2LQTA

Solution structure of chchd7
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
NPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRAVGNMPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Coiled-coil-helix-coiled-coil-helix domain-containing protei
publication title Structural characterization of CHCHD5 and CHCHD7: Two atypical human twin CX(9)C proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2lqtA00
1HP8A 2LGQA 2RNBA 1U96A 1U97A 1Z2GA 2RN9A 2HP8A 2LQTA
chains in the Genus database with same CATH superfamily
3WB2A 2FKXA 2X7RB 2AGAA 5LMNB 2YI8A 3TXQA 2RQ6A 4FFBA 4WFAV 5JWPA 3SYOA 1P84F 2P5OA 3ZRWB 2YIAA 4FLTA 1NVPD 2UXBO 1VP7A 3SYPA 5CB4B 2XASA 1FPOA 5KHKA 4DV5O 1TAEA 4BW9A 2AHZA 2E74B 2W0XA 2BTQB 5ITZA 2CTRA 3TETA 2Y4TA 3CJHB 2XT9A 3K04A 4JI5B 2DMXA 3STLC 2OIEA 4X1KB 1KB9F 1YJWV 2FMLA 3CCEV 1FFTB 2ZDIA 4FMTA 4FM1A 3ABMB 2QTSA 4CC6A 5KX5A 3T1CA 3P3PA 2AZ2A 3LUTB 2Y4UA 3APOA 1TUBB 3ZEDA 3FB7C 2ZM6B 2HHHB 4CC5A 3R66A 3ZMVA 5LHIA 1W2BU 4ZI7A 3E83A 4K3AA 5KA6A 1BSMA 2QWQB 1HWYA 1ZX3A 3CS5A 3ZHQA 4X9QA 2L6LA 4LFAB 3WB0A 1M4UA 2A0LA 1KKDA 2Q6AA 4QE7A 1SZXA 2M6YA 2GV9A 2KB1A 1B06A 4LF4B 5EK0A 1FFXB 1FD9A 4NTWA 3B77A 3ZRSA 4JI7B 2E76B 1SQVH 3S3XA 5KMGA 4DR1O 3LSSA 1WNSA 4J7ZA 3CCLV 2EIJC 4YJ3B 4JI6B 3J81N 3HKCB 5LA6B 3E2EA 4DR7O 3OE7G 2EX3A 2LO1A 4TV8B 4I9QA 5CA0B 1KECA 4WBNA 1NTKH 2YEVB 5EYPA 1YSCA 4JI4B 3JASB 4KHPB 3OR7C 3SJBC 4DV0B 4BIUA 3T4DA 1L1FA 4DR3B 1VIBA 2WLLB 1D2DA 5JJEB 5J2TB 1HNWB 2JGDA 3CMEV 4UVAA 5BY1A 1K34A 3ZHRA 2QKAA 3E86A 3JAKA 1JX9A 4DV6B 3JSNA 1QU7A 4LC1A 4NXNO 3DTUB 4PV1B 2V7QG 3RYFB 1XNRB 1QR9A 1FXKB 3RYIA 3QNEA 2Q5ZA 3IAYA 2N04A 3M7MX 3CRMA 1JR9A 1Q86W 1K4CC 2DW4A 4IHJA 2CTWA 3I56V 4O2BA 4GX5A 3OR6C 1EN4A 4J7JA 1R3JC 1QBZA 3JAMN 2UXNA 1XEQA 2UXCO 4UUJC 3AEIA 1BGYH 4YJ2B 2QKCA 5EC2C 1GTOA 4PD4F 3CYOA 3CB2A 3T1YB 2VQFB 4LFBO 4YXWG 1FXVA 4JI2B 4L87A 3RT3C 4DO2A 2W0FC 1XMOO 2PYJA 1P7BA 1AB3A 1ZWIC 4FFBB 4X89A 1B3QA 2QGNA 1ROPA 1JJ2U 4FJCC 4JI8O 2LFSA 1LR1A 2NNUA 5GTHZ 3F7YC 2DYSB 1MZEA 4B3SO 2VRZA 3LNMB 1KP3A 3L9DA 2KSDA 5ITZB 3T1HO 3FYEB 4FLXA 4X65B 2IH3C 1YI2V 2H8PC 5FLXN 4IYIA 2F4VO 1OCRC 3ETDA 4XDJA 3RYCA 3TK1A 3ZMZA 3KCYA 5KX5B 3FD9A 4MS2A 2W6IG 2OTLV 4JI3B 3ICXA 1N32O 5LOVA 1L0LH 1R6KA 1K4DC 1VARA 4Q6GA 4JI0B 4LF8B 4ZI7B 2B1GA 2UUCO 2CH7A 2YDEA 4J7KA 3OEHG 3AK2A 1KU9A 4U7OA 1XI1A 1O9GA 1SRYA 2ADQB 4G27B 1VQ8V 2FL4A 2P90A 3CE2A 2UU9O 2LGWA 2P06A 3E8FA 4MSWC 3FB8C 4MVQA 5JCOC 3ZMUA 4NB5A 2QEXV 1MZFA 4X66O 3ZHVA 4JGSA 1QHTA 4RQEA 4B3MB 1D5NA 4KFMA 4X64B 1Q5OA 1R6TA 2XNDG 3I55V 2X6BA 5EYPB 1HR0B 2QWPB 4PI2A 4AQYO 1NU1H 1IVSA 1RFYA 3WFVA 2JGDB 2K1EA 1A32A 1AI4A 2UXDB 1NT2B 3ZMSA 3OUSA 1YCIA 2LFRA 2AHYA 4QIWF 3JAKB 4X62B 4UXNA 1NR7A 3AG1C 1Y74B 2OCCC 2Q8VA 5EBLC 1YZBA 5H6QA 3QO5A 3RYIB 2HP8A 2HEPA 4ZHQB 2QSAA 2WWWA 3K9AA 5JH7A 1N36B 4EB6A 1QLEC 2WLJA 3L73H 2H94A 4IT5A 1YTFD 4GX1A 3GVMA 4O2BB 1QLNA 5FNVA 4DRXA 2WLIA 1Z2GA 3U11A 5EZYB 3OTOO 3BEHA 4U3FH 1MMMA 5KUMA 2EZPA 3HR0A 3Q4HA 4R7CA 4TQFA 3VQVA 4I50A 4FFKA 1GM7A 1SQFA 3IFXA 1FXHA 3CRAA 2HJDA 3AK1A 4JPRA 5GONA 4NKGB 1HNXO 1FXKC 3RYHA 3UM7A 1XHZA 2X6CA 4DR6O 5H9CA 4LF6B 3A0RA 1IXMA 1SQBH 3K03A 1GAXA 3QTCA 4E2LA 1CPYA 2ZIOA 1COWG 5L3GA 1N8RW 4H33A 3OMNB 1I08A 5A9GA 2PI5A 4WFFA 4BAYA 4NR1A 4DV3B 1JFFB 3MD0A 2N05A 2P67A 5EBWC 1AP5A 1EM1A 3TGUH 3CCVV 1J5EB 1VQKV 2D2CB 2UUBB 2M7WA 4GUNA 1Q43A 5LMUO 3F5WC 4TQDA 4DR2B 4PA3A 2QM8A 4CH4A 3ZJZA 4U7NA 4LF5B 2UXXA 1H8HG 2CUGA 3H1LH 5LHGA 3E8BA 2DWEC 1Z5VA 2IU3A 1FS0G 1K73W 1M56C 4X1KA 4RWUA 2R9AA 2CH7B 2WLKA 4LF9B 2HFEC 4WF9V 2YIDA 4PELA 3J7AU 2UUAB 1AI7A 1WB8A 3O9OA 2CK3G 2BE3A 5B5EZ 2YS8A 1F7YA 4JYCA 3C3SA 2DQ3A 2ZR2A 2JVDA 4JI1B 1SS3A 1TUBA 2EIJB 5JCOA 1I0HA 3E8GA 2RDCA 1NJIW 1N34B 3ABTA 1NH2D 4QPJA 2CTQA 4H0LB 2WPDG 3I5DA 1YJ9V 4DK1A 1BCCH 2Q9LA 4OPAA 4TT3G 1NVPB 4O4JA 3HKDB 3KCXA 5JJNB 4JTDB 4IIJA 3UT5A 4RO2A 2ZE6A 4TWKA 2WA4A 1Q82W 5C93A 1H2SB 5L3DA 5H2FZ 2A79B 2CE4A 2Y69C 5KUKA 2H3OA 1OZ0A 3HKCA 3HB3B 5LA6A 1DF4A 2KQXA 4FM2A 3S3WA 4MVOA 4Z1VA 1X59A 5CA0A 1OCCB 1M5IA 1M57C 1XNQB 1SESA 1XMQO 1US6A 3VQXA 4EB6B 3JD4A 3ETGA 2IJJA 2LW7A 4DV2O 5LHHA 4DUZO 4DR5O 1XL4A 5BZBA 5CA3A 2GBOA 2ZQMA 4JASA 5J2TA 3QO7A 2JDIG 4I50B 4AI8A 3P30A 4LNUA 4J42A 3SYQA 4QGPA 4WFGA 1K33A 1SQQH 4HNAB 5IE9A 1G1XB 4QNHB 5GONB 1MOFA 4W4KA 3SPCA 1BHAA 1FXKA 3QVNA 3K0GA 4LH7A 3RYHB 5LGUA 3JARA 5F2VO 1EZJA 3VQYA 1H2NA 3TXSA 4P2ZA 2E3CA 3A0HZ 1GN4A 4TV9A 3NR7A 4R50A 2YUAA 3ABKC 2HR3A 1JPXA 5JQGA 2KG7B 3RW0A 1MA1A 4PJ0Z 4YJ2A 5IWAO 4O4IB 3ZX6A 5L3EA 2XAJA 1AJPA 1XILA 4FLUA 2HJFC 5IY5B 4LF7O 5CBHA 2NR5A 1OCRB 4MTOA 4KUMA 3E89A 1VQ9V 1FAFA 2GHYA 1XQ8A 2VWKA 1S5LZ 1OCOC 3F7VC 3K58A 5BXZA 4DV7B 1MNGA 4PI0A 1JA8A 2R72A 4JYYA 2RNBA 4J11A 1R3LC 2OYQA 5IJ0A 2B5UA 1TA8A 3SJCC 1MG1A 4FZ1A 3BCCH 3K3WA 4YHHO 2JJ1G 2E5LO 1ZTEA 2O57A 2XTAA 1VQMV 4YY3O 4IGGA 2A3QA 2GUZB 3IGAC 2WAMA 4LR3A 5KHIA 4DV4B 4DV5B 1XDCA 2R9IA 1JOYA 2ETNA 3AG2C 3SGIA 1FKAO 4EFBA 2JRIA 1F51A 4P9PA 3CCRV 1VQ4V 2JGUA 3RWRD 4B3TO 1KMIZ 3QO8A 1YHQV 1BT8A 3RVYA 3O65A 4NXMO 4O4JB 4Q20A 4DV1O 4IIJB 1NS1A 3JD2A 3UT5B 1HP8A 3A8TA 5BMVA 3OEEG 4O4HB 1X4TA 5B1BC 1IBKO 4JAUA 3U0ZA 5IYZB 4ABMA 3AK3A 3K79A 4BIZA 3AG1B 2LP7A 2PYLA 2OCCB 1PD3A 2PTMA 4O2AB 1RPOA 5IYCO 2IBZH 4HYOA 4QJFB 4CS3A 4AHCA 3D36C 1P49A 2XHBA 1QLEB 4DR4O 3SPJA 3RFRA 1S0VA 4GKKO 1YITV 4DR1B 3N2KB 1K5SA 3WU2Z 3OGIB 4LBEC 3CRQA 4DR7B 1S3JA 2OTJV 5TISZ 4LFCO 2VQEO 2AXTZ 4B3RO 3MAQA 4LNUB 4DV6O 2HVJC 3AG4C 2QWOB 4MTGA 1Y74A 1ZL8A 1F23A 1I94O 2EZOA 1OCCC 1BZKA 4ZHQA 2JEUA 3JARB 1L8DA 4G2KA 1Y76B 2PF4E 4TV9B 1V55B 3B2EE 4FLYA 5EZYA 3ZN1A 3ZHTA 2BCCH 2FTKA 3CXHF 1Y6XA 4NXNB 3T2MA 5JQGB 1FYJA 2CGOA 2OCHA 5HFMA 4CBCA 4H13B 2IM9A 5KLVH 1SETA 4UVBA 5D5QA 2VQFO 2ZE7A 3CCSV 1WN7A 3G6BA 4JYBA 1TVKB 4OX9O 2QR4A 1S5JA 5E79Z 2UXCB 1GKFA 2BOBC 3BY6A 1HW7A 1HNZO 5CBGA 4K8XA 4BWAA 5CA1A 1IBLO 4LFBB 1W0JG 5IJ0B 1XMOB 5DM6V 4C7UA 2WLNA 1M56B 4CH3A 4GYCB 4JI8B 3CCMV 3C3TA 5IY5C 4MTFA 1YTFB 1JFFA 2YI9A 4B3SB 1BHBA 3CCJV 3STZC 4MVSA 2Q69A 3RBZA 3ZRXA 1NZ6A 3CHXA 1QNMA 1DLBA 3HKEB 1R3IC 1WPXA 1DGSA 2F66C 3JYCA 3T1HB 4UCVA 1IURA 4GKJO 4DYLA 3EHBB 3CEIA 1L0NH 2F4VB 1AR4A 1B04A 4MW3A 2P6JA 2Q7GA 2Z5UA 3ASNB 1Q6UA 1WP8A 3B8MA 3SPHA 4D7SA 5JJJB 1N0JA 1N32B 1D5AA 1M1KW 3CRCA 3SJQC 2D3OW 1JJOA 5BMVB 2RMKB 2RN9A 1K8AW 2ZXWC 1GN3A 4R8CA 2Z0AA 4N23A 2P7TC 1B6QA 4EEQA 3OAAG 2UUCB 4HAMA 2Y69B 5K1PA 4LH6A 3K5MA 2QM4A 2EILC 3G6EV 4MVZA 1M57B 3ZRVA 3AG7A 4X88A 1WP7A 3D36A 1ORQC 2HVKC 2BSKA 3HKDA 4CH6A 3BPZA 2UU9B 2OWOA 1ZUQA 3B4SA 3K9SA 1R3KC 4X66B 3CC7V 2A06H 3C90A 4RUFA 4DUYO 2ZINA 5DN6G 3DC5A 2ZR3A 5FPOA 1ZL8B 1K5QA 4AQYB 4X1IA 1VF5B 1MSDA 1GM8A 4J10A 2Q67A 2V4DA 1Q6HA 3X2QC 1VQ7V 4B08A 4X1YB 1LUVA 1IZ3A 2DJVA 1BMFG 1SKVA 1KC8W 3ABKB 1G4YB 5KAIZ 4GCZA 2YXLA 3LDCA 1NH2B 1PM9A 3KG2A 1SQPH 1QR8A 4MTXA 5B1AC 3MDSA 2F93B 3GWKC 4DK0A 2A9HA 4HNAA 1R73A 4OXSA 4Z1MG 3B40A 1IBMB 1KKCA 3OTOB 4QPKA 2PY5A 1I5XA 1OCOB 1PP9H 1RSOB 5DEDA 1ZLZA 4UCRA 1V55C 1N33O 5CA1B 4FLWA 3ZMTA 4CS4A 3ZN0A 4GLXA 1V9PA 4NYKA 2KG7A 1YIJV 2Q7HA 1HNXB 1OCZB 2CDYA 4O4IA 4JAAA 3K0DA 3OFNG 3H1HH 4DR6B 3LDEA 4XDLA 1PNKA 3F5TA 1QCEA 5AG2A 3SPIA 2HLDG 1GRJA 1Y67A 3UCSC 3VOUA 3OGCC 3AG2B 2Q0AA 4I5SA 1BQZA 2XAGA 4GT1A 2QWNB 3LNNA 1H2GA 4FZ0A 4PDLA 3CC4V 3G67A 3CCUV 1VQ5V 3SYAA 1U96A 4ZOLB 3H1IH 5LMUB 2IJKA 3BABA 1J95A 3CRRA 4G28B 2R70A 2GUZA 1P7GA 1UFIA 3L74H 4PDVA 2XUMA 1M9NA 1N4CA 4W4LA 2Y0IA 2DN9A 4K0KO 5B1BB 3IJ4A 4O4LA 3OT7A 2Y48A 1GO3F 4JYAO 4U3JA 1I5YA 2EINB 3ASNC 1ENVA 2MW2B 4IYHA 5GW7A 1EN5A 3OM3B 1U97A 4QE9A 2BSKB 3CX5F 5J9PC 4K35A 2EULA 4D7TA 1V54C 1XHXA 1MABG 1VF6C 1KQSU 4O4HA 5EBMC 1E1RG 5IYZA 4WFBV 1MSWD 1BQ0A 3R65A 4BIOA 4RAIA 3AG4B 1FJGO 2CAZC 4I0XB 2Q68A 4O2AA 2Z3YA 4X1IB 3DGEA 2EBOA 4WFEA 5LXTA 5LP6C 1S76D 4JV5B 1KD1W 2QKSA 3N2KA 3LSQA 4YIPA 2XAFA 1CEZA 3ZS8C 2QA4V 4FLZA 4KP4A 2YICA 1XUQA 4I4TB 1I7FA 1OV9A 4F6EA 4HZ3A 1CXZB 5BR8O 5LL6Y 1OHHG 1Q90D 4OGQB 5L3BA 3CWBH 4DV2B 3L70H 3JCUZ 1VEWA 2YXHA 2ZKOA 4X8AA 4DUZB 4DR5B 2F1MA 3P3NA 2R9RB 2ZNIA 4LWSA 1NTMH 3RGBA 4LCUC 1Y76A 3CXCU 3FB5C 2ADPA 1BS3A 1YEWA 3FAVA 5KA5A 3SPGA 2JS3A 3AG3C 3FFQA 3JCZA 5LMNO 1NI8A 1SC5B 3FKSG 2B1IA 3U10A 1QVGU 1TVKA 2K9PA 1GK9A 3CCQV 2DYRC 3H1JH 3VQWA 1P4RA 3ZHUA 1YF2A 4DV7O 1YVWA 1RPRA 2AW9A 5H6RA 3K08A 1W59A 2NLJC 4EFEA 1DK1A 3LDDA 4LF7B 2JEXA 2Q4PA 5B1NA 3L75H 1EZVH 5EIBD 1OCZC 2PGGA 2ZE8A 1AI5A 4JI5O 2ITDC 3JATA 4PA4A 4JF3A 3K5LA 1AR1B 1VQPV 4FK5C 4I9WA 5L3CA 2UXBB 2EIMB 4PDRA 3D8CA 2DE0X 1AI6A 4PA9A 1M90W 2EIKC 3HKBB 1TUEB 4F6RB 4DV4O 3HKEA 5E1AC 2ODMA 2W6JG 5IYDO 4RUEA 3RN4A 5DECA 2ZXWB 2E75B 2WLHA 4YHHB 4O4LB 1PV0A 2ZM6O 3E22B 2E5LB 2XAHA 2HHHO 3H01A 3KZIZ 4P9OA 1RM1C 4U3JB 2EILB 4YY3B 2P4KA 3OD4A 2XOKG 1OJHA 1T5EA 2F43G 3JALA 3T4ZA 4JZ2A 2GTSA 3SR2C 1JMKC 2VWJA 4LFAO 5GTIZ 3CC2V 2ZE5A 3E35A 3OUFA 4B3TB 1VF6A 4LF4O 4JI7O 3PJSK 4Z2WA 4NXMB 4FVMA 2JIZG 4CS2A 3JAWA 4JI6O 4A5UB 1H2LA 3G80A 4UCUA 4YIOA 1EBOA 3FX7A 4DV1B 2MK3A 4UV9A 4TUYA 2ZD9A 3W7SA 2EINC 5LXTB 3DSQA 5LP6A 1SA0B 2QTOA 4I7ZB 1JCHA 4JI4O 1Q6IA 3WB1A 4KHPO 3X2QB 1IBKB 1Q7YW 4DV0O 3G71V 3QF7A 4DR3O 1NBMG 3H1KH 2A7WA 3G4SV 5IYBO 1ZAUA 3GB7C 1HNWO 3L72H 2Y0PA 5EIBC 1VQNV 2C2AA 3H9VA 5B1AB 3OMIB 2RCVA 4DR4B 1GN6A 3JD3A 1WB7A 4GKKB 2IW5A 3K5OA 4MVRA 1XNRO 1R6NA 1VQOV 3JSLA 5L3FA 4KXRA 3N2GA 1AR5A 1URFA 4LFCB 1BE3H 2VQEB 4LWSB 3CMAV 4MT8A 4B3RB 4X1YA 5IJ9B 3BFRA 1CP9A 5EC1C 4X20A 1SQGA 3FAVB 5JVDB 5KHHA 4BW5A 5A2QN 1I94B 2KKWA 5K1XA 4J9YB 3J80N 3T1YO 3SDLA 4ZKIA 5LBQA 4JI2O 3D3QA 5FL7G 3ASOC 1K92A 3B8NA 4MVUA 1PNLA 3WG7B 2X6AA 2IU0A 1M93A 1SZTA 2AZ0A 1E1QG 1PL4A 2P4VA 1RSOA 3ABLB 1Q8IA 4GZRB 1AILA 2P22C 1KBHA 2ITCC 1NKDA 4OX9B 1H38A 3W7UA 4FIPC 4N21A 3JATB 4X65O 2LQTA 1S5HC 1GN2A 3KKYA 2CTPA 1LUWA 2YSUB 4UVCA 1HNZB 5J2UA 2B9ZA 1QQCA 1UJWB 1IBLB 2WLMA 4DXWA 3BA8A 4JTAB 4OPHA 4ZBMA 4JI3O 5LYJA 2BOCC 2JK5C 2JJ2G 1JVMA 3FB6C 1NR1A 1GH6A 1SQXH 4JI0O 5IDJA 5KAFZ 2JS5A 4LF8O 2IJHA 5H5NA 2WSSG 4H37A 2QDOA 3JALB 3OTFA 4ZOLA 2EIMC 3M8AA 1K97A 3GWOA 4GKJB 4PHZA 2YIBD 2VS0A 1V54B 2G38A 1IXBA 1F4MA 2ILMA 4MW8A 2LGQA 1QVFU 2FYUH 5C8YA 3JD1A 3JAWB 4I55A 4EKWA 3ABMC 3OMAB 1XOUA 1F4NA 4IL6Z 3K59A 4B3MO 4F4LA 1K9MW 2ZT9B 4X64O 4TUYB 4DW0A 1Z5WA 4LP8A 3TCUA 3ZCCA 3P32A 5LP6B 1HR0O 4B7EA 3BVOA 3THOA 5KMGB 1WA8A 3JD0A 1AJNA 2OT5A 3K5NA 3D3IA 2UXDO 3RVZA 4WBNB 4NVPA 2X0LA 2EJ7A 4X62O 2ATKC 3DXRA 2V1DA 1KUQA 3W7TA 1HDJA 3IC9A 4I0XA 1Y4MA 2QWRB 4TSFG 3N2GB 1N36O 4FLVA 4DUYB 1S72V 2ZIMA 3EXAA 1AJQA 1Q3EA 3CSXA 4UFZA 1PPJH 3PN1A 4X20B 1DTOA 4I4TA 1PL0A 1VQ6V 2Q0OC 3AG3B 4J80A 2QJ1A 4KL1A 3W7XA 4NTYA 4E4EA 4IHJB 5KHGA 4GX2A 1G8MA 1IBMO 5B3SB 2BTOA 2DYRB 1EN6A 3FYIB 3UKMA 1NTZH 4LF6O 3N27A 3SYCA 3MHHC 5HFLA 3ABUA 3CPWU 1H2KA 1UPGA 1WAZA 3BAAA 2DOSA 2FB5A 2YC0A 3B09A 2Q73A 3BRCA 3ZIAG 3MHSC 4DV3O 3LSUA 4XDKA 5J2UB 2EIKB 3WG7C 1N33B 2XAQA 2IH1C 2GDSA 1J5EO 1SERA 4UCOA 4D6TH 1VQLV 2UUBO 1KP2A 3ML0A 5FPRA 2WA3A 1WLEA 1WPBA 4JAVA 2CGNA 2GSMB 3ABLC 5LYJB 1LNQA 2LJ2A 4DR2O 2HG5C 4LF5O 1Q81W 3SJAC 5CMUA 4PDMA 4CZZA 4J41A 3A2FA 1RM1B 3RYCB 3W7WA 3EVKA 4P30A 2ZNJA 3APQA 5D5PA 1K3EA 2RJZA 3ZRWA 1NQTA 4ZIBA 4LF9O 3VBBA 4UB6Z 2DYSC 2YXYA 2UUAO 5CB4A 1AVMA 3L71H 3HKBA 5LOVB 1BL8A 4B7KA 4F6RA 5IT9N 3QG5A 2BTQA 1E79G 3CJHA 4WFHA 3ZHSA 1H2MA 4JI1O 3A0BZ 4WCEV 5C8YB 4I55B 4L8JA 1O9HA 1N34O 2ZDIC 3E22A 2QM7A 4CH5A 1XBLA 1R1BA 3ETEA 4PA6A 1YJNV 1TGOA 3M99B 1PKXA 1AROP 1THZA 4K0KB 1GMGA 2DWDC 2HKOA 2IJIA 5CN0A 4DW1A 1WA8B 1YDXA 2PUSA 4UB8Z 2PZSA 4UCSA 2L35A 4JYAB 2DQ0A 1IDSA 1EFRG 3DXRB 2PI4A 4TOIA 3BA9A 5KHJA 1XNQO 1FFXA 4JV5O 4JTCB 1SA0A 4ASUG 2F23A 4FPPA 4XBFA 3NXSA 1DF5A 4AILC 4UCTA 4YJ3A 4PA7A 1VMGA 4TV8A 3K57A 1FJGB 1YXBA 1RP3B 3IC7A 2LW1A 1ZSPA 4R6ZA 1XREA 1XMQB 3ZBHA 5JH7B 2YEVA 1WJZA 2OIGA 4FM0A 3JASA 3CD6V 5B1OA 4MVMA 5LGNA 1K7DA 5FNVB 4DRXB 2WLIB 3ASOB 3CP1A 2GTAA 1GM9A 1G6UA 1XL6A 2WLLA 2YIBA 3HPLC 3BHPA 4JZGA 2F95B 1VF7A 2N74A 2ARHA 2Q7EA 1N0NA 3Q4HB 3TJTA 1KYOF 2ZCEA 5BR8B 1Y66A 5LGTA 4UV8A 5IJ9A 2NN4A 4ICGA 4NTXA 4HBNA 1SF9A 5CBFA 3UQ8A 1H8EG 3UO2A 3OW2U 4RQFA 3RYFA 5JVDA 3K06A 1JQ0A 1W0KG 4J9ZB 3DC6A 3ETQA 5B66Z 3UO3A 3E8HA 3EFFK 4BR6A 5B3SC 4K8ZA 2QE7G 4GX0A 1AP6A 1IX9A 2EJRA 1S77D 1PNMA 4H44B 5IWAB
chains in the Genus database with same CATH topology
1HP8A 2LGQA 2RNBA 1U96A 1U97A 1Z2GA 2RN9A 2HP8A 2LQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP8 A;  2LGQ A;  2RNB A;  1U96 A;  1U97 A;  1Z2G A;  2RN9 A;  2HP8 A;  2LQT A; 
#chains in the Genus database with same CATH topology
 3WB2 A;  2FKX A;  2X7R B;  2AGA A;  5LMN B;  2YI8 A;  3TXQ A;  2RQ6 A;  4FFB A;  4WFA V;  5JWP A;  3SYO A;  1P84 F;  2P5O A;  3ZRW B;  2YIA A;  4FLT A;  1NVP D;  2UXB O;  1VP7 A;  3SYP A;  5CB4 B;  2XAS A;  1FPO A;  5KHK A;  4DV5 O;  1TAE A;  4BW9 A;  2AHZ A;  2E74 B;  2W0X A;  2BTQ B;  5ITZ A;  2CTR A;  3TET A;  2Y4T A;  3CJH B;  2XT9 A;  3K04 A;  4JI5 B;  2DMX A;  3STL C;  2OIE A;  4X1K B;  1KB9 F;  1YJW V;  2FML A;  3CCE V;  1FFT B;  2ZDI A;  4FMT A;  4FM1 A;  3ABM B;  2QTS A;  4CC6 A;  5KX5 A;  3T1C A;  3P3P A;  2AZ2 A;  3LUT B;  2Y4U A;  3APO A;  1TUB B;  3ZED A;  3FB7 C;  2ZM6 B;  2HHH B;  4CC5 A;  3R66 A;  3ZMV A;  5LHI A;  1W2B U;  4ZI7 A;  3E83 A;  4K3A A;  5KA6 A;  1BSM A;  2QWQ B;  1HWY A;  1ZX3 A;  3CS5 A;  3ZHQ A;  4X9Q A;  2L6L A;  4LFA B;  3WB0 A;  1M4U A;  2A0L A;  1KKD A;  2Q6A A;  4QE7 A;  1SZX A;  2M6Y A;  2GV9 A;  2KB1 A;  1B06 A;  4LF4 B;  5EK0 A;  1FFX B;  1FD9 A;  4NTW A;  3B77 A;  3ZRS A;  4JI7 B;  2E76 B;  1SQV H;  3S3X A;  5KMG A;  4DR1 O;  3LSS A;  1WNS A;  4J7Z A;  3CCL V;  2EIJ C;  4YJ3 B;  4JI6 B;  3J81 N;  3HKC B;  5LA6 B;  3E2E A;  4DR7 O;  3OE7 G;  2EX3 A;  2LO1 A;  4TV8 B;  4I9Q A;  5CA0 B;  1KEC A;  4WBN A;  1NTK H;  2YEV B;  5EYP A;  1YSC A;  4JI4 B;  3JAS B;  4KHP B;  3OR7 C;  3SJB C;  4DV0 B;  4BIU A;  3T4D A;  1L1F A;  4DR3 B;  1VIB A;  2WLL B;  1D2D A;  5JJE B;  5J2T B;  1HNW B;  2JGD A;  3CME V;  4UVA A;  5BY1 A;  1K34 A;  3ZHR A;  2QKA A;  3E86 A;  3JAK A;  1JX9 A;  4DV6 B;  3JSN A;  1QU7 A;  4LC1 A;  4NXN O;  3DTU B;  4PV1 B;  2V7Q G;  3RYF B;  1XNR B;  1QR9 A;  1FXK B;  3RYI A;  3QNE A;  2Q5Z A;  3IAY A;  2N04 A;  3M7M X;  3CRM A;  1JR9 A;  1Q86 W;  1K4C C;  2DW4 A;  4IHJ A;  2CTW A;  3I56 V;  4O2B A;  4GX5 A;  3OR6 C;  1EN4 A;  4J7J A;  1R3J C;  1QBZ A;  3JAM N;  2UXN A;  1XEQ A;  2UXC O;  4UUJ C;  3AEI A;  1BGY H;  4YJ2 B;  2QKC A;  5EC2 C;  1GTO A;  4PD4 F;  3CYO A;  3CB2 A;  3T1Y B;  2VQF B;  4LFB O;  4YXW G;  1FXV A;  4JI2 B;  4L87 A;  3RT3 C;  4DO2 A;  2W0F C;  1XMO O;  2PYJ A;  1P7B A;  1AB3 A;  1ZWI C;  4FFB B;  4X89 A;  1B3Q A;  2QGN A;  1ROP A;  1JJ2 U;  4FJC C;  4JI8 O;  2LFS A;  1LR1 A;  2NNU A;  5GTH Z;  3F7Y C;  2DYS B;  1MZE A;  4B3S O;  2VRZ A;  3LNM B;  1KP3 A;  3L9D A;  2KSD A;  5ITZ B;  3T1H O;  3FYE B;  4FLX A;  4X65 B;  2IH3 C;  1YI2 V;  2H8P C;  5FLX N;  4IYI A;  2F4V O;  1OCR C;  3ETD A;  4XDJ A;  3RYC A;  3TK1 A;  3ZMZ A;  3KCY A;  5KX5 B;  3FD9 A;  4MS2 A;  2W6I G;  2OTL V;  4JI3 B;  3ICX A;  1N32 O;  5LOV A;  1L0L H;  1R6K A;  1K4D C;  1VAR A;  4Q6G A;  4JI0 B;  4LF8 B;  4ZI7 B;  2B1G A;  2UUC O;  2CH7 A;  2YDE A;  4J7K A;  3OEH G;  3AK2 A;  1KU9 A;  4U7O A;  1XI1 A;  1O9G A;  1SRY A;  2ADQ B;  4G27 B;  1VQ8 V;  2FL4 A;  2P90 A;  3CE2 A;  2UU9 O;  2LGW A;  2P06 A;  3E8F A;  4MSW C;  3FB8 C;  4MVQ A;  5JCO C;  3ZMU A;  4NB5 A;  2QEX V;  1MZF A;  4X66 O;  3ZHV A;  4JGS A;  1QHT A;  4RQE A;  4B3M B;  1D5N A;  4KFM A;  4X64 B;  1Q5O A;  1R6T A;  2XND G;  3I55 V;  2X6B A;  5EYP B;  1HR0 B;  2QWP B;  4PI2 A;  4AQY O;  1NU1 H;  1IVS A;  1RFY A;  3WFV A;  2JGD B;  2K1E A;  1A32 A;  1AI4 A;  2UXD B;  1NT2 B;  3ZMS A;  3OUS A;  1YCI A;  2LFR A;  2AHY A;  4QIW F;  3JAK B;  4X62 B;  4UXN A;  1NR7 A;  3AG1 C;  1Y74 B;  2OCC C;  2Q8V A;  5EBL C;  1YZB A;  5H6Q A;  3QO5 A;  3RYI B;  2HP8 A;  2HEP A;  4ZHQ B;  2QSA A;  2WWW A;  3K9A A;  5JH7 A;  1N36 B;  4EB6 A;  1QLE C;  2WLJ A;  3L73 H;  2H94 A;  4IT5 A;  1YTF D;  4GX1 A;  3GVM A;  4O2B B;  1QLN A;  5FNV A;  4DRX A;  2WLI A;  1Z2G A;  3U11 A;  5EZY B;  3OTO O;  3BEH A;  4U3F H;  1MMM A;  5KUM A;  2EZP A;  3HR0 A;  3Q4H A;  4R7C A;  4TQF A;  3VQV A;  4I50 A;  4FFK A;  1GM7 A;  1SQF A;  3IFX A;  1FXH A;  3CRA A;  2HJD A;  3AK1 A;  4JPR A;  5GON A;  4NKG B;  1HNX O;  1FXK C;  3RYH A;  3UM7 A;  1XHZ A;  2X6C A;  4DR6 O;  5H9C A;  4LF6 B;  3A0R A;  1IXM A;  1SQB H;  3K03 A;  1GAX A;  3QTC A;  4E2L A;  1CPY A;  2ZIO A;  1COW G;  5L3G A;  1N8R W;  4H33 A;  3OMN B;  1I08 A;  5A9G A;  2PI5 A;  4WFF A;  4BAY A;  4NR1 A;  4DV3 B;  1JFF B;  3MD0 A;  2N05 A;  2P67 A;  5EBW C;  1AP5 A;  1EM1 A;  3TGU H;  3CCV V;  1J5E B;  1VQK V;  2D2C B;  2UUB B;  2M7W A;  4GUN A;  1Q43 A;  5LMU O;  3F5W C;  4TQD A;  4DR2 B;  4PA3 A;  2QM8 A;  4CH4 A;  3ZJZ A;  4U7N A;  4LF5 B;  2UXX A;  1H8H G;  2CUG A;  3H1L H;  5LHG A;  3E8B A;  2DWE C;  1Z5V A;  2IU3 A;  1FS0 G;  1K73 W;  1M56 C;  4X1K A;  4RWU A;  2R9A A;  2CH7 B;  2WLK A;  4LF9 B;  2HFE C;  4WF9 V;  2YID A;  4PEL A;  3J7A U;  2UUA B;  1AI7 A;  1WB8 A;  3O9O A;  2CK3 G;  2BE3 A;  5B5E Z;  2YS8 A;  1F7Y A;  4JYC A;  3C3S A;  2DQ3 A;  2ZR2 A;  2JVD A;  4JI1 B;  1SS3 A;  1TUB A;  2EIJ B;  5JCO A;  1I0H A;  3E8G A;  2RDC A;  1NJI W;  1N34 B;  3ABT A;  1NH2 D;  4QPJ A;  2CTQ A;  4H0L B;  2WPD G;  3I5D A;  1YJ9 V;  4DK1 A;  1BCC H;  2Q9L A;  4OPA A;  4TT3 G;  1NVP B;  4O4J A;  3HKD B;  3KCX A;  5JJN B;  4JTD B;  4IIJ A;  3UT5 A;  4RO2 A;  2ZE6 A;  4TWK A;  2WA4 A;  1Q82 W;  5C93 A;  1H2S B;  5L3D A;  5H2F Z;  2A79 B;  2CE4 A;  2Y69 C;  5KUK A;  2H3O A;  1OZ0 A;  3HKC A;  3HB3 B;  5LA6 A;  1DF4 A;  2KQX A;  4FM2 A;  3S3W A;  4MVO A;  4Z1V A;  1X59 A;  5CA0 A;  1OCC B;  1M5I A;  1M57 C;  1XNQ B;  1SES A;  1XMQ O;  1US6 A;  3VQX A;  4EB6 B;  3JD4 A;  3ETG A;  2IJJ A;  2LW7 A;  4DV2 O;  5LHH A;  4DUZ O;  4DR5 O;  1XL4 A;  5BZB A;  5CA3 A;  2GBO A;  2ZQM A;  4JAS A;  5J2T A;  3QO7 A;  2JDI G;  4I50 B;  4AI8 A;  3P30 A;  4LNU A;  4J42 A;  3SYQ A;  4QGP A;  4WFG A;  1K33 A;  1SQQ H;  4HNA B;  5IE9 A;  1G1X B;  4QNH B;  5GON B;  1MOF A;  4W4K A;  3SPC A;  1BHA A;  1FXK A;  3QVN A;  3K0G A;  4LH7 A;  3RYH B;  5LGU A;  3JAR A;  5F2V O;  1EZJ A;  3VQY A;  1H2N A;  3TXS A;  4P2Z A;  2E3C A;  3A0H Z;  1GN4 A;  4TV9 A;  3NR7 A;  4R50 A;  2YUA A;  3ABK C;  2HR3 A;  1JPX A;  5JQG A;  2KG7 B;  3RW0 A;  1MA1 A;  4PJ0 Z;  4YJ2 A;  5IWA O;  4O4I B;  3ZX6 A;  5L3E A;  2XAJ A;  1AJP A;  1XIL A;  4FLU A;  2HJF C;  5IY5 B;  4LF7 O;  5CBH A;  2NR5 A;  1OCR B;  4MTO A;  4KUM A;  3E89 A;  1VQ9 V;  1FAF A;  2GHY A;  1XQ8 A;  2VWK A;  1S5L Z;  1OCO C;  3F7V C;  3K58 A;  5BXZ A;  4DV7 B;  1MNG A;  4PI0 A;  1JA8 A;  2R72 A;  4JYY A;  2RNB A;  4J11 A;  1R3L C;  2OYQ A;  5IJ0 A;  2B5U A;  1TA8 A;  3SJC C;  1MG1 A;  4FZ1 A;  3BCC H;  3K3W A;  4YHH O;  2JJ1 G;  2E5L O;  1ZTE A;  2O57 A;  2XTA A;  1VQM V;  4YY3 O;  4IGG A;  2A3Q A;  2GUZ B;  3IGA C;  2WAM A;  4LR3 A;  5KHI A;  4DV4 B;  4DV5 B;  1XDC A;  2R9I A;  1JOY A;  2ETN A;  3AG2 C;  3SGI A;  1FKA O;  4EFB A;  2JRI A;  1F51 A;  4P9P A;  3CCR V;  1VQ4 V;  2JGU A;  3RWR D;  4B3T O;  1KMI Z;  3QO8 A;  1YHQ V;  1BT8 A;  3RVY A;  3O65 A;  4NXM O;  4O4J B;  4Q20 A;  4DV1 O;  4IIJ B;  1NS1 A;  3JD2 A;  3UT5 B;  1HP8 A;  3A8T A;  5BMV A;  3OEE G;  4O4H B;  1X4T A;  5B1B C;  1IBK O;  4JAU A;  3U0Z A;  5IYZ B;  4ABM A;  3AK3 A;  3K79 A;  4BIZ A;  3AG1 B;  2LP7 A;  2PYL A;  2OCC B;  1PD3 A;  2PTM A;  4O2A B;  1RPO A;  5IYC O;  2IBZ H;  4HYO A;  4QJF B;  4CS3 A;  4AHC A;  3D36 C;  1P49 A;  2XHB A;  1QLE B;  4DR4 O;  3SPJ A;  3RFR A;  1S0V A;  4GKK O;  1YIT V;  4DR1 B;  3N2K B;  1K5S A;  3WU2 Z;  3OGI B;  4LBE C;  3CRQ A;  4DR7 B;  1S3J A;  2OTJ V;  5TIS Z;  4LFC O;  2VQE O;  2AXT Z;  4B3R O;  3MAQ A;  4LNU B;  4DV6 O;  2HVJ C;  3AG4 C;  2QWO B;  4MTG A;  1Y74 A;  1ZL8 A;  1F23 A;  1I94 O;  2EZO A;  1OCC C;  1BZK A;  4ZHQ A;  2JEU A;  3JAR B;  1L8D A;  4G2K A;  1Y76 B;  2PF4 E;  4TV9 B;  1V55 B;  3B2E E;  4FLY A;  5EZY A;  3ZN1 A;  3ZHT A;  2BCC H;  2FTK A;  3CXH F;  1Y6X A;  4NXN B;  3T2M A;  5JQG B;  1FYJ A;  2CGO A;  2OCH A;  5HFM A;  4CBC A;  4H13 B;  2IM9 A;  5KLV H;  1SET A;  4UVB A;  5D5Q A;  2VQF O;  2ZE7 A;  3CCS V;  1WN7 A;  3G6B A;  4JYB A;  1TVK B;  4OX9 O;  2QR4 A;  1S5J A;  5E79 Z;  2UXC B;  1GKF A;  2BOB C;  3BY6 A;  1HW7 A;  1HNZ O;  5CBG A;  4K8X A;  4BWA A;  5CA1 A;  1IBL O;  4LFB B;  1W0J G;  5IJ0 B;  1XMO B;  5DM6 V;  4C7U A;  2WLN A;  1M56 B;  4CH3 A;  4GYC B;  4JI8 B;  3CCM V;  3C3T A;  5IY5 C;  4MTF A;  1YTF B;  1JFF A;  2YI9 A;  4B3S B;  1BHB A;  3CCJ V;  3STZ C;  4MVS A;  2Q69 A;  3RBZ A;  3ZRX A;  1NZ6 A;  3CHX A;  1QNM A;  1DLB A;  3HKE B;  1R3I C;  1WPX A;  1DGS A;  2F66 C;  3JYC A;  3T1H B;  4UCV A;  1IUR A;  4GKJ O;  4DYL A;  3EHB B;  3CEI A;  1L0N H;  2F4V B;  1AR4 A;  1B04 A;  4MW3 A;  2P6J A;  2Q7G A;  2Z5U A;  3ASN B;  1Q6U A;  1WP8 A;  3B8M A;  3SPH A;  4D7S A;  5JJJ B;  1N0J A;  1N32 B;  1D5A A;  1M1K W;  3CRC A;  3SJQ C;  2D3O W;  1JJO A;  5BMV B;  2RMK B;  2RN9 A;  1K8A W;  2ZXW C;  1GN3 A;  4R8C A;  2Z0A A;  4N23 A;  2P7T C;  1B6Q A;  4EEQ A;  3OAA G;  2UUC B;  4HAM A;  2Y69 B;  5K1P A;  4LH6 A;  3K5M A;  2QM4 A;  2EIL C;  3G6E V;  4MVZ A;  1M57 B;  3ZRV A;  3AG7 A;  4X88 A;  1WP7 A;  3D36 A;  1ORQ C;  2HVK C;  2BSK A;  3HKD A;  4CH6 A;  3BPZ A;  2UU9 B;  2OWO A;  1ZUQ A;  3B4S A;  3K9S A;  1R3K C;  4X66 B;  3CC7 V;  2A06 H;  3C90 A;  4RUF A;  4DUY O;  2ZIN A;  5DN6 G;  3DC5 A;  2ZR3 A;  5FPO A;  1ZL8 B;  1K5Q A;  4AQY B;  4X1I A;  1VF5 B;  1MSD A;  1GM8 A;  4J10 A;  2Q67 A;  2V4D A;  1Q6H A;  3X2Q C;  1VQ7 V;  4B08 A;  4X1Y B;  1LUV A;  1IZ3 A;  2DJV A;  1BMF G;  1SKV A;  1KC8 W;  3ABK B;  1G4Y B;  5KAI Z;  4GCZ A;  2YXL A;  3LDC A;  1NH2 B;  1PM9 A;  3KG2 A;  1SQP H;  1QR8 A;  4MTX A;  5B1A C;  3MDS A;  2F93 B;  3GWK C;  4DK0 A;  2A9H A;  4HNA A;  1R73 A;  4OXS A;  4Z1M G;  3B40 A;  1IBM B;  1KKC A;  3OTO B;  4QPK A;  2PY5 A;  1I5X A;  1OCO B;  1PP9 H;  1RSO B;  5DED A;  1ZLZ A;  4UCR A;  1V55 C;  1N33 O;  5CA1 B;  4FLW A;  3ZMT A;  4CS4 A;  3ZN0 A;  4GLX A;  1V9P A;  4NYK A;  2KG7 A;  1YIJ V;  2Q7H A;  1HNX B;  1OCZ B;  2CDY A;  4O4I A;  4JAA A;  3K0D A;  3OFN G;  3H1H H;  4DR6 B;  3LDE A;  4XDL A;  1PNK A;  3F5T A;  1QCE A;  5AG2 A;  3SPI A;  2HLD G;  1GRJ A;  1Y67 A;  3UCS C;  3VOU A;  3OGC C;  3AG2 B;  2Q0A A;  4I5S A;  1BQZ A;  2XAG A;  4GT1 A;  2QWN B;  3LNN A;  1H2G A;  4FZ0 A;  4PDL A;  3CC4 V;  3G67 A;  3CCU V;  1VQ5 V;  3SYA A;  1U96 A;  4ZOL B;  3H1I H;  5LMU B;  2IJK A;  3BAB A;  1J95 A;  3CRR A;  4G28 B;  2R70 A;  2GUZ A;  1P7G A;  1UFI A;  3L74 H;  4PDV A;  2XUM A;  1M9N A;  1N4C A;  4W4L A;  2Y0I A;  2DN9 A;  4K0K O;  5B1B B;  3IJ4 A;  4O4L A;  3OT7 A;  2Y48 A;  1GO3 F;  4JYA O;  4U3J A;  1I5Y A;  2EIN B;  3ASN C;  1ENV A;  2MW2 B;  4IYH A;  5GW7 A;  1EN5 A;  3OM3 B;  1U97 A;  4QE9 A;  2BSK B;  3CX5 F;  5J9P C;  4K35 A;  2EUL A;  4D7T A;  1V54 C;  1XHX A;  1MAB G;  1VF6 C;  1KQS U;  4O4H A;  5EBM C;  1E1R G;  5IYZ A;  4WFB V;  1MSW D;  1BQ0 A;  3R65 A;  4BIO A;  4RAI A;  3AG4 B;  1FJG O;  2CAZ C;  4I0X B;  2Q68 A;  4O2A A;  2Z3Y A;  4X1I B;  3DGE A;  2EBO A;  4WFE A;  5LXT A;  5LP6 C;  1S76 D;  4JV5 B;  1KD1 W;  2QKS A;  3N2K A;  3LSQ A;  4YIP A;  2XAF A;  1CEZ A;  3ZS8 C;  2QA4 V;  4FLZ A;  4KP4 A;  2YIC A;  1XUQ A;  4I4T B;  1I7F A;  1OV9 A;  4F6E A;  4HZ3 A;  1CXZ B;  5BR8 O;  5LL6 Y;  1OHH G;  1Q90 D;  4OGQ B;  5L3B A;  3CWB H;  4DV2 B;  3L70 H;  3JCU Z;  1VEW A;  2YXH A;  2ZKO A;  4X8A A;  4DUZ B;  4DR5 B;  2F1M A;  3P3N A;  2R9R B;  2ZNI A;  4LWS A;  1NTM H;  3RGB A;  4LCU C;  1Y76 A;  3CXC U;  3FB5 C;  2ADP A;  1BS3 A;  1YEW A;  3FAV A;  5KA5 A;  3SPG A;  2JS3 A;  3AG3 C;  3FFQ A;  3JCZ A;  5LMN O;  1NI8 A;  1SC5 B;  3FKS G;  2B1I A;  3U10 A;  1QVG U;  1TVK A;  2K9P A;  1GK9 A;  3CCQ V;  2DYR C;  3H1J H;  3VQW A;  1P4R A;  3ZHU A;  1YF2 A;  4DV7 O;  1YVW A;  1RPR A;  2AW9 A;  5H6R A;  3K08 A;  1W59 A;  2NLJ C;  4EFE A;  1DK1 A;  3LDD A;  4LF7 B;  2JEX A;  2Q4P A;  5B1N A;  3L75 H;  1EZV H;  5EIB D;  1OCZ C;  2PGG A;  2ZE8 A;  1AI5 A;  4JI5 O;  2ITD C;  3JAT A;  4PA4 A;  4JF3 A;  3K5L A;  1AR1 B;  1VQP V;  4FK5 C;  4I9W A;  5L3C A;  2UXB B;  2EIM B;  4PDR A;  3D8C A;  2DE0 X;  1AI6 A;  4PA9 A;  1M90 W;  2EIK C;  3HKB B;  1TUE B;  4F6R B;  4DV4 O;  3HKE A;  5E1A C;  2ODM A;  2W6J G;  5IYD O;  4RUE A;  3RN4 A;  5DEC A;  2ZXW B;  2E75 B;  2WLH A;  4YHH B;  4O4L B;  1PV0 A;  2ZM6 O;  3E22 B;  2E5L B;  2XAH A;  2HHH O;  3H01 A;  3KZI Z;  4P9O A;  1RM1 C;  4U3J B;  2EIL B;  4YY3 B;  2P4K A;  3OD4 A;  2XOK G;  1OJH A;  1T5E A;  2F43 G;  3JAL A;  3T4Z A;  4JZ2 A;  2GTS A;  3SR2 C;  1JMK C;  2VWJ A;  4LFA O;  5GTI Z;  3CC2 V;  2ZE5 A;  3E35 A;  3OUF A;  4B3T B;  1VF6 A;  4LF4 O;  4JI7 O;  3PJS K;  4Z2W A;  4NXM B;  4FVM A;  2JIZ G;  4CS2 A;  3JAW A;  4JI6 O;  4A5U B;  1H2L A;  3G80 A;  4UCU A;  4YIO A;  1EBO A;  3FX7 A;  4DV1 B;  2MK3 A;  4UV9 A;  4TUY A;  2ZD9 A;  3W7S A;  2EIN C;  5LXT B;  3DSQ A;  5LP6 A;  1SA0 B;  2QTO A;  4I7Z B;  1JCH A;  4JI4 O;  1Q6I A;  3WB1 A;  4KHP O;  3X2Q B;  1IBK B;  1Q7Y W;  4DV0 O;  3G71 V;  3QF7 A;  4DR3 O;  1NBM G;  3H1K H;  2A7W A;  3G4S V;  5IYB O;  1ZAU A;  3GB7 C;  1HNW O;  3L72 H;  2Y0P A;  5EIB C;  1VQN V;  2C2A A;  3H9V A;  5B1A B;  3OMI B;  2RCV A;  4DR4 B;  1GN6 A;  3JD3 A;  1WB7 A;  4GKK B;  2IW5 A;  3K5O A;  4MVR A;  1XNR O;  1R6N A;  1VQO V;  3JSL A;  5L3F A;  4KXR A;  3N2G A;  1AR5 A;  1URF A;  4LFC B;  1BE3 H;  2VQE B;  4LWS B;  3CMA V;  4MT8 A;  4B3R B;  4X1Y A;  5IJ9 B;  3BFR A;  1CP9 A;  5EC1 C;  4X20 A;  1SQG A;  3FAV B;  5JVD B;  5KHH A;  4BW5 A;  5A2Q N;  1I94 B;  2KKW A;  5K1X A;  4J9Y B;  3J80 N;  3T1Y O;  3SDL A;  4ZKI A;  5LBQ A;  4JI2 O;  3D3Q A;  5FL7 G;  3ASO C;  1K92 A;  3B8N A;  4MVU A;  1PNL A;  3WG7 B;  2X6A A;  2IU0 A;  1M93 A;  1SZT A;  2AZ0 A;  1E1Q G;  1PL4 A;  2P4V A;  1RSO A;  3ABL B;  1Q8I A;  4GZR B;  1AIL A;  2P22 C;  1KBH A;  2ITC C;  1NKD A;  4OX9 B;  1H38 A;  3W7U A;  4FIP C;  4N21 A;  3JAT B;  4X65 O;  2LQT A;  1S5H C;  1GN2 A;  3KKY A;  2CTP A;  1LUW A;  2YSU B;  4UVC A;  1HNZ B;  5J2U A;  2B9Z A;  1QQC A;  1UJW B;  1IBL B;  2WLM A;  4DXW A;  3BA8 A;  4JTA B;  4OPH A;  4ZBM A;  4JI3 O;  5LYJ A;  2BOC C;  2JK5 C;  2JJ2 G;  1JVM A;  3FB6 C;  1NR1 A;  1GH6 A;  1SQX H;  4JI0 O;  5IDJ A;  5KAF Z;  2JS5 A;  4LF8 O;  2IJH A;  5H5N A;  2WSS G;  4H37 A;  2QDO A;  3JAL B;  3OTF A;  4ZOL A;  2EIM C;  3M8A A;  1K97 A;  3GWO A;  4GKJ B;  4PHZ A;  2YIB D;  2VS0 A;  1V54 B;  2G38 A;  1IXB A;  1F4M A;  2ILM A;  4MW8 A;  2LGQ A;  1QVF U;  2FYU H;  5C8Y A;  3JD1 A;  3JAW B;  4I55 A;  4EKW A;  3ABM C;  3OMA B;  1XOU A;  1F4N A;  4IL6 Z;  3K59 A;  4B3M O;  4F4L A;  1K9M W;  2ZT9 B;  4X64 O;  4TUY B;  4DW0 A;  1Z5W A;  4LP8 A;  3TCU A;  3ZCC A;  3P32 A;  5LP6 B;  1HR0 O;  4B7E A;  3BVO A;  3THO A;  5KMG B;  1WA8 A;  3JD0 A;  1AJN A;  2OT5 A;  3K5N A;  3D3I A;  2UXD O;  3RVZ A;  4WBN B;  4NVP A;  2X0L A;  2EJ7 A;  4X62 O;  2ATK C;  3DXR A;  2V1D A;  1KUQ A;  3W7T A;  1HDJ A;  3IC9 A;  4I0X A;  1Y4M A;  2QWR B;  4TSF G;  3N2G B;  1N36 O;  4FLV A;  4DUY B;  1S72 V;  2ZIM A;  3EXA A;  1AJQ A;  1Q3E A;  3CSX A;  4UFZ A;  1PPJ H;  3PN1 A;  4X20 B;  1DTO A;  4I4T A;  1PL0 A;  1VQ6 V;  2Q0O C;  3AG3 B;  4J80 A;  2QJ1 A;  4KL1 A;  3W7X A;  4NTY A;  4E4E A;  4IHJ B;  5KHG A;  4GX2 A;  1G8M A;  1IBM O;  5B3S B;  2BTO A;  2DYR B;  1EN6 A;  3FYI B;  3UKM A;  1NTZ H;  4LF6 O;  3N27 A;  3SYC A;  3MHH C;  5HFL A;  3ABU A;  3CPW U;  1H2K A;  1UPG A;  1WAZ A;  3BAA A;  2DOS A;  2FB5 A;  2YC0 A;  3B09 A;  2Q73 A;  3BRC A;  3ZIA G;  3MHS C;  4DV3 O;  3LSU A;  4XDK A;  5J2U B;  2EIK B;  3WG7 C;  1N33 B;  2XAQ A;  2IH1 C;  2GDS A;  1J5E O;  1SER A;  4UCO A;  4D6T H;  1VQL V;  2UUB O;  1KP2 A;  3ML0 A;  5FPR A;  2WA3 A;  1WLE A;  1WPB A;  4JAV A;  2CGN A;  2GSM B;  3ABL C;  5LYJ B;  1LNQ A;  2LJ2 A;  4DR2 O;  2HG5 C;  4LF5 O;  1Q81 W;  3SJA C;  5CMU A;  4PDM A;  4CZZ A;  4J41 A;  3A2F A;  1RM1 B;  3RYC B;  3W7W A;  3EVK A;  4P30 A;  2ZNJ A;  3APQ A;  5D5P A;  1K3E A;  2RJZ A;  3ZRW A;  1NQT A;  4ZIB A;  4LF9 O;  3VBB A;  4UB6 Z;  2DYS C;  2YXY A;  2UUA O;  5CB4 A;  1AVM A;  3L71 H;  3HKB A;  5LOV B;  1BL8 A;  4B7K A;  4F6R A;  5IT9 N;  3QG5 A;  2BTQ A;  1E79 G;  3CJH A;  4WFH A;  3ZHS A;  1H2M A;  4JI1 O;  3A0B Z;  4WCE V;  5C8Y B;  4I55 B;  4L8J A;  1O9H A;  1N34 O;  2ZDI C;  3E22 A;  2QM7 A;  4CH5 A;  1XBL A;  1R1B A;  3ETE A;  4PA6 A;  1YJN V;  1TGO A;  3M99 B;  1PKX A;  1ARO P;  1THZ A;  4K0K B;  1GMG A;  2DWD C;  2HKO A;  2IJI A;  5CN0 A;  4DW1 A;  1WA8 B;  1YDX A;  2PUS A;  4UB8 Z;  2PZS A;  4UCS A;  2L35 A;  4JYA B;  2DQ0 A;  1IDS A;  1EFR G;  3DXR B;  2PI4 A;  4TOI A;  3BA9 A;  5KHJ A;  1XNQ O;  1FFX A;  4JV5 O;  4JTC B;  1SA0 A;  4ASU G;  2F23 A;  4FPP A;  4XBF A;  3NXS A;  1DF5 A;  4AIL C;  4UCT A;  4YJ3 A;  4PA7 A;  1VMG A;  4TV8 A;  3K57 A;  1FJG B;  1YXB A;  1RP3 B;  3IC7 A;  2LW1 A;  1ZSP A;  4R6Z A;  1XRE A;  1XMQ B;  3ZBH A;  5JH7 B;  2YEV A;  1WJZ A;  2OIG A;  4FM0 A;  3JAS A;  3CD6 V;  5B1O A;  4MVM A;  5LGN A;  1K7D A;  5FNV B;  4DRX B;  2WLI B;  3ASO B;  3CP1 A;  2GTA A;  1GM9 A;  1G6U A;  1XL6 A;  2WLL A;  2YIB A;  3HPL C;  3BHP A;  4JZG A;  2F95 B;  1VF7 A;  2N74 A;  2ARH A;  2Q7E A;  1N0N A;  3Q4H B;  3TJT A;  1KYO F;  2ZCE A;  5BR8 B;  1Y66 A;  5LGT A;  4UV8 A;  5IJ9 A;  2NN4 A;  4ICG A;  4NTX A;  4HBN A;  1SF9 A;  5CBF A;  3UQ8 A;  1H8E G;  3UO2 A;  3OW2 U;  4RQF A;  3RYF A;  5JVD A;  3K06 A;  1JQ0 A;  1W0K G;  4J9Z B;  3DC6 A;  3ETQ A;  5B66 Z;  3UO3 A;  3E8H A;  3EFF K;  4BR6 A;  5B3S C;  4K8Z A;  2QE7 G;  4GX0 A;  1AP6 A;  1IX9 A;  2EJR A;  1S77 D;  1PNM A;  4H44 B;  5IWA B; 
#chains in the Genus database with same CATH homology
 1HP8 A;  2LGQ A;  2RNB A;  1U96 A;  1U97 A;  1Z2G A;  2RN9 A;  2HP8 A;  2LQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...