4X66O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x66O00
4A5UB 2VQFO 1A32A 4DV6O 4B3TO 3M8AA 4JI8O 4NXNO 4JI7O 1N32O 4OPHA 4DR7O 5LL6Y 2ZKOA 2UXBO 4AQYO 5IT9N 3RT3C 4DR5O 1FYJA 1XMQO 4DR2O 1HNXO 5BR8O 2VQEO 1IBKO 2N74A 2LW7A 4OPAA 4DUYO 1HR0O 4GKJO 1X59A 4DV4O 1FKAO 2UXCO 1AILA 2Z0AA 1HNWO 4DR4O 3J81N 1HNZO 4JI5O 3J7AU 2HHHO 4DV5O 1G1XB 4B3MO 4JI3O 4JV5O 2FKXA 1R1BA 4LF9O 1YZBA 4X66O 1J5EO 4X64O 4KHPO 4OX9O 1D2DA 4JI1O 5BY1A 1I94O 4B3RO 1XNQO 3SDLA 1IBMO 1AB3A 2UXDO 2DOSA 1NS1A 2JRIA 4DR1O 4LF8O 3J80N 4JI4O 1FJGO 4JI0O 4YY3O 1N34O 4LFAO 5IWAO 4LFBO 1KUQA 5A2QN 3OTOO 1XMOO 3JAMN 3R66A 4JYAO 4GKKO 4LF6O 4LF4O 5LMUO 4LFCO 4DV3O 1R6TA 4DR6O 1XEQA 2UUCO 5FLXN 2UUAO 4X62O 1IBLO 2UU9O 2UUBO 2AGAA 2DJVA 4LF7O 4DV7O 1N36O 3F5TA 4JI2O 4DV2O 4DV1O 4DR3O 1F7YA 4NXMO 1XNRO 5BXZA 4DV0O 5LMNO 4LF5O 1DK1A 3O65A 2ZM6O 5H5NA 4DUZO 3T1HO 2E5LO 4K0KO 4JI6O 4X65O 4YHHO 1N33O 2F4VO 4B3SO 3T1YO
chains in the Genus database with same CATH superfamily
3IC7A 3LUTB 3JASB 1KP2A 4YIOA 1KBHA 4FM1A 2YUAA 2DYSC 2CGOA 1WLEA 2AHYA 3B8NA 4JZGA 1OCRC 5DEDA 1XOUA 4DR2B 1S5LZ 1CXZB 1Q6UA 3SPGA 2NLJC 3WG7B 2LO1A 1B04A 3K58A 4LH7A 2KB1A 1HNWO 4R6ZA 2BTQA 2GSMB 4PJ0Z 4J10A 3CX5F 1M56C 1VQ4V 4J9YB 2A06H 1FXHA 1MABG 3ZMZA 4YJ2A 1K73W 5ITZB 1YJ9V 2ZNJA 4X66B 2JGDA 1NVPD 5TISZ 1AI7A 2UUBB 4GT1A 3SDLA 1K7DA 1FFXB 4L8JA 3RN4A 3JYCA 1MNGA 4JI0B 3BFRA 3OR7C 4DV0B 4ABMA 3S3XA 2HKOA 3GWOA 3RVZA 3ZJZA 5KX5A 2F4VB 3CJHB 1F23A 2UXBB 3D3QA 4BAYA 2PTMA 2IH3C 4UB6Z 4LF5B 3O65A 3OEHG 1SQFA 4X1IA 2E5LO 1VMGA 4BIOA 1ZWIC 1N33B 5LYJB 3F7VC 4XDJA 3N2KA 2UXDO 1N4CA 4UCSA 1Q86W 4NXNO 3K5NA 1Q81W 3D36A 1H8EG 3ZMVA 4N23A 1NQTA 1MZFA 4W4KA 1P49A 4AILC 1YJNV 1IBKO 4FMTA 3QF7A 1H8HG 1I0HA 3MD0A 2YIBA 3ZN1A 1Q43A 1Y6XA 1YIJV 1TVKB 2C2AA 2WLKA 3KCXA 1OCRB 4O4JA 1FJGB 2Q0AA 2OIEA 2XUMA 3QO8A 2GHYA 4YIPA 1R1BA 4LF9O 1KP3A 3SPHA 1YZBA 2GUZB 1DGSA 1CP9A 4H44B 4J7ZA 5D5QA 3JD4A 3M99B 1M56B 3ETEA 3W7TA 1I94O 3WU2Z 1WAZA 1V55B 1HDJA 2QWNB 5LP6C 3IFXA 1R3IC 1JPXA 3OTOO 2XTAA 2IJHA 4PDMA 3HB3B 3LSSA 3BCCH 2OWOA 2YSUB 1M9NA 1IURA 4QE7A 3BA9A 5F2VO 4JAVA 2E75B 4LF7O 1KQSU 1DF4A 2HFEC 2XAGA 2HG5C 2JGDB 4DV1O 1GM9A 1R3KC 1AJNA 2P4KA 1I5XA 1VQKV 1S77D 4UCTA 2Q8VA 2XASA 4KUMA 2OTJV 4FFBA 3CS5A 1HR0B 3CCQV 3OGCC 2LQTA 2ILMA 2CGNA 1HW7A 1VF5B 4P9PA 2VRZA 2EINC 4JI7O 1N32O 4LNUA 3K59A 2EZPA 2ZKOA 4NR1A 2CTRA 1OCOC 4X89A 1RSOA 2RJZA 5KX5B 3E83A 4DK0A 4F4LA 2XHBA 1G4YB 1O9GA 3SR2C 5J2TA 1JJ2U 2DE0X 1QCEA 5IWAB 3IAYA 4LC1A 4K8XA 1VQ8V 1VP7A 4B3MO 1Q3EA 2HP8A 2PUSA 3JARA 3K5OA 3D3IA 3N2KB 1Z5VA 4DO2A 5CA1A 5B1NA 5LHIA 2KSDA 1MG1A 1MSWD 3N2GB 3SJQC 3L72H 3VBBA 4DR1O 1WP7A 5GTHZ 1IXMA 2W0XA 3TGUH 4LFBO 2MK3A 1LNQA 3E22A 2BSKA 3R66A 1UPGA 1XL6A 2ZM6B 2E3CA 4X65B 4LFCO 1H2LA 5LBQA 1Q7YW 2A0LA 1IVSA 1PM9A 2W6JG 2Y69C 2CE4A 1OCCC 5LXTB 3OFNG 3JATA 3TJTA 4TUYA 2QKSA 5JCOA 5CB4A 2Q7EA 2JK5C 4DYLA 1XMQB 2VQEB 3CD6V 3RYCA 2FYUH 2N04A 2UXNA 4IYHA 1VQ6V 2ZR3A 1W59A 3CB2A 5FL7G 1LUVA 4DW1A 1YSCA 3ASNB 3DSQA 5LA6A 4NXNB 3THOA 1YEWA 1G6UA 3EHBB 1IDSA 5LGNA 1GN6A 3ABKC 1GRJA 1J5EB 2D2CB 1GN2A 3F5WC 2ZNIA 4PDVA 3QNEA 1JA8A 4TT3G 4CZZA 2FB5A 4TQFA 2FL4A 4CH6A 5B1OA 2FMLA 1Q90D 4IYIA 3FKSG 1R6KA 2AZ2A 3X2QC 1AJPA 5CA0A 1K8AW 5J2UB 3AG1B 4JYAB 3CC7V 3DXRB 1XDCA 1F4NA 1SETA 1PV0A 3CMEV 2R9IA 1JX9A 1V9PA 4G2KA 1SC5B 4LNUB 1YI2V 3H1LH 4X1KA 2V7QG 1AB3A 3OR6C 1RSOB 4LF8O 4UCOA 3OTOB 2AXTZ 2ZXWC 5EBMC 1QVFU 1EFRG 1Z5WA 5LOVB 2YI9A 4D7SA 1COWG 3FYIB 2HVJC 5JVDB 4O2AB 2W6IG 1JQ0A 2UUBO 5E79Z 3SJCC 4U3JA 4MTGA 2OT5A 1B06A 3E35A 4W4LA 3E8BA 3HR0A 1VQMV 1L0LH 4K35A 3ICXA 4O4HA 4DV0O 1SA0B 4J41A 5CA1B 4MTXA 1H2NA 3QTCA 3K5MA 1VF6C 3JSLA 4DRXB 1H2GA 2YXYA 1M57B 5KMGA 3HKCA 1KECA 2XAQA 2R9AA 2F4VO 1GO3F 4A5UB 1SS3A 3KG2A 3M8AA 4P9OA 5KAFZ 3U10A 1NBMG 4UB8Z 3C90A 2UXBO 3IC9A 3ZEDA 3B2EE 5IY5C 4B7EA 1RP3B 2ARHA 4YXWG 4PA7A 4FJCC 4TV9A 1SQPH 3JATB 4E4EA 4B3RB 2DYRB 2G38A 2XT9A 2QJ1A 1IBMB 4JF3A 5KA5A 4JTDB 3D8CA 1Y66A 1VF7A 1N34B 3WG7C 1MOFA 4QJFB 1K3EA 3CXCU 2W0FC 4NKGB 4C7UA 2IU3A 1L1FA 4DR6B 4BIZA 1U97A 1JMKC 2QTOA 5JQGA 1NJIW 1S72V 4JYBA 3WB0A 1TUBA 4DR1B 2NNUA 1I7FA 1W0JG 3OEEG 4XDKA 1FJGO 3G6BA 4XDLA 4LFBB 2ATKC 4BW5A 1QNMA 4N21A 5B1AB 1R6TA 5IJ0A 4UV9A 2ZXWB 3BPZA 3CP1A 1BZKA 2ZQMA 2QTSA 2X0LA 1JVMA 1SZTA 3JAKA 3JSNA 3SYOA 5LHGA 3CYOA 4Q6GA 1FS0G 4X1KB 3ZHUA 1AR5A 5EZYA 4FLXA 2UXCB 2NN4A 3OUFA 3JAWA 1VIBA 4TV8B 3I55V 1BCCH 4ZIBA 2BCCH 1XHZA 2A9HA 3KZIZ 1ZTEA 4JI3B 4GYCB 3GVMA 1MZEA 1GN4A 3RT3C 2H94A 1S0VA 1WA8B 4X1YA 4DK1A 1BSMA 1JJOA 4OX9B 2QKAA 3EFFK 1HR0O 1T5EA 3WFVA 1AILA 2GBOA 3G6EV 2DQ0A 4O4HB 4GX2A 3JCZA 4PA9A 3FX7A 1D5AA 4D6TH 2EILB 2Q4PA 1G1XB 2OCHA 3JALA 1AI6A 1N8RW 2CDYA 3CCVV 1U96A 3OT7A 4R8CA 3RYFB 4MVOA 2H8PC 3FD9A 4I0XA 4I4TA 3SYPA 4B08A 2DWEC 3CHXA 2CH7B 5FPOA 4DV7B 5B1BB 4WBNB 5DN6G 4LF8B 3J80N 3B09A 3VQYA 4JI4O 1TAEA 4L87A 3RGBA 4RQEA 4NXMB 3K0GA 5IWAO 1RM1C 5A2QN 1QQCA 4U7OA 1GKFA 1V55C 3K06A 3ZHTA 1H2MA 1AP6A 3WB1A 4LWSA 2ZR2A 4DR4B 3ZRWA 2WLLA 4U3FH 4TSFG 3NXSA 3RYHA 1ZUQA 4PDRA 2F66C 5JQGB 3ABUA 3QO5A 4WFEA 2Y0IA 3RFRA 3BEHA 2ZM6O 1K4CC 4X65O 2EIJC 2PI5A 4ZBMA 1GMGA 4DV6O 1HWYA 4O4LA 4OPHA 1Q6IA 2PI4A 3RBZA 4JGSA 3W7SA 4I7ZB 1XMQO 4G28B 2QEXV 2OIGA 3ABTA 2JGUA 2VQEO 3ML0A 4JI1B 4Z1MG 1WJZA 2QR4A 4U7NA 4FFKA 3ASOB 2AZ0A 1ZL8A 2P67A 3J81N 1K5SA 1D5NA 2OTLV 1YXBA 3IJ4A 2EULA 1ROPA 1R3LC 3LSQA 2EIMB 5KUMA 2CUGA 2Y4TA 1J5EO 3QO7A 1Y67A 3ZBHA 3ZX6A 1D2DA 3WB2A 1M93A 1K5QA 1N36B 2CK3G 3HKDB 2PYLA 3DGEA 1JFFA 1AI4A 4I55B 4JYAO 1K92A 1NR7A 1P84F 1NVPB 3FB5C 3AG2B 2HEPA 4ZI7A 1FFTB 3K9AA 1RM1B 5GW7A 1FXKA 4B7KA 4B3TB 3F7YC 1Q8IA 5JJNB 5C93A 2HJDA 3JALB 5JJJB 3CMAV 3CPWU 2Q6AA 5HFLA 5KHGA 1Y76A 1SQGA 4JAUA 4X20A 4I0XB 4I4TB 5EYPA 3IGAC 1XL4A 1NTZH 3CCMV 1O9HA 1GAXA 4UUJC 4DV4B 1JCHA 2BTQB 1BE3H 5FNVA 5EIBC 1SRYA 2V1DA 2JEXA 3K3WA 4YJ2B 4AQYO 2EIJB 2BOCC 1KC8W 1OJHA 1NI8A 4PI2A 1R73A 3ASNC 5CBFA 4FK5C 2Q69A 4CBCA 2LW7A 1QLEB 2XNDG 2IW5A 3S3WA 3RYHB 3LNNA 2Y4UA 3T2MA 2HLDG 2JIZG 2Z0AA 3APQA 4EB6A 3AG4B 3OMAB 3LDEA 3SJAC 2QA4V 2P6JA 2XOKG 2HR3A 4WFHA 1KB9F 3ZRXA 4ZKIA 1KKDA 4LF6B 1NH2B 3CWBH 3H1JH 5EIBD 3VQWA 4H37A 4ZOLA 4JYCA 3AG1C 4O4LB 2YXLA 4B3RO 2BOBC 2ZT9B 3CRRA 5IJ9A 1IBMO 1ZX3A 2XAJA 1WNSA 4JI4B 2QWRB 1N34O 4XBFA 1US6A 4LH6A 4X1IB 1K9MW 4PD4F 3CC2V 4FM0A 4DR6O 3W7UA 1ZL8B 1SF9A 2ZDIA 1NTMH 2WA4A 4QPKA 2JS3A 1H38A 2IJJA 3G4SV 1VQ7V 2A79B 5EC1C 1QLNA 3OM3B 4UV8A 3UCSC 4P30A 1VQPV 1P4RA 5H5NA 3GWKC 3FAVA 3K9SA 4O2BA 3R65A 4O4JB 4UCRA 3AK2A 1VARA 4RWUA 3OMIB 5H2FZ 2B5UA 3STZC 3TK1A 5L3EA 4DV6B 2IH1C 1M57C 5BZBA 3CEIA 3CE2A 1K97A 1XHXA 5A9GA 2ZD9A 3OTFA 1FXKB 1TGOA 5EC2C 4FZ1A 4GX1A 2UXCO 1XNQB 2EIKB 4FVMA 5L3CA 4X20B 3BABA 2YS8A 2F23A 3STLC 4X88A 4JTAB 2DYRC 3M7MX 1S5JA 5EBLC 4JI3O 4BR6A 5JCOC 3OUSA 2HJFC 4CS4A 2ZE8A 3G80A 5IYZA 3H1KH 2ZE5A 1XBLA 2WLMA 4R50A 4OX9O 2Z3YA 2UU9B 4FIPC 2P90A 2PGGA 1K33A 5GONA 4DV2B 3H1HH 1AP5A 2RDCA 4EKWA 1WP8A 4FFBB 2KG7A 1XI1A 5LGUA 5LMNB 4AHCA 4BW9A 1NKDA 1BT8A 3UKMA 5IDJA 1S76D 1PP9H 1XEQA 3UM7A 2D3OW 1DF5A 1AROP 2AGAA 2X6BA 3DTUB 4F6RA 5B1AC 3CCLV 4DV7O 5B5EZ 3K0DA 1WB7A 4P2ZA 3AEIA 2YICA 3AK3A 1F4MA 2A3QA 4NXMO 1VEWA 4MVUA 4FM2A 3AG3B 3E2EA 2WA3A 3FYEB 5IJ9B 4J11A 3TCUA 5J2TB 2DN9A 1NR1A 2L35A 4DR4O 3OW2U 2VQFO 1A32A 4EFEA 4G27B 5E1AC 3E86A 4JASA 3CCSV 2PY5A 3W7WA 4DV5B 2HHHB 3JARB 3OE7G 3HKBA 4AQYB 5C8YA 1EN4A 4NTXA 1JOYA 3K79A 1VF6A 3ZMUA 1R3JC 3E8GA 4X9QA 3K04A 2ADQB 2R9RB 4FLVA 1SERA 2YXHA 1ORQC 4HNAA 3E22B 4I50A 3MHSC 5B3SB 2BSKB 4LFAB 2WSSG 4FPPA 4UVBA 2CAZC 1I5YA 2F95B 3O9OA 4O2BB 5CBGA 4CS2A 4DXWA 2ZINA 1UFIA 3ZN0A 4KHPO 2UUAB 4RQFA 4Z2WA 2EILC 4JI1O 3RWRD 3P3PA 4TUYB 4UCUA 5EK0A 5EBWC 2LP7A 1DLBA 1SQVH 5CB4B 3CCUV 2K1EA 1ZAUA 4F6EA 4GUNA 4YY3O 2NR5A 4RAIA 3RYCB 1KUQA 3JD2A 1Q82W 2ZE7A 3EVKA 3TETA 5B1BC 4LR3A 4NTYA 4WFAV 5LA6B 2Q67A 1B6QA 5ITZA 1VQOV 2F43G 3L75H 3FB7C 2JEUA 1DTOA 1K4DC 1OCZB 3MHHC 1N36O 4JAAA 1BHAA 1YF2A 3OD4A 1EN6A 4K3AA 2YEVA 2WWWA 3ABMB 2LGWA 4DUYB 2IJIA 3CRAA 1S5HC 1VQLV 2PYJA 3DC5A 3PJSK 5CA0B 4MS2A 4D7TA 4B3TO 3G67A 1YJWV 5LL6Y 4X8AA 1X4TA 3CJHA 3I56V 5L3DA 4Z1VA 4WFBV 2RCVA 2P06A 1UJWB 2RN9A 2ADPA 3LSUA 4OPAA 2GTSA 2GDSA 4MSWC 4DV4O 2PZSA 3MDSA 2UXXA 1G8MA 5LYJA 4MVZA 2P5OA 3P3NA 3KKYA 3ASOC 3CSXA 3HKEA 1Q5OA 1QU7A 1GM8A 2Y0PA 4IL6Z 2QWPB 2UUCB 2YIAA 4AI8A 4PA4A 4U3JB 2BE3A 2EIMC 1THZA 4JI2B 5H6RA 1AR1B 4R7CA 2M7WA 3SYCA 4QPJA 4LBEC 1SKVA 4J42A 1YTFB 1BHBA 3HPLC 2ITCC 5KMGB 2P4VA 3APOA 5D5PA 3HKCB 4LF6O 1FAFA 5LMUO 4JI6B 3ZHQA 1YHQV 3N27A 1EZJA 1MA1A 4X62O 1VQ9V 2AW9A 2GTAA 1VQNV 2PF4E 2O57A 3AG2C 2IJKA 4FLYA 4H0LB 2LW1A 3U0ZA 1W0KG 1F7YA 3FB6C 5KA6A 4TV9B 4DR5B 1KD1W 1ENVA 3CCJV 4MW8A 3L71H 3SGIA 4CH4A 1Q6HA 2JJ2G 4KXRA 4GKJB 4GCZA 1K34A 3FB8C 2Q5ZA 3E8FA 4H13B 3Q4HA 4GX5A 2VQFB 1MMMA 2ZE6A 3P32A 1AJQA 2VWJA 1SQQH 3RW0A 5KAIZ 4JYYA 2QKCA 1PL0A 2ZIMA 2IU0A 2OCCB 3H01A 5BMVA 1SZXA 2YC0A 4MTOA 5B66Z 5LHHA 3JD3A 1Y74A 4X64B 2N74A 1S3JA 1TUBB 3ZS8C 1J95A 1M4UA 1OV9A 2F93B 4E2LA 3ZHSA 1PNKA 3CCRV 2YEVB 1QLEC 3B77A 3J7AU 2QM8A 3ZMTA 1XMOB 3SYQA 4MT8A 4GKKB 5KHKA 5IJ0B 4IGGA 3A0BZ 4UVAA 1RPOA 2LGQA 3A2FA 3AG4C 4KHPB 1JR9A 1IXBA 1IBLB 4I9QA 4EEQA 4TOIA 4B3SO 1XNQO 2DMXA 3JAKB 3B4SA 1TUEB 5IYCO 2WLIA 2V4DA 3ZHRA 3OAAG 4YY3B 2X7RB 1BGYH 5EZYB 2XAHA 3GB7C 3JAMN 2ODMA 3JAWB 4J7KA 4K0KB 4OXSA 4MVQA 2EX3A 3ZRSA 3L9DA 5JH7A 2E74B 2UU9O 3T1YB 4K8ZA 1YITV 4JI8B 3JD0A 5KHJA 2ZIOA 3HKEB 2R72A 4PI0A 1FXVA 3SPJA 3F5TA 4DR7B 4BIUA 4J80A 4X1YB 4DV2O 3N2GA 2EBOA 4PA6A 3D36C 3CRCA 3BA8A 5AG2A 5IE9A 5LMNO 1NH2D 1M90W 3JD1A 4ICGA 1XREA 4MVRA 2DYSB 3VQVA 1HNZB 5LP6A 3E89A 3QG5A 2R70A 3DC6A 1IX9A 3KCYA 5H6QA 1AVMA 4PA3A 4BWAA 1E1RG 5LXTA 2B1IA 3H9VA 5HFMA 4PHZA 1HNXO 5KHIA 4QGPA 1HP8A 2CTWA 4ZHQA 4CC6A 1YDXA 2X6CA 1PNMA 5IYDO 4OGQB 3TXSA 3PN1A 2JS5A 4CS3A 1FXKC 4KP4A 1KU9A 3LNMB 1BQZA 2HHHO 4DV5O 2Q7HA 4JV5O 2EIKC 1L8DA 4LWSB 2IM9A 4LF4B 3B8MA 5J9PC 2YIBD 4DV3B 3BAAA 3Q4HB 3ZRWB 2WLLB 4JTCB 2N05A 4FLTA 4IHJA 3CXHF 4CH3A 1W2BU 2DQ3A 1P7GA 2RNBA 2DWDC 4LCUC 3ZIAG 3C3SA 3SPCA 5BMVB 3A8TA 4DR3B 1Y74B 4Q20A 4TQDA 3TXQA 4LFAO 1GN3A 5KHHA 5LMUB 2Q68A 5J2UA 1E1QG 4DUZB 1EM1A 1ZSPA 3T1HB 4YHHB 3DXRA 4X62B 2UUAO 4LP8A 5JJEB 4B3SB 5CN0A 1WPBA 2ZCEA 3P30A 2OYQA 3CC4V 1PNLA 2CTQA 2YI8A 4UVCA 1XNRO 3LDCA 1QHTA 1WPXA 3EXAA 2BTOA 5L3GA 3T1CA 2GV9A 2WLIB 5LOVA 5CA3A 1VQ5V 1PD3A 3AG3C 5GTIZ 2K9PA 1HNWB 1L0NH 5JVDA 4O2AA 3VQXA 2YDEA 1H2SB 1TA8A 5IT9N 5JH7B 2X6AA 5K1PA 3L73H 5BR8O 3L70H 4GX0A 4HBNA 4NB5A 4MVMA 3MAQA 1SA0A 1OHHG 2YIDA 4DUYO 1X59A 4QIWF 1OZ0A 3OMNB 2ZDIC 2QGNA 3BY6A 4DRXA 1JFFB 1LR1A 4IT5A 5KLVH 1XQ8A 5IYBO 5L3BA 4JI5O 4FLUA 3RYIA 4ZI7B 2CTPA 1CPYA 2P22C 3C3TA 3SPIA 3ZHVA 5B3SC 5LP6B 4NYKA 4MTFA 2B1GA 1SQXH 1XUQA 2KKWA 5BY1A 1CEZA 1Y76B 2WPDG 3ETGA 1NS1A 4IIJA 1Y4MA 5EYPB 4CH5A 4MVSA 3UT5A 1WB8A 4ZHQB 1SQBH 1EZVH 3BRCA 3K03A 2XAFA 2E5LB 5FNVB 1F51A 1BL8A 2QE7G 2WLHA 4NVPA 2UUCO 2Y48A 1QBZA 1QR8A 2UXDB 2QM7A 4I5SA 2JDIG 3L74H 3H1IH 4JI2O 4J9ZB 3E8HA 2RMKB 1GH6A 2LFSA 4PV1B 5BXZA 4IHJB 1IBKB 1GTOA 3SJBC 1OCZC 4JPRA 1SESA 2EINB 4JI6O 1NU1H 1NTKH 4EB6B 2QSAA 1YCIA 1OCOB 1I08A 1FPOA 3ABMC 3UO3A 2FTKA 1NZ6A 2QDOA 3W7XA 4HAMA 1LUWA 4KFMA 1PL4A 4ZOLB 4LF9B 2JJ1G 2E76B 4FZ0A 5L3FA 4DR5O 1PKXA 4DR2O 1HNXB 2EJ7A 4FLWA 4PDLA 1MSDA 1N0NA 3ZRVA 2JVDA 3LDDA 4GKJO 1I94B 1FKAO 4J7JA 1Z2GA 4CC5A 1WN7A 5DM6V 3K57A 3U11A 4TV8A 4O4IA 3ZMSA 4HZ3A 2Q7GA 4JV5B 2Q9LA 2FKXA 1KYOF 1ZLZA 2ITDC 3AK1A 4UFZA 4X66O 4WF9V 2KQXA 1V54C 4QE9A 2VS0A 4X64O 4H33A 2DW4A 3JCUZ 1QVGU 1WA8A 5K1XA 1M5IA 3CRMA 4LF7B 2LJ2A 1YVWA 3BVOA 4ASUG 3OGIB 1FD9A 2JRIA 1AR4A 4DV1B 4JI0O 2VWKA 4EFBA 4YJ3A 1EBOA 5H9CA 4I9WA 1XMOO 3FAVB 3JASA 2Y69B 4GKKO 1NT2B 1OCCB 2L6LA 3UQ8A 5FLXN 1KKCA 2P7TC 3ABLC 4HYOA 4WFGA 5CMUA 1IBLO 5FPRA 3RYFA 3RYIB 2DJVA 1E79G 4DW0A 1GK9A 4JI7B 1N32B 5CBHA 2CH7A 4WBNA 1XNRB 3ETDA 4GZRB 4JZ2A 3RVYA 1BS3A 4LF5O 1DK1A 3CRQA 4MW3A 4K0KO 1XILA 1KMIZ 3K5LA 4IIJB 3ZCCA 1IZ3A 1N33O 3UT5B 2QWOB 3T1YO 3ABKB 4JI8O 3B40A 1URFA 1M1KW 1RFYA 2M6YA 4DR7O 4B3MB 4KL1A 2WLJA 1YTFD 2QWQB 4RO2A 5IYZB 1FFXA 5LGTA 1P7BA 1FYJA 5BR8B 1BMFG 3NR7A 3T4ZA 5GONB 3X2QB 4RUFA 3VOUA 5DECA 4RUEA 1R6NA 2OCCC 2Z5UA 2Q73A 1HNZO 2KG7B 4JI5B 2WAMA 1AI5A 5KUKA 2Q0OC 1EN5A 3AG7A 3BHPA 2WLNA 4LFCB 2EZOA 4WFFA 3QVNA 4F6RB 4PELA 2AHZA 4UCVA 2B9ZA 3T4DA 2IBZH 1N0JA 1QR9A 2DOSA 2QM4A 1V54B 1B3QA 2HVKC 2ETNA 1GM7A 2MW2B 2H3OA 3A0RA 2RQ6A 3I5DA 4LF4O 4TWKA 1BQ0A 4QNHB 5JWPA 4DV3O 3G71V 4O4IB 2EJRA 3SYAA 3HKBB 1H2KA 5C8YB 4FLZA 3K08A 4NTWA 4DR3O 4UXNA 1TVKA 3HKDA 3ABLB 2A7WA 3ETQA 4WCEV 3FFQA 3CCEV 4I55A 1PPJH 4DUZO 3T1HO 2LFRA 3A0HZ 2F1MA 4HNAB 4I50B 4YHHO 2GUZA 1RPRA 5IY5B 4GLXA 3UO2A 4YJ3B
chains in the Genus database with same CATH topology
4A5UB 2VQFO 1A32A 4DV6O 4B3TO 3M8AA 4JI8O 4NXNO 4JI7O 1N32O 4OPHA 4DR7O 5LL6Y 2ZKOA 2UXBO 4AQYO 5IT9N 3RT3C 4DR5O 1FYJA 1XMQO 4DR2O 1HNXO 5BR8O 2VQEO 1IBKO 2N74A 2LW7A 4OPAA 4DUYO 1HR0O 4GKJO 1X59A 4DV4O 1FKAO 2UXCO 1AILA 2Z0AA 1HNWO 4DR4O 3J81N 1HNZO 4JI5O 3J7AU 2HHHO 4DV5O 1G1XB 4B3MO 4JI3O 4JV5O 2FKXA 1R1BA 4LF9O 1YZBA 4X66O 1J5EO 4X64O 4KHPO 4OX9O 1D2DA 4JI1O 5BY1A 1I94O 4B3RO 1XNQO 3SDLA 1IBMO 1AB3A 2UXDO 2DOSA 1NS1A 2JRIA 4DR1O 4LF8O 3J80N 4JI4O 1FJGO 4JI0O 4YY3O 1N34O 4LFAO 5IWAO 4LFBO 1KUQA 5A2QN 3OTOO 1XMOO 3JAMN 3R66A 4JYAO 4GKKO 4LF6O 4LF4O 5LMUO 4LFCO 4DV3O 1R6TA 4DR6O 1XEQA 2UUCO 5FLXN 2UUAO 4X62O 1IBLO 2UU9O 2UUBO 2AGAA 2DJVA 4LF7O 4DV7O 1N36O 3F5TA 4JI2O 4DV2O 4DV1O 4DR3O 1F7YA 4NXMO 1XNRO 5BXZA 4DV0O 5LMNO 4LF5O 1DK1A 3O65A 2ZM6O 5H5NA 4DUZO 3T1HO 2E5LO 4K0KO 4JI6O 4X65O 4YHHO 1N33O 2F4VO 4B3SO 3T1YO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5U B;  2VQF O;  1A32 A;  4DV6 O;  4B3T O;  3M8A A;  4JI8 O;  4NXN O;  4JI7 O;  1N32 O;  4OPH A;  4DR7 O;  5LL6 Y;  2ZKO A;  2UXB O;  4AQY O;  5IT9 N;  3RT3 C;  4DR5 O;  1FYJ A;  1XMQ O;  4DR2 O;  1HNX O;  5BR8 O;  2VQE O;  1IBK O;  2N74 A;  2LW7 A;  4OPA A;  4DUY O;  1HR0 O;  4GKJ O;  1X59 A;  4DV4 O;  1FKA O;  2UXC O;  1AIL A;  2Z0A A;  1HNW O;  4DR4 O;  3J81 N;  1HNZ O;  4JI5 O;  3J7A U;  2HHH O;  4DV5 O;  1G1X B;  4B3M O;  4JI3 O;  4JV5 O;  2FKX A;  1R1B A;  4LF9 O;  1YZB A;  4X66 O;  1J5E O;  4X64 O;  4KHP O;  4OX9 O;  1D2D A;  4JI1 O;  5BY1 A;  1I94 O;  4B3R O;  1XNQ O;  3SDL A;  1IBM O;  1AB3 A;  2UXD O;  2DOS A;  1NS1 A;  2JRI A;  4DR1 O;  4LF8 O;  3J80 N;  4JI4 O;  1FJG O;  4JI0 O;  4YY3 O;  1N34 O;  4LFA O;  5IWA O;  4LFB O;  1KUQ A;  5A2Q N;  3OTO O;  1XMO O;  3JAM N;  3R66 A;  4JYA O;  4GKK O;  4LF6 O;  4LF4 O;  5LMU O;  4LFC O;  4DV3 O;  1R6T A;  4DR6 O;  1XEQ A;  2UUC O;  5FLX N;  2UUA O;  4X62 O;  1IBL O;  2UU9 O;  2UUB O;  2AGA A;  2DJV A;  4LF7 O;  4DV7 O;  1N36 O;  3F5T A;  4JI2 O;  4DV2 O;  4DV1 O;  4DR3 O;  1F7Y A;  4NXM O;  1XNR O;  5BXZ A;  4DV0 O;  5LMN O;  4LF5 O;  1DK1 A;  3O65 A;  2ZM6 O;  5H5N A;  4DUZ O;  3T1H O;  2E5L O;  4K0K O;  4JI6 O;  4X65 O;  4YHH O;  1N33 O;  2F4V O;  4B3S O;  3T1Y O; 
#chains in the Genus database with same CATH topology
 3IC7 A;  3LUT B;  3JAS B;  1KP2 A;  4YIO A;  1KBH A;  4FM1 A;  2YUA A;  2DYS C;  2CGO A;  1WLE A;  2AHY A;  3B8N A;  4JZG A;  1OCR C;  5DED A;  1XOU A;  4DR2 B;  1S5L Z;  1CXZ B;  1Q6U A;  3SPG A;  2NLJ C;  3WG7 B;  2LO1 A;  1B04 A;  3K58 A;  4LH7 A;  2KB1 A;  1HNW O;  4R6Z A;  2BTQ A;  2GSM B;  4PJ0 Z;  4J10 A;  3CX5 F;  1M56 C;  1VQ4 V;  4J9Y B;  2A06 H;  1FXH A;  1MAB G;  3ZMZ A;  4YJ2 A;  1K73 W;  5ITZ B;  1YJ9 V;  2ZNJ A;  4X66 B;  2JGD A;  1NVP D;  5TIS Z;  1AI7 A;  2UUB B;  4GT1 A;  3SDL A;  1K7D A;  1FFX B;  4L8J A;  3RN4 A;  3JYC A;  1MNG A;  4JI0 B;  3BFR A;  3OR7 C;  4DV0 B;  4ABM A;  3S3X A;  2HKO A;  3GWO A;  3RVZ A;  3ZJZ A;  5KX5 A;  2F4V B;  3CJH B;  1F23 A;  2UXB B;  3D3Q A;  4BAY A;  2PTM A;  2IH3 C;  4UB6 Z;  4LF5 B;  3O65 A;  3OEH G;  1SQF A;  4X1I A;  2E5L O;  1VMG A;  4BIO A;  1ZWI C;  1N33 B;  5LYJ B;  3F7V C;  4XDJ A;  3N2K A;  2UXD O;  1N4C A;  4UCS A;  1Q86 W;  4NXN O;  3K5N A;  1Q81 W;  3D36 A;  1H8E G;  3ZMV A;  4N23 A;  1NQT A;  1MZF A;  4W4K A;  1P49 A;  4AIL C;  1YJN V;  1IBK O;  4FMT A;  3QF7 A;  1H8H G;  1I0H A;  3MD0 A;  2YIB A;  3ZN1 A;  1Q43 A;  1Y6X A;  1YIJ V;  1TVK B;  2C2A A;  2WLK A;  3KCX A;  1OCR B;  4O4J A;  1FJG B;  2Q0A A;  2OIE A;  2XUM A;  3QO8 A;  2GHY A;  4YIP A;  1R1B A;  4LF9 O;  1KP3 A;  3SPH A;  1YZB A;  2GUZ B;  1DGS A;  1CP9 A;  4H44 B;  4J7Z A;  5D5Q A;  3JD4 A;  3M99 B;  1M56 B;  3ETE A;  3W7T A;  1I94 O;  3WU2 Z;  1WAZ A;  1V55 B;  1HDJ A;  2QWN B;  5LP6 C;  3IFX A;  1R3I C;  1JPX A;  3OTO O;  2XTA A;  2IJH A;  4PDM A;  3HB3 B;  3LSS A;  3BCC H;  2OWO A;  2YSU B;  1M9N A;  1IUR A;  4QE7 A;  3BA9 A;  5F2V O;  4JAV A;  2E75 B;  4LF7 O;  1KQS U;  1DF4 A;  2HFE C;  2XAG A;  2HG5 C;  2JGD B;  4DV1 O;  1GM9 A;  1R3K C;  1AJN A;  2P4K A;  1I5X A;  1VQK V;  1S77 D;  4UCT A;  2Q8V A;  2XAS A;  4KUM A;  2OTJ V;  4FFB A;  3CS5 A;  1HR0 B;  3CCQ V;  3OGC C;  2LQT A;  2ILM A;  2CGN A;  1HW7 A;  1VF5 B;  4P9P A;  2VRZ A;  2EIN C;  4JI7 O;  1N32 O;  4LNU A;  3K59 A;  2EZP A;  2ZKO A;  4NR1 A;  2CTR A;  1OCO C;  4X89 A;  1RSO A;  2RJZ A;  5KX5 B;  3E83 A;  4DK0 A;  4F4L A;  2XHB A;  1G4Y B;  1O9G A;  3SR2 C;  5J2T A;  1JJ2 U;  2DE0 X;  1QCE A;  5IWA B;  3IAY A;  4LC1 A;  4K8X A;  1VQ8 V;  1VP7 A;  4B3M O;  1Q3E A;  2HP8 A;  2PUS A;  3JAR A;  3K5O A;  3D3I A;  3N2K B;  1Z5V A;  4DO2 A;  5CA1 A;  5B1N A;  5LHI A;  2KSD A;  1MG1 A;  1MSW D;  3N2G B;  3SJQ C;  3L72 H;  3VBB A;  4DR1 O;  1WP7 A;  5GTH Z;  1IXM A;  2W0X A;  3TGU H;  4LFB O;  2MK3 A;  1LNQ A;  3E22 A;  2BSK A;  3R66 A;  1UPG A;  1XL6 A;  2ZM6 B;  2E3C A;  4X65 B;  4LFC O;  1H2L A;  5LBQ A;  1Q7Y W;  2A0L A;  1IVS A;  1PM9 A;  2W6J G;  2Y69 C;  2CE4 A;  1OCC C;  5LXT B;  3OFN G;  3JAT A;  3TJT A;  4TUY A;  2QKS A;  5JCO A;  5CB4 A;  2Q7E A;  2JK5 C;  4DYL A;  1XMQ B;  2VQE B;  3CD6 V;  3RYC A;  2FYU H;  2N04 A;  2UXN A;  4IYH A;  1VQ6 V;  2ZR3 A;  1W59 A;  3CB2 A;  5FL7 G;  1LUV A;  4DW1 A;  1YSC A;  3ASN B;  3DSQ A;  5LA6 A;  4NXN B;  3THO A;  1YEW A;  1G6U A;  3EHB B;  1IDS A;  5LGN A;  1GN6 A;  3ABK C;  1GRJ A;  1J5E B;  2D2C B;  1GN2 A;  3F5W C;  2ZNI A;  4PDV A;  3QNE A;  1JA8 A;  4TT3 G;  4CZZ A;  2FB5 A;  4TQF A;  2FL4 A;  4CH6 A;  5B1O A;  2FML A;  1Q90 D;  4IYI A;  3FKS G;  1R6K A;  2AZ2 A;  3X2Q C;  1AJP A;  5CA0 A;  1K8A W;  5J2U B;  3AG1 B;  4JYA B;  3CC7 V;  3DXR B;  1XDC A;  1F4N A;  1SET A;  1PV0 A;  3CME V;  2R9I A;  1JX9 A;  1V9P A;  4G2K A;  1SC5 B;  4LNU B;  1YI2 V;  3H1L H;  4X1K A;  2V7Q G;  1AB3 A;  3OR6 C;  1RSO B;  4LF8 O;  4UCO A;  3OTO B;  2AXT Z;  2ZXW C;  5EBM C;  1QVF U;  1EFR G;  1Z5W A;  5LOV B;  2YI9 A;  4D7S A;  1COW G;  3FYI B;  2HVJ C;  5JVD B;  4O2A B;  2W6I G;  1JQ0 A;  2UUB O;  5E79 Z;  3SJC C;  4U3J A;  4MTG A;  2OT5 A;  1B06 A;  3E35 A;  4W4L A;  3E8B A;  3HR0 A;  1VQM V;  1L0L H;  4K35 A;  3ICX A;  4O4H A;  4DV0 O;  1SA0 B;  4J41 A;  5CA1 B;  4MTX A;  1H2N A;  3QTC A;  3K5M A;  1VF6 C;  3JSL A;  4DRX B;  1H2G A;  2YXY A;  1M57 B;  5KMG A;  3HKC A;  1KEC A;  2XAQ A;  2R9A A;  2F4V O;  1GO3 F;  4A5U B;  1SS3 A;  3KG2 A;  3M8A A;  4P9O A;  5KAF Z;  3U10 A;  1NBM G;  4UB8 Z;  3C90 A;  2UXB O;  3IC9 A;  3ZED A;  3B2E E;  5IY5 C;  4B7E A;  1RP3 B;  2ARH A;  4YXW G;  4PA7 A;  4FJC C;  4TV9 A;  1SQP H;  3JAT B;  4E4E A;  4B3R B;  2DYR B;  2G38 A;  2XT9 A;  2QJ1 A;  1IBM B;  4JF3 A;  5KA5 A;  4JTD B;  3D8C A;  1Y66 A;  1VF7 A;  1N34 B;  3WG7 C;  1MOF A;  4QJF B;  1K3E A;  3CXC U;  2W0F C;  4NKG B;  4C7U A;  2IU3 A;  1L1F A;  4DR6 B;  4BIZ A;  1U97 A;  1JMK C;  2QTO A;  5JQG A;  1NJI W;  1S72 V;  4JYB A;  3WB0 A;  1TUB A;  4DR1 B;  2NNU A;  1I7F A;  1W0J G;  3OEE G;  4XDK A;  1FJG O;  3G6B A;  4XDL A;  4LFB B;  2ATK C;  4BW5 A;  1QNM A;  4N21 A;  5B1A B;  1R6T A;  5IJ0 A;  4UV9 A;  2ZXW B;  3BPZ A;  3CP1 A;  1BZK A;  2ZQM A;  2QTS A;  2X0L A;  1JVM A;  1SZT A;  3JAK A;  3JSN A;  3SYO A;  5LHG A;  3CYO A;  4Q6G A;  1FS0 G;  4X1K B;  3ZHU A;  1AR5 A;  5EZY A;  4FLX A;  2UXC B;  2NN4 A;  3OUF A;  3JAW A;  1VIB A;  4TV8 B;  3I55 V;  1BCC H;  4ZIB A;  2BCC H;  1XHZ A;  2A9H A;  3KZI Z;  1ZTE A;  4JI3 B;  4GYC B;  3GVM A;  1MZE A;  1GN4 A;  3RT3 C;  2H94 A;  1S0V A;  1WA8 B;  4X1Y A;  4DK1 A;  1BSM A;  1JJO A;  4OX9 B;  2QKA A;  3EFF K;  1HR0 O;  1T5E A;  3WFV A;  1AIL A;  2GBO A;  3G6E V;  2DQ0 A;  4O4H B;  4GX2 A;  3JCZ A;  4PA9 A;  3FX7 A;  1D5A A;  4D6T H;  2EIL B;  2Q4P A;  1G1X B;  2OCH A;  3JAL A;  1AI6 A;  1N8R W;  2CDY A;  3CCV V;  1U96 A;  3OT7 A;  4R8C A;  3RYF B;  4MVO A;  2H8P C;  3FD9 A;  4I0X A;  4I4T A;  3SYP A;  4B08 A;  2DWE C;  3CHX A;  2CH7 B;  5FPO A;  4DV7 B;  5B1B B;  4WBN B;  5DN6 G;  4LF8 B;  3J80 N;  3B09 A;  3VQY A;  4JI4 O;  1TAE A;  4L87 A;  3RGB A;  4RQE A;  4NXM B;  3K0G A;  5IWA O;  1RM1 C;  5A2Q N;  1QQC A;  4U7O A;  1GKF A;  1V55 C;  3K06 A;  3ZHT A;  1H2M A;  1AP6 A;  3WB1 A;  4LWS A;  2ZR2 A;  4DR4 B;  3ZRW A;  2WLL A;  4U3F H;  4TSF G;  3NXS A;  3RYH A;  1ZUQ A;  4PDR A;  2F66 C;  5JQG B;  3ABU A;  3QO5 A;  4WFE A;  2Y0I A;  3RFR A;  3BEH A;  2ZM6 O;  1K4C C;  4X65 O;  2EIJ C;  2PI5 A;  4ZBM A;  1GMG A;  4DV6 O;  1HWY A;  4O4L A;  4OPH A;  1Q6I A;  2PI4 A;  3RBZ A;  4JGS A;  3W7S A;  4I7Z B;  1XMQ O;  4G28 B;  2QEX V;  2OIG A;  3ABT A;  2JGU A;  2VQE O;  3ML0 A;  4JI1 B;  4Z1M G;  1WJZ A;  2QR4 A;  4U7N A;  4FFK A;  3ASO B;  2AZ0 A;  1ZL8 A;  2P67 A;  3J81 N;  1K5S A;  1D5N A;  2OTL V;  1YXB A;  3IJ4 A;  2EUL A;  1ROP A;  1R3L C;  3LSQ A;  2EIM B;  5KUM A;  2CUG A;  2Y4T A;  1J5E O;  3QO7 A;  1Y67 A;  3ZBH A;  3ZX6 A;  1D2D A;  3WB2 A;  1M93 A;  1K5Q A;  1N36 B;  2CK3 G;  3HKD B;  2PYL A;  3DGE A;  1JFF A;  1AI4 A;  4I55 B;  4JYA O;  1K92 A;  1NR7 A;  1P84 F;  1NVP B;  3FB5 C;  3AG2 B;  2HEP A;  4ZI7 A;  1FFT B;  3K9A A;  1RM1 B;  5GW7 A;  1FXK A;  4B7K A;  4B3T B;  3F7Y C;  1Q8I A;  5JJN B;  5C93 A;  2HJD A;  3JAL B;  5JJJ B;  3CMA V;  3CPW U;  2Q6A A;  5HFL A;  5KHG A;  1Y76 A;  1SQG A;  4JAU A;  4X20 A;  4I0X B;  4I4T B;  5EYP A;  3IGA C;  1XL4 A;  1NTZ H;  3CCM V;  1O9H A;  1GAX A;  4UUJ C;  4DV4 B;  1JCH A;  2BTQ B;  1BE3 H;  5FNV A;  5EIB C;  1SRY A;  2V1D A;  2JEX A;  3K3W A;  4YJ2 B;  4AQY O;  2EIJ B;  2BOC C;  1KC8 W;  1OJH A;  1NI8 A;  4PI2 A;  1R73 A;  3ASN C;  5CBF A;  4FK5 C;  2Q69 A;  4CBC A;  2LW7 A;  1QLE B;  2XND G;  2IW5 A;  3S3W A;  3RYH B;  3LNN A;  2Y4U A;  3T2M A;  2HLD G;  2JIZ G;  2Z0A A;  3APQ A;  4EB6 A;  3AG4 B;  3OMA B;  3LDE A;  3SJA C;  2QA4 V;  2P6J A;  2XOK G;  2HR3 A;  4WFH A;  1KB9 F;  3ZRX A;  4ZKI A;  1KKD A;  4LF6 B;  1NH2 B;  3CWB H;  3H1J H;  5EIB D;  3VQW A;  4H37 A;  4ZOL A;  4JYC A;  3AG1 C;  4O4L B;  2YXL A;  4B3R O;  2BOB C;  2ZT9 B;  3CRR A;  5IJ9 A;  1IBM O;  1ZX3 A;  2XAJ A;  1WNS A;  4JI4 B;  2QWR B;  1N34 O;  4XBF A;  1US6 A;  4LH6 A;  4X1I B;  1K9M W;  4PD4 F;  3CC2 V;  4FM0 A;  4DR6 O;  3W7U A;  1ZL8 B;  1SF9 A;  2ZDI A;  1NTM H;  2WA4 A;  4QPK A;  2JS3 A;  1H38 A;  2IJJ A;  3G4S V;  1VQ7 V;  2A79 B;  5EC1 C;  1QLN A;  3OM3 B;  4UV8 A;  3UCS C;  4P30 A;  1VQP V;  1P4R A;  5H5N A;  3GWK C;  3FAV A;  3K9S A;  4O2B A;  3R65 A;  4O4J B;  4UCR A;  3AK2 A;  1VAR A;  4RWU A;  3OMI B;  5H2F Z;  2B5U A;  3STZ C;  3TK1 A;  5L3E A;  4DV6 B;  2IH1 C;  1M57 C;  5BZB A;  3CEI A;  3CE2 A;  1K97 A;  1XHX A;  5A9G A;  2ZD9 A;  3OTF A;  1FXK B;  1TGO A;  5EC2 C;  4FZ1 A;  4GX1 A;  2UXC O;  1XNQ B;  2EIK B;  4FVM A;  5L3C A;  4X20 B;  3BAB A;  2YS8 A;  2F23 A;  3STL C;  4X88 A;  4JTA B;  2DYR C;  3M7M X;  1S5J A;  5EBL C;  4JI3 O;  4BR6 A;  5JCO C;  3OUS A;  2HJF C;  4CS4 A;  2ZE8 A;  3G80 A;  5IYZ A;  3H1K H;  2ZE5 A;  1XBL A;  2WLM A;  4R50 A;  4OX9 O;  2Z3Y A;  2UU9 B;  4FIP C;  2P90 A;  2PGG A;  1K33 A;  5GON A;  4DV2 B;  3H1H H;  1AP5 A;  2RDC A;  4EKW A;  1WP8 A;  4FFB B;  2KG7 A;  1XI1 A;  5LGU A;  5LMN B;  4AHC A;  4BW9 A;  1NKD A;  1BT8 A;  3UKM A;  5IDJ A;  1S76 D;  1PP9 H;  1XEQ A;  3UM7 A;  2D3O W;  1DF5 A;  1ARO P;  2AGA A;  2X6B A;  3DTU B;  4F6R A;  5B1A C;  3CCL V;  4DV7 O;  5B5E Z;  3K0D A;  1WB7 A;  4P2Z A;  3AEI A;  2YIC A;  3AK3 A;  1F4M A;  2A3Q A;  4NXM O;  1VEW A;  4MVU A;  4FM2 A;  3AG3 B;  3E2E A;  2WA3 A;  3FYE B;  5IJ9 B;  4J11 A;  3TCU A;  5J2T B;  2DN9 A;  1NR1 A;  2L35 A;  4DR4 O;  3OW2 U;  2VQF O;  1A32 A;  4EFE A;  4G27 B;  5E1A C;  3E86 A;  4JAS A;  3CCS V;  2PY5 A;  3W7W A;  4DV5 B;  2HHH B;  3JAR B;  3OE7 G;  3HKB A;  4AQY B;  5C8Y A;  1EN4 A;  4NTX A;  1JOY A;  3K79 A;  1VF6 A;  3ZMU A;  1R3J C;  3E8G A;  4X9Q A;  3K04 A;  2ADQ B;  2R9R B;  4FLV A;  1SER A;  2YXH A;  1ORQ C;  4HNA A;  3E22 B;  4I50 A;  3MHS C;  5B3S B;  2BSK B;  4LFA B;  2WSS G;  4FPP A;  4UVB A;  2CAZ C;  1I5Y A;  2F95 B;  3O9O A;  4O2B B;  5CBG A;  4CS2 A;  4DXW A;  2ZIN A;  1UFI A;  3ZN0 A;  4KHP O;  2UUA B;  4RQF A;  4Z2W A;  2EIL C;  4JI1 O;  3RWR D;  3P3P A;  4TUY B;  4UCU A;  5EK0 A;  5EBW C;  2LP7 A;  1DLB A;  1SQV H;  5CB4 B;  3CCU V;  2K1E A;  1ZAU A;  4F6E A;  4GUN A;  4YY3 O;  2NR5 A;  4RAI A;  3RYC B;  1KUQ A;  3JD2 A;  1Q82 W;  2ZE7 A;  3EVK A;  3TET A;  5B1B C;  4LR3 A;  4NTY A;  4WFA V;  5LA6 B;  2Q67 A;  1B6Q A;  5ITZ A;  1VQO V;  2F43 G;  3L75 H;  3FB7 C;  2JEU A;  1DTO A;  1K4D C;  1OCZ B;  3MHH C;  1N36 O;  4JAA A;  1BHA A;  1YF2 A;  3OD4 A;  1EN6 A;  4K3A A;  2YEV A;  2WWW A;  3ABM B;  2LGW A;  4DUY B;  2IJI A;  3CRA A;  1S5H C;  1VQL V;  2PYJ A;  3DC5 A;  3PJS K;  5CA0 B;  4MS2 A;  4D7T A;  4B3T O;  3G67 A;  1YJW V;  5LL6 Y;  4X8A A;  1X4T A;  3CJH A;  3I56 V;  5L3D A;  4Z1V A;  4WFB V;  2RCV A;  2P06 A;  1UJW B;  2RN9 A;  2ADP A;  3LSU A;  4OPA A;  2GTS A;  2GDS A;  4MSW C;  4DV4 O;  2PZS A;  3MDS A;  2UXX A;  1G8M A;  5LYJ A;  4MVZ A;  2P5O A;  3P3N A;  3KKY A;  3ASO C;  3CSX A;  3HKE A;  1Q5O A;  1QU7 A;  1GM8 A;  2Y0P A;  4IL6 Z;  2QWP B;  2UUC B;  2YIA A;  4AI8 A;  4PA4 A;  4U3J B;  2BE3 A;  2EIM C;  1THZ A;  4JI2 B;  5H6R A;  1AR1 B;  4R7C A;  2M7W A;  3SYC A;  4QPJ A;  4LBE C;  1SKV A;  4J42 A;  1YTF B;  1BHB A;  3HPL C;  2ITC C;  5KMG B;  2P4V A;  3APO A;  5D5P A;  3HKC B;  4LF6 O;  1FAF A;  5LMU O;  4JI6 B;  3ZHQ A;  1YHQ V;  3N27 A;  1EZJ A;  1MA1 A;  4X62 O;  1VQ9 V;  2AW9 A;  2GTA A;  1VQN V;  2PF4 E;  2O57 A;  3AG2 C;  2IJK A;  4FLY A;  4H0L B;  2LW1 A;  3U0Z A;  1W0K G;  1F7Y A;  3FB6 C;  5KA6 A;  4TV9 B;  4DR5 B;  1KD1 W;  1ENV A;  3CCJ V;  4MW8 A;  3L71 H;  3SGI A;  4CH4 A;  1Q6H A;  2JJ2 G;  4KXR A;  4GKJ B;  4GCZ A;  1K34 A;  3FB8 C;  2Q5Z A;  3E8F A;  4H13 B;  3Q4H A;  4GX5 A;  2VQF B;  1MMM A;  2ZE6 A;  3P32 A;  1AJQ A;  2VWJ A;  1SQQ H;  3RW0 A;  5KAI Z;  4JYY A;  2QKC A;  1PL0 A;  2ZIM A;  2IU0 A;  2OCC B;  3H01 A;  5BMV A;  1SZX A;  2YC0 A;  4MTO A;  5B66 Z;  5LHH A;  3JD3 A;  1Y74 A;  4X64 B;  2N74 A;  1S3J A;  1TUB B;  3ZS8 C;  1J95 A;  1M4U A;  1OV9 A;  2F93 B;  4E2L A;  3ZHS A;  1PNK A;  3CCR V;  2YEV B;  1QLE C;  3B77 A;  3J7A U;  2QM8 A;  3ZMT A;  1XMO B;  3SYQ A;  4MT8 A;  4GKK B;  5KHK A;  5IJ0 B;  4IGG A;  3A0B Z;  4UVA A;  1RPO A;  2LGQ A;  3A2F A;  3AG4 C;  4KHP B;  1JR9 A;  1IXB A;  1IBL B;  4I9Q A;  4EEQ A;  4TOI A;  4B3S O;  1XNQ O;  2DMX A;  3JAK B;  3B4S A;  1TUE B;  5IYC O;  2WLI A;  2V4D A;  3ZHR A;  3OAA G;  4YY3 B;  2X7R B;  1BGY H;  5EZY B;  2XAH A;  3GB7 C;  3JAM N;  2ODM A;  3JAW B;  4J7K A;  4K0K B;  4OXS A;  4MVQ A;  2EX3 A;  3ZRS A;  3L9D A;  5JH7 A;  2E74 B;  2UU9 O;  3T1Y B;  4K8Z A;  1YIT V;  4JI8 B;  3JD0 A;  5KHJ A;  2ZIO A;  3HKE B;  2R72 A;  4PI0 A;  1FXV A;  3SPJ A;  3F5T A;  4DR7 B;  4BIU A;  4J80 A;  4X1Y B;  4DV2 O;  3N2G A;  2EBO A;  4PA6 A;  3D36 C;  3CRC A;  3BA8 A;  5AG2 A;  5IE9 A;  5LMN O;  1NH2 D;  1M90 W;  3JD1 A;  4ICG A;  1XRE A;  4MVR A;  2DYS B;  3VQV A;  1HNZ B;  5LP6 A;  3E89 A;  3QG5 A;  2R70 A;  3DC6 A;  1IX9 A;  3KCY A;  5H6Q A;  1AVM A;  4PA3 A;  4BWA A;  1E1R G;  5LXT A;  2B1I A;  3H9V A;  5HFM A;  4PHZ A;  1HNX O;  5KHI A;  4QGP A;  1HP8 A;  2CTW A;  4ZHQ A;  4CC6 A;  1YDX A;  2X6C A;  1PNM A;  5IYD O;  4OGQ B;  3TXS A;  3PN1 A;  2JS5 A;  4CS3 A;  1FXK C;  4KP4 A;  1KU9 A;  3LNM B;  1BQZ A;  2HHH O;  4DV5 O;  2Q7H A;  4JV5 O;  2EIK C;  1L8D A;  4LWS B;  2IM9 A;  4LF4 B;  3B8M A;  5J9P C;  2YIB D;  4DV3 B;  3BAA A;  3Q4H B;  3ZRW B;  2WLL B;  4JTC B;  2N05 A;  4FLT A;  4IHJ A;  3CXH F;  4CH3 A;  1W2B U;  2DQ3 A;  1P7G A;  2RNB A;  2DWD C;  4LCU C;  3ZIA G;  3C3S A;  3SPC A;  5BMV B;  3A8T A;  4DR3 B;  1Y74 B;  4Q20 A;  4TQD A;  3TXQ A;  4LFA O;  1GN3 A;  5KHH A;  5LMU B;  2Q68 A;  5J2U A;  1E1Q G;  4DUZ B;  1EM1 A;  1ZSP A;  3T1H B;  4YHH B;  3DXR A;  4X62 B;  2UUA O;  4LP8 A;  5JJE B;  4B3S B;  5CN0 A;  1WPB A;  2ZCE A;  3P30 A;  2OYQ A;  3CC4 V;  1PNL A;  2CTQ A;  2YI8 A;  4UVC A;  1XNR O;  3LDC A;  1QHT A;  1WPX A;  3EXA A;  2BTO A;  5L3G A;  3T1C A;  2GV9 A;  2WLI B;  5LOV A;  5CA3 A;  1VQ5 V;  1PD3 A;  3AG3 C;  5GTI Z;  2K9P A;  1HNW B;  1L0N H;  5JVD A;  4O2A A;  3VQX A;  2YDE A;  1H2S B;  1TA8 A;  5IT9 N;  5JH7 B;  2X6A A;  5K1P A;  3L73 H;  5BR8 O;  3L70 H;  4GX0 A;  4HBN A;  4NB5 A;  4MVM A;  3MAQ A;  1SA0 A;  1OHH G;  2YID A;  4DUY O;  1X59 A;  4QIW F;  1OZ0 A;  3OMN B;  2ZDI C;  2QGN A;  3BY6 A;  4DRX A;  1JFF B;  1LR1 A;  4IT5 A;  5KLV H;  1XQ8 A;  5IYB O;  5L3B A;  4JI5 O;  4FLU A;  3RYI A;  4ZI7 B;  2CTP A;  1CPY A;  2P22 C;  3C3T A;  3SPI A;  3ZHV A;  5B3S C;  5LP6 B;  4NYK A;  4MTF A;  2B1G A;  1SQX H;  1XUQ A;  2KKW A;  5BY1 A;  1CEZ A;  1Y76 B;  2WPD G;  3ETG A;  1NS1 A;  4IIJ A;  1Y4M A;  5EYP B;  4CH5 A;  4MVS A;  3UT5 A;  1WB8 A;  4ZHQ B;  1SQB H;  1EZV H;  3BRC A;  3K03 A;  2XAF A;  2E5L B;  5FNV B;  1F51 A;  1BL8 A;  2QE7 G;  2WLH A;  4NVP A;  2UUC O;  2Y48 A;  1QBZ A;  1QR8 A;  2UXD B;  2QM7 A;  4I5S A;  2JDI G;  3L74 H;  3H1I H;  4JI2 O;  4J9Z B;  3E8H A;  2RMK B;  1GH6 A;  2LFS A;  4PV1 B;  5BXZ A;  4IHJ B;  1IBK B;  1GTO A;  3SJB C;  1OCZ C;  4JPR A;  1SES A;  2EIN B;  4JI6 O;  1NU1 H;  1NTK H;  4EB6 B;  2QSA A;  1YCI A;  1OCO B;  1I08 A;  1FPO A;  3ABM C;  3UO3 A;  2FTK A;  1NZ6 A;  2QDO A;  3W7X A;  4HAM A;  1LUW A;  4KFM A;  1PL4 A;  4ZOL B;  4LF9 B;  2JJ1 G;  2E76 B;  4FZ0 A;  5L3F A;  4DR5 O;  1PKX A;  4DR2 O;  1HNX B;  2EJ7 A;  4FLW A;  4PDL A;  1MSD A;  1N0N A;  3ZRV A;  2JVD A;  3LDD A;  4GKJ O;  1I94 B;  1FKA O;  4J7J A;  1Z2G A;  4CC5 A;  1WN7 A;  5DM6 V;  3K57 A;  3U11 A;  4TV8 A;  4O4I A;  3ZMS A;  4HZ3 A;  2Q7G A;  4JV5 B;  2Q9L A;  2FKX A;  1KYO F;  1ZLZ A;  2ITD C;  3AK1 A;  4UFZ A;  4X66 O;  4WF9 V;  2KQX A;  1V54 C;  4QE9 A;  2VS0 A;  4X64 O;  4H33 A;  2DW4 A;  3JCU Z;  1QVG U;  1WA8 A;  5K1X A;  1M5I A;  3CRM A;  4LF7 B;  2LJ2 A;  1YVW A;  3BVO A;  4ASU G;  3OGI B;  1FD9 A;  2JRI A;  1AR4 A;  4DV1 B;  4JI0 O;  2VWK A;  4EFB A;  4YJ3 A;  1EBO A;  5H9C A;  4I9W A;  1XMO O;  3FAV B;  3JAS A;  2Y69 B;  4GKK O;  1NT2 B;  1OCC B;  2L6L A;  3UQ8 A;  5FLX N;  1KKC A;  2P7T C;  3ABL C;  4HYO A;  4WFG A;  5CMU A;  1IBL O;  5FPR A;  3RYF A;  3RYI B;  2DJV A;  1E79 G;  4DW0 A;  1GK9 A;  4JI7 B;  1N32 B;  5CBH A;  2CH7 A;  4WBN A;  1XNR B;  3ETD A;  4GZR B;  4JZ2 A;  3RVY A;  1BS3 A;  4LF5 O;  1DK1 A;  3CRQ A;  4MW3 A;  4K0K O;  1XIL A;  1KMI Z;  3K5L A;  4IIJ B;  3ZCC A;  1IZ3 A;  1N33 O;  3UT5 B;  2QWO B;  3T1Y O;  3ABK B;  4JI8 O;  3B40 A;  1URF A;  1M1K W;  1RFY A;  2M6Y A;  4DR7 O;  4B3M B;  4KL1 A;  2WLJ A;  1YTF D;  2QWQ B;  4RO2 A;  5IYZ B;  1FFX A;  5LGT A;  1P7B A;  1FYJ A;  5BR8 B;  1BMF G;  3NR7 A;  3T4Z A;  5GON B;  3X2Q B;  4RUF A;  3VOU A;  5DEC A;  4RUE A;  1R6N A;  2OCC C;  2Z5U A;  2Q73 A;  1HNZ O;  2KG7 B;  4JI5 B;  2WAM A;  1AI5 A;  5KUK A;  2Q0O C;  1EN5 A;  3AG7 A;  3BHP A;  2WLN A;  4LFC B;  2EZO A;  4WFF A;  3QVN A;  4F6R B;  4PEL A;  2AHZ A;  4UCV A;  2B9Z A;  3T4D A;  2IBZ H;  1N0J A;  1QR9 A;  2DOS A;  2QM4 A;  1V54 B;  1B3Q A;  2HVK C;  2ETN A;  1GM7 A;  2MW2 B;  2H3O A;  3A0R A;  2RQ6 A;  3I5D A;  4LF4 O;  4TWK A;  1BQ0 A;  4QNH B;  5JWP A;  4DV3 O;  3G71 V;  4O4I B;  2EJR A;  3SYA A;  3HKB B;  1H2K A;  5C8Y B;  4FLZ A;  3K08 A;  4NTW A;  4DR3 O;  4UXN A;  1TVK A;  3HKD A;  3ABL B;  2A7W A;  3ETQ A;  4WCE V;  3FFQ A;  3CCE V;  4I55 A;  1PPJ H;  4DUZ O;  3T1H O;  2LFR A;  3A0H Z;  2F1M A;  4HNA B;  4I50 B;  4YHH O;  2GUZ A;  1RPR A;  5IY5 B;  4GLX A;  3UO2 A;  4YJ3 B; 
#chains in the Genus database with same CATH homology
 4A5U B;  2VQF O;  1A32 A;  4DV6 O;  4B3T O;  3M8A A;  4JI8 O;  4NXN O;  4JI7 O;  1N32 O;  4OPH A;  4DR7 O;  5LL6 Y;  2ZKO A;  2UXB O;  4AQY O;  5IT9 N;  3RT3 C;  4DR5 O;  1FYJ A;  1XMQ O;  4DR2 O;  1HNX O;  5BR8 O;  2VQE O;  1IBK O;  2N74 A;  2LW7 A;  4OPA A;  4DUY O;  1HR0 O;  4GKJ O;  1X59 A;  4DV4 O;  1FKA O;  2UXC O;  1AIL A;  2Z0A A;  1HNW O;  4DR4 O;  3J81 N;  1HNZ O;  4JI5 O;  3J7A U;  2HHH O;  4DV5 O;  1G1X B;  4B3M O;  4JI3 O;  4JV5 O;  2FKX A;  1R1B A;  4LF9 O;  1YZB A;  4X66 O;  1J5E O;  4X64 O;  4KHP O;  4OX9 O;  1D2D A;  4JI1 O;  5BY1 A;  1I94 O;  4B3R O;  1XNQ O;  3SDL A;  1IBM O;  1AB3 A;  2UXD O;  2DOS A;  1NS1 A;  2JRI A;  4DR1 O;  4LF8 O;  3J80 N;  4JI4 O;  1FJG O;  4JI0 O;  4YY3 O;  1N34 O;  4LFA O;  5IWA O;  4LFB O;  1KUQ A;  5A2Q N;  3OTO O;  1XMO O;  3JAM N;  3R66 A;  4JYA O;  4GKK O;  4LF6 O;  4LF4 O;  5LMU O;  4LFC O;  4DV3 O;  1R6T A;  4DR6 O;  1XEQ A;  2UUC O;  5FLX N;  2UUA O;  4X62 O;  1IBL O;  2UU9 O;  2UUB O;  2AGA A;  2DJV A;  4LF7 O;  4DV7 O;  1N36 O;  3F5T A;  4JI2 O;  4DV2 O;  4DV1 O;  4DR3 O;  1F7Y A;  4NXM O;  1XNR O;  5BXZ A;  4DV0 O;  5LMN O;  4LF5 O;  1DK1 A;  3O65 A;  2ZM6 O;  5H5N A;  4DUZ O;  3T1H O;  2E5L O;  4K0K O;  4JI6 O;  4X65 O;  4YHH O;  1N33 O;  2F4V O;  4B3S O;  3T1Y O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...