3SJQC

Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
80
structure length
80
Chain Sequence
TQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQARKLRSVKMEQRKLNDQANTLVDLAKTQLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for calmodulin as a dynamic calcium sensor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
molecule keywords Calmodulin
total genus 35
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3sjqC00
4LBEC 2WLIB 4JTDB 3K03A 3UKMA 2HG5C 4H37A 4H33A 4RO2A 3BEHA 2ITCC 2Y69C 3F7YC 3LDCA 5BZBA 4MS2A 4MW8A 3OGCC 2DWEC 4QE7A 3SPJA 1ZWIC 3FB7C 1OCRC 5EC1C 2WLLB 4PA9A 5B3SC 1K4DC 4G28B 4MTOA 4KFMA 3VOUA 3K04A 4JTCB 4MVSA 1XL6A 2EINC 3OR7C 2HVJC 4PDMA 3E8BA 4MVRA 2WLHA 3UM7A 1KKDA 3R65A 4MVQA 1R3KC 4R6ZA 4RUEA 4PA3A 3FB6C 4J9ZB 2KB1A 4GX1A 2HVKC 2A9HA 4LCUC 4MTGA 4P30A 4WFGA 2X6BA 5EC2C 2EILC 2JK5C 4OXSA 2EIJC 4DXWA 5KUKA 2NLJC 2YEVA 5CBHA 2OCCC 1JVMA 4MVOA 3E8FA 4XDJA 4PA6A 5CBFA 2H8PC 1G4YB 4R8CA 3LNMB 3SPCA 4QNHB 4I9WA 3E89A 5EBLC 3RVZA 4EKWA 3AG3C 1K4CC 4PA7A 1OCZC 1P7BA 2QTOA 4LP8A 2HJFC 4TWKA 3SPGA 4X8AA 3RBZA 5J9PC 4R7CA 3ABMC 3FB5C 3EFFK 3SYAA 3LDEA 4QE9A 3FB8C 2QKSA 4G27B 4MVZA 4F4LA 3PJSK 4GX0A 5EBMC 4XDKA 5CBGA 3SYQA 3T4ZA 2AHYA 4GX2A 3TETA 2IH1C 3AG1C 3LUTB 1QLEC 4PA4A 2EIKC 3SPHA 2A0LA 5KUMA 4JTAB 4HZ3A 2Q68A 2X6AA 3OUFA 1R3LC 2BOBC 2ITDC 4MW3A 3AG2C 4X89A 4MVMA 4BW5A 3LDDA 3E8HA 2HFEC 3TCUA 5EK0A 3GB7C 3SPIA 2WLLA 2DWDC 2Q6AA 1R3IC 4PDRA 2K1EA 4WFHA 3WG7C 1M57C 3OUSA 2Q69A 4J9YB 2WLIA 3E83A 2ATKC 3T2MA 3RVYA 3STZC 1ORQC 5EBWC 4XDLA 2Q67A 1XL4A 1OCOC 5B1AC 2WLJA 3IFXA 4MTFA 2A79B 2EIMC 2WLMA 3E86A 3HPLC 3RW0A 3ABKC 4HYOA 2WLNA 1V54C 4ZBMA 3E8GA 4PDLA 1R3JC 1V55C 5E1AC 3ZJZA 3K0DA 3KG2A 4MSWC 2ZD9A 2X6CA 3ASNC 3ZRSA 3AG4C 4P9OA 4CBCA 1M56C 4PDVA 3OR6C 3F7VC 1OCCC 1LNQA 2W0FC 4R50A 2P7TC 4RAIA 4WFEA 3T4DA 1J95A 4P2ZA 4UUJC 3SJQC 2WLKA 4GX5A 2R9RB 3SYOA 3ABLC 3F5WC 4X88A 5B1BC 3IGAC 3K0GA 3SYCA 3T1CA 3K08A 5IY5C 3K06A 4MVUA 2ZXWC 4WFFA 1BL8A 3JYCA 2BOCC 3X2QC 2DYRC 4P9PA 2IH3C 1S5HC 3ASOC 3STLC 2AHZA 2DYSC 4RUFA 3SYPA
chains in the Genus database with same CATH superfamily
3W7SA 1FJGO 4OX9O 2D2CB 1F4NA 2YXHA 4MS2A 3HKCA 2Q0OC 4FZ0A 4DV3O 4MVSA 4DV2O 3E8BA 2IBZH 1CPYA 2Z0AA 2UXDB 2UXNA 4Z1MG 4U7NA 3S3WA 1AI6A 4K8XA 5KUKA 2QM8A 5CA1B 5JQGB 4LF5B 4I9QA 3RVZA 1IBKO 1YVWA 1VF5B 2Q73A 1DF5A 2VWJA 2Y69B 3ABMC 3QF7A 4RWUA 5B1NA 3FD9A 3LDEA 4QE9A 4K0KB 5LL6Y 4GX2A 4NTYA 2JVDA 1Q82W 2ZQMA 3BFRA 2BOBC 4X89A 2X0LA 1QBZA 1H8HG 1M90W 4DV4O 2Y4UA 3B2EE 5LMNB 3OMIB 3KZIZ 2V1DA 3I5DA 2OTLV 2P22C 3EHBB 2Y4TA 4L87A 1YIJV 5EIBD 1M9NA 3AK3A 4CS2A 3OAAG 4E2LA 4P9OA 3T1YB 2DN9A 4X64O 2GUZA 2XASA 1Q7YW 1IXMA 2DMXA 3SJCC 2AZ2A 3F5WC 3JCZA 1AR5A 3UO3A 4FFBB 3AG1B 2E5LO 1H2SB 2RQ6A 4LF7B 1SQBH 2ZT9B 1Y74B 2IJHA 4B3SB 5IJ0A 2F66C 2BTOA 4TV9A 2OCHA 1GRJA 1H2NA 1URFA 4KHPO 2P4VA 3VOUA 4O4IB 4O4JB 4ICGA 4RUEA 1RFYA 4PA3A 1MZFA 4MTGA 5BXZA 5CA0B 1GAXA 4GLXA 5HFLA 3H1HH 3ABTA 1U96A 5IWAB 4EKWA 2AZ0A 4X8AA 4JI3B 2XHBA 2Q5ZA 1Q5OA 1GN4A 1L0LH 4F4LA 4MVZA 2ZE8A 5CA0A 4LF6O 1I94O 4X66O 3OW2U 4NXMO 2CE4A 4O4IA 3JASB 5FNVA 3DXRB 2D3OW 3OUFA 2Z3YA 4LNUB 4X20B 3S3XA 4CS3A 1RPRA 3CWBH 4ZKIA 1EN6A 3OT7A 3TCUA 5JJEB 4TQFA 3SPIA 4DR7B 4JI4B 4DUZB 1M57C 2M7WA 4RQEA 3T2MA 2WPDG 2ZIMA 4BIOA 5IJ0B 1H2MA 3BABA 5KHKA 4LF4O 2O57A 4LFCB 1GN3A 2WLNA 1V54C 3D3QA 1AB3A 2FKXA 2ZR3A 2JRIA 4I0XB 4TUYB 1MSDA 3AG4C 3OR6C 1F7YA 4TOIA 4J80A 3ZMUA 1S5JA 1YTFB 2HEPA 1K5SA 3T4DA 2GSMB 3D3IA 3B77A 2ZNIA 5LP6A 3JALA 1XOUA 1SC5B 3DGEA 1KB9F 3H1IH 3G4SV 3ASOC 4LBEC 3UKMA 5IJ9A 4DW0A 4RO2A 2YI9A 4X62O 3L71H 1BMFG 1H8EG 4B3SO 1EN5A 3CRMA 2Y0IA 3ZHSA 2UXCO 3IAYA 3H01A 5KLVH 1PV0A 2N74A 1Y6XA 3QTCA 4F6RA 4DR2O 1IBLB 4DV0O 3CRQA 3J7AU 4MVQA 2B5UA 3VBBA 2KB1A 4FM1A 5DECA 4DRXB 4DV0B 4DR2B 1P84F 5J2TB 1PNMA 5D5QA 2LGQA 1KBHA 2YEVA 1XHXA 5CBFA 4UV8A 1WNSA 2XAQA 1PNLA 1WA8A 5KX5A 4LF9B 2PYLA 5LOVB 2BTQB 3D36A 2KG7B 4TWKA 5KHGA 2R9AA 5IYZB 4LF9O 3W7XA 5LA6A 1NH2D 2QKSA 1IBMB 2QEXV 3PJSK 4GX0A 5LYJB 2CTPA 4JI7B 1COWG 5B66Z 2QM7A 3SPHA 2X6AA 1WLEA 1XI1A 4IT5A 4U3JA 4TQDA 2UXCB 5HFMA 3HKCB 4X62B 2ETNA 5BR8O 4J9YB 4FLZA 1BQ0A 1OCZB 1GTOA 4O4HA 1N33O 3ZRWA 4UFZA 4WF9V 4BWAA 3BVOA 2DQ3A 1S72V 5BMVA 1GO3F 4PD4F 2E76B 4AQYO 1V54B 4JI4O 4ZI7B 4DR7O 4PI2A 5LP6B 3GWKC 3ASOB 2ZIOA 1FFXA 3K57A 1S76D 5L3GA 5BR8B 3CRRA 1XBLA 4AILC 2ITCC 1W0JG 1Y66A 3DC5A 1KQSU 3SGIA 3B8NA 1OJHA 3CC4V 1FJGB 2PUSA 3L75H 1EN4A 1N32O 3K04A 4JTCB 4WBNB 1X4TA 1XL6A 4DV1O 4FLUA 4B3MO 2JGUA 3DXRA 4R6ZA 2PY5A 1S3JA 2F43G 1RM1B 2ZCEA 3H1LH 1IX9A 2Q8VA 3CCSV 5JH7B 4PA6A 1B3QA 4F6RB 1NR1A 4DV6B 4FLWA 3P30A 3N2KB 3SPGA 3K9SA 3RBZA 4WBNA 2F23A 4ABMA 3ZCCA 4CC5A 1ZX3A 5EBMC 1V55B 4BIZA 1VQPV 3ZMTA 1Q8IA 4YJ3B 1KECA 2UXBO 4UB8Z 4LH6A 2W6JG 3FKSG 3N2GA 1DTOA 4UVBA 2Q0AA 2EZOA 2XNDG 3E8HA 3MD0A 2YIBD 2YICA 5EYPA 3CCRV 3AEIA 2ZE6A 1VQNV 3WB1A 2WLJA 1N32B 3BRCA 1HDJA 1B04A 4J7JA 3JASA 2GBOA 1GMGA 2X6CA 3ASNC 1D2DA 3ZEDA 5A9GA 2ZDIC 1OCCC 4TV8B 4R50A 4LFAB 3C3SA 4WFEA 2WAMA 4X65B 1YF2A 3WFVA 4LF4B 1JJOA 2R9RB 4YY3O 2P90A 3CXCU 5L3CA 1RM1C 4I4TB 4J10A 1TUBB 1TUBA 2IM9A 3RYFB 4K0KO 4EFEA 4N23A 2F1MA 3STLC 3IC7A 1ZL8B 5GW7A 5KMGA 2CUGA 4UCTA 1WP8A 3RGBA 3K58A 1GM9A 4UVAA 2XUMA 1GM8A 1L8DA 3W7WA 3CCMV 4EB6B 3B40A 4X66B 2Q7HA 1N33B 4PDMA 3IJ4A 4I7ZB 3J80N 3HKDA 4O4LB 1K3EA 1HWYA 2LP7A 3LNMB 1XNQO 2QWRB 1JA8A 1I08A 3OEEG 4OX9B 1IBKB 4X1YA 3FB5C 1SQVH 3JD3A 3NR7A 4JAAA 1Q6IA 5IY5B 2VQEB 1Q81W 2Y48A 1VF7A 3AG1C 2JGDB 4J11A 5KX5B 2ZR2A 1V9PA 5EK0A 1YSCA 1SQQH 3D36C 3EVKA 3ASNB 2WLIA 2YIDA 1DK1A 3AG4B 5IYCO 3L73H 3K3WA 2EIMC 4B7EA 1AI7A 3ZJZA 4UCVA 3OTOO 4HBNA 5DN6G 1JJ2U 2A3QA 2YS8A 2VQEO 3CE2A 1KP2A 4NB5A 4X88A 3K08A 5LHGA 4X20A 2BOCC 4O2BA 4JYAB 2IH3C 3RN4A 1AI5A 2CGNA 2LQTA 3K79A 2R70A 2ZM6O 2Y69C 1NR7A 3OGCC 4GUNA 5GONB 2QA4V 3RYIA 3O65A 4DW1A 5IDJA 4AI8A 1GK9A 1IDSA 1G8MA 5JJJB 4MVRA 1VQ9V 2UU9B 3ZN0A 1WJZA 1MG1A 2EIMB 2ZE7A 4NKGB 3RW0A 4WFGA 2UUBB 1IXBA 1BZKA 3JAWA 2GDSA 4KUMA 3D8CA 2W0XA 2P6JA 3RFRA 3UO2A 3IC9A 1L1FA 4R7CA 3G71V 3ZRWB 2LJ2A 3OTFA 3UT5B 5CA3A 1SQPH 1RP3B 1ENVA 1HNXO 1FAFA 4GKKB 4LR3A 3UCSC 3VQYA 5KUMA 1BSMA 1MMMA 3JAKB 3AG2C 1XQ8A 4IHJA 1WN7A 1EZJA 4I55A 3DTUB 2CH7A 5ITZB 4ASUG 4B3RO 2ATKC 1Q90D 4JF3A 4EEQA 3SR2C 4GKJO 3ABKC 2IU3A 1KD1W 4O2AB 1FS0G 2GTSA 1E1RG 4ZIBA 4NTXA 2HJDA 2QKAA 4IHJB 1HNWB 3SYCA 1XUQA 2ADQB 1BCCH 3OFNG 4JI0B 2ZDIA 2HKOA 3ZRXA 1KYOF 4MW8A 2UXBB 1ZLZA 2Y0PA 3ZHVA 3C90A 3HKEA 4G28B 4WCEV 2P67A 1FXKA 4DR3O 4KP4A 4JI5B 3OMNB 2QWNB 2CDYA 2F4VO 3BPZA 3U10A 2K9PA 3E8FA 1TA8A 5IYDO 4U3JB 2PI4A 4R8CA 2HP8A 1X59A 2EIJB 1H2KA 2XOKG 1PPJH 3M99B 4I9WA 2YSUB 1M57B 1SKVA 5LOVA 5F2VO 1QNMA 2B1GA 3A2FA 1N36B 5GONA 4F6EA 2YIAA 3L74H 1WPXA 1VQLV 1AJQA 1VQ5V 2ZKOA 1KUQA 3RT3C 4FFKA 1IZ3A 2X7RB 3L70H 1AILA 4FLXA 3LUTB 1NS1A 4JV5B 1JX9A 1OZ0A 2L6LA 2RDCA 1N0JA 1TVKB 2YEVB 1J5EO 2H3OA 4U7OA 4N21A 1BHBA 4BR6A 4DYLA 2XAHA 5J2UA 1VP7A 4I4TA 4B3TB 4O4JA 1EZVH 3ZRSA 3CS5A 2JDIG 2JJ2G 2NR5A 1Y4MA 4LF8O 1VEWA 2XAGA 4GX5A 4J7ZA 2UU9O 1SERA 3K5LA 2IU0A 3A0HZ 1SS3A 1XDCA 1M93A 2YI8A 3T1HB 3K5NA 2HHHO 3QNEA 4P9PA 1QCEA 2AHZA 2DYSC 1BGYH 3L9DA 2ZM6B 2E74B 4JTDB 3JD0A 3TXSA 2R9IA 5EZYB 5EZYA 4TUYA 2W6IG 3LDCA 2FB5A 3SPJA 1OCRC 1K5QA 5FNVB 1SA0B 5C8YA 4CS4A 1A32A 1K73W 3SDLA 2WLHA 4H13B 1R3KC 1YCIA 5B1AB 1SZTA 3ZBHA 2X6BA 4X1IB 3CCJV 1R6NA 3OTOB 3BA9A 4XBFA 2GUZB 2OCCC 4MVOA 1VQOV 4HNAA 3N2KA 4X9QA 4D6TH 3VQVA 2YUAA 4PA7A 4LP8A 2VQFO 4GCZA 2QJ1A 2E3CA 1VQ7V 4J41A 1PD3A 1QQCA 3TETA 1AP5A 2WSSG 3HB3B 2ZINA 3CJHB 2A0LA 3E35A 4D7TA 1B06A 1SF9A 4H44B 5H5NA 1R3LC 4BW5A 1AJPA 1R1BA 1QVGU 1AROP 3GB7C 2QM4A 2Q6AA 2IJIA 3MHSC 2R72A 4ZOLA 3LSSA 2WA3A 2YC0A 2XAJA 3LNNA 4DR5B 1XMOO 2BE3A 2QDOA 1M56C 4PDVA 3AK2A 4JZGA 4NXMB 2RN9A 4DV7B 4X1KB 3SJQC 5IJ9B 4LF6B 3APQA 1AR1B 4NXNO 3G6EV 2QWPB 3HKEB 5EBWC 3AK1A 3CRAA 4OGQB 3JALB 2M6YA 2EJRA 5IE9A 3FB7C 3N27A 1Q43A 4KFMA 1PM9A 3I56V 5GTIZ 3CCLV 1HR0B 4G2KA 5DEDA 1HP8A 1YI2V 4OPAA 2B9ZA 3UQ8A 5LA6B 2AW9A 2LW7A 4JI2B 3LSUA 5LYJA 4DR1O 1G4YB 1HNZB 1Y67A 2LGWA 1S5LZ 2MW2B 3AG3C 1NI8A 3CMAV 4UVCA 3RYCA 1FXKB 3JD2A 3TGUH 3BY6A 3FB8C 2EZPA 1THZA 5CBGA 3A0BZ 5KAIZ 1US6A 2BCCH 3W7UA 3SYQA 4FLTA 4MTXA 4X64B 1ZSPA 4DR4B 3TJTA 2P06A 4MVMA 2ARHA 3H1KH 1HNWO 1NTKH 1AP6A 4MT8A 3E83A 1JCHA 5JVDA 3RYHA 4JYCA 3IFXA 2A79B 1VF6A 3RWRD 4DV6O 1OCCB 1V55C 1EBOA 2OCCB 1DLBA 1Q6HA 2P5OA 1GH6A 4A5UB 2GHYA 3OE7G 5K1XA 1YJNV 4P2ZA 2ODMA 2CAZC 3AG2B 4I0XA 3OGIB 4LFBO 3JARB 3B8MA 3JARA 1SA0A 2EULA 3CP1A 4AQYB 1S5HC 4X1KA 3F7YC 1PNKA 1DGSA 2KG7A 4BIUA 3E22B 1TGOA 1Y76A 5B1OA 2JIZG 5LHIA 1SQFA 1XMQB 5TISZ 4DV3B 3C3TA 2LFSA 4GX1A 1Q3EA 1AVMA 5ITZA 2EILC 2JK5C 3THOA 4BW9A 3E2EA 4JV5O 3F5TA 2VQFB 5EBLC 5CB4A 4KXRA 2Q4PA 3CJHA 2XT9A 1TVKA 5C93A 4NR1A 1XEQA 2PTMA 4Q20A 1N36O 3OD4A 3T4ZA 4FLYA 2V4DA 5DM6V 3HR0A 1N34B 3NXSA 4GT1A 1Q6UA 1ZUQA 4TT3G 4JTAB 1EFRG 4HZ3A 2XAFA 1UPGA 2QKCA 4ZHQA 1IBLO 2BSKA 3HKBB 4DR3B 3WB0A 3JD4A 4TV8A 1FFXB 3STZC 3WU2Z 2Q67A 1FYJA 2KKWA 5EIBC 3CC7V 5L3EA 5LXTB 1DF4A 1R6TA 1WAZA 3H1JH 1Q86W 4PDLA 4MSWC 1T5EA 2W0FC 2XTAA 1VQ8V 4B7KA 3OEHG 4UUJC 4O2BB 2WLKA 3MHHC 1JMKC 5JWPA 4ZI7A 1F4MA 1RSOA 5LHHA 2YIBA 4GYCB 2QGNA 4B3TO 4WFFA 1VQKV 1E79G 4DR1B 2PZSA 2N05A 4UXNA 3CEIA 3EXAA 4AHCA 3T1HO 3J81N 4H37A 3BEHA 4JYBA 3FAVB 2DWEC 2OYQA 1PL0A 2YDEA 1YDXA 2PI5A 1ROPA 3K59A 4K3AA 2QSAA 1KKCA 4YHHB 2JEXA 1PP9H 1N4CA 5D5PA 3L72H 4JI8B 1WPBA 1W2BU 1ZAUA 2Q7GA 4YXWG 3OM3B 2IW5A 4YY3B 1NBMG 4DK1A 2F95B 1K4CC 2JGDA 1NVPB 3R66A 4LFAO 5IYBO 3ETQA 3SYAA 4G27B 3U11A 3M7MX 5H2FZ 3BAAA 2L35A 1Z5WA 3AG7A 4DR5O 2QWOB 3M8AA 4YHHO 3ZX6A 1JPXA 4CH6A 1IURA 4NYKA 4MW3A 1W0KG 3BCCH 2UUCO 1KC8W 4I50B 2EBOA 3KKYA 3ZMSA 4YIPA 4XDLA 2EJ7A 3ABKB 5BMVB 3FFQA 2PYJA 4MTFA 5FPOA 4JAVA 4O4HB 2QTSA 3RYIB 1LR1A 1EM1A 2ILMA 4DK0A 2E5LB 3CD6V 1JOYA 4KL1A 1NH2B 5LXTA 2FTKA 3FYIB 3QO7A 4I50A 4JPRA 5B1BB 1NJIW 2VWKA 4O2AA 3SYOA 4UCOA 3K0GA 2BTQA 2ZXWC 1BL8A 2LFRA 4JI6O 3JYCA 1SESA 5L3BA 1BS3A 4O4LA 2KSDA 3HKDB 1QLNA 3B09A 2CH7B 3ABMB 1GM7A 1MZEA 1ZWIC 2DYRB 3HKBA 3DSQA 2RJZA 1BT8A 4LC1A 4LNUA 2EINC 4J7KA 2DOSA 1P7GA 5LMUB 3JCUZ 5EC2C 4DRXA 3UT5A 2EIJC 5CBHA 3B4SA 3ML0A 1FXVA 1AJNA 2DW4A 3SPCA 3ETEA 4B3MB 1XMOB 2HJFC 3QG5A 1XNRB 5KHHA 4CZZA 1G6UA 5LMNO 1QHTA 2AHYA 3ZHRA 1XNRO 2Z5UA 3AG3B 4LF5O 2EIKC 2DQ0A 2JS3A 1K34A 2JEUA 4C7UA 2IJKA 5JH7A 4JGSA 4QGPA 4J42A 1Y76B 1K33A 1UJWB 5LGTA 2QE7G 3ZMVA 3ETDA 3G80A 1QU7A 3TXQA 1NU1H 1AR4A 4W4KA 1ORQC 3CSXA 2LO1A 1MABG 1E1QG 1YHQV 4LFBB 3GWOA 4UCUA 5E1AC 3ZIAG 1QR8A 1NTMH 1QLEB 5IT9N 5JJNB 1CXZB 1O9GA 4RAIA 2N04A 2UXDO 1JFFB 4LWSA 3ZS8C 3QVNA 1OV9A 1GKFA 4PHZA 2QWQB 2KQXA 4MVUA 3Q4HB 5KHIA 3Q4HA 3X2QC 2ZXWB 2WLIB 1HW7A 2FYUH 4I5SA 3VQXA 2EINB 4JI5O 5JVDB 4YJ2B 5A2QN 1SQXH 4JI1B 3P3NA 5EC1C 3FX7A 1FKAO 1BE3H 2UXXA 5B3SB 1KKDA 1MNGA 4DR4O 1JFFA 4LWSB 1NT2B 1HR0O 1ZTEA 3KCYA 1CP9A 5CA1A 4X1YB 4HAMA 1L0NH 2H8PC 4QNHB 1Z2GA 4FFBA 2AXTZ 2NN4A 2QTOA 1MSWD 1XNQB 1JR9A 3CX5F 1B6QA 3EFFK 4DUYO 4JI2O 1F23A 4Q6GA 3VQWA 3O9OA 3CCUV 1GN2A 5LBQA 3K5MA 2VRZA 4UCSA 2Q68A 1J5EB 2UUCB 1D5AA 1I7FA 4JI8O 5J2TA 2QR4A 2PGGA 4IL6Z 1I5YA 5KMGB 3JAWB 5LGNA 1XREA 1R6KA 1XL4A 4DV5O 1YTFD 1H2GA 2WLMA 1M56B 5KAFZ 3K0DA 4PJ0Z 3W7TA 1I94B 1HNXB 2A06H 3I55V 4CBCA 4X65O 1F51A 2OTJV 2P7TC 1ZL8A 3LSQA 3RYFA 4DUYB 2Q7EA 4UV9A 4DV5B 2JS5A 1NQTA 4ZHQB 1LUWA 3P32A 3SYPA 4Z1VA 3CMEV 3KCXA 3ZHTA 2EX3A 3JSNA 3H9VA 4FVMA 1FXKC 3BHPA 4JAUA 4CH3A 4D7SA 3N2GB 2WLLB 4PA9A 5B3SC 1M1KW 1S77D 3APOA 1CEZA 1AI4A 1WB7A 2HVJC 3OR7C 4UCRA 5E79Z 3UM7A 2CTQA 2GV9A 1OCOB 4FLVA 4J9ZB 1PL4A 1WP7A 3JATB 4L8JA 4JI1O 4IYHA 4DXWA 1BHAA 2RNBA 2NLJC 3CB2A 5FL7G 4IGGA 3CHXA 4WFBV 4W4LA 2ZE5A 3CPWU 1H38A 1VQ6V 4GZRB 4FK5C 3ZN1A 1P7BA 4DR6O 4UB6Z 5JCOA 1IBMO 1N34O 4FZ1A 4CC6A 4KHPB 2FL4A 2CGOA 3U0ZA 5H6QA 3ZHUA 1YJWV 4PA4A 1W59A 2WWWA 1FFTB 3SJAC 2C2AA 1K97A 2ITDC 5C8YB 4PELA 3OMAB 2YXLA 4H0LB 1YJ9V 2V7QG 1K9MW 3JSLA 1NKDA 2RCVA 4PDRA 3SJBC 2Q69A 1D5NA 4K8ZA 1RPOA 3K9AA 5LP6C 1K8AW 2G38A 4FJCC 3JAMN 4ZBMA 2HHHB 3E8GA 3WB2A 1YEWA 3KG2A 2ZD9A 4K35A 5J2UB 1TAEA 1GN6A 3RYHB 5B5EZ 1SETA 2AGAA 4YJ2A 3GVMA 4JZ2A 2UUBO 2Q9LA 3K06A 3WG7B 2NNUA 4JYYA 4FMTA 4TSFG 1XMQO 5FLXN 4RUFA 1Z5VA 2HG5C 3FAVA 3PN1A 3ABLB 4H33A 3CCQV 3K5OA 1K4DC 1NTZH 4MTOA 1QR9A 4NVPA 5K1PA 4PV1B 4DUZO 1RSOB 3FB6C 4LH7A 2HVKC 1OCRB 4X1IA 5EYPB 4JI7O 4QPKA 2YXYA 4U3FH 1JVMA 3G67A 2GTAA 3QO5A 2IJJA 1NZ6A 2JJ1G 3CCEV 3JD1A 5H9CA 1WA8B 4DV2B 4CH4A 4YJ3A 5LMUO 4E4EA 1R73A 4DR6B 5CN0A 2DJVA 1G1XB 1K7DA 4JI3O 4WFAV 4JI0O 3DC6A 2EIKB 2F4VB 2MK3A 4BAYA 1MA1A 3CYOA 4YIOA 5AG2A 1QLEC 2ZNJA 1VQMV 2BSKB 2HLDG 1S0VA 2A7WA 2VS0A 1KP3A 4Z2WA 4IYIA 3LDDA 2HFEC 5CB4B 4EB6A 2DWDC 1XHZA 1R3IC 4WFHA 3WG7C 5LGUA 3OUSA 1TUEB 4JI6B 5BY1A 3P3PA 4GKJB 1OCOC 1PKXA 3E86A 4HYOA 5KA5A 4LF8B 1VMGA 2H94A 1I5XA 1VARA 4QPJA 2ADPA 4QJFB 1HNZO 1M5IA 1VQ4V 1Y74A 3ABLC 5IY5C 2DE0X 4GKKO 2P4KA 4FIPC 1MOFA 2RMKB 1BQZA 4NXNB 4EFBA 1VIBA 2OT5A 3T1YO 3TK1A 4CH5A 3K03A 4DV7O 2LW1A 5H6RA 1YZBA 4NTWA 3CRCA 5BZBA 4QE7A 2F93B 4DV1B 1SZXA 2UUAB 4JASA 5L3DA 4IIJA 5GTHZ 4I55B 3MDSA 1O9HA 3CCVV 4DV4B 3R65A 5CMUA 3FYEB 4P30A 4RQFA 1FXHA 2A9HA 4LCUC 1VF6C 4FM2A 4HNAB 4OXSA 2CTRA 4LFCO 1YITV 4XDJA 2WA4A 1I0HA 3E89A 1P49A 2OWOA 5FPRA 1OHHG 1OCZC 1N0NA 2B1IA 3CC2V 5J9PC 5IWAO 3A0RA 3G6BA 1UFIA 2UUAO 2PF4E 2E75B 3ETGA 4XDKA 1H2LA 4JYAO 2FMLA 2IH1C 3JATA 1XILA 3X2QB 1IVSA 4FPPA 5L3FA 1FD9A 2OIGA 1FPOA 1SRYA 1WB8A 3E22A 5IYZA 3MAQA 1SQGA 1QVFU 4B08A 2OIEA 3CXHF 4TV9B 4DO2A 3BA8A 1K92A 2CTWA 2WLLA 4ZOLB 1P4RA 2K1EA 5JQGA 3RVYA 3ABUA 4PI0A 5JCOC 4LF7O 5B1AC 4OPHA 3HPLC 3ICXA 3RYCB 4IIJB 1KU9A 1R3JC 1KMIZ 1NVPD 3QO8A 2CK3G 3F7VC 1JQ0A 1LUVA 1M4UA 1LNQA 3ZRVA 1N8RW 1J95A 3ZMZA 3A8TA 1YXBA 4FM0A 3JAKA 2HR3A 5B1BC 3IGAC 3T1CA 2EILB 3ZHQA 5KHJA 2DYSB 4B3RB 2DYRC 5KA6A 1U97A 4QIWF
chains in the Genus database with same CATH topology
2WLIB 3W7SA 4I5SA 2EINB 1GM9A 1F4NA 4MS2A 4UVAA 2EJRA 1GM8A 3FB7C 5EC1C 3W7WA 3CCMV 4KFMA 3I56V 2UXXA 4MVSA 5B3SB 3CCLV 4PDMA 3E8BA 1CPYA 1KKDA 2UXNA 4G2KA 4Z1MG 4U7NA 1YI2V 1AI6A 1CP9A 5KUKA 2QM8A 1K3EA 1HWYA 4HAMA 2H8PC 2LP7A 1G4YB 4QNHB 3LNMB 3RVZA 3AG3C 1DF5A 2QTOA 3OEEG 1MSWD 3CMAV 4UVCA 1FXKB 2Y69B 3ABMC 3FB5C 3JD2A 1B6QA 3EFFK 5B1NA 3JD3A 3BY6A 3LDEA 4QE9A 3FB8C 2EZPA 5IY5B 1THZA 5CBGA 3W7UA 1Q81W 3SYQA 4GX2A 2Y48A 1F23A 3AG1C 3CCUV 4MTXA 1Q82W 2ZQMA 5LBQA 2Q68A 2BOBC 4X89A 4MVMA 2ZR2A 2X0LA 1QBZA 1H8HG 5EK0A 1M90W 1YSCA 4MT8A 3ASNB 1I5YA 2WLIA 3E83A 5LGNA 1JCHA 3AG4B 5IYCO 1R6KA 3OMIB 1XL4A 2V1DA 4JYCA 1YTFD 3K3WA 3IFXA 2A79B 1H2GA 2EIMC 2WLMA 1AI7A 2OTLV 3EHBB 1M56B 1YIJV 4L87A 1OCCB 1V55C 1EBOA 1M9NA 3K0DA 3ZJZA 3W7TA 2OCCB 1DLBA 3I55V 3OAAG 4E2LA 4P9OA 4CBCA 5DN6G 1JJ2U 1F51A 2OTJV 2P7TC 2XASA 1Q7YW 2GHYA 3OE7G 1YJNV 4P2ZA 1IXMA 3LSQA 3AG2B 1KP2A 4UV9A 4X88A 3F5WC 3JCZA 3K08A 1NQTA 5LHGA 3B8MA 3P32A 2BOCC 3AG1B 3CP1A 2IH3C 1S5HC 3SYPA 3CMEV 1AI5A 3K79A 2IJHA 1FXKC 2Y69C 4JAUA 1NR7A 3F7YC 1PNKA 3OGCC 2WLLB 4PA9A 5B3SC 2QA4V 4BIUA 1M1KW 1S77D 3VOUA 5B1OA 5IDJA 2JIZG 1GK9A 5LHIA 1CEZA 1AI4A 1G8MA 2HVJC 3OR7C 4MVRA 3UM7A 1VQ9V 3ZN0A 4RUEA 1MG1A 1OCOB 2LFSA 4PA3A 2EIMB 4J9ZB 4MTGA 4GX1A 3RW0A 4WFGA 2EILC 2JK5C 1BHAA 4DXWA 5HFLA 2NLJC 5FL7G 3E2EA 3ABTA 4KUMA 2P6JA 5EBLC 4WFBV 4EKWA 1VQ6V 3CPWU 1H38A 4FK5C 5C93A 3ZN1A 1P7BA 1L1FA 4X8AA 4R7CA 3G71V 3ZRWB 4F4LA 4MVZA 5CA3A 4Q20A 3T4ZA 5H6QA 1ENVA 5DM6V 3OW2U 3NXSA 1YJWV 4GT1A 4PA4A 2WWWA 4TT3G 5KUMA 1FFTB 4JTAB 2C2AA 1EFRG 1K97A 4HZ3A 2D3OW 2XAFA 3OUFA 2Z3YA 2ITDC 3AG2C 4PELA 1RPRA 1EZJA 4ZKIA 3OMAB 3DTUB 3TCUA 3SPIA 1YJ9V 2V7QG 1K9MW 4ASUG 1NKDA 4PDRA 3JD4A 1M57C 2Q69A 2M7WA 4RQEA 3T2MA 2ATKC 2WPDG 3STZC 2Q67A 1RPOA 3K9AA 3CC7V 4JF3A 5L3EA 1DF4A 1K8AW 4FJCC 3ABKC 1Q86W 2WLNA 1V54C 4ZBMA 2IU3A 3E8GA 4PDLA 1KD1W 2ZR3A 3KG2A 4MSWC 2ZD9A 3AG4C 1FS0G 3OR6C 3ZMUA 2W0FC 1VQ8V 1YTFB 1SETA 1K5SA 3T4DA 3OEHG 2GSMB 4UUJC 3D3IA 1E1RG 2WLKA 3B77A 3MHHC 1F4MA 5LHHA 3SYCA 3K06A 4WFFA 3DGEA 3WG7B 1VQKV 1E79G 2NNUA 3OFNG 4FMTA 3G4SV 4TSFG 3ASOC 2ZDIA 2HKOA 4RUFA 4UXNA 4LBEC 3UKMA 2HG5C 4H37A 3ZRXA 3ABLB 4H33A 4RO2A 3BEHA 4JYBA 3CCQV 4MW8A 1BMFG 2DWEC 1H8EG 1PL0A 2PI5A 1ROPA 1K4DC 4G28B 4WCEV 2P67A 4MTOA 3H01A 1QR9A 1FXKA 4MVQA 4KP4A 2JEXA 3FB6C 3OMNB 2B5UA 2KB1A 3VBBA 2HVKC 1OCRB 4QPKA 1PNMA 2YEVA 1JVMA 5IYDO 3E8FA 5CBFA 2PI4A 4UV8A 4R8CA 1W2BU 2EIJB 1PNLA 2IJJA 2XAQA 2XOKG 3M99B 2YSUB 3QO5A 1M57B 2JJ1G 2IW5A 3OM3B 1NBMG 4YXWG 3CCEV 2B1GA 3D36A 1K4CC 3JD1A 4TWKA 5H9CA 1NVPB 5IYBO 1WPXA 1VQLV 3SYAA 1AJQA 1R73A 3W7XA 1NH2D 1VQ5V 5CN0A 2QKSA 4G27B 1K7DA 4WFAV 3PJSK 4GX0A 2QEXV 2EIKB 1COWG 2MK3A 2X7RB 4BAYA 3CYOA 2QM7A 3LUTB 1QLEC 1VQMV 2HLDG 1S0VA 1JX9A 1OZ0A 3SPHA 1JPXA 1KP3A 2X6AA 1WLEA 4MW3A 1W0KG 3LDDA 2HFEC 2YEVB 5HFMA 1KC8W 2DWDC 1R3IC 2EBOA 4U7OA 4WFHA 3WG7C 5LGUA 4N21A 3ZMSA 3OUSA 1BHBA 4J9YB 1TUEB 4XDLA 1OCZB 3ABKB 1GTOA 2XAHA 1OCOC 1PKXA 3ZRWA 4MTFA 4WF9V 3E86A 4HYOA 5KA5A 2DQ3A 4JAVA 2H94A 1S72V 1GO3F 3ZRSA 1I5XA 2JDIG 2JJ2G 1V54B 3CD6V 1JOYA 1Y4MA 1NH2B 4QPJA 2FTKA 3FYIB 3QO7A 4QJFB 3ASOB 4JPRA 5B1BB 1NJIW 2XAGA 4GX5A 1SERA 1VQ4V 2IU0A 3SYOA 3ABLC 5IY5C 3K0GA 1S76D 5L3GA 4FIPC 1MOFA 2ZXWC 1BL8A 2LFRA 3JYCA 3QNEA 4P9PA 1SESA 1QCEA 2OT5A 2AHZA 2DYSC 5L3BA 4JTDB 3TK1A 3K03A 3JD0A 5H6RA 2R9IA 1QLNA 2ITCC 1W0JG 1Y66A 3ABMB 2W6IG 3LDCA 1GM7A 5BZBA 1KQSU 4QE7A 3SPJA 1ZWIC 3B8NA 1OCRC 4JASA 1K5QA 3CC4V 2DYRB 5L3DA 4LC1A 3K04A 4JTCB 1XL6A 2EINC 3CCVV 1K73W 2WLHA 3R65A 5CMUA 1R3KC 4R6ZA 3FYEB 4P30A 4I9WA 4RQFA 5EC2C 1FXHA 1SZTA 2A9HA 4LCUC 5B1AB 2X6BA 4OXSA 1S3JA 2EIJC 2F43G 3CCJV 1R6NA 1RM1B 5CBHA 2OCCC 4XBFA 4MVOA 1YITV 1VQOV 3CCSV 3ML0A 4XDJA 4PA6A 1FXVA 1AJNA 2DW4A 3SPCA 1NR1A 3E89A 3ETEA 3P30A 1OHHG 4PA7A 1OCZC 4LP8A 3SPGA 2B1IA 2HJFC 3CC2V 4GCZA 3RBZA 5J9PC 3A0RA 1VQ7V 3ZCCA 4CZZA 5EBMC 3ETGA 4XDKA 1PD3A 1V55B 2AHYA 3TETA 2Z5UA 2IH1C 3X2QB 4BIZA 3AG3B 1VQPV 4FPPA 5L3FA 2EIKC 2DQ0A 2WSSG 3ZMTA 3HB3B 1SRYA 1K34A 2A0LA 1KECA 2JEUA 3E35A 2IJKA 2W6JG 1R3LC 3FKSG 1DTOA 4BW5A 1QVFU 1AJPA 4JGSA 2EZOA 4UVBA 2XNDG 1K33A 3E8HA 4DO2A 1UJWB 1QVGU 1AROP 5LGTA 1K92A 3GB7C 2WLLA 2Q6AA 1P4RA 2K1EA 2QE7G 2IJIA 3ZMVA 3MD0A 3ETDA 3MHSC 3RVYA 1ORQC 3ABUA 3LSSA 3AEIA 3CCRV 1VQNV 5B1AC 2WLJA 1MABG 2XAJA 3HPLC 1E1QG 1YHQV 3GWOA 1R3JC 5E1AC 3ZIAG 1GMGA 3ASNC 2X6CA 3QO8A 1NVPD 2CK3G 1QR8A 1M56C 2ZDIC 4PDVA 1QLEB 1OCCC 1JQ0A 3F7VC 1LNQA 4R50A 4RAIA 4WFEA 3ZRVA 1N8RW 1J95A 2WAMA 3SJQC 3WFVA 3ZMZA 1AR1B 2R9RB 2P90A 1GKFA 3CXCU 2HR3A 5B1BC 3IGAC 3T1CA 2EILB 5L3CA 3G6EV 1RM1C 4MVUA 2DYSB 3X2QC 2DYRC 4N23A 5EBWC 3STLC 3IC7A 2ZXWB 4QIWF 5KA6A 5GW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LBE C;  2WLI B;  4JTD B;  3K03 A;  3UKM A;  2HG5 C;  4H37 A;  4H33 A;  4RO2 A;  3BEH A;  2ITC C;  2Y69 C;  3F7Y C;  3LDC A;  5BZB A;  4MS2 A;  4MW8 A;  3OGC C;  2DWE C;  4QE7 A;  3SPJ A;  1ZWI C;  3FB7 C;  1OCR C;  5EC1 C;  2WLL B;  4PA9 A;  5B3S C;  1K4D C;  4G28 B;  4MTO A;  4KFM A;  3VOU A;  3K04 A;  4JTC B;  4MVS A;  1XL6 A;  2EIN C;  3OR7 C;  2HVJ C;  4PDM A;  3E8B A;  4MVR A;  2WLH A;  3UM7 A;  1KKD A;  3R65 A;  4MVQ A;  1R3K C;  4R6Z A;  4RUE A;  4PA3 A;  3FB6 C;  4J9Z B;  2KB1 A;  4GX1 A;  2HVK C;  2A9H A;  4LCU C;  4MTG A;  4P30 A;  4WFG A;  2X6B A;  5EC2 C;  2EIL C;  2JK5 C;  4OXS A;  2EIJ C;  4DXW A;  5KUK A;  2NLJ C;  2YEV A;  5CBH A;  2OCC C;  1JVM A;  4MVO A;  3E8F A;  4XDJ A;  4PA6 A;  5CBF A;  2H8P C;  1G4Y B;  4R8C A;  3LNM B;  3SPC A;  4QNH B;  4I9W A;  3E89 A;  5EBL C;  3RVZ A;  4EKW A;  3AG3 C;  1K4C C;  4PA7 A;  1OCZ C;  1P7B A;  2QTO A;  4LP8 A;  2HJF C;  4TWK A;  3SPG A;  4X8A A;  3RBZ A;  5J9P C;  4R7C A;  3ABM C;  3FB5 C;  3EFF K;  3SYA A;  3LDE A;  4QE9 A;  3FB8 C;  2QKS A;  4G27 B;  4MVZ A;  4F4L A;  3PJS K;  4GX0 A;  5EBM C;  4XDK A;  5CBG A;  3SYQ A;  3T4Z A;  2AHY A;  4GX2 A;  3TET A;  2IH1 C;  3AG1 C;  3LUT B;  1QLE C;  4PA4 A;  2EIK C;  3SPH A;  2A0L A;  5KUM A;  4JTA B;  4HZ3 A;  2Q68 A;  2X6A A;  3OUF A;  1R3L C;  2BOB C;  2ITD C;  4MW3 A;  3AG2 C;  4X89 A;  4MVM A;  4BW5 A;  3LDD A;  3E8H A;  2HFE C;  3TCU A;  5EK0 A;  3GB7 C;  3SPI A;  2WLL A;  2DWD C;  2Q6A A;  1R3I C;  4PDR A;  2K1E A;  4WFH A;  3WG7 C;  1M57 C;  3OUS A;  2Q69 A;  4J9Y B;  2WLI A;  3E83 A;  2ATK C;  3T2M A;  3RVY A;  3STZ C;  1ORQ C;  5EBW C;  4XDL A;  2Q67 A;  1XL4 A;  1OCO C;  5B1A C;  2WLJ A;  3IFX A;  4MTF A;  2A79 B;  2EIM C;  2WLM A;  3E86 A;  3HPL C;  3RW0 A;  3ABK C;  4HYO A;  2WLN A;  1V54 C;  4ZBM A;  3E8G A;  4PDL A;  1R3J C;  1V55 C;  5E1A C;  3ZJZ A;  3K0D A;  3KG2 A;  4MSW C;  2ZD9 A;  2X6C A;  3ASN C;  3ZRS A;  3AG4 C;  4P9O A;  4CBC A;  1M56 C;  4PDV A;  3OR6 C;  3F7V C;  1OCC C;  1LNQ A;  2W0F C;  4R50 A;  2P7T C;  4RAI A;  4WFE A;  3T4D A;  1J95 A;  4P2Z A;  4UUJ C;  3SJQ C;  2WLK A;  4GX5 A;  2R9R B;  3SYO A;  3ABL C;  3F5W C;  4X88 A;  5B1B C;  3IGA C;  3K0G A;  3SYC A;  3T1C A;  3K08 A;  5IY5 C;  3K06 A;  4MVU A;  2ZXW C;  4WFF A;  1BL8 A;  3JYC A;  2BOC C;  3X2Q C;  2DYR C;  4P9P A;  2IH3 C;  1S5H C;  3ASO C;  3STL C;  2AHZ A;  2DYS C;  4RUF A;  3SYP A; 
#chains in the Genus database with same CATH topology
 3W7S A;  1FJG O;  4OX9 O;  2D2C B;  1F4N A;  2YXH A;  4MS2 A;  3HKC A;  2Q0O C;  4FZ0 A;  4DV3 O;  4MVS A;  4DV2 O;  3E8B A;  2IBZ H;  1CPY A;  2Z0A A;  2UXD B;  2UXN A;  4Z1M G;  4U7N A;  3S3W A;  1AI6 A;  4K8X A;  5KUK A;  2QM8 A;  5CA1 B;  5JQG B;  4LF5 B;  4I9Q A;  3RVZ A;  1IBK O;  1YVW A;  1VF5 B;  2Q73 A;  1DF5 A;  2VWJ A;  2Y69 B;  3ABM C;  3QF7 A;  4RWU A;  5B1N A;  3FD9 A;  3LDE A;  4QE9 A;  4K0K B;  5LL6 Y;  4GX2 A;  4NTY A;  2JVD A;  1Q82 W;  2ZQM A;  3BFR A;  2BOB C;  4X89 A;  2X0L A;  1QBZ A;  1H8H G;  1M90 W;  4DV4 O;  2Y4U A;  3B2E E;  5LMN B;  3OMI B;  3KZI Z;  2V1D A;  3I5D A;  2OTL V;  2P22 C;  3EHB B;  2Y4T A;  4L87 A;  1YIJ V;  5EIB D;  1M9N A;  3AK3 A;  4CS2 A;  3OAA G;  4E2L A;  4P9O A;  3T1Y B;  2DN9 A;  4X64 O;  2GUZ A;  2XAS A;  1Q7Y W;  1IXM A;  2DMX A;  3SJC C;  2AZ2 A;  3F5W C;  3JCZ A;  1AR5 A;  3UO3 A;  4FFB B;  3AG1 B;  2E5L O;  1H2S B;  2RQ6 A;  4LF7 B;  1SQB H;  2ZT9 B;  1Y74 B;  2IJH A;  4B3S B;  5IJ0 A;  2F66 C;  2BTO A;  4TV9 A;  2OCH A;  1GRJ A;  1H2N A;  1URF A;  4KHP O;  2P4V A;  3VOU A;  4O4I B;  4O4J B;  4ICG A;  4RUE A;  1RFY A;  4PA3 A;  1MZF A;  4MTG A;  5BXZ A;  5CA0 B;  1GAX A;  4GLX A;  5HFL A;  3H1H H;  3ABT A;  1U96 A;  5IWA B;  4EKW A;  2AZ0 A;  4X8A A;  4JI3 B;  2XHB A;  2Q5Z A;  1Q5O A;  1GN4 A;  1L0L H;  4F4L A;  4MVZ A;  2ZE8 A;  5CA0 A;  4LF6 O;  1I94 O;  4X66 O;  3OW2 U;  4NXM O;  2CE4 A;  4O4I A;  3JAS B;  5FNV A;  3DXR B;  2D3O W;  3OUF A;  2Z3Y A;  4LNU B;  4X20 B;  3S3X A;  4CS3 A;  1RPR A;  3CWB H;  4ZKI A;  1EN6 A;  3OT7 A;  3TCU A;  5JJE B;  4TQF A;  3SPI A;  4DR7 B;  4JI4 B;  4DUZ B;  1M57 C;  2M7W A;  4RQE A;  3T2M A;  2WPD G;  2ZIM A;  4BIO A;  5IJ0 B;  1H2M A;  3BAB A;  5KHK A;  4LF4 O;  2O57 A;  4LFC B;  1GN3 A;  2WLN A;  1V54 C;  3D3Q A;  1AB3 A;  2FKX A;  2ZR3 A;  2JRI A;  4I0X B;  4TUY B;  1MSD A;  3AG4 C;  3OR6 C;  1F7Y A;  4TOI A;  4J80 A;  3ZMU A;  1S5J A;  1YTF B;  2HEP A;  1K5S A;  3T4D A;  2GSM B;  3D3I A;  3B77 A;  2ZNI A;  5LP6 A;  3JAL A;  1XOU A;  1SC5 B;  3DGE A;  1KB9 F;  3H1I H;  3G4S V;  3ASO C;  4LBE C;  3UKM A;  5IJ9 A;  4DW0 A;  4RO2 A;  2YI9 A;  4X62 O;  3L71 H;  1BMF G;  1H8E G;  4B3S O;  1EN5 A;  3CRM A;  2Y0I A;  3ZHS A;  2UXC O;  3IAY A;  3H01 A;  5KLV H;  1PV0 A;  2N74 A;  1Y6X A;  3QTC A;  4F6R A;  4DR2 O;  1IBL B;  4DV0 O;  3CRQ A;  3J7A U;  4MVQ A;  2B5U A;  3VBB A;  2KB1 A;  4FM1 A;  5DEC A;  4DRX B;  4DV0 B;  4DR2 B;  1P84 F;  5J2T B;  1PNM A;  5D5Q A;  2LGQ A;  1KBH A;  2YEV A;  1XHX A;  5CBF A;  4UV8 A;  1WNS A;  2XAQ A;  1PNL A;  1WA8 A;  5KX5 A;  4LF9 B;  2PYL A;  5LOV B;  2BTQ B;  3D36 A;  2KG7 B;  4TWK A;  5KHG A;  2R9A A;  5IYZ B;  4LF9 O;  3W7X A;  5LA6 A;  1NH2 D;  2QKS A;  1IBM B;  2QEX V;  3PJS K;  4GX0 A;  5LYJ B;  2CTP A;  4JI7 B;  1COW G;  5B66 Z;  2QM7 A;  3SPH A;  2X6A A;  1WLE A;  1XI1 A;  4IT5 A;  4U3J A;  4TQD A;  2UXC B;  5HFM A;  3HKC B;  4X62 B;  2ETN A;  5BR8 O;  4J9Y B;  4FLZ A;  1BQ0 A;  1OCZ B;  1GTO A;  4O4H A;  1N33 O;  3ZRW A;  4UFZ A;  4WF9 V;  4BWA A;  3BVO A;  2DQ3 A;  1S72 V;  5BMV A;  1GO3 F;  4PD4 F;  2E76 B;  4AQY O;  1V54 B;  4JI4 O;  4ZI7 B;  4DR7 O;  4PI2 A;  5LP6 B;  3GWK C;  3ASO B;  2ZIO A;  1FFX A;  3K57 A;  1S76 D;  5L3G A;  5BR8 B;  3CRR A;  1XBL A;  4AIL C;  2ITC C;  1W0J G;  1Y66 A;  3DC5 A;  1KQS U;  3SGI A;  3B8N A;  1OJH A;  3CC4 V;  1FJG B;  2PUS A;  3L75 H;  1EN4 A;  1N32 O;  3K04 A;  4JTC B;  4WBN B;  1X4T A;  1XL6 A;  4DV1 O;  4FLU A;  4B3M O;  2JGU A;  3DXR A;  4R6Z A;  2PY5 A;  1S3J A;  2F43 G;  1RM1 B;  2ZCE A;  3H1L H;  1IX9 A;  2Q8V A;  3CCS V;  5JH7 B;  4PA6 A;  1B3Q A;  4F6R B;  1NR1 A;  4DV6 B;  4FLW A;  3P30 A;  3N2K B;  3SPG A;  3K9S A;  3RBZ A;  4WBN A;  2F23 A;  4ABM A;  3ZCC A;  4CC5 A;  1ZX3 A;  5EBM C;  1V55 B;  4BIZ A;  1VQP V;  3ZMT A;  1Q8I A;  4YJ3 B;  1KEC A;  2UXB O;  4UB8 Z;  4LH6 A;  2W6J G;  3FKS G;  3N2G A;  1DTO A;  4UVB A;  2Q0A A;  2EZO A;  2XND G;  3E8H A;  3MD0 A;  2YIB D;  2YIC A;  5EYP A;  3CCR V;  3AEI A;  2ZE6 A;  1VQN V;  3WB1 A;  2WLJ A;  1N32 B;  3BRC A;  1HDJ A;  1B04 A;  4J7J A;  3JAS A;  2GBO A;  1GMG A;  2X6C A;  3ASN C;  1D2D A;  3ZED A;  5A9G A;  2ZDI C;  1OCC C;  4TV8 B;  4R50 A;  4LFA B;  3C3S A;  4WFE A;  2WAM A;  4X65 B;  1YF2 A;  3WFV A;  4LF4 B;  1JJO A;  2R9R B;  4YY3 O;  2P90 A;  3CXC U;  5L3C A;  1RM1 C;  4I4T B;  4J10 A;  1TUB B;  1TUB A;  2IM9 A;  3RYF B;  4K0K O;  4EFE A;  4N23 A;  2F1M A;  3STL C;  3IC7 A;  1ZL8 B;  5GW7 A;  5KMG A;  2CUG A;  4UCT A;  1WP8 A;  3RGB A;  3K58 A;  1GM9 A;  4UVA A;  2XUM A;  1GM8 A;  1L8D A;  3W7W A;  3CCM V;  4EB6 B;  3B40 A;  4X66 B;  2Q7H A;  1N33 B;  4PDM A;  3IJ4 A;  4I7Z B;  3J80 N;  3HKD A;  4O4L B;  1K3E A;  1HWY A;  2LP7 A;  3LNM B;  1XNQ O;  2QWR B;  1JA8 A;  1I08 A;  3OEE G;  4OX9 B;  1IBK B;  4X1Y A;  3FB5 C;  1SQV H;  3JD3 A;  3NR7 A;  4JAA A;  1Q6I A;  5IY5 B;  2VQE B;  1Q81 W;  2Y48 A;  1VF7 A;  3AG1 C;  2JGD B;  4J11 A;  5KX5 B;  2ZR2 A;  1V9P A;  5EK0 A;  1YSC A;  1SQQ H;  3D36 C;  3EVK A;  3ASN B;  2WLI A;  2YID A;  1DK1 A;  3AG4 B;  5IYC O;  3L73 H;  3K3W A;  2EIM C;  4B7E A;  1AI7 A;  3ZJZ A;  4UCV A;  3OTO O;  4HBN A;  5DN6 G;  1JJ2 U;  2A3Q A;  2YS8 A;  2VQE O;  3CE2 A;  1KP2 A;  4NB5 A;  4X88 A;  3K08 A;  5LHG A;  4X20 A;  2BOC C;  4O2B A;  4JYA B;  2IH3 C;  3RN4 A;  1AI5 A;  2CGN A;  2LQT A;  3K79 A;  2R70 A;  2ZM6 O;  2Y69 C;  1NR7 A;  3OGC C;  4GUN A;  5GON B;  2QA4 V;  3RYI A;  3O65 A;  4DW1 A;  5IDJ A;  4AI8 A;  1GK9 A;  1IDS A;  1G8M A;  5JJJ B;  4MVR A;  1VQ9 V;  2UU9 B;  3ZN0 A;  1WJZ A;  1MG1 A;  2EIM B;  2ZE7 A;  4NKG B;  3RW0 A;  4WFG A;  2UUB B;  1IXB A;  1BZK A;  3JAW A;  2GDS A;  4KUM A;  3D8C A;  2W0X A;  2P6J A;  3RFR A;  3UO2 A;  3IC9 A;  1L1F A;  4R7C A;  3G71 V;  3ZRW B;  2LJ2 A;  3OTF A;  3UT5 B;  5CA3 A;  1SQP H;  1RP3 B;  1ENV A;  1HNX O;  1FAF A;  4GKK B;  4LR3 A;  3UCS C;  3VQY A;  5KUM A;  1BSM A;  1MMM A;  3JAK B;  3AG2 C;  1XQ8 A;  4IHJ A;  1WN7 A;  1EZJ A;  4I55 A;  3DTU B;  2CH7 A;  5ITZ B;  4ASU G;  4B3R O;  2ATK C;  1Q90 D;  4JF3 A;  4EEQ A;  3SR2 C;  4GKJ O;  3ABK C;  2IU3 A;  1KD1 W;  4O2A B;  1FS0 G;  2GTS A;  1E1R G;  4ZIB A;  4NTX A;  2HJD A;  2QKA A;  4IHJ B;  1HNW B;  3SYC A;  1XUQ A;  2ADQ B;  1BCC H;  3OFN G;  4JI0 B;  2ZDI A;  2HKO A;  3ZRX A;  1KYO F;  4MW8 A;  2UXB B;  1ZLZ A;  2Y0P A;  3ZHV A;  3C90 A;  3HKE A;  4G28 B;  4WCE V;  2P67 A;  1FXK A;  4DR3 O;  4KP4 A;  4JI5 B;  3OMN B;  2QWN B;  2CDY A;  2F4V O;  3BPZ A;  3U10 A;  2K9P A;  3E8F A;  1TA8 A;  5IYD O;  4U3J B;  2PI4 A;  4R8C A;  2HP8 A;  1X59 A;  2EIJ B;  1H2K A;  2XOK G;  1PPJ H;  3M99 B;  4I9W A;  2YSU B;  1M57 B;  1SKV A;  5LOV A;  5F2V O;  1QNM A;  2B1G A;  3A2F A;  1N36 B;  5GON A;  4F6E A;  2YIA A;  3L74 H;  1WPX A;  1VQL V;  1AJQ A;  1VQ5 V;  2ZKO A;  1KUQ A;  3RT3 C;  4FFK A;  1IZ3 A;  2X7R B;  3L70 H;  1AIL A;  4FLX A;  3LUT B;  1NS1 A;  4JV5 B;  1JX9 A;  1OZ0 A;  2L6L A;  2RDC A;  1N0J A;  1TVK B;  2YEV B;  1J5E O;  2H3O A;  4U7O A;  4N21 A;  1BHB A;  4BR6 A;  4DYL A;  2XAH A;  5J2U A;  1VP7 A;  4I4T A;  4B3T B;  4O4J A;  1EZV H;  3ZRS A;  3CS5 A;  2JDI G;  2JJ2 G;  2NR5 A;  1Y4M A;  4LF8 O;  1VEW A;  2XAG A;  4GX5 A;  4J7Z A;  2UU9 O;  1SER A;  3K5L A;  2IU0 A;  3A0H Z;  1SS3 A;  1XDC A;  1M93 A;  2YI8 A;  3T1H B;  3K5N A;  2HHH O;  3QNE A;  4P9P A;  1QCE A;  2AHZ A;  2DYS C;  1BGY H;  3L9D A;  2ZM6 B;  2E74 B;  4JTD B;  3JD0 A;  3TXS A;  2R9I A;  5EZY B;  5EZY A;  4TUY A;  2W6I G;  3LDC A;  2FB5 A;  3SPJ A;  1OCR C;  1K5Q A;  5FNV B;  1SA0 B;  5C8Y A;  4CS4 A;  1A32 A;  1K73 W;  3SDL A;  2WLH A;  4H13 B;  1R3K C;  1YCI A;  5B1A B;  1SZT A;  3ZBH A;  2X6B A;  4X1I B;  3CCJ V;  1R6N A;  3OTO B;  3BA9 A;  4XBF A;  2GUZ B;  2OCC C;  4MVO A;  1VQO V;  4HNA A;  3N2K A;  4X9Q A;  4D6T H;  3VQV A;  2YUA A;  4PA7 A;  4LP8 A;  2VQF O;  4GCZ A;  2QJ1 A;  2E3C A;  1VQ7 V;  4J41 A;  1PD3 A;  1QQC A;  3TET A;  1AP5 A;  2WSS G;  3HB3 B;  2ZIN A;  3CJH B;  2A0L A;  3E35 A;  4D7T A;  1B06 A;  1SF9 A;  4H44 B;  5H5N A;  1R3L C;  4BW5 A;  1AJP A;  1R1B A;  1QVG U;  1ARO P;  3GB7 C;  2QM4 A;  2Q6A A;  2IJI A;  3MHS C;  2R72 A;  4ZOL A;  3LSS A;  2WA3 A;  2YC0 A;  2XAJ A;  3LNN A;  4DR5 B;  1XMO O;  2BE3 A;  2QDO A;  1M56 C;  4PDV A;  3AK2 A;  4JZG A;  4NXM B;  2RN9 A;  4DV7 B;  4X1K B;  3SJQ C;  5IJ9 B;  4LF6 B;  3APQ A;  1AR1 B;  4NXN O;  3G6E V;  2QWP B;  3HKE B;  5EBW C;  3AK1 A;  3CRA A;  4OGQ B;  3JAL B;  2M6Y A;  2EJR A;  5IE9 A;  3FB7 C;  3N27 A;  1Q43 A;  4KFM A;  1PM9 A;  3I56 V;  5GTI Z;  3CCL V;  1HR0 B;  4G2K A;  5DED A;  1HP8 A;  1YI2 V;  4OPA A;  2B9Z A;  3UQ8 A;  5LA6 B;  2AW9 A;  2LW7 A;  4JI2 B;  3LSU A;  5LYJ A;  4DR1 O;  1G4Y B;  1HNZ B;  1Y67 A;  2LGW A;  1S5L Z;  2MW2 B;  3AG3 C;  1NI8 A;  3CMA V;  4UVC A;  3RYC A;  1FXK B;  3JD2 A;  3TGU H;  3BY6 A;  3FB8 C;  2EZP A;  1THZ A;  5CBG A;  3A0B Z;  5KAI Z;  1US6 A;  2BCC H;  3W7U A;  3SYQ A;  4FLT A;  4MTX A;  4X64 B;  1ZSP A;  4DR4 B;  3TJT A;  2P06 A;  4MVM A;  2ARH A;  3H1K H;  1HNW O;  1NTK H;  1AP6 A;  4MT8 A;  3E83 A;  1JCH A;  5JVD A;  3RYH A;  4JYC A;  3IFX A;  2A79 B;  1VF6 A;  3RWR D;  4DV6 O;  1OCC B;  1V55 C;  1EBO A;  2OCC B;  1DLB A;  1Q6H A;  2P5O A;  1GH6 A;  4A5U B;  2GHY A;  3OE7 G;  5K1X A;  1YJN V;  4P2Z A;  2ODM A;  2CAZ C;  3AG2 B;  4I0X A;  3OGI B;  4LFB O;  3JAR B;  3B8M A;  3JAR A;  1SA0 A;  2EUL A;  3CP1 A;  4AQY B;  1S5H C;  4X1K A;  3F7Y C;  1PNK A;  1DGS A;  2KG7 A;  4BIU A;  3E22 B;  1TGO A;  1Y76 A;  5B1O A;  2JIZ G;  5LHI A;  1SQF A;  1XMQ B;  5TIS Z;  4DV3 B;  3C3T A;  2LFS A;  4GX1 A;  1Q3E A;  1AVM A;  5ITZ A;  2EIL C;  2JK5 C;  3THO A;  4BW9 A;  3E2E A;  4JV5 O;  3F5T A;  2VQF B;  5EBL C;  5CB4 A;  4KXR A;  2Q4P A;  3CJH A;  2XT9 A;  1TVK A;  5C93 A;  4NR1 A;  1XEQ A;  2PTM A;  4Q20 A;  1N36 O;  3OD4 A;  3T4Z A;  4FLY A;  2V4D A;  5DM6 V;  3HR0 A;  1N34 B;  3NXS A;  4GT1 A;  1Q6U A;  1ZUQ A;  4TT3 G;  4JTA B;  1EFR G;  4HZ3 A;  2XAF A;  1UPG A;  2QKC A;  4ZHQ A;  1IBL O;  2BSK A;  3HKB B;  4DR3 B;  3WB0 A;  3JD4 A;  4TV8 A;  1FFX B;  3STZ C;  3WU2 Z;  2Q67 A;  1FYJ A;  2KKW A;  5EIB C;  3CC7 V;  5L3E A;  5LXT B;  1DF4 A;  1R6T A;  1WAZ A;  3H1J H;  1Q86 W;  4PDL A;  4MSW C;  1T5E A;  2W0F C;  2XTA A;  1VQ8 V;  4B7K A;  3OEH G;  4UUJ C;  4O2B B;  2WLK A;  3MHH C;  1JMK C;  5JWP A;  4ZI7 A;  1F4M A;  1RSO A;  5LHH A;  2YIB A;  4GYC B;  2QGN A;  4B3T O;  4WFF A;  1VQK V;  1E79 G;  4DR1 B;  2PZS A;  2N05 A;  4UXN A;  3CEI A;  3EXA A;  4AHC A;  3T1H O;  3J81 N;  4H37 A;  3BEH A;  4JYB A;  3FAV B;  2DWE C;  2OYQ A;  1PL0 A;  2YDE A;  1YDX A;  2PI5 A;  1ROP A;  3K59 A;  4K3A A;  2QSA A;  1KKC A;  4YHH B;  2JEX A;  1PP9 H;  1N4C A;  5D5P A;  3L72 H;  4JI8 B;  1WPB A;  1W2B U;  1ZAU A;  2Q7G A;  4YXW G;  3OM3 B;  2IW5 A;  4YY3 B;  1NBM G;  4DK1 A;  2F95 B;  1K4C C;  2JGD A;  1NVP B;  3R66 A;  4LFA O;  5IYB O;  3ETQ A;  3SYA A;  4G27 B;  3U11 A;  3M7M X;  5H2F Z;  3BAA A;  2L35 A;  1Z5W A;  3AG7 A;  4DR5 O;  2QWO B;  3M8A A;  4YHH O;  3ZX6 A;  1JPX A;  4CH6 A;  1IUR A;  4NYK A;  4MW3 A;  1W0K G;  3BCC H;  2UUC O;  1KC8 W;  4I50 B;  2EBO A;  3KKY A;  3ZMS A;  4YIP A;  4XDL A;  2EJ7 A;  3ABK B;  5BMV B;  3FFQ A;  2PYJ A;  4MTF A;  5FPO A;  4JAV A;  4O4H B;  2QTS A;  3RYI B;  1LR1 A;  1EM1 A;  2ILM A;  4DK0 A;  2E5L B;  3CD6 V;  1JOY A;  4KL1 A;  1NH2 B;  5LXT A;  2FTK A;  3FYI B;  3QO7 A;  4I50 A;  4JPR A;  5B1B B;  1NJI W;  2VWK A;  4O2A A;  3SYO A;  4UCO A;  3K0G A;  2BTQ A;  2ZXW C;  1BL8 A;  2LFR A;  4JI6 O;  3JYC A;  1SES A;  5L3B A;  1BS3 A;  4O4L A;  2KSD A;  3HKD B;  1QLN A;  3B09 A;  2CH7 B;  3ABM B;  1GM7 A;  1MZE A;  1ZWI C;  2DYR B;  3HKB A;  3DSQ A;  2RJZ A;  1BT8 A;  4LC1 A;  4LNU A;  2EIN C;  4J7K A;  2DOS A;  1P7G A;  5LMU B;  3JCU Z;  5EC2 C;  4DRX A;  3UT5 A;  2EIJ C;  5CBH A;  3B4S A;  3ML0 A;  1FXV A;  1AJN A;  2DW4 A;  3SPC A;  3ETE A;  4B3M B;  1XMO B;  2HJF C;  3QG5 A;  1XNR B;  5KHH A;  4CZZ A;  1G6U A;  5LMN O;  1QHT A;  2AHY A;  3ZHR A;  1XNR O;  2Z5U A;  3AG3 B;  4LF5 O;  2EIK C;  2DQ0 A;  2JS3 A;  1K34 A;  2JEU A;  4C7U A;  2IJK A;  5JH7 A;  4JGS A;  4QGP A;  4J42 A;  1Y76 B;  1K33 A;  1UJW B;  5LGT A;  2QE7 G;  3ZMV A;  3ETD A;  3G80 A;  1QU7 A;  3TXQ A;  1NU1 H;  1AR4 A;  4W4K A;  1ORQ C;  3CSX A;  2LO1 A;  1MAB G;  1E1Q G;  1YHQ V;  4LFB B;  3GWO A;  4UCU A;  5E1A C;  3ZIA G;  1QR8 A;  1NTM H;  1QLE B;  5IT9 N;  5JJN B;  1CXZ B;  1O9G A;  4RAI A;  2N04 A;  2UXD O;  1JFF B;  4LWS A;  3ZS8 C;  3QVN A;  1OV9 A;  1GKF A;  4PHZ A;  2QWQ B;  2KQX A;  4MVU A;  3Q4H B;  5KHI A;  3Q4H A;  3X2Q C;  2ZXW B;  2WLI B;  1HW7 A;  2FYU H;  4I5S A;  3VQX A;  2EIN B;  4JI5 O;  5JVD B;  4YJ2 B;  5A2Q N;  1SQX H;  4JI1 B;  3P3N A;  5EC1 C;  3FX7 A;  1FKA O;  1BE3 H;  2UXX A;  5B3S B;  1KKD A;  1MNG A;  4DR4 O;  1JFF A;  4LWS B;  1NT2 B;  1HR0 O;  1ZTE A;  3KCY A;  1CP9 A;  5CA1 A;  4X1Y B;  4HAM A;  1L0N H;  2H8P C;  4QNH B;  1Z2G A;  4FFB A;  2AXT Z;  2NN4 A;  2QTO A;  1MSW D;  1XNQ B;  1JR9 A;  3CX5 F;  1B6Q A;  3EFF K;  4DUY O;  4JI2 O;  1F23 A;  4Q6G A;  3VQW A;  3O9O A;  3CCU V;  1GN2 A;  5LBQ A;  3K5M A;  2VRZ A;  4UCS A;  2Q68 A;  1J5E B;  2UUC B;  1D5A A;  1I7F A;  4JI8 O;  5J2T A;  2QR4 A;  2PGG A;  4IL6 Z;  1I5Y A;  5KMG B;  3JAW B;  5LGN A;  1XRE A;  1R6K A;  1XL4 A;  4DV5 O;  1YTF D;  1H2G A;  2WLM A;  1M56 B;  5KAF Z;  3K0D A;  4PJ0 Z;  3W7T A;  1I94 B;  1HNX B;  2A06 H;  3I55 V;  4CBC A;  4X65 O;  1F51 A;  2OTJ V;  2P7T C;  1ZL8 A;  3LSQ A;  3RYF A;  4DUY B;  2Q7E A;  4UV9 A;  4DV5 B;  2JS5 A;  1NQT A;  4ZHQ B;  1LUW A;  3P32 A;  3SYP A;  4Z1V A;  3CME V;  3KCX A;  3ZHT A;  2EX3 A;  3JSN A;  3H9V A;  4FVM A;  1FXK C;  3BHP A;  4JAU A;  4CH3 A;  4D7S A;  3N2G B;  2WLL B;  4PA9 A;  5B3S C;  1M1K W;  1S77 D;  3APO A;  1CEZ A;  1AI4 A;  1WB7 A;  2HVJ C;  3OR7 C;  4UCR A;  5E79 Z;  3UM7 A;  2CTQ A;  2GV9 A;  1OCO B;  4FLV A;  4J9Z B;  1PL4 A;  1WP7 A;  3JAT B;  4L8J A;  4JI1 O;  4IYH A;  4DXW A;  1BHA A;  2RNB A;  2NLJ C;  3CB2 A;  5FL7 G;  4IGG A;  3CHX A;  4WFB V;  4W4L A;  2ZE5 A;  3CPW U;  1H38 A;  1VQ6 V;  4GZR B;  4FK5 C;  3ZN1 A;  1P7B A;  4DR6 O;  4UB6 Z;  5JCO A;  1IBM O;  1N34 O;  4FZ1 A;  4CC6 A;  4KHP B;  2FL4 A;  2CGO A;  3U0Z A;  5H6Q A;  3ZHU A;  1YJW V;  4PA4 A;  1W59 A;  2WWW A;  1FFT B;  3SJA C;  2C2A A;  1K97 A;  2ITD C;  5C8Y B;  4PEL A;  3OMA B;  2YXL A;  4H0L B;  1YJ9 V;  2V7Q G;  1K9M W;  3JSL A;  1NKD A;  2RCV A;  4PDR A;  3SJB C;  2Q69 A;  1D5N A;  4K8Z A;  1RPO A;  3K9A A;  5LP6 C;  1K8A W;  2G38 A;  4FJC C;  3JAM N;  4ZBM A;  2HHH B;  3E8G A;  3WB2 A;  1YEW A;  3KG2 A;  2ZD9 A;  4K35 A;  5J2U B;  1TAE A;  1GN6 A;  3RYH B;  5B5E Z;  1SET A;  2AGA A;  4YJ2 A;  3GVM A;  4JZ2 A;  2UUB O;  2Q9L A;  3K06 A;  3WG7 B;  2NNU A;  4JYY A;  4FMT A;  4TSF G;  1XMQ O;  5FLX N;  4RUF A;  1Z5V A;  2HG5 C;  3FAV A;  3PN1 A;  3ABL B;  4H33 A;  3CCQ V;  3K5O A;  1K4D C;  1NTZ H;  4MTO A;  1QR9 A;  4NVP A;  5K1P A;  4PV1 B;  4DUZ O;  1RSO B;  3FB6 C;  4LH7 A;  2HVK C;  1OCR B;  4X1I A;  5EYP B;  4JI7 O;  4QPK A;  2YXY A;  4U3F H;  1JVM A;  3G67 A;  2GTA A;  3QO5 A;  2IJJ A;  1NZ6 A;  2JJ1 G;  3CCE V;  3JD1 A;  5H9C A;  1WA8 B;  4DV2 B;  4CH4 A;  4YJ3 A;  5LMU O;  4E4E A;  1R73 A;  4DR6 B;  5CN0 A;  2DJV A;  1G1X B;  1K7D A;  4JI3 O;  4WFA V;  4JI0 O;  3DC6 A;  2EIK B;  2F4V B;  2MK3 A;  4BAY A;  1MA1 A;  3CYO A;  4YIO A;  5AG2 A;  1QLE C;  2ZNJ A;  1VQM V;  2BSK B;  2HLD G;  1S0V A;  2A7W A;  2VS0 A;  1KP3 A;  4Z2W A;  4IYI A;  3LDD A;  2HFE C;  5CB4 B;  4EB6 A;  2DWD C;  1XHZ A;  1R3I C;  4WFH A;  3WG7 C;  5LGU A;  3OUS A;  1TUE B;  4JI6 B;  5BY1 A;  3P3P A;  4GKJ B;  1OCO C;  1PKX A;  3E86 A;  4HYO A;  5KA5 A;  4LF8 B;  1VMG A;  2H94 A;  1I5X A;  1VAR A;  4QPJ A;  2ADP A;  4QJF B;  1HNZ O;  1M5I A;  1VQ4 V;  1Y74 A;  3ABL C;  5IY5 C;  2DE0 X;  4GKK O;  2P4K A;  4FIP C;  1MOF A;  2RMK B;  1BQZ A;  4NXN B;  4EFB A;  1VIB A;  2OT5 A;  3T1Y O;  3TK1 A;  4CH5 A;  3K03 A;  4DV7 O;  2LW1 A;  5H6R A;  1YZB A;  4NTW A;  3CRC A;  5BZB A;  4QE7 A;  2F93 B;  4DV1 B;  1SZX A;  2UUA B;  4JAS A;  5L3D A;  4IIJ A;  5GTH Z;  4I55 B;  3MDS A;  1O9H A;  3CCV V;  4DV4 B;  3R65 A;  5CMU A;  3FYE B;  4P30 A;  4RQF A;  1FXH A;  2A9H A;  4LCU C;  1VF6 C;  4FM2 A;  4HNA B;  4OXS A;  2CTR A;  4LFC O;  1YIT V;  4XDJ A;  2WA4 A;  1I0H A;  3E89 A;  1P49 A;  2OWO A;  5FPR A;  1OHH G;  1OCZ C;  1N0N A;  2B1I A;  3CC2 V;  5J9P C;  5IWA O;  3A0R A;  3G6B A;  1UFI A;  2UUA O;  2PF4 E;  2E75 B;  3ETG A;  4XDK A;  1H2L A;  4JYA O;  2FML A;  2IH1 C;  3JAT A;  1XIL A;  3X2Q B;  1IVS A;  4FPP A;  5L3F A;  1FD9 A;  2OIG A;  1FPO A;  1SRY A;  1WB8 A;  3E22 A;  5IYZ A;  3MAQ A;  1SQG A;  1QVF U;  4B08 A;  2OIE A;  3CXH F;  4TV9 B;  4DO2 A;  3BA8 A;  1K92 A;  2CTW A;  2WLL A;  4ZOL B;  1P4R A;  2K1E A;  5JQG A;  3RVY A;  3ABU A;  4PI0 A;  5JCO C;  4LF7 O;  5B1A C;  4OPH A;  3HPL C;  3ICX A;  3RYC B;  4IIJ B;  1KU9 A;  1R3J C;  1KMI Z;  1NVP D;  3QO8 A;  2CK3 G;  3F7V C;  1JQ0 A;  1LUV A;  1M4U A;  1LNQ A;  3ZRV A;  1N8R W;  1J95 A;  3ZMZ A;  3A8T A;  1YXB A;  4FM0 A;  3JAK A;  2HR3 A;  5B1B C;  3IGA C;  3T1C A;  2EIL B;  3ZHQ A;  5KHJ A;  2DYS B;  4B3R B;  2DYR C;  5KA6 A;  1U97 A;  4QIW F; 
#chains in the Genus database with same CATH homology
 2WLI B;  3W7S A;  4I5S A;  2EIN B;  1GM9 A;  1F4N A;  4MS2 A;  4UVA A;  2EJR A;  1GM8 A;  3FB7 C;  5EC1 C;  3W7W A;  3CCM V;  4KFM A;  3I56 V;  2UXX A;  4MVS A;  5B3S B;  3CCL V;  4PDM A;  3E8B A;  1CPY A;  1KKD A;  2UXN A;  4G2K A;  4Z1M G;  4U7N A;  1YI2 V;  1AI6 A;  1CP9 A;  5KUK A;  2QM8 A;  1K3E A;  1HWY A;  4HAM A;  2H8P C;  2LP7 A;  1G4Y B;  4QNH B;  3LNM B;  3RVZ A;  3AG3 C;  1DF5 A;  2QTO A;  3OEE G;  1MSW D;  3CMA V;  4UVC A;  1FXK B;  2Y69 B;  3ABM C;  3FB5 C;  3JD2 A;  1B6Q A;  3EFF K;  5B1N A;  3JD3 A;  3BY6 A;  3LDE A;  4QE9 A;  3FB8 C;  2EZP A;  5IY5 B;  1THZ A;  5CBG A;  3W7U A;  1Q81 W;  3SYQ A;  4GX2 A;  2Y48 A;  1F23 A;  3AG1 C;  3CCU V;  4MTX A;  1Q82 W;  2ZQM A;  5LBQ A;  2Q68 A;  2BOB C;  4X89 A;  4MVM A;  2ZR2 A;  2X0L A;  1QBZ A;  1H8H G;  5EK0 A;  1M90 W;  1YSC A;  4MT8 A;  3ASN B;  1I5Y A;  2WLI A;  3E83 A;  5LGN A;  1JCH A;  3AG4 B;  5IYC O;  1R6K A;  3OMI B;  1XL4 A;  2V1D A;  4JYC A;  1YTF D;  3K3W A;  3IFX A;  2A79 B;  1H2G A;  2EIM C;  2WLM A;  1AI7 A;  2OTL V;  3EHB B;  1M56 B;  1YIJ V;  4L87 A;  1OCC B;  1V55 C;  1EBO A;  1M9N A;  3K0D A;  3ZJZ A;  3W7T A;  2OCC B;  1DLB A;  3I55 V;  3OAA G;  4E2L A;  4P9O A;  4CBC A;  5DN6 G;  1JJ2 U;  1F51 A;  2OTJ V;  2P7T C;  2XAS A;  1Q7Y W;  2GHY A;  3OE7 G;  1YJN V;  4P2Z A;  1IXM A;  3LSQ A;  3AG2 B;  1KP2 A;  4UV9 A;  4X88 A;  3F5W C;  3JCZ A;  3K08 A;  1NQT A;  5LHG A;  3B8M A;  3P32 A;  2BOC C;  3AG1 B;  3CP1 A;  2IH3 C;  1S5H C;  3SYP A;  3CME V;  1AI5 A;  3K79 A;  2IJH A;  1FXK C;  2Y69 C;  4JAU A;  1NR7 A;  3F7Y C;  1PNK A;  3OGC C;  2WLL B;  4PA9 A;  5B3S C;  2QA4 V;  4BIU A;  1M1K W;  1S77 D;  3VOU A;  5B1O A;  5IDJ A;  2JIZ G;  1GK9 A;  5LHI A;  1CEZ A;  1AI4 A;  1G8M A;  2HVJ C;  3OR7 C;  4MVR A;  3UM7 A;  1VQ9 V;  3ZN0 A;  4RUE A;  1MG1 A;  1OCO B;  2LFS A;  4PA3 A;  2EIM B;  4J9Z B;  4MTG A;  4GX1 A;  3RW0 A;  4WFG A;  2EIL C;  2JK5 C;  1BHA A;  4DXW A;  5HFL A;  2NLJ C;  5FL7 G;  3E2E A;  3ABT A;  4KUM A;  2P6J A;  5EBL C;  4WFB V;  4EKW A;  1VQ6 V;  3CPW U;  1H38 A;  4FK5 C;  5C93 A;  3ZN1 A;  1P7B A;  1L1F A;  4X8A A;  4R7C A;  3G71 V;  3ZRW B;  4F4L A;  4MVZ A;  5CA3 A;  4Q20 A;  3T4Z A;  5H6Q A;  1ENV A;  5DM6 V;  3OW2 U;  3NXS A;  1YJW V;  4GT1 A;  4PA4 A;  2WWW A;  4TT3 G;  5KUM A;  1FFT B;  4JTA B;  2C2A A;  1EFR G;  1K97 A;  4HZ3 A;  2D3O W;  2XAF A;  3OUF A;  2Z3Y A;  2ITD C;  3AG2 C;  4PEL A;  1RPR A;  1EZJ A;  4ZKI A;  3OMA B;  3DTU B;  3TCU A;  3SPI A;  1YJ9 V;  2V7Q G;  1K9M W;  4ASU G;  1NKD A;  4PDR A;  3JD4 A;  1M57 C;  2Q69 A;  2M7W A;  4RQE A;  3T2M A;  2ATK C;  2WPD G;  3STZ C;  2Q67 A;  1RPO A;  3K9A A;  3CC7 V;  4JF3 A;  5L3E A;  1DF4 A;  1K8A W;  4FJC C;  3ABK C;  1Q86 W;  2WLN A;  1V54 C;  4ZBM A;  2IU3 A;  3E8G A;  4PDL A;  1KD1 W;  2ZR3 A;  3KG2 A;  4MSW C;  2ZD9 A;  3AG4 C;  1FS0 G;  3OR6 C;  3ZMU A;  2W0F C;  1VQ8 V;  1YTF B;  1SET A;  1K5S A;  3T4D A;  3OEH G;  2GSM B;  4UUJ C;  3D3I A;  1E1R G;  2WLK A;  3B77 A;  3MHH C;  1F4M A;  5LHH A;  3SYC A;  3K06 A;  4WFF A;  3DGE A;  3WG7 B;  1VQK V;  1E79 G;  2NNU A;  3OFN G;  4FMT A;  3G4S V;  4TSF G;  3ASO C;  2ZDI A;  2HKO A;  4RUF A;  4UXN A;  4LBE C;  3UKM A;  2HG5 C;  4H37 A;  3ZRX A;  3ABL B;  4H33 A;  4RO2 A;  3BEH A;  4JYB A;  3CCQ V;  4MW8 A;  1BMF G;  2DWE C;  1H8E G;  1PL0 A;  2PI5 A;  1ROP A;  1K4D C;  4G28 B;  4WCE V;  2P67 A;  4MTO A;  3H01 A;  1QR9 A;  1FXK A;  4MVQ A;  4KP4 A;  2JEX A;  3FB6 C;  3OMN B;  2B5U A;  2KB1 A;  3VBB A;  2HVK C;  1OCR B;  4QPK A;  1PNM A;  2YEV A;  1JVM A;  5IYD O;  3E8F A;  5CBF A;  2PI4 A;  4UV8 A;  4R8C A;  1W2B U;  2EIJ B;  1PNL A;  2IJJ A;  2XAQ A;  2XOK G;  3M99 B;  2YSU B;  3QO5 A;  1M57 B;  2JJ1 G;  2IW5 A;  3OM3 B;  1NBM G;  4YXW G;  3CCE V;  2B1G A;  3D36 A;  1K4C C;  3JD1 A;  4TWK A;  5H9C A;  1NVP B;  5IYB O;  1WPX A;  1VQL V;  3SYA A;  1AJQ A;  1R73 A;  3W7X A;  1NH2 D;  1VQ5 V;  5CN0 A;  2QKS A;  4G27 B;  1K7D A;  4WFA V;  3PJS K;  4GX0 A;  2QEX V;  2EIK B;  1COW G;  2MK3 A;  2X7R B;  4BAY A;  3CYO A;  2QM7 A;  3LUT B;  1QLE C;  1VQM V;  2HLD G;  1S0V A;  1JX9 A;  1OZ0 A;  3SPH A;  1JPX A;  1KP3 A;  2X6A A;  1WLE A;  4MW3 A;  1W0K G;  3LDD A;  2HFE C;  2YEV B;  5HFM A;  1KC8 W;  2DWD C;  1R3I C;  2EBO A;  4U7O A;  4WFH A;  3WG7 C;  5LGU A;  4N21 A;  3ZMS A;  3OUS A;  1BHB A;  4J9Y B;  1TUE B;  4XDL A;  1OCZ B;  3ABK B;  1GTO A;  2XAH A;  1OCO C;  1PKX A;  3ZRW A;  4MTF A;  4WF9 V;  3E86 A;  4HYO A;  5KA5 A;  2DQ3 A;  4JAV A;  2H94 A;  1S72 V;  1GO3 F;  3ZRS A;  1I5X A;  2JDI G;  2JJ2 G;  1V54 B;  3CD6 V;  1JOY A;  1Y4M A;  1NH2 B;  4QPJ A;  2FTK A;  3FYI B;  3QO7 A;  4QJF B;  3ASO B;  4JPR A;  5B1B B;  1NJI W;  2XAG A;  4GX5 A;  1SER A;  1VQ4 V;  2IU0 A;  3SYO A;  3ABL C;  5IY5 C;  3K0G A;  1S76 D;  5L3G A;  4FIP C;  1MOF A;  2ZXW C;  1BL8 A;  2LFR A;  3JYC A;  3QNE A;  4P9P A;  1SES A;  1QCE A;  2OT5 A;  2AHZ A;  2DYS C;  5L3B A;  4JTD B;  3TK1 A;  3K03 A;  3JD0 A;  5H6R A;  2R9I A;  1QLN A;  2ITC C;  1W0J G;  1Y66 A;  3ABM B;  2W6I G;  3LDC A;  1GM7 A;  5BZB A;  1KQS U;  4QE7 A;  3SPJ A;  1ZWI C;  3B8N A;  1OCR C;  4JAS A;  1K5Q A;  3CC4 V;  2DYR B;  5L3D A;  4LC1 A;  3K04 A;  4JTC B;  1XL6 A;  2EIN C;  3CCV V;  1K73 W;  2WLH A;  3R65 A;  5CMU A;  1R3K C;  4R6Z A;  3FYE B;  4P30 A;  4I9W A;  4RQF A;  5EC2 C;  1FXH A;  1SZT A;  2A9H A;  4LCU C;  5B1A B;  2X6B A;  4OXS A;  1S3J A;  2EIJ C;  2F43 G;  3CCJ V;  1R6N A;  1RM1 B;  5CBH A;  2OCC C;  4XBF A;  4MVO A;  1YIT V;  1VQO V;  3CCS V;  3ML0 A;  4XDJ A;  4PA6 A;  1FXV A;  1AJN A;  2DW4 A;  3SPC A;  1NR1 A;  3E89 A;  3ETE A;  3P30 A;  1OHH G;  4PA7 A;  1OCZ C;  4LP8 A;  3SPG A;  2B1I A;  2HJF C;  3CC2 V;  4GCZ A;  3RBZ A;  5J9P C;  3A0R A;  1VQ7 V;  3ZCC A;  4CZZ A;  5EBM C;  3ETG A;  4XDK A;  1PD3 A;  1V55 B;  2AHY A;  3TET A;  2Z5U A;  2IH1 C;  3X2Q B;  4BIZ A;  3AG3 B;  1VQP V;  4FPP A;  5L3F A;  2EIK C;  2DQ0 A;  2WSS G;  3ZMT A;  3HB3 B;  1SRY A;  1K34 A;  2A0L A;  1KEC A;  2JEU A;  3E35 A;  2IJK A;  2W6J G;  1R3L C;  3FKS G;  1DTO A;  4BW5 A;  1QVF U;  1AJP A;  4JGS A;  2EZO A;  4UVB A;  2XND G;  1K33 A;  3E8H A;  4DO2 A;  1UJW B;  1QVG U;  1ARO P;  5LGT A;  1K92 A;  3GB7 C;  2WLL A;  2Q6A A;  1P4R A;  2K1E A;  2QE7 G;  2IJI A;  3ZMV A;  3MD0 A;  3ETD A;  3MHS C;  3RVY A;  1ORQ C;  3ABU A;  3LSS A;  3AEI A;  3CCR V;  1VQN V;  5B1A C;  2WLJ A;  1MAB G;  2XAJ A;  3HPL C;  1E1Q G;  1YHQ V;  3GWO A;  1R3J C;  5E1A C;  3ZIA G;  1GMG A;  3ASN C;  2X6C A;  3QO8 A;  1NVP D;  2CK3 G;  1QR8 A;  1M56 C;  2ZDI C;  4PDV A;  1QLE B;  1OCC C;  1JQ0 A;  3F7V C;  1LNQ A;  4R50 A;  4RAI A;  4WFE A;  3ZRV A;  1N8R W;  1J95 A;  2WAM A;  3SJQ C;  3WFV A;  3ZMZ A;  1AR1 B;  2R9R B;  2P90 A;  1GKF A;  3CXC U;  2HR3 A;  5B1B C;  3IGA C;  3T1C A;  2EIL B;  5L3C A;  3G6E V;  1RM1 C;  4MVU A;  2DYS B;  3X2Q C;  2DYR C;  4N23 A;  5EBW C;  3STL C;  3IC7 A;  2ZXW B;  4QIW F;  5KA6 A;  5GW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...