2CTPA

Solution structure of j-domain from human dnaj subfamily b menber 12
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
GSSGSSGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of J-domain from human DnaJ subfamily B menber 12
rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily B member 12
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ctpA01
1WJZA 3UO2A 2LGWA 2QWNB 1N4CA 1XBLA 2CTWA 3AG7A 2CTRA 2M6YA 2CTQA 2CUGA 2GUZB 1FAFA 2QWOB 2CTPA 2QWPB 2YUAA 2N04A 1BQ0A 2KQXA 2PF4E 2Y4UA 4J7ZA 1FPOA 2OCHA 2LO1A 2Y4TA 3APQA 2YS8A 4IT5A 3APOA 1NZ6A 2GUZA 2N05A 1BQZA 2QSAA 1IURA 3BVOA 3UO3A 1HDJA 3UCSC 2DMXA 2L6LA 2QWQB 4RWUA 2EJ7A 2QWRB 2DN9A 1GH6A 4J80A
chains in the Genus database with same CATH superfamily
4CH3A 3J7AU 3F7YC 4DW0A 3HKCB 1N34B 4TUYA 4B7EA 5LP6C 3OUFA 4X1KB 1H2NA 3T1YO 5IYZA 3RVZA 2PUSA 4ZOLA 3ZMUA 1KBHA 4GYCB 2X7RB 2UXDO 1S77D 2OYQA 3RYHB 1KECA 3L73H 5EBMC 2CTWA 2WA3A 1US6A 2WLIB 1OCCC 1K5SA 2EIMC 1TUEB 3K59A 2Z5UA 4JAUA 3CCLV 1Q8IA 1Y4MA 1IXBA 3STLC 1D5AA 3WB1A 3FFQA 2BOBC 4PI0A 3P3PA 2JGUA 5CA3A 5KX5B 3CCUV 3B8NA 2WLLB 4DUZO 3MDSA 4OXSA 4FM2A 3TCUA 2EX3A 4RQFA 5L3CA 4GLXA 4AQYB 3ZRXA 4L8JA 4KFMA 4PDLA 5FPOA 4B3MO 1Q43A 2NNUA 1L0LH 4LCUC 3ZRVA 3AG4C 1SF9A 4N21A 3G4SV 1AI6A 1GM9A 4DR7O 3AK3A 3OEEG 4DR7B 1YJ9V 2PI5A 2WLLA 4EKWA 5KX5A 2ODMA 3SJQC 1Q6IA 3H1JH 4UXNA 4JI7B 4MVSA 1QLEB 5K1PA 1S72V 1XMQB 1NS1A 3CXHF 4J80A 3H9VA 1EN5A 1K4CC 4D6TH 1HR0B 3JD1A 2YIBA 3EFFK 1AROP 5BZBA 5DEDA 1K92A 3OMAB 3ASOB 4FZ1A 4IHJA 3UM7A 1VF6A 3M8AA 3F5TA 2NN4A 1YTFD 5EZYA 4I5SA 1PPJH 2Z0AA 3K03A 1VQ9V 3SGIA 4IIJB 3E86A 4I7ZB 1K97A 1FAFA 4IGGA 1WA8A 1W59A 2CH7B 3RFRA 4X1YA 4MVRA 1F23A 2YDEA 2GUZA 3CEIA 2PYLA 2A06H 1GN3A 2CE4A 4JZ2A 3M7MX 4LWSB 3B4SA 5IY5B 2QKSA 2Q0OC 4DV2B 3OAAG 5IYBO 2P6JA 2ZE7A 3DTUB 4FLYA 3RYIB 4DR3O 5IY5C 4O4JB 1W0JG 2HP8A 2CGNA 2ZE5A 2DJVA 2C2AA 1QVFU 3LNMB 1NTMH 4LC1A 3AG3C 4JTAB 3ZHSA 2B5UA 3ABTA 5EC2C 2IU3A 1Z5WA 5E1AC 4QE7A 2R70A 4TUYB 5JJJB 1T5EA 4H13B 4X20A 5LYJA 3JALB 4Z1VA 3K04A 5LHIA 4FM0A 5E79Z 4I55B 1IBKB 4U7NA 1JCHA 2CUGA 4JPRA 4NTYA 1EFRG 3SYOA 1Y74A 2HHHB 3G6EV 3QF7A 3RGBA 4DR1B 4O2AB 4XDLA 4CH4A 1PNKA 3OGIB 4HAMA 4UCRA 1L1FA 4K35A 3ZN0A 1P7BA 1EBOA 1HNWO 1E79G 4BIZA 2XAGA 3QTCA 2AW9A 1J5EO 2AZ2A 2DN9A 1I94O 1GN6A 3JD2A 4JI5B 1M1KW 3OMIB 2M6YA 4R8CA 4XDKA 3G67A 1K5QA 3OTFA 2X6CA 5B5EZ 2DWEC 3K79A 1N36O 1R3JC 1NU1H 1H8HG 3A0HZ 3VQXA 1N0JA 1VQLV 4TSFG 2QWQB 3E22A 2YC0A 2B1GA 4GKKO 3BRCA 4FFKA 1PL4A 2P90A 4B7KA 2WLIA 4LF9B 2OIEA 4FLZA 1SQPH 3O9OA 4O2BB 2P4VA 4LF4O 3H1HH 2Y4UA 4MVZA 4OGQB 4TWKA 1LNQA 4DR4B 1CEZA 4B3RB 1XMOO 2OWOA 2XAJA 5KHJA 1QR9A 5LA6B 4F6EA 5IYZB 2KKWA 4UCVA 5CB4A 1SA0A 4MVUA 2QDOA 2IW5A 5H2FZ 3JARB 1CPYA 3AG7A 3HKBB 5LHHA 4IIJA 4R50A 4LNUB 2DQ0A 1SQGA 1A32A 3K08A 4KP4A 4DO2A 4IL6Z 1H2SB 1HNZB 1P49A 1IURA 1THZA 2HJDA 3TJTA 1N8RW 4RO2A 4X1IA 4WFEA 1Q5OA 4I55A 2L6LA 3D3IA 2LFSA 4MTFA 1WPXA 4DV4B 5KHGA 4DYLA 4DV4O 1VMGA 5CBFA 5H6QA 4LBEC 1G4YB 4L87A 3K5LA 3CS5A 1KYOF 4QNHB 1MSWD 3ASNB 3APQA 4JYAB 2Y69B 3LDDA 2UUAB 3U0ZA 2QM7A 2OT5A 2P06A 2EIJC 1YJWV 1BHBA 4JI4O 2G38A 4B3SO 1ZLZA 5C8YA 4JI4B 1Y66A 3IJ4A 2EIJB 1OZ0A 2LFRA 1MZEA 2HJFC 4Z2WA 3W7TA 2GV9A 3ETQA 4O4HA 3SYQA 3HKCA 4WFGA 2Q5ZA 5B1AC 3G6BA 2W6JG 5IYCO 4EB6B 3T1HO 4JYYA 3CMEV 3SPGA 4AQYO 3T1HB 3I55V 1BCCH 3G80A 2ATKC 4X62B 3T4ZA 3ZHUA 4LNUA 4GUNA 4NXMB 2EULA 4HYOA 1I5YA 3LSQA 2P5OA 1N32O 2EIKB 2IJHA 3K5OA 1SA0B 2Y0PA 2RJZA 2UUCB 1L0NH 2OCCC 3FYIB 4JYCA 5B1BB 2ZR3A 1F4MA 2RN9A 4LR3A 4U7OA 2HFEC 3K06A 4PJ0Z 4O4LA 1AB3A 1JQ0A 1XMQO 4JYBA 3SPHA 2X0LA 3N2GA 5LGNA 1AJNA 2WA4A 3E8FA 3RYFB 4OPAA 1SZXA 1GK9A 4DV5O 1YDXA 3JASA 2V1DA 3ZHTA 5K1XA 4DR2O 3RYCA 3ZMZA 4DR2B 4YY3O 1E1QG 2UUBB 1EM1A 4KHPO 4LF8B 3W7XA 3ABMC 3T1CA 3HPLC 4JI3B 4WFHA 3RYIA 3FYEB 1HNXO 3FB7C 1YITV 4PA3A 3DGEA 4MVQA 4H33A 2ZE6A 3JAWB 3LNNA 3KCYA 1GH6A 4DR5O 1R6KA 3C3SA 4EFEA 2ZM6B 4WFAV 3A0RA 3CCQV 2BTQB 2VQFO 4UUJC 3K0GA 4YIOA 2R9RB 4DR3B 3CRQA 1XQ8A 4PDVA 4DV0B 3ZIAG 2H94A 1BT8A 4I9QA 2QA4V 4DK1A 2Q67A 1PM9A 3RWRD 1Y74B 1TVKA 3NXSA 1KKDA 1RFYA 3ETDA 4DRXB 4E2LA 4MTOA 4QPKA 5JCOA 3CC7V 1WLEA 4CS3A 3L75H 4FK5C 3B77A 3R66A 4O2BA 3ZRWB 1OCOC 3R65A 3H1IH 2X6AA 1R1BA 3ABUA 5JH7A 2R72A 3UKMA 5LBQA 5EIBD 2NLJC 1S76D 4UVCA 3IC7A 3T1YB 1S5JA 2DW4A 3SJCC 1QNMA 1GTOA 1KKCA 2DE0X 4DRXA 1KU9A 1URFA 3QO7A 1VQ7V 1XHZA 1OHHG 3ZMVA 3DXRB 2JK5C 3IFXA 1SETA 1J5EB 1VQMV 2YXYA 4JI5O 1QLNA 1HW7A 2HVKC 1ZX3A 4MVOA 3JAMN 1O9HA 3MD0A 3B40A 1H2KA 3QG5A 2ZKOA 4YHHB 1FS0G 3FB5C 5J9PC 4LFCO 1GO3F 4DUZB 2A79B 3RVYA 2CK3G 1FJGO 1RPOA 2LW7A 4RUFA 1H8EG 3BAAA 4LF9O 2Q73A 2K9PA 4I0XB 2PYJA 2Q68A 5KAIZ 3LDCA 3OT7A 3A8TA 1M56B 1XUQA 5JJEB 2QTOA 1MMMA 4U3JB 1RM1C 4D7SA 1SKVA 1XBLA 3JASB 4BAYA 3TXQA 4JI8O 4X8AA 1F4NA 4RAIA 4LFAO 4JI7O 3QO5A 2XNDG 3P30A 2GTSA 4JZGA 3N2KB 3U10A 1MNGA 4GT1A 1DLBA 4LFAB 3JATA 3L9DA 3CRMA 3T4DA 4MW3A 1SQVH 1HNZO 1YXBA 3HKDB 1PV0A 3M99B 4DV3B 3QVNA 1Q81W 2LGWA 3K0DA 1KUQA 4JI6B 1YHQV 4DV3O 1N33B 2QWOB 4J41A 5GTHZ 3ABLB 4WFFA 2WSSG 2KQXA 4GKJB 4Z1MG 2ZT9B 4F6RB 2LO1A 4DUYO 4LF6B 3U11A 4X66O 4DUYB 4LF6O 2F43G 4FFBB 2YICA 4D7TA 4X66B 2JGDB 3ABLC 1JFFB 4AI8A 3CP1A 4B3SB 4I9WA 4OX9O 1I08A 3K3WA 4W4LA 2WLNA 2BCCH 5JVDA 3AK1A 5LXTA 2FKXA 4JI0O 4OX9B 3WFVA 2JEUA 2YS8A 1EN4A 3F5WC 5LHGA 3D36C 4HNAA 1CP9A 1PNMA 4FVMA 4U3FH 3CC2V 4RWUA 2QGNA 2F4VB 3E2EA 4XDJA 5B1OA 3UO2A 3ZRWA 3JCZA 1PNLA 1M5IA 3ZMTA 4NXNB 1K3EA 2XASA 2WLJA 2YXLA 3CRRA 3RT3C 1VP7A 4J9YB 1VEWA 4AHCA 2JEXA 1DF4A 3AEIA 1ZSPA 1KP2A 1FKAO 3SYAA 4X62O 5KHKA 4CS4A 1XNRB 1KB9F 3CJHA 4LFBO 4ZI7B 1AJPA 1K9MW 2UUCO 1EN6A 4PA9A 2IJKA 2ADPA 1JX9A 3X2QB 2PI4A 2DQ3A 3BVOA 2OTJV 1OCCB 2GSMB 5KHHA 5IJ0A 1FXKC 3SYCA 5AG2A 1JMKC 2HHHO 5LMUO 4DR1O 3IC9A 5IYDO 1JPXA 2CTPA 2QWPB 1IZ3A 1O9GA 2YUAA 2DOSA 2DWDC 3I5DA 4X20B 5EBWC 5B66Z 2XTAA 4ZIBA 4UCUA 1LUVA 4JASA 3B09A 4FLUA 3ZRSA 4DV5B 3FB6C 1HWYA 4I4TB 4N23A 5LP6A 5CB4B 4CH6A 2ZE8A 4MVMA 1SQXH 3RYHA 1Q6HA 2XOKG 1VQ6V 2XT9A 3AG4B 4P30A 1XOUA 2QEXV 4LF7O 2Q7EA 1QHTA 4YY3B 2FTKA 2AGAA 4UV9A 1GM7A 4ZOLB 3ZBHA 4KHPB 1Y76A 2ITCC 1QR8A 3S3WA 1OCRC 1KQSU 3CRAA 3N2GB 3BCCH 4KXRA 2OIGA 1AP6A 2YEVB 5CA1B 3OEHG 3CCJV 1KMIZ 3GVMA 1R3KC 3C90A 4DV6B 4O4LB 3FX7A 1OCRB 2CTRA 4DV6O 5KMGA 4P9OA 1QCEA 4JAVA 1R3LC 2JS5A 4LH6A 2PGGA 1XMOB 2YXHA 1ZWIC 1TGOA 1GM8A 3ZX6A 4B3TB 5IT9N 3OTOO 4CC5A 2MW2B 3HKEA 2Q6AA 2N74A 5KUKA 4TV8B 4FJCC 4FM1A 3ASOC 2DYRC 3K9SA 2A9HA 3JD0A 2B1IA 3OD4A 3L71H 3EVKA 5GW7A 1IVSA 4G28B 4K3AA 4YIPA 2D3OW 4X64B 2DYSB 1P7GA 5L3FA 3CYOA 1NTKH 3LSSA 3KG2A 4ABMA 1UJWB 2UXXA 2RMKB 3E8BA 1R6TA 2M7WA 1ZTEA 2IH1C 3TGUH 4UCSA 4JV5O 2ADQB 3JYCA 1OCZC 3QNEA 5H5NA 1XNQO 4JYAO 5BR8B 2IBZH 1N0NA 2N05A 2BTOA 1K73W 1NJIW 2ZCEA 1IBMO 1DK1A 2UXDB 3W7WA 4H0LB 2ZQMA 3G71V 2QJ1A 2WWWA 1AILA 1AI7A 4NR1A 3VQVA 1ZL8A 4BR6A 4X89A 1VQKV 1XEQA 2ZNJA 4FMTA 1SC5B 4JF3A 4WFBV 4AILC 1VQPV 2P22C 1YEWA 2E75B 5IE9A 3ICXA 1ORQC 1YSCA 2ILMA 1P4RA 5LL6Y 4LWSA 1DGSA 2EIKC 4CZZA 1FFXB 2ZXWB 4FLWA 4UFZA 5BMVB 4J7JA 1RP3B 2ITDC 1K8AW 1GKFA 2OCCB 2FB5A 1B3QA 5B1BC 1KP3A 3AG2B 3ZHVA 4B3MB 5FPRA 2HEPA 2H8PC 3KKYA 1XL6A 1MG1A 1WJZA 3CSXA 4JI1B 4YJ3B 4TV9B 1XL4A 3TXSA 3ABKB 1ZUQA 1QBZA 5JQGB 1VF6C 2JIZG 1VQ5V 2AHYA 1G8MA 2P67A 1HR0O 4J7KA 1Z2GA 5D5QA 3JAKB 1WN7A 4NYKA 5GONB 5DN6G 2KB1A 2EBOA 1SZTA 5J2TA 1GN2A 1NH2B 3IAYA 3J80N 1VQ8V 1JR9A 1FFTB 2GTAA 2QTSA 1YVWA 5GTIZ 3CCVV 3LSUA 2LJ2A 4PV1B 3CX5F 1NVPD 1P84F 2Q4PA 4CBCA 1Y67A 2BE3A 1J95A 1SQQH 4RQEA 1QQCA 4IYIA 3FB8C 1RSOA 4F4LA 4DV2O 1G1XB 1IX9A 4DR5B 4WCEV 1S0VA 2UXBB 1XHXA 3CXCU 2IU0A 1SRYA 1FXKA 2UXBO 2XAHA 5JH7B 3ZHQA 3A2FA 3QO8A 1E1RG 3L70H 3ETEA 2EINC 3RBZA 4KL1A 3UCSC 4R7CA 1OCOB 4YJ3A 5J2TB 3E8HA 3NR7A 3JD3A 2VQEO 1IBLB 3ML0A 4Q20A 4JI2O 3H01A 2F95B 2LP7A 4E4EA 4UCOA 2VQEB 4LP8A 2BSKA 4JI2B 2CDYA 3OM3B 2P7TC 1AR4A 4O4JA 1COWG 1SERA 1UPGA 3SPIA 2ZNIA 1IDSA 3DSQA 3KCXA 4GX0A 4I50A 5J2UA 1ENVA 2Q9LA 2JS3A 5BY1A 3CB2A 3WB0A 4F6RA 2E74B 4BW5A 4EEQA 3OUSA 5L3DA 1JA8A 5TISZ 4X65B 4PDRA 1K7DA 3OW2U 5B3SC 5CBGA 1K34A 1M56C 1BZKA 1JFFA 1VQ4V 1Q90D 2Y4TA 1M57B 1B06A 1WA8B 1Z5VA 4FZ0A 4FFBA 2DMXA 4ZI7A 3STZC 1HNWB 4HZ3A 1AI5A 1BL8A 3VQWA 5BMVA 3EXAA 5H6RA 3O65A 1X4TA 4WF9V 1MOFA 2LW1A 4U3JA 2JDIG 4LFCB 1V55C 4ZHQA 1AP5A 1BSMA 3HKDA 4JAAA 5A2QN 4DR6O 3E35A 1RPRA 2VWJA 1MSDA 1N36B 4I50B 5L3BA 3N2KA 1V55B 1Q82W 4TT3G 3MHHC 1WPBA 4ZHQB 1NI8A 2HVJC 4MTXA 3BFRA 4YXWG 1LUWA 3D3QA 3P32A 4B3TO 5F2VO 1WP7A 2XUMA 1D5NA 4LF5O 4DR4O 1TVKB 3LDEA 4RUEA 3AG1B 1I7FA 5IJ9B 4QE9A 1Q7YW 3SPCA 2EILC 1GMGA 1JJOA 2ZIMA 2ZDIC 3B8MA 1WP8A 2YI8A 4UB8Z 5LOVB 3JCUZ 4HNAB 1Q3EA 3AG1C 4DV1O 2QKAA 1VQNV 3FD9A 4DV1B 1FXHA 4NB5A 1VF7A 5KMGB 5JVDB 4W4KA 3BHPA 4JI6O 1YF2A 4EB6A 3CHXA 3E83A 3RN4A 3CPWU 5LOVA 2CH7A 2KSDA 1N34O 1XNQB 5C93A 2EZPA 2Q8VA 4CC6A 5KA5A 3JSLA 3HB3B 4UVAA 2JRIA 3VBBA 2PTMA 1FXVA 3Q4HA 5CBHA 4PDMA 3RYCB 5EYPB 2UUAO 2R9IA 4FLVA 3IGAC 4NKGB 3K58A 2Y48A 2AXTZ 3WB2A 1S5HC 2XHBA 3FAVA 4IHJB 4BWAA 2E3CA 1PL0A 1XREA 4JI0B 5KHIA 4I4TA 4UV8A 3UT5B 3CWBH 5L3GA 3CCSV 4R6ZA 3BABA 1SQFA 2A7WA 1SESA 3K57A 2UXCB 2MK3A 4PA6A 5KLVH 2VS0A 2UXCO 2HLDG 3C3TA 5LMNB 1SS3A 4KUMA 2EIMB 5ITZA 2GDSA 5DM6V 4J7ZA 4DW1A 5LP6B 4TOIA 1DF5A 4MTGA 1IXMA 4QPJA 1NT2B 1QVGU 2GBOA 1N32B 1FXKB 1KD1W 2AZ0A 4J11A 4H44B 2NR5A 4MW8A 1WB8A 3CD6V 2GHYA 2Q7GA 4JI1O 1GAXA 1AI4A 2XAQA 3JAKA 2X6BA 1TUBA 2QSAA 2IJJA 2W0XA 1S3JA 5A9GA 5JWPA 4GX1A 1PKXA 2WLKA 2CAZC 5LMUB 4BIUA 2V7QG 5LYJB 4K0KB 1UFIA 5IWAO 5LGTA 4JGSA 3E22B 5DECA 5IWAB 1QLEC 5LA6A 3CRCA 4YJ2B 3BPZA 3OR7C 5EYPA 1WAZA 1MABG 2DYRB 1G6UA 3EHBB 3OFNG 3TK1A 1BMFG 4EFBA 2UUBO 1YCIA 1H2GA 4QJFB 4FIPC 1XDCA 3RYFA 3PJSK 1RM1B 4LF8O 4TV8A 3SR2C 4Q6GA 2L35A 4PA7A 1R3IC 4JTDB 4FLTA 4K8XA 5D5PA 1HNXB 3SDLA 1HP8A 2ZM6O 4J10A 4G27B 2Q0AA 1OCZB 1Q86W 2N04A 4X1IB 1R6NA 2YIBD 4X1YB 3AK2A 3ZJZA 3CC4V 3OTOB 4DXWA 2XAFA 4GZRB 3VQYA 1QU7A 2YIAA 5KA6A 2BOCC 3FKSG 2DYSC 2B9ZA 4MT8A 4ZBMA 4DV0O 5EZYB 3BY6A 3GWOA 2ZIOA 4O2AA 2F1MA 1EZVH 2R9AA 4MSWC 1IBLO 1NQTA 3OGCC 4X64O 1BE3H 1V54B 2WAMA 1JJ2U 2FMLA 4JV5B 4P2ZA 3AG3B 1NKDA 2LQTA 1YTFB 1Y76B 4O4IA 4O4HB 1V54C 3K5NA 4DK0A 4NTWA 1IBKO 5C8YB 5BR8O 2RNBA 2E5LO 3D8CA 4BIOA 1IBMB 2E5LB 2ARHA 5EK0A 3MHSC 3K5MA 3UO3A 1B04A 2PZSA 3SJBC 5KUMA 2JVDA 1TAEA 4NVPA 1GRJA 4I0XA 1BQZA 1I94B 3CJHB 4GCZA 5CN0A 1BS3A 3JD4A 2YIDA 1MZFA 3ZMSA 3APOA 1NZ6A 1S5LZ 3AG2C 1YZBA 1ZAUA 4YHHO 1XILA 4JTCB 5KAFZ 1AJQA 2JJ1G 4MS2A 5J2UB 2QWNB 1FJGB 1N4CA 3X2QC 2K1EA 4C7UA 1KC8W 5JQGA 2RDCA 2VRZA 3HKBA 3UT5A 3P3NA 1I5XA 2OCHA 2D2CB 4LH7A 3JARA 4PD4F 4X88A 1AVMA 2RCVA 3HKEB 2BSKB 1R73A 1Y6XA 2Z3YA 3WG7B 1VF5B 1BGYH 3J81N 1M93A 4B3RO 5EIBC 3ABMB 4TQFA 1AR1B 4QIWF 4JI8B 3PN1A 4YJ2A 5FNVB 1MA1A 4UB6Z 3WG7C 3E8GA 1BQ0A 1H2MA 4NTXA 4BW9A 1H2LA 1AR5A 5FLXN 3W7SA 2ZR2A 1V9PA 3SPJA 1VIBA 3L72H 5B1NA 4HBNA 1HDJA 4J9ZB 1GN4A 5IJ0B 1NR1A 5LXTB 1WB7A 1RSOB 2F23A 1L8DA 2GUZB 1VARA 2IH3C 1NH2D 3CMAV 3H1KH 5LGUA 3UQ8A 1N33O 3H1LH 2F93B 3CE2A 5L3EA 4GKJO 4ICGA 3TETA 4ZKIA 2KG7A 2Q69A 2EJRA 2V4DA 2VWKA 2QWRB 5EBLC 3GWKC 1PD3A 3L74H 1NTZH 2A3QA 4UVBA 2HKOA 3DC6A 4OPHA 1FFXA 2WPDG 2QM8A 5FL7G 5ITZB 3BA9A 5GONA 4FPPA 2W0FC 4ASUG 3ASNC 1D2DA 3BEHA 1YIJV 4IYHA 2WLMA 4XBFA 2Y69C 2EINB 2OTLV 1CXZB 4O4IB 1OJHA 2F4VO 2IJIA 2YEVA 4A5UB 3ZN1A 2YSUB 4J42A 4X1KA 4PA4A 5JCOC 1YI2V 3B2EE 4PELA 4NXNO 1EZJA 3JALA 3OMNB 1ZL8B 3HR0A 1M9NA 4TV9A 5CA0B 2Y0IA 5JJNB 5LMNO 2AHZA 1M57C 2W6IG 5FNVA 3FAVB 3DC5A 3JSNA 3SJAC 3ZCCA 1VQOV 1I0HA 4X9QA 4WBNB 1XNRO 1NVPB 4H37A 2FL4A 5B1AB 3T2MA 4LFBB 2EJ7A 1YJNV 4NXMO 2IM9A 3Q4HB 4K8ZA 3S3XA 1OV9A 3OE7G 5EC1C 2E76B 2RQ6A 3DXRA 3CCEV 1PP9H 5B3SB 2UU9O 3ZEDA 2HR3A 1FPOA 3WU2Z 3LUTB 2UU9B 4GX5A 3ZHRA 2EZOA 2H3OA 3I56V 2ZDIA 4G2KA 4GX2A 1U96A 4X65O 1M4UA 3K9AA 3BA8A 2QM4A 2ZD9A 5CA1A 4PI2A 5HFLA 2QE7G 1Q6UA 1M90W 4K0KO 2ZINA 2ZXWC 3MAQA 4IT5A 4CH5A 2QKCA 3KZIZ 5IJ9A 1TA8A 1WNSA 3E89A 1JVMA 1H38A 4WBNA 3F7VC 4LF7B 2Q7HA 1FD9A 3N27A 2JJ2G 3D36A 1B6QA 1K33A 2QR4A 4DR6B 4FLXA 5CA0A 2LGQA 4JI3O 1DTOA 3VOUA 5HFMA 3JATB 4CS2A 1NR7A 1U97A 1W0KG 2F66C 4GKKB 1JOYA 3ETGA 2P4KA 1TUBB 1K4DC 4LF4B 1BHAA 1F7YA 2EILB 1FYJA 4DV7O 3ABKC 4UCTA 2CGOA 2PY5A 2WLHA 3THOA 2FYUH 3ZS8C 2VQFB 4DV7B 3OR6C 1NBMG 5IDJA 4LF5B 1SQBH 2JGDA 2ETNA 2UXNA 1W2BU 4PHZA 3RW0A 5CMUA 5H9CA 4TQDA 4B08A 2KG7B 3CCRV 1X59A 2BTQA 2CTQA 1LR1A 1XI1A 2PF4E 3A0BZ 2HG5C 2O57A 3JAWA 3SYPA 5BXZA 3W7UA 2A0LA 4QGPA 3CCMV 2YI9A 1F51A 3GB7C 1ROPA 4P9PA
chains in the Genus database with same CATH topology
1WJZA 3UO2A 2LGWA 2QWNB 1N4CA 1XBLA 2CTWA 3AG7A 2CTRA 2M6YA 2CTQA 2CUGA 2GUZB 1FAFA 2QWOB 2CTPA 2QWPB 2YUAA 2N04A 1BQ0A 2KQXA 2PF4E 2Y4UA 4J7ZA 1FPOA 2OCHA 2LO1A 2Y4TA 3APQA 2YS8A 4IT5A 3APOA 1NZ6A 2GUZA 2N05A 1BQZA 2QSAA 1IURA 3BVOA 3UO3A 1HDJA 3UCSC 2DMXA 2L6LA 2QWQB 4RWUA 2EJ7A 2QWRB 2DN9A 1GH6A 4J80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJZ A;  3UO2 A;  2LGW A;  2QWN B;  1N4C A;  1XBL A;  2CTW A;  3AG7 A;  2CTR A;  2M6Y A;  2CTQ A;  2CUG A;  2GUZ B;  1FAF A;  2QWO B;  2CTP A;  2QWP B;  2YUA A;  2N04 A;  1BQ0 A;  2KQX A;  2PF4 E;  2Y4U A;  4J7Z A;  1FPO A;  2OCH A;  2LO1 A;  2Y4T A;  3APQ A;  2YS8 A;  4IT5 A;  3APO A;  1NZ6 A;  2GUZ A;  2N05 A;  1BQZ A;  2QSA A;  1IUR A;  3BVO A;  3UO3 A;  1HDJ A;  3UCS C;  2DMX A;  2L6L A;  2QWQ B;  4RWU A;  2EJ7 A;  2QWR B;  2DN9 A;  1GH6 A;  4J80 A; 
#chains in the Genus database with same CATH topology
 4CH3 A;  3J7A U;  3F7Y C;  4DW0 A;  3HKC B;  1N34 B;  4TUY A;  4B7E A;  5LP6 C;  3OUF A;  4X1K B;  1H2N A;  3T1Y O;  5IYZ A;  3RVZ A;  2PUS A;  4ZOL A;  3ZMU A;  1KBH A;  4GYC B;  2X7R B;  2UXD O;  1S77 D;  2OYQ A;  3RYH B;  1KEC A;  3L73 H;  5EBM C;  2CTW A;  2WA3 A;  1US6 A;  2WLI B;  1OCC C;  1K5S A;  2EIM C;  1TUE B;  3K59 A;  2Z5U A;  4JAU A;  3CCL V;  1Q8I A;  1Y4M A;  1IXB A;  3STL C;  1D5A A;  3WB1 A;  3FFQ A;  2BOB C;  4PI0 A;  3P3P A;  2JGU A;  5CA3 A;  5KX5 B;  3CCU V;  3B8N A;  2WLL B;  4DUZ O;  3MDS A;  4OXS A;  4FM2 A;  3TCU A;  2EX3 A;  4RQF A;  5L3C A;  4GLX A;  4AQY B;  3ZRX A;  4L8J A;  4KFM A;  4PDL A;  5FPO A;  4B3M O;  1Q43 A;  2NNU A;  1L0L H;  4LCU C;  3ZRV A;  3AG4 C;  1SF9 A;  4N21 A;  3G4S V;  1AI6 A;  1GM9 A;  4DR7 O;  3AK3 A;  3OEE G;  4DR7 B;  1YJ9 V;  2PI5 A;  2WLL A;  4EKW A;  5KX5 A;  2ODM A;  3SJQ C;  1Q6I A;  3H1J H;  4UXN A;  4JI7 B;  4MVS A;  1QLE B;  5K1P A;  1S72 V;  1XMQ B;  1NS1 A;  3CXH F;  4J80 A;  3H9V A;  1EN5 A;  1K4C C;  4D6T H;  1HR0 B;  3JD1 A;  2YIB A;  3EFF K;  1ARO P;  5BZB A;  5DED A;  1K92 A;  3OMA B;  3ASO B;  4FZ1 A;  4IHJ A;  3UM7 A;  1VF6 A;  3M8A A;  3F5T A;  2NN4 A;  1YTF D;  5EZY A;  4I5S A;  1PPJ H;  2Z0A A;  3K03 A;  1VQ9 V;  3SGI A;  4IIJ B;  3E86 A;  4I7Z B;  1K97 A;  1FAF A;  4IGG A;  1WA8 A;  1W59 A;  2CH7 B;  3RFR A;  4X1Y A;  4MVR A;  1F23 A;  2YDE A;  2GUZ A;  3CEI A;  2PYL A;  2A06 H;  1GN3 A;  2CE4 A;  4JZ2 A;  3M7M X;  4LWS B;  3B4S A;  5IY5 B;  2QKS A;  2Q0O C;  4DV2 B;  3OAA G;  5IYB O;  2P6J A;  2ZE7 A;  3DTU B;  4FLY A;  3RYI B;  4DR3 O;  5IY5 C;  4O4J B;  1W0J G;  2HP8 A;  2CGN A;  2ZE5 A;  2DJV A;  2C2A A;  1QVF U;  3LNM B;  1NTM H;  4LC1 A;  3AG3 C;  4JTA B;  3ZHS A;  2B5U A;  3ABT A;  5EC2 C;  2IU3 A;  1Z5W A;  5E1A C;  4QE7 A;  2R70 A;  4TUY B;  5JJJ B;  1T5E A;  4H13 B;  4X20 A;  5LYJ A;  3JAL B;  4Z1V A;  3K04 A;  5LHI A;  4FM0 A;  5E79 Z;  4I55 B;  1IBK B;  4U7N A;  1JCH A;  2CUG A;  4JPR A;  4NTY A;  1EFR G;  3SYO A;  1Y74 A;  2HHH B;  3G6E V;  3QF7 A;  3RGB A;  4DR1 B;  4O2A B;  4XDL A;  4CH4 A;  1PNK A;  3OGI B;  4HAM A;  4UCR A;  1L1F A;  4K35 A;  3ZN0 A;  1P7B A;  1EBO A;  1HNW O;  1E79 G;  4BIZ A;  2XAG A;  3QTC A;  2AW9 A;  1J5E O;  2AZ2 A;  2DN9 A;  1I94 O;  1GN6 A;  3JD2 A;  4JI5 B;  1M1K W;  3OMI B;  2M6Y A;  4R8C A;  4XDK A;  3G67 A;  1K5Q A;  3OTF A;  2X6C A;  5B5E Z;  2DWE C;  3K79 A;  1N36 O;  1R3J C;  1NU1 H;  1H8H G;  3A0H Z;  3VQX A;  1N0J A;  1VQL V;  4TSF G;  2QWQ B;  3E22 A;  2YC0 A;  2B1G A;  4GKK O;  3BRC A;  4FFK A;  1PL4 A;  2P90 A;  4B7K A;  2WLI A;  4LF9 B;  2OIE A;  4FLZ A;  1SQP H;  3O9O A;  4O2B B;  2P4V A;  4LF4 O;  3H1H H;  2Y4U A;  4MVZ A;  4OGQ B;  4TWK A;  1LNQ A;  4DR4 B;  1CEZ A;  4B3R B;  1XMO O;  2OWO A;  2XAJ A;  5KHJ A;  1QR9 A;  5LA6 B;  4F6E A;  5IYZ B;  2KKW A;  4UCV A;  5CB4 A;  1SA0 A;  4MVU A;  2QDO A;  2IW5 A;  5H2F Z;  3JAR B;  1CPY A;  3AG7 A;  3HKB B;  5LHH A;  4IIJ A;  4R50 A;  4LNU B;  2DQ0 A;  1SQG A;  1A32 A;  3K08 A;  4KP4 A;  4DO2 A;  4IL6 Z;  1H2S B;  1HNZ B;  1P49 A;  1IUR A;  1THZ A;  2HJD A;  3TJT A;  1N8R W;  4RO2 A;  4X1I A;  4WFE A;  1Q5O A;  4I55 A;  2L6L A;  3D3I A;  2LFS A;  4MTF A;  1WPX A;  4DV4 B;  5KHG A;  4DYL A;  4DV4 O;  1VMG A;  5CBF A;  5H6Q A;  4LBE C;  1G4Y B;  4L87 A;  3K5L A;  3CS5 A;  1KYO F;  4QNH B;  1MSW D;  3ASN B;  3APQ A;  4JYA B;  2Y69 B;  3LDD A;  2UUA B;  3U0Z A;  2QM7 A;  2OT5 A;  2P06 A;  2EIJ C;  1YJW V;  1BHB A;  4JI4 O;  2G38 A;  4B3S O;  1ZLZ A;  5C8Y A;  4JI4 B;  1Y66 A;  3IJ4 A;  2EIJ B;  1OZ0 A;  2LFR A;  1MZE A;  2HJF C;  4Z2W A;  3W7T A;  2GV9 A;  3ETQ A;  4O4H A;  3SYQ A;  3HKC A;  4WFG A;  2Q5Z A;  5B1A C;  3G6B A;  2W6J G;  5IYC O;  4EB6 B;  3T1H O;  4JYY A;  3CME V;  3SPG A;  4AQY O;  3T1H B;  3I55 V;  1BCC H;  3G80 A;  2ATK C;  4X62 B;  3T4Z A;  3ZHU A;  4LNU A;  4GUN A;  4NXM B;  2EUL A;  4HYO A;  1I5Y A;  3LSQ A;  2P5O A;  1N32 O;  2EIK B;  2IJH A;  3K5O A;  1SA0 B;  2Y0P A;  2RJZ A;  2UUC B;  1L0N H;  2OCC C;  3FYI B;  4JYC A;  5B1B B;  2ZR3 A;  1F4M A;  2RN9 A;  4LR3 A;  4U7O A;  2HFE C;  3K06 A;  4PJ0 Z;  4O4L A;  1AB3 A;  1JQ0 A;  1XMQ O;  4JYB A;  3SPH A;  2X0L A;  3N2G A;  5LGN A;  1AJN A;  2WA4 A;  3E8F A;  3RYF B;  4OPA A;  1SZX A;  1GK9 A;  4DV5 O;  1YDX A;  3JAS A;  2V1D A;  3ZHT A;  5K1X A;  4DR2 O;  3RYC A;  3ZMZ A;  4DR2 B;  4YY3 O;  1E1Q G;  2UUB B;  1EM1 A;  4KHP O;  4LF8 B;  3W7X A;  3ABM C;  3T1C A;  3HPL C;  4JI3 B;  4WFH A;  3RYI A;  3FYE B;  1HNX O;  3FB7 C;  1YIT V;  4PA3 A;  3DGE A;  4MVQ A;  4H33 A;  2ZE6 A;  3JAW B;  3LNN A;  3KCY A;  1GH6 A;  4DR5 O;  1R6K A;  3C3S A;  4EFE A;  2ZM6 B;  4WFA V;  3A0R A;  3CCQ V;  2BTQ B;  2VQF O;  4UUJ C;  3K0G A;  4YIO A;  2R9R B;  4DR3 B;  3CRQ A;  1XQ8 A;  4PDV A;  4DV0 B;  3ZIA G;  2H94 A;  1BT8 A;  4I9Q A;  2QA4 V;  4DK1 A;  2Q67 A;  1PM9 A;  3RWR D;  1Y74 B;  1TVK A;  3NXS A;  1KKD A;  1RFY A;  3ETD A;  4DRX B;  4E2L A;  4MTO A;  4QPK A;  5JCO A;  3CC7 V;  1WLE A;  4CS3 A;  3L75 H;  4FK5 C;  3B77 A;  3R66 A;  4O2B A;  3ZRW B;  1OCO C;  3R65 A;  3H1I H;  2X6A A;  1R1B A;  3ABU A;  5JH7 A;  2R72 A;  3UKM A;  5LBQ A;  5EIB D;  2NLJ C;  1S76 D;  4UVC A;  3IC7 A;  3T1Y B;  1S5J A;  2DW4 A;  3SJC C;  1QNM A;  1GTO A;  1KKC A;  2DE0 X;  4DRX A;  1KU9 A;  1URF A;  3QO7 A;  1VQ7 V;  1XHZ A;  1OHH G;  3ZMV A;  3DXR B;  2JK5 C;  3IFX A;  1SET A;  1J5E B;  1VQM V;  2YXY A;  4JI5 O;  1QLN A;  1HW7 A;  2HVK C;  1ZX3 A;  4MVO A;  3JAM N;  1O9H A;  3MD0 A;  3B40 A;  1H2K A;  3QG5 A;  2ZKO A;  4YHH B;  1FS0 G;  3FB5 C;  5J9P C;  4LFC O;  1GO3 F;  4DUZ B;  2A79 B;  3RVY A;  2CK3 G;  1FJG O;  1RPO A;  2LW7 A;  4RUF A;  1H8E G;  3BAA A;  4LF9 O;  2Q73 A;  2K9P A;  4I0X B;  2PYJ A;  2Q68 A;  5KAI Z;  3LDC A;  3OT7 A;  3A8T A;  1M56 B;  1XUQ A;  5JJE B;  2QTO A;  1MMM A;  4U3J B;  1RM1 C;  4D7S A;  1SKV A;  1XBL A;  3JAS B;  4BAY A;  3TXQ A;  4JI8 O;  4X8A A;  1F4N A;  4RAI A;  4LFA O;  4JI7 O;  3QO5 A;  2XND G;  3P30 A;  2GTS A;  4JZG A;  3N2K B;  3U10 A;  1MNG A;  4GT1 A;  1DLB A;  4LFA B;  3JAT A;  3L9D A;  3CRM A;  3T4D A;  4MW3 A;  1SQV H;  1HNZ O;  1YXB A;  3HKD B;  1PV0 A;  3M99 B;  4DV3 B;  3QVN A;  1Q81 W;  2LGW A;  3K0D A;  1KUQ A;  4JI6 B;  1YHQ V;  4DV3 O;  1N33 B;  2QWO B;  4J41 A;  5GTH Z;  3ABL B;  4WFF A;  2WSS G;  2KQX A;  4GKJ B;  4Z1M G;  2ZT9 B;  4F6R B;  2LO1 A;  4DUY O;  4LF6 B;  3U11 A;  4X66 O;  4DUY B;  4LF6 O;  2F43 G;  4FFB B;  2YIC A;  4D7T A;  4X66 B;  2JGD B;  3ABL C;  1JFF B;  4AI8 A;  3CP1 A;  4B3S B;  4I9W A;  4OX9 O;  1I08 A;  3K3W A;  4W4L A;  2WLN A;  2BCC H;  5JVD A;  3AK1 A;  5LXT A;  2FKX A;  4JI0 O;  4OX9 B;  3WFV A;  2JEU A;  2YS8 A;  1EN4 A;  3F5W C;  5LHG A;  3D36 C;  4HNA A;  1CP9 A;  1PNM A;  4FVM A;  4U3F H;  3CC2 V;  4RWU A;  2QGN A;  2F4V B;  3E2E A;  4XDJ A;  5B1O A;  3UO2 A;  3ZRW A;  3JCZ A;  1PNL A;  1M5I A;  3ZMT A;  4NXN B;  1K3E A;  2XAS A;  2WLJ A;  2YXL A;  3CRR A;  3RT3 C;  1VP7 A;  4J9Y B;  1VEW A;  4AHC A;  2JEX A;  1DF4 A;  3AEI A;  1ZSP A;  1KP2 A;  1FKA O;  3SYA A;  4X62 O;  5KHK A;  4CS4 A;  1XNR B;  1KB9 F;  3CJH A;  4LFB O;  4ZI7 B;  1AJP A;  1K9M W;  2UUC O;  1EN6 A;  4PA9 A;  2IJK A;  2ADP A;  1JX9 A;  3X2Q B;  2PI4 A;  2DQ3 A;  3BVO A;  2OTJ V;  1OCC B;  2GSM B;  5KHH A;  5IJ0 A;  1FXK C;  3SYC A;  5AG2 A;  1JMK C;  2HHH O;  5LMU O;  4DR1 O;  3IC9 A;  5IYD O;  1JPX A;  2CTP A;  2QWP B;  1IZ3 A;  1O9G A;  2YUA A;  2DOS A;  2DWD C;  3I5D A;  4X20 B;  5EBW C;  5B66 Z;  2XTA A;  4ZIB A;  4UCU A;  1LUV A;  4JAS A;  3B09 A;  4FLU A;  3ZRS A;  4DV5 B;  3FB6 C;  1HWY A;  4I4T B;  4N23 A;  5LP6 A;  5CB4 B;  4CH6 A;  2ZE8 A;  4MVM A;  1SQX H;  3RYH A;  1Q6H A;  2XOK G;  1VQ6 V;  2XT9 A;  3AG4 B;  4P30 A;  1XOU A;  2QEX V;  4LF7 O;  2Q7E A;  1QHT A;  4YY3 B;  2FTK A;  2AGA A;  4UV9 A;  1GM7 A;  4ZOL B;  3ZBH A;  4KHP B;  1Y76 A;  2ITC C;  1QR8 A;  3S3W A;  1OCR C;  1KQS U;  3CRA A;  3N2G B;  3BCC H;  4KXR A;  2OIG A;  1AP6 A;  2YEV B;  5CA1 B;  3OEH G;  3CCJ V;  1KMI Z;  3GVM A;  1R3K C;  3C90 A;  4DV6 B;  4O4L B;  3FX7 A;  1OCR B;  2CTR A;  4DV6 O;  5KMG A;  4P9O A;  1QCE A;  4JAV A;  1R3L C;  2JS5 A;  4LH6 A;  2PGG A;  1XMO B;  2YXH A;  1ZWI C;  1TGO A;  1GM8 A;  3ZX6 A;  4B3T B;  5IT9 N;  3OTO O;  4CC5 A;  2MW2 B;  3HKE A;  2Q6A A;  2N74 A;  5KUK A;  4TV8 B;  4FJC C;  4FM1 A;  3ASO C;  2DYR C;  3K9S A;  2A9H A;  3JD0 A;  2B1I A;  3OD4 A;  3L71 H;  3EVK A;  5GW7 A;  1IVS A;  4G28 B;  4K3A A;  4YIP A;  2D3O W;  4X64 B;  2DYS B;  1P7G A;  5L3F A;  3CYO A;  1NTK H;  3LSS A;  3KG2 A;  4ABM A;  1UJW B;  2UXX A;  2RMK B;  3E8B A;  1R6T A;  2M7W A;  1ZTE A;  2IH1 C;  3TGU H;  4UCS A;  4JV5 O;  2ADQ B;  3JYC A;  1OCZ C;  3QNE A;  5H5N A;  1XNQ O;  4JYA O;  5BR8 B;  2IBZ H;  1N0N A;  2N05 A;  2BTO A;  1K73 W;  1NJI W;  2ZCE A;  1IBM O;  1DK1 A;  2UXD B;  3W7W A;  4H0L B;  2ZQM A;  3G71 V;  2QJ1 A;  2WWW A;  1AIL A;  1AI7 A;  4NR1 A;  3VQV A;  1ZL8 A;  4BR6 A;  4X89 A;  1VQK V;  1XEQ A;  2ZNJ A;  4FMT A;  1SC5 B;  4JF3 A;  4WFB V;  4AIL C;  1VQP V;  2P22 C;  1YEW A;  2E75 B;  5IE9 A;  3ICX A;  1ORQ C;  1YSC A;  2ILM A;  1P4R A;  5LL6 Y;  4LWS A;  1DGS A;  2EIK C;  4CZZ A;  1FFX B;  2ZXW B;  4FLW A;  4UFZ A;  5BMV B;  4J7J A;  1RP3 B;  2ITD C;  1K8A W;  1GKF A;  2OCC B;  2FB5 A;  1B3Q A;  5B1B C;  1KP3 A;  3AG2 B;  3ZHV A;  4B3M B;  5FPR A;  2HEP A;  2H8P C;  3KKY A;  1XL6 A;  1MG1 A;  1WJZ A;  3CSX A;  4JI1 B;  4YJ3 B;  4TV9 B;  1XL4 A;  3TXS A;  3ABK B;  1ZUQ A;  1QBZ A;  5JQG B;  1VF6 C;  2JIZ G;  1VQ5 V;  2AHY A;  1G8M A;  2P67 A;  1HR0 O;  4J7K A;  1Z2G A;  5D5Q A;  3JAK B;  1WN7 A;  4NYK A;  5GON B;  5DN6 G;  2KB1 A;  2EBO A;  1SZT A;  5J2T A;  1GN2 A;  1NH2 B;  3IAY A;  3J80 N;  1VQ8 V;  1JR9 A;  1FFT B;  2GTA A;  2QTS A;  1YVW A;  5GTI Z;  3CCV V;  3LSU A;  2LJ2 A;  4PV1 B;  3CX5 F;  1NVP D;  1P84 F;  2Q4P A;  4CBC A;  1Y67 A;  2BE3 A;  1J95 A;  1SQQ H;  4RQE A;  1QQC A;  4IYI A;  3FB8 C;  1RSO A;  4F4L A;  4DV2 O;  1G1X B;  1IX9 A;  4DR5 B;  4WCE V;  1S0V A;  2UXB B;  1XHX A;  3CXC U;  2IU0 A;  1SRY A;  1FXK A;  2UXB O;  2XAH A;  5JH7 B;  3ZHQ A;  3A2F A;  3QO8 A;  1E1R G;  3L70 H;  3ETE A;  2EIN C;  3RBZ A;  4KL1 A;  3UCS C;  4R7C A;  1OCO B;  4YJ3 A;  5J2T B;  3E8H A;  3NR7 A;  3JD3 A;  2VQE O;  1IBL B;  3ML0 A;  4Q20 A;  4JI2 O;  3H01 A;  2F95 B;  2LP7 A;  4E4E A;  4UCO A;  2VQE B;  4LP8 A;  2BSK A;  4JI2 B;  2CDY A;  3OM3 B;  2P7T C;  1AR4 A;  4O4J A;  1COW G;  1SER A;  1UPG A;  3SPI A;  2ZNI A;  1IDS A;  3DSQ A;  3KCX A;  4GX0 A;  4I50 A;  5J2U A;  1ENV A;  2Q9L A;  2JS3 A;  5BY1 A;  3CB2 A;  3WB0 A;  4F6R A;  2E74 B;  4BW5 A;  4EEQ A;  3OUS A;  5L3D A;  1JA8 A;  5TIS Z;  4X65 B;  4PDR A;  1K7D A;  3OW2 U;  5B3S C;  5CBG A;  1K34 A;  1M56 C;  1BZK A;  1JFF A;  1VQ4 V;  1Q90 D;  2Y4T A;  1M57 B;  1B06 A;  1WA8 B;  1Z5V A;  4FZ0 A;  4FFB A;  2DMX A;  4ZI7 A;  3STZ C;  1HNW B;  4HZ3 A;  1AI5 A;  1BL8 A;  3VQW A;  5BMV A;  3EXA A;  5H6R A;  3O65 A;  1X4T A;  4WF9 V;  1MOF A;  2LW1 A;  4U3J A;  2JDI G;  4LFC B;  1V55 C;  4ZHQ A;  1AP5 A;  1BSM A;  3HKD A;  4JAA A;  5A2Q N;  4DR6 O;  3E35 A;  1RPR A;  2VWJ A;  1MSD A;  1N36 B;  4I50 B;  5L3B A;  3N2K A;  1V55 B;  1Q82 W;  4TT3 G;  3MHH C;  1WPB A;  4ZHQ B;  1NI8 A;  2HVJ C;  4MTX A;  3BFR A;  4YXW G;  1LUW A;  3D3Q A;  3P32 A;  4B3T O;  5F2V O;  1WP7 A;  2XUM A;  1D5N A;  4LF5 O;  4DR4 O;  1TVK B;  3LDE A;  4RUE A;  3AG1 B;  1I7F A;  5IJ9 B;  4QE9 A;  1Q7Y W;  3SPC A;  2EIL C;  1GMG A;  1JJO A;  2ZIM A;  2ZDI C;  3B8M A;  1WP8 A;  2YI8 A;  4UB8 Z;  5LOV B;  3JCU Z;  4HNA B;  1Q3E A;  3AG1 C;  4DV1 O;  2QKA A;  1VQN V;  3FD9 A;  4DV1 B;  1FXH A;  4NB5 A;  1VF7 A;  5KMG B;  5JVD B;  4W4K A;  3BHP A;  4JI6 O;  1YF2 A;  4EB6 A;  3CHX A;  3E83 A;  3RN4 A;  3CPW U;  5LOV A;  2CH7 A;  2KSD A;  1N34 O;  1XNQ B;  5C93 A;  2EZP A;  2Q8V A;  4CC6 A;  5KA5 A;  3JSL A;  3HB3 B;  4UVA A;  2JRI A;  3VBB A;  2PTM A;  1FXV A;  3Q4H A;  5CBH A;  4PDM A;  3RYC B;  5EYP B;  2UUA O;  2R9I A;  4FLV A;  3IGA C;  4NKG B;  3K58 A;  2Y48 A;  2AXT Z;  3WB2 A;  1S5H C;  2XHB A;  3FAV A;  4IHJ B;  4BWA A;  2E3C A;  1PL0 A;  1XRE A;  4JI0 B;  5KHI A;  4I4T A;  4UV8 A;  3UT5 B;  3CWB H;  5L3G A;  3CCS V;  4R6Z A;  3BAB A;  1SQF A;  2A7W A;  1SES A;  3K57 A;  2UXC B;  2MK3 A;  4PA6 A;  5KLV H;  2VS0 A;  2UXC O;  2HLD G;  3C3T A;  5LMN B;  1SS3 A;  4KUM A;  2EIM B;  5ITZ A;  2GDS A;  5DM6 V;  4J7Z A;  4DW1 A;  5LP6 B;  4TOI A;  1DF5 A;  4MTG A;  1IXM A;  4QPJ A;  1NT2 B;  1QVG U;  2GBO A;  1N32 B;  1FXK B;  1KD1 W;  2AZ0 A;  4J11 A;  4H44 B;  2NR5 A;  4MW8 A;  1WB8 A;  3CD6 V;  2GHY A;  2Q7G A;  4JI1 O;  1GAX A;  1AI4 A;  2XAQ A;  3JAK A;  2X6B A;  1TUB A;  2QSA A;  2IJJ A;  2W0X A;  1S3J A;  5A9G A;  5JWP A;  4GX1 A;  1PKX A;  2WLK A;  2CAZ C;  5LMU B;  4BIU A;  2V7Q G;  5LYJ B;  4K0K B;  1UFI A;  5IWA O;  5LGT A;  4JGS A;  3E22 B;  5DEC A;  5IWA B;  1QLE C;  5LA6 A;  3CRC A;  4YJ2 B;  3BPZ A;  3OR7 C;  5EYP A;  1WAZ A;  1MAB G;  2DYR B;  1G6U A;  3EHB B;  3OFN G;  3TK1 A;  1BMF G;  4EFB A;  2UUB O;  1YCI A;  1H2G A;  4QJF B;  4FIP C;  1XDC A;  3RYF A;  3PJS K;  1RM1 B;  4LF8 O;  4TV8 A;  3SR2 C;  4Q6G A;  2L35 A;  4PA7 A;  1R3I C;  4JTD B;  4FLT A;  4K8X A;  5D5P A;  1HNX B;  3SDL A;  1HP8 A;  2ZM6 O;  4J10 A;  4G27 B;  2Q0A A;  1OCZ B;  1Q86 W;  2N04 A;  4X1I B;  1R6N A;  2YIB D;  4X1Y B;  3AK2 A;  3ZJZ A;  3CC4 V;  3OTO B;  4DXW A;  2XAF A;  4GZR B;  3VQY A;  1QU7 A;  2YIA A;  5KA6 A;  2BOC C;  3FKS G;  2DYS C;  2B9Z A;  4MT8 A;  4ZBM A;  4DV0 O;  5EZY B;  3BY6 A;  3GWO A;  2ZIO A;  4O2A A;  2F1M A;  1EZV H;  2R9A A;  4MSW C;  1IBL O;  1NQT A;  3OGC C;  4X64 O;  1BE3 H;  1V54 B;  2WAM A;  1JJ2 U;  2FML A;  4JV5 B;  4P2Z A;  3AG3 B;  1NKD A;  2LQT A;  1YTF B;  1Y76 B;  4O4I A;  4O4H B;  1V54 C;  3K5N A;  4DK0 A;  4NTW A;  1IBK O;  5C8Y B;  5BR8 O;  2RNB A;  2E5L O;  3D8C A;  4BIO A;  1IBM B;  2E5L B;  2ARH A;  5EK0 A;  3MHS C;  3K5M A;  3UO3 A;  1B04 A;  2PZS A;  3SJB C;  5KUM A;  2JVD A;  1TAE A;  4NVP A;  1GRJ A;  4I0X A;  1BQZ A;  1I94 B;  3CJH B;  4GCZ A;  5CN0 A;  1BS3 A;  3JD4 A;  2YID A;  1MZF A;  3ZMS A;  3APO A;  1NZ6 A;  1S5L Z;  3AG2 C;  1YZB A;  1ZAU A;  4YHH O;  1XIL A;  4JTC B;  5KAF Z;  1AJQ A;  2JJ1 G;  4MS2 A;  5J2U B;  2QWN B;  1FJG B;  1N4C A;  3X2Q C;  2K1E A;  4C7U A;  1KC8 W;  5JQG A;  2RDC A;  2VRZ A;  3HKB A;  3UT5 A;  3P3N A;  1I5X A;  2OCH A;  2D2C B;  4LH7 A;  3JAR A;  4PD4 F;  4X88 A;  1AVM A;  2RCV A;  3HKE B;  2BSK B;  1R73 A;  1Y6X A;  2Z3Y A;  3WG7 B;  1VF5 B;  1BGY H;  3J81 N;  1M93 A;  4B3R O;  5EIB C;  3ABM B;  4TQF A;  1AR1 B;  4QIW F;  4JI8 B;  3PN1 A;  4YJ2 A;  5FNV B;  1MA1 A;  4UB6 Z;  3WG7 C;  3E8G A;  1BQ0 A;  1H2M A;  4NTX A;  4BW9 A;  1H2L A;  1AR5 A;  5FLX N;  3W7S A;  2ZR2 A;  1V9P A;  3SPJ A;  1VIB A;  3L72 H;  5B1N A;  4HBN A;  1HDJ A;  4J9Z B;  1GN4 A;  5IJ0 B;  1NR1 A;  5LXT B;  1WB7 A;  1RSO B;  2F23 A;  1L8D A;  2GUZ B;  1VAR A;  2IH3 C;  1NH2 D;  3CMA V;  3H1K H;  5LGU A;  3UQ8 A;  1N33 O;  3H1L H;  2F93 B;  3CE2 A;  5L3E A;  4GKJ O;  4ICG A;  3TET A;  4ZKI A;  2KG7 A;  2Q69 A;  2EJR A;  2V4D A;  2VWK A;  2QWR B;  5EBL C;  3GWK C;  1PD3 A;  3L74 H;  1NTZ H;  2A3Q A;  4UVB A;  2HKO A;  3DC6 A;  4OPH A;  1FFX A;  2WPD G;  2QM8 A;  5FL7 G;  5ITZ B;  3BA9 A;  5GON A;  4FPP A;  2W0F C;  4ASU G;  3ASN C;  1D2D A;  3BEH A;  1YIJ V;  4IYH A;  2WLM A;  4XBF A;  2Y69 C;  2EIN B;  2OTL V;  1CXZ B;  4O4I B;  1OJH A;  2F4V O;  2IJI A;  2YEV A;  4A5U B;  3ZN1 A;  2YSU B;  4J42 A;  4X1K A;  4PA4 A;  5JCO C;  1YI2 V;  3B2E E;  4PEL A;  4NXN O;  1EZJ A;  3JAL A;  3OMN B;  1ZL8 B;  3HR0 A;  1M9N A;  4TV9 A;  5CA0 B;  2Y0I A;  5JJN B;  5LMN O;  2AHZ A;  1M57 C;  2W6I G;  5FNV A;  3FAV B;  3DC5 A;  3JSN A;  3SJA C;  3ZCC A;  1VQO V;  1I0H A;  4X9Q A;  4WBN B;  1XNR O;  1NVP B;  4H37 A;  2FL4 A;  5B1A B;  3T2M A;  4LFB B;  2EJ7 A;  1YJN V;  4NXM O;  2IM9 A;  3Q4H B;  4K8Z A;  3S3X A;  1OV9 A;  3OE7 G;  5EC1 C;  2E76 B;  2RQ6 A;  3DXR A;  3CCE V;  1PP9 H;  5B3S B;  2UU9 O;  3ZED A;  2HR3 A;  1FPO A;  3WU2 Z;  3LUT B;  2UU9 B;  4GX5 A;  3ZHR A;  2EZO A;  2H3O A;  3I56 V;  2ZDI A;  4G2K A;  4GX2 A;  1U96 A;  4X65 O;  1M4U A;  3K9A A;  3BA8 A;  2QM4 A;  2ZD9 A;  5CA1 A;  4PI2 A;  5HFL A;  2QE7 G;  1Q6U A;  1M90 W;  4K0K O;  2ZIN A;  2ZXW C;  3MAQ A;  4IT5 A;  4CH5 A;  2QKC A;  3KZI Z;  5IJ9 A;  1TA8 A;  1WNS A;  3E89 A;  1JVM A;  1H38 A;  4WBN A;  3F7V C;  4LF7 B;  2Q7H A;  1FD9 A;  3N27 A;  2JJ2 G;  3D36 A;  1B6Q A;  1K33 A;  2QR4 A;  4DR6 B;  4FLX A;  5CA0 A;  2LGQ A;  4JI3 O;  1DTO A;  3VOU A;  5HFM A;  3JAT B;  4CS2 A;  1NR7 A;  1U97 A;  1W0K G;  2F66 C;  4GKK B;  1JOY A;  3ETG A;  2P4K A;  1TUB B;  1K4D C;  4LF4 B;  1BHA A;  1F7Y A;  2EIL B;  1FYJ A;  4DV7 O;  3ABK C;  4UCT A;  2CGO A;  2PY5 A;  2WLH A;  3THO A;  2FYU H;  3ZS8 C;  2VQF B;  4DV7 B;  3OR6 C;  1NBM G;  5IDJ A;  4LF5 B;  1SQB H;  2JGD A;  2ETN A;  2UXN A;  1W2B U;  4PHZ A;  3RW0 A;  5CMU A;  5H9C A;  4TQD A;  4B08 A;  2KG7 B;  3CCR V;  1X59 A;  2BTQ A;  2CTQ A;  1LR1 A;  1XI1 A;  2PF4 E;  3A0B Z;  2HG5 C;  2O57 A;  3JAW A;  3SYP A;  5BXZ A;  3W7U A;  2A0L A;  4QGP A;  3CCM V;  2YI9 A;  1F51 A;  3GB7 C;  1ROP A;  4P9P A; 
#chains in the Genus database with same CATH homology
 1WJZ A;  3UO2 A;  2LGW A;  2QWN B;  1N4C A;  1XBL A;  2CTW A;  3AG7 A;  2CTR A;  2M6Y A;  2CTQ A;  2CUG A;  2GUZ B;  1FAF A;  2QWO B;  2CTP A;  2QWP B;  2YUA A;  2N04 A;  1BQ0 A;  2KQX A;  2PF4 E;  2Y4U A;  4J7Z A;  1FPO A;  2OCH A;  2LO1 A;  2Y4T A;  3APQ A;  2YS8 A;  4IT5 A;  3APO A;  1NZ6 A;  2GUZ A;  2N05 A;  1BQZ A;  2QSA A;  1IUR A;  3BVO A;  3UO3 A;  1HDJ A;  3UCS C;  2DMX A;  2L6L A;  2QWQ B;  4RWU A;  2EJ7 A;  2QWR B;  2DN9 A;  1GH6 A;  4J80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...