2CTPA

Solution structure of j-domain from human dnaj subfamily b menber 12
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
b'GSSGSSGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily B member 12
publication title Solution structure of J-domain from human DnaJ subfamily B menber 12
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ctpA01
1GH6A 2N04A 1IURA 2N05A 2YS8A 2L6LA 2QWOB 4J80A 1FAFA 2GUZB 3UO3A 1XBLA 2LO1A 3APOA 2M6YA 2QWPB 3BVOA 2DN9A 4RWUA 2Y4UA 2CTQA 2CTPA 2GUZA 2YUAA 3AG7A 2QWRB 1N4CA 1FPOA 3APQA 2EJ7A 2DMXA 1BQ0A 2Y4TA 2CUGA 3UCSC 1HDJA 2PF4E 2CTWA 2CTRA 4IT5A 2QWNB 1NZ6A 2KQXA 4J7ZA 1WJZA 3UO2A 1BQZA 2QSAA 2LGWA 2QWQB 2OCHA
chains in the Genus database with same CATH superfamily
1QR9A 4O4LB 4QJFB 5LHGA 4H13B 1BZKA 4EFBA 4TWKA 3T1YO 1VP7A 1D5NA 3P32A 5KUMA 1JCHA 2NR5A 3QO8A 4FZ0A 4N21A 3S3WA 4JYBA 1GN2A 4YJ2A 5B1BC 2ZXWB 2RMKB 4JI4O 4DR2O 1PP9H 1QLEB 4B3SO 5C8YA 4JI8O 1GMGA 3HR0A 2VQEO 4O2AA 4I9QA 3D8CA 4GKKB 4TV8A 4GX5A 2H3OA 2LGWA 5LP6A 3TXSA 2IJJA 3JD2A 1GN3A 4CC5A 2HJDA 1AVMA 2R70A 5JVDB 1HNXO 2JJ2G 4DV7B 4CH3A 2PY5A 2IH3C 3K9SA 2IU3A 4X20A 4ZIBA 1A32A 1K3EA 4JI6O 1K5QA 4JTAB 3A0HZ 4H37A 3L72H 4MVSA 4LFCB 1Q6HA 1AI4A 3DXRB 5K1XA 1Y74A 2ADPA 4FFBA 3UT5A 1YI2V 2UXCB 1Q43A 4LFAB 2ZNIA 2GBOA 3FYIB 1V55B 2MW2B 4F4LA 4I4TA 3BEHA 1MA1A 5LXTA 4DR7B 1OCZB 2Q69A 2Q9LA 2YS8A 3LSUA 5KAIZ 5GW7A 1NTMH 4FJCC 3CJHB 2P5OA 3JATB 4DV1O 4JI7B 4DV0B 1K73W 4NB5A 4J7ZA 2QA4V 1F4NA 4P30A 4XDJA 2HEPA 1XDCA 4K0KB 2FB5A 4KHPO 5BXZA 3SDLA 2Q0AA 1WP8A 3JAWB 5FPOA 1M56C 5B1AB 3MAQA 2F93B 3K5MA 4BIZA 1LNQA 4J41A 1GKFA 4Z1MG 2LFSA 3CCEV 2E74B 2WLNA 1EN6A 1OCCB 2FKXA 3CRRA 5IE9A 3W7SA 4MVOA 1ZWIC 1G6UA 3KZIZ 3OMNB 1UPGA 3DSQA 1H38A 3ZN1A 4X89A 2OWOA 1Q81W 2GDSA 3BY6A 2JK5C 2EILC 4FLUA 5CB4A 1AB3A 1KECA 4CZZA 5KAFZ 4MS2A 2YXYA 3AG4B 2YEVA 3JALA 4YIOA 2EX3A 4JPRA 1SRYA 3EVKA 3RGBA 4TV9B 2Q0OC 2V7QG 2UXDO 1S5LZ 3UO3A 4JASA 5FNVB 3FB6C 2M7WA 1BHAA 3ABTA 2QKCA 2BOBC 1I5XA 2Q67A 3OFNG 2CUGA 3ZMVA 3OM3B 1I94B 2KKWA 4BWAA 1RSOB 3J7AU 1WA8A 1N0NA 2W0XA 1FKAO 1ORQC 2P06A 4U3JA 5JJEB 5CBHA 2E3CA 2GV9A 1KUQA 4CH6A 3HKDB 5LHHA 3HPLC 1JJOA 3H1LH 3VQVA 2AW9A 2JS3A 1R6KA 5B5EZ 3AG2C 3H9VA 4LF5O 2BTOA 3CCSV 3FAVB 1PL0A 5IJ0B 4GKJO 1OV9A 4J9ZB 1I08A 4B7EA 2WPDG 3L73H 4P2ZA 3JASA 1M9NA 4J7KA 5JCOC 3B8MA 4KXRA 4RUFA 3EHBB 2Y0IA 4MVRA 1YDXA 1MSDA 4QIWF 3E8HA 2DYSC 4RAIA 3CB2A 4K35A 1AROP 3JARB 3TCUA 4ZOLB 1JJ2U 2QJ1A 4X64B 4U7NA 4LF8O 3T4DA 2ZT9B 3TJTA 3M7MX 4TQFA 5J2TB 2GUZA 2JIZG 3OE7G 3RWRD 5IYBO 1ZL8B 2QSAA 4ZBMA 4DUYO 2ZM6O 4HBNA 1FD9A 3OTOO 1IURA 3ZHTA 4IIJA 1VF5B 1KB9F 2ETNA 2CAZC 4LNUA 1NTZH 4DR3O 1HNZO 4AQYB 2E5LO 5KHHA 2OT5A 2OTJV 1VQ8V 2CDYA 1S3JA 3WFVA 1AILA 4QE9A 4EB6B 2F1MA 4MVUA 1NR1A 2EZPA 4K3AA 2PTMA 4JYAB 4DR1O 2UXBB 2K9PA 2OTLV 4X1KB 2Y69C 2UXNA 1JX9A 2PGGA 4C7UA 4MW3A 3TK1A 3NR7A 3QTCA 2QGNA 3JYCA 2ODMA 1Y67A 3EXAA 5LMNB 1JPXA 5IDJA 3ZHUA 1XNQO 3S3XA 3CCRV 4FLTA 4B3TB 1V55C 4NYKA 1VQPV 4O4IA 1HW7A 4LBEC 4KFMA 3G67A 3CCMV 5FL7G 5DEDA 1OCZC 1Q90D 1SZXA 2LW1A 1J5EB 1X59A 5L3DA 3WG7C 1NVPB 3SYCA 1ENVA 3PN1A 3DTUB 2YDEA 2R9IA 4UV9A 3UQ8A 1CEZA 4IHJB 5IY5C 3I5DA 2BSKA 1XREA 4JI5B 3U0ZA 4B3RO 3JAKB 2IM9A 3BPZA 5BZBA 3ZX6A 4G2KA 5LMUO 2DWDC 5BMVA 1SQXH 2CTWA 5EBWC 1SZTA 1RPOA 1RM1B 1U97A 1YCIA 2ATKC 3CRAA 5IWAO 1P7BA 1IBLO 3SYPA 1Z2GA 1BHBA 1F51A 1VQ9V 1EBOA 4DO2A 4PA6A 5J2UA 2XHBA 2IH1C 3E8FA 3KKYA 4NKGB 3N2KA 4DK1A 3OMAB 4WBNB 4WCEV 1QCEA 1W59A 3CE2A 3SJCC 3JSNA 5EC1C 5LYJB 1UJWB 1KMIZ 3J81N 4OPHA 4DK0A 5IJ9B 2AXTZ 1JFFA 3AG1B 4EFEA 1P7GA 1BQZA 2WLLA 4B3MB 3M99B 2OCCB 1YJ9V 1VMGA 5KX5B 1IVSA 5LOVA 4X65B 2Q7GA 4JTDB 2YSUB 2YIBA 1YITV 3SYOA 2QWNB 2UUAB 1VIBA 5JJJB 2UUBB 4UCSA 1M56B 4YHHO 4U7OA 1Q3EA 2QKSA 3L74H 3CC4V 2HVKC 2YIDA 5KLVH 1Y6XA 3OR6C 4JI3B 2CTPA 1S5HC 2ZNJA 3JAMN 2VRZA 3CXHF 1AJPA 4BIUA 3AG3C 1O9HA 4DV6B 3CX5F 1S0VA 4JI1B 1HNWO 5JH7A 2HHHO 3CCVV 2KSDA 1M90W 3HKBB 4JAUA 2VWKA 2R9RB 3IAYA 1ZLZA 2Z0AA 3CRQA 4PI0A 3LDDA 1FJGB 3MHSC 2K1EA 3T4ZA 3GWKC 1J95A 2Q7HA 1JA8A 2LFRA 2EIKB 5JWPA 4UB6Z 2HFEC 1IZ3A 3L75H 4B3MO 1IXBA 3FB8C 3DC5A 2PI5A 1S5JA 5KMGA 1W0KG 4DV2B 3A2FA 3ASOB 2WLMA 3RYHA 2CH7A 2KG7B 4IYIA 2L35A 1NBMG 2PZSA 5EZYB 1L0NH 1G8MA 5LGNA 2CK3G 3CP1A 1VF6A 4CS4A 5JQGB 1KD1W 3CD6V 4DR6O 1N34B 4DUZO 4D7SA 3PJSK 1Q82W 2F23A 4IL6Z 5FLXN 2VQFO 3OR7C 3P3NA 3RVZA 3AG2B 2PUSA 1FXKA 3OD4A 2DJVA 2Y4TA 3ZHVA 1PNLA 4CBCA 4FLZA 3SPHA 1V9PA 1COWG 4O4HB 1W0JG 2DYSB 4LWSA 2MK3A 1FXVA 4J9YB 2B1GA 5CA0A 3LDEA 4YY3B 1KYOF 4NXNB 3K58A 2ZDIC 1EZJA 1VQ7V 1XEQA 5DN6G 1QR8A 4R8CA 3AK3A 3T1HO 1SA0B 4ZI7B 3RYIA 5GONB 4O2BA 5EBLC 3SPGA 1FAFA 4GX2A 1MSWD 4AILC 1IBMB 3G71V 1U96A 2DE0X 2CTQA 1AI7A 1R3LC 1TVKB 1ZSPA 2YEVB 2HR3A 4B08A 1IBKO 1ROPA 3WU2Z 3E86A 2PYLA 3KG2A 3L70H 4LCUC 3RBZA 1AP6A 2X0LA 2EIJB 1IDSA 3G6EV 3CCLV 2P6JA 4U3FH 1H2MA 4MTGA 3K03A 2ILMA 3FYEB 1H2NA 4I50A 4HZ3A 1TUEB 4X66B 2YXHA 2H8PC 3HKEA 4DR4O 2UU9O 2E76B 1S76D 1US6A 2HJFC 1NI8A 3E22B 2WLIA 4LF9B 2A0LA 3K04A 4X62B 3ABLB 4DV3O 4WFBV 4JI2O 4MVMA 4BW5A 1QNMA 2Y69B 1O9GA 3D36C 3MD0A 1R6NA 1RM1C 2LW7A 2HLDG 3RYCA 1ZUQA 4QPKA 4BW9A 4MW8A 5CA3A 3BHPA 1Q8IA 4MSWC 3N2GA 4LC1A 2F95B 5IYZA 2CGOA 1ZAUA 3G80A 1YF2A 1VQNV 1KP3A 5H6RA 5K1PA 1GH6A 4TUYA 4HNAA 4GCZA 3AG1C 1GM8A 2Y48A 1I7FA 3HKCA 4UCOA 5IYDO 3WG7B 2OCCC 3CMAV 1N33B 3WB2A 1TUBB 5IY5B 3A8TA 5KHKA 2QM4A 1GN4A 4IT5A 5CN0A 4JF3A 4GKKO 2WA3A 1EN5A 3IJ4A 4UB8Z 4X1IB 3ZRXA 3ZHSA 1JR9A 2GUZB 5EYPB 5EK0A 4DXWA 2A7WA 3VOUA 5ITZA 1JVMA 4DV7O 1VQ5V 3OW2U 2F66C 2B1IA 2A06H 5EC2C 2OIGA 3B09A 2XAGA 5KA5A 4IIJB 1R3KC 3CCJV 4LF4B 5LP6C 1B6QA 1QBZA 4LFCO 1WLEA 4HAMA 2ZINA 3MHHC 4O4LA 4W4LA 1GN6A 5E79Z 2YICA 2JDIG 2UXCO 4LFAO 2A9HA 1SQVH 1QU7A 5BR8B 4KP4A 1QLNA 2XAHA 1SESA 4LF7B 1XMQB 1SQFA 1OZ0A 1N36B 1NVPD 4DR7O 1OJHA 2EIKC 4UCTA 5L3FA 3LNNA 4KL1A 4GT1A 1JOYA 4DRXA 1NTKH 3CPWU 4JI7O 4PA7A 1HR0B 4DV0O 4PA9A 3ASOC 1VQLV 1JMKC 5LA6B 1BGYH 1PV0A 1G4YB 4K0KO 3ZMTA 1RFYA 4R7CA 4UXNA 1SETA 3AG3B 2Z5UA 1S77D 1QVGU 4FLWA 1BSMA 2ADQB 2JEUA 2ITCC 2X6BA 3H1HH 5EBMC 4A5UB 4TOIA 4NTXA 1YEWA 2ZKOA 1HWYA 5HFLA 2Y4UA 4NXMB 3DXRA 4JYCA 4FLVA 3UKMA 1QHTA 1S72V 4YJ3B 3ML0A 3ICXA 2JGDA 3B2EE 4X1YB 1ZX3A 4WFGA 5B3SC 1XL4A 1SQPH 5J2UB 4Z2WA 1R3IC 4TQDA 2G38A 4DYLA 3QVNA 2P22C 3CJHA 4AHCA 5KHGA 1N32B 1JFFB 4F6RB 3ZHRA 3JATA 4MVZA 3QO7A 2A79B 1M5IA 3JD0A 1I94O 1VF7A 3ETDA 3H1JH 1YHQV 1KC8W 1MG1A 1EM1A 2WLJA 3N27A 3X2QB 2RDCA 3OUSA 4R6ZA 5LOVB 2EIJC 1NQTA 1NU1H 4OXSA 3SYQA 3ZEDA 2QWPB 4JI0B 3CCUV 4RO2A 3JAWA 3AK1A 4I9WA 2QTSA 1K34A 1GTOA 3MDSA 4I0XB 4LH7A 1AR1B 4DV4B 1PNKA 3O9OA 4DV5B 2H94A 3ZRVA 2PI4A 2IJIA 1YSCA 3M8AA 1XBLA 2BTQB 3ZHQA 3SJBC 1AI6A 3FD9A 3ABLC 3CC2V 4H33A 3TXQA 4E4EA 3SYAA 4WFAV 1DGSA 1K97A 2V1DA 3RYFB 4LF6B 4CS2A 4I55B 2UUCB 4X64O 4IYHA 1GK9A 3ETQA 3H1IH 4TV9A 2Q5ZA 3D3QA 3I56V 3ZMUA 5FNVA 3ZRWB 3K0DA 1F7YA 3LUTB 3STLC 4PDRA 2NN4A 5KMGB 2LP7A 1BL8A 1Q6UA 2YI9A 3GB7C 3RYHB 4DR5B 4YXWG 2ZR3A 2DYRB 4PA3A 3P3PA 2AGAA 4OX9B 4AQYO 3F5TA 2XAJA 2YIAA 2D3OW 3LDCA 4XDLA 3W7TA 2E75B 1V54B 3HKDA 1SS3A 3KCXA 3L71H 4J7JA 4PELA 2QM8A 3K5OA 1NKDA 5F2VO 3I55V 2JRIA 1D2DA 1SQQH 1Z5VA 3FAVA 2DQ0A 4UV8A 4ZHQB 4JYAO 2UXBO 4LFBB 5IJ0A 3W7XA 3E8GA 4JV5B 2DN9A 2FL4A 1FPOA 3Q4HB 1Y76B 2HP8A 1VQKV 4FM0A 3OMIB 4PD4F 5LMNO 5B1NA 1CPYA 1OHHG 3J80N 5JJNB 2OCHA 3LSQA 4X9QA 2Q73A 3ABUA 3R66A 1CXZB 3JARA 3OEEG 4B3TO 3IFXA 4ZOLA 3A0RA 2XUMA 5KHJA 2HG5C 4XBFA 2QR4A 1UFIA 1EN4A 1KKCA 4NR1A 1NH2D 5HFMA 4HYOA 1FS0G 2C2AA 4PJ0Z 1SC5B 3SPCA 4K8ZA 3CCQV 1JQ0A 1J5EO 4O2BB 2XASA 2LQTA 4YJ2B 2DQ3A 3IC7A 3LSSA 2XOKG 5LGUA 1PM9A 1H8EG 1M57C 1ZL8A 4CH5A 2N74A 5C8YB 4JI5O 3JCUZ 3SJQC 5L3GA 4O4JA 1T5EA 4O2AB 1YIJV 1XL6A 3GWOA 4TV8B 2HKOA 4RUEA 1GAXA 5LP6B 3K3WA 1EFRG 1Y4MA 2F4VB 4ASUG 2W6IG 1XMOB 1PPJH 5KUKA 2LO1A 1IXMA 3OGIB 5GTHZ 5DM6V 4X20B 1DLBA 2EINB 5J9PC 2IBZH 2OYQA 1GM9A 1L0LH 1NZ6A 3C90A 2RNBA 1GRJA 2ZE6A 2NNUA 3CWBH 5IT9N 2FMLA 1SQBH 3RYCB 2QEXV 1Y74B 4FFBB 4OPAA 5D5QA 3UT5B 2ZCEA 1QQCA 1K8AW 4X65O 3T1YB 4H44B 3IGAC 2ZE8A 2EBOA 1RPRA 3K08A 4I4TB 1WB8A 4PDMA 4FIPC 1SKVA 2LGQA 1BS3A 2UUAO 5LXTB 4ABMA 1R6TA 2UUBO 3CRCA 3B77A 1BCCH 4J80A 4I7ZB 3UM7A 2IW5A 1SQGA 2ZIMA 2QE7G 4JI4B 4IHJA 4DR2B 2KB1A 5CA1A 3CS5A 4B3SB 5C93A 1VQ4V 4B7KA 4J42A 4JI8B 4JI3O 2LJ2A 1WNSA 2O57A 4FFKA 3X2QC 3JAKA 2VQEB 3BAAA 1NT2B 2QKAA 5B1OA 1YJWV 1PD3A 1N8RW 1MABG 2Q6AA 3SPIA 4DV6O 4JI1O 1K92A 4F6EA 4BAYA 3KCYA 3LNMB 4MVQA 4LH6A 2XAQA 1HNXB 3BA9A 1FJGO 1YJNV 2ITDC 1K9MW 5B3SB 2IJHA 5H9CA 4ICGA 1I5YA 2W6JG 1E79G 1WP7A 5CBFA 2YC0A 5LYJA 4FZ1A 4JI6B 5IJ9A 1WPBA 1KKDA 5A2QN 4PI2A 1Q7YW 1PL4A 4FLYA 4DV2O 2YI8A 5CB4B 1YZBA 5L3BA 4JZ2A 4LR3A 2OIEA 5H5NA 1MZFA 3JALB 5KX5A 5H6QA 1H2KA 2CTRA 2PYJA 3H1KH 2BE3A 2RN9A 1B3QA 1N34O 4P9OA 4DRXB 4X8AA 1NH2B 1K5SA 4L8JA 3B8NA 4DV1B 4PA4A 2DYRC 4PDLA 1B04A 2P4VA 4X88A 1BT8A 3WB1A 1FFXA 4R50A 1WA8B 1VF6C 4IGGA 1GM7A 1FFTB 4U3JB 1K4CC 4KHPB 2Y0PA 2ZE7A 4CS3A 1V54C 4TSFG 2QWOB 4QGPA 3K79A 4UCUA 2GSMB 3HKBA 4UCVA 1IX9A 2DMXA 1BQ0A 4YY3O 4NXNO 1FYJA 2WSSG 1FXKC 3CHXA 4WF9V 3AK2A 3ZN0A 1P84F 2P90A 3ASNB 1QVFU 3JASB 3QO5A 1BMFG 1Y66A 1LUWA 4FVMA 3APOA 1H2GA 1IBMO 3B4SA 4RWUA 3K5NA 2ZE5A 2JVDA 3T2MA 1N4CA 2GTSA 3QF7A 2JGDB 2KG7A 2GHYA 2YIBD 1VQOV 5EZYA 2EIMB 2F43G 1L1FA 5JQGA 3E8BA 4LP8A 4FMTA 3RW0A 2UXDB 2ZQMA 5LHIA 4X66O 4Q20A 3BABA 1XHZA 5KHIA 1SERA 1XI1A 1HDJA 1MNGA 1WB7A 1ZTEA 4G27B 4WFFA 1DF4A 3ABKC 5LGTA 4LF9O 2R9AA 4P9PA 1R1BA 4UFZA 4JAAA 1M93A 1E1RG 2EZOA 2YXLA 2ZD9A 4I5SA 4X62O 3K06A 4LNUB 3R65A 1Q6IA 4FLXA 4WFHA 5JCOA 2Q68A 2DWEC 4O4HA 4GX1A 1F23A 3UCSC 3VQWA 3C3SA 2AHZA 3AEIA 1XNRB 4JTCB 3UO2A 4LF5B 3BRCA 1LUVA 2EINC 3E83A 2UXXA 3ABMB 1SA0A 4GKJB 4ZI7A 3G4SV 5GONA 5DECA 3ZCCA 4UVBA 2X7RB 4Q6GA 1VARA 3CRMA 1WPXA 1AR5A 2VS0A 1N33O 2AHYA 2A3QA 1EZVH 5LBQA 1TVKA 1KP2A 1M57B 2JJ1G 3K5LA 1R3JC 5EIBC 5TISZ 3F7YC 3CMEV 3NXSA 3RN4A 1NS1A 2X6CA 1N0JA 1K4DC 1HP8A 4O4IB 1OCOC 2WLHA 4QE7A 5FPRA 4LF8B 1L8DA 3THOA 2X6AA 1G1XB 3L9DA 5JVDA 3ETEA 3ETGA 1PKXA 4MTFA 3W7WA 3SGIA 2P67A 3ZJZA 1OCRB 3E22A 1THZA 2BSKB 4DUYB 2ZM6B 4LF4O 3OTOB 1MMMA 3B40A 1D5AA 4DR3B 4XDKA 1HNZB 5BMVB 1NJIW 2E5LB 3GVMA 2AZ0A 4CC6A 2DOSA 2XTAA 5BR8O 3JSLA 1XNRO 4LF7O 2ARHA 2IU0A 3CC7V 3TETA 1XUQA 1XMQO 4UVCA 3VBBA 2Z3YA 1H2LA 1N36O 2ZIOA 4PDVA 1DK1A 2L6LA 4AI8A 4OGQB 4DR1B 3N2KB 2V4DA 1AJNA 3CYOA 1XOUA 4J10A 4MTOA 4FM1A 3K0GA 1HR0O 3OT7A 2QTOA 2WLLB 2EULA 3QG5A 1TUBA 2Q4PA 4N23A 1XNQB 4EEQA 5BY1A 3CXCU 3BCCH 3A0BZ 3ZS8C 4WFEA 3F5WC 4UCRA 4X1IA 1YTFD 4QNHB 3BVOA 3HB3B 3U10A 5EYPA 2ZXWC 2RJZA 2JS5A 1QLEC 1TA8A 3W7UA 3C3TA 2QM7A 4NTWA 3T1CA 4D7TA 2EJRA 2W0FC 1P4RA 1F4MA 4K8XA 4O4JB 3K9AA 1YXBA 3E2EA 4B3RB 3VQXA 5AG2A 3FKSG 4QPJA 4NXMO 1XHXA 5LMUB 3OTFA 1GO3F 4DW0A 1AJQA 2CGNA 2Q7EA 1VQMV 3E35A 5JH7B 5EIBD 5E1AC 3CSXA 1TGOA 5IWAB 1MOFA 1IBLB 5D5PA 2HVJC 5L3CA 3SPJA 1M1KW 5IYCO 2XAFA 2RQ6A 3ASNC 1N32O 1DF5A 4EKWA 2XT9A 5B1BB 2D2CB 3RT3C 2B5UA 4BR6A 2BCCH 1AR4A 4BIOA 3RFRA 5LA6A 3FFQA 2CH7B 2EIMC 1RSOA 3VQYA 3EFFK 4MTXA 4JI0O 1Q5OA 2QWRB 3JD3A 1KBHA 1KU9A 2EJ7A 4MT8A 4FK5C 2PF4E 1NR7A 1TAEA 2WLKA 2WA4A 3D3IA 3G6BA 4GZRB 1WJZA 3OGCC 3ZMSA 3FB7C 4DV4O 4GX0A 4DV5O 4RQFA 5CA1B 1X4TA 4YHHB 5LL6Y 4CH4A 4E2LA 2N05A 1Q86W 3H01A 4TT3G 1FXKB 5B1AC 5KA6A 1RP3B 1I0HA 1HNWB 3OUFA 4NTYA 4YJ3A 3K59A 2CE4A 2IJKA 4LF6O 1AI5A 1OCCC 2HHHB 4X1YA 2UUCO 4LWSB 3DC6A 4H0LB 2AZ2A 1Z5WA 3ZMZA 5CA0B 4ZKIA 4UUJC 3FB5C 3SR2C 3ABMC 4DW1A 4FM2A 1W2BU 2DW4A 1PNMA 3RYIB 5J2TA 2KQXA 4F6RA 1E1QG 4G28B 5CBGA 3ZBHA 4L87A 2FYUH 3AG4C 2XNDG 5L3EA 4DR5O 5B66Z 2ZR2A 4OX9O 3ABKB 2JGUA 1DTOA 3JCZA 3JD4A 4JGSA 1URFA 1YVWA 3DGEA 2P4KA 3U11A 1LR1A 3BA8A 4DR6B 2B9ZA 4FPPA 4DUZB 3IC9A 3STZC 1YTFB 4I0XA 1B06A 2N04A 3OEHG 4I50B 4KUMA 4EB6A 2VQFB 4GUNA 1VQ6V 4D6TH 3HKEB 1OCRC 2M6YA 4LFBO 1FXHA 2BOCC 4YIPA 1H2SB 4PV1B 1FFXB 4GYCB 4J11A 1MZEA 2BTQA 2YUAA 2FTKA 4JV5O 2WLIB 2ZDIA 3E89A 4X1KA 3QNEA 1WAZA 4JYYA 1P49A 2EILB 3RYFA 5GTIZ 4Z1VA 4I55A 4NVPA 2QDOA 3P30A 4RQEA 1BE3H 3N2GB 1R73A 4W4KA 4GLXA 5IYZB 3SJAC 1XQ8A 1OCOB 3ZIAG 3ZRWA 3K57A 3ZRSA 3T1HB 4JAVA 1K33A 2WWWA 4TUYB 4HNAB 4PHZA 2QWQB 3HKCB 3JD1A 5H2FZ 1XILA 1SF9A 2GTAA 1IBKB 2JEXA 1H8HG 3F7VC 1M4UA 5A9GA 2WAMA 1WN7A 3TGUH 2RCVA 2NLJC 2R72A 1K7DA 2F4VO 3O65A 3D36A 5ITZB 5CMUA 2Q8VA 3WB0A 2VWJA 1XMOO 3OAAG 4ZHQA 3AG7A 4DR4B 2UU9B 1AP5A 3APQA 2P7TC 1KQSU 3CEIA 3RVYA 4JZGA 3Q4HA 1CP9A 3FX7A 1Y76A 1VEWA 4UVAA 4WBNA 4DV3B 4JI2B 3BFRA
chains in the Genus database with same CATH topology
1GH6A 2N04A 1IURA 2N05A 2YS8A 2L6LA 2QWOB 4J80A 1FAFA 2GUZB 3UO3A 1XBLA 2LO1A 3APOA 2M6YA 2QWPB 3BVOA 2DN9A 4RWUA 2Y4UA 2CTQA 2CTPA 2GUZA 2YUAA 3AG7A 2QWRB 1N4CA 1FPOA 3APQA 2EJ7A 2DMXA 1BQ0A 2Y4TA 2CUGA 3UCSC 1HDJA 2PF4E 2CTWA 2CTRA 4IT5A 2QWNB 1NZ6A 2KQXA 4J7ZA 1WJZA 3UO2A 1BQZA 2QSAA 2LGWA 2QWQB 2OCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GH6 A;  2N04 A;  1IUR A;  2N05 A;  2YS8 A;  2L6L A;  2QWO B;  4J80 A;  1FAF A;  2GUZ B;  3UO3 A;  1XBL A;  2LO1 A;  3APO A;  2M6Y A;  2QWP B;  3BVO A;  2DN9 A;  4RWU A;  2Y4U A;  2CTQ A;  2CTP A;  2GUZ A;  2YUA A;  3AG7 A;  2QWR B;  1N4C A;  1FPO A;  3APQ A;  2EJ7 A;  2DMX A;  1BQ0 A;  2Y4T A;  2CUG A;  3UCS C;  1HDJ A;  2PF4 E;  2CTW A;  2CTR A;  4IT5 A;  2QWN B;  1NZ6 A;  2KQX A;  4J7Z A;  1WJZ A;  3UO2 A;  1BQZ A;  2QSA A;  2LGW A;  2QWQ B;  2OCH A; 
#chains in the Genus database with same CATH topology
 1QR9 A;  4O4L B;  4QJF B;  5LHG A;  4H13 B;  1BZK A;  4EFB A;  4TWK A;  3T1Y O;  1VP7 A;  1D5N A;  3P32 A;  5KUM A;  1JCH A;  2NR5 A;  3QO8 A;  4FZ0 A;  4N21 A;  3S3W A;  4JYB A;  1GN2 A;  4YJ2 A;  5B1B C;  2ZXW B;  2RMK B;  4JI4 O;  4DR2 O;  1PP9 H;  1QLE B;  4B3S O;  5C8Y A;  4JI8 O;  1GMG A;  3HR0 A;  2VQE O;  4O2A A;  4I9Q A;  3D8C A;  4GKK B;  4TV8 A;  4GX5 A;  2H3O A;  2LGW A;  5LP6 A;  3TXS A;  2IJJ A;  3JD2 A;  1GN3 A;  4CC5 A;  2HJD A;  1AVM A;  2R70 A;  5JVD B;  1HNX O;  2JJ2 G;  4DV7 B;  4CH3 A;  2PY5 A;  2IH3 C;  3K9S A;  2IU3 A;  4X20 A;  4ZIB A;  1A32 A;  1K3E A;  4JI6 O;  1K5Q A;  4JTA B;  3A0H Z;  4H37 A;  3L72 H;  4MVS A;  4LFC B;  1Q6H A;  1AI4 A;  3DXR B;  5K1X A;  1Y74 A;  2ADP A;  4FFB A;  3UT5 A;  1YI2 V;  2UXC B;  1Q43 A;  4LFA B;  2ZNI A;  2GBO A;  3FYI B;  1V55 B;  2MW2 B;  4F4L A;  4I4T A;  3BEH A;  1MA1 A;  5LXT A;  4DR7 B;  1OCZ B;  2Q69 A;  2Q9L A;  2YS8 A;  3LSU A;  5KAI Z;  5GW7 A;  1NTM H;  4FJC C;  3CJH B;  2P5O A;  3JAT B;  4DV1 O;  4JI7 B;  4DV0 B;  1K73 W;  4NB5 A;  4J7Z A;  2QA4 V;  1F4N A;  4P30 A;  4XDJ A;  2HEP A;  1XDC A;  4K0K B;  2FB5 A;  4KHP O;  5BXZ A;  3SDL A;  2Q0A A;  1WP8 A;  3JAW B;  5FPO A;  1M56 C;  5B1A B;  3MAQ A;  2F93 B;  3K5M A;  4BIZ A;  1LNQ A;  4J41 A;  1GKF A;  4Z1M G;  2LFS A;  3CCE V;  2E74 B;  2WLN A;  1EN6 A;  1OCC B;  2FKX A;  3CRR A;  5IE9 A;  3W7S A;  4MVO A;  1ZWI C;  1G6U A;  3KZI Z;  3OMN B;  1UPG A;  3DSQ A;  1H38 A;  3ZN1 A;  4X89 A;  2OWO A;  1Q81 W;  2GDS A;  3BY6 A;  2JK5 C;  2EIL C;  4FLU A;  5CB4 A;  1AB3 A;  1KEC A;  4CZZ A;  5KAF Z;  4MS2 A;  2YXY A;  3AG4 B;  2YEV A;  3JAL A;  4YIO A;  2EX3 A;  4JPR A;  1SRY A;  3EVK A;  3RGB A;  4TV9 B;  2Q0O C;  2V7Q G;  2UXD O;  1S5L Z;  3UO3 A;  4JAS A;  5FNV B;  3FB6 C;  2M7W A;  1BHA A;  3ABT A;  2QKC A;  2BOB C;  1I5X A;  2Q67 A;  3OFN G;  2CUG A;  3ZMV A;  3OM3 B;  1I94 B;  2KKW A;  4BWA A;  1RSO B;  3J7A U;  1WA8 A;  1N0N A;  2W0X A;  1FKA O;  1ORQ C;  2P06 A;  4U3J A;  5JJE B;  5CBH A;  2E3C A;  2GV9 A;  1KUQ A;  4CH6 A;  3HKD B;  5LHH A;  3HPL C;  1JJO A;  3H1L H;  3VQV A;  2AW9 A;  2JS3 A;  1R6K A;  5B5E Z;  3AG2 C;  3H9V A;  4LF5 O;  2BTO A;  3CCS V;  3FAV B;  1PL0 A;  5IJ0 B;  4GKJ O;  1OV9 A;  4J9Z B;  1I08 A;  4B7E A;  2WPD G;  3L73 H;  4P2Z A;  3JAS A;  1M9N A;  4J7K A;  5JCO C;  3B8M A;  4KXR A;  4RUF A;  3EHB B;  2Y0I A;  4MVR A;  1YDX A;  1MSD A;  4QIW F;  3E8H A;  2DYS C;  4RAI A;  3CB2 A;  4K35 A;  1ARO P;  3JAR B;  3TCU A;  4ZOL B;  1JJ2 U;  2QJ1 A;  4X64 B;  4U7N A;  4LF8 O;  3T4D A;  2ZT9 B;  3TJT A;  3M7M X;  4TQF A;  5J2T B;  2GUZ A;  2JIZ G;  3OE7 G;  3RWR D;  5IYB O;  1ZL8 B;  2QSA A;  4ZBM A;  4DUY O;  2ZM6 O;  4HBN A;  1FD9 A;  3OTO O;  1IUR A;  3ZHT A;  4IIJ A;  1VF5 B;  1KB9 F;  2ETN A;  2CAZ C;  4LNU A;  1NTZ H;  4DR3 O;  1HNZ O;  4AQY B;  2E5L O;  5KHH A;  2OT5 A;  2OTJ V;  1VQ8 V;  2CDY A;  1S3J A;  3WFV A;  1AIL A;  4QE9 A;  4EB6 B;  2F1M A;  4MVU A;  1NR1 A;  2EZP A;  4K3A A;  2PTM A;  4JYA B;  4DR1 O;  2UXB B;  2K9P A;  2OTL V;  4X1K B;  2Y69 C;  2UXN A;  1JX9 A;  2PGG A;  4C7U A;  4MW3 A;  3TK1 A;  3NR7 A;  3QTC A;  2QGN A;  3JYC A;  2ODM A;  1Y67 A;  3EXA A;  5LMN B;  1JPX A;  5IDJ A;  3ZHU A;  1XNQ O;  3S3X A;  3CCR V;  4FLT A;  4B3T B;  1V55 C;  4NYK A;  1VQP V;  4O4I A;  1HW7 A;  4LBE C;  4KFM A;  3G67 A;  3CCM V;  5FL7 G;  5DED A;  1OCZ C;  1Q90 D;  1SZX A;  2LW1 A;  1J5E B;  1X59 A;  5L3D A;  3WG7 C;  1NVP B;  3SYC A;  1ENV A;  3PN1 A;  3DTU B;  2YDE A;  2R9I A;  4UV9 A;  3UQ8 A;  1CEZ A;  4IHJ B;  5IY5 C;  3I5D A;  2BSK A;  1XRE A;  4JI5 B;  3U0Z A;  4B3R O;  3JAK B;  2IM9 A;  3BPZ A;  5BZB A;  3ZX6 A;  4G2K A;  5LMU O;  2DWD C;  5BMV A;  1SQX H;  2CTW A;  5EBW C;  1SZT A;  1RPO A;  1RM1 B;  1U97 A;  1YCI A;  2ATK C;  3CRA A;  5IWA O;  1P7B A;  1IBL O;  3SYP A;  1Z2G A;  1BHB A;  1F51 A;  1VQ9 V;  1EBO A;  4DO2 A;  4PA6 A;  5J2U A;  2XHB A;  2IH1 C;  3E8F A;  3KKY A;  4NKG B;  3N2K A;  4DK1 A;  3OMA B;  4WBN B;  4WCE V;  1QCE A;  1W59 A;  3CE2 A;  3SJC C;  3JSN A;  5EC1 C;  5LYJ B;  1UJW B;  1KMI Z;  3J81 N;  4OPH A;  4DK0 A;  5IJ9 B;  2AXT Z;  1JFF A;  3AG1 B;  4EFE A;  1P7G A;  1BQZ A;  2WLL A;  4B3M B;  3M99 B;  2OCC B;  1YJ9 V;  1VMG A;  5KX5 B;  1IVS A;  5LOV A;  4X65 B;  2Q7G A;  4JTD B;  2YSU B;  2YIB A;  1YIT V;  3SYO A;  2QWN B;  2UUA B;  1VIB A;  5JJJ B;  2UUB B;  4UCS A;  1M56 B;  4YHH O;  4U7O A;  1Q3E A;  2QKS A;  3L74 H;  3CC4 V;  2HVK C;  2YID A;  5KLV H;  1Y6X A;  3OR6 C;  4JI3 B;  2CTP A;  1S5H C;  2ZNJ A;  3JAM N;  2VRZ A;  3CXH F;  1AJP A;  4BIU A;  3AG3 C;  1O9H A;  4DV6 B;  3CX5 F;  1S0V A;  4JI1 B;  1HNW O;  5JH7 A;  2HHH O;  3CCV V;  2KSD A;  1M90 W;  3HKB B;  4JAU A;  2VWK A;  2R9R B;  3IAY A;  1ZLZ A;  2Z0A A;  3CRQ A;  4PI0 A;  3LDD A;  1FJG B;  3MHS C;  2K1E A;  3T4Z A;  3GWK C;  1J95 A;  2Q7H A;  1JA8 A;  2LFR A;  2EIK B;  5JWP A;  4UB6 Z;  2HFE C;  1IZ3 A;  3L75 H;  4B3M O;  1IXB A;  3FB8 C;  3DC5 A;  2PI5 A;  1S5J A;  5KMG A;  1W0K G;  4DV2 B;  3A2F A;  3ASO B;  2WLM A;  3RYH A;  2CH7 A;  2KG7 B;  4IYI A;  2L35 A;  1NBM G;  2PZS A;  5EZY B;  1L0N H;  1G8M A;  5LGN A;  2CK3 G;  3CP1 A;  1VF6 A;  4CS4 A;  5JQG B;  1KD1 W;  3CD6 V;  4DR6 O;  1N34 B;  4DUZ O;  4D7S A;  3PJS K;  1Q82 W;  2F23 A;  4IL6 Z;  5FLX N;  2VQF O;  3OR7 C;  3P3N A;  3RVZ A;  3AG2 B;  2PUS A;  1FXK A;  3OD4 A;  2DJV A;  2Y4T A;  3ZHV A;  1PNL A;  4CBC A;  4FLZ A;  3SPH A;  1V9P A;  1COW G;  4O4H B;  1W0J G;  2DYS B;  4LWS A;  2MK3 A;  1FXV A;  4J9Y B;  2B1G A;  5CA0 A;  3LDE A;  4YY3 B;  1KYO F;  4NXN B;  3K58 A;  2ZDI C;  1EZJ A;  1VQ7 V;  1XEQ A;  5DN6 G;  1QR8 A;  4R8C A;  3AK3 A;  3T1H O;  1SA0 B;  4ZI7 B;  3RYI A;  5GON B;  4O2B A;  5EBL C;  3SPG A;  1FAF A;  4GX2 A;  1MSW D;  4AIL C;  1IBM B;  3G71 V;  1U96 A;  2DE0 X;  2CTQ A;  1AI7 A;  1R3L C;  1TVK B;  1ZSP A;  2YEV B;  2HR3 A;  4B08 A;  1IBK O;  1ROP A;  3WU2 Z;  3E86 A;  2PYL A;  3KG2 A;  3L70 H;  4LCU C;  3RBZ A;  1AP6 A;  2X0L A;  2EIJ B;  1IDS A;  3G6E V;  3CCL V;  2P6J A;  4U3F H;  1H2M A;  4MTG A;  3K03 A;  2ILM A;  3FYE B;  1H2N A;  4I50 A;  4HZ3 A;  1TUE B;  4X66 B;  2YXH A;  2H8P C;  3HKE A;  4DR4 O;  2UU9 O;  2E76 B;  1S76 D;  1US6 A;  2HJF C;  1NI8 A;  3E22 B;  2WLI A;  4LF9 B;  2A0L A;  3K04 A;  4X62 B;  3ABL B;  4DV3 O;  4WFB V;  4JI2 O;  4MVM A;  4BW5 A;  1QNM A;  2Y69 B;  1O9G A;  3D36 C;  3MD0 A;  1R6N A;  1RM1 C;  2LW7 A;  2HLD G;  3RYC A;  1ZUQ A;  4QPK A;  4BW9 A;  4MW8 A;  5CA3 A;  3BHP A;  1Q8I A;  4MSW C;  3N2G A;  4LC1 A;  2F95 B;  5IYZ A;  2CGO A;  1ZAU A;  3G80 A;  1YF2 A;  1VQN V;  1KP3 A;  5H6R A;  5K1P A;  1GH6 A;  4TUY A;  4HNA A;  4GCZ A;  3AG1 C;  1GM8 A;  2Y48 A;  1I7F A;  3HKC A;  4UCO A;  5IYD O;  3WG7 B;  2OCC C;  3CMA V;  1N33 B;  3WB2 A;  1TUB B;  5IY5 B;  3A8T A;  5KHK A;  2QM4 A;  1GN4 A;  4IT5 A;  5CN0 A;  4JF3 A;  4GKK O;  2WA3 A;  1EN5 A;  3IJ4 A;  4UB8 Z;  4X1I B;  3ZRX A;  3ZHS A;  1JR9 A;  2GUZ B;  5EYP B;  5EK0 A;  4DXW A;  2A7W A;  3VOU A;  5ITZ A;  1JVM A;  4DV7 O;  1VQ5 V;  3OW2 U;  2F66 C;  2B1I A;  2A06 H;  5EC2 C;  2OIG A;  3B09 A;  2XAG A;  5KA5 A;  4IIJ B;  1R3K C;  3CCJ V;  4LF4 B;  5LP6 C;  1B6Q A;  1QBZ A;  4LFC O;  1WLE A;  4HAM A;  2ZIN A;  3MHH C;  4O4L A;  4W4L A;  1GN6 A;  5E79 Z;  2YIC A;  2JDI G;  2UXC O;  4LFA O;  2A9H A;  1SQV H;  1QU7 A;  5BR8 B;  4KP4 A;  1QLN A;  2XAH A;  1SES A;  4LF7 B;  1XMQ B;  1SQF A;  1OZ0 A;  1N36 B;  1NVP D;  4DR7 O;  1OJH A;  2EIK C;  4UCT A;  5L3F A;  3LNN A;  4KL1 A;  4GT1 A;  1JOY A;  4DRX A;  1NTK H;  3CPW U;  4JI7 O;  4PA7 A;  1HR0 B;  4DV0 O;  4PA9 A;  3ASO C;  1VQL V;  1JMK C;  5LA6 B;  1BGY H;  1PV0 A;  1G4Y B;  4K0K O;  3ZMT A;  1RFY A;  4R7C A;  4UXN A;  1SET A;  3AG3 B;  2Z5U A;  1S77 D;  1QVG U;  4FLW A;  1BSM A;  2ADQ B;  2JEU A;  2ITC C;  2X6B A;  3H1H H;  5EBM C;  4A5U B;  4TOI A;  4NTX A;  1YEW A;  2ZKO A;  1HWY A;  5HFL A;  2Y4U A;  4NXM B;  3DXR A;  4JYC A;  4FLV A;  3UKM A;  1QHT A;  1S72 V;  4YJ3 B;  3ML0 A;  3ICX A;  2JGD A;  3B2E E;  4X1Y B;  1ZX3 A;  4WFG A;  5B3S C;  1XL4 A;  1SQP H;  5J2U B;  4Z2W A;  1R3I C;  4TQD A;  2G38 A;  4DYL A;  3QVN A;  2P22 C;  3CJH A;  4AHC A;  5KHG A;  1N32 B;  1JFF B;  4F6R B;  3ZHR A;  3JAT A;  4MVZ A;  3QO7 A;  2A79 B;  1M5I A;  3JD0 A;  1I94 O;  1VF7 A;  3ETD A;  3H1J H;  1YHQ V;  1KC8 W;  1MG1 A;  1EM1 A;  2WLJ A;  3N27 A;  3X2Q B;  2RDC A;  3OUS A;  4R6Z A;  5LOV B;  2EIJ C;  1NQT A;  1NU1 H;  4OXS A;  3SYQ A;  3ZED A;  2QWP B;  4JI0 B;  3CCU V;  4RO2 A;  3JAW A;  3AK1 A;  4I9W A;  2QTS A;  1K34 A;  1GTO A;  3MDS A;  4I0X B;  4LH7 A;  1AR1 B;  4DV4 B;  1PNK A;  3O9O A;  4DV5 B;  2H94 A;  3ZRV A;  2PI4 A;  2IJI A;  1YSC A;  3M8A A;  1XBL A;  2BTQ B;  3ZHQ A;  3SJB C;  1AI6 A;  3FD9 A;  3ABL C;  3CC2 V;  4H33 A;  3TXQ A;  4E4E A;  3SYA A;  4WFA V;  1DGS A;  1K97 A;  2V1D A;  3RYF B;  4LF6 B;  4CS2 A;  4I55 B;  2UUC B;  4X64 O;  4IYH A;  1GK9 A;  3ETQ A;  3H1I H;  4TV9 A;  2Q5Z A;  3D3Q A;  3I56 V;  3ZMU A;  5FNV A;  3ZRW B;  3K0D A;  1F7Y A;  3LUT B;  3STL C;  4PDR A;  2NN4 A;  5KMG B;  2LP7 A;  1BL8 A;  1Q6U A;  2YI9 A;  3GB7 C;  3RYH B;  4DR5 B;  4YXW G;  2ZR3 A;  2DYR B;  4PA3 A;  3P3P A;  2AGA A;  4OX9 B;  4AQY O;  3F5T A;  2XAJ A;  2YIA A;  2D3O W;  3LDC A;  4XDL A;  3W7T A;  2E75 B;  1V54 B;  3HKD A;  1SS3 A;  3KCX A;  3L71 H;  4J7J A;  4PEL A;  2QM8 A;  3K5O A;  1NKD A;  5F2V O;  3I55 V;  2JRI A;  1D2D A;  1SQQ H;  1Z5V A;  3FAV A;  2DQ0 A;  4UV8 A;  4ZHQ B;  4JYA O;  2UXB O;  4LFB B;  5IJ0 A;  3W7X A;  3E8G A;  4JV5 B;  2DN9 A;  2FL4 A;  1FPO A;  3Q4H B;  1Y76 B;  2HP8 A;  1VQK V;  4FM0 A;  3OMI B;  4PD4 F;  5LMN O;  5B1N A;  1CPY A;  1OHH G;  3J80 N;  5JJN B;  2OCH A;  3LSQ A;  4X9Q A;  2Q73 A;  3ABU A;  3R66 A;  1CXZ B;  3JAR A;  3OEE G;  4B3T O;  3IFX A;  4ZOL A;  3A0R A;  2XUM A;  5KHJ A;  2HG5 C;  4XBF A;  2QR4 A;  1UFI A;  1EN4 A;  1KKC A;  4NR1 A;  1NH2 D;  5HFM A;  4HYO A;  1FS0 G;  2C2A A;  4PJ0 Z;  1SC5 B;  3SPC A;  4K8Z A;  3CCQ V;  1JQ0 A;  1J5E O;  4O2B B;  2XAS A;  2LQT A;  4YJ2 B;  2DQ3 A;  3IC7 A;  3LSS A;  2XOK G;  5LGU A;  1PM9 A;  1H8E G;  1M57 C;  1ZL8 A;  4CH5 A;  2N74 A;  5C8Y B;  4JI5 O;  3JCU Z;  3SJQ C;  5L3G A;  4O4J A;  1T5E A;  4O2A B;  1YIJ V;  1XL6 A;  3GWO A;  4TV8 B;  2HKO A;  4RUE A;  1GAX A;  5LP6 B;  3K3W A;  1EFR G;  1Y4M A;  2F4V B;  4ASU G;  2W6I G;  1XMO B;  1PPJ H;  5KUK A;  2LO1 A;  1IXM A;  3OGI B;  5GTH Z;  5DM6 V;  4X20 B;  1DLB A;  2EIN B;  5J9P C;  2IBZ H;  2OYQ A;  1GM9 A;  1L0L H;  1NZ6 A;  3C90 A;  2RNB A;  1GRJ A;  2ZE6 A;  2NNU A;  3CWB H;  5IT9 N;  2FML A;  1SQB H;  3RYC B;  2QEX V;  1Y74 B;  4FFB B;  4OPA A;  5D5Q A;  3UT5 B;  2ZCE A;  1QQC A;  1K8A W;  4X65 O;  3T1Y B;  4H44 B;  3IGA C;  2ZE8 A;  2EBO A;  1RPR A;  3K08 A;  4I4T B;  1WB8 A;  4PDM A;  4FIP C;  1SKV A;  2LGQ A;  1BS3 A;  2UUA O;  5LXT B;  4ABM A;  1R6T A;  2UUB O;  3CRC A;  3B77 A;  1BCC H;  4J80 A;  4I7Z B;  3UM7 A;  2IW5 A;  1SQG A;  2ZIM A;  2QE7 G;  4JI4 B;  4IHJ A;  4DR2 B;  2KB1 A;  5CA1 A;  3CS5 A;  4B3S B;  5C93 A;  1VQ4 V;  4B7K A;  4J42 A;  4JI8 B;  4JI3 O;  2LJ2 A;  1WNS A;  2O57 A;  4FFK A;  3X2Q C;  3JAK A;  2VQE B;  3BAA A;  1NT2 B;  2QKA A;  5B1O A;  1YJW V;  1PD3 A;  1N8R W;  1MAB G;  2Q6A A;  3SPI A;  4DV6 O;  4JI1 O;  1K92 A;  4F6E A;  4BAY A;  3KCY A;  3LNM B;  4MVQ A;  4LH6 A;  2XAQ A;  1HNX B;  3BA9 A;  1FJG O;  1YJN V;  2ITD C;  1K9M W;  5B3S B;  2IJH A;  5H9C A;  4ICG A;  1I5Y A;  2W6J G;  1E79 G;  1WP7 A;  5CBF A;  2YC0 A;  5LYJ A;  4FZ1 A;  4JI6 B;  5IJ9 A;  1WPB A;  1KKD A;  5A2Q N;  4PI2 A;  1Q7Y W;  1PL4 A;  4FLY A;  4DV2 O;  2YI8 A;  5CB4 B;  1YZB A;  5L3B A;  4JZ2 A;  4LR3 A;  2OIE A;  5H5N A;  1MZF A;  3JAL B;  5KX5 A;  5H6Q A;  1H2K A;  2CTR A;  2PYJ A;  3H1K H;  2BE3 A;  2RN9 A;  1B3Q A;  1N34 O;  4P9O A;  4DRX B;  4X8A A;  1NH2 B;  1K5S A;  4L8J A;  3B8N A;  4DV1 B;  4PA4 A;  2DYR C;  4PDL A;  1B04 A;  2P4V A;  4X88 A;  1BT8 A;  3WB1 A;  1FFX A;  4R50 A;  1WA8 B;  1VF6 C;  4IGG A;  1GM7 A;  1FFT B;  4U3J B;  1K4C C;  4KHP B;  2Y0P A;  2ZE7 A;  4CS3 A;  1V54 C;  4TSF G;  2QWO B;  4QGP A;  3K79 A;  4UCU A;  2GSM B;  3HKB A;  4UCV A;  1IX9 A;  2DMX A;  1BQ0 A;  4YY3 O;  4NXN O;  1FYJ A;  2WSS G;  1FXK C;  3CHX A;  4WF9 V;  3AK2 A;  3ZN0 A;  1P84 F;  2P90 A;  3ASN B;  1QVF U;  3JAS B;  3QO5 A;  1BMF G;  1Y66 A;  1LUW A;  4FVM A;  3APO A;  1H2G A;  1IBM O;  3B4S A;  4RWU A;  3K5N A;  2ZE5 A;  2JVD A;  3T2M A;  1N4C A;  2GTS A;  3QF7 A;  2JGD B;  2KG7 A;  2GHY A;  2YIB D;  1VQO V;  5EZY A;  2EIM B;  2F43 G;  1L1F A;  5JQG A;  3E8B A;  4LP8 A;  4FMT A;  3RW0 A;  2UXD B;  2ZQM A;  5LHI A;  4X66 O;  4Q20 A;  3BAB A;  1XHZ A;  5KHI A;  1SER A;  1XI1 A;  1HDJ A;  1MNG A;  1WB7 A;  1ZTE A;  4G27 B;  4WFF A;  1DF4 A;  3ABK C;  5LGT A;  4LF9 O;  2R9A A;  4P9P A;  1R1B A;  4UFZ A;  4JAA A;  1M93 A;  1E1R G;  2EZO A;  2YXL A;  2ZD9 A;  4I5S A;  4X62 O;  3K06 A;  4LNU B;  3R65 A;  1Q6I A;  4FLX A;  4WFH A;  5JCO A;  2Q68 A;  2DWE C;  4O4H A;  4GX1 A;  1F23 A;  3UCS C;  3VQW A;  3C3S A;  2AHZ A;  3AEI A;  1XNR B;  4JTC B;  3UO2 A;  4LF5 B;  3BRC A;  1LUV A;  2EIN C;  3E83 A;  2UXX A;  3ABM B;  1SA0 A;  4GKJ B;  4ZI7 A;  3G4S V;  5GON A;  5DEC A;  3ZCC A;  4UVB A;  2X7R B;  4Q6G A;  1VAR A;  3CRM A;  1WPX A;  1AR5 A;  2VS0 A;  1N33 O;  2AHY A;  2A3Q A;  1EZV H;  5LBQ A;  1TVK A;  1KP2 A;  1M57 B;  2JJ1 G;  3K5L A;  1R3J C;  5EIB C;  5TIS Z;  3F7Y C;  3CME V;  3NXS A;  3RN4 A;  1NS1 A;  2X6C A;  1N0J A;  1K4D C;  1HP8 A;  4O4I B;  1OCO C;  2WLH A;  4QE7 A;  5FPR A;  4LF8 B;  1L8D A;  3THO A;  2X6A A;  1G1X B;  3L9D A;  5JVD A;  3ETE A;  3ETG A;  1PKX A;  4MTF A;  3W7W A;  3SGI A;  2P67 A;  3ZJZ A;  1OCR B;  3E22 A;  1THZ A;  2BSK B;  4DUY B;  2ZM6 B;  4LF4 O;  3OTO B;  1MMM A;  3B40 A;  1D5A A;  4DR3 B;  4XDK A;  1HNZ B;  5BMV B;  1NJI W;  2E5L B;  3GVM A;  2AZ0 A;  4CC6 A;  2DOS A;  2XTA A;  5BR8 O;  3JSL A;  1XNR O;  4LF7 O;  2ARH A;  2IU0 A;  3CC7 V;  3TET A;  1XUQ A;  1XMQ O;  4UVC A;  3VBB A;  2Z3Y A;  1H2L A;  1N36 O;  2ZIO A;  4PDV A;  1DK1 A;  2L6L A;  4AI8 A;  4OGQ B;  4DR1 B;  3N2K B;  2V4D A;  1AJN A;  3CYO A;  1XOU A;  4J10 A;  4MTO A;  4FM1 A;  3K0G A;  1HR0 O;  3OT7 A;  2QTO A;  2WLL B;  2EUL A;  3QG5 A;  1TUB A;  2Q4P A;  4N23 A;  1XNQ B;  4EEQ A;  5BY1 A;  3CXC U;  3BCC H;  3A0B Z;  3ZS8 C;  4WFE A;  3F5W C;  4UCR A;  4X1I A;  1YTF D;  4QNH B;  3BVO A;  3HB3 B;  3U10 A;  5EYP A;  2ZXW C;  2RJZ A;  2JS5 A;  1QLE C;  1TA8 A;  3W7U A;  3C3T A;  2QM7 A;  4NTW A;  3T1C A;  4D7T A;  2EJR A;  2W0F C;  1P4R A;  1F4M A;  4K8X A;  4O4J B;  3K9A A;  1YXB A;  3E2E A;  4B3R B;  3VQX A;  5AG2 A;  3FKS G;  4QPJ A;  4NXM O;  1XHX A;  5LMU B;  3OTF A;  1GO3 F;  4DW0 A;  1AJQ A;  2CGN A;  2Q7E A;  1VQM V;  3E35 A;  5JH7 B;  5EIB D;  5E1A C;  3CSX A;  1TGO A;  5IWA B;  1MOF A;  1IBL B;  5D5P A;  2HVJ C;  5L3C A;  3SPJ A;  1M1K W;  5IYC O;  2XAF A;  2RQ6 A;  3ASN C;  1N32 O;  1DF5 A;  4EKW A;  2XT9 A;  5B1B B;  2D2C B;  3RT3 C;  2B5U A;  4BR6 A;  2BCC H;  1AR4 A;  4BIO A;  3RFR A;  5LA6 A;  3FFQ A;  2CH7 B;  2EIM C;  1RSO A;  3VQY A;  3EFF K;  4MTX A;  4JI0 O;  1Q5O A;  2QWR B;  3JD3 A;  1KBH A;  1KU9 A;  2EJ7 A;  4MT8 A;  4FK5 C;  2PF4 E;  1NR7 A;  1TAE A;  2WLK A;  2WA4 A;  3D3I A;  3G6B A;  4GZR B;  1WJZ A;  3OGC C;  3ZMS A;  3FB7 C;  4DV4 O;  4GX0 A;  4DV5 O;  4RQF A;  5CA1 B;  1X4T A;  4YHH B;  5LL6 Y;  4CH4 A;  4E2L A;  2N05 A;  1Q86 W;  3H01 A;  4TT3 G;  1FXK B;  5B1A C;  5KA6 A;  1RP3 B;  1I0H A;  1HNW B;  3OUF A;  4NTY A;  4YJ3 A;  3K59 A;  2CE4 A;  2IJK A;  4LF6 O;  1AI5 A;  1OCC C;  2HHH B;  4X1Y A;  2UUC O;  4LWS B;  3DC6 A;  4H0L B;  2AZ2 A;  1Z5W A;  3ZMZ A;  5CA0 B;  4ZKI A;  4UUJ C;  3FB5 C;  3SR2 C;  3ABM C;  4DW1 A;  4FM2 A;  1W2B U;  2DW4 A;  1PNM A;  3RYI B;  5J2T A;  2KQX A;  4F6R A;  1E1Q G;  4G28 B;  5CBG A;  3ZBH A;  4L87 A;  2FYU H;  3AG4 C;  2XND G;  5L3E A;  4DR5 O;  5B66 Z;  2ZR2 A;  4OX9 O;  3ABK B;  2JGU A;  1DTO A;  3JCZ A;  3JD4 A;  4JGS A;  1URF A;  1YVW A;  3DGE A;  2P4K A;  3U11 A;  1LR1 A;  3BA8 A;  4DR6 B;  2B9Z A;  4FPP A;  4DUZ B;  3IC9 A;  3STZ C;  1YTF B;  4I0X A;  1B06 A;  2N04 A;  3OEH G;  4I50 B;  4KUM A;  4EB6 A;  2VQF B;  4GUN A;  1VQ6 V;  4D6T H;  3HKE B;  1OCR C;  2M6Y A;  4LFB O;  1FXH A;  2BOC C;  4YIP A;  1H2S B;  4PV1 B;  1FFX B;  4GYC B;  4J11 A;  1MZE A;  2BTQ A;  2YUA A;  2FTK A;  4JV5 O;  2WLI B;  2ZDI A;  3E89 A;  4X1K A;  3QNE A;  1WAZ A;  4JYY A;  1P49 A;  2EIL B;  3RYF A;  5GTI Z;  4Z1V A;  4I55 A;  4NVP A;  2QDO A;  3P30 A;  4RQE A;  1BE3 H;  3N2G B;  1R73 A;  4W4K A;  4GLX A;  5IYZ B;  3SJA C;  1XQ8 A;  1OCO B;  3ZIA G;  3ZRW A;  3K57 A;  3ZRS A;  3T1H B;  4JAV A;  1K33 A;  2WWW A;  4TUY B;  4HNA B;  4PHZ A;  2QWQ B;  3HKC B;  3JD1 A;  5H2F Z;  1XIL A;  1SF9 A;  2GTA A;  1IBK B;  2JEX A;  1H8H G;  3F7V C;  1M4U A;  5A9G A;  2WAM A;  1WN7 A;  3TGU H;  2RCV A;  2NLJ C;  2R72 A;  1K7D A;  2F4V O;  3O65 A;  3D36 A;  5ITZ B;  5CMU A;  2Q8V A;  3WB0 A;  2VWJ A;  1XMO O;  3OAA G;  4ZHQ A;  3AG7 A;  4DR4 B;  2UU9 B;  1AP5 A;  3APQ A;  2P7T C;  1KQS U;  3CEI A;  3RVY A;  4JZG A;  3Q4H A;  1CP9 A;  3FX7 A;  1Y76 A;  1VEW A;  4UVA A;  4WBN A;  4DV3 B;  4JI2 B;  3BFR A; 
#chains in the Genus database with same CATH homology
 1GH6 A;  2N04 A;  1IUR A;  2N05 A;  2YS8 A;  2L6L A;  2QWO B;  4J80 A;  1FAF A;  2GUZ B;  3UO3 A;  1XBL A;  2LO1 A;  3APO A;  2M6Y A;  2QWP B;  3BVO A;  2DN9 A;  4RWU A;  2Y4U A;  2CTQ A;  2CTP A;  2GUZ A;  2YUA A;  3AG7 A;  2QWR B;  1N4C A;  1FPO A;  3APQ A;  2EJ7 A;  2DMX A;  1BQ0 A;  2Y4T A;  2CUG A;  3UCS C;  1HDJ A;  2PF4 E;  2CTW A;  2CTR A;  4IT5 A;  2QWN B;  1NZ6 A;  2KQX A;  4J7Z A;  1WJZ A;  3UO2 A;  1BQZ A;  2QSA A;  2LGW A;  2QWQ B;  2OCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...