3SJQC

Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
80
structure length
80
Chain Sequence
TQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQARKLRSVKMEQRKLNDQANTLVDLAKTQLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Calmodulin
publication title Structural basis for calmodulin as a dynamic calcium sensor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 35
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3sjqC00
4OXSA 3E8HA 2IH1C 3LNMB 4G28B 2AHZA 1BL8A 4P30A 5KUKA 1V55C 2Q67A 3IFXA 3OGCC 2HVJC 3AG2C 3STLC 5EBMC 4RUEA 4JTCB 5EC1C 2DYSC 4QE9A 5EBLC 3SYAA 4LP8A 3SYPA 3E89A 3STZC 4R6ZA 3F5WC 5CBFA 2WLIB 4X89A 5B3SC 2WLNA 4R50A 3RVZA 2A79B 5KUMA 5J9PC 3TCUA 4JTDB 3E83A 3JYCA 4J9ZB 4LCUC 2EINC 4GX2A 3RVYA 5CBGA 1K4CC 3OUFA 3IGAC 2DYRC 4H33A 2WLLA 3UM7A 3K0GA 4JTAB 1R3IC 2OCCC 3HPLC 1K4DC 2HG5C 1S5HC 3ASNC 4MVSA 1R3JC 1OCCC 3F7YC 3E86A 4GX1A 4HYOA 5B1AC 1ZWIC 5EBWC 3SJQC 2HVKC 3SPJA 2X6AA 4MW8A 2ZD9A 1M57C 1G4YB 4PA4A 4P9OA 3E8BA 3OR7C 4WFGA 3E8FA 4G27B 3K03A 3AG1C 1LNQA 3T2MA 4PDRA 4MSWC 4WFHA 3X2QC 1V54C 2Q6AA 3AG4C 4UUJC 1XL4A 3VOUA 2HFEC 2X6CA 3RBZA 2A0LA 4XDJA 4GX0A 2W0FC 3K06A 4BW5A 1QLEC 4PA3A 3TETA 4PDLA 2ITCC 3EFFK 4PA6A 2YEVA 4X88A 2IH3C 4RUFA 3ZJZA 3F7VC 4QNHB 2WLHA 2R9RB 3E8GA 3SPHA 3FB8C 2KB1A 4TWKA 3LDEA 4MTFA 3OUSA 3SPGA 2EIKC 4KFMA 2WLKA 3SYCA 1KKDA 4MVUA 4WFEA 3FB7C 4R8CA 4HZ3A 2Q69A 1P7BA 1OCOC 3FB6C 1OCRC 2ITDC 4J9YB 4XDLA 2AHYA 2WLLB 3T1CA 4MVZA 4MVQA 1J95A 4MVRA 2X6BA 4H37A 5EC2C 3PJSK 2ATKC 1XL6A 3K0DA 1R3LC 3AG3C 2WLMA 4WFFA 2QTOA 2NLJC 3R65A 2BOBC 4XDKA 3UKMA 4MTOA 2HJFC 2A9HA 5BZBA 3ASOC 3BEHA 4P2ZA 5B1BC 4MTGA 3LUTB 4RAIA 3RW0A 3SYOA 4GX5A 3WG7C 3ZRSA 4F4LA 2Q68A 3KG2A 3ABMC 4RO2A 2BOCC 1ORQC 2ZXWC 3SYQA 4EKWA 2EIMC 4PA9A 4MW3A 4PDMA 4MVOA 1OCZC 3GB7C 3LDCA 4X8AA 3OR6C 4MS2A 4PDVA 2K1EA 4P9PA 3T4DA 4LBEC 1M56C 1JVMA 3FB5C 2H8PC 2DWDC 1R3KC 3ABKC 4PA7A 3K08A 4DXWA 3ABLC 2WLJA 3LDDA 3T4ZA 5CBHA 2P7TC 5IY5C 5EK0A 2Y69C 2EILC 4MVMA 4ZBMA 4CBCA 2DWEC 2JK5C 2QKSA 4R7CA 3SPIA 5E1AC 3SPCA 4QE7A 4I9WA 2WLIA 3K04A 2EIJC
chains in the Genus database with same CATH superfamily
3ZMSA 4DV3O 3AG2C 3QO8A 2QWQB 2OTLV 4R50A 3RVZA 4O4HB 2OCCB 1EZVH 1WA8A 5F2VO 4JYAB 4LF9O 3LSUA 1IBMB 1SA0A 1KMIZ 1ZL8A 2VWKA 2KSDA 4W4KA 3ZHQA 5CMUA 3HR0A 3CMAV 5B1AC 2N74A 1BQZA 3APQA 3L71H 1GN3A 2Q7HA 4FM2A 1KUQA 4TUYA 3X2QC 5BR8O 1XL4A 2RDCA 5J2UB 3AEIA 1JJOA 3QTCA 5FPRA 2CE4A 4BR6A 2LGQA 4DYLA 2VQEO 2R70A 4N23A 4JI4B 4BWAA 1P7BA 2N05A 1KYOF 4LNUA 1S77D 1PNLA 1NR7A 1O9HA 1US6A 1XNRB 1B3QA 1WP8A 4YJ2A 2QA4V 1GRJA 2QWOB 5LGNA 4OX9B 3Q4HA 2YICA 1K5QA 5LP6A 3RYCB 1XILA 2QM4A 2CDYA 4GX5A 4LC1A 4DUYB 1M5IA 4JYYA 2XHBA 5KX5A 5FL7G 3A0BZ 1VQ8V 3GB7C 2Z0AA 1H2LA 2YXYA 3JATB 5J2TB 1RFYA 1M56C 2DN9A 1S0VA 4FZ0A 1NVPD 3CCUV 4DR1O 4KXRA 4MVMA 4CBCA 4LFBO 2YUAA 1MOFA 4R7CA 1N8RW 3SPCA 2WLIA 4YIOA 2ZNJA 1JQ0A 2EIJC 5KUKA 1LUWA 2XTAA 3IFXA 3ZMUA 1RPRA 4ZHQA 2UXDO 2WSSG 4J41A 3R66A 5KHGA 4DR7O 3ASNB 1Y66A 3A0HZ 4X1YB 2GTAA 2NNUA 1JOYA 5JH7A 2HG5C 2KQXA 3BA9A 1JX9A 4TV9A 1ZWIC 1PPJH 3JSLA 2VQFO 2BTOA 4U3FH 1CXZB 4GUNA 1Y76B 4UUJC 4B3TB 4IIJA 1QLEC 3BFRA 2P4KA 1DGSA 3CEIA 4LF4B 4ZIBA 2WA3A 1PNKA 1M4UA 1N33B 3ZHTA 3G80A 1NU1H 2LJ2A 5LHIA 1EN4A 1XBLA 2AW9A 4MVZA 1HNZB 5EC2C 1XL6A 2EJRA 2JEUA 1L0NH 3JAKB 2NLJC 4WFBV 1NVPB 5IJ0A 2A9HA 2EJ7A 4X20B 3ABMB 5L3FA 4P2ZA 2EIMB 3W7SA 3WG7C 2BOCC 4IYIA 3D36C 5BMVB 4MS2A 1Y4MA 5CA1B 2IJJA 5CB4A 3JAMN 2JJ1G 1QNMA 3UO3A 2WLJA 1JFFA 2M7WA 4DR6B 3QO5A 4ZBMA 4DV0O 2F23A 3TK1A 1FKAO 1BL8A 3KCYA 5KHKA 4JI7B 2A7WA 3STLC 2IM9A 4QIWF 1AI6A 3SYPA 5CBFA 2RJZA 4UVCA 1SS3A 2XAHA 5AG2A 1TGOA 4ICGA 3U10A 1N0JA 5CBGA 3OUFA 2Z5UA 4H33A 1ZAUA 2WLLA 4J11A 1I08A 2PGGA 3T1HB 5JWPA 3RYHA 1OCCC 1K5SA 4NVPA 1YJNV 2CK3G 5FNVB 4O4IA 1V54B 3SPJA 2PI5A 4K8ZA 1EZJA 2HHHO 3T1YO 1VIBA 2O57A 3T2MA 1NS1A 2ZR3A 3SDLA 4FM0A 4E2LA 2X6CA 1V9PA 4BW5A 3K06A 4JI6O 4BIZA 2GTSA 2IJHA 2ITCC 5LMUO 3DTUB 2VRZA 3LDEA 3OE7G 3JARB 1NT2B 4GKKO 3ASOB 3HKEA 5H6RA 1VQ7V 4KHPO 4YJ3B 1VF5B 5IT9N 2UUBO 5JVDA 4WBNB 1TA8A 1YI2V 1FJGO 2QSAA 3LUTB 2B1GA 3BAAA 1R73A 5KA6A 4FM1A 3CMEV 4IT5A 4EFBA 3BCCH 2YIDA 4DV3B 2EILB 3OW2U 4LFCO 2HKOA 1R3KC 3DC6A 2UUAO 2ADQB 2QKSA 4LF9B 1HNWO 2P4VA 2IH1C 4UCUA 5EIBD 5IWAO 2QM7A 3MHSC 4LF8O 3CCJV 2ZQMA 4X66O 1VQNV 3JD3A 3CCVV 1Q82W 5GONA 1HP8A 4Z2WA 3ZX6A 3CJHB 3H1IH 1SQFA 1HWYA 2LFSA 2YXHA 4FLZA 4GT1A 5BR8B 3UM7A 4HNAB 2CAZC 1ZUQA 4MVSA 1CEZA 2QWNB 3GWOA 3E86A 2Q8VA 2VQEB 4HYOA 3CE2A 4F6RA 5EYPB 1M57C 3G4SV 3CCEV 1KQSU 3RGBA 1QVGU 3K5OA 3RYIB 2LGWA 3SGIA 1IXMA 2R72A 4GX0A 1K8AW 2XAFA 3QO7A 2IH3C 1N32O 2FB5A 3F7VC 4DR3O 5LMNO 1GK9A 3OUSA 5IYZB 4FZ1A 2LQTA 3WB2A 5C8YA 3CCQV 3UT5A 3FB6C 3ZBHA 1IDSA 2KG7B 4J7KA 4O4JA 1YJWV 4WFFA 3CRAA 1S72V 5BZBA 2DQ3A 2ILMA 1TUBA 4WCEV 1IVSA 5L3EA 2DYSB 4DR1B 1KD1W 4FFBB 2XT9A 4LFBB 4B7KA 4N21A 4RO2A 3ZN0A 2ZXWC 2G38A 2XUMA 1TVKA 3S3WA 5LXTA 1DLBA 1EFRG 2Y69B 1Q81W 3T4DA 2JVDA 2UXDB 3UCSC 1LUVA 4BIUA 1I0HA 1W0JG 4QPJA 1Z5VA 4DR7B 1OV9A 2GHYA 4KL1A 1T5EA 1XMQO 2IU3A 3LNMB 3JAWA 3OGCC 1XDCA 2HVJC 4DV2B 4KUMA 5D5PA 4E4EA 2Z3YA 2ETNA 2Q73A 5TISZ 2F95B 2VQFB 1IURA 1WB8A 1R3IC 3HPLC 1K4DC 1R3JC 3G6EV 1WA8B 3M99B 3J7AU 2OCHA 1SA0B 1ZL8B 4PA4A 3OR7C 4WFGA 2QR4A 3K03A 4K0KB 1L0LH 5BY1A 5DM6V 1XHXA 4DR5B 4PHZA 1SQBH 4PA3A 3C90A 4QPKA 4TUYB 1GM9A 2KB1A 2EIKC 4AI8A 2WPDG 3AG3B 3CCMV 1Q86W 1OCRC 4XDLA 4IL6Z 1HNXO 4JI5O 2JGUA 3SJBC 4TQFA 4X9QA 1YF2A 2EX3A 4DRXA 1R3LC 4NB5A 1MSDA 2DQ0A 1COWG 2ZIMA 4LNUB 4MTGA 3CC7V 3E35A 4NTWA 3CC4V 2W6IG 3SYQA 1OCZC 5LP6B 1O9GA 2CUGA 3N27A 1QVFU 1Z5WA 1JVMA 1GN2A 3W7XA 2V4DA 1H2NA 4I0XA 5KX5B 1I7FA 5EK0A 5IY5C 1XQ8A 4FK5C 5LGUA 5EZYA 4I9WA 2PYJA 3K3WA 2JS5A 1IX9A 4OXSA 2AHZA 2YC0A 4O2AA 1RP3B 3ZIAG 2UUCO 1IBKO 3ZRWA 2EINB 4K3AA 5LBQA 2WLIB 4X89A 4X64B 5KUMA 3HKBB 2HHHB 3T1YB 5KLVH 3HKDA 4ZHQB 3JSNA 2CTWA 2DYRC 3JCZA 3CCLV 4JI6B 4I55A 5LMUB 1SKVA 1YTFB 2H3OA 3RYFA 5JH7B 4DUZB 4TV9B 4X1IA 4GKKB 3A0RA 4CS3A 2C2AA 1NTMH 4EFEA 2KKWA 4KHPB 3E2EA 2UUBB 4MT8A 3E8GA 2GV9A 1FJGB 3LNNA 4ZOLA 4IIJB 1WPXA 4WFEA 1RM1C 1J95A 4H37A 3ZHSA 4JI2B 1GKFA 2EIJB 3ZMTA 4XDKA 1K3EA 4LFCB 5B1BC 1P4RA 2UUAB 1OJHA 4I7ZB 1P49A 4DO2A 1E1RG 5IJ0B 4PA9A 4YHHO 4MVOA 1HNWB 3QNEA 3EHBB 3LDCA 5IWAB 1SESA 4FFKA 4LF8B 4X66B 2LP7A 1JJ2U 1Q6UA 4NTXA 1SF9A 5CB4B 3CPWU 1VARA 1ZTEA 1JFFB 5B3SB 3JALA 1V55C 5L3CA 2QWPB 1K7DA 3SJCC 3J81N 3UQ8A 2N04A 4PI0A 1RSOA 5KHHA 2WLNA 3ETQA 4J7JA 3CXCU 2XAJA 4FLXA 3OMIB 1WN7A 2OCCC 4JAVA 4GKJO 1SERA 4J10A 3H1LH 1AI4A 2Q7GA 1AR4A 1N32B 4DR3B 3BRCA 3K9AA 5GTHZ 1UFIA 4CH5A 3L9DA 5LMNB 3DGEA 2HJDA 3ZMVA 4LF5O 3OFNG 1G8MA 2EZOA 3WB0A 2QKCA 2A0LA 3ETGA 1ROPA 4NXMO 3M8AA 4X88A 1BQ0A 3FB8C 2DW4A 5K1PA 3W7UA 3OMNB 1YDXA 3FB7C 2AHYA 1MG1A 4JAUA 3FD9A 1RPOA 5DEDA 2X6BA 1BT8A 2ODMA 3U11A 3THOA 5DN6G 3K0DA 2ARHA 4UVBA 4LH6A 4UCOA 3CXHF 1W59A 4B3MO 2P67A 3BA8A 3HKEB 3SR2C 3JD0A 4TT3G 3WB1A 4O4HA 2DE0X 4LF6O 4UB8Z 2UXBO 5JVDB 3DC5A 4EKWA 1NH2D 3O9OA 2JGDA 1XMQB 3ABLB 3ABUA 4X8AA 5CA3A 4UV8A 1B06A 1F51A 1AI7A 4DXWA 1OCCB 3T4ZA 2P7TC 1QHTA 1VQMV 1S76D 1H2KA 4HBNA 4Z1MG 3DSQA 1WNSA 5JCOC 3UO2A 2FMLA 2PUSA 3KKYA 4RUEA 4QE9A 4UV9A 4R6ZA 3F5WC 4JASA 2P6JA 2CTQA 3BPZA 4UFZA 1ENVA 4XBFA 3AK3A 3FFQA 5GONB 3CRCA 5DECA 3HKCA 3ASNC 5GTIZ 1BGYH 1E1QG 1I94O 1KECA 4JV5O 4OPAA 4GX1A 5EBWC 5H6QA 3E8FA 3AG1C 2W6JG 1BS3A 1FXVA 3TXQA 3MAQA 4JI5B 1HNXB 1PM9A 3AK2A 2Y0PA 4F6RB 5H2FZ 1MABG 4GLXA 3H1HH 3IJ4A 1BCCH 3N2KB 1WP7A 5CA0B 4ZKIA 2YEVA 1BHAA 5L3BA 1FS0G 4MTFA 3TXSA 4X1KA 2D3OW 4MVUA 4R8CA 4HZ3A 1HR0O 3KCXA 5GW7A 1NH2B 3WFVA 3PJSK 3FYIB 1FFXA 3D36A 2E74B 2WLMA 1Q90D 3ML0A 5C8YB 3UT5B 2JEXA 3BEHA 3MDSA 2BE3A 3H1JH 3CRMA 1SQPH 1QLNA 4O4JB 3ABMC 2EIMC 5C93A 1KB9F 4MW3A 4PDMA 1B04A 1KP2A 1TUBB 4JGSA 1Q6IA 4DV6O 3HB3B 5L3DA 4LBEC 2UUCB 1IBKB 5LGTA 4B3RO 2H8PC 3E22B 4J80A 1G1XB 5CBHA 4DV4O 3ZRVA 2BTQA 3N2GA 2B9ZA 5LXTB 5ITZA 3CB2A 1M57B 1YHQV 1N4CA 3K04A 3OEHG 4P30A 2LW1A 1VF6C 4L8JA 3QG5A 1K9MW 4JZGA 2RCVA 2DOSA 4JTDB 3VBBA 4CH3A 5FPOA 1S5HC 4FLYA 1XNQO 4O2BA 4DK0A 1MZFA 1NTZH 3C3TA 2ZD9A 1F7YA 3VQWA 1GAXA 3CRRA 2Q4PA 2EZPA 5LYJA 1V54C 1A32A 1YEWA 1BSMA 1XUQA 4PA6A 4K8XA 4RUFA 3ZJZA 1OCOB 4QNHB 5CA1A 2R9RB 4IHJA 2PF4E 3M7MX 4JI8O 2P22C 2Q69A 4JYCA 4J9YB 4FLWA 4YHHB 2QE7G 1ZX3A 4LF7O 4EB6A 5LA6B 4H0LB 5JJEB 2L6LA 3UKMA 1G6UA 3ASOC 3JASA 4DW1A 3VQVA 1NTKH 2Q0AA 2BSKA 2MK3A 4DRXB 1FAFA 1OZ0A 4CS4A 3A2FA 3CC2V 5KMGA 1WJZA 1YXBA 5IDJA 4UCTA 5LHHA 3OD4A 3MHHC 2Y0IA 4U3JB 3CYOA 4PA7A 4FVMA 2EILC 1NR1A 2ZDIC 3RWRD 4DV5O 2DWEC 5E1AC 4QE7A 5KHIA 4UXNA 2RMKB 1S3JA 3JD2A 2YSUB 4GKJB 4CH6A 5EZYB 4Q20A 2LO1A 3RFRA 4ZI7B 3TCUA 4O2AB 4U7OA 4LF5B 1TAEA 3RVYA 3ZRWB 1Q6HA 2EIKB 3JARA 2AZ0A 1WPBA 3DXRB 1DF5A 4YY3O 1VQ6V 4B08A 4WBNA 1YSCA 3AG4B 4I50A 4B3TO 4DV7O 1AB3A 4JZ2A 3ZCCA 4G27B 5IE9A 1WLEA 3I5DA 3RYFB 3ZMZA 4PDLA 1N36O 4NKGB 3JD4A 4LR3A 4RWUA 4X1IB 4O4LA 1K97A 1ZLZA 3SPGA 4B3MB 2WLKA 1AR5A 2JDIG 2HEPA 5HFLA 4A5UB 1D5AA 4LF6B 2UXBB 4MVQA 2X0LA 4ASUG 2ATKC 1N34O 4ZOLB 2OT5A 4CC5A 2FTKA 1VQLV 2Q5ZA 1EBOA 3ZN1A 1R1BA 3CJHA 1H2SB 1WB7A 5LL6Y 3ABKB 2V1DA 4FLTA 1AR1B 5JJNB 1CP9A 4DW0A 4QGPA 3OTFA 4HNAA 3ETEA 2GBOA 4LFAO 5EIBC 1KBHA 3K79A 4DR2O 4CC6A 2Y69C 1Q7YW 2HR3A 2OTJV 3AG2B 5KHJA 1AVMA 4Z1VA 4YXWG 2GUZA 2VWJA 2R9AA 1XMOO 4YJ2B 3F5TA 4DV0B 3RYIA 1XREA 1YVWA 2JRIA 5EBLC 3ZEDA 3LSQA 3Q4HB 1I94B 4JV5B 1PP9H 2NR5A 2GDSA 2P5OA 1FXKC 2QKAA 1VEWA 3LSSA 3JALB 4BAYA 4RQEA 2RQ6A 4UCRA 5KA5A 1NQTA 4U7NA 4GX2A 4Q6GA 5B1AB 1RSOB 3K9SA 1RM1B 3FYEB 3WU2Z 4X62O 2RN9A 2RNBA 5LOVA 3X2QB 3A8TA 4MW8A 4PV1B 4FLVA 5B1BB 4MSWC 1ZSPA 1Y74A 1AILA 1VQKV 1M9NA 3OM3B 1QQCA 3BHPA 2W0FC 4I4TA 3TETA 1UJWB 3EFFK 2F43G 1P7GA 3CS5A 3SYCA 2XAQA 4DR4O 1X59A 2ADPA 5A2QN 2ITDC 1EN6A 2XNDG 1PL0A 4JF3A 1IBLO 5H9CA 4NR1A 3P3PA 4DV6B 3AG3C 2DJVA 1FXKA 5IJ9A 4B3RB 1K92A 3VQXA 4DV4B 2LW7A 1GTOA 2IU0A 4W4LA 3FAVA 2UU9O 2ZINA 2B1IA 1M56B 1WAZA 3NR7A 2EULA 4P9PA 4RQFA 4DV1O 4FJCC 5LP6C 3K5NA 4AQYO 2HLDG 3FKSG 2JGDB 3K59A 4QJFB 4JI3O 3G6BA 1XEQA 4G28B 4NXNO 1SQXH 2Q67A 5EC1C 1Q3EA 1XNQB 2V7QG 3ZHRA 2OIGA 2CH7A 2A79B 4KP4A 1K34A 3JYCA 4J9ZB 4LWSA 2EINC 5JQGA 1VMGA 3K58A 3K0GA 4WFAV 2UXCO 4JPRA 4EEQA 2QEXV 1EN5A 5FLXN 2PYLA 5JJJB 1G4YB 3B40A 3HKCB 1VQ9V 5B5EZ 3ICXA 3ZHVA 2IJIA 4JI8B 1QLEB 3VQYA 1SZXA 3CD6V 4X65O 2IW5A 1Q8IA 4TSFG 2XASA 2OYQA 4LF7B 4H44B 3PN1A 1MA1A 3ETDA 2Y4UA 1FD9A 2A3QA 1M93A 1FYJA 1SQVH 2YEVB 2IBZH 2WLLB 1L1FA 3OTOO 1AI5A 1MNGA 2QDOA 3D8CA 1AP6A 1FPOA 3RYHB 1HW7A 1VQOV 4X1KB 1SETA 3WG7B 4O4IB 4JI0O 2HJFC 1U96A 4AHCA 1H8EG 2ZKOA 1FFXB 4AILC 3SYOA 4F4LA 3HKBA 4DV5B 1Y67A 4G2KA 2E5LO 3BY6A 3B2EE 4JAAA 1I5XA 3K5LA 1BMFG 4TV8A 3OEEG 4I9QA 5K1XA 1M1KW 1GM8A 3L70H 2DWDC 1VP7A 2WWWA 2F4VO 1U97A 3CX5F 1BE3H 3H01A 2AZ2A 3SPIA 4DV2O 4FLUA 1KU9A 1JA8A 3CWBH 3AG1B 3E8HA 1SQGA 2P90A 2BTQB 3N2GB 4YY3B 4JTCB 5ITZB 3SYAA 3RN4A 1D5NA 2Q0OC 3L75H 5B3SC 4UVAA 1IZ3A 2AGAA 4DV7B 4BIOA 3D3IA 4LCUC 1URFA 2CTPA 1K4CC 3IGAC 4JI1O 1KC8W 1QBZA 3F7YC 1YITV 1N36B 4PJ0Z 4K0KO 3IC9A 5J2UA 4DR5O 1F4NA 5L3GA 1TUEB 1LNQA 4WFHA 1EM1A 4F6EA 4FPPA 4GYCB 4O2BB 5HFMA 1MZEA 1DK1A 2WAMA 1N34B 2Y48A 1SRYA 5LYJB 3ZRXA 2R9IA 1SZTA 2YIBA 4D7SA 1PD3A 2QTSA 1AJPA 4YIPA 1XHZA 1KKCA 2QJ1A 4IHJB 3RYCA 3AG7A 2QTOA 4B3SO 2AXTZ 5B1OA 3IC7A 4LFAB 1CPYA 2QGNA 4DR2B 3ZHUA 3JATA 5J2TA 3ZRSA 4EB6B 1J5EO 4HAMA 2JS3A 2Q7EA 3JASB 1XMOB 2BSKB 3I55V 5JCOA 4PDVA 2K1EA 1H2GA 5E79Z 2ZNIA 3CCSV 1GMGA 1Y6XA 4BW9A 1XI1A 3ABLC 5KMGB 1PV0A 3O65A 2FKXA 1X4TA 2Q9LA 2JK5C 1GH6A 2DMXA 1YJ9V 2PTMA 4X64O 1YCIA 5BXZA 4X62B 4CH4A 4LP8A 3STZC 4X1YA 3CCRV 1MMMA 4L87A 3TGUH 3B4SA 2OWOA 4OGQB 1MSWD 3BVOA 2ZM6O 2X7RB 1UPGA 1TVKB 1AP5A 4NTYA 1JPXA 4PI2A 3U0ZA 1AROP 3G67A 3L72H 4DUZO 5LHGA 4UB6Z 1SQQH 1Y76A 3SJQC 3TJTA 1JCHA 3B8MA 3E8BA 4JYAO 4DR4B 2H94A 1F23A 1IBMO 2XOKG 3JAWB 3L74H 1FFTB 3BABA 3FX7A 2HFEC 3RBZA 1QR9A 4I50B 3W7WA 2E3CA 1IBLB 4JYBA 5KAIZ 3B8NA 3CP1A 1QCEA 3SPHA 1K73W 1GN6A 2JJ2G 4KFMA 2M6YA 3JAKA 1KKDA 3CRQA 2FL4A 4JI2O 2UU9B 4X20A 1R6TA 4MVRA 4O4LB 2Y4TA 2PZSA 2QWRB 4D6TH 1F4MA 3R65A 4MTOA 4PELA 2ZXWB 4DV1B 4JI4O 2VS0A 5BMVA 4AQYB 1QU7A 4OPHA 4C7UA 1QR8A 2E75B 1NI8A 4JI3B 2Q68A 3KG2A 3JCUZ 3QF7A 4J42A 1XNRO 3P32A 2D2CB 4GZRB 4NXNB 1VF6A 1H2MA 4GCZA 1JMKC 4OX9O 3K08A 3K5MA 1GO3F 2YIAA 2JIZG 1N0NA 2OIEA 4DUYO 5H5NA 2CGOA 1BHBA 1Q5OA 2P06A 1D2DA 5B1NA 2ZT9B 4PD4F 3SJAC 1JR9A 2UXCB 5KAFZ 3N2KA 5CN0A 3OMAB 1NKDA 5CA0A 2GUZB 1VF7A 1VQ4V 3E83A 2FYUH 3OT7A 4TQDA 5FNVA 3J80N 4NYKA 3KZIZ 2BCCH 4X65B 3CSXA 4JTAB 4LH7A 2QM8A 2ZE6A 4B7EA 2EBOA 4I0XB 1FXHA 3ZS8C 2NN4A 1R6KA 4IGGA 2PY5A 1BZKA 2CGNA 5IYDO 4MTXA 4WF9V 2K9PA 3VOUA 2MW2B 5LOVB 2IJKA 3OTOB 3RT3C 4XDJA 2ZE7A 3L73H 2LFRA 4JI0B 2WLHA 1OCRB 1Y74B 3E22A 1VQPV 1NBMG 4NXMB 4YJ3A 1NJIW 4I4TB 3H1KH 3HKDB 1L8DA 1OCOC 3T1CA 2E5LB 5D5QA 4FIPC 4IYHA 2UXXA 2YI9A 1GN4A 2YDEA 4I55B 3S3XA 4LF4O 1Z2GA 3IAYA 2F4VB 5IYCO 1H8HG 1N33O 2ZDIA 1OCZB 4I5SA 1NZ6A 3EXAA 1W2BU 1FXKB 2ZE8A 1AJQA 3B77A 5IJ9B 1ORQC 4H13B 1HNZO 1GM7A 1Q43A 2W0XA 3AK1A 5IY5B 4CZZA 2ZR2A 3GWKC 2B5UA 3FAVB 3FB5C 3OGIB 3C3SA 3LDDA 2ZIOA 2F1MA 3GVMA 3EVKA 1I5YA 2L35A 1KP3A 4JI1B 4D7TA 3P30A 5EBMC 3P3NA 1S5JA 2DYSC 1DTOA 3E89A 3I56V 2UXNA 2WA4A 1THZA 1VQ5V 2DYRB 4DR6O 5J9PC 2E76B 2YI8A 1OHHG 2YS8A 4UCSA 5EYPA 1AJNA 2CH7B 5A9GA 4JI7O 5IYBO 2ZCEA 1S5LZ 1YTFD 3H9VA 3W7TA 4LWSB 5JQGB 5LA6A 2HVKC 2F93B 2CTRA 2X6AA 4P9OA 3OAAG 1XOUA 4PDRA 1PKXA 2Q6AA 4ABMA 2PI4A 3AG4C 3MD0A 5IYZA 3T1HO 1P84F 3ABTA 4B3SB 3G71V 3JD1A 1M90W 4TWKA 4U3JA 2KG7A 1HDJA 1PNMA 3B09A 1B6QA 2A06H 1YZBA 3CHXA 1J5EB 4UCVA 1E79G 3NXSA 1H38A 1W0KG 4CS2A 1HR0B 4FFBA 2BOBC 1R6NA 2XAGA 4RAIA 4ZI7A 2GSMB 3RW0A 2YXLA 2F66C 3QVNA 1YIJV 2ZE5A 5B66Z 1LR1A 3OR6C 3DXRA 2YIBD 4DK1A 1PL4A 4TOIA 3ABKC 2HP8A 3APOA 4TV8B 4FMTA 1SC5B 1IXBA 1K33A 1V55B 2ZM6B 3K57A 4J7ZA 1DF4A 4K35A 3D3QA
chains in the Genus database with same CATH topology
3E8HA 4P30A 3LNMB 3ZMSA 3OGCC 2P90A 2HVJC 3AG2C 4JTCB 4KUMA 3SYAA 3QO8A 1K9MW 2Z3YA 2OTLV 5B3SC 4R50A 3RVZA 4JTDB 4UVAA 2OCCB 3VBBA 3D3IA 4LCUC 1K4CC 3IGAC 1R3IC 1KC8W 3HPLC 1K4DC 1S5HC 5CMUA 1QBZA 1R3JC 3F7YC 3G6EV 1YITV 3CMAV 3M99B 5B1AC 2ZD9A 4PA4A 1F4NA 5L3GA 1TUEB 3OR7C 4WFGA 3K03A 1LNQA 2EZPA 5DM6V 4WFHA 4FPPA 3X2QC 1V54C 5HFMA 1XL4A 3AEIA 2WAMA 2Y48A 4PA3A 4PA6A 1SRYA 4QPKA 4RUFA 3ZJZA 1OCOB 4QNHB 2R9RB 3ZRXA 1GM9A 2KB1A 2R9IA 4N23A 1SZTA 2EIKC 1PD3A 1AJPA 2WPDG 3AG3B 2Q69A 3CCMV 1P7BA 1Q86W 4JYCA 1OCRC 4J9YB 4XDLA 1S77D 1PNLA 1NR7A 2QE7G 1R3LC 2QA4V 2QTOA 2DQ0A 1COWG 5B1OA 3UKMA 5LGNA 3IC7A 3ASOC 4MTGA 1CPYA 1K5QA 3CC7V 3E35A 2MK3A 4GX5A 3ZRSA 4LC1A 3CC4V 2W6IG 4HAMA 1OZ0A 3SYQA 3CC2V 5IDJA 5FL7G 1VQ8V 1OCZC 3GB7C 3I55V 5LHHA 4PDVA 1QVFU 2K1EA 1H2GA 1M56C 1JVMA 3MHHC 1S0VA 3CCSV 1GMGA 3CYOA 3CCUV 4PA7A 1NVPD 3W7XA 3ABLC 5IY5C 5EK0A 2EILC 1NR1A 2ZDIC 4MVMA 4CBCA 2DWEC 1MOFA 2JK5C 4R7CA 1N8RW 4FK5C 5E1AC 3SPCA 4QE7A 5LGUA 4I9WA 3K3WA 4UXNA 2WLIA 1JQ0A 2EIJC 4OXSA 2AHZA 5KUKA 1YJ9V 3IFXA 3ZIAG 3ZMUA 1S3JA 3JD2A 2YSUB 1RPRA 3ZRWA 4LP8A 2EINB 3STZC 3CCRV 4Q20A 4L87A 2WSSG 5LBQA 2WLIB 4X89A 2IU3A 5KUMA 1MSWD 3TCUA 4U7OA 3RVYA 2X7RB 3ASNB 3ZRWB 1Y66A 2EIKB 2DYRC 3JCZA 1JPXA 2NNUA 3CCLV 1DF5A 1JOYA 2HG5C 1AROP 1JX9A 1VQ6V 5LHGA 1ZWIC 3SJQC 1YTFB 1YSCA 3AG4B 1JCHA 3B8MA 3E8BA 3ZCCA 4G27B 2H94A 1F23A 2XOKG 1WLEA 4UUJC 1FFTB 2HFEC 3A0RA 3RBZA 1QR9A 3W7WA 2C2AA 1QLEC 3ZMZA 4PDLA 3JD4A 4JYBA 3E2EA 4MT8A 3B8NA 3CP1A 1QCEA 3E8GA 3SPHA 1K73W 1K97A 2JJ2G 3SPGA 4KFMA 1PNKA 2WLKA 1KKDA 2JDIG 1WPXA 4WFEA 5HFLA 5LHIA 1RM1C 4MVZA 4MVQA 1J95A 4MVRA 4H37A 5EC2C 2X0LA 4ASUG 2ATKC 1XL6A 2EJRA 2JEUA 1F4MA 2OT5A 1GKFA 2EIJB 2NLJC 4WFBV 3ZMTA 3R65A 4XDKA 1K3EA 2FTKA 4MTOA 1VQLV 4PELA 2A9HA 1NVPB 3ABMB 5L3FA 1EBOA 2ZXWB 4P2ZA 5B1BC 3ZN1A 2EIMB 3W7SA 1P4RA 1QR8A 3WG7C 2Q68A 3KG2A 2BOCC 1E1RG 4DO2A 4PA9A 3ABKB 3P32A 4MVOA 2V1DA 3QNEA 1AR1B 3EHBB 3LDCA 1SESA 1CP9A 4MS2A 1Y4MA 2IJJA 3ETEA 4GCZA 2JJ1G 2LP7A 1JJ2U 3K08A 3K79A 2WLJA 1GO3F 2M7WA 2Y69C 1Q7YW 2JIZG 2HR3A 3QO5A 4ZBMA 2OTJV 3AG2B 1BHBA 3TK1A 3CPWU 4YXWG 5B1NA 1BL8A 5B3SB 5L3CA 1V55C 1K7DA 3STLC 5CN0A 3OMAB 4QIWF 1AI6A 5EBLC 1NKDA 3LSQA 3SYPA 5CBFA 4UVCA 2WLNA 1FXKC 1VQ4V 2XAHA 3LSSA 4BAYA 4RQEA 3E83A 5KA5A 3CXCU 1NQTA 2XAJA 4U7NA 4GX2A 3OMIB 5CBGA 3OUFA 2Z5UA 4H33A 5B1AB 2WLLA 4JTAB 1RM1B 2OCCC 3FYEB 4JAVA 2QM8A 1OCCC 1K5SA 1SERA 1YJNV 2CK3G 2EBOA 1AI4A 3X2QB 1V54B 3K9AA 1FXHA 4MW8A 3SPJA 2PI5A 1EZJA 3DGEA 3ZMVA 5B1BB 1R6KA 3T2MA 3OFNG 4MSWC 2ZR3A 5IYDO 4MTXA 4WF9V 4E2LA 3VOUA 1VQKV 1G8MA 1M9NA 2EZOA 2IJKA 2X6CA 3OM3B 2A0LA 4XDJA 2W0FC 3ETGA 3K06A 4BW5A 1ROPA 4BIZA 3TETA 1UJWB 2IJHA 2ITCC 3EFFK 2F43G 4X88A 2LFRA 2WLHA 1OCRB 3DTUB 3FB8C 2DW4A 3W7UA 3LDEA 3SYCA 1VQPV 1NBMG 3OMNB 2XAQA 3OE7G 1NJIW 3FB7C 1OCOC 2ITDC 3T1CA 2AHYA 1MG1A 4FIPC 4JAUA 2XNDG 1PL0A 1RPOA 4JF3A 2UXXA 2X6BA 3ASOB 5H9CA 5H6RA 5DN6G 1VQ7V 3K0DA 3AG3C 4UVBA 1FXKA 1K92A 1YI2V 5IYCO 3LUTB 1H8HG 2P67A 1GTOA 1OCZB 2ZDIA 2B1GA 3JD0A 4I5SA 4TT3G 2IU0A 1R73A 1W2BU 1FXKB 3B77A 1AJQA 1ORQC 4EKWA 2B1IA 1M56B 5KA6A 1GM7A 3CMEV 1NH2D 3ABLB 3ABUA 4X8AA 5CA3A 5IY5B 2EILB 4CZZA 4P9PA 2ZR2A 2B5UA 3OW2U 3FB5C 4UV8A 2HKOA 4RQFA 1R3KC 1F51A 1AI7A 4FJCC 4DXWA 3LDDA 1OCCB 3T4ZA 2P7TC 2HLDG 3FKSG 1VQMV 1S76D 4QJFB 2QKSA 4Z1MG 1I5YA 1KP3A 2IH1C 4G28B 2QM7A 3MHSC 2Q67A 3CCJV 2ZQMA 3P30A 5EBMC 1VQNV 3JD3A 3CCVV 4RUEA 1Q82W 5EC1C 2DYSC 4QE9A 4UV9A 2V7QG 1DTOA 3E89A 3I56V 4R6ZA 2UXNA 3F5WC 1THZA 1VQ5V 4JASA 2P6JA 2DYRB 2A79B 5J9PC 1ENVA 4XBFA 4KP4A 1K34A 1HWYA 2LFSA 3JYCA 4J9ZB 1OHHG 2EINC 4GT1A 1AJNA 3UM7A 3K0GA 5IYBO 4WFAV 1YTFD 3ASNC 4MVSA 1E1QG 4JPRA 2QEXV 3GWOA 1KECA 3W7TA 1CEZA 3E86A 4GX1A 4HYOA 5EBWC 2HVKC 2X6AA 1G4YB 1M57C 3G4SV 1VQ9V 4P9OA 5H6QA 3OAAG 3E8FA 3CCEV 3AG1C 2IJIA 1KQSU 4PDRA 2W6JG 1QLEB 1PKXA 3CD6V 1FXVA 2Q6AA 2IW5A 2PI4A 3AG4C 1QVGU 3MD0A 4TSFG 1IXMA 1MABG 2XASA 4GX0A 1K8AW 2XAFA 3QO7A 4ZKIA 2YEVA 3ABTA 2IH3C 3G71V 3JD1A 3ETDA 3F7VC 1BHAA 1M90W 5L3BA 4TWKA 1GK9A 1FS0G 4MTFA 3OUSA 2D3OW 1PNMA 4MVUA 1B6QA 4R8CA 3CCQV 4HZ3A 3FB6C 2YEVB 5GW7A 2WLLB 1NH2B 1L1FA 1AI5A 3WFVA 3PJSK 3FYIB 1E79G 3NXSA 3D36A 1H38A 1W0KG 1VQOV 1YJWV 2WLMA 4WFFA 3ML0A 1SETA 3WG7B 2BOBC 2JEXA 1S72V 2HJFC 5BZBA 2DQ3A 3BEHA 1R6NA 1H8EG 2XAGA 4RAIA 4WCEV 5L3EA 1QLNA 2DYSB 2GSMB 3RW0A 3SYOA 4F4LA 1KD1W 4G2KA 4N21A 3ABMC 4RO2A 3BY6A 3ZN0A 2ZXWC 1YIJV 2EIMC 5C93A 4MW3A 1I5XA 4PDMA 4JGSA 1KP2A 1BMFG 3OEEG 3HB3B 5L3DA 1M1KW 1GM8A 1DLBA 1EFRG 2Y69B 3OR6C 1Q81W 3T4DA 4LBEC 5LGTA 2H8PC 2DWDC 2WWWA 3ABKC 5CBHA 3ZRVA 4BIUA 4FMTA 3H01A 1K33A 1V55B 1W0JG 4QPJA 1M57B 3SPIA 2GHYA 1YHQV 1DF4A 3K04A 3OEHG 3AG1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OXS A;  3E8H A;  2IH1 C;  3LNM B;  4G28 B;  2AHZ A;  1BL8 A;  4P30 A;  5KUK A;  1V55 C;  2Q67 A;  3IFX A;  3OGC C;  2HVJ C;  3AG2 C;  3STL C;  5EBM C;  4RUE A;  4JTC B;  5EC1 C;  2DYS C;  4QE9 A;  5EBL C;  3SYA A;  4LP8 A;  3SYP A;  3E89 A;  3STZ C;  4R6Z A;  3F5W C;  5CBF A;  2WLI B;  4X89 A;  5B3S C;  2WLN A;  4R50 A;  3RVZ A;  2A79 B;  5KUM A;  5J9P C;  3TCU A;  4JTD B;  3E83 A;  3JYC A;  4J9Z B;  4LCU C;  2EIN C;  4GX2 A;  3RVY A;  5CBG A;  1K4C C;  3OUF A;  3IGA C;  2DYR C;  4H33 A;  2WLL A;  3UM7 A;  3K0G A;  4JTA B;  1R3I C;  2OCC C;  3HPL C;  1K4D C;  2HG5 C;  1S5H C;  3ASN C;  4MVS A;  1R3J C;  1OCC C;  3F7Y C;  3E86 A;  4GX1 A;  4HYO A;  5B1A C;  1ZWI C;  5EBW C;  3SJQ C;  2HVK C;  3SPJ A;  2X6A A;  4MW8 A;  2ZD9 A;  1M57 C;  1G4Y B;  4PA4 A;  4P9O A;  3E8B A;  3OR7 C;  4WFG A;  3E8F A;  4G27 B;  3K03 A;  3AG1 C;  1LNQ A;  3T2M A;  4PDR A;  4MSW C;  4WFH A;  3X2Q C;  1V54 C;  2Q6A A;  3AG4 C;  4UUJ C;  1XL4 A;  3VOU A;  2HFE C;  2X6C A;  3RBZ A;  2A0L A;  4XDJ A;  4GX0 A;  2W0F C;  3K06 A;  4BW5 A;  1QLE C;  4PA3 A;  3TET A;  4PDL A;  2ITC C;  3EFF K;  4PA6 A;  2YEV A;  4X88 A;  2IH3 C;  4RUF A;  3ZJZ A;  3F7V C;  4QNH B;  2WLH A;  2R9R B;  3E8G A;  3SPH A;  3FB8 C;  2KB1 A;  4TWK A;  3LDE A;  4MTF A;  3OUS A;  3SPG A;  2EIK C;  4KFM A;  2WLK A;  3SYC A;  1KKD A;  4MVU A;  4WFE A;  3FB7 C;  4R8C A;  4HZ3 A;  2Q69 A;  1P7B A;  1OCO C;  3FB6 C;  1OCR C;  2ITD C;  4J9Y B;  4XDL A;  2AHY A;  2WLL B;  3T1C A;  4MVZ A;  4MVQ A;  1J95 A;  4MVR A;  2X6B A;  4H37 A;  5EC2 C;  3PJS K;  2ATK C;  1XL6 A;  3K0D A;  1R3L C;  3AG3 C;  2WLM A;  4WFF A;  2QTO A;  2NLJ C;  3R65 A;  2BOB C;  4XDK A;  3UKM A;  4MTO A;  2HJF C;  2A9H A;  5BZB A;  3ASO C;  3BEH A;  4P2Z A;  5B1B C;  4MTG A;  3LUT B;  4RAI A;  3RW0 A;  3SYO A;  4GX5 A;  3WG7 C;  3ZRS A;  4F4L A;  2Q68 A;  3KG2 A;  3ABM C;  4RO2 A;  2BOC C;  1ORQ C;  2ZXW C;  3SYQ A;  4EKW A;  2EIM C;  4PA9 A;  4MW3 A;  4PDM A;  4MVO A;  1OCZ C;  3GB7 C;  3LDC A;  4X8A A;  3OR6 C;  4MS2 A;  4PDV A;  2K1E A;  4P9P A;  3T4D A;  4LBE C;  1M56 C;  1JVM A;  3FB5 C;  2H8P C;  2DWD C;  1R3K C;  3ABK C;  4PA7 A;  3K08 A;  4DXW A;  3ABL C;  2WLJ A;  3LDD A;  3T4Z A;  5CBH A;  2P7T C;  5IY5 C;  5EK0 A;  2Y69 C;  2EIL C;  4MVM A;  4ZBM A;  4CBC A;  2DWE C;  2JK5 C;  2QKS A;  4R7C A;  3SPI A;  5E1A C;  3SPC A;  4QE7 A;  4I9W A;  2WLI A;  3K04 A;  2EIJ C; 
#chains in the Genus database with same CATH topology
 3ZMS A;  4DV3 O;  3AG2 C;  3QO8 A;  2QWQ B;  2OTL V;  4R50 A;  3RVZ A;  4O4H B;  2OCC B;  1EZV H;  1WA8 A;  5F2V O;  4JYA B;  4LF9 O;  3LSU A;  1IBM B;  1SA0 A;  1KMI Z;  1ZL8 A;  2VWK A;  2KSD A;  4W4K A;  3ZHQ A;  5CMU A;  3HR0 A;  3CMA V;  5B1A C;  2N74 A;  1BQZ A;  3APQ A;  3L71 H;  1GN3 A;  2Q7H A;  4FM2 A;  1KUQ A;  4TUY A;  3X2Q C;  5BR8 O;  1XL4 A;  2RDC A;  5J2U B;  3AEI A;  1JJO A;  3QTC A;  5FPR A;  2CE4 A;  4BR6 A;  2LGQ A;  4DYL A;  2VQE O;  2R70 A;  4N23 A;  4JI4 B;  4BWA A;  1P7B A;  2N05 A;  1KYO F;  4LNU A;  1S77 D;  1PNL A;  1NR7 A;  1O9H A;  1US6 A;  1XNR B;  1B3Q A;  1WP8 A;  4YJ2 A;  2QA4 V;  1GRJ A;  2QWO B;  5LGN A;  4OX9 B;  3Q4H A;  2YIC A;  1K5Q A;  5LP6 A;  3RYC B;  1XIL A;  2QM4 A;  2CDY A;  4GX5 A;  4LC1 A;  4DUY B;  1M5I A;  4JYY A;  2XHB A;  5KX5 A;  5FL7 G;  3A0B Z;  1VQ8 V;  3GB7 C;  2Z0A A;  1H2L A;  2YXY A;  3JAT B;  5J2T B;  1RFY A;  1M56 C;  2DN9 A;  1S0V A;  4FZ0 A;  1NVP D;  3CCU V;  4DR1 O;  4KXR A;  4MVM A;  4CBC A;  4LFB O;  2YUA A;  1MOF A;  4R7C A;  1N8R W;  3SPC A;  2WLI A;  4YIO A;  2ZNJ A;  1JQ0 A;  2EIJ C;  5KUK A;  1LUW A;  2XTA A;  3IFX A;  3ZMU A;  1RPR A;  4ZHQ A;  2UXD O;  2WSS G;  4J41 A;  3R66 A;  5KHG A;  4DR7 O;  3ASN B;  1Y66 A;  3A0H Z;  4X1Y B;  2GTA A;  2NNU A;  1JOY A;  5JH7 A;  2HG5 C;  2KQX A;  3BA9 A;  1JX9 A;  4TV9 A;  1ZWI C;  1PPJ H;  3JSL A;  2VQF O;  2BTO A;  4U3F H;  1CXZ B;  4GUN A;  1Y76 B;  4UUJ C;  4B3T B;  4IIJ A;  1QLE C;  3BFR A;  2P4K A;  1DGS A;  3CEI A;  4LF4 B;  4ZIB A;  2WA3 A;  1PNK A;  1M4U A;  1N33 B;  3ZHT A;  3G80 A;  1NU1 H;  2LJ2 A;  5LHI A;  1EN4 A;  1XBL A;  2AW9 A;  4MVZ A;  1HNZ B;  5EC2 C;  1XL6 A;  2EJR A;  2JEU A;  1L0N H;  3JAK B;  2NLJ C;  4WFB V;  1NVP B;  5IJ0 A;  2A9H A;  2EJ7 A;  4X20 B;  3ABM B;  5L3F A;  4P2Z A;  2EIM B;  3W7S A;  3WG7 C;  2BOC C;  4IYI A;  3D36 C;  5BMV B;  4MS2 A;  1Y4M A;  5CA1 B;  2IJJ A;  5CB4 A;  3JAM N;  2JJ1 G;  1QNM A;  3UO3 A;  2WLJ A;  1JFF A;  2M7W A;  4DR6 B;  3QO5 A;  4ZBM A;  4DV0 O;  2F23 A;  3TK1 A;  1FKA O;  1BL8 A;  3KCY A;  5KHK A;  4JI7 B;  2A7W A;  3STL C;  2IM9 A;  4QIW F;  1AI6 A;  3SYP A;  5CBF A;  2RJZ A;  4UVC A;  1SS3 A;  2XAH A;  5AG2 A;  1TGO A;  4ICG A;  3U10 A;  1N0J A;  5CBG A;  3OUF A;  2Z5U A;  4H33 A;  1ZAU A;  2WLL A;  4J11 A;  1I08 A;  2PGG A;  3T1H B;  5JWP A;  3RYH A;  1OCC C;  1K5S A;  4NVP A;  1YJN V;  2CK3 G;  5FNV B;  4O4I A;  1V54 B;  3SPJ A;  2PI5 A;  4K8Z A;  1EZJ A;  2HHH O;  3T1Y O;  1VIB A;  2O57 A;  3T2M A;  1NS1 A;  2ZR3 A;  3SDL A;  4FM0 A;  4E2L A;  2X6C A;  1V9P A;  4BW5 A;  3K06 A;  4JI6 O;  4BIZ A;  2GTS A;  2IJH A;  2ITC C;  5LMU O;  3DTU B;  2VRZ A;  3LDE A;  3OE7 G;  3JAR B;  1NT2 B;  4GKK O;  3ASO B;  3HKE A;  5H6R A;  1VQ7 V;  4KHP O;  4YJ3 B;  1VF5 B;  5IT9 N;  2UUB O;  5JVD A;  4WBN B;  1TA8 A;  1YI2 V;  1FJG O;  2QSA A;  3LUT B;  2B1G A;  3BAA A;  1R73 A;  5KA6 A;  4FM1 A;  3CME V;  4IT5 A;  4EFB A;  3BCC H;  2YID A;  4DV3 B;  2EIL B;  3OW2 U;  4LFC O;  2HKO A;  1R3K C;  3DC6 A;  2UUA O;  2ADQ B;  2QKS A;  4LF9 B;  1HNW O;  2P4V A;  2IH1 C;  4UCU A;  5EIB D;  5IWA O;  2QM7 A;  3MHS C;  4LF8 O;  3CCJ V;  2ZQM A;  4X66 O;  1VQN V;  3JD3 A;  3CCV V;  1Q82 W;  5GON A;  1HP8 A;  4Z2W A;  3ZX6 A;  3CJH B;  3H1I H;  1SQF A;  1HWY A;  2LFS A;  2YXH A;  4FLZ A;  4GT1 A;  5BR8 B;  3UM7 A;  4HNA B;  2CAZ C;  1ZUQ A;  4MVS A;  1CEZ A;  2QWN B;  3GWO A;  3E86 A;  2Q8V A;  2VQE B;  4HYO A;  3CE2 A;  4F6R A;  5EYP B;  1M57 C;  3G4S V;  3CCE V;  1KQS U;  3RGB A;  1QVG U;  3K5O A;  3RYI B;  2LGW A;  3SGI A;  1IXM A;  2R72 A;  4GX0 A;  1K8A W;  2XAF A;  3QO7 A;  2IH3 C;  1N32 O;  2FB5 A;  3F7V C;  4DR3 O;  5LMN O;  1GK9 A;  3OUS A;  5IYZ B;  4FZ1 A;  2LQT A;  3WB2 A;  5C8Y A;  3CCQ V;  3UT5 A;  3FB6 C;  3ZBH A;  1IDS A;  2KG7 B;  4J7K A;  4O4J A;  1YJW V;  4WFF A;  3CRA A;  1S72 V;  5BZB A;  2DQ3 A;  2ILM A;  1TUB A;  4WCE V;  1IVS A;  5L3E A;  2DYS B;  4DR1 B;  1KD1 W;  4FFB B;  2XT9 A;  4LFB B;  4B7K A;  4N21 A;  4RO2 A;  3ZN0 A;  2ZXW C;  2G38 A;  2XUM A;  1TVK A;  3S3W A;  5LXT A;  1DLB A;  1EFR G;  2Y69 B;  1Q81 W;  3T4D A;  2JVD A;  2UXD B;  3UCS C;  1LUV A;  4BIU A;  1I0H A;  1W0J G;  4QPJ A;  1Z5V A;  4DR7 B;  1OV9 A;  2GHY A;  4KL1 A;  1T5E A;  1XMQ O;  2IU3 A;  3LNM B;  3JAW A;  3OGC C;  1XDC A;  2HVJ C;  4DV2 B;  4KUM A;  5D5P A;  4E4E A;  2Z3Y A;  2ETN A;  2Q73 A;  5TIS Z;  2F95 B;  2VQF B;  1IUR A;  1WB8 A;  1R3I C;  3HPL C;  1K4D C;  1R3J C;  3G6E V;  1WA8 B;  3M99 B;  3J7A U;  2OCH A;  1SA0 B;  1ZL8 B;  4PA4 A;  3OR7 C;  4WFG A;  2QR4 A;  3K03 A;  4K0K B;  1L0L H;  5BY1 A;  5DM6 V;  1XHX A;  4DR5 B;  4PHZ A;  1SQB H;  4PA3 A;  3C90 A;  4QPK A;  4TUY B;  1GM9 A;  2KB1 A;  2EIK C;  4AI8 A;  2WPD G;  3AG3 B;  3CCM V;  1Q86 W;  1OCR C;  4XDL A;  4IL6 Z;  1HNX O;  4JI5 O;  2JGU A;  3SJB C;  4TQF A;  4X9Q A;  1YF2 A;  2EX3 A;  4DRX A;  1R3L C;  4NB5 A;  1MSD A;  2DQ0 A;  1COW G;  2ZIM A;  4LNU B;  4MTG A;  3CC7 V;  3E35 A;  4NTW A;  3CC4 V;  2W6I G;  3SYQ A;  1OCZ C;  5LP6 B;  1O9G A;  2CUG A;  3N27 A;  1QVF U;  1Z5W A;  1JVM A;  1GN2 A;  3W7X A;  2V4D A;  1H2N A;  4I0X A;  5KX5 B;  1I7F A;  5EK0 A;  5IY5 C;  1XQ8 A;  4FK5 C;  5LGU A;  5EZY A;  4I9W A;  2PYJ A;  3K3W A;  2JS5 A;  1IX9 A;  4OXS A;  2AHZ A;  2YC0 A;  4O2A A;  1RP3 B;  3ZIA G;  2UUC O;  1IBK O;  3ZRW A;  2EIN B;  4K3A A;  5LBQ A;  2WLI B;  4X89 A;  4X64 B;  5KUM A;  3HKB B;  2HHH B;  3T1Y B;  5KLV H;  3HKD A;  4ZHQ B;  3JSN A;  2CTW A;  2DYR C;  3JCZ A;  3CCL V;  4JI6 B;  4I55 A;  5LMU B;  1SKV A;  1YTF B;  2H3O A;  3RYF A;  5JH7 B;  4DUZ B;  4TV9 B;  4X1I A;  4GKK B;  3A0R A;  4CS3 A;  2C2A A;  1NTM H;  4EFE A;  2KKW A;  4KHP B;  3E2E A;  2UUB B;  4MT8 A;  3E8G A;  2GV9 A;  1FJG B;  3LNN A;  4ZOL A;  4IIJ B;  1WPX A;  4WFE A;  1RM1 C;  1J95 A;  4H37 A;  3ZHS A;  4JI2 B;  1GKF A;  2EIJ B;  3ZMT A;  4XDK A;  1K3E A;  4LFC B;  5B1B C;  1P4R A;  2UUA B;  1OJH A;  4I7Z B;  1P49 A;  4DO2 A;  1E1R G;  5IJ0 B;  4PA9 A;  4YHH O;  4MVO A;  1HNW B;  3QNE A;  3EHB B;  3LDC A;  5IWA B;  1SES A;  4FFK A;  4LF8 B;  4X66 B;  2LP7 A;  1JJ2 U;  1Q6U A;  4NTX A;  1SF9 A;  5CB4 B;  3CPW U;  1VAR A;  1ZTE A;  1JFF B;  5B3S B;  3JAL A;  1V55 C;  5L3C A;  2QWP B;  1K7D A;  3SJC C;  3J81 N;  3UQ8 A;  2N04 A;  4PI0 A;  1RSO A;  5KHH A;  2WLN A;  3ETQ A;  4J7J A;  3CXC U;  2XAJ A;  4FLX A;  3OMI B;  1WN7 A;  2OCC C;  4JAV A;  4GKJ O;  1SER A;  4J10 A;  3H1L H;  1AI4 A;  2Q7G A;  1AR4 A;  1N32 B;  4DR3 B;  3BRC A;  3K9A A;  5GTH Z;  1UFI A;  4CH5 A;  3L9D A;  5LMN B;  3DGE A;  2HJD A;  3ZMV A;  4LF5 O;  3OFN G;  1G8M A;  2EZO A;  3WB0 A;  2QKC A;  2A0L A;  3ETG A;  1ROP A;  4NXM O;  3M8A A;  4X88 A;  1BQ0 A;  3FB8 C;  2DW4 A;  5K1P A;  3W7U A;  3OMN B;  1YDX A;  3FB7 C;  2AHY A;  1MG1 A;  4JAU A;  3FD9 A;  1RPO A;  5DED A;  2X6B A;  1BT8 A;  2ODM A;  3U11 A;  3THO A;  5DN6 G;  3K0D A;  2ARH A;  4UVB A;  4LH6 A;  4UCO A;  3CXH F;  1W59 A;  4B3M O;  2P67 A;  3BA8 A;  3HKE B;  3SR2 C;  3JD0 A;  4TT3 G;  3WB1 A;  4O4H A;  2DE0 X;  4LF6 O;  4UB8 Z;  2UXB O;  5JVD B;  3DC5 A;  4EKW A;  1NH2 D;  3O9O A;  2JGD A;  1XMQ B;  3ABL B;  3ABU A;  4X8A A;  5CA3 A;  4UV8 A;  1B06 A;  1F51 A;  1AI7 A;  4DXW A;  1OCC B;  3T4Z A;  2P7T C;  1QHT A;  1VQM V;  1S76 D;  1H2K A;  4HBN A;  4Z1M G;  3DSQ A;  1WNS A;  5JCO C;  3UO2 A;  2FML A;  2PUS A;  3KKY A;  4RUE A;  4QE9 A;  4UV9 A;  4R6Z A;  3F5W C;  4JAS A;  2P6J A;  2CTQ A;  3BPZ A;  4UFZ A;  1ENV A;  4XBF A;  3AK3 A;  3FFQ A;  5GON B;  3CRC A;  5DEC A;  3HKC A;  3ASN C;  5GTI Z;  1BGY H;  1E1Q G;  1I94 O;  1KEC A;  4JV5 O;  4OPA A;  4GX1 A;  5EBW C;  5H6Q A;  3E8F A;  3AG1 C;  2W6J G;  1BS3 A;  1FXV A;  3TXQ A;  3MAQ A;  4JI5 B;  1HNX B;  1PM9 A;  3AK2 A;  2Y0P A;  4F6R B;  5H2F Z;  1MAB G;  4GLX A;  3H1H H;  3IJ4 A;  1BCC H;  3N2K B;  1WP7 A;  5CA0 B;  4ZKI A;  2YEV A;  1BHA A;  5L3B A;  1FS0 G;  4MTF A;  3TXS A;  4X1K A;  2D3O W;  4MVU A;  4R8C A;  4HZ3 A;  1HR0 O;  3KCX A;  5GW7 A;  1NH2 B;  3WFV A;  3PJS K;  3FYI B;  1FFX A;  3D36 A;  2E74 B;  2WLM A;  1Q90 D;  3ML0 A;  5C8Y B;  3UT5 B;  2JEX A;  3BEH A;  3MDS A;  2BE3 A;  3H1J H;  3CRM A;  1SQP H;  1QLN A;  4O4J B;  3ABM C;  2EIM C;  5C93 A;  1KB9 F;  4MW3 A;  4PDM A;  1B04 A;  1KP2 A;  1TUB B;  4JGS A;  1Q6I A;  4DV6 O;  3HB3 B;  5L3D A;  4LBE C;  2UUC B;  1IBK B;  5LGT A;  4B3R O;  2H8P C;  3E22 B;  4J80 A;  1G1X B;  5CBH A;  4DV4 O;  3ZRV A;  2BTQ A;  3N2G A;  2B9Z A;  5LXT B;  5ITZ A;  3CB2 A;  1M57 B;  1YHQ V;  1N4C A;  3K04 A;  3OEH G;  4P30 A;  2LW1 A;  1VF6 C;  4L8J A;  3QG5 A;  1K9M W;  4JZG A;  2RCV A;  2DOS A;  4JTD B;  3VBB A;  4CH3 A;  5FPO A;  1S5H C;  4FLY A;  1XNQ O;  4O2B A;  4DK0 A;  1MZF A;  1NTZ H;  3C3T A;  2ZD9 A;  1F7Y A;  3VQW A;  1GAX A;  3CRR A;  2Q4P A;  2EZP A;  5LYJ A;  1V54 C;  1A32 A;  1YEW A;  1BSM A;  1XUQ A;  4PA6 A;  4K8X A;  4RUF A;  3ZJZ A;  1OCO B;  4QNH B;  5CA1 A;  2R9R B;  4IHJ A;  2PF4 E;  3M7M X;  4JI8 O;  2P22 C;  2Q69 A;  4JYC A;  4J9Y B;  4FLW A;  4YHH B;  2QE7 G;  1ZX3 A;  4LF7 O;  4EB6 A;  5LA6 B;  4H0L B;  5JJE B;  2L6L A;  3UKM A;  1G6U A;  3ASO C;  3JAS A;  4DW1 A;  3VQV A;  1NTK H;  2Q0A A;  2BSK A;  2MK3 A;  4DRX B;  1FAF A;  1OZ0 A;  4CS4 A;  3A2F A;  3CC2 V;  5KMG A;  1WJZ A;  1YXB A;  5IDJ A;  4UCT A;  5LHH A;  3OD4 A;  3MHH C;  2Y0I A;  4U3J B;  3CYO A;  4PA7 A;  4FVM A;  2EIL C;  1NR1 A;  2ZDI C;  3RWR D;  4DV5 O;  2DWE C;  5E1A C;  4QE7 A;  5KHI A;  4UXN A;  2RMK B;  1S3J A;  3JD2 A;  2YSU B;  4GKJ B;  4CH6 A;  5EZY B;  4Q20 A;  2LO1 A;  3RFR A;  4ZI7 B;  3TCU A;  4O2A B;  4U7O A;  4LF5 B;  1TAE A;  3RVY A;  3ZRW B;  1Q6H A;  2EIK B;  3JAR A;  2AZ0 A;  1WPB A;  3DXR B;  1DF5 A;  4YY3 O;  1VQ6 V;  4B08 A;  4WBN A;  1YSC A;  3AG4 B;  4I50 A;  4B3T O;  4DV7 O;  1AB3 A;  4JZ2 A;  3ZCC A;  4G27 B;  5IE9 A;  1WLE A;  3I5D A;  3RYF B;  3ZMZ A;  4PDL A;  1N36 O;  4NKG B;  3JD4 A;  4LR3 A;  4RWU A;  4X1I B;  4O4L A;  1K97 A;  1ZLZ A;  3SPG A;  4B3M B;  2WLK A;  1AR5 A;  2JDI G;  2HEP A;  5HFL A;  4A5U B;  1D5A A;  4LF6 B;  2UXB B;  4MVQ A;  2X0L A;  4ASU G;  2ATK C;  1N34 O;  4ZOL B;  2OT5 A;  4CC5 A;  2FTK A;  1VQL V;  2Q5Z A;  1EBO A;  3ZN1 A;  1R1B A;  3CJH A;  1H2S B;  1WB7 A;  5LL6 Y;  3ABK B;  2V1D A;  4FLT A;  1AR1 B;  5JJN B;  1CP9 A;  4DW0 A;  4QGP A;  3OTF A;  4HNA A;  3ETE A;  2GBO A;  4LFA O;  5EIB C;  1KBH A;  3K79 A;  4DR2 O;  4CC6 A;  2Y69 C;  1Q7Y W;  2HR3 A;  2OTJ V;  3AG2 B;  5KHJ A;  1AVM A;  4Z1V A;  4YXW G;  2GUZ A;  2VWJ A;  2R9A A;  1XMO O;  4YJ2 B;  3F5T A;  4DV0 B;  3RYI A;  1XRE A;  1YVW A;  2JRI A;  5EBL C;  3ZED A;  3LSQ A;  3Q4H B;  1I94 B;  4JV5 B;  1PP9 H;  2NR5 A;  2GDS A;  2P5O A;  1FXK C;  2QKA A;  1VEW A;  3LSS A;  3JAL B;  4BAY A;  4RQE A;  2RQ6 A;  4UCR A;  5KA5 A;  1NQT A;  4U7N A;  4GX2 A;  4Q6G A;  5B1A B;  1RSO B;  3K9S A;  1RM1 B;  3FYE B;  3WU2 Z;  4X62 O;  2RN9 A;  2RNB A;  5LOV A;  3X2Q B;  3A8T A;  4MW8 A;  4PV1 B;  4FLV A;  5B1B B;  4MSW C;  1ZSP A;  1Y74 A;  1AIL A;  1VQK V;  1M9N A;  3OM3 B;  1QQC A;  3BHP A;  2W0F C;  4I4T A;  3TET A;  1UJW B;  3EFF K;  2F43 G;  1P7G A;  3CS5 A;  3SYC A;  2XAQ A;  4DR4 O;  1X59 A;  2ADP A;  5A2Q N;  2ITD C;  1EN6 A;  2XND G;  1PL0 A;  4JF3 A;  1IBL O;  5H9C A;  4NR1 A;  3P3P A;  4DV6 B;  3AG3 C;  2DJV A;  1FXK A;  5IJ9 A;  4B3R B;  1K92 A;  3VQX A;  4DV4 B;  2LW7 A;  1GTO A;  2IU0 A;  4W4L A;  3FAV A;  2UU9 O;  2ZIN A;  2B1I A;  1M56 B;  1WAZ A;  3NR7 A;  2EUL A;  4P9P A;  4RQF A;  4DV1 O;  4FJC C;  5LP6 C;  3K5N A;  4AQY O;  2HLD G;  3FKS G;  2JGD B;  3K59 A;  4QJF B;  4JI3 O;  3G6B A;  1XEQ A;  4G28 B;  4NXN O;  1SQX H;  2Q67 A;  5EC1 C;  1Q3E A;  1XNQ B;  2V7Q G;  3ZHR A;  2OIG A;  2CH7 A;  2A79 B;  4KP4 A;  1K34 A;  3JYC A;  4J9Z B;  4LWS A;  2EIN C;  5JQG A;  1VMG A;  3K58 A;  3K0G A;  4WFA V;  2UXC O;  4JPR A;  4EEQ A;  2QEX V;  1EN5 A;  5FLX N;  2PYL A;  5JJJ B;  1G4Y B;  3B40 A;  3HKC B;  1VQ9 V;  5B5E Z;  3ICX A;  3ZHV A;  2IJI A;  4JI8 B;  1QLE B;  3VQY A;  1SZX A;  3CD6 V;  4X65 O;  2IW5 A;  1Q8I A;  4TSF G;  2XAS A;  2OYQ A;  4LF7 B;  4H44 B;  3PN1 A;  1MA1 A;  3ETD A;  2Y4U A;  1FD9 A;  2A3Q A;  1M93 A;  1FYJ A;  1SQV H;  2YEV B;  2IBZ H;  2WLL B;  1L1F A;  3OTO O;  1AI5 A;  1MNG A;  2QDO A;  3D8C A;  1AP6 A;  1FPO A;  3RYH B;  1HW7 A;  1VQO V;  4X1K B;  1SET A;  3WG7 B;  4O4I B;  4JI0 O;  2HJF C;  1U96 A;  4AHC A;  1H8E G;  2ZKO A;  1FFX B;  4AIL C;  3SYO A;  4F4L A;  3HKB A;  4DV5 B;  1Y67 A;  4G2K A;  2E5L O;  3BY6 A;  3B2E E;  4JAA A;  1I5X A;  3K5L A;  1BMF G;  4TV8 A;  3OEE G;  4I9Q A;  5K1X A;  1M1K W;  1GM8 A;  3L70 H;  2DWD C;  1VP7 A;  2WWW A;  2F4V O;  1U97 A;  3CX5 F;  1BE3 H;  3H01 A;  2AZ2 A;  3SPI A;  4DV2 O;  4FLU A;  1KU9 A;  1JA8 A;  3CWB H;  3AG1 B;  3E8H A;  1SQG A;  2P90 A;  2BTQ B;  3N2G B;  4YY3 B;  4JTC B;  5ITZ B;  3SYA A;  3RN4 A;  1D5N A;  2Q0O C;  3L75 H;  5B3S C;  4UVA A;  1IZ3 A;  2AGA A;  4DV7 B;  4BIO A;  3D3I A;  4LCU C;  1URF A;  2CTP A;  1K4C C;  3IGA C;  4JI1 O;  1KC8 W;  1QBZ A;  3F7Y C;  1YIT V;  1N36 B;  4PJ0 Z;  4K0K O;  3IC9 A;  5J2U A;  4DR5 O;  1F4N A;  5L3G A;  1TUE B;  1LNQ A;  4WFH A;  1EM1 A;  4F6E A;  4FPP A;  4GYC B;  4O2B B;  5HFM A;  1MZE A;  1DK1 A;  2WAM A;  1N34 B;  2Y48 A;  1SRY A;  5LYJ B;  3ZRX A;  2R9I A;  1SZT A;  2YIB A;  4D7S A;  1PD3 A;  2QTS A;  1AJP A;  4YIP A;  1XHZ A;  1KKC A;  2QJ1 A;  4IHJ B;  3RYC A;  3AG7 A;  2QTO A;  4B3S O;  2AXT Z;  5B1O A;  3IC7 A;  4LFA B;  1CPY A;  2QGN A;  4DR2 B;  3ZHU A;  3JAT A;  5J2T A;  3ZRS A;  4EB6 B;  1J5E O;  4HAM A;  2JS3 A;  2Q7E A;  3JAS B;  1XMO B;  2BSK B;  3I55 V;  5JCO A;  4PDV A;  2K1E A;  1H2G A;  5E79 Z;  2ZNI A;  3CCS V;  1GMG A;  1Y6X A;  4BW9 A;  1XI1 A;  3ABL C;  5KMG B;  1PV0 A;  3O65 A;  2FKX A;  1X4T A;  2Q9L A;  2JK5 C;  1GH6 A;  2DMX A;  1YJ9 V;  2PTM A;  4X64 O;  1YCI A;  5BXZ A;  4X62 B;  4CH4 A;  4LP8 A;  3STZ C;  4X1Y A;  3CCR V;  1MMM A;  4L87 A;  3TGU H;  3B4S A;  2OWO A;  4OGQ B;  1MSW D;  3BVO A;  2ZM6 O;  2X7R B;  1UPG A;  1TVK B;  1AP5 A;  4NTY A;  1JPX A;  4PI2 A;  3U0Z A;  1ARO P;  3G67 A;  3L72 H;  4DUZ O;  5LHG A;  4UB6 Z;  1SQQ H;  1Y76 A;  3SJQ C;  3TJT A;  1JCH A;  3B8M A;  3E8B A;  4JYA O;  4DR4 B;  2H94 A;  1F23 A;  1IBM O;  2XOK G;  3JAW B;  3L74 H;  1FFT B;  3BAB A;  3FX7 A;  2HFE C;  3RBZ A;  1QR9 A;  4I50 B;  3W7W A;  2E3C A;  1IBL B;  4JYB A;  5KAI Z;  3B8N A;  3CP1 A;  1QCE A;  3SPH A;  1K73 W;  1GN6 A;  2JJ2 G;  4KFM A;  2M6Y A;  3JAK A;  1KKD A;  3CRQ A;  2FL4 A;  4JI2 O;  2UU9 B;  4X20 A;  1R6T A;  4MVR A;  4O4L B;  2Y4T A;  2PZS A;  2QWR B;  4D6T H;  1F4M A;  3R65 A;  4MTO A;  4PEL A;  2ZXW B;  4DV1 B;  4JI4 O;  2VS0 A;  5BMV A;  4AQY B;  1QU7 A;  4OPH A;  4C7U A;  1QR8 A;  2E75 B;  1NI8 A;  4JI3 B;  2Q68 A;  3KG2 A;  3JCU Z;  3QF7 A;  4J42 A;  1XNR O;  3P32 A;  2D2C B;  4GZR B;  4NXN B;  1VF6 A;  1H2M A;  4GCZ A;  1JMK C;  4OX9 O;  3K08 A;  3K5M A;  1GO3 F;  2YIA A;  2JIZ G;  1N0N A;  2OIE A;  4DUY O;  5H5N A;  2CGO A;  1BHB A;  1Q5O A;  2P06 A;  1D2D A;  5B1N A;  2ZT9 B;  4PD4 F;  3SJA C;  1JR9 A;  2UXC B;  5KAF Z;  3N2K A;  5CN0 A;  3OMA B;  1NKD A;  5CA0 A;  2GUZ B;  1VF7 A;  1VQ4 V;  3E83 A;  2FYU H;  3OT7 A;  4TQD A;  5FNV A;  3J80 N;  4NYK A;  3KZI Z;  2BCC H;  4X65 B;  3CSX A;  4JTA B;  4LH7 A;  2QM8 A;  2ZE6 A;  4B7E A;  2EBO A;  4I0X B;  1FXH A;  3ZS8 C;  2NN4 A;  1R6K A;  4IGG A;  2PY5 A;  1BZK A;  2CGN A;  5IYD O;  4MTX A;  4WF9 V;  2K9P A;  3VOU A;  2MW2 B;  5LOV B;  2IJK A;  3OTO B;  3RT3 C;  4XDJ A;  2ZE7 A;  3L73 H;  2LFR A;  4JI0 B;  2WLH A;  1OCR B;  1Y74 B;  3E22 A;  1VQP V;  1NBM G;  4NXM B;  4YJ3 A;  1NJI W;  4I4T B;  3H1K H;  3HKD B;  1L8D A;  1OCO C;  3T1C A;  2E5L B;  5D5Q A;  4FIP C;  4IYH A;  2UXX A;  2YI9 A;  1GN4 A;  2YDE A;  4I55 B;  3S3X A;  4LF4 O;  1Z2G A;  3IAY A;  2F4V B;  5IYC O;  1H8H G;  1N33 O;  2ZDI A;  1OCZ B;  4I5S A;  1NZ6 A;  3EXA A;  1W2B U;  1FXK B;  2ZE8 A;  1AJQ A;  3B77 A;  5IJ9 B;  1ORQ C;  4H13 B;  1HNZ O;  1GM7 A;  1Q43 A;  2W0X A;  3AK1 A;  5IY5 B;  4CZZ A;  2ZR2 A;  3GWK C;  2B5U A;  3FAV B;  3FB5 C;  3OGI B;  3C3S A;  3LDD A;  2ZIO A;  2F1M A;  3GVM A;  3EVK A;  1I5Y A;  2L35 A;  1KP3 A;  4JI1 B;  4D7T A;  3P30 A;  5EBM C;  3P3N A;  1S5J A;  2DYS C;  1DTO A;  3E89 A;  3I56 V;  2UXN A;  2WA4 A;  1THZ A;  1VQ5 V;  2DYR B;  4DR6 O;  5J9P C;  2E76 B;  2YI8 A;  1OHH G;  2YS8 A;  4UCS A;  5EYP A;  1AJN A;  2CH7 B;  5A9G A;  4JI7 O;  5IYB O;  2ZCE A;  1S5L Z;  1YTF D;  3H9V A;  3W7T A;  4LWS B;  5JQG B;  5LA6 A;  2HVK C;  2F93 B;  2CTR A;  2X6A A;  4P9O A;  3OAA G;  1XOU A;  4PDR A;  1PKX A;  2Q6A A;  4ABM A;  2PI4 A;  3AG4 C;  3MD0 A;  5IYZ A;  3T1H O;  1P84 F;  3ABT A;  4B3S B;  3G71 V;  3JD1 A;  1M90 W;  4TWK A;  4U3J A;  2KG7 A;  1HDJ A;  1PNM A;  3B09 A;  1B6Q A;  2A06 H;  1YZB A;  3CHX A;  1J5E B;  4UCV A;  1E79 G;  3NXS A;  1H38 A;  1W0K G;  4CS2 A;  1HR0 B;  4FFB A;  2BOB C;  1R6N A;  2XAG A;  4RAI A;  4ZI7 A;  2GSM B;  3RW0 A;  2YXL A;  2F66 C;  3QVN A;  1YIJ V;  2ZE5 A;  5B66 Z;  1LR1 A;  3OR6 C;  3DXR A;  2YIB D;  4DK1 A;  1PL4 A;  4TOI A;  3ABK C;  2HP8 A;  3APO A;  4TV8 B;  4FMT A;  1SC5 B;  1IXB A;  1K33 A;  1V55 B;  2ZM6 B;  3K57 A;  4J7Z A;  1DF4 A;  4K35 A;  3D3Q A; 
#chains in the Genus database with same CATH homology
 3E8H A;  4P30 A;  3LNM B;  3ZMS A;  3OGC C;  2P90 A;  2HVJ C;  3AG2 C;  4JTC B;  4KUM A;  3SYA A;  3QO8 A;  1K9M W;  2Z3Y A;  2OTL V;  5B3S C;  4R50 A;  3RVZ A;  4JTD B;  4UVA A;  2OCC B;  3VBB A;  3D3I A;  4LCU C;  1K4C C;  3IGA C;  1R3I C;  1KC8 W;  3HPL C;  1K4D C;  1S5H C;  5CMU A;  1QBZ A;  1R3J C;  3F7Y C;  3G6E V;  1YIT V;  3CMA V;  3M99 B;  5B1A C;  2ZD9 A;  4PA4 A;  1F4N A;  5L3G A;  1TUE B;  3OR7 C;  4WFG A;  3K03 A;  1LNQ A;  2EZP A;  5DM6 V;  4WFH A;  4FPP A;  3X2Q C;  1V54 C;  5HFM A;  1XL4 A;  3AEI A;  2WAM A;  2Y48 A;  4PA3 A;  4PA6 A;  1SRY A;  4QPK A;  4RUF A;  3ZJZ A;  1OCO B;  4QNH B;  2R9R B;  3ZRX A;  1GM9 A;  2KB1 A;  2R9I A;  4N23 A;  1SZT A;  2EIK C;  1PD3 A;  1AJP A;  2WPD G;  3AG3 B;  2Q69 A;  3CCM V;  1P7B A;  1Q86 W;  4JYC A;  1OCR C;  4J9Y B;  4XDL A;  1S77 D;  1PNL A;  1NR7 A;  2QE7 G;  1R3L C;  2QA4 V;  2QTO A;  2DQ0 A;  1COW G;  5B1O A;  3UKM A;  5LGN A;  3IC7 A;  3ASO C;  4MTG A;  1CPY A;  1K5Q A;  3CC7 V;  3E35 A;  2MK3 A;  4GX5 A;  3ZRS A;  4LC1 A;  3CC4 V;  2W6I G;  4HAM A;  1OZ0 A;  3SYQ A;  3CC2 V;  5IDJ A;  5FL7 G;  1VQ8 V;  1OCZ C;  3GB7 C;  3I55 V;  5LHH A;  4PDV A;  1QVF U;  2K1E A;  1H2G A;  1M56 C;  1JVM A;  3MHH C;  1S0V A;  3CCS V;  1GMG A;  3CYO A;  3CCU V;  4PA7 A;  1NVP D;  3W7X A;  3ABL C;  5IY5 C;  5EK0 A;  2EIL C;  1NR1 A;  2ZDI C;  4MVM A;  4CBC A;  2DWE C;  1MOF A;  2JK5 C;  4R7C A;  1N8R W;  4FK5 C;  5E1A C;  3SPC A;  4QE7 A;  5LGU A;  4I9W A;  3K3W A;  4UXN A;  2WLI A;  1JQ0 A;  2EIJ C;  4OXS A;  2AHZ A;  5KUK A;  1YJ9 V;  3IFX A;  3ZIA G;  3ZMU A;  1S3J A;  3JD2 A;  2YSU B;  1RPR A;  3ZRW A;  4LP8 A;  2EIN B;  3STZ C;  3CCR V;  4Q20 A;  4L87 A;  2WSS G;  5LBQ A;  2WLI B;  4X89 A;  2IU3 A;  5KUM A;  1MSW D;  3TCU A;  4U7O A;  3RVY A;  2X7R B;  3ASN B;  3ZRW B;  1Y66 A;  2EIK B;  2DYR C;  3JCZ A;  1JPX A;  2NNU A;  3CCL V;  1DF5 A;  1JOY A;  2HG5 C;  1ARO P;  1JX9 A;  1VQ6 V;  5LHG A;  1ZWI C;  3SJQ C;  1YTF B;  1YSC A;  3AG4 B;  1JCH A;  3B8M A;  3E8B A;  3ZCC A;  4G27 B;  2H94 A;  1F23 A;  2XOK G;  1WLE A;  4UUJ C;  1FFT B;  2HFE C;  3A0R A;  3RBZ A;  1QR9 A;  3W7W A;  2C2A A;  1QLE C;  3ZMZ A;  4PDL A;  3JD4 A;  4JYB A;  3E2E A;  4MT8 A;  3B8N A;  3CP1 A;  1QCE A;  3E8G A;  3SPH A;  1K73 W;  1K97 A;  2JJ2 G;  3SPG A;  4KFM A;  1PNK A;  2WLK A;  1KKD A;  2JDI G;  1WPX A;  4WFE A;  5HFL A;  5LHI A;  1RM1 C;  4MVZ A;  4MVQ A;  1J95 A;  4MVR A;  4H37 A;  5EC2 C;  2X0L A;  4ASU G;  2ATK C;  1XL6 A;  2EJR A;  2JEU A;  1F4M A;  2OT5 A;  1GKF A;  2EIJ B;  2NLJ C;  4WFB V;  3ZMT A;  3R65 A;  4XDK A;  1K3E A;  2FTK A;  4MTO A;  1VQL V;  4PEL A;  2A9H A;  1NVP B;  3ABM B;  5L3F A;  1EBO A;  2ZXW B;  4P2Z A;  5B1B C;  3ZN1 A;  2EIM B;  3W7S A;  1P4R A;  1QR8 A;  3WG7 C;  2Q68 A;  3KG2 A;  2BOC C;  1E1R G;  4DO2 A;  4PA9 A;  3ABK B;  3P32 A;  4MVO A;  2V1D A;  3QNE A;  1AR1 B;  3EHB B;  3LDC A;  1SES A;  1CP9 A;  4MS2 A;  1Y4M A;  2IJJ A;  3ETE A;  4GCZ A;  2JJ1 G;  2LP7 A;  1JJ2 U;  3K08 A;  3K79 A;  2WLJ A;  1GO3 F;  2M7W A;  2Y69 C;  1Q7Y W;  2JIZ G;  2HR3 A;  3QO5 A;  4ZBM A;  2OTJ V;  3AG2 B;  1BHB A;  3TK1 A;  3CPW U;  4YXW G;  5B1N A;  1BL8 A;  5B3S B;  5L3C A;  1V55 C;  1K7D A;  3STL C;  5CN0 A;  3OMA B;  4QIW F;  1AI6 A;  5EBL C;  1NKD A;  3LSQ A;  3SYP A;  5CBF A;  4UVC A;  2WLN A;  1FXK C;  1VQ4 V;  2XAH A;  3LSS A;  4BAY A;  4RQE A;  3E83 A;  5KA5 A;  3CXC U;  1NQT A;  2XAJ A;  4U7N A;  4GX2 A;  3OMI B;  5CBG A;  3OUF A;  2Z5U A;  4H33 A;  5B1A B;  2WLL A;  4JTA B;  1RM1 B;  2OCC C;  3FYE B;  4JAV A;  2QM8 A;  1OCC C;  1K5S A;  1SER A;  1YJN V;  2CK3 G;  2EBO A;  1AI4 A;  3X2Q B;  1V54 B;  3K9A A;  1FXH A;  4MW8 A;  3SPJ A;  2PI5 A;  1EZJ A;  3DGE A;  3ZMV A;  5B1B B;  1R6K A;  3T2M A;  3OFN G;  4MSW C;  2ZR3 A;  5IYD O;  4MTX A;  4WF9 V;  4E2L A;  3VOU A;  1VQK V;  1G8M A;  1M9N A;  2EZO A;  2IJK A;  2X6C A;  3OM3 B;  2A0L A;  4XDJ A;  2W0F C;  3ETG A;  3K06 A;  4BW5 A;  1ROP A;  4BIZ A;  3TET A;  1UJW B;  2IJH A;  2ITC C;  3EFF K;  2F43 G;  4X88 A;  2LFR A;  2WLH A;  1OCR B;  3DTU B;  3FB8 C;  2DW4 A;  3W7U A;  3LDE A;  3SYC A;  1VQP V;  1NBM G;  3OMN B;  2XAQ A;  3OE7 G;  1NJI W;  3FB7 C;  1OCO C;  2ITD C;  3T1C A;  2AHY A;  1MG1 A;  4FIP C;  4JAU A;  2XND G;  1PL0 A;  1RPO A;  4JF3 A;  2UXX A;  2X6B A;  3ASO B;  5H9C A;  5H6R A;  5DN6 G;  1VQ7 V;  3K0D A;  3AG3 C;  4UVB A;  1FXK A;  1K92 A;  1YI2 V;  5IYC O;  3LUT B;  1H8H G;  2P67 A;  1GTO A;  1OCZ B;  2ZDI A;  2B1G A;  3JD0 A;  4I5S A;  4TT3 G;  2IU0 A;  1R73 A;  1W2B U;  1FXK B;  3B77 A;  1AJQ A;  1ORQ C;  4EKW A;  2B1I A;  1M56 B;  5KA6 A;  1GM7 A;  3CME V;  1NH2 D;  3ABL B;  3ABU A;  4X8A A;  5CA3 A;  5IY5 B;  2EIL B;  4CZZ A;  4P9P A;  2ZR2 A;  2B5U A;  3OW2 U;  3FB5 C;  4UV8 A;  2HKO A;  4RQF A;  1R3K C;  1F51 A;  1AI7 A;  4FJC C;  4DXW A;  3LDD A;  1OCC B;  3T4Z A;  2P7T C;  2HLD G;  3FKS G;  1VQM V;  1S76 D;  4QJF B;  2QKS A;  4Z1M G;  1I5Y A;  1KP3 A;  2IH1 C;  4G28 B;  2QM7 A;  3MHS C;  2Q67 A;  3CCJ V;  2ZQM A;  3P30 A;  5EBM C;  1VQN V;  3JD3 A;  3CCV V;  4RUE A;  1Q82 W;  5EC1 C;  2DYS C;  4QE9 A;  4UV9 A;  2V7Q G;  1DTO A;  3E89 A;  3I56 V;  4R6Z A;  2UXN A;  3F5W C;  1THZ A;  1VQ5 V;  4JAS A;  2P6J A;  2DYR B;  2A79 B;  5J9P C;  1ENV A;  4XBF A;  4KP4 A;  1K34 A;  1HWY A;  2LFS A;  3JYC A;  4J9Z B;  1OHH G;  2EIN C;  4GT1 A;  1AJN A;  3UM7 A;  3K0G A;  5IYB O;  4WFA V;  1YTF D;  3ASN C;  4MVS A;  1E1Q G;  4JPR A;  2QEX V;  3GWO A;  1KEC A;  3W7T A;  1CEZ A;  3E86 A;  4GX1 A;  4HYO A;  5EBW C;  2HVK C;  2X6A A;  1G4Y B;  1M57 C;  3G4S V;  1VQ9 V;  4P9O A;  5H6Q A;  3OAA G;  3E8F A;  3CCE V;  3AG1 C;  2IJI A;  1KQS U;  4PDR A;  2W6J G;  1QLE B;  1PKX A;  3CD6 V;  1FXV A;  2Q6A A;  2IW5 A;  2PI4 A;  3AG4 C;  1QVG U;  3MD0 A;  4TSF G;  1IXM A;  1MAB G;  2XAS A;  4GX0 A;  1K8A W;  2XAF A;  3QO7 A;  4ZKI A;  2YEV A;  3ABT A;  2IH3 C;  3G71 V;  3JD1 A;  3ETD A;  3F7V C;  1BHA A;  1M90 W;  5L3B A;  4TWK A;  1GK9 A;  1FS0 G;  4MTF A;  3OUS A;  2D3O W;  1PNM A;  4MVU A;  1B6Q A;  4R8C A;  3CCQ V;  4HZ3 A;  3FB6 C;  2YEV B;  5GW7 A;  2WLL B;  1NH2 B;  1L1F A;  1AI5 A;  3WFV A;  3PJS K;  3FYI B;  1E79 G;  3NXS A;  3D36 A;  1H38 A;  1W0K G;  1VQO V;  1YJW V;  2WLM A;  4WFF A;  3ML0 A;  1SET A;  3WG7 B;  2BOB C;  2JEX A;  1S72 V;  2HJF C;  5BZB A;  2DQ3 A;  3BEH A;  1R6N A;  1H8E G;  2XAG A;  4RAI A;  4WCE V;  5L3E A;  1QLN A;  2DYS B;  2GSM B;  3RW0 A;  3SYO A;  4F4L A;  1KD1 W;  4G2K A;  4N21 A;  3ABM C;  4RO2 A;  3BY6 A;  3ZN0 A;  2ZXW C;  1YIJ V;  2EIM C;  5C93 A;  4MW3 A;  1I5X A;  4PDM A;  4JGS A;  1KP2 A;  1BMF G;  3OEE G;  3HB3 B;  5L3D A;  1M1K W;  1GM8 A;  1DLB A;  1EFR G;  2Y69 B;  3OR6 C;  1Q81 W;  3T4D A;  4LBE C;  5LGT A;  2H8P C;  2DWD C;  2WWW A;  3ABK C;  5CBH A;  3ZRV A;  4BIU A;  4FMT A;  3H01 A;  1K33 A;  1V55 B;  1W0J G;  4QPJ A;  1M57 B;  3SPI A;  2GHY A;  1YHQ V;  1DF4 A;  3K04 A;  3OEH G;  3AG1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...