2CTPA

Solution structure of j-domain from human dnaj subfamily b menber 12
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
GSSGSSGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily B member 12
publication title Solution structure of J-domain from human DnaJ subfamily B menber 12
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ctpA01
2LGWA 3APOA 2CUGA 2QWNB 2QWQB 2L6LA 2KQXA 4IT5A 4J7ZA 2CTWA 2YUAA 2QWOB 2Y4TA 2YS8A 3AG7A 1XBLA 2DN9A 2OCHA 1BQZA 2N05A 2CTQA 1WJZA 3UO3A 1IURA 2QSAA 2Y4UA 2M6YA 3APQA 1BQ0A 3UCSC 2CTRA 4J80A 2PF4E 2N04A 2EJ7A 2LO1A 1FAFA 1NZ6A 3BVOA 2CTPA 3UO2A 1HDJA 1GH6A 2GUZA 2GUZB 4RWUA 2QWPB 2QWRB 2DMXA 1FPOA 1N4CA
chains in the Genus database with same CATH superfamily
4B3MO 2CAZC 5EBWC 4JZ2A 1VQNV 2ZE6A 5IY5B 4DV1O 4YY3O 2LW7A 4IT5A 4J9YB 4UV8A 1Z5VA 2F95B 1DTOA 4NXMB 2R72A 3BCCH 2QSAA 3AG4B 2EIKB 1YZBA 4XDLA 3CWBH 4UXNA 4WFFA 3RFRA 2BTQA 4OX9B 3E89A 4KXRA 2DW4A 4JI1O 4LP8A 4CH3A 1SF9A 3ZHRA 4TWKA 1E1QG 2VWKA 3CCVV 5KUMA 1TVKB 2JGUA 3SYQA 5B1AB 4K35A 2E5LB 2ZE7A 2JGDB 2GDSA 1S5JA 2P06A 4HNAB 1IURA 2BCCH 2X0LA 3IC9A 1H2SB 3N2KB 1KKDA 1B6QA 1R6KA 4P2ZA 2GTSA 2B1IA 4I9QA 3JSLA 1R6NA 1PKXA 4MVMA 5LMNB 3N2GA 4LFAB 4H33A 4TV9B 1MOFA 1MNGA 1QNMA 4E4EA 4PHZA 4FM0A 2QJ1A 1VIBA 3WB2A 1XNQB 1S5HC 3ASOC 3ZMTA 3BY6A 5JCOC 4DV6O 1K97A 1ZL8B 3OTOO 3CCEV 1M1KW 1NTKH 2X6AA 4DR2O 1GM7A 1I7FA 5IY5C 5LOVA 4K0KO 2GTAA 5C8YA 4JF3A 1JFFB 3SPJA 4JV5B 4GT1A 4DR3O 4F6EA 3FD9A 1YTFD 4Z2WA 4XBFA 2YICA 4NB5A 2E3CA 4ZOLB 1M4UA 3K5NA 3QVNA 4YJ3A 1M5IA 1KMIZ 2QWOB 3K08A 1RSOB 2A3QA 3GWOA 3GB7C 2JIZG 1V9PA 2LW1A 1QHTA 4TQDA 5CA3A 2FB5A 2BTOA 4WFHA 2CTPA 1FYJA 4X20A 2X7RB 4MW8A 4DV5B 2ZIOA 4JGSA 3TK1A 3SPIA 2G38A 3FAVB 4DUYB 1G6UA 4X1KB 2PI5A 2UU9B 4QNHB 3Q4HB 2IW5A 2ITCC 2ZDIA 4FM2A 1PL4A 2W6IG 3VQYA 4TUYB 2EBOA 4EB6A 3JAKA 2VQEO 1OCOB 4HYOA 3JARB 5GW7A 4YHHO 4OX9O 4RUFA 4W4LA 3CCRV 4O4LA 1P7GA 1N33B 1YTFB 3M99B 2Q9LA 3ZRWA 4UCRA 1VEWA 3E35A 4L87A 1OCCB 1FFXB 1TA8A 1Q5OA 2UXBB 4ZI7B 3WB1A 4LFBO 1RP3B 2EIMC 4JI6B 1XUQA 5J2UA 3ML0A 3ZHTA 1YF2A 3LDEA 5H9CA 1YEWA 3JATA 4JTDB 1JOYA 1KD1W 2LO1A 4U7NA 1Q6IA 3EXAA 5LMNO 1M90W 3ZRVA 4DYLA 1FPOA 1P84F 4RQFA 4H13B 1PNLA 2ZXWB 2E76B 2RCVA 5GTHZ 2Y4TA 4Q6GA 2F93B 2VRZA 1K9MW 2ITDC 5L3BA 5JQGA 4NTWA 4X88A 2ARHA 5CN0A 1SRYA 2LP7A 4LCUC 1BZKA 3FB5C 5DN6G 4JAVA 3QO8A 4GCZA 1FXKB 4DR7O 3JAMN 2WLLA 3AK1A 1QLEB 3BA8A 1NR1A 4LFCB 3UT5A 4EKWA 1BSMA 1SQPH 3LDDA 5B5EZ 1XNRO 2OWOA 3SPGA 5IDJA 3B8MA 3HKEA 5CBFA 4LH7A 1HWYA 1HW7A 3LSSA 1HNWO 5K1XA 1K73W 2ZQMA 1OCCC 3JALA 4XDKA 2XT9A 4Q20A 5LA6A 1SA0A 2RNBA 1GN4A 1FKAO 3T1YB 3CXCU 1CEZA 3HKCA 4NTYA 4EEQA 3E22B 5KUKA 2IBZH 3L70H 3ZN0A 2LGWA 1M57B 5KMGB 3QO7A 3JAWB 2UUAB 1IBMO 4JYAO 2ZCEA 2UXCB 3SYPA 3U0ZA 1VMGA 2ZXWC 4X66B 1BGYH 4B08A 3D36C 3HR0A 4NYKA 5J2TB 1PP9H 2ZE5A 4JI4B 1NTMH 1AI7A 4D6TH 2BOBC 2UUCO 2X6CA 4KUMA 4KFMA 3FX7A 3LNNA 1HNXB 1XHXA 1FXKC 2DYRB 2VQFO 4O4IA 2GSMB 1QLEC 1PPJH 2QEXV 4O2BB 2Q69A 2QM4A 2WLMA 1FJGO 1KC8W 1MG1A 1DF4A 3RYFB 2GUZB 3U11A 1K7DA 1AJNA 4PDLA 1H2NA 4TOIA 2ZR2A 4FZ1A 1I94B 1QCEA 1MSWD 2B1GA 4X65B 2ZM6B 3KZIZ 1VARA 1F4MA 1W0JG 4YJ2B 4PDRA 5FNVA 1Y74B 3AG2B 4YIOA 5BMVB 3RW0A 1KU9A 2Y0IA 1COWG 2KQXA 2YXYA 1BT8A 1IBLO 3VQXA 5LMUO 2PYJA 3OR6C 4LF7B 4X9QA 1N36B 1KP2A 1IXMA 5GONB 2F4VB 2RQ6A 3SDLA 1L8DA 2W0XA 4ZHQB 4J10A 4IIJA 2WSSG 4P9PA 4P30A 1ENVA 4O4HA 5LGUA 2QM8A 1GRJA 3STLC 2DYRC 4B3MB 1KKCA 1Y67A 4DV1B 5BZBA 2BE3A 4YY3B 5LBQA 4RUEA 4UVBA 4GKJO 1I08A 2OT5A 4JI2O 5BY1A 5LHGA 1ZAUA 3OMNB 2IJIA 3DTUB 4CH4A 3G4SV 1W2BU 3FYIB 4WBNA 3MHSC 3TXSA 2WA4A 4JI1B 2IJKA 1BQ0A 1X59A 3ZEDA 3A0HZ 3D8CA 3L9DA 3CCLV 2JEUA 4J9ZB 2UXCO 1JMKC 2JS3A 4LC1A 3AG2C 5B1NA 4NTXA 1VQ8V 1Q90D 3OEEG 2YI9A 4UB6Z 4DV4O 1IX9A 1YJWV 3RYCA 2HVJC 5LYJA 3QG5A 4N23A 1D5AA 2DE0X 2DJVA 1RPOA 3R66A 5D5PA 2A7WA 3JD0A 1AILA 3B40A 1VQ6V 1SQVH 5IYCO 3E8GA 2JK5C 4RO2A 2O57A 2WLHA 4NKGB 1NH2D 1P4RA 4F6RB 1LR1A 3FB8C 3ASNC 4DV6B 2P7TC 3OTOB 4LF8O 3UO3A 4JI0O 3FKSG 4B7EA 2DOSA 4DR2B 2QR4A 4U3JA 3VBBA 1BL8A 1URFA 4K0KB 5L3FA 1MZFA 1NTZH 4R7CA 2ZR3A 4NXNO 5DECA 3A2FA 2ZM6O 3D3QA 1FS0G 2PZSA 5CMUA 5EC1C 4FLXA 2YUAA 3OTFA 3SYAA 2XAQA 5KX5B 1QLNA 3T4ZA 2QTOA 1UFIA 1IZ3A 2MW2B 4KP4A 3TXQA 2KG7B 1SC5B 1N34O 1PM9A 2XASA 1G1XB 2Z3YA 3L72H 5B1BC 1ZX3A 2Q67A 3UM7A 4IHJB 4PD4F 4B7KA 1Q6UA 4WFAV 1LNQA 2QTSA 2CH7A 2HR3A 2HHHO 2JS5A 3GVMA 3RN4A 4DRXA 2VWJA 3I56V 2F23A 1VP7A 1I5YA 3UQ8A 3CE2A 5EZYB 4JI3O 1SZTA 4J7JA 5LP6B 2CUGA 4TV8B 4GX1A 1S76D 1HP8A 1NH2B 5FLXN 3G67A 1PV0A 1OHHG 4B3SO 4I50B 1S72V 2YIDA 4QGPA 2VQEB 3C3SA 2Q5ZA 4DR6O 4YHHB 4DV0O 3CJHA 4G27B 2YDEA 2DMXA 4X1YB 1N8RW 1KB9F 4FLTA 3FB7C 4CS3A 5L3CA 4CZZA 2DN9A 1NI8A 2UXXA 3ZMZA 3DSQA 2LJ2A 3I5DA 4LF6O 2P90A 2X6BA 1SQQH 1XILA 1GAXA 3HKDB 3JCUZ 3T1HO 5DM6V 2BTQB 2JDIG 4LFBB 2V7QG 1Z5WA 5CBGA 4RAIA 2UXDO 1H8HG 2D2CB 1YIJV 4MTGA 1NVPB 3OGCC 3ABLB 1Q43A 1THZA 1XMOO 3OFNG 2QKAA 3K03A 4FZ0A 5A9GA 1JQ0A 2PTMA 1K5QA 3MAQA 5EYPA 4X1IA 3RGBA 2R70A 5LP6C 3K57A 3N2GB 3H1KH 3WU2Z 5L3EA 1KYOF 3CSXA 1VQKV 1ZWIC 2A79B 2EZOA 1K4CC 4DR7B 3RYHA 3P3PA 3CCSV 2UXNA 2DWDC 2Q73A 1K34A 4MTXA 3SJCC 2YIBA 2A9HA 2F43G 2HJDA 2QWPB 3JCZA 1XNRB 5H6QA 2P6JA 1N0JA 2RDCA 2EIMB 4MTFA 1US6A 2PI4A 3BEHA 5C8YB 1HNWB 3C3TA 3CYOA 4GZRB 5BR8O 4R50A 3JYCA 3BA9A 2LFSA 1PD3A 2PGGA 5KHHA 1WP8A 2XUMA 5EIBC 2CK3G 3WG7B 1DLBA 4YJ3B 5IJ0A 2H8PC 5CA0A 4X1KA 1IBKO 2Q7HA 3H1LH 1F4NA 3W7TA 3ABMB 3W7WA 4CBCA 3B4SA 3D3IA 3ABLC 2Z0AA 4DW1A 4UCVA 1IBMB 2HEPA 4HBNA 4JYAB 4X20B 1K3EA 3ICXA 4Z1MG 4QE9A 1B3QA 1AROP 2AW9A 3VQVA 2EINB 5A2QN 4MSWC 1KBHA 2OCHA 4NR1A 1S3JA 4WF9V 1Q8IA 3K0DA 3ZMUA 2UUCB 2HLDG 3OMAB 1AB3A 3G6BA 1E1RG 2KKWA 1M93A 2WLIA 3F7VC 2VQFB 1AI6A 4EB6B 1FFXA 1P49A 3U10A 4J11A 4I7ZB 4LH6A 4O2AA 1JA8A 5CBHA 1FJGB 1XEQA 4FFKA 3G6EV 1YCIA 1D5NA 2FMLA 4ZBMA 4IL6Z 1VQ9V 4O4LB 3UCSC 2N04A 1ZUQA 2XAHA 2UUBB 1TGOA 4MTOA 1AR5A 4PV1B 5JH7A 2Q7EA 1PNKA 3WG7C 1BQZA 4LNUA 2WLKA 5J2UB 2IH3C 2M6YA 3JATB 3ABUA 2D3OW 2ZE8A 3OE7G 1JJOA 3ABMC 5LL6Y 4X89A 3AG1B 1RM1B 1GN3A 3KCXA 1T5EA 2E75B 1IBLB 2GBOA 2WPDG 2ZIMA 2JJ2G 5LMUB 1AR1B 2H3OA 1KUQA 4R6ZA 2EINC 4GYCB 1SETA 4LF9O 2HVKC 1H8EG 1VF6A 3JASA 4DUZO 3HPLC 4DW0A 5JQGB 1MMMA 4CH5A 4OGQB 1OCZB 3H01A 4FFBA 2ZDIC 4KL1A 2V4DA 1NR7A 1AR4A 3K3WA 1ORQC 4DV7O 2IJJA 4FIPC 4DR4O 1IXBA 2WLLB 3B8NA 1GMGA 3RYIA 2ZT9B 4I55A 2YS8A 3B2EE 4GKJB 3UT5B 5L3GA 3DXRA 4JI5O 4MVUA 2WLNA 4JI2B 1HNZB 1Y76A 1YSCA 3OEHG 4K8ZA 3HKEB 5IE9A 2FYUH 1YJNV 5EBLC 1AI5A 3CHXA 2Q8VA 3CCUV 4EFEA 1RFYA 2QWRB 1LUWA 4X64O 1DGSA 3FB6C 4PA6A 3JALB 2HFEC 4PA9A 1Y4MA 1RPRA 1Z2GA 3W7SA 1QBZA 1Y6XA 5LA6B 1SA0B 4LWSA 3P32A 1Y66A 1QQCA 2K9PA 5ITZA 3QTCA 5KHGA 2RN9A 1JVMA 3HKCB 4UUJC 4DV4B 1M56B 1F7YA 3AG1C 1RM1C 1J95A 3SJQC 3APOA 4LBEC 1K92A 2Q7GA 2AHZA 3P3NA 5L3DA 1WAZA 2YC0A 2BOCC 3T1CA 1J5EO 3DGEA 4O4JB 3ZMSA 1GN6A 4PI2A 4WFBV 1WB8A 4I0XB 1OCZC 5AG2A 3K5LA 4LF8B 4DV3O 1WA8A 4JI0B 1W59A 4YXWG 4JPRA 3K06A 4BW9A 3CC7V 3M7MX 4O4IB 3T2MA 2IH1C 2UUBO 1SS3A 3NR7A 1ZTEA 4NXNB 4DK1A 1BE3H 1ZSPA 4OPAA 4QPKA 2AXTZ 3BFRA 1Y74A 2ZD9A 4JASA 4X8AA 1YI2V 1AI4A 1S5LZ 1WPBA 2YSUB 4BW5A 5JJEB 3VQWA 1N34B 2CTWA 1U97A 3ETEA 3K0GA 5LHHA 3ABTA 3BAAA 3STZC 3K5MA 2PF4E 4B3TO 5FNVB 3ZHSA 2FL4A 5CB4B 3JD2A 2HHHB 4ZHQA 3CMAV 1WLEA 1M56C 1OJHA 1XQ8A 1O9HA 1EZVH 3CMEV 3ASNB 2QA4V 5EC2C 4UCOA 3PJSK 4JI3B 1L0NH 5KA5A 4H37A 1M9NA 3KG2A 1R3JC 3K04A 4MVZA 1FAFA 4ASUG 3IC7A 4B3SB 3K59A 1HNZO 4IIJB 2L35A 2ZNIA 1VQLV 2JEXA 1AJQA 2R9RB 3ABKB 1R1BA 4DR6B 3F7YC 5IWAO 3O9OA 4DV0B 4JI8B 4X62O 1WJZA 1Q81W 3APQA 1TUBB 1LUVA 5C93A 4DR1O 2ADPA 5B1BB 1Q86W 2P4VA 2AHYA 4LF5O 4LF6B 5LGTA 2JVDA 1QU7A 1L0LH 1R6TA 3T1HB 1HR0O 1PL0A 4WBNB 1EM1A 5FPRA 5DEDA 2C2AA 1QR8A 3OD4A 4JI7O 2V1DA 1BMFG 2ZINA 2UXDB 5LXTA 1R3IC 3X2QB 3ZCCA 4KHPO 4F4LA 4ICGA 5BXZA 5JVDA 1ROPA 4Z1VA 3J81N 4QIWF 1XMOB 2QWNB 2XOKG 3CC2V 2AZ0A 3SGIA 3CP1A 4AQYO 4MVOA 3FYEB 1YVWA 3RYCB 5LYJB 5IYZA 3L71H 2ILMA 5H2FZ 3IJ4A 4GKKO 3UO2A 5KHJA 3LUTB 1FFTB 4D7TA 2VS0A 4E2LA 1YJ9V 3MD0A 4GX0A 3CCJV 3E86A 2PYLA 3L74H 1NT2B 3SJBC 2NR5A 4LR3A 3W7UA 5KX5A 4MS2A 4PDMA 4C7UA 3ABKC 3FFQA 2QKCA 1S0VA 1YDXA 5CA1A 4IGGA 1XOUA 2RMKB 3LSUA 4U3JB 2RJZA 2Y69B 3SYOA 3J7AU 1F23A 4HZ3A 3O65A 3BPZA 1JJ2U 5BR8B 4I4TB 2QGNA 4JZGA 4PDVA 2WWWA 5B3SC 5JCOA 1XL4A 4JAAA 3HKBA 2LQTA 2NN4A 2EZPA 1IBKB 3X2QC 2BSKA 5IJ9A 5JJNB 2OTLV 1E79G 3IGAC 2YEVB 3G71V 4ZKIA 1KQSU 3RBZA 4DV2O 3J80N 3K5OA 1N32O 2QWQB 3K79A 3RWRD 2CH7B 5JJJB 4DXWA 1VQ7V 3E8FA 4MVSA 5B1OA 2HG5C 1H38A 4BIUA 4DRXB 1UJWB 5LHIA 2XNDG 2IJHA 1B04A 4UVAA 3AG3B 1CXZB 4JI8O 3N27A 2JRIA 2E74B 2Q6AA 1TVKA 2JGDA 3L73H 4HNAA 1MA1A 2CDYA 1VQ4V 1WN7A 3HKDA 1GN2A 3CEIA 3N2KA 3TJTA 3S3XA 2KB1A 2YIBD 1AP6A 1KECA 1K5SA 2HKOA 3CJHB 3ZN1A 2IU0A 2Y69C 2Y48A 4UCUA 4MW3A 3LNMB 3DC5A 2EX3A 1CPYA 4J7ZA 1AVMA 2NLJC 4FVMA 4TV9A 3CS5A 2M7WA 2WA3A 1FXHA 3SPCA 3OM3B 4FLWA 4L8JA 2P5OA 3PN1A 2B9ZA 1ZL8A 5IYBO 3OW2U 1K33A 4WFEA 4UVCA 4TQFA 4PJ0Z 1UPGA 5K1PA 3AG7A 3H9VA 2QKSA 1L1FA 1MABG 2CTQA 1EN5A 1JFFA 4GUNA 1AP5A 3LSQA 2Q0OC 2A0LA 1GM9A 1D2DA 1EFRG 2N74A 4PA3A 4RWUA 4LF9B 3AG3C 4CS4A 4ZOLA 1XMQO 4DUZB 1TAEA 5EYPB 4X1IB 2L6LA 5H6RA 4UCTA 3H1JH 5FL7G 4TT3G 5LOVB 3RT3C 4CC6A 1RSOA 3ZHUA 2QE7G 4DV7B 4DR4B 3NXSA 4G2KA 4J80A 2EIJB 3AG4C 3EHBB 3RYHB 2EIKC 3BVOA 5KLVH 2Y0PA 4JI5B 3ETGA 4B3RO 3ZX6A 1SQBH 3UKMA 3ETQA 4MVRA 4I9WA 4GX2A 3FAVA 1OCRB 3THOA 2WLJA 5B1AC 3Q4HA 4X64B 4LF4O 1NS1A 2XHBA 3KKYA 1XL6A 4TUYA 1JX9A 2FTKA 3H1HH 3SR2C 2DYSB 4A5UB 3EVKA 5KHKA 1SQFA 4DR5O 5IJ0B 5CA0B 3JARA 1XDCA 3A8TA 4R8CA 2Z5UA 3ZMVA 5GTIZ 1H2LA 4CS2A 1YITV 1WB7A 3MHHC 2XAFA 1NQTA 2ADQB 1QVGU 2ZNJA 1SERA 3OGIB 1DF5A 2MK3A 4NXMO 1J5EB 3OUFA 3JAKB 4IYHA 5IYDO 3JD1A 4ZI7A 1I5XA 4DV3B 4EFBA 3W7XA 3EFFK 4TSFG 2E5LO 1MZEA 4FK5C 3A0BZ 2WLIB 4FMTA 3ZRSA 2EIJC 3JD4A 1NU1H 3ZRWB 1K4DC 2R9IA 5F2VO 3F5WC 2R9AA 1GK9A 3ZRXA 3CPWU 4O2AB 1WPXA 3CB2A 3D36A 3M8AA 4H44B 4MVQA 1OCRC 3DC6A 2HJFC 4G28B 2CE4A 5KHIA 4I5SA 1VQPV 4P9OA 4LFAO 1GKFA 2EJRA 1GTOA 3L75H 2PY5A 5HFMA 5JH7B 2DYSC 1FXKA 1XNQO 1Q82W 1SQXH 2P4KA 4B3TB 2W6JG 1XBLA 4LNUB 2W0FC 4CH6A 2OTJV 2XAGA 1BCCH 5J9PC 1QR9A 1PNMA 4JYYA 4FLYA 2YI8A 1JCHA 4CC5A 3OT7A 1K8AW 4JV5O 3H1IH 3WFVA 2IM9A 4PI0A 1OCOC 4DO2A 2OYQA 2XAJA 2ZKOA 1SZXA 2N05A 1R3LC 3JASB 5E1AC 1X4TA 3CRAA 3E2EA 2HP8A 3BABA 3CRCA 2DQ0A 2WAMA 4FFBB 4BAYA 4OPHA 1F51A 2ODMA 4QJFB 3E22A 5IWAB 3HB3B 4RQEA 5EBMC 2FKXA 4X62B 2QDOA 4WCEV 3A0RA 3BHPA 2IU3A 1N0NA 1O9GA 4OXSA 5KMGA 3JAWA 4J7KA 4DR1B 3RYIB 2JJ1G 4I55B 4J41A 4IYIA 4LF5B 3DXRB 4DV5O 4JTCB 1NJIW 2EULA 5EK0A 2PUSA 1Y76B 3F5TA 4UV9A 1XHZA 1ZLZA 1HR0B 5J2TA 4DUYO 2F66C 2UU9O 4MT8A 1VF7A 4JI7B 3B09A 1N4CA 3AK3A 4J42A 4KHPB 1GM8A 3E8BA 3R65A 4JTAB 3QNEA 1EZJA 5KA6A 1BHAA 1H2GA 4LWSB 4O4JA 4ABMA 5ITZB 4O2BA 1S77D 4I0XA 3GWKC 4QE7A 1IVSA 1YXBA 1NZ6A 3RYFA 2GUZA 1Q7YW 4AQYB 4AILC 1G4YB 2OCCB 5H5NA 3ETDA 1N33O 3T4DA 4GKKB 1GO3F 2GHYA 3CCMV 1OZ0A 4XDJA 4YJ2A 1VF6C 2UXBO 3K58A 1JPXA 3I55V 3CRMA 4YIPA 4PA4A 4JI6O 1XREA 1Q6HA 5BMVA 1WA8B 4K3AA 2YIAA 4W4KA 4NVPA 5E79Z 3C90A 2H94A 2Q4PA 4UB8Z 1XI1A 5KAIZ 4PA7A 2Q0AA 2AZ2A 3LDCA 5CB4A 2YXHA 3SJAC 5GONA 2B5UA 2GV9A 4FLVA 2K1EA 4DK0A 3K9SA 1M57C 3CC4V 3OR7C 1WNSA 1VQMV 4N21A 3ZS8C 3CX5F 4DV2B 3AK2A 1N32B 4FLUA 3OAAG 4LFCO 3AEIA 3IFXA 5IT9N 1BHBA 1IDSA 3CRRA 4K8XA 2F1MA 2OCCC 5FPOA 4O4HB 2KSDA 4AHCA 1EBOA 1R73A 4JAUA 3RVYA 4UFZA 1I0HA 1TUBA 4BIZA 3CD6V 3E8HA 1NKDA 1MSDA 1R3KC 1V54B 2ATKC 3TGUH 3K9AA 4JYBA 3TETA 3SYCA 3T1YO 2OIEA 3JSNA 1QVFU 3KCYA 4H0LB 4U3FH 5B3SB 4GX5A 1Q3EA 5D5QA 1A32A 1BS3A 1AJPA 4GLXA 2LGQA 3B77A 2CGOA 3E83A 3QF7A 2UUAO 1FD9A 4D7SA 3VOUA 4X66O 1YHQV 4QPJA 2Q68A 3S3WA 4F6RA 1SQGA 1JR9A 1FXVA 4JI4O 2DWEC 3TCUA 1B06A 2DQ3A 2EILB 3JD3A 3ZJZA 4PELA 1V55B 5LXTB 1VF5B 1EN4A 2A06H 1HNXO 2EJ7A 5HFLA 3QO5A 1H2KA 4FM1A 2YXLA 5KAFZ 3IAYA 3SPHA 4BWAA 5LGNA 3WB0A 4ZIBA 5JVDB 1NBMG 1OV9A 1H2MA 2ETNA 1EN6A 3OUSA 2OIGA 4FPPA 4WFGA 2KG7A 1XMQB 5IYZB 1VQ5V 1I94O 3ZHVA 2P67A 2NNUA 1V54C 4IHJA 3RVZA 1G8MA 4X65O 4I4TA 4DR3B 1WP7A 2P22C 1U96A 2AGAA 1DK1A 4AI8A 3ZHQA 3MDSA 3ZBHA 4B3RB 5EIBD 1W0KG 2CTRA 5CA1B 1CP9A 5EZYA 1SKVA 4BR6A 2YEVA 1VQOV 2LFRA 3CRQA 5LP6A 4LF7O 4TV8A 4LF4B 5TISZ 1NVPD 1N36O 3OMIB 2F4VO 5JWPA 1KP3A 3BRCA 3G80A 4FJCC 4HAMA 4I50A 3ASOB 1SESA 2CGNA 2QM7A 1TUEB 4JYCA 2Y4UA 2XTAA 4DR5B 3CXHF 2EILC 3HKBB 5B66Z 1P7BA 4UCSA 4FLZA 1V55C 3P30A 4U7OA 3ZIAG 1HDJA 2BSKB 5IJ9B 1GH6A 4BIOA 3CCQV 4X1YA
chains in the Genus database with same CATH topology
2LGWA 3APOA 2CUGA 2QWNB 2QWQB 2L6LA 2KQXA 4IT5A 4J7ZA 2CTWA 2YUAA 2QWOB 2Y4TA 2YS8A 3AG7A 1XBLA 2DN9A 2OCHA 1BQZA 2N05A 2CTQA 1WJZA 3UO3A 1IURA 2QSAA 2Y4UA 2M6YA 3APQA 1BQ0A 3UCSC 2CTRA 4J80A 2PF4E 2N04A 2EJ7A 2LO1A 1FAFA 1NZ6A 3BVOA 2CTPA 3UO2A 1HDJA 1GH6A 2GUZA 2GUZB 4RWUA 2QWPB 2QWRB 2DMXA 1FPOA 1N4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGW A;  3APO A;  2CUG A;  2QWN B;  2QWQ B;  2L6L A;  2KQX A;  4IT5 A;  4J7Z A;  2CTW A;  2YUA A;  2QWO B;  2Y4T A;  2YS8 A;  3AG7 A;  1XBL A;  2DN9 A;  2OCH A;  1BQZ A;  2N05 A;  2CTQ A;  1WJZ A;  3UO3 A;  1IUR A;  2QSA A;  2Y4U A;  2M6Y A;  3APQ A;  1BQ0 A;  3UCS C;  2CTR A;  4J80 A;  2PF4 E;  2N04 A;  2EJ7 A;  2LO1 A;  1FAF A;  1NZ6 A;  3BVO A;  2CTP A;  3UO2 A;  1HDJ A;  1GH6 A;  2GUZ A;  2GUZ B;  4RWU A;  2QWP B;  2QWR B;  2DMX A;  1FPO A;  1N4C A; 
#chains in the Genus database with same CATH topology
 4B3M O;  2CAZ C;  5EBW C;  4JZ2 A;  1VQN V;  2ZE6 A;  5IY5 B;  4DV1 O;  4YY3 O;  2LW7 A;  4IT5 A;  4J9Y B;  4UV8 A;  1Z5V A;  2F95 B;  1DTO A;  4NXM B;  2R72 A;  3BCC H;  2QSA A;  3AG4 B;  2EIK B;  1YZB A;  4XDL A;  3CWB H;  4UXN A;  4WFF A;  3RFR A;  2BTQ A;  4OX9 B;  3E89 A;  4KXR A;  2DW4 A;  4JI1 O;  4LP8 A;  4CH3 A;  1SF9 A;  3ZHR A;  4TWK A;  1E1Q G;  2VWK A;  3CCV V;  5KUM A;  1TVK B;  2JGU A;  3SYQ A;  5B1A B;  4K35 A;  2E5L B;  2ZE7 A;  2JGD B;  2GDS A;  1S5J A;  2P06 A;  4HNA B;  1IUR A;  2BCC H;  2X0L A;  3IC9 A;  1H2S B;  3N2K B;  1KKD A;  1B6Q A;  1R6K A;  4P2Z A;  2GTS A;  2B1I A;  4I9Q A;  3JSL A;  1R6N A;  1PKX A;  4MVM A;  5LMN B;  3N2G A;  4LFA B;  4H33 A;  4TV9 B;  1MOF A;  1MNG A;  1QNM A;  4E4E A;  4PHZ A;  4FM0 A;  2QJ1 A;  1VIB A;  3WB2 A;  1XNQ B;  1S5H C;  3ASO C;  3ZMT A;  3BY6 A;  5JCO C;  4DV6 O;  1K97 A;  1ZL8 B;  3OTO O;  3CCE V;  1M1K W;  1NTK H;  2X6A A;  4DR2 O;  1GM7 A;  1I7F A;  5IY5 C;  5LOV A;  4K0K O;  2GTA A;  5C8Y A;  4JF3 A;  1JFF B;  3SPJ A;  4JV5 B;  4GT1 A;  4DR3 O;  4F6E A;  3FD9 A;  1YTF D;  4Z2W A;  4XBF A;  2YIC A;  4NB5 A;  2E3C A;  4ZOL B;  1M4U A;  3K5N A;  3QVN A;  4YJ3 A;  1M5I A;  1KMI Z;  2QWO B;  3K08 A;  1RSO B;  2A3Q A;  3GWO A;  3GB7 C;  2JIZ G;  1V9P A;  2LW1 A;  1QHT A;  4TQD A;  5CA3 A;  2FB5 A;  2BTO A;  4WFH A;  2CTP A;  1FYJ A;  4X20 A;  2X7R B;  4MW8 A;  4DV5 B;  2ZIO A;  4JGS A;  3TK1 A;  3SPI A;  2G38 A;  3FAV B;  4DUY B;  1G6U A;  4X1K B;  2PI5 A;  2UU9 B;  4QNH B;  3Q4H B;  2IW5 A;  2ITC C;  2ZDI A;  4FM2 A;  1PL4 A;  2W6I G;  3VQY A;  4TUY B;  2EBO A;  4EB6 A;  3JAK A;  2VQE O;  1OCO B;  4HYO A;  3JAR B;  5GW7 A;  4YHH O;  4OX9 O;  4RUF A;  4W4L A;  3CCR V;  4O4L A;  1P7G A;  1N33 B;  1YTF B;  3M99 B;  2Q9L A;  3ZRW A;  4UCR A;  1VEW A;  3E35 A;  4L87 A;  1OCC B;  1FFX B;  1TA8 A;  1Q5O A;  2UXB B;  4ZI7 B;  3WB1 A;  4LFB O;  1RP3 B;  2EIM C;  4JI6 B;  1XUQ A;  5J2U A;  3ML0 A;  3ZHT A;  1YF2 A;  3LDE A;  5H9C A;  1YEW A;  3JAT A;  4JTD B;  1JOY A;  1KD1 W;  2LO1 A;  4U7N A;  1Q6I A;  3EXA A;  5LMN O;  1M90 W;  3ZRV A;  4DYL A;  1FPO A;  1P84 F;  4RQF A;  4H13 B;  1PNL A;  2ZXW B;  2E76 B;  2RCV A;  5GTH Z;  2Y4T A;  4Q6G A;  2F93 B;  2VRZ A;  1K9M W;  2ITD C;  5L3B A;  5JQG A;  4NTW A;  4X88 A;  2ARH A;  5CN0 A;  1SRY A;  2LP7 A;  4LCU C;  1BZK A;  3FB5 C;  5DN6 G;  4JAV A;  3QO8 A;  4GCZ A;  1FXK B;  4DR7 O;  3JAM N;  2WLL A;  3AK1 A;  1QLE B;  3BA8 A;  1NR1 A;  4LFC B;  3UT5 A;  4EKW A;  1BSM A;  1SQP H;  3LDD A;  5B5E Z;  1XNR O;  2OWO A;  3SPG A;  5IDJ A;  3B8M A;  3HKE A;  5CBF A;  4LH7 A;  1HWY A;  1HW7 A;  3LSS A;  1HNW O;  5K1X A;  1K73 W;  2ZQM A;  1OCC C;  3JAL A;  4XDK A;  2XT9 A;  4Q20 A;  5LA6 A;  1SA0 A;  2RNB A;  1GN4 A;  1FKA O;  3T1Y B;  3CXC U;  1CEZ A;  3HKC A;  4NTY A;  4EEQ A;  3E22 B;  5KUK A;  2IBZ H;  3L70 H;  3ZN0 A;  2LGW A;  1M57 B;  5KMG B;  3QO7 A;  3JAW B;  2UUA B;  1IBM O;  4JYA O;  2ZCE A;  2UXC B;  3SYP A;  3U0Z A;  1VMG A;  2ZXW C;  4X66 B;  1BGY H;  4B08 A;  3D36 C;  3HR0 A;  4NYK A;  5J2T B;  1PP9 H;  2ZE5 A;  4JI4 B;  1NTM H;  1AI7 A;  4D6T H;  2BOB C;  2UUC O;  2X6C A;  4KUM A;  4KFM A;  3FX7 A;  3LNN A;  1HNX B;  1XHX A;  1FXK C;  2DYR B;  2VQF O;  4O4I A;  2GSM B;  1QLE C;  1PPJ H;  2QEX V;  4O2B B;  2Q69 A;  2QM4 A;  2WLM A;  1FJG O;  1KC8 W;  1MG1 A;  1DF4 A;  3RYF B;  2GUZ B;  3U11 A;  1K7D A;  1AJN A;  4PDL A;  1H2N A;  4TOI A;  2ZR2 A;  4FZ1 A;  1I94 B;  1QCE A;  1MSW D;  2B1G A;  4X65 B;  2ZM6 B;  3KZI Z;  1VAR A;  1F4M A;  1W0J G;  4YJ2 B;  4PDR A;  5FNV A;  1Y74 B;  3AG2 B;  4YIO A;  5BMV B;  3RW0 A;  1KU9 A;  2Y0I A;  1COW G;  2KQX A;  2YXY A;  1BT8 A;  1IBL O;  3VQX A;  5LMU O;  2PYJ A;  3OR6 C;  4LF7 B;  4X9Q A;  1N36 B;  1KP2 A;  1IXM A;  5GON B;  2F4V B;  2RQ6 A;  3SDL A;  1L8D A;  2W0X A;  4ZHQ B;  4J10 A;  4IIJ A;  2WSS G;  4P9P A;  4P30 A;  1ENV A;  4O4H A;  5LGU A;  2QM8 A;  1GRJ A;  3STL C;  2DYR C;  4B3M B;  1KKC A;  1Y67 A;  4DV1 B;  5BZB A;  2BE3 A;  4YY3 B;  5LBQ A;  4RUE A;  4UVB A;  4GKJ O;  1I08 A;  2OT5 A;  4JI2 O;  5BY1 A;  5LHG A;  1ZAU A;  3OMN B;  2IJI A;  3DTU B;  4CH4 A;  3G4S V;  1W2B U;  3FYI B;  4WBN A;  3MHS C;  3TXS A;  2WA4 A;  4JI1 B;  2IJK A;  1BQ0 A;  1X59 A;  3ZED A;  3A0H Z;  3D8C A;  3L9D A;  3CCL V;  2JEU A;  4J9Z B;  2UXC O;  1JMK C;  2JS3 A;  4LC1 A;  3AG2 C;  5B1N A;  4NTX A;  1VQ8 V;  1Q90 D;  3OEE G;  2YI9 A;  4UB6 Z;  4DV4 O;  1IX9 A;  1YJW V;  3RYC A;  2HVJ C;  5LYJ A;  3QG5 A;  4N23 A;  1D5A A;  2DE0 X;  2DJV A;  1RPO A;  3R66 A;  5D5P A;  2A7W A;  3JD0 A;  1AIL A;  3B40 A;  1VQ6 V;  1SQV H;  5IYC O;  3E8G A;  2JK5 C;  4RO2 A;  2O57 A;  2WLH A;  4NKG B;  1NH2 D;  1P4R A;  4F6R B;  1LR1 A;  3FB8 C;  3ASN C;  4DV6 B;  2P7T C;  3OTO B;  4LF8 O;  3UO3 A;  4JI0 O;  3FKS G;  4B7E A;  2DOS A;  4DR2 B;  2QR4 A;  4U3J A;  3VBB A;  1BL8 A;  1URF A;  4K0K B;  5L3F A;  1MZF A;  1NTZ H;  4R7C A;  2ZR3 A;  4NXN O;  5DEC A;  3A2F A;  2ZM6 O;  3D3Q A;  1FS0 G;  2PZS A;  5CMU A;  5EC1 C;  4FLX A;  2YUA A;  3OTF A;  3SYA A;  2XAQ A;  5KX5 B;  1QLN A;  3T4Z A;  2QTO A;  1UFI A;  1IZ3 A;  2MW2 B;  4KP4 A;  3TXQ A;  2KG7 B;  1SC5 B;  1N34 O;  1PM9 A;  2XAS A;  1G1X B;  2Z3Y A;  3L72 H;  5B1B C;  1ZX3 A;  2Q67 A;  3UM7 A;  4IHJ B;  4PD4 F;  4B7K A;  1Q6U A;  4WFA V;  1LNQ A;  2QTS A;  2CH7 A;  2HR3 A;  2HHH O;  2JS5 A;  3GVM A;  3RN4 A;  4DRX A;  2VWJ A;  3I56 V;  2F23 A;  1VP7 A;  1I5Y A;  3UQ8 A;  3CE2 A;  5EZY B;  4JI3 O;  1SZT A;  4J7J A;  5LP6 B;  2CUG A;  4TV8 B;  4GX1 A;  1S76 D;  1HP8 A;  1NH2 B;  5FLX N;  3G67 A;  1PV0 A;  1OHH G;  4B3S O;  4I50 B;  1S72 V;  2YID A;  4QGP A;  2VQE B;  3C3S A;  2Q5Z A;  4DR6 O;  4YHH B;  4DV0 O;  3CJH A;  4G27 B;  2YDE A;  2DMX A;  4X1Y B;  1N8R W;  1KB9 F;  4FLT A;  3FB7 C;  4CS3 A;  5L3C A;  4CZZ A;  2DN9 A;  1NI8 A;  2UXX A;  3ZMZ A;  3DSQ A;  2LJ2 A;  3I5D A;  4LF6 O;  2P90 A;  2X6B A;  1SQQ H;  1XIL A;  1GAX A;  3HKD B;  3JCU Z;  3T1H O;  5DM6 V;  2BTQ B;  2JDI G;  4LFB B;  2V7Q G;  1Z5W A;  5CBG A;  4RAI A;  2UXD O;  1H8H G;  2D2C B;  1YIJ V;  4MTG A;  1NVP B;  3OGC C;  3ABL B;  1Q43 A;  1THZ A;  1XMO O;  3OFN G;  2QKA A;  3K03 A;  4FZ0 A;  5A9G A;  1JQ0 A;  2PTM A;  1K5Q A;  3MAQ A;  5EYP A;  4X1I A;  3RGB A;  2R70 A;  5LP6 C;  3K57 A;  3N2G B;  3H1K H;  3WU2 Z;  5L3E A;  1KYO F;  3CSX A;  1VQK V;  1ZWI C;  2A79 B;  2EZO A;  1K4C C;  4DR7 B;  3RYH A;  3P3P A;  3CCS V;  2UXN A;  2DWD C;  2Q73 A;  1K34 A;  4MTX A;  3SJC C;  2YIB A;  2A9H A;  2F43 G;  2HJD A;  2QWP B;  3JCZ A;  1XNR B;  5H6Q A;  2P6J A;  1N0J A;  2RDC A;  2EIM B;  4MTF A;  1US6 A;  2PI4 A;  3BEH A;  5C8Y B;  1HNW B;  3C3T A;  3CYO A;  4GZR B;  5BR8 O;  4R50 A;  3JYC A;  3BA9 A;  2LFS A;  1PD3 A;  2PGG A;  5KHH A;  1WP8 A;  2XUM A;  5EIB C;  2CK3 G;  3WG7 B;  1DLB A;  4YJ3 B;  5IJ0 A;  2H8P C;  5CA0 A;  4X1K A;  1IBK O;  2Q7H A;  3H1L H;  1F4N A;  3W7T A;  3ABM B;  3W7W A;  4CBC A;  3B4S A;  3D3I A;  3ABL C;  2Z0A A;  4DW1 A;  4UCV A;  1IBM B;  2HEP A;  4HBN A;  4JYA B;  4X20 B;  1K3E A;  3ICX A;  4Z1M G;  4QE9 A;  1B3Q A;  1ARO P;  2AW9 A;  3VQV A;  2EIN B;  5A2Q N;  4MSW C;  1KBH A;  2OCH A;  4NR1 A;  1S3J A;  4WF9 V;  1Q8I A;  3K0D A;  3ZMU A;  2UUC B;  2HLD G;  3OMA B;  1AB3 A;  3G6B A;  1E1R G;  2KKW A;  1M93 A;  2WLI A;  3F7V C;  2VQF B;  1AI6 A;  4EB6 B;  1FFX A;  1P49 A;  3U10 A;  4J11 A;  4I7Z B;  4LH6 A;  4O2A A;  1JA8 A;  5CBH A;  1FJG B;  1XEQ A;  4FFK A;  3G6E V;  1YCI A;  1D5N A;  2FML A;  4ZBM A;  4IL6 Z;  1VQ9 V;  4O4L B;  3UCS C;  2N04 A;  1ZUQ A;  2XAH A;  2UUB B;  1TGO A;  4MTO A;  1AR5 A;  4PV1 B;  5JH7 A;  2Q7E A;  1PNK A;  3WG7 C;  1BQZ A;  4LNU A;  2WLK A;  5J2U B;  2IH3 C;  2M6Y A;  3JAT B;  3ABU A;  2D3O W;  2ZE8 A;  3OE7 G;  1JJO A;  3ABM C;  5LL6 Y;  4X89 A;  3AG1 B;  1RM1 B;  1GN3 A;  3KCX A;  1T5E A;  2E75 B;  1IBL B;  2GBO A;  2WPD G;  2ZIM A;  2JJ2 G;  5LMU B;  1AR1 B;  2H3O A;  1KUQ A;  4R6Z A;  2EIN C;  4GYC B;  1SET A;  4LF9 O;  2HVK C;  1H8E G;  1VF6 A;  3JAS A;  4DUZ O;  3HPL C;  4DW0 A;  5JQG B;  1MMM A;  4CH5 A;  4OGQ B;  1OCZ B;  3H01 A;  4FFB A;  2ZDI C;  4KL1 A;  2V4D A;  1NR7 A;  1AR4 A;  3K3W A;  1ORQ C;  4DV7 O;  2IJJ A;  4FIP C;  4DR4 O;  1IXB A;  2WLL B;  3B8N A;  1GMG A;  3RYI A;  2ZT9 B;  4I55 A;  2YS8 A;  3B2E E;  4GKJ B;  3UT5 B;  5L3G A;  3DXR A;  4JI5 O;  4MVU A;  2WLN A;  4JI2 B;  1HNZ B;  1Y76 A;  1YSC A;  3OEH G;  4K8Z A;  3HKE B;  5IE9 A;  2FYU H;  1YJN V;  5EBL C;  1AI5 A;  3CHX A;  2Q8V A;  3CCU V;  4EFE A;  1RFY A;  2QWR B;  1LUW A;  4X64 O;  1DGS A;  3FB6 C;  4PA6 A;  3JAL B;  2HFE C;  4PA9 A;  1Y4M A;  1RPR A;  1Z2G A;  3W7S A;  1QBZ A;  1Y6X A;  5LA6 B;  1SA0 B;  4LWS A;  3P32 A;  1Y66 A;  1QQC A;  2K9P A;  5ITZ A;  3QTC A;  5KHG A;  2RN9 A;  1JVM A;  3HKC B;  4UUJ C;  4DV4 B;  1M56 B;  1F7Y A;  3AG1 C;  1RM1 C;  1J95 A;  3SJQ C;  3APO A;  4LBE C;  1K92 A;  2Q7G A;  2AHZ A;  3P3N A;  5L3D A;  1WAZ A;  2YC0 A;  2BOC C;  3T1C A;  1J5E O;  3DGE A;  4O4J B;  3ZMS A;  1GN6 A;  4PI2 A;  4WFB V;  1WB8 A;  4I0X B;  1OCZ C;  5AG2 A;  3K5L A;  4LF8 B;  4DV3 O;  1WA8 A;  4JI0 B;  1W59 A;  4YXW G;  4JPR A;  3K06 A;  4BW9 A;  3CC7 V;  3M7M X;  4O4I B;  3T2M A;  2IH1 C;  2UUB O;  1SS3 A;  3NR7 A;  1ZTE A;  4NXN B;  4DK1 A;  1BE3 H;  1ZSP A;  4OPA A;  4QPK A;  2AXT Z;  3BFR A;  1Y74 A;  2ZD9 A;  4JAS A;  4X8A A;  1YI2 V;  1AI4 A;  1S5L Z;  1WPB A;  2YSU B;  4BW5 A;  5JJE B;  3VQW A;  1N34 B;  2CTW A;  1U97 A;  3ETE A;  3K0G A;  5LHH A;  3ABT A;  3BAA A;  3STZ C;  3K5M A;  2PF4 E;  4B3T O;  5FNV B;  3ZHS A;  2FL4 A;  5CB4 B;  3JD2 A;  2HHH B;  4ZHQ A;  3CMA V;  1WLE A;  1M56 C;  1OJH A;  1XQ8 A;  1O9H A;  1EZV H;  3CME V;  3ASN B;  2QA4 V;  5EC2 C;  4UCO A;  3PJS K;  4JI3 B;  1L0N H;  5KA5 A;  4H37 A;  1M9N A;  3KG2 A;  1R3J C;  3K04 A;  4MVZ A;  1FAF A;  4ASU G;  3IC7 A;  4B3S B;  3K59 A;  1HNZ O;  4IIJ B;  2L35 A;  2ZNI A;  1VQL V;  2JEX A;  1AJQ A;  2R9R B;  3ABK B;  1R1B A;  4DR6 B;  3F7Y C;  5IWA O;  3O9O A;  4DV0 B;  4JI8 B;  4X62 O;  1WJZ A;  1Q81 W;  3APQ A;  1TUB B;  1LUV A;  5C93 A;  4DR1 O;  2ADP A;  5B1B B;  1Q86 W;  2P4V A;  2AHY A;  4LF5 O;  4LF6 B;  5LGT A;  2JVD A;  1QU7 A;  1L0L H;  1R6T A;  3T1H B;  1HR0 O;  1PL0 A;  4WBN B;  1EM1 A;  5FPR A;  5DED A;  2C2A A;  1QR8 A;  3OD4 A;  4JI7 O;  2V1D A;  1BMF G;  2ZIN A;  2UXD B;  5LXT A;  1R3I C;  3X2Q B;  3ZCC A;  4KHP O;  4F4L A;  4ICG A;  5BXZ A;  5JVD A;  1ROP A;  4Z1V A;  3J81 N;  4QIW F;  1XMO B;  2QWN B;  2XOK G;  3CC2 V;  2AZ0 A;  3SGI A;  3CP1 A;  4AQY O;  4MVO A;  3FYE B;  1YVW A;  3RYC B;  5LYJ B;  5IYZ A;  3L71 H;  2ILM A;  5H2F Z;  3IJ4 A;  4GKK O;  3UO2 A;  5KHJ A;  3LUT B;  1FFT B;  4D7T A;  2VS0 A;  4E2L A;  1YJ9 V;  3MD0 A;  4GX0 A;  3CCJ V;  3E86 A;  2PYL A;  3L74 H;  1NT2 B;  3SJB C;  2NR5 A;  4LR3 A;  3W7U A;  5KX5 A;  4MS2 A;  4PDM A;  4C7U A;  3ABK C;  3FFQ A;  2QKC A;  1S0V A;  1YDX A;  5CA1 A;  4IGG A;  1XOU A;  2RMK B;  3LSU A;  4U3J B;  2RJZ A;  2Y69 B;  3SYO A;  3J7A U;  1F23 A;  4HZ3 A;  3O65 A;  3BPZ A;  1JJ2 U;  5BR8 B;  4I4T B;  2QGN A;  4JZG A;  4PDV A;  2WWW A;  5B3S C;  5JCO A;  1XL4 A;  4JAA A;  3HKB A;  2LQT A;  2NN4 A;  2EZP A;  1IBK B;  3X2Q C;  2BSK A;  5IJ9 A;  5JJN B;  2OTL V;  1E79 G;  3IGA C;  2YEV B;  3G71 V;  4ZKI A;  1KQS U;  3RBZ A;  4DV2 O;  3J80 N;  3K5O A;  1N32 O;  2QWQ B;  3K79 A;  3RWR D;  2CH7 B;  5JJJ B;  4DXW A;  1VQ7 V;  3E8F A;  4MVS A;  5B1O A;  2HG5 C;  1H38 A;  4BIU A;  4DRX B;  1UJW B;  5LHI A;  2XND G;  2IJH A;  1B04 A;  4UVA A;  3AG3 B;  1CXZ B;  4JI8 O;  3N27 A;  2JRI A;  2E74 B;  2Q6A A;  1TVK A;  2JGD A;  3L73 H;  4HNA A;  1MA1 A;  2CDY A;  1VQ4 V;  1WN7 A;  3HKD A;  1GN2 A;  3CEI A;  3N2K A;  3TJT A;  3S3X A;  2KB1 A;  2YIB D;  1AP6 A;  1KEC A;  1K5S A;  2HKO A;  3CJH B;  3ZN1 A;  2IU0 A;  2Y69 C;  2Y48 A;  4UCU A;  4MW3 A;  3LNM B;  3DC5 A;  2EX3 A;  1CPY A;  4J7Z A;  1AVM A;  2NLJ C;  4FVM A;  4TV9 A;  3CS5 A;  2M7W A;  2WA3 A;  1FXH A;  3SPC A;  3OM3 B;  4FLW A;  4L8J A;  2P5O A;  3PN1 A;  2B9Z A;  1ZL8 A;  5IYB O;  3OW2 U;  1K33 A;  4WFE A;  4UVC A;  4TQF A;  4PJ0 Z;  1UPG A;  5K1P A;  3AG7 A;  3H9V A;  2QKS A;  1L1F A;  1MAB G;  2CTQ A;  1EN5 A;  1JFF A;  4GUN A;  1AP5 A;  3LSQ A;  2Q0O C;  2A0L A;  1GM9 A;  1D2D A;  1EFR G;  2N74 A;  4PA3 A;  4RWU A;  4LF9 B;  3AG3 C;  4CS4 A;  4ZOL A;  1XMQ O;  4DUZ B;  1TAE A;  5EYP B;  4X1I B;  2L6L A;  5H6R A;  4UCT A;  3H1J H;  5FL7 G;  4TT3 G;  5LOV B;  3RT3 C;  4CC6 A;  1RSO A;  3ZHU A;  2QE7 G;  4DV7 B;  4DR4 B;  3NXS A;  4G2K A;  4J80 A;  2EIJ B;  3AG4 C;  3EHB B;  3RYH B;  2EIK C;  3BVO A;  5KLV H;  2Y0P A;  4JI5 B;  3ETG A;  4B3R O;  3ZX6 A;  1SQB H;  3UKM A;  3ETQ A;  4MVR A;  4I9W A;  4GX2 A;  3FAV A;  1OCR B;  3THO A;  2WLJ A;  5B1A C;  3Q4H A;  4X64 B;  4LF4 O;  1NS1 A;  2XHB A;  3KKY A;  1XL6 A;  4TUY A;  1JX9 A;  2FTK A;  3H1H H;  3SR2 C;  2DYS B;  4A5U B;  3EVK A;  5KHK A;  1SQF A;  4DR5 O;  5IJ0 B;  5CA0 B;  3JAR A;  1XDC A;  3A8T A;  4R8C A;  2Z5U A;  3ZMV A;  5GTI Z;  1H2L A;  4CS2 A;  1YIT V;  1WB7 A;  3MHH C;  2XAF A;  1NQT A;  2ADQ B;  1QVG U;  2ZNJ A;  1SER A;  3OGI B;  1DF5 A;  2MK3 A;  4NXM O;  1J5E B;  3OUF A;  3JAK B;  4IYH A;  5IYD O;  3JD1 A;  4ZI7 A;  1I5X A;  4DV3 B;  4EFB A;  3W7X A;  3EFF K;  4TSF G;  2E5L O;  1MZE A;  4FK5 C;  3A0B Z;  2WLI B;  4FMT A;  3ZRS A;  2EIJ C;  3JD4 A;  1NU1 H;  3ZRW B;  1K4D C;  2R9I A;  5F2V O;  3F5W C;  2R9A A;  1GK9 A;  3ZRX A;  3CPW U;  4O2A B;  1WPX A;  3CB2 A;  3D36 A;  3M8A A;  4H44 B;  4MVQ A;  1OCR C;  3DC6 A;  2HJF C;  4G28 B;  2CE4 A;  5KHI A;  4I5S A;  1VQP V;  4P9O A;  4LFA O;  1GKF A;  2EJR A;  1GTO A;  3L75 H;  2PY5 A;  5HFM A;  5JH7 B;  2DYS C;  1FXK A;  1XNQ O;  1Q82 W;  1SQX H;  2P4K A;  4B3T B;  2W6J G;  1XBL A;  4LNU B;  2W0F C;  4CH6 A;  2OTJ V;  2XAG A;  1BCC H;  5J9P C;  1QR9 A;  1PNM A;  4JYY A;  4FLY A;  2YI8 A;  1JCH A;  4CC5 A;  3OT7 A;  1K8A W;  4JV5 O;  3H1I H;  3WFV A;  2IM9 A;  4PI0 A;  1OCO C;  4DO2 A;  2OYQ A;  2XAJ A;  2ZKO A;  1SZX A;  2N05 A;  1R3L C;  3JAS B;  5E1A C;  1X4T A;  3CRA A;  3E2E A;  2HP8 A;  3BAB A;  3CRC A;  2DQ0 A;  2WAM A;  4FFB B;  4BAY A;  4OPH A;  1F51 A;  2ODM A;  4QJF B;  3E22 A;  5IWA B;  3HB3 B;  4RQE A;  5EBM C;  2FKX A;  4X62 B;  2QDO A;  4WCE V;  3A0R A;  3BHP A;  2IU3 A;  1N0N A;  1O9G A;  4OXS A;  5KMG A;  3JAW A;  4J7K A;  4DR1 B;  3RYI B;  2JJ1 G;  4I55 B;  4J41 A;  4IYI A;  4LF5 B;  3DXR B;  4DV5 O;  4JTC B;  1NJI W;  2EUL A;  5EK0 A;  2PUS A;  1Y76 B;  3F5T A;  4UV9 A;  1XHZ A;  1ZLZ A;  1HR0 B;  5J2T A;  4DUY O;  2F66 C;  2UU9 O;  4MT8 A;  1VF7 A;  4JI7 B;  3B09 A;  1N4C A;  3AK3 A;  4J42 A;  4KHP B;  1GM8 A;  3E8B A;  3R65 A;  4JTA B;  3QNE A;  1EZJ A;  5KA6 A;  1BHA A;  1H2G A;  4LWS B;  4O4J A;  4ABM A;  5ITZ B;  4O2B A;  1S77 D;  4I0X A;  3GWK C;  4QE7 A;  1IVS A;  1YXB A;  1NZ6 A;  3RYF A;  2GUZ A;  1Q7Y W;  4AQY B;  4AIL C;  1G4Y B;  2OCC B;  5H5N A;  3ETD A;  1N33 O;  3T4D A;  4GKK B;  1GO3 F;  2GHY A;  3CCM V;  1OZ0 A;  4XDJ A;  4YJ2 A;  1VF6 C;  2UXB O;  3K58 A;  1JPX A;  3I55 V;  3CRM A;  4YIP A;  4PA4 A;  4JI6 O;  1XRE A;  1Q6H A;  5BMV A;  1WA8 B;  4K3A A;  2YIA A;  4W4K A;  4NVP A;  5E79 Z;  3C90 A;  2H94 A;  2Q4P A;  4UB8 Z;  1XI1 A;  5KAI Z;  4PA7 A;  2Q0A A;  2AZ2 A;  3LDC A;  5CB4 A;  2YXH A;  3SJA C;  5GON A;  2B5U A;  2GV9 A;  4FLV A;  2K1E A;  4DK0 A;  3K9S A;  1M57 C;  3CC4 V;  3OR7 C;  1WNS A;  1VQM V;  4N21 A;  3ZS8 C;  3CX5 F;  4DV2 B;  3AK2 A;  1N32 B;  4FLU A;  3OAA G;  4LFC O;  3AEI A;  3IFX A;  5IT9 N;  1BHB A;  1IDS A;  3CRR A;  4K8X A;  2F1M A;  2OCC C;  5FPO A;  4O4H B;  2KSD A;  4AHC A;  1EBO A;  1R73 A;  4JAU A;  3RVY A;  4UFZ A;  1I0H A;  1TUB A;  4BIZ A;  3CD6 V;  3E8H A;  1NKD A;  1MSD A;  1R3K C;  1V54 B;  2ATK C;  3TGU H;  3K9A A;  4JYB A;  3TET A;  3SYC A;  3T1Y O;  2OIE A;  3JSN A;  1QVF U;  3KCY A;  4H0L B;  4U3F H;  5B3S B;  4GX5 A;  1Q3E A;  5D5Q A;  1A32 A;  1BS3 A;  1AJP A;  4GLX A;  2LGQ A;  3B77 A;  2CGO A;  3E83 A;  3QF7 A;  2UUA O;  1FD9 A;  4D7S A;  3VOU A;  4X66 O;  1YHQ V;  4QPJ A;  2Q68 A;  3S3W A;  4F6R A;  1SQG A;  1JR9 A;  1FXV A;  4JI4 O;  2DWE C;  3TCU A;  1B06 A;  2DQ3 A;  2EIL B;  3JD3 A;  3ZJZ A;  4PEL A;  1V55 B;  5LXT B;  1VF5 B;  1EN4 A;  2A06 H;  1HNX O;  2EJ7 A;  5HFL A;  3QO5 A;  1H2K A;  4FM1 A;  2YXL A;  5KAF Z;  3IAY A;  3SPH A;  4BWA A;  5LGN A;  3WB0 A;  4ZIB A;  5JVD B;  1NBM G;  1OV9 A;  1H2M A;  2ETN A;  1EN6 A;  3OUS A;  2OIG A;  4FPP A;  4WFG A;  2KG7 A;  1XMQ B;  5IYZ B;  1VQ5 V;  1I94 O;  3ZHV A;  2P67 A;  2NNU A;  1V54 C;  4IHJ A;  3RVZ A;  1G8M A;  4X65 O;  4I4T A;  4DR3 B;  1WP7 A;  2P22 C;  1U96 A;  2AGA A;  1DK1 A;  4AI8 A;  3ZHQ A;  3MDS A;  3ZBH A;  4B3R B;  5EIB D;  1W0K G;  2CTR A;  5CA1 B;  1CP9 A;  5EZY A;  1SKV A;  4BR6 A;  2YEV A;  1VQO V;  2LFR A;  3CRQ A;  5LP6 A;  4LF7 O;  4TV8 A;  4LF4 B;  5TIS Z;  1NVP D;  1N36 O;  3OMI B;  2F4V O;  5JWP A;  1KP3 A;  3BRC A;  3G80 A;  4FJC C;  4HAM A;  4I50 A;  3ASO B;  1SES A;  2CGN A;  2QM7 A;  1TUE B;  4JYC A;  2Y4U A;  2XTA A;  4DR5 B;  3CXH F;  2EIL C;  3HKB B;  5B66 Z;  1P7B A;  4UCS A;  4FLZ A;  1V55 C;  3P30 A;  4U7O A;  3ZIA G;  1HDJ A;  2BSK B;  5IJ9 B;  1GH6 A;  4BIO A;  3CCQ V;  4X1Y A; 
#chains in the Genus database with same CATH homology
 2LGW A;  3APO A;  2CUG A;  2QWN B;  2QWQ B;  2L6L A;  2KQX A;  4IT5 A;  4J7Z A;  2CTW A;  2YUA A;  2QWO B;  2Y4T A;  2YS8 A;  3AG7 A;  1XBL A;  2DN9 A;  2OCH A;  1BQZ A;  2N05 A;  2CTQ A;  1WJZ A;  3UO3 A;  1IUR A;  2QSA A;  2Y4U A;  2M6Y A;  3APQ A;  1BQ0 A;  3UCS C;  2CTR A;  4J80 A;  2PF4 E;  2N04 A;  2EJ7 A;  2LO1 A;  1FAF A;  1NZ6 A;  3BVO A;  2CTP A;  3UO2 A;  1HDJ A;  1GH6 A;  2GUZ A;  2GUZ B;  4RWU A;  2QWP B;  2QWR B;  2DMX A;  1FPO A;  1N4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...