4X66O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x66O00
4AQYO 3M8AA 4JI0O 1FKAO 1D2DA 5BY1A 2ZM6O 1IBMO 2E5LO 4JI4O 2FKXA 2HHHO 5H5NA 4JI2O 4JI7O 4NXMO 1R1BA 4LF7O 4DR7O 4JI6O 3F5TA 4LFAO 1XNRO 1FYJA 4JI1O 4X66O 4JI3O 4JYAO 4JV5O 2VQFO 4DUZO 2LW7A 4B3SO 5BR8O 4X64O 5A2QN 2N74A 1YZBA 2UUCO 3O65A 1HNXO 1HNZO 4DV6O 4DR2O 2UXCO 4LF9O 4DR1O 1AILA 3RT3C 1F7YA 4LF5O 4DV0O 4DV4O 1HNWO 4YHHO 3J81N 1XMQO 4B3TO 4DV1O 4X62O 1NS1A 4DR5O 2UUAO 5FLXN 1N36O 1DK1A 1N34O 4GKKO 4YY3O 4NXNO 1XMOO 4DV7O 4DR6O 4OX9O 4LF4O 3R66A 1IBKO 2Z0AA 4KHPO 1N33O 3T1HO 4A5UB 2F4VO 1R6TA 2DOSA 4LF8O 1FJGO 2UXDO 1HR0O 1I94O 3OTOO 3J80N 4B3RO 4DR4O 4OPAA 4DV2O 1XNQO 5IT9N 5LMUO 4OPHA 4GKJO 4LF6O 5BXZA 5LMNO 4JI5O 2JRIA 4LFCO 2UXBO 4JI8O 3JAMN 4X65O 1J5EO 3T1YO 1IBLO 4DV5O 4DR3O 2AGAA 2DJVA 3SDLA 1XEQA 4DUYO 4B3MO 1KUQA 5IWAO 4LFBO 1AB3A 3J7AU 2ZKOA 1G1XB 2VQEO 2UUBO 2UU9O 4K0KO 1A32A 1X59A 1N32O 5LL6Y 4DV3O
chains in the Genus database with same CATH superfamily
2OCCB 4AQYO 1KMIZ 1GMGA 3BY6A 1MSWD 1I0HA 3K08A 3ZHQA 2NN4A 3SJBC 4X20B 2CUGA 1J5EB 2ZR3A 3S3XA 1LUWA 2YIBA 4H37A 1S5LZ 3ETQA 3HKDA 3C90A 3ZBHA 4UCRA 1UJWB 1XILA 3TCUA 5B1AB 2BTQA 3AG1B 5LP6C 4E2LA 4I0XA 2VQFO 4O4IB 3FB6C 5IYDO 2N74A 1SETA 4B3SB 3K0DA 4JI0B 2OCCC 3AK1A 1Q7YW 3G67A 5H2FZ 4J9ZB 4B08A 2YDEA 1HDJA 1SQVH 1B6QA 1NH2B 1M90W 4HAMA 4FIPC 2ZDIC 3KG2A 4HZ3A 4J7ZA 1MA1A 3LUTB 3K06A 5B3SB 1VQNV 2ZIMA 5B1AC 3CC2V 2ZE8A 3AG1C 4MW3A 3ZHRA 1P7BA 1XOUA 4JF3A 3CCRV 1HR0O 1I94O 5C93A 4W4LA 4HNAA 4DV4B 3W7XA 4YHHB 2A0LA 3O9OA 2WPDG 1CEZA 4R8CA 2Q69A 4DO2A 3BRCA 2ZNIA 1BSMA 4TV8A 2GHYA 3ZHUA 4IL6Z 4BW5A 4JI5O 1VIBA 2PGGA 2WLKA 5CB4A 3SJQC 1QLNA 4KHPB 2B9ZA 4GX5A 5HFLA 1Y4MA 4DW1A 5DN6G 1IDSA 2YI9A 1M1KW 4GYCB 1K97A 1G6UA 2GV9A 2Q7EA 4JAAA 4MTXA 2UUBB 4EFBA 5KUMA 4GKJB 3U11A 3ZMZA 4BWAA 4X65B 3T1YB 2QWQB 1PP9H 1BQZA 1H2GA 1R1BA 3K5LA 1I7FA 1SZTA 1MSDA 3CC7V 3KCYA 3ZEDA 3THOA 4LFBB 2RJZA 1XBLA 1GKFA 4D6TH 1ORQC 4X66O 3CCEV 1KD1W 3UKMA 1XNRB 4J11A 1Y76B 2PY5A 3U0ZA 3DXRA 1YVWA 1UFIA 1NT2B 4JYYA 1F7YA 3OEHG 3ML0A 4JI4B 1RSOB 2ETNA 4XDJA 3RYIA 4DRXB 2BTOA 2K1EA 1OJHA 2AW9A 4DV1O 4X62O 1XHZA 4MVSA 3APQA 1TAEA 3IC9A 3QO5A 2R70A 5KLVH 5JQGB 2B1GA 5B1BC 4ZKIA 2EIJB 3FX7A 1JA8A 1O9HA 3JSNA 2UXDO 3JARA 2XTAA 2UXCB 1SQGA 4F6RA 2LQTA 3CYOA 4QNHB 4FZ1A 4J42A 4B7KA 1NTZH 1M4UA 1N36B 1R6NA 3G80A 4GX2A 1NVPD 4UVAA 2VWKA 2K9PA 3UQ8A 1VQKV 2XAGA 3RYFB 4JGSA 4GX0A 2NLJC 4DW0A 3E89A 3JCZA 4DV5B 4MVUA 4Z1VA 5CN0A 3SYQA 2GDSA 2EIJC 2CTQA 4KFMA 2Q67A 1YTFB 1IVSA 4LP8A 2CTRA 4UCOA 1RFYA 1N32O 3ABTA 4DR4B 1LR1A 2GUZB 3M99B 1MOFA 2DYRB 1PD3A 4LWSB 2RNBA 4I4TA 3ABMB 4CBCA 1NTMH 1QCEA 4KL1A 4MTFA 3CPWU 1V54C 4XBFA 4ZOLA 3DC5A 1N4CA 1S5HC 2FL4A 2EINB 4BIOA 3CXCU 4JI6B 1NR7A 1KKDA 1FD9A 3T1CA 4DUZO 2QE7G 1VQLV 3JD3A 2XAHA 1AI6A 4DV6O 3ZHVA 4ICGA 4UV9A 2QSAA 3A0BZ 3EVKA 2CH7A 3N2GB 4TV9B 2BE3A 2HKOA 5JCOC 2DYRC 2EZPA 4B3TO 2F23A 3ABMC 3OW2U 1VF5B 1Y74B 1NH2D 1N0NA 1QQCA 1IX9A 2EINC 3RYHB 3JAWB 3OFNG 2BOBC 3ZMUA 1N33O 1JJOA 4IHJA 2VWJA 4WF9V 3WFVA 3SPJA 3SPHA 4DYLA 2DMXA 2YXLA 2A3QA 1YIJV 4MVRA 5CA0B 1WPBA 3K57A 4OPAA 2EJ7A 4Z2WA 2RMKB 3N2KA 4NVPA 1HWYA 4J10A 4EFEA 1PPJH 2VS0A 5LGUA 1J5EO 4TT3G 2O57A 1N0JA 3SPCA 3UT5B 2AGAA 5J2UB 1NJIW 4WFEA 3KCXA 1NTKH 2LGWA 4KXRA 2ZCEA 1H8HG 1P49A 1VQ9V 1AR4A 2ZD9A 1MMMA 3ZN0A 3B77A 2IH1C 3L74H 4QJFB 3M8AA 4JI0O 3CHXA 1AR5A 2V7QG 1BHBA 2LJ2A 3DSQA 3MAQA 3CCMV 4C7UA 1I08A 2P6JA 3ZRWA 4JZGA 5K1PA 5LOVA 3X2QC 2CE4A 1F4NA 4G2KA 1MG1A 1HNXB 4DR2B 3AG4C 3IC7A 4DV4O 4YHHO 5IDJA 3D3IA 3FB8C 4TWKA 3PJSK 3RVYA 1N34O 3B40A 4CZZA 1Q3EA 3IJ4A 3WB0A 1CXZB 4LFAB 5BZBA 4DV7B 4OX9B 4KHPO 2YS8A 1SZXA 1NR1A 4JI3B 4JV5B 2IM9A 3JCUZ 5JH7B 2UUCB 2JJ2G 3SYCA 5JJEB 4FM1A 4MW8A 3ZMVA 4X1YA 3CEIA 5LYJB 5GONB 2W6JG 4NYKA 2M6YA 4OPHA 4GKJO 3OE7G 3JSLA 3ETGA 3T4DA 1LNQA 3AEIA 4X65O 2ZIOA 3T1YO 2MK3A 3GB7C 5B1NA 1ZLZA 4RUEA 1PL4A 3KKYA 3H1JH 5ITZB 4XDLA 4LFBO 3ZS8C 4JASA 4YJ2B 2Q7GA 5L3EA 1A32A 2P22C 1FKAO 1XQ8A 1BE3H 2WWWA 1TA8A 4JI4O 4XDKA 3BFRA 5H5NA 3MD0A 5IJ0B 2Q7HA 1CPYA 4L8JA 1PM9A 1EN6A 2IH3C 3CCJV 1TGOA 3F5TA 4ASUG 2Y48A 3TXSA 5C8YB 3LNMB 2QA4V 5BMVB 2UXXA 3W7UA 1YITV 1GM8A 3CCQV 1NKDA 2UXCO 1Y6XA 1R73A 3SPGA 1HNWO 4UUJC 2P7TC 1YI2V 2BCCH 1R3LC 3WB1A 1N36O 3JAKB 1M56B 1XMOO 2QKAA 2XAJA 3C3SA 2YXYA 4WFHA 4DR6B 2ITCC 4LF4B 3IAYA 3WG7B 1R3IC 3T4ZA 3STZC 2FYUH 2F4VB 3K5MA 3HB3B 1IURA 4HYOA 4DR1B 2C2AA 4BR6A 2Y4UA 1AR1B 4DR4O 1VQMV 3AK2A 2JGDA 4O4JA 5JJJB 1AI7A 1KECA 2AHZA 3ZRXA 3CE2A 3E8BA 4QPJA 2ZE6A 4DR5B 5IYZB 4JTCB 4RAIA 3SYPA 4AILC 3FAVA 3JYCA 1K33A 1SF9A 1VF6C 1M56C 4YXWG 1IBLO 4K8XA 1KYOF 1W59A 2XOKG 1V9PA 3A0RA 5CBFA 1F23A 2F43G 1B3QA 3WG7C 4WBNA 4I5SA 2QDOA 4R6ZA 4J7JA 5IWAB 2R9IA 1VQ7V 1ZL8B 3BABA 5FNVA 2HVJC 4W4KA 4JAUA 2ZM6O 4FZ0A 4CH5A 2P5OA 4HNAB 2QTSA 3JALA 3ETDA 2YICA 5B5EZ 5IY5B 3LDDA 1T5EA 2JK5C 5LA6B 3ZRVA 2ZE5A 3FB7C 1LUVA 3WB2A 3CJHA 2WLIB 4DR7B 1JVMA 4U3JA 4CS2A 2LW7A 4K0KB 4O4LB 1WLEA 1L0LH 3O65A 4UB8Z 5IJ9A 2KB1A 4MTGA 4I9QA 3RFRA 1Z5VA 5EBWC 4PHZA 4WFBV 4DV0O 3B8NA 3BEHA 2F1MA 1R6KA 3CS5A 3QTCA 1NS1A 1JJ2U 4JYBA 5IY5C 1GAXA 4O4HA 4I50A 2UUAB 4MVOA 3CMEV 2PI4A 4JYAB 5EK0A 2QGNA 4K35A 2DYSC 2JDIG 3SYOA 2OIGA 3FFQA 4IT5A 1H8EG 4LF5B 4LH7A 2LGQA 1K4DC 5EIBC 1S77D 2H94A 1TUEB 1XL6A 3LSUA 2BOCC 1DGSA 5LMNO 3OAAG 4NXNB 4IGGA 3JASB 3CC4V 1KBHA 1BQ0A 3RYIB 1EFRG 2P06A 2XAFA 2X6BA 1L0NH 3JD4A 4DUYO 3BA8A 2EJRA 4P30A 1FJGB 1KQSU 5IYBO 5KMGA 3LDEA 3E8GA 4PA9A 4X1IB 1QR8A 1SQBH 1UPGA 1K4CC 4I55A 2FTKA 5GTIZ 1WN7A 2AZ2A 3Q4HB 5JVDA 5FPOA 4ZHQA 3SJCC 2HHHB 2OTJV 1HP8A 1TUBA 1TVKB 2KKWA 1K34A 3F5WC 3CCSV 1SA0A 3E35A 2F66C 4LF7B 4LFAO 1YEWA 5KX5A 1FXKB 4AI8A 4JI1O 1VMGA 4JI3O 3UO3A 4JV5O 5B66Z 4X1KB 2KQXA 3E22A 2VQEB 2VRZA 3OEEG 4DK0A 5CA1A 3FYIB 3HKEB 3OGIB 2UUCO 4QPKA 2F95B 4HBNA 4CC6A 4TOIA 3LSQA 1K92A 3J81N 3NXSA 3STLC 3U10A 2R9AA 4NXMB 2Z3YA 4NKGB 1K73W 5B1BB 1URFA 4NTYA 1Z5WA 2Q8VA 5LHHA 1IBKO 5J2TB 1FXKC 3JD1A 1ZAUA 1Q6UA 5BR8B 3T1HB 2LFRA 4IYIA 4EEQA 4IIJB 3P32A 4GT1A 3BCCH 2N04A 2PTMA 5KA6A 4NTWA 3ABKB 5JWPA 4J9YB 1GM7A 3DTUB 1DTOA 4FMTA 3D8CA 3OR6C 1AI5A 5E1AC 1KU9A 3CSXA 1S76D 1E79G 5EZYB 2R72A 5CA3A 1I5YA 3K9AA 1FPOA 3K3WA 2LP7A 2ODMA 5LGNA 1IXBA 1XNQB 3EFFK 1NQTA 3ABKC 1V54B 2XAQA 1JQ0A 2YIAA 3EXAA 1QU7A 3RVZA 5L3DA 1OZ0A 4FLXA 1F4MA 2EIMB 1H2LA 1EZVH 4WFAV 1PNLA 3KZIZ 3P3PA 3TETA 4X64B 1MABG 4DR1O 2IBZH 4R50A 4N21A 1WA8B 1W0KG 2V1DA 1XREA 3D36A 1PNMA 2IU3A 1XMQO 4FLVA 4DR5O 3BHPA 4TSFG 4YY3O 3ZHSA 3E86A 2E3CA 1Q81W 2XNDG 1ZX3A 1RP3B 1ZUQA 2EIMC 1FFXB 4L87A 5KA5A 2BSKB 1KB9F 4LNUA 1Y76A 4X9QA 4H33A 1RM1B 3OTOO 4PV1B 3B09A 4B3RO 1SESA 1RSOA 3TGUH 1YXBA 4DRXA 2DN9A 1D5AA 3RYCA 3HKBB 3L73H 3L72H 2OCHA 2IJJA 3SJAC 1OCOB 2ZE7A 3RGBA 2DJVA 5JQGA 1H2KA 4DR3B 2CAZC 1AB3A 2QKCA 4JTDB 3QVNA 2Q4PA 2EIKB 4MS2A 5KAFZ 2GBOA 4K0KO 1RM1C 2YC0A 5LL6Y 4UVCA 5AG2A 1H2NA 2MW2B 3I5DA 4ZIBA 5HFMA 5LXTA 2YUAA 2XUMA 3RN4A 2EULA 1JX9A 3H9VA 4X1YB 3ZN1A 5LBQA 1D5NA 4LFCB 4JI8B 2AZ0A 5EYPB 1K5SA 5D5QA 3F7YC 3RYFA 3I56V 1OCOC 1AJNA 3X2QB 5E79Z 3E8HA 4JYAO 4B3SO 2KSDA 5A2QN 2B1IA 2VQFB 2EIKC 3AG4B 2H3OA 2GUZA 1IBMB 4LF5O 2ZQMA 2Z5UA 4YIOA 2M7WA 5FL7G 3LSSA 4LWSA 3WU2Z 4JI7B 3JATB 3UCSC 5LHIA 5GW7A 4NXNO 4PELA 2N05A 4LH6A 1AI4A 1ZSPA 2EX3A 1FJGO 3TK1A 1K7DA 1HNZB 4BIUA 1S0VA 2WA4A 4LF9B 1VEWA 1ZTEA 1M93A 3CP1A 4TV9A 3N2GA 5IT9N 3CMAV 2X7RB 2FMLA 3SYAA 5BXZA 1ROPA 4GKKB 2WLLA 1Y74A 2JRIA 2PYJA 1WPXA 4JI5B 4CH3A 3E8FA 2ILMA 2H8PC 5K1XA 3JAWA 3TXQA 4EB6B 2KG7B 1VQOV 1HW7A 4FFBB 4FLYA 1YJWV 1KC8W 1YDXA 3DC6A 2ZKOA 2VQEO 2UUBO 4UCUA 4PI0A 5CA0A 1YJNV 3H1IH 4PDMA 4Z1MG 2LFSA 4TQDA 5DECA 2GSMB 3AG7A 3LNNA 3FB5C 4O2BB 1BMFG 4FVMA 4NXMO 3CCLV 1US6A 2Q0OC 4WFFA 3MDSA 3JD2A 3UT5A 3HR0A 5F2VO 1L8DA 5J2UA 2X6AA 4G27B 1XNRO 4PA4A 1IXMA 1YTFD 3HKCB 5BR8O 1OCCC 1CP9A 1Q86W 1W0JG 1ZWIC 4H0LB 1Q5OA 2Y0PA 3D3QA 3VQYA 3UM7A 5L3BA 4P9OA 1COWG 4TUYA 1EN4A 1IZ3A 4DV1B 4X62B 3H01A 4ZI7B 3SGIA 4B7EA 2DQ0A 2Y4TA 3R65A 3OMIB 1JPXA 2PZSA 3VQVA 5IYCO 4LCUC 3L75H 4JYCA 2HEPA 4WFGA 2UXDB 4JPRA 1KP3A 3EHBB 4FLUA 3AG2B 1XNQO 5LGTA 5LHGA 3G6EV 1WB7A 2AXTZ 4YJ3A 1G8MA 1XUQA 1DF4A 3HKDB 1S3JA 4DV5O 2HFEC 2P67A 3QNEA 1ENVA 2Y69B 3GWKC 2LO1A 2BTQB 3SPIA 3ASNB 1AP6A 4I0XB 4EKWA 3CRCA 1QVFU 1NZ6A 1Q6HA 1Y67A 2QJ1A 3W7TA 4X88A 1XI1A 5LYJA 1N32B 5EBMC 3AG2C 3CRAA 2W0FC 5H6RA 1FXVA 5DEDA 3ASOB 3OD4A 2DE0X 2IJKA 4OGQB 1I5XA 1GTOA 1M9NA 3SR2C 1YSCA 2CGOA 3BVOA 2OIEA 4JI6O 2Y69C 1SQQH 1V55C 2GTAA 1Q82W 3ASNC 4PI2A 1BT8A 1L1FA 5L3CA 4YJ2A 2JVDA 1EN5A 5KMGB 4FLWA 1AILA 4DV6B 3C3TA 3ASOC 1EM1A 1FS0G 4UCSA 1QVGU 4MSWC 2Q0AA 4TV8B 2NR5A 2HJFC 3RW0A 5CB4B 3QO8A 3MHSC 1VQ5V 3OM3B 1BZKA 1OCRC 3R66A 3E2EA 3OMNB 2Z0AA 1WB8A 5C8YA 2DYSB 5L3GA 2Q9LA 1SA0B 1JFFA 2DW4A 3ZMTA 5KX5B 5B1OA 5BMVA 3W7WA 3BAAA 5EC2C 4O2AA 1S72V 3E22B 1AJQA 4UCVA 4FJCC 1SQFA 1GH6A 4R7CA 2HJDA 1BL8A 3BA9A 1VF6A 3QF7A 3VQWA 3JAKA 4LFCO 4JI8O 3OUFA 1VARA 3I55V 1GK9A 1XHXA 1VP7A 3SDLA 2ARHA 2PUSA 1H2MA 3FYEB 1P84F 4H13B 1PKXA 1N8RW 2A9HA 2JIZG 3K5NA 1FXHA 3DXRB 1X59A 1O9GA 3B8MA 4DV2B 1RPRA 4J7KA 1D2DA 1M5IA 1SC5B 1IBMO 3IGAC 3BPZA 1QHTA 5IYZA 3DGEA 1NU1H 1GN6A 2HG5C 4G28B 4JI7O 3GVMA 2A06H 2YSUB 2IJHA 4BAYA 1H38A 3B2EE 2DWDC 3MHHC 2ZNJA 4UCTA 3A8TA 1PL0A 1JMKC 3ZHTA 1QR9A 2UU9B 1YZBA 4RQEA 3JARB 1ZL8A 3H1LH 1HNXO 1HNZO 4DR2O 1P7GA 4F6RB 2NNUA 2QTOA 1OV9A 4LF9O 2RN9A 2Q5ZA 2XT9A 5FPRA 1EZJA 4CH4A 2IJIA 4GKKO 3OGCC 4X89A 1H2SB 4CS3A 1BGYH 2RDCA 5LA6A 4DV7O 5LP6A 4OX9O 1N34B 2AHYA 4FLTA 4QGPA 2YEVA 2QR4A 2WLIA 1Q8IA 3B4SA 2QM8A 3ABUA 5B3SC 2ZINA 4O4LA 2HR3A 4KUMA 3ZX6A 2Y0IA 4DK1A 4X20A 4UVBA 3VBBA 2ZDIA 2ZXWB 4JTAB 1FFTB 3CCUV 3CRQA 2W6IG 4I4TB 3CX5F 3JAMN 1X4TA 4ZOLB 2YIBD 4PDRA 4PA7A 4O4IA 4D7TA 1K5QA 1AP5A 4LF8B 1K3EA 2ZR2A 5J9PC 1SS3A 2Q68A 2ITDC 5CMUA 4LNUB 3QO7A 5LMUB 4K8ZA 2CH7B 2ZXWC 4CS4A 2A7WA 4D7SA 2UXBB 2QWRB 4FPPA 3D36C 3JASA 5KHKA 1JOYA 3RYCB 1NBMG 4IHJB 4GZRB 4P9PA 1GRJA 3OTFA 4X1IA 4U7NA 2CK3G 4LBEC 3CRMA 5H9CA 4MVQA 2OWOA 4JAVA 4YIPA 1WP8A 2E5LB 2WLMA 3N2KB 4PA3A 1Q90D 4JI2B 3Q4HA 3L9DA 4NR1A 2ADQB 1HNWB 4P2ZA 5LXTB 1TVKA 4DR6O 3K9SA 4F6EA 2A79B 1XMOB 1VQPV 4LF4O 1FXKA 1Y66A 4I7ZB 2F4VO 1SKVA 4X1KA 5L3FA 1P4RA 3ZRSA 1KP2A 3HKEA 5EIBD 2B5UA 4MVMA 2XHBA 4MVZA 5KHJA 3K79A 2OYQA 1SERA 3E83A 2HP8A 1GO3F 4F4LA 3W7SA 1Q6IA 3K59A 2GTSA 2R9RB 2RQ6A 1IBLB 1GN3A 3ICXA 3JD0A 5J2TA 2P4KA 3ZRWB 3ETEA 4PDVA 5IWAO 4RQFA 4NTXA 5LOVB 1QBZA 2G38A 1G4YB 4IIJA 3ABLB 1K9MW 2F93B 4LF6B 5GTHZ 2ZM6B 3K0GA 2JEUA 2WLLB 4DR7O 1EBOA 3IFXA 4B3MB 3RBZA 3OMAB 3LDCA 4LR3A 1BS3A 4GUNA 2W0XA 5EZYA 4OXSA 1YF2A 1WP7A 3S3WA 1AVMA 2JS3A 4DV3B 4AQYB 2QWPB 3ABLC 2PYLA 4ABMA 3G6BA 5H6QA 5A9GA 5KHHA 4DV0B 2WLHA 3H1HH 2UUAO 2DWEC 1DK1A 1VQ8V 1MZEA 4WCEV 2JEXA 4CC5A 2EZOA 3VOUA 4AHCA 1SQPH 4J80A 2E75B 1RPOA 1U97A 1GN2A 1Z2GA 1B04A 2Q6AA 3T2MA 1AROP 2JS5A 3P3NA 5JCOA 4DV2O 1WA8A 2X0LA 4N23A 1WAZA 4UB6Z 4UV8A 3K04A 2IW5A 3F7VC 5LMNB 1W2BU 2WSSG 4TUYB 2X6CA 3CCVV 4QE9A 1XEQA 3RWRD 2IU0A 1FFXA 1YCIA 4QIWF 4FM0A 4DUYB 2BSKA 4QE7A 4Q6GA 1G1XB 2QKSA 1HR0B 1I94B 2UU9O 1SQXH 1NI8A 3HPLC 1GN4A 4RUFA 3K58A 1BCCH 3PN1A 5TISZ 2FKXA 2YIDA 2HHHO 2EILB 3HKBA 1F51A 4UFZA 3L70H 1Q43A 3RYHA 1B06A 3A2FA 3CWBH 4LF7O 2L35A 2PI5A 1DLBA 4PD4F 2QWOB 4MT8A 4YJ3B 1OCCB 1FYJA 1U96A 1VQ4V 3VQXA 5IE9A 3A0HZ 5JJNB 4JI1B 3OR7C 4TQFA 2RCVA 2CTPA 3FKSG 2EBOA 2YI8A 3NR7A 3RT3C 2JGDB 4O4JB 2Q73A 2JJ1G 1QLEB 4U7OA 2EILC 1QNMA 3FAVB 4K3AA 5FLXN 3UO2A 2D2CB 4MTOA 3L71H 1YJ9V 5EYPA 1OCZB 4DXWA 2ZT9B 1KKCA 2CTWA 4U3FH 4X66B 2WA3A 2UXNA 3T1HO 4A5UB 1IBKB 4WBNB 1R6TA 4JZ2A 4LC1A 4PA6A 4FM2A 2PF4E 2CGNA 4LF8O 2OT5A 4J41A 2DQ3A 4PDLA 5D5PA 5EC1C 5FNVB 3J80N 2FB5A 1MZFA 3P30A 1FAFA 4RO2A 3M7MX 1E1RG 5LMUO 1K8AW 1THZA 4H44B 1QLEC 3JATA 1VQ6V 3JALB 3CXHF 2UXBO 1OCZC 4X8AA 4RWUA 3CJHB 1AJPA 3TJTA 1KUQA 4U3JB 4I9WA 4BIZA 1MNGA 5IJ9B 1JFFB 4GCZA 3G71V 1OHHG 5BY1A 3ZMSA 4FLZA 4O2AB 2LW1A 2E5LO 3QG5A 3GWOA 4JI2O 3AK3A 4Q20A 3APOA 1V55B 4O4HB 4ZBMA 4I50B 2JGUA 1YHQV 5JH7A 2CDYA 4EB6A 2HVKC 1PV0A 2KG7A 1S5JA 4CH6A 2D3OW 4FFBA 1M57B 1PNKA 2WLNA 5EBLC 5KUKA 4X64O 3G4SV 5GONA 2ATKC 2V4DA 5KHGA 1BHAA 4GX1A 3OT7A 2QWNB 2L6LA 3AG3B 3K03A 2QM7A 1JCHA 1WNSA 1OCRB 1SRYA 1DF5A 1XMQB 4O2BA 1R3JC 2ADPA 2QM4A 5ITZA 1XDCA 4FK5C 4YY3B 1JR9A 4BW9A 5KAIZ 1XL4A 4NB5A 5CBHA 5KHIA 4DUZB 2WAMA 1M57C 2DOSA 3HKCA 3ZCCA 3H1KH 1J95A 1VF7A 1R3KC 1GM9A 2P4VA 4I55B 3ZIAG 2E76B 5IJ0A 3OTOB 2OTLV 3AG3C 4B3RB 4B3TB 2XASA 1E1QG 4LF6O 4UXNA 1NVPB 5JVDB 4ZHQB 4IYHA 2P90A 2E74B 3OUSA 4ZI7A 1TUBB 4FFKA 3ZJZA 4KP4A 4DR3O 3K5OA 3FD9A 4E4EA 3CRRA 3CD6V 1N33B 5CBGA 4GLXA 4B3MO 5LP6B 2HLDG 3N27A 4PJ0Z 2YXHA 3J7AU 2YEVB 1WJZA 2WLJA 5DM6V 5CA1B 3CB2A 2QEXV 4DV3O
chains in the Genus database with same CATH topology
4AQYO 3M8AA 4JI0O 1FKAO 1D2DA 5BY1A 2ZM6O 1IBMO 2E5LO 4JI4O 2FKXA 2HHHO 5H5NA 4JI2O 4JI7O 4NXMO 1R1BA 4LF7O 4DR7O 4JI6O 3F5TA 4LFAO 1XNRO 1FYJA 4JI1O 4X66O 4JI3O 4JYAO 4JV5O 2VQFO 4DUZO 2LW7A 4B3SO 5BR8O 4X64O 5A2QN 2N74A 1YZBA 2UUCO 3O65A 1HNXO 1HNZO 4DV6O 4DR2O 2UXCO 4LF9O 4DR1O 1AILA 3RT3C 1F7YA 4LF5O 4DV0O 4DV4O 1HNWO 4YHHO 3J81N 1XMQO 4B3TO 4DV1O 4X62O 1NS1A 4DR5O 2UUAO 5FLXN 1N36O 1DK1A 1N34O 4GKKO 4YY3O 4NXNO 1XMOO 4DV7O 4DR6O 4OX9O 4LF4O 3R66A 1IBKO 2Z0AA 4KHPO 1N33O 3T1HO 4A5UB 2F4VO 1R6TA 2DOSA 4LF8O 1FJGO 2UXDO 1HR0O 1I94O 3OTOO 3J80N 4B3RO 4DR4O 4OPAA 4DV2O 1XNQO 5IT9N 5LMUO 4OPHA 4GKJO 4LF6O 5BXZA 5LMNO 4JI5O 2JRIA 4LFCO 2UXBO 4JI8O 3JAMN 4X65O 1J5EO 3T1YO 1IBLO 4DV5O 4DR3O 2AGAA 2DJVA 3SDLA 1XEQA 4DUYO 4B3MO 1KUQA 5IWAO 4LFBO 1AB3A 3J7AU 2ZKOA 1G1XB 2VQEO 2UUBO 2UU9O 4K0KO 1A32A 1X59A 1N32O 5LL6Y 4DV3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY O;  3M8A A;  4JI0 O;  1FKA O;  1D2D A;  5BY1 A;  2ZM6 O;  1IBM O;  2E5L O;  4JI4 O;  2FKX A;  2HHH O;  5H5N A;  4JI2 O;  4JI7 O;  4NXM O;  1R1B A;  4LF7 O;  4DR7 O;  4JI6 O;  3F5T A;  4LFA O;  1XNR O;  1FYJ A;  4JI1 O;  4X66 O;  4JI3 O;  4JYA O;  4JV5 O;  2VQF O;  4DUZ O;  2LW7 A;  4B3S O;  5BR8 O;  4X64 O;  5A2Q N;  2N74 A;  1YZB A;  2UUC O;  3O65 A;  1HNX O;  1HNZ O;  4DV6 O;  4DR2 O;  2UXC O;  4LF9 O;  4DR1 O;  1AIL A;  3RT3 C;  1F7Y A;  4LF5 O;  4DV0 O;  4DV4 O;  1HNW O;  4YHH O;  3J81 N;  1XMQ O;  4B3T O;  4DV1 O;  4X62 O;  1NS1 A;  4DR5 O;  2UUA O;  5FLX N;  1N36 O;  1DK1 A;  1N34 O;  4GKK O;  4YY3 O;  4NXN O;  1XMO O;  4DV7 O;  4DR6 O;  4OX9 O;  4LF4 O;  3R66 A;  1IBK O;  2Z0A A;  4KHP O;  1N33 O;  3T1H O;  4A5U B;  2F4V O;  1R6T A;  2DOS A;  4LF8 O;  1FJG O;  2UXD O;  1HR0 O;  1I94 O;  3OTO O;  3J80 N;  4B3R O;  4DR4 O;  4OPA A;  4DV2 O;  1XNQ O;  5IT9 N;  5LMU O;  4OPH A;  4GKJ O;  4LF6 O;  5BXZ A;  5LMN O;  4JI5 O;  2JRI A;  4LFC O;  2UXB O;  4JI8 O;  3JAM N;  4X65 O;  1J5E O;  3T1Y O;  1IBL O;  4DV5 O;  4DR3 O;  2AGA A;  2DJV A;  3SDL A;  1XEQ A;  4DUY O;  4B3M O;  1KUQ A;  5IWA O;  4LFB O;  1AB3 A;  3J7A U;  2ZKO A;  1G1X B;  2VQE O;  2UUB O;  2UU9 O;  4K0K O;  1A32 A;  1X59 A;  1N32 O;  5LL6 Y;  4DV3 O; 
#chains in the Genus database with same CATH topology
 2OCC B;  4AQY O;  1KMI Z;  1GMG A;  3BY6 A;  1MSW D;  1I0H A;  3K08 A;  3ZHQ A;  2NN4 A;  3SJB C;  4X20 B;  2CUG A;  1J5E B;  2ZR3 A;  3S3X A;  1LUW A;  2YIB A;  4H37 A;  1S5L Z;  3ETQ A;  3HKD A;  3C90 A;  3ZBH A;  4UCR A;  1UJW B;  1XIL A;  3TCU A;  5B1A B;  2BTQ A;  3AG1 B;  5LP6 C;  4E2L A;  4I0X A;  2VQF O;  4O4I B;  3FB6 C;  5IYD O;  2N74 A;  1SET A;  4B3S B;  3K0D A;  4JI0 B;  2OCC C;  3AK1 A;  1Q7Y W;  3G67 A;  5H2F Z;  4J9Z B;  4B08 A;  2YDE A;  1HDJ A;  1SQV H;  1B6Q A;  1NH2 B;  1M90 W;  4HAM A;  4FIP C;  2ZDI C;  3KG2 A;  4HZ3 A;  4J7Z A;  1MA1 A;  3LUT B;  3K06 A;  5B3S B;  1VQN V;  2ZIM A;  5B1A C;  3CC2 V;  2ZE8 A;  3AG1 C;  4MW3 A;  3ZHR A;  1P7B A;  1XOU A;  4JF3 A;  3CCR V;  1HR0 O;  1I94 O;  5C93 A;  4W4L A;  4HNA A;  4DV4 B;  3W7X A;  4YHH B;  2A0L A;  3O9O A;  2WPD G;  1CEZ A;  4R8C A;  2Q69 A;  4DO2 A;  3BRC A;  2ZNI A;  1BSM A;  4TV8 A;  2GHY A;  3ZHU A;  4IL6 Z;  4BW5 A;  4JI5 O;  1VIB A;  2PGG A;  2WLK A;  5CB4 A;  3SJQ C;  1QLN A;  4KHP B;  2B9Z A;  4GX5 A;  5HFL A;  1Y4M A;  4DW1 A;  5DN6 G;  1IDS A;  2YI9 A;  1M1K W;  4GYC B;  1K97 A;  1G6U A;  2GV9 A;  2Q7E A;  4JAA A;  4MTX A;  2UUB B;  4EFB A;  5KUM A;  4GKJ B;  3U11 A;  3ZMZ A;  4BWA A;  4X65 B;  3T1Y B;  2QWQ B;  1PP9 H;  1BQZ A;  1H2G A;  1R1B A;  3K5L A;  1I7F A;  1SZT A;  1MSD A;  3CC7 V;  3KCY A;  3ZED A;  3THO A;  4LFB B;  2RJZ A;  1XBL A;  1GKF A;  4D6T H;  1ORQ C;  4X66 O;  3CCE V;  1KD1 W;  3UKM A;  1XNR B;  4J11 A;  1Y76 B;  2PY5 A;  3U0Z A;  3DXR A;  1YVW A;  1UFI A;  1NT2 B;  4JYY A;  1F7Y A;  3OEH G;  3ML0 A;  4JI4 B;  1RSO B;  2ETN A;  4XDJ A;  3RYI A;  4DRX B;  2BTO A;  2K1E A;  1OJH A;  2AW9 A;  4DV1 O;  4X62 O;  1XHZ A;  4MVS A;  3APQ A;  1TAE A;  3IC9 A;  3QO5 A;  2R70 A;  5KLV H;  5JQG B;  2B1G A;  5B1B C;  4ZKI A;  2EIJ B;  3FX7 A;  1JA8 A;  1O9H A;  3JSN A;  2UXD O;  3JAR A;  2XTA A;  2UXC B;  1SQG A;  4F6R A;  2LQT A;  3CYO A;  4QNH B;  4FZ1 A;  4J42 A;  4B7K A;  1NTZ H;  1M4U A;  1N36 B;  1R6N A;  3G80 A;  4GX2 A;  1NVP D;  4UVA A;  2VWK A;  2K9P A;  3UQ8 A;  1VQK V;  2XAG A;  3RYF B;  4JGS A;  4GX0 A;  2NLJ C;  4DW0 A;  3E89 A;  3JCZ A;  4DV5 B;  4MVU A;  4Z1V A;  5CN0 A;  3SYQ A;  2GDS A;  2EIJ C;  2CTQ A;  4KFM A;  2Q67 A;  1YTF B;  1IVS A;  4LP8 A;  2CTR A;  4UCO A;  1RFY A;  1N32 O;  3ABT A;  4DR4 B;  1LR1 A;  2GUZ B;  3M99 B;  1MOF A;  2DYR B;  1PD3 A;  4LWS B;  2RNB A;  4I4T A;  3ABM B;  4CBC A;  1NTM H;  1QCE A;  4KL1 A;  4MTF A;  3CPW U;  1V54 C;  4XBF A;  4ZOL A;  3DC5 A;  1N4C A;  1S5H C;  2FL4 A;  2EIN B;  4BIO A;  3CXC U;  4JI6 B;  1NR7 A;  1KKD A;  1FD9 A;  3T1C A;  4DUZ O;  2QE7 G;  1VQL V;  3JD3 A;  2XAH A;  1AI6 A;  4DV6 O;  3ZHV A;  4ICG A;  4UV9 A;  2QSA A;  3A0B Z;  3EVK A;  2CH7 A;  3N2G B;  4TV9 B;  2BE3 A;  2HKO A;  5JCO C;  2DYR C;  2EZP A;  4B3T O;  2F23 A;  3ABM C;  3OW2 U;  1VF5 B;  1Y74 B;  1NH2 D;  1N0N A;  1QQC A;  1IX9 A;  2EIN C;  3RYH B;  3JAW B;  3OFN G;  2BOB C;  3ZMU A;  1N33 O;  1JJO A;  4IHJ A;  2VWJ A;  4WF9 V;  3WFV A;  3SPJ A;  3SPH A;  4DYL A;  2DMX A;  2YXL A;  2A3Q A;  1YIJ V;  4MVR A;  5CA0 B;  1WPB A;  3K57 A;  4OPA A;  2EJ7 A;  4Z2W A;  2RMK B;  3N2K A;  4NVP A;  1HWY A;  4J10 A;  4EFE A;  1PPJ H;  2VS0 A;  5LGU A;  1J5E O;  4TT3 G;  2O57 A;  1N0J A;  3SPC A;  3UT5 B;  2AGA A;  5J2U B;  1NJI W;  4WFE A;  3KCX A;  1NTK H;  2LGW A;  4KXR A;  2ZCE A;  1H8H G;  1P49 A;  1VQ9 V;  1AR4 A;  2ZD9 A;  1MMM A;  3ZN0 A;  3B77 A;  2IH1 C;  3L74 H;  4QJF B;  3M8A A;  4JI0 O;  3CHX A;  1AR5 A;  2V7Q G;  1BHB A;  2LJ2 A;  3DSQ A;  3MAQ A;  3CCM V;  4C7U A;  1I08 A;  2P6J A;  3ZRW A;  4JZG A;  5K1P A;  5LOV A;  3X2Q C;  2CE4 A;  1F4N A;  4G2K A;  1MG1 A;  1HNX B;  4DR2 B;  3AG4 C;  3IC7 A;  4DV4 O;  4YHH O;  5IDJ A;  3D3I A;  3FB8 C;  4TWK A;  3PJS K;  3RVY A;  1N34 O;  3B40 A;  4CZZ A;  1Q3E A;  3IJ4 A;  3WB0 A;  1CXZ B;  4LFA B;  5BZB A;  4DV7 B;  4OX9 B;  4KHP O;  2YS8 A;  1SZX A;  1NR1 A;  4JI3 B;  4JV5 B;  2IM9 A;  3JCU Z;  5JH7 B;  2UUC B;  2JJ2 G;  3SYC A;  5JJE B;  4FM1 A;  4MW8 A;  3ZMV A;  4X1Y A;  3CEI A;  5LYJ B;  5GON B;  2W6J G;  4NYK A;  2M6Y A;  4OPH A;  4GKJ O;  3OE7 G;  3JSL A;  3ETG A;  3T4D A;  1LNQ A;  3AEI A;  4X65 O;  2ZIO A;  3T1Y O;  2MK3 A;  3GB7 C;  5B1N A;  1ZLZ A;  4RUE A;  1PL4 A;  3KKY A;  3H1J H;  5ITZ B;  4XDL A;  4LFB O;  3ZS8 C;  4JAS A;  4YJ2 B;  2Q7G A;  5L3E A;  1A32 A;  2P22 C;  1FKA O;  1XQ8 A;  1BE3 H;  2WWW A;  1TA8 A;  4JI4 O;  4XDK A;  3BFR A;  5H5N A;  3MD0 A;  5IJ0 B;  2Q7H A;  1CPY A;  4L8J A;  1PM9 A;  1EN6 A;  2IH3 C;  3CCJ V;  1TGO A;  3F5T A;  4ASU G;  2Y48 A;  3TXS A;  5C8Y B;  3LNM B;  2QA4 V;  5BMV B;  2UXX A;  3W7U A;  1YIT V;  1GM8 A;  3CCQ V;  1NKD A;  2UXC O;  1Y6X A;  1R73 A;  3SPG A;  1HNW O;  4UUJ C;  2P7T C;  1YI2 V;  2BCC H;  1R3L C;  3WB1 A;  1N36 O;  3JAK B;  1M56 B;  1XMO O;  2QKA A;  2XAJ A;  3C3S A;  2YXY A;  4WFH A;  4DR6 B;  2ITC C;  4LF4 B;  3IAY A;  3WG7 B;  1R3I C;  3T4Z A;  3STZ C;  2FYU H;  2F4V B;  3K5M A;  3HB3 B;  1IUR A;  4HYO A;  4DR1 B;  2C2A A;  4BR6 A;  2Y4U A;  1AR1 B;  4DR4 O;  1VQM V;  3AK2 A;  2JGD A;  4O4J A;  5JJJ B;  1AI7 A;  1KEC A;  2AHZ A;  3ZRX A;  3CE2 A;  3E8B A;  4QPJ A;  2ZE6 A;  4DR5 B;  5IYZ B;  4JTC B;  4RAI A;  3SYP A;  4AIL C;  3FAV A;  3JYC A;  1K33 A;  1SF9 A;  1VF6 C;  1M56 C;  4YXW G;  1IBL O;  4K8X A;  1KYO F;  1W59 A;  2XOK G;  1V9P A;  3A0R A;  5CBF A;  1F23 A;  2F43 G;  1B3Q A;  3WG7 C;  4WBN A;  4I5S A;  2QDO A;  4R6Z A;  4J7J A;  5IWA B;  2R9I A;  1VQ7 V;  1ZL8 B;  3BAB A;  5FNV A;  2HVJ C;  4W4K A;  4JAU A;  2ZM6 O;  4FZ0 A;  4CH5 A;  2P5O A;  4HNA B;  2QTS A;  3JAL A;  3ETD A;  2YIC A;  5B5E Z;  5IY5 B;  3LDD A;  1T5E A;  2JK5 C;  5LA6 B;  3ZRV A;  2ZE5 A;  3FB7 C;  1LUV A;  3WB2 A;  3CJH A;  2WLI B;  4DR7 B;  1JVM A;  4U3J A;  4CS2 A;  2LW7 A;  4K0K B;  4O4L B;  1WLE A;  1L0L H;  3O65 A;  4UB8 Z;  5IJ9 A;  2KB1 A;  4MTG A;  4I9Q A;  3RFR A;  1Z5V A;  5EBW C;  4PHZ A;  4WFB V;  4DV0 O;  3B8N A;  3BEH A;  2F1M A;  1R6K A;  3CS5 A;  3QTC A;  1NS1 A;  1JJ2 U;  4JYB A;  5IY5 C;  1GAX A;  4O4H A;  4I50 A;  2UUA B;  4MVO A;  3CME V;  2PI4 A;  4JYA B;  5EK0 A;  2QGN A;  4K35 A;  2DYS C;  2JDI G;  3SYO A;  2OIG A;  3FFQ A;  4IT5 A;  1H8E G;  4LF5 B;  4LH7 A;  2LGQ A;  1K4D C;  5EIB C;  1S77 D;  2H94 A;  1TUE B;  1XL6 A;  3LSU A;  2BOC C;  1DGS A;  5LMN O;  3OAA G;  4NXN B;  4IGG A;  3JAS B;  3CC4 V;  1KBH A;  1BQ0 A;  3RYI B;  1EFR G;  2P06 A;  2XAF A;  2X6B A;  1L0N H;  3JD4 A;  4DUY O;  3BA8 A;  2EJR A;  4P30 A;  1FJG B;  1KQS U;  5IYB O;  5KMG A;  3LDE A;  3E8G A;  4PA9 A;  4X1I B;  1QR8 A;  1SQB H;  1UPG A;  1K4C C;  4I55 A;  2FTK A;  5GTI Z;  1WN7 A;  2AZ2 A;  3Q4H B;  5JVD A;  5FPO A;  4ZHQ A;  3SJC C;  2HHH B;  2OTJ V;  1HP8 A;  1TUB A;  1TVK B;  2KKW A;  1K34 A;  3F5W C;  3CCS V;  1SA0 A;  3E35 A;  2F66 C;  4LF7 B;  4LFA O;  1YEW A;  5KX5 A;  1FXK B;  4AI8 A;  4JI1 O;  1VMG A;  4JI3 O;  3UO3 A;  4JV5 O;  5B66 Z;  4X1K B;  2KQX A;  3E22 A;  2VQE B;  2VRZ A;  3OEE G;  4DK0 A;  5CA1 A;  3FYI B;  3HKE B;  3OGI B;  2UUC O;  4QPK A;  2F95 B;  4HBN A;  4CC6 A;  4TOI A;  3LSQ A;  1K92 A;  3J81 N;  3NXS A;  3STL C;  3U10 A;  2R9A A;  4NXM B;  2Z3Y A;  4NKG B;  1K73 W;  5B1B B;  1URF A;  4NTY A;  1Z5W A;  2Q8V A;  5LHH A;  1IBK O;  5J2T B;  1FXK C;  3JD1 A;  1ZAU A;  1Q6U A;  5BR8 B;  3T1H B;  2LFR A;  4IYI A;  4EEQ A;  4IIJ B;  3P32 A;  4GT1 A;  3BCC H;  2N04 A;  2PTM A;  5KA6 A;  4NTW A;  3ABK B;  5JWP A;  4J9Y B;  1GM7 A;  3DTU B;  1DTO A;  4FMT A;  3D8C A;  3OR6 C;  1AI5 A;  5E1A C;  1KU9 A;  3CSX A;  1S76 D;  1E79 G;  5EZY B;  2R72 A;  5CA3 A;  1I5Y A;  3K9A A;  1FPO A;  3K3W A;  2LP7 A;  2ODM A;  5LGN A;  1IXB A;  1XNQ B;  3EFF K;  1NQT A;  3ABK C;  1V54 B;  2XAQ A;  1JQ0 A;  2YIA A;  3EXA A;  1QU7 A;  3RVZ A;  5L3D A;  1OZ0 A;  4FLX A;  1F4M A;  2EIM B;  1H2L A;  1EZV H;  4WFA V;  1PNL A;  3KZI Z;  3P3P A;  3TET A;  4X64 B;  1MAB G;  4DR1 O;  2IBZ H;  4R50 A;  4N21 A;  1WA8 B;  1W0K G;  2V1D A;  1XRE A;  3D36 A;  1PNM A;  2IU3 A;  1XMQ O;  4FLV A;  4DR5 O;  3BHP A;  4TSF G;  4YY3 O;  3ZHS A;  3E86 A;  2E3C A;  1Q81 W;  2XND G;  1ZX3 A;  1RP3 B;  1ZUQ A;  2EIM C;  1FFX B;  4L87 A;  5KA5 A;  2BSK B;  1KB9 F;  4LNU A;  1Y76 A;  4X9Q A;  4H33 A;  1RM1 B;  3OTO O;  4PV1 B;  3B09 A;  4B3R O;  1SES A;  1RSO A;  3TGU H;  1YXB A;  4DRX A;  2DN9 A;  1D5A A;  3RYC A;  3HKB B;  3L73 H;  3L72 H;  2OCH A;  2IJJ A;  3SJA C;  1OCO B;  2ZE7 A;  3RGB A;  2DJV A;  5JQG A;  1H2K A;  4DR3 B;  2CAZ C;  1AB3 A;  2QKC A;  4JTD B;  3QVN A;  2Q4P A;  2EIK B;  4MS2 A;  5KAF Z;  2GBO A;  4K0K O;  1RM1 C;  2YC0 A;  5LL6 Y;  4UVC A;  5AG2 A;  1H2N A;  2MW2 B;  3I5D A;  4ZIB A;  5HFM A;  5LXT A;  2YUA A;  2XUM A;  3RN4 A;  2EUL A;  1JX9 A;  3H9V A;  4X1Y B;  3ZN1 A;  5LBQ A;  1D5N A;  4LFC B;  4JI8 B;  2AZ0 A;  5EYP B;  1K5S A;  5D5Q A;  3F7Y C;  3RYF A;  3I56 V;  1OCO C;  1AJN A;  3X2Q B;  5E79 Z;  3E8H A;  4JYA O;  4B3S O;  2KSD A;  5A2Q N;  2B1I A;  2VQF B;  2EIK C;  3AG4 B;  2H3O A;  2GUZ A;  1IBM B;  4LF5 O;  2ZQM A;  2Z5U A;  4YIO A;  2M7W A;  5FL7 G;  3LSS A;  4LWS A;  3WU2 Z;  4JI7 B;  3JAT B;  3UCS C;  5LHI A;  5GW7 A;  4NXN O;  4PEL A;  2N05 A;  4LH6 A;  1AI4 A;  1ZSP A;  2EX3 A;  1FJG O;  3TK1 A;  1K7D A;  1HNZ B;  4BIU A;  1S0V A;  2WA4 A;  4LF9 B;  1VEW A;  1ZTE A;  1M93 A;  3CP1 A;  4TV9 A;  3N2G A;  5IT9 N;  3CMA V;  2X7R B;  2FML A;  3SYA A;  5BXZ A;  1ROP A;  4GKK B;  2WLL A;  1Y74 A;  2JRI A;  2PYJ A;  1WPX A;  4JI5 B;  4CH3 A;  3E8F A;  2ILM A;  2H8P C;  5K1X A;  3JAW A;  3TXQ A;  4EB6 B;  2KG7 B;  1VQO V;  1HW7 A;  4FFB B;  4FLY A;  1YJW V;  1KC8 W;  1YDX A;  3DC6 A;  2ZKO A;  2VQE O;  2UUB O;  4UCU A;  4PI0 A;  5CA0 A;  1YJN V;  3H1I H;  4PDM A;  4Z1M G;  2LFS A;  4TQD A;  5DEC A;  2GSM B;  3AG7 A;  3LNN A;  3FB5 C;  4O2B B;  1BMF G;  4FVM A;  4NXM O;  3CCL V;  1US6 A;  2Q0O C;  4WFF A;  3MDS A;  3JD2 A;  3UT5 A;  3HR0 A;  5F2V O;  1L8D A;  5J2U A;  2X6A A;  4G27 B;  1XNR O;  4PA4 A;  1IXM A;  1YTF D;  3HKC B;  5BR8 O;  1OCC C;  1CP9 A;  1Q86 W;  1W0J G;  1ZWI C;  4H0L B;  1Q5O A;  2Y0P A;  3D3Q A;  3VQY A;  3UM7 A;  5L3B A;  4P9O A;  1COW G;  4TUY A;  1EN4 A;  1IZ3 A;  4DV1 B;  4X62 B;  3H01 A;  4ZI7 B;  3SGI A;  4B7E A;  2DQ0 A;  2Y4T A;  3R65 A;  3OMI B;  1JPX A;  2PZS A;  3VQV A;  5IYC O;  4LCU C;  3L75 H;  4JYC A;  2HEP A;  4WFG A;  2UXD B;  4JPR A;  1KP3 A;  3EHB B;  4FLU A;  3AG2 B;  1XNQ O;  5LGT A;  5LHG A;  3G6E V;  1WB7 A;  2AXT Z;  4YJ3 A;  1G8M A;  1XUQ A;  1DF4 A;  3HKD B;  1S3J A;  4DV5 O;  2HFE C;  2P67 A;  3QNE A;  1ENV A;  2Y69 B;  3GWK C;  2LO1 A;  2BTQ B;  3SPI A;  3ASN B;  1AP6 A;  4I0X B;  4EKW A;  3CRC A;  1QVF U;  1NZ6 A;  1Q6H A;  1Y67 A;  2QJ1 A;  3W7T A;  4X88 A;  1XI1 A;  5LYJ A;  1N32 B;  5EBM C;  3AG2 C;  3CRA A;  2W0F C;  5H6R A;  1FXV A;  5DED A;  3ASO B;  3OD4 A;  2DE0 X;  2IJK A;  4OGQ B;  1I5X A;  1GTO A;  1M9N A;  3SR2 C;  1YSC A;  2CGO A;  3BVO A;  2OIE A;  4JI6 O;  2Y69 C;  1SQQ H;  1V55 C;  2GTA A;  1Q82 W;  3ASN C;  4PI2 A;  1BT8 A;  1L1F A;  5L3C A;  4YJ2 A;  2JVD A;  1EN5 A;  5KMG B;  4FLW A;  1AIL A;  4DV6 B;  3C3T A;  3ASO C;  1EM1 A;  1FS0 G;  4UCS A;  1QVG U;  4MSW C;  2Q0A A;  4TV8 B;  2NR5 A;  2HJF C;  3RW0 A;  5CB4 B;  3QO8 A;  3MHS C;  1VQ5 V;  3OM3 B;  1BZK A;  1OCR C;  3R66 A;  3E2E A;  3OMN B;  2Z0A A;  1WB8 A;  5C8Y A;  2DYS B;  5L3G A;  2Q9L A;  1SA0 B;  1JFF A;  2DW4 A;  3ZMT A;  5KX5 B;  5B1O A;  5BMV A;  3W7W A;  3BAA A;  5EC2 C;  4O2A A;  1S72 V;  3E22 B;  1AJQ A;  4UCV A;  4FJC C;  1SQF A;  1GH6 A;  4R7C A;  2HJD A;  1BL8 A;  3BA9 A;  1VF6 A;  3QF7 A;  3VQW A;  3JAK A;  4LFC O;  4JI8 O;  3OUF A;  1VAR A;  3I55 V;  1GK9 A;  1XHX A;  1VP7 A;  3SDL A;  2ARH A;  2PUS A;  1H2M A;  3FYE B;  1P84 F;  4H13 B;  1PKX A;  1N8R W;  2A9H A;  2JIZ G;  3K5N A;  1FXH A;  3DXR B;  1X59 A;  1O9G A;  3B8M A;  4DV2 B;  1RPR A;  4J7K A;  1D2D A;  1M5I A;  1SC5 B;  1IBM O;  3IGA C;  3BPZ A;  1QHT A;  5IYZ A;  3DGE A;  1NU1 H;  1GN6 A;  2HG5 C;  4G28 B;  4JI7 O;  3GVM A;  2A06 H;  2YSU B;  2IJH A;  4BAY A;  1H38 A;  3B2E E;  2DWD C;  3MHH C;  2ZNJ A;  4UCT A;  3A8T A;  1PL0 A;  1JMK C;  3ZHT A;  1QR9 A;  2UU9 B;  1YZB A;  4RQE A;  3JAR B;  1ZL8 A;  3H1L H;  1HNX O;  1HNZ O;  4DR2 O;  1P7G A;  4F6R B;  2NNU A;  2QTO A;  1OV9 A;  4LF9 O;  2RN9 A;  2Q5Z A;  2XT9 A;  5FPR A;  1EZJ A;  4CH4 A;  2IJI A;  4GKK O;  3OGC C;  4X89 A;  1H2S B;  4CS3 A;  1BGY H;  2RDC A;  5LA6 A;  4DV7 O;  5LP6 A;  4OX9 O;  1N34 B;  2AHY A;  4FLT A;  4QGP A;  2YEV A;  2QR4 A;  2WLI A;  1Q8I A;  3B4S A;  2QM8 A;  3ABU A;  5B3S C;  2ZIN A;  4O4L A;  2HR3 A;  4KUM A;  3ZX6 A;  2Y0I A;  4DK1 A;  4X20 A;  4UVB A;  3VBB A;  2ZDI A;  2ZXW B;  4JTA B;  1FFT B;  3CCU V;  3CRQ A;  2W6I G;  4I4T B;  3CX5 F;  3JAM N;  1X4T A;  4ZOL B;  2YIB D;  4PDR A;  4PA7 A;  4O4I A;  4D7T A;  1K5Q A;  1AP5 A;  4LF8 B;  1K3E A;  2ZR2 A;  5J9P C;  1SS3 A;  2Q68 A;  2ITD C;  5CMU A;  4LNU B;  3QO7 A;  5LMU B;  4K8Z A;  2CH7 B;  2ZXW C;  4CS4 A;  2A7W A;  4D7S A;  2UXB B;  2QWR B;  4FPP A;  3D36 C;  3JAS A;  5KHK A;  1JOY A;  3RYC B;  1NBM G;  4IHJ B;  4GZR B;  4P9P A;  1GRJ A;  3OTF A;  4X1I A;  4U7N A;  2CK3 G;  4LBE C;  3CRM A;  5H9C A;  4MVQ A;  2OWO A;  4JAV A;  4YIP A;  1WP8 A;  2E5L B;  2WLM A;  3N2K B;  4PA3 A;  1Q90 D;  4JI2 B;  3Q4H A;  3L9D A;  4NR1 A;  2ADQ B;  1HNW B;  4P2Z A;  5LXT B;  1TVK A;  4DR6 O;  3K9S A;  4F6E A;  2A79 B;  1XMO B;  1VQP V;  4LF4 O;  1FXK A;  1Y66 A;  4I7Z B;  2F4V O;  1SKV A;  4X1K A;  5L3F A;  1P4R A;  3ZRS A;  1KP2 A;  3HKE A;  5EIB D;  2B5U A;  4MVM A;  2XHB A;  4MVZ A;  5KHJ A;  3K79 A;  2OYQ A;  1SER A;  3E83 A;  2HP8 A;  1GO3 F;  4F4L A;  3W7S A;  1Q6I A;  3K59 A;  2GTS A;  2R9R B;  2RQ6 A;  1IBL B;  1GN3 A;  3ICX A;  3JD0 A;  5J2T A;  2P4K A;  3ZRW B;  3ETE A;  4PDV A;  5IWA O;  4RQF A;  4NTX A;  5LOV B;  1QBZ A;  2G38 A;  1G4Y B;  4IIJ A;  3ABL B;  1K9M W;  2F93 B;  4LF6 B;  5GTH Z;  2ZM6 B;  3K0G A;  2JEU A;  2WLL B;  4DR7 O;  1EBO A;  3IFX A;  4B3M B;  3RBZ A;  3OMA B;  3LDC A;  4LR3 A;  1BS3 A;  4GUN A;  2W0X A;  5EZY A;  4OXS A;  1YF2 A;  1WP7 A;  3S3W A;  1AVM A;  2JS3 A;  4DV3 B;  4AQY B;  2QWP B;  3ABL C;  2PYL A;  4ABM A;  3G6B A;  5H6Q A;  5A9G A;  5KHH A;  4DV0 B;  2WLH A;  3H1H H;  2UUA O;  2DWE C;  1DK1 A;  1VQ8 V;  1MZE A;  4WCE V;  2JEX A;  4CC5 A;  2EZO A;  3VOU A;  4AHC A;  1SQP H;  4J80 A;  2E75 B;  1RPO A;  1U97 A;  1GN2 A;  1Z2G A;  1B04 A;  2Q6A A;  3T2M A;  1ARO P;  2JS5 A;  3P3N A;  5JCO A;  4DV2 O;  1WA8 A;  2X0L A;  4N23 A;  1WAZ A;  4UB6 Z;  4UV8 A;  3K04 A;  2IW5 A;  3F7V C;  5LMN B;  1W2B U;  2WSS G;  4TUY B;  2X6C A;  3CCV V;  4QE9 A;  1XEQ A;  3RWR D;  2IU0 A;  1FFX A;  1YCI A;  4QIW F;  4FM0 A;  4DUY B;  2BSK A;  4QE7 A;  4Q6G A;  1G1X B;  2QKS A;  1HR0 B;  1I94 B;  2UU9 O;  1SQX H;  1NI8 A;  3HPL C;  1GN4 A;  4RUF A;  3K58 A;  1BCC H;  3PN1 A;  5TIS Z;  2FKX A;  2YID A;  2HHH O;  2EIL B;  3HKB A;  1F51 A;  4UFZ A;  3L70 H;  1Q43 A;  3RYH A;  1B06 A;  3A2F A;  3CWB H;  4LF7 O;  2L35 A;  2PI5 A;  1DLB A;  4PD4 F;  2QWO B;  4MT8 A;  4YJ3 B;  1OCC B;  1FYJ A;  1U96 A;  1VQ4 V;  3VQX A;  5IE9 A;  3A0H Z;  5JJN B;  4JI1 B;  3OR7 C;  4TQF A;  2RCV A;  2CTP A;  3FKS G;  2EBO A;  2YI8 A;  3NR7 A;  3RT3 C;  2JGD B;  4O4J B;  2Q73 A;  2JJ1 G;  1QLE B;  4U7O A;  2EIL C;  1QNM A;  3FAV B;  4K3A A;  5FLX N;  3UO2 A;  2D2C B;  4MTO A;  3L71 H;  1YJ9 V;  5EYP A;  1OCZ B;  4DXW A;  2ZT9 B;  1KKC A;  2CTW A;  4U3F H;  4X66 B;  2WA3 A;  2UXN A;  3T1H O;  4A5U B;  1IBK B;  4WBN B;  1R6T A;  4JZ2 A;  4LC1 A;  4PA6 A;  4FM2 A;  2PF4 E;  2CGN A;  4LF8 O;  2OT5 A;  4J41 A;  2DQ3 A;  4PDL A;  5D5P A;  5EC1 C;  5FNV B;  3J80 N;  2FB5 A;  1MZF A;  3P30 A;  1FAF A;  4RO2 A;  3M7M X;  1E1R G;  5LMU O;  1K8A W;  1THZ A;  4H44 B;  1QLE C;  3JAT A;  1VQ6 V;  3JAL B;  3CXH F;  2UXB O;  1OCZ C;  4X8A A;  4RWU A;  3CJH B;  1AJP A;  3TJT A;  1KUQ A;  4U3J B;  4I9W A;  4BIZ A;  1MNG A;  5IJ9 B;  1JFF B;  4GCZ A;  3G71 V;  1OHH G;  5BY1 A;  3ZMS A;  4FLZ A;  4O2A B;  2LW1 A;  2E5L O;  3QG5 A;  3GWO A;  4JI2 O;  3AK3 A;  4Q20 A;  3APO A;  1V55 B;  4O4H B;  4ZBM A;  4I50 B;  2JGU A;  1YHQ V;  5JH7 A;  2CDY A;  4EB6 A;  2HVK C;  1PV0 A;  2KG7 A;  1S5J A;  4CH6 A;  2D3O W;  4FFB A;  1M57 B;  1PNK A;  2WLN A;  5EBL C;  5KUK A;  4X64 O;  3G4S V;  5GON A;  2ATK C;  2V4D A;  5KHG A;  1BHA A;  4GX1 A;  3OT7 A;  2QWN B;  2L6L A;  3AG3 B;  3K03 A;  2QM7 A;  1JCH A;  1WNS A;  1OCR B;  1SRY A;  1DF5 A;  1XMQ B;  4O2B A;  1R3J C;  2ADP A;  2QM4 A;  5ITZ A;  1XDC A;  4FK5 C;  4YY3 B;  1JR9 A;  4BW9 A;  5KAI Z;  1XL4 A;  4NB5 A;  5CBH A;  5KHI A;  4DUZ B;  2WAM A;  1M57 C;  2DOS A;  3HKC A;  3ZCC A;  3H1K H;  1J95 A;  1VF7 A;  1R3K C;  1GM9 A;  2P4V A;  4I55 B;  3ZIA G;  2E76 B;  5IJ0 A;  3OTO B;  2OTL V;  3AG3 C;  4B3R B;  4B3T B;  2XAS A;  1E1Q G;  4LF6 O;  4UXN A;  1NVP B;  5JVD B;  4ZHQ B;  4IYH A;  2P90 A;  2E74 B;  3OUS A;  4ZI7 A;  1TUB B;  4FFK A;  3ZJZ A;  4KP4 A;  4DR3 O;  3K5O A;  3FD9 A;  4E4E A;  3CRR A;  3CD6 V;  1N33 B;  5CBG A;  4GLX A;  4B3M O;  5LP6 B;  2HLD G;  3N27 A;  4PJ0 Z;  2YXH A;  3J7A U;  2YEV B;  1WJZ A;  2WLJ A;  5DM6 V;  5CA1 B;  3CB2 A;  2QEX V;  4DV3 O; 
#chains in the Genus database with same CATH homology
 4AQY O;  3M8A A;  4JI0 O;  1FKA O;  1D2D A;  5BY1 A;  2ZM6 O;  1IBM O;  2E5L O;  4JI4 O;  2FKX A;  2HHH O;  5H5N A;  4JI2 O;  4JI7 O;  4NXM O;  1R1B A;  4LF7 O;  4DR7 O;  4JI6 O;  3F5T A;  4LFA O;  1XNR O;  1FYJ A;  4JI1 O;  4X66 O;  4JI3 O;  4JYA O;  4JV5 O;  2VQF O;  4DUZ O;  2LW7 A;  4B3S O;  5BR8 O;  4X64 O;  5A2Q N;  2N74 A;  1YZB A;  2UUC O;  3O65 A;  1HNX O;  1HNZ O;  4DV6 O;  4DR2 O;  2UXC O;  4LF9 O;  4DR1 O;  1AIL A;  3RT3 C;  1F7Y A;  4LF5 O;  4DV0 O;  4DV4 O;  1HNW O;  4YHH O;  3J81 N;  1XMQ O;  4B3T O;  4DV1 O;  4X62 O;  1NS1 A;  4DR5 O;  2UUA O;  5FLX N;  1N36 O;  1DK1 A;  1N34 O;  4GKK O;  4YY3 O;  4NXN O;  1XMO O;  4DV7 O;  4DR6 O;  4OX9 O;  4LF4 O;  3R66 A;  1IBK O;  2Z0A A;  4KHP O;  1N33 O;  3T1H O;  4A5U B;  2F4V O;  1R6T A;  2DOS A;  4LF8 O;  1FJG O;  2UXD O;  1HR0 O;  1I94 O;  3OTO O;  3J80 N;  4B3R O;  4DR4 O;  4OPA A;  4DV2 O;  1XNQ O;  5IT9 N;  5LMU O;  4OPH A;  4GKJ O;  4LF6 O;  5BXZ A;  5LMN O;  4JI5 O;  2JRI A;  4LFC O;  2UXB O;  4JI8 O;  3JAM N;  4X65 O;  1J5E O;  3T1Y O;  1IBL O;  4DV5 O;  4DR3 O;  2AGA A;  2DJV A;  3SDL A;  1XEQ A;  4DUY O;  4B3M O;  1KUQ A;  5IWA O;  4LFB O;  1AB3 A;  3J7A U;  2ZKO A;  1G1X B;  2VQE O;  2UUB O;  2UU9 O;  4K0K O;  1A32 A;  1X59 A;  1N32 O;  5LL6 Y;  4DV3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...