4PDLA

Structure of k+ selective nak mutant in caesium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdlA00
3IFXA 4WFEA 5B3SC 3PJSK 3T4ZA 1S5HC 1XL6A 3LDDA 2ITDC 1ZWIC 3SYOA 5EC2C 3LNMB 3OR7C 2H8PC 3E8HA 3FB5C 3T2MA 3RBZA 5EBWC 5IY5C 4MSWC 2NLJC 1QLEC 3E86A 4MVRA 5EBMC 1J95A 4ZBMA 3F7VC 5KUMA 3SPHA 2OCCC 1V54C 5BZBA 2WLLB 2X6CA 3R65A 1R3LC 4MVZA 2A9HA 4GX1A 2ITCC 1G4YB 3ABLC 4LBEC 2QTOA 3AG1C 3X2QC 2AHYA 3ASNC 4RO2A 2Q6AA 3SPJA 3E8BA 4PDVA 4MVUA 4P2ZA 4DXWA 4J9ZB 1K4DC 3FB8C 3LUTB 4PA9A 4MVSA 2R9RB 4UUJC 4XDKA 4X88A 3UM7A 4WFHA 2EIMC 1R3JC 2WLNA 4H33A 4R7CA 3STZC 4X89A 4BW5A 2QKSA 3ASOC 5J9PC 4G27B 3FB6C 4MVOA 4QE9A 3SPIA 4KFMA 4QNHB 3RVZA 2BOCC 1R3IC 3F5WC 2WLHA 2EIJC 3RVYA 1M56C 3SPCA 2YEVA 3JYCA 4OXSA 2JK5C 3E89A 3E8GA 1M57C 4G28B 5B1AC 4TWKA 4PA3A 2HG5C 3F7YC 5CBFA 2DWDC 4MVQA 3SYQA 4MTFA 4WFGA 4JTAB 3BEHA 4QE7A 3OGCC 2WLKA 2BOBC 3TETA 3AG3C 3K03A 3SJQC 3EFFK 3E8FA 4HZ3A 2WLIB 4RUFA 4JTCB 2EINC 2DYRC 4I9WA 4PA4A 3SYPA 5EBLC 4GX0A 5E1AC 3IGAC 4RUEA 2ATKC 3ZRSA 2WLMA 1P7BA 4GX2A 4MW3A 4PDLA 4EKWA 2P7TC 3TCUA 4MTOA 2EIKC 3E83A 3K06A 4H37A 4PA7A 3GB7C 3VOUA 4LP8A 1OCZC 5KUKA 2HJFC 3OR6C 1OCCC 2W0FC 3OUSA 3WG7C 4HYOA 4R8CA 3K08A 3K04A 3SYCA 2AHZA 4LCUC 4PA6A 2A79B 2HFEC 2HVKC 3ZJZA 2EILC 1OCRC 1LNQA 5EK0A 2ZXWC 2X6AA 4R50A 1JVMA 3SYAA 4P30A 4CBCA 1OCOC 4P9PA 2IH1C 1BL8A 3HPLC 2HVJC 2KB1A 2A0LA 3LDCA 2DWEC 3OUFA 3SPGA 3T4DA 4JTDB 5CBGA 3UKMA 2IH3C 2WLLA 2WLJA 3ABMC 4MVMA 3T1CA 2Y69C 1XL4A 2K1EA 2Q69A 3STLC 4XDLA 1KKDA 4PDMA 3RW0A 4X8AA 5B1BC 3AG4C 3FB7C 3K0GA 3LDEA 1ORQC 4F4LA 4WFFA 1V55C 2DYSC 3K0DA 3AG2C 3KG2A 4P9OA 2WLIA 5CBHA 1R3KC 4XDJA 4J9YB 4RAIA 1K4CC 4MW8A 4MS2A 4MTGA 4GX5A 4PDRA 5EC1C 2X6BA 2ZD9A 3ABKC 4R6ZA 2Q67A 2Q68A
chains in the Genus database with same CATH superfamily
1IBKO 2OTLV 3SDLA 4CC5A 2ZT9B 2ARHA 4JGSA 1DK1A 1BQZA 1QVFU 4MSWC 1M1KW 1XDCA 3A2FA 2OWOA 1XREA 4MVZA 4TSFG 2FMLA 2A9HA 3G6EV 1IVSA 4X9QA 4GZRB 2UUBO 1QR8A 5BMVA 4LR3A 5LYJA 2Q6AA 3ZS8C 3I5DA 4DXWA 1D5AA 2NNUA 1TVKB 5B1NA 3H9VA 4WF9V 1YI2V 1Q7YW 4JZ2A 1US6A 2ZKOA 2WAMA 4DV5B 2ILMA 4X62B 4WFGA 1QLNA 3KCXA 5LOVA 1SF9A 2EIKB 1H2KA 4J7ZA 3W7XA 3CCJV 2YDEA 1K34A 3IGAC 1M5IA 4PD4F 2DJVA 3ZRSA 2WLMA 4DV0O 3MHSC 2ZXWB 3MHHC 3HKCB 4L8JA 4DV7B 2ZIOA 1FXKC 2R9AA 1WB7A 4LCUC 1KBHA 2QDOA 1LNQA 5H5NA 4O4HB 1N4CA 4DV1B 1OCOC 1M4UA 2IH1C 1BE3H 3H1LH 4DR2O 2WPDG 4FLUA 2WLJA 3MDSA 1D5NA 1YTFB 2CTQA 2Y69C 3CYOA 2UXCB 3K0GA 1R73A 1HNWB 2ZR3A 2Z0AA 3AG2C 5KAIZ 1JFFB 2F66C 4MS2A 2ZNIA 3P3PA 3IC7A 3G80A 1SRYA 4CH3A 3ZMUA 4B08A 2LJ2A 3OAAG 1Q6IA 2DQ0A 2A3QA 5EBMC 2Q73A 1AJQA 1SQQH 2IU0A 3R65A 4ICGA 3HKBB 1EFRG 2XOKG 3ABTA 4BR6A 4DK0A 2E5LB 3BVOA 3T1YB 4RQFA 2PTMA 1ZUQA 2ZM6B 5KHKA 3OMIB 1GN6A 1JA8A 2QWPB 2RCVA 1OV9A 3C3TA 2WLNA 1XNRB 3DGEA 1YF2A 3FB6C 1LUWA 1MOFA 2RNBA 1NBMG 3UT5A 4TWKA 4PA3A 4OPAA 2JEXA 2JDIG 4NXMB 5IDJA 4J42A 3JASA 1S3JA 3HR0A 3ZHRA 4EFBA 4DR3B 4HAMA 2Q7HA 4KHPB 1IXMA 1FXKB 1P7BA 4PDLA 1N33B 3TCUA 2XHBA 4NR1A 2DQ3A 1OCOB 5EYPA 4GCZA 3FX7A 2Y69B 2ETNA 1S5JA 3UO2A 3SR2C 4JI5B 5B1OA 3THOA 4IT5A 4O2BB 1J5EO 3AG2B 4OPHA 1IURA 1WN7A 3R66A 1HR0O 4MVMA 3KKYA 4LF5B 4FLYA 3K5MA 4O4JB 1VEWA 1ZL8B 1FXVA 3E2EA 4CH6A 1ZAUA 4EFEA 4DO2A 3TXSA 5EIBC 3LDDA 1BHAA 2CGNA 3SYOA 1O9HA 2YIBD 3RBZA 5D5QA 4FLZA 2HR3A 2WLLB 3ZHUA 3I55V 1G4YB 4D6TH 2XAHA 3LSQA 2QTOA 2Z3YA 4DUYO 3Q4HA 4E2LA 3JD2A 1VQKV 2BSKA 1F4NA 2B1GA 3QVNA 4WFHA 1Y76A 1HP8A 4X89A 5H2FZ 1GKFA 3F5TA 4KFMA 3ZRWA 5J2TB 3CC7V 4DV3B 3VQVA 2W6JG 3LSUA 3G67A 3B40A 1BZKA 4HNAA 1XMOO 1NS1A 5KX5B 2UXNA 3CS5A 2DW4A 4DR5B 5H6QA 1YVWA 3CRAA 3E8FA 4TV8A 3DC5A 1W59A 1Y74B 2UUAO 5KMGB 2P7TC 3JCZA 5K1PA 3TXQA 4CS4A 2FKXA 2CTRA 2AXTZ 2W0FC 4R8CA 1VQ5V 1EZVH 2ODMA 4DV2B 4CS3A 4DR4O 5EK0A 3JALB 2X6AA 3JSNA 4X1IA 5LL6Y 1K8AW 4CBCA 4LF5O 2CGOA 4YXWG 2XAJA 2EULA 1M90W 1KKCA 1IZ3A 4F6RB 2PYJA 2OIGA 4WFFA 1L0NH 4NXNO 2UU9O 4FJCC 4R6ZA 3K9SA 2P90A 3OGIB 1E1QG 3CEIA 5EC2C 3LNMB 3OR7C 3SJBC 1BCCH 4LH6A 4LFBO 3O9OA 2O57A 1RPOA 3DXRA 4J7JA 1J95A 3WB0A 1UPGA 3SPHA 1COWG 3CMAV 2CH7A 3B2EE 4IL6Z 4X64O 4NKGB 1Z5WA 2Y0IA 1H38A 2AHYA 1G8MA 4RO2A 2EZOA 4MVUA 1YDXA 5FNVB 1K4DC 4JF3A 4ZOLB 3OFNG 4GKJB 1IX9A 4NB5A 1ZX3A 3N2GB 4JI2O 3E8GA 3U0ZA 5JH7A 1FJGB 2GV9A 1N34O 2VRZA 2XAFA 4DK1A 5C8YB 2F23A 5CA1B 3CJHB 2DMXA 1F7YA 2BCCH 2JS3A 2F95B 1AI5A 4O2AB 1NU1H 4B3MO 5ITZA 4RUEA 1PL0A 2VQEB 2ATKC 4IYHA 4CC6A 2ZE6A 4DUZO 4FZ1A 1VIBA 4H13B 3CCRV 3WG7C 4B3RO 1AI4A 3W7WA 2UXDO 1IBLO 1TVKA 4B7KA 2CUGA 3ABLB 4P9PA 1MZFA 1CEZA 3CHXA 1BS3A 3SPGA 1W0JG 3ABMC 4TUYB 1HNXO 3KZIZ 2AW9A 1XL4A 2KG7A 3RYFB 5LA6A 4DR7O 2F4VO 2DYSC 3KG2A 4XDJA 2GUZB 3CC4V 2Q0OC 3IJ4A 3QG5A 1AVMA 1RP3B 1DTOA 2Q68A 3VQXA 1Q6UA 2JEUA 3ABUA 4DRXA 2IBZH 5LHIA 4JAAA 2B1IA 2ITDC 4I0XA 4JI6O 5C93A 2H8PC 1K97A 5CN0A 5CB4A 4I4TB 4FLTA 3MD0A 4LH7A 4O4IB 1M9NA 2ITCC 5L3FA 4AQYO 3H1KH 3UO3A 4QGPA 4YIPA 1I5YA 4O4LA 2DOSA 3OW2U 4NTYA 3JD0A 4UUJC 3UM7A 3ETGA 4BW5A 4G27B 3L75H 4MVOA 3D3QA 4H0LB 3DSQA 1VQMV 3E89A 3CCVV 3MAQA 4JV5O 2DWDC 4X65O 4TV9B 1YHQV 3ZHTA 2BOBC 5KAFZ 4RUFA 3O65A 3E22B 3SYPA 2QM4A 2YICA 1VQ7V 3N27A 2OIEA 3CCEV 3WG7B 4LC1A 1FFXB 4GLXA 1GO3F 4TQDA 3T1HB 1B3QA 1SC5B 2F43G 3AK1A 4CH4A 1EM1A 4HYOA 1KD1W 3ABMB 1BT8A 2EILC 1R6TA 2YXHA 1VF5B 3L9DA 2DYSB 2DWEC 3IC9A 2GSMB 1L1FA 3T1CA 3JAMN 1B6QA 4UCSA 2R72A 5GTIZ 2AZ0A 5KHIA 1Q6HA 4JI7B 2JGDB 2Q5ZA 4J9YB 4PHZA 3CX5F 2YS8A 5B3SC 4DV6O 4ZI7B 2UUCB 1VQNV 3T2MA 1PKXA 3FAVB 5BR8O 1VQLV 4ZBMA 1SZTA 3B09A 2CAZC 1THZA 3JD3A 1LUVA 4K35A 4KUMA 1SESA 3I56V 5DM6V 1N0NA 3D36C 2UXBB 4N21A 3K5OA 2PUSA 3H01A 4UXNA 3X2QC 4K8ZA 5TISZ 1WPBA 3E8BA 3ZMVA 1SKVA 4XDKA 4YJ3B 4PI0A 1WPXA 4AHCA 1NTKH 5J9PC 1NJIW 2ADPA 3JYCA 5A9GA 3ZEDA 2P6JA 4K3AA 5LMUB 1IBMB 3BEHA 3QTCA 3TETA 1SETA 4LFCB 4HZ3A 3H1JH 3CCMV 1PPJH 5JVDB 3HKEA 4GKKB 2V4DA 2EILB 2CTWA 1CXZB 1Q82W 1S0VA 3J81N 1HWYA 4DR1B 4LP8A 4U3JB 2QWOB 4LFAO 3RYCA 3SYCA 2C2AA 4B3SO 3FFQA 1QU7A 1GK9A 1YCIA 5FLXN 3WB2A 3BPZA 3QO5A 3JAKB 1RPRA 4J41A 1YZBA 2HHHB 5IWAB 4JI0B 1K92A 1XQ8A 5FPOA 5B3SB 3RW0A 4OGQB 5LGNA 1I7FA 1G6UA 2JGUA 1KECA 1F51A 3CWBH 1WNSA 1XNQB 1H2MA 3IFXA 4IIJB 4IGGA 1NKDA 3JATA 4LNUA 3E8HA 3FB5C 2FB5A 3X2QB 5IJ0B 4YHHB 2NLJC 5FPRA 4C7UA 3JSLA 1V54C 4BWAA 2OCHA 1KUQA 5IJ9A 2JIZG 3JALA 1DGSA 1W2BU 3H1HH 1XMQB 4K8XA 1SERA 4TOIA 5J2UB 1AILA 4X88A 4B7EA 4UCUA 4ZIBA 4K0KB 1MABG 2P67A 3K58A 3SPIA 2RN9A 4UB6Z 2ZDIA 4YY3B 2ZIMA 3BY6A 4Q6GA 4QE7A 4JYAB 3L72H 3BFRA 1NVPD 4WFAV 5KA5A 1YXBA 1PV0A 4UVBA 3K9AA 3K5LA 1KC8W 5F2VO 4DV5O 2F1MA 4IHJA 4X62O 1EN5A 1TUBA 1EN4A 2P06A 1QR9A 1JX9A 3CRRA 3HKDB 1OCZC 2HJFC 2PZSA 1E1RG 4EB6B 2WWWA 4YJ2A 4LF6B 1I5XA 4OX9B 1OCRC 1WP7A 2BTOA 5KHJA 1UJWB 1JMKC 2YXYA 1N8RW 3A0BZ 3OUFA 1QHTA 3L71H 4Z1VA 4DV7O 5C8YA 2XUMA 2BTQB 4X1KA 4DV4B 2Q9LA 2EBOA 4WBNA 4DV1O 4DR6B 1V54B 1Z5VA 2YUAA 2Q67A 1S5HC 4J10A 3ZIAG 5DECA 5EBWC 2UXCO 5IY5C 4DW1A 1HNWO 4AILC 3M7MX 3ZMSA 2QM7A 4GX1A 2LQTA 2Z5UA 1PP9H 3BHPA 4JPRA 2VWKA 4E4EA 1WAZA 1Q86W 2Y4TA 5JQGA 4P2ZA 4X1YA 3APOA 4TUYA 4R7CA 1N0JA 4BIOA 3CB2A 1O9GA 3RYFA 2E5LO 3SPCA 2QGNA 2MK3A 2IW5A 3T1YO 3CPWU 5B1AC 1NZ6A 1FYJA 1MG1A 4G2KA 4XBFA 2GUZA 4MVQA 2ZM6O 1VQPV 4D7SA 2P22C 3JAWA 1L0LH 5B66Z 1N36B 1XNRO 4WFBV 1KYOF 5BMVB 1OCZB 1P7GA 4I4TA 1YIJV 1AI6A 4LWSB 4O4IA 1OCRB 1Z2GA 2VQFB 4NXMO 3CE2A 4X66B 1EZJA 1AB3A 2RQ6A 3TK1A 1ENVA 5IYZB 1NH2D 4DR3O 4KL1A 4KHPO 5IT9N 3ZRXA 2HFEC 2HVKC 2W6IG 1YJNV 1URFA 2B5UA 3VQWA 5LOVB 4LF8B 5JWPA 1N33O 1S77D 1VF6A 3ZN0A 2QWQB 4JI3B 4JAVA 1I0HA 3STLC 4UCOA 2GTAA 2HKOA 1TGOA 4X8AA 3ZMTA 4FM2A 3RYHB 3ASOB 3BRCA 4JI5O 1N32B 5IY5B 4X20A 4W4LA 4U7NA 3E22A 4NTXA 4FM1A 1H2GA 4WFEA 1CP9A 4F6EA 1VP7A 1TA8A 3E86A 4I50B 4UCTA 4FFKA 4UCVA 5CA3A 5EZYB 2YIAA 3S3WA 2Q8VA 4ZHQB 1I94B 2ZINA 3ABLC 5LGTA 1B06A 3AEIA 2XTAA 4JI1B 1UFIA 4PDVA 2P4VA 5B1AB 3FB8C 1XHXA 3LUTB 2PY5A 2R9RB 5L3DA 1R3JC 3BABA 2OYQA 1VARA 3A0HZ 4JI4B 4QJFB 4LF9B 2JK5C 1KQSU 1GM7A 4KXRA 5LBQA 1H2SB 4B3TB 1WA8B 2VWJA 5JCOC 2IJKA 2ZE7A 3TGUH 2DYRC 1RSOA 5D5PA 4YIOA 4DV3O 4JAUA 1G1XB 2XAQA 3OTOB 4PA7A 3N2KA 3VOUA 2JJ2G 2H3OA 4DR5O 2Y4UA 3D8CA 3UT5B 3JASB 3LNNA 1R6NA 3SYAA 4TQFA 3ZN1A 4LF7B 1EBOA 2JRIA 3T4DA 1VQOV 2Q7GA 4MTXA 1B04A 2HJDA 2K1EA 5GONB 2X7RB 1KKDA 5B1BC 1VF7A 1YITV 4DV2O 5KA6A 3G6BA 1OHHG 1R3KC 3B8MA 1BGYH 5EYPB 5E79Z 2LFRA 2CTPA 2LO1A 3ABKC 4CS2A 1K33A 5JVDA 3T4ZA 2XT9A 2F93B 2UXXA 2IJIA 1FKAO 1JPXA 4FLWA 1E79G 2V7QG 3ETDA 4Q20A 3U10A 2QSAA 1H2NA 3JARB 1PNKA 2EJRA 2ZQMA 2JJ1G 1P49A 2Q7EA 2PI5A 5CA0B 5KLVH 1K3EA 1FD9A 1A32A 4JI4O 1VQ9V 2YC0A 1QQCA 1DF4A 4LF4B 2WA4A 1SA0B 1VQ6V 1DF5A 1GM9A 3HKCA 3RVYA 2DYRB 1XI1A 3L73H 3OEHG 1U97A 3F7YC 2ZE5A 5CBFA 3SYQA 2LGWA 4JTAB 3UQ8A 4IIJA 4FMTA 4O4HA 4GKJO 5GTHZ 5IJ0A 4I9QA 1JOYA 5EBLC 2ZNJA 3AK2A 5CMUA 1GN2A 1FJGO 1KMIZ 3H1IH 2E74B 5KHGA 1JFFA 3ETEA 1RFYA 3OR6C 1Q5OA 1OCCC 2IJJA 2PI4A 4PA6A 4HNAB 5J2UA 4QPJA 4IYIA 3FKSG 4PI2A 5B1BB 2VQEO 5LMNB 4Z2WA 1GAXA 4TV8B 3ASNB 1IBKB 3HKBA 3ABKB 3PN1A 3FD9A 4UV9A 4FLXA 1NVPB 1MSWD 2Y0PA 4GT1A 3NR7A 1MA1A 2HLDG 2VS0A 4UVAA 1AP6A 2ZD9A 4Z1MG 4HBNA 3RYIB 3PJSK 2UUBB 1S76D 5JJNB 2IM9A 2M6YA 4X1IB 1SZXA 3K3WA 1M93A 3E35A 2CDYA 3HKDA 3F7VC 5KUMA 4UCRA 2WSSG 1R3LC 2AGAA 3OTFA 3HB3B 4PELA 3NXSA 2WA3A 1Y6XA 1ROPA 1FXKA 4J9ZB 1XBLA 2EIMC 2QKSA 3BCCH 1GMGA 2BOCC 3F5WC 1SQVH 3DXRB 2XAGA 4DV0B 1NR7A 1X59A 2ZR2A 2CH7B 4MTFA 3VQYA 4DW0A 3K03A 3SJQC 4O2BA 1V9PA 1BMFG 4BIUA 1OCCB 2LFSA 1DLBA 4GX0A 3U11A 4EKWA 4O4JA 3OE7G 3K06A 4DR2B 1ZL8A 5KUKA 2XNDG 1PL4A 5LMNO 1H8HG 3D3IA 5JH7B 1F23A 1Y4MA 2QEXV 2FYUH 1AJNA 4R50A 2KKWA 2G38A 3RN4A 3C90A 2YIDA 2QM8A 3T1HO 3WB1A 1GN3A 2WLLA 5ITZB 1Q81W 3UCSC 5JJEB 1IDSA 3LDEA 5L3GA 1TAEA 1ORQC 4QPKA 2YEVB 5B5EZ 1H2LA 4FFBB 2B9ZA 1R6KA 1Q90D 4LWSA 1XL6A 2CE4A 3W7TA 1FAFA 1ZWIC 2QA4V 1FPOA 5J2TA 3S3XA 1ZTEA 4JI7O 1NH2B 5IYZA 1MSDA 4ASUG 3SJCC 4PJ0Z 1GH6A 5KX5A 5KHHA 2EIMB 1K5SA 2JS5A 2KG7B 5LA6B 1Y74A 2K9PA 2UUCO 1TUEB 1YJ9V 1MMMA 2QWNB 5IYBO 5L3BA 1S5LZ 1NQTA 4H33A 1NTZH 4DRXB 5KMGA 1BHBA 4I0XB 4QE9A 3RYHA 1R3IC 4EEQA 2EIJC 2BE3A 3P32A 5CB4B 4KP4A 2UXBO 1R1BA 2PF4E 3ZX6A 1QVGU 3APQA 5LP6C 2AZ2A 1IXBA 3OMNB 2WLKA 2PYLA 1ZLZA 3EFFK 1SQBH 1GN4A 2NR5A 2Q0AA 2WLIB 1BQ0A 4O4LB 4PA4A 4I50A 1Y67A 5EZYA 1SQXH 4GYCB 1J5EB 4UVCA 4ZHQA 4I55B 5HFMA 4NVPA 5LMUO 4F6RA 1AI7A 1IBMO 2QE7G 5AG2A 1HR0B 1K5QA 1QCEA 4LFCO 2ZE8A 3K08A 3AK3A 1K9MW 4UFZA 3J80N 3B4SA 4UV8A 4GKKO 3OD4A 3EXAA 1BL8A 2A0LA 2QTSA 1S72V 2IH3C 4DR1O 3QF7A 1NT2B 3CD6V 2Q69A 4JASA 2ZCEA 3CP1A 1WA8A 1WJZA 3FB7C 4J7KA 3M8AA 4AI8A 1V55C 5FNVA 4ZOLA 2HHHO 1KB9F 2YI9A 2HP8A 5IWAO 4JI0O 4DUYB 1FS0G 3L70H 3SGIA 3N2GA 1QLEC 4NTWA 1VQ8V 5CA1A 4ZKIA 3CJHA 4I7ZB 2N05A 1XNQO 1AP5A 3ETQA 2E75B 2EIJB 3SPJA 1XMOB 4O2AA 3K59A 2YXLA 4YHHO 2P5OA 2R9IA 4MVSA 2ADQB 5LP6B 3STZC 5GONA 3ASOC 3CMEV 2UUAB 4BIZA 1KP3A 1M57C 2GDSA 1XMQO 4D7TA 4TT3G 1AR5A 1FXHA 3OGCC 5LXTB 2FTKA 1Q8IA 2EINC 5L3CA 4K0KO 3ZRVA 2RJZA 2HEPA 4DR4B 5E1AC 4WCEV 3CC2V 4YY3O 4GX2A 4MW3A 1NI8A 1ZSPA 1YEWA 3OEEG 3JARA 4MTOA 3EVKA 3E83A 4JYAO 1VMGA 1OZ0A 3W7UA 3J7AU 3L74H 4JYCA 2N04A 1NTMH 5CA0A 1GTOA 4RWUA 1HW7A 3GWOA 1MZEA 4RQEA 2OT5A 1WB8A 1KP2A 1SA0A 4NXNB 5JCOA 2UU9B 5LYJB 1V55B 3LDCA 4JTDB 2QJ1A 2ZDIC 3IAYA 3HKEB 4LFBB 2CK3G 3P3NA 4LF6O 1CPYA 4J80A 4OX9O 3TJTA 4JZGA 4GUNA 2GBOA 3CXHF 4P9OA 1QLEB 1T5EA 4X64B 3RYCB 2X6BA 3G4SV 1AROP 1JJ2U 4JYYA 4FK5C 4DV4O 1Q3EA 4MVRA 4TV9A 5GW7A 4DR6O 4ABMA 2R70A 1JJOA 2GHYA 4LBEC 4JI2B 1VQ4V 3AG1C 3BAAA 1N34B 2MW2B 3AG7A 1M57B 1FFXA 1FFTB 3JATB 4FLVA 2PGGA 4LNUB 3RVZA 2D3OW 2WLHA 1EN6A 3RFRA 2EINB 3WFVA 4B3MB 5A2QN 4OXSA 2E76B 1YTFD 2HG5C 4DUZB 4BAYA 2QKAA 1L8DA 3ICXA 3OT7A 5IJ9B 3RYIA 3AG3C 3CCQV 4UB8Z 1LR1A 1MNGA 4B3RB 5LHHA 2UXDB 3LSSA 1IBLB 2KQXA 1OJHA 1U96A 3G71V 4U7OA 3JD4A 2LW1A 2N74A 2IU3A 2JGDA 1HNXB 3DTUB 1N36O 1PNMA 2XASA 3K04A 1XHZA 2M7WA 4DR7B 2F4VB 4ZI7A 1SS3A 4P30A 2L6LA 3FAVA 2VQFO 2KB1A 2L35A 2NN4A 4X66O 1PM9A 5BXZA 4JI6B 3CSXA 4FZ0A 3GWKC 4IHJB 5L3EA 1TUBB 1JR9A 4U3FH 3FYEB 3K0DA 4LF8O 1K4CC 3DC6A 4YJ2B 4YJ3A 3SJAC 4AQYB 1P84F 2EZPA 4JI3O 5IYCO 4FPPA 1QBZA 2YSUB 1SQGA 5K1XA 3AG1B 2JVDA 3BA8A 1N32O 2X6CA 5IYDO 4J11A 1JQ0A 3VBBA 4X1KB 1HNZB 2YIBA 3C3SA 5IE9A 1YSCA 1PD3A 1SQFA 3ZCCA 1VF6C 4JV5B 3ASNC 4WBNB 4X65B 3EHBB 2RMKB 4PA9A 3K5NA 4QIWF 3ML0A 3KCYA 2LP7A 1XUQA 3AG3B 1F4MA 1WLEA 1I94O 4QNHB 2FL4A 4U3JA 1M56C 1YJWV 2P4KA 2YEVA 3ZMZA 1I08A 1Y66A 4JI1O 4FFBA 4CZZA 5HFLA 2EX3A 1P4RA 3QO8A 5JJJB 3JAKA 1WP8A 4FIPC 1SQPH 3JD1A 4JTCB 5BY1A 3GVMA 1BSMA 1K73W 4JYBA 4CH5A 5JQGB 3BA9A 2QKCA 4BW9A 4X1YB 4LF9O 2V1DA 4N23A 1NR1A 4JI8B 3A8TA 4MT8A 4B3TO 3QO7A 1GRJA 3CCUV 3FYIB 2A79B 1XEQA 3JAWB 3D36A 3CCLV 3QNEA 3ZHSA 3OTOO 3HPLC 3Q4HB 2HVJC 2BSKB 4DV6B 3OM3B 3JCUZ 3ZHVA 1Y76B 3B8NA 4XDLA 4PDMA 2OTJV 5BR8B 3W7SA 3AG4C 1Q43A 5DN6G 4F4LA 3ZRWB 5LGUA 1AJPA 2WLIA 4MW8A 1AR1B 4LF7O 4G28B 1W0KG 1D2DA 1JCHA 5H9CA 4H44B 4A5UB 3OMAB 4I55A 3ZHQA 3CRCA 2W0XA 3A0RA 4NYKA 3M99B 2OCCC 1HNZO 2IJHA 5BZBA 1RM1C 5H6RA 2DE0X 2H94A 4DYLA 1M56B 3CCSV 4X20B 2EJ7A 1PNLA 2D2CB 2YI8A 1K7DA 3WU2Z 2E3CA 2LGQA 3CRQA 4I5SA 5FL7G 4FM0A 4EB6A 4PV1B 3CXCU 1XILA 3B77A 2DN9A 5EIBD 3RT3C 4FVMA 2KSDA 4LFAB 4LF4O 4B3SB 1AR4A 2GTSA 3CRMA 4I9WA 5LHGA 3K57A 4JI8O 1KU9A 3RWRD 3P30A 2BTQA 4W4KA 2EIKC 2QR4A 4H37A 1GM8A 3GB7C 3RGBA 1H8EG 3OUSA 2AHZA 2Y48A 2RDCA 3ZJZA 2A7WA 2ZXWC 5LP6A 1X4TA 1JVMA 3AG4B 1QNMA 2X0LA 5CBGA 1RSOB 3UKMA 2LW7A 2A06H 4L87A 5DEDA 5LXTA 2Q4PA 2QWRB 3ZBHA 3N2KB 1HDJA 5CBHA 1XOUA 4RAIA 2OCCB 3K79A 4GX5A 5EC1C 4PDRA 1RM1B 4MTGA
chains in the Genus database with same CATH topology
4WFEA 3ABUA 1CP9A 2JEUA 5LHIA 2OTLV 2B1IA 2ITDC 5C93A 4JGSA 2H8PC 1FS0G 1K97A 1QVFU 5CN0A 4MSWC 1QLEC 3E86A 1M1KW 3MD0A 5CA3A 1VQ8V 4MVZA 4TSFG 4ZKIA 2A9HA 3G6EV 1M9NA 2ITCC 5L3FA 3ABLC 5LGTA 1QR8A 3AEIA 1I5YA 2EIJB 3OW2U 2Q6AA 3SPJA 4PDVA 5B1AB 4DXWA 3FB8C 2R9IA 3LUTB 4MVSA 2R9RB 3JD0A 2NNUA 4UUJC 3UM7A 5L3DA 1R3JC 5B1NA 3STZC 3ETGA 4BW5A 3ASOC 3CMEV 4WF9V 1YI2V 4G27B 4MVOA 1Q7YW 4BIZA 4QJFB 1KP3A 2WAMA 1VQMV 2JK5C 3E89A 1M57C 1KQSU 4TT3G 1GM7A 3CCVV 2DWDC 5LBQA 1FXHA 4WFGA 1YHQV 1QLNA 3OGCC 2BOBC 2FTKA 2EIKB 2IJKA 3W7XA 4RUFA 2EINC 5L3CA 2DYRC 1VQ7V 3SYPA 3ZRVA 3CCJV 3CCEV 3WG7B 1K34A 5E1AC 4WCEV 3IGAC 3CC2V 4LC1A 3ZRSA 2WLMA 4GX2A 4JAUA 4MW3A 2XAQA 3MHSC 1GO3F 2ZXWB 3OEEG 4MTOA 3E83A 4PA7A 3VOUA 2F43G 2JJ2G 3MHHC 1OZ0A 3W7UA 4JYCA 1FXKC 4HYOA 1KD1W 3ABMB 4LCUC 1GTOA 2EILC 1LNQA 3GWOA 4RQEA 2OT5A 1R6NA 3SYAA 1KP2A 1OCOC 2IH1C 3ZN1A 1V55B 2DYSB 3LDCA 2DWEC 1EBOA 3T4DA 1VQOV 4JTDB 2ZDIC 2GSMB 4MTXA 1L1FA 2WPDG 2WLJA 1YTFB 3T1CA 2Y69C 2K1EA 2X7RB 1KKDA 3CYOA 2CK3G 1B6QA 5B1BC 3K0GA 1CPYA 1YITV 1R73A 5KA6A 2ZR3A 3AG2C 4P9OA 1QLEB 1OHHG 1R3KC 4J9YB 3B8MA 4MS2A 4MTGA 2LFRA 2X6BA 3G4SV 3ABKC 1AROP 3IC7A 1K33A 5B3SC 1JJ2U 3T4ZA 1SRYA 3ZMUA 4FK5C 2UXXA 3OAAG 1VQNV 2IJIA 3T2MA 2DQ0A 1PKXA 1JPXA 1E79G 5EBMC 4MVRA 1VQLV 4ZBMA 1SZTA 1AJQA 2IU0A 2V7QG 3ETDA 3R65A 1THZA 4Q20A 3JD3A 5GW7A 1EFRG 2XOKG 3ABTA 1PNKA 1SESA 2EJRA 4KUMA 3I56V 5DM6V 2ZQMA 2GHYA 4LBEC 1VQ4V 4N21A 3AG1C 3H01A 4UXNA 2JJ1G 3X2QC 4RQFA 3E8BA 2PI5A 1M57B 3OMIB 1K3EA 3ZMVA 4XDKA 1WPXA 1VQ9V 2WLNA 1FFTB 1DF4A 3DGEA 1VQ6V 5J9PC 3FB6C 1NJIW 1DF5A 3RVZA 1GM9A 2WLHA 3RVYA 1MOFA 2EINB 3WFVA 2D3OW 2DYRB 3JYCA 4OXSA 1NBMG 3OEHG 4TWKA 4PA3A 2HG5C 3F7YC 2JEXA 2JDIG 5CBFA 4BAYA 1YTFD 3SYQA 2P6JA 5IDJA 4JTAB 3BEHA 3TETA 1SETA 1S3JA 3AG3C 4FMTA 3CCQV 4HAMA 4HZ3A 1JOYA 5EBLC 5LHHA 3CCMV 1IXMA 3LSSA 1FXKB 5CMUA 1P7BA 2EILB 4PDLA 3TCUA 3G71V 1Q82W 1S0VA 4U7OA 3JD4A 1HWYA 2DQ3A 1OCOB 2IU3A 4LP8A 3DTUB 3ETEA 3OR6C 1OCCC 1PNMA 2IJJA 2XASA 3K04A 3SYCA 2C2AA 4GCZA 4PA6A 2PI4A 2Y69B 2M7WA 1GK9A 4QPJA 3FKSG 5B1OA 5B1BB 3QO5A 4P30A 1RPRA 2KB1A 3AG2B 3ASNB 1K92A 4MVMA 3ABKB 5B3SB 3RW0A 4UV9A 5L3EA 5LGNA 1NVPB 1MSWD 4GT1A 3FYEB 1FXVA 2HLDG 3K0DA 1KECA 3E2EA 1K4CC 1F51A 4UVAA 4Z1MG 2ZD9A 3IFXA 4DO2A 1NKDA 3PJSK 2EZPA 3LDDA 1S76D 1BHAA 5IYCO 4FPPA 3SYOA 1QBZA 3E8HA 3FB5C 2YSUB 3RBZA 3AG1B 3K3WA 3X2QB 3E35A 2NLJC 3F7VC 5KUMA 1V54C 2HR3A 2WSSG 2WLLB 2X6CA 1R3LC 5IYDO 3HB3B 2JIZG 1JQ0A 3I55V 3VBBA 4PELA 1G4YB 3NXSA 2XAHA 3LSQA 1W2BU 2QTOA 1YSCA 1PD3A 3ZCCA 2Z3YA 3ASNC 1ROPA 4E2LA 3JD2A 1VQKV 1FXKA 1SERA 1F4NA 4J9ZB 3EHBB 4PA9A 2B1GA 4X88A 4WFHA 2EIMC 4QIWF 3ML0A 2LP7A 4X89A 2QKSA 3AG3B 1F4MA 1MABG 1WLEA 2P67A 1GKFA 3SPIA 4KFMA 4QNHB 1GMGA 2BOCC 3F5WC 1M56C 3ZRWA 2XAGA 1YJWV 2YEVA 3CC7V 2ZDIA 1NR7A 3ZMZA 2W6JG 1Y66A 2ZR2A 3BY6A 5HFLA 4CZZA 4MTFA 1P4RA 3QO8A 4QE7A 2UXNA 1NVPD 3K03A 2DW4A 3SJQC 4WFAV 5H6QA 4FIPC 5KA5A 3E8FA 3JD1A 4UVBA 4JTCB 3K9AA 1K73W 4JYBA 1KC8W 1BMFG 4BIUA 1OCCB 2LFSA 1DLBA 4GX0A 2V1DA 4N23A 1NR1A 4EKWA 2P7TC 3JCZA 4MT8A 3QO7A 3OE7G 3K06A 1QR9A 1JX9A 1OCZC 3CCUV 5KUKA 2XNDG 2HJFC 1E1RG 3FYIB 1H8HG 2W0FC 4R8CA 3D3IA 2WWWA 1VQ5V 1F23A 1Y4MA 2A79B 2QEXV 1I5XA 1AJNA 1OCRC 5EK0A 2X6AA 4R50A 1UJWB 3D36A 1K8AW 4CBCA 3CCLV 3QNEA 1N8RW 3HPLC 4YXWG 2HVJC 3OUFA 2QM8A 2XAJA 1M90W 3OM3B 2WLLA 1Q81W 3B8NA 4XDLA 4PDMA 2OTJV 3W7SA 3AG4C 3LDEA 5L3GA 5DN6G 1ORQC 2EBOA 4QPKA 4WFFA 3ZRWB 4F4LA 2YEVB 5LGUA 1AJPA 2WLIA 4MW8A 1V54B 1AR1B 4G28B 1W0KG 4FJCC 4R6ZA 2Q67A 2P90A 1R6KA 1S5HC 1XL6A 1JCHA 5H9CA 3ZIAG 3W7TA 1E1QG 3OMAB 1ZWIC 5EC2C 3LNMB 3OR7C 5EBWC 3A0RA 1RPOA 5IY5C 2QA4V 1J95A 1NH2B 3M99B 3SPHA 2OCCC 1COWG 3CMAV 2IJHA 5BZBA 1RM1C 5H6RA 4ASUG 3ZMSA 2QM7A 4GX1A 2EIMB 1K5SA 2Z5UA 2H94A 4JPRA 1H38A 2AHYA 1Q86W 1M56B 3CCSV 1G8MA 4RO2A 2EZOA 1TUEB 4MVUA 4P2ZA 1YJ9V 1PNLA 1K4DC 5IYBO 5L3BA 4JF3A 3OFNG 1NQTA 4H33A 4R7CA 1K7DA 1BHBA 4QE9A 1R3IC 4I5SA 2EIJC 3P32A 3SPCA 4KP4A 5FL7G 2MK3A 2IW5A 3CPWU 3E8GA 5B1AC 1MG1A 4G2KA 4XBFA 3CXCU 2XAFA 3B77A 4MVQA 1QVGU 1VQPV 3OMNB 2WLKA 3EFFK 4WFBV 2WLIB 1AI5A 1OCZB 5LHGA 4I9WA 4PA4A 1YIJV 1AI6A 4RUEA 1PL0A 2ATKC 3P30A 1OCRB 4UVCA 5HFMA 2EIKC 1EZJA 1AI7A 2QE7G 4H37A 1GM8A 3GB7C 3TK1A 1K5QA 1QCEA 1ENVA 1NH2D 1H8EG 3CCRV 3OUSA 3WG7C 3K08A 2AHZA 3ZRXA 1AI4A 2Y48A 1K9MW 2HFEC 2HVKC 3ZJZA 2W6IG 3W7WA 1YJNV 2ZXWC 4UV8A 1JVMA 2B5UA 3AG4B 1S77D 3ABLB 4P9PA 1BL8A 1CEZA 2X0LA 2A0LA 5CBGA 3SPGA 3ZN0A 3UKMA 1S72V 1W0JG 2IH3C 3ABMC 4JAVA 4L87A 1XL4A 3CD6V 2Q69A 4JASA 3STLC 3CP1A 2HKOA 3ZMTA 4X8AA 3FB7C 3ASOB 1V55C 2DYSC 3KG2A 5IY5B 5CBHA 4XDJA 4RAIA 4U7NA 2OCCB 3CC4V 3K79A 4GX5A 4PDRA 5EC1C 1RM1B 1H2GA 1DTOA 2Q68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFX A;  4WFE A;  5B3S C;  3PJS K;  3T4Z A;  1S5H C;  1XL6 A;  3LDD A;  2ITD C;  1ZWI C;  3SYO A;  5EC2 C;  3LNM B;  3OR7 C;  2H8P C;  3E8H A;  3FB5 C;  3T2M A;  3RBZ A;  5EBW C;  5IY5 C;  4MSW C;  2NLJ C;  1QLE C;  3E86 A;  4MVR A;  5EBM C;  1J95 A;  4ZBM A;  3F7V C;  5KUM A;  3SPH A;  2OCC C;  1V54 C;  5BZB A;  2WLL B;  2X6C A;  3R65 A;  1R3L C;  4MVZ A;  2A9H A;  4GX1 A;  2ITC C;  1G4Y B;  3ABL C;  4LBE C;  2QTO A;  3AG1 C;  3X2Q C;  2AHY A;  3ASN C;  4RO2 A;  2Q6A A;  3SPJ A;  3E8B A;  4PDV A;  4MVU A;  4P2Z A;  4DXW A;  4J9Z B;  1K4D C;  3FB8 C;  3LUT B;  4PA9 A;  4MVS A;  2R9R B;  4UUJ C;  4XDK A;  4X88 A;  3UM7 A;  4WFH A;  2EIM C;  1R3J C;  2WLN A;  4H33 A;  4R7C A;  3STZ C;  4X89 A;  4BW5 A;  2QKS A;  3ASO C;  5J9P C;  4G27 B;  3FB6 C;  4MVO A;  4QE9 A;  3SPI A;  4KFM A;  4QNH B;  3RVZ A;  2BOC C;  1R3I C;  3F5W C;  2WLH A;  2EIJ C;  3RVY A;  1M56 C;  3SPC A;  2YEV A;  3JYC A;  4OXS A;  2JK5 C;  3E89 A;  3E8G A;  1M57 C;  4G28 B;  5B1A C;  4TWK A;  4PA3 A;  2HG5 C;  3F7Y C;  5CBF A;  2DWD C;  4MVQ A;  3SYQ A;  4MTF A;  4WFG A;  4JTA B;  3BEH A;  4QE7 A;  3OGC C;  2WLK A;  2BOB C;  3TET A;  3AG3 C;  3K03 A;  3SJQ C;  3EFF K;  3E8F A;  4HZ3 A;  2WLI B;  4RUF A;  4JTC B;  2EIN C;  2DYR C;  4I9W A;  4PA4 A;  3SYP A;  5EBL C;  4GX0 A;  5E1A C;  3IGA C;  4RUE A;  2ATK C;  3ZRS A;  2WLM A;  1P7B A;  4GX2 A;  4MW3 A;  4PDL A;  4EKW A;  2P7T C;  3TCU A;  4MTO A;  2EIK C;  3E83 A;  3K06 A;  4H37 A;  4PA7 A;  3GB7 C;  3VOU A;  4LP8 A;  1OCZ C;  5KUK A;  2HJF C;  3OR6 C;  1OCC C;  2W0F C;  3OUS A;  3WG7 C;  4HYO A;  4R8C A;  3K08 A;  3K04 A;  3SYC A;  2AHZ A;  4LCU C;  4PA6 A;  2A79 B;  2HFE C;  2HVK C;  3ZJZ A;  2EIL C;  1OCR C;  1LNQ A;  5EK0 A;  2ZXW C;  2X6A A;  4R50 A;  1JVM A;  3SYA A;  4P30 A;  4CBC A;  1OCO C;  4P9P A;  2IH1 C;  1BL8 A;  3HPL C;  2HVJ C;  2KB1 A;  2A0L A;  3LDC A;  2DWE C;  3OUF A;  3SPG A;  3T4D A;  4JTD B;  5CBG A;  3UKM A;  2IH3 C;  2WLL A;  2WLJ A;  3ABM C;  4MVM A;  3T1C A;  2Y69 C;  1XL4 A;  2K1E A;  2Q69 A;  3STL C;  4XDL A;  1KKD A;  4PDM A;  3RW0 A;  4X8A A;  5B1B C;  3AG4 C;  3FB7 C;  3K0G A;  3LDE A;  1ORQ C;  4F4L A;  4WFF A;  1V55 C;  2DYS C;  3K0D A;  3AG2 C;  3KG2 A;  4P9O A;  2WLI A;  5CBH A;  1R3K C;  4XDJ A;  4J9Y B;  4RAI A;  1K4C C;  4MW8 A;  4MS2 A;  4MTG A;  4GX5 A;  4PDR A;  5EC1 C;  2X6B A;  2ZD9 A;  3ABK C;  4R6Z A;  2Q67 A;  2Q68 A; 
#chains in the Genus database with same CATH topology
 1IBK O;  2OTL V;  3SDL A;  4CC5 A;  2ZT9 B;  2ARH A;  4JGS A;  1DK1 A;  1BQZ A;  1QVF U;  4MSW C;  1M1K W;  1XDC A;  3A2F A;  2OWO A;  1XRE A;  4MVZ A;  4TSF G;  2FML A;  2A9H A;  3G6E V;  1IVS A;  4X9Q A;  4GZR B;  2UUB O;  1QR8 A;  5BMV A;  4LR3 A;  5LYJ A;  2Q6A A;  3ZS8 C;  3I5D A;  4DXW A;  1D5A A;  2NNU A;  1TVK B;  5B1N A;  3H9V A;  4WF9 V;  1YI2 V;  1Q7Y W;  4JZ2 A;  1US6 A;  2ZKO A;  2WAM A;  4DV5 B;  2ILM A;  4X62 B;  4WFG A;  1QLN A;  3KCX A;  5LOV A;  1SF9 A;  2EIK B;  1H2K A;  4J7Z A;  3W7X A;  3CCJ V;  2YDE A;  1K34 A;  3IGA C;  1M5I A;  4PD4 F;  2DJV A;  3ZRS A;  2WLM A;  4DV0 O;  3MHS C;  2ZXW B;  3MHH C;  3HKC B;  4L8J A;  4DV7 B;  2ZIO A;  1FXK C;  2R9A A;  1WB7 A;  4LCU C;  1KBH A;  2QDO A;  1LNQ A;  5H5N A;  4O4H B;  1N4C A;  4DV1 B;  1OCO C;  1M4U A;  2IH1 C;  1BE3 H;  3H1L H;  4DR2 O;  2WPD G;  4FLU A;  2WLJ A;  3MDS A;  1D5N A;  1YTF B;  2CTQ A;  2Y69 C;  3CYO A;  2UXC B;  3K0G A;  1R73 A;  1HNW B;  2ZR3 A;  2Z0A A;  3AG2 C;  5KAI Z;  1JFF B;  2F66 C;  4MS2 A;  2ZNI A;  3P3P A;  3IC7 A;  3G80 A;  1SRY A;  4CH3 A;  3ZMU A;  4B08 A;  2LJ2 A;  3OAA G;  1Q6I A;  2DQ0 A;  2A3Q A;  5EBM C;  2Q73 A;  1AJQ A;  1SQQ H;  2IU0 A;  3R65 A;  4ICG A;  3HKB B;  1EFR G;  2XOK G;  3ABT A;  4BR6 A;  4DK0 A;  2E5L B;  3BVO A;  3T1Y B;  4RQF A;  2PTM A;  1ZUQ A;  2ZM6 B;  5KHK A;  3OMI B;  1GN6 A;  1JA8 A;  2QWP B;  2RCV A;  1OV9 A;  3C3T A;  2WLN A;  1XNR B;  3DGE A;  1YF2 A;  3FB6 C;  1LUW A;  1MOF A;  2RNB A;  1NBM G;  3UT5 A;  4TWK A;  4PA3 A;  4OPA A;  2JEX A;  2JDI G;  4NXM B;  5IDJ A;  4J42 A;  3JAS A;  1S3J A;  3HR0 A;  3ZHR A;  4EFB A;  4DR3 B;  4HAM A;  2Q7H A;  4KHP B;  1IXM A;  1FXK B;  1P7B A;  4PDL A;  1N33 B;  3TCU A;  2XHB A;  4NR1 A;  2DQ3 A;  1OCO B;  5EYP A;  4GCZ A;  3FX7 A;  2Y69 B;  2ETN A;  1S5J A;  3UO2 A;  3SR2 C;  4JI5 B;  5B1O A;  3THO A;  4IT5 A;  4O2B B;  1J5E O;  3AG2 B;  4OPH A;  1IUR A;  1WN7 A;  3R66 A;  1HR0 O;  4MVM A;  3KKY A;  4LF5 B;  4FLY A;  3K5M A;  4O4J B;  1VEW A;  1ZL8 B;  1FXV A;  3E2E A;  4CH6 A;  1ZAU A;  4EFE A;  4DO2 A;  3TXS A;  5EIB C;  3LDD A;  1BHA A;  2CGN A;  3SYO A;  1O9H A;  2YIB D;  3RBZ A;  5D5Q A;  4FLZ A;  2HR3 A;  2WLL B;  3ZHU A;  3I55 V;  1G4Y B;  4D6T H;  2XAH A;  3LSQ A;  2QTO A;  2Z3Y A;  4DUY O;  3Q4H A;  4E2L A;  3JD2 A;  1VQK V;  2BSK A;  1F4N A;  2B1G A;  3QVN A;  4WFH A;  1Y76 A;  1HP8 A;  4X89 A;  5H2F Z;  1GKF A;  3F5T A;  4KFM A;  3ZRW A;  5J2T B;  3CC7 V;  4DV3 B;  3VQV A;  2W6J G;  3LSU A;  3G67 A;  3B40 A;  1BZK A;  4HNA A;  1XMO O;  1NS1 A;  5KX5 B;  2UXN A;  3CS5 A;  2DW4 A;  4DR5 B;  5H6Q A;  1YVW A;  3CRA A;  3E8F A;  4TV8 A;  3DC5 A;  1W59 A;  1Y74 B;  2UUA O;  5KMG B;  2P7T C;  3JCZ A;  5K1P A;  3TXQ A;  4CS4 A;  2FKX A;  2CTR A;  2AXT Z;  2W0F C;  4R8C A;  1VQ5 V;  1EZV H;  2ODM A;  4DV2 B;  4CS3 A;  4DR4 O;  5EK0 A;  3JAL B;  2X6A A;  3JSN A;  4X1I A;  5LL6 Y;  1K8A W;  4CBC A;  4LF5 O;  2CGO A;  4YXW G;  2XAJ A;  2EUL A;  1M90 W;  1KKC A;  1IZ3 A;  4F6R B;  2PYJ A;  2OIG A;  4WFF A;  1L0N H;  4NXN O;  2UU9 O;  4FJC C;  4R6Z A;  3K9S A;  2P90 A;  3OGI B;  1E1Q G;  3CEI A;  5EC2 C;  3LNM B;  3OR7 C;  3SJB C;  1BCC H;  4LH6 A;  4LFB O;  3O9O A;  2O57 A;  1RPO A;  3DXR A;  4J7J A;  1J95 A;  3WB0 A;  1UPG A;  3SPH A;  1COW G;  3CMA V;  2CH7 A;  3B2E E;  4IL6 Z;  4X64 O;  4NKG B;  1Z5W A;  2Y0I A;  1H38 A;  2AHY A;  1G8M A;  4RO2 A;  2EZO A;  4MVU A;  1YDX A;  5FNV B;  1K4D C;  4JF3 A;  4ZOL B;  3OFN G;  4GKJ B;  1IX9 A;  4NB5 A;  1ZX3 A;  3N2G B;  4JI2 O;  3E8G A;  3U0Z A;  5JH7 A;  1FJG B;  2GV9 A;  1N34 O;  2VRZ A;  2XAF A;  4DK1 A;  5C8Y B;  2F23 A;  5CA1 B;  3CJH B;  2DMX A;  1F7Y A;  2BCC H;  2JS3 A;  2F95 B;  1AI5 A;  4O2A B;  1NU1 H;  4B3M O;  5ITZ A;  4RUE A;  1PL0 A;  2VQE B;  2ATK C;  4IYH A;  4CC6 A;  2ZE6 A;  4DUZ O;  4FZ1 A;  1VIB A;  4H13 B;  3CCR V;  3WG7 C;  4B3R O;  1AI4 A;  3W7W A;  2UXD O;  1IBL O;  1TVK A;  4B7K A;  2CUG A;  3ABL B;  4P9P A;  1MZF A;  1CEZ A;  3CHX A;  1BS3 A;  3SPG A;  1W0J G;  3ABM C;  4TUY B;  1HNX O;  3KZI Z;  2AW9 A;  1XL4 A;  2KG7 A;  3RYF B;  5LA6 A;  4DR7 O;  2F4V O;  2DYS C;  3KG2 A;  4XDJ A;  2GUZ B;  3CC4 V;  2Q0O C;  3IJ4 A;  3QG5 A;  1AVM A;  1RP3 B;  1DTO A;  2Q68 A;  3VQX A;  1Q6U A;  2JEU A;  3ABU A;  4DRX A;  2IBZ H;  5LHI A;  4JAA A;  2B1I A;  2ITD C;  4I0X A;  4JI6 O;  5C93 A;  2H8P C;  1K97 A;  5CN0 A;  5CB4 A;  4I4T B;  4FLT A;  3MD0 A;  4LH7 A;  4O4I B;  1M9N A;  2ITC C;  5L3F A;  4AQY O;  3H1K H;  3UO3 A;  4QGP A;  4YIP A;  1I5Y A;  4O4L A;  2DOS A;  3OW2 U;  4NTY A;  3JD0 A;  4UUJ C;  3UM7 A;  3ETG A;  4BW5 A;  4G27 B;  3L75 H;  4MVO A;  3D3Q A;  4H0L B;  3DSQ A;  1VQM V;  3E89 A;  3CCV V;  3MAQ A;  4JV5 O;  2DWD C;  4X65 O;  4TV9 B;  1YHQ V;  3ZHT A;  2BOB C;  5KAF Z;  4RUF A;  3O65 A;  3E22 B;  3SYP A;  2QM4 A;  2YIC A;  1VQ7 V;  3N27 A;  2OIE A;  3CCE V;  3WG7 B;  4LC1 A;  1FFX B;  4GLX A;  1GO3 F;  4TQD A;  3T1H B;  1B3Q A;  1SC5 B;  2F43 G;  3AK1 A;  4CH4 A;  1EM1 A;  4HYO A;  1KD1 W;  3ABM B;  1BT8 A;  2EIL C;  1R6T A;  2YXH A;  1VF5 B;  3L9D A;  2DYS B;  2DWE C;  3IC9 A;  2GSM B;  1L1F A;  3T1C A;  3JAM N;  1B6Q A;  4UCS A;  2R72 A;  5GTI Z;  2AZ0 A;  5KHI A;  1Q6H A;  4JI7 B;  2JGD B;  2Q5Z A;  4J9Y B;  4PHZ A;  3CX5 F;  2YS8 A;  5B3S C;  4DV6 O;  4ZI7 B;  2UUC B;  1VQN V;  3T2M A;  1PKX A;  3FAV B;  5BR8 O;  1VQL V;  4ZBM A;  1SZT A;  3B09 A;  2CAZ C;  1THZ A;  3JD3 A;  1LUV A;  4K35 A;  4KUM A;  1SES A;  3I56 V;  5DM6 V;  1N0N A;  3D36 C;  2UXB B;  4N21 A;  3K5O A;  2PUS A;  3H01 A;  4UXN A;  3X2Q C;  4K8Z A;  5TIS Z;  1WPB A;  3E8B A;  3ZMV A;  1SKV A;  4XDK A;  4YJ3 B;  4PI0 A;  1WPX A;  4AHC A;  1NTK H;  5J9P C;  1NJI W;  2ADP A;  3JYC A;  5A9G A;  3ZED A;  2P6J A;  4K3A A;  5LMU B;  1IBM B;  3BEH A;  3QTC A;  3TET A;  1SET A;  4LFC B;  4HZ3 A;  3H1J H;  3CCM V;  1PPJ H;  5JVD B;  3HKE A;  4GKK B;  2V4D A;  2EIL B;  2CTW A;  1CXZ B;  1Q82 W;  1S0V A;  3J81 N;  1HWY A;  4DR1 B;  4LP8 A;  4U3J B;  2QWO B;  4LFA O;  3RYC A;  3SYC A;  2C2A A;  4B3S O;  3FFQ A;  1QU7 A;  1GK9 A;  1YCI A;  5FLX N;  3WB2 A;  3BPZ A;  3QO5 A;  3JAK B;  1RPR A;  4J41 A;  1YZB A;  2HHH B;  5IWA B;  4JI0 B;  1K92 A;  1XQ8 A;  5FPO A;  5B3S B;  3RW0 A;  4OGQ B;  5LGN A;  1I7F A;  1G6U A;  2JGU A;  1KEC A;  1F51 A;  3CWB H;  1WNS A;  1XNQ B;  1H2M A;  3IFX A;  4IIJ B;  4IGG A;  1NKD A;  3JAT A;  4LNU A;  3E8H A;  3FB5 C;  2FB5 A;  3X2Q B;  5IJ0 B;  4YHH B;  2NLJ C;  5FPR A;  4C7U A;  3JSL A;  1V54 C;  4BWA A;  2OCH A;  1KUQ A;  5IJ9 A;  2JIZ G;  3JAL A;  1DGS A;  1W2B U;  3H1H H;  1XMQ B;  4K8X A;  1SER A;  4TOI A;  5J2U B;  1AIL A;  4X88 A;  4B7E A;  4UCU A;  4ZIB A;  4K0K B;  1MAB G;  2P67 A;  3K58 A;  3SPI A;  2RN9 A;  4UB6 Z;  2ZDI A;  4YY3 B;  2ZIM A;  3BY6 A;  4Q6G A;  4QE7 A;  4JYA B;  3L72 H;  3BFR A;  1NVP D;  4WFA V;  5KA5 A;  1YXB A;  1PV0 A;  4UVB A;  3K9A A;  3K5L A;  1KC8 W;  5F2V O;  4DV5 O;  2F1M A;  4IHJ A;  4X62 O;  1EN5 A;  1TUB A;  1EN4 A;  2P06 A;  1QR9 A;  1JX9 A;  3CRR A;  3HKD B;  1OCZ C;  2HJF C;  2PZS A;  1E1R G;  4EB6 B;  2WWW A;  4YJ2 A;  4LF6 B;  1I5X A;  4OX9 B;  1OCR C;  1WP7 A;  2BTO A;  5KHJ A;  1UJW B;  1JMK C;  2YXY A;  1N8R W;  3A0B Z;  3OUF A;  1QHT A;  3L71 H;  4Z1V A;  4DV7 O;  5C8Y A;  2XUM A;  2BTQ B;  4X1K A;  4DV4 B;  2Q9L A;  2EBO A;  4WBN A;  4DV1 O;  4DR6 B;  1V54 B;  1Z5V A;  2YUA A;  2Q67 A;  1S5H C;  4J10 A;  3ZIA G;  5DEC A;  5EBW C;  2UXC O;  5IY5 C;  4DW1 A;  1HNW O;  4AIL C;  3M7M X;  3ZMS A;  2QM7 A;  4GX1 A;  2LQT A;  2Z5U A;  1PP9 H;  3BHP A;  4JPR A;  2VWK A;  4E4E A;  1WAZ A;  1Q86 W;  2Y4T A;  5JQG A;  4P2Z A;  4X1Y A;  3APO A;  4TUY A;  4R7C A;  1N0J A;  4BIO A;  3CB2 A;  1O9G A;  3RYF A;  2E5L O;  3SPC A;  2QGN A;  2MK3 A;  2IW5 A;  3T1Y O;  3CPW U;  5B1A C;  1NZ6 A;  1FYJ A;  1MG1 A;  4G2K A;  4XBF A;  2GUZ A;  4MVQ A;  2ZM6 O;  1VQP V;  4D7S A;  2P22 C;  3JAW A;  1L0L H;  5B66 Z;  1N36 B;  1XNR O;  4WFB V;  1KYO F;  5BMV B;  1OCZ B;  1P7G A;  4I4T A;  1YIJ V;  1AI6 A;  4LWS B;  4O4I A;  1OCR B;  1Z2G A;  2VQF B;  4NXM O;  3CE2 A;  4X66 B;  1EZJ A;  1AB3 A;  2RQ6 A;  3TK1 A;  1ENV A;  5IYZ B;  1NH2 D;  4DR3 O;  4KL1 A;  4KHP O;  5IT9 N;  3ZRX A;  2HFE C;  2HVK C;  2W6I G;  1YJN V;  1URF A;  2B5U A;  3VQW A;  5LOV B;  4LF8 B;  5JWP A;  1N33 O;  1S77 D;  1VF6 A;  3ZN0 A;  2QWQ B;  4JI3 B;  4JAV A;  1I0H A;  3STL C;  4UCO A;  2GTA A;  2HKO A;  1TGO A;  4X8A A;  3ZMT A;  4FM2 A;  3RYH B;  3ASO B;  3BRC A;  4JI5 O;  1N32 B;  5IY5 B;  4X20 A;  4W4L A;  4U7N A;  3E22 A;  4NTX A;  4FM1 A;  1H2G A;  4WFE A;  1CP9 A;  4F6E A;  1VP7 A;  1TA8 A;  3E86 A;  4I50 B;  4UCT A;  4FFK A;  4UCV A;  5CA3 A;  5EZY B;  2YIA A;  3S3W A;  2Q8V A;  4ZHQ B;  1I94 B;  2ZIN A;  3ABL C;  5LGT A;  1B06 A;  3AEI A;  2XTA A;  4JI1 B;  1UFI A;  4PDV A;  2P4V A;  5B1A B;  3FB8 C;  1XHX A;  3LUT B;  2PY5 A;  2R9R B;  5L3D A;  1R3J C;  3BAB A;  2OYQ A;  1VAR A;  3A0H Z;  4JI4 B;  4QJF B;  4LF9 B;  2JK5 C;  1KQS U;  1GM7 A;  4KXR A;  5LBQ A;  1H2S B;  4B3T B;  1WA8 B;  2VWJ A;  5JCO C;  2IJK A;  2ZE7 A;  3TGU H;  2DYR C;  1RSO A;  5D5P A;  4YIO A;  4DV3 O;  4JAU A;  1G1X B;  2XAQ A;  3OTO B;  4PA7 A;  3N2K A;  3VOU A;  2JJ2 G;  2H3O A;  4DR5 O;  2Y4U A;  3D8C A;  3UT5 B;  3JAS B;  3LNN A;  1R6N A;  3SYA A;  4TQF A;  3ZN1 A;  4LF7 B;  1EBO A;  2JRI A;  3T4D A;  1VQO V;  2Q7G A;  4MTX A;  1B04 A;  2HJD A;  2K1E A;  5GON B;  2X7R B;  1KKD A;  5B1B C;  1VF7 A;  1YIT V;  4DV2 O;  5KA6 A;  3G6B A;  1OHH G;  1R3K C;  3B8M A;  1BGY H;  5EYP B;  5E79 Z;  2LFR A;  2CTP A;  2LO1 A;  3ABK C;  4CS2 A;  1K33 A;  5JVD A;  3T4Z A;  2XT9 A;  2F93 B;  2UXX A;  2IJI A;  1FKA O;  1JPX A;  4FLW A;  1E79 G;  2V7Q G;  3ETD A;  4Q20 A;  3U10 A;  2QSA A;  1H2N A;  3JAR B;  1PNK A;  2EJR A;  2ZQM A;  2JJ1 G;  1P49 A;  2Q7E A;  2PI5 A;  5CA0 B;  5KLV H;  1K3E A;  1FD9 A;  1A32 A;  4JI4 O;  1VQ9 V;  2YC0 A;  1QQC A;  1DF4 A;  4LF4 B;  2WA4 A;  1SA0 B;  1VQ6 V;  1DF5 A;  1GM9 A;  3HKC A;  3RVY A;  2DYR B;  1XI1 A;  3L73 H;  3OEH G;  1U97 A;  3F7Y C;  2ZE5 A;  5CBF A;  3SYQ A;  2LGW A;  4JTA B;  3UQ8 A;  4IIJ A;  4FMT A;  4O4H A;  4GKJ O;  5GTH Z;  5IJ0 A;  4I9Q A;  1JOY A;  5EBL C;  2ZNJ A;  3AK2 A;  5CMU A;  1GN2 A;  1FJG O;  1KMI Z;  3H1I H;  2E74 B;  5KHG A;  1JFF A;  3ETE A;  1RFY A;  3OR6 C;  1Q5O A;  1OCC C;  2IJJ A;  2PI4 A;  4PA6 A;  4HNA B;  5J2U A;  4QPJ A;  4IYI A;  3FKS G;  4PI2 A;  5B1B B;  2VQE O;  5LMN B;  4Z2W A;  1GAX A;  4TV8 B;  3ASN B;  1IBK B;  3HKB A;  3ABK B;  3PN1 A;  3FD9 A;  4UV9 A;  4FLX A;  1NVP B;  1MSW D;  2Y0P A;  4GT1 A;  3NR7 A;  1MA1 A;  2HLD G;  2VS0 A;  4UVA A;  1AP6 A;  2ZD9 A;  4Z1M G;  4HBN A;  3RYI B;  3PJS K;  2UUB B;  1S76 D;  5JJN B;  2IM9 A;  2M6Y A;  4X1I B;  1SZX A;  3K3W A;  1M93 A;  3E35 A;  2CDY A;  3HKD A;  3F7V C;  5KUM A;  4UCR A;  2WSS G;  1R3L C;  2AGA A;  3OTF A;  3HB3 B;  4PEL A;  3NXS A;  2WA3 A;  1Y6X A;  1ROP A;  1FXK A;  4J9Z B;  1XBL A;  2EIM C;  2QKS A;  3BCC H;  1GMG A;  2BOC C;  3F5W C;  1SQV H;  3DXR B;  2XAG A;  4DV0 B;  1NR7 A;  1X59 A;  2ZR2 A;  2CH7 B;  4MTF A;  3VQY A;  4DW0 A;  3K03 A;  3SJQ C;  4O2B A;  1V9P A;  1BMF G;  4BIU A;  1OCC B;  2LFS A;  1DLB A;  4GX0 A;  3U11 A;  4EKW A;  4O4J A;  3OE7 G;  3K06 A;  4DR2 B;  1ZL8 A;  5KUK A;  2XND G;  1PL4 A;  5LMN O;  1H8H G;  3D3I A;  5JH7 B;  1F23 A;  1Y4M A;  2QEX V;  2FYU H;  1AJN A;  4R50 A;  2KKW A;  2G38 A;  3RN4 A;  3C90 A;  2YID A;  2QM8 A;  3T1H O;  3WB1 A;  1GN3 A;  2WLL A;  5ITZ B;  1Q81 W;  3UCS C;  5JJE B;  1IDS A;  3LDE A;  5L3G A;  1TAE A;  1ORQ C;  4QPK A;  2YEV B;  5B5E Z;  1H2L A;  4FFB B;  2B9Z A;  1R6K A;  1Q90 D;  4LWS A;  1XL6 A;  2CE4 A;  3W7T A;  1FAF A;  1ZWI C;  2QA4 V;  1FPO A;  5J2T A;  3S3X A;  1ZTE A;  4JI7 O;  1NH2 B;  5IYZ A;  1MSD A;  4ASU G;  3SJC C;  4PJ0 Z;  1GH6 A;  5KX5 A;  5KHH A;  2EIM B;  1K5S A;  2JS5 A;  2KG7 B;  5LA6 B;  1Y74 A;  2K9P A;  2UUC O;  1TUE B;  1YJ9 V;  1MMM A;  2QWN B;  5IYB O;  5L3B A;  1S5L Z;  1NQT A;  4H33 A;  1NTZ H;  4DRX B;  5KMG A;  1BHB A;  4I0X B;  4QE9 A;  3RYH A;  1R3I C;  4EEQ A;  2EIJ C;  2BE3 A;  3P32 A;  5CB4 B;  4KP4 A;  2UXB O;  1R1B A;  2PF4 E;  3ZX6 A;  1QVG U;  3APQ A;  5LP6 C;  2AZ2 A;  1IXB A;  3OMN B;  2WLK A;  2PYL A;  1ZLZ A;  3EFF K;  1SQB H;  1GN4 A;  2NR5 A;  2Q0A A;  2WLI B;  1BQ0 A;  4O4L B;  4PA4 A;  4I50 A;  1Y67 A;  5EZY A;  1SQX H;  4GYC B;  1J5E B;  4UVC A;  4ZHQ A;  4I55 B;  5HFM A;  4NVP A;  5LMU O;  4F6R A;  1AI7 A;  1IBM O;  2QE7 G;  5AG2 A;  1HR0 B;  1K5Q A;  1QCE A;  4LFC O;  2ZE8 A;  3K08 A;  3AK3 A;  1K9M W;  4UFZ A;  3J80 N;  3B4S A;  4UV8 A;  4GKK O;  3OD4 A;  3EXA A;  1BL8 A;  2A0L A;  2QTS A;  1S72 V;  2IH3 C;  4DR1 O;  3QF7 A;  1NT2 B;  3CD6 V;  2Q69 A;  4JAS A;  2ZCE A;  3CP1 A;  1WA8 A;  1WJZ A;  3FB7 C;  4J7K A;  3M8A A;  4AI8 A;  1V55 C;  5FNV A;  4ZOL A;  2HHH O;  1KB9 F;  2YI9 A;  2HP8 A;  5IWA O;  4JI0 O;  4DUY B;  1FS0 G;  3L70 H;  3SGI A;  3N2G A;  1QLE C;  4NTW A;  1VQ8 V;  5CA1 A;  4ZKI A;  3CJH A;  4I7Z B;  2N05 A;  1XNQ O;  1AP5 A;  3ETQ A;  2E75 B;  2EIJ B;  3SPJ A;  1XMO B;  4O2A A;  3K59 A;  2YXL A;  4YHH O;  2P5O A;  2R9I A;  4MVS A;  2ADQ B;  5LP6 B;  3STZ C;  5GON A;  3ASO C;  3CME V;  2UUA B;  4BIZ A;  1KP3 A;  1M57 C;  2GDS A;  1XMQ O;  4D7T A;  4TT3 G;  1AR5 A;  1FXH A;  3OGC C;  5LXT B;  2FTK A;  1Q8I A;  2EIN C;  5L3C A;  4K0K O;  3ZRV A;  2RJZ A;  2HEP A;  4DR4 B;  5E1A C;  4WCE V;  3CC2 V;  4YY3 O;  4GX2 A;  4MW3 A;  1NI8 A;  1ZSP A;  1YEW A;  3OEE G;  3JAR A;  4MTO A;  3EVK A;  3E83 A;  4JYA O;  1VMG A;  1OZ0 A;  3W7U A;  3J7A U;  3L74 H;  4JYC A;  2N04 A;  1NTM H;  5CA0 A;  1GTO A;  4RWU A;  1HW7 A;  3GWO A;  1MZE A;  4RQE A;  2OT5 A;  1WB8 A;  1KP2 A;  1SA0 A;  4NXN B;  5JCO A;  2UU9 B;  5LYJ B;  1V55 B;  3LDC A;  4JTD B;  2QJ1 A;  2ZDI C;  3IAY A;  3HKE B;  4LFB B;  2CK3 G;  3P3N A;  4LF6 O;  1CPY A;  4J80 A;  4OX9 O;  3TJT A;  4JZG A;  4GUN A;  2GBO A;  3CXH F;  4P9O A;  1QLE B;  1T5E A;  4X64 B;  3RYC B;  2X6B A;  3G4S V;  1ARO P;  1JJ2 U;  4JYY A;  4FK5 C;  4DV4 O;  1Q3E A;  4MVR A;  4TV9 A;  5GW7 A;  4DR6 O;  4ABM A;  2R70 A;  1JJO A;  2GHY A;  4LBE C;  4JI2 B;  1VQ4 V;  3AG1 C;  3BAA A;  1N34 B;  2MW2 B;  3AG7 A;  1M57 B;  1FFX A;  1FFT B;  3JAT B;  4FLV A;  2PGG A;  4LNU B;  3RVZ A;  2D3O W;  2WLH A;  1EN6 A;  3RFR A;  2EIN B;  3WFV A;  4B3M B;  5A2Q N;  4OXS A;  2E76 B;  1YTF D;  2HG5 C;  4DUZ B;  4BAY A;  2QKA A;  1L8D A;  3ICX A;  3OT7 A;  5IJ9 B;  3RYI A;  3AG3 C;  3CCQ V;  4UB8 Z;  1LR1 A;  1MNG A;  4B3R B;  5LHH A;  2UXD B;  3LSS A;  1IBL B;  2KQX A;  1OJH A;  1U96 A;  3G71 V;  4U7O A;  3JD4 A;  2LW1 A;  2N74 A;  2IU3 A;  2JGD A;  1HNX B;  3DTU B;  1N36 O;  1PNM A;  2XAS A;  3K04 A;  1XHZ A;  2M7W A;  4DR7 B;  2F4V B;  4ZI7 A;  1SS3 A;  4P30 A;  2L6L A;  3FAV A;  2VQF O;  2KB1 A;  2L35 A;  2NN4 A;  4X66 O;  1PM9 A;  5BXZ A;  4JI6 B;  3CSX A;  4FZ0 A;  3GWK C;  4IHJ B;  5L3E A;  1TUB B;  1JR9 A;  4U3F H;  3FYE B;  3K0D A;  4LF8 O;  1K4C C;  3DC6 A;  4YJ2 B;  4YJ3 A;  3SJA C;  4AQY B;  1P84 F;  2EZP A;  4JI3 O;  5IYC O;  4FPP A;  1QBZ A;  2YSU B;  1SQG A;  5K1X A;  3AG1 B;  2JVD A;  3BA8 A;  1N32 O;  2X6C A;  5IYD O;  4J11 A;  1JQ0 A;  3VBB A;  4X1K B;  1HNZ B;  2YIB A;  3C3S A;  5IE9 A;  1YSC A;  1PD3 A;  1SQF A;  3ZCC A;  1VF6 C;  4JV5 B;  3ASN C;  4WBN B;  4X65 B;  3EHB B;  2RMK B;  4PA9 A;  3K5N A;  4QIW F;  3ML0 A;  3KCY A;  2LP7 A;  1XUQ A;  3AG3 B;  1F4M A;  1WLE A;  1I94 O;  4QNH B;  2FL4 A;  4U3J A;  1M56 C;  1YJW V;  2P4K A;  2YEV A;  3ZMZ A;  1I08 A;  1Y66 A;  4JI1 O;  4FFB A;  4CZZ A;  5HFL A;  2EX3 A;  1P4R A;  3QO8 A;  5JJJ B;  3JAK A;  1WP8 A;  4FIP C;  1SQP H;  3JD1 A;  4JTC B;  5BY1 A;  3GVM A;  1BSM A;  1K73 W;  4JYB A;  4CH5 A;  5JQG B;  3BA9 A;  2QKC A;  4BW9 A;  4X1Y B;  4LF9 O;  2V1D A;  4N23 A;  1NR1 A;  4JI8 B;  3A8T A;  4MT8 A;  4B3T O;  3QO7 A;  1GRJ A;  3CCU V;  3FYI B;  2A79 B;  1XEQ A;  3JAW B;  3D36 A;  3CCL V;  3QNE A;  3ZHS A;  3OTO O;  3HPL C;  3Q4H B;  2HVJ C;  2BSK B;  4DV6 B;  3OM3 B;  3JCU Z;  3ZHV A;  1Y76 B;  3B8N A;  4XDL A;  4PDM A;  2OTJ V;  5BR8 B;  3W7S A;  3AG4 C;  1Q43 A;  5DN6 G;  4F4L A;  3ZRW B;  5LGU A;  1AJP A;  2WLI A;  4MW8 A;  1AR1 B;  4LF7 O;  4G28 B;  1W0K G;  1D2D A;  1JCH A;  5H9C A;  4H44 B;  4A5U B;  3OMA B;  4I55 A;  3ZHQ A;  3CRC A;  2W0X A;  3A0R A;  4NYK A;  3M99 B;  2OCC C;  1HNZ O;  2IJH A;  5BZB A;  1RM1 C;  5H6R A;  2DE0 X;  2H94 A;  4DYL A;  1M56 B;  3CCS V;  4X20 B;  2EJ7 A;  1PNL A;  2D2C B;  2YI8 A;  1K7D A;  3WU2 Z;  2E3C A;  2LGQ A;  3CRQ A;  4I5S A;  5FL7 G;  4FM0 A;  4EB6 A;  4PV1 B;  3CXC U;  1XIL A;  3B77 A;  2DN9 A;  5EIB D;  3RT3 C;  4FVM A;  2KSD A;  4LFA B;  4LF4 O;  4B3S B;  1AR4 A;  2GTS A;  3CRM A;  4I9W A;  5LHG A;  3K57 A;  4JI8 O;  1KU9 A;  3RWR D;  3P30 A;  2BTQ A;  4W4K A;  2EIK C;  2QR4 A;  4H37 A;  1GM8 A;  3GB7 C;  3RGB A;  1H8E G;  3OUS A;  2AHZ A;  2Y48 A;  2RDC A;  3ZJZ A;  2A7W A;  2ZXW C;  5LP6 A;  1X4T A;  1JVM A;  3AG4 B;  1QNM A;  2X0L A;  5CBG A;  1RSO B;  3UKM A;  2LW7 A;  2A06 H;  4L87 A;  5DED A;  5LXT A;  2Q4P A;  2QWR B;  3ZBH A;  3N2K B;  1HDJ A;  5CBH A;  1XOU A;  4RAI A;  2OCC B;  3K79 A;  4GX5 A;  5EC1 C;  4PDR A;  1RM1 B;  4MTG A; 
#chains in the Genus database with same CATH homology
 4WFE A;  3ABU A;  1CP9 A;  2JEU A;  5LHI A;  2OTL V;  2B1I A;  2ITD C;  5C93 A;  4JGS A;  2H8P C;  1FS0 G;  1K97 A;  1QVF U;  5CN0 A;  4MSW C;  1QLE C;  3E86 A;  1M1K W;  3MD0 A;  5CA3 A;  1VQ8 V;  4MVZ A;  4TSF G;  4ZKI A;  2A9H A;  3G6E V;  1M9N A;  2ITC C;  5L3F A;  3ABL C;  5LGT A;  1QR8 A;  3AEI A;  1I5Y A;  2EIJ B;  3OW2 U;  2Q6A A;  3SPJ A;  4PDV A;  5B1A B;  4DXW A;  3FB8 C;  2R9I A;  3LUT B;  4MVS A;  2R9R B;  3JD0 A;  2NNU A;  4UUJ C;  3UM7 A;  5L3D A;  1R3J C;  5B1N A;  3STZ C;  3ETG A;  4BW5 A;  3ASO C;  3CME V;  4WF9 V;  1YI2 V;  4G27 B;  4MVO A;  1Q7Y W;  4BIZ A;  4QJF B;  1KP3 A;  2WAM A;  1VQM V;  2JK5 C;  3E89 A;  1M57 C;  1KQS U;  4TT3 G;  1GM7 A;  3CCV V;  2DWD C;  5LBQ A;  1FXH A;  4WFG A;  1YHQ V;  1QLN A;  3OGC C;  2BOB C;  2FTK A;  2EIK B;  2IJK A;  3W7X A;  4RUF A;  2EIN C;  5L3C A;  2DYR C;  1VQ7 V;  3SYP A;  3ZRV A;  3CCJ V;  3CCE V;  3WG7 B;  1K34 A;  5E1A C;  4WCE V;  3IGA C;  3CC2 V;  4LC1 A;  3ZRS A;  2WLM A;  4GX2 A;  4JAU A;  4MW3 A;  2XAQ A;  3MHS C;  1GO3 F;  2ZXW B;  3OEE G;  4MTO A;  3E83 A;  4PA7 A;  3VOU A;  2F43 G;  2JJ2 G;  3MHH C;  1OZ0 A;  3W7U A;  4JYC A;  1FXK C;  4HYO A;  1KD1 W;  3ABM B;  4LCU C;  1GTO A;  2EIL C;  1LNQ A;  3GWO A;  4RQE A;  2OT5 A;  1R6N A;  3SYA A;  1KP2 A;  1OCO C;  2IH1 C;  3ZN1 A;  1V55 B;  2DYS B;  3LDC A;  2DWE C;  1EBO A;  3T4D A;  1VQO V;  4JTD B;  2ZDI C;  2GSM B;  4MTX A;  1L1F A;  2WPD G;  2WLJ A;  1YTF B;  3T1C A;  2Y69 C;  2K1E A;  2X7R B;  1KKD A;  3CYO A;  2CK3 G;  1B6Q A;  5B1B C;  3K0G A;  1CPY A;  1YIT V;  1R73 A;  5KA6 A;  2ZR3 A;  3AG2 C;  4P9O A;  1QLE B;  1OHH G;  1R3K C;  4J9Y B;  3B8M A;  4MS2 A;  4MTG A;  2LFR A;  2X6B A;  3G4S V;  3ABK C;  1ARO P;  3IC7 A;  1K33 A;  5B3S C;  1JJ2 U;  3T4Z A;  1SRY A;  3ZMU A;  4FK5 C;  2UXX A;  3OAA G;  1VQN V;  2IJI A;  3T2M A;  2DQ0 A;  1PKX A;  1JPX A;  1E79 G;  5EBM C;  4MVR A;  1VQL V;  4ZBM A;  1SZT A;  1AJQ A;  2IU0 A;  2V7Q G;  3ETD A;  3R65 A;  1THZ A;  4Q20 A;  3JD3 A;  5GW7 A;  1EFR G;  2XOK G;  3ABT A;  1PNK A;  1SES A;  2EJR A;  4KUM A;  3I56 V;  5DM6 V;  2ZQM A;  2GHY A;  4LBE C;  1VQ4 V;  4N21 A;  3AG1 C;  3H01 A;  4UXN A;  2JJ1 G;  3X2Q C;  4RQF A;  3E8B A;  2PI5 A;  1M57 B;  3OMI B;  1K3E A;  3ZMV A;  4XDK A;  1WPX A;  1VQ9 V;  2WLN A;  1FFT B;  1DF4 A;  3DGE A;  1VQ6 V;  5J9P C;  3FB6 C;  1NJI W;  1DF5 A;  3RVZ A;  1GM9 A;  2WLH A;  3RVY A;  1MOF A;  2EIN B;  3WFV A;  2D3O W;  2DYR B;  3JYC A;  4OXS A;  1NBM G;  3OEH G;  4TWK A;  4PA3 A;  2HG5 C;  3F7Y C;  2JEX A;  2JDI G;  5CBF A;  4BAY A;  1YTF D;  3SYQ A;  2P6J A;  5IDJ A;  4JTA B;  3BEH A;  3TET A;  1SET A;  1S3J A;  3AG3 C;  4FMT A;  3CCQ V;  4HAM A;  4HZ3 A;  1JOY A;  5EBL C;  5LHH A;  3CCM V;  1IXM A;  3LSS A;  1FXK B;  5CMU A;  1P7B A;  2EIL B;  4PDL A;  3TCU A;  3G71 V;  1Q82 W;  1S0V A;  4U7O A;  3JD4 A;  1HWY A;  2DQ3 A;  1OCO B;  2IU3 A;  4LP8 A;  3DTU B;  3ETE A;  3OR6 C;  1OCC C;  1PNM A;  2IJJ A;  2XAS A;  3K04 A;  3SYC A;  2C2A A;  4GCZ A;  4PA6 A;  2PI4 A;  2Y69 B;  2M7W A;  1GK9 A;  4QPJ A;  3FKS G;  5B1O A;  5B1B B;  3QO5 A;  4P30 A;  1RPR A;  2KB1 A;  3AG2 B;  3ASN B;  1K92 A;  4MVM A;  3ABK B;  5B3S B;  3RW0 A;  4UV9 A;  5L3E A;  5LGN A;  1NVP B;  1MSW D;  4GT1 A;  3FYE B;  1FXV A;  2HLD G;  3K0D A;  1KEC A;  3E2E A;  1K4C C;  1F51 A;  4UVA A;  4Z1M G;  2ZD9 A;  3IFX A;  4DO2 A;  1NKD A;  3PJS K;  2EZP A;  3LDD A;  1S76 D;  1BHA A;  5IYC O;  4FPP A;  3SYO A;  1QBZ A;  3E8H A;  3FB5 C;  2YSU B;  3RBZ A;  3AG1 B;  3K3W A;  3X2Q B;  3E35 A;  2NLJ C;  3F7V C;  5KUM A;  1V54 C;  2HR3 A;  2WSS G;  2WLL B;  2X6C A;  1R3L C;  5IYD O;  3HB3 B;  2JIZ G;  1JQ0 A;  3I55 V;  3VBB A;  4PEL A;  1G4Y B;  3NXS A;  2XAH A;  3LSQ A;  1W2B U;  2QTO A;  1YSC A;  1PD3 A;  3ZCC A;  2Z3Y A;  3ASN C;  1ROP A;  4E2L A;  3JD2 A;  1VQK V;  1FXK A;  1SER A;  1F4N A;  4J9Z B;  3EHB B;  4PA9 A;  2B1G A;  4X88 A;  4WFH A;  2EIM C;  4QIW F;  3ML0 A;  2LP7 A;  4X89 A;  2QKS A;  3AG3 B;  1F4M A;  1MAB G;  1WLE A;  2P67 A;  1GKF A;  3SPI A;  4KFM A;  4QNH B;  1GMG A;  2BOC C;  3F5W C;  1M56 C;  3ZRW A;  2XAG A;  1YJW V;  2YEV A;  3CC7 V;  2ZDI A;  1NR7 A;  3ZMZ A;  2W6J G;  1Y66 A;  2ZR2 A;  3BY6 A;  5HFL A;  4CZZ A;  4MTF A;  1P4R A;  3QO8 A;  4QE7 A;  2UXN A;  1NVP D;  3K03 A;  2DW4 A;  3SJQ C;  4WFA V;  5H6Q A;  4FIP C;  5KA5 A;  3E8F A;  3JD1 A;  4UVB A;  4JTC B;  3K9A A;  1K73 W;  4JYB A;  1KC8 W;  1BMF G;  4BIU A;  1OCC B;  2LFS A;  1DLB A;  4GX0 A;  2V1D A;  4N23 A;  1NR1 A;  4EKW A;  2P7T C;  3JCZ A;  4MT8 A;  3QO7 A;  3OE7 G;  3K06 A;  1QR9 A;  1JX9 A;  1OCZ C;  3CCU V;  5KUK A;  2XND G;  2HJF C;  1E1R G;  3FYI B;  1H8H G;  2W0F C;  4R8C A;  3D3I A;  2WWW A;  1VQ5 V;  1F23 A;  1Y4M A;  2A79 B;  2QEX V;  1I5X A;  1AJN A;  1OCR C;  5EK0 A;  2X6A A;  4R50 A;  1UJW B;  3D36 A;  1K8A W;  4CBC A;  3CCL V;  3QNE A;  1N8R W;  3HPL C;  4YXW G;  2HVJ C;  3OUF A;  2QM8 A;  2XAJ A;  1M90 W;  3OM3 B;  2WLL A;  1Q81 W;  3B8N A;  4XDL A;  4PDM A;  2OTJ V;  3W7S A;  3AG4 C;  3LDE A;  5L3G A;  5DN6 G;  1ORQ C;  2EBO A;  4QPK A;  4WFF A;  3ZRW B;  4F4L A;  2YEV B;  5LGU A;  1AJP A;  2WLI A;  4MW8 A;  1V54 B;  1AR1 B;  4G28 B;  1W0K G;  4FJC C;  4R6Z A;  2Q67 A;  2P90 A;  1R6K A;  1S5H C;  1XL6 A;  1JCH A;  5H9C A;  3ZIA G;  3W7T A;  1E1Q G;  3OMA B;  1ZWI C;  5EC2 C;  3LNM B;  3OR7 C;  5EBW C;  3A0R A;  1RPO A;  5IY5 C;  2QA4 V;  1J95 A;  1NH2 B;  3M99 B;  3SPH A;  2OCC C;  1COW G;  3CMA V;  2IJH A;  5BZB A;  1RM1 C;  5H6R A;  4ASU G;  3ZMS A;  2QM7 A;  4GX1 A;  2EIM B;  1K5S A;  2Z5U A;  2H94 A;  4JPR A;  1H38 A;  2AHY A;  1Q86 W;  1M56 B;  3CCS V;  1G8M A;  4RO2 A;  2EZO A;  1TUE B;  4MVU A;  4P2Z A;  1YJ9 V;  1PNL A;  1K4D C;  5IYB O;  5L3B A;  4JF3 A;  3OFN G;  1NQT A;  4H33 A;  4R7C A;  1K7D A;  1BHB A;  4QE9 A;  1R3I C;  4I5S A;  2EIJ C;  3P32 A;  3SPC A;  4KP4 A;  5FL7 G;  2MK3 A;  2IW5 A;  3CPW U;  3E8G A;  5B1A C;  1MG1 A;  4G2K A;  4XBF A;  3CXC U;  2XAF A;  3B77 A;  4MVQ A;  1QVG U;  1VQP V;  3OMN B;  2WLK A;  3EFF K;  4WFB V;  2WLI B;  1AI5 A;  1OCZ B;  5LHG A;  4I9W A;  4PA4 A;  1YIJ V;  1AI6 A;  4RUE A;  1PL0 A;  2ATK C;  3P30 A;  1OCR B;  4UVC A;  5HFM A;  2EIK C;  1EZJ A;  1AI7 A;  2QE7 G;  4H37 A;  1GM8 A;  3GB7 C;  3TK1 A;  1K5Q A;  1QCE A;  1ENV A;  1NH2 D;  1H8E G;  3CCR V;  3OUS A;  3WG7 C;  3K08 A;  2AHZ A;  3ZRX A;  1AI4 A;  2Y48 A;  1K9M W;  2HFE C;  2HVK C;  3ZJZ A;  2W6I G;  3W7W A;  1YJN V;  2ZXW C;  4UV8 A;  1JVM A;  2B5U A;  3AG4 B;  1S77 D;  3ABL B;  4P9P A;  1BL8 A;  1CEZ A;  2X0L A;  2A0L A;  5CBG A;  3SPG A;  3ZN0 A;  3UKM A;  1S72 V;  1W0J G;  2IH3 C;  3ABM C;  4JAV A;  4L87 A;  1XL4 A;  3CD6 V;  2Q69 A;  4JAS A;  3STL C;  3CP1 A;  2HKO A;  3ZMT A;  4X8A A;  3FB7 C;  3ASO B;  1V55 C;  2DYS C;  3KG2 A;  5IY5 B;  5CBH A;  4XDJ A;  4RAI A;  4U7N A;  2OCC B;  3CC4 V;  3K79 A;  4GX5 A;  4PDR A;  5EC1 C;  1RM1 B;  1H2G A;  1DTO A;  2Q68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...