2LQTA

Solution structure of chchd7
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
NPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRAVGNMPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of CHCHD5 and CHCHD7: Two atypical human twin CX(9)C proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords Coiled-coil-helix-coiled-coil-helix domain-containing protei
total genus 24
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2lqtA00
1HP8A 1U97A 2HP8A 2LQTA 2RNBA 2RN9A 1Z2GA 1U96A 2LGQA
chains in the Genus database with same CATH superfamily
4TUYB 2R9RB 3DC5A 1M57B 4LCUC 4BW9A 3QO7A 4YJ2A 1SF9A 5LYJA 3UKMA 5GONA 1SERA 4I0XA 1XQ8A 4HYOA 3U0ZA 1TGOA 1MSWD 4DV5O 3K0DA 3ZMUA 2E74B 1B06A 1GM7A 4YHHO 4EFBA 2CDYA 1VQ9V 3H9VA 4PA3A 1THZA 4O4IB 4DV1O 2PGGA 1WA8B 5B1AB 1R6KA 2IJJA 4JV5O 3CWBH 3ABLB 2B1GA 4TV9A 4QE7A 3QTCA 3SJBC 1K73W 4AHCA 2GTAA 1XL6A 4LFCB 1MOFA 4JAAA 3K59A 5K1PA 4FVMA 3P3NA 5B5EZ 4OX9O 2XHBA 2Q68A 2YICA 1NTKH 5H6RA 1AI7A 5EC2C 3FKSG 3AG1C 5CA3A 3SYCA 5CBFA 3FB8C 3D3IA 3DXRB 5EIBD 3DGEA 4PA7A 2FMLA 3OE7G 3H01A 3ZCCA 2BE3A 5LA6B 3FD9A 1N33O 3NR7A 4I55B 1Q8IA 1M5IA 3STLC 3K08A 2ZT9B 3C3TA 1FAFA 2N74A 4FPPA 1GN3A 1EN4A 1JPXA 3JSNA 4I50A 3FB7C 4G28B 5IYDO 1BE3H 2V1DA 2X6BA 4TSFG 1YJNV 1GAXA 3JD0A 1J5EB 2N04A 3ABLC 3A0BZ 2VRZA 3MHHC 3J81N 2PYLA 2WLNA 3SYOA 4JAUA 5LXTA 1OCOB 4LP8A 4DV1B 2AXTZ 2QM7A 3LNNA 3T4DA 3TJTA 2ZD9A 1CEZA 1PL0A 4DR3B 5IT9N 3E8GA 1OJHA 4JPRA 3BRCA 2C2AA 4I9QA 3AK2A 2IH3C 4YJ3A 4O4LA 1RSOB 3OFNG 1Q7YW 5H2FZ 2AGAA 3HKBA 3SPGA 3SJAC 4F6RA 1NR1A 4GUNA 2KKWA 1HP8A 1TUEB 3JASA 5B3SB 1SA0B 1V54B 5LBQA 1H8EG 4WFEA 5KX5B 4JI6O 1KBHA 1MMMA 3O9OA 2LGQA 1NI8A 2WLJA 3CCSV 4GT1A 2XAFA 3LSSA 1Q5OA 1SZXA 3JATA 2H94A 2IBZH 3SGIA 4E4EA 2EIMC 3CRQA 4X1KB 3VBBA 3CCJV 1BHBA 4OPHA 4DUYO 2M6YA 4OX9B 4F6EA 4DR4O 2XAHA 1SQVH 2E3CA 4FFBB 1BS3A 3E89A 4HNAB 1SS3A 3UO2A 4DRXA 3LDDA 3BCCH 4U3JB 2RMKB 2UXCB 4O4LB 3ZMZA 3RYHB 1YIJV 4DV3B 4UB6Z 3G67A 2LW1A 4DW0A 3OTOO 3ZRVA 2ATKC 2P06A 4O2AA 4X88A 5D5QA 5LOVA 5IWAB 4DO2A 2Q6AA 1I5YA 4W4KA 1WPBA 1H2GA 2ILMA 4DK1A 2IH1C 1SQQH 3ETEA 4K0KB 5IJ0A 4XDKA 2VQEB 2X7RB 3K79A 1IBMO 2Y69C 4ZOLB 1V55B 1JR9A 2CTRA 3AG4B 3ZEDA 3KZIZ 1XNRB 2ZR3A 2ZXWB 4JI0O 2DE0X 1ORQC 2R9AA 4UVAA 4XBFA 4JTAB 5LP6C 1V55C 2E75B 4CH4A 2Y69B 4JI8B 2OTLV 4DV7O 2Y48A 1QBZA 4RO2A 1VQNV 4IHJA 2BTQA 4C7UA 1VF5B 1SQXH 1R6NA 3QF7A 3UT5B 2HFEC 1XMQO 4B3MO 3G80A 2EJ7A 1QVGU 1PNMA 4KXRA 3C3SA 1VQOV 2OT5A 4CC6A 4FLUA 4DR6O 3DXRA 3ZJZA 3CC4V 3L72H 5KHKA 3OEHG 3OR7C 1Q6UA 2Z3YA 5BR8B 1L0NH 5CA0B 4L87A 3F5TA 4TQDA 2CGNA 2UUAB 3CXHF 1DGSA 1WP7A 1XHZA 1H2KA 2CTQA 5BMVB 4PI2A 2WLIB 1AVMA 1OV9A 3K5LA 1URFA 1R3KC 2AHZA 5KMGB 5EIBC 3STZC 4DR7B 1MG1A 3VOUA 3S3WA 2EIKB 3ZRWB 2ZXWC 4LBEC 3FAVA 1Y67A 2JIZG 2UXBO 2UXDO 4LFAO 1XILA 3CJHB 3S3XA 4JF3A 1A32A 1EM1A 3DC6A 2Y0IA 4Z1VA 3JALB 1GTOA 5BMVA 4GYCB 2AZ0A 1XL4A 1N0NA 3ZHVA 1N4CA 4O4JB 1YJ9V 2FL4A 3K0GA 3CD6V 2XAGA 3JCZA 1BQ0A 5A2QN 5D5PA 3J7AU 4U7OA 2X0LA 3ZHTA 4JI1B 1XNRO 1H2NA 1D2DA 4JYAB 1M93A 1Q6HA 4B7EA 5BY1A 1Q3EA 3CCEV 3RGBA 5KUKA 1Z2GA 4MW8A 3CCLV 4HZ3A 4UVCA 1JJ2U 2ADPA 4RUEA 5BR8O 2OYQA 1K97A 1PD3A 4N23A 4LFBB 4FJCC 1SQBH 1YCIA 4X64B 2Q69A 5FPRA 2QM4A 1NTZH 4B3TB 1O9GA 2EJRA 4TT3G 4MTGA 2ZIMA 2IW5A 4X1IB 3Q4HA 5E79Z 1NBMG 2QR4A 3T4ZA 3CCMV 1P84F 3ASOC 4B3SB 5IYZA 2YXLA 1AJPA 1FJGB 1G1XB 4WF9V 3N27A 1JFFB 1MSDA 2F43G 4K8ZA 2DWEC 1I94B 1S5LZ 5LP6A 3FX7A 3ETDA 4J7JA 2EX3A 4FFKA 4GX0A 5CN0A 3ABTA 4TQFA 3BA8A 3K5MA 5KX5A 4PA6A 4CH6A 3CCQV 5LMUB 2P5OA 1AP5A 2N05A 3ZRSA 3UCSC 3TETA 2EBOA 2QWPB 3ZN1A 2LJ2A 3CCUV 3ZMTA 1L8DA 2NN4A 4DUZO 1P4RA 2VQFO 4YIOA 3QNEA 4NKGB 1KMIZ 3CP1A 4H44B 4JI7O 5KA6A 4LNUA 5LMNB 4LF8O 4LFAB 4MVSA 1SESA 4RWUA 1M56B 2LFRA 3ASNB 4BW5A 1CPYA 3K5OA 2EULA 3RT3C 3HKEA 2YDEA 1F4MA 4I0XB 3EVKA 1G8MA 1BMFG 4JV5B 2QDOA 3L9DA 4QGPA 2UXXA 4ZBMA 5IJ0B 3UQ8A 3MAQA 2QKAA 1XOUA 5EBWC 1OCZC 2QSAA 5DM6V 4O2AB 3ETQA 1ZX3A 1E1RG 1GRJA 1N32B 3CHXA 1D5NA 1GM8A 3OMIB 4PELA 1WB8A 3F7VC 3JAWB 3IGAC 3B2EE 3RW0A 4JYBA 1ENVA 1HW7A 1KQSU 2V4DA 1YF2A 4YIPA 3SR2C 4DV7B 2HG5C 4WBNA 4I7ZB 3BEHA 1QLEB 3ABUA 2A06H 2HKOA 4A5UB 1K9MW 4LF7O 1PL4A 4QE9A 2R9IA 4JI5B 2XTAA 4QJFB 4WFBV 3F7YC 2HR3A 3H1IH 2JRIA 3BABA 3RBZA 1QR9A 4D7SA 1N8RW 4X20A 4JI2B 3RVZA 3I55V 4J9ZB 4J7KA 3JD1A 5EZYA 3SYPA 3SPIA 5J2UA 4DR3O 3CC7V 2DQ0A 5AG2A 4XDLA 1MZFA 3OD4A 1V54C 1L0LH 2VQEO 2FYUH 3OUFA 4UCVA 3ZHQA 5J2TA 2IM9A 2WA4A 1N32O 3E2EA 3A2FA 2P4VA 5L3CA 3JYCA 5B1BB 5LHHA 2IU0A 4DR7O 1ZL8A 4ZI7B 3EXAA 4G27B 2K1EA 2EILB 2YS8A 4GKJB 3CB2A 2P4KA 5BZBA 1TVKB 2EIMB 2VWKA 1VQ7V 1COWG 1QHTA 4PI0A 3G6EV 3T1HO 2F93B 1JJOA 1AR1B 1DK1A 2WPDG 2HVJC 2IJIA 1VQLV 3AG4C 4XDJA 1ZUQA 4FK5C 3B8NA 1F4NA 4X89A 2KB1A 1IBLB 5IYBO 4BIOA 1KYOF 3WU2Z 1NT2B 1NKDA 5JQGB 2YIBD 1SRYA 2R72A 2P90A 3CS5A 5JH7B 1W0JG 2BTQB 1W0KG 5JJJB 4MT8A 2Q9LA 3CRAA 5CB4A 1PV0A 5C8YB 1FJGO 2WWWA 2FTKA 2F4VB 4B3TO 5HFLA 4UVBA 3SPJA 2EINB 3OW2U 2YEVB 1QU7A 3BY6A 1Y74A 4WFAV 4JI3B 1WNSA 2HVKC 4I55A 4PD4F 3ZRWA 4D7TA 1SA0A 1HNZB 3VQYA 1E1QG 3OEEG 1IVSA 2E5LB 2QWOB 3JD4A 4AQYO 4NXNB 4MVOA 4X8AA 2Q8VA 2WLIA 1ZTEA 2PTMA 1BZKA 1RFYA 1S5HC 1GH6A 3LUTB 3I56V 4PHZA 2DOSA 1I94O 4JTCB 2ZR2A 3UT5A 5B3SC 4O4HB 4DV0B 1AILA 4MVUA 1BHAA 5BXZA 1VIBA 4DV4O 4LC1A 4LFBO 4HNAA 4Q6GA 1S76D 4X62B 3OUSA 5FPOA 1WA8A 3N2KB 4LF4O 2L6LA 2ZDIC 2QM8A 5KAFZ 2M7WA 1Q90D 4ZHQA 5CB4B 4WBNB 2Q5ZA 2YI8A 2GHYA 2VS0A 3E8HA 1EN6A 1MZEA 4UUJC 3FFQA 1VARA 3W7XA 4AILC 2EINC 4WFGA 2JEUA 1I5XA 3K5NA 2XOKG 3CRMA 2YSUB 2CK3G 5L3FA 2ZIOA 5ITZB 1Z5VA 5LMUO 1EZVH 1HNZO 4DV2O 2XAQA 4UFZA 4MTOA 5L3DA 3WG7C 1KP2A 3LNMB 2CE4A 4LF6O 2CUGA 4X66O 2Q7GA 4NTWA 4E2LA 3T1YO 4FM0A 3HKDB 4JI5O 1JOYA 5LMNO 4X1YB 4LF8B 3CMEV 3CJHA 2ARHA 5LGNA 1QQCA 1NVPB 1PP9H 4BIZA 5EC1C 3BA9A 4I4TA 3BHPA 3JAMN 5KMGA 2Q7HA 5EYPB 4DR5B 2HHHB 2OCCC 3TXQA 1FYJA 1GN4A 1S77D 2MW2B 1AI6A 4ICGA 3CCRV 5LA6A 3IC9A 1UFIA 1NZ6A 1Y76B 3B4SA 2ZNJA 3KG2A 1YTFB 2WA3A 5H5NA 1RP3B 3D3QA 3K3WA 1R6TA 3L70H 3PJSK 4LH7A 3GB7C 1HDJA 1EZJA 4MTFA 5LP6B 2ODMA 3E83A 3ABMC 3JD3A 1YEWA 2Q7EA 4AI8A 1HNXB 4LWSA 4X65O 2OTJV 4P2ZA 3FYIB 3ABMB 1WP8A 3O65A 1WB7A 3X2QB 1AJNA 4Z1MG 5CBHA 1H2SB 5L3GA 1VQKV 1VQMV 1AI4A 4GX1A 4TWKA 2EIJB 2W6IG 1FS0G 2YEVA 1H38A 1VMGA 1VEWA 1FXKA 1YXBA 4UV9A 4JZ2A 4DV6O 2KG7B 4J9YB 2W6JG 4LF9O 4QPKA 1JQ0A 3FB5C 4ZKIA 3ZMVA 1F7YA 2DYSB 2A3QA 1NH2B 1XMOO 1KECA 3ZBHA 4FM2A 4I50B 2DYSC 4JI7B 4I5SA 3JCUZ 2D3OW 1RM1C 4O4JA 2FB5A 4BR6A 2F4VO 3NXSA 3SYQA 2KG7A 1XBLA 5LHGA 1R73A 4JASA 2PZSA 4NXMO 2DJVA 1TUBB 4GKKB 1OCCB 3K57A 2Q67A 4FLZA 1HNWB 3AG2C 2MK3A 4JI3O 1K5QA 2WLKA 3ZMSA 3VQWA 5LL6Y 3ZIAG 3DTUB 2DYRB 2HP8A 1UPGA 4JI4O 1FXVA 4LNUB 3SJQC 1Y4MA 1FXHA 2K9PA 1KD1W 2ETNA 2IJHA 5C8YA 4CH3A 2B1IA 4TV9B 2UU9B 4LF7B 2DW4A 2ZM6B 2UUAO 2YC0A 1S5JA 3APQA 5B1AC 1XEQA 1S0VA 4AQYB 1P7BA 4K3AA 1UJWB 3JASB 2DMXA 5EBMC 3A0RA 4U3FH 5JVDB 1Y76A 1M9NA 4R8CA 1VQ5V 2RNBA 4GX2A 1KB9F 1QLEC 2GDSA 1NU1H 1K7DA 4MS2A 4CS2A 2RJZA 2B5UA 1GM9A 5IY5B 3JARA 2LQTA 1M57C 3E22B 3ICXA 4YXWG 3K58A 2UUBB 2DWDC 1W2BU 2QWQB 2JGUA 5KHIA 3K06A 2QKCA 4X1YA 5JJNB 1IX9A 4CC5A 4LF4B 4PA9A 4JI1O 4FLXA 2QE7G 5KHJA 1EFRG 1SKVA 1YZBA 2ZKOA 1Q86W 4U7NA 3WB2A 3H1HH 4YHHB 2YIDA 3W7UA 1WJZA 3HKCA 4YY3B 2YI9A 4EB6A 3AEIA 2WLHA 5FL7G 5JWPA 3M99B 1GN6A 3H1JH 1K4CC 1FXKB 1XMQB 5LGTA 4U3JA 3HB3B 4GLXA 4JI4B 3T1YB 3BPZA 3B77A 3FAVB 2YIBA 4Z2WA 4IT5A 2EIJC 3AK1A 1EN5A 5FLXN 5B1BC 4NVPA 1KP3A 1IXBA 3JATB 3N2KA 5KHHA 1U96A 3VQXA 3MDSA 1BL8A 3CEIA 4K35A 1AP6A 3F5WC 1KKCA 2ZE6A 1LR1A 2X6AA 5ITZA 4DR4B 4IL6Z 4DYLA 3OM3B 4PDMA 4F4LA 1WN7A 1K34A 1FFTB 1YVWA 1DF4A 2JGDA 3HKCB 1RSOA 2H8PC 1HR0O 5H6QA 4JI6B 2EILC 4JI0B 1VQ4V 5J9PC 2L35A 1OCRB 2ZINA 2Q0AA 1OHHG 4FZ1A 1PM9A 3CE2A 1GMGA 3ABKB 4FZ0A 1JFFA 4BWAA 4DXWA 3E35A 2F1MA 1IBKB 4YY3O 1TAEA 2A9HA 4LR3A 2Q4PA 3FB6C 2P67A 3L73H 3CX5F 2B9ZA 1XMOB 3RVYA 4MW3A 5CBGA 3QO8A 1JMKC 1D5AA 3IAYA 4MSWC 2HJFC 3ML0A 1QLNA 1JCHA 2IU3A 3U10A 1J95A 4YJ3B 1YHQV 2KQXA 1M90W 5IWAO 1ZAUA 5CA1B 5JJEB 1X4TA 4B3SO 2XT9A 2ZQMA 5H9CA 3CPWU 2F23A 2QEXV 1WAZA 1SQPH 2JDIG 1Q6IA 1J5EO 3OMNB 3TCUA 1IZ3A 2Q0OC 1FKAO 1VQ8V 4EKWA 1IXMA 5B66Z 4RUFA 2GSMB 4TV8A 5A9GA 3B40A 3OAAG 1PPJH 4O4IA 1BQZA 1NVPD 2OIGA 3EFFK 5JQGA 3BVOA 4J41A 2JVDA 4OGQB 5LGUA 1R3IC 2AZ2A 1K8AW 1F51A 2WAMA 1XNQO 1VF6C 1KKDA 5L3EA 3FYEB 4TV8B 1WLEA 4UCRA 5FNVA 1N36B 2HJDA 3OTOB 1AI5A 3QO5A 2ZE7A 1YTFD 4CS3A 2WSSG 4WFHA 3ZRXA 2UUBO 2QGNA 4PA4A 4GKKO 4DR2B 2F95B 3HR0A 1V9PA 3AG3C 2JS3A 3ZN0A 3RYFB 1LUVA 4WCEV 5CA1A 4L8JA 2XUMA 5E1AC 4DV2B 1Y66A 4DR6B 3ZHRA 3GVMA 4JYYA 4QIWF 1XI1A 3E22A 1RPOA 2UXCO 4MVZA 2LFSA 1Q81W 2YXHA 1SQGA 3N2GA 1ZWIC 5LYJB 5HFMA 5L3BA 1JA8A 4B3MB 1JVMA 4DW1A 4JYCA 5CA0A 4K0KO 3H1KH 4X65B 1WPXA 4J10A 4P9PA 3R66A 1NR7A 3K9SA 2WLMA 1Y6XA 5TISZ 3ZHSA 1E79G 1Z5WA 2PI4A 4FLVA 2QKSA 3L74H 4JTDB 2OWOA 1PNKA 3PN1A 4MVRA 2BSKA 1YSCA 2XASA 3ASNC 5IJ9A 2GTSA 3OTFA 3RYHA 1MA1A 2CTPA 3RFRA 3QG5A 4H0LB 1S3JA 1M1KW 4R7CA 3OT7A 3TK1A 5KAIZ 3OMAB 1AR5A 5IYCO 5IY5C 1BT8A 1ZSPA 2E76B 1GK9A 3RYFA 2UUCO 5C93A 1F23A 5J2UB 4X62O 4FLTA 3MHSC 4KHPB 2ZM6O 4JI2O 2A0LA 5DECA 5JVDA 4O2BA 1TA8A 1G6UA 3AG7A 1FXKC 3APOA 3E8BA 2PYJA 1JX9A 4RAIA 1HR0B 1KUQA 4I9WA 1K5SA 4P9OA 3H1LH 5LHIA 3L71H 3T2MA 3CCVV 5IDJA 4OPAA 3AG3B 2HLDG 2XAJA 4MTXA 4ZHQB 3M8AA 2ZCEA 3THOA 3LDCA 2UXDB 4WFFA 4PDLA 3IFXA 4I4TB 2LGWA 2QA4V 4DV3O 3CC2V 3AG2B 1GN2A 3JSLA 3G6BA 1VQ6V 1NJIW 3W7SA 1AB3A 3M7MX 3HKDA 2PY5A 2Z5UA 2JJ1G 3EHBB 4O4HA 1H2LA 1ZLZA 1IBKO 1BGYH 1SC5B 3ZS8C 4NTYA 2KSDA 4FIPC 3P3PA 2AW9A 4JAVA 2P7TC 3ABKC 2H3OA 4GX5A 4F6RB 2IJKA 2UXNA 1XREA 1OCZB 5EBLC 2RQ6A 2BOCC 1VQPV 3WFVA 1VF6A 4BAYA 5GTHZ 1Y74B 4B3RB 4H33A 2A79B 4IIJA 4LFCO 2A7WA 3IC7A 2VQFB 3N2GB 5EYPA 4PDRA 3KKYA 3ZHUA 2GBOA 2JK5C 3UO3A 3K03A 5JCOC 1M56C 3CSXA 4K8XA 1PKXA 2QJ1A 4PDVA 4LF5O 2W0FC 3LSQA 2NLJC 2D2CB 3X2QC 3W7TA 4GKJO 3OR6C 4NR1A 4DV4B 3K9AA 4NB5A 5IE9A 2QWNB 4DR2O 1N36O 2ZDIA 2R70A 4Q20A 4MVMA 4DR1B 3SPCA 3SYAA 1US6A 4DUZB 5CMUA 3WB1A 3OGIB 2DN9A 1Q82W 5LOVB 4ASUG 1TUBA 3JAWA 3P32A 5KHGA 2G38A 1FD9A 1R3JC 1OCOC 3CRCA 3WB0A 1K4DC 4RQEA 1I7FA 5B1OA 1X59A 1YI2V 4FMTA 5F2VO 3ASOB 1M4UA 3QVNA 5EZYB 1O9HA 1FFXA 1IURA 4J7ZA 3P30A 1L1FA 4EB6B 2CGOA 3RYIA 4KL1A 4LF6B 3CRRA 3GWKC 3IJ4A 2PF4E 1R3LC 2XNDG 3SDLA 2HEPA 4X9QA 3T1CA 4LF5B 3B09A 1FFXB 1B6QA 2QWRB 3JARB 3OGCC 4NXMB 4PJ0Z 1PNLA 1IDSA 4DV0O 4R6ZA 2P22C 3WG7B 3TXSA 4ABMA 2Q73A 1HNWO 2HHHO 3VQVA 4UCTA 4NYKA 2NNUA 5JH7A 5FNVB 4QNHB 2FKXA 3W7WA 4UCOA 4X20B 1GO3F 1B04A 4JGSA 2ITCC 3A8TA 3L75H 4DV5B 1R1BA 1T5EA 4D6TH 1DTOA 4IGGA 4JI8O 2EIKC 4UXNA 3R65A 2F66C 4HBNA 1LUWA 1W59A 4DRXB 4DR5O 1XUQA 5KLVH 2CH7A 1SETA 2LW7A 3CYOA 4CBCA 2W0XA 2CAZC 3D36C 3B8MA 4ZI7A 2CH7B 2NR5A 1KU9A 4GZRB 4NTXA 2LP7A 4GCZA 3HKEB 4P30A 4CZZA 2EZPA 1TVKA 5J2TB 3HKBB 2E5LO 2Z0AA 2CTWA 4B7KA 2UUCB 2VWJA 1NQTA 1YDXA 1K33A 4H13B 1SZTA 4MVQA 2EZOA 3DSQA 5EK0A 1S72V 4FLYA 1ZL8B 3RN4A 3E86A 2DQ3A 3BFRA 1OZ0A 4HAMA 4QPJA 4YJ2B 1AR4A 2RDCA 3J80N 2QTSA 4FFBA 4OXSA 1QR8A 2JGDB 3G4SV 4IHJB 5JCOA 3I5DA 3U11A 2Y0PA 3LSUA 5LXTB 2YIAA 4LH6A 4RQFA 1RM1B 1IBMB 3C90A 2P6JA 3ETGA 2OCHA 3CMAV 1N0JA 4G2KA 2ZNIA 2WLLA 3JALA 3UM7A 4ZOLA 1NS1A 1CP9A 1DLBA 4PV1B 3CXCU 1Q43A 1N34O 1FPOA 1I08A 4JZGA 4KP4A 1CXZB 4LF9B 1N33B 4J42A 1H8HG 1XDCA 2ITDC 4EFEA 3JD2A 1IBLO 4TOIA 4CH5A 5DN6G 1QNMA 4JYAO 5GTIZ 2WLLB 2JS5A 4N21A 5IJ9B 3JAKB 1H2MA 1AJQA 4BIUA 1NTMH 2V7QG 4UCSA 1HWYA 4EEQA 1MNGA 1P49A 4J80A 5K1XA 4TUYA 4NXNO 1I0HA 1K92A 3AK3A 4KFMA 1U97A 5IYZB 2O57A 2UXBB 1XNQB 3D36A 2YXYA 1DF5A 1OCRC 3MD0A 4B3RO 2X6CA 1B3QA 2JEXA 3KCXA 4DV6B 2GUZA 3D8CA 4KUMA 3SPHA 1NH2D 4IYHA 4FLWA 1KC8W 4DUYB 5GONB 1GKFA 2UU9O 1VF7A 2JJ2G 4CS4A 2RN9A 3ZX6A 4J11A 5KA5A 4W4LA 2BCCH 4IIJB 2YUAA 2DYRC 4UCUA 2BTOA 2GUZB 2BSKB 1BSMA 2ADQB 4H37A 4UV8A 3G71V 1MABG 3E8FA 3LDEA 4UB8Z 2BOBC 4KHPO 3RWRD 1XHXA 3GWOA 1OCCC 1AROP 4O2BB 3BAAA 2PI5A 1BCCH 4B08A 3TGUH 4DR1O 4X66B 3RYCA 2QTOA 1HNXO 1K3EA 1RPRA 3T1HB 1EBOA 1N34B 1VP7A 3RYIB 3JAKA 4FM1A 3Q4HB 1ROPA 2OIEA 5DEDA 2ZE8A 2PUSA 4X64O 2OCCB 5GW7A 1P7GA 4ZIBA 4DK0A 2Y4UA 1YJWV 5B1NA 2Y4TA 4X1IA 4X1KA 4LWSB 1YITV 1QVFU 3A0HZ 2LO1A 3K04A 1QCEA 3SJCC 4R50A 3HPLC 1G4YB 3AG1B 1LNQA 4IYIA 3KCYA 2GV9A 1SQFA 5KUMA 2RCVA 2AHYA 3RYCB 2ZE5A
chains in the Genus database with same CATH topology
1HP8A 1U97A 2HP8A 2LQTA 2RNBA 2RN9A 1Z2GA 1U96A 2LGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP8 A;  1U97 A;  2HP8 A;  2LQT A;  2RNB A;  2RN9 A;  1Z2G A;  1U96 A;  2LGQ A; 
#chains in the Genus database with same CATH topology
 4TUY B;  2R9R B;  3DC5 A;  1M57 B;  4LCU C;  4BW9 A;  3QO7 A;  4YJ2 A;  1SF9 A;  5LYJ A;  3UKM A;  5GON A;  1SER A;  4I0X A;  1XQ8 A;  4HYO A;  3U0Z A;  1TGO A;  1MSW D;  4DV5 O;  3K0D A;  3ZMU A;  2E74 B;  1B06 A;  1GM7 A;  4YHH O;  4EFB A;  2CDY A;  1VQ9 V;  3H9V A;  4PA3 A;  1THZ A;  4O4I B;  4DV1 O;  2PGG A;  1WA8 B;  5B1A B;  1R6K A;  2IJJ A;  4JV5 O;  3CWB H;  3ABL B;  2B1G A;  4TV9 A;  4QE7 A;  3QTC A;  3SJB C;  1K73 W;  4AHC A;  2GTA A;  1XL6 A;  4LFC B;  1MOF A;  4JAA A;  3K59 A;  5K1P A;  4FVM A;  3P3N A;  5B5E Z;  4OX9 O;  2XHB A;  2Q68 A;  2YIC A;  1NTK H;  5H6R A;  1AI7 A;  5EC2 C;  3FKS G;  3AG1 C;  5CA3 A;  3SYC A;  5CBF A;  3FB8 C;  3D3I A;  3DXR B;  5EIB D;  3DGE A;  4PA7 A;  2FML A;  3OE7 G;  3H01 A;  3ZCC A;  2BE3 A;  5LA6 B;  3FD9 A;  1N33 O;  3NR7 A;  4I55 B;  1Q8I A;  1M5I A;  3STL C;  3K08 A;  2ZT9 B;  3C3T A;  1FAF A;  2N74 A;  4FPP A;  1GN3 A;  1EN4 A;  1JPX A;  3JSN A;  4I50 A;  3FB7 C;  4G28 B;  5IYD O;  1BE3 H;  2V1D A;  2X6B A;  4TSF G;  1YJN V;  1GAX A;  3JD0 A;  1J5E B;  2N04 A;  3ABL C;  3A0B Z;  2VRZ A;  3MHH C;  3J81 N;  2PYL A;  2WLN A;  3SYO A;  4JAU A;  5LXT A;  1OCO B;  4LP8 A;  4DV1 B;  2AXT Z;  2QM7 A;  3LNN A;  3T4D A;  3TJT A;  2ZD9 A;  1CEZ A;  1PL0 A;  4DR3 B;  5IT9 N;  3E8G A;  1OJH A;  4JPR A;  3BRC A;  2C2A A;  4I9Q A;  3AK2 A;  2IH3 C;  4YJ3 A;  4O4L A;  1RSO B;  3OFN G;  1Q7Y W;  5H2F Z;  2AGA A;  3HKB A;  3SPG A;  3SJA C;  4F6R A;  1NR1 A;  4GUN A;  2KKW A;  1HP8 A;  1TUE B;  3JAS A;  5B3S B;  1SA0 B;  1V54 B;  5LBQ A;  1H8E G;  4WFE A;  5KX5 B;  4JI6 O;  1KBH A;  1MMM A;  3O9O A;  2LGQ A;  1NI8 A;  2WLJ A;  3CCS V;  4GT1 A;  2XAF A;  3LSS A;  1Q5O A;  1SZX A;  3JAT A;  2H94 A;  2IBZ H;  3SGI A;  4E4E A;  2EIM C;  3CRQ A;  4X1K B;  3VBB A;  3CCJ V;  1BHB A;  4OPH A;  4DUY O;  2M6Y A;  4OX9 B;  4F6E A;  4DR4 O;  2XAH A;  1SQV H;  2E3C A;  4FFB B;  1BS3 A;  3E89 A;  4HNA B;  1SS3 A;  3UO2 A;  4DRX A;  3LDD A;  3BCC H;  4U3J B;  2RMK B;  2UXC B;  4O4L B;  3ZMZ A;  3RYH B;  1YIJ V;  4DV3 B;  4UB6 Z;  3G67 A;  2LW1 A;  4DW0 A;  3OTO O;  3ZRV A;  2ATK C;  2P06 A;  4O2A A;  4X88 A;  5D5Q A;  5LOV A;  5IWA B;  4DO2 A;  2Q6A A;  1I5Y A;  4W4K A;  1WPB A;  1H2G A;  2ILM A;  4DK1 A;  2IH1 C;  1SQQ H;  3ETE A;  4K0K B;  5IJ0 A;  4XDK A;  2VQE B;  2X7R B;  3K79 A;  1IBM O;  2Y69 C;  4ZOL B;  1V55 B;  1JR9 A;  2CTR A;  3AG4 B;  3ZED A;  3KZI Z;  1XNR B;  2ZR3 A;  2ZXW B;  4JI0 O;  2DE0 X;  1ORQ C;  2R9A A;  4UVA A;  4XBF A;  4JTA B;  5LP6 C;  1V55 C;  2E75 B;  4CH4 A;  2Y69 B;  4JI8 B;  2OTL V;  4DV7 O;  2Y48 A;  1QBZ A;  4RO2 A;  1VQN V;  4IHJ A;  2BTQ A;  4C7U A;  1VF5 B;  1SQX H;  1R6N A;  3QF7 A;  3UT5 B;  2HFE C;  1XMQ O;  4B3M O;  3G80 A;  2EJ7 A;  1QVG U;  1PNM A;  4KXR A;  3C3S A;  1VQO V;  2OT5 A;  4CC6 A;  4FLU A;  4DR6 O;  3DXR A;  3ZJZ A;  3CC4 V;  3L72 H;  5KHK A;  3OEH G;  3OR7 C;  1Q6U A;  2Z3Y A;  5BR8 B;  1L0N H;  5CA0 B;  4L87 A;  3F5T A;  4TQD A;  2CGN A;  2UUA B;  3CXH F;  1DGS A;  1WP7 A;  1XHZ A;  1H2K A;  2CTQ A;  5BMV B;  4PI2 A;  2WLI B;  1AVM A;  1OV9 A;  3K5L A;  1URF A;  1R3K C;  2AHZ A;  5KMG B;  5EIB C;  3STZ C;  4DR7 B;  1MG1 A;  3VOU A;  3S3W A;  2EIK B;  3ZRW B;  2ZXW C;  4LBE C;  3FAV A;  1Y67 A;  2JIZ G;  2UXB O;  2UXD O;  4LFA O;  1XIL A;  3CJH B;  3S3X A;  4JF3 A;  1A32 A;  1EM1 A;  3DC6 A;  2Y0I A;  4Z1V A;  3JAL B;  1GTO A;  5BMV A;  4GYC B;  2AZ0 A;  1XL4 A;  1N0N A;  3ZHV A;  1N4C A;  4O4J B;  1YJ9 V;  2FL4 A;  3K0G A;  3CD6 V;  2XAG A;  3JCZ A;  1BQ0 A;  5A2Q N;  5D5P A;  3J7A U;  4U7O A;  2X0L A;  3ZHT A;  4JI1 B;  1XNR O;  1H2N A;  1D2D A;  4JYA B;  1M93 A;  1Q6H A;  4B7E A;  5BY1 A;  1Q3E A;  3CCE V;  3RGB A;  5KUK A;  1Z2G A;  4MW8 A;  3CCL V;  4HZ3 A;  4UVC A;  1JJ2 U;  2ADP A;  4RUE A;  5BR8 O;  2OYQ A;  1K97 A;  1PD3 A;  4N23 A;  4LFB B;  4FJC C;  1SQB H;  1YCI A;  4X64 B;  2Q69 A;  5FPR A;  2QM4 A;  1NTZ H;  4B3T B;  1O9G A;  2EJR A;  4TT3 G;  4MTG A;  2ZIM A;  2IW5 A;  4X1I B;  3Q4H A;  5E79 Z;  1NBM G;  2QR4 A;  3T4Z A;  3CCM V;  1P84 F;  3ASO C;  4B3S B;  5IYZ A;  2YXL A;  1AJP A;  1FJG B;  1G1X B;  4WF9 V;  3N27 A;  1JFF B;  1MSD A;  2F43 G;  4K8Z A;  2DWE C;  1I94 B;  1S5L Z;  5LP6 A;  3FX7 A;  3ETD A;  4J7J A;  2EX3 A;  4FFK A;  4GX0 A;  5CN0 A;  3ABT A;  4TQF A;  3BA8 A;  3K5M A;  5KX5 A;  4PA6 A;  4CH6 A;  3CCQ V;  5LMU B;  2P5O A;  1AP5 A;  2N05 A;  3ZRS A;  3UCS C;  3TET A;  2EBO A;  2QWP B;  3ZN1 A;  2LJ2 A;  3CCU V;  3ZMT A;  1L8D A;  2NN4 A;  4DUZ O;  1P4R A;  2VQF O;  4YIO A;  3QNE A;  4NKG B;  1KMI Z;  3CP1 A;  4H44 B;  4JI7 O;  5KA6 A;  4LNU A;  5LMN B;  4LF8 O;  4LFA B;  4MVS A;  1SES A;  4RWU A;  1M56 B;  2LFR A;  3ASN B;  4BW5 A;  1CPY A;  3K5O A;  2EUL A;  3RT3 C;  3HKE A;  2YDE A;  1F4M A;  4I0X B;  3EVK A;  1G8M A;  1BMF G;  4JV5 B;  2QDO A;  3L9D A;  4QGP A;  2UXX A;  4ZBM A;  5IJ0 B;  3UQ8 A;  3MAQ A;  2QKA A;  1XOU A;  5EBW C;  1OCZ C;  2QSA A;  5DM6 V;  4O2A B;  3ETQ A;  1ZX3 A;  1E1R G;  1GRJ A;  1N32 B;  3CHX A;  1D5N A;  1GM8 A;  3OMI B;  4PEL A;  1WB8 A;  3F7V C;  3JAW B;  3IGA C;  3B2E E;  3RW0 A;  4JYB A;  1ENV A;  1HW7 A;  1KQS U;  2V4D A;  1YF2 A;  4YIP A;  3SR2 C;  4DV7 B;  2HG5 C;  4WBN A;  4I7Z B;  3BEH A;  1QLE B;  3ABU A;  2A06 H;  2HKO A;  4A5U B;  1K9M W;  4LF7 O;  1PL4 A;  4QE9 A;  2R9I A;  4JI5 B;  2XTA A;  4QJF B;  4WFB V;  3F7Y C;  2HR3 A;  3H1I H;  2JRI A;  3BAB A;  3RBZ A;  1QR9 A;  4D7S A;  1N8R W;  4X20 A;  4JI2 B;  3RVZ A;  3I55 V;  4J9Z B;  4J7K A;  3JD1 A;  5EZY A;  3SYP A;  3SPI A;  5J2U A;  4DR3 O;  3CC7 V;  2DQ0 A;  5AG2 A;  4XDL A;  1MZF A;  3OD4 A;  1V54 C;  1L0L H;  2VQE O;  2FYU H;  3OUF A;  4UCV A;  3ZHQ A;  5J2T A;  2IM9 A;  2WA4 A;  1N32 O;  3E2E A;  3A2F A;  2P4V A;  5L3C A;  3JYC A;  5B1B B;  5LHH A;  2IU0 A;  4DR7 O;  1ZL8 A;  4ZI7 B;  3EXA A;  4G27 B;  2K1E A;  2EIL B;  2YS8 A;  4GKJ B;  3CB2 A;  2P4K A;  5BZB A;  1TVK B;  2EIM B;  2VWK A;  1VQ7 V;  1COW G;  1QHT A;  4PI0 A;  3G6E V;  3T1H O;  2F93 B;  1JJO A;  1AR1 B;  1DK1 A;  2WPD G;  2HVJ C;  2IJI A;  1VQL V;  3AG4 C;  4XDJ A;  1ZUQ A;  4FK5 C;  3B8N A;  1F4N A;  4X89 A;  2KB1 A;  1IBL B;  5IYB O;  4BIO A;  1KYO F;  3WU2 Z;  1NT2 B;  1NKD A;  5JQG B;  2YIB D;  1SRY A;  2R72 A;  2P90 A;  3CS5 A;  5JH7 B;  1W0J G;  2BTQ B;  1W0K G;  5JJJ B;  4MT8 A;  2Q9L A;  3CRA A;  5CB4 A;  1PV0 A;  5C8Y B;  1FJG O;  2WWW A;  2FTK A;  2F4V B;  4B3T O;  5HFL A;  4UVB A;  3SPJ A;  2EIN B;  3OW2 U;  2YEV B;  1QU7 A;  3BY6 A;  1Y74 A;  4WFA V;  4JI3 B;  1WNS A;  2HVK C;  4I55 A;  4PD4 F;  3ZRW A;  4D7T A;  1SA0 A;  1HNZ B;  3VQY A;  1E1Q G;  3OEE G;  1IVS A;  2E5L B;  2QWO B;  3JD4 A;  4AQY O;  4NXN B;  4MVO A;  4X8A A;  2Q8V A;  2WLI A;  1ZTE A;  2PTM A;  1BZK A;  1RFY A;  1S5H C;  1GH6 A;  3LUT B;  3I56 V;  4PHZ A;  2DOS A;  1I94 O;  4JTC B;  2ZR2 A;  3UT5 A;  5B3S C;  4O4H B;  4DV0 B;  1AIL A;  4MVU A;  1BHA A;  5BXZ A;  1VIB A;  4DV4 O;  4LC1 A;  4LFB O;  4HNA A;  4Q6G A;  1S76 D;  4X62 B;  3OUS A;  5FPO A;  1WA8 A;  3N2K B;  4LF4 O;  2L6L A;  2ZDI C;  2QM8 A;  5KAF Z;  2M7W A;  1Q90 D;  4ZHQ A;  5CB4 B;  4WBN B;  2Q5Z A;  2YI8 A;  2GHY A;  2VS0 A;  3E8H A;  1EN6 A;  1MZE A;  4UUJ C;  3FFQ A;  1VAR A;  3W7X A;  4AIL C;  2EIN C;  4WFG A;  2JEU A;  1I5X A;  3K5N A;  2XOK G;  3CRM A;  2YSU B;  2CK3 G;  5L3F A;  2ZIO A;  5ITZ B;  1Z5V A;  5LMU O;  1EZV H;  1HNZ O;  4DV2 O;  2XAQ A;  4UFZ A;  4MTO A;  5L3D A;  3WG7 C;  1KP2 A;  3LNM B;  2CE4 A;  4LF6 O;  2CUG A;  4X66 O;  2Q7G A;  4NTW A;  4E2L A;  3T1Y O;  4FM0 A;  3HKD B;  4JI5 O;  1JOY A;  5LMN O;  4X1Y B;  4LF8 B;  3CME V;  3CJH A;  2ARH A;  5LGN A;  1QQC A;  1NVP B;  1PP9 H;  4BIZ A;  5EC1 C;  3BA9 A;  4I4T A;  3BHP A;  3JAM N;  5KMG A;  2Q7H A;  5EYP B;  4DR5 B;  2HHH B;  2OCC C;  3TXQ A;  1FYJ A;  1GN4 A;  1S77 D;  2MW2 B;  1AI6 A;  4ICG A;  3CCR V;  5LA6 A;  3IC9 A;  1UFI A;  1NZ6 A;  1Y76 B;  3B4S A;  2ZNJ A;  3KG2 A;  1YTF B;  2WA3 A;  5H5N A;  1RP3 B;  3D3Q A;  3K3W A;  1R6T A;  3L70 H;  3PJS K;  4LH7 A;  3GB7 C;  1HDJ A;  1EZJ A;  4MTF A;  5LP6 B;  2ODM A;  3E83 A;  3ABM C;  3JD3 A;  1YEW A;  2Q7E A;  4AI8 A;  1HNX B;  4LWS A;  4X65 O;  2OTJ V;  4P2Z A;  3FYI B;  3ABM B;  1WP8 A;  3O65 A;  1WB7 A;  3X2Q B;  1AJN A;  4Z1M G;  5CBH A;  1H2S B;  5L3G A;  1VQK V;  1VQM V;  1AI4 A;  4GX1 A;  4TWK A;  2EIJ B;  2W6I G;  1FS0 G;  2YEV A;  1H38 A;  1VMG A;  1VEW A;  1FXK A;  1YXB A;  4UV9 A;  4JZ2 A;  4DV6 O;  2KG7 B;  4J9Y B;  2W6J G;  4LF9 O;  4QPK A;  1JQ0 A;  3FB5 C;  4ZKI A;  3ZMV A;  1F7Y A;  2DYS B;  2A3Q A;  1NH2 B;  1XMO O;  1KEC A;  3ZBH A;  4FM2 A;  4I50 B;  2DYS C;  4JI7 B;  4I5S A;  3JCU Z;  2D3O W;  1RM1 C;  4O4J A;  2FB5 A;  4BR6 A;  2F4V O;  3NXS A;  3SYQ A;  2KG7 A;  1XBL A;  5LHG A;  1R73 A;  4JAS A;  2PZS A;  4NXM O;  2DJV A;  1TUB B;  4GKK B;  1OCC B;  3K57 A;  2Q67 A;  4FLZ A;  1HNW B;  3AG2 C;  2MK3 A;  4JI3 O;  1K5Q A;  2WLK A;  3ZMS A;  3VQW A;  5LL6 Y;  3ZIA G;  3DTU B;  2DYR B;  2HP8 A;  1UPG A;  4JI4 O;  1FXV A;  4LNU B;  3SJQ C;  1Y4M A;  1FXH A;  2K9P A;  1KD1 W;  2ETN A;  2IJH A;  5C8Y A;  4CH3 A;  2B1I A;  4TV9 B;  2UU9 B;  4LF7 B;  2DW4 A;  2ZM6 B;  2UUA O;  2YC0 A;  1S5J A;  3APQ A;  5B1A C;  1XEQ A;  1S0V A;  4AQY B;  1P7B A;  4K3A A;  1UJW B;  3JAS B;  2DMX A;  5EBM C;  3A0R A;  4U3F H;  5JVD B;  1Y76 A;  1M9N A;  4R8C A;  1VQ5 V;  2RNB A;  4GX2 A;  1KB9 F;  1QLE C;  2GDS A;  1NU1 H;  1K7D A;  4MS2 A;  4CS2 A;  2RJZ A;  2B5U A;  1GM9 A;  5IY5 B;  3JAR A;  2LQT A;  1M57 C;  3E22 B;  3ICX A;  4YXW G;  3K58 A;  2UUB B;  2DWD C;  1W2B U;  2QWQ B;  2JGU A;  5KHI A;  3K06 A;  2QKC A;  4X1Y A;  5JJN B;  1IX9 A;  4CC5 A;  4LF4 B;  4PA9 A;  4JI1 O;  4FLX A;  2QE7 G;  5KHJ A;  1EFR G;  1SKV A;  1YZB A;  2ZKO A;  1Q86 W;  4U7N A;  3WB2 A;  3H1H H;  4YHH B;  2YID A;  3W7U A;  1WJZ A;  3HKC A;  4YY3 B;  2YI9 A;  4EB6 A;  3AEI A;  2WLH A;  5FL7 G;  5JWP A;  3M99 B;  1GN6 A;  3H1J H;  1K4C C;  1FXK B;  1XMQ B;  5LGT A;  4U3J A;  3HB3 B;  4GLX A;  4JI4 B;  3T1Y B;  3BPZ A;  3B77 A;  3FAV B;  2YIB A;  4Z2W A;  4IT5 A;  2EIJ C;  3AK1 A;  1EN5 A;  5FLX N;  5B1B C;  4NVP A;  1KP3 A;  1IXB A;  3JAT B;  3N2K A;  5KHH A;  1U96 A;  3VQX A;  3MDS A;  1BL8 A;  3CEI A;  4K35 A;  1AP6 A;  3F5W C;  1KKC A;  2ZE6 A;  1LR1 A;  2X6A A;  5ITZ A;  4DR4 B;  4IL6 Z;  4DYL A;  3OM3 B;  4PDM A;  4F4L A;  1WN7 A;  1K34 A;  1FFT B;  1YVW A;  1DF4 A;  2JGD A;  3HKC B;  1RSO A;  2H8P C;  1HR0 O;  5H6Q A;  4JI6 B;  2EIL C;  4JI0 B;  1VQ4 V;  5J9P C;  2L35 A;  1OCR B;  2ZIN A;  2Q0A A;  1OHH G;  4FZ1 A;  1PM9 A;  3CE2 A;  1GMG A;  3ABK B;  4FZ0 A;  1JFF A;  4BWA A;  4DXW A;  3E35 A;  2F1M A;  1IBK B;  4YY3 O;  1TAE A;  2A9H A;  4LR3 A;  2Q4P A;  3FB6 C;  2P67 A;  3L73 H;  3CX5 F;  2B9Z A;  1XMO B;  3RVY A;  4MW3 A;  5CBG A;  3QO8 A;  1JMK C;  1D5A A;  3IAY A;  4MSW C;  2HJF C;  3ML0 A;  1QLN A;  1JCH A;  2IU3 A;  3U10 A;  1J95 A;  4YJ3 B;  1YHQ V;  2KQX A;  1M90 W;  5IWA O;  1ZAU A;  5CA1 B;  5JJE B;  1X4T A;  4B3S O;  2XT9 A;  2ZQM A;  5H9C A;  3CPW U;  2F23 A;  2QEX V;  1WAZ A;  1SQP H;  2JDI G;  1Q6I A;  1J5E O;  3OMN B;  3TCU A;  1IZ3 A;  2Q0O C;  1FKA O;  1VQ8 V;  4EKW A;  1IXM A;  5B66 Z;  4RUF A;  2GSM B;  4TV8 A;  5A9G A;  3B40 A;  3OAA G;  1PPJ H;  4O4I A;  1BQZ A;  1NVP D;  2OIG A;  3EFF K;  5JQG A;  3BVO A;  4J41 A;  2JVD A;  4OGQ B;  5LGU A;  1R3I C;  2AZ2 A;  1K8A W;  1F51 A;  2WAM A;  1XNQ O;  1VF6 C;  1KKD A;  5L3E A;  3FYE B;  4TV8 B;  1WLE A;  4UCR A;  5FNV A;  1N36 B;  2HJD A;  3OTO B;  1AI5 A;  3QO5 A;  2ZE7 A;  1YTF D;  4CS3 A;  2WSS G;  4WFH A;  3ZRX A;  2UUB O;  2QGN A;  4PA4 A;  4GKK O;  4DR2 B;  2F95 B;  3HR0 A;  1V9P A;  3AG3 C;  2JS3 A;  3ZN0 A;  3RYF B;  1LUV A;  4WCE V;  5CA1 A;  4L8J A;  2XUM A;  5E1A C;  4DV2 B;  1Y66 A;  4DR6 B;  3ZHR A;  3GVM A;  4JYY A;  4QIW F;  1XI1 A;  3E22 A;  1RPO A;  2UXC O;  4MVZ A;  2LFS A;  1Q81 W;  2YXH A;  1SQG A;  3N2G A;  1ZWI C;  5LYJ B;  5HFM A;  5L3B A;  1JA8 A;  4B3M B;  1JVM A;  4DW1 A;  4JYC A;  5CA0 A;  4K0K O;  3H1K H;  4X65 B;  1WPX A;  4J10 A;  4P9P A;  3R66 A;  1NR7 A;  3K9S A;  2WLM A;  1Y6X A;  5TIS Z;  3ZHS A;  1E79 G;  1Z5W A;  2PI4 A;  4FLV A;  2QKS A;  3L74 H;  4JTD B;  2OWO A;  1PNK A;  3PN1 A;  4MVR A;  2BSK A;  1YSC A;  2XAS A;  3ASN C;  5IJ9 A;  2GTS A;  3OTF A;  3RYH A;  1MA1 A;  2CTP A;  3RFR A;  3QG5 A;  4H0L B;  1S3J A;  1M1K W;  4R7C A;  3OT7 A;  3TK1 A;  5KAI Z;  3OMA B;  1AR5 A;  5IYC O;  5IY5 C;  1BT8 A;  1ZSP A;  2E76 B;  1GK9 A;  3RYF A;  2UUC O;  5C93 A;  1F23 A;  5J2U B;  4X62 O;  4FLT A;  3MHS C;  4KHP B;  2ZM6 O;  4JI2 O;  2A0L A;  5DEC A;  5JVD A;  4O2B A;  1TA8 A;  1G6U A;  3AG7 A;  1FXK C;  3APO A;  3E8B A;  2PYJ A;  1JX9 A;  4RAI A;  1HR0 B;  1KUQ A;  4I9W A;  1K5S A;  4P9O A;  3H1L H;  5LHI A;  3L71 H;  3T2M A;  3CCV V;  5IDJ A;  4OPA A;  3AG3 B;  2HLD G;  2XAJ A;  4MTX A;  4ZHQ B;  3M8A A;  2ZCE A;  3THO A;  3LDC A;  2UXD B;  4WFF A;  4PDL A;  3IFX A;  4I4T B;  2LGW A;  2QA4 V;  4DV3 O;  3CC2 V;  3AG2 B;  1GN2 A;  3JSL A;  3G6B A;  1VQ6 V;  1NJI W;  3W7S A;  1AB3 A;  3M7M X;  3HKD A;  2PY5 A;  2Z5U A;  2JJ1 G;  3EHB B;  4O4H A;  1H2L A;  1ZLZ A;  1IBK O;  1BGY H;  1SC5 B;  3ZS8 C;  4NTY A;  2KSD A;  4FIP C;  3P3P A;  2AW9 A;  4JAV A;  2P7T C;  3ABK C;  2H3O A;  4GX5 A;  4F6R B;  2IJK A;  2UXN A;  1XRE A;  1OCZ B;  5EBL C;  2RQ6 A;  2BOC C;  1VQP V;  3WFV A;  1VF6 A;  4BAY A;  5GTH Z;  1Y74 B;  4B3R B;  4H33 A;  2A79 B;  4IIJ A;  4LFC O;  2A7W A;  3IC7 A;  2VQF B;  3N2G B;  5EYP A;  4PDR A;  3KKY A;  3ZHU A;  2GBO A;  2JK5 C;  3UO3 A;  3K03 A;  5JCO C;  1M56 C;  3CSX A;  4K8X A;  1PKX A;  2QJ1 A;  4PDV A;  4LF5 O;  2W0F C;  3LSQ A;  2NLJ C;  2D2C B;  3X2Q C;  3W7T A;  4GKJ O;  3OR6 C;  4NR1 A;  4DV4 B;  3K9A A;  4NB5 A;  5IE9 A;  2QWN B;  4DR2 O;  1N36 O;  2ZDI A;  2R70 A;  4Q20 A;  4MVM A;  4DR1 B;  3SPC A;  3SYA A;  1US6 A;  4DUZ B;  5CMU A;  3WB1 A;  3OGI B;  2DN9 A;  1Q82 W;  5LOV B;  4ASU G;  1TUB A;  3JAW A;  3P32 A;  5KHG A;  2G38 A;  1FD9 A;  1R3J C;  1OCO C;  3CRC A;  3WB0 A;  1K4D C;  4RQE A;  1I7F A;  5B1O A;  1X59 A;  1YI2 V;  4FMT A;  5F2V O;  3ASO B;  1M4U A;  3QVN A;  5EZY B;  1O9H A;  1FFX A;  1IUR A;  4J7Z A;  3P30 A;  1L1F A;  4EB6 B;  2CGO A;  3RYI A;  4KL1 A;  4LF6 B;  3CRR A;  3GWK C;  3IJ4 A;  2PF4 E;  1R3L C;  2XND G;  3SDL A;  2HEP A;  4X9Q A;  3T1C A;  4LF5 B;  3B09 A;  1FFX B;  1B6Q A;  2QWR B;  3JAR B;  3OGC C;  4NXM B;  4PJ0 Z;  1PNL A;  1IDS A;  4DV0 O;  4R6Z A;  2P22 C;  3WG7 B;  3TXS A;  4ABM A;  2Q73 A;  1HNW O;  2HHH O;  3VQV A;  4UCT A;  4NYK A;  2NNU A;  5JH7 A;  5FNV B;  4QNH B;  2FKX A;  3W7W A;  4UCO A;  4X20 B;  1GO3 F;  1B04 A;  4JGS A;  2ITC C;  3A8T A;  3L75 H;  4DV5 B;  1R1B A;  1T5E A;  4D6T H;  1DTO A;  4IGG A;  4JI8 O;  2EIK C;  4UXN A;  3R65 A;  2F66 C;  4HBN A;  1LUW A;  1W59 A;  4DRX B;  4DR5 O;  1XUQ A;  5KLV H;  2CH7 A;  1SET A;  2LW7 A;  3CYO A;  4CBC A;  2W0X A;  2CAZ C;  3D36 C;  3B8M A;  4ZI7 A;  2CH7 B;  2NR5 A;  1KU9 A;  4GZR B;  4NTX A;  2LP7 A;  4GCZ A;  3HKE B;  4P30 A;  4CZZ A;  2EZP A;  1TVK A;  5J2T B;  3HKB B;  2E5L O;  2Z0A A;  2CTW A;  4B7K A;  2UUC B;  2VWJ A;  1NQT A;  1YDX A;  1K33 A;  4H13 B;  1SZT A;  4MVQ A;  2EZO A;  3DSQ A;  5EK0 A;  1S72 V;  4FLY A;  1ZL8 B;  3RN4 A;  3E86 A;  2DQ3 A;  3BFR A;  1OZ0 A;  4HAM A;  4QPJ A;  4YJ2 B;  1AR4 A;  2RDC A;  3J80 N;  2QTS A;  4FFB A;  4OXS A;  1QR8 A;  2JGD B;  3G4S V;  4IHJ B;  5JCO A;  3I5D A;  3U11 A;  2Y0P A;  3LSU A;  5LXT B;  2YIA A;  4LH6 A;  4RQF A;  1RM1 B;  1IBM B;  3C90 A;  2P6J A;  3ETG A;  2OCH A;  3CMA V;  1N0J A;  4G2K A;  2ZNI A;  2WLL A;  3JAL A;  3UM7 A;  4ZOL A;  1NS1 A;  1CP9 A;  1DLB A;  4PV1 B;  3CXC U;  1Q43 A;  1N34 O;  1FPO A;  1I08 A;  4JZG A;  4KP4 A;  1CXZ B;  4LF9 B;  1N33 B;  4J42 A;  1H8H G;  1XDC A;  2ITD C;  4EFE A;  3JD2 A;  1IBL O;  4TOI A;  4CH5 A;  5DN6 G;  1QNM A;  4JYA O;  5GTI Z;  2WLL B;  2JS5 A;  4N21 A;  5IJ9 B;  3JAK B;  1H2M A;  1AJQ A;  4BIU A;  1NTM H;  2V7Q G;  4UCS A;  1HWY A;  4EEQ A;  1MNG A;  1P49 A;  4J80 A;  5K1X A;  4TUY A;  4NXN O;  1I0H A;  1K92 A;  3AK3 A;  4KFM A;  1U97 A;  5IYZ B;  2O57 A;  2UXB B;  1XNQ B;  3D36 A;  2YXY A;  1DF5 A;  1OCR C;  3MD0 A;  4B3R O;  2X6C A;  1B3Q A;  2JEX A;  3KCX A;  4DV6 B;  2GUZ A;  3D8C A;  4KUM A;  3SPH A;  1NH2 D;  4IYH A;  4FLW A;  1KC8 W;  4DUY B;  5GON B;  1GKF A;  2UU9 O;  1VF7 A;  2JJ2 G;  4CS4 A;  2RN9 A;  3ZX6 A;  4J11 A;  5KA5 A;  4W4L A;  2BCC H;  4IIJ B;  2YUA A;  2DYR C;  4UCU A;  2BTO A;  2GUZ B;  2BSK B;  1BSM A;  2ADQ B;  4H37 A;  4UV8 A;  3G71 V;  1MAB G;  3E8F A;  3LDE A;  4UB8 Z;  2BOB C;  4KHP O;  3RWR D;  1XHX A;  3GWO A;  1OCC C;  1ARO P;  4O2B B;  3BAA A;  2PI5 A;  1BCC H;  4B08 A;  3TGU H;  4DR1 O;  4X66 B;  3RYC A;  2QTO A;  1HNX O;  1K3E A;  1RPR A;  3T1H B;  1EBO A;  1N34 B;  1VP7 A;  3RYI B;  3JAK A;  4FM1 A;  3Q4H B;  1ROP A;  2OIE A;  5DED A;  2ZE8 A;  2PUS A;  4X64 O;  2OCC B;  5GW7 A;  1P7G A;  4ZIB A;  4DK0 A;  2Y4U A;  1YJW V;  5B1N A;  2Y4T A;  4X1I A;  4X1K A;  4LWS B;  1YIT V;  1QVF U;  3A0H Z;  2LO1 A;  3K04 A;  1QCE A;  3SJC C;  4R50 A;  3HPL C;  1G4Y B;  3AG1 B;  1LNQ A;  4IYI A;  3KCY A;  2GV9 A;  1SQF A;  5KUM A;  2RCV A;  2AHY A;  3RYC B;  2ZE5 A; 
#chains in the Genus database with same CATH homology
 1HP8 A;  1U97 A;  2HP8 A;  2LQT A;  2RNB A;  2RN9 A;  1Z2G A;  1U96 A;  2LGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...