4PDLA

Structure of k+ selective nak mutant in caesium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
molecule keywords Potassium channel protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdlA00
3KG2A 2BOBC 3SPGA 3OUSA 4J9YB 1P7BA 4WFEA 3IGAC 3TETA 2QKSA 2W0FC 2WLLA 3E8GA 2WLKA 3IFXA 4ZBMA 4BW5A 3GB7C 4MW3A 2DYRC 4CBCA 4X88A 3AG4C 1XL4A 3SJQC 3UM7A 2DWDC 1J95A 1R3KC 5CBFA 3K0GA 3OR7C 4F4LA 4PDVA 2EIJC 1ORQC 4MVQA 4PA9A 3E8HA 4PA4A 3TCUA 2WLMA 3FB8C 2ZXWC 2HJFC 4JTDB 3ASOC 3JYCA 3X2QC 3PJSK 2Q68A 4JTAB 4PDLA 4TWKA 1KKDA 3FB6C 3HPLC 3SYCA 3SYPA 3EFFK 3R65A 2EIMC 2K1EA 2QTOA 4LBEC 3RVYA 3E8FA 5BZBA 2OCCC 5EBMC 3E83A 4MSWC 3RW0A 4R50A 3ABLC 4XDJA 1V54C 4MVUA 5KUMA 2Y69C 5EC1C 3T4ZA 4P2ZA 1V55C 2X6BA 3K0DA 2X6CA 5B1AC 4EKWA 4GX0A 4HYOA 4RUEA 3ZRSA 3F5WC 3K04A 3LDDA 4PA6A 3ASNC 4MVMA 3UKMA 4JTCB 2NLJC 3K03A 2A79B 2A0LA 3AG2C 3ABKC 1M57C 2H8PC 4LP8A 1G4YB 3ZJZA 4QNHB 3LUTB 3SYOA 2JK5C 4R7CA 2IH1C 3E8BA 4MVSA 4RO2A 4MVRA 3LDEA 4I9WA 4X8AA 2P7TC 1R3LC 4PDRA 1K4CC 5E1AC 4MTOA 3T2MA 2AHZA 4OXSA 1QLEC 3FB5C 2IH3C 1R3IC 3BEHA 5EC2C 3E86A 2ITCC 4RAIA 4PA7A 3T4DA 4MTGA 4R6ZA 3VOUA 4H37A 4PA3A 4QE9A 5J9PC 3K06A 3OUFA 4XDLA 4QE7A 3SPHA 4MVOA 2DWEC 5B1BC 2A9HA 2ATKC 1ZWIC 3AG3C 5EK0A 1OCRC 1K4DC 2WLHA 3K08A 4WFGA 3SPCA 3FB7C 4P9OA 3F7YC 5EBWC 1M56C 2HG5C 2EINC 4GX5A 3SYQA 1S5HC 4XDKA 2HVKC 2KB1A 2WLLB 4UUJC 3RBZA 4X89A 4MS2A 2HVJC 1R3JC 5EBLC 1OCOC 1XL6A 4RUFA 2X6AA 3STZC 2YEVA 3STLC 2WLIA 4GX2A 3WG7C 3F7VC 2WLNA 4MTFA 1LNQA 3OGCC 2BOCC 4MVZA 2DYSC 2Q69A 3E89A 3SPIA 3SYAA 4DXWA 5CBHA 4H33A 5IY5C 1JVMA 2ZD9A 4KFMA 2EILC 3RVZA 3SPJA 2AHYA 3T1CA 5KUKA 2WLJA 2EIKC 2Q6AA 4WFFA 2ITDC 4P30A 1BL8A 3LNMB 2HFEC 4LCUC 4MW8A 4G28B 2WLIB 2R9RB 4P9PA 4GX1A 5B3SC 3AG1C 4R8CA 4J9ZB 4G27B 4PDMA 3ABMC 1OCZC 3OR6C 5CBGA 4HZ3A 1OCCC 4WFHA 3LDCA 2Q67A
chains in the Genus database with same CATH superfamily
3ASNB 1P7BA 3E8GA 4K35A 2LP7A 2QR4A 4AHCA 4EFEA 1EN6A 4FFKA 4JPRA 5EZYB 5KMGB 4PA4A 3TCUA 5LHGA 2QM4A 1ZL8B 3VQWA 1H2GA 4DR1B 1HDJA 4DV3O 3SYPA 4J10A 1BGYH 3CE2A 1XOUA 1YSCA 1HNXB 4JI4O 2IU3A 3T4ZA 3CC7V 3IJ4A 3ZBHA 1I94O 4MVMA 4DV7B 3H1HH 1Q7YW 2HEPA 3ZN1A 2DYSB 4CC6A 3W7UA 1OCZB 4X1KA 1GN2A 3CCUV 1TAEA 1FD9A 4I9WA 1XI1A 2LO1A 1R6KA 5JCOC 2FTKA 4NVPA 3QO7A 3VOUA 4H37A 4BIZA 4PA3A 3L9DA 1N32O 4YJ3B 1RSOA 4DV3B 2FB5A 1D5AA 1ZWIC 2Y48A 3JD3A 1QNMA 2UXDO 1KP2A 4BAYA 3RBZA 3SJCC 4RUFA 3CB2A 1E1RG 3HB3B 3F7VC 1LNQA 4X1IA 1AI7A 4JI0B 2PYJA 1XMQB 2ILMA 2EIKC 4YJ3A 4JAAA 4G28B 2WLIB 1UPGA 3FX7A 3CCLV 5IYCO 3K3WA 4MTOA 3JAKA 2G38A 1BQZA 4F6RA 3CMEV 5IDJA 4IYIA 2CTWA 1URFA 2YS8A 2E75B 4Q20A 4LF5B 3CRCA 3B09A 3K0GA 3RFRA 5FPOA 2L35A 3E8HA 2F4VO 3RYIB 1LR1A 4GKKO 1KP3A 1KKCA 4LFAO 1SZTA 1N0NA 1FXHA 3B77A 4X64B 4ABMA 1K9MW 4YY3O 5JQGA 5LMNO 4B7EA 1KQSU 4YHHO 4JTCB 3M7MX 1VQPV 3HR0A 3RYHB 3WB1A 3AG1B 1BHAA 5CA1B 2NN4A 2RN9A 5IJ9B 3CC2V 4J80A 1VQ6V 4W4LA 4LFCB 1JCHA 4TV8A 4GUNA 4PA7A 5LP6B 5D5QA 1FAFA 1N33O 3D36C 4DR1O 2LFSA 3OUFA 5DN6G 3SJBC 3KZIZ 4QE7A 4CS3A 4HAMA 1QR9A 4JYAO 1JFFB 5IYZA 1MMMA 5J2UB 3RYHA 1NTKH 2R70A 2JGUA 2KB1A 1HP8A 4BWAA 1EN5A 5L3DA 2P67A 1PP9H 1H38A 2R72A 1NQTA 1R6TA 1DK1A 1NTMH 4XBFA 2CAZC 4PELA 1N34B 3IC7A 4KP4A 2Z0AA 1NVPB 3ZHQA 4LCUC 3ABLB 2F1MA 4P9PA 1JOYA 3QVNA 2CUGA 3TXSA 1OCCC 1WN7A 2Q67A 1X4TA 1ZTEA 4CH6A 2QKSA 4BW5A 3VQYA 4LF8O 3X2QB 2ZIMA 1AI5A 2UXCO 3E35A 1ZUQA 1VF6C 3JYCA 3A0BZ 1JJOA 4LC1A 2Y4UA 1HNXO 4MSWC 4JI4B 1QBZA 2VS0A 3GVMA 3JATB 5KHGA 2P4KA 1XMQO 4TT3G 4JI1O 3W7WA 3ETEA 4X20A 2VQEB 2D2CB 3K03A 3BRCA 1NR7A 1M57C 2B1IA 3BPZA 2AZ2A 5B66Z 2HP8A 3NR7A 3TXQA 2ODMA 3AG3B 1YJ9V 5IWAB 2P7TC 3JD4A 3W7XA 5J2UA 5LHHA 2ZE5A 2EULA 4IHJB 3CEIA 4X66O 3K06A 1GN3A 4EB6A 4DK1A 4LR3A 4B08A 3K5LA 5LGUA 5EK0A 4NKGB 3T1YO 2JJ1G 1W0JG 2UUAB 3H9VA 2IW5A 1OHHG 1SKVA 1SESA 2RCVA 1IDSA 3MAQA 4KXRA 2P4VA 3SYAA 4I55A 1VQ9V 5CBHA 1HNWB 1SF9A 3L71H 4GZRB 4R8CA 2UXXA 4HZ3A 2JGDA 3B40A 3HKBA 1BSMA 1E79G 1AP5A 4YY3B 4I0XA 2IJKA 3UM7A 5LMNB 5GW7A 4ZI7A 2UUBB 2LJ2A 1VQLV 5C8YA 5KA6A 1EN4A 3UT5B 4I4TA 2D3OW 1VQ4V 2QKCA 2XTAA 5L3FA 1MOFA 1XMOB 3AK3A 4Z1MG 1X59A 2V1DA 1Q8IA 2DOSA 3GWOA 5KHKA 5CA0B 1Q82W 4K0KB 1N33B 1GN4A 1EZJA 2XUMA 4JZ2A 1KBHA 1LUWA 3CCRV 2WA4A 1Q43A 2C2AA 3K58A 1BHBA 3JSNA 3QTCA 4B3MB 2VRZA 1FFTB 2W0XA 3P32A 5GTIZ 4YJ2A 1AJNA 4QE9A 4DV0O 1DF4A 4DV1O 3L70H 4XDLA 2WWWA 3F5TA 3ZMTA 2A9HA 3QNEA 4J7ZA 1WNSA 5EBWC 5L3EA 1TUBB 2HVKC 1P49A 1DLBA 3G6EV 4IHJA 4YXWG 1IVSA 4O4JB 1G1XB 1Z2GA 5JQGB 3STLC 2UUAO 4GX2A 4J7JA 3O65A 2KG7B 3K5MA 3SPIA 4B3TB 5IY5C 2AZ0A 2EILC 2CGOA 2CTPA 3DXRA 2GTSA 4P30A 1KECA 4Z2WA 3CJHB 2FL4A 4JASA 1QQCA 2AXTZ 3ZIAG 4UB8Z 5JH7B 2XAQA 3N2GA 4WFEA 1YTFD 3OMAB 4LF8B 3IFXA 1HNZB 1XBLA 1QCEA 4UV9A 4DUYO 5CBFA 4J42A 1N36O 1XNQB 4PDVA 1PNMA 2BE3A 2WLMA 2QWNB 3BY6A 2YXHA 3OGIB 2XNDG 2HJDA 5CB4A 3QO8A 1RM1C 4X65B 4JGSA 4LBEC 4O2BB 4L8JA 1YJWV 3ABLC 4PHZA 3CRRA 4LF7O 4MVUA 2Y69C 4ZI7B 1GO3F 2LW7A 3AK1A 3DSQA 1PV0A 4E4EA 2H8PC 1R1BA 3WFVA 1G4YB 1FJGB 2ZNJA 1WP8A 2ZR2A 3LDEA 4JI3O 3J7AU 2CGNA 1N8RW 4BR6A 1HNZO 2E5LO 3T2MA 5IYZB 2W6JG 2ADPA 1I7FA 1VQMV 1YVWA 4R6ZA 2VWJA 1TVKA 4DV4O 2IM9A 1FFXA 5DM6V 1WB8A 4JV5B 1SQPH 4ZOLB 2YXYA 3CC4V 2EJ7A 2P6JA 1E1QG 1K92A 3HKEA 3QF7A 1OZ0A 1ZLZA 2YEVA 2H3OA 4X20B 1PD3A 5BR8O 2BOCC 2Z3YA 1FXKA 4LF9B 4DXWA 2ZR3A 2CDYA 3BAAA 5JVDA 3LNMB 5CN0A 2GHYA 4DV5B 3C90A 4JI7B 5EYPB 1R73A 1SQGA 3MD0A 1Y76A 3ABMC 3U11A 4F6RB 1AR1B 1GM8A 4B3SO 4J9YB 2QM8A 3EVKA 5E79Z 1EFRG 4DR4O 4RQFA 2GV9A 2QSAA 5K1XA 1V55B 4JI8B 4X62O 3FB8C 4JTDB 1I0HA 2Q9LA 1SQXH 2ZDIA 3CCMV 4X1KB 4FLTA 1YXBA 5IT9N 2BSKA 4DW1A 3H1LH 1XMOO 4E2LA 5HFLA 3UQ8A 4LH6A 3ZRSA 2CK3G 4LF4O 2JS3A 4CS4A 4GLXA 2JEXA 3JCZA 3ETGA 1KC8W 4O2AA 2PI4A 3HKEB 1WJZA 3K79A 4FM1A 4RO2A 4RQEA 2P90A 2Z5UA 3M99B 1MABG 1K8AW 1I08A 4B3MO 1R3IC 4D7SA 2ITCC 5KA5A 5F2VO 1SRYA 5IJ0B 3ZHVA 1F4MA 5IE9A 2DWEC 4UB6Z 1K4DC 1W0KG 3H1KH 2HLDG 1Y76B 1Y4MA 2HG5C 2UUBO 2YUAA 5LOVA 4FFBB 2XT9A 1VQOV 4LFBB 1FS0G 4NR1A 4JI6B 1FXVA 4TQFA 4DV6O 4DR3O 3T1HO 5A9GA 1S5JA 1Y67A 3JAKB 3E89A 4U7NA 3MHHC 4UV8A 5KUKA 4DRXA 2FYUH 4UVCA 4JI5O 3G71V 1N0JA 5LMUO 4I9QA 4MW8A 1GM7A 1K73W 1BT8A 4GKKB 4QPJA 4LF7B 4P9OA 1EBOA 2UXNA 3JAMN 4KL1A 4B3SB 4U3FH 5H6RA 2WLKA 1V9PA 3LSQA 4X88A 1SQBH 4H0LB 2QWQB 1EZVH 3SGIA 2ZE6A 3DC5A 2PZSA 1XREA 1KKDA 1L8DA 1XILA 1VQNV 4AQYO 3E2EA 4ASUG 3AK2A 3RVYA 4YIPA 5KAFZ 5ITZA 5LXTA 3JAWB 1QU7A 2X6BA 1IBKB 3QO5A 1NVPD 3K04A 4X9QA 3A0RA 1U97A 3UKMA 1VMGA 1JR9A 3THOA 2PYLA 2KKWA 4DR2O 2F23A 3WB0A 2YSUB 2XAGA 4DV2B 4I4TB 4JI3B 1SERA 1Z5VA 3CXCU 2VWKA 3OMIB 2R9IA 2AHZA 3BA8A 3ZHTA 2UXBO 3GWKC 2IJHA 5BR8B 2V4DA 1P4RA 3ASOB 3LSSA 4EFBA 1FXKC 2Q5ZA 5KLVH 5CA0A 1CPYA 4UCUA 1Q6HA 2ZT9B 1XNQO 1QR8A 3RYCA 4LWSB 2QA4V 3ZHSA 4UUJC 3SDLA 2JDIG 2VQFO 1K97A 4LF6O 4WFBV 3WG7C 3BFRA 4JAUA 3E22A 2YDEA 4KFMA 3RVZA 1NI8A 4OPAA 2OTLV 2UXCB 4J11A 5H5NA 2HFEC 3BCCH 4FMTA 2MK3A 1TGOA 3D36A 1JQ0A 2BTQB 1Q81W 1FFXB 2A3QA 4DR5O 3TK1A 5B1BB 1CP9A 2PY5A 2DQ0A 5JCOA 3CHXA 1B3QA 2EINB 2YIBA 2Q8VA 1L1FA 1Q6IA 3X2QC 1P7GA 3OAAG 2Q68A 1QLNA 1COWG 3CPWU 4JI6O 1H8EG 2PI5A 2OCHA 4LFCO 1V55C 1U96A 1VP7A 4LF4B 4JI2O 3L75H 3ASNC 1L0LH 2NLJC 4DR6B 5ITZB 1YITV 5DECA 2KQXA 1B6QA 3ABTA 1DF5A 1US6A 1K4CC 3EXAA 4LWSA 4U3JA 1IBLB 1K7DA 2OT5A 4H13B 4UVBA 1VQ5V 5FPRA 1OJHA 1DGSA 4DR4B 1MSWD 3I55V 4O4IB 2DW4A 1GMGA 3AG4B 1NR1A 1S5LZ 5KHJA 1QVFU 4EEQA 1R6NA 5L3BA 4UFZA 2HHHO 4FZ1A 3T1YB 4GX5A 4G2KA 1OV9A 5B5EZ 1T5EA 2KG7A 3JSLA 4HNAA 1SQQH 3ABKB 3D8CA 3B4SA 4H33A 4MTXA 3N27A 5JWPA 1M1KW 3CJHA 5C93A 5KX5A 1VQKV 2OCCB 5IJ9A 4PI2A 2CE4A 3FD9A 1ZSPA 1O9GA 5LMUB 4OGQB 5BY1A 1NKDA 3OR6C 4TOIA 3HPLC 4CS2A 2Q0AA 1NJIW 1Z5WA 2XAHA 4B3TO 2EJRA 1S72V 2CH7A 3CCJV 4MVQA 3KCXA 1Y74B 4DR2B 4B3RO 4DV7O 3JASA 4DR7B 4NB5A 1AP6A 3AEIA 3R65A 2ZQMA 2CTQA 3E83A 4FIPC 3DC6A 3WB2A 1W2BU 4P2ZA 3K0DA 4DUYB 2N74A 4LNUB 1OCCB 4BIUA 4PA6A 2OWOA 1JJ2U 3HKCB 4LP8A 4Z1VA 5BMVA 2ZIOA 2DQ3A 4I50B 4FLVA 2JS5A 1TUBA 1N36B 1RSOB 3E86A 3K9SA 1SS3A 3W7TA 3OM3B 3C3SA 3WG7B 1H2MA 1Y66A 3AG3C 4D7TA 4EB6B 5LXTB 1F23A 1OCOB 2EINC 3DXRB 4CZZA 5CA3A 2WLLB 3VQXA 1H2NA 5LGNA 5LP6C 1AR5A 2VQFB 3G4SV 2GBOA 2WLNA 3OTOO 3OFNG 3SPJA 1XEQA 3M8AA 2QWRB 4WFFA 5IJ0A 2ITDC 4JYCA 4I5SA 1VQ7V 2JGDB 3CCEV 2LGQA 2O57A 4PDMA 5CBGA 4DUZB 1W59A 4UCRA 2ETNA 1ROPA 2BOBC 2JRIA 3ML0A 2W0FC 2WLLA 1Q5OA 1XHZA 4JV5O 2DYRC 3JD1A 2DWDC 2Y69B 1R3KC 1A32A 1XHXA 3OR7C 1RPOA 2HHHB 2EIJC 3APOA 1K34A 3CX5F 4DR6O 3DGEA 3PJSK 4JTAB 4PDLA 3FB6C 3HKCA 5L3GA 3RN4A 2K1EA 2ZINA 1M9NA 4XDJA 5BXZA 1IBLO 5B1NA 2CH7B 3RT3C 4I55B 3BA9A 3J81N 5JVDB 4JI8O 3LDDA 4DYLA 4DV0B 5H2FZ 2A79B 2A7WA 3ZJZA 2NNUA 1VQ8V 2F43G 4TQDA 4MVRA 2Q7EA 1SA0B 5E1AC 2P5OA 1BQ0A 1NTZH 1KYOF 2BTOA 3NXSA 5EC2C 2VQEO 2E76B 3ZMZA 5GTHZ 3S3XA 2Q4PA 4B3RB 3OEEG 2GUZA 1JX9A 2RDCA 4KHPB 5B1BC 2ATKC 2YIDA 3SPCA 2EZPA 2P22C 2AGAA 1M56C 2EILB 3JARB 1TUEB 1NBMG 1S5HC 3K5NA 3EHBB 1HWYA 4UCSA 4HBNA 1R3JC 3RYFA 4NTXA 1OCOC 1XL6A 3STZC 4L87A 4FM0A 1SQFA 2X0LA 4MVZA 4A5UB 4PV1B 5K1PA 3CCQV 2F4VB 1KMIZ 2FMLA 4WFAV 2UU9B 2WPDG 4O4LB 1THZA 4U3JB 4NXMB 3CRQA 2ZDIC 1YHQV 4IL6Z 4JYBA 4FVMA 2W6IG 4DUZO 4OX9O 1IX9A 3G80A 4ZBMA 1ZL8A 4PJ0Z 3C3TA 2MW2B 1S77D 2DE0X 4FLYA 4X1YA 4PA9A 4ZHQB 2HJFC 2ZE8A 4GCZA 4TWKA 1SA0A 5LHIA 3PN1A 5EZYA 4N23A 2EIMC 2ZXWB 2UUCB 1FKAO 5EBMC 1H8HG 4IIJB 1V54C 5LBQA 5B1AC 4AILC 4RUEA 1H2SB 5KAIZ 4WCEV 2ZE7A 4JI5B 3L73H 4X66B 1XNRO 3AG2C 2KSDA 1HW7A 1AR4A 1IBMB 1YJNV 2QWOB 2IH1C 3APQA 4ZHQA 4JYAB 3CWBH 2QWPB 5A2QN 1SETA 4OXSA 1QLEC 3FB5C 3CCVV 1VF6A 1BZKA 2QTSA 4RAIA 3OTOB 2YIAA 1Y6XA 4W4KA 3CD6V 2XOKG 3I56V 5LYJA 3VBBA 4IGGA 1N4CA 4I0XB 2ZM6O 3OE7G 1Q6UA 4RWUA 2EIKB 1EM1A 1NS1A 5KX5B 2E3CA 5EBLC 5JJJB 4I7ZB 2QKAA 1ZAUA 1H2KA 5LL6Y 4MTFA 1ENVA 3P30A 4DV1B 5H6QA 5HFMA 1VARA 2ZNIA 4TV9B 1UFIA 5BMVB 1CXZB 3BHPA 1YIJV 4UCTA 2P06A 2LQTA 5CMUA 1Y74A 5B3SC 5EIBD 3AG1C 1D5NA 4JZGA 1JPXA 5H9CA 3OUSA 3N2KB 1K33A 3ABUA 5AG2A 3SR2C 2B9ZA 1GH6A 3HKDB 5C8YB 2F66C 1AJQA 4ZOLA 1KD1W 5B1AB 1HR0B 1XQ8A 4YJ2B 2NR5A 2Y0IA 1GKFA 2BCCH 4TV9A 5IYBO 3BABA 2QTOA 3Q4HA 3K9AA 5LA6B 2OCCC 1AB3A 1SC5B 1FXKB 2PGGA 1AILA 4GX0A 4HYOA 2GTAA 2F93B 4O2AB 4UCVA 4IT5A 3N2KA 1B04A 4UVAA 2XASA 4QGPA 4NXMO 1GK9A 4QNHB 1RPRA 5JJEB 3CS5A 1R3LC 2A06H 2Q7GA 3IC9A 4LF6B 1JA8A 2IH3C 3FKSG 1NH2B 3BEHA 3QG5A 4K0KO 1I94B 1N32B 2F95B 3JALB 1KUQA 5J9PC 1RP3B 1FJGO 4MVOA 3ETDA 4DK0A 2M7WA 3F7YC 1IXMA 3D3IA 4ICGA 2QEXV 2XHBA 1H2LA 1Q90D 4I50A 2DMXA 2RMKB 2X6AA 5IYDO 3IAYA 3G6BA 2QJ1A 4FJCC 5KMGA 3LNNA 3H1JH 3K5OA 1BMFG 2AHYA 4O4HB 4K8ZA 2B1GA 1BL8A 4OPHA 1M90W 1P84F 1PL0A 3CRAA 4BIOA 4G27B 3WU2Z 4WFHA 3K57A 3RGBA 4NTYA 2IJIA 2HKOA 4TSFG 4LF5O 2EX3A 1AI6A 1QLEB 1XL4A 4TUYA 4JI0O 1MNGA 1KB9F 1BCCH 4F4LA 2IU0A 2M6YA 5LOVB 4IYHA 1SQVH 2Q7HA 1K3EA 4HNAB 1IZ3A 1DTOA 3HKDA 4QIWF 3ZHUA 4DW0A 4EKWA 4YHHB 2YEVB 2A0LA 2K9PA 2FKXA 4GKJB 2YICA 5B3SB 4X1IB 4TUYB 3SYOA 2JK5C 3FYIB 4R7CA 3E8BA 3ZMUA 5KHIA 3ZHRA 1S76D 4LFAB 3G67A 4GT1A 1WPBA 1MZFA 3JCUZ 4GYCB 5EYPA 3CRMA 5J2TA 5L3CA 2B5UA 3I5DA 3A0HZ 1NU1H 2PF4E 2YXLA 3JASB 4CH4A 2PUSA 3H1IH 5CA1A 3RWRD 1TVKB 4QPKA 3O9OA 3L72H 4U7OA 3FB7C 3U10A 2WA3A 1WA8B 1AVMA 1GM9A 5IWAO 1NH2D 2GSMB 2V7QG 3ZEDA 3W7SA 1M4UA 3JALA 5FNVA 3ZMSA 1ZX3A 3P3PA 2UUCO 2JJ2G 1XDCA 1BE3H 2ADQB 1N34O 1YZBA 2AW9A 2Q6AA 4X62B 1J5EO 4PI0A 2EBOA 3FFQA 1GAXA 3FAVB 4J9ZB 4KUMA 4PD4F 3LDCA 4DV6B 4DR3B 3ZS8C 3KKYA 4NXNB 3OT7A 1IURA 1AJPA 5TISZ 4MW3A 4CBCA 4D6TH 3AG4C 2H94A 1S3JA 1J95A 4TV8B 4N21A 1HR0O 2EIMB 2ZXWC 3D3QA 3ASOC 3VQVA 3E8FA 3RW0A 4QJFB 4ZKIA 1JFFA 5EC1C 4AI8A 2E5LB 3BVOA 4Q6GA 2X6CA 3CYOA 3F5WC 3ZCCA 3R66A 2XAFA 1D2DA 3JD0A 1YDXA 2Y0PA 3FYEB 3OW2U 1GTOA 4GKJO 1F51A 1MZEA 3TGUH 4JAVA 4WBNA 1O9HA 1AROP 4X8AA 4NXNO 3B8MA 1M93A 2QE7G 1IBKO 1XUQA 2ARHA 1JMKC 5FNVB 3ZN0A 2LFRA 3T1HB 1PL4A 1S0VA 1K5SA 3SPHA 3JARA 2EZOA 4DV2O 4DV5O 1GN6A 5B1OA 2QM7A 4X89A 1KU9A 2RQ6A 1F4NA 3LSUA 2Q69A 4O4JA 1JVMA 2ZD9A 1MA1A 4FM2A 1G6UA 1YEWA 1HNWO 2WLJA 5KHHA 2OIEA 5JH7A 3JATA 4LFBO 3MDSA 3MHSC 5EIBC 1PKXA 4DR7O 3OMNB 1Q3EA 1VIBA 3KG2A 3TETA 1TA8A 2N05A 4FPPA 3H01A 1RFYA 5D5PA 1ORQC 4FFBA 1WP7A 5FLXN 4FZ0A 4FLUA 3CP1A 1L0NH 1FYJA 2XAJA 1V54B 3S3WA 3OEHG 4WBNB 1LUVA 3HKBB 4R50A 2JEUA 2PTMA 2IBZH 4FLWA 1WPXA 1M57B 1B06A 1GRJA 3ZMVA 4CC5A 4DRXB 2UXBB 4O4HA 2UU9O 3UO3A 2N04A 1WAZA 2WSSG 3ABKC 1SZXA 4KHPO 3E22B 1AI4A 1I5YA 4J41A 3LUTB 5IY5B 3JD2A 3CMAV 1FPOA 1VF7A 1QHTA 4H44B 3ZRWA 4OX9B 1VEWA 2JVDA 2E74B 4UXNA 1K5QA 4MT8A 1F7YA 5FL7G 4FK5C 1YTFB 3A2FA 3T4DA 2R9AA 3ABMB 4MTGA 3RYFB 3K59A 4JI2B 1IXBA 4IIJA 2GDSA 1IBMO 2BTQA 4FLXA 4YIOA 3RYCB 2WLHA 3K08A 4WFGA 2Q73A 1YCIA 3JAWA 1J5EB 3CSXA 3OTFA 3SYQA 3UT5A 2UXDB 5LP6A 5LGTA 1PM9A 1G8MA 1MG1A 4MS2A 5JJNB 2BSKB 4ZIBA 3OGCC 4C7UA 1NZ6A 2DYSC 2YI9A 3P3NA 4DR5B 4CH5A 1YI2V 4B7KA 2YIBD 4JYYA 2WAMA 4FLZA 2QDOA 4DO2A 4X1YB 2EIJB 1VF5B 5GONA 2CTRA 5LYJB 1BS3A 2R9RB 4GX1A 4AQYB 2LGWA 2LW1A 1OCZC 1PNKA 3ZX6A 1WB7A 3SPGA 4J7KA 3IGAC 4K8XA 4LH7A 3GB7C 4LF9O 3SJQC 2ZM6B 1I5XA 3U0ZA 3SYCA 3EFFK 3OD4A 4O4IA 2Y4TA 5BZBA 4X64O 1MSDA 1M5IA 5KUMA 2OIGA 3ZRWB 1CEZA 1UJWB 3CCSV 2YC0A 4F6EA 3CXHF 2YI8A 1M56B 2DN9A 3TJTA 3A8TA 4BW9A 1XNRB 2DYRB 2L6LA 3ZRVA 4O2BA 1WLEA 3AG2B 4MVSA 3KCYA 1YF2A 2DJVA 4X65O 3L74H 1QVGU 4PDRA 2OTJV 3B2EE 1WA8A 4JF3A 1RM1B 4NYKA 3UO2A 2Q0OC 3J80N 2RJZA 3Q4HB 5LA6A 4DV4B 1PPJH 3B8NA 2ZKOA 1OCRB 4WF9V 2JIZG 2OYQA 1Q86W 1NT2B 3ETQA 3AG7A 4NTWA 1OCRC 4UCOA 3SJAC 2GUZB 1PNLA 3N2GB 4XDKA 2X7RB 4CH3A 3DTUB 5GONB 4JI1B 5CB4B 2HVJC 5DEDA 2WLIA 2IJJA 3FAVA 3ICXA 2HR3A 2RNBA 2ZCEA 5J2TB 3ZRXA 2QGNA 3T1CA 4LNUA 3UCSC 4JI7O 3RYIA 4O4LA 4K3AA
chains in the Genus database with same CATH topology
3ASNB 2IJIA 2XAQA 1P7BA 2HKOA 4WFEA 1NJIW 1YTFD 4TSFG 3OMAB 2XAHA 3E8GA 3IFXA 2LP7A 1AI6A 1QLEB 1QCEA 1XL4A 2EJRA 4UV9A 1S72V 5CBFA 4JPRA 4F4LA 2IU0A 4PDVA 1PNMA 3CCJV 4MVQA 4PA4A 3TCUA 2WLMA 5LHGA 3BY6A 1H2GA 2XNDG 3QO8A 3SYPA 3AEIA 3R65A 2ZQMA 1RM1C 4JGSA 4LBEC 1K3EA 1DTOA 3E83A 4FIPC 4QIWF 1YJWV 3ABLC 1YSCA 4MVUA 2IU3A 2Y69C 3T4ZA 4P2ZA 1W2BU 3K0DA 3CC7V 1GO3F 4EKWA 1OCCB 4BIUA 4PA6A 4MVMA 2YEVB 2A0LA 1Q7YW 2H8PC 1JJ2U 3ZN1A 3WFVA 5B3SB 2DYSB 4LP8A 1G4YB 3SYOA 2JK5C 3W7UA 1OCZB 3FYIB 2ZR2A 2DQ3A 4R7CA 3E8BA 3ZMUA 3CCUV 1S76D 3LDEA 4I9WA 1N8RW 4GT1A 1R6KA 3T2MA 2W6JG 2FTKA 5L3CA 3E86A 2B5UA 3QO7A 1VQMV 4R6ZA 3VOUA 4H37A 4BIZA 4PA3A 3W7TA 5DM6V 3OM3B 3WG7B 1Y66A 4QPKA 3AG3C 1ZWIC 4U7OA 2Y48A 3FB7C 3JD3A 3CC4V 2P6JA 1E1QG 1F23A 1OCOB 1KP2A 2EINC 4CZZA 5CA3A 1GM9A 1K92A 1NH2D 2WLLB 4BAYA 3RBZA 1OZ0A 2GSMB 2V7QG 3W7SA 5LGNA 4RUFA 3ZMSA 2YEVA 1E1RG 3G4SV 3HB3B 1PD3A 2WLNA 3F7VC 1LNQA 2JJ2G 2BOCC 2Z3YA 1FXKA 1AI7A 3OFNG 4DXWA 2ZR3A 3SPJA 2EIKC 2Q6AA 4WFFA 2ITDC 3LNMB 5CN0A 2GHYA 4JYCA 4I5SA 1VQ7V 3CCEV 2EBOA 4G28B 2WLIB 1R73A 3CCLV 3MD0A 5IYCO 4J9ZB 4PDMA 3K3WA 3ABMC 4KUMA 1AR1B 5CBGA 1GM8A 3LDCA 4MTOA 1ROPA 2BOBC 4J9YB 2QM8A 3ML0A 1EFRG 2W0FC 2WLLA 5IDJA 4RQFA 3CMEV 1AJPA 4MW3A 2DYRC 3JD1A 4CBCA 3AG4C 2H94A 4Q20A 1S3JA 2DWDC 2Y69B 1J95A 1R3KC 1V55B 3K0GA 3OR7C 1RPOA 2EIJC 3E8HA 4N21A 3FB8C 2EIMB 1K34A 2ZXWC 3ASOC 3DGEA 4JTDB 3PJSK 4JTAB 4PDLA 3FB6C 5L3GA 1KP3A 1SZTA 2ZDIA 2K1EA 3CCMV 3E8FA 1M9NA 3RW0A 4QJFB 4ZKIA 1FXHA 4XDJA 3B77A 5EC1C 5B1NA 4E2LA 1K9MW 5HFLA 2X6CA 3CYOA 3ZRSA 3F5WC 3LDDA 3ZCCA 2CK3G 2XAFA 1KQSU 3JD0A 4JTCB 2A79B 1VQPV 3FYEB 3OW2U 1GTOA 1F51A 2JEXA 3JCZA 3ETGA 3AG1B 3ZJZA 1KC8W 2PI4A 1BHAA 2NNUA 1VQ8V 4JAVA 3K79A 4RO2A 4RQEA 2F43G 2P90A 1AROP 4MVRA 2Z5UA 4X8AA 3M99B 1MABG 3B8MA 5E1AC 1K8AW 3CC2V 2QE7G 1VQ6V 1JCHA 1R3IC 3NXSA 5EC2C 2ITCC 4PA7A 3ZMZA 5KA5A 3ZN0A 2LFRA 1SRYA 3OEEG 2LFSA 3OUFA 5DN6G 1S0VA 1K5SA 4QE7A 3SPHA 1F4MA 1JX9A 2DWEC 5B1BC 2ATKC 1K4DC 1W0KG 3SPCA 4HAMA 2EZOA 2EZPA 1QR9A 2HLDG 1M56C 1Y4MA 2EILB 2HG5C 1TUEB 1NBMG 1S5HC 5B1OA 3EHBB 2KB1A 1VQOV 1FS0G 1HWYA 2QM7A 4X89A 2P67A 5L3DA 1FXVA 1R3JC 1OCOC 1XL6A 1H38A 3STZC 1NQTA 4L87A 1F4NA 2X0LA 4MVZA 2Q69A 3E89A 4U7NA 4XBFA 3MHHC 4UV8A 1JVMA 2ZD9A 4PELA 5KUKA 3CCQV 2WLJA 3IC7A 4KP4A 1NVPB 4WFAV 4UVCA 4LCUC 2WPDG 3G71V 3ABLB 3MHSC 1PKXA 4MW8A 1GM7A 3OMNB 1THZA 4P9PA 1JOYA 1K73W 2ZDIC 4QPJA 1YHQV 1OCCC 2Q67A 1EBOA 2UXNA 4JYBA 4P9OA 2W6IG 3KG2A 3TETA 2QKSA 5H6RA 2WLKA 4ZBMA 3LSQA 4BW5A 4FPPA 4X88A 3X2QB 3H01A 1AI5A 1S77D 3E35A 1ORQC 4PA9A 2HJFC 3JYCA 4GCZA 1KKDA 3CP1A 4TWKA 5LHIA 4LC1A 1VQNV 2XAJA 1V54B 4N23A 3E2EA 2EIMC 2ZXWB 3OEHG 4ASUG 3RVYA 5EBMC 4MSWC 1QBZA 1H8HG 4R50A 1V54C 2JEUA 2X6BA 1WPXA 4TT3G 5LBQA 5B1AC 3QO5A 3W7WA 1M57B 4RUEA 3ZMVA 1NVPD 3K04A 3A0RA 4WCEV 3ETEA 3UKMA 3K03A 2WSSG 3AG2C 1NR7A 3ABKC 1M57C 2B1IA 1AI4A 1YJNV 1I5YA 3LUTB 5IY5B 3JD2A 2YSUB 2IH1C 2XAGA 3CMAV 3AG3B 1YJ9V 1SERA 3ZRWA 3CXCU 2P7TC 3JD4A 3OMIB 2R9IA 4UXNA 1SETA 1K5QA 2AHZA 4OXSA 1QLEC 3FB5C 3W7XA 5LHHA 4MT8A 3CCVV 5FL7G 4FK5C 1YTFB 4RAIA 3T4DA 3ABMB 2IJHA 4MTGA 1P4RA 3ASOB 3LSSA 1FXKC 3K06A 3CD6V 1CPYA 2XOKG 3I56V 3VBBA 5LGUA 5EK0A 2WLHA 3K08A 4WFGA 1QR8A 3OE7G 2JJ1G 3SYQA 2EIKB 2QA4V 1W0JG 4UUJC 2JDIG 5LGTA 4MS2A 1G8MA 1MG1A 1K97A 5EBLC 4WFBV 2IW5A 1OHHG 1SESA 3WG7C 4MTFA 1ENVA 3P30A 3OGCC 4JAUA 2DYSC 3SYAA 5H6QA 5HFMA 1VQ9V 5CBHA 1YI2V 4KFMA 3RVZA 2OTLV 2WAMA 4DO2A 2HFEC 1YIJV 4FMTA 2EIJB 2MK3A 5CMUA 2R9RB 5B3SC 4GX1A 3AG1C 3D36A 4R8CA 2UXXA 1JQ0A 1OCZC 1PNKA 4HZ3A 1JPXA 5H9CA 3SPGA 3OUSA 1K33A 3ABUA 3IGAC 1Q81W 3TK1A 1E79G 3GB7C 5B1BB 2IJKA 3SJQC 3UM7A 5GW7A 1CP9A 1AJQA 1I5XA 2DQ0A 1KD1W 5B1AB 1VQLV 2EINB 5KA6A 1L1FA 2D3OW 3X2QC 1VQ4V 1GKFA 3OAAG 2Q68A 1QLNA 1COWG 3CPWU 5IYBO 3SYCA 1H8EG 3EFFK 5L3FA 2QTOA 2PI5A 3K9AA 5BZBA 2OCCC 1MOFA 4Z1MG 2V1DA 5KUMA 3ZRWB 1FXKB 1CEZA 1V55C 1UJWB 3GWOA 4GX0A 4HYOA 3CCSV 1Q82W 3ASNC 2NLJC 1EZJA 1M56B 3CCRV 2DYRB 4UVAA 2XASA 1GK9A 4QNHB 1YITV 3ZRVA 2C2AA 1RPRA 1B6QA 1WLEA 3AG2B 4MVSA 1BHBA 3ABTA 1QVGU 1DF5A 1R3LC 1K4CC 4PDRA 1FFTB 2OTJV 2IH3C 3FKSG 1NH2B 4JF3A 3BEHA 1K7DA 1RM1B 3P32A 2OT5A 3B8NA 1AJNA 4UVBA 1VQ5V 4QE9A 1OCRB 1DF4A 5J9PC 4WF9V 2JIZG 4XDLA 2WWWA 1MSWD 3I55V 1Q86W 4MVOA 2DW4A 3ETDA 1GMGA 2A9HA 3ZMTA 3AG4B 1NR1A 1OCRC 3QNEA 1QVFU 2M7WA 1R6NA 3F7YC 5L3BA 5EBWC 5L3EA 1IXMA 1PNLA 4GX5A 3D3IA 2HVKC 4XDKA 2X7RB 4G2KA 2QEXV 1DLBA 3G6EV 3DTUB 4YXWG 2HVJC 2X6AA 5IYDO 3STLC 2WLIA 4GX2A 2IJJA 4FJCC 3ABKB 2HR3A 3SPIA 5IY5C 4H33A 2EILC 4MTXA 1BMFG 3ZRXA 1M1KW 2AHYA 3T1CA 2B1GA 4P30A 1BL8A 5C93A 1VQKV 2OCCB 1M90W 1KECA 1PL0A 4JASA 1NKDA 4G27B 3ZIAG 3OR6C 3HPLC 4WFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KG2 A;  2BOB C;  3SPG A;  3OUS A;  4J9Y B;  1P7B A;  4WFE A;  3IGA C;  3TET A;  2QKS A;  2W0F C;  2WLL A;  3E8G A;  2WLK A;  3IFX A;  4ZBM A;  4BW5 A;  3GB7 C;  4MW3 A;  2DYR C;  4CBC A;  4X88 A;  3AG4 C;  1XL4 A;  3SJQ C;  3UM7 A;  2DWD C;  1J95 A;  1R3K C;  5CBF A;  3K0G A;  3OR7 C;  4F4L A;  4PDV A;  2EIJ C;  1ORQ C;  4MVQ A;  4PA9 A;  3E8H A;  4PA4 A;  3TCU A;  2WLM A;  3FB8 C;  2ZXW C;  2HJF C;  4JTD B;  3ASO C;  3JYC A;  3X2Q C;  3PJS K;  2Q68 A;  4JTA B;  4PDL A;  4TWK A;  1KKD A;  3FB6 C;  3HPL C;  3SYC A;  3SYP A;  3EFF K;  3R65 A;  2EIM C;  2K1E A;  2QTO A;  4LBE C;  3RVY A;  3E8F A;  5BZB A;  2OCC C;  5EBM C;  3E83 A;  4MSW C;  3RW0 A;  4R50 A;  3ABL C;  4XDJ A;  1V54 C;  4MVU A;  5KUM A;  2Y69 C;  5EC1 C;  3T4Z A;  4P2Z A;  1V55 C;  2X6B A;  3K0D A;  2X6C A;  5B1A C;  4EKW A;  4GX0 A;  4HYO A;  4RUE A;  3ZRS A;  3F5W C;  3K04 A;  3LDD A;  4PA6 A;  3ASN C;  4MVM A;  3UKM A;  4JTC B;  2NLJ C;  3K03 A;  2A79 B;  2A0L A;  3AG2 C;  3ABK C;  1M57 C;  2H8P C;  4LP8 A;  1G4Y B;  3ZJZ A;  4QNH B;  3LUT B;  3SYO A;  2JK5 C;  4R7C A;  2IH1 C;  3E8B A;  4MVS A;  4RO2 A;  4MVR A;  3LDE A;  4I9W A;  4X8A A;  2P7T C;  1R3L C;  4PDR A;  1K4C C;  5E1A C;  4MTO A;  3T2M A;  2AHZ A;  4OXS A;  1QLE C;  3FB5 C;  2IH3 C;  1R3I C;  3BEH A;  5EC2 C;  3E86 A;  2ITC C;  4RAI A;  4PA7 A;  3T4D A;  4MTG A;  4R6Z A;  3VOU A;  4H37 A;  4PA3 A;  4QE9 A;  5J9P C;  3K06 A;  3OUF A;  4XDL A;  4QE7 A;  3SPH A;  4MVO A;  2DWE C;  5B1B C;  2A9H A;  2ATK C;  1ZWI C;  3AG3 C;  5EK0 A;  1OCR C;  1K4D C;  2WLH A;  3K08 A;  4WFG A;  3SPC A;  3FB7 C;  4P9O A;  3F7Y C;  5EBW C;  1M56 C;  2HG5 C;  2EIN C;  4GX5 A;  3SYQ A;  1S5H C;  4XDK A;  2HVK C;  2KB1 A;  2WLL B;  4UUJ C;  3RBZ A;  4X89 A;  4MS2 A;  2HVJ C;  1R3J C;  5EBL C;  1OCO C;  1XL6 A;  4RUF A;  2X6A A;  3STZ C;  2YEV A;  3STL C;  2WLI A;  4GX2 A;  3WG7 C;  3F7V C;  2WLN A;  4MTF A;  1LNQ A;  3OGC C;  2BOC C;  4MVZ A;  2DYS C;  2Q69 A;  3E89 A;  3SPI A;  3SYA A;  4DXW A;  5CBH A;  4H33 A;  5IY5 C;  1JVM A;  2ZD9 A;  4KFM A;  2EIL C;  3RVZ A;  3SPJ A;  2AHY A;  3T1C A;  5KUK A;  2WLJ A;  2EIK C;  2Q6A A;  4WFF A;  2ITD C;  4P30 A;  1BL8 A;  3LNM B;  2HFE C;  4LCU C;  4MW8 A;  4G28 B;  2WLI B;  2R9R B;  4P9P A;  4GX1 A;  5B3S C;  3AG1 C;  4R8C A;  4J9Z B;  4G27 B;  4PDM A;  3ABM C;  1OCZ C;  3OR6 C;  5CBG A;  4HZ3 A;  1OCC C;  4WFH A;  3LDC A;  2Q67 A; 
#chains in the Genus database with same CATH topology
 3ASN B;  1P7B A;  3E8G A;  4K35 A;  2LP7 A;  2QR4 A;  4AHC A;  4EFE A;  1EN6 A;  4FFK A;  4JPR A;  5EZY B;  5KMG B;  4PA4 A;  3TCU A;  5LHG A;  2QM4 A;  1ZL8 B;  3VQW A;  1H2G A;  4DR1 B;  1HDJ A;  4DV3 O;  3SYP A;  4J10 A;  1BGY H;  3CE2 A;  1XOU A;  1YSC A;  1HNX B;  4JI4 O;  2IU3 A;  3T4Z A;  3CC7 V;  3IJ4 A;  3ZBH A;  1I94 O;  4MVM A;  4DV7 B;  3H1H H;  1Q7Y W;  2HEP A;  3ZN1 A;  2DYS B;  4CC6 A;  3W7U A;  1OCZ B;  4X1K A;  1GN2 A;  3CCU V;  1TAE A;  1FD9 A;  4I9W A;  1XI1 A;  2LO1 A;  1R6K A;  5JCO C;  2FTK A;  4NVP A;  3QO7 A;  3VOU A;  4H37 A;  4BIZ A;  4PA3 A;  3L9D A;  1N32 O;  4YJ3 B;  1RSO A;  4DV3 B;  2FB5 A;  1D5A A;  1ZWI C;  2Y48 A;  3JD3 A;  1QNM A;  2UXD O;  1KP2 A;  4BAY A;  3RBZ A;  3SJC C;  4RUF A;  3CB2 A;  1E1R G;  3HB3 B;  3F7V C;  1LNQ A;  4X1I A;  1AI7 A;  4JI0 B;  2PYJ A;  1XMQ B;  2ILM A;  2EIK C;  4YJ3 A;  4JAA A;  4G28 B;  2WLI B;  1UPG A;  3FX7 A;  3CCL V;  5IYC O;  3K3W A;  4MTO A;  3JAK A;  2G38 A;  1BQZ A;  4F6R A;  3CME V;  5IDJ A;  4IYI A;  2CTW A;  1URF A;  2YS8 A;  2E75 B;  4Q20 A;  4LF5 B;  3CRC A;  3B09 A;  3K0G A;  3RFR A;  5FPO A;  2L35 A;  3E8H A;  2F4V O;  3RYI B;  1LR1 A;  4GKK O;  1KP3 A;  1KKC A;  4LFA O;  1SZT A;  1N0N A;  1FXH A;  3B77 A;  4X64 B;  4ABM A;  1K9M W;  4YY3 O;  5JQG A;  5LMN O;  4B7E A;  1KQS U;  4YHH O;  4JTC B;  3M7M X;  1VQP V;  3HR0 A;  3RYH B;  3WB1 A;  3AG1 B;  1BHA A;  5CA1 B;  2NN4 A;  2RN9 A;  5IJ9 B;  3CC2 V;  4J80 A;  1VQ6 V;  4W4L A;  4LFC B;  1JCH A;  4TV8 A;  4GUN A;  4PA7 A;  5LP6 B;  5D5Q A;  1FAF A;  1N33 O;  3D36 C;  4DR1 O;  2LFS A;  3OUF A;  5DN6 G;  3SJB C;  3KZI Z;  4QE7 A;  4CS3 A;  4HAM A;  1QR9 A;  4JYA O;  1JFF B;  5IYZ A;  1MMM A;  5J2U B;  3RYH A;  1NTK H;  2R70 A;  2JGU A;  2KB1 A;  1HP8 A;  4BWA A;  1EN5 A;  5L3D A;  2P67 A;  1PP9 H;  1H38 A;  2R72 A;  1NQT A;  1R6T A;  1DK1 A;  1NTM H;  4XBF A;  2CAZ C;  4PEL A;  1N34 B;  3IC7 A;  4KP4 A;  2Z0A A;  1NVP B;  3ZHQ A;  4LCU C;  3ABL B;  2F1M A;  4P9P A;  1JOY A;  3QVN A;  2CUG A;  3TXS A;  1OCC C;  1WN7 A;  2Q67 A;  1X4T A;  1ZTE A;  4CH6 A;  2QKS A;  4BW5 A;  3VQY A;  4LF8 O;  3X2Q B;  2ZIM A;  1AI5 A;  2UXC O;  3E35 A;  1ZUQ A;  1VF6 C;  3JYC A;  3A0B Z;  1JJO A;  4LC1 A;  2Y4U A;  1HNX O;  4MSW C;  4JI4 B;  1QBZ A;  2VS0 A;  3GVM A;  3JAT B;  5KHG A;  2P4K A;  1XMQ O;  4TT3 G;  4JI1 O;  3W7W A;  3ETE A;  4X20 A;  2VQE B;  2D2C B;  3K03 A;  3BRC A;  1NR7 A;  1M57 C;  2B1I A;  3BPZ A;  2AZ2 A;  5B66 Z;  2HP8 A;  3NR7 A;  3TXQ A;  2ODM A;  3AG3 B;  1YJ9 V;  5IWA B;  2P7T C;  3JD4 A;  3W7X A;  5J2U A;  5LHH A;  2ZE5 A;  2EUL A;  4IHJ B;  3CEI A;  4X66 O;  3K06 A;  1GN3 A;  4EB6 A;  4DK1 A;  4LR3 A;  4B08 A;  3K5L A;  5LGU A;  5EK0 A;  4NKG B;  3T1Y O;  2JJ1 G;  1W0J G;  2UUA B;  3H9V A;  2IW5 A;  1OHH G;  1SKV A;  1SES A;  2RCV A;  1IDS A;  3MAQ A;  4KXR A;  2P4V A;  3SYA A;  4I55 A;  1VQ9 V;  5CBH A;  1HNW B;  1SF9 A;  3L71 H;  4GZR B;  4R8C A;  2UXX A;  4HZ3 A;  2JGD A;  3B40 A;  3HKB A;  1BSM A;  1E79 G;  1AP5 A;  4YY3 B;  4I0X A;  2IJK A;  3UM7 A;  5LMN B;  5GW7 A;  4ZI7 A;  2UUB B;  2LJ2 A;  1VQL V;  5C8Y A;  5KA6 A;  1EN4 A;  3UT5 B;  4I4T A;  2D3O W;  1VQ4 V;  2QKC A;  2XTA A;  5L3F A;  1MOF A;  1XMO B;  3AK3 A;  4Z1M G;  1X59 A;  2V1D A;  1Q8I A;  2DOS A;  3GWO A;  5KHK A;  5CA0 B;  1Q82 W;  4K0K B;  1N33 B;  1GN4 A;  1EZJ A;  2XUM A;  4JZ2 A;  1KBH A;  1LUW A;  3CCR V;  2WA4 A;  1Q43 A;  2C2A A;  3K58 A;  1BHB A;  3JSN A;  3QTC A;  4B3M B;  2VRZ A;  1FFT B;  2W0X A;  3P32 A;  5GTI Z;  4YJ2 A;  1AJN A;  4QE9 A;  4DV0 O;  1DF4 A;  4DV1 O;  3L70 H;  4XDL A;  2WWW A;  3F5T A;  3ZMT A;  2A9H A;  3QNE A;  4J7Z A;  1WNS A;  5EBW C;  5L3E A;  1TUB B;  2HVK C;  1P49 A;  1DLB A;  3G6E V;  4IHJ A;  4YXW G;  1IVS A;  4O4J B;  1G1X B;  1Z2G A;  5JQG B;  3STL C;  2UUA O;  4GX2 A;  4J7J A;  3O65 A;  2KG7 B;  3K5M A;  3SPI A;  4B3T B;  5IY5 C;  2AZ0 A;  2EIL C;  2CGO A;  2CTP A;  3DXR A;  2GTS A;  4P30 A;  1KEC A;  4Z2W A;  3CJH B;  2FL4 A;  4JAS A;  1QQC A;  2AXT Z;  3ZIA G;  4UB8 Z;  5JH7 B;  2XAQ A;  3N2G A;  4WFE A;  1YTF D;  3OMA B;  4LF8 B;  3IFX A;  1HNZ B;  1XBL A;  1QCE A;  4UV9 A;  4DUY O;  5CBF A;  4J42 A;  1N36 O;  1XNQ B;  4PDV A;  1PNM A;  2BE3 A;  2WLM A;  2QWN B;  3BY6 A;  2YXH A;  3OGI B;  2XND G;  2HJD A;  5CB4 A;  3QO8 A;  1RM1 C;  4X65 B;  4JGS A;  4LBE C;  4O2B B;  4L8J A;  1YJW V;  3ABL C;  4PHZ A;  3CRR A;  4LF7 O;  4MVU A;  2Y69 C;  4ZI7 B;  1GO3 F;  2LW7 A;  3AK1 A;  3DSQ A;  1PV0 A;  4E4E A;  2H8P C;  1R1B A;  3WFV A;  1G4Y B;  1FJG B;  2ZNJ A;  1WP8 A;  2ZR2 A;  3LDE A;  4JI3 O;  3J7A U;  2CGN A;  1N8R W;  4BR6 A;  1HNZ O;  2E5L O;  3T2M A;  5IYZ B;  2W6J G;  2ADP A;  1I7F A;  1VQM V;  1YVW A;  4R6Z A;  2VWJ A;  1TVK A;  4DV4 O;  2IM9 A;  1FFX A;  5DM6 V;  1WB8 A;  4JV5 B;  1SQP H;  4ZOL B;  2YXY A;  3CC4 V;  2EJ7 A;  2P6J A;  1E1Q G;  1K92 A;  3HKE A;  3QF7 A;  1OZ0 A;  1ZLZ A;  2YEV A;  2H3O A;  4X20 B;  1PD3 A;  5BR8 O;  2BOC C;  2Z3Y A;  1FXK A;  4LF9 B;  4DXW A;  2ZR3 A;  2CDY A;  3BAA A;  5JVD A;  3LNM B;  5CN0 A;  2GHY A;  4DV5 B;  3C90 A;  4JI7 B;  5EYP B;  1R73 A;  1SQG A;  3MD0 A;  1Y76 A;  3ABM C;  3U11 A;  4F6R B;  1AR1 B;  1GM8 A;  4B3S O;  4J9Y B;  2QM8 A;  3EVK A;  5E79 Z;  1EFR G;  4DR4 O;  4RQF A;  2GV9 A;  2QSA A;  5K1X A;  1V55 B;  4JI8 B;  4X62 O;  3FB8 C;  4JTD B;  1I0H A;  2Q9L A;  1SQX H;  2ZDI A;  3CCM V;  4X1K B;  4FLT A;  1YXB A;  5IT9 N;  2BSK A;  4DW1 A;  3H1L H;  1XMO O;  4E2L A;  5HFL A;  3UQ8 A;  4LH6 A;  3ZRS A;  2CK3 G;  4LF4 O;  2JS3 A;  4CS4 A;  4GLX A;  2JEX A;  3JCZ A;  3ETG A;  1KC8 W;  4O2A A;  2PI4 A;  3HKE B;  1WJZ A;  3K79 A;  4FM1 A;  4RO2 A;  4RQE A;  2P90 A;  2Z5U A;  3M99 B;  1MAB G;  1K8A W;  1I08 A;  4B3M O;  1R3I C;  4D7S A;  2ITC C;  5KA5 A;  5F2V O;  1SRY A;  5IJ0 B;  3ZHV A;  1F4M A;  5IE9 A;  2DWE C;  4UB6 Z;  1K4D C;  1W0K G;  3H1K H;  2HLD G;  1Y76 B;  1Y4M A;  2HG5 C;  2UUB O;  2YUA A;  5LOV A;  4FFB B;  2XT9 A;  1VQO V;  4LFB B;  1FS0 G;  4NR1 A;  4JI6 B;  1FXV A;  4TQF A;  4DV6 O;  4DR3 O;  3T1H O;  5A9G A;  1S5J A;  1Y67 A;  3JAK B;  3E89 A;  4U7N A;  3MHH C;  4UV8 A;  5KUK A;  4DRX A;  2FYU H;  4UVC A;  4JI5 O;  3G71 V;  1N0J A;  5LMU O;  4I9Q A;  4MW8 A;  1GM7 A;  1K73 W;  1BT8 A;  4GKK B;  4QPJ A;  4LF7 B;  4P9O A;  1EBO A;  2UXN A;  3JAM N;  4KL1 A;  4B3S B;  4U3F H;  5H6R A;  2WLK A;  1V9P A;  3LSQ A;  4X88 A;  1SQB H;  4H0L B;  2QWQ B;  1EZV H;  3SGI A;  2ZE6 A;  3DC5 A;  2PZS A;  1XRE A;  1KKD A;  1L8D A;  1XIL A;  1VQN V;  4AQY O;  3E2E A;  4ASU G;  3AK2 A;  3RVY A;  4YIP A;  5KAF Z;  5ITZ A;  5LXT A;  3JAW B;  1QU7 A;  2X6B A;  1IBK B;  3QO5 A;  1NVP D;  3K04 A;  4X9Q A;  3A0R A;  1U97 A;  3UKM A;  1VMG A;  1JR9 A;  3THO A;  2PYL A;  2KKW A;  4DR2 O;  2F23 A;  3WB0 A;  2YSU B;  2XAG A;  4DV2 B;  4I4T B;  4JI3 B;  1SER A;  1Z5V A;  3CXC U;  2VWK A;  3OMI B;  2R9I A;  2AHZ A;  3BA8 A;  3ZHT A;  2UXB O;  3GWK C;  2IJH A;  5BR8 B;  2V4D A;  1P4R A;  3ASO B;  3LSS A;  4EFB A;  1FXK C;  2Q5Z A;  5KLV H;  5CA0 A;  1CPY A;  4UCU A;  1Q6H A;  2ZT9 B;  1XNQ O;  1QR8 A;  3RYC A;  4LWS B;  2QA4 V;  3ZHS A;  4UUJ C;  3SDL A;  2JDI G;  2VQF O;  1K97 A;  4LF6 O;  4WFB V;  3WG7 C;  3BFR A;  4JAU A;  3E22 A;  2YDE A;  4KFM A;  3RVZ A;  1NI8 A;  4OPA A;  2OTL V;  2UXC B;  4J11 A;  5H5N A;  2HFE C;  3BCC H;  4FMT A;  2MK3 A;  1TGO A;  3D36 A;  1JQ0 A;  2BTQ B;  1Q81 W;  1FFX B;  2A3Q A;  4DR5 O;  3TK1 A;  5B1B B;  1CP9 A;  2PY5 A;  2DQ0 A;  5JCO A;  3CHX A;  1B3Q A;  2EIN B;  2YIB A;  2Q8V A;  1L1F A;  1Q6I A;  3X2Q C;  1P7G A;  3OAA G;  2Q68 A;  1QLN A;  1COW G;  3CPW U;  4JI6 O;  1H8E G;  2PI5 A;  2OCH A;  4LFC O;  1V55 C;  1U96 A;  1VP7 A;  4LF4 B;  4JI2 O;  3L75 H;  3ASN C;  1L0L H;  2NLJ C;  4DR6 B;  5ITZ B;  1YIT V;  5DEC A;  2KQX A;  1B6Q A;  3ABT A;  1DF5 A;  1US6 A;  1K4C C;  3EXA A;  4LWS A;  4U3J A;  1IBL B;  1K7D A;  2OT5 A;  4H13 B;  4UVB A;  1VQ5 V;  5FPR A;  1OJH A;  1DGS A;  4DR4 B;  1MSW D;  3I55 V;  4O4I B;  2DW4 A;  1GMG A;  3AG4 B;  1NR1 A;  1S5L Z;  5KHJ A;  1QVF U;  4EEQ A;  1R6N A;  5L3B A;  4UFZ A;  2HHH O;  4FZ1 A;  3T1Y B;  4GX5 A;  4G2K A;  1OV9 A;  5B5E Z;  1T5E A;  2KG7 A;  3JSL A;  4HNA A;  1SQQ H;  3ABK B;  3D8C A;  3B4S A;  4H33 A;  4MTX A;  3N27 A;  5JWP A;  1M1K W;  3CJH A;  5C93 A;  5KX5 A;  1VQK V;  2OCC B;  5IJ9 A;  4PI2 A;  2CE4 A;  3FD9 A;  1ZSP A;  1O9G A;  5LMU B;  4OGQ B;  5BY1 A;  1NKD A;  3OR6 C;  4TOI A;  3HPL C;  4CS2 A;  2Q0A A;  1NJI W;  1Z5W A;  2XAH A;  4B3T O;  2EJR A;  1S72 V;  2CH7 A;  3CCJ V;  4MVQ A;  3KCX A;  1Y74 B;  4DR2 B;  4B3R O;  4DV7 O;  3JAS A;  4DR7 B;  4NB5 A;  1AP6 A;  3AEI A;  3R65 A;  2ZQM A;  2CTQ A;  3E83 A;  4FIP C;  3DC6 A;  3WB2 A;  1W2B U;  4P2Z A;  3K0D A;  4DUY B;  2N74 A;  4LNU B;  1OCC B;  4BIU A;  4PA6 A;  2OWO A;  1JJ2 U;  3HKC B;  4LP8 A;  4Z1V A;  5BMV A;  2ZIO A;  2DQ3 A;  4I50 B;  4FLV A;  2JS5 A;  1TUB A;  1N36 B;  1RSO B;  3E86 A;  3K9S A;  1SS3 A;  3W7T A;  3OM3 B;  3C3S A;  3WG7 B;  1H2M A;  1Y66 A;  3AG3 C;  4D7T A;  4EB6 B;  5LXT B;  1F23 A;  1OCO B;  2EIN C;  3DXR B;  4CZZ A;  5CA3 A;  2WLL B;  3VQX A;  1H2N A;  5LGN A;  5LP6 C;  1AR5 A;  2VQF B;  3G4S V;  2GBO A;  2WLN A;  3OTO O;  3OFN G;  3SPJ A;  1XEQ A;  3M8A A;  2QWR B;  4WFF A;  5IJ0 A;  2ITD C;  4JYC A;  4I5S A;  1VQ7 V;  2JGD B;  3CCE V;  2LGQ A;  2O57 A;  4PDM A;  5CBG A;  4DUZ B;  1W59 A;  4UCR A;  2ETN A;  1ROP A;  2BOB C;  2JRI A;  3ML0 A;  2W0F C;  2WLL A;  1Q5O A;  1XHZ A;  4JV5 O;  2DYR C;  3JD1 A;  2DWD C;  2Y69 B;  1R3K C;  1A32 A;  1XHX A;  3OR7 C;  1RPO A;  2HHH B;  2EIJ C;  3APO A;  1K34 A;  3CX5 F;  4DR6 O;  3DGE A;  3PJS K;  4JTA B;  4PDL A;  3FB6 C;  3HKC A;  5L3G A;  3RN4 A;  2K1E A;  2ZIN A;  1M9N A;  4XDJ A;  5BXZ A;  1IBL O;  5B1N A;  2CH7 B;  3RT3 C;  4I55 B;  3BA9 A;  3J81 N;  5JVD B;  4JI8 O;  3LDD A;  4DYL A;  4DV0 B;  5H2F Z;  2A79 B;  2A7W A;  3ZJZ A;  2NNU A;  1VQ8 V;  2F43 G;  4TQD A;  4MVR A;  2Q7E A;  1SA0 B;  5E1A C;  2P5O A;  1BQ0 A;  1NTZ H;  1KYO F;  2BTO A;  3NXS A;  5EC2 C;  2VQE O;  2E76 B;  3ZMZ A;  5GTH Z;  3S3X A;  2Q4P A;  4B3R B;  3OEE G;  2GUZ A;  1JX9 A;  2RDC A;  4KHP B;  5B1B C;  2ATK C;  2YID A;  3SPC A;  2EZP A;  2P22 C;  2AGA A;  1M56 C;  2EIL B;  3JAR B;  1TUE B;  1NBM G;  1S5H C;  3K5N A;  3EHB B;  1HWY A;  4UCS A;  4HBN A;  1R3J C;  3RYF A;  4NTX A;  1OCO C;  1XL6 A;  3STZ C;  4L87 A;  4FM0 A;  1SQF A;  2X0L A;  4MVZ A;  4A5U B;  4PV1 B;  5K1P A;  3CCQ V;  2F4V B;  1KMI Z;  2FML A;  4WFA V;  2UU9 B;  2WPD G;  4O4L B;  1THZ A;  4U3J B;  4NXM B;  3CRQ A;  2ZDI C;  1YHQ V;  4IL6 Z;  4JYB A;  4FVM A;  2W6I G;  4DUZ O;  4OX9 O;  1IX9 A;  3G80 A;  4ZBM A;  1ZL8 A;  4PJ0 Z;  3C3T A;  2MW2 B;  1S77 D;  2DE0 X;  4FLY A;  4X1Y A;  4PA9 A;  4ZHQ B;  2HJF C;  2ZE8 A;  4GCZ A;  4TWK A;  1SA0 A;  5LHI A;  3PN1 A;  5EZY A;  4N23 A;  2EIM C;  2ZXW B;  2UUC B;  1FKA O;  5EBM C;  1H8H G;  4IIJ B;  1V54 C;  5LBQ A;  5B1A C;  4AIL C;  4RUE A;  1H2S B;  5KAI Z;  4WCE V;  2ZE7 A;  4JI5 B;  3L73 H;  4X66 B;  1XNR O;  3AG2 C;  2KSD A;  1HW7 A;  1AR4 A;  1IBM B;  1YJN V;  2QWO B;  2IH1 C;  3APQ A;  4ZHQ A;  4JYA B;  3CWB H;  2QWP B;  5A2Q N;  1SET A;  4OXS A;  1QLE C;  3FB5 C;  3CCV V;  1VF6 A;  1BZK A;  2QTS A;  4RAI A;  3OTO B;  2YIA A;  1Y6X A;  4W4K A;  3CD6 V;  2XOK G;  3I56 V;  5LYJ A;  3VBB A;  4IGG A;  1N4C A;  4I0X B;  2ZM6 O;  3OE7 G;  1Q6U A;  4RWU A;  2EIK B;  1EM1 A;  1NS1 A;  5KX5 B;  2E3C A;  5EBL C;  5JJJ B;  4I7Z B;  2QKA A;  1ZAU A;  1H2K A;  5LL6 Y;  4MTF A;  1ENV A;  3P30 A;  4DV1 B;  5H6Q A;  5HFM A;  1VAR A;  2ZNI A;  4TV9 B;  1UFI A;  5BMV B;  1CXZ B;  3BHP A;  1YIJ V;  4UCT A;  2P06 A;  2LQT A;  5CMU A;  1Y74 A;  5B3S C;  5EIB D;  3AG1 C;  1D5N A;  4JZG A;  1JPX A;  5H9C A;  3OUS A;  3N2K B;  1K33 A;  3ABU A;  5AG2 A;  3SR2 C;  2B9Z A;  1GH6 A;  3HKD B;  5C8Y B;  2F66 C;  1AJQ A;  4ZOL A;  1KD1 W;  5B1A B;  1HR0 B;  1XQ8 A;  4YJ2 B;  2NR5 A;  2Y0I A;  1GKF A;  2BCC H;  4TV9 A;  5IYB O;  3BAB A;  2QTO A;  3Q4H A;  3K9A A;  5LA6 B;  2OCC C;  1AB3 A;  1SC5 B;  1FXK B;  2PGG A;  1AIL A;  4GX0 A;  4HYO A;  2GTA A;  2F93 B;  4O2A B;  4UCV A;  4IT5 A;  3N2K A;  1B04 A;  4UVA A;  2XAS A;  4QGP A;  4NXM O;  1GK9 A;  4QNH B;  1RPR A;  5JJE B;  3CS5 A;  1R3L C;  2A06 H;  2Q7G A;  3IC9 A;  4LF6 B;  1JA8 A;  2IH3 C;  3FKS G;  1NH2 B;  3BEH A;  3QG5 A;  4K0K O;  1I94 B;  1N32 B;  2F95 B;  3JAL B;  1KUQ A;  5J9P C;  1RP3 B;  1FJG O;  4MVO A;  3ETD A;  4DK0 A;  2M7W A;  3F7Y C;  1IXM A;  3D3I A;  4ICG A;  2QEX V;  2XHB A;  1H2L A;  1Q90 D;  4I50 A;  2DMX A;  2RMK B;  2X6A A;  5IYD O;  3IAY A;  3G6B A;  2QJ1 A;  4FJC C;  5KMG A;  3LNN A;  3H1J H;  3K5O A;  1BMF G;  2AHY A;  4O4H B;  4K8Z A;  2B1G A;  1BL8 A;  4OPH A;  1M90 W;  1P84 F;  1PL0 A;  3CRA A;  4BIO A;  4G27 B;  3WU2 Z;  4WFH A;  3K57 A;  3RGB A;  4NTY A;  2IJI A;  2HKO A;  4TSF G;  4LF5 O;  2EX3 A;  1AI6 A;  1QLE B;  1XL4 A;  4TUY A;  4JI0 O;  1MNG A;  1KB9 F;  1BCC H;  4F4L A;  2IU0 A;  2M6Y A;  5LOV B;  4IYH A;  1SQV H;  2Q7H A;  1K3E A;  4HNA B;  1IZ3 A;  1DTO A;  3HKD A;  4QIW F;  3ZHU A;  4DW0 A;  4EKW A;  4YHH B;  2YEV B;  2A0L A;  2K9P A;  2FKX A;  4GKJ B;  2YIC A;  5B3S B;  4X1I B;  4TUY B;  3SYO A;  2JK5 C;  3FYI B;  4R7C A;  3E8B A;  3ZMU A;  5KHI A;  3ZHR A;  1S76 D;  4LFA B;  3G67 A;  4GT1 A;  1WPB A;  1MZF A;  3JCU Z;  4GYC B;  5EYP A;  3CRM A;  5J2T A;  5L3C A;  2B5U A;  3I5D A;  3A0H Z;  1NU1 H;  2PF4 E;  2YXL A;  3JAS B;  4CH4 A;  2PUS A;  3H1I H;  5CA1 A;  3RWR D;  1TVK B;  4QPK A;  3O9O A;  3L72 H;  4U7O A;  3FB7 C;  3U10 A;  2WA3 A;  1WA8 B;  1AVM A;  1GM9 A;  5IWA O;  1NH2 D;  2GSM B;  2V7Q G;  3ZED A;  3W7S A;  1M4U A;  3JAL A;  5FNV A;  3ZMS A;  1ZX3 A;  3P3P A;  2UUC O;  2JJ2 G;  1XDC A;  1BE3 H;  2ADQ B;  1N34 O;  1YZB A;  2AW9 A;  2Q6A A;  4X62 B;  1J5E O;  4PI0 A;  2EBO A;  3FFQ A;  1GAX A;  3FAV B;  4J9Z B;  4KUM A;  4PD4 F;  3LDC A;  4DV6 B;  4DR3 B;  3ZS8 C;  3KKY A;  4NXN B;  3OT7 A;  1IUR A;  1AJP A;  5TIS Z;  4MW3 A;  4CBC A;  4D6T H;  3AG4 C;  2H94 A;  1S3J A;  1J95 A;  4TV8 B;  4N21 A;  1HR0 O;  2EIM B;  2ZXW C;  3D3Q A;  3ASO C;  3VQV A;  3E8F A;  3RW0 A;  4QJF B;  4ZKI A;  1JFF A;  5EC1 C;  4AI8 A;  2E5L B;  3BVO A;  4Q6G A;  2X6C A;  3CYO A;  3F5W C;  3ZCC A;  3R66 A;  2XAF A;  1D2D A;  3JD0 A;  1YDX A;  2Y0P A;  3FYE B;  3OW2 U;  1GTO A;  4GKJ O;  1F51 A;  1MZE A;  3TGU H;  4JAV A;  4WBN A;  1O9H A;  1ARO P;  4X8A A;  4NXN O;  3B8M A;  1M93 A;  2QE7 G;  1IBK O;  1XUQ A;  2ARH A;  1JMK C;  5FNV B;  3ZN0 A;  2LFR A;  3T1H B;  1PL4 A;  1S0V A;  1K5S A;  3SPH A;  3JAR A;  2EZO A;  4DV2 O;  4DV5 O;  1GN6 A;  5B1O A;  2QM7 A;  4X89 A;  1KU9 A;  2RQ6 A;  1F4N A;  3LSU A;  2Q69 A;  4O4J A;  1JVM A;  2ZD9 A;  1MA1 A;  4FM2 A;  1G6U A;  1YEW A;  1HNW O;  2WLJ A;  5KHH A;  2OIE A;  5JH7 A;  3JAT A;  4LFB O;  3MDS A;  3MHS C;  5EIB C;  1PKX A;  4DR7 O;  3OMN B;  1Q3E A;  1VIB A;  3KG2 A;  3TET A;  1TA8 A;  2N05 A;  4FPP A;  3H01 A;  1RFY A;  5D5P A;  1ORQ C;  4FFB A;  1WP7 A;  5FLX N;  4FZ0 A;  4FLU A;  3CP1 A;  1L0N H;  1FYJ A;  2XAJ A;  1V54 B;  3S3W A;  3OEH G;  4WBN B;  1LUV A;  3HKB B;  4R50 A;  2JEU A;  2PTM A;  2IBZ H;  4FLW A;  1WPX A;  1M57 B;  1B06 A;  1GRJ A;  3ZMV A;  4CC5 A;  4DRX B;  2UXB B;  4O4H A;  2UU9 O;  3UO3 A;  2N04 A;  1WAZ A;  2WSS G;  3ABK C;  1SZX A;  4KHP O;  3E22 B;  1AI4 A;  1I5Y A;  4J41 A;  3LUT B;  5IY5 B;  3JD2 A;  3CMA V;  1FPO A;  1VF7 A;  1QHT A;  4H44 B;  3ZRW A;  4OX9 B;  1VEW A;  2JVD A;  2E74 B;  4UXN A;  1K5Q A;  4MT8 A;  1F7Y A;  5FL7 G;  4FK5 C;  1YTF B;  3A2F A;  3T4D A;  2R9A A;  3ABM B;  4MTG A;  3RYF B;  3K59 A;  4JI2 B;  1IXB A;  4IIJ A;  2GDS A;  1IBM O;  2BTQ A;  4FLX A;  4YIO A;  3RYC B;  2WLH A;  3K08 A;  4WFG A;  2Q73 A;  1YCI A;  3JAW A;  1J5E B;  3CSX A;  3OTF A;  3SYQ A;  3UT5 A;  2UXD B;  5LP6 A;  5LGT A;  1PM9 A;  1G8M A;  1MG1 A;  4MS2 A;  5JJN B;  2BSK B;  4ZIB A;  3OGC C;  4C7U A;  1NZ6 A;  2DYS C;  2YI9 A;  3P3N A;  4DR5 B;  4CH5 A;  1YI2 V;  4B7K A;  2YIB D;  4JYY A;  2WAM A;  4FLZ A;  2QDO A;  4DO2 A;  4X1Y B;  2EIJ B;  1VF5 B;  5GON A;  2CTR A;  5LYJ B;  1BS3 A;  2R9R B;  4GX1 A;  4AQY B;  2LGW A;  2LW1 A;  1OCZ C;  1PNK A;  3ZX6 A;  1WB7 A;  3SPG A;  4J7K A;  3IGA C;  4K8X A;  4LH7 A;  3GB7 C;  4LF9 O;  3SJQ C;  2ZM6 B;  1I5X A;  3U0Z A;  3SYC A;  3EFF K;  3OD4 A;  4O4I A;  2Y4T A;  5BZB A;  4X64 O;  1MSD A;  1M5I A;  5KUM A;  2OIG A;  3ZRW B;  1CEZ A;  1UJW B;  3CCS V;  2YC0 A;  4F6E A;  3CXH F;  2YI8 A;  1M56 B;  2DN9 A;  3TJT A;  3A8T A;  4BW9 A;  1XNR B;  2DYR B;  2L6L A;  3ZRV A;  4O2B A;  1WLE A;  3AG2 B;  4MVS A;  3KCY A;  1YF2 A;  2DJV A;  4X65 O;  3L74 H;  1QVG U;  4PDR A;  2OTJ V;  3B2E E;  1WA8 A;  4JF3 A;  1RM1 B;  4NYK A;  3UO2 A;  2Q0O C;  3J80 N;  2RJZ A;  3Q4H B;  5LA6 A;  4DV4 B;  1PPJ H;  3B8N A;  2ZKO A;  1OCR B;  4WF9 V;  2JIZ G;  2OYQ A;  1Q86 W;  1NT2 B;  3ETQ A;  3AG7 A;  4NTW A;  1OCR C;  4UCO A;  3SJA C;  2GUZ B;  1PNL A;  3N2G B;  4XDK A;  2X7R B;  4CH3 A;  3DTU B;  5GON B;  4JI1 B;  5CB4 B;  2HVJ C;  5DED A;  2WLI A;  2IJJ A;  3FAV A;  3ICX A;  2HR3 A;  2RNB A;  2ZCE A;  5J2T B;  3ZRX A;  2QGN A;  3T1C A;  4LNU A;  3UCS C;  4JI7 O;  3RYI A;  4O4L A;  4K3A A; 
#chains in the Genus database with same CATH homology
 3ASN B;  2IJI A;  2XAQ A;  1P7B A;  2HKO A;  4WFE A;  1NJI W;  1YTF D;  4TSF G;  3OMA B;  2XAH A;  3E8G A;  3IFX A;  2LP7 A;  1AI6 A;  1QLE B;  1QCE A;  1XL4 A;  2EJR A;  4UV9 A;  1S72 V;  5CBF A;  4JPR A;  4F4L A;  2IU0 A;  4PDV A;  1PNM A;  3CCJ V;  4MVQ A;  4PA4 A;  3TCU A;  2WLM A;  5LHG A;  3BY6 A;  1H2G A;  2XND G;  3QO8 A;  3SYP A;  3AEI A;  3R65 A;  2ZQM A;  1RM1 C;  4JGS A;  4LBE C;  1K3E A;  1DTO A;  3E83 A;  4FIP C;  4QIW F;  1YJW V;  3ABL C;  1YSC A;  4MVU A;  2IU3 A;  2Y69 C;  3T4Z A;  4P2Z A;  1W2B U;  3K0D A;  3CC7 V;  1GO3 F;  4EKW A;  1OCC B;  4BIU A;  4PA6 A;  4MVM A;  2YEV B;  2A0L A;  1Q7Y W;  2H8P C;  1JJ2 U;  3ZN1 A;  3WFV A;  5B3S B;  2DYS B;  4LP8 A;  1G4Y B;  3SYO A;  2JK5 C;  3W7U A;  1OCZ B;  3FYI B;  2ZR2 A;  2DQ3 A;  4R7C A;  3E8B A;  3ZMU A;  3CCU V;  1S76 D;  3LDE A;  4I9W A;  1N8R W;  4GT1 A;  1R6K A;  3T2M A;  2W6J G;  2FTK A;  5L3C A;  3E86 A;  2B5U A;  3QO7 A;  1VQM V;  4R6Z A;  3VOU A;  4H37 A;  4BIZ A;  4PA3 A;  3W7T A;  5DM6 V;  3OM3 B;  3WG7 B;  1Y66 A;  4QPK A;  3AG3 C;  1ZWI C;  4U7O A;  2Y48 A;  3FB7 C;  3JD3 A;  3CC4 V;  2P6J A;  1E1Q G;  1F23 A;  1OCO B;  1KP2 A;  2EIN C;  4CZZ A;  5CA3 A;  1GM9 A;  1K92 A;  1NH2 D;  2WLL B;  4BAY A;  3RBZ A;  1OZ0 A;  2GSM B;  2V7Q G;  3W7S A;  5LGN A;  4RUF A;  3ZMS A;  2YEV A;  1E1R G;  3G4S V;  3HB3 B;  1PD3 A;  2WLN A;  3F7V C;  1LNQ A;  2JJ2 G;  2BOC C;  2Z3Y A;  1FXK A;  1AI7 A;  3OFN G;  4DXW A;  2ZR3 A;  3SPJ A;  2EIK C;  2Q6A A;  4WFF A;  2ITD C;  3LNM B;  5CN0 A;  2GHY A;  4JYC A;  4I5S A;  1VQ7 V;  3CCE V;  2EBO A;  4G28 B;  2WLI B;  1R73 A;  3CCL V;  3MD0 A;  5IYC O;  4J9Z B;  4PDM A;  3K3W A;  3ABM C;  4KUM A;  1AR1 B;  5CBG A;  1GM8 A;  3LDC A;  4MTO A;  1ROP A;  2BOB C;  4J9Y B;  2QM8 A;  3ML0 A;  1EFR G;  2W0F C;  2WLL A;  5IDJ A;  4RQF A;  3CME V;  1AJP A;  4MW3 A;  2DYR C;  3JD1 A;  4CBC A;  3AG4 C;  2H94 A;  4Q20 A;  1S3J A;  2DWD C;  2Y69 B;  1J95 A;  1R3K C;  1V55 B;  3K0G A;  3OR7 C;  1RPO A;  2EIJ C;  3E8H A;  4N21 A;  3FB8 C;  2EIM B;  1K34 A;  2ZXW C;  3ASO C;  3DGE A;  4JTD B;  3PJS K;  4JTA B;  4PDL A;  3FB6 C;  5L3G A;  1KP3 A;  1SZT A;  2ZDI A;  2K1E A;  3CCM V;  3E8F A;  1M9N A;  3RW0 A;  4QJF B;  4ZKI A;  1FXH A;  4XDJ A;  3B77 A;  5EC1 C;  5B1N A;  4E2L A;  1K9M W;  5HFL A;  2X6C A;  3CYO A;  3ZRS A;  3F5W C;  3LDD A;  3ZCC A;  2CK3 G;  2XAF A;  1KQS U;  3JD0 A;  4JTC B;  2A79 B;  1VQP V;  3FYE B;  3OW2 U;  1GTO A;  1F51 A;  2JEX A;  3JCZ A;  3ETG A;  3AG1 B;  3ZJZ A;  1KC8 W;  2PI4 A;  1BHA A;  2NNU A;  1VQ8 V;  4JAV A;  3K79 A;  4RO2 A;  4RQE A;  2F43 G;  2P90 A;  1ARO P;  4MVR A;  2Z5U A;  4X8A A;  3M99 B;  1MAB G;  3B8M A;  5E1A C;  1K8A W;  3CC2 V;  2QE7 G;  1VQ6 V;  1JCH A;  1R3I C;  3NXS A;  5EC2 C;  2ITC C;  4PA7 A;  3ZMZ A;  5KA5 A;  3ZN0 A;  2LFR A;  1SRY A;  3OEE G;  2LFS A;  3OUF A;  5DN6 G;  1S0V A;  1K5S A;  4QE7 A;  3SPH A;  1F4M A;  1JX9 A;  2DWE C;  5B1B C;  2ATK C;  1K4D C;  1W0K G;  3SPC A;  4HAM A;  2EZO A;  2EZP A;  1QR9 A;  2HLD G;  1M56 C;  1Y4M A;  2EIL B;  2HG5 C;  1TUE B;  1NBM G;  1S5H C;  5B1O A;  3EHB B;  2KB1 A;  1VQO V;  1FS0 G;  1HWY A;  2QM7 A;  4X89 A;  2P67 A;  5L3D A;  1FXV A;  1R3J C;  1OCO C;  1XL6 A;  1H38 A;  3STZ C;  1NQT A;  4L87 A;  1F4N A;  2X0L A;  4MVZ A;  2Q69 A;  3E89 A;  4U7N A;  4XBF A;  3MHH C;  4UV8 A;  1JVM A;  2ZD9 A;  4PEL A;  5KUK A;  3CCQ V;  2WLJ A;  3IC7 A;  4KP4 A;  1NVP B;  4WFA V;  4UVC A;  4LCU C;  2WPD G;  3G71 V;  3ABL B;  3MHS C;  1PKX A;  4MW8 A;  1GM7 A;  3OMN B;  1THZ A;  4P9P A;  1JOY A;  1K73 W;  2ZDI C;  4QPJ A;  1YHQ V;  1OCC C;  2Q67 A;  1EBO A;  2UXN A;  4JYB A;  4P9O A;  2W6I G;  3KG2 A;  3TET A;  2QKS A;  5H6R A;  2WLK A;  4ZBM A;  3LSQ A;  4BW5 A;  4FPP A;  4X88 A;  3X2Q B;  3H01 A;  1AI5 A;  1S77 D;  3E35 A;  1ORQ C;  4PA9 A;  2HJF C;  3JYC A;  4GCZ A;  1KKD A;  3CP1 A;  4TWK A;  5LHI A;  4LC1 A;  1VQN V;  2XAJ A;  1V54 B;  4N23 A;  3E2E A;  2EIM C;  2ZXW B;  3OEH G;  4ASU G;  3RVY A;  5EBM C;  4MSW C;  1QBZ A;  1H8H G;  4R50 A;  1V54 C;  2JEU A;  2X6B A;  1WPX A;  4TT3 G;  5LBQ A;  5B1A C;  3QO5 A;  3W7W A;  1M57 B;  4RUE A;  3ZMV A;  1NVP D;  3K04 A;  3A0R A;  4WCE V;  3ETE A;  3UKM A;  3K03 A;  2WSS G;  3AG2 C;  1NR7 A;  3ABK C;  1M57 C;  2B1I A;  1AI4 A;  1YJN V;  1I5Y A;  3LUT B;  5IY5 B;  3JD2 A;  2YSU B;  2IH1 C;  2XAG A;  3CMA V;  3AG3 B;  1YJ9 V;  1SER A;  3ZRW A;  3CXC U;  2P7T C;  3JD4 A;  3OMI B;  2R9I A;  4UXN A;  1SET A;  1K5Q A;  2AHZ A;  4OXS A;  1QLE C;  3FB5 C;  3W7X A;  5LHH A;  4MT8 A;  3CCV V;  5FL7 G;  4FK5 C;  1YTF B;  4RAI A;  3T4D A;  3ABM B;  2IJH A;  4MTG A;  1P4R A;  3ASO B;  3LSS A;  1FXK C;  3K06 A;  3CD6 V;  1CPY A;  2XOK G;  3I56 V;  3VBB A;  5LGU A;  5EK0 A;  2WLH A;  3K08 A;  4WFG A;  1QR8 A;  3OE7 G;  2JJ1 G;  3SYQ A;  2EIK B;  2QA4 V;  1W0J G;  4UUJ C;  2JDI G;  5LGT A;  4MS2 A;  1G8M A;  1MG1 A;  1K97 A;  5EBL C;  4WFB V;  2IW5 A;  1OHH G;  1SES A;  3WG7 C;  4MTF A;  1ENV A;  3P30 A;  3OGC C;  4JAU A;  2DYS C;  3SYA A;  5H6Q A;  5HFM A;  1VQ9 V;  5CBH A;  1YI2 V;  4KFM A;  3RVZ A;  2OTL V;  2WAM A;  4DO2 A;  2HFE C;  1YIJ V;  4FMT A;  2EIJ B;  2MK3 A;  5CMU A;  2R9R B;  5B3S C;  4GX1 A;  3AG1 C;  3D36 A;  4R8C A;  2UXX A;  1JQ0 A;  1OCZ C;  1PNK A;  4HZ3 A;  1JPX A;  5H9C A;  3SPG A;  3OUS A;  1K33 A;  3ABU A;  3IGA C;  1Q81 W;  3TK1 A;  1E79 G;  3GB7 C;  5B1B B;  2IJK A;  3SJQ C;  3UM7 A;  5GW7 A;  1CP9 A;  1AJQ A;  1I5X A;  2DQ0 A;  1KD1 W;  5B1A B;  1VQL V;  2EIN B;  5KA6 A;  1L1F A;  2D3O W;  3X2Q C;  1VQ4 V;  1GKF A;  3OAA G;  2Q68 A;  1QLN A;  1COW G;  3CPW U;  5IYB O;  3SYC A;  1H8E G;  3EFF K;  5L3F A;  2QTO A;  2PI5 A;  3K9A A;  5BZB A;  2OCC C;  1MOF A;  4Z1M G;  2V1D A;  5KUM A;  3ZRW B;  1FXK B;  1CEZ A;  1V55 C;  1UJW B;  3GWO A;  4GX0 A;  4HYO A;  3CCS V;  1Q82 W;  3ASN C;  2NLJ C;  1EZJ A;  1M56 B;  3CCR V;  2DYR B;  4UVA A;  2XAS A;  1GK9 A;  4QNH B;  1YIT V;  3ZRV A;  2C2A A;  1RPR A;  1B6Q A;  1WLE A;  3AG2 B;  4MVS A;  1BHB A;  3ABT A;  1QVG U;  1DF5 A;  1R3L C;  1K4C C;  4PDR A;  1FFT B;  2OTJ V;  2IH3 C;  3FKS G;  1NH2 B;  4JF3 A;  3BEH A;  1K7D A;  1RM1 B;  3P32 A;  2OT5 A;  3B8N A;  1AJN A;  4UVB A;  1VQ5 V;  4QE9 A;  1OCR B;  1DF4 A;  5J9P C;  4WF9 V;  2JIZ G;  4XDL A;  2WWW A;  1MSW D;  3I55 V;  1Q86 W;  4MVO A;  2DW4 A;  3ETD A;  1GMG A;  2A9H A;  3ZMT A;  3AG4 B;  1NR1 A;  1OCR C;  3QNE A;  1QVF U;  2M7W A;  1R6N A;  3F7Y C;  5L3B A;  5EBW C;  5L3E A;  1IXM A;  1PNL A;  4GX5 A;  3D3I A;  2HVK C;  4XDK A;  2X7R B;  4G2K A;  2QEX V;  1DLB A;  3G6E V;  3DTU B;  4YXW G;  2HVJ C;  2X6A A;  5IYD O;  3STL C;  2WLI A;  4GX2 A;  2IJJ A;  4FJC C;  3ABK B;  2HR3 A;  3SPI A;  5IY5 C;  4H33 A;  2EIL C;  4MTX A;  1BMF G;  3ZRX A;  1M1K W;  2AHY A;  3T1C A;  2B1G A;  4P30 A;  1BL8 A;  5C93 A;  1VQK V;  2OCC B;  1M90 W;  1KEC A;  1PL0 A;  4JAS A;  1NKD A;  4G27 B;  3ZIA G;  3OR6 C;  3HPL C;  4WFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...