O 4JI2O 3T1YO 4DV0O 3J7AU 1XNQO 3O65A 4LFBO 1HR0O 5A2QN 3J81N 4X62O 4OPAA 1FKAO 4OPHA 4AQYO 1NS1A 4YHHO 2E5LO 1N33O 1FJGO 1HNZO 4JV5O 2LW7A 4OX9O 4LF4O 4NXNO 2UUCO 2N74A 4LFCO 4DV5O 2UXCO 1D2DA 4A5UB 4JI7O 4K0KO 3JAMN 4DR7O 4LF6O 3M8AA 4GKKO 4DR6O 1YZBA 2UU9O 1N36O 5FLXN 1DK1A 5LMNO 4DR2O 1AB3A 1XNRO 1XMQO 4DR5O 4YY3O 1G1XB 1XMOO 2UUAO 2UUBO 4DR1O 4NXMO 2JRIA 4DV1O 1R1BA 4LF8O 4DV4O 1HNXO 2ZKOA 3T1HO 4DR4O 4JI6O 4DV2O 4DR3O 2UXDO
chains in the Genus database with same CATH superfamily
2Q7GA 4AHCA 4GUNA 1Z2GA 1QU7A 2HVKC 2HP8A 3E35A 1YITV 1K5SA 5KLVH 4NR1A 1SA0B 5LOVB 3SYAA 4P30A 4YXWG 4UB8Z 1EN4A 5B1AB 1ZUQA 1SQVH 3P3PA 1OJHA 5IYDO 5LHGA 3MAQA 3CMEV 3RVYA 1NVPB 2R9IA 1F4MA 2Y69B 1AI7A 5IT9N 3SDLA 3K57A 4PI2A 4BIZA 2ILMA 2XAQA 3SR2C 3ZMZA 1SA0A 5LOVA 4MS2A 4JV5B 2EX3A 2IH3C 2QEXV 3DC5A 1IBKO 1US6A 1QBZA 3CC2V 2XOKG 1M4UA 1U97A 2YSUB 4DR7B 2UU9B 3FB8C 3CXCU 4XDLA 1K9MW 4TT3G 5A2QN 2W0FC 1B06A 4NXMB 2UUBB 2HVJC 4DR1B 1I08A 4ZBMA 4C7UA 3DTUB 1HNZO 2BCCH 1YIJV 1MZEA 4X20B 4HYOA 4JTDB 3ZN1A 3ZRWB 4GX5A 3FB6C 2JS5A 4ASUG 4JI3B 3QG5A 1THZA 3SGIA 4X20A 3FYIB 3JD1A 2XUMA 4DV6B 5KMGB 1URFA 2KG7B 3RYCB 3ZRWA 1GKFA 4CS2A 1YSCA 2ZINA 5KA5A 2Q73A 5HFLA 4YJ3B 2Z3YA 3T1HO 2LP7A 4JI1B 1GH6A 2P67A 1N8RW 3AK3A 2EILB 5GTIZ 2E76B 3FX7A 3SPHA 2CK3G 5EIBC 3G67A 4U3JB 2KSDA 2KQXA 3UKMA 2LFRA 1I5XA 3CCEV 1Q90D 4PJ0Z 2KG7A 3AG4C 3B09A 5CA1B 3RYCA 2AGAA 1K7DA 2M7WA 2R9AA 1VQ4V 4YJ3A 3R65A 2A0LA 5F2VO 5H9CA 3E8GA 2E75B 3WB2A 4U3JA 1CXZB 1Q7YW 4I9QA 1V55C 1KP2A 2YIAA 5CA1A 5LMNB 3U0ZA 1BSMA 1WB7A 2QJ1A 2AHZA 1OCZC 2RNBA 3F5WC 3VBBA 5CA3A 4YHHB 3ZHSA 3X2QC 4N23A 4X1KB 2EINB 3K5MA 4WFAV 2HR3A 4XDKA 1PM9A 3BRCA 2CTWA 3E22B 5TISZ 3UT5B 4D6TH 1KP3A 4PA7A 4GKKB 2JIZG 2EJRA 3T1YO 3J7AU 2WA3A 4UXNA 1ZLZA 4HAMA 3GVMA 3RYIB 4X1KA 2IBZH 2HJDA 2QE7G 1M1KW 3E22A 3UT5A 3L72H 4Z2WA 1SQQH 2ITDC 3JARB 1QNMA 1M56B 1GK9A 2WA4A 2IJJA 1RFYA 3ZX6A 1UPGA 4MTXA 2L6LA 3O9OA 3WFVA 3RYIA 1W2BU 1ZTEA 5IJ9B 4PDLA 1Q86W 2ZNJA 1QLEB 1VQNV 4LH6A 2PGGA 1AR5A 3CRRA 4K8XA 1MABG 3SYPA 3K59A 1SZXA 4FLYA 1OZ0A 4LF9B 3DC6A 1SRYA 5IJ9A 3PJSK 4DV1O 4O4JB 4IGGA 2OYQA 1ZWIC 1MSWD 2YXHA 5LGTA 1K97A 3OW2U 3AK2A 1J5EB 3W7UA 1NTMH 5IWAO 1OCCC 3DSQA 1SQBH 5KHJA 4X8AA 4O4JA 1V54B 4BR6A 2ZDIC 1IBLB 4JI8B 4FFBB 4X66O 2PUSA 3ZMUA 4LFAB 5LHIA 3VQYA 3BEHA 3RYHB 1RPRA 1XNQB 3CB2A 4KHPO 5KHGA 2F43G 5LA6B 4FFBA 1XNRB 4X1IB 1L1FA 2CTPA 4DK0A 1S5LZ 3AG4B 5L3BA 1N33B 1FJGB 2Q8VA 3RYHA 3OM3B 1UJWB 4W4LA 2XNDG 3K0DA 4DUYO 5DECA 4TQFA 2DQ3A 3IAYA 5K1XA 5LA6A 3QTCA 1V55B 3MDSA 4X1IA 1EBOA 2A3QA 4WCEV 3TXQA 2XASA 2JS3A 2XAGA 3Q4HB 3K58A 1OCZB 2XTAA 4YY3B 3K0GA 5JH7B 4OPAA 1FKAO 3LNNA 4UB6Z 3RGBA 4AQYO 3X2QB 1G4YB 4PV1B 1R3LC 4DV4B 2E5LO 5IYBO 3JSNA 5EC1C 5L3DA 2DQ0A 2OIEA 4LF4O 3Q4HA 2LGQA 4IHJB 4ZOLB 5JH7A 4IT5A 3IC7A 1VQLV 1Y66A 1DK1A 1H2GA 4MVMA 3HB3B 4CZZA 2CE4A 2G38A 1XMOO 2P4VA 1B3QA 5EC2C 4IHJA 5BR8B 1M90W 2VQEB 4EFBA 4ZOLA 3UO2A 1M5IA 3RFRA 2QR4A 4NKGB 4B3MB 2ZM6B 3ZRXA 3K06A 3FD9A 4GKJB 3RT3C 2GDSA 5JVDB 4BW9A 1OCOB 4H44B 4RUFA 3MHHC 2Q0AA 1BL8A 1XBLA 3ZHUA 2P6JA 1QVFU 5JVDA 4R7CA 3JCZA 1VQ5V 1WPXA 1H2KA 4DV7O 1PPJH 5B1NA 1SQFA 5AG2A 5EIBD 2IU0A 5LMUO 1DLBA 5GONB 5B1BC 4WFEA 1R6TA 4QE7A 1WB8A 3R66A 4QIWF 4MVQA 3ABMC 3H1IH 5L3FA 1N4CA 5H6RA 3CRAA 1FFXB 4U7OA 4DV5B 2Y4UA 1JVMA 2GTSA 4JI2O 3K5OA 5GONA 1N36B 4QPKA 4J11A 2ZDIA 1HR0O 3S3WA 2IU3A 1FFXA 3OT7A 1R6KA 4DW1A 4OPHA 3L70H 4WFBV 5J2UB 1XOUA 4IYHA 3AG1B 3RWRD 4MTFA 2UXDB 3OUSA 3H1KH 2FYUH 2ETNA 3CP1A 2BSKA 1FPOA 5J2UA 4YIPA 2IW5A 2Q68A 5FLXN 4FLXA 3E2EA 1XREA 5KA6A 2QKSA 1WLEA 2KB1A 5IE9A 2CDYA 1IBMB 1R1BA 4ICGA 2F95B 1Y6XA 2ZKOA 1GAXA 4DR4O 3RN4A 1ROPA 1WPBA 3IGAC 1VEWA 4MVOA 4YIOA 4JYAB 2PI4A 4IIJB 4MVSA 4MW8A 2P22C 3NR7A 1BS3A 1NJIW 4LF5O 2UXBO 1Q8IA 3KZIZ 2BOCC 2LW1A 4LFBB 4UCOA 2ZQMA 5H5NA 1AROP 3E89A 3U10A 1HDJA 4LP8A 3JD0A 1D5AA 1FXKC 3ABLB 3NXSA 4LF7O 4DUZO 4TUYB 5KHHA 1OCRC 1BT8A 3AG2C 1N32O 1OHHG 3AG3C 5LHHA 1JCHA 4GX2A 3JD3A 3SYQA 4TUYA 3CWBH 3UO3A 2X6CA 3HKEA 5B1BB 3BABA 4WF9V 3C90A 5JCOC 4UVBA 3ABMB 4BWAA 1JFFA 2WLMA 4P9OA 4OX9O 1SESA 2ZE6A 1Q3EA 2JK5C 3E8BA 1U96A 2GSMB 1KKCA 1Z5WA 3ETQA 1Q6HA 2HFEC 3IC9A 4UCSA 3JAWB 1EZJA 1LR1A 2YXYA 1VF7A 5KAFZ 2ZNIA 4J9YB 2A79B 5GW7A 2BTOA 4J7ZA 2FKXA 5EBLC 3STLC 4B3RO 1JQ0A 1H8HG 3L74H 1MOFA 3OTOO 3JAWA 2B1GA 1X59A 3VQXA 1NU1H 4X89A 3OAAG 2NN4A 1NQTA 2DJVA 3CCMV 2RCVA 3WG7C 3UCSC 2QM4A 4ZI7B 3CCLV 4X62B 1JR9A 4NTXA 1JX9A 3WB0A 1AP5A 1Q6UA 2OT5A 1F23A 3N2GB 4LNUB 2P90A 4BIOA 2EINC 3ZRVA 3CCJV 1XI1A 4LFCB 2YICA 4ZI7A 2UXCB 4JI7B 3LNMB 3BVOA 3SPIA 3N2GA 3RYFB 1FXKB 2WLLB 4LNUA 4EB6A 3K3WA 3QO7A 3DGEA 2BTQA 3M99B 5LBQA 1OCRB 1NBMG 5JJJB 4I4TB 4FMTA 3AG2B 5CN0A 4ABMA 1M56C 3AG3B 4JV5O 2ODMA 1YCIA 4HZ3A 4DV2B 1NZ6A 1VQMV 1OV9A 3OMAB 3RYFA 1FXKA 2WLLA 1S76D 4A5UB 4K0KO 4DR7O 3M8AA 2ZCEA 4KL1A 1NI8A 2UU9O 4I4TA 2DMXA 1QLEC 1Y4MA 2R9RB 4E2LA 1IBKB 1JJOA 4NXMO 2UUBO 4DR1O 1XDCA 5JQGB 3BHPA 1BMFG 3M7MX 1TAEA 2B5UA 3T4ZA 3BPZA 4JZ2A 4UV8A 2Q4PA 1MNGA 4MW3A 2BE3A 2ARHA 4JGSA 1GN6A 3LSUA 5JCOA 3ZHQA 1QQCA 4P2ZA 1K4CC 4UCTA 1PL4A 5D5PA 5JQGA 4JI3O 1H2LA 3JD2A 3JCUZ 1V54C 3F7YC 3OMNB 2YEVB 2F4VB 3QO5A 4KFMA 1P49A 2JJ2G 4DV6O 1IX9A 2BOBC 2Z0AA 2HKOA 5LP6C 4JI1O 2CGOA 2ZIOA 2YEVA 3CS5A 1XL6A 4O4LB 3E8FA 1LUVA 5IYZB 1AJQA 3AK1A 1EN6A 4NXNB 1VARA 4JYYA 1KECA 4PELA 1GM9A 3F5TA 4O4LA 4DR6B 2KKWA 3WG7B 2HEPA 4F6EA 2YIBA 4DR2B 5IYZA 3EFFK 4XBFA 2DE0X 1NVPD 4H13B 5K1PA 4IYIA 1GRJA 4YHHO 4I50A 3HKBB 1R3IC 4X65B 3MD0A 3JASB 4TQDA 4OGQB 2Y0PA 4GKKO 3CCRV 4JI0B 4I5SA 5L3GA 1MMMA 2WAMA 3RBZA 3HKBA 2QWQB 3ETGA 5IY5C 3C3TA 3JASA 2EULA 3T1CA 4ZKIA 1VIBA 4WFFA 2WLHA 4P9PA 1JA8A 1OCOC 2NR5A 4B3SB 1QCEA 4JAUA 1PL0A 1MSDA 1P7BA 2X0LA 2YIDA 4NTWA 4AI8A 4TWKA 1YHQV 4TOIA 5J9PC 3B4SA 1K5QA 3ZS8C 3CYOA 4LF9O 3WU2Z 4JI5B 4UCRA 1YEWA 4DW0A 4UCVA 5IDJA 1VQPV 1JMKC 2CH7B 2Q0OC 1J5EO 1AI5A 2ZD9A 2VRZA 3KG2A 3K9AA 3BY6A 5B3SC 1VF5B 2V4DA 3IJ4A 4JI8O 1IBLO 4FLVA 3CCSV 1Y67A 2LO1A 1PD3A 4LFAO 3CPWU 2CH7A 5LP6B 1KB9F 4GX0A 1XNQO 2R72A 2JEXA 4DR5B 4LCUC 3FB5C 2OCCC 2F66C 1QVGU 1SF9A 4PDRA 1NS1A 4PA6A 1HNXB 1N33O 1FJGO 1XUQA 1FS0G 5LP6A 4PDMA 5C93A 5L3EA 3AG1C 4DR3B 1D5NA 3JD4A 2EIKC 1DF4A 4FLWA 3OUFA 2Y0IA 1Q43A 4CBCA 4AILC 2HHHB 3WB1A 2XHBA 2W6IG 2Q67A 4B7KA 2FL4A 4R6ZA 1W0KG 1VQ9V 4D7TA 2W0XA 4YY3O 1G1XB 3ABKC 2JGDA 1WA8B 4RO2A 3SJCC 1P4RA 4FM1A 4NVPA 1S72V 4FZ1A 4DV4O 2ATKC 2Q9LA 3G80A 1MZFA 3B8NA 2ZE7A 1Q5OA 2LFSA 1TGOA 2JJ1G 5C8YB 3A0RA 1HW7A 1WA8A 2E5LB 3CXHF 3AEIA 1SQGA 5IY5B 1YVWA 2GHYA 5KHIA 1ZSPA 4B3TB 1DF5A 5BR8O 5LL6Y 4Z1VA 4MTOA 4DV0B 2RMKB 5C8YA 2VQEO 4HNAA 5FPRA 3GB7C 3SYOA 2QWOB 1MG1A 2EBOA 1R3KC 1W0JG 2ZM6O 4B3MO 4LC1A 4GKJO 3ABLC 2RDCA 4UFZA 4DRXB 1H2SB 4KP4A 3CRMA 3SYCA 2X6AA 4Z1MG 2XAHA 1PV0A 1ZAUA 5LYJA 5DM6V 2WSSG 4DRXA 4RQEA 4X1YA 2ADPA 4G28B 4PA9A 3VQVA 3ABTA 4JTAB 2N04A 2Q7HA 3J81N 2UUAB 3G71V 3KCXA 5B3SB 4LH7A 3K08A 1BE3H 2F23A 2IJIA 2IJHA 3APQA 2XT9A 2CAZC 4DV5O 2P7TC 2Q5ZA 2WWWA 3A8TA 1R3JC 5EBWC 1XQ8A 4X64B 2O57A 2PYLA 1N36O 4DV3B 4FK5C 3A0HZ 2OCCB 3LSQA 2BSKB 3N2KB 2AW9A 4DXWA 1H8EG 4JI2B 2EIKB 1HNWB 1HR0B 1YJNV 2UXDO 2YXLA 4PA3A 3L75H 1N34B 3HKCB 1K73W 2GTAA 3TK1A 3N2KA 4QNHB 1CP9A 1I94B 3CE2A 3TGUH 1WJZA 5B66Z 3APOA 1RM1C 3K79A 3ABKB 3T2MA 1COWG 3QO8A 3HKCA 4GYCB 1IBMO 3AG7A 3GWKC 4D7SA 5EBMC 2P4KA 4CS3A 1KQSU 4QGPA 1XHZA 4JYAO 2LGWA 2QTSA 2UXNA 3KKYA 3D3QA 3OE7G 1RPOA 2Y48A 5KHKA 3HKDB 5B1OA 2QWPB 1KU9A 3G6BA 3LDEA 1JPXA 2PZSA 3I5DA 3W7TA 3ZCCA 4BAYA 4LFBO 2PYJA 4O2BB 1KC8W 4W4KA 2QM7A 4Q6GA 1TA8A 3SJBC 2DWDC 1J95A 3HKDA 2D2CB 4LF8B 1YI2V 2K9PA 4MVZA 3HKEB 3QVNA 4JI6B 1CEZA 3LDDA 2N74A 1K92A 2OWOA 4TV9B 4O2BA 4H0LB 1D2DA 1JFFB 2HG5C 2LJ2A 5KUMA 1NTKH 4H37A 3CCVV 4J7KA 3ZEDA 1AB3A 3BFRA 4FLUA 3H01A 1RSOB 5KUKA 1JJ2U 3TXSA 4TV9A 4DK1A 4N21A 4X9QA 1QR9A 2QGNA 2VQFB 3D36C 4FVMA 3TCUA 2ZR3A 1BGYH 4RUEA 2FMLA 2X7RB 4KXRA 1RSOA 4JAVA 4TSFG 5EYPB 2DYSB 3K04A 3ZHVA 1T5EA 2WLIB 1SC5B 2ZIMA 2QSAA 2DYRB 3QNEA 3JSLA 4JI4B 1GMGA 2ZT9B 1AILA 4F4LA 2RQ6A 2QWNB 5EYPA 1MA1A 5DN6G 2WLIA 2N05A 3ASNC 4R8CA 2EIMC 4U7NA 4QJFB 4HBNA 1YXBA 4I7ZB 1RM1B 4FM2A 1XEQA 1VQKV 2V7QG 4LR3A 3RVZA 2UUCB 2YI9A 2QA4V 2NNUA 1KUQA 4LF6B 3JALB 5IYCO 4CH4A 4RQFA 3O65A 4TV8B 1SETA 3KCYA 3PN1A 1I7FA 3FB7C 1XMQB 4XDJA 4X62O 3IFXA 1F51A 2XAFA 5GTHZ 1SZTA 3QF7A 3I56V 4EB6B 3CMAV 2BTQB 2LW7A 2WPDG 3JALA 1FAFA 1ZL8B 2ZXWC 2PF4E 3ZHRA 1IDSA 4TV8A 1E1RG 2JEUA 2YUAA 4RAIA 4LFCO 3N27A 4MVUA 2UXCO 4FJCC 4JI7O 1AP6A 3OGIB 4LBEC 4DYLA 1YZBA 1TVKB 4J41A 4MSWC 3STZC 1YJWV 2EZOA 5CBGA 1ZL8A 5CBFA 3CEIA 2ITCC 2FB5A 2RJZA 5ITZB 2HJFC 2DW4A 4R50A 4PI0A 2DWEC 4EFEA 1E79G 2W6JG 1VQ6V 4DV2O 1TVKA 4JYCA 1YTFB 2K1EA 1VMGA 4CH5A 5H6QA 2ZE8A 5ITZA 1KYOF 2B1IA 1LNQA 1NTZH 2QKCA 3E83A 3W7XA 1VP7A 4JYBA 4GX1A 3ASOC 4FLTA 2A06H 4I0XB 4K0KB 3ZN0A 2Q69A 1FYJA 1Q6IA 1M57C 1RP3B 1WP8A 3OR7C 4BIUA 3B8MA 3D8CA 1HNZB 1PP9H 4I0XA 4GLXA 3ABUA 4ZIBA 3H1JH 4G27B 1Z5VA 3D36A 3K9SA 1P84F 2F4VO 2PI5A 2DOSA 1TUBB 3E86A 3BA8A 3G4SV 3ASNB 2EIMB 3CSXA 1I0HA 2CTRA 3SPCA 3T1HB 1TUBA 1N0NA 3GWOA 1KKDA 3I55V 3THOA 4NXNO 2WLNA 1P7GA 3B77A 2QKAA 1GN2A 4GZRB 4I50B 2H8PC 4DO2A 4FPPA 2GBOA 2F1MA 2YC0A 5KMGA 4DR6O 4JTCB 2LQTA 4K35A 3OR6C 5LMNO 4DR2O 2CUGA 3SJAC 1S77D 1G6UA 3L73H 4JPRA 5KAIZ 2OTLV 1BQ0A 4KUMA 5LGNA 4WFHA 1FXVA 1GN3A 1NKDA 2ZXWB 5IJ0B 3DXRB 1EZVH 4X65O 3JATB 3ICXA 4X88A 1Y74B 1XL4A 1IXBA 1S3JA 2EJ7A 2MK3A 5BY1A 1YTFD 4JI0O 1BHAA 2QM8A 1PKXA 4YJ2B 3ML0A 3L9DA 5IJ0A 2YS8A 1Y76B 3DXRA 2V1DA 3JATA 3T1YB 1Y74A 5BZBA 1BCCH 3CJHB 5JJEB 4YJ2A 4JAAA 1M93A 1Y76A 4UVCA 1ZX3A 4B3SO 3UM7A 4EEQA 1BHBA 1X4TA 4JF3A 3ASOB 3CJHA 1F7YA 1SQPH 3D3IA 1FD9A 4JI5O 3TETA 4GCZA 1FXHA 1M57B 1VF6C 4PA4A 5E79Z 1VQ8V 2VWKA 1Q82W 4B08A 3JARA 3LSSA 3BA9A 4PDVA 3CC4V 1EM1A 2UXXA 5B5EZ 4DV1B 1H2NA 5D5QA 3HR0A 1KD1W 1H38A 2YIBD 3SPJA 3FKSG 5IWAB 4IL6Z 1K4DC 3JAMN 3H1HH 3CCQV 1BQZA 1SS3A 1N0JA 1WNSA 2X6BA 1IZ3A 4X66B 5A9GA 1XNRO 1IXMA 3H1LH 1S0VA 4DR5O 2JRIA 1LUWA 3P30A 3VQWA 1QR8A 1HNXO 1K34A 4KHPB 4CS4A 4EKWA 3TJTA 2WLKA 2JGDB 4DR3O 2AZ2A 1AR4A 2HHHO 1NH2B 2ZE5A 2EIJC 1E1QG 1O9GA 4DUYB 2ADQB 3B2EE 2F93B 4CH3A 5JWPA 4UV9A 3T4DA 4JASA 4MTGA 4RWUA 1NR7A 3CHXA 5H2FZ 5J2TB 4G2KA 3OEHG 4I55B 4Q20A 2OTJV 4O2AB 5FNVB 4H33A 4HNAB 3ZRSA 4AQYB 3CRQA 3MHSC 3L71H 4I9WA 3K03A 3JAKB 5J2TA 1L8DA 4LF4B 1XILA 1EFRG 2MW2B 4ZHQB 1SKVA 2Y4TA 4I55A 4MVRA 4WFGA 3ZBHA 3OMIB 4O2AA 5FNVA 4BW5A 4B3TO 1SQXH 3CCUV 4DV0O 2QWRB 5LYJB 1G8MA 1DGSA 3JAKA 3W7SA 2H94A 1FFTB 1XMOB 4X1YB 3ZMVA 4ZHQA 4NTYA 4O4HB 1AR1B 4U3FH 4UVAA 4E4EA 2JDIG 3OGCC 1AI6A 1Q81W 5DEDA 3ZHTA 4FLZA 2H3OA 3OD4A 2A7WA 3ZMTA 2L35A 2GV9A 4O4HA 1B04A 4FZ0A 1AJPA 1K3EA 1V9PA 4B7EA 2XAJA 5CA0B 1F4NA 5CBHA 1EN5A 3LUTB 2UUAO 2AZ0A 2OCHA 4L87A 1R73A 1VF6A 5LXTB 3LDCA 3JYCA 4DV7B 1K33A 1ENVA 3U11A 5LMUB 1GM8A 3ETDA 4FIPC 1OCCB 5CA0A 1CPYA 5BMVB 2DYSC 1NH2D 4X64O 1SERA 5KX5B 4DV3O 5LXTA 1S5HC 3ETEA 4MT8A 2DYRC 5CMUA 1JOYA 2WLJA 4LWSB 3RW0A 1L0LH 2FTKA 4JZGA 2IM9A 5BMVA 1IURA 2CTQA 1HNWO 1HP8A 2VWJA 1PNLA 2AXTZ 2VS0A 3EVKA 5KX5A 3EHBB 1N34O 2EIJB 1QHTA 1I94O 4WBNB 4LWSA 2Z5UA 2PTMA 2Q6AA 1DTOA 3K5NA 1W59A 4J10A 3OFNG 2RN9A 1AI4A 5BXZA 4PHZA 1M9NA 3FYEB 4NB5A 4QE9A 1HWYA 2IH1C 4WBNA 4FFKA 1YDXA 3A0BZ 3G6EV 1GN4A 2P06A 4DR4B 2A9HA 3HPLC 1KBHA 5JJNB 3OEEG 3ZIAG 1WAZA 5EZYB 1AJNA 2ZR2A 3B40A 1YF2A 3BAAA 1KMIZ 1GO3F 3CD6V 1WN7A 2C2AA 1UFIA 2YI8A 4K8ZA 5FPOA 2R70A 3BCCH 2M6YA 4LF5B 5EZYA 2UXBB 1WP7A 4UCUA 4LF8O 3C3SA 4J80A 5B1AC 4IIJA 1XHXA 4JI6O 4GT1A 4LF7B 2JGUA 3P32A 4DUZB 2Y69C 5L3CA 1YJ9V 1BZKA 2JVDA 3S3XA 3FFQA 2EZPA 1N32B 2IJKA 3SJQC 3F7VC 3W7WA 4J9ZB 3CC7V 1GM7A 2E74B 5LGUA 4K3AA 3J80N 1AVMA 4CC6A 2QTOA 2VQFO 2YDEA 2B9ZA 3EXAA 4F6RB 4J7JA 2NLJC 3ZMSA 1K8AW 2AHYA 1A32A 1B6QA 2Q7EA 1H2MA 4OX9B 2PY5A 4J42A 5FL7G 2D3OW 2CGNA 2QDOA 3VOUA 1O9HA 5CB4B 1QLNA 4F6RA 1NR1A 3CRCA 1I5YA 2E3CA 4JI4O 5E1AC 4O4IB 3A2FA 4CH6A 1TUEB 2P5OA 4NYKA 2GUZB 3ZJZA 4L8JA 4QPJA 5CB4A 2DN9A 2OIGA 4OXSA 3E8HA 1R6NA 4UUJC 4O4IA 5HFMA 1ORQC 2GUZA 2UUCO 2HLDG 2EILC 3K5LA 3OTFA 3UQ8A 1VQ7V 1PNKA 4FM0A 5EK0A 1IVSA 4B3RB 4LF6O 1VQOV 3FAVB 3H9VA 3OTOB 1L0NH 3CX5F 4CC5A 1PNMA 3SPGA 1XMQO 1NT2B 3P3NA 1S5JA 3FAVA 4PD4F 1GTOA
chains in the Genus database with same CATH topology
3RT3C 4X65O 2HHHO 5IWAO 5BY1A 2FKXA 4B3RO 2AGAA 4JI0O 4JI3O 4X64O 3OTOO 4DV3O 1X59A 4X66O 4DV6O 4LF5O 4LF9O 5BR8O 5LL6Y 2UXBO 2Z0AA 3J80N 2VQEO 1IBMO 1AILA 2DJVA 1FYJA 4JI1O 1HNWO 4DV7O 4KHPO 5H5NA 2VQFO 4B3MO 3SDLA 2ZM6O 5IT9N 4GKJO 4LF7O 5LMUO 4DUZO 1N34O 1J5EO 4JYAO 1A32A 4B3SO 1R6TA 1I94O 3R66A 4DUYO 4JI8O 1N32O 1IBLO 1XEQA 1IBKO 2F4VO 1F7YA 4LFAO 5BXZA 2DOSA 3F5TA 4B3TO 4JI4O 1KUQA 4JI5O 4JI2O 3T1YO 4DV0O 3J7AU 1XNQO 3O65A 4LFBO 1HR0O 5A2QN 3J81N 4X62O 4OPAA 1FKAO 4OPHA 4AQYO 1NS1A 4YHHO 2E5LO 1N33O 1FJGO 1HNZO 4JV5O 2LW7A 4OX9O 4LF4O 4NXNO 2UUCO 2N74A 4LFCO 4DV5O 2UXCO 1D2DA 4A5UB 4JI7O 4K0KO 3JAMN 4DR7O 4LF6O 3M8AA 4GKKO 4DR6O 1YZBA 2UU9O 1N36O 5FLXN 1DK1A 5LMNO 4DR2O 1AB3A 1XNRO 1XMQO 4DR5O 4YY3O 1G1XB 1XMOO 2UUAO 2UUBO 4DR1O 4NXMO 2JRIA 4DV1O 1R1BA 4LF8O 4DV4O 1HNXO 2ZKOA 3T1HO 4DR4O 4JI6O 4DV2O 4DR3O 2UXDO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT3 C;  4X65 O;  2HHH O;  5IWA O;  5BY1 A;  2FKX A;  4B3R O;  2AGA A;  4JI0 O;  4JI3 O;  4X64 O;  3OTO O;  4DV3 O;  1X59 A;  4X66 O;  4DV6 O;  4LF5 O;  4LF9 O;  5BR8 O;  5LL6 Y;  2UXB O;  2Z0A A;  3J80 N;  2VQE O;  1IBM O;  1AIL A;  2DJV A;  1FYJ A;  4JI1 O;  1HNW O;  4DV7 O;  4KHP O;  5H5N A;  2VQF O;  4B3M O;  3SDL A;  2ZM6 O;  5IT9 N;  4GKJ O;  4LF7 O;  5LMU O;  4DUZ O;  1N34 O;  1J5E O;  4JYA O;  1A32 A;  4B3S O;  1R6T A;  1I94 O;  3R66 A;  4DUY O;  4JI8 O;  1N32 O;  1IBL O;  1XEQ A;  1IBK O;  2F4V O;  1F7Y A;  4LFA O;  5BXZ A;  2DOS A;  3F5T A;  4B3T O;  4JI4 O;  1KUQ A;  4JI5 O;  4JI2 O;  3T1Y O;  4DV0 O;  3J7A U;  1XNQ O;  3O65 A;  4LFB O;  1HR0 O;  5A2Q N;  3J81 N;  4X62 O;  4OPA A;  1FKA O;  4OPH A;  4AQY O;  1NS1 A;  4YHH O;  2E5L O;  1N33 O;  1FJG O;  1HNZ O;  4JV5 O;  2LW7 A;  4OX9 O;  4LF4 O;  4NXN O;  2UUC O;  2N74 A;  4LFC O;  4DV5 O;  2UXC O;  1D2D A;  4A5U B;  4JI7 O;  4K0K O;  3JAM N;  4DR7 O;  4LF6 O;  3M8A A;  4GKK O;  4DR6 O;  1YZB A;  2UU9 O;  1N36 O;  5FLX N;  1DK1 A;  5LMN O;  4DR2 O;  1AB3 A;  1XNR O;  1XMQ O;  4DR5 O;  4YY3 O;  1G1X B;  1XMO O;  2UUA O;  2UUB O;  4DR1 O;  4NXM O;  2JRI A;  4DV1 O;  1R1B A;  4LF8 O;  4DV4 O;  1HNX O;  2ZKO A;  3T1H O;  4DR4 O;  4JI6 O;  4DV2 O;  4DR3 O;  2UXD O; 
#chains in the Genus database with same CATH topology
 2Q7G A;  4AHC A;  4GUN A;  1Z2G A;  1QU7 A;  2HVK C;  2HP8 A;  3E35 A;  1YIT V;  1K5S A;  5KLV H;  4NR1 A;  1SA0 B;  5LOV B;  3SYA A;  4P30 A;  4YXW G;  4UB8 Z;  1EN4 A;  5B1A B;  1ZUQ A;  1SQV H;  3P3P A;  1OJH A;  5IYD O;  5LHG A;  3MAQ A;  3CME V;  3RVY A;  1NVP B;  2R9I A;  1F4M A;  2Y69 B;  1AI7 A;  5IT9 N;  3SDL A;  3K57 A;  4PI2 A;  4BIZ A;  2ILM A;  2XAQ A;  3SR2 C;  3ZMZ A;  1SA0 A;  5LOV A;  4MS2 A;  4JV5 B;  2EX3 A;  2IH3 C;  2QEX V;  3DC5 A;  1IBK O;  1US6 A;  1QBZ A;  3CC2 V;  2XOK G;  1M4U A;  1U97 A;  2YSU B;  4DR7 B;  2UU9 B;  3FB8 C;  3CXC U;  4XDL A;  1K9M W;  4TT3 G;  5A2Q N;  2W0F C;  1B06 A;  4NXM B;  2UUB B;  2HVJ C;  4DR1 B;  1I08 A;  4ZBM A;  4C7U A;  3DTU B;  1HNZ O;  2BCC H;  1YIJ V;  1MZE A;  4X20 B;  4HYO A;  4JTD B;  3ZN1 A;  3ZRW B;  4GX5 A;  3FB6 C;  2JS5 A;  4ASU G;  4JI3 B;  3QG5 A;  1THZ A;  3SGI A;  4X20 A;  3FYI B;  3JD1 A;  2XUM A;  4DV6 B;  5KMG B;  1URF A;  2KG7 B;  3RYC B;  3ZRW A;  1GKF A;  4CS2 A;  1YSC A;  2ZIN A;  5KA5 A;  2Q73 A;  5HFL A;  4YJ3 B;  2Z3Y A;  3T1H O;  2LP7 A;  4JI1 B;  1GH6 A;  2P67 A;  1N8R W;  3AK3 A;  2EIL B;  5GTI Z;  2E76 B;  3FX7 A;  3SPH A;  2CK3 G;  5EIB C;  3G67 A;  4U3J B;  2KSD A;  2KQX A;  3UKM A;  2LFR A;  1I5X A;  3CCE V;  1Q90 D;  4PJ0 Z;  2KG7 A;  3AG4 C;  3B09 A;  5CA1 B;  3RYC A;  2AGA A;  1K7D A;  2M7W A;  2R9A A;  1VQ4 V;  4YJ3 A;  3R65 A;  2A0L A;  5F2V O;  5H9C A;  3E8G A;  2E75 B;  3WB2 A;  4U3J A;  1CXZ B;  1Q7Y W;  4I9Q A;  1V55 C;  1KP2 A;  2YIA A;  5CA1 A;  5LMN B;  3U0Z A;  1BSM A;  1WB7 A;  2QJ1 A;  2AHZ A;  1OCZ C;  2RNB A;  3F5W C;  3VBB A;  5CA3 A;  4YHH B;  3ZHS A;  3X2Q C;  4N23 A;  4X1K B;  2EIN B;  3K5M A;  4WFA V;  2HR3 A;  4XDK A;  1PM9 A;  3BRC A;  2CTW A;  3E22 B;  5TIS Z;  3UT5 B;  4D6T H;  1KP3 A;  4PA7 A;  4GKK B;  2JIZ G;  2EJR A;  3T1Y O;  3J7A U;  2WA3 A;  4UXN A;  1ZLZ A;  4HAM A;  3GVM A;  3RYI B;  4X1K A;  2IBZ H;  2HJD A;  2QE7 G;  1M1K W;  3E22 A;  3UT5 A;  3L72 H;  4Z2W A;  1SQQ H;  2ITD C;  3JAR B;  1QNM A;  1M56 B;  1GK9 A;  2WA4 A;  2IJJ A;  1RFY A;  3ZX6 A;  1UPG A;  4MTX A;  2L6L A;  3O9O A;  3WFV A;  3RYI A;  1W2B U;  1ZTE A;  5IJ9 B;  4PDL A;  1Q86 W;  2ZNJ A;  1QLE B;  1VQN V;  4LH6 A;  2PGG A;  1AR5 A;  3CRR A;  4K8X A;  1MAB G;  3SYP A;  3K59 A;  1SZX A;  4FLY A;  1OZ0 A;  4LF9 B;  3DC6 A;  1SRY A;  5IJ9 A;  3PJS K;  4DV1 O;  4O4J B;  4IGG A;  2OYQ A;  1ZWI C;  1MSW D;  2YXH A;  5LGT A;  1K97 A;  3OW2 U;  3AK2 A;  1J5E B;  3W7U A;  1NTM H;  5IWA O;  1OCC C;  3DSQ A;  1SQB H;  5KHJ A;  4X8A A;  4O4J A;  1V54 B;  4BR6 A;  2ZDI C;  1IBL B;  4JI8 B;  4FFB B;  4X66 O;  2PUS A;  3ZMU A;  4LFA B;  5LHI A;  3VQY A;  3BEH A;  3RYH B;  1RPR A;  1XNQ B;  3CB2 A;  4KHP O;  5KHG A;  2F43 G;  5LA6 B;  4FFB A;  1XNR B;  4X1I B;  1L1F A;  2CTP A;  4DK0 A;  1S5L Z;  3AG4 B;  5L3B A;  1N33 B;  1FJG B;  2Q8V A;  3RYH A;  3OM3 B;  1UJW B;  4W4L A;  2XND G;  3K0D A;  4DUY O;  5DEC A;  4TQF A;  2DQ3 A;  3IAY A;  5K1X A;  5LA6 A;  3QTC A;  1V55 B;  3MDS A;  4X1I A;  1EBO A;  2A3Q A;  4WCE V;  3TXQ A;  2XAS A;  2JS3 A;  2XAG A;  3Q4H B;  3K58 A;  1OCZ B;  2XTA A;  4YY3 B;  3K0G A;  5JH7 B;  4OPA A;  1FKA O;  3LNN A;  4UB6 Z;  3RGB A;  4AQY O;  3X2Q B;  1G4Y B;  4PV1 B;  1R3L C;  4DV4 B;  2E5L O;  5IYB O;  3JSN A;  5EC1 C;  5L3D A;  2DQ0 A;  2OIE A;  4LF4 O;  3Q4H A;  2LGQ A;  4IHJ B;  4ZOL B;  5JH7 A;  4IT5 A;  3IC7 A;  1VQL V;  1Y66 A;  1DK1 A;  1H2G A;  4MVM A;  3HB3 B;  4CZZ A;  2CE4 A;  2G38 A;  1XMO O;  2P4V A;  1B3Q A;  5EC2 C;  4IHJ A;  5BR8 B;  1M90 W;  2VQE B;  4EFB A;  4ZOL A;  3UO2 A;  1M5I A;  3RFR A;  2QR4 A;  4NKG B;  4B3M B;  2ZM6 B;  3ZRX A;  3K06 A;  3FD9 A;  4GKJ B;  3RT3 C;  2GDS A;  5JVD B;  4BW9 A;  1OCO B;  4H44 B;  4RUF A;  3MHH C;  2Q0A A;  1BL8 A;  1XBL A;  3ZHU A;  2P6J A;  1QVF U;  5JVD A;  4R7C A;  3JCZ A;  1VQ5 V;  1WPX A;  1H2K A;  4DV7 O;  1PPJ H;  5B1N A;  1SQF A;  5AG2 A;  5EIB D;  2IU0 A;  5LMU O;  1DLB A;  5GON B;  5B1B C;  4WFE A;  1R6T A;  4QE7 A;  1WB8 A;  3R66 A;  4QIW F;  4MVQ A;  3ABM C;  3H1I H;  5L3F A;  1N4C A;  5H6R A;  3CRA A;  1FFX B;  4U7O A;  4DV5 B;  2Y4U A;  1JVM A;  2GTS A;  4JI2 O;  3K5O A;  5GON A;  1N36 B;  4QPK A;  4J11 A;  2ZDI A;  1HR0 O;  3S3W A;  2IU3 A;  1FFX A;  3OT7 A;  1R6K A;  4DW1 A;  4OPH A;  3L70 H;  4WFB V;  5J2U B;  1XOU A;  4IYH A;  3AG1 B;  3RWR D;  4MTF A;  2UXD B;  3OUS A;  3H1K H;  2FYU H;  2ETN A;  3CP1 A;  2BSK A;  1FPO A;  5J2U A;  4YIP A;  2IW5 A;  2Q68 A;  5FLX N;  4FLX A;  3E2E A;  1XRE A;  5KA6 A;  2QKS A;  1WLE A;  2KB1 A;  5IE9 A;  2CDY A;  1IBM B;  1R1B A;  4ICG A;  2F95 B;  1Y6X A;  2ZKO A;  1GAX A;  4DR4 O;  3RN4 A;  1ROP A;  1WPB A;  3IGA C;  1VEW A;  4MVO A;  4YIO A;  4JYA B;  2PI4 A;  4IIJ B;  4MVS A;  4MW8 A;  2P22 C;  3NR7 A;  1BS3 A;  1NJI W;  4LF5 O;  2UXB O;  1Q8I A;  3KZI Z;  2BOC C;  2LW1 A;  4LFB B;  4UCO A;  2ZQM A;  5H5N A;  1ARO P;  3E89 A;  3U10 A;  1HDJ A;  4LP8 A;  3JD0 A;  1D5A A;  1FXK C;  3ABL B;  3NXS A;  4LF7 O;  4DUZ O;  4TUY B;  5KHH A;  1OCR C;  1BT8 A;  3AG2 C;  1N32 O;  1OHH G;  3AG3 C;  5LHH A;  1JCH A;  4GX2 A;  3JD3 A;  3SYQ A;  4TUY A;  3CWB H;  3UO3 A;  2X6C A;  3HKE A;  5B1B B;  3BAB A;  4WF9 V;  3C90 A;  5JCO C;  4UVB A;  3ABM B;  4BWA A;  1JFF A;  2WLM A;  4P9O A;  4OX9 O;  1SES A;  2ZE6 A;  1Q3E A;  2JK5 C;  3E8B A;  1U96 A;  2GSM B;  1KKC A;  1Z5W A;  3ETQ A;  1Q6H A;  2HFE C;  3IC9 A;  4UCS A;  3JAW B;  1EZJ A;  1LR1 A;  2YXY A;  1VF7 A;  5KAF Z;  2ZNI A;  4J9Y B;  2A79 B;  5GW7 A;  2BTO A;  4J7Z A;  2FKX A;  5EBL C;  3STL C;  4B3R O;  1JQ0 A;  1H8H G;  3L74 H;  1MOF A;  3OTO O;  3JAW A;  2B1G A;  1X59 A;  3VQX A;  1NU1 H;  4X89 A;  3OAA G;  2NN4 A;  1NQT A;  2DJV A;  3CCM V;  2RCV A;  3WG7 C;  3UCS C;  2QM4 A;  4ZI7 B;  3CCL V;  4X62 B;  1JR9 A;  4NTX A;  1JX9 A;  3WB0 A;  1AP5 A;  1Q6U A;  2OT5 A;  1F23 A;  3N2G B;  4LNU B;  2P90 A;  4BIO A;  2EIN C;  3ZRV A;  3CCJ V;  1XI1 A;  4LFC B;  2YIC A;  4ZI7 A;  2UXC B;  4JI7 B;  3LNM B;  3BVO A;  3SPI A;  3N2G A;  3RYF B;  1FXK B;  2WLL B;  4LNU A;  4EB6 A;  3K3W A;  3QO7 A;  3DGE A;  2BTQ A;  3M99 B;  5LBQ A;  1OCR B;  1NBM G;  5JJJ B;  4I4T B;  4FMT A;  3AG2 B;  5CN0 A;  4ABM A;  1M56 C;  3AG3 B;  4JV5 O;  2ODM A;  1YCI A;  4HZ3 A;  4DV2 B;  1NZ6 A;  1VQM V;  1OV9 A;  3OMA B;  3RYF A;  1FXK A;  2WLL A;  1S76 D;  4A5U B;  4K0K O;  4DR7 O;  3M8A A;  2ZCE A;  4KL1 A;  1NI8 A;  2UU9 O;  4I4T A;  2DMX A;  1QLE C;  1Y4M A;  2R9R B;  4E2L A;  1IBK B;  1JJO A;  4NXM O;  2UUB O;  4DR1 O;  1XDC A;  5JQG B;  3BHP A;  1BMF G;  3M7M X;  1TAE A;  2B5U A;  3T4Z A;  3BPZ A;  4JZ2 A;  4UV8 A;  2Q4P A;  1MNG A;  4MW3 A;  2BE3 A;  2ARH A;  4JGS A;  1GN6 A;  3LSU A;  5JCO A;  3ZHQ A;  1QQC A;  4P2Z A;  1K4C C;  4UCT A;  1PL4 A;  5D5P A;  5JQG A;  4JI3 O;  1H2L A;  3JD2 A;  3JCU Z;  1V54 C;  3F7Y C;  3OMN B;  2YEV B;  2F4V B;  3QO5 A;  4KFM A;  1P49 A;  2JJ2 G;  4DV6 O;  1IX9 A;  2BOB C;  2Z0A A;  2HKO A;  5LP6 C;  4JI1 O;  2CGO A;  2ZIO A;  2YEV A;  3CS5 A;  1XL6 A;  4O4L B;  3E8F A;  1LUV A;  5IYZ B;  1AJQ A;  3AK1 A;  1EN6 A;  4NXN B;  1VAR A;  4JYY A;  1KEC A;  4PEL A;  1GM9 A;  3F5T A;  4O4L A;  4DR6 B;  2KKW A;  3WG7 B;  2HEP A;  4F6E A;  2YIB A;  4DR2 B;  5IYZ A;  3EFF K;  4XBF A;  2DE0 X;  1NVP D;  4H13 B;  5K1P A;  4IYI A;  1GRJ A;  4YHH O;  4I50 A;  3HKB B;  1R3I C;  4X65 B;  3MD0 A;  3JAS B;  4TQD A;  4OGQ B;  2Y0P A;  4GKK O;  3CCR V;  4JI0 B;  4I5S A;  5L3G A;  1MMM A;  2WAM A;  3RBZ A;  3HKB A;  2QWQ B;  3ETG A;  5IY5 C;  3C3T A;  3JAS A;  2EUL A;  3T1C A;  4ZKI A;  1VIB A;  4WFF A;  2WLH A;  4P9P A;  1JA8 A;  1OCO C;  2NR5 A;  4B3S B;  1QCE A;  4JAU A;  1PL0 A;  1MSD A;  1P7B A;  2X0L A;  2YID A;  4NTW A;  4AI8 A;  4TWK A;  1YHQ V;  4TOI A;  5J9P C;  3B4S A;  1K5Q A;  3ZS8 C;  3CYO A;  4LF9 O;  3WU2 Z;  4JI5 B;  4UCR A;  1YEW A;  4DW0 A;  4UCV A;  5IDJ A;  1VQP V;  1JMK C;  2CH7 B;  2Q0O C;  1J5E O;  1AI5 A;  2ZD9 A;  2VRZ A;  3KG2 A;  3K9A A;  3BY6 A;  5B3S C;  1VF5 B;  2V4D A;  3IJ4 A;  4JI8 O;  1IBL O;  4FLV A;  3CCS V;  1Y67 A;  2LO1 A;  1PD3 A;  4LFA O;  3CPW U;  2CH7 A;  5LP6 B;  1KB9 F;  4GX0 A;  1XNQ O;  2R72 A;  2JEX A;  4DR5 B;  4LCU C;  3FB5 C;  2OCC C;  2F66 C;  1QVG U;  1SF9 A;  4PDR A;  1NS1 A;  4PA6 A;  1HNX B;  1N33 O;  1FJG O;  1XUQ A;  1FS0 G;  5LP6 A;  4PDM A;  5C93 A;  5L3E A;  3AG1 C;  4DR3 B;  1D5N A;  3JD4 A;  2EIK C;  1DF4 A;  4FLW A;  3OUF A;  2Y0I A;  1Q43 A;  4CBC A;  4AIL C;  2HHH B;  3WB1 A;  2XHB A;  2W6I G;  2Q67 A;  4B7K A;  2FL4 A;  4R6Z A;  1W0K G;  1VQ9 V;  4D7T A;  2W0X A;  4YY3 O;  1G1X B;  3ABK C;  2JGD A;  1WA8 B;  4RO2 A;  3SJC C;  1P4R A;  4FM1 A;  4NVP A;  1S72 V;  4FZ1 A;  4DV4 O;  2ATK C;  2Q9L A;  3G80 A;  1MZF A;  3B8N A;  2ZE7 A;  1Q5O A;  2LFS A;  1TGO A;  2JJ1 G;  5C8Y B;  3A0R A;  1HW7 A;  1WA8 A;  2E5L B;  3CXH F;  3AEI A;  1SQG A;  5IY5 B;  1YVW A;  2GHY A;  5KHI A;  1ZSP A;  4B3T B;  1DF5 A;  5BR8 O;  5LL6 Y;  4Z1V A;  4MTO A;  4DV0 B;  2RMK B;  5C8Y A;  2VQE O;  4HNA A;  5FPR A;  3GB7 C;  3SYO A;  2QWO B;  1MG1 A;  2EBO A;  1R3K C;  1W0J G;  2ZM6 O;  4B3M O;  4LC1 A;  4GKJ O;  3ABL C;  2RDC A;  4UFZ A;  4DRX B;  1H2S B;  4KP4 A;  3CRM A;  3SYC A;  2X6A A;  4Z1M G;  2XAH A;  1PV0 A;  1ZAU A;  5LYJ A;  5DM6 V;  2WSS G;  4DRX A;  4RQE A;  4X1Y A;  2ADP A;  4G28 B;  4PA9 A;  3VQV A;  3ABT A;  4JTA B;  2N04 A;  2Q7H A;  3J81 N;  2UUA B;  3G71 V;  3KCX A;  5B3S B;  4LH7 A;  3K08 A;  1BE3 H;  2F23 A;  2IJI A;  2IJH A;  3APQ A;  2XT9 A;  2CAZ C;  4DV5 O;  2P7T C;  2Q5Z A;  2WWW A;  3A8T A;  1R3J C;  5EBW C;  1XQ8 A;  4X64 B;  2O57 A;  2PYL A;  1N36 O;  4DV3 B;  4FK5 C;  3A0H Z;  2OCC B;  3LSQ A;  2BSK B;  3N2K B;  2AW9 A;  4DXW A;  1H8E G;  4JI2 B;  2EIK B;  1HNW B;  1HR0 B;  1YJN V;  2UXD O;  2YXL A;  4PA3 A;  3L75 H;  1N34 B;  3HKC B;  1K73 W;  2GTA A;  3TK1 A;  3N2K A;  4QNH B;  1CP9 A;  1I94 B;  3CE2 A;  3TGU H;  1WJZ A;  5B66 Z;  3APO A;  1RM1 C;  3K79 A;  3ABK B;  3T2M A;  1COW G;  3QO8 A;  3HKC A;  4GYC B;  1IBM O;  3AG7 A;  3GWK C;  4D7S A;  5EBM C;  2P4K A;  4CS3 A;  1KQS U;  4QGP A;  1XHZ A;  4JYA O;  2LGW A;  2QTS A;  2UXN A;  3KKY A;  3D3Q A;  3OE7 G;  1RPO A;  2Y48 A;  5KHK A;  3HKD B;  5B1O A;  2QWP B;  1KU9 A;  3G6B A;  3LDE A;  1JPX A;  2PZS A;  3I5D A;  3W7T A;  3ZCC A;  4BAY A;  4LFB O;  2PYJ A;  4O2B B;  1KC8 W;  4W4K A;  2QM7 A;  4Q6G A;  1TA8 A;  3SJB C;  2DWD C;  1J95 A;  3HKD A;  2D2C B;  4LF8 B;  1YI2 V;  2K9P A;  4MVZ A;  3HKE B;  3QVN A;  4JI6 B;  1CEZ A;  3LDD A;  2N74 A;  1K92 A;  2OWO A;  4TV9 B;  4O2B A;  4H0L B;  1D2D A;  1JFF B;  2HG5 C;  2LJ2 A;  5KUM A;  1NTK H;  4H37 A;  3CCV V;  4J7K A;  3ZED A;  1AB3 A;  3BFR A;  4FLU A;  3H01 A;  1RSO B;  5KUK A;  1JJ2 U;  3TXS A;  4TV9 A;  4DK1 A;  4N21 A;  4X9Q A;  1QR9 A;  2QGN A;  2VQF B;  3D36 C;  4FVM A;  3TCU A;  2ZR3 A;  1BGY H;  4RUE A;  2FML A;  2X7R B;  4KXR A;  1RSO A;  4JAV A;  4TSF G;  5EYP B;  2DYS B;  3K04 A;  3ZHV A;  1T5E A;  2WLI B;  1SC5 B;  2ZIM A;  2QSA A;  2DYR B;  3QNE A;  3JSL A;  4JI4 B;  1GMG A;  2ZT9 B;  1AIL A;  4F4L A;  2RQ6 A;  2QWN B;  5EYP A;  1MA1 A;  5DN6 G;  2WLI A;  2N05 A;  3ASN C;  4R8C A;  2EIM C;  4U7N A;  4QJF B;  4HBN A;  1YXB A;  4I7Z B;  1RM1 B;  4FM2 A;  1XEQ A;  1VQK V;  2V7Q G;  4LR3 A;  3RVZ A;  2UUC B;  2YI9 A;  2QA4 V;  2NNU A;  1KUQ A;  4LF6 B;  3JAL B;  5IYC O;  4CH4 A;  4RQF A;  3O65 A;  4TV8 B;  1SET A;  3KCY A;  3PN1 A;  1I7F A;  3FB7 C;  1XMQ B;  4XDJ A;  4X62 O;  3IFX A;  1F51 A;  2XAF A;  5GTH Z;  1SZT A;  3QF7 A;  3I56 V;  4EB6 B;  3CMA V;  2BTQ B;  2LW7 A;  2WPD G;  3JAL A;  1FAF A;  1ZL8 B;  2ZXW C;  2PF4 E;  3ZHR A;  1IDS A;  4TV8 A;  1E1R G;  2JEU A;  2YUA A;  4RAI A;  4LFC O;  3N27 A;  4MVU A;  2UXC O;  4FJC C;  4JI7 O;  1AP6 A;  3OGI B;  4LBE C;  4DYL A;  1YZB A;  1TVK B;  4J41 A;  4MSW C;  3STZ C;  1YJW V;  2EZO A;  5CBG A;  1ZL8 A;  5CBF A;  3CEI A;  2ITC C;  2FB5 A;  2RJZ A;  5ITZ B;  2HJF C;  2DW4 A;  4R50 A;  4PI0 A;  2DWE C;  4EFE A;  1E79 G;  2W6J G;  1VQ6 V;  4DV2 O;  1TVK A;  4JYC A;  1YTF B;  2K1E A;  1VMG A;  4CH5 A;  5H6Q A;  2ZE8 A;  5ITZ A;  1KYO F;  2B1I A;  1LNQ A;  1NTZ H;  2QKC A;  3E83 A;  3W7X A;  1VP7 A;  4JYB A;  4GX1 A;  3ASO C;  4FLT A;  2A06 H;  4I0X B;  4K0K B;  3ZN0 A;  2Q69 A;  1FYJ A;  1Q6I A;  1M57 C;  1RP3 B;  1WP8 A;  3OR7 C;  4BIU A;  3B8M A;  3D8C A;  1HNZ B;  1PP9 H;  4I0X A;  4GLX A;  3ABU A;  4ZIB A;  3H1J H;  4G27 B;  1Z5V A;  3D36 A;  3K9S A;  1P84 F;  2F4V O;  2PI5 A;  2DOS A;  1TUB B;  3E86 A;  3BA8 A;  3G4S V;  3ASN B;  2EIM B;  3CSX A;  1I0H A;  2CTR A;  3SPC A;  3T1H B;  1TUB A;  1N0N A;  3GWO A;  1KKD A;  3I55 V;  3THO A;  4NXN O;  2WLN A;  1P7G A;  3B77 A;  2QKA A;  1GN2 A;  4GZR B;  4I50 B;  2H8P C;  4DO2 A;  4FPP A;  2GBO A;  2F1M A;  2YC0 A;  5KMG A;  4DR6 O;  4JTC B;  2LQT A;  4K35 A;  3OR6 C;  5LMN O;  4DR2 O;  2CUG A;  3SJA C;  1S77 D;  1G6U A;  3L73 H;  4JPR A;  5KAI Z;  2OTL V;  1BQ0 A;  4KUM A;  5LGN A;  4WFH A;  1FXV A;  1GN3 A;  1NKD A;  2ZXW B;  5IJ0 B;  3DXR B;  1EZV H;  4X65 O;  3JAT B;  3ICX A;  4X88 A;  1Y74 B;  1XL4 A;  1IXB A;  1S3J A;  2EJ7 A;  2MK3 A;  5BY1 A;  1YTF D;  4JI0 O;  1BHA A;  2QM8 A;  1PKX A;  4YJ2 B;  3ML0 A;  3L9D A;  5IJ0 A;  2YS8 A;  1Y76 B;  3DXR A;  2V1D A;  3JAT A;  3T1Y B;  1Y74 A;  5BZB A;  1BCC H;  3CJH B;  5JJE B;  4YJ2 A;  4JAA A;  1M93 A;  1Y76 A;  4UVC A;  1ZX3 A;  4B3S O;  3UM7 A;  4EEQ A;  1BHB A;  1X4T A;  4JF3 A;  3ASO B;  3CJH A;  1F7Y A;  1SQP H;  3D3I A;  1FD9 A;  4JI5 O;  3TET A;  4GCZ A;  1FXH A;  1M57 B;  1VF6 C;  4PA4 A;  5E79 Z;  1VQ8 V;  2VWK A;  1Q82 W;  4B08 A;  3JAR A;  3LSS A;  3BA9 A;  4PDV A;  3CC4 V;  1EM1 A;  2UXX A;  5B5E Z;  4DV1 B;  1H2N A;  5D5Q A;  3HR0 A;  1KD1 W;  1H38 A;  2YIB D;  3SPJ A;  3FKS G;  5IWA B;  4IL6 Z;  1K4D C;  3JAM N;  3H1H H;  3CCQ V;  1BQZ A;  1SS3 A;  1N0J A;  1WNS A;  2X6B A;  1IZ3 A;  4X66 B;  5A9G A;  1XNR O;  1IXM A;  3H1L H;  1S0V A;  4DR5 O;  2JRI A;  1LUW A;  3P30 A;  3VQW A;  1QR8 A;  1HNX O;  1K34 A;  4KHP B;  4CS4 A;  4EKW A;  3TJT A;  2WLK A;  2JGD B;  4DR3 O;  2AZ2 A;  1AR4 A;  2HHH O;  1NH2 B;  2ZE5 A;  2EIJ C;  1E1Q G;  1O9G A;  4DUY B;  2ADQ B;  3B2E E;  2F93 B;  4CH3 A;  5JWP A;  4UV9 A;  3T4D A;  4JAS A;  4MTG A;  4RWU A;  1NR7 A;  3CHX A;  5H2F Z;  5J2T B;  4G2K A;  3OEH G;  4I55 B;  4Q20 A;  2OTJ V;  4O2A B;  5FNV B;  4H33 A;  4HNA B;  3ZRS A;  4AQY B;  3CRQ A;  3MHS C;  3L71 H;  4I9W A;  3K03 A;  3JAK B;  5J2T A;  1L8D A;  4LF4 B;  1XIL A;  1EFR G;  2MW2 B;  4ZHQ B;  1SKV A;  2Y4T A;  4I55 A;  4MVR A;  4WFG A;  3ZBH A;  3OMI B;  4O2A A;  5FNV A;  4BW5 A;  4B3T O;  1SQX H;  3CCU V;  4DV0 O;  2QWR B;  5LYJ B;  1G8M A;  1DGS A;  3JAK A;  3W7S A;  2H94 A;  1FFT B;  1XMO B;  4X1Y B;  3ZMV A;  4ZHQ A;  4NTY A;  4O4H B;  1AR1 B;  4U3F H;  4UVA A;  4E4E A;  2JDI G;  3OGC C;  1AI6 A;  1Q81 W;  5DED A;  3ZHT A;  4FLZ A;  2H3O A;  3OD4 A;  2A7W A;  3ZMT A;  2L35 A;  2GV9 A;  4O4H A;  1B04 A;  4FZ0 A;  1AJP A;  1K3E A;  1V9P A;  4B7E A;  2XAJ A;  5CA0 B;  1F4N A;  5CBH A;  1EN5 A;  3LUT B;  2UUA O;  2AZ0 A;  2OCH A;  4L87 A;  1R73 A;  1VF6 A;  5LXT B;  3LDC A;  3JYC A;  4DV7 B;  1K33 A;  1ENV A;  3U11 A;  5LMU B;  1GM8 A;  3ETD A;  4FIP C;  1OCC B;  5CA0 A;  1CPY A;  5BMV B;  2DYS C;  1NH2 D;  4X64 O;  1SER A;  5KX5 B;  4DV3 O;  5LXT A;  1S5H C;  3ETE A;  4MT8 A;  2DYR C;  5CMU A;  1JOY A;  2WLJ A;  4LWS B;  3RW0 A;  1L0L H;  2FTK A;  4JZG A;  2IM9 A;  5BMV A;  1IUR A;  2CTQ A;  1HNW O;  1HP8 A;  2VWJ A;  1PNL A;  2AXT Z;  2VS0 A;  3EVK A;  5KX5 A;  3EHB B;  1N34 O;  2EIJ B;  1QHT A;  1I94 O;  4WBN B;  4LWS A;  2Z5U A;  2PTM A;  2Q6A A;  1DTO A;  3K5N A;  1W59 A;  4J10 A;  3OFN G;  2RN9 A;  1AI4 A;  5BXZ A;  4PHZ A;  1M9N A;  3FYE B;  4NB5 A;  4QE9 A;  1HWY A;  2IH1 C;  4WBN A;  4FFK A;  1YDX A;  3A0B Z;  3G6E V;  1GN4 A;  2P06 A;  4DR4 B;  2A9H A;  3HPL C;  1KBH A;  5JJN B;  3OEE G;  3ZIA G;  1WAZ A;  5EZY B;  1AJN A;  2ZR2 A;  3B40 A;  1YF2 A;  3BAA A;  1KMI Z;  1GO3 F;  3CD6 V;  1WN7 A;  2C2A A;  1UFI A;  2YI8 A;  4K8Z A;  5FPO A;  2R70 A;  3BCC H;  2M6Y A;  4LF5 B;  5EZY A;  2UXB B;  1WP7 A;  4UCU A;  4LF8 O;  3C3S A;  4J80 A;  5B1A C;  4IIJ A;  1XHX A;  4JI6 O;  4GT1 A;  4LF7 B;  2JGU A;  3P32 A;  4DUZ B;  2Y69 C;  5L3C A;  1YJ9 V;  1BZK A;  2JVD A;  3S3X A;  3FFQ A;  2EZP A;  1N32 B;  2IJK A;  3SJQ C;  3F7V C;  3W7W A;  4J9Z B;  3CC7 V;  1GM7 A;  2E74 B;  5LGU A;  4K3A A;  3J80 N;  1AVM A;  4CC6 A;  2QTO A;  2VQF O;  2YDE A;  2B9Z A;  3EXA A;  4F6R B;  4J7J A;  2NLJ C;  3ZMS A;  1K8A W;  2AHY A;  1A32 A;  1B6Q A;  2Q7E A;  1H2M A;  4OX9 B;  2PY5 A;  4J42 A;  5FL7 G;  2D3O W;  2CGN A;  2QDO A;  3VOU A;  1O9H A;  5CB4 B;  1QLN A;  4F6R A;  1NR1 A;  3CRC A;  1I5Y A;  2E3C A;  4JI4 O;  5E1A C;  4O4I B;  3A2F A;  4CH6 A;  1TUE B;  2P5O A;  4NYK A;  2GUZ B;  3ZJZ A;  4L8J A;  4QPJ A;  5CB4 A;  2DN9 A;  2OIG A;  4OXS A;  3E8H A;  1R6N A;  4UUJ C;  4O4I A;  5HFM A;  1ORQ C;  2GUZ A;  2UUC O;  2HLD G;  2EIL C;  3K5L A;  3OTF A;  3UQ8 A;  1VQ7 V;  1PNK A;  4FM0 A;  5EK0 A;  1IVS A;  4B3R B;  4LF6 O;  1VQO V;  3FAV B;  3H9V A;  3OTO B;  1L0N H;  3CX5 F;  4CC5 A;  1PNM A;  3SPG A;  1XMQ O;  1NT2 B;  3P3N A;  1S5J A;  3FAV A;  4PD4 F;  1GTO A; 
#chains in the Genus database with same CATH homology
 3RT3 C;  4X65 O;  2HHH O;  5IWA O;  5BY1 A;  2FKX A;  4B3R O;  2AGA A;  4JI0 O;  4JI3 O;  4X64 O;  3OTO O;  4DV3 O;  1X59 A;  4X66 O;  4DV6 O;  4LF5 O;  4LF9 O;  5BR8 O;  5LL6 Y;  2UXB O;  2Z0A A;  3J80 N;  2VQE O;  1IBM O;  1AIL A;  2DJV A;  1FYJ A;  4JI1 O;  1HNW O;  4DV7 O;  4KHP O;  5H5N A;  2VQF O;  4B3M O;  3SDL A;  2ZM6 O;  5IT9 N;  4GKJ O;  4LF7 O;  5LMU O;  4DUZ O;  1N34 O;  1J5E O;  4JYA O;  1A32 A;  4B3S O;  1R6T A;  1I94 O;  3R66 A;  4DUY O;  4JI8 O;  1N32 O;  1IBL O;  1XEQ A;  1IBK O;  2F4V O;  1F7Y A;  4LFA O;  5BXZ A;  2DOS A;  3F5T A;  4B3T O;  4JI4 O;  1KUQ A;  4JI5 O;  4JI2 O;  3T1Y O;  4DV0 O;  3J7A U;  1XNQ O;  3O65 A;  4LFB O;  1HR0 O;  5A2Q N;  3J81 N;  4X62 O;  4OPA A;  1FKA O;  4OPH A;  4AQY O;  1NS1 A;  4YHH O;  2E5L O;  1N33 O;  1FJG O;  1HNZ O;  4JV5 O;  2LW7 A;  4OX9 O;  4LF4 O;  4NXN O;  2UUC O;  2N74 A;  4LFC O;  4DV5 O;  2UXC O;  1D2D A;  4A5U B;  4JI7 O;  4K0K O;  3JAM N;  4DR7 O;  4LF6 O;  3M8A A;  4GKK O;  4DR6 O;  1YZB A;  2UU9 O;  1N36 O;  5FLX N;  1DK1 A;  5LMN O;  4DR2 O;  1AB3 A;  1XNR O;  1XMQ O;  4DR5 O;  4YY3 O;  1G1X B;  1XMO O;  2UUA O;  2UUB O;  4DR1 O;  4NXM O;  2JRI A;  4DV1 O;  1R1B A;  4LF8 O;  4DV4 O;  1HNX O;  2ZKO A;  3T1H O;  4DR4 O;  4JI6 O;  4DV2 O;  4DR3 O;  2UXD O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...