3SJQC

Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
80
structure length
80
Chain Sequence
TQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQARKLRSVKMEQRKLNDQANTLVDLAKTQLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calmodulin
publication title Structural basis for calmodulin as a dynamic calcium sensor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 35
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3sjqC00
2W0FC 4HZ3A 3OUFA 5EC1C 3UM7A 3ASNC 4J9YB 4KFMA 2EIJC 3T1CA 3TCUA 1R3IC 4PDMA 5B3SC 2Q67A 2DYRC 3R65A 4RAIA 2H8PC 3VOUA 1V55C 1K4CC 2A0LA 4MS2A 2WLIB 4PDRA 1R3LC 2DWEC 5EBLC 2WLIA 3STZC 1ORQC 4HYOA 4H37A 4RUEA 4TWKA 1XL4A 3RVYA 3E8FA 5CBHA 4MVUA 1XL6A 5KUMA 1ZWIC 4LBEC 2DYSC 3EFFK 3K0DA 2YEVA 3F5WC 4R8CA 4GX1A 2HFEC 4JTCB 3E8GA 3SPGA 4R50A 3ASOC 3E8BA 3K03A 2WLKA 2P7TC 2WLLB 4MTOA 3T2MA 1J95A 2WLJA 4MVRA 4OXSA 2WLLA 3SPHA 1R3KC 2HG5C 3E89A 3SYPA 4X88A 2EILC 2NLJC 2WLMA 1M57C 2ZXWC 4XDKA 3RW0A 3SYCA 1OCRC 4J9ZB 4MW8A 3JYCA 2Y69C 4GX2A 3ZRSA 1KKDA 3K08A 1LNQA 4F4LA 3ZJZA 2HVJC 4P2ZA 4PDLA 5CBGA 3ABKC 4PA6A 4P9PA 4X8AA 3AG4C 4MVSA 5BZBA 3K0GA 2Q6AA 4G28B 5E1AC 2R9RB 4XDJA 4JTDB 3OR6C 4GX5A 3SYOA 4R6ZA 4MVMA 3IFXA 3WG7C 2BOCC 3IGAC 3AG3C 4H33A 2HVKC 2K1EA 2EINC 1OCOC 1R3JC 4MTGA 4R7CA 3LNMB 3SYAA 4UUJC 3T4DA 3LUTB 4X89A 2WLNA 4I9WA 3F7VC 3OUSA 3SPJA 5IY5C 2Q69A 4PA7A 4EKWA 2EIMC 2X6AA 3STLC 4ZBMA 4XDLA 3AG1C 2ITCC 3FB7C 4WFGA 3RVZA 5EC2C 2ATKC 4MW3A 1OCCC 4QE7A 3LDEA 2ITDC 3ABLC 3SPCA 4WFEA 3SYQA 4GX0A 5J9PC 2ZD9A 5EK0A 4MSWC 4PA4A 3FB5C 3KG2A 5EBMC 5B1BC 1K4DC 4P9OA 2A79B 1S5HC 3RBZA 4LP8A 3FB6C 4PA3A 4MVQA 2AHYA 4JTAB 4RO2A 1M56C 3HPLC 5EBWC 4BW5A 4WFFA 3ABMC 4CBCA 4PDVA 2QKSA 1G4YB 3E83A 4QE9A 3SPIA 3K04A 2IH1C 3AG2C 4MVOA 1QLEC 4P30A 2Q68A 2HJFC 3E86A 5CBFA 2JK5C 5KUKA 2AHZA 3BEHA 3F7YC 4RUFA 2EIKC 3GB7C 3T4ZA 3E8HA 3LDCA 4G27B 4MTFA 3SJQC 4WFHA 3UKMA 3K06A 4LCUC 2IH3C 5B1AC 4QNHB 3OGCC 1BL8A 1P7BA 4MVZA 3X2QC 2WLHA 1V54C 4PA9A 1JVMA 2KB1A 2QTOA 2A9HA 3LDDA 3PJSK 4DXWA 3OR7C 1OCZC 2DWDC 2X6BA 2X6CA 3FB8C 2OCCC 2BOBC 3TETA
chains in the Genus database with same CATH superfamily
2W0FC 1VF7A 4B3SO 1SERA 4I50A 4RAIA 3DXRB 2F23A 3B77A 3K58A 1K4CC 3AG4B 3SGIA 3JATB 3BHPA 3U0ZA 4G2KA 2YEVA 1WP7A 1THZA 4DW1A 3OM3B 4MVRA 4DR5O 5HFMA 2FB5A 2CE4A 2ZXWC 4LFCB 2YI8A 3ZHVA 1RPRA 2DN9A 4DO2A 4B3RB 4UVBA 3AEIA 5FLXN 1DTOA 1HNWO 2F93B 1K92A 3VQVA 2OTLV 1WP8A 4I9WA 2C2AA 4K35A 3GVMA 5LHGA 1CP9A 2QWQB 1E1RG 2VRZA 5LP6A 3M8AA 5B1BC 4PELA 2X0LA 4W4LA 1S5HC 1M1KW 2RN9A 1M90W 4I55B 2Y0PA 1SA0A 2OCHA 1EN5A 1I94O 4GUNA 2WA3A 1QQCA 2EIKC 3GB7C 4DV3O 3HR0A 1JR9A 4YIOA 2P06A 4FIPC 4LCUC 4DV0B 2B1IA 2CUGA 4MVZA 4GCZA 1SF9A 2CDYA 4FM0A 4FZ1A 4YJ3B 3CCRV 1VQOV 4TT3G 4EEQA 2QDOA 3ETEA 4X1IA 3HKCB 3ZMTA 1FJGO 1SESA 2QR4A 4B3TB 3JAWA 5LXTB 1TUEB 2A06H 1AB3A 1VF5B 4MS2A 2UXXA 1L0LH 2WPDG 1ORQC 2F43G 5E79Z 1VQ7V 2OIGA 4DV1O 4X62O 4PJ0Z 1R1BA 3G80A 4OXSA 3E89A 2QGNA 1Q6HA 3SYPA 1M93A 2Q8VA 4WFAV 1OCZB 2Y69C 3G6BA 4JV5B 2Z5UA 4IIJA 3ABKC 1QLEB 3DC5A 3K0GA 2W0XA 1IBMO 4CS3A 2ADPA 1XNRB 3OAAG 2LFRA 5JQGA 3MHHC 3LNMB 1OV9A 1JJOA 1D5NA 3L71H 2FMLA 4LF6O 4DRXB 3QG5A 2IU0A 4FJCC 4O4IB 3RYIB 3B8NA 3RVZA 4WCEV 1FXKB 2OCCB 5J9PC 4BWAA 3FYIB 4O4HB 5KMGB 4J7JA 4JASA 3L70H 3CCJV 2ODMA 3P3PA 4DR1B 4FK5C 5ITZA 4JI6O 1GK9A 5BMVA 1EBOA 4JI3O 2UXCO 4IHJA 4OGQB 2JGDA 4O2BA 1AR5A 2PTMA 3LDCA 3SJQC 2HHHO 4JYAB 3E22A 1P84F 4TUYA 2R9AA 2YEVB 5IWAO 3WFVA 4XBFA 2XAGA 3HKDA 2EJRA 3FB8C 4BR6A 1ZUQA 5FPRA 4ASUG 2XTAA 1IBLO 2GV9A 2CAZC 2W6JG 2EIJC 1SS3A 1R3IC 4DV6B 2A7WA 3SJCC 4JYYA 2DE0X 5JVDB 1PKXA 5JH7A 5AG2A 4I0XB 1GAXA 2Z3YA 4MVUA 1ZWIC 5LGTA 3EFFK 3H1KH 5CA1A 2JGUA 3ZHTA 3A2FA 2WLJA 1JA8A 5EZYA 4FLTA 5KAFZ 4I4TA 4QPKA 5DECA 1BHBA 2E5LB 1FKAO 3RW0A 1F51A 1I08A 1KKDA 4PV1B 5CMUA 1M9NA 4O4JA 2XAHA 2QM8A 4AQYB 2BTQB 1U97A 4LNUA 4G28B 2B5UA 3SR2C 2AGAA 1NVPB 3IGAC 2NN4A 1SA0B 4UUJC 4CH4A 3LUTB 3T1HB 2QTSA 4ZBMA 4HNAA 2ITCC 1XHXA 3E2EA 4FLZA 2LP7A 4TOIA 2ITDC 2QWNB 2B1GA 4TQDA 3JALA 2AHYA 4X1IB 1Y74A 2DYRB 2QWOB 3ABMC 3TXQA 4X1YB 1V55B 4MVOA 4U7OA 2HJFC 5L3BA 1JFFB 2AHZA 4YY3O 3RWRD 4J7KA 1Y4MA 2YUAA 4O2AA 1SQFA 2PYLA 3OGIB 3U11A 1XMOB 1WA8B 1H2KA 2EULA 1PNLA 2LFSA 4NTWA 4DXWA 1OCZC 1P49A 4X1KA 2Q0OC 1KQSU 1GKFA 3AG1B 1DF5A 1PM9A 3TCUA 1QU7A 1S76D 4X65B 5J2UA 3VQYA 2A0LA 3RGBA 2DQ0A 2KQXA 2JJ1G 4CC5A 2XUMA 1E1QG 5KX5B 1AJNA 3K3WA 1S72V 4LBEC 3K0DA 4J7ZA 4R8CA 2L35A 5JQGB 3FFQA 2UU9O 4QJFB 4ZI7B 1SQPH 3VBBA 4K0KB 1JCHA 3OE7G 1AP6A 5CB4B 1PP9H 4UCUA 4FMTA 2OWOA 1R73A 2Q9LA 4U3JB 2Q6AA 2QEXV 5IDJA 4GX5A 2MW2B 1MG1A 1H2MA 1Z5VA 2JGDB 5C8YB 5H9CA 2GDSA 4O2BB 4GZRB 2Q69A 4AI8A 2DJVA 4JI4O 5EC2C 1P4RA 2VQEB 1B6QA 3KZIZ 1GTOA 3HPLC 1GN3A 5D5QA 4JAVA 4QE9A 4RQFA 4DV7B 2EX3A 3ZHUA 4MT8A 5CBFA 4UFZA 1S77D 4I5SA 1NZ6A 2E74B 4DR3O 4DR2O 1RM1C 1Z2GA 2P5OA 3JASA 1FAFA 4OPHA 5IYBO 4CC6A 3IJ4A 2AZ0A 5CA1B 1VEWA 5LP6C 2ZXWB 1WNSA 3CP1A 4KHPO 4I4TB 4DUYB 2XHBA 4I7ZB 3L73H 1WPBA 1RSOB 4LH6A 3QTCA 5IJ9B 1ENVA 2Y0IA 3H1IH 4O4JB 3JCUZ 2GUZB 5EIBC 3QF7A 4PD4F 1UPGA 3CSXA 1SQQH 4UCTA 3I5DA 5KHJA 4MTOA 2WLLB 4DV0O 2ZE8A 4OPAA 1R3KC 1EFRG 3RYHA 2Q4PA 4JZGA 5IT9N 1GN4A 4HNAB 5B1BB 4F6RB 1VQPV 2YXLA 1H8EG 4F4LA 4B3TO 3CYOA 2YC0A 2PUSA 2ZR3A 3E35A 3VQWA 1FXVA 1AR1B 4P9PA 3JALB 2DMXA 3N2GB 3K79A 1Y74B 1EN6A 4IT5A 3SYOA 3CC7V 4GYCB 2EIKB 2QA4V 4YJ2A 1OCOC 2IJJA 1HNZB 1Y76A 5LHHA 2ZM6O 1YI2V 4LF4B 4LF5O 2D2CB 4Q20A 3CC4V 5IE9A 4O2AB 4H44B 3AG1C 3SJAC 3RN4A 3CE2A 3ABLC 1TA8A 2ZD9A 4X66B 4MSWC 5EBMC 4X1KB 3RBZA 4JV5O 4HBNA 3R66A 1XNQO 4X64B 5GONB 3MAQA 1FS0G 1Y6XA 1XNRO 3L74H 3OEEG 1AROP 2NNUA 3F5TA 4FPPA 5B1AC 1N34B 1XI1A 1P7BA 3HKBA 3JCZA 2KB1A 4Z2WA 1D5AA 5KLVH 1YJ9V 2K9PA 2ZT9B 4HZ3A 2Y69B 5LMUB 2HKOA 5F2VO 2H3OA 5B3SC 2H8PC 1O9GA 1H8HG 5LMNB 4UXNA 4WFBV 4TWKA 4NXNB 4LWSA 2JDIG 5EYPA 4JAAA 4FLUA 1K7DA 3T2MA 1YTFD 3I56V 1X4TA 2G38A 5LA6A 3OW2U 1XUQA 3BVOA 1AR4A 4D6TH 3W7WA 3APQA 1AP5A 3AK1A 3LSQA 1K34A 1Q6UA 2QKAA 3K57A 2E75B 1F4MA 4DV6O 1KECA 4JI1O 4DV5B 1URFA 4N21A 3ZHQA 1QVFU 4NVPA 4TV8B 4IGGA 2BOCC 3B09A 4MTGA 3SYAA 2PI4A 3MD0A 1AI4A 1QLNA 1WJZA 1VMGA 3C3TA 1COWG 3JASB 5KHKA 3CPWU 1ZAUA 1K5SA 3CCLV 3ZMSA 2EIJB 2OIEA 1BSMA 5EBWC 1NTMH 1G4YB 2DQ3A 4X20A 5KUKA 4GKJB 3LSUA 4G27B 2KSDA 4ZHQA 2ADQB 3JARA 3K06A 3JAKB 1Q86W 4DYLA 4GT1A 4PA9A 3T1HO 4B3MB 3H1LH 4JI7B 1QCEA 2UUCB 4CS4A 2RDCA 1VQ8V 1BS3A 1H2LA 3OUFA 3UO2A 3UM7A 3ASNC 2GHYA 2UUBB 3R65A 1AI5A 3JD2A 4JI2B 1UJWB 1VQMV 2WLIB 2ZE7A 2DWEC 3ABTA 4PHZA 4E2LA 3AK3A 4PI0A 3OTOB 1S5JA 1JPXA 3OMNB 2DYSC 1Q8IA 1VARA 1N33O 2PZSA 4NTYA 2V1DA 1Q81W 3ZS8C 2CTPA 3LNNA 1XMQB 1DGSA 2ETNA 4KL1A 2F4VB 1TUBB 4B7KA 1FFXB 2XOKG 3SYCA 3UT5B 4DR6B 4LF7O 3A0HZ 3IAYA 4UCSA 3ABMB 2AXTZ 3A0BZ 1K33A 4X65O 1R6NA 1VQKV 2O57A 2P6JA 2LW1A 1Q5OA 5KHIA 2Q7EA 2EINC 3GWKC 1LUWA 2P4VA 4UVAA 2DW4A 2WLNA 2F95B 3EVKA 4DK0A 1HR0B 1M5IA 3HKBB 4RQEA 1SC5B 3LDEA 4EFEA 3SYQA 1KYOF 5GTIZ 5EK0A 3APOA 3P3NA 1S3JA 4BW5A 2QKSA 3K04A 3AG2C 3OMAB 4RUFA 1T5EA 2IW5A 3FX7A 3ZBHA 4WFHA 1XHZA 4JZ2A 4JI0B 4LWSB 3RYCA 3AG3B 5EYPB 4AHCA 3ZHSA 3CCSV 2UUAO 3PJSK 1LR1A 3UQ8A 2JJ2G 3QNEA 4O4LA 5JJEB 4I50B 1PPJH 4PDMA 4CS2A 2VQFB 2D3OW 3BRCA 3KCYA 1NBMG 1KUQA 2JS3A 4DV4B 1K3EA 3BY6A 2Q73A 4R50A 4DV2B 3E8BA 1WB7A 1KBHA 4LFBO 2HG5C 4L87A 1YITV 3BAAA 4J42A 3UCSC 1AJQA 4FFBA 3JD0A 2CH7A 1FFTB 2IM9A 1GRJA 4DUYO 2Y4TA 2HVJC 4LFAO 4EB6A 4IYIA 4B3SB 4X8AA 2PGGA 4F6EA 4GLXA 2IJKA 5B5EZ 1VQ4V 3CMEV 3ZMUA 2BTOA 1RM1B 1K9MW 4JI8O 2M7WA 1G8MA 5IYZA 3OUSA 3SPJA 1PNMA 3JARB 3O65A 3ETQA 1R6TA 3GWOA 1NKDA 2IJHA 2PYJA 2ZNIA 4DR5B 5LP6B 2CTQA 4TV9A 5BY1A 1YZBA 4ICGA 3FB5C 2FTKA 5IJ0A 4YHHO 3CRCA 4X9QA 3OFNG 1CPYA 2UXDO 3ZN0A 1P7GA 4IL6Z 1DF4A 4YXWG 1XILA 3BABA 5LGUA 1BQZA 5CA0A 3OMIB 1HNWB 3HKEA 2IU3A 5FL7G 3NR7A 4LF8O 1YHQV 2E76B 1IURA 5IYCO 3JAWB 2GSMB 4CH6A 1ROPA 4UB8Z 1JJ2U 3IC9A 3ICXA 1MSDA 3QO7A 3WU2Z 4LF9O 2EZOA 3ZEDA 1V9PA 3QO5A 1HWYA 1IBKB 4KXRA 4X64O 1N8RW 1OCOB 1I94B 4FM1A 1MNGA 1SQBH 1SQVH 1IXBA 1I7FA 3A8TA 3FKSG 4JTCB 4DV3B 1NT2B 5LOVA 2CGOA 4DR7B 1QHTA 1TVKA 4D7SA 2EILC 2NLJC 3ABLB 4Q6GA 1N4CA 3JSLA 4LR3A 1SZTA 5GTHZ 4IIJB 5LMUO 4PDLA 3B4SA 4K3AA 1BZKA 2UXBO 3IFXA 3CEIA 4U7NA 3TJTA 1VQNV 3AG3C 1OZ0A 4R7CA 1J5EO 5JWPA 2JRIA 5B1AB 1N0JA 5BR8O 4Z1VA 4U3FH 2Q0AA 1Q7YW 1SKVA 1VQ5V 3RYCB 3FB7C 4X62B 4DV1B 2Q7GA 1FXHA 2LQTA 4WFEA 3D3QA 2MK3A 3BCCH 5B3SB 2KG7A 5L3GA 5ITZB 4O4LB 3L9DA 2Q7HA 4PDVA 3E83A 5BMVB 1ZLZA 1YEWA 4IHJB 3E86A 4JI5B 3CXHF 5LYJA 3PN1A 4DV5O 2XASA 3UKMA 1CEZA 1IBMB 1PV0A 3E22B 4TUYB 1SETA 1DLBA 1ZL8A 4DUZB 3HKDB 2A3QA 4QPJA 2X6BA 4LF6B 1NTZH 4LFCO 1F4NA 3TETA 5EC1C 1IVSA 3ML0A 4FFBB 3DC6A 3WB2A 4BIUA 4B3RO 3QO8A 3J81N 2CH7B 4FLWA 1HDJA 3DXRA 5JH7B 3J7AU 5EBLC 4PI2A 4EB6B 4RUEA 4JI6B 3JATA 1KB9F 1H2GA 5CBHA 4GKJO 2YIAA 2JVDA 1IX9A 3E8GA 3ASOC 1SZXA 2HHHB 2P7TC 5EZYB 5IYZB 3H1JH 3N27A 3SPHA 1GN6A 2R72A 5IWAB 1XEQA 4B3MO 1WN7A 1M57C 2UUCO 1MOFA 4J9ZB 4GX2A 2ZE6A 4J80A 2KKWA 2OT5A 1IBLB 5IJ0B 1NI8A 2P4KA 3THOA 4LNUB 2YDEA 3FD9A 1Q90D 2H94A 3CRQA 1MZFA 5DM6V 4UCVA 3CCMV 1VIBA 2L6LA 3HKEB 2ATKC 2ZDIC 4UVCA 4GX0A 4NXMB 1L8DA 3ASNB 4JYBA 4MTXA 2IJIA 4NTXA 1M56C 4WFFA 2BSKA 1OCRB 3SPIA 2Q5ZA 2QM7A 1ZX3A 4I55A 1KD1W 1MZEA 3E8HA 2DYSB 2F1MA 4LC1A 5L3EA 3MDSA 4ZKIA 5IYDO 1BL8A 2RJZA 5L3CA 3CC2V 4KUMA 5BXZA 3O9OA 1TVKB 4BW9A 3W7UA 5J2UB 3VOUA 1VQLV 1W0KG 3AG7A 1WAZA 4PDRA 3ABUA 2XT9A 1H2NA 2LO1A 4TSFG 2AZ2A 1KU9A 4W4KA 1XL6A 5KUMA 4DR4B 2EINB 1EM1A 2NR5A 3RYFA 4BIZA 1S0VA 1US6A 1WPXA 4C7UA 5K1PA 2RNBA 3BPZA 1YVWA 4NYKA 5KAIZ 3D36A 2VWKA 2IBZH 1R6KA 1PD3A 3Q4HA 2LW7A 1VQ6V 1F7YA 4DR1O 1YTFB 3ZRWA 4P2ZA 3AG2B 5L3DA 4WBNA 2KG7B 2VQFO 5E1AC 1F23A 2F66C 2WSSG 2BE3A 4UCRA 4MVMA 3WG7C 4JYAO 1QBZA 2RQ6A 2Y4UA 2HJDA 4LH7A 5IY5C 4PA7A 4DV2O 3STLC 3CRRA 5K1XA 1YIJV 4O4IA 3SPCA 3M99B 2XAQA 1ZTEA 4PA4A 1NH2D 1Z5WA 4O4HA 4P9OA 1I5YA 4LP8A 2ZR2A 4A5UB 4JYCA 3SDLA 3NXSA 2IH3C 1GM9A 1MA1A 3X2QC 1V54C 1A32A 3D3IA 3TXSA 3T1YB 2E5LO 4NB5A 3C90A 4JI4B 3TGUH 4UB6Z 1IZ3A 4KFMA 4AQYO 2FYUH 1G1XB 2YIDA 3G4SV 5B1OA 2FKXA 5JJNB 5JVDA 3CXCU 4I0XA 1K97A 1EN4A 1S5LZ 2E3CA 1GM7A 2LGQA 4DR2B 4DR3B 3CX5F 3SPGA 3W7SA 2HR3A 4FLYA 1Q3EA 5H6QA 3RYHB 4OX9B 5CA3A 1VF6C 3J80N 3WB0A 3CCEV 2VWJA 4XDKA 5KA5A 4D7TA 4ZOLA 1OCRC 2ZNJA 3BA9A 4YIPA 3K08A 5JJJB 1LNQA 3K5NA 4KHPB 5LGNA 5CBGA 2M6YA 5A2QN 2BTQA 4WF9V 2BSKB 2VS0A 3OR6C 1MSWD 3W7XA 4YJ2B 4H0LB 1IBKO 2K1EA 1Y76B 1XMOO 2PY5A 4KP4A 1QNMA 3CMAV 2GTAA 2GBOA 2ZDIA 2EIMC 1O9HA 3EXAA 3WB1A 1I5XA 4XDLA 4DR7O 2ZQMA 3KCXA 4ABMA 4K8XA 3CJHA 1K4DC 1EZJA 4MVQA 4CBCA 1B3QA 3DSQA 4X1YA 2XAJA 2Q68A 2HLDG 1WLEA 3K59A 1N36B 1JFFA 1BGYH 1NU1H 3M7MX 4NKGB 1PL4A 1N0NA 4DK1A 1NR1A 4K0KO 1WA8A 2ZM6B 1B06A 3A0RA 4LF5B 4RWUA 3LDDA 3RYFB 1RPOA 1Q82W 2EILB 4GKKB 3CRAA 1RP3B 1SRYA 1Q6IA 1KP2A 1E79G 1AI7A 3Q4HB 1HNXB 2Q67A 1ZSPA 1QR8A 2EBOA 3ZRWB 1H2SB 3K5MA 3STZC 4H37A 4JI5O 5L3FA 4Z1MG 4WBNB 1XNQB 2N74A 5KX5A 2HEPA 3AK2A 5LA6B 5TISZ 2V7QG 1J95A 4DUZO 4ZI7A 2VQEO 4H13B 4I9QA 1M4UA 3JSNA 1D2DA 5CB4A 1JQ0A 3K5LA 4ZIBA 3ZRSA 3ZJZA 4DV7O 3CD6V 2B9ZA 3CRMA 1N32B 1HW7A 3AG4C 4U3JA 4XDJA 4JTDB 1XQ8A 1VQ9V 1L1FA 3ZIAG 3T4DA 4CH5A 4X89A 5C8YA 2P90A 1L0NH 3H9VA 2X6AA 3JD1A 4WFGA 1XDCA 2ILMA 4CH3A 2AW9A 5D5PA 4DW0A 5FNVA 3JD4A 1B04A 3ZX6A 4N23A 3FAVA 4X20B 5H5NA 4P30A 1YJWV 4B7EA 2DOSA 3K9AA 4UV8A 3F7YC 4JI1B 4ZHQB 1BCCH 5J2TA 3G67A 2W6IG 1TGOA 2V4DA 3ASOB 2ZIOA 1X59A 2WLHA 1GH6A 4JPRA 5DEDA 3SJBC 2DWDC 2X6CA 2QWPB 1KC8W 1M57B 2YICA 3ZRVA 2JEUA 2YI9A 3EHBB 2OTJV 1BHAA 1OCCB 3T1CA 4NXMO 3FYEB 4FVMA 3OD4A 4J11A 4ZOLB 5CN0A 3S3XA 1RSOA 1R3LC 5IJ9A 4HYOA 2ZINA 1HNZO 1XL4A 4LF4O 2GUZA 3VQXA 5A9GA 3B40A 1YJNV 1VF6A 3K03A 4JGSA 2YIBA 1GMGA 2WLLA 4EFBA 1PNKA 4X66O 2RCVA 2WLMA 1NVPD 4MW8A 4F6RA 1YXBA 1M56B 5HFLA 3CB2A 3P32A 3CJHB 5EIBD 1YDXA 3N2KA 3CCUV 4MVSA 3K9SA 3N2GA 4R6ZA 4TQFA 1BMFG 2QJ1A 4H33A 2HVKC 1N34O 1R3JC 2QE7G 1RFYA 4DR4O 1KP3A 1OJHA 1Q43A 2YXYA 4BIOA 4EKWA 1N33B 2WAMA 4IYHA 3S3WA 1XBLA 3D36C 2Y48A 1YCIA 4J10A 1FJGB 1BE3H 3DTUB 3HB3B 2ZIMA 2JS5A 2A79B 5LHIA 4JTAB 4RO2A 5LMNO 1UFIA 1YSCA 3DGEA 4LF7B 1QLEC 1BQ0A 3P30A 4NXNO 1GN2A 3BEHA 2EJ7A 5LBQA 5GONA 2CTRA 1JOYA 3RFRA 2ZKOA 3B8MA 1FD9A 2OYQA 5JCOC 3OGCC 2CGNA 3CCQV 1JVMA 1AI6A 4JF3A 1AVMA 1FXKC 2OCCC 2R70A 2BCCH 1W59A 1BT8A 5B1NA 1VP7A 4J9YB 1K5QA 1MABG 4K8ZA 1WB8A 2JIZG 3UO3A 3WG7B 2RMKB 3OT7A 1U96A 3E8FA 2YSUB 2P67A 2P22C 4NR1A 2LGWA 4J41A 3F5WC 4FZ0A 1OHHG 2HFEC 4HAMA 4JAUA 2WLKA 5IY5B 1HP8A 4QIWF 4X88A 3JAMN 2EZPA 2UUAB 3T1YO 4L8JA 4BAYA 1TAEA 3I55V 2LJ2A 4CZZA 5FNVB 4JI3B 2UXCB 3ZN1A 5KHHA 3FAVB 3CS5A 4UV9A 4TV8A 3U10A 4E4EA 4JI7O 1GO3F 2YXHA 3X2QB 1V54B 5J2TB 1H38A 1W2BU 2CK3G 4OX9O 2N04A 4TV9B 1OCCC 4QE7A 3L72H 4LFBB 2UXNA 1NJIW 2UUBO 3BFRA 1SQGA 4JI2O 1KMIZ 4AILC 3H01A 1JMKC 4B08A 3CWBH 4LFAB 1NS1A 5KA6A 2JK5C 3OTOO 3B2EE 2QKCA 2FL4A 3T4ZA 5CA0B 5DN6G 1K8AW 3W7TA 3KKYA 4JI8B 1XMQO 2XAFA 3JAKA 4QNHB 4FLXA 1CXZB 1Y66A 2A9HA 2F4VO 3ETGA 3OTFA 1IXMA 4DR6O 2JEXA 3TK1A 2ARHA 2N05A 5H2FZ 3ETDA 4YHHB 2DYRC 5LL6Y 3K5OA 2YIBD 1V55C 2UXDB 1FYJA 5GW7A 1LUVA 2WLIA 5C93A 5KHGA 3N2KB 3RVYA 3C3SA 2X7RB 3D8CA 1N36O 2WWWA 4GX1A 1PL0A 1HR0O 3ZMVA 5LOVB 2PF4E 4YJ3A 2EIMB 1QR9A 2XNDG 1NR7A 3ZMZA 1NTKH 4FM2A 3HKCA 3ZHRA 4UCOA 3G71V 4LF8B 3G6EV 4FLVA 5LXTA 4GKKO 1TUBA 1FFXA 1FPOA 3JD3A 2R9IA 2WA4A 3JYCA 1W0JG 2ZCEA 3UT5A 1Y67A 1AILA 3H1HH 1HNXO 4PA6A 1JX9A 1IDSA 1XREA 3LSSA 5BZBA 1DK1A 4YY3B 2R9RB 3ZCCA 1G6UA 4LF9B 3OEHG 4JI0O 1AJPA 1SQXH 5H6RA 2GTSA 1KKCA 3F7VC 2QSAA 1XOUA 4MW3A 2CTWA 1QVGU 3KG2A 3CHXA 1NQTA 3FB6C 4PA3A 1I0HA 3L75H 2Z0AA 4QGPA 2YS8A 2IH1C 1N32O 1EZVH 5LYJB 5FPOA 2QM4A 5B66Z 2HP8A 4DV4O 1NH2B 3ABKB 2ZE5A 4FFKA 5JCOA 1GM8A 4MTFA 2UXBB 4DRXA 1K73W 1ZL8B 1J5EB 2UU9B 3RYIA 3BA8A 1FXKA 3MHSC 3RT3C 2QTOA 2QWRB 3ZRXA 5BR8B 1YF2A 3OR7C 5KMGA 3QVNA 3CCVV 3IC7A 1MMMA 2PI5A 2BOBC
chains in the Genus database with same CATH topology
2W0FC 1SRYA 2GSMB 1KP2A 1E79G 1AI7A 1ROPA 1SERA 2Q67A 1JJ2U 4RAIA 3B77A 3QO7A 1K4CC 2EZOA 3AG4B 1QR8A 1ENVA 2EBOA 3ZRWB 3QO5A 3STZC 1HWYA 4H37A 5L3FA 4Z1MG 1N8RW 1OCOB 4G2KA 2YEVA 3FKSG 4JTCB 1THZA 4MTOA 2WLLB 2V7QG 3OM3B 1J95A 4MVRA 1R3KC 1EFRG 5HFMA 2EILC 2NLJC 3ABLB 2ZXWC 5B1BB 1JQ0A 1VQPV 3ZRSA 1H8EG 4F4LA 1RPRA 3ZJZA 3CYOA 3CD6V 1SZTA 2ZR3A 3E35A 4DO2A 4PDLA 1FXVA 1AR1B 4P9PA 3AG4C 3K79A 4XDJA 4JTDB 4UVBA 3SYOA 3AEIA 3CC7V 1DTOA 3IFXA 2EIKB 2QA4V 4U7NA 1VQ9V 1L1FA 3AG3C 1VQNV 1OCOC 1OZ0A 4R7CA 1K92A 2IJJA 3ZIAG 2OTLV 5LHHA 1YI2V 3T4DA 5B1AB 4X89A 4Q20A 4I9WA 2P90A 3CC4V 2C2AA 2X6AA 1Q7YW 1VQ5V 3JD1A 3AG1C 3FB7C 4WFGA 5LHGA 1CP9A 1FXHA 1E1RG 3ABLC 4WFEA 2ZD9A 4MSWC 5B1BC 5EBMC 4PELA 2X0LA 1S5HC 2MK3A 3RBZA 3JD4A 5B3SB 5L3GA 4N23A 1M1KW 4PDVA 3E83A 1M90W 1YJWV 4P30A 3E86A 3K9AA 4UV8A 3F7YC 2EIKC 3GB7C 2XASA 1FS0G 3UKMA 3OEEG 1CEZA 1AROP 2NNUA 4FPPA 2W6IG 4FIPC 1SETA 4LCUC 5B1AC 3ASOB 1DLBA 2B1IA 1P7BA 4MVZA 2WLHA 3JCZA 4GCZA 2KB1A 4JPRA 4QPJA 2DWDC 2X6BA 2X6CA 1YJ9V 1F4NA 1KC8W 3CCRV 1VQOV 1M57B 4TT3G 3ZRVA 3ETEA 2JEUA 3ZMTA 3EHBB 4HZ3A 1SESA 5EC1C 3TETA 2OTJV 1BHAA 2Y69B 3ML0A 1OCCB 3T1CA 3FYEB 1TUEB 2HKOA 4BIUA 5B3SC 3QO8A 5CN0A 2H8PC 1H8HG 4MS2A 2UXXA 1R3LC 5EBLC 2WPDG 4UXNA 1ORQC 4HYOA 2F43G 4RUEA 4TWKA 4WFBV 1XL4A 1H2GA 5CBHA 2JDIG 1VQ7V 1K7DA 1YJNV 3E8GA 3ASOC 3K03A 4JGSA 1GMGA 2P7TC 3T2MA 1YTFD 3I56V 4OXSA 3OW2U 2WLLA 3SPHA 3E89A 1PNKA 3SYPA 3W7WA 2WLMA 1M57C 1NVPD 4WFAV 1MOFA 4J9ZB 1OCZB 3LSQA 4MW8A 2Y69C 1K34A 4GX2A 1M56B 2OT5A 5HFLA 2Z5UA 3P32A 3ABKC 1F4MA 3CCUV 1KECA 1QLEB 4MVSA 3K0GA 2H94A 4N21A 1QVFU 4R6ZA 1BMFG 2BOCC 2LFRA 3OAAG 4H33A 2HVKC 4MTGA 1R3JC 3MHHC 2QE7G 3LNMB 3SYAA 1KP3A 2PI4A 3MD0A 1AI4A 1QLNA 5DM6V 4EKWA 2IU0A 2WAMA 3CCMV 1COWG 4FJCC 3B8NA 3RVZA 2ATKC 2Y48A 2ZDIC 4WCEV 1FXKB 3CPWU 2OCCB 1K5SA 5J9PC 3FYIB 4UVCA 4GX0A 3CCLV 3DTUB 3HB3B 4JASA 2A79B 3ASNB 4JYBA 3ZMSA 2EIJB 4MTXA 5LHIA 3CCJV 2IJIA 4JTAB 4RO2A 1M56C 5EBWC 4WFFA 1YSCA 3DGEA 1G4YB 1OCRB 4FK5C 3SPIA 1GK9A 1QLEC 2QM7A 3P30A 2DQ3A 1KD1W 1EBOA 5KUKA 3BEHA 3E8HA 5LBQA 3LDCA 4G27B 1JOYA 2DYSB 3SJQC 4LC1A 5L3EA 3K06A 1Q86W 3B8MA 4ZKIA 5IYDO 3OGCC 1BL8A 4GT1A 2YEVB 3CCQV 4PA9A 1JVMA 3WFVA 5L3CA 4XBFA 3CC2V 2XAGA 1AI6A 4JF3A 1QCEA 4KUMA 2EJRA 1FXKC 3FB8C 2OCCC 4ASUG 5B1NA 1VQ8V 3OUFA 2W6JG 3UM7A 3ASNC 4J9YB 2EIJC 2GHYA 1R3IC 3W7UA 3R65A 3VOUA 1AI5A 3JD2A 1VQLV 1W0KG 1K5QA 1UJWB 1VQMV 2WLIB 4PDRA 1MABG 3ABUA 2DWEC 1PKXA 4TSFG 2JIZG 3ABTA 3WG7B 4E2LA 3E8FA 2Z3YA 4MVUA 1XL6A 2YSUB 5KUMA 1ZWIC 2EINB 5LGTA 1JPXA 2P67A 3OMNB 2DYSC 3EFFK 3F5WC 1OHHG 2HFEC 4HAMA 4JAUA 2V1DA 2WLKA 5IY5B 4BIZA 1Q81W 1S0VA 1WPXA 2WLJA 4QIWF 4X88A 2EZPA 3D36A 4QPKA 1R6KA 1PD3A 2XOKG 4BAYA 1BHBA 3RW0A 3SYCA 1F51A 1VQ6V 1KKDA 5CMUA 3I55V 1YTFB 1M9NA 3ZRWA 3ABMB 2XAHA 4CZZA 1K33A 4P2ZA 2QM8A 3AG2B 5L3DA 3ZN1A 4G28B 2B5UA 1F23A 2WSSG 5E1AC 1R6NA 1VQKV 2P6JA 1NVPB 4MVMA 3WG7C 4UV9A 3IGAC 2EINC 1QBZA 4UUJC 3LUTB 4UVAA 2DW4A 2WLNA 1GO3F 3X2QB 5IY5C 1V54B 4PA7A 1H38A 3STLC 4ZBMA 1W2BU 2ITCC 3E2EA 2CK3G 4RQEA 2LP7A 1OCCC 4QE7A 1YIJV 3LDEA 2ITDC 2UXNA 3SPCA 3SYQA 3M99B 1NJIW 2XAQA 5EK0A 4PA4A 1NH2D 2B1GA 4P9OA 1I5YA 4LP8A 1S3JA 2AHYA 4BW5A 2ZR2A 2DYRB 3ABMC 2QKSA 3H01A 1V55B 4JYCA 3K04A 3AG2C 4MVOA 4U7OA 2HJFC 5KA6A 2JK5C 3OMAB 3NXSA 5L3BA 2AHZA 4RUFA 3T4ZA 1Y4MA 5DN6G 2IW5A 1K8AW 4WFHA 3W7TA 2IH3C 2XAFA 1GM9A 4QNHB 3AG3B 1PNLA 3X2QC 2LFSA 1V54C 3CCSV 1Y66A 3D3IA 2A9HA 3PJSK 4DXWA 1OCZC 3ETGA 1IXMA 2JEXA 2JJ2G 1KQSU 3QNEA 1GKFA 3AG1B 1DF5A 3TK1A 3ETDA 4KFMA 3TCUA 4PDMA 2DYRC 1S76D 3G4SV 5B1OA 1V55C 2A0LA 2D3OW 5GW7A 2DQ0A 2WLIA 5C93A 3CXCU 2JJ1G 3RVYA 1E1QG 1NBMG 1K97A 2X7RB 1AJNA 3K3WA 1S72V 4LBEC 1GM7A 3K0DA 1K3EA 4R8CA 2WWWA 4GX1A 1PL0A 3BY6A 3SPGA 4R50A 3ZMVA 3E8BA 3W7SA 2HR3A 2EIMB 1QR9A 2XNDG 4QJFB 1NR7A 5H6QA 3VBBA 3ZMZA 2HG5C 5CA3A 4L87A 1YITV 3G71V 1JCHA 3OE7G 3CCEV 3G6EV 1AJQA 4XDKA 3JD0A 5KA5A 1OCRC 2R9IA 3JD3A 1FFTB 3JYCA 1W0JG 3K08A 1LNQA 4FMTA 2HVJC 5LGNA 1R73A 5CBGA 4PA6A 1JX9A 4X8AA 3LSSA 5BZBA 2Q6AA 4WF9V 2QEXV 2R9RB 3ZCCA 5IDJA 2IJKA 3OR6C 4GX5A 3OEHG 1VQ4V 3CMEV 3ZMUA 3W7XA 1MSWD 1MG1A 1RM1B 1K9MW 1AJPA 2K1EA 2M7WA 5H6RA 4KP4A 1G8MA 5H9CA 3CMAV 3F7VC 3OUSA 3SPJA 2ZDIA 1PNMA 2Q69A 2EIMC 3GWOA 1I5XA 1NKDA 4XDLA 2IJHA 5EC2C 4MW3A 1QVGU 1P4RA 2ZQMA 3FB5C 3KG2A 2FTKA 1NQTA 1K4DC 3OFNG 3FB6C 1B6QA 4PA3A 1CPYA 1EZJA 4MVQA 1GTOA 4CBCA 3HPLC 3ZN0A 4JAVA 4QE9A 4RQFA 2IH1C 2XAJA 2Q68A 4MT8A 1DF4A 5CBFA 4YXWG 2HLDG 1S77D 1WLEA 1NH2B 3ABKB 4I5SA 5LGUA 1RM1C 1GM8A 4MTFA 1K73W 3OMIB 1NR1A 2IU3A 5FL7G 1FXKA 5IYBO 3MHSC 2QTOA 3A0RA 3ZRXA 1YHQV 3LDDA 1RPOA 3OR7C 3CCVV 1Q82W 3IC7A 2EILB 2PI5A 2ZXWB 2BOBC 5IYCO 3CP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0F C;  4HZ3 A;  3OUF A;  5EC1 C;  3UM7 A;  3ASN C;  4J9Y B;  4KFM A;  2EIJ C;  3T1C A;  3TCU A;  1R3I C;  4PDM A;  5B3S C;  2Q67 A;  2DYR C;  3R65 A;  4RAI A;  2H8P C;  3VOU A;  1V55 C;  1K4C C;  2A0L A;  4MS2 A;  2WLI B;  4PDR A;  1R3L C;  2DWE C;  5EBL C;  2WLI A;  3STZ C;  1ORQ C;  4HYO A;  4H37 A;  4RUE A;  4TWK A;  1XL4 A;  3RVY A;  3E8F A;  5CBH A;  4MVU A;  1XL6 A;  5KUM A;  1ZWI C;  4LBE C;  2DYS C;  3EFF K;  3K0D A;  2YEV A;  3F5W C;  4R8C A;  4GX1 A;  2HFE C;  4JTC B;  3E8G A;  3SPG A;  4R50 A;  3ASO C;  3E8B A;  3K03 A;  2WLK A;  2P7T C;  2WLL B;  4MTO A;  3T2M A;  1J95 A;  2WLJ A;  4MVR A;  4OXS A;  2WLL A;  3SPH A;  1R3K C;  2HG5 C;  3E89 A;  3SYP A;  4X88 A;  2EIL C;  2NLJ C;  2WLM A;  1M57 C;  2ZXW C;  4XDK A;  3RW0 A;  3SYC A;  1OCR C;  4J9Z B;  4MW8 A;  3JYC A;  2Y69 C;  4GX2 A;  3ZRS A;  1KKD A;  3K08 A;  1LNQ A;  4F4L A;  3ZJZ A;  2HVJ C;  4P2Z A;  4PDL A;  5CBG A;  3ABK C;  4PA6 A;  4P9P A;  4X8A A;  3AG4 C;  4MVS A;  5BZB A;  3K0G A;  2Q6A A;  4G28 B;  5E1A C;  2R9R B;  4XDJ A;  4JTD B;  3OR6 C;  4GX5 A;  3SYO A;  4R6Z A;  4MVM A;  3IFX A;  3WG7 C;  2BOC C;  3IGA C;  3AG3 C;  4H33 A;  2HVK C;  2K1E A;  2EIN C;  1OCO C;  1R3J C;  4MTG A;  4R7C A;  3LNM B;  3SYA A;  4UUJ C;  3T4D A;  3LUT B;  4X89 A;  2WLN A;  4I9W A;  3F7V C;  3OUS A;  3SPJ A;  5IY5 C;  2Q69 A;  4PA7 A;  4EKW A;  2EIM C;  2X6A A;  3STL C;  4ZBM A;  4XDL A;  3AG1 C;  2ITC C;  3FB7 C;  4WFG A;  3RVZ A;  5EC2 C;  2ATK C;  4MW3 A;  1OCC C;  4QE7 A;  3LDE A;  2ITD C;  3ABL C;  3SPC A;  4WFE A;  3SYQ A;  4GX0 A;  5J9P C;  2ZD9 A;  5EK0 A;  4MSW C;  4PA4 A;  3FB5 C;  3KG2 A;  5EBM C;  5B1B C;  1K4D C;  4P9O A;  2A79 B;  1S5H C;  3RBZ A;  4LP8 A;  3FB6 C;  4PA3 A;  4MVQ A;  2AHY A;  4JTA B;  4RO2 A;  1M56 C;  3HPL C;  5EBW C;  4BW5 A;  4WFF A;  3ABM C;  4CBC A;  4PDV A;  2QKS A;  1G4Y B;  3E83 A;  4QE9 A;  3SPI A;  3K04 A;  2IH1 C;  3AG2 C;  4MVO A;  1QLE C;  4P30 A;  2Q68 A;  2HJF C;  3E86 A;  5CBF A;  2JK5 C;  5KUK A;  2AHZ A;  3BEH A;  3F7Y C;  4RUF A;  2EIK C;  3GB7 C;  3T4Z A;  3E8H A;  3LDC A;  4G27 B;  4MTF A;  3SJQ C;  4WFH A;  3UKM A;  3K06 A;  4LCU C;  2IH3 C;  5B1A C;  4QNH B;  3OGC C;  1BL8 A;  1P7B A;  4MVZ A;  3X2Q C;  2WLH A;  1V54 C;  4PA9 A;  1JVM A;  2KB1 A;  2QTO A;  2A9H A;  3LDD A;  3PJS K;  4DXW A;  3OR7 C;  1OCZ C;  2DWD C;  2X6B A;  2X6C A;  3FB8 C;  2OCC C;  2BOB C;  3TET A; 
#chains in the Genus database with same CATH topology
 2W0F C;  1VF7 A;  4B3S O;  1SER A;  4I50 A;  4RAI A;  3DXR B;  2F23 A;  3B77 A;  3K58 A;  1K4C C;  3AG4 B;  3SGI A;  3JAT B;  3BHP A;  3U0Z A;  4G2K A;  2YEV A;  1WP7 A;  1THZ A;  4DW1 A;  3OM3 B;  4MVR A;  4DR5 O;  5HFM A;  2FB5 A;  2CE4 A;  2ZXW C;  4LFC B;  2YI8 A;  3ZHV A;  1RPR A;  2DN9 A;  4DO2 A;  4B3R B;  4UVB A;  3AEI A;  5FLX N;  1DTO A;  1HNW O;  2F93 B;  1K92 A;  3VQV A;  2OTL V;  1WP8 A;  4I9W A;  2C2A A;  4K35 A;  3GVM A;  5LHG A;  1CP9 A;  2QWQ B;  1E1R G;  2VRZ A;  5LP6 A;  3M8A A;  5B1B C;  4PEL A;  2X0L A;  4W4L A;  1S5H C;  1M1K W;  2RN9 A;  1M90 W;  4I55 B;  2Y0P A;  1SA0 A;  2OCH A;  1EN5 A;  1I94 O;  4GUN A;  2WA3 A;  1QQC A;  2EIK C;  3GB7 C;  4DV3 O;  3HR0 A;  1JR9 A;  4YIO A;  2P06 A;  4FIP C;  4LCU C;  4DV0 B;  2B1I A;  2CUG A;  4MVZ A;  4GCZ A;  1SF9 A;  2CDY A;  4FM0 A;  4FZ1 A;  4YJ3 B;  3CCR V;  1VQO V;  4TT3 G;  4EEQ A;  2QDO A;  3ETE A;  4X1I A;  3HKC B;  3ZMT A;  1FJG O;  1SES A;  2QR4 A;  4B3T B;  3JAW A;  5LXT B;  1TUE B;  2A06 H;  1AB3 A;  1VF5 B;  4MS2 A;  2UXX A;  1L0L H;  2WPD G;  1ORQ C;  2F43 G;  5E79 Z;  1VQ7 V;  2OIG A;  4DV1 O;  4X62 O;  4PJ0 Z;  1R1B A;  3G80 A;  4OXS A;  3E89 A;  2QGN A;  1Q6H A;  3SYP A;  1M93 A;  2Q8V A;  4WFA V;  1OCZ B;  2Y69 C;  3G6B A;  4JV5 B;  2Z5U A;  4IIJ A;  3ABK C;  1QLE B;  3DC5 A;  3K0G A;  2W0X A;  1IBM O;  4CS3 A;  2ADP A;  1XNR B;  3OAA G;  2LFR A;  5JQG A;  3MHH C;  3LNM B;  1OV9 A;  1JJO A;  1D5N A;  3L71 H;  2FML A;  4LF6 O;  4DRX B;  3QG5 A;  2IU0 A;  4FJC C;  4O4I B;  3RYI B;  3B8N A;  3RVZ A;  4WCE V;  1FXK B;  2OCC B;  5J9P C;  4BWA A;  3FYI B;  4O4H B;  5KMG B;  4J7J A;  4JAS A;  3L70 H;  3CCJ V;  2ODM A;  3P3P A;  4DR1 B;  4FK5 C;  5ITZ A;  4JI6 O;  1GK9 A;  5BMV A;  1EBO A;  4JI3 O;  2UXC O;  4IHJ A;  4OGQ B;  2JGD A;  4O2B A;  1AR5 A;  2PTM A;  3LDC A;  3SJQ C;  2HHH O;  4JYA B;  3E22 A;  1P84 F;  4TUY A;  2R9A A;  2YEV B;  5IWA O;  3WFV A;  4XBF A;  2XAG A;  3HKD A;  2EJR A;  3FB8 C;  4BR6 A;  1ZUQ A;  5FPR A;  4ASU G;  2XTA A;  1IBL O;  2GV9 A;  2CAZ C;  2W6J G;  2EIJ C;  1SS3 A;  1R3I C;  4DV6 B;  2A7W A;  3SJC C;  4JYY A;  2DE0 X;  5JVD B;  1PKX A;  5JH7 A;  5AG2 A;  4I0X B;  1GAX A;  2Z3Y A;  4MVU A;  1ZWI C;  5LGT A;  3EFF K;  3H1K H;  5CA1 A;  2JGU A;  3ZHT A;  3A2F A;  2WLJ A;  1JA8 A;  5EZY A;  4FLT A;  5KAF Z;  4I4T A;  4QPK A;  5DEC A;  1BHB A;  2E5L B;  1FKA O;  3RW0 A;  1F51 A;  1I08 A;  1KKD A;  4PV1 B;  5CMU A;  1M9N A;  4O4J A;  2XAH A;  2QM8 A;  4AQY B;  2BTQ B;  1U97 A;  4LNU A;  4G28 B;  2B5U A;  3SR2 C;  2AGA A;  1NVP B;  3IGA C;  2NN4 A;  1SA0 B;  4UUJ C;  4CH4 A;  3LUT B;  3T1H B;  2QTS A;  4ZBM A;  4HNA A;  2ITC C;  1XHX A;  3E2E A;  4FLZ A;  2LP7 A;  4TOI A;  2ITD C;  2QWN B;  2B1G A;  4TQD A;  3JAL A;  2AHY A;  4X1I B;  1Y74 A;  2DYR B;  2QWO B;  3ABM C;  3TXQ A;  4X1Y B;  1V55 B;  4MVO A;  4U7O A;  2HJF C;  5L3B A;  1JFF B;  2AHZ A;  4YY3 O;  3RWR D;  4J7K A;  1Y4M A;  2YUA A;  4O2A A;  1SQF A;  2PYL A;  3OGI B;  3U11 A;  1XMO B;  1WA8 B;  1H2K A;  2EUL A;  1PNL A;  2LFS A;  4NTW A;  4DXW A;  1OCZ C;  1P49 A;  4X1K A;  2Q0O C;  1KQS U;  1GKF A;  3AG1 B;  1DF5 A;  1PM9 A;  3TCU A;  1QU7 A;  1S76 D;  4X65 B;  5J2U A;  3VQY A;  2A0L A;  3RGB A;  2DQ0 A;  2KQX A;  2JJ1 G;  4CC5 A;  2XUM A;  1E1Q G;  5KX5 B;  1AJN A;  3K3W A;  1S72 V;  4LBE C;  3K0D A;  4J7Z A;  4R8C A;  2L35 A;  5JQG B;  3FFQ A;  2UU9 O;  4QJF B;  4ZI7 B;  1SQP H;  3VBB A;  4K0K B;  1JCH A;  3OE7 G;  1AP6 A;  5CB4 B;  1PP9 H;  4UCU A;  4FMT A;  2OWO A;  1R73 A;  2Q9L A;  4U3J B;  2Q6A A;  2QEX V;  5IDJ A;  4GX5 A;  2MW2 B;  1MG1 A;  1H2M A;  1Z5V A;  2JGD B;  5C8Y B;  5H9C A;  2GDS A;  4O2B B;  4GZR B;  2Q69 A;  4AI8 A;  2DJV A;  4JI4 O;  5EC2 C;  1P4R A;  2VQE B;  1B6Q A;  3KZI Z;  1GTO A;  3HPL C;  1GN3 A;  5D5Q A;  4JAV A;  4QE9 A;  4RQF A;  4DV7 B;  2EX3 A;  3ZHU A;  4MT8 A;  5CBF A;  4UFZ A;  1S77 D;  4I5S A;  1NZ6 A;  2E74 B;  4DR3 O;  4DR2 O;  1RM1 C;  1Z2G A;  2P5O A;  3JAS A;  1FAF A;  4OPH A;  5IYB O;  4CC6 A;  3IJ4 A;  2AZ0 A;  5CA1 B;  1VEW A;  5LP6 C;  2ZXW B;  1WNS A;  3CP1 A;  4KHP O;  4I4T B;  4DUY B;  2XHB A;  4I7Z B;  3L73 H;  1WPB A;  1RSO B;  4LH6 A;  3QTC A;  5IJ9 B;  1ENV A;  2Y0I A;  3H1I H;  4O4J B;  3JCU Z;  2GUZ B;  5EIB C;  3QF7 A;  4PD4 F;  1UPG A;  3CSX A;  1SQQ H;  4UCT A;  3I5D A;  5KHJ A;  4MTO A;  2WLL B;  4DV0 O;  2ZE8 A;  4OPA A;  1R3K C;  1EFR G;  3RYH A;  2Q4P A;  4JZG A;  5IT9 N;  1GN4 A;  4HNA B;  5B1B B;  4F6R B;  1VQP V;  2YXL A;  1H8E G;  4F4L A;  4B3T O;  3CYO A;  2YC0 A;  2PUS A;  2ZR3 A;  3E35 A;  3VQW A;  1FXV A;  1AR1 B;  4P9P A;  3JAL B;  2DMX A;  3N2G B;  3K79 A;  1Y74 B;  1EN6 A;  4IT5 A;  3SYO A;  3CC7 V;  4GYC B;  2EIK B;  2QA4 V;  4YJ2 A;  1OCO C;  2IJJ A;  1HNZ B;  1Y76 A;  5LHH A;  2ZM6 O;  1YI2 V;  4LF4 B;  4LF5 O;  2D2C B;  4Q20 A;  3CC4 V;  5IE9 A;  4O2A B;  4H44 B;  3AG1 C;  3SJA C;  3RN4 A;  3CE2 A;  3ABL C;  1TA8 A;  2ZD9 A;  4X66 B;  4MSW C;  5EBM C;  4X1K B;  3RBZ A;  4JV5 O;  4HBN A;  3R66 A;  1XNQ O;  4X64 B;  5GON B;  3MAQ A;  1FS0 G;  1Y6X A;  1XNR O;  3L74 H;  3OEE G;  1ARO P;  2NNU A;  3F5T A;  4FPP A;  5B1A C;  1N34 B;  1XI1 A;  1P7B A;  3HKB A;  3JCZ A;  2KB1 A;  4Z2W A;  1D5A A;  5KLV H;  1YJ9 V;  2K9P A;  2ZT9 B;  4HZ3 A;  2Y69 B;  5LMU B;  2HKO A;  5F2V O;  2H3O A;  5B3S C;  2H8P C;  1O9G A;  1H8H G;  5LMN B;  4UXN A;  4WFB V;  4TWK A;  4NXN B;  4LWS A;  2JDI G;  5EYP A;  4JAA A;  4FLU A;  1K7D A;  3T2M A;  1YTF D;  3I56 V;  1X4T A;  2G38 A;  5LA6 A;  3OW2 U;  1XUQ A;  3BVO A;  1AR4 A;  4D6T H;  3W7W A;  3APQ A;  1AP5 A;  3AK1 A;  3LSQ A;  1K34 A;  1Q6U A;  2QKA A;  3K57 A;  2E75 B;  1F4M A;  4DV6 O;  1KEC A;  4JI1 O;  4DV5 B;  1URF A;  4N21 A;  3ZHQ A;  1QVF U;  4NVP A;  4TV8 B;  4IGG A;  2BOC C;  3B09 A;  4MTG A;  3SYA A;  2PI4 A;  3MD0 A;  1AI4 A;  1QLN A;  1WJZ A;  1VMG A;  3C3T A;  1COW G;  3JAS B;  5KHK A;  3CPW U;  1ZAU A;  1K5S A;  3CCL V;  3ZMS A;  2EIJ B;  2OIE A;  1BSM A;  5EBW C;  1NTM H;  1G4Y B;  2DQ3 A;  4X20 A;  5KUK A;  4GKJ B;  3LSU A;  4G27 B;  2KSD A;  4ZHQ A;  2ADQ B;  3JAR A;  3K06 A;  3JAK B;  1Q86 W;  4DYL A;  4GT1 A;  4PA9 A;  3T1H O;  4B3M B;  3H1L H;  4JI7 B;  1QCE A;  2UUC B;  4CS4 A;  2RDC A;  1VQ8 V;  1BS3 A;  1H2L A;  3OUF A;  3UO2 A;  3UM7 A;  3ASN C;  2GHY A;  2UUB B;  3R65 A;  1AI5 A;  3JD2 A;  4JI2 B;  1UJW B;  1VQM V;  2WLI B;  2ZE7 A;  2DWE C;  3ABT A;  4PHZ A;  4E2L A;  3AK3 A;  4PI0 A;  3OTO B;  1S5J A;  1JPX A;  3OMN B;  2DYS C;  1Q8I A;  1VAR A;  1N33 O;  2PZS A;  4NTY A;  2V1D A;  1Q81 W;  3ZS8 C;  2CTP A;  3LNN A;  1XMQ B;  1DGS A;  2ETN A;  4KL1 A;  2F4V B;  1TUB B;  4B7K A;  1FFX B;  2XOK G;  3SYC A;  3UT5 B;  4DR6 B;  4LF7 O;  3A0H Z;  3IAY A;  4UCS A;  3ABM B;  2AXT Z;  3A0B Z;  1K33 A;  4X65 O;  1R6N A;  1VQK V;  2O57 A;  2P6J A;  2LW1 A;  1Q5O A;  5KHI A;  2Q7E A;  2EIN C;  3GWK C;  1LUW A;  2P4V A;  4UVA A;  2DW4 A;  2WLN A;  2F95 B;  3EVK A;  4DK0 A;  1HR0 B;  1M5I A;  3HKB B;  4RQE A;  1SC5 B;  3LDE A;  4EFE A;  3SYQ A;  1KYO F;  5GTI Z;  5EK0 A;  3APO A;  3P3N A;  1S3J A;  4BW5 A;  2QKS A;  3K04 A;  3AG2 C;  3OMA B;  4RUF A;  1T5E A;  2IW5 A;  3FX7 A;  3ZBH A;  4WFH A;  1XHZ A;  4JZ2 A;  4JI0 B;  4LWS B;  3RYC A;  3AG3 B;  5EYP B;  4AHC A;  3ZHS A;  3CCS V;  2UUA O;  3PJS K;  1LR1 A;  3UQ8 A;  2JJ2 G;  3QNE A;  4O4L A;  5JJE B;  4I50 B;  1PPJ H;  4PDM A;  4CS2 A;  2VQF B;  2D3O W;  3BRC A;  3KCY A;  1NBM G;  1KUQ A;  2JS3 A;  4DV4 B;  1K3E A;  3BY6 A;  2Q73 A;  4R50 A;  4DV2 B;  3E8B A;  1WB7 A;  1KBH A;  4LFB O;  2HG5 C;  4L87 A;  1YIT V;  3BAA A;  4J42 A;  3UCS C;  1AJQ A;  4FFB A;  3JD0 A;  2CH7 A;  1FFT B;  2IM9 A;  1GRJ A;  4DUY O;  2Y4T A;  2HVJ C;  4LFA O;  4EB6 A;  4IYI A;  4B3S B;  4X8A A;  2PGG A;  4F6E A;  4GLX A;  2IJK A;  5B5E Z;  1VQ4 V;  3CME V;  3ZMU A;  2BTO A;  1RM1 B;  1K9M W;  4JI8 O;  2M7W A;  1G8M A;  5IYZ A;  3OUS A;  3SPJ A;  1PNM A;  3JAR B;  3O65 A;  3ETQ A;  1R6T A;  3GWO A;  1NKD A;  2IJH A;  2PYJ A;  2ZNI A;  4DR5 B;  5LP6 B;  2CTQ A;  4TV9 A;  5BY1 A;  1YZB A;  4ICG A;  3FB5 C;  2FTK A;  5IJ0 A;  4YHH O;  3CRC A;  4X9Q A;  3OFN G;  1CPY A;  2UXD O;  3ZN0 A;  1P7G A;  4IL6 Z;  1DF4 A;  4YXW G;  1XIL A;  3BAB A;  5LGU A;  1BQZ A;  5CA0 A;  3OMI B;  1HNW B;  3HKE A;  2IU3 A;  5FL7 G;  3NR7 A;  4LF8 O;  1YHQ V;  2E76 B;  1IUR A;  5IYC O;  3JAW B;  2GSM B;  4CH6 A;  1ROP A;  4UB8 Z;  1JJ2 U;  3IC9 A;  3ICX A;  1MSD A;  3QO7 A;  3WU2 Z;  4LF9 O;  2EZO A;  3ZED A;  1V9P A;  3QO5 A;  1HWY A;  1IBK B;  4KXR A;  4X64 O;  1N8R W;  1OCO B;  1I94 B;  4FM1 A;  1MNG A;  1SQB H;  1SQV H;  1IXB A;  1I7F A;  3A8T A;  3FKS G;  4JTC B;  4DV3 B;  1NT2 B;  5LOV A;  2CGO A;  4DR7 B;  1QHT A;  1TVK A;  4D7S A;  2EIL C;  2NLJ C;  3ABL B;  4Q6G A;  1N4C A;  3JSL A;  4LR3 A;  1SZT A;  5GTH Z;  4IIJ B;  5LMU O;  4PDL A;  3B4S A;  4K3A A;  1BZK A;  2UXB O;  3IFX A;  3CEI A;  4U7N A;  3TJT A;  1VQN V;  3AG3 C;  1OZ0 A;  4R7C A;  1J5E O;  5JWP A;  2JRI A;  5B1A B;  1N0J A;  5BR8 O;  4Z1V A;  4U3F H;  2Q0A A;  1Q7Y W;  1SKV A;  1VQ5 V;  3RYC B;  3FB7 C;  4X62 B;  4DV1 B;  2Q7G A;  1FXH A;  2LQT A;  4WFE A;  3D3Q A;  2MK3 A;  3BCC H;  5B3S B;  2KG7 A;  5L3G A;  5ITZ B;  4O4L B;  3L9D A;  2Q7H A;  4PDV A;  3E83 A;  5BMV B;  1ZLZ A;  1YEW A;  4IHJ B;  3E86 A;  4JI5 B;  3CXH F;  5LYJ A;  3PN1 A;  4DV5 O;  2XAS A;  3UKM A;  1CEZ A;  1IBM B;  1PV0 A;  3E22 B;  4TUY B;  1SET A;  1DLB A;  1ZL8 A;  4DUZ B;  3HKD B;  2A3Q A;  4QPJ A;  2X6B A;  4LF6 B;  1NTZ H;  4LFC O;  1F4N A;  3TET A;  5EC1 C;  1IVS A;  3ML0 A;  4FFB B;  3DC6 A;  3WB2 A;  4BIU A;  4B3R O;  3QO8 A;  3J81 N;  2CH7 B;  4FLW A;  1HDJ A;  3DXR A;  5JH7 B;  3J7A U;  5EBL C;  4PI2 A;  4EB6 B;  4RUE A;  4JI6 B;  3JAT A;  1KB9 F;  1H2G A;  5CBH A;  4GKJ O;  2YIA A;  2JVD A;  1IX9 A;  3E8G A;  3ASO C;  1SZX A;  2HHH B;  2P7T C;  5EZY B;  5IYZ B;  3H1J H;  3N27 A;  3SPH A;  1GN6 A;  2R72 A;  5IWA B;  1XEQ A;  4B3M O;  1WN7 A;  1M57 C;  2UUC O;  1MOF A;  4J9Z B;  4GX2 A;  2ZE6 A;  4J80 A;  2KKW A;  2OT5 A;  1IBL B;  5IJ0 B;  1NI8 A;  2P4K A;  3THO A;  4LNU B;  2YDE A;  3FD9 A;  1Q90 D;  2H94 A;  3CRQ A;  1MZF A;  5DM6 V;  4UCV A;  3CCM V;  1VIB A;  2L6L A;  3HKE B;  2ATK C;  2ZDI C;  4UVC A;  4GX0 A;  4NXM B;  1L8D A;  3ASN B;  4JYB A;  4MTX A;  2IJI A;  4NTX A;  1M56 C;  4WFF A;  2BSK A;  1OCR B;  3SPI A;  2Q5Z A;  2QM7 A;  1ZX3 A;  4I55 A;  1KD1 W;  1MZE A;  3E8H A;  2DYS B;  2F1M A;  4LC1 A;  5L3E A;  3MDS A;  4ZKI A;  5IYD O;  1BL8 A;  2RJZ A;  5L3C A;  3CC2 V;  4KUM A;  5BXZ A;  3O9O A;  1TVK B;  4BW9 A;  3W7U A;  5J2U B;  3VOU A;  1VQL V;  1W0K G;  3AG7 A;  1WAZ A;  4PDR A;  3ABU A;  2XT9 A;  1H2N A;  2LO1 A;  4TSF G;  2AZ2 A;  1KU9 A;  4W4K A;  1XL6 A;  5KUM A;  4DR4 B;  2EIN B;  1EM1 A;  2NR5 A;  3RYF A;  4BIZ A;  1S0V A;  1US6 A;  1WPX A;  4C7U A;  5K1P A;  2RNB A;  3BPZ A;  1YVW A;  4NYK A;  5KAI Z;  3D36 A;  2VWK A;  2IBZ H;  1R6K A;  1PD3 A;  3Q4H A;  2LW7 A;  1VQ6 V;  1F7Y A;  4DR1 O;  1YTF B;  3ZRW A;  4P2Z A;  3AG2 B;  5L3D A;  4WBN A;  2KG7 B;  2VQF O;  5E1A C;  1F23 A;  2F66 C;  2WSS G;  2BE3 A;  4UCR A;  4MVM A;  3WG7 C;  4JYA O;  1QBZ A;  2RQ6 A;  2Y4U A;  2HJD A;  4LH7 A;  5IY5 C;  4PA7 A;  4DV2 O;  3STL C;  3CRR A;  5K1X A;  1YIJ V;  4O4I A;  3SPC A;  3M99 B;  2XAQ A;  1ZTE A;  4PA4 A;  1NH2 D;  1Z5W A;  4O4H A;  4P9O A;  1I5Y A;  4LP8 A;  2ZR2 A;  4A5U B;  4JYC A;  3SDL A;  3NXS A;  2IH3 C;  1GM9 A;  1MA1 A;  3X2Q C;  1V54 C;  1A32 A;  3D3I A;  3TXS A;  3T1Y B;  2E5L O;  4NB5 A;  3C90 A;  4JI4 B;  3TGU H;  4UB6 Z;  1IZ3 A;  4KFM A;  4AQY O;  2FYU H;  1G1X B;  2YID A;  3G4S V;  5B1O A;  2FKX A;  5JJN B;  5JVD A;  3CXC U;  4I0X A;  1K97 A;  1EN4 A;  1S5L Z;  2E3C A;  1GM7 A;  2LGQ A;  4DR2 B;  4DR3 B;  3CX5 F;  3SPG A;  3W7S A;  2HR3 A;  4FLY A;  1Q3E A;  5H6Q A;  3RYH B;  4OX9 B;  5CA3 A;  1VF6 C;  3J80 N;  3WB0 A;  3CCE V;  2VWJ A;  4XDK A;  5KA5 A;  4D7T A;  4ZOL A;  1OCR C;  2ZNJ A;  3BA9 A;  4YIP A;  3K08 A;  5JJJ B;  1LNQ A;  3K5N A;  4KHP B;  5LGN A;  5CBG A;  2M6Y A;  5A2Q N;  2BTQ A;  4WF9 V;  2BSK B;  2VS0 A;  3OR6 C;  1MSW D;  3W7X A;  4YJ2 B;  4H0L B;  1IBK O;  2K1E A;  1Y76 B;  1XMO O;  2PY5 A;  4KP4 A;  1QNM A;  3CMA V;  2GTA A;  2GBO A;  2ZDI A;  2EIM C;  1O9H A;  3EXA A;  3WB1 A;  1I5X A;  4XDL A;  4DR7 O;  2ZQM A;  3KCX A;  4ABM A;  4K8X A;  3CJH A;  1K4D C;  1EZJ A;  4MVQ A;  4CBC A;  1B3Q A;  3DSQ A;  4X1Y A;  2XAJ A;  2Q68 A;  2HLD G;  1WLE A;  3K59 A;  1N36 B;  1JFF A;  1BGY H;  1NU1 H;  3M7M X;  4NKG B;  1PL4 A;  1N0N A;  4DK1 A;  1NR1 A;  4K0K O;  1WA8 A;  2ZM6 B;  1B06 A;  3A0R A;  4LF5 B;  4RWU A;  3LDD A;  3RYF B;  1RPO A;  1Q82 W;  2EIL B;  4GKK B;  3CRA A;  1RP3 B;  1SRY A;  1Q6I A;  1KP2 A;  1E79 G;  1AI7 A;  3Q4H B;  1HNX B;  2Q67 A;  1ZSP A;  1QR8 A;  2EBO A;  3ZRW B;  1H2S B;  3K5M A;  3STZ C;  4H37 A;  4JI5 O;  5L3F A;  4Z1M G;  4WBN B;  1XNQ B;  2N74 A;  5KX5 A;  2HEP A;  3AK2 A;  5LA6 B;  5TIS Z;  2V7Q G;  1J95 A;  4DUZ O;  4ZI7 A;  2VQE O;  4H13 B;  4I9Q A;  1M4U A;  3JSN A;  1D2D A;  5CB4 A;  1JQ0 A;  3K5L A;  4ZIB A;  3ZRS A;  3ZJZ A;  4DV7 O;  3CD6 V;  2B9Z A;  3CRM A;  1N32 B;  1HW7 A;  3AG4 C;  4U3J A;  4XDJ A;  4JTD B;  1XQ8 A;  1VQ9 V;  1L1F A;  3ZIA G;  3T4D A;  4CH5 A;  4X89 A;  5C8Y A;  2P90 A;  1L0N H;  3H9V A;  2X6A A;  3JD1 A;  4WFG A;  1XDC A;  2ILM A;  4CH3 A;  2AW9 A;  5D5P A;  4DW0 A;  5FNV A;  3JD4 A;  1B04 A;  3ZX6 A;  4N23 A;  3FAV A;  4X20 B;  5H5N A;  4P30 A;  1YJW V;  4B7E A;  2DOS A;  3K9A A;  4UV8 A;  3F7Y C;  4JI1 B;  4ZHQ B;  1BCC H;  5J2T A;  3G67 A;  2W6I G;  1TGO A;  2V4D A;  3ASO B;  2ZIO A;  1X59 A;  2WLH A;  1GH6 A;  4JPR A;  5DED A;  3SJB C;  2DWD C;  2X6C A;  2QWP B;  1KC8 W;  1M57 B;  2YIC A;  3ZRV A;  2JEU A;  2YI9 A;  3EHB B;  2OTJ V;  1BHA A;  1OCC B;  3T1C A;  4NXM O;  3FYE B;  4FVM A;  3OD4 A;  4J11 A;  4ZOL B;  5CN0 A;  3S3X A;  1RSO A;  1R3L C;  5IJ9 A;  4HYO A;  2ZIN A;  1HNZ O;  1XL4 A;  4LF4 O;  2GUZ A;  3VQX A;  5A9G A;  3B40 A;  1YJN V;  1VF6 A;  3K03 A;  4JGS A;  2YIB A;  1GMG A;  2WLL A;  4EFB A;  1PNK A;  4X66 O;  2RCV A;  2WLM A;  1NVP D;  4MW8 A;  4F6R A;  1YXB A;  1M56 B;  5HFL A;  3CB2 A;  3P32 A;  3CJH B;  5EIB D;  1YDX A;  3N2K A;  3CCU V;  4MVS A;  3K9S A;  3N2G A;  4R6Z A;  4TQF A;  1BMF G;  2QJ1 A;  4H33 A;  2HVK C;  1N34 O;  1R3J C;  2QE7 G;  1RFY A;  4DR4 O;  1KP3 A;  1OJH A;  1Q43 A;  2YXY A;  4BIO A;  4EKW A;  1N33 B;  2WAM A;  4IYH A;  3S3W A;  1XBL A;  3D36 C;  2Y48 A;  1YCI A;  4J10 A;  1FJG B;  1BE3 H;  3DTU B;  3HB3 B;  2ZIM A;  2JS5 A;  2A79 B;  5LHI A;  4JTA B;  4RO2 A;  5LMN O;  1UFI A;  1YSC A;  3DGE A;  4LF7 B;  1QLE C;  1BQ0 A;  3P30 A;  4NXN O;  1GN2 A;  3BEH A;  2EJ7 A;  5LBQ A;  5GON A;  2CTR A;  1JOY A;  3RFR A;  2ZKO A;  3B8M A;  1FD9 A;  2OYQ A;  5JCO C;  3OGC C;  2CGN A;  3CCQ V;  1JVM A;  1AI6 A;  4JF3 A;  1AVM A;  1FXK C;  2OCC C;  2R70 A;  2BCC H;  1W59 A;  1BT8 A;  5B1N A;  1VP7 A;  4J9Y B;  1K5Q A;  1MAB G;  4K8Z A;  1WB8 A;  2JIZ G;  3UO3 A;  3WG7 B;  2RMK B;  3OT7 A;  1U96 A;  3E8F A;  2YSU B;  2P67 A;  2P22 C;  4NR1 A;  2LGW A;  4J41 A;  3F5W C;  4FZ0 A;  1OHH G;  2HFE C;  4HAM A;  4JAU A;  2WLK A;  5IY5 B;  1HP8 A;  4QIW F;  4X88 A;  3JAM N;  2EZP A;  2UUA B;  3T1Y O;  4L8J A;  4BAY A;  1TAE A;  3I55 V;  2LJ2 A;  4CZZ A;  5FNV B;  4JI3 B;  2UXC B;  3ZN1 A;  5KHH A;  3FAV B;  3CS5 A;  4UV9 A;  4TV8 A;  3U10 A;  4E4E A;  4JI7 O;  1GO3 F;  2YXH A;  3X2Q B;  1V54 B;  5J2T B;  1H38 A;  1W2B U;  2CK3 G;  4OX9 O;  2N04 A;  4TV9 B;  1OCC C;  4QE7 A;  3L72 H;  4LFB B;  2UXN A;  1NJI W;  2UUB O;  3BFR A;  1SQG A;  4JI2 O;  1KMI Z;  4AIL C;  3H01 A;  1JMK C;  4B08 A;  3CWB H;  4LFA B;  1NS1 A;  5KA6 A;  2JK5 C;  3OTO O;  3B2E E;  2QKC A;  2FL4 A;  3T4Z A;  5CA0 B;  5DN6 G;  1K8A W;  3W7T A;  3KKY A;  4JI8 B;  1XMQ O;  2XAF A;  3JAK A;  4QNH B;  4FLX A;  1CXZ B;  1Y66 A;  2A9H A;  2F4V O;  3ETG A;  3OTF A;  1IXM A;  4DR6 O;  2JEX A;  3TK1 A;  2ARH A;  2N05 A;  5H2F Z;  3ETD A;  4YHH B;  2DYR C;  5LL6 Y;  3K5O A;  2YIB D;  1V55 C;  2UXD B;  1FYJ A;  5GW7 A;  1LUV A;  2WLI A;  5C93 A;  5KHG A;  3N2K B;  3RVY A;  3C3S A;  2X7R B;  3D8C A;  1N36 O;  2WWW A;  4GX1 A;  1PL0 A;  1HR0 O;  3ZMV A;  5LOV B;  2PF4 E;  4YJ3 A;  2EIM B;  1QR9 A;  2XND G;  1NR7 A;  3ZMZ A;  1NTK H;  4FM2 A;  3HKC A;  3ZHR A;  4UCO A;  3G71 V;  4LF8 B;  3G6E V;  4FLV A;  5LXT A;  4GKK O;  1TUB A;  1FFX A;  1FPO A;  3JD3 A;  2R9I A;  2WA4 A;  3JYC A;  1W0J G;  2ZCE A;  3UT5 A;  1Y67 A;  1AIL A;  3H1H H;  1HNX O;  4PA6 A;  1JX9 A;  1IDS A;  1XRE A;  3LSS A;  5BZB A;  1DK1 A;  4YY3 B;  2R9R B;  3ZCC A;  1G6U A;  4LF9 B;  3OEH G;  4JI0 O;  1AJP A;  1SQX H;  5H6R A;  2GTS A;  1KKC A;  3F7V C;  2QSA A;  1XOU A;  4MW3 A;  2CTW A;  1QVG U;  3KG2 A;  3CHX A;  1NQT A;  3FB6 C;  4PA3 A;  1I0H A;  3L75 H;  2Z0A A;  4QGP A;  2YS8 A;  2IH1 C;  1N32 O;  1EZV H;  5LYJ B;  5FPO A;  2QM4 A;  5B66 Z;  2HP8 A;  4DV4 O;  1NH2 B;  3ABK B;  2ZE5 A;  4FFK A;  5JCO A;  1GM8 A;  4MTF A;  2UXB B;  4DRX A;  1K73 W;  1ZL8 B;  1J5E B;  2UU9 B;  3RYI A;  3BA8 A;  1FXK A;  3MHS C;  3RT3 C;  2QTO A;  2QWR B;  3ZRX A;  5BR8 B;  1YF2 A;  3OR7 C;  5KMG A;  3QVN A;  3CCV V;  3IC7 A;  1MMM A;  2PI5 A;  2BOB C; 
#chains in the Genus database with same CATH homology
 2W0F C;  1SRY A;  2GSM B;  1KP2 A;  1E79 G;  1AI7 A;  1ROP A;  1SER A;  2Q67 A;  1JJ2 U;  4RAI A;  3B77 A;  3QO7 A;  1K4C C;  2EZO A;  3AG4 B;  1QR8 A;  1ENV A;  2EBO A;  3ZRW B;  3QO5 A;  3STZ C;  1HWY A;  4H37 A;  5L3F A;  4Z1M G;  1N8R W;  1OCO B;  4G2K A;  2YEV A;  3FKS G;  4JTC B;  1THZ A;  4MTO A;  2WLL B;  2V7Q G;  3OM3 B;  1J95 A;  4MVR A;  1R3K C;  1EFR G;  5HFM A;  2EIL C;  2NLJ C;  3ABL B;  2ZXW C;  5B1B B;  1JQ0 A;  1VQP V;  3ZRS A;  1H8E G;  4F4L A;  1RPR A;  3ZJZ A;  3CYO A;  3CD6 V;  1SZT A;  2ZR3 A;  3E35 A;  4DO2 A;  4PDL A;  1FXV A;  1AR1 B;  4P9P A;  3AG4 C;  3K79 A;  4XDJ A;  4JTD B;  4UVB A;  3SYO A;  3AEI A;  3CC7 V;  1DTO A;  3IFX A;  2EIK B;  2QA4 V;  4U7N A;  1VQ9 V;  1L1F A;  3AG3 C;  1VQN V;  1OCO C;  1OZ0 A;  4R7C A;  1K92 A;  2IJJ A;  3ZIA G;  2OTL V;  5LHH A;  1YI2 V;  3T4D A;  5B1A B;  4X89 A;  4Q20 A;  4I9W A;  2P90 A;  3CC4 V;  2C2A A;  2X6A A;  1Q7Y W;  1VQ5 V;  3JD1 A;  3AG1 C;  3FB7 C;  4WFG A;  5LHG A;  1CP9 A;  1FXH A;  1E1R G;  3ABL C;  4WFE A;  2ZD9 A;  4MSW C;  5B1B C;  5EBM C;  4PEL A;  2X0L A;  1S5H C;  2MK3 A;  3RBZ A;  3JD4 A;  5B3S B;  5L3G A;  4N23 A;  1M1K W;  4PDV A;  3E83 A;  1M90 W;  1YJW V;  4P30 A;  3E86 A;  3K9A A;  4UV8 A;  3F7Y C;  2EIK C;  3GB7 C;  2XAS A;  1FS0 G;  3UKM A;  3OEE G;  1CEZ A;  1ARO P;  2NNU A;  4FPP A;  2W6I G;  4FIP C;  1SET A;  4LCU C;  5B1A C;  3ASO B;  1DLB A;  2B1I A;  1P7B A;  4MVZ A;  2WLH A;  3JCZ A;  4GCZ A;  2KB1 A;  4JPR A;  4QPJ A;  2DWD C;  2X6B A;  2X6C A;  1YJ9 V;  1F4N A;  1KC8 W;  3CCR V;  1VQO V;  1M57 B;  4TT3 G;  3ZRV A;  3ETE A;  2JEU A;  3ZMT A;  3EHB B;  4HZ3 A;  1SES A;  5EC1 C;  3TET A;  2OTJ V;  1BHA A;  2Y69 B;  3ML0 A;  1OCC B;  3T1C A;  3FYE B;  1TUE B;  2HKO A;  4BIU A;  5B3S C;  3QO8 A;  5CN0 A;  2H8P C;  1H8H G;  4MS2 A;  2UXX A;  1R3L C;  5EBL C;  2WPD G;  4UXN A;  1ORQ C;  4HYO A;  2F43 G;  4RUE A;  4TWK A;  4WFB V;  1XL4 A;  1H2G A;  5CBH A;  2JDI G;  1VQ7 V;  1K7D A;  1YJN V;  3E8G A;  3ASO C;  3K03 A;  4JGS A;  1GMG A;  2P7T C;  3T2M A;  1YTF D;  3I56 V;  4OXS A;  3OW2 U;  2WLL A;  3SPH A;  3E89 A;  1PNK A;  3SYP A;  3W7W A;  2WLM A;  1M57 C;  1NVP D;  4WFA V;  1MOF A;  4J9Z B;  1OCZ B;  3LSQ A;  4MW8 A;  2Y69 C;  1K34 A;  4GX2 A;  1M56 B;  2OT5 A;  5HFL A;  2Z5U A;  3P32 A;  3ABK C;  1F4M A;  3CCU V;  1KEC A;  1QLE B;  4MVS A;  3K0G A;  2H94 A;  4N21 A;  1QVF U;  4R6Z A;  1BMF G;  2BOC C;  2LFR A;  3OAA G;  4H33 A;  2HVK C;  4MTG A;  1R3J C;  3MHH C;  2QE7 G;  3LNM B;  3SYA A;  1KP3 A;  2PI4 A;  3MD0 A;  1AI4 A;  1QLN A;  5DM6 V;  4EKW A;  2IU0 A;  2WAM A;  3CCM V;  1COW G;  4FJC C;  3B8N A;  3RVZ A;  2ATK C;  2Y48 A;  2ZDI C;  4WCE V;  1FXK B;  3CPW U;  2OCC B;  1K5S A;  5J9P C;  3FYI B;  4UVC A;  4GX0 A;  3CCL V;  3DTU B;  3HB3 B;  4JAS A;  2A79 B;  3ASN B;  4JYB A;  3ZMS A;  2EIJ B;  4MTX A;  5LHI A;  3CCJ V;  2IJI A;  4JTA B;  4RO2 A;  1M56 C;  5EBW C;  4WFF A;  1YSC A;  3DGE A;  1G4Y B;  1OCR B;  4FK5 C;  3SPI A;  1GK9 A;  1QLE C;  2QM7 A;  3P30 A;  2DQ3 A;  1KD1 W;  1EBO A;  5KUK A;  3BEH A;  3E8H A;  5LBQ A;  3LDC A;  4G27 B;  1JOY A;  2DYS B;  3SJQ C;  4LC1 A;  5L3E A;  3K06 A;  1Q86 W;  3B8M A;  4ZKI A;  5IYD O;  3OGC C;  1BL8 A;  4GT1 A;  2YEV B;  3CCQ V;  4PA9 A;  1JVM A;  3WFV A;  5L3C A;  4XBF A;  3CC2 V;  2XAG A;  1AI6 A;  4JF3 A;  1QCE A;  4KUM A;  2EJR A;  1FXK C;  3FB8 C;  2OCC C;  4ASU G;  5B1N A;  1VQ8 V;  3OUF A;  2W6J G;  3UM7 A;  3ASN C;  4J9Y B;  2EIJ C;  2GHY A;  1R3I C;  3W7U A;  3R65 A;  3VOU A;  1AI5 A;  3JD2 A;  1VQL V;  1W0K G;  1K5Q A;  1UJW B;  1VQM V;  2WLI B;  4PDR A;  1MAB G;  3ABU A;  2DWE C;  1PKX A;  4TSF G;  2JIZ G;  3ABT A;  3WG7 B;  4E2L A;  3E8F A;  2Z3Y A;  4MVU A;  1XL6 A;  2YSU B;  5KUM A;  1ZWI C;  2EIN B;  5LGT A;  1JPX A;  2P67 A;  3OMN B;  2DYS C;  3EFF K;  3F5W C;  1OHH G;  2HFE C;  4HAM A;  4JAU A;  2V1D A;  2WLK A;  5IY5 B;  4BIZ A;  1Q81 W;  1S0V A;  1WPX A;  2WLJ A;  4QIW F;  4X88 A;  2EZP A;  3D36 A;  4QPK A;  1R6K A;  1PD3 A;  2XOK G;  4BAY A;  1BHB A;  3RW0 A;  3SYC A;  1F51 A;  1VQ6 V;  1KKD A;  5CMU A;  3I55 V;  1YTF B;  1M9N A;  3ZRW A;  3ABM B;  2XAH A;  4CZZ A;  1K33 A;  4P2Z A;  2QM8 A;  3AG2 B;  5L3D A;  3ZN1 A;  4G28 B;  2B5U A;  1F23 A;  2WSS G;  5E1A C;  1R6N A;  1VQK V;  2P6J A;  1NVP B;  4MVM A;  3WG7 C;  4UV9 A;  3IGA C;  2EIN C;  1QBZ A;  4UUJ C;  3LUT B;  4UVA A;  2DW4 A;  2WLN A;  1GO3 F;  3X2Q B;  5IY5 C;  1V54 B;  4PA7 A;  1H38 A;  3STL C;  4ZBM A;  1W2B U;  2ITC C;  3E2E A;  2CK3 G;  4RQE A;  2LP7 A;  1OCC C;  4QE7 A;  1YIJ V;  3LDE A;  2ITD C;  2UXN A;  3SPC A;  3SYQ A;  3M99 B;  1NJI W;  2XAQ A;  5EK0 A;  4PA4 A;  1NH2 D;  2B1G A;  4P9O A;  1I5Y A;  4LP8 A;  1S3J A;  2AHY A;  4BW5 A;  2ZR2 A;  2DYR B;  3ABM C;  2QKS A;  3H01 A;  1V55 B;  4JYC A;  3K04 A;  3AG2 C;  4MVO A;  4U7O A;  2HJF C;  5KA6 A;  2JK5 C;  3OMA B;  3NXS A;  5L3B A;  2AHZ A;  4RUF A;  3T4Z A;  1Y4M A;  5DN6 G;  2IW5 A;  1K8A W;  4WFH A;  3W7T A;  2IH3 C;  2XAF A;  1GM9 A;  4QNH B;  3AG3 B;  1PNL A;  3X2Q C;  2LFS A;  1V54 C;  3CCS V;  1Y66 A;  3D3I A;  2A9H A;  3PJS K;  4DXW A;  1OCZ C;  3ETG A;  1IXM A;  2JEX A;  2JJ2 G;  1KQS U;  3QNE A;  1GKF A;  3AG1 B;  1DF5 A;  3TK1 A;  3ETD A;  4KFM A;  3TCU A;  4PDM A;  2DYR C;  1S76 D;  3G4S V;  5B1O A;  1V55 C;  2A0L A;  2D3O W;  5GW7 A;  2DQ0 A;  2WLI A;  5C93 A;  3CXC U;  2JJ1 G;  3RVY A;  1E1Q G;  1NBM G;  1K97 A;  2X7R B;  1AJN A;  3K3W A;  1S72 V;  4LBE C;  1GM7 A;  3K0D A;  1K3E A;  4R8C A;  2WWW A;  4GX1 A;  1PL0 A;  3BY6 A;  3SPG A;  4R50 A;  3ZMV A;  3E8B A;  3W7S A;  2HR3 A;  2EIM B;  1QR9 A;  2XND G;  4QJF B;  1NR7 A;  5H6Q A;  3VBB A;  3ZMZ A;  2HG5 C;  5CA3 A;  4L87 A;  1YIT V;  3G71 V;  1JCH A;  3OE7 G;  3CCE V;  3G6E V;  1AJQ A;  4XDK A;  3JD0 A;  5KA5 A;  1OCR C;  2R9I A;  3JD3 A;  1FFT B;  3JYC A;  1W0J G;  3K08 A;  1LNQ A;  4FMT A;  2HVJ C;  5LGN A;  1R73 A;  5CBG A;  4PA6 A;  1JX9 A;  4X8A A;  3LSS A;  5BZB A;  2Q6A A;  4WF9 V;  2QEX V;  2R9R B;  3ZCC A;  5IDJ A;  2IJK A;  3OR6 C;  4GX5 A;  3OEH G;  1VQ4 V;  3CME V;  3ZMU A;  3W7X A;  1MSW D;  1MG1 A;  1RM1 B;  1K9M W;  1AJP A;  2K1E A;  2M7W A;  5H6R A;  4KP4 A;  1G8M A;  5H9C A;  3CMA V;  3F7V C;  3OUS A;  3SPJ A;  2ZDI A;  1PNM A;  2Q69 A;  2EIM C;  3GWO A;  1I5X A;  1NKD A;  4XDL A;  2IJH A;  5EC2 C;  4MW3 A;  1QVG U;  1P4R A;  2ZQM A;  3FB5 C;  3KG2 A;  2FTK A;  1NQT A;  1K4D C;  3OFN G;  3FB6 C;  1B6Q A;  4PA3 A;  1CPY A;  1EZJ A;  4MVQ A;  1GTO A;  4CBC A;  3HPL C;  3ZN0 A;  4JAV A;  4QE9 A;  4RQF A;  2IH1 C;  2XAJ A;  2Q68 A;  4MT8 A;  1DF4 A;  5CBF A;  4YXW G;  2HLD G;  1S77 D;  1WLE A;  1NH2 B;  3ABK B;  4I5S A;  5LGU A;  1RM1 C;  1GM8 A;  4MTF A;  1K73 W;  3OMI B;  1NR1 A;  2IU3 A;  5FL7 G;  1FXK A;  5IYB O;  3MHS C;  2QTO A;  3A0R A;  3ZRX A;  1YHQ V;  3LDD A;  1RPO A;  3OR7 C;  3CCV V;  1Q82 W;  3IC7 A;  2EIL B;  2PI5 A;  2ZXW B;  2BOB C;  5IYC O;  3CP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...