3SJQC

Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
80
structure length
80
Chain Sequence
b'TQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQARKLRSVKMEQRKLNDQANTLVDLAKTQLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calmodulin
publication title Structural basis for calmodulin as a dynamic calcium sensor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 35
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3sjqC00
2ZXWC 4XDKA 1ZWIC 3F7YC 4PA7A 3F5WC 2BOCC 4DXWA 3ZJZA 2ATKC 2W0FC 1R3JC 2AHZA 4HZ3A 4P2ZA 4QNHB 1XL4A 4XDLA 3LDCA 4RUFA 2EIJC 4MVRA 4PDMA 4MVMA 4X8AA 5B3SC 3JYCA 4X89A 3SYQA 2WLJA 3ABMC 2JK5C 4WFEA 2QTOA 4PDLA 4MS2A 4BW5A 2WLIB 2WLNA 4WFHA 2Q6AA 3ABLC 3OUSA 2X6AA 4MTFA 2WLLB 3LDEA 1XL6A 1R3LC 3OUFA 4P9PA 1OCZC 2WLMA 3E89A 3LDDA 3UKMA 3AG1C 4J9YB 3STLC 5B1BC 4MVZA 3UM7A 3GB7C 2HJFC 3SYCA 3OR7C 4GX2A 4RUEA 3FB8C 1OCCC 3SPIA 2A9HA 1OCOC 1G4YB 5EK0A 3K08A 4P30A 2HFEC 4PDRA 2R9RB 2WLKA 3K0DA 4QE9A 4JTAB 5B1AC 4XDJA 2WLHA 2IH3C 2Q67A 1S5HC 3K0GA 4R8CA 3AG2C 3HPLC 4PA6A 4GX5A 2A79B 3T4ZA 3ABKC 4HYOA 5KUMA 3TETA 3ASOC 4TWKA 4GX1A 2EILC 4H33A 3TCUA 5EC1C 3VOUA 4KFMA 4MVOA 4WFGA 5EC2C 4PA9A 3EFFK 4QE7A 3AG4C 4LBEC 4MTOA 2ITDC 3K06A 3SPCA 4RAIA 3SYPA 3T2MA 4EKWA 4PDVA 3SPHA 2OCCC 4X88A 3RW0A 3K04A 4MVSA 3SPGA 3X2QC 3R65A 3E8FA 1ORQC 2QKSA 4H37A 3STZC 1K4CC 4F4LA 3AG3C 2DWEC 3BEHA 3IFXA 3SPJA 3FB7C 4WFFA 5KUKA 2DWDC 4PA3A 3T1CA 4MW3A 2Y69C 3KG2A 5CBGA 4UUJC 5J9PC 1V54C 4PA4A 4J9ZB 2X6CA 3E8BA 2X6BA 1V55C 2IH1C 5EBWC 2EIMC 3LNMB 3RVYA 3T4DA 5IY5C 2HVJC 5CBFA 1LNQA 2KB1A 3LUTB 4MW8A 1P7BA 5EBMC 3IGAC 1J95A 2A0LA 3E8HA 3RBZA 1OCRC 3E86A 4R6ZA 2Q69A 4G28B 4R50A 2K1EA 2P7TC 1M56C 3OR6C 1JVMA 1KKDA 3ASNC 1K4DC 4JTCB 4MVUA 4JTDB 4I9WA 2YEVA 4LP8A 4G27B 5E1AC 5EBLC 3SYAA 2NLJC 3F7VC 4LCUC 2WLIA 2HVKC 4R7CA 3ZRSA 4MVQA 1M57C 4MTGA 2BOBC 3OGCC 4RO2A 3SJQC 2WLLA 2AHYA 3FB5C 5BZBA 5CBHA 4P9OA 2ITCC 2EINC 3E8GA 2DYSC 3WG7C 4CBCA 1R3KC 2HG5C 1QLEC 2H8PC 2ZD9A 4OXSA 4ZBMA 3SYOA 3FB6C 2Q68A 2DYRC 3PJSK 2EIKC 3E83A 4MSWC 1R3IC 3K03A 4GX0A 3RVZA 1BL8A
chains in the Genus database with same CATH superfamily
1KBHA 4E4EA 5LOVB 4BIUA 1AI4A 4I50A 5LP6B 4KP4A 2Q6AA 5LHHA 2N74A 3JATA 5B1AB 4O4LA 4TV9A 2CTWA 4MVZA 5IT9N 3OR7C 4I5SA 1HNWO 2A9HA 1Q5OA 2WLKA 2JRIA 4FZ0A 1S5HC 1WN7A 4B3TO 1NS1A 3AG2C 1O9HA 2JEUA 2QM7A 4H33A 2E5LB 2RJZA 4AHCA 4DR1B 1FKAO 2FKXA 1JMKC 2UXCB 1ZUQA 4PELA 1W2BU 1QR9A 3QG5A 1H2GA 2R9IA 2WA4A 3UT5B 1HP8A 3QO5A 5KUKA 2DE0X 1HNXB 3T1HO 4IHJB 3P3NA 2JEXA 2IJHA 4DUZB 2NR5A 1Y4MA 4L87A 2B1IA 1V9PA 2EIMC 3LNMB 3T4DA 4YY3O 1Y66A 3LUTB 4FMTA 1K5SA 4IIJA 3E8HA 2RNBA 4CZZA 1PL4A 5H6QA 1KKDA 3ASNC 1KUQA 2YXHA 1DLBA 3JCZA 1NQTA 3AG1B 4X20A 2BOBC 3ETGA 4JI2B 1GRJA 2ZD9A 2EJRA 2Q0OC 3K5NA 4QGPA 5IYBO 1FXKC 4F6RA 4JYCA 1P7GA 1VQ8V 3RVZA 3BA9A 2PI4A 4FLXA 3HKDB 5H2FZ 1L0LH 4HZ3A 1PKXA 1CPYA 4OPAA 4LF4B 4CH6A 2PGGA 2KSDA 1L8DA 4X65O 4BW5A 3CCUV 2ZE7A 2CTRA 3B09A 1N32O 4DR5O 3ZN0A 4X1KB 4LFBO 3ZMSA 3LDDA 4JI6B 2R9AA 4DR2O 3P32A 3OTFA 5CMUA 4DV7O 3K08A 3UO2A 3H1JH 5LHIA 3S3WA 3ASOC 1RPOA 4O4IB 4FM1A 5K1PA 3AEIA 4O2BB 4EB6B 3JAWB 3K06A 4EEQA 5LMNO 2QR4A 1SRYA 1Y6XA 2HHHO 2EIMB 3CJHA 2P22C 1HNWB 2GUZA 1RM1C 1R6TA 3CHXA 3W7UA 3JD1A 3ASNB 4B3TB 1H8EG 5CA1B 4JI5O 3DTUB 4NR1A 1OCRC 4B08A 2AZ2A 1U97A 3CE2A 2ZNIA 1WPXA 1GK9A 3CCRV 2ADPA 3D8CA 4JTDB 5EIBD 1AI6A 4H44B 4LR3A 1R73A 3P30A 1L1FA 4BIOA 2XTAA 3T1HB 3OW2U 1R3KC 4B7KA 3JALB 4U7NA 2YIAA 1VQPV 3GWKC 3HKEB 4UCTA 1KKCA 3F7YC 1H2NA 1XHZA 1PNLA 4DR3O 4JAUA 4B3SO 2ZIMA 2Q4PA 2WLJA 3ABMC 3DC5A 1IBLO 5KX5A 1XQ8A 1VF6C 3QF7A 1KECA 2FL4A 4UFZA 1AJQA 3VBBA 1Q86W 3B40A 2WLMA 4DW0A 1NH2B 1FXKA 3ASOB 4ZIBA 1AVMA 1IXMA 1S76D 4BAYA 2RMKB 5EK0A 4G2KA 2B1GA 4FVMA 1SQXH 3D36C 1O9GA 4ZI7B 4WBNB 4NTYA 1JJ2U 2LP7A 4J42A 2UUBO 1IDSA 3TCUA 2NN4A 3AG4C 4X65B 2QWRB 4DV6B 4W4LA 4JZGA 4LFBB 3AG3C 4DR2B 4JAVA 3WB1A 1NZ6A 4Q6GA 4DV7B 4NB5A 1OCRB 2IJIA 2Y69C 1QNMA 3G4SV 3RVYA 1M1KW 4YJ3A 2QE7G 5CB4A 3CC7V 2DMXA 3GWOA 3RBZA 1Q90D 2JS5A 1TAEA 1DF5A 2K1EA 5LMNB 2WA3A 3DC6A 4JTCB 2HHHB 4YJ2B 5KA6A 2UUCB 4LCUC 1P49A 2A3QA 1BHAA 2ETNA 4NYKA 5JWPA 2RQ6A 2H3OA 3K9AA 4CS4A 4RQFA 2LW7A 3TXQA 3I55V 3E83A 3ABMB 5C8YA 3MHHC 4JI5B 3ZHTA 3K5LA 5DECA 4XDKA 1SA0A 1JFFB 3F5WC 2CGOA 2XOKG 2L35A 4CH5A 4LNUB 3U10A 5L3GA 4UB8Z 3R66A 4FLVA 3FX7A 1I94B 2DJVA 4QJFB 3BHPA 5JCOC 2CGNA 1EBOA 4WFHA 1NH2D 1N36O 1KU9A 1PM9A 3ABLC 2KKWA 5GONB 1R3LC 4DW1A 1ZTEA 4PHZA 2HEPA 1FFTB 3AG4B 3WB2A 1GM9A 3RYHA 1ZSPA 2CTQA 1K92A 1H2SB 4UCRA 3AG3B 1IBLB 1NJIW 1XNQB 3SPHA 1WJZA 3RN4A 3E8FA 4Q20A 2CE4A 2ZCEA 5J2UB 5BXZA 2UUAB 2JDIG 3APOA 3CCEV 4AI8A 1AILA 2LGQA 1PNMA 2ODMA 2HR3A 1LNQA 5B3SB 4FLYA 3W7WA 2XAQA 4MTXA 1VQ4V 3AK3A 3QTCA 4X1IB 1Q8IA 1TVKA 4JI7O 4X9QA 3B8MA 2BTQA 2FB5A 2MW2B 2EZPA 4MVQA 1M57C 4HNAB 1XNRO 5E79Z 2IBZH 1XOUA 2QWPB 4GKKO 3WG7C 3JD4A 1OCOB 5F2VO 3TXSA 4O4HA 1QLEC 3CRAA 1K5QA 2RCVA 2PI5A 4LH6A 3FAVB 3H1IH 5A2QN 3E22B 3K3WA 2P6JA 4DV2O 2DN9A 3FD9A 1VMGA 4F6EA 1E79G 3BRCA 4X62B 4BWAA 2F43G 4DR6O 4OGQB 5KMGB 5B5EZ 1XI1A 2XAGA 3A8TA 2WLLB 3HB3B 4J80A 2B5UA 3STLC 4HAMA 4AQYO 1EN4A 3RYCB 2HJDA 5IJ0B 1OZ0A 4GT1A 1F4NA 1YJ9V 2IH3C 1H2MA 4R8CA 2UXBB 4I55A 3E35A 2BE3A 2UXDO 4I4TB 4HYOA 3CC4V 4O2AB 5EC1C 1XBLA 1X59A 4MTOA 5EZYA 3T2MA 3JD2A 1N36B 1P84F 2PF4E 1ORQC 2X7RB 3W7SA 2P5OA 2QGNA 1GM7A 2XHBA 1Q7YW 1QR8A 4J9ZB 2X6CA 2X6BA 2IH1C 2OT5A 4PJ0Z 2OYQA 3KCYA 4IYHA 3RYIB 4R50A 3OAAG 5JH7B 4TQDA 4J7KA 4DV0O 1GTOA 5FLXN 1CEZA 1Q81W 2E3CA 2F1MA 1QHTA 3L73H 2QKCA 1M4UA 1MSWD 3AK1A 2BSKB 5D5PA 2HG5C 1Q6IA 4DRXB 4DK0A 5JJJB 1SETA 1I5YA 1ZWIC 2BOCC 4TUYA 1JJOA 2LFSA 2AHZA 1Q6UA 2HP8A 3B2EE 4J41A 4MVMA 2AGAA 4JI7B 3K58A 1Y76A 1GN3A 1Y67A 2WPDG 4YHHB 2ZE8A 1QVGU 1BQ0A 5LGTA 4B3RB 3ZRWA 2M7WA 1XREA 3VQXA 2RN9A 2ZDIC 3AG1C 5JQGA 3B77A 2P06A 2FMLA 4GKJO 2Q7EA 5HFLA 3Q4HB 1RFYA 1AB3A 3JARB 3O65A 4GX1A 1AR1B 4CC5A 3VOUA 3ZEDA 4MVOA 1BMFG 2VWJA 2GHYA 4NTWA 4DR6B 1HNZO 1BHBA 3R65A 3OGIB 2JGDB 1YXBA 1S3JA 1MSDA 1I08A 4JYYA 2ZIOA 1R1BA 2XT9A 1WA8A 3OMNB 5EBWC 1IURA 1G1XB 3S3XA 5IY5C 2KG7A 2UXDB 1PV0A 1VQ5V 1J95A 2A0LA 2Q7HA 2OIGA 2QSAA 5LOVA 1K33A 5GTIZ 4D7TA 4K35A 2Z3YA 1VQLV 3OR6C 5LP6A 1K4DC 2UXNA 3ZHRA 3BCCH 3RYFB 4DV3O 1Y74B 4AILC 3C90A 5ITZB 4CS2A 5LHGA 4X1YB 3BABA 1GH6A 1SZTA 1SQPH 3TK1A 2EIKC 1VQOV 1FFXB 3OMAB 2VWKA 4PA7A 3QVNA 1CP9A 1JCHA 1N33O 3CCQV 2ZE6A 1XUQA 4DV0B 1LR1A 4JYBA 2LJ2A 4BR6A 3SYQA 4QPKA 2BCCH 2AXTZ 3N2GB 3THOA 5CA0B 1F23A 5KLVH 3O9OA 1ZL8B 1SF9A 1SERA 3CRRA 4J9YB 1NR7A 3UT5A 1YHQV 1SS3A 4IHJA 4FFKA 1UJWB 4IT5A 2HFEC 3K0DA 5H6RA 4DV5B 3EVKA 2BTOA 2A79B 3T4ZA 3ABKC 2Y4TA 4JI4O 5BY1A 4LFAB 3H1KH 2ITDC 3SYPA 1IBKO 4B3MO 1E1RG 3ZHQA 5IJ9B 3STZC 2C2AA 2ZDIA 4F4LA 5IY5B 2XUMA 3ZMZA 4FLWA 4PA3A 2L6LA 4MW3A 4FFBB 3CMEV 4X66O 4PA4A 4K3AA 2F66C 4MW8A 3HKDA 3D3QA 4KXRA 4GCZA 3EHBB 1HNZB 1GAXA 3CSXA 3ETDA 5JJEB 3SJBC 2EIKB 3ZRSA 2EX3A 2QWQB 1KQSU 2PYJA 1AP5A 2RDCA 2EINC 4X1KA 2DYRC 4GUNA 1WB7A 1VQKV 3RT3C 3WU2Z 5LXTB 1MG1A 1YEWA 4DXWA 3SJCC 2YI8A 3DGEA 3JYCA 4O4IA 4WFBV 3BVOA 2P67A 4DV3B 1DGSA 4O2BA 3OE7G 2VS0A 4EB6A 5TISZ 3HKCB 3JAWA 1NTZH 3APQA 3L74H 1MMMA 4I9QA 4P9PA 4ZOLB 3ZHUA 3MD0A 4YY3B 2MK3A 3ABKB 3GB7C 3SPIA 1MOFA 4JTAB 1N33B 1Z5VA 4O4JB 1TA8A 5CA1A 1WP7A 4GX5A 1RSOB 5GW7A 2KQXA 2PTMA 4KFMA 5LMUO 2JGUA 1TUEB 3EXAA 1PPJH 1QU7A 4UVAA 1UPGA 1H2KA 4MVSA 4ASUG 4H13B 3QO8A 5BMVB 2YIBD 3I56V 2HLDG 2OIEA 3IFXA 1QQCA 1QLNA 3T1CA 3JALA 3CXHF 3ZHSA 5KHGA 1IZ3A 4TSFG 4ICGA 4N23A 1FD9A 3HKEA 1P7BA 5LGNA 1JQ0A 4JI4B 4R6ZA 1N32B 1K73W 4FM0A 4DR5B 4TV8B 2EINB 4I9WA 1H2LA 4LP8A 1IBKB 4B3MB 3AG7A 4G27B 3F7VC 3MHSC 2DYRB 1EFRG 3VQVA 1YZBA 2AHYA 2DQ3A 3HR0A 4X66B 4CBCA 3ZMUA 1NKDA 1KC8W 4MSWC 1WLEA 4GX0A 1SQVH 1DF4A 1FXHA 2EILB 2JVDA 4ZI7A 4WBNA 2V4DA 4LFCO 4I7ZB 4JPRA 5B3SC 1VARA 3JSNA 3CX5F 1YF2A 3F5TA 3ZMTA 1XL6A 3B8NA 4DUYO 2P4KA 3J7AU 2HJFC 2NNUA 1XMOO 1WPBA 1G4YB 1OCOC 1TUBB 4LF6O 2R9RB 4QE9A 3MDSA 2WLHA 2P4VA 1GMGA 1YDXA 2Y0PA 1OHHG 4TWKA 1QVFU 4HBNA 3EFFK 5CN0A 4RAIA 1NU1H 4PDVA 5D5QA 5K1XA 2EJ7A 4YJ2A 2E74B 2K9PA 2QWOB 3HKBB 3CMAV 5L3DA 4LF7O 3ETQA 1NTMH 1NBMG 1AR5A 3CC2V 5B1OA 3KG2A 4DR3B 5J9PC 3KCXA 5KAFZ 1Q82W 4B3SB 4LF5O 2CH7B 1NI8A 1QBZA 3CPWU 3BAAA 1JFFA 3K5OA 4Z1MG 3ZRXA 2ZM6O 1VF6A 5LMUB 2Q69A 2VQEO 1ZAUA 4LNUA 4MVUA 5J2TB 5LYJB 3JSLA 4ZHQB 1YITV 1GM8A 2Z0AA 4PI0A 3ZN1A 4JI0O 5B1BB 1KD1W 4I0XB 2VQFO 5GONA 4CC6A 3D36A 5EYPB 3OMIB 2Q5ZA 2UUBB 4KHPO 3FKSG 2Q68A 3CRQA 4UVBA 3L75H 4XBFA 4JYAO 4CH4A 1MNGA 4QNHB 1XL4A 1I7FA 4GZRB 2V7QG 3SR2C 4RUFA 4OX9O 1AR4A 3M8AA 1PNKA 2WLIB 2X6AA 4E2LA 2QDOA 3H9VA 2QJ1A 5J2UA 1OCZC 1YIJV 2DW4A 3UM7A 4NKGB 3C3SA 1OV9A 1VIBA 2PY5A 4WCEV 4I0XA 2LFRA 5LA6B 1Z2GA 4DYLA 1JOYA 2QM8A 4LWSB 3UQ8A 1YTFB 3JASB 3J81N 2F93B 2XNDG 5JVDB 5L3FA 4X1IA 2XAHA 2OCCC 3RW0A 3K04A 5FPOA 4DUYB 2YI9A 3LSUA 1J5EO 3BEHA 2DWEC 3I5DA 1SC5B 4HNAA 1XMOB 5IYCO 4WFFA 1XMQO 1V54C 4X64O 3E8BA 4DV4O 2YIDA 1FPOA 3FAVA 3IGAC 3E22A 1F4MA 5JCOA 3N2KB 1M56C 2GV9A 4UCSA 4FPPA 1K7DA 4FM2A 5KMGA 3LNNA 2E75B 2HVKC 3H1LH 4NXNO 2WLLA 4DR1O 1VEWA 3E8GA 2UXCO 5FNVB 4LF5B 1SQGA 1NTKH 2D2CB 4GLXA 1M9NA 3RYCA 1WAZA 2ZM6B 5IJ0A 3DXRB 5IWAO 5IYZB 5BR8O 1YJWV 2M6YA 4U3JB 5GTHZ 3NXSA 1N34O 4I4TA 3JCUZ 1VQ6V 4MVRA 3P3PA 2YEVB 4O2AA 1OCZB 2QKAA 3H01A 2QTOA 3K59A 1GN6A 2ZE5A 3BPZA 3LSQA 3OUSA 2VQFB 3BA8A 3OUFA 1FYJA 4JGSA 1G8MA 2ZR2A 4JZ2A 1ZLZA 4KHPB 3SYCA 3IAYA 4JYAB 1B04A 1YTFD 1XEQA 2QTSA 1Q43A 2O57A 5DN6G 5IYDO 2OCCB 1K3EA 4PV1B 1FS0G 4I50B 4OX9B 4FJCC 3OD4A 3RYIA 1XNRB 5JH7A 3UO3A 3SPCA 4EKWA 4GKKB 1AJPA 1D5AA 1KP3A 1V54B 3JATB 4ZKIA 4FLZA 5KHJA 4O4LB 4TV9B 4H37A 3DSQA 3VQWA 1HR0O 4K8XA 4TOIA 4LF4O 1JPXA 3CS5A 4FLUA 2XASA 2GTAA 4DV2B 2BSKA 4DRXA 1DTOA 1M56B 1WP8A 4EFEA 2LO1A 2QA4V 1VP7A 4J10A 4JI6O 5CBFA 3FFQA 2FYUH 2KB1A 4DR4O 1K34A 3E86A 1S77D 1W0KG 4H0LB 2OWOA 1SQQH 2Y0IA 4Z1VA 2DQ0A 4J7ZA 5E1AC 3ZRVA 2NLJC 4AQYB 3A2FA 1J5EB 3K9SA 1PL0A 1SQBH 1SZXA 2ITCC 2DYSC 3RWRD 1XMQB 4X64B 4DV4B 4JF3A 4ZBMA 3G6EV 5LBQA 3W7XA 2W6JG 2AW9A 4UV8A 4IIJB 1E1QG 3ZHVA 1K8AW 2ATKC 2W0FC 3Q4HA 3JARA 1XDCA 1M93A 5DEDA 4MS2A 1NR1A 4NXNB 4X20B 3LSSA 4FIPC 3LDEA 2JGDA 1P4RA 1YCIA 3UKMA 2CK3G 4F6RB 2QEXV 3E2EA 3FB8C 4LF8O 3L72H 5IWAB 1AI7A 2IU0A 2GSMB 5BR8B 1AP6A 2IU3A 2F95B 3ML0A 1MABG 1N34B 5IE9A 1H8HG 1UFIA 5KHKA 3CRCA 2PUSA 4K0KO 4PD4F 4JI1O 3G67A 1URFA 1M90W 3QO7A 4DK1A 1B6QA 3RYFA 5B66Z 4KL1A 4N21A 2CDYA 3SPGA 5C93A 1Y74A 2Q9LA 1BCCH 4FLTA 2PYLA 2QKSA 5ITZA 1K4CC 3CB2A 3FB7C 3VQYA 3KKYA 1OJHA 4D6TH 4NXMO 4X1YA 1T5EA 3CCSV 1S72V 2XAJA 2WSSG 1AJNA 4OPHA 1FFXA 3PN1A 1XILA 2W0XA 2DYSB 2YXLA 5EBLC 1JA8A 1RPRA 1HR0B 1GN4A 1BT8A 1U96A 5B1NA 3IC7A 3CJHB 4R7CA 2EBOA 3N2GA 4MTGA 5CA0A 2LQTA 3SJQC 4P9OA 4GKJB 4DV6O 1ZL8A 2GUZB 3N27A 1D2DA 4YIPA 1N0JA 3OM3B 2UU9O 3SYOA 2EULA 3AG2B 3CYOA 2ZXWC 4DR4B 4WFAV 2R72A 1HDJA 3KZIZ 4IL6Z 4FK5C 3LDCA 1FJGO 1GKFA 2Q0AA 1VF7A 3A0RA 1US6A 1S0VA 5IJ9A 3OT7A 2IW5A 1WNSA 4B7EA 2UUCO 1OCCC 2YXYA 2YIBA 4FFBA 4JI8O 3G71V 2VRZA 1HWYA 3WFVA 3HPLC 3SJAC 1N4CA 3CXCU 3TETA 1Q3EA 3U11A 3JD3A 1ZX3A 2EILC 2ADQB 2Y48A 5KHHA 4PA9A 1W0JG 5KX5B 4GYCB 1TGOA 4A5UB 1PP9H 1YVWA 3MAQA 3CRMA 5A9GA 1BZKA 3T1YO 2LW1A 5L3EA 2UXXA 3SPJA 1G6UA 3K57A 3C3TA 1FXKB 3K79A 1I94O 4LF8B 2YS8A 1W59A 1NVPB 1EN5A 1EM1A 3WB0A 1BSMA 1CXZB 2CTPA 1EN6A 3SGIA 5DM6V 3OTOO 3CCJV 5KHIA 3CCMV 2HKOA 3SDLA 2JS3A 1KB9F 5LXTA 4K0KB 1YJNV 4JI1B 2ZINA 1SESA 3H1HH 3ETEA 5L3CA 4TQFA 2DOSA 1M5IA 3HKCA 1HW7A 5L3BA 2Z5UA 3AK2A 2OTJV 4NXMB 2ZXWB 5CBHA 2FTKA 2IJJA 1XNQO 4JAAA 2ZT9B 4ZOLA 5FPRA 2GTSA 5FL7G 2YICA 3FYEB 3PJSK 3K03A 4YJ3B 5CB4B 2UUAO 1BL8A 3BY6A 2P90A 4Z2WA 3TGUH 3TJTA 2CUGA 4O4JA 2Y4UA 1QCEA 1RSOA 4PDMA 1S5LZ 2XAFA 3A0HZ 4PDLA 2OCHA 2WLNA 1OCCB 1GN2A 3CEIA 4UCVA 2OTLV 5BMVA 1RM1B 3QNEA 4K8ZA 3CP1A 5B1BC 2UU9B 2Q7GA 4QIWF 5C8YB 3K5MA 3ABTA 4P30A 4DR7O 1SA0B 2D3OW 4ABMA 2JIZG 1FJGB 4CH3A 3NR7A 2R70A 4TV8A 3G80A 1NVPD 1F7YA 5H9CA 2ZKOA 1N8RW 3W7TA 3B4SA 4X62O 1VQ7V 3L71H 5KA5A 4JI8B 5CBGA 2YSUB 1B3QA 4JI3O 3RYHB 1D5NA 1FXVA 2GBOA 1KP2A 4G28B 4C7UA 3JAMN 2UXBO 3BFRA 5LGUA 1MZFA 3RGBA 3T1YB 4NVPA 3ZX6A 3U0ZA 2ILMA 1FAFA 3IC9A 3OGCC 1IXBA 3FB5C 3A0BZ 2H8PC 4W4KA 4UVCA 4DV1O 3OTOB 1PD3A 2YC0A 3FB6C 3ZMVA 3L9DA 1R3IC 5H5NA 1KYOF 1DK1A 1TUBA 1BE3H 1JX9A 2ZR3A 3OEEG 2Q8VA 1A32A 1VQNV 1TVKB 1MA1A 4RWUA 4X89A 3IJ4A 2JK5C 4YIOA 4WFEA 1S5JA 3ZS8C 2BTQB 1IBMO 1VF5B 2X0LA 1AI5A 1KMIZ 2G38A 3HKBA 2Y69B 1ROPA 3E89A 1Z5WA 4O4HB 2YUAA 4TT3G 4GX2A 4RUEA 1VQMV 2F4VO 3M99B 2N04A 4XDJA 3ZBHA 4UCOA 2Q67A 4UB6Z 4BIZA 3K0GA 1K9MW 4LF9O 2CH7A 4PA6A 1MZEA 4J7JA 3RFRA 1GO3F 3JAKB 5KAIZ 5EC2C 4QE7A 4LBEC 3ABUA 1K97A 5J2TA 5LYJA 4ZHQA 2EZOA 2A06H 3X2QC 4EFBA 2JJ2G 2PZSA 3UCSC 2F23A 2WAMA 2N05A 4IYIA 4YHHO 1SKVA 2DWDC 4B3RO 5EYPA 4DR7B 1BS3A 4LFCB 1V55C 2IM9A 2QWNB 4JV5O 2HVJC 4I55B 2GDSA 1EZVH 2H94A 3CCLV 2P7TC 5EZYB 1RP3B 2JJ1G 2E76B 5JJNB 3ABLB 2W6IG 1ENVA 2Q73A 3SYAA 2ARHA 4J11A 4L8JA 3JAKA 2WLIA 5AG2A 3FYIB 3CCVV 4MT8A 4LF6B 1LUWA 2V1DA 3OEHG 1H38A 5IDJA 4JI3B 4LC1A 4KUMA 4OXSA 1Q6HA 3JD0A 3ZCCA 2YDEA 4UXNA 5LA6A 4YXWG 1XHXA 3ZJZA 3OFNG 1R3JC 4P2ZA 4XDLA 2IJKA 2EIJC 1YSCA 4LWSA 4X8AA 2QM4A 4LF7B 3JASA 2E5LO 3M7MX 5CA3A 4U7OA 5JVDA 2LGWA 3CD6V 2ZQMA 1IX9A 4MTFA 3J80N 5LP6C 3ZIAG 4RQEA 4DV1B 1SQFA 1B06A 1HNXO 4LH7A 2VQEB 4PDRA 1NT2B 4DUZO 5B1AC 4TUYB 3GVMA 3X2QB 4UCUA 5KUMA 5HFMA 4JI0B 3CWBH 3N2KA 4CS3A 4WFGA 1Y76B 1COWG 1IBMB 4PI2A 1N0NA 1M57B 1THZA 4X88A 3ZRWB 4WF9V 3WG7B 1V55B 2CAZC 4NTXA 4QPJA 1QLEB 2A7WA 1AROP 5JQGB 3G6BA 4UV9A 2F4VB 4JI2O 4UUJC 4D7SA 5FNVA 1F51A 1R6NA 4LF9B 3D3IA 2WWWA 2ZNJA 5EBMC 3DXRA 1R6KA 4U3FH 1YI2V 5IYZA 1IVSA 1LUVA 4FZ1A 4U3JA 4DO2A 4BW9A 1JVMA 4DV5O 2YEVA 3L70H 1JR9A 1X4TA 4IGGA 1EZJA 1BQZA 4RO2A 4LFAO 1I5XA 5BZBA 5LL6Y 3ICXA 1I0HA 2B9ZA 1WA8B 4JASA 2AZ0A 1VQ9V 2EIJB 4JV5B 1BGYH 1WB8A 2KG7B 1L0NH 5EIBC
chains in the Genus database with same CATH topology
2ZXWC 1DF4A 1FXHA 2EILB 4WFAV 3K3WA 2P6JA 4BIUA 4FK5C 3LDCA 1AI4A 4JPRA 1GKFA 5B3SC 1E79G 2F43G 3A0RA 4KP4A 2Q6AA 5LHHA 2XAGA 2WLLB 5B1AB 3HB3B 3ZMTA 1S0VA 1XL6A 3B8NA 2B5UA 3STLC 4MVZA 4HAMA 2IW5A 2HJFC 2NNUA 3OR7C 4I5SA 1OCCC 2A9HA 1G4YB 1OCOC 3G71V 2R9RB 1OZ0A 2WLKA 4GT1A 4QE9A 1F4NA 1HWYA 2WLHA 1YJ9V 2IH3C 1S5HC 4R8CA 3AG2C 1GMGA 3WFVA 3HPLC 3E35A 3CXCU 3TETA 4HYOA 1OHHG 3JD3A 4TWKA 2JEUA 2EILC 2QM7A 4H33A 1QVFU 3CC4V 5EC1C 2Y48A 4PA9A 3EFFK 5CN0A 1W0JG 4MTOA 3T2MA 4RAIA 3JD2A 4PDVA 4PELA 1W2BU 1QR9A 1ORQC 2X7RB 3W7SA 3CMAV 5L3DA 5L3EA 2UXXA 1H2GA 2R9IA 3SPJA 1FXKB 3K79A 3QO5A 1NBMG 5KUKA 1GM7A 3CC2V 5B1OA 1NVPB 3KG2A 2JEXA 2IJHA 1Q7YW 5J9PC 1Q82W 1QR8A 1Y4MA 4J9ZB 2X6CA 2X6BA 4L87A 2B1IA 2IH1C 5DM6V 3CCJV 3CCMV 2EIMC 3LNMB 2OT5A 2HKOA 3T4DA 1Y66A 3LUTB 4FMTA 1QBZA 3CPWU 1K5SA 4Z1MG 3ZRXA 3E8HA 4CZZA 1YJNV 1SESA 2Q69A 5H6QA 4R50A 3OAAG 1KKDA 3ETEA 3ASNC 4MVUA 1GTOA 5L3CA 1CEZA 1DLBA 1YITV 1GM8A 3JCZA 3ZN1A 1Q81W 1NQTA 5L3BA 3AG1B 2Z5UA 5B1BB 2OTJV 1KD1W 2BOBC 2ZXWB 5CBHA 3ETGA 2FTKA 2IJJA 1MSWD 3D36A 2HG5C 3OMIB 2ZD9A 2EJRA 5FL7G 3FYEB 5IYBO 1FXKC 3FKSG 2Q68A 4JYCA 3PJSK 1SETA 1VQ8V 3K03A 4UVBA 1I5YA 3RVZA 4XBFA 2PI4A 1BL8A 3BY6A 1ZWIC 2P90A 2BOCC 2LFSA 2AHZA 4HZ3A 4QNHB 1PKXA 1XL4A 2V7QG 1QCEA 1CPYA 4RUFA 4PDMA 4MVMA 2XAFA 2WPDG 4PDLA 1QVGU 4BW5A 1PNKA 2WLIB 2WLNA 5LGTA 3CCUV 1OCCB 2OTLV 3ZRWA 2X6AA 2M7WA 4E2LA 3ZN0A 1RM1B 3QNEA 1OCZC 3ZMSA 2ZDIC 3LDDA 2DW4A 3AG1C 3CP1A 3UM7A 1YIJV 5B1BC 3B77A 3P32A 5CMUA 4QIWF 4WCEV 2LFRA 3ABTA 3K08A 4P30A 2D3OW 1JOYA 2JIZG 2QM8A 5HFLA 5LHIA 3ASOC 4GX1A 1AR1B 1RPOA 1YTFB 3VOUA 2XNDG 1BMFG 4MVOA 2GHYA 3AEIA 5L3FA 3K06A 2XAHA 2OCCC 1SRYA 3RW0A 3K04A 1BHBA 3R65A 1NVPD 2EIMB 2DWEC 1S3JA 3BEHA 5H9CA 1N8RW 3W7TA 1VQ7V 5IYCO 4WFFA 5KA5A 1RM1C 5CBGA 2YSUB 3OMNB 3W7UA 1V54C 3JD1A 3E8BA 3ASNB 5EBWC 5IY5C 1H8EG 3IGAC 1VQ5V 1J95A 1F4MA 2A0LA 1FXVA 3DTUB 1OCRC 1KP2A 1K33A 4G28B 2Z3YA 1VQLV 1M56C 3OR6C 1WPXA 1GK9A 3CCRV 1K4DC 2UXNA 4FPPA 4JTDB 1AI6A 5LGUA 1K7DA 1R73A 3P30A 1L1FA 2HVKC 5LHGA 3OGCC 2WLLA 3FB5C 3E8GA 3OW2U 1R3KC 1SZTA 2H8PC 4U7NA 4UVCA 1PD3A 3TK1A 3FB6C 3ZMVA 1VQPV 1M9NA 2EIKC 1VQOV 1R3IC 3OMAB 1JX9A 2ZR3A 3F7YC 4PA7A 3OEEG 1CP9A 1JCHA 1PNLA 1YJWV 4JAUA 3CCQV 1VQNV 3NXSA 4JYBA 1VQ6V 4MVRA 4X89A 2YEVB 3SYQA 2WLJA 1OCZB 3ABMC 2JK5C 4QPKA 4WFEA 3H01A 2QTOA 1KECA 3LSQA 3OUSA 2X0LA 1AI5A 1AJQA 3VBBA 1Q86W 1F23A 3OUFA 2Y69B 1ROPA 4JGSA 1G8MA 2WLMA 3E89A 1SERA 2ZR2A 4J9YB 1NR7A 1NH2B 1FXKA 3ASOB 3SYCA 4TT3G 4GX2A 4RUEA 1VQMV 1IXMA 1YHQV 1S76D 4BAYA 5EK0A 1UJWB 2HFEC 3M99B 3K0DA 4G2KA 5H6RA 1YTFD 2B1GA 4XDJA 2Q67A 4BIZA 5DN6G 3K0GA 2OCCB 5IYDO 1K9MW 4PA6A 1K3EA 1JJ2U 2A79B 2LP7A 3ABKC 3T4ZA 1FS0G 3TCUA 4FJCC 1GO3F 5EC2C 4QE7A 3AG4C 4LBEC 2ITDC 3SPCA 3SYPA 4EKWA 3ABUA 1AJPA 1K97A 1V54B 1KP3A 2EZOA 1E1RG 3X2QC 4ZKIA 2JJ2G 4H37A 3STZC 2C2AA 2ZDIA 4F4LA 3AG3C 5IY5B 3ZMZA 1JPXA 4JAVA 2WAMA 2XASA 2DWDC 4PA3A 1OCRB 4MW3A 2IJIA 2Y69C 3CMEV 1DTOA 4PA4A 1M56B 1V55C 3G4SV 3RVYA 2QA4V 2HVJC 1M1KW 5CBFA 2QE7G 3CC7V 2KB1A 4MW8A 3GWOA 4GCZA 3RBZA 1K34A 3E86A 1S77D 2H94A 3EHBB 3CCLV 1W0KG 1DF5A 2K1EA 2P7TC 2JJ1G 4JTCB 3ABLB 2W6IG 1ENVA 2DQ0A 5E1AC 3ZRVA 3SYAA 5KA6A 2NLJC 3ETDA 4LCUC 2WLIA 2EIKB 1BHAA 3ZRSA 3FYIB 3CCVV 4MT8A 1PL0A 1KQSU 2ITCC 2EINC 2DYSC 2V1DA 3OEHG 1H38A 5IDJA 3K9AA 4LC1A 4KUMA 4OXSA 3JD0A 4JF3A 4ZBMA 3ZCCA 3G6EV 4RQFA 5LBQA 2DYRC 3I55V 3E83A 3ABMB 4UXNA 2W6JG 3MHHC 3W7XA 1VQKV 4UV8A 4XDKA 4YXWG 1E1QG 3F5WC 1K8AW 1MG1A 3ZJZA 4DXWA 2ATKC 2W0FC 2XOKG 3OFNG 1R3JC 4P2ZA 4XDLA 3DGEA 2IJKA 2EIJC 1YSCA 5L3GA 4X8AA 3JYCA 4WFBV 2P67A 3OE7G 4U7OA 5CA3A 4QJFB 4MS2A 3CD6V 1NR1A 1EBOA 4WFHA 3LSSA 4FIPC 1NH2D 3ABLC 2ZQMA 4MTFA 3LDEA 1R3LC 1P4RA 4P9PA 3ZIAG 3UKMA 2CK3G 3MD0A 4RQEA 2MK3A 3ABKB 3GB7C 2QEXV 3E2EA 3FB8C 3SPIA 1AI7A 1MOFA 1FFTB 4PDRA 5B1AC 3AG4B 4JTAB 2IU0A 2GSMB 1GM9A 2IU3A 3ML0A 1MABG 1K92A 4GX5A 1H8HG 5GW7A 3X2QB 5KUMA 5HFMA 3AG3B 4KFMA 4WFGA 1COWG 1NJIW 1TUEB 1M90W 3QO7A 4UVAA 1B6QA 3SPHA 1M57B 1THZA 4X88A 4N21A 4MVSA 3SPGA 3ZRWB 5C93A 4ASUG 4WF9V 3E8FA 3QO8A 4Q20A 2QKSA 3WG7B 1V55B 3I56V 2HLDG 1K4CC 4QPJA 1QLEB 3IFXA 1AROP 3FB7C 2JDIG 1QLNA 4UV9A 3T1CA 3CCEV 3CCSV 1S72V 4UUJC 1F51A 1PNMA 1R6NA 2XAJA 4TSFG 2WSSG 1AJNA 4N23A 2HR3A 3D3IA 2WWWA 1LNQA 5EBMC 1P7BA 1R6KA 5B3SB 1YI2V 5LGNA 3W7WA 2XAQA 1JQ0A 4R6ZA 1K73W 4MTXA 4DO2A 1VQ4V 1JVMA 2EINB 2DYSB 4I9WA 2YEVA 4LP8A 4G27B 5EBLC 1RPRA 3B8MA 3F7VC 3MHSC 1EZJA 2DYRB 3IC7A 5B1NA 4R7CA 1EFRG 2EZPA 2EBOA 4MVQA 1M57C 4MTGA 4RO2A 1I5XA 3SJQC 2AHYA 2DQ3A 5BZBA 4P9OA 3WG7C 3JD4A 1OCOB 4CBCA 3ZMUA 1QLEC 4JASA 1VQ9V 1NKDA 1KC8W 3OM3B 1K5QA 2EIJB 3SYOA 3AG2B 2PI5A 4MSWC 1WLEA 4GX0A 3CYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXW C;  4XDK A;  1ZWI C;  3F7Y C;  4PA7 A;  3F5W C;  2BOC C;  4DXW A;  3ZJZ A;  2ATK C;  2W0F C;  1R3J C;  2AHZ A;  4HZ3 A;  4P2Z A;  4QNH B;  1XL4 A;  4XDL A;  3LDC A;  4RUF A;  2EIJ C;  4MVR A;  4PDM A;  4MVM A;  4X8A A;  5B3S C;  3JYC A;  4X89 A;  3SYQ A;  2WLJ A;  3ABM C;  2JK5 C;  4WFE A;  2QTO A;  4PDL A;  4MS2 A;  4BW5 A;  2WLI B;  2WLN A;  4WFH A;  2Q6A A;  3ABL C;  3OUS A;  2X6A A;  4MTF A;  2WLL B;  3LDE A;  1XL6 A;  1R3L C;  3OUF A;  4P9P A;  1OCZ C;  2WLM A;  3E89 A;  3LDD A;  3UKM A;  3AG1 C;  4J9Y B;  3STL C;  5B1B C;  4MVZ A;  3UM7 A;  3GB7 C;  2HJF C;  3SYC A;  3OR7 C;  4GX2 A;  4RUE A;  3FB8 C;  1OCC C;  3SPI A;  2A9H A;  1OCO C;  1G4Y B;  5EK0 A;  3K08 A;  4P30 A;  2HFE C;  4PDR A;  2R9R B;  2WLK A;  3K0D A;  4QE9 A;  4JTA B;  5B1A C;  4XDJ A;  2WLH A;  2IH3 C;  2Q67 A;  1S5H C;  3K0G A;  4R8C A;  3AG2 C;  3HPL C;  4PA6 A;  4GX5 A;  2A79 B;  3T4Z A;  3ABK C;  4HYO A;  5KUM A;  3TET A;  3ASO C;  4TWK A;  4GX1 A;  2EIL C;  4H33 A;  3TCU A;  5EC1 C;  3VOU A;  4KFM A;  4MVO A;  4WFG A;  5EC2 C;  4PA9 A;  3EFF K;  4QE7 A;  3AG4 C;  4LBE C;  4MTO A;  2ITD C;  3K06 A;  3SPC A;  4RAI A;  3SYP A;  3T2M A;  4EKW A;  4PDV A;  3SPH A;  2OCC C;  4X88 A;  3RW0 A;  3K04 A;  4MVS A;  3SPG A;  3X2Q C;  3R65 A;  3E8F A;  1ORQ C;  2QKS A;  4H37 A;  3STZ C;  1K4C C;  4F4L A;  3AG3 C;  2DWE C;  3BEH A;  3IFX A;  3SPJ A;  3FB7 C;  4WFF A;  5KUK A;  2DWD C;  4PA3 A;  3T1C A;  4MW3 A;  2Y69 C;  3KG2 A;  5CBG A;  4UUJ C;  5J9P C;  1V54 C;  4PA4 A;  4J9Z B;  2X6C A;  3E8B A;  2X6B A;  1V55 C;  2IH1 C;  5EBW C;  2EIM C;  3LNM B;  3RVY A;  3T4D A;  5IY5 C;  2HVJ C;  5CBF A;  1LNQ A;  2KB1 A;  3LUT B;  4MW8 A;  1P7B A;  5EBM C;  3IGA C;  1J95 A;  2A0L A;  3E8H A;  3RBZ A;  1OCR C;  3E86 A;  4R6Z A;  2Q69 A;  4G28 B;  4R50 A;  2K1E A;  2P7T C;  1M56 C;  3OR6 C;  1JVM A;  1KKD A;  3ASN C;  1K4D C;  4JTC B;  4MVU A;  4JTD B;  4I9W A;  2YEV A;  4LP8 A;  4G27 B;  5E1A C;  5EBL C;  3SYA A;  2NLJ C;  3F7V C;  4LCU C;  2WLI A;  2HVK C;  4R7C A;  3ZRS A;  4MVQ A;  1M57 C;  4MTG A;  2BOB C;  3OGC C;  4RO2 A;  3SJQ C;  2WLL A;  2AHY A;  3FB5 C;  5BZB A;  5CBH A;  4P9O A;  2ITC C;  2EIN C;  3E8G A;  2DYS C;  3WG7 C;  4CBC A;  1R3K C;  2HG5 C;  1QLE C;  2H8P C;  2ZD9 A;  4OXS A;  4ZBM A;  3SYO A;  3FB6 C;  2Q68 A;  2DYR C;  3PJS K;  2EIK C;  3E83 A;  4MSW C;  1R3I C;  3K03 A;  4GX0 A;  3RVZ A;  1BL8 A; 
#chains in the Genus database with same CATH topology
 1KBH A;  4E4E A;  5LOV B;  4BIU A;  1AI4 A;  4I50 A;  5LP6 B;  4KP4 A;  2Q6A A;  5LHH A;  2N74 A;  3JAT A;  5B1A B;  4O4L A;  4TV9 A;  2CTW A;  4MVZ A;  5IT9 N;  3OR7 C;  4I5S A;  1HNW O;  2A9H A;  1Q5O A;  2WLK A;  2JRI A;  4FZ0 A;  1S5H C;  1WN7 A;  4B3T O;  1NS1 A;  3AG2 C;  1O9H A;  2JEU A;  2QM7 A;  4H33 A;  2E5L B;  2RJZ A;  4AHC A;  4DR1 B;  1FKA O;  2FKX A;  1JMK C;  2UXC B;  1ZUQ A;  4PEL A;  1W2B U;  1QR9 A;  3QG5 A;  1H2G A;  2R9I A;  2WA4 A;  3UT5 B;  1HP8 A;  3QO5 A;  5KUK A;  2DE0 X;  1HNX B;  3T1H O;  4IHJ B;  3P3N A;  2JEX A;  2IJH A;  4DUZ B;  2NR5 A;  1Y4M A;  4L87 A;  2B1I A;  1V9P A;  2EIM C;  3LNM B;  3T4D A;  4YY3 O;  1Y66 A;  3LUT B;  4FMT A;  1K5S A;  4IIJ A;  3E8H A;  2RNB A;  4CZZ A;  1PL4 A;  5H6Q A;  1KKD A;  3ASN C;  1KUQ A;  2YXH A;  1DLB A;  3JCZ A;  1NQT A;  3AG1 B;  4X20 A;  2BOB C;  3ETG A;  4JI2 B;  1GRJ A;  2ZD9 A;  2EJR A;  2Q0O C;  3K5N A;  4QGP A;  5IYB O;  1FXK C;  4F6R A;  4JYC A;  1P7G A;  1VQ8 V;  3RVZ A;  3BA9 A;  2PI4 A;  4FLX A;  3HKD B;  5H2F Z;  1L0L H;  4HZ3 A;  1PKX A;  1CPY A;  4OPA A;  4LF4 B;  4CH6 A;  2PGG A;  2KSD A;  1L8D A;  4X65 O;  4BW5 A;  3CCU V;  2ZE7 A;  2CTR A;  3B09 A;  1N32 O;  4DR5 O;  3ZN0 A;  4X1K B;  4LFB O;  3ZMS A;  3LDD A;  4JI6 B;  2R9A A;  4DR2 O;  3P32 A;  3OTF A;  5CMU A;  4DV7 O;  3K08 A;  3UO2 A;  3H1J H;  5LHI A;  3S3W A;  3ASO C;  1RPO A;  4O4I B;  4FM1 A;  5K1P A;  3AEI A;  4O2B B;  4EB6 B;  3JAW B;  3K06 A;  4EEQ A;  5LMN O;  2QR4 A;  1SRY A;  1Y6X A;  2HHH O;  2EIM B;  3CJH A;  2P22 C;  1HNW B;  2GUZ A;  1RM1 C;  1R6T A;  3CHX A;  3W7U A;  3JD1 A;  3ASN B;  4B3T B;  1H8E G;  5CA1 B;  4JI5 O;  3DTU B;  4NR1 A;  1OCR C;  4B08 A;  2AZ2 A;  1U97 A;  3CE2 A;  2ZNI A;  1WPX A;  1GK9 A;  3CCR V;  2ADP A;  3D8C A;  4JTD B;  5EIB D;  1AI6 A;  4H44 B;  4LR3 A;  1R73 A;  3P30 A;  1L1F A;  4BIO A;  2XTA A;  3T1H B;  3OW2 U;  1R3K C;  4B7K A;  3JAL B;  4U7N A;  2YIA A;  1VQP V;  3GWK C;  3HKE B;  4UCT A;  1KKC A;  3F7Y C;  1H2N A;  1XHZ A;  1PNL A;  4DR3 O;  4JAU A;  4B3S O;  2ZIM A;  2Q4P A;  2WLJ A;  3ABM C;  3DC5 A;  1IBL O;  5KX5 A;  1XQ8 A;  1VF6 C;  3QF7 A;  1KEC A;  2FL4 A;  4UFZ A;  1AJQ A;  3VBB A;  1Q86 W;  3B40 A;  2WLM A;  4DW0 A;  1NH2 B;  1FXK A;  3ASO B;  4ZIB A;  1AVM A;  1IXM A;  1S76 D;  4BAY A;  2RMK B;  5EK0 A;  4G2K A;  2B1G A;  4FVM A;  1SQX H;  3D36 C;  1O9G A;  4ZI7 B;  4WBN B;  4NTY A;  1JJ2 U;  2LP7 A;  4J42 A;  2UUB O;  1IDS A;  3TCU A;  2NN4 A;  3AG4 C;  4X65 B;  2QWR B;  4DV6 B;  4W4L A;  4JZG A;  4LFB B;  3AG3 C;  4DR2 B;  4JAV A;  3WB1 A;  1NZ6 A;  4Q6G A;  4DV7 B;  4NB5 A;  1OCR B;  2IJI A;  2Y69 C;  1QNM A;  3G4S V;  3RVY A;  1M1K W;  4YJ3 A;  2QE7 G;  5CB4 A;  3CC7 V;  2DMX A;  3GWO A;  3RBZ A;  1Q90 D;  2JS5 A;  1TAE A;  1DF5 A;  2K1E A;  5LMN B;  2WA3 A;  3DC6 A;  4JTC B;  2HHH B;  4YJ2 B;  5KA6 A;  2UUC B;  4LCU C;  1P49 A;  2A3Q A;  1BHA A;  2ETN A;  4NYK A;  5JWP A;  2RQ6 A;  2H3O A;  3K9A A;  4CS4 A;  4RQF A;  2LW7 A;  3TXQ A;  3I55 V;  3E83 A;  3ABM B;  5C8Y A;  3MHH C;  4JI5 B;  3ZHT A;  3K5L A;  5DEC A;  4XDK A;  1SA0 A;  1JFF B;  3F5W C;  2CGO A;  2XOK G;  2L35 A;  4CH5 A;  4LNU B;  3U10 A;  5L3G A;  4UB8 Z;  3R66 A;  4FLV A;  3FX7 A;  1I94 B;  2DJV A;  4QJF B;  3BHP A;  5JCO C;  2CGN A;  1EBO A;  4WFH A;  1NH2 D;  1N36 O;  1KU9 A;  1PM9 A;  3ABL C;  2KKW A;  5GON B;  1R3L C;  4DW1 A;  1ZTE A;  4PHZ A;  2HEP A;  1FFT B;  3AG4 B;  3WB2 A;  1GM9 A;  3RYH A;  1ZSP A;  2CTQ A;  1K92 A;  1H2S B;  4UCR A;  3AG3 B;  1IBL B;  1NJI W;  1XNQ B;  3SPH A;  1WJZ A;  3RN4 A;  3E8F A;  4Q20 A;  2CE4 A;  2ZCE A;  5J2U B;  5BXZ A;  2UUA B;  2JDI G;  3APO A;  3CCE V;  4AI8 A;  1AIL A;  2LGQ A;  1PNM A;  2ODM A;  2HR3 A;  1LNQ A;  5B3S B;  4FLY A;  3W7W A;  2XAQ A;  4MTX A;  1VQ4 V;  3AK3 A;  3QTC A;  4X1I B;  1Q8I A;  1TVK A;  4JI7 O;  4X9Q A;  3B8M A;  2BTQ A;  2FB5 A;  2MW2 B;  2EZP A;  4MVQ A;  1M57 C;  4HNA B;  1XNR O;  5E79 Z;  2IBZ H;  1XOU A;  2QWP B;  4GKK O;  3WG7 C;  3JD4 A;  1OCO B;  5F2V O;  3TXS A;  4O4H A;  1QLE C;  3CRA A;  1K5Q A;  2RCV A;  2PI5 A;  4LH6 A;  3FAV B;  3H1I H;  5A2Q N;  3E22 B;  3K3W A;  2P6J A;  4DV2 O;  2DN9 A;  3FD9 A;  1VMG A;  4F6E A;  1E79 G;  3BRC A;  4X62 B;  4BWA A;  2F43 G;  4DR6 O;  4OGQ B;  5KMG B;  5B5E Z;  1XI1 A;  2XAG A;  3A8T A;  2WLL B;  3HB3 B;  4J80 A;  2B5U A;  3STL C;  4HAM A;  4AQY O;  1EN4 A;  3RYC B;  2HJD A;  5IJ0 B;  1OZ0 A;  4GT1 A;  1F4N A;  1YJ9 V;  2IH3 C;  1H2M A;  4R8C A;  2UXB B;  4I55 A;  3E35 A;  2BE3 A;  2UXD O;  4I4T B;  4HYO A;  3CC4 V;  4O2A B;  5EC1 C;  1XBL A;  1X59 A;  4MTO A;  5EZY A;  3T2M A;  3JD2 A;  1N36 B;  1P84 F;  2PF4 E;  1ORQ C;  2X7R B;  3W7S A;  2P5O A;  2QGN A;  1GM7 A;  2XHB A;  1Q7Y W;  1QR8 A;  4J9Z B;  2X6C A;  2X6B A;  2IH1 C;  2OT5 A;  4PJ0 Z;  2OYQ A;  3KCY A;  4IYH A;  3RYI B;  4R50 A;  3OAA G;  5JH7 B;  4TQD A;  4J7K A;  4DV0 O;  1GTO A;  5FLX N;  1CEZ A;  1Q81 W;  2E3C A;  2F1M A;  1QHT A;  3L73 H;  2QKC A;  1M4U A;  1MSW D;  3AK1 A;  2BSK B;  5D5P A;  2HG5 C;  1Q6I A;  4DRX B;  4DK0 A;  5JJJ B;  1SET A;  1I5Y A;  1ZWI C;  2BOC C;  4TUY A;  1JJO A;  2LFS A;  2AHZ A;  1Q6U A;  2HP8 A;  3B2E E;  4J41 A;  4MVM A;  2AGA A;  4JI7 B;  3K58 A;  1Y76 A;  1GN3 A;  1Y67 A;  2WPD G;  4YHH B;  2ZE8 A;  1QVG U;  1BQ0 A;  5LGT A;  4B3R B;  3ZRW A;  2M7W A;  1XRE A;  3VQX A;  2RN9 A;  2ZDI C;  3AG1 C;  5JQG A;  3B77 A;  2P06 A;  2FML A;  4GKJ O;  2Q7E A;  5HFL A;  3Q4H B;  1RFY A;  1AB3 A;  3JAR B;  3O65 A;  4GX1 A;  1AR1 B;  4CC5 A;  3VOU A;  3ZED A;  4MVO A;  1BMF G;  2VWJ A;  2GHY A;  4NTW A;  4DR6 B;  1HNZ O;  1BHB A;  3R65 A;  3OGI B;  2JGD B;  1YXB A;  1S3J A;  1MSD A;  1I08 A;  4JYY A;  2ZIO A;  1R1B A;  2XT9 A;  1WA8 A;  3OMN B;  5EBW C;  1IUR A;  1G1X B;  3S3X A;  5IY5 C;  2KG7 A;  2UXD B;  1PV0 A;  1VQ5 V;  1J95 A;  2A0L A;  2Q7H A;  2OIG A;  2QSA A;  5LOV A;  1K33 A;  5GTI Z;  4D7T A;  4K35 A;  2Z3Y A;  1VQL V;  3OR6 C;  5LP6 A;  1K4D C;  2UXN A;  3ZHR A;  3BCC H;  3RYF B;  4DV3 O;  1Y74 B;  4AIL C;  3C90 A;  5ITZ B;  4CS2 A;  5LHG A;  4X1Y B;  3BAB A;  1GH6 A;  1SZT A;  1SQP H;  3TK1 A;  2EIK C;  1VQO V;  1FFX B;  3OMA B;  2VWK A;  4PA7 A;  3QVN A;  1CP9 A;  1JCH A;  1N33 O;  3CCQ V;  2ZE6 A;  1XUQ A;  4DV0 B;  1LR1 A;  4JYB A;  2LJ2 A;  4BR6 A;  3SYQ A;  4QPK A;  2BCC H;  2AXT Z;  3N2G B;  3THO A;  5CA0 B;  1F23 A;  5KLV H;  3O9O A;  1ZL8 B;  1SF9 A;  1SER A;  3CRR A;  4J9Y B;  1NR7 A;  3UT5 A;  1YHQ V;  1SS3 A;  4IHJ A;  4FFK A;  1UJW B;  4IT5 A;  2HFE C;  3K0D A;  5H6R A;  4DV5 B;  3EVK A;  2BTO A;  2A79 B;  3T4Z A;  3ABK C;  2Y4T A;  4JI4 O;  5BY1 A;  4LFA B;  3H1K H;  2ITD C;  3SYP A;  1IBK O;  4B3M O;  1E1R G;  3ZHQ A;  5IJ9 B;  3STZ C;  2C2A A;  2ZDI A;  4F4L A;  5IY5 B;  2XUM A;  3ZMZ A;  4FLW A;  4PA3 A;  2L6L A;  4MW3 A;  4FFB B;  3CME V;  4X66 O;  4PA4 A;  4K3A A;  2F66 C;  4MW8 A;  3HKD A;  3D3Q A;  4KXR A;  4GCZ A;  3EHB B;  1HNZ B;  1GAX A;  3CSX A;  3ETD A;  5JJE B;  3SJB C;  2EIK B;  3ZRS A;  2EX3 A;  2QWQ B;  1KQS U;  2PYJ A;  1AP5 A;  2RDC A;  2EIN C;  4X1K A;  2DYR C;  4GUN A;  1WB7 A;  1VQK V;  3RT3 C;  3WU2 Z;  5LXT B;  1MG1 A;  1YEW A;  4DXW A;  3SJC C;  2YI8 A;  3DGE A;  3JYC A;  4O4I A;  4WFB V;  3BVO A;  2P67 A;  4DV3 B;  1DGS A;  4O2B A;  3OE7 G;  2VS0 A;  4EB6 A;  5TIS Z;  3HKC B;  3JAW A;  1NTZ H;  3APQ A;  3L74 H;  1MMM A;  4I9Q A;  4P9P A;  4ZOL B;  3ZHU A;  3MD0 A;  4YY3 B;  2MK3 A;  3ABK B;  3GB7 C;  3SPI A;  1MOF A;  4JTA B;  1N33 B;  1Z5V A;  4O4J B;  1TA8 A;  5CA1 A;  1WP7 A;  4GX5 A;  1RSO B;  5GW7 A;  2KQX A;  2PTM A;  4KFM A;  5LMU O;  2JGU A;  1TUE B;  3EXA A;  1PPJ H;  1QU7 A;  4UVA A;  1UPG A;  1H2K A;  4MVS A;  4ASU G;  4H13 B;  3QO8 A;  5BMV B;  2YIB D;  3I56 V;  2HLD G;  2OIE A;  3IFX A;  1QQC A;  1QLN A;  3T1C A;  3JAL A;  3CXH F;  3ZHS A;  5KHG A;  1IZ3 A;  4TSF G;  4ICG A;  4N23 A;  1FD9 A;  3HKE A;  1P7B A;  5LGN A;  1JQ0 A;  4JI4 B;  4R6Z A;  1N32 B;  1K73 W;  4FM0 A;  4DR5 B;  4TV8 B;  2EIN B;  4I9W A;  1H2L A;  4LP8 A;  1IBK B;  4B3M B;  3AG7 A;  4G27 B;  3F7V C;  3MHS C;  2DYR B;  1EFR G;  3VQV A;  1YZB A;  2AHY A;  2DQ3 A;  3HR0 A;  4X66 B;  4CBC A;  3ZMU A;  1NKD A;  1KC8 W;  4MSW C;  1WLE A;  4GX0 A;  1SQV H;  1DF4 A;  1FXH A;  2EIL B;  2JVD A;  4ZI7 A;  4WBN A;  2V4D A;  4LFC O;  4I7Z B;  4JPR A;  5B3S C;  1VAR A;  3JSN A;  3CX5 F;  1YF2 A;  3F5T A;  3ZMT A;  1XL6 A;  3B8N A;  4DUY O;  2P4K A;  3J7A U;  2HJF C;  2NNU A;  1XMO O;  1WPB A;  1G4Y B;  1OCO C;  1TUB B;  4LF6 O;  2R9R B;  4QE9 A;  3MDS A;  2WLH A;  2P4V A;  1GMG A;  1YDX A;  2Y0P A;  1OHH G;  4TWK A;  1QVF U;  4HBN A;  3EFF K;  5CN0 A;  4RAI A;  1NU1 H;  4PDV A;  5D5Q A;  5K1X A;  2EJ7 A;  4YJ2 A;  2E74 B;  2K9P A;  2QWO B;  3HKB B;  3CMA V;  5L3D A;  4LF7 O;  3ETQ A;  1NTM H;  1NBM G;  1AR5 A;  3CC2 V;  5B1O A;  3KG2 A;  4DR3 B;  5J9P C;  3KCX A;  5KAF Z;  1Q82 W;  4B3S B;  4LF5 O;  2CH7 B;  1NI8 A;  1QBZ A;  3CPW U;  3BAA A;  1JFF A;  3K5O A;  4Z1M G;  3ZRX A;  2ZM6 O;  1VF6 A;  5LMU B;  2Q69 A;  2VQE O;  1ZAU A;  4LNU A;  4MVU A;  5J2T B;  5LYJ B;  3JSL A;  4ZHQ B;  1YIT V;  1GM8 A;  2Z0A A;  4PI0 A;  3ZN1 A;  4JI0 O;  5B1B B;  1KD1 W;  4I0X B;  2VQF O;  5GON A;  4CC6 A;  3D36 A;  5EYP B;  3OMI B;  2Q5Z A;  2UUB B;  4KHP O;  3FKS G;  2Q68 A;  3CRQ A;  4UVB A;  3L75 H;  4XBF A;  4JYA O;  4CH4 A;  1MNG A;  4QNH B;  1XL4 A;  1I7F A;  4GZR B;  2V7Q G;  3SR2 C;  4RUF A;  4OX9 O;  1AR4 A;  3M8A A;  1PNK A;  2WLI B;  2X6A A;  4E2L A;  2QDO A;  3H9V A;  2QJ1 A;  5J2U A;  1OCZ C;  1YIJ V;  2DW4 A;  3UM7 A;  4NKG B;  3C3S A;  1OV9 A;  1VIB A;  2PY5 A;  4WCE V;  4I0X A;  2LFR A;  5LA6 B;  1Z2G A;  4DYL A;  1JOY A;  2QM8 A;  4LWS B;  3UQ8 A;  1YTF B;  3JAS B;  3J81 N;  2F93 B;  2XND G;  5JVD B;  5L3F A;  4X1I A;  2XAH A;  2OCC C;  3RW0 A;  3K04 A;  5FPO A;  4DUY B;  2YI9 A;  3LSU A;  1J5E O;  3BEH A;  2DWE C;  3I5D A;  1SC5 B;  4HNA A;  1XMO B;  5IYC O;  4WFF A;  1XMQ O;  1V54 C;  4X64 O;  3E8B A;  4DV4 O;  2YID A;  1FPO A;  3FAV A;  3IGA C;  3E22 A;  1F4M A;  5JCO A;  3N2K B;  1M56 C;  2GV9 A;  4UCS A;  4FPP A;  1K7D A;  4FM2 A;  5KMG A;  3LNN A;  2E75 B;  2HVK C;  3H1L H;  4NXN O;  2WLL A;  4DR1 O;  1VEW A;  3E8G A;  2UXC O;  5FNV B;  4LF5 B;  1SQG A;  1NTK H;  2D2C B;  4GLX A;  1M9N A;  3RYC A;  1WAZ A;  2ZM6 B;  5IJ0 A;  3DXR B;  5IWA O;  5IYZ B;  5BR8 O;  1YJW V;  2M6Y A;  4U3J B;  5GTH Z;  3NXS A;  1N34 O;  4I4T A;  3JCU Z;  1VQ6 V;  4MVR A;  3P3P A;  2YEV B;  4O2A A;  1OCZ B;  2QKA A;  3H01 A;  2QTO A;  3K59 A;  1GN6 A;  2ZE5 A;  3BPZ A;  3LSQ A;  3OUS A;  2VQF B;  3BA8 A;  3OUF A;  1FYJ A;  4JGS A;  1G8M A;  2ZR2 A;  4JZ2 A;  1ZLZ A;  4KHP B;  3SYC A;  3IAY A;  4JYA B;  1B04 A;  1YTF D;  1XEQ A;  2QTS A;  1Q43 A;  2O57 A;  5DN6 G;  5IYD O;  2OCC B;  1K3E A;  4PV1 B;  1FS0 G;  4I50 B;  4OX9 B;  4FJC C;  3OD4 A;  3RYI A;  1XNR B;  5JH7 A;  3UO3 A;  3SPC A;  4EKW A;  4GKK B;  1AJP A;  1D5A A;  1KP3 A;  1V54 B;  3JAT B;  4ZKI A;  4FLZ A;  5KHJ A;  4O4L B;  4TV9 B;  4H37 A;  3DSQ A;  3VQW A;  1HR0 O;  4K8X A;  4TOI A;  4LF4 O;  1JPX A;  3CS5 A;  4FLU A;  2XAS A;  2GTA A;  4DV2 B;  2BSK A;  4DRX A;  1DTO A;  1M56 B;  1WP8 A;  4EFE A;  2LO1 A;  2QA4 V;  1VP7 A;  4J10 A;  4JI6 O;  5CBF A;  3FFQ A;  2FYU H;  2KB1 A;  4DR4 O;  1K34 A;  3E86 A;  1S77 D;  1W0K G;  4H0L B;  2OWO A;  1SQQ H;  2Y0I A;  4Z1V A;  2DQ0 A;  4J7Z A;  5E1A C;  3ZRV A;  2NLJ C;  4AQY B;  3A2F A;  1J5E B;  3K9S A;  1PL0 A;  1SQB H;  1SZX A;  2ITC C;  2DYS C;  3RWR D;  1XMQ B;  4X64 B;  4DV4 B;  4JF3 A;  4ZBM A;  3G6E V;  5LBQ A;  3W7X A;  2W6J G;  2AW9 A;  4UV8 A;  4IIJ B;  1E1Q G;  3ZHV A;  1K8A W;  2ATK C;  2W0F C;  3Q4H A;  3JAR A;  1XDC A;  1M93 A;  5DED A;  4MS2 A;  1NR1 A;  4NXN B;  4X20 B;  3LSS A;  4FIP C;  3LDE A;  2JGD A;  1P4R A;  1YCI A;  3UKM A;  2CK3 G;  4F6R B;  2QEX V;  3E2E A;  3FB8 C;  4LF8 O;  3L72 H;  5IWA B;  1AI7 A;  2IU0 A;  2GSM B;  5BR8 B;  1AP6 A;  2IU3 A;  2F95 B;  3ML0 A;  1MAB G;  1N34 B;  5IE9 A;  1H8H G;  1UFI A;  5KHK A;  3CRC A;  2PUS A;  4K0K O;  4PD4 F;  4JI1 O;  3G67 A;  1URF A;  1M90 W;  3QO7 A;  4DK1 A;  1B6Q A;  3RYF A;  5B66 Z;  4KL1 A;  4N21 A;  2CDY A;  3SPG A;  5C93 A;  1Y74 A;  2Q9L A;  1BCC H;  4FLT A;  2PYL A;  2QKS A;  5ITZ A;  1K4C C;  3CB2 A;  3FB7 C;  3VQY A;  3KKY A;  1OJH A;  4D6T H;  4NXM O;  4X1Y A;  1T5E A;  3CCS V;  1S72 V;  2XAJ A;  2WSS G;  1AJN A;  4OPH A;  1FFX A;  3PN1 A;  1XIL A;  2W0X A;  2DYS B;  2YXL A;  5EBL C;  1JA8 A;  1RPR A;  1HR0 B;  1GN4 A;  1BT8 A;  1U96 A;  5B1N A;  3IC7 A;  3CJH B;  4R7C A;  2EBO A;  3N2G A;  4MTG A;  5CA0 A;  2LQT A;  3SJQ C;  4P9O A;  4GKJ B;  4DV6 O;  1ZL8 A;  2GUZ B;  3N27 A;  1D2D A;  4YIP A;  1N0J A;  3OM3 B;  2UU9 O;  3SYO A;  2EUL A;  3AG2 B;  3CYO A;  2ZXW C;  4DR4 B;  4WFA V;  2R72 A;  1HDJ A;  3KZI Z;  4IL6 Z;  4FK5 C;  3LDC A;  1FJG O;  1GKF A;  2Q0A A;  1VF7 A;  3A0R A;  1US6 A;  1S0V A;  5IJ9 A;  3OT7 A;  2IW5 A;  1WNS A;  4B7E A;  2UUC O;  1OCC C;  2YXY A;  2YIB A;  4FFB A;  4JI8 O;  3G71 V;  2VRZ A;  1HWY A;  3WFV A;  3HPL C;  3SJA C;  1N4C A;  3CXC U;  3TET A;  1Q3E A;  3U11 A;  3JD3 A;  1ZX3 A;  2EIL C;  2ADQ B;  2Y48 A;  5KHH A;  4PA9 A;  1W0J G;  5KX5 B;  4GYC B;  1TGO A;  4A5U B;  1PP9 H;  1YVW A;  3MAQ A;  3CRM A;  5A9G A;  1BZK A;  3T1Y O;  2LW1 A;  5L3E A;  2UXX A;  3SPJ A;  1G6U A;  3K57 A;  3C3T A;  1FXK B;  3K79 A;  1I94 O;  4LF8 B;  2YS8 A;  1W59 A;  1NVP B;  1EN5 A;  1EM1 A;  3WB0 A;  1BSM A;  1CXZ B;  2CTP A;  1EN6 A;  3SGI A;  5DM6 V;  3OTO O;  3CCJ V;  5KHI A;  3CCM V;  2HKO A;  3SDL A;  2JS3 A;  1KB9 F;  5LXT A;  4K0K B;  1YJN V;  4JI1 B;  2ZIN A;  1SES A;  3H1H H;  3ETE A;  5L3C A;  4TQF A;  2DOS A;  1M5I A;  3HKC A;  1HW7 A;  5L3B A;  2Z5U A;  3AK2 A;  2OTJ V;  4NXM B;  2ZXW B;  5CBH A;  2FTK A;  2IJJ A;  1XNQ O;  4JAA A;  2ZT9 B;  4ZOL A;  5FPR A;  2GTS A;  5FL7 G;  2YIC A;  3FYE B;  3PJS K;  3K03 A;  4YJ3 B;  5CB4 B;  2UUA O;  1BL8 A;  3BY6 A;  2P90 A;  4Z2W A;  3TGU H;  3TJT A;  2CUG A;  4O4J A;  2Y4U A;  1QCE A;  1RSO A;  4PDM A;  1S5L Z;  2XAF A;  3A0H Z;  4PDL A;  2OCH A;  2WLN A;  1OCC B;  1GN2 A;  3CEI A;  4UCV A;  2OTL V;  5BMV A;  1RM1 B;  3QNE A;  4K8Z A;  3CP1 A;  5B1B C;  2UU9 B;  2Q7G A;  4QIW F;  5C8Y B;  3K5M A;  3ABT A;  4P30 A;  4DR7 O;  1SA0 B;  2D3O W;  4ABM A;  2JIZ G;  1FJG B;  4CH3 A;  3NR7 A;  2R70 A;  4TV8 A;  3G80 A;  1NVP D;  1F7Y A;  5H9C A;  2ZKO A;  1N8R W;  3W7T A;  3B4S A;  4X62 O;  1VQ7 V;  3L71 H;  5KA5 A;  4JI8 B;  5CBG A;  2YSU B;  1B3Q A;  4JI3 O;  3RYH B;  1D5N A;  1FXV A;  2GBO A;  1KP2 A;  4G28 B;  4C7U A;  3JAM N;  2UXB O;  3BFR A;  5LGU A;  1MZF A;  3RGB A;  3T1Y B;  4NVP A;  3ZX6 A;  3U0Z A;  2ILM A;  1FAF A;  3IC9 A;  3OGC C;  1IXB A;  3FB5 C;  3A0B Z;  2H8P C;  4W4K A;  4UVC A;  4DV1 O;  3OTO B;  1PD3 A;  2YC0 A;  3FB6 C;  3ZMV A;  3L9D A;  1R3I C;  5H5N A;  1KYO F;  1DK1 A;  1TUB A;  1BE3 H;  1JX9 A;  2ZR3 A;  3OEE G;  2Q8V A;  1A32 A;  1VQN V;  1TVK B;  1MA1 A;  4RWU A;  4X89 A;  3IJ4 A;  2JK5 C;  4YIO A;  4WFE A;  1S5J A;  3ZS8 C;  2BTQ B;  1IBM O;  1VF5 B;  2X0L A;  1AI5 A;  1KMI Z;  2G38 A;  3HKB A;  2Y69 B;  1ROP A;  3E89 A;  1Z5W A;  4O4H B;  2YUA A;  4TT3 G;  4GX2 A;  4RUE A;  1VQM V;  2F4V O;  3M99 B;  2N04 A;  4XDJ A;  3ZBH A;  4UCO A;  2Q67 A;  4UB6 Z;  4BIZ A;  3K0G A;  1K9M W;  4LF9 O;  2CH7 A;  4PA6 A;  1MZE A;  4J7J A;  3RFR A;  1GO3 F;  3JAK B;  5KAI Z;  5EC2 C;  4QE7 A;  4LBE C;  3ABU A;  1K97 A;  5J2T A;  5LYJ A;  4ZHQ A;  2EZO A;  2A06 H;  3X2Q C;  4EFB A;  2JJ2 G;  2PZS A;  3UCS C;  2F23 A;  2WAM A;  2N05 A;  4IYI A;  4YHH O;  1SKV A;  2DWD C;  4B3R O;  5EYP A;  4DR7 B;  1BS3 A;  4LFC B;  1V55 C;  2IM9 A;  2QWN B;  4JV5 O;  2HVJ C;  4I55 B;  2GDS A;  1EZV H;  2H94 A;  3CCL V;  2P7T C;  5EZY B;  1RP3 B;  2JJ1 G;  2E76 B;  5JJN B;  3ABL B;  2W6I G;  1ENV A;  2Q73 A;  3SYA A;  2ARH A;  4J11 A;  4L8J A;  3JAK A;  2WLI A;  5AG2 A;  3FYI B;  3CCV V;  4MT8 A;  4LF6 B;  1LUW A;  2V1D A;  3OEH G;  1H38 A;  5IDJ A;  4JI3 B;  4LC1 A;  4KUM A;  4OXS A;  1Q6H A;  3JD0 A;  3ZCC A;  2YDE A;  4UXN A;  5LA6 A;  4YXW G;  1XHX A;  3ZJZ A;  3OFN G;  1R3J C;  4P2Z A;  4XDL A;  2IJK A;  2EIJ C;  1YSC A;  4LWS A;  4X8A A;  2QM4 A;  4LF7 B;  3JAS A;  2E5L O;  3M7M X;  5CA3 A;  4U7O A;  5JVD A;  2LGW A;  3CD6 V;  2ZQM A;  1IX9 A;  4MTF A;  3J80 N;  5LP6 C;  3ZIA G;  4RQE A;  4DV1 B;  1SQF A;  1B06 A;  1HNX O;  4LH7 A;  2VQE B;  4PDR A;  1NT2 B;  4DUZ O;  5B1A C;  4TUY B;  3GVM A;  3X2Q B;  4UCU A;  5KUM A;  5HFM A;  4JI0 B;  3CWB H;  3N2K A;  4CS3 A;  4WFG A;  1Y76 B;  1COW G;  1IBM B;  4PI2 A;  1N0N A;  1M57 B;  1THZ A;  4X88 A;  3ZRW B;  4WF9 V;  3WG7 B;  1V55 B;  2CAZ C;  4NTX A;  4QPJ A;  1QLE B;  2A7W A;  1ARO P;  5JQG B;  3G6B A;  4UV9 A;  2F4V B;  4JI2 O;  4UUJ C;  4D7S A;  5FNV A;  1F51 A;  1R6N A;  4LF9 B;  3D3I A;  2WWW A;  2ZNJ A;  5EBM C;  3DXR A;  1R6K A;  4U3F H;  1YI2 V;  5IYZ A;  1IVS A;  1LUV A;  4FZ1 A;  4U3J A;  4DO2 A;  4BW9 A;  1JVM A;  4DV5 O;  2YEV A;  3L70 H;  1JR9 A;  1X4T A;  4IGG A;  1EZJ A;  1BQZ A;  4RO2 A;  4LFA O;  1I5X A;  5BZB A;  5LL6 Y;  3ICX A;  1I0H A;  2B9Z A;  1WA8 B;  4JAS A;  2AZ0 A;  1VQ9 V;  2EIJ B;  4JV5 B;  1BGY H;  1WB8 A;  2KG7 B;  1L0N H;  5EIB C; 
#chains in the Genus database with same CATH homology
 2ZXW C;  1DF4 A;  1FXH A;  2EIL B;  4WFA V;  3K3W A;  2P6J A;  4BIU A;  4FK5 C;  3LDC A;  1AI4 A;  4JPR A;  1GKF A;  5B3S C;  1E79 G;  2F43 G;  3A0R A;  4KP4 A;  2Q6A A;  5LHH A;  2XAG A;  2WLL B;  5B1A B;  3HB3 B;  3ZMT A;  1S0V A;  1XL6 A;  3B8N A;  2B5U A;  3STL C;  4MVZ A;  4HAM A;  2IW5 A;  2HJF C;  2NNU A;  3OR7 C;  4I5S A;  1OCC C;  2A9H A;  1G4Y B;  1OCO C;  3G71 V;  2R9R B;  1OZ0 A;  2WLK A;  4GT1 A;  4QE9 A;  1F4N A;  1HWY A;  2WLH A;  1YJ9 V;  2IH3 C;  1S5H C;  4R8C A;  3AG2 C;  1GMG A;  3WFV A;  3HPL C;  3E35 A;  3CXC U;  3TET A;  4HYO A;  1OHH G;  3JD3 A;  4TWK A;  2JEU A;  2EIL C;  2QM7 A;  4H33 A;  1QVF U;  3CC4 V;  5EC1 C;  2Y48 A;  4PA9 A;  3EFF K;  5CN0 A;  1W0J G;  4MTO A;  3T2M A;  4RAI A;  3JD2 A;  4PDV A;  4PEL A;  1W2B U;  1QR9 A;  1ORQ C;  2X7R B;  3W7S A;  3CMA V;  5L3D A;  5L3E A;  2UXX A;  1H2G A;  2R9I A;  3SPJ A;  1FXK B;  3K79 A;  3QO5 A;  1NBM G;  5KUK A;  1GM7 A;  3CC2 V;  5B1O A;  1NVP B;  3KG2 A;  2JEX A;  2IJH A;  1Q7Y W;  5J9P C;  1Q82 W;  1QR8 A;  1Y4M A;  4J9Z B;  2X6C A;  2X6B A;  4L87 A;  2B1I A;  2IH1 C;  5DM6 V;  3CCJ V;  3CCM V;  2EIM C;  3LNM B;  2OT5 A;  2HKO A;  3T4D A;  1Y66 A;  3LUT B;  4FMT A;  1QBZ A;  3CPW U;  1K5S A;  4Z1M G;  3ZRX A;  3E8H A;  4CZZ A;  1YJN V;  1SES A;  2Q69 A;  5H6Q A;  4R50 A;  3OAA G;  1KKD A;  3ETE A;  3ASN C;  4MVU A;  1GTO A;  5L3C A;  1CEZ A;  1DLB A;  1YIT V;  1GM8 A;  3JCZ A;  3ZN1 A;  1Q81 W;  1NQT A;  5L3B A;  3AG1 B;  2Z5U A;  5B1B B;  2OTJ V;  1KD1 W;  2BOB C;  2ZXW B;  5CBH A;  3ETG A;  2FTK A;  2IJJ A;  1MSW D;  3D36 A;  2HG5 C;  3OMI B;  2ZD9 A;  2EJR A;  5FL7 G;  3FYE B;  5IYB O;  1FXK C;  3FKS G;  2Q68 A;  4JYC A;  3PJS K;  1SET A;  1VQ8 V;  3K03 A;  4UVB A;  1I5Y A;  3RVZ A;  4XBF A;  2PI4 A;  1BL8 A;  3BY6 A;  1ZWI C;  2P90 A;  2BOC C;  2LFS A;  2AHZ A;  4HZ3 A;  4QNH B;  1PKX A;  1XL4 A;  2V7Q G;  1QCE A;  1CPY A;  4RUF A;  4PDM A;  4MVM A;  2XAF A;  2WPD G;  4PDL A;  1QVG U;  4BW5 A;  1PNK A;  2WLI B;  2WLN A;  5LGT A;  3CCU V;  1OCC B;  2OTL V;  3ZRW A;  2X6A A;  2M7W A;  4E2L A;  3ZN0 A;  1RM1 B;  3QNE A;  1OCZ C;  3ZMS A;  2ZDI C;  3LDD A;  2DW4 A;  3AG1 C;  3CP1 A;  3UM7 A;  1YIJ V;  5B1B C;  3B77 A;  3P32 A;  5CMU A;  4QIW F;  4WCE V;  2LFR A;  3ABT A;  3K08 A;  4P30 A;  2D3O W;  1JOY A;  2JIZ G;  2QM8 A;  5HFL A;  5LHI A;  3ASO C;  4GX1 A;  1AR1 B;  1RPO A;  1YTF B;  3VOU A;  2XND G;  1BMF G;  4MVO A;  2GHY A;  3AEI A;  5L3F A;  3K06 A;  2XAH A;  2OCC C;  1SRY A;  3RW0 A;  3K04 A;  1BHB A;  3R65 A;  1NVP D;  2EIM B;  2DWE C;  1S3J A;  3BEH A;  5H9C A;  1N8R W;  3W7T A;  1VQ7 V;  5IYC O;  4WFF A;  5KA5 A;  1RM1 C;  5CBG A;  2YSU B;  3OMN B;  3W7U A;  1V54 C;  3JD1 A;  3E8B A;  3ASN B;  5EBW C;  5IY5 C;  1H8E G;  3IGA C;  1VQ5 V;  1J95 A;  1F4M A;  2A0L A;  1FXV A;  3DTU B;  1OCR C;  1KP2 A;  1K33 A;  4G28 B;  2Z3Y A;  1VQL V;  1M56 C;  3OR6 C;  1WPX A;  1GK9 A;  3CCR V;  1K4D C;  2UXN A;  4FPP A;  4JTD B;  1AI6 A;  5LGU A;  1K7D A;  1R73 A;  3P30 A;  1L1F A;  2HVK C;  5LHG A;  3OGC C;  2WLL A;  3FB5 C;  3E8G A;  3OW2 U;  1R3K C;  1SZT A;  2H8P C;  4U7N A;  4UVC A;  1PD3 A;  3TK1 A;  3FB6 C;  3ZMV A;  1VQP V;  1M9N A;  2EIK C;  1VQO V;  1R3I C;  3OMA B;  1JX9 A;  2ZR3 A;  3F7Y C;  4PA7 A;  3OEE G;  1CP9 A;  1JCH A;  1PNL A;  1YJW V;  4JAU A;  3CCQ V;  1VQN V;  3NXS A;  4JYB A;  1VQ6 V;  4MVR A;  4X89 A;  2YEV B;  3SYQ A;  2WLJ A;  1OCZ B;  3ABM C;  2JK5 C;  4QPK A;  4WFE A;  3H01 A;  2QTO A;  1KEC A;  3LSQ A;  3OUS A;  2X0L A;  1AI5 A;  1AJQ A;  3VBB A;  1Q86 W;  1F23 A;  3OUF A;  2Y69 B;  1ROP A;  4JGS A;  1G8M A;  2WLM A;  3E89 A;  1SER A;  2ZR2 A;  4J9Y B;  1NR7 A;  1NH2 B;  1FXK A;  3ASO B;  3SYC A;  4TT3 G;  4GX2 A;  4RUE A;  1VQM V;  1IXM A;  1YHQ V;  1S76 D;  4BAY A;  5EK0 A;  1UJW B;  2HFE C;  3M99 B;  3K0D A;  4G2K A;  5H6R A;  1YTF D;  2B1G A;  4XDJ A;  2Q67 A;  4BIZ A;  5DN6 G;  3K0G A;  2OCC B;  5IYD O;  1K9M W;  4PA6 A;  1K3E A;  1JJ2 U;  2A79 B;  2LP7 A;  3ABK C;  3T4Z A;  1FS0 G;  3TCU A;  4FJC C;  1GO3 F;  5EC2 C;  4QE7 A;  3AG4 C;  4LBE C;  2ITD C;  3SPC A;  3SYP A;  4EKW A;  3ABU A;  1AJP A;  1K97 A;  1V54 B;  1KP3 A;  2EZO A;  1E1R G;  3X2Q C;  4ZKI A;  2JJ2 G;  4H37 A;  3STZ C;  2C2A A;  2ZDI A;  4F4L A;  3AG3 C;  5IY5 B;  3ZMZ A;  1JPX A;  4JAV A;  2WAM A;  2XAS A;  2DWD C;  4PA3 A;  1OCR B;  4MW3 A;  2IJI A;  2Y69 C;  3CME V;  1DTO A;  4PA4 A;  1M56 B;  1V55 C;  3G4S V;  3RVY A;  2QA4 V;  2HVJ C;  1M1K W;  5CBF A;  2QE7 G;  3CC7 V;  2KB1 A;  4MW8 A;  3GWO A;  4GCZ A;  3RBZ A;  1K34 A;  3E86 A;  1S77 D;  2H94 A;  3EHB B;  3CCL V;  1W0K G;  1DF5 A;  2K1E A;  2P7T C;  2JJ1 G;  4JTC B;  3ABL B;  2W6I G;  1ENV A;  2DQ0 A;  5E1A C;  3ZRV A;  3SYA A;  5KA6 A;  2NLJ C;  3ETD A;  4LCU C;  2WLI A;  2EIK B;  1BHA A;  3ZRS A;  3FYI B;  3CCV V;  4MT8 A;  1PL0 A;  1KQS U;  2ITC C;  2EIN C;  2DYS C;  2V1D A;  3OEH G;  1H38 A;  5IDJ A;  3K9A A;  4LC1 A;  4KUM A;  4OXS A;  3JD0 A;  4JF3 A;  4ZBM A;  3ZCC A;  3G6E V;  4RQF A;  5LBQ A;  2DYR C;  3I55 V;  3E83 A;  3ABM B;  4UXN A;  2W6J G;  3MHH C;  3W7X A;  1VQK V;  4UV8 A;  4XDK A;  4YXW G;  1E1Q G;  3F5W C;  1K8A W;  1MG1 A;  3ZJZ A;  4DXW A;  2ATK C;  2W0F C;  2XOK G;  3OFN G;  1R3J C;  4P2Z A;  4XDL A;  3DGE A;  2IJK A;  2EIJ C;  1YSC A;  5L3G A;  4X8A A;  3JYC A;  4WFB V;  2P67 A;  3OE7 G;  4U7O A;  5CA3 A;  4QJF B;  4MS2 A;  3CD6 V;  1NR1 A;  1EBO A;  4WFH A;  3LSS A;  4FIP C;  1NH2 D;  3ABL C;  2ZQM A;  4MTF A;  3LDE A;  1R3L C;  1P4R A;  4P9P A;  3ZIA G;  3UKM A;  2CK3 G;  3MD0 A;  4RQE A;  2MK3 A;  3ABK B;  3GB7 C;  2QEX V;  3E2E A;  3FB8 C;  3SPI A;  1AI7 A;  1MOF A;  1FFT B;  4PDR A;  5B1A C;  3AG4 B;  4JTA B;  2IU0 A;  2GSM B;  1GM9 A;  2IU3 A;  3ML0 A;  1MAB G;  1K92 A;  4GX5 A;  1H8H G;  5GW7 A;  3X2Q B;  5KUM A;  5HFM A;  3AG3 B;  4KFM A;  4WFG A;  1COW G;  1NJI W;  1TUE B;  1M90 W;  3QO7 A;  4UVA A;  1B6Q A;  3SPH A;  1M57 B;  1THZ A;  4X88 A;  4N21 A;  4MVS A;  3SPG A;  3ZRW B;  5C93 A;  4ASU G;  4WF9 V;  3E8F A;  3QO8 A;  4Q20 A;  2QKS A;  3WG7 B;  1V55 B;  3I56 V;  2HLD G;  1K4C C;  4QPJ A;  1QLE B;  3IFX A;  1ARO P;  3FB7 C;  2JDI G;  1QLN A;  4UV9 A;  3T1C A;  3CCE V;  3CCS V;  1S72 V;  4UUJ C;  1F51 A;  1PNM A;  1R6N A;  2XAJ A;  4TSF G;  2WSS G;  1AJN A;  4N23 A;  2HR3 A;  3D3I A;  2WWW A;  1LNQ A;  5EBM C;  1P7B A;  1R6K A;  5B3S B;  1YI2 V;  5LGN A;  3W7W A;  2XAQ A;  1JQ0 A;  4R6Z A;  1K73 W;  4MTX A;  4DO2 A;  1VQ4 V;  1JVM A;  2EIN B;  2DYS B;  4I9W A;  2YEV A;  4LP8 A;  4G27 B;  5EBL C;  1RPR A;  3B8M A;  3F7V C;  3MHS C;  1EZJ A;  2DYR B;  3IC7 A;  5B1N A;  4R7C A;  1EFR G;  2EZP A;  2EBO A;  4MVQ A;  1M57 C;  4MTG A;  4RO2 A;  1I5X A;  3SJQ C;  2AHY A;  2DQ3 A;  5BZB A;  4P9O A;  3WG7 C;  3JD4 A;  1OCO B;  4CBC A;  3ZMU A;  1QLE C;  4JAS A;  1VQ9 V;  1NKD A;  1KC8 W;  3OM3 B;  1K5Q A;  2EIJ B;  3SYO A;  3AG2 B;  2PI5 A;  4MSW C;  1WLE A;  4GX0 A;  3CYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...