4X66O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x66O00
1J5EO 1IBLO 2VQEO 4NXNO 1XNQO 3J81N 2UUBO 3M8AA 4YHHO 3OTOO 4JI7O 4JYAO 4JI4O 1FYJA 1N32O 4JI2O 1AILA 4B3SO 4DUZO 4LFBO 4DUYO 3T1YO 2DJVA 5LMUO 1R6TA 4JI0O 4DR3O 1FJGO 4X66O 2UUCO 4DV0O 4AQYO 3J80N 5BY1A 4DV2O 4LFAO 1KUQA 1I94O 4JI3O 4A5UB 4K0KO 2ZM6O 1F7YA 2E5LO 1N33O 1HNXO 1N34O 1A32A 2UUAO 2FKXA 4DR1O 4LF9O 2UXDO 4X64O 1YZBA 2HHHO 3RT3C 1R1BA 4LF7O 4LF4O 2UXCO 1AB3A 1X59A 4GKJO 1HNZO 5BXZA 3SDLA 3JAMN 3O65A 4GKKO 2LW7A 3J7AU 5A2QN 4DR7O 2AGAA 4LF8O 1N36O 1XEQA 2N74A 1G1XB 1FKAO 1DK1A 4DV4O 5LMNO 4DV3O 4JV5O 4LF6O 1XMQO 5IWAO 1HNWO 4DV5O 1HR0O 4JI5O 4B3MO 1IBKO 4X62O 4LFCO 5IT9N 2UU9O 4KHPO 4JI8O 2ZKOA 3T1HO 4B3TO 3R66A 5LL6Y 4OPAA 4DR6O 2Z0AA 5H5NA 2JRIA 4DR5O 1D2DA 1XNRO 4LF5O 4YY3O 4DV6O 4B3RO 5FLXN 4JI6O 4DR2O 4JI1O 2UXBO 3F5TA 4DR4O 4NXMO 2VQFO 4DV7O 4OX9O 2DOSA 4DV1O 2F4VO 4X65O 4OPHA 1NS1A 1XMOO 1IBMO 5BR8O
chains in the Genus database with same CATH superfamily
1XNQO 1GN6A 1WP7A 1AR4A 4CC5A 1FXKC 4FFBB 3K58A 1NJIW 2HKOA 4X65B 4K8ZA 1N32O 2RCVA 2FL4A 1MMMA 3K59A 1CP9A 1NTZH 1Y67A 3OTFA 4E2LA 1F23A 1SESA 3OEHG 5J2TA 1VF6C 3OD4A 4EFBA 2K1EA 3M7MX 5H2FZ 1K4DC 4H13B 4DV0O 2Y48A 3CCLV 3BEHA 4MVMA 3TXQA 1PPJH 1O9GA 4K0KO 5LHHA 1V55C 5B3SC 1JMKC 1XILA 4PA9A 2OCHA 2O57A 2F95B 4TOIA 2E5LO 2Q67A 1VIBA 4DR1O 3BVOA 3BA8A 4LC1A 4TT3G 2RQ6A 1G6UA 3RT3C 3N27A 4FLXA 3X2QC 3UT5B 4PD4F 3K04A 5LOVA 4XBFA 1HNWB 1YITV 3IGAC 5IYCO 4LH6A 5A2QN 1XHZA 3DSQA 3TCUA 4DR7O 1Q6UA 4TUYB 2OT5A 1YJNV 2W6IG 3ZHTA 3K0DA 2EINB 1GAXA 2XOKG 2R9IA 1VQ6V 3RYCA 3T1HO 4DV3B 1Q3EA 4DV7B 1NU1H 4J42A 2YXYA 1KD1W 1V54B 4X1KB 1XNRO 4DV6O 4QNHB 4WFGA 2XAGA 4G28B 3RYIB 5FPRA 5KUKA 3B2EE 3ZCCA 1J5EO 1IBLO 1CXZB 4J9YB 4B3RB 5DECA 2GUZB 3KCYA 1M56B 3ABLB 4EFEA 5IYZA 5BR8B 2IU0A 4DUZO 5HFMA 3ZN0A 3OR7C 2ITDC 2YEVB 4ZHQB 4NYKA 3EHBB 5LHIA 4UVAA 1HW7A 2ZR2A 3WG7C 1ZLZA 4UCUA 3AEIA 1SQVH 3DC5A 1L0NH 4GX0A 4JPRA 4R7CA 5CN0A 1F51A 3CRMA 1RPOA 5ITZB 1K8AW 3FYEB 2UXDO 1LNQA 1KMIZ 1GM8A 1T5EA 2ZXWC 5LGTA 4O4HA 5BXZA 5H6QA 5IY5C 1QVFU 4UCSA 5B1AC 2UXCB 2JVDA 2L6LA 3PN1A 3RYFA 1N36O 3GWOA 2AHYA 1S77D 5CA1A 2B5UA 1XMQO 1GMGA 4DK1A 5B1BB 5DN6G 1AVMA 4J7KA 4EB6B 4HYOA 4HNAA 2ZKOA 1CEZA 4NTYA 1YDXA 4QPKA 4FMTA 2M7WA 2OCCB 1KKCA 4FLUA 1JPXA 3OMIB 3BA9A 3KKYA 3WB1A 1EN6A 3HKBA 4D7SA 2ZD9A 5L3FA 3UQ8A 5TISZ 1H2MA 4I0XB 1U96A 3I56V 2QWPB 1OCCC 1Q8IA 3GB7C 1AROP 2PGGA 2XUMA 1M4UA 3E8BA 1UPGA 2JDIG 1S0VA 2EZOA 3BABA 4CS4A 3BRCA 3T1YO 4BIOA 3CX5F 4JYAB 4DR3O 3SJCC 5LP6B 4OXSA 3CJHB 2B9ZA 1US6A 2XHBA 1XOUA 4AQYO 4EEQA 3HKEB 2BCCH 5C93A 4DV2O 4JI0B 1PNLA 2HHHB 1FJGB 4HAMA 1I94O 3JD1A 2FYUH 4X66B 2NNUA 4QJFB 1TUBA 2F93B 1HNXO 1VEWA 4ZOLB 2FKXA 4Z2WA 3G6EV 4O2AA 3EXAA 2G38A 2Y0PA 1B04A 3OT7A 1SQGA 3E83A 3TGUH 1M5IA 1NT2B 3JALB 4RUEA 1K92A 4DXWA 2YIBA 3K5NA 5KUMA 2KB1A 5CB4A 1DK1A 4JV5O 4WBNA 4P9OA 2N05A 5IWAO 1VQMV 1HR0O 3ASOB 2Q9LA 4JYCA 3CEIA 2UU9O 1KKDA 3H9VA 4LF6B 1W0JG 2OWOA 4JAUA 5H5NA 2LP7A 3OUFA 1OCZC 1ZSPA 4GLXA 3F5TA 2OTLV 3OR6C 1U97A 1RP3B 2DOSA 3ZRWB 2QEXV 4LF5B 4NTWA 3OE7G 5KAFZ 1BS3A 5LYJA 4RAIA 4N21A 1BMFG 1GTOA 2XAQA 3A0BZ 5IYBO 1QQCA 5BMVB 3ZMSA 1OCOB 1OV9A 4J80A 3HKDA 2M6YA 3SYAA 2Y0IA 1Y76B 4PA4A 4JI4B 4IIJA 4K0KB 4TQFA 4O4IB 5EC2C 4O4JB 1VQOV 2E5LB 3HB3B 2YIAA 5E1AC 1TGOA 3Q4HA 1OZ0A 2HEPA 2NN4A 4LFBB 3JSLA 1NTKH 2Z5UA 1S5JA 2EIJC 4K3AA 1Q6IA 1XREA 2DYRB 3B8NA 4O2BB 2ZM6O 2ZNIA 1EZVH 4MVQA 1MABG 3IJ4A 3JD2A 3BAAA 1AJNA 2P7TC 4DR7B 1BQZA 2DYSB 4WFHA 4GX1A 1N0JA 1PNMA 1S3JA 4I9WA 5K1XA 4LF9B 3G71V 2PI4A 3THOA 4E4EA 2KSDA 2CAZC 2ZR3A 4LF4B 2AXTZ 3JAKB 3IAYA 5GONB 2EILC 4ZIBA 4GKJB 1FFTB 3T1HB 3BY6A 3KZIZ 2Q7EA 2ZE6A 4DV5O 1GN2A 4B3MO 1ZL8A 2VWJA 5B1OA 1UFIA 2JRIA 4W4KA 1J5EB 4I55B 3D3IA 4ZKIA 2CTPA 2ZQMA 1VQNV 1S5LZ 1M57B 2W0XA 4OX9O 4DV1O 4UCVA 4DW1A 4YY3B 1OCRB 3K0GA 2V1DA 3HPLC 3LSUA 5J2UB 4MVRA 5FL7G 5IJ9B 1RM1B 3IC9A 1E1QG 4H44B 4UCRA 2XNDG 1N8RW 1JQ0A 4MVSA 4WF9V 1SKVA 1NTMH 2JGUA 1AP5A 3JARB 1FFXB 1KU9A 5JQGA 4QE7A 3NR7A 1EN4A 1KECA 3K5LA 4X20A 4PA6A 2X7RB 1FXHA 3SGIA 3FFQA 4JGSA 5L3GA 4PJ0Z 1YEWA 2CDYA 3A0HZ 1Z5WA 4R50A 2QTSA 3VQYA 3F7VC 2IM9A 4X1KA 4MTXA 3ZIAG 3ML0A 1KP2A 3CMEV 2P67A 3H1KH 1AI6A 3B40A 2XASA 3G6BA 3ZX6A 5CBHA 2WLIA 1K5SA 2A9HA 2GUZA 2IH1C 4K8XA 2B1IA 2P22C 2PUSA 3W7XA 1H8EG 4FLYA 1YXBA 1WP8A 4BAYA 5EZYB 3FYIB 1FXKB 5LA6B 4KHPO 1Q81W 2FB5A 2W6JG 3EVKA 3QO5A 2KQXA 4TSFG 2YEVA 3JSNA 5GW7A 2CTQA 1IZ3A 4JI6O 5EYPA 4UB6Z 3QO8A 3MD0A 4UCTA 1IX9A 4DR4O 4MTOA 2RN9A 3WFVA 3RYHB 3O9OA 3L74H 4F6RB 2UXNA 1IBMO 3CRQA 4NXNO 2ZIMA 2UUBO 4LWSA 4DR2B 5ITZA 3M8AA 3T1YB 2Q6AA 3VBBA 1V55B 3LDEA 5B3SB 2F4VB 1K4CC 1AI5A 4FZ0A 3C3SA 1GKFA 1R6TA 3X2QB 2QSAA 2UUCO 3UM7A 5JH7B 3P3NA 4KL1A 4YIPA 5KHKA 2KKWA 3CSXA 4LFAO 3ABMC 4N23A 1FXVA 1N33O 2ADQB 3QO7A 4FM1A 2GBOA 4AI8A 3ETDA 4I7ZB 4X64O 1KQSU 1R1BA 2OIEA 3E8FA 2CTWA 3ICXA 5IDJA 2QM4A 1YJ9V 3B4SA 2Y4TA 2XAHA 5IWAB 2R72A 2AZ2A 3K08A 1HR0B 1NKDA 3WU2Z 4F6EA 2GV9A 5D5QA 2UU9B 5F2VO 4LF8O 1XEQA 1G1XB 5B66Z 2X0LA 4H0LB 2F1MA 4GKKB 1S72V 1SA0B 1AJPA 4YJ2A 4FIPC 1IBKO 4X62O 3CCQV 5JVDB 4LFCO 2QTOA 3OFNG 3JCZA 3VOUA 4OGQB 1JFFB 3F5WC 3LDCA 2EIMC 4TV8B 3VQWA 2OTJV 3CJHA 2DMXA 1VQKV 3B8MA 4PDLA 4Q6GA 1XDCA 2AHZA 4JI1O 4YXWG 5GTHZ 3CC2V 4GUNA 1XBLA 2VQFO 2JEUA 2YXHA 3QG5A 1EM1A 1WNSA 1JA8A 4PV1B 2BSKB 1AI4A 3WG7B 1JCHA 4IL6Z 2X6BA 1M90W 4JTAB 1W2BU 1JJOA 2Q73A 3AG4C 2ARHA 4JYBA 4U3JA 1QVGU 3JAWB 4JI2O 1AILA 3MDSA 3ZHVA 1P7GA 2ODMA 2LW1A 5LMUO 1K33A 4MTFA 4B7EA 5KA6A 3E22B 1YCIA 5CMUA 1TVKA 2QM7A 3L9DA 2ZXWB 4LBEC 1Q86W 3ZN1A 2PY5A 2OYQA 5IY5B 2WA3A 4B3SB 1R73A 3HR0A 2P90A 5B1AB 3CXHF 1XUQA 3E8GA 3ZRVA 3BCCH 4FVMA 1N34O 2ZINA 1A32A 4XDKA 3OGIB 2GTAA 1Y6XA 3QF7A 3H1IH 2YICA 3MHHC 4MT8A 1YZBA 1SF9A 2WLJA 4Q20A 2BTQB 2CE4A 1RPRA 3JATB 2KG7B 2DE0X 2K9PA 2UXXA 4I4TA 1SQPH 1W59A 3CCEV 4YJ3A 3G4SV 5LMNO 4MVOA 2ITCC 5EBWC 1WPBA 1KC8W 2HFEC 5KHJA 2JS3A 2F23A 3L75H 5BMVA 5IT9N 5FNVB 1M1KW 4B3TO 3N2KA 4DV1B 3CD6V 1ROPA 4DYLA 4ZI7A 1H2NA 3DC6A 4O4JA 1YF2A 4JI8B 2E76B 4TQDA 2JGDB 1XHXA 1L8DA 3CCMV 3OMAB 1JJ2U 3N2GA 3J81N 5DM6V 2JJ2G 3ZBHA 4JI7O 5KAIZ 5C8YB 4O4LA 1Q82W 1QLEB 5H6RA 1H2SB 2E3CA 4TV9B 2DJVA 1WA8A 3C3TA 3IC7A 4I5SA 2QKCA 3JAKA 1DF5A 2RNBA 3HKCA 4BIUA 2ETNA 3ETEA 1H2LA 4DUYB 2HG5C 5J2TB 5IYDO 2EJRA 1BZKA 5IJ0A 2LJ2A 3ZJZA 1H2GA 1K97A 4JI3B 1BGYH 4LF7O 4LH7A 3ABKC 5L3EA 2Y4UA 5LGNA 3AG1C 2UUAB 4U7OA 1E79G 1QU7A 3CYOA 2B1GA 1Y66A 3ETGA 5GTIZ 1GRJA 3OUSA 4RQFA 2IU3A 3JD0A 3J7AU 1OCZB 1MSWD 5EC1C 1VQ7V 1YIJV 5J2UA 4J7ZA 5L3BA 1VQ9V 4JAAA 1Y74A 4IGGA 2QWNB 5B5EZ 5B1BC 3B09A 4DV4B 3K79A 2EIKC 2BOCC 4BW5A 1Z2GA 5LBQA 3JARA 4DR6O 1FFXA 2WLLA 2P5OA 4JI5B 4NXNB 4BIZA 2ILMA 2GHYA 3RYCB 5FLXN 4DRXA 1IVSA 1BHBA 1QBZA 3A2FA 3SPGA 4X1IA 2XAJA 2EZPA 4X65O 4FZ1A 1I5YA 2VQEO 1NQTA 4FLVA 1S76D 2MK3A 2XT9A 2EIJB 1MZEA 3C90A 4NXMB 3W7SA 2IBZH 2YS8A 1BL8A 1YI2V 4B08A 2UUCB 1XMOB 1R6NA 1XNQB 5DEDA 2BE3A 1BSMA 3CP1A 3K03A 4WFEA 3VQVA 1R3IC 1GK9A 1NR7A 5LHGA 4LFAB 3H1JH 1EBOA 4RUFA 5LGUA 3CHXA 4AHCA 1N32B 2HP8A 1FPOA 4X88A 1PP9H 2JEXA 4W4LA 1LUWA 4NVPA 3K9AA 1XL6A 3L71H 4GX2A 3AK3A 3SJQC 3ZHQA 1N0NA 2EILB 4UFZA 1F7YA 3FAVA 1JR9A 4IHJB 1NH2D 4DV0B 3SPHA 2ZE5A 2Z3YA 1MA1A 1I5XA 1GO3F 2Y69C 4FM0A 1PNKA 1WPXA 2YDEA 3CWBH 3LSSA 1AI7A 3KCXA 2IJHA 4PDMA 1AB3A 4MVUA 1Z5VA 1WB8A 1KBHA 4DR1B 3D36A 4LNUA 4ABMA 4O4HB 4F6RA 1V9PA 2QWOB 3U11A 2RJZA 5E79Z 4DV3O 3JD3A 3RYFB 3FD9A 4FLTA 1VQLV 4MTGA 5CA1B 5JJEB 5LL6Y 2DW4A 2CH7A 1GH6A 4G27B 5JJJB 1NH2B 4HNAB 1SQFA 4B3RO 1X4TA 3S3WA 3UKMA 3H1HH 2ZE8A 3RBZA 4FFBA 2QKSA 1I08A 3CS5A 1XNRB 4OPHA 4JI2B 1NS1A 3M99B 4DV6B 5BR8O 1JX9A 3HKBB 5CA0B 2DWEC 1N4CA 1AP6A 4GX5A 3RGBA 3CXCU 4KP4A 5KHGA 5K1PA 1NZ6A 1IBLB 5KMGB 2WLHA 4LR3A 3DTUB 2IH3C 3ZHRA 2YIBD 2PYLA 1N34B 4H33A 3AG2C 3RVYA 3K9SA 1K73W 2QJ1A 4DUZB 1COWG 3E86A 2CTRA 2RMKB 4PA7A 1M9NA 4MVZA 1SS3A 2Q0OC 4KXRA 2XTAA 4IYIA 3AG3C 3UT5A 2JIZG 4JZ2A 1JFFA 4TV8A 1ENVA 1K5QA 1TUBB 2UXCO 1IDSA 4LCUC 2DWDC 4X1YB 4TUYA 3O65A 4O2AB 2UXDB 3CCUV 3OEEG 4Z1VA 3R65A 1VQ4V 3ASNC 4R8CA 2R9RB 4B3TB 1BHAA 2Q69A 1WN7A 3RN4A 4HZ3A 4BW9A 4MS2A 3FB5C 1N36B 5CB4B 5EIBC 4WBNB 1TA8A 3RFRA 3RYIA 1XI1A 2PYJA 1XMQB 4UVBA 2LGWA 3SJAC 1BE3H 5CBGA 5A9GA 2JJ1G 4JZGA 3FB8C 1URFA 3QVNA 4J41A 4CBCA 3CCJV 3E2EA 3APQA 4NTXA 2RDCA 5LXTB 3H1LH 3L72H 1B6QA 2EX3A 3WB0A 1NI8A 3ABMB 1WLEA 4JYAO 1M93A 1YSCA 4ZHQA 5LYJB 1G4YB 1AR1B 4UV8A 1FS0G 3APOA 3CRRA 4X9QA 4JI0O 3ZEDA 2QM8A 1R3LC 1FJGO 1K7DA 3GWKC 3ZS8C 4X66O 3BFRA 2VWKA 3ZMTA 4EKWA 3HKDB 2YI9A 2DN9A 2LQTA 2ZNJA 4IIJB 1Q6HA 3IFXA 4DR3B 3DGEA 3STZC 4LF7B 5KX5B 1SZTA 3CRAA 1UJWB 4PI0A 3CMAV 3Q4HB 4AQYB 1JVMA 4DV2B 3OM3B 3MAQA 1I94B 3B77A 2X6CA 3DXRB 4D7TA 1HNXB 3ZMVA 2EIMB 1P7BA 3QNEA 3CC4V 2LW7A 4AILC 2YIDA 1AR5A 1FKAO 1YHQV 3K5OA 4EB6A 3G67A 3L70H 2YXLA 4LF6O 5JJNB 3CCRV 4DR6B 3ETQA 2OIGA 4FPPA 2GSMB 3BPZA 4UVCA 2WAMA 3LDDA 4P30A 5AG2A 4X8AA 1ZTEA 3JASB 2ZDIA 2ZIOA 4JV5B 4TV9A 3TXSA 3AG4B 3L73H 2PF4E 2QDOA 4WFFA 2Z0AA 3LNNA 4DR5O 5IE9A 1QHTA 4LF5O 4I0XA 2VQEB 1ZL8B 3H01A 5EBLC 2F43G 4Z1MG 3SPIA 3ZHSA 3D36C 2AZ0A 2EBOA 1MOFA 5EK0A 1R3JC 4DW0A 1WJZA 2IJJA 4J9ZB 4BWAA 3CB2A 3I55V 1GN3A 2XAFA 4JI4O 2IJKA 3AG7A 2EULA 4TWKA 5LP6A 1ZWIC 3S3XA 4LFBO 5CBFA 2R70A 3HKEA 3W7WA 2HVJC 3D8CA 2YSUB 3T2MA 4QPJA 4ZOLA 5JQGB 1KUQA 3RWRD 4X20B 1EZJA 4FJCC 2NR5A 2QA4V 4LF9O 3U0ZA 1D5NA 4P9PA 3JALA 1P49A 2LFSA 2ZT9B 2ZM6B 4LF4O 1Y4MA 2WA4A 4C7UA 4GKJO 1FAFA 4I50B 1E1RG 1Q7YW 4RQEA 3JAMN 1YTFD 3A0RA 4D6TH 1RSOB 5JCOA 3T4DA 5KHHA 4NR1A 3SYQA 4BR6A 1SQBH 1BCCH 2WLIB 2ADPA 1PV0A 2A3QA 1DGSA 3ZRWA 4DV5B 2DQ3A 4B3MB 4YY3O 3SJBC 3MHSC 3ABTA 4H37A 2WWWA 1LUVA 4MW3A 4CH6A 1VP7A 4U3FH 4MSWC 1F4MA 4ICGA 5EYPB 1OCCB 4IHJA 4FLWA 2EINC 1YTFB 3OTOO 2PZSA 3EFFK 4OX9B 1Y76A 2CUGA 1FYJA 3E89A 3NXSA 4LWSB 1V54C 4O4IA 1VQ8V 4NKGB 1TUEB 3ABKB 2JS5A 5L3DA 4O2BA 3E8HA 3ZHUA 3AG1B 2LGQA 4GCZA 4R6ZA 5BY1A 3CRCA 2CK3G 3T1CA 1M56C 5EBMC 3ABLC 1SC5B 1QLNA 1VMGA 4X89A 4WFBV 2Q4PA 2BOBC 4CC6A 1HNZO 4RWUA 1VF5B 1WAZA 4K35A 5GONA 2A7WA 2WLMA 2EIKB 3JCUZ 4XDJA 3SDLA 4DO2A 3F7YC 2PI5A 3T4ZA 2CGNA 3ZMUA 3K57A 2R9AA 4XDLA 4ZBMA 3K5MA 3RW0A 3ZRXA 1I0HA 5CA0A 1TAEA 4PDVA 3JYCA 4KUMA 5L3CA 2QKAA 3P32A 1OHHG 4I55A 5KMGA 1PKXA 4NB5A 4QE9A 2MW2B 2PTMA 4YJ2B 1D2DA 2Q7GA 3GVMA 1GM9A 5LOVB 3OMNB 4DK0A 1P4RA 3QTCA 4KHPB 5IJ9A 4DR2O 3K3WA 2UXBO 2LO1A 4UXNA 1IXMA 2F4VO 1K34A 1SERA 1RFYA 4JI6B 2W0FC 2GTSA 1H2KA 4YHHO 1EFRG 4DR4B 2FMLA 2QE7G 1IBMB 4J10A 1Q90D 2OCCC 2VRZA 2UUBB 1QLEC 2YUAA 2Y69B 2ZDIC 1W0KG 4RO2A 4X1YA 2GDSA 4U3JB 4U7NA 3SPCA 5KLVH 3ZMZA 1QNMA 1L0LH 3VQXA 2YC0A 1GN4A 1MSDA 1TVKB 1G8MA 1K9MW 4QGPA 4ASUG 2QR4A 4IYHA 2P4VA 1DF4A 3LNMB 1SZXA 5KHIA 4FM2A 4UUJC 1JOYA 1FD9A 2EJ7A 5IYZB 4FLZA 5CA3A 5LP6C 5J9PC 1N33B 3RVZA 4UB8Z 1IXBA 1PL4A 4HBNA 2IW5A 3LSQA 3PJSK 4X64B 4GKKO 4CH3A 4JASA 1NVPD 3UO3A 5LXTA 2H8PC 4QIWF 2L35A 5KA5A 5EZYA 3LUTB 4GZRB 3P3PA 1FXKA 5LA6A 1I7FA 2LFRA 4DR5B 1HNWO 2WLKA 4I4TB 1R3KC 4LF8B 3W7TA 2N04A 2V4DA 4YJ3B 2HVKC 2WSSG 3CC7V 1P84F 4J7JA 2H3OA 1VF6A 3RYHA 1IBKB 4UV9A 4X62B 4LFCB 2P4KA 1K3EA 3I5DA 3N2KB 4DV7O 4ZI7B 4GYCB 5JCOC 5KX5A 3AG2B 2D2CB 1SQQH 1J95A 5EIBD 1XQ8A 2AW9A 1B3QA 3ASOC 4PI2A 4JI1B 3OAAG 4GT1A 3SYOA 3E35A 1VQPV 4CH5A 3UO2A 2VQFB 5HFLA 1NVPB 3N2GB 3AK2A 3DXRA 3AG3B 1QR8A 4B3SO 5JH7A 5FPOA 1HP8A 3OGCC 4O4LB 4B7KA 1MNGA 1WA8B 2A06H 2QGNA 1YVWA 5LMUB 4JTDB 4A5UB 3ASNB 1THZA 3HKCB 2HLDG 1BQ0A 1F4NA 1OCOC 3JASA 3ZRSA 2ATKC 2WPDG 1O9HA 3JD4A 2WLNA 1DLBA 5IJ0B 1ZUQA 4PHZA 4I9QA 2X6AA 5H9CA 3U10A 1SQXH 4G2KA 1D5AA 4JAVA 3ABUA 1PM9A 4JF3A 1SETA 1XL4A 4KFMA 4F4LA 2Q68A 1SRYA 2DYRC 1SA0A 3FKSG 3G80A 2N74A 5JVDA 2H94A 1L1FA 2NLJC 3BHPA 2ZE7A 1PL0A 4PELA 2CGOA 2DYSC 3WB2A 4L8JA 4JI8O 1ORQC 5LMNB 2P6JA 2YI8A 4OPAA 1Y74B 2DQ0A 5B1NA 2P06A 4L87A 3OW2U 4J11A 4P2ZA 2BSKA 2HR3A 4YIOA 2QWQB 3OTOB 1NBMG 3SPJA 1CPYA 3FX7A 2WLLB 1VARA 1EN5A 3JAWA 3K06A 4DRXB 1QCEA 1YJWV 1VF7A 2E74B 4X1IB 1KYOF 1AJQA 3E22A 2D3OW 2JK5C 4WCEV 2C2AA 4I50A 2QWRB 1KB9F 3FB6C 4DUYO 4JI7B 2Q8VA 4IT5A 1M57C 1Q5OA 1RSOA 3TK1A 4LP8A 3TJTA 2A79B 1OCRC 1RM1C 3D3QA 3J80N 1NR1A 4CZZA 4JI3O 3SR2C 1HNZB 1PD3A 4PA3A 3KG2A 2UUAO 1WB7A 2IJIA 2BTQA 3W7UA 2HJFC 1H8HG 4PDRA 2HHHO 1LR1A 3FAVB 3JATA 5JWPA 3TETA 2KG7A 1X59A 1MG1A 1VQ5V 3CPWU 4MW8A 1Q43A 1MZFA 3UCSC 4FFKA 2FTKA 3AK1A 1H38A 1ZAUA 1KP3A 3CCVV 2V7QG 1ZX3A 4UCOA 4CS2A 3SYPA 3CE2A 2AGAA 3P30A 3STLC 4WFAV 1GM7A 4JYYA 1OJHA 4DV4O 4JTCB 2BTOA 4LNUB 5FNVA 3CCSV 1HWYA 2Q0AA 2Q7HA 3A8TA 4JI5O 1DTOA 2A0LA 3SYCA 1B06A 2UXBB 1BT8A 4CH4A 3R66A 4CS3A 5BZBA 2JGDA 2HJDA 2ZCEA 2Q5ZA 5D5PA 1S5HC 1HDJA 1QR9A 4YHHB 3FB7C 4FK5C 1R6KA 2VS0A 4NXMO 2CH7B 2E75B 2F66C 5C8YA 1IURA 1XMOO
chains in the Genus database with same CATH topology
1J5EO 1IBLO 2VQEO 4NXNO 1XNQO 3J81N 2UUBO 3M8AA 4YHHO 3OTOO 4JI7O 4JYAO 4JI4O 1FYJA 1N32O 4JI2O 1AILA 4B3SO 4DUZO 4LFBO 4DUYO 3T1YO 2DJVA 5LMUO 1R6TA 4JI0O 4DR3O 1FJGO 4X66O 2UUCO 4DV0O 4AQYO 3J80N 5BY1A 4DV2O 4LFAO 1KUQA 1I94O 4JI3O 4A5UB 4K0KO 2ZM6O 1F7YA 2E5LO 1N33O 1HNXO 1N34O 1A32A 2UUAO 2FKXA 4DR1O 4LF9O 2UXDO 4X64O 1YZBA 2HHHO 3RT3C 1R1BA 4LF7O 4LF4O 2UXCO 1AB3A 1X59A 4GKJO 1HNZO 5BXZA 3SDLA 3JAMN 3O65A 4GKKO 2LW7A 3J7AU 5A2QN 4DR7O 2AGAA 4LF8O 1N36O 1XEQA 2N74A 1G1XB 1FKAO 1DK1A 4DV4O 5LMNO 4DV3O 4JV5O 4LF6O 1XMQO 5IWAO 1HNWO 4DV5O 1HR0O 4JI5O 4B3MO 1IBKO 4X62O 4LFCO 5IT9N 2UU9O 4KHPO 4JI8O 2ZKOA 3T1HO 4B3TO 3R66A 5LL6Y 4OPAA 4DR6O 2Z0AA 5H5NA 2JRIA 4DR5O 1D2DA 1XNRO 4LF5O 4YY3O 4DV6O 4B3RO 5FLXN 4JI6O 4DR2O 4JI1O 2UXBO 3F5TA 4DR4O 4NXMO 2VQFO 4DV7O 4OX9O 2DOSA 4DV1O 2F4VO 4X65O 4OPHA 1NS1A 1XMOO 1IBMO 5BR8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E O;  1IBL O;  2VQE O;  4NXN O;  1XNQ O;  3J81 N;  2UUB O;  3M8A A;  4YHH O;  3OTO O;  4JI7 O;  4JYA O;  4JI4 O;  1FYJ A;  1N32 O;  4JI2 O;  1AIL A;  4B3S O;  4DUZ O;  4LFB O;  4DUY O;  3T1Y O;  2DJV A;  5LMU O;  1R6T A;  4JI0 O;  4DR3 O;  1FJG O;  4X66 O;  2UUC O;  4DV0 O;  4AQY O;  3J80 N;  5BY1 A;  4DV2 O;  4LFA O;  1KUQ A;  1I94 O;  4JI3 O;  4A5U B;  4K0K O;  2ZM6 O;  1F7Y A;  2E5L O;  1N33 O;  1HNX O;  1N34 O;  1A32 A;  2UUA O;  2FKX A;  4DR1 O;  4LF9 O;  2UXD O;  4X64 O;  1YZB A;  2HHH O;  3RT3 C;  1R1B A;  4LF7 O;  4LF4 O;  2UXC O;  1AB3 A;  1X59 A;  4GKJ O;  1HNZ O;  5BXZ A;  3SDL A;  3JAM N;  3O65 A;  4GKK O;  2LW7 A;  3J7A U;  5A2Q N;  4DR7 O;  2AGA A;  4LF8 O;  1N36 O;  1XEQ A;  2N74 A;  1G1X B;  1FKA O;  1DK1 A;  4DV4 O;  5LMN O;  4DV3 O;  4JV5 O;  4LF6 O;  1XMQ O;  5IWA O;  1HNW O;  4DV5 O;  1HR0 O;  4JI5 O;  4B3M O;  1IBK O;  4X62 O;  4LFC O;  5IT9 N;  2UU9 O;  4KHP O;  4JI8 O;  2ZKO A;  3T1H O;  4B3T O;  3R66 A;  5LL6 Y;  4OPA A;  4DR6 O;  2Z0A A;  5H5N A;  2JRI A;  4DR5 O;  1D2D A;  1XNR O;  4LF5 O;  4YY3 O;  4DV6 O;  4B3R O;  5FLX N;  4JI6 O;  4DR2 O;  4JI1 O;  2UXB O;  3F5T A;  4DR4 O;  4NXM O;  2VQF O;  4DV7 O;  4OX9 O;  2DOS A;  4DV1 O;  2F4V O;  4X65 O;  4OPH A;  1NS1 A;  1XMO O;  1IBM O;  5BR8 O; 
#chains in the Genus database with same CATH topology
 1XNQ O;  1GN6 A;  1WP7 A;  1AR4 A;  4CC5 A;  1FXK C;  4FFB B;  3K58 A;  1NJI W;  2HKO A;  4X65 B;  4K8Z A;  1N32 O;  2RCV A;  2FL4 A;  1MMM A;  3K59 A;  1CP9 A;  1NTZ H;  1Y67 A;  3OTF A;  4E2L A;  1F23 A;  1SES A;  3OEH G;  5J2T A;  1VF6 C;  3OD4 A;  4EFB A;  2K1E A;  3M7M X;  5H2F Z;  1K4D C;  4H13 B;  4DV0 O;  2Y48 A;  3CCL V;  3BEH A;  4MVM A;  3TXQ A;  1PPJ H;  1O9G A;  4K0K O;  5LHH A;  1V55 C;  5B3S C;  1JMK C;  1XIL A;  4PA9 A;  2OCH A;  2O57 A;  2F95 B;  4TOI A;  2E5L O;  2Q67 A;  1VIB A;  4DR1 O;  3BVO A;  3BA8 A;  4LC1 A;  4TT3 G;  2RQ6 A;  1G6U A;  3RT3 C;  3N27 A;  4FLX A;  3X2Q C;  3UT5 B;  4PD4 F;  3K04 A;  5LOV A;  4XBF A;  1HNW B;  1YIT V;  3IGA C;  5IYC O;  4LH6 A;  5A2Q N;  1XHZ A;  3DSQ A;  3TCU A;  4DR7 O;  1Q6U A;  4TUY B;  2OT5 A;  1YJN V;  2W6I G;  3ZHT A;  3K0D A;  2EIN B;  1GAX A;  2XOK G;  2R9I A;  1VQ6 V;  3RYC A;  3T1H O;  4DV3 B;  1Q3E A;  4DV7 B;  1NU1 H;  4J42 A;  2YXY A;  1KD1 W;  1V54 B;  4X1K B;  1XNR O;  4DV6 O;  4QNH B;  4WFG A;  2XAG A;  4G28 B;  3RYI B;  5FPR A;  5KUK A;  3B2E E;  3ZCC A;  1J5E O;  1IBL O;  1CXZ B;  4J9Y B;  4B3R B;  5DEC A;  2GUZ B;  3KCY A;  1M56 B;  3ABL B;  4EFE A;  5IYZ A;  5BR8 B;  2IU0 A;  4DUZ O;  5HFM A;  3ZN0 A;  3OR7 C;  2ITD C;  2YEV B;  4ZHQ B;  4NYK A;  3EHB B;  5LHI A;  4UVA A;  1HW7 A;  2ZR2 A;  3WG7 C;  1ZLZ A;  4UCU A;  3AEI A;  1SQV H;  3DC5 A;  1L0N H;  4GX0 A;  4JPR A;  4R7C A;  5CN0 A;  1F51 A;  3CRM A;  1RPO A;  5ITZ B;  1K8A W;  3FYE B;  2UXD O;  1LNQ A;  1KMI Z;  1GM8 A;  1T5E A;  2ZXW C;  5LGT A;  4O4H A;  5BXZ A;  5H6Q A;  5IY5 C;  1QVF U;  4UCS A;  5B1A C;  2UXC B;  2JVD A;  2L6L A;  3PN1 A;  3RYF A;  1N36 O;  3GWO A;  2AHY A;  1S77 D;  5CA1 A;  2B5U A;  1XMQ O;  1GMG A;  4DK1 A;  5B1B B;  5DN6 G;  1AVM A;  4J7K A;  4EB6 B;  4HYO A;  4HNA A;  2ZKO A;  1CEZ A;  4NTY A;  1YDX A;  4QPK A;  4FMT A;  2M7W A;  2OCC B;  1KKC A;  4FLU A;  1JPX A;  3OMI B;  3BA9 A;  3KKY A;  3WB1 A;  1EN6 A;  3HKB A;  4D7S A;  2ZD9 A;  5L3F A;  3UQ8 A;  5TIS Z;  1H2M A;  4I0X B;  1U96 A;  3I56 V;  2QWP B;  1OCC C;  1Q8I A;  3GB7 C;  1ARO P;  2PGG A;  2XUM A;  1M4U A;  3E8B A;  1UPG A;  2JDI G;  1S0V A;  2EZO A;  3BAB A;  4CS4 A;  3BRC A;  3T1Y O;  4BIO A;  3CX5 F;  4JYA B;  4DR3 O;  3SJC C;  5LP6 B;  4OXS A;  3CJH B;  2B9Z A;  1US6 A;  2XHB A;  1XOU A;  4AQY O;  4EEQ A;  3HKE B;  2BCC H;  5C93 A;  4DV2 O;  4JI0 B;  1PNL A;  2HHH B;  1FJG B;  4HAM A;  1I94 O;  3JD1 A;  2FYU H;  4X66 B;  2NNU A;  4QJF B;  1TUB A;  2F93 B;  1HNX O;  1VEW A;  4ZOL B;  2FKX A;  4Z2W A;  3G6E V;  4O2A A;  3EXA A;  2G38 A;  2Y0P A;  1B04 A;  3OT7 A;  1SQG A;  3E83 A;  3TGU H;  1M5I A;  1NT2 B;  3JAL B;  4RUE A;  1K92 A;  4DXW A;  2YIB A;  3K5N A;  5KUM A;  2KB1 A;  5CB4 A;  1DK1 A;  4JV5 O;  4WBN A;  4P9O A;  2N05 A;  5IWA O;  1VQM V;  1HR0 O;  3ASO B;  2Q9L A;  4JYC A;  3CEI A;  2UU9 O;  1KKD A;  3H9V A;  4LF6 B;  1W0J G;  2OWO A;  4JAU A;  5H5N A;  2LP7 A;  3OUF A;  1OCZ C;  1ZSP A;  4GLX A;  3F5T A;  2OTL V;  3OR6 C;  1U97 A;  1RP3 B;  2DOS A;  3ZRW B;  2QEX V;  4LF5 B;  4NTW A;  3OE7 G;  5KAF Z;  1BS3 A;  5LYJ A;  4RAI A;  4N21 A;  1BMF G;  1GTO A;  2XAQ A;  3A0B Z;  5IYB O;  1QQC A;  5BMV B;  3ZMS A;  1OCO B;  1OV9 A;  4J80 A;  3HKD A;  2M6Y A;  3SYA A;  2Y0I A;  1Y76 B;  4PA4 A;  4JI4 B;  4IIJ A;  4K0K B;  4TQF A;  4O4I B;  5EC2 C;  4O4J B;  1VQO V;  2E5L B;  3HB3 B;  2YIA A;  5E1A C;  1TGO A;  3Q4H A;  1OZ0 A;  2HEP A;  2NN4 A;  4LFB B;  3JSL A;  1NTK H;  2Z5U A;  1S5J A;  2EIJ C;  4K3A A;  1Q6I A;  1XRE A;  2DYR B;  3B8N A;  4O2B B;  2ZM6 O;  2ZNI A;  1EZV H;  4MVQ A;  1MAB G;  3IJ4 A;  3JD2 A;  3BAA A;  1AJN A;  2P7T C;  4DR7 B;  1BQZ A;  2DYS B;  4WFH A;  4GX1 A;  1N0J A;  1PNM A;  1S3J A;  4I9W A;  5K1X A;  4LF9 B;  3G71 V;  2PI4 A;  3THO A;  4E4E A;  2KSD A;  2CAZ C;  2ZR3 A;  4LF4 B;  2AXT Z;  3JAK B;  3IAY A;  5GON B;  2EIL C;  4ZIB A;  4GKJ B;  1FFT B;  3T1H B;  3BY6 A;  3KZI Z;  2Q7E A;  2ZE6 A;  4DV5 O;  1GN2 A;  4B3M O;  1ZL8 A;  2VWJ A;  5B1O A;  1UFI A;  2JRI A;  4W4K A;  1J5E B;  4I55 B;  3D3I A;  4ZKI A;  2CTP A;  2ZQM A;  1VQN V;  1S5L Z;  1M57 B;  2W0X A;  4OX9 O;  4DV1 O;  4UCV A;  4DW1 A;  4YY3 B;  1OCR B;  3K0G A;  2V1D A;  3HPL C;  3LSU A;  5J2U B;  4MVR A;  5FL7 G;  5IJ9 B;  1RM1 B;  3IC9 A;  1E1Q G;  4H44 B;  4UCR A;  2XND G;  1N8R W;  1JQ0 A;  4MVS A;  4WF9 V;  1SKV A;  1NTM H;  2JGU A;  1AP5 A;  3JAR B;  1FFX B;  1KU9 A;  5JQG A;  4QE7 A;  3NR7 A;  1EN4 A;  1KEC A;  3K5L A;  4X20 A;  4PA6 A;  2X7R B;  1FXH A;  3SGI A;  3FFQ A;  4JGS A;  5L3G A;  4PJ0 Z;  1YEW A;  2CDY A;  3A0H Z;  1Z5W A;  4R50 A;  2QTS A;  3VQY A;  3F7V C;  2IM9 A;  4X1K A;  4MTX A;  3ZIA G;  3ML0 A;  1KP2 A;  3CME V;  2P67 A;  3H1K H;  1AI6 A;  3B40 A;  2XAS A;  3G6B A;  3ZX6 A;  5CBH A;  2WLI A;  1K5S A;  2A9H A;  2GUZ A;  2IH1 C;  4K8X A;  2B1I A;  2P22 C;  2PUS A;  3W7X A;  1H8E G;  4FLY A;  1YXB A;  1WP8 A;  4BAY A;  5EZY B;  3FYI B;  1FXK B;  5LA6 B;  4KHP O;  1Q81 W;  2FB5 A;  2W6J G;  3EVK A;  3QO5 A;  2KQX A;  4TSF G;  2YEV A;  3JSN A;  5GW7 A;  2CTQ A;  1IZ3 A;  4JI6 O;  5EYP A;  4UB6 Z;  3QO8 A;  3MD0 A;  4UCT A;  1IX9 A;  4DR4 O;  4MTO A;  2RN9 A;  3WFV A;  3RYH B;  3O9O A;  3L74 H;  4F6R B;  2UXN A;  1IBM O;  3CRQ A;  4NXN O;  2ZIM A;  2UUB O;  4LWS A;  4DR2 B;  5ITZ A;  3M8A A;  3T1Y B;  2Q6A A;  3VBB A;  1V55 B;  3LDE A;  5B3S B;  2F4V B;  1K4C C;  1AI5 A;  4FZ0 A;  3C3S A;  1GKF A;  1R6T A;  3X2Q B;  2QSA A;  2UUC O;  3UM7 A;  5JH7 B;  3P3N A;  4KL1 A;  4YIP A;  5KHK A;  2KKW A;  3CSX A;  4LFA O;  3ABM C;  4N23 A;  1FXV A;  1N33 O;  2ADQ B;  3QO7 A;  4FM1 A;  2GBO A;  4AI8 A;  3ETD A;  4I7Z B;  4X64 O;  1KQS U;  1R1B A;  2OIE A;  3E8F A;  2CTW A;  3ICX A;  5IDJ A;  2QM4 A;  1YJ9 V;  3B4S A;  2Y4T A;  2XAH A;  5IWA B;  2R72 A;  2AZ2 A;  3K08 A;  1HR0 B;  1NKD A;  3WU2 Z;  4F6E A;  2GV9 A;  5D5Q A;  2UU9 B;  5F2V O;  4LF8 O;  1XEQ A;  1G1X B;  5B66 Z;  2X0L A;  4H0L B;  2F1M A;  4GKK B;  1S72 V;  1SA0 B;  1AJP A;  4YJ2 A;  4FIP C;  1IBK O;  4X62 O;  3CCQ V;  5JVD B;  4LFC O;  2QTO A;  3OFN G;  3JCZ A;  3VOU A;  4OGQ B;  1JFF B;  3F5W C;  3LDC A;  2EIM C;  4TV8 B;  3VQW A;  2OTJ V;  3CJH A;  2DMX A;  1VQK V;  3B8M A;  4PDL A;  4Q6G A;  1XDC A;  2AHZ A;  4JI1 O;  4YXW G;  5GTH Z;  3CC2 V;  4GUN A;  1XBL A;  2VQF O;  2JEU A;  2YXH A;  3QG5 A;  1EM1 A;  1WNS A;  1JA8 A;  4PV1 B;  2BSK B;  1AI4 A;  3WG7 B;  1JCH A;  4IL6 Z;  2X6B A;  1M90 W;  4JTA B;  1W2B U;  1JJO A;  2Q73 A;  3AG4 C;  2ARH A;  4JYB A;  4U3J A;  1QVG U;  3JAW B;  4JI2 O;  1AIL A;  3MDS A;  3ZHV A;  1P7G A;  2ODM A;  2LW1 A;  5LMU O;  1K33 A;  4MTF A;  4B7E A;  5KA6 A;  3E22 B;  1YCI A;  5CMU A;  1TVK A;  2QM7 A;  3L9D A;  2ZXW B;  4LBE C;  1Q86 W;  3ZN1 A;  2PY5 A;  2OYQ A;  5IY5 B;  2WA3 A;  4B3S B;  1R73 A;  3HR0 A;  2P90 A;  5B1A B;  3CXH F;  1XUQ A;  3E8G A;  3ZRV A;  3BCC H;  4FVM A;  1N34 O;  2ZIN A;  1A32 A;  4XDK A;  3OGI B;  2GTA A;  1Y6X A;  3QF7 A;  3H1I H;  2YIC A;  3MHH C;  4MT8 A;  1YZB A;  1SF9 A;  2WLJ A;  4Q20 A;  2BTQ B;  2CE4 A;  1RPR A;  3JAT B;  2KG7 B;  2DE0 X;  2K9P A;  2UXX A;  4I4T A;  1SQP H;  1W59 A;  3CCE V;  4YJ3 A;  3G4S V;  5LMN O;  4MVO A;  2ITC C;  5EBW C;  1WPB A;  1KC8 W;  2HFE C;  5KHJ A;  2JS3 A;  2F23 A;  3L75 H;  5BMV A;  5IT9 N;  5FNV B;  1M1K W;  4B3T O;  3N2K A;  4DV1 B;  3CD6 V;  1ROP A;  4DYL A;  4ZI7 A;  1H2N A;  3DC6 A;  4O4J A;  1YF2 A;  4JI8 B;  2E76 B;  4TQD A;  2JGD B;  1XHX A;  1L8D A;  3CCM V;  3OMA B;  1JJ2 U;  3N2G A;  3J81 N;  5DM6 V;  2JJ2 G;  3ZBH A;  4JI7 O;  5KAI Z;  5C8Y B;  4O4L A;  1Q82 W;  1QLE B;  5H6R A;  1H2S B;  2E3C A;  4TV9 B;  2DJV A;  1WA8 A;  3C3T A;  3IC7 A;  4I5S A;  2QKC A;  3JAK A;  1DF5 A;  2RNB A;  3HKC A;  4BIU A;  2ETN A;  3ETE A;  1H2L A;  4DUY B;  2HG5 C;  5J2T B;  5IYD O;  2EJR A;  1BZK A;  5IJ0 A;  2LJ2 A;  3ZJZ A;  1H2G A;  1K97 A;  4JI3 B;  1BGY H;  4LF7 O;  4LH7 A;  3ABK C;  5L3E A;  2Y4U A;  5LGN A;  3AG1 C;  2UUA B;  4U7O A;  1E79 G;  1QU7 A;  3CYO A;  2B1G A;  1Y66 A;  3ETG A;  5GTI Z;  1GRJ A;  3OUS A;  4RQF A;  2IU3 A;  3JD0 A;  3J7A U;  1OCZ B;  1MSW D;  5EC1 C;  1VQ7 V;  1YIJ V;  5J2U A;  4J7Z A;  5L3B A;  1VQ9 V;  4JAA A;  1Y74 A;  4IGG A;  2QWN B;  5B5E Z;  5B1B C;  3B09 A;  4DV4 B;  3K79 A;  2EIK C;  2BOC C;  4BW5 A;  1Z2G A;  5LBQ A;  3JAR A;  4DR6 O;  1FFX A;  2WLL A;  2P5O A;  4JI5 B;  4NXN B;  4BIZ A;  2ILM A;  2GHY A;  3RYC B;  5FLX N;  4DRX A;  1IVS A;  1BHB A;  1QBZ A;  3A2F A;  3SPG A;  4X1I A;  2XAJ A;  2EZP A;  4X65 O;  4FZ1 A;  1I5Y A;  2VQE O;  1NQT A;  4FLV A;  1S76 D;  2MK3 A;  2XT9 A;  2EIJ B;  1MZE A;  3C90 A;  4NXM B;  3W7S A;  2IBZ H;  2YS8 A;  1BL8 A;  1YI2 V;  4B08 A;  2UUC B;  1XMO B;  1R6N A;  1XNQ B;  5DED A;  2BE3 A;  1BSM A;  3CP1 A;  3K03 A;  4WFE A;  3VQV A;  1R3I C;  1GK9 A;  1NR7 A;  5LHG A;  4LFA B;  3H1J H;  1EBO A;  4RUF A;  5LGU A;  3CHX A;  4AHC A;  1N32 B;  2HP8 A;  1FPO A;  4X88 A;  1PP9 H;  2JEX A;  4W4L A;  1LUW A;  4NVP A;  3K9A A;  1XL6 A;  3L71 H;  4GX2 A;  3AK3 A;  3SJQ C;  3ZHQ A;  1N0N A;  2EIL B;  4UFZ A;  1F7Y A;  3FAV A;  1JR9 A;  4IHJ B;  1NH2 D;  4DV0 B;  3SPH A;  2ZE5 A;  2Z3Y A;  1MA1 A;  1I5X A;  1GO3 F;  2Y69 C;  4FM0 A;  1PNK A;  1WPX A;  2YDE A;  3CWB H;  3LSS A;  1AI7 A;  3KCX A;  2IJH A;  4PDM A;  1AB3 A;  4MVU A;  1Z5V A;  1WB8 A;  1KBH A;  4DR1 B;  3D36 A;  4LNU A;  4ABM A;  4O4H B;  4F6R A;  1V9P A;  2QWO B;  3U11 A;  2RJZ A;  5E79 Z;  4DV3 O;  3JD3 A;  3RYF B;  3FD9 A;  4FLT A;  1VQL V;  4MTG A;  5CA1 B;  5JJE B;  5LL6 Y;  2DW4 A;  2CH7 A;  1GH6 A;  4G27 B;  5JJJ B;  1NH2 B;  4HNA B;  1SQF A;  4B3R O;  1X4T A;  3S3W A;  3UKM A;  3H1H H;  2ZE8 A;  3RBZ A;  4FFB A;  2QKS A;  1I08 A;  3CS5 A;  1XNR B;  4OPH A;  4JI2 B;  1NS1 A;  3M99 B;  4DV6 B;  5BR8 O;  1JX9 A;  3HKB B;  5CA0 B;  2DWE C;  1N4C A;  1AP6 A;  4GX5 A;  3RGB A;  3CXC U;  4KP4 A;  5KHG A;  5K1P A;  1NZ6 A;  1IBL B;  5KMG B;  2WLH A;  4LR3 A;  3DTU B;  2IH3 C;  3ZHR A;  2YIB D;  2PYL A;  1N34 B;  4H33 A;  3AG2 C;  3RVY A;  3K9S A;  1K73 W;  2QJ1 A;  4DUZ B;  1COW G;  3E86 A;  2CTR A;  2RMK B;  4PA7 A;  1M9N A;  4MVZ A;  1SS3 A;  2Q0O C;  4KXR A;  2XTA A;  4IYI A;  3AG3 C;  3UT5 A;  2JIZ G;  4JZ2 A;  1JFF A;  4TV8 A;  1ENV A;  1K5Q A;  1TUB B;  2UXC O;  1IDS A;  4LCU C;  2DWD C;  4X1Y B;  4TUY A;  3O65 A;  4O2A B;  2UXD B;  3CCU V;  3OEE G;  4Z1V A;  3R65 A;  1VQ4 V;  3ASN C;  4R8C A;  2R9R B;  4B3T B;  1BHA A;  2Q69 A;  1WN7 A;  3RN4 A;  4HZ3 A;  4BW9 A;  4MS2 A;  3FB5 C;  1N36 B;  5CB4 B;  5EIB C;  4WBN B;  1TA8 A;  3RFR A;  3RYI A;  1XI1 A;  2PYJ A;  1XMQ B;  4UVB A;  2LGW A;  3SJA C;  1BE3 H;  5CBG A;  5A9G A;  2JJ1 G;  4JZG A;  3FB8 C;  1URF A;  3QVN A;  4J41 A;  4CBC A;  3CCJ V;  3E2E A;  3APQ A;  4NTX A;  2RDC A;  5LXT B;  3H1L H;  3L72 H;  1B6Q A;  2EX3 A;  3WB0 A;  1NI8 A;  3ABM B;  1WLE A;  4JYA O;  1M93 A;  1YSC A;  4ZHQ A;  5LYJ B;  1G4Y B;  1AR1 B;  4UV8 A;  1FS0 G;  3APO A;  3CRR A;  4X9Q A;  4JI0 O;  3ZED A;  2QM8 A;  1R3L C;  1FJG O;  1K7D A;  3GWK C;  3ZS8 C;  4X66 O;  3BFR A;  2VWK A;  3ZMT A;  4EKW A;  3HKD B;  2YI9 A;  2DN9 A;  2LQT A;  2ZNJ A;  4IIJ B;  1Q6H A;  3IFX A;  4DR3 B;  3DGE A;  3STZ C;  4LF7 B;  5KX5 B;  1SZT A;  3CRA A;  1UJW B;  4PI0 A;  3CMA V;  3Q4H B;  4AQY B;  1JVM A;  4DV2 B;  3OM3 B;  3MAQ A;  1I94 B;  3B77 A;  2X6C A;  3DXR B;  4D7T A;  1HNX B;  3ZMV A;  2EIM B;  1P7B A;  3QNE A;  3CC4 V;  2LW7 A;  4AIL C;  2YID A;  1AR5 A;  1FKA O;  1YHQ V;  3K5O A;  4EB6 A;  3G67 A;  3L70 H;  2YXL A;  4LF6 O;  5JJN B;  3CCR V;  4DR6 B;  3ETQ A;  2OIG A;  4FPP A;  2GSM B;  3BPZ A;  4UVC A;  2WAM A;  3LDD A;  4P30 A;  5AG2 A;  4X8A A;  1ZTE A;  3JAS B;  2ZDI A;  2ZIO A;  4JV5 B;  4TV9 A;  3TXS A;  3AG4 B;  3L73 H;  2PF4 E;  2QDO A;  4WFF A;  2Z0A A;  3LNN A;  4DR5 O;  5IE9 A;  1QHT A;  4LF5 O;  4I0X A;  2VQE B;  1ZL8 B;  3H01 A;  5EBL C;  2F43 G;  4Z1M G;  3SPI A;  3ZHS A;  3D36 C;  2AZ0 A;  2EBO A;  1MOF A;  5EK0 A;  1R3J C;  4DW0 A;  1WJZ A;  2IJJ A;  4J9Z B;  4BWA A;  3CB2 A;  3I55 V;  1GN3 A;  2XAF A;  4JI4 O;  2IJK A;  3AG7 A;  2EUL A;  4TWK A;  5LP6 A;  1ZWI C;  3S3X A;  4LFB O;  5CBF A;  2R70 A;  3HKE A;  3W7W A;  2HVJ C;  3D8C A;  2YSU B;  3T2M A;  4QPJ A;  4ZOL A;  5JQG B;  1KUQ A;  3RWR D;  4X20 B;  1EZJ A;  4FJC C;  2NR5 A;  2QA4 V;  4LF9 O;  3U0Z A;  1D5N A;  4P9P A;  3JAL A;  1P49 A;  2LFS A;  2ZT9 B;  2ZM6 B;  4LF4 O;  1Y4M A;  2WA4 A;  4C7U A;  4GKJ O;  1FAF A;  4I50 B;  1E1R G;  1Q7Y W;  4RQE A;  3JAM N;  1YTF D;  3A0R A;  4D6T H;  1RSO B;  5JCO A;  3T4D A;  5KHH A;  4NR1 A;  3SYQ A;  4BR6 A;  1SQB H;  1BCC H;  2WLI B;  2ADP A;  1PV0 A;  2A3Q A;  1DGS A;  3ZRW A;  4DV5 B;  2DQ3 A;  4B3M B;  4YY3 O;  3SJB C;  3MHS C;  3ABT A;  4H37 A;  2WWW A;  1LUV A;  4MW3 A;  4CH6 A;  1VP7 A;  4U3F H;  4MSW C;  1F4M A;  4ICG A;  5EYP B;  1OCC B;  4IHJ A;  4FLW A;  2EIN C;  1YTF B;  3OTO O;  2PZS A;  3EFF K;  4OX9 B;  1Y76 A;  2CUG A;  1FYJ A;  3E89 A;  3NXS A;  4LWS B;  1V54 C;  4O4I A;  1VQ8 V;  4NKG B;  1TUE B;  3ABK B;  2JS5 A;  5L3D A;  4O2B A;  3E8H A;  3ZHU A;  3AG1 B;  2LGQ A;  4GCZ A;  4R6Z A;  5BY1 A;  3CRC A;  2CK3 G;  3T1C A;  1M56 C;  5EBM C;  3ABL C;  1SC5 B;  1QLN A;  1VMG A;  4X89 A;  4WFB V;  2Q4P A;  2BOB C;  4CC6 A;  1HNZ O;  4RWU A;  1VF5 B;  1WAZ A;  4K35 A;  5GON A;  2A7W A;  2WLM A;  2EIK B;  3JCU Z;  4XDJ A;  3SDL A;  4DO2 A;  3F7Y C;  2PI5 A;  3T4Z A;  2CGN A;  3ZMU A;  3K57 A;  2R9A A;  4XDL A;  4ZBM A;  3K5M A;  3RW0 A;  3ZRX A;  1I0H A;  5CA0 A;  1TAE A;  4PDV A;  3JYC A;  4KUM A;  5L3C A;  2QKA A;  3P32 A;  1OHH G;  4I55 A;  5KMG A;  1PKX A;  4NB5 A;  4QE9 A;  2MW2 B;  2PTM A;  4YJ2 B;  1D2D A;  2Q7G A;  3GVM A;  1GM9 A;  5LOV B;  3OMN B;  4DK0 A;  1P4R A;  3QTC A;  4KHP B;  5IJ9 A;  4DR2 O;  3K3W A;  2UXB O;  2LO1 A;  4UXN A;  1IXM A;  2F4V O;  1K34 A;  1SER A;  1RFY A;  4JI6 B;  2W0F C;  2GTS A;  1H2K A;  4YHH O;  1EFR G;  4DR4 B;  2FML A;  2QE7 G;  1IBM B;  4J10 A;  1Q90 D;  2OCC C;  2VRZ A;  2UUB B;  1QLE C;  2YUA A;  2Y69 B;  2ZDI C;  1W0K G;  4RO2 A;  4X1Y A;  2GDS A;  4U3J B;  4U7N A;  3SPC A;  5KLV H;  3ZMZ A;  1QNM A;  1L0L H;  3VQX A;  2YC0 A;  1GN4 A;  1MSD A;  1TVK B;  1G8M A;  1K9M W;  4QGP A;  4ASU G;  2QR4 A;  4IYH A;  2P4V A;  1DF4 A;  3LNM B;  1SZX A;  5KHI A;  4FM2 A;  4UUJ C;  1JOY A;  1FD9 A;  2EJ7 A;  5IYZ B;  4FLZ A;  5CA3 A;  5LP6 C;  5J9P C;  1N33 B;  3RVZ A;  4UB8 Z;  1IXB A;  1PL4 A;  4HBN A;  2IW5 A;  3LSQ A;  3PJS K;  4X64 B;  4GKK O;  4CH3 A;  4JAS A;  1NVP D;  3UO3 A;  5LXT A;  2H8P C;  4QIW F;  2L35 A;  5KA5 A;  5EZY A;  3LUT B;  4GZR B;  3P3P A;  1FXK A;  5LA6 A;  1I7F A;  2LFR A;  4DR5 B;  1HNW O;  2WLK A;  4I4T B;  1R3K C;  4LF8 B;  3W7T A;  2N04 A;  2V4D A;  4YJ3 B;  2HVK C;  2WSS G;  3CC7 V;  1P84 F;  4J7J A;  2H3O A;  1VF6 A;  3RYH A;  1IBK B;  4UV9 A;  4X62 B;  4LFC B;  2P4K A;  1K3E A;  3I5D A;  3N2K B;  4DV7 O;  4ZI7 B;  4GYC B;  5JCO C;  5KX5 A;  3AG2 B;  2D2C B;  1SQQ H;  1J95 A;  5EIB D;  1XQ8 A;  2AW9 A;  1B3Q A;  3ASO C;  4PI2 A;  4JI1 B;  3OAA G;  4GT1 A;  3SYO A;  3E35 A;  1VQP V;  4CH5 A;  3UO2 A;  2VQF B;  5HFL A;  1NVP B;  3N2G B;  3AK2 A;  3DXR A;  3AG3 B;  1QR8 A;  4B3S O;  5JH7 A;  5FPO A;  1HP8 A;  3OGC C;  4O4L B;  4B7K A;  1MNG A;  1WA8 B;  2A06 H;  2QGN A;  1YVW A;  5LMU B;  4JTD B;  4A5U B;  3ASN B;  1THZ A;  3HKC B;  2HLD G;  1BQ0 A;  1F4N A;  1OCO C;  3JAS A;  3ZRS A;  2ATK C;  2WPD G;  1O9H A;  3JD4 A;  2WLN A;  1DLB A;  5IJ0 B;  1ZUQ A;  4PHZ A;  4I9Q A;  2X6A A;  5H9C A;  3U10 A;  1SQX H;  4G2K A;  1D5A A;  4JAV A;  3ABU A;  1PM9 A;  4JF3 A;  1SET A;  1XL4 A;  4KFM A;  4F4L A;  2Q68 A;  1SRY A;  2DYR C;  1SA0 A;  3FKS G;  3G80 A;  2N74 A;  5JVD A;  2H94 A;  1L1F A;  2NLJ C;  3BHP A;  2ZE7 A;  1PL0 A;  4PEL A;  2CGO A;  2DYS C;  3WB2 A;  4L8J A;  4JI8 O;  1ORQ C;  5LMN B;  2P6J A;  2YI8 A;  4OPA A;  1Y74 B;  2DQ0 A;  5B1N A;  2P06 A;  4L87 A;  3OW2 U;  4J11 A;  4P2Z A;  2BSK A;  2HR3 A;  4YIO A;  2QWQ B;  3OTO B;  1NBM G;  3SPJ A;  1CPY A;  3FX7 A;  2WLL B;  1VAR A;  1EN5 A;  3JAW A;  3K06 A;  4DRX B;  1QCE A;  1YJW V;  1VF7 A;  2E74 B;  4X1I B;  1KYO F;  1AJQ A;  3E22 A;  2D3O W;  2JK5 C;  4WCE V;  2C2A A;  4I50 A;  2QWR B;  1KB9 F;  3FB6 C;  4DUY O;  4JI7 B;  2Q8V A;  4IT5 A;  1M57 C;  1Q5O A;  1RSO A;  3TK1 A;  4LP8 A;  3TJT A;  2A79 B;  1OCR C;  1RM1 C;  3D3Q A;  3J80 N;  1NR1 A;  4CZZ A;  4JI3 O;  3SR2 C;  1HNZ B;  1PD3 A;  4PA3 A;  3KG2 A;  2UUA O;  1WB7 A;  2IJI A;  2BTQ A;  3W7U A;  2HJF C;  1H8H G;  4PDR A;  2HHH O;  1LR1 A;  3FAV B;  3JAT A;  5JWP A;  3TET A;  2KG7 A;  1X59 A;  1MG1 A;  1VQ5 V;  3CPW U;  4MW8 A;  1Q43 A;  1MZF A;  3UCS C;  4FFK A;  2FTK A;  3AK1 A;  1H38 A;  1ZAU A;  1KP3 A;  3CCV V;  2V7Q G;  1ZX3 A;  4UCO A;  4CS2 A;  3SYP A;  3CE2 A;  2AGA A;  3P30 A;  3STL C;  4WFA V;  1GM7 A;  4JYY A;  1OJH A;  4DV4 O;  4JTC B;  2BTO A;  4LNU B;  5FNV A;  3CCS V;  1HWY A;  2Q0A A;  2Q7H A;  3A8T A;  4JI5 O;  1DTO A;  2A0L A;  3SYC A;  1B06 A;  2UXB B;  1BT8 A;  4CH4 A;  3R66 A;  4CS3 A;  5BZB A;  2JGD A;  2HJD A;  2ZCE A;  2Q5Z A;  5D5P A;  1S5H C;  1HDJ A;  1QR9 A;  4YHH B;  3FB7 C;  4FK5 C;  1R6K A;  2VS0 A;  4NXM O;  2CH7 B;  2E75 B;  2F66 C;  5C8Y A;  1IUR A;  1XMO O; 
#chains in the Genus database with same CATH homology
 1J5E O;  1IBL O;  2VQE O;  4NXN O;  1XNQ O;  3J81 N;  2UUB O;  3M8A A;  4YHH O;  3OTO O;  4JI7 O;  4JYA O;  4JI4 O;  1FYJ A;  1N32 O;  4JI2 O;  1AIL A;  4B3S O;  4DUZ O;  4LFB O;  4DUY O;  3T1Y O;  2DJV A;  5LMU O;  1R6T A;  4JI0 O;  4DR3 O;  1FJG O;  4X66 O;  2UUC O;  4DV0 O;  4AQY O;  3J80 N;  5BY1 A;  4DV2 O;  4LFA O;  1KUQ A;  1I94 O;  4JI3 O;  4A5U B;  4K0K O;  2ZM6 O;  1F7Y A;  2E5L O;  1N33 O;  1HNX O;  1N34 O;  1A32 A;  2UUA O;  2FKX A;  4DR1 O;  4LF9 O;  2UXD O;  4X64 O;  1YZB A;  2HHH O;  3RT3 C;  1R1B A;  4LF7 O;  4LF4 O;  2UXC O;  1AB3 A;  1X59 A;  4GKJ O;  1HNZ O;  5BXZ A;  3SDL A;  3JAM N;  3O65 A;  4GKK O;  2LW7 A;  3J7A U;  5A2Q N;  4DR7 O;  2AGA A;  4LF8 O;  1N36 O;  1XEQ A;  2N74 A;  1G1X B;  1FKA O;  1DK1 A;  4DV4 O;  5LMN O;  4DV3 O;  4JV5 O;  4LF6 O;  1XMQ O;  5IWA O;  1HNW O;  4DV5 O;  1HR0 O;  4JI5 O;  4B3M O;  1IBK O;  4X62 O;  4LFC O;  5IT9 N;  2UU9 O;  4KHP O;  4JI8 O;  2ZKO A;  3T1H O;  4B3T O;  3R66 A;  5LL6 Y;  4OPA A;  4DR6 O;  2Z0A A;  5H5N A;  2JRI A;  4DR5 O;  1D2D A;  1XNR O;  4LF5 O;  4YY3 O;  4DV6 O;  4B3R O;  5FLX N;  4JI6 O;  4DR2 O;  4JI1 O;  2UXB O;  3F5T A;  4DR4 O;  4NXM O;  2VQF O;  4DV7 O;  4OX9 O;  2DOS A;  4DV1 O;  2F4V O;  4X65 O;  4OPH A;  1NS1 A;  1XMO O;  1IBM O;  5BR8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...