2LQTA

Solution structure of chchd7
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
b'NPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRAVGNMPY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coiled-coil-helix-coiled-coil-helix domain-containing protei
publication title Structural characterization of CHCHD5 and CHCHD7: Two atypical human twin CX(9)C proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 24
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2lqtA00
1HP8A 1U96A 2LGQA 2HP8A 2RNBA 1U97A 1Z2GA 2RN9A 2LQTA
chains in the Genus database with same CATH superfamily
3AG3C 3ZMZA 2VRZA 5BXZA 4KP4A 1KP3A 3A0HZ 5J2TA 1MA1A 3SJQC 3AK3A 1YEWA 3L71H 1J5EB 1BQ0A 2UXXA 2DQ3A 3CCQV 1CP9A 2UUBB 5LA6A 1Q81W 4DV0O 4LF8O 4DW0A 2IH1C 4O4HA 4NKGB 2ZCEA 4J9ZB 2AGAA 4H0LB 4U3JB 4BIUA 2JIZG 4ZI7B 3W7XA 2HFEC 4ZOLB 1PM9A 2C2AA 1Z2GA 2HLDG 2DOSA 1V9PA 1O9HA 4ZHQB 4UCVA 1GRJA 2Z3YA 2PTMA 2B9ZA 2QJ1A 2QWPB 3UT5A 2XTAA 2JJ2G 5IYZB 3K57A 1RSOA 4NB5A 1HNWO 4PA3A 4IGGA 3K9SA 3FKSG 4KFMA 4UVBA 5KX5B 2XOKG 5KHJA 4PI0A 4MVZA 5EYPA 1QLEC 1ZL8B 3CJHB 3JD3A 2CUGA 3T1YO 4R7CA 5J2UB 3CE2A 3E83A 4PDLA 2PY5A 4DV5O 4UVCA 2WLMA 1H8HG 5DEDA 3AK1A 5BR8B 1ENVA 1R73A 3KZIZ 2E76B 4UB8Z 1IBMB 5LHGA 1Q90D 1PNLA 4MVMA 4JI0B 1WA8A 5IE9A 4DRXA 1YITV 4DR5O 2ZXWC 2BTQB 3ABLB 5EBMC 3H1KH 1SF9A 1H8EG 3SDLA 4OX9O 2Q9LA 3I56V 4JV5B 1VF5B 2AZ0A 1BCCH 4B7EA 4L8JA 5KHHA 2RN9A 5BY1A 2L35A 1UPGA 3ASNC 3RT3C 4IYIA 1XMQB 2ZE5A 2LGWA 3ZBHA 2R9AA 4I55A 1VMGA 2LO1A 3T1HB 5D5PA 2YI8A 2LP7A 2QSAA 4DUYB 1R3JC 2KG7A 4JI4B 3N27A 1WJZA 2GBOA 3G71V 3AG1C 2DW4A 1GN6A 2ADPA 1ZSPA 1NTKH 1HR0O 2OIGA 1QHTA 3G67A 2Y48A 1Z5WA 1MOFA 2YXHA 3HB3B 1JFFB 3H1HH 3OEHG 4DUZB 5B1BC 2OTLV 1XOUA 3O9OA 1E1RG 2EIKB 4O4IA 4U7OA 3OR6C 3LDCA 4CS3A 1WB8A 3U0ZA 2HHHO 1TUBB 4MSWC 3B77A 1W0JG 4E4EA 1JJ2U 4Z2WA 5CA0B 1PPJH 3FD9A 4ZBMA 4JF3A 2A7WA 4GX5A 4B3TB 3ZHRA 1N32O 3D3IA 4MTXA 3T4DA 1QLEB 4B3RB 3UCSC 2DN9A 3FB7C 2EILB 2ILMA 2QKAA 3OTOO 2X0LA 5IJ9B 4B08A 1OCCC 4J80A 4D6TH 3K58A 3BA8A 3WB1A 1NR7A 1TVKA 4YJ3A 3CWBH 5CA1B 4FZ0A 4LF9B 2Q69A 1I94O 4FLVA 3E8GA 3P3PA 1JVMA 3BEHA 3C90A 3E2EA 1US6A 4JI1O 2UXDB 3DXRA 1HNZB 3CCSV 2AZ2A 4Z1VA 4UV9A 5EIBC 4FMTA 3CXHF 3BPZA 4W4KA 2PYJA 5B1NA 2ETNA 2P4KA 4NYKA 2QGNA 4XBFA 1LUWA 1M9NA 5JVDA 3G6BA 3AG4C 3L73H 1VQMV 3ZCCA 4X66O 3F7VC 1FXKA 3RBZA 3JALB 1AI6A 2ITCC 4J41A 5ITZB 4YJ2A 3HKBB 1YHQV 4UB6Z 3SJCC 4PA9A 1EZJA 3JCUZ 4RAIA 2A9HA 4PA4A 4J7JA 5JQGA 2UU9O 3BRCA 2PF4E 1F51A 5B1BB 4JI2B 1B6QA 3LNMB 2JGUA 3WB0A 3FFQA 3S3XA 2HJDA 3D8CA 3RVZA 2QWQB 2VS0A 5H5NA 5KUMA 3FAVB 1YXBA 1AB3A 4LFAB 1RM1C 3GVMA 2WA3A 1SESA 4LNUA 4FLUA 3FB5C 2FMLA 1XBLA 3ZRWA 3E8FA 4DR1B 5DN6G 1S72V 2YIAA 2F66C 3F5TA 4FFKA 1MNGA 5IJ0A 3CMEV 1OZ0A 2IH3C 4P9OA 1N34B 3B4SA 1NH2B 4JAVA 4JZGA 3AG2B 2NLJC 4O4LA 2K9PA 1OV9A 1DK1A 3KCXA 2R72A 3N2KB 5LP6A 3QO8A 1GMGA 4DR4O 1SQBH 5CN0A 3SPGA 3BVOA 1Q86W 1EM1A 2IJJA 1TUEB 4IHJB 1G1XB 3ETGA 3RYCA 1Q6UA 4TV8A 1GK9A 2EJRA 2UXBO 1FXHA 1MZFA 4DXWA 5L3CA 2ARHA 3K3WA 4L87A 4PD4F 4BIZA 2Y0PA 1DTOA 2CGNA 4P30A 4DR2B 2QEXV 5J2TB 1K4CC 1K7DA 2WLNA 1SC5B 1SQXH 3CD6V 3IJ4A 4LF5B 1K33A 4HAMA 1V55C 2LFRA 2XT9A 4X20A 4JI5O 3UKMA 2B5UA 5LA6B 3PN1A 3BAAA 4O4HB 3IAYA 4GLXA 4JYAO 3UO3A 2RQ6A 5LHHA 5CA0A 3STLC 1S5HC 5JJJB 4RQEA 5H6QA 1XREA 4W4LA 1S77D 1EFRG 2EINC 4CC5A 1FJGB 4WFBV 4J7ZA 2QKSA 3CRMA 1KC8W 4PHZA 4X1YA 5JWPA 1AR5A 4G2KA 1AI5A 3UT5B 5IJ9A 1RSOB 3PJSK 2VWKA 2WPDG 3TGUH 5LMUB 1DF5A 3T4ZA 4TQDA 3CYOA 4FLTA 1OHHG 3ABKB 4B3MO 1K5SA 2ZIOA 4NTXA 1EN4A 3AG7A 4G28B 4DK0A 2JDIG 2OCHA 1FD9A 1RP3B 5BMVA 4DK1A 1AROP 4QIWF 3QO5A 3LNNA 4JI7B 5GONB 2AHYA 2JJ1G 1B06A 2ZR3A 4N21A 2KSDA 1OCOC 3IGAC 4MT8A 2WLLA 2DWEC 1WA8B 5IYBO 4FVMA 3IFXA 4DRXB 4UCUA 3CCRV 5KA6A 1AILA 5EBLC 1Q82W 1FXVA 3H1LH 2LGQA 4K0KO 3KG2A 3HKEA 4PDRA 3QVNA 1N33B 3ZMUA 2KQXA 3ABMC 1OCZB 3LSQA 3GWKC 4AQYB 2UXNA 3HKBA 2Q8VA 3JCZA 1GM7A 2JGDA 4RWUA 4TV9A 1J5EO 2X6BA 4I55B 4JI3B 2UUBO 1QVGU 1O9GA 1QU7A 3I5DA 2JS5A 3DC5A 1FXKC 1VQ9V 2KG7B 4JYAB 2X6CA 3SJBC 2WSSG 1T5EA 4MVRA 4CH6A 5C93A 1GM9A 4O2BA 1SQPH 5EK0A 4K3AA 3K5LA 1QVFU 1H2LA 1NI8A 2EINB 4DV1B 3CS5A 3L75H 1HW7A 3VOUA 3P3NA 4FJCC 1VEWA 4O4IB 4TQFA 2ZE8A 4Z1MG 2P7TC 3K5MA 3VQVA 3J81N 4PELA 4KL1A 4R8CA 1VF6C 5H9CA 4DV7B 1S5LZ 1VQ6V 4O4JA 3BY6A 4FM2A 3ZJZA 2CTWA 3CCJV 5DM6V 3N2KA 4J42A 3SYAA 3Q4HA 5IYCO 2HKOA 3OT7A 5BR8O 1YTFB 4LP8A 1IBMO 2P4VA 4LH6A 5A2QN 1TVKB 4YJ3B 4JI0O 1NVPB 2ODMA 2XAFA 1OCOB 1XL6A 2DYRB 2EJ7A 2KB1A 3H1IH 2FB5A 1PL0A 4UCOA 4X64B 1XHZA 4JV5O 2Q6AA 1EZVH 4WFFA 3ZRVA 5GTIZ 3DXRB 5K1XA 1P7BA 5AG2A 1ZAUA 1SQGA 4JAUA 2LW7A 2RMKB 4J11A 1X59A 1XMQO 1BE3H 4QPJA 4A5UB 1NQTA 2ADQB 1R3IC 4UCTA 1Q3EA 2A79B 3OMIB 3VBBA 5JVDB 3T1HO 1JA8A 2UXCB 1KU9A 3APQA 3DC6A 3SPJA 1XHXA 4MTOA 4QPKA 4DUYO 1TGOA 2AHZA 4JI4O 2Q68A 2HEPA 1FXKB 1AP6A 1E79G 3JAMN 5L3GA 4YJ2B 4DV3B 2F93B 1K97A 1WB7A 2V7QG 1HDJA 2LW1A 5JQGB 3CC4V 4DUZO 1PKXA 1P4RA 1M57C 1ZTEA 4MVSA 3K03A 5L3DA 4GKKB 3ZN0A 1R3KC 3LUTB 1UJWB 1JPXA 4MVQA 1FS0G 4B3TO 4LCUC 1VQ4V 2YS8A 4B3RO 4LNUB 4ZIBA 4LF6B 4CZZA 1VARA 3K0DA 3ZRWB 4DR7B 2AXTZ 1Z5VA 3D36C 5GONA 5IJ0B 1L0NH 2Y69C 5EC1C 1VQ8V 3SYCA 2YIDA 1F4MA 3OAAG 2MK3A 4JI8O 4MW3A 1IBKB 3W7WA 4LF9O 4O4LB 2GHYA 1WPBA 3A0RA 4O2AA 3JAKA 5HFLA 1JR9A 4DR3B 3OR7C 4F4LA 3U10A 5LP6B 1IX9A 4B3SB 2UXDO 3FYEB 1HNZO 2F4VB 1Y67A 3AG3B 4R50A 3CP1A 2ZIMA 4NTWA 2QWOB 3RYCB 2FYUH 4PDVA 4TV8B 1MSWD 3AEIA 3SGIA 5IWAB 1S76D 1D5NA 1DGSA 1OJHA 4WFEA 1N4CA 5KHIA 3E22A 1NBMG 4IIJB 5CBGA 5B3SC 5FPRA 2DMXA 2QM4A 4DV2B 2F1MA 4I5SA 4X20B 2P5OA 2DYSC 3RGBA 4LFCB 4I50B 2P67A 3CCMV 4D7TA 5KUKA 5L3EA 4JI2O 2HVKC 1M57B 2F23A 5LGUA 2R70A 3CCLV 4BW9A 4QJFB 4LFAO 2LJ2A 4I0XA 4E2LA 3M99B 3O65A 4X1YB 1KKCA 2FL4A 4OGQB 4CH5A 4DR1O 1L0LH 2PGGA 1M56C 2RNBA 4WFAV 1W2BU 1Q6HA 1NU1H 4GUNA 2ZE6A 4JASA 3TJTA 2Y69B 3ML0A 1N34O 2WLHA 4JI8B 3GWOA 1EN5A 3K06A 3OD4A 4JI6B 1AJQA 1MABG 4X65O 1G8MA 3JATA 1J95A 3RN4A 5IYDO 2ZXWB 1PL4A 1JCHA 1RFYA 3JAWA 3C3TA 2XAQA 5BMVB 1VQOV 3SYQA 3E35A 3JARA 3RYIA 4I7ZB 3A0BZ 1XMOB 1YCIA 1XUQA 1RPRA 4K8XA 4QGPA 2WLLB 1RPOA 3ASNB 1P49A 2ZQMA 4X1KA 1JQ0A 4LF7B 3HKDA 2BCCH 3ZHQA 1FAFA 4BAYA 3CC7V 3A8TA 2EX3A 5IY5C 3HKEB 2QE7G 3JSLA 4DR2O 3STZC 1YIJV 3MAQA 4B7KA 3EXAA 2H3OA 3AG1B 2WWWA 3M8AA 3BFRA 2EZPA 2JGDB 4LF5O 4GX1A 4TV9B 5A9GA 1H2KA 5FL7G 1GKFA 2ZM6B 1SZXA 2DYSB 2QWRB 3LDEA 5JJEB 1R6KA 1WP8A 1QQCA 1MZEA 3N2GA 4FLZA 4O2BB 1H2NA 2Y0IA 1VF6A 2XASA 4LR3A 4J7KA 1FJGO 4HZ3A 3SYPA 4JTDB 4FLYA 2WAMA 1GN2A 2PYLA 2IJHA 2K1EA 3OW2U 1HNXB 1PNKA 3OGCC 1OCCB 3HPLC 3CSXA 1VQNV 5LMUO 2EIJC 1XQ8A 1W59A 4O4JB 2HJFC 4KUMA 4X65B 2ZKOA 1VIBA 2GUZA 4LWSA 3ZEDA 1WLEA 2CAZC 3CRQA 4NR1A 4EFBA 2HP8A 1SS3A 2ZINA 1K92A 4JI7O 3ASOC 2M6YA 3Q4HB 3KCYA 5LMNB 2YEVA 5DECA 3RWRD 2QM8A 3I55V 3ZRSA 2W6IG 4LF4O 4PI2A 3C3SA 1AP5A 3JD2A 4QE7A 1A32A 2YIBD 5CB4A 2FTKA 3ETDA 3P32A 2OCCC 2E75B 2XUMA 1VQ7V 3AG4B 2X7RB 2Q0OC 1N33O 4NXMB 4P2ZA 1WPXA 4I9WA 5H2FZ 5EC2C 3OM3B 4TUYA 1THZA 4FK5C 4IIJA 3LSUA 4AQYO 4MW8A 1Q5OA 2Q67A 1M93A 2QM7A 1U97A 3LDDA 2XNDG 2H8PC 3IC7A 4CBCA 4PA7A 5JH7A 4KXRA 2YXLA 4JI3O 5LXTB 3E89A 4I50A 2WA4A 5B1AC 5LYJA 2CTRA 3RVYA 5EBWC 3CRAA 2PI4A 3VQXA 4X62B 3APOA 5FLXN 1K9MW 1AR4A 1RM1B 1U96A 4DV1O 3BHPA 1AVMA 3WG7C 1YI2V 3DTUB 5B66Z 1BMFG 3EFFK 2UUCB 1ROPA 5JCOC 3EHBB 1TA8A 3K04A 1Q6IA 1DLBA 3D36A 2BSKB 2W6JG 3X2QC 4DV7O 2GSMB 3QF7A 1R6NA 1QNMA 5LL6Y 1SRYA 4I4TA 4P9PA 3JSNA 2IJKA 1IXBA 2QWNB 4NVPA 4CH3A 1XDCA 1FKAO 2V4DA 4KHPB 2OTJV 4RQFA 1MG1A 5IT9N 2XAJA 4LF4B 2A3QA 4HBNA 4O2AB 3JAKB 5CBHA 2OYQA 2M7WA 2CTPA 4RUFA 2OCCB 1PV0A 4X64O 4FM0A 4QE9A 3CC2V 2P90A 1XNRB 4AILC 4OXSA 2JK5C 4YY3B 2DQ0A 1AI7A 3J80N 3RFRA 4DYLA 4QNHB 4LFBB 2F95B 4GX2A 1Q43A 1XNQB 3F7YC 1N0JA 1NTZH 3UM7A 1V55B 2BE3A 3B8NA 2UXCO 3TXQA 2Q0AA 1BSMA 1VP7A 2BOBC 4MTFA 3E22B 2XHBA 4PDMA 1CXZB 4DV3O 2P06A 3K9AA 2GTSA 1QR9A 1VQ5V 4J10A 2E5LB 3THOA 3B09A 2N04A 2CH7A 3BCCH 2A0LA 3TXSA 3K59A 2JVDA 4H13B 3DSQA 1CPYA 3QNEA 2GTAA 2N05A 1H2SB 1IDSA 4EEQA 4GKKO 5CBFA 1KD1W 3X2QB 4JTCB 4I0XB 3K5OA 4GKJB 4BIOA 1GN3A 3G80A 4LF6O 4X1IA 5HFMA 5FNVA 4DR7O 3ZHVA 2IW5A 3CCVV 3CX5F 4MS2A 1ZX3A 1YJNV 4ICGA 3TETA 3CMAV 2QTSA 1XI1A 1IBKO 3VQYA 2HVJC 2B1GA 3JATB 3QG5A 3W7SA 1K8AW 5L3FA 2UUAB 3B8MA 3JAWB 2PI5A 4TWKA 4DR3O 1I5XA 2CE4A 2WLJA 1N8RW 3ZHSA 3JARB 3RYIB 2DE0X 4B3SO 3UO2A 2F4VO 2VQEB 1FFXA 3RYHA 5GTHZ 2OIEA 3ABMB 3OUSA 4H33A 3ABLC 2MW2B 3JASA 4MTGA 1IBLB 3ZN1A 4X1KB 3HKDB 3HKCA 1LR1A 5LXTA 1JMKC 1GTOA 5IWAO 3CXCU 4HNAB 3CPWU 4DV4B 2CDYA 1P7GA 4G27B 3ETQA 2GDSA 3CB2A 4DV6B 2E3CA 4FIPC 1Q7YW 2YI9A 1WN7A 2YDEA 2ZDIC 1JX9A 1Y74A 4YHHB 2CGOA 4NXNB 4DV2O 3ZMSA 1TAEA 4YXWG 1F23A 4TOIA 1KBHA 1R6TA 5IDJA 3CCEV 3NR7A 4LFCO 4UXNA 1KYOF 1S3JA 1IZ3A 4F6RA 3NXSA 2BSKA 4AHCA 1KKDA 3N2GB 1K73W 1SQVH 3JD0A 3ZMTA 2EIKC 3AK2A 1NR1A 1XILA 2YUAA 1N36B 2R9IA 4U3FH 2YXYA 4LBEC 4WBNB 1JJOA 3FB6C 1F4NA 1I7FA 2AW9A 1KP2A 3JYCA 1GO3F 5TISZ 4IL6Z 4PV1B 3OTFA 1KECA 2IU0A 4CS4A 1XL4A 2WLIB 2Y4TA 3E86A 5C8YA 5LOVA 2EILC 4JI6O 2OWOA 1BHBA 4FFBA 3E8HA 1W0KG 2GV9A 2EIMC 3JD1A 2GUZB 3L9DA 4LWSB 1KMIZ 5FPOA 3ETEA 3S3WA 1SETA 2Z5UA 4MVUA 1Q8IA 4DR6B 4TT3G 4JYBA 1SA0A 3K08A 1QLNA 2XAHA 1BZKA 1GH6A 3L72H 1XMOO 3ZMVA 4JGSA 4FM1A 5LGTA 2YEVB 4BWAA 3RYFB 4K8ZA 3T2MA 1XEQA 2LQTA 3CHXA 5CB4B 4LF7O 2ZNJA 3MHHC 5LHIA 1H2MA 2P22C 4EB6A 2D3OW 1DF4A 1NZ6A 2YIBA 5JJNB 4FZ1A 3OMAB 4C7UA 1BL8A 4TUYB 1HP8A 3QTCA 1YDXA 2BTOA 5F2VO 3F5WC 5KMGA 1LNQA 5L3BA 1FPOA 3JD4A 3ICXA 3BABA 5JH7B 4DV0B 1LUVA 4LF8B 4IYHA 1COWG 3CRCA 1KQSU 5LBQA 1B04A 2ZM6O 5JCOA 2QR4A 4PA6A 4EKWA 3B2EE 5LYJB 2VQFO 3OGIB 1URFA 1GAXA 5EZYA 4XDLA 4ASUG 5KAIZ 4GYCB 1BGYH 2EBOA 4X8AA 2F43G 3IC9A 5E79Z 1NH2D 1HNWB 1L8DA 2IU3A 4TSFG 2OT5A 1HNXO 3ZHUA 1Y76A 1YZBA 1SKVA 5D5QA 4I4TB 3T1YB 2X6AA 4WFHA 4YIOA 1BS3A 3K79A 1M90W 4DV5B 2EIMB 1AJNA 2IJIA 4Q6GA 5EIBD 3WB2A 4J9YB 1S5JA 1Y66A 1YJWV 1PP9H 2IM9A 4X9QA 3AG2C 5LMNO 3L70H 4X89A 4K35A 2L6LA 4DR5B 5KLVH 3HR0A 1FYJA 2JEXA 3QO7A 4JYYA 4OX9B 4HNAA 4DO2A 4RO2A 3R66A 4NXMO 4F6EA 1YVWA 2Q7HA 1VQPV 3D3QA 4WFGA 2HR3A 5B3SB 3CEIA 1E1QG 1K3EA 1BHAA 3KKYA 2EULA 4U3JA 3MD0A 4ZI7A 4ABMA 2VQFB 2PZSA 2YSUB 2JRIA 4ZOLA 1HR0B 3LSSA 4FLXA 4WF9V 4X62O 2G38A 1L1FA 3U11A 4ZHQA 2VWJA 1V54C 3OFNG 4RUEA 5H6RA 2CH7B 5IYZA 4WBNA 5GW7A 2UUCO 1QBZA 2HHHB 5KX5A 1G4YB 3ABUA 1B3QA 1SQQH 1M56B 1N32B 2WLIA 1ZL8A 3CJHA 1EBOA 3TK1A 4LH7A 2ATKC 3DGEA 5J2UA 3H1JH 3FB8C 3OTOB 4N23A 2QTOA 4CH4A 3ZRXA 4UUJC 4XDJA 2XAGA 1M5IA 2HG5C 1SZTA 3A2FA 3W7TA 4X1IB 5FNVB 5B1OA 4KHPO 2Z0AA 3ABKC 4IT5A 4JZ2A 1QCEA 1VQKV 1QR8A 1P84F 5E1AC 2BTQA 1I94B 3RYFA 1YF2A 2QKCA 4GCZA 1IVSA 1ORQC 4BW5A 3K5NA 1NJIW 4JI1B 2P6JA 1AR1B 1S0VA 2W0FC 3ZS8C 3M7MX 1D2DA 1R3LC 1EN6A 5IY5B 2JS3A 1XNRO 2QA4V 1FFXB 3RYHB 1ZWIC 4YY3O 4LFBO 3JASB 2ZDIA 1NKDA 1XNQO 1M1KW 2QDOA 3OMNB 5KHKA 1PD3A 4H37A 3HKCB 1BQZA 3OE7G 4X66B 1OCZC 1MMMA 2ZD9A 2FKXA 1HWYA 1VF7A 4BR6A 1WAZA 1IURA 2ITDC 5KA5A 5CMUA 4MVOA 4UV8A 1Y74B 2E74B 4JTAB 1JFFA 2WLKA 3T1CA 2E5LO 1KUQA 2UU9B 1NS1A 1V54B 3WU2Z 3R65A 5BZBA 5J9PC 1TUBA 4ZKIA 1D5AA 4UVAA 3RW0A 1IXMA 4F6RB 2JEUA 2CTQA 3CRRA 4D7SA 3SPIA 1ZUQA 5CA3A 2LFSA 1G6UA 2EIJB 4DW1A 1SERA 2YC0A 3G6EV 3FX7A 1YTFD 2D2CB 2DWDC 1NT2B 4H44B 4GKJO 3MHSC 4OPHA 4X88A 1NVPD 2W0XA 4JPRA 3P30A 3MDSA 4CS2A 2Q5ZA 1WNSA 1I5YA 1FFTB 5CA1A 3ASOB 1I08A 4I9QA 5EYPB 2Q7EA 5C8YB 5LOVB 2NNUA 2ZT9B 4FFBB 2EZOA 4YIPA 2UUAO 4DR4B 2A06H 3SYOA 2KKWA 1X4TA 2Q4PA 4PJ0Z 4NTYA 3BA9A 3WFVA 3EVKA 1NTMH 1SA0B 2IBZH 1UFIA 3SR2C 2DYRC 2VQEO 1YJ9V 3TCUA 2V1DA 1Y6XA 1YSCA 1K4DC 1OCRC 1IBLO 2UXBB 4FPPA 2ZE7A 1MSDA 4WCEV 1F7YA 1I0HA 3CCUV 2Y4UA 2ZNIA 3SJAC 3GB7C 3JALA 1H38A 4DV4O 4EB6B 4JAAA 5B1AB 5ITZA 1ZLZA 3ZIAG 4CC6A 5K1PA 2O57A 3SPCA 3H01A 4DV6O 1Y4MA 2H94A 4UCRA 1JOYA 1K5QA 4YHHO 3ZX6A 4JI5B 4UFZA 3K0GA 5KMGB 1GM8A 4NXNO 4OPAA 1AI4A 2RJZA 4GT1A 3FYIB 4UCSA 1N0NA 2Q7GA 2Q73A 3OEEG 1PNMA 3WG7B 4HYOA 1CEZA 2CK3G 1KB9F 1WP7A 3OUFA 3FAVA 1AJPA 2DJVA 3VQWA 2NN4A 5EZYB 1BT8A 3G4SV 4LC1A 3ABTA 4GX0A 4FLWA 3L74H 4AI8A 3W7UA 1N36O 2ZR2A 1GN4A 1K34A 2YICA 5KAFZ 3SPHA 1VQLV 5KHGA 4EFEA 1Y76B 1SQFA 4Q20A 3J7AU 4B3MB 2N74A 3UQ8A 2BOCC 4R6ZA 4JYCA 5B5EZ 4U7NA 1H2GA 1R1BA 1M4UA 3ZHTA 4DR6O 2R9RB 2RDCA 3E8BA 4XDKA 3B40A 4IHJA 5LGNA 2RCVA 2B1IA 2PUSA 4GZRB 3H9VA 2NR5A 1OCRB 5LP6C 4K0KB
chains in the Genus database with same CATH topology
1HP8A 1U96A 2LGQA 2HP8A 2RNBA 1U97A 1Z2GA 2RN9A 2LQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP8 A;  1U96 A;  2LGQ A;  2HP8 A;  2RNB A;  1U97 A;  1Z2G A;  2RN9 A;  2LQT A; 
#chains in the Genus database with same CATH topology
 3AG3 C;  3ZMZ A;  2VRZ A;  5BXZ A;  4KP4 A;  1KP3 A;  3A0H Z;  5J2T A;  1MA1 A;  3SJQ C;  3AK3 A;  1YEW A;  3L71 H;  1J5E B;  1BQ0 A;  2UXX A;  2DQ3 A;  3CCQ V;  1CP9 A;  2UUB B;  5LA6 A;  1Q81 W;  4DV0 O;  4LF8 O;  4DW0 A;  2IH1 C;  4O4H A;  4NKG B;  2ZCE A;  4J9Z B;  2AGA A;  4H0L B;  4U3J B;  4BIU A;  2JIZ G;  4ZI7 B;  3W7X A;  2HFE C;  4ZOL B;  1PM9 A;  2C2A A;  1Z2G A;  2HLD G;  2DOS A;  1V9P A;  1O9H A;  4ZHQ B;  4UCV A;  1GRJ A;  2Z3Y A;  2PTM A;  2B9Z A;  2QJ1 A;  2QWP B;  3UT5 A;  2XTA A;  2JJ2 G;  5IYZ B;  3K57 A;  1RSO A;  4NB5 A;  1HNW O;  4PA3 A;  4IGG A;  3K9S A;  3FKS G;  4KFM A;  4UVB A;  5KX5 B;  2XOK G;  5KHJ A;  4PI0 A;  4MVZ A;  5EYP A;  1QLE C;  1ZL8 B;  3CJH B;  3JD3 A;  2CUG A;  3T1Y O;  4R7C A;  5J2U B;  3CE2 A;  3E83 A;  4PDL A;  2PY5 A;  4DV5 O;  4UVC A;  2WLM A;  1H8H G;  5DED A;  3AK1 A;  5BR8 B;  1ENV A;  1R73 A;  3KZI Z;  2E76 B;  4UB8 Z;  1IBM B;  5LHG A;  1Q90 D;  1PNL A;  4MVM A;  4JI0 B;  1WA8 A;  5IE9 A;  4DRX A;  1YIT V;  4DR5 O;  2ZXW C;  2BTQ B;  3ABL B;  5EBM C;  3H1K H;  1SF9 A;  1H8E G;  3SDL A;  4OX9 O;  2Q9L A;  3I56 V;  4JV5 B;  1VF5 B;  2AZ0 A;  1BCC H;  4B7E A;  4L8J A;  5KHH A;  2RN9 A;  5BY1 A;  2L35 A;  1UPG A;  3ASN C;  3RT3 C;  4IYI A;  1XMQ B;  2ZE5 A;  2LGW A;  3ZBH A;  2R9A A;  4I55 A;  1VMG A;  2LO1 A;  3T1H B;  5D5P A;  2YI8 A;  2LP7 A;  2QSA A;  4DUY B;  1R3J C;  2KG7 A;  4JI4 B;  3N27 A;  1WJZ A;  2GBO A;  3G71 V;  3AG1 C;  2DW4 A;  1GN6 A;  2ADP A;  1ZSP A;  1NTK H;  1HR0 O;  2OIG A;  1QHT A;  3G67 A;  2Y48 A;  1Z5W A;  1MOF A;  2YXH A;  3HB3 B;  1JFF B;  3H1H H;  3OEH G;  4DUZ B;  5B1B C;  2OTL V;  1XOU A;  3O9O A;  1E1R G;  2EIK B;  4O4I A;  4U7O A;  3OR6 C;  3LDC A;  4CS3 A;  1WB8 A;  3U0Z A;  2HHH O;  1TUB B;  4MSW C;  3B77 A;  1W0J G;  4E4E A;  1JJ2 U;  4Z2W A;  5CA0 B;  1PPJ H;  3FD9 A;  4ZBM A;  4JF3 A;  2A7W A;  4GX5 A;  4B3T B;  3ZHR A;  1N32 O;  3D3I A;  4MTX A;  3T4D A;  1QLE B;  4B3R B;  3UCS C;  2DN9 A;  3FB7 C;  2EIL B;  2ILM A;  2QKA A;  3OTO O;  2X0L A;  5IJ9 B;  4B08 A;  1OCC C;  4J80 A;  4D6T H;  3K58 A;  3BA8 A;  3WB1 A;  1NR7 A;  1TVK A;  4YJ3 A;  3CWB H;  5CA1 B;  4FZ0 A;  4LF9 B;  2Q69 A;  1I94 O;  4FLV A;  3E8G A;  3P3P A;  1JVM A;  3BEH A;  3C90 A;  3E2E A;  1US6 A;  4JI1 O;  2UXD B;  3DXR A;  1HNZ B;  3CCS V;  2AZ2 A;  4Z1V A;  4UV9 A;  5EIB C;  4FMT A;  3CXH F;  3BPZ A;  4W4K A;  2PYJ A;  5B1N A;  2ETN A;  2P4K A;  4NYK A;  2QGN A;  4XBF A;  1LUW A;  1M9N A;  5JVD A;  3G6B A;  3AG4 C;  3L73 H;  1VQM V;  3ZCC A;  4X66 O;  3F7V C;  1FXK A;  3RBZ A;  3JAL B;  1AI6 A;  2ITC C;  4J41 A;  5ITZ B;  4YJ2 A;  3HKB B;  1YHQ V;  4UB6 Z;  3SJC C;  4PA9 A;  1EZJ A;  3JCU Z;  4RAI A;  2A9H A;  4PA4 A;  4J7J A;  5JQG A;  2UU9 O;  3BRC A;  2PF4 E;  1F51 A;  5B1B B;  4JI2 B;  1B6Q A;  3LNM B;  2JGU A;  3WB0 A;  3FFQ A;  3S3X A;  2HJD A;  3D8C A;  3RVZ A;  2QWQ B;  2VS0 A;  5H5N A;  5KUM A;  3FAV B;  1YXB A;  1AB3 A;  4LFA B;  1RM1 C;  3GVM A;  2WA3 A;  1SES A;  4LNU A;  4FLU A;  3FB5 C;  2FML A;  1XBL A;  3ZRW A;  3E8F A;  4DR1 B;  5DN6 G;  1S72 V;  2YIA A;  2F66 C;  3F5T A;  4FFK A;  1MNG A;  5IJ0 A;  3CME V;  1OZ0 A;  2IH3 C;  4P9O A;  1N34 B;  3B4S A;  1NH2 B;  4JAV A;  4JZG A;  3AG2 B;  2NLJ C;  4O4L A;  2K9P A;  1OV9 A;  1DK1 A;  3KCX A;  2R72 A;  3N2K B;  5LP6 A;  3QO8 A;  1GMG A;  4DR4 O;  1SQB H;  5CN0 A;  3SPG A;  3BVO A;  1Q86 W;  1EM1 A;  2IJJ A;  1TUE B;  4IHJ B;  1G1X B;  3ETG A;  3RYC A;  1Q6U A;  4TV8 A;  1GK9 A;  2EJR A;  2UXB O;  1FXH A;  1MZF A;  4DXW A;  5L3C A;  2ARH A;  3K3W A;  4L87 A;  4PD4 F;  4BIZ A;  2Y0P A;  1DTO A;  2CGN A;  4P30 A;  4DR2 B;  2QEX V;  5J2T B;  1K4C C;  1K7D A;  2WLN A;  1SC5 B;  1SQX H;  3CD6 V;  3IJ4 A;  4LF5 B;  1K33 A;  4HAM A;  1V55 C;  2LFR A;  2XT9 A;  4X20 A;  4JI5 O;  3UKM A;  2B5U A;  5LA6 B;  3PN1 A;  3BAA A;  4O4H B;  3IAY A;  4GLX A;  4JYA O;  3UO3 A;  2RQ6 A;  5LHH A;  5CA0 A;  3STL C;  1S5H C;  5JJJ B;  4RQE A;  5H6Q A;  1XRE A;  4W4L A;  1S77 D;  1EFR G;  2EIN C;  4CC5 A;  1FJG B;  4WFB V;  4J7Z A;  2QKS A;  3CRM A;  1KC8 W;  4PHZ A;  4X1Y A;  5JWP A;  1AR5 A;  4G2K A;  1AI5 A;  3UT5 B;  5IJ9 A;  1RSO B;  3PJS K;  2VWK A;  2WPD G;  3TGU H;  5LMU B;  1DF5 A;  3T4Z A;  4TQD A;  3CYO A;  4FLT A;  1OHH G;  3ABK B;  4B3M O;  1K5S A;  2ZIO A;  4NTX A;  1EN4 A;  3AG7 A;  4G28 B;  4DK0 A;  2JDI G;  2OCH A;  1FD9 A;  1RP3 B;  5BMV A;  4DK1 A;  1ARO P;  4QIW F;  3QO5 A;  3LNN A;  4JI7 B;  5GON B;  2AHY A;  2JJ1 G;  1B06 A;  2ZR3 A;  4N21 A;  2KSD A;  1OCO C;  3IGA C;  4MT8 A;  2WLL A;  2DWE C;  1WA8 B;  5IYB O;  4FVM A;  3IFX A;  4DRX B;  4UCU A;  3CCR V;  5KA6 A;  1AIL A;  5EBL C;  1Q82 W;  1FXV A;  3H1L H;  2LGQ A;  4K0K O;  3KG2 A;  3HKE A;  4PDR A;  3QVN A;  1N33 B;  3ZMU A;  2KQX A;  3ABM C;  1OCZ B;  3LSQ A;  3GWK C;  4AQY B;  2UXN A;  3HKB A;  2Q8V A;  3JCZ A;  1GM7 A;  2JGD A;  4RWU A;  4TV9 A;  1J5E O;  2X6B A;  4I55 B;  4JI3 B;  2UUB O;  1QVG U;  1O9G A;  1QU7 A;  3I5D A;  2JS5 A;  3DC5 A;  1FXK C;  1VQ9 V;  2KG7 B;  4JYA B;  2X6C A;  3SJB C;  2WSS G;  1T5E A;  4MVR A;  4CH6 A;  5C93 A;  1GM9 A;  4O2B A;  1SQP H;  5EK0 A;  4K3A A;  3K5L A;  1QVF U;  1H2L A;  1NI8 A;  2EIN B;  4DV1 B;  3CS5 A;  3L75 H;  1HW7 A;  3VOU A;  3P3N A;  4FJC C;  1VEW A;  4O4I B;  4TQF A;  2ZE8 A;  4Z1M G;  2P7T C;  3K5M A;  3VQV A;  3J81 N;  4PEL A;  4KL1 A;  4R8C A;  1VF6 C;  5H9C A;  4DV7 B;  1S5L Z;  1VQ6 V;  4O4J A;  3BY6 A;  4FM2 A;  3ZJZ A;  2CTW A;  3CCJ V;  5DM6 V;  3N2K A;  4J42 A;  3SYA A;  3Q4H A;  5IYC O;  2HKO A;  3OT7 A;  5BR8 O;  1YTF B;  4LP8 A;  1IBM O;  2P4V A;  4LH6 A;  5A2Q N;  1TVK B;  4YJ3 B;  4JI0 O;  1NVP B;  2ODM A;  2XAF A;  1OCO B;  1XL6 A;  2DYR B;  2EJ7 A;  2KB1 A;  3H1I H;  2FB5 A;  1PL0 A;  4UCO A;  4X64 B;  1XHZ A;  4JV5 O;  2Q6A A;  1EZV H;  4WFF A;  3ZRV A;  5GTI Z;  3DXR B;  5K1X A;  1P7B A;  5AG2 A;  1ZAU A;  1SQG A;  4JAU A;  2LW7 A;  2RMK B;  4J11 A;  1X59 A;  1XMQ O;  1BE3 H;  4QPJ A;  4A5U B;  1NQT A;  2ADQ B;  1R3I C;  4UCT A;  1Q3E A;  2A79 B;  3OMI B;  3VBB A;  5JVD B;  3T1H O;  1JA8 A;  2UXC B;  1KU9 A;  3APQ A;  3DC6 A;  3SPJ A;  1XHX A;  4MTO A;  4QPK A;  4DUY O;  1TGO A;  2AHZ A;  4JI4 O;  2Q68 A;  2HEP A;  1FXK B;  1AP6 A;  1E79 G;  3JAM N;  5L3G A;  4YJ2 B;  4DV3 B;  2F93 B;  1K97 A;  1WB7 A;  2V7Q G;  1HDJ A;  2LW1 A;  5JQG B;  3CC4 V;  4DUZ O;  1PKX A;  1P4R A;  1M57 C;  1ZTE A;  4MVS A;  3K03 A;  5L3D A;  4GKK B;  3ZN0 A;  1R3K C;  3LUT B;  1UJW B;  1JPX A;  4MVQ A;  1FS0 G;  4B3T O;  4LCU C;  1VQ4 V;  2YS8 A;  4B3R O;  4LNU B;  4ZIB A;  4LF6 B;  4CZZ A;  1VAR A;  3K0D A;  3ZRW B;  4DR7 B;  2AXT Z;  1Z5V A;  3D36 C;  5GON A;  5IJ0 B;  1L0N H;  2Y69 C;  5EC1 C;  1VQ8 V;  3SYC A;  2YID A;  1F4M A;  3OAA G;  2MK3 A;  4JI8 O;  4MW3 A;  1IBK B;  3W7W A;  4LF9 O;  4O4L B;  2GHY A;  1WPB A;  3A0R A;  4O2A A;  3JAK A;  5HFL A;  1JR9 A;  4DR3 B;  3OR7 C;  4F4L A;  3U10 A;  5LP6 B;  1IX9 A;  4B3S B;  2UXD O;  3FYE B;  1HNZ O;  2F4V B;  1Y67 A;  3AG3 B;  4R50 A;  3CP1 A;  2ZIM A;  4NTW A;  2QWO B;  3RYC B;  2FYU H;  4PDV A;  4TV8 B;  1MSW D;  3AEI A;  3SGI A;  5IWA B;  1S76 D;  1D5N A;  1DGS A;  1OJH A;  4WFE A;  1N4C A;  5KHI A;  3E22 A;  1NBM G;  4IIJ B;  5CBG A;  5B3S C;  5FPR A;  2DMX A;  2QM4 A;  4DV2 B;  2F1M A;  4I5S A;  4X20 B;  2P5O A;  2DYS C;  3RGB A;  4LFC B;  4I50 B;  2P67 A;  3CCM V;  4D7T A;  5KUK A;  5L3E A;  4JI2 O;  2HVK C;  1M57 B;  2F23 A;  5LGU A;  2R70 A;  3CCL V;  4BW9 A;  4QJF B;  4LFA O;  2LJ2 A;  4I0X A;  4E2L A;  3M99 B;  3O65 A;  4X1Y B;  1KKC A;  2FL4 A;  4OGQ B;  4CH5 A;  4DR1 O;  1L0L H;  2PGG A;  1M56 C;  2RNB A;  4WFA V;  1W2B U;  1Q6H A;  1NU1 H;  4GUN A;  2ZE6 A;  4JAS A;  3TJT A;  2Y69 B;  3ML0 A;  1N34 O;  2WLH A;  4JI8 B;  3GWO A;  1EN5 A;  3K06 A;  3OD4 A;  4JI6 B;  1AJQ A;  1MAB G;  4X65 O;  1G8M A;  3JAT A;  1J95 A;  3RN4 A;  5IYD O;  2ZXW B;  1PL4 A;  1JCH A;  1RFY A;  3JAW A;  3C3T A;  2XAQ A;  5BMV B;  1VQO V;  3SYQ A;  3E35 A;  3JAR A;  3RYI A;  4I7Z B;  3A0B Z;  1XMO B;  1YCI A;  1XUQ A;  1RPR A;  4K8X A;  4QGP A;  2WLL B;  1RPO A;  3ASN B;  1P49 A;  2ZQM A;  4X1K A;  1JQ0 A;  4LF7 B;  3HKD A;  2BCC H;  3ZHQ A;  1FAF A;  4BAY A;  3CC7 V;  3A8T A;  2EX3 A;  5IY5 C;  3HKE B;  2QE7 G;  3JSL A;  4DR2 O;  3STZ C;  1YIJ V;  3MAQ A;  4B7K A;  3EXA A;  2H3O A;  3AG1 B;  2WWW A;  3M8A A;  3BFR A;  2EZP A;  2JGD B;  4LF5 O;  4GX1 A;  4TV9 B;  5A9G A;  1H2K A;  5FL7 G;  1GKF A;  2ZM6 B;  1SZX A;  2DYS B;  2QWR B;  3LDE A;  5JJE B;  1R6K A;  1WP8 A;  1QQC A;  1MZE A;  3N2G A;  4FLZ A;  4O2B B;  1H2N A;  2Y0I A;  1VF6 A;  2XAS A;  4LR3 A;  4J7K A;  1FJG O;  4HZ3 A;  3SYP A;  4JTD B;  4FLY A;  2WAM A;  1GN2 A;  2PYL A;  2IJH A;  2K1E A;  3OW2 U;  1HNX B;  1PNK A;  3OGC C;  1OCC B;  3HPL C;  3CSX A;  1VQN V;  5LMU O;  2EIJ C;  1XQ8 A;  1W59 A;  4O4J B;  2HJF C;  4KUM A;  4X65 B;  2ZKO A;  1VIB A;  2GUZ A;  4LWS A;  3ZED A;  1WLE A;  2CAZ C;  3CRQ A;  4NR1 A;  4EFB A;  2HP8 A;  1SS3 A;  2ZIN A;  1K92 A;  4JI7 O;  3ASO C;  2M6Y A;  3Q4H B;  3KCY A;  5LMN B;  2YEV A;  5DEC A;  3RWR D;  2QM8 A;  3I55 V;  3ZRS A;  2W6I G;  4LF4 O;  4PI2 A;  3C3S A;  1AP5 A;  3JD2 A;  4QE7 A;  1A32 A;  2YIB D;  5CB4 A;  2FTK A;  3ETD A;  3P32 A;  2OCC C;  2E75 B;  2XUM A;  1VQ7 V;  3AG4 B;  2X7R B;  2Q0O C;  1N33 O;  4NXM B;  4P2Z A;  1WPX A;  4I9W A;  5H2F Z;  5EC2 C;  3OM3 B;  4TUY A;  1THZ A;  4FK5 C;  4IIJ A;  3LSU A;  4AQY O;  4MW8 A;  1Q5O A;  2Q67 A;  1M93 A;  2QM7 A;  1U97 A;  3LDD A;  2XND G;  2H8P C;  3IC7 A;  4CBC A;  4PA7 A;  5JH7 A;  4KXR A;  2YXL A;  4JI3 O;  5LXT B;  3E89 A;  4I50 A;  2WA4 A;  5B1A C;  5LYJ A;  2CTR A;  3RVY A;  5EBW C;  3CRA A;  2PI4 A;  3VQX A;  4X62 B;  3APO A;  5FLX N;  1K9M W;  1AR4 A;  1RM1 B;  1U96 A;  4DV1 O;  3BHP A;  1AVM A;  3WG7 C;  1YI2 V;  3DTU B;  5B66 Z;  1BMF G;  3EFF K;  2UUC B;  1ROP A;  5JCO C;  3EHB B;  1TA8 A;  3K04 A;  1Q6I A;  1DLB A;  3D36 A;  2BSK B;  2W6J G;  3X2Q C;  4DV7 O;  2GSM B;  3QF7 A;  1R6N A;  1QNM A;  5LL6 Y;  1SRY A;  4I4T A;  4P9P A;  3JSN A;  2IJK A;  1IXB A;  2QWN B;  4NVP A;  4CH3 A;  1XDC A;  1FKA O;  2V4D A;  4KHP B;  2OTJ V;  4RQF A;  1MG1 A;  5IT9 N;  2XAJ A;  4LF4 B;  2A3Q A;  4HBN A;  4O2A B;  3JAK B;  5CBH A;  2OYQ A;  2M7W A;  2CTP A;  4RUF A;  2OCC B;  1PV0 A;  4X64 O;  4FM0 A;  4QE9 A;  3CC2 V;  2P90 A;  1XNR B;  4AIL C;  4OXS A;  2JK5 C;  4YY3 B;  2DQ0 A;  1AI7 A;  3J80 N;  3RFR A;  4DYL A;  4QNH B;  4LFB B;  2F95 B;  4GX2 A;  1Q43 A;  1XNQ B;  3F7Y C;  1N0J A;  1NTZ H;  3UM7 A;  1V55 B;  2BE3 A;  3B8N A;  2UXC O;  3TXQ A;  2Q0A A;  1BSM A;  1VP7 A;  2BOB C;  4MTF A;  3E22 B;  2XHB A;  4PDM A;  1CXZ B;  4DV3 O;  2P06 A;  3K9A A;  2GTS A;  1QR9 A;  1VQ5 V;  4J10 A;  2E5L B;  3THO A;  3B09 A;  2N04 A;  2CH7 A;  3BCC H;  2A0L A;  3TXS A;  3K59 A;  2JVD A;  4H13 B;  3DSQ A;  1CPY A;  3QNE A;  2GTA A;  2N05 A;  1H2S B;  1IDS A;  4EEQ A;  4GKK O;  5CBF A;  1KD1 W;  3X2Q B;  4JTC B;  4I0X B;  3K5O A;  4GKJ B;  4BIO A;  1GN3 A;  3G80 A;  4LF6 O;  4X1I A;  5HFM A;  5FNV A;  4DR7 O;  3ZHV A;  2IW5 A;  3CCV V;  3CX5 F;  4MS2 A;  1ZX3 A;  1YJN V;  4ICG A;  3TET A;  3CMA V;  2QTS A;  1XI1 A;  1IBK O;  3VQY A;  2HVJ C;  2B1G A;  3JAT B;  3QG5 A;  3W7S A;  1K8A W;  5L3F A;  2UUA B;  3B8M A;  3JAW B;  2PI5 A;  4TWK A;  4DR3 O;  1I5X A;  2CE4 A;  2WLJ A;  1N8R W;  3ZHS A;  3JAR B;  3RYI B;  2DE0 X;  4B3S O;  3UO2 A;  2F4V O;  2VQE B;  1FFX A;  3RYH A;  5GTH Z;  2OIE A;  3ABM B;  3OUS A;  4H33 A;  3ABL C;  2MW2 B;  3JAS A;  4MTG A;  1IBL B;  3ZN1 A;  4X1K B;  3HKD B;  3HKC A;  1LR1 A;  5LXT A;  1JMK C;  1GTO A;  5IWA O;  3CXC U;  4HNA B;  3CPW U;  4DV4 B;  2CDY A;  1P7G A;  4G27 B;  3ETQ A;  2GDS A;  3CB2 A;  4DV6 B;  2E3C A;  4FIP C;  1Q7Y W;  2YI9 A;  1WN7 A;  2YDE A;  2ZDI C;  1JX9 A;  1Y74 A;  4YHH B;  2CGO A;  4NXN B;  4DV2 O;  3ZMS A;  1TAE A;  4YXW G;  1F23 A;  4TOI A;  1KBH A;  1R6T A;  5IDJ A;  3CCE V;  3NR7 A;  4LFC O;  4UXN A;  1KYO F;  1S3J A;  1IZ3 A;  4F6R A;  3NXS A;  2BSK A;  4AHC A;  1KKD A;  3N2G B;  1K73 W;  1SQV H;  3JD0 A;  3ZMT A;  2EIK C;  3AK2 A;  1NR1 A;  1XIL A;  2YUA A;  1N36 B;  2R9I A;  4U3F H;  2YXY A;  4LBE C;  4WBN B;  1JJO A;  3FB6 C;  1F4N A;  1I7F A;  2AW9 A;  1KP2 A;  3JYC A;  1GO3 F;  5TIS Z;  4IL6 Z;  4PV1 B;  3OTF A;  1KEC A;  2IU0 A;  4CS4 A;  1XL4 A;  2WLI B;  2Y4T A;  3E86 A;  5C8Y A;  5LOV A;  2EIL C;  4JI6 O;  2OWO A;  1BHB A;  4FFB A;  3E8H A;  1W0K G;  2GV9 A;  2EIM C;  3JD1 A;  2GUZ B;  3L9D A;  4LWS B;  1KMI Z;  5FPO A;  3ETE A;  3S3W A;  1SET A;  2Z5U A;  4MVU A;  1Q8I A;  4DR6 B;  4TT3 G;  4JYB A;  1SA0 A;  3K08 A;  1QLN A;  2XAH A;  1BZK A;  1GH6 A;  3L72 H;  1XMO O;  3ZMV A;  4JGS A;  4FM1 A;  5LGT A;  2YEV B;  4BWA A;  3RYF B;  4K8Z A;  3T2M A;  1XEQ A;  2LQT A;  3CHX A;  5CB4 B;  4LF7 O;  2ZNJ A;  3MHH C;  5LHI A;  1H2M A;  2P22 C;  4EB6 A;  2D3O W;  1DF4 A;  1NZ6 A;  2YIB A;  5JJN B;  4FZ1 A;  3OMA B;  4C7U A;  1BL8 A;  4TUY B;  1HP8 A;  3QTC A;  1YDX A;  2BTO A;  5F2V O;  3F5W C;  5KMG A;  1LNQ A;  5L3B A;  1FPO A;  3JD4 A;  3ICX A;  3BAB A;  5JH7 B;  4DV0 B;  1LUV A;  4LF8 B;  4IYH A;  1COW G;  3CRC A;  1KQS U;  5LBQ A;  1B04 A;  2ZM6 O;  5JCO A;  2QR4 A;  4PA6 A;  4EKW A;  3B2E E;  5LYJ B;  2VQF O;  3OGI B;  1URF A;  1GAX A;  5EZY A;  4XDL A;  4ASU G;  5KAI Z;  4GYC B;  1BGY H;  2EBO A;  4X8A A;  2F43 G;  3IC9 A;  5E79 Z;  1NH2 D;  1HNW B;  1L8D A;  2IU3 A;  4TSF G;  2OT5 A;  1HNX O;  3ZHU A;  1Y76 A;  1YZB A;  1SKV A;  5D5Q A;  4I4T B;  3T1Y B;  2X6A A;  4WFH A;  4YIO A;  1BS3 A;  3K79 A;  1M90 W;  4DV5 B;  2EIM B;  1AJN A;  2IJI A;  4Q6G A;  5EIB D;  3WB2 A;  4J9Y B;  1S5J A;  1Y66 A;  1YJW V;  1PP9 H;  2IM9 A;  4X9Q A;  3AG2 C;  5LMN O;  3L70 H;  4X89 A;  4K35 A;  2L6L A;  4DR5 B;  5KLV H;  3HR0 A;  1FYJ A;  2JEX A;  3QO7 A;  4JYY A;  4OX9 B;  4HNA A;  4DO2 A;  4RO2 A;  3R66 A;  4NXM O;  4F6E A;  1YVW A;  2Q7H A;  1VQP V;  3D3Q A;  4WFG A;  2HR3 A;  5B3S B;  3CEI A;  1E1Q G;  1K3E A;  1BHA A;  3KKY A;  2EUL A;  4U3J A;  3MD0 A;  4ZI7 A;  4ABM A;  2VQF B;  2PZS A;  2YSU B;  2JRI A;  4ZOL A;  1HR0 B;  3LSS A;  4FLX A;  4WF9 V;  4X62 O;  2G38 A;  1L1F A;  3U11 A;  4ZHQ A;  2VWJ A;  1V54 C;  3OFN G;  4RUE A;  5H6R A;  2CH7 B;  5IYZ A;  4WBN A;  5GW7 A;  2UUC O;  1QBZ A;  2HHH B;  5KX5 A;  1G4Y B;  3ABU A;  1B3Q A;  1SQQ H;  1M56 B;  1N32 B;  2WLI A;  1ZL8 A;  3CJH A;  1EBO A;  3TK1 A;  4LH7 A;  2ATK C;  3DGE A;  5J2U A;  3H1J H;  3FB8 C;  3OTO B;  4N23 A;  2QTO A;  4CH4 A;  3ZRX A;  4UUJ C;  4XDJ A;  2XAG A;  1M5I A;  2HG5 C;  1SZT A;  3A2F A;  3W7T A;  4X1I B;  5FNV B;  5B1O A;  4KHP O;  2Z0A A;  3ABK C;  4IT5 A;  4JZ2 A;  1QCE A;  1VQK V;  1QR8 A;  1P84 F;  5E1A C;  2BTQ A;  1I94 B;  3RYF A;  1YF2 A;  2QKC A;  4GCZ A;  1IVS A;  1ORQ C;  4BW5 A;  3K5N A;  1NJI W;  4JI1 B;  2P6J A;  1AR1 B;  1S0V A;  2W0F C;  3ZS8 C;  3M7M X;  1D2D A;  1R3L C;  1EN6 A;  5IY5 B;  2JS3 A;  1XNR O;  2QA4 V;  1FFX B;  3RYH B;  1ZWI C;  4YY3 O;  4LFB O;  3JAS B;  2ZDI A;  1NKD A;  1XNQ O;  1M1K W;  2QDO A;  3OMN B;  5KHK A;  1PD3 A;  4H37 A;  3HKC B;  1BQZ A;  3OE7 G;  4X66 B;  1OCZ C;  1MMM A;  2ZD9 A;  2FKX A;  1HWY A;  1VF7 A;  4BR6 A;  1WAZ A;  1IUR A;  2ITD C;  5KA5 A;  5CMU A;  4MVO A;  4UV8 A;  1Y74 B;  2E74 B;  4JTA B;  1JFF A;  2WLK A;  3T1C A;  2E5L O;  1KUQ A;  2UU9 B;  1NS1 A;  1V54 B;  3WU2 Z;  3R65 A;  5BZB A;  5J9P C;  1TUB A;  4ZKI A;  1D5A A;  4UVA A;  3RW0 A;  1IXM A;  4F6R B;  2JEU A;  2CTQ A;  3CRR A;  4D7S A;  3SPI A;  1ZUQ A;  5CA3 A;  2LFS A;  1G6U A;  2EIJ B;  4DW1 A;  1SER A;  2YC0 A;  3G6E V;  3FX7 A;  1YTF D;  2D2C B;  2DWD C;  1NT2 B;  4H44 B;  4GKJ O;  3MHS C;  4OPH A;  4X88 A;  1NVP D;  2W0X A;  4JPR A;  3P30 A;  3MDS A;  4CS2 A;  2Q5Z A;  1WNS A;  1I5Y A;  1FFT B;  5CA1 A;  3ASO B;  1I08 A;  4I9Q A;  5EYP B;  2Q7E A;  5C8Y B;  5LOV B;  2NNU A;  2ZT9 B;  4FFB B;  2EZO A;  4YIP A;  2UUA O;  4DR4 B;  2A06 H;  3SYO A;  2KKW A;  1X4T A;  2Q4P A;  4PJ0 Z;  4NTY A;  3BA9 A;  3WFV A;  3EVK A;  1NTM H;  1SA0 B;  2IBZ H;  1UFI A;  3SR2 C;  2DYR C;  2VQE O;  1YJ9 V;  3TCU A;  2V1D A;  1Y6X A;  1YSC A;  1K4D C;  1OCR C;  1IBL O;  2UXB B;  4FPP A;  2ZE7 A;  1MSD A;  4WCE V;  1F7Y A;  1I0H A;  3CCU V;  2Y4U A;  2ZNI A;  3SJA C;  3GB7 C;  3JAL A;  1H38 A;  4DV4 O;  4EB6 B;  4JAA A;  5B1A B;  5ITZ A;  1ZLZ A;  3ZIA G;  4CC6 A;  5K1P A;  2O57 A;  3SPC A;  3H01 A;  4DV6 O;  1Y4M A;  2H94 A;  4UCR A;  1JOY A;  1K5Q A;  4YHH O;  3ZX6 A;  4JI5 B;  4UFZ A;  3K0G A;  5KMG B;  1GM8 A;  4NXN O;  4OPA A;  1AI4 A;  2RJZ A;  4GT1 A;  3FYI B;  4UCS A;  1N0N A;  2Q7G A;  2Q73 A;  3OEE G;  1PNM A;  3WG7 B;  4HYO A;  1CEZ A;  2CK3 G;  1KB9 F;  1WP7 A;  3OUF A;  3FAV A;  1AJP A;  2DJV A;  3VQW A;  2NN4 A;  5EZY B;  1BT8 A;  3G4S V;  4LC1 A;  3ABT A;  4GX0 A;  4FLW A;  3L74 H;  4AI8 A;  3W7U A;  1N36 O;  2ZR2 A;  1GN4 A;  1K34 A;  2YIC A;  5KAF Z;  3SPH A;  1VQL V;  5KHG A;  4EFE A;  1Y76 B;  1SQF A;  4Q20 A;  3J7A U;  4B3M B;  2N74 A;  3UQ8 A;  2BOC C;  4R6Z A;  4JYC A;  5B5E Z;  4U7N A;  1H2G A;  1R1B A;  1M4U A;  3ZHT A;  4DR6 O;  2R9R B;  2RDC A;  3E8B A;  4XDK A;  3B40 A;  4IHJ A;  5LGN A;  2RCV A;  2B1I A;  2PUS A;  4GZR B;  3H9V A;  2NR5 A;  1OCR B;  5LP6 C;  4K0K B; 
#chains in the Genus database with same CATH homology
 1HP8 A;  1U96 A;  2LGQ A;  2HP8 A;  2RNB A;  1U97 A;  1Z2G A;  2RN9 A;  2LQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...