4PDLA

Structure of k+ selective nak mutant in caesium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdlA00
3SPGA 1XL6A 4EKWA 3T2MA 2Q69A 2R9RB 3E8FA 4GX1A 3LDEA 4G28B 4J9ZB 2AHYA 1S5HC 5CBFA 2WLLA 3AG3C 4P9PA 1P7BA 1M57C 2WLKA 5EBMC 5KUKA 3E8HA 5B1AC 4TWKA 3F5WC 2HJFC 3F7YC 3OR7C 4MVSA 1R3IC 1K4DC 2WLNA 4I9WA 4MVUA 3HPLC 4PDRA 1OCCC 2EIJC 4X88A 4RAIA 3UM7A 4MW3A 4P9OA 4XDLA 3BEHA 4WFFA 4R6ZA 1R3LC 4GX2A 3SPIA 5B1BC 2EIKC 2W0FC 3FB6C 5EC1C 2WLLB 4DXWA 4QNHB 2YEVA 3E86A 4H33A 4R50A 4X89A 3STLC 2K1EA 3ZJZA 1LNQA 1ORQC 4LBEC 3EFFK 3OUSA 2DWEC 3RBZA 4BW5A 2DYSC 1G4YB 1V55C 3RVZA 2EIMC 2X6AA 4XDKA 2Y69C 3AG2C 4PA6A 3LUTB 3OGCC 4GX0A 2H8PC 4QE7A 2P7TC 5EK0A 3FB7C 3LDDA 2IH3C 4JTCB 4HYOA 4OXSA 3X2QC 3SYAA 3E8GA 3T4ZA 3K03A 1V54C 1QLEC 3SPCA 4R8CA 3STZC 3T4DA 3SPJA 2QKSA 4QE9A 1JVMA 4PDMA 3SPHA 3E89A 2EILC 3SYPA 3TCUA 2A0LA 4MSWC 4MTGA 4F4LA 2KB1A 3FB5C 3FB8C 4MTOA 2DWDC 4WFHA 3PJSK 3E8BA 2Q68A 4XDJA 3KG2A 4MW8A 3IFXA 4PA9A 2X6BA 4MVRA 4PA4A 1R3KC 5CBHA 4MVMA 3F7VC 4WFEA 1OCOC 1ZWIC 2IH1C 3SYQA 5EBWC 2JK5C 1K4CC 4MS2A 4PA7A 2ZD9A 3LNMB 1OCRC 4LCUC 1XL4A 2X6CA 4PDLA 3IGAC 5CBGA 2BOBC 3E83A 3ABKC 4X8AA 4R7CA 3K04A 1R3JC 3AG4C 3WG7C 4MTFA 3SYCA 2A79B 2AHZA 2WLIA 4MVQA 2HVJC 4ZBMA 3UKMA 5E1AC 3T1CA 4KFMA 2EINC 1OCZC 4HZ3A 4RO2A 3SYOA 2A9HA 3K0GA 3K0DA 3AG1C 3RVYA 3K06A 3ASNC 3VOUA 4MVZA 4WFGA 4CBCA 3RW0A 4MVOA 2WLHA 5J9PC 4H37A 5BZBA 2WLMA 3LDCA 3OR6C 3R65A 4GX5A 4RUFA 2ZXWC 2Q67A 2DYRC 2WLIB 4G27B 5IY5C 2QTOA 3JYCA 3K08A 2OCCC 5KUMA 5B3SC 3ABLC 4RUEA 1M56C 5EC2C 1KKDA 4J9YB 4LP8A 3ZRSA 2Q6AA 1J95A 4PDVA 1BL8A 3GB7C 4JTAB 4PA3A 3TETA 5EBLC 4JTDB 3ASOC 3ABMC 3SJQC 3OUFA 2HFEC 4P30A 2ITDC 2HVKC 2WLJA 2HG5C 2NLJC 2ATKC 2ITCC 4P2ZA 4UUJC 2BOCC
chains in the Genus database with same CATH superfamily
4LF9B 2VQFB 4G28B 3AG3C 3R66A 3L72H 5CA3A 4TWKA 4FM0A 3AG4B 4PDRA 4O2AB 5HFLA 2JGDA 4FLYA 1NH2B 4JI0B 2QWOB 3FKSG 3CCSV 1LNQA 4LBEC 4LF5O 3T1YB 4BW5A 4W4KA 4PV1B 4NXNB 1X4TA 2X0LA 3JALA 1GM8A 1AJQA 3P30A 3RGBA 1R6TA 5IYCO 4LF7O 1VP7A 2ETNA 4BR6A 3T4DA 2R9AA 2EBOA 1PNMA 2EIKB 2W0XA 3B77A 4F4LA 4MTGA 1JJ2U 1N8RW 3OAAG 2WAMA 3QNEA 3KZIZ 3A0BZ 1PP9H 3GWOA 4IHJB 4JI2O 3RYFB 4LF6B 3FYIB 1JFFB 1KQSU 2CGOA 5BY1A 3D8CA 4X66B 3Q4HA 2WLIA 1TVKB 5E1AC 4JI6B 2ZR2A 2ZE5A 4DR7B 4DV4B 2RDCA 4CBCA 3RYIA 3J7AU 4RUFA 2WA3A 3AK1A 2YIBD 5CB4B 4B3SB 1T5EA 1FYJA 2QM8A 1SETA 5FNVB 4LF8B 3M99B 3HKEA 5FPOA 2YI9A 1Q6IA 1CP9A 4P30A 1GM7A 2HVKC 4DUZB 2QTSA 4I7ZB 4X62O 3BRCA 2OT5A 4IIJA 3LNNA 1Y4MA 5CBFA 1JOYA 2CUGA 1O9HA 4UXNA 5B5EZ 3F5WC 4GYCB 3SJCC 4PELA 1L0NH 1VEWA 2BSKA 1TGOA 4GX2A 4PI0A 4U7NA 5EIBD 1SQFA 2YEVA 1M4UA 2FKXA 4OGQB 2PTMA 4X64O 2BCCH 1WAZA 1ZAUA 1A32A 3JATB 3RN4A 5IY5B 3PN1A 2OTLV 3ABLB 4LFBB 3L73H 3P3NA 1KC8W 1NQTA 1XDCA 1K92A 4UCSA 1WN7A 5DECA 3X2QC 1I5YA 1E1RG 1UJWB 4KXRA 2AZ0A 5LHIA 3TXSA 2P06A 3E8BA 5CN0A 4WCEV 1HWYA 3LNMB 1HNXB 1YTFD 3ABKC 1XEQA 4YJ3A 4DRXA 4CH5A 2XAHA 4ZBMA 2UUAO 5GTIZ 5L3FA 2Z3YA 4F6RB 3UO3A 2WLMA 2VQEB 5LHHA 2WLIB 1MA1A 4NXMB 3RYHA 1BZKA 2JS5A 2DW4A 2CK3G 2P90A 1F23A 3B09A 4JTDB 2O57A 1XNRB 2B1IA 3H9VA 3QO8A 4YY3O 4OPAA 4DV3O 4WF9V 1M90W 4UUJC 1VQ7V 3O65A 4LF4B 4NR1A 4JPRA 3HKEB 4DW0A 3BAAA 1VF5B 2EJRA 3OMIB 3H1KH 2ZNIA 4MVUA 3DXRB 4WFAV 4DV0B 4IGGA 4IIJB 2ZKOA 4JI3B 2LO1A 2AW9A 3CRAA 1G6UA 3DC6A 1AI4A 2QGNA 1KP2A 1IBKB 1SQPH 1K3EA 2XUMA 1N33B 2EIMC 3LUTB 1HNWO 3FB7C 2HP8A 2UU9O 1S0VA 4PD4F 2JEUA 2XOKG 4MT8A 2EILC 3JARA 2IJJA 3FB5C 1VF6C 1XMQO 4MW8A 3P32A 3JAKA 4H44B 3AG2B 1XREA 1K4CC 2ZD9A 2YXYA 1Z5WA 5CBGA 4PDLA 1B04A 3IGAC 4HAMA 1AP6A 3K04A 3SYCA 1FXVA 5IE9A 2L35A 1NVPD 4HZ3A 4TQFA 3AG1C 4DUYB 3APOA 4GX5A 2ZXWC 1IBLB 1S5LZ 4DRXB 4B08A 3K59A 2OYQA 1J95A 1SZTA 4FLWA 2RQ6A 2YUAA 2F93B 3CEIA 3N2KA 3QO7A 2V4DA 2UXXA 3RYHB 3SPGA 4ZHQA 2Q8VA 2R9RB 2XASA 3CPWU 5L3CA 4JI8B 5LOVB 1N36O 4K0KO 4U3FH 2Z0AA 3N2GB 5KX5A 4MW3A 4RQEA 1EFRG 4R6ZA 1HNZO 2UXCO 4QNHB 2XAFA 3MAQA 1P49A 1ORQC 4LF5B 1AJNA 5IYDO 4DV5B 1N34B 1QR9A 3RVZA 3AG3B 3BABA 4UCOA 4GX0A 2ZINA 4H0LB 5B3SB 4CZZA 5KHKA 4J42A 4LF7B 2F4VB 1WLEA 5DN6G 4UB8Z 3K03A 4MSWC 3E2EA 2BTOA 2YDEA 1KB9F 4FK5C 4JYYA 4MVRA 2E5LO 2VWKA 3BY6A 4ICGA 4FIPC 5EBWC 4X1KA 1M57B 1OCRC 1XL4A 3JARB 5B1OA 1MABG 1TUEB 3WG7C 1WPBA 4AI8A 2DE0X 1KKCA 4LNUB 3G6EV 3K5NA 2QR4A 1WB8A 5C93A 3T1CA 2M7WA 1OJHA 3E22B 4UFZA 2D3OW 5JCOC 3JAKB 3SGIA 4ZOLA 1WA8B 4JYAO 1BS3A 2JJ1G 3P3PA 3LDCA 3FX7A 2Q67A 2JVDA 2WA4A 1VQNV 4DV2B 3JYCA 4C7UA 5ITZA 4DR3B 3APQA 1AI6A 1KU9A 4B3RO 4DV7O 4KHPB 4P2ZA 3OMAB 2YC0A 1OV9A 3OFNG 1GN6A 2PZSA 4DR1B 1LUVA 4NVPA 3U11A 3N2KB 2ZIMA 3JD3A 1R3IC 3ETGA 5KA5A 2EIJC 3UM7A 4RAIA 4ZHQB 1GAXA 4YHHB 2Q7HA 3QF7A 3OE7G 2QSAA 3DSQA 5B1BC 4I50A 2ZCEA 2HJDA 2A7WA 4X89A 2R72A 5LYJA 2P4KA 1FD9A 4EFEA 2GSMB 1K8AW 2JDIG 2H3OA 4TV8A 4JI7B 4Z2WA 1GN3A 2QM7A 4TSFG 4AQYB 4U3JA 1PPJH 4DW1A 1M56B 1THZA 4CH4A 1IBMO 1L1FA 1W59A 3QG5A 4CC5A 2ZE6A 3L75H 3SYAA 2ZM6O 1WP8A 3L74H 2DJVA 2B5UA 5BXZA 2DWDC 3CRQA 1GK9A 4I4TA 2AGAA 3ABTA 4PA9A 4GKKO 3F7VC 4F6EA 4FLVA 2JK5C 2C2AA 4MS2A 3WB2A 5L3BA 1YZBA 3A0RA 2CE4A 3BA8A 3HKDA 2P67A 4DV6B 4JI4O 1JX9A 3OW2U 4CC6A 1IURA 1IZ3A 4K3AA 1Z2GA 1R6NA 1GRJA 3CCEV 4X1KB 4MVOA 5J9PC 1K5SA 4H37A 4B3TO 1G1XB 4CS2A 1Y74A 5H9CA 2IU3A 2N04A 4G27B 1DLBA 3NR7A 2HR3A 2OCCC 1YIJV 1GH6A 1KKDA 3CMEV 4X65O 4PDVA 2GV9A 2Y48A 2ZDIC 1BT8A 3G4SV 4O4JA 5FPRA 1K34A 5LL6Y 1XHZA 4JI1O 1I94O 3ASOC 1Q8IA 3JD4A 3CCJV 4DYLA 3EVKA 2GTAA 1TUBA 2ODMA 1VQPV 4WBNA 1SKVA 5H2FZ 4YJ2B 2V1DA 4O4LA 1OCOB 2WLNA 5IJ9A 2JEXA 2LFSA 1MZEA 1CXZB 1ZX3A 4I0XB 5EYPA 1ZUQA 5EC1C 3STLC 5DEDA 2DMXA 4DR5O 3LSUA 1K9MW 3A0HZ 1ZTEA 4DV1O 5FL7G 1XOUA 4PA6A 1H8HG 5JJJB 1FXKC 1Y66A 4I50B 5EK0A 2N05A 5LYJB 1JMKC 1VIBA 3KCYA 1V54C 4LFAB 1JVMA 3QTCA 4PDMA 5B1NA 1YI2V 2MW2B 2KB1A 4NTXA 2Q7GA 3CSXA 4WFHA 1RM1B 4U3JB 1GM9A 2OTJV 3KG2A 1TAEA 3IFXA 1VQOV 2UUCO 4PA4A 3TJTA 1AI5A 3D3IA 4FFKA 2EZPA 1EZJA 2WSSG 2BOBC 3E83A 3ZHUA 4BW9A 2YXLA 1OCCB 1M93A 4MVQA 5L3GA 5C8YA 1BQ0A 1WP7A 1M5IA 1BMFG 4FM2A 5EZYA 3ASNC 1SQQH 3OR6C 3H1IH 5JCOA 4UV9A 3HKDB 2DYRC 4GT1A 3DGEA 2YIBA 4PA3A 4FFBA 5LP6C 2XAQA 1Y74B 2DOSA 2XT9A 3QO5A 4EKWA 3T2MA 1FFTB 3IC9A 2ZXWB 5LGNA 1U97A 1YJWV 2AHYA 1Y76B 4O4IA 4O4JB 4P9PA 2OIEA 2WLKA 2GBOA 2HJFC 2PUSA 4ZIBA 4HNAA 4TUYA 1HNZB 1YJNV 2OIGA 4R50A 3W7SA 1UPGA 4UB6Z 5JVDA 1Q6UA 5IJ9B 3BVOA 1FKAO 4E2LA 1EN5A 2Y69C 1COWG 5EYPB 2RNBA 2R70A 1RFYA 3K5LA 3ZN0A 1DF4A 3OEHG 1PM9A 1FAFA 1FPOA 3E8GA 3L70H 1QLEC 3CRMA 5HFMA 4NKGB 4QE9A 2ZT9B 3JAWA 3ABMB 4DR6O 2JGUA 3PJSK 3ZHTA 2E75B 4JI5O 4FLTA 3RWRD 3TK1A 1US6A 2BE3A 3J81N 2ZIOA 1R3KC 4UCRA 2HHHO 4PA7A 2JGDB 3OGIB 3ZBHA 4TV9A 3ABUA 2K9PA 4X8AA 1AB3A 3ZHVA 3B4SA 3CCRV 1NR7A 1NZ6A 4KFMA 2EINC 1OCZC 3ICXA 1W0KG 4JYAB 2FMLA 2AXTZ 3JALB 3IC7A 3NXSA 4CS3A 1J5EB 1AROP 1PNKA 1PL0A 1XNQO 4FLZA 3CXCU 4L8JA 4TOIA 4LP8A 1SERA 3TGUH 5LMNB 3WG7B 3N27A 5EZYB 4U7OA 2XNDG 2DQ3A 1TA8A 2ZDIA 2NLJC 3WFVA 1H8EG 5KMGA 3OTFA 3E8FA 1VQ8V 4GKJB 1P7GA 4FFBB 3Q4HB 1XMOO 1YITV 5B1AC 5K1XA 3OR7C 1K4DC 1H2SB 3ZEDA 5A9GA 1QU7A 1MZFA 3RYIB 2GHYA 1XUQA 2QE7G 4B3MO 1P4RA 3BFRA 4N23A 1NKDA 1E79G 4QJFB 4DR2B 4XDKA 2XAJA 2IJIA 3FAVA 4HNAB 3OGCC 4TUYB 1IBMB 1CPYA 2JIZG 3JCUZ 3T4ZA 3ETDA 5JVDB 3D36C 1FXKA 3TCUA 2Z5UA 4I5SA 4EFBA 4DR4O 4GZRB 1DF5A 4FM1A 2UXBO 2BTQA 2QWQB 2LFRA 3JCZA 2JS3A 2P5OA 2QM4A 4MVMA 2LQTA 3THOA 3CE2A 2BSKB 4OX9O 4JZGA 1VQ4V 1KECA 2X6CA 3ZHSA 2KSDA 1IXMA 3AG4C 2YEVB 4NYKA 3SDLA 3HKBA 2ZR3A 1IXBA 3S3WA 1BGYH 3K06A 3CRRA 4LF9O 2VQFO 4TV9B 4BAYA 3G67A 3L9DA 4ZI7A 4LFCB 4LWSA 2DYSB 1K33A 1V55B 5BMVA 3IAYA 1YTFB 5LBQA 5KUMA 1QVGU 2AZ2A 2CH7A 2Q6AA 2CGNA 5BR8B 1K7DA 3OUFA 3JSLA 4PI2A 4JI0O 3OMNB 5LP6A 2P22C 4X1YA 1D2DA 4J9ZB 4YJ3B 4NXNO 1Y67A 2CTQA 1F7YA 2DN9A 2LW1A 4RWUA 1B6QA 4EEQA 1NR1A 1URFA 3T1HB 4ABMA 1R3LC 3SPIA 2Y4TA 2QJ1A 3AK3A 3SR2C 3JD1A 3RBZA 1BQZA 1OZ0A 3LSSA 4YIPA 3VQYA 4LF6O 3ZN1A 4X66O 1QLNA 3ZMZA 1NTKH 4HYOA 4B7EA 3ZMUA 1Q7YW 4JI6O 5FLXN 4IYHA 1NTMH 3UQ8A 4DR7O 5KLVH 4DV4O 2QKCA 1DGSA 3FB8C 3UO2A 3KCXA 1ENVA 3FAVB 2XTAA 1VQMV 2X6BA 1M1KW 1SA0A 2PYLA 3SYQA 1ZWIC 3C3TA 1SZXA 1AR4A 3SJBC 4B3SO 1Q86W 2GTSA 3KKYA 3MDSA 1I5XA 2PGGA 3RYCA 1I0HA 1IVSA 4LF8O 3HB3B 3J80N 2HVJC 1BSMA 2BTQB 2Q73A 3RT3C 4DUZO 3C90A 4O4HA 1Q43A 1Q6HA 1RP3B 3K0GA 3K0DA 2A06H 2PI4A 1H2MA 2IW5A 2P6JA 3CMAV 3HKBB 5IY5C 4GCZA 1SRYA 3WU2Z 3ABLC 3TXQA 5CA1A 2OCHA 4JGSA 3W7TA 4A5UB 4JI2B 3JASA 3K9AA 1NVPB 2E76B 4ZI7B 1S3JA 4W4LA 2F95B 1L8DA 3EXAA 3SJQC 3CCVV 2YXHA 5BMVB 2VS0A 2CTWA 3O9OA 5LMUO 2ITCC 3ASNB 3ZMSA 1KBHA 2CH7B 3UCSC 3E35A 3GWKC 1HDJA 2D2CB 1N0JA 2WLLA 2FTKA 3DTUB 3FFQA 1XILA 5JJNB 4LFBO 1BHAA 1QHTA 2YS8A 4D7TA 3G80A 5DM6V 1AI7A 2WWWA 2YICA 4X88A 4QGPA 4X1YB 5L3DA 3H1HH 5IWAO 4DXWA 4D7SA 2CTPA 3E86A 2G38A 4X62B 1SQXH 2ARHA 4X1IA 1WNSA 1L0LH 2H8PC 1HNXO 1R6KA 2OWOA 3JSNA 5H6QA 3QVNA 4OXSA 4BIUA 3ZX6A 4R8CA 3SYPA 4DR6B 4MTXA 2VQEO 4XDJA 4XBFA 5KHIA 3B8MA 1XHXA 3D36A 5CA0A 4Q6GA 4X64B 4NXMO 5KX5B 4NTWA 3B2EE 1RSOA 1VMGA 1N0NA 1XNRO 4NB5A 1SA0B 2GDSA 1G8MA 4LF4O 4X20A 4WFGA 1W2BU 2Y0IA 1NJIW 2KKWA 3JD2A 3ZMTA 3RYCB 5JH7A 2QWNB 5H5NA 1D5AA 1VF6A 5EC2C 2EZOA 4J9YB 4O4HB 1AVMA 1JCHA 1ZSPA 3CWBH 4DV0O 5EBLC 3X2QB 4JI3O 1IDSA 2UUAB 1S77D 1OCZB 5IJ0A 4E4EA 4UCVA 1IBKO 1NH2D 1XL6A 5CA1B 2Q69A 3W7XA 1GO3F 5LA6A 3M8AA 1VQ5V 3EHBB 2V7QG 4OPHA 1FS0G 4JZ2A 1YVWA 1P7BA 3ETQA 1XI1A 1B06A 1I7FA 2Q0AA 3ABKB 2FB5A 4ZOLB 3DC5A 3BEHA 2W0FC 4YY3B 2WLLB 4LR3A 4DV3B 4B3MB 3ZJZA 1TVKA 1U96A 5ITZB 2HKOA 1FFXA 4TQDA 1EN6A 4QE7A 1GMGA 3ZMVA 2P7TC 2Q0OC 2UXNA 1WPXA 2X7RB 4I55A 1KYOF 1R73A 5CMUA 3W7UA 1PKXA 2YSUB 5CB4A 5IYZA 5AG2A 3SPJA 3I5DA 1ROPA 5IDJA 3U0ZA 3A2FA 2RN9A 4DUYO 2Q68A 5J2UA 1AP5A 1IBLO 4WFEA 1QVFU 1QQCA 1HNWB 3UT5A 5JWPA 2UU9B 1S72V 5CA0B 1EN4A 1H2LA 1GN2A 2LP7A 4RO2A 4TV8B 3CCUV 1VQ6V 4H13B 1K97A 1XMQB 1Q81W 2F1MA 1RSOB 2NN4A 2Q9LA 4JI8O 2F23A 2EIMB 1UFIA 1JPXA 3I56V 5B3SC 4AHCA 3H01A 3OTOO 1S76D 4K35A 4X20B 4RQFA 1N4CA 1QCEA 3JATA 5H6RA 4I4TB 1JQ0A 5D5QA 5JH7B 4KUMA 4FZ0A 2EILB 3K79A 1IX9A 2L6LA 4DV5O 2MK3A 1N34O 3BCCH 1M57C 3CX5F 1R1BA 3E8HA 1SQGA 1Z5VA 5IJ0B 2XHBA 2F4VO 1FJGO 4JV5O 3L71H 4J41A 4XDLA 5IT9N 3CCMV 4WFFA 5LA6B 3ZCCA 5JQGA 3FB6C 3AK2A 3AG1B 2A3QA 2IJKA 3EFFK 5L3EA 4F6RA 1K73W 1N36B 3MD0A 4K8ZA 1YCIA 4J80A 4K0KB 3ZRVA 3LDDA 3ZIAG 3G6BA 5LHGA 1RPOA 1Q82W 2QKSA 1TUBB 3E89A 1FFXB 3CJHA 4WBNB 2UXCB 1YDXA 3GVMA 4MTOA 4O4LB 3CP1A 1PD3A 1AILA 1KP3A 1MOFA 4I55B 4L87A 4DV2O 2QWPB 1HR0O 1ZL8A 2NR5A 5F2VO 3RFRA 5IYZB 1AR1B 2H94A 1YHQV 4DR3O 1R3JC 5B66Z 4Z1VA 5J2UB 2HLDG 4K8XA 4DO2A 3CC7V 4YXWG 3VBBA 3SYOA 4KHPO 1GTOA 2QDOA 3DXRA 3ZRWA 2ADPA 3R65A 1V9PA 3UT5B 2E5LB 1BHBA 4DR1O 3D3QA 2UUBO 2ZE7A 2W6JG 1Q3EA 4RUEA 1M56C 3VQVA 1N32O 4YHHO 4ZKIA 2ZQMA 5KHJA 1MNGA 1WJZA 5GTHZ 1M9NA 2IU0A 2F66C 5LMUB 1G4YB 3ZHQA 4DK0A 1QR8A 4QPJA 5K1PA 5A2QN 4JI7O 1D5NA 3CCLV 4AQYO 1BCCH 3ETEA 1VQ9V 5C8YB 1OCRB 2FYUH 2JRIA 1SQVH 2W6IG 2PYJA 4NTYA 4EB6A 5IWAB 1LR1A 4B3RB 1K5QA 4DV7B 2PF4E 3OUSA 3CCQV 1WB7A 2QA4V 4FJCC 1BE3H 4J7JA 4UCTA 5JQGB 3MHHC 3OEEG 4DV6O 3AEIA 4O2BA 3SPCA 3STZC 4J10A 2EX3A 3CC2V 3K9SA 4O4IB 3M7MX 4KP4A 2CDYA 4J7KA 1QNMA 5LGUA 1GN4A 4UV8A 1OCOC 3G71V 3AG7A 5KAFZ 3CJHB 4UVBA 4R7CA 1HP8A 3MHSC 4FZ1A 5LOVA 1MSWD 2AHZA 2HEPA 2EIJB 4CH6A 3UKMA 2ZM6B 2ILMA 4UVAA 3ZS8C 1H2GA 5B1BB 2Y0PA 3N2GA 1ZL8B 3LSQA 3K3WA 5D5PA 2WLHA 2LW7A 5BZBA 4JASA 2Q4PA 4GKKB 4FLXA 1PV0A 5GW7A 3K5MA 1VF7A 3JAWB 2UXDO 1BL8A 2NNUA 4JTAB 3ZRWB 1JR9A 1RPRA 3U10A 3CXHF 4JI4B 1YSCA 4B7KA 2B9ZA 2WLJA 2HG5C 1RM1C 1YEWA 4JYBA 4B3TB 4FPPA 4GX1A 3LDEA 3VQWA 4UCUA 1S5HC 4ASUG 4FVMA 1CEZA 2IJHA 3WB1A 3F5TA 2E3CA 3F7YC 4X65B 4IL6Z 1OCCC 4LFAO 4P9OA 2P4VA 2PI5A 4JI1B 1I94B 2EIKC 3VQXA 1X59A 4J7ZA 3FYEB 1JA8A 3IJ4A 4LNUA 2K1EA 3CHXA 3E22A 3T1YO 1DTOA 2LGQA 4GUNA 1WA8A 4BIZA 1NBMG 2X6AA 2ZNJA 1EM1A 4LH7A 1OHHG 2LJ2A 2OCCB 4EB6B 4IYIA 2IH3C 4JTCB 4WFBV 5KMGB 3OM3B 3A8TA 4J11A 3SPHA 3ASOB 4JAAA 1MG1A 2RCVA 4UVCA 3CD6V 1AJPA 4BWAA 4DR5B 1KD1W 5CBHA 4DV1B 1QBZA 4AILC 4O2BB 5GONA 3CC4V 1H2KA 1SS3A 2VRZA 4MTFA 2IBZH 2CAZC 1XBLA 3SJAC 1W0JG 3RVYA 3VOUA 3OT7A 3WB0A 2UUCB 1Y6XA 4LC1A 1PL4A 4IT5A 1YJ9V 3W7WA 4JF3A 1FXKB 3CB2A 2VWJA 3OTOB 4KL1A 3GB7C 1Q90D 5KAIZ 3TETA 3FD9A 1V54B 3ABMC 2HFEC 2LGWA 1VQLV 1AR5A 2BOCC 2YIDA 1F51A 4DK1A 1O9GA 5EBMC 2PY5A 4FMTA 3BHPA 1YXBA 4MVSA 1FJGB 2XAGA 4I9WA 4JV5B 2KG7A 4LWSB 1XQ8A 4Z1MG 1NS1A 3JD0A 1H2NA 2KQXA 1DK1A 3BPZA 4QPKA 4N21A 4QIWF 2DYRB 1P84F 2QEXV 4G2KA 1KMIZ 4GLXA 5LP6B 5JJEB 2A0LA 1SC5B 5J2TA 5KHGA 1NI8A 1LUWA 3HKCA 1B3QA 2QKAA 3B8NA 5LXTA 1J5EO 2RMKB 1HR0B 2IH1C 3HR0A 1E1QG 4LCUC 2B1GA 4TT3G 5LMNO 2Y4UA 4YJ2A 2A79B 4YIOA 2GUZA 1F4NA 1HW7A 4X9QA 1PNLA 2A9HA 2EJ7A 2IM9A 5GONB 5KA6A 4MVZA 4I0XA 3RW0A 3CRCA 4JI5B 2QWRB 3K57A 4JAVA 4GKJO 2Q5ZA 2UUBB 1SQBH 2QTOA 2Y69B 2HHHB 3K08A 1VARA 1N32B 2F43G 5EIBC 4Q20A 1QLEB 1YF2A 3CYOA 4HBNA 3I55V 4O2AA 4CS4A 1NTZH 4DR2O 2DQ0A 1MSDA 4LH6A 2WPDG 5KUKA 1S5JA 1XNQB 3ZHRA 1KUQA 3HPLC 1F4MA 1EZVH 3ML0A 2R9IA 2EINB 3S3XA 3C3SA 3BA9A 1ZLZA 4H33A 5KHHA 5IYBO 1FXHA 2DWEC 4I9QA 1N33O 2DYSC 1V55C 2KG7B 5E79Z 3AG2C 3JASB 1NU1H 1XMOB 1Q5OA 4CH3A 1SESA 2M6YA 3OD4A 4IHJA 4PJ0Z 3RYFA 1JFFA 4LFCO 4JYCA 1NT2B 2RJZA 1I08A 2FL4A 1EBOA 3CS5A 3H1LH 5B1AB 2JJ2G 4D6TH 5J2TB 1Y76A 5BR8O 2E74B 3HKCB 5LXTB 4X1IB 3H1JH 3B40A 2Q7EA 5TISZ 2EULA 2YIAA 4DR4B 5FNVA 2UXBB 2N74A 1MMMA 4BIOA 1SF9A 2GUZB 1JJOA 1H38A 5LGTA 4OX9B 3ZRSA 1VQKV 2UXDB 3ZRXA 2ZE8A 4FLUA 3T1HO 3JAMN 4PHZA 1GKFA 4JAUA 3K58A 2ADQB 2YI8A 2ITDC 3K5OA 2CTRA 2ATKC
chains in the Genus database with same CATH topology
1QR8A 3OFNG 4QPJA 4G28B 4J9ZB 3CCLV 3AG3C 3ETEA 1VQ9V 5CA3A 1OCRB 4TWKA 3JD3A 1R3IC 3ETGA 3AG4B 2W6IG 1B6QA 2EIJC 4PDRA 4RAIA 3UM7A 5KA5A 5HFLA 1NR1A 1R3LC 3SPIA 3OE7G 5B1BC 1NH2B 4X89A 1K5QA 3FKSG 3CCSV 1LNQA 4LBEC 2GSMB 1K8AW 2JDIG 3JD1A 3OUSA 3RBZA 4BW5A 3CCQV 2QM7A 4TSFG 1OZ0A 2X0LA 2QA4V 4FJCC 3LSSA 1GM8A 1M56B 1THZA 1AJQA 3P30A 3ZN1A 5IYCO 3MHHC 1L1FA 1QLNA 3OEEG 3ZMZA 3AEIA 4HYOA 3SYAA 3ZMUA 3SPCA 1Q7YW 3STZC 3T4DA 3CC2V 2EBOA 1PNMA 2EIKB 3B77A 4F4LA 2B5UA 4MTGA 1JJ2U 3FB8C 1N8RW 1ENVA 3OAAG 2DWDC 4KP4A 2WAMA 3QNEA 1GK9A 3ABTA 4PA9A 1VQMV 2X6BA 1M1KW 3F7VC 5LGUA 4UV8A 1OCOC 1ZWIC 3SYQA 3G71V 2JK5C 2C2AA 3GWOA 4MS2A 5L3BA 1Q86W 4UVBA 3A0RA 4R7CA 3MHSC 3FYIB 1I5XA 1KQSU 2P67A 1MSWD 2AHZA 2WLIA 1JX9A 2EIJB 3HB3B 2HVJC 3OW2U 3UKMA 4UVAA 5E1AC 2ZR2A 1H2GA 1R6NA 5B1BB 3K0GA 4CBCA 3K0DA 3LSQA 3CCEV 3K3WA 4MVOA 2WLHA 5J9PC 1K5SA 4H37A 5BZBA 2PI4A 4JASA 4RUFA 5H9CA 2IU3A 2IW5A 2P6JA 3CMAV 4G27B 1DLBA 5IY5C 4GCZA 5GW7A 1SRYA 2HR3A 2OCCC 3ABLC 1YIJV 4JGSA 3W7TA 1KKDA 3CMEV 4PDVA 2QM8A 1BL8A 2NNUA 2Y48A 2ZDIC 4JTAB 3ZRWB 1SETA 1RPRA 3G4SV 3K9AA 1NVPB 1K34A 1YSCA 3M99B 1S3JA 3ASOC 3SJQC 1CP9A 4P30A 1GM7A 2HVKC 3CCVV 3JD4A 2WLJA 2HG5C 3CCJV 1RM1C 3ASNB 2ITCC 3ZMSA 4JYBA 2OT5A 1VQPV 4FPPA 3E35A 4GX1A 3LDEA 1Y4MA 2V1DA 1S5HC 5CBFA 2WLLA 1JOYA 4ASUG 1CEZA 2IJHA 1OCOB 2FTKA 3DTUB 1BHAA 4UXNA 3F5WC 3F7YC 2WLNA 5DM6V 1AI7A 2WWWA 2JEXA 4PELA 1OCCC 4X88A 2LFSA 4P9OA 2PI5A 5L3DA 4GX2A 2EIKC 4U7NA 5EC1C 4DXWA 2YEVA 3E86A 3FYEB 3STLC 2K1EA 1K9MW 1DTOA 5FL7G 4BIZA 1NBMG 2X6AA 4PA6A 1H8HG 2H8PC 5IY5B 1FXKC 1OHHG 1Y66A 2OCCB 2OTLV 1R6KA 3ABLB 5EK0A 5H6QA 1KC8W 1NQTA 2IH3C 1K92A 4JTCB 4OXSA 3X2QC 4WFBV 1I5YA 1V54C 4BIUA 4R8CA 3OM3B 1E1RG 1UJWB 1JVMA 4PDMA 5B1NA 3SPHA 3ASOB 1YI2V 3SYPA 5LHIA 2KB1A 1MG1A 4UVCA 3CD6V 4WFHA 4MTXA 1RM1B 1GM9A 3E8BA 5CN0A 4XDJA 1AJPA 3KG2A 2OTJV 3IFXA 1VQOV 4XBFA 3B8MA 3D36A 4PA4A 1KD1W 5CBHA 1QBZA 1AI5A 3D3IA 4WCEV 1HWYA 3LNMB 2EZPA 1EZJA 3CC4V 2WSSG 2BOBC 1YTFD 3E83A 3ABKC 4MTFA 1OCCB 4MVQA 2XAHA 4ZBMA 5L3GA 1W0JG 1G8MA 1BMFG 3RVYA 3VOUA 3ASNC 5L3FA 2Z3YA 4WFGA 1W2BU 2WLMA 3OR6C 1NJIW 3ZMTA 3JD2A 4UV9A 4LC1A 5LHHA 2DYRC 2WLIB 1YJ9V 3W7WA 4GT1A 4JF3A 2DW4A 2CK3G 1FXKB 5EC2C 2EZOA 4J9YB 2P90A 1F23A 3GB7C 3DGEA 1JCHA 4PA3A 3TETA 5EBLC 4JTDB 3X2QB 2XAQA 1V54B 2B1IA 3QO8A 1S77D 3ABMC 1OCZB 2HFEC 4WF9V 1VQLV 1M90W 4UUJC 3QO5A 1VQ7V 1NH2D 2BOCC 1XL6A 4EKWA 3T2MA 2Q69A 3W7XA 1GO3F 1FFTB 1VQ5V 2ZXWB 5LGNA 3EHBB 2V7QG 1YJWV 2AHYA 1F51A 1FS0G 4JPRA 4P9PA 1P7BA 2WLKA 5EBMC 4FMTA 2EJRA 3OMIB 2HJFC 4MVSA 3ABKB 2XAGA 4I9WA 4MVUA 4WFAV 3BEHA 2W0FC 1YJNV 2WLLB 4Z1MG 1AI4A 4R50A 3W7SA 1KP2A 3ZJZA 3JD0A 1K3EA 1G4YB 2HKOA 4QPKA 4N21A 2EIMC 4QIWF 4E2LA 2Y69C 1COWG 2DYRB 3LUTB 4QE7A 1GMGA 3ZMVA 3ZN0A 1DF4A 2P7TC 2UXNA 2X7RB 1WPXA 2QEXV 3FB7C 3OEHG 1R73A 4G2KA 5CMUA 3W7UA 1S0VA 3E8GA 1PKXA 1QLEC 2JEUA 2XOKG 2YSUB 3SPJA 5HFMA 4QE9A 1ROPA 5IDJA 4MT8A 2EILC 2A0LA 3ABMB 2IJJA 3FB5C 3PJSK 2Q68A 4MW8A 3P32A 3TK1A 3B8NA 1R3KC 4WFEA 2IH1C 3AG2B 1K4CC 4PA7A 1E1QG 2ZD9A 1QVFU 4LCUC 2B1GA 5CBGA 3ABUA 3IGAC 4PDLA 4TT3G 4HAMA 4X8AA 3K04A 3SYCA 2A79B 1FXVA 1S72V 3CCRV 1NR7A 4KFMA 1F4NA 2EINC 1OCZC 1NVPD 4HZ3A 1W0KG 2LP7A 4RO2A 3CCUV 1PNLA 2A9HA 1VQ6V 3AG1C 5KA6A 4MVZA 3RW0A 1K97A 1Q81W 3IC7A 4GX5A 4JAVA 3NXSA 2ZXWC 1AROP 1PNKA 1PL0A 2EIMB 2QTOA 2Y69B 1JPXA 3K08A 3I56V 5B3SC 3CXCU 3H01A 4LP8A 1SERA 1J95A 1S76D 1SZTA 3WG7B 4U7OA 4RQFA 1QCEA 5H6RA 2F43G 2XNDG 2DQ3A 4Q20A 1QLEB 1JQ0A 4KUMA 2EILB 3QO7A 2ZDIA 2NLJC 3CYOA 3K79A 3WFVA 2UXXA 3I55V 3SPGA 1H8EG 2R9RB 3E8FA 2MK3A 2XASA 3CPWU 5L3CA 1VQ8V 2DQ0A 1M57C 2WPDG 5KUKA 1YITV 3E8HA 5B1AC 3OR7C 1K4DC 3HPLC 4MW3A 4XDLA 1F4MA 4RQEA 3CCMV 1EFRG 4R6ZA 4WFFA 2GHYA 3ZCCA 3ML0A 2R9IA 3FB6C 2EINB 2QE7G 4QNHB 2XAFA 4H33A 3AG1B 1P4RA 1ORQC 2IJKA 4N23A 3EFFK 5IYBO 1FXHA 1NKDA 2DWEC 1AJNA 2DYSC 1E79G 5IYDO 1V55C 4QJFB 5L3EA 1QR9A 3RVZA 4XDKA 2XAJA 3AG2C 2IJIA 3AG3B 3OGCC 4GX0A 1K73W 3MD0A 5B3SB 4CZZA 3ZRVA 1CPYA 3LDDA 1WLEA 3ZIAG 5DN6G 2JIZG 3T4ZA 1SESA 1RPOA 3ETDA 3K03A 5LHGA 1Q82W 2QKSA 1FXKA 3E89A 3TCUA 4MSWC 3E2EA 2Z5UA 4I5SA 4MTOA 3CP1A 1PD3A 1DF5A 4FK5C 4JYCA 1KP3A 1MOFA 2LFRA 3JCZA 4L87A 4MVRA 4MVMA 3BY6A 4FIPC 5EBWC 1M57B 1EBOA 1AR1B 1OCRC 1VQ4V 1XL4A 1KECA 2H94A 2X6CA 5B1OA 1YHQV 5B1AB 2JJ2G 1MABG 1TUEB 1R3JC 1IXMA 3AG4C 3WG7C 2YEVB 2HLDG 3G6EV 4DO2A 2ZR3A 3CC7V 5C93A 3T1CA 2M7WA 4YXWG 2D3OW 3VBBA 3SYOA 1GTOA 3K06A 3ZRWA 2JJ1G 4BAYA 3LDCA 3R65A 2Q67A 1BHBA 2DYSB 1K33A 1V55B 1VQNV 1YTFB 5LBQA 1H38A 3JYCA 2W6JG 5LGTA 5KUMA 1QVGU 4RUEA 1M56C 3ZRSA 2Q6AA 1VQKV 3ZRXA 4ZKIA 2ZQMA 1GKFA 4JAUA 1AI6A 1M9NA 1K7DA 2IU0A 3OUFA 2ITDC 2ATKC 4P2ZA 3OMNB 3OMAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPG A;  1XL6 A;  4EKW A;  3T2M A;  2Q69 A;  2R9R B;  3E8F A;  4GX1 A;  3LDE A;  4G28 B;  4J9Z B;  2AHY A;  1S5H C;  5CBF A;  2WLL A;  3AG3 C;  4P9P A;  1P7B A;  1M57 C;  2WLK A;  5EBM C;  5KUK A;  3E8H A;  5B1A C;  4TWK A;  3F5W C;  2HJF C;  3F7Y C;  3OR7 C;  4MVS A;  1R3I C;  1K4D C;  2WLN A;  4I9W A;  4MVU A;  3HPL C;  4PDR A;  1OCC C;  2EIJ C;  4X88 A;  4RAI A;  3UM7 A;  4MW3 A;  4P9O A;  4XDL A;  3BEH A;  4WFF A;  4R6Z A;  1R3L C;  4GX2 A;  3SPI A;  5B1B C;  2EIK C;  2W0F C;  3FB6 C;  5EC1 C;  2WLL B;  4DXW A;  4QNH B;  2YEV A;  3E86 A;  4H33 A;  4R50 A;  4X89 A;  3STL C;  2K1E A;  3ZJZ A;  1LNQ A;  1ORQ C;  4LBE C;  3EFF K;  3OUS A;  2DWE C;  3RBZ A;  4BW5 A;  2DYS C;  1G4Y B;  1V55 C;  3RVZ A;  2EIM C;  2X6A A;  4XDK A;  2Y69 C;  3AG2 C;  4PA6 A;  3LUT B;  3OGC C;  4GX0 A;  2H8P C;  4QE7 A;  2P7T C;  5EK0 A;  3FB7 C;  3LDD A;  2IH3 C;  4JTC B;  4HYO A;  4OXS A;  3X2Q C;  3SYA A;  3E8G A;  3T4Z A;  3K03 A;  1V54 C;  1QLE C;  3SPC A;  4R8C A;  3STZ C;  3T4D A;  3SPJ A;  2QKS A;  4QE9 A;  1JVM A;  4PDM A;  3SPH A;  3E89 A;  2EIL C;  3SYP A;  3TCU A;  2A0L A;  4MSW C;  4MTG A;  4F4L A;  2KB1 A;  3FB5 C;  3FB8 C;  4MTO A;  2DWD C;  4WFH A;  3PJS K;  3E8B A;  2Q68 A;  4XDJ A;  3KG2 A;  4MW8 A;  3IFX A;  4PA9 A;  2X6B A;  4MVR A;  4PA4 A;  1R3K C;  5CBH A;  4MVM A;  3F7V C;  4WFE A;  1OCO C;  1ZWI C;  2IH1 C;  3SYQ A;  5EBW C;  2JK5 C;  1K4C C;  4MS2 A;  4PA7 A;  2ZD9 A;  3LNM B;  1OCR C;  4LCU C;  1XL4 A;  2X6C A;  4PDL A;  3IGA C;  5CBG A;  2BOB C;  3E83 A;  3ABK C;  4X8A A;  4R7C A;  3K04 A;  1R3J C;  3AG4 C;  3WG7 C;  4MTF A;  3SYC A;  2A79 B;  2AHZ A;  2WLI A;  4MVQ A;  2HVJ C;  4ZBM A;  3UKM A;  5E1A C;  3T1C A;  4KFM A;  2EIN C;  1OCZ C;  4HZ3 A;  4RO2 A;  3SYO A;  2A9H A;  3K0G A;  3K0D A;  3AG1 C;  3RVY A;  3K06 A;  3ASN C;  3VOU A;  4MVZ A;  4WFG A;  4CBC A;  3RW0 A;  4MVO A;  2WLH A;  5J9P C;  4H37 A;  5BZB A;  2WLM A;  3LDC A;  3OR6 C;  3R65 A;  4GX5 A;  4RUF A;  2ZXW C;  2Q67 A;  2DYR C;  2WLI B;  4G27 B;  5IY5 C;  2QTO A;  3JYC A;  3K08 A;  2OCC C;  5KUM A;  5B3S C;  3ABL C;  4RUE A;  1M56 C;  5EC2 C;  1KKD A;  4J9Y B;  4LP8 A;  3ZRS A;  2Q6A A;  1J95 A;  4PDV A;  1BL8 A;  3GB7 C;  4JTA B;  4PA3 A;  3TET A;  5EBL C;  4JTD B;  3ASO C;  3ABM C;  3SJQ C;  3OUF A;  2HFE C;  4P30 A;  2ITD C;  2HVK C;  2WLJ A;  2HG5 C;  2NLJ C;  2ATK C;  2ITC C;  4P2Z A;  4UUJ C;  2BOC C; 
#chains in the Genus database with same CATH topology
 4LF9 B;  2VQF B;  4G28 B;  3AG3 C;  3R66 A;  3L72 H;  5CA3 A;  4TWK A;  4FM0 A;  3AG4 B;  4PDR A;  4O2A B;  5HFL A;  2JGD A;  4FLY A;  1NH2 B;  4JI0 B;  2QWO B;  3FKS G;  3CCS V;  1LNQ A;  4LBE C;  4LF5 O;  3T1Y B;  4BW5 A;  4W4K A;  4PV1 B;  4NXN B;  1X4T A;  2X0L A;  3JAL A;  1GM8 A;  1AJQ A;  3P30 A;  3RGB A;  1R6T A;  5IYC O;  4LF7 O;  1VP7 A;  2ETN A;  4BR6 A;  3T4D A;  2R9A A;  2EBO A;  1PNM A;  2EIK B;  2W0X A;  3B77 A;  4F4L A;  4MTG A;  1JJ2 U;  1N8R W;  3OAA G;  2WAM A;  3QNE A;  3KZI Z;  3A0B Z;  1PP9 H;  3GWO A;  4IHJ B;  4JI2 O;  3RYF B;  4LF6 B;  3FYI B;  1JFF B;  1KQS U;  2CGO A;  5BY1 A;  3D8C A;  4X66 B;  3Q4H A;  2WLI A;  1TVK B;  5E1A C;  4JI6 B;  2ZR2 A;  2ZE5 A;  4DR7 B;  4DV4 B;  2RDC A;  4CBC A;  3RYI A;  3J7A U;  4RUF A;  2WA3 A;  3AK1 A;  2YIB D;  5CB4 B;  4B3S B;  1T5E A;  1FYJ A;  2QM8 A;  1SET A;  5FNV B;  4LF8 B;  3M99 B;  3HKE A;  5FPO A;  2YI9 A;  1Q6I A;  1CP9 A;  4P30 A;  1GM7 A;  2HVK C;  4DUZ B;  2QTS A;  4I7Z B;  4X62 O;  3BRC A;  2OT5 A;  4IIJ A;  3LNN A;  1Y4M A;  5CBF A;  1JOY A;  2CUG A;  1O9H A;  4UXN A;  5B5E Z;  3F5W C;  4GYC B;  3SJC C;  4PEL A;  1L0N H;  1VEW A;  2BSK A;  1TGO A;  4GX2 A;  4PI0 A;  4U7N A;  5EIB D;  1SQF A;  2YEV A;  1M4U A;  2FKX A;  4OGQ B;  2PTM A;  4X64 O;  2BCC H;  1WAZ A;  1ZAU A;  1A32 A;  3JAT B;  3RN4 A;  5IY5 B;  3PN1 A;  2OTL V;  3ABL B;  4LFB B;  3L73 H;  3P3N A;  1KC8 W;  1NQT A;  1XDC A;  1K92 A;  4UCS A;  1WN7 A;  5DEC A;  3X2Q C;  1I5Y A;  1E1R G;  1UJW B;  4KXR A;  2AZ0 A;  5LHI A;  3TXS A;  2P06 A;  3E8B A;  5CN0 A;  4WCE V;  1HWY A;  3LNM B;  1HNX B;  1YTF D;  3ABK C;  1XEQ A;  4YJ3 A;  4DRX A;  4CH5 A;  2XAH A;  4ZBM A;  2UUA O;  5GTI Z;  5L3F A;  2Z3Y A;  4F6R B;  3UO3 A;  2WLM A;  2VQE B;  5LHH A;  2WLI B;  1MA1 A;  4NXM B;  3RYH A;  1BZK A;  2JS5 A;  2DW4 A;  2CK3 G;  2P90 A;  1F23 A;  3B09 A;  4JTD B;  2O57 A;  1XNR B;  2B1I A;  3H9V A;  3QO8 A;  4YY3 O;  4OPA A;  4DV3 O;  4WF9 V;  1M90 W;  4UUJ C;  1VQ7 V;  3O65 A;  4LF4 B;  4NR1 A;  4JPR A;  3HKE B;  4DW0 A;  3BAA A;  1VF5 B;  2EJR A;  3OMI B;  3H1K H;  2ZNI A;  4MVU A;  3DXR B;  4WFA V;  4DV0 B;  4IGG A;  4IIJ B;  2ZKO A;  4JI3 B;  2LO1 A;  2AW9 A;  3CRA A;  1G6U A;  3DC6 A;  1AI4 A;  2QGN A;  1KP2 A;  1IBK B;  1SQP H;  1K3E A;  2XUM A;  1N33 B;  2EIM C;  3LUT B;  1HNW O;  3FB7 C;  2HP8 A;  2UU9 O;  1S0V A;  4PD4 F;  2JEU A;  2XOK G;  4MT8 A;  2EIL C;  3JAR A;  2IJJ A;  3FB5 C;  1VF6 C;  1XMQ O;  4MW8 A;  3P32 A;  3JAK A;  4H44 B;  3AG2 B;  1XRE A;  1K4C C;  2ZD9 A;  2YXY A;  1Z5W A;  5CBG A;  4PDL A;  1B04 A;  3IGA C;  4HAM A;  1AP6 A;  3K04 A;  3SYC A;  1FXV A;  5IE9 A;  2L35 A;  1NVP D;  4HZ3 A;  4TQF A;  3AG1 C;  4DUY B;  3APO A;  4GX5 A;  2ZXW C;  1IBL B;  1S5L Z;  4DRX B;  4B08 A;  3K59 A;  2OYQ A;  1J95 A;  1SZT A;  4FLW A;  2RQ6 A;  2YUA A;  2F93 B;  3CEI A;  3N2K A;  3QO7 A;  2V4D A;  2UXX A;  3RYH B;  3SPG A;  4ZHQ A;  2Q8V A;  2R9R B;  2XAS A;  3CPW U;  5L3C A;  4JI8 B;  5LOV B;  1N36 O;  4K0K O;  4U3F H;  2Z0A A;  3N2G B;  5KX5 A;  4MW3 A;  4RQE A;  1EFR G;  4R6Z A;  1HNZ O;  2UXC O;  4QNH B;  2XAF A;  3MAQ A;  1P49 A;  1ORQ C;  4LF5 B;  1AJN A;  5IYD O;  4DV5 B;  1N34 B;  1QR9 A;  3RVZ A;  3AG3 B;  3BAB A;  4UCO A;  4GX0 A;  2ZIN A;  4H0L B;  5B3S B;  4CZZ A;  5KHK A;  4J42 A;  4LF7 B;  2F4V B;  1WLE A;  5DN6 G;  4UB8 Z;  3K03 A;  4MSW C;  3E2E A;  2BTO A;  2YDE A;  1KB9 F;  4FK5 C;  4JYY A;  4MVR A;  2E5L O;  2VWK A;  3BY6 A;  4ICG A;  4FIP C;  5EBW C;  4X1K A;  1M57 B;  1OCR C;  1XL4 A;  3JAR B;  5B1O A;  1MAB G;  1TUE B;  3WG7 C;  1WPB A;  4AI8 A;  2DE0 X;  1KKC A;  4LNU B;  3G6E V;  3K5N A;  2QR4 A;  1WB8 A;  5C93 A;  3T1C A;  2M7W A;  1OJH A;  3E22 B;  4UFZ A;  2D3O W;  5JCO C;  3JAK B;  3SGI A;  4ZOL A;  1WA8 B;  4JYA O;  1BS3 A;  2JJ1 G;  3P3P A;  3LDC A;  3FX7 A;  2Q67 A;  2JVD A;  2WA4 A;  1VQN V;  4DV2 B;  3JYC A;  4C7U A;  5ITZ A;  4DR3 B;  3APQ A;  1AI6 A;  1KU9 A;  4B3R O;  4DV7 O;  4KHP B;  4P2Z A;  3OMA B;  2YC0 A;  1OV9 A;  3OFN G;  1GN6 A;  2PZS A;  4DR1 B;  1LUV A;  4NVP A;  3U11 A;  3N2K B;  2ZIM A;  3JD3 A;  1R3I C;  3ETG A;  5KA5 A;  2EIJ C;  3UM7 A;  4RAI A;  4ZHQ B;  1GAX A;  4YHH B;  2Q7H A;  3QF7 A;  3OE7 G;  2QSA A;  3DSQ A;  5B1B C;  4I50 A;  2ZCE A;  2HJD A;  2A7W A;  4X89 A;  2R72 A;  5LYJ A;  2P4K A;  1FD9 A;  4EFE A;  2GSM B;  1K8A W;  2JDI G;  2H3O A;  4TV8 A;  4JI7 B;  4Z2W A;  1GN3 A;  2QM7 A;  4TSF G;  4AQY B;  4U3J A;  1PPJ H;  4DW1 A;  1M56 B;  1THZ A;  4CH4 A;  1IBM O;  1L1F A;  1W59 A;  3QG5 A;  4CC5 A;  2ZE6 A;  3L75 H;  3SYA A;  2ZM6 O;  1WP8 A;  3L74 H;  2DJV A;  2B5U A;  5BXZ A;  2DWD C;  3CRQ A;  1GK9 A;  4I4T A;  2AGA A;  3ABT A;  4PA9 A;  4GKK O;  3F7V C;  4F6E A;  4FLV A;  2JK5 C;  2C2A A;  4MS2 A;  3WB2 A;  5L3B A;  1YZB A;  3A0R A;  2CE4 A;  3BA8 A;  3HKD A;  2P67 A;  4DV6 B;  4JI4 O;  1JX9 A;  3OW2 U;  4CC6 A;  1IUR A;  1IZ3 A;  4K3A A;  1Z2G A;  1R6N A;  1GRJ A;  3CCE V;  4X1K B;  4MVO A;  5J9P C;  1K5S A;  4H37 A;  4B3T O;  1G1X B;  4CS2 A;  1Y74 A;  5H9C A;  2IU3 A;  2N04 A;  4G27 B;  1DLB A;  3NR7 A;  2HR3 A;  2OCC C;  1YIJ V;  1GH6 A;  1KKD A;  3CME V;  4X65 O;  4PDV A;  2GV9 A;  2Y48 A;  2ZDI C;  1BT8 A;  3G4S V;  4O4J A;  5FPR A;  1K34 A;  5LL6 Y;  1XHZ A;  4JI1 O;  1I94 O;  3ASO C;  1Q8I A;  3JD4 A;  3CCJ V;  4DYL A;  3EVK A;  2GTA A;  1TUB A;  2ODM A;  1VQP V;  4WBN A;  1SKV A;  5H2F Z;  4YJ2 B;  2V1D A;  4O4L A;  1OCO B;  2WLN A;  5IJ9 A;  2JEX A;  2LFS A;  1MZE A;  1CXZ B;  1ZX3 A;  4I0X B;  5EYP A;  1ZUQ A;  5EC1 C;  3STL C;  5DED A;  2DMX A;  4DR5 O;  3LSU A;  1K9M W;  3A0H Z;  1ZTE A;  4DV1 O;  5FL7 G;  1XOU A;  4PA6 A;  1H8H G;  5JJJ B;  1FXK C;  1Y66 A;  4I50 B;  5EK0 A;  2N05 A;  5LYJ B;  1JMK C;  1VIB A;  3KCY A;  1V54 C;  4LFA B;  1JVM A;  3QTC A;  4PDM A;  5B1N A;  1YI2 V;  2MW2 B;  2KB1 A;  4NTX A;  2Q7G A;  3CSX A;  4WFH A;  1RM1 B;  4U3J B;  1GM9 A;  2OTJ V;  3KG2 A;  1TAE A;  3IFX A;  1VQO V;  2UUC O;  4PA4 A;  3TJT A;  1AI5 A;  3D3I A;  4FFK A;  2EZP A;  1EZJ A;  2WSS G;  2BOB C;  3E83 A;  3ZHU A;  4BW9 A;  2YXL A;  1OCC B;  1M93 A;  4MVQ A;  5L3G A;  5C8Y A;  1BQ0 A;  1WP7 A;  1M5I A;  1BMF G;  4FM2 A;  5EZY A;  3ASN C;  1SQQ H;  3OR6 C;  3H1I H;  5JCO A;  4UV9 A;  3HKD B;  2DYR C;  4GT1 A;  3DGE A;  2YIB A;  4PA3 A;  4FFB A;  5LP6 C;  2XAQ A;  1Y74 B;  2DOS A;  2XT9 A;  3QO5 A;  4EKW A;  3T2M A;  1FFT B;  3IC9 A;  2ZXW B;  5LGN A;  1U97 A;  1YJW V;  2AHY A;  1Y76 B;  4O4I A;  4O4J B;  4P9P A;  2OIE A;  2WLK A;  2GBO A;  2HJF C;  2PUS A;  4ZIB A;  4HNA A;  4TUY A;  1HNZ B;  1YJN V;  2OIG A;  4R50 A;  3W7S A;  1UPG A;  4UB6 Z;  5JVD A;  1Q6U A;  5IJ9 B;  3BVO A;  1FKA O;  4E2L A;  1EN5 A;  2Y69 C;  1COW G;  5EYP B;  2RNB A;  2R70 A;  1RFY A;  3K5L A;  3ZN0 A;  1DF4 A;  3OEH G;  1PM9 A;  1FAF A;  1FPO A;  3E8G A;  3L70 H;  1QLE C;  3CRM A;  5HFM A;  4NKG B;  4QE9 A;  2ZT9 B;  3JAW A;  3ABM B;  4DR6 O;  2JGU A;  3PJS K;  3ZHT A;  2E75 B;  4JI5 O;  4FLT A;  3RWR D;  3TK1 A;  1US6 A;  2BE3 A;  3J81 N;  2ZIO A;  1R3K C;  4UCR A;  2HHH O;  4PA7 A;  2JGD B;  3OGI B;  3ZBH A;  4TV9 A;  3ABU A;  2K9P A;  4X8A A;  1AB3 A;  3ZHV A;  3B4S A;  3CCR V;  1NR7 A;  1NZ6 A;  4KFM A;  2EIN C;  1OCZ C;  3ICX A;  1W0K G;  4JYA B;  2FML A;  2AXT Z;  3JAL B;  3IC7 A;  3NXS A;  4CS3 A;  1J5E B;  1ARO P;  1PNK A;  1PL0 A;  1XNQ O;  4FLZ A;  3CXC U;  4L8J A;  4TOI A;  4LP8 A;  1SER A;  3TGU H;  5LMN B;  3WG7 B;  3N27 A;  5EZY B;  4U7O A;  2XND G;  2DQ3 A;  1TA8 A;  2ZDI A;  2NLJ C;  3WFV A;  1H8E G;  5KMG A;  3OTF A;  3E8F A;  1VQ8 V;  4GKJ B;  1P7G A;  4FFB B;  3Q4H B;  1XMO O;  1YIT V;  5B1A C;  5K1X A;  3OR7 C;  1K4D C;  1H2S B;  3ZED A;  5A9G A;  1QU7 A;  1MZF A;  3RYI B;  2GHY A;  1XUQ A;  2QE7 G;  4B3M O;  1P4R A;  3BFR A;  4N23 A;  1NKD A;  1E79 G;  4QJF B;  4DR2 B;  4XDK A;  2XAJ A;  2IJI A;  3FAV A;  4HNA B;  3OGC C;  4TUY B;  1IBM B;  1CPY A;  2JIZ G;  3JCU Z;  3T4Z A;  3ETD A;  5JVD B;  3D36 C;  1FXK A;  3TCU A;  2Z5U A;  4I5S A;  4EFB A;  4DR4 O;  4GZR B;  1DF5 A;  4FM1 A;  2UXB O;  2BTQ A;  2QWQ B;  2LFR A;  3JCZ A;  2JS3 A;  2P5O A;  2QM4 A;  4MVM A;  2LQT A;  3THO A;  3CE2 A;  2BSK B;  4OX9 O;  4JZG A;  1VQ4 V;  1KEC A;  2X6C A;  3ZHS A;  2KSD A;  1IXM A;  3AG4 C;  2YEV B;  4NYK A;  3SDL A;  3HKB A;  2ZR3 A;  1IXB A;  3S3W A;  1BGY H;  3K06 A;  3CRR A;  4LF9 O;  2VQF O;  4TV9 B;  4BAY A;  3G67 A;  3L9D A;  4ZI7 A;  4LFC B;  4LWS A;  2DYS B;  1K33 A;  1V55 B;  5BMV A;  3IAY A;  1YTF B;  5LBQ A;  5KUM A;  1QVG U;  2AZ2 A;  2CH7 A;  2Q6A A;  2CGN A;  5BR8 B;  1K7D A;  3OUF A;  3JSL A;  4PI2 A;  4JI0 O;  3OMN B;  5LP6 A;  2P22 C;  4X1Y A;  1D2D A;  4J9Z B;  4YJ3 B;  4NXN O;  1Y67 A;  2CTQ A;  1F7Y A;  2DN9 A;  2LW1 A;  4RWU A;  1B6Q A;  4EEQ A;  1NR1 A;  1URF A;  3T1H B;  4ABM A;  1R3L C;  3SPI A;  2Y4T A;  2QJ1 A;  3AK3 A;  3SR2 C;  3JD1 A;  3RBZ A;  1BQZ A;  1OZ0 A;  3LSS A;  4YIP A;  3VQY A;  4LF6 O;  3ZN1 A;  4X66 O;  1QLN A;  3ZMZ A;  1NTK H;  4HYO A;  4B7E A;  3ZMU A;  1Q7Y W;  4JI6 O;  5FLX N;  4IYH A;  1NTM H;  3UQ8 A;  4DR7 O;  5KLV H;  4DV4 O;  2QKC A;  1DGS A;  3FB8 C;  3UO2 A;  3KCX A;  1ENV A;  3FAV B;  2XTA A;  1VQM V;  2X6B A;  1M1K W;  1SA0 A;  2PYL A;  3SYQ A;  1ZWI C;  3C3T A;  1SZX A;  1AR4 A;  3SJB C;  4B3S O;  1Q86 W;  2GTS A;  3KKY A;  3MDS A;  1I5X A;  2PGG A;  3RYC A;  1I0H A;  1IVS A;  4LF8 O;  3HB3 B;  3J80 N;  2HVJ C;  1BSM A;  2BTQ B;  2Q73 A;  3RT3 C;  4DUZ O;  3C90 A;  4O4H A;  1Q43 A;  1Q6H A;  1RP3 B;  3K0G A;  3K0D A;  2A06 H;  2PI4 A;  1H2M A;  2IW5 A;  2P6J A;  3CMA V;  3HKB B;  5IY5 C;  4GCZ A;  1SRY A;  3WU2 Z;  3ABL C;  3TXQ A;  5CA1 A;  2OCH A;  4JGS A;  3W7T A;  4A5U B;  4JI2 B;  3JAS A;  3K9A A;  1NVP B;  2E76 B;  4ZI7 B;  1S3J A;  4W4L A;  2F95 B;  1L8D A;  3EXA A;  3SJQ C;  3CCV V;  2YXH A;  5BMV B;  2VS0 A;  2CTW A;  3O9O A;  5LMU O;  2ITC C;  3ASN B;  3ZMS A;  1KBH A;  2CH7 B;  3UCS C;  3E35 A;  3GWK C;  1HDJ A;  2D2C B;  1N0J A;  2WLL A;  2FTK A;  3DTU B;  3FFQ A;  1XIL A;  5JJN B;  4LFB O;  1BHA A;  1QHT A;  2YS8 A;  4D7T A;  3G80 A;  5DM6 V;  1AI7 A;  2WWW A;  2YIC A;  4X88 A;  4QGP A;  4X1Y B;  5L3D A;  3H1H H;  5IWA O;  4DXW A;  4D7S A;  2CTP A;  3E86 A;  2G38 A;  4X62 B;  1SQX H;  2ARH A;  4X1I A;  1WNS A;  1L0L H;  2H8P C;  1HNX O;  1R6K A;  2OWO A;  3JSN A;  5H6Q A;  3QVN A;  4OXS A;  4BIU A;  3ZX6 A;  4R8C A;  3SYP A;  4DR6 B;  4MTX A;  2VQE O;  4XDJ A;  4XBF A;  5KHI A;  3B8M A;  1XHX A;  3D36 A;  5CA0 A;  4Q6G A;  4X64 B;  4NXM O;  5KX5 B;  4NTW A;  3B2E E;  1RSO A;  1VMG A;  1N0N A;  1XNR O;  4NB5 A;  1SA0 B;  2GDS A;  1G8M A;  4LF4 O;  4X20 A;  4WFG A;  1W2B U;  2Y0I A;  1NJI W;  2KKW A;  3JD2 A;  3ZMT A;  3RYC B;  5JH7 A;  2QWN B;  5H5N A;  1D5A A;  1VF6 A;  5EC2 C;  2EZO A;  4J9Y B;  4O4H B;  1AVM A;  1JCH A;  1ZSP A;  3CWB H;  4DV0 O;  5EBL C;  3X2Q B;  4JI3 O;  1IDS A;  2UUA B;  1S77 D;  1OCZ B;  5IJ0 A;  4E4E A;  4UCV A;  1IBK O;  1NH2 D;  1XL6 A;  5CA1 B;  2Q69 A;  3W7X A;  1GO3 F;  5LA6 A;  3M8A A;  1VQ5 V;  3EHB B;  2V7Q G;  4OPH A;  1FS0 G;  4JZ2 A;  1YVW A;  1P7B A;  3ETQ A;  1XI1 A;  1B06 A;  1I7F A;  2Q0A A;  3ABK B;  2FB5 A;  4ZOL B;  3DC5 A;  3BEH A;  2W0F C;  4YY3 B;  2WLL B;  4LR3 A;  4DV3 B;  4B3M B;  3ZJZ A;  1TVK A;  1U96 A;  5ITZ B;  2HKO A;  1FFX A;  4TQD A;  1EN6 A;  4QE7 A;  1GMG A;  3ZMV A;  2P7T C;  2Q0O C;  2UXN A;  1WPX A;  2X7R B;  4I55 A;  1KYO F;  1R73 A;  5CMU A;  3W7U A;  1PKX A;  2YSU B;  5CB4 A;  5IYZ A;  5AG2 A;  3SPJ A;  3I5D A;  1ROP A;  5IDJ A;  3U0Z A;  3A2F A;  2RN9 A;  4DUY O;  2Q68 A;  5J2U A;  1AP5 A;  1IBL O;  4WFE A;  1QVF U;  1QQC A;  1HNW B;  3UT5 A;  5JWP A;  2UU9 B;  1S72 V;  5CA0 B;  1EN4 A;  1H2L A;  1GN2 A;  2LP7 A;  4RO2 A;  4TV8 B;  3CCU V;  1VQ6 V;  4H13 B;  1K97 A;  1XMQ B;  1Q81 W;  2F1M A;  1RSO B;  2NN4 A;  2Q9L A;  4JI8 O;  2F23 A;  2EIM B;  1UFI A;  1JPX A;  3I56 V;  5B3S C;  4AHC A;  3H01 A;  3OTO O;  1S76 D;  4K35 A;  4X20 B;  4RQF A;  1N4C A;  1QCE A;  3JAT A;  5H6R A;  4I4T B;  1JQ0 A;  5D5Q A;  5JH7 B;  4KUM A;  4FZ0 A;  2EIL B;  3K79 A;  1IX9 A;  2L6L A;  4DV5 O;  2MK3 A;  1N34 O;  3BCC H;  1M57 C;  3CX5 F;  1R1B A;  3E8H A;  1SQG A;  1Z5V A;  5IJ0 B;  2XHB A;  2F4V O;  1FJG O;  4JV5 O;  3L71 H;  4J41 A;  4XDL A;  5IT9 N;  3CCM V;  4WFF A;  5LA6 B;  3ZCC A;  5JQG A;  3FB6 C;  3AK2 A;  3AG1 B;  2A3Q A;  2IJK A;  3EFF K;  5L3E A;  4F6R A;  1K73 W;  1N36 B;  3MD0 A;  4K8Z A;  1YCI A;  4J80 A;  4K0K B;  3ZRV A;  3LDD A;  3ZIA G;  3G6B A;  5LHG A;  1RPO A;  1Q82 W;  2QKS A;  1TUB B;  3E89 A;  1FFX B;  3CJH A;  4WBN B;  2UXC B;  1YDX A;  3GVM A;  4MTO A;  4O4L B;  3CP1 A;  1PD3 A;  1AIL A;  1KP3 A;  1MOF A;  4I55 B;  4L87 A;  4DV2 O;  2QWP B;  1HR0 O;  1ZL8 A;  2NR5 A;  5F2V O;  3RFR A;  5IYZ B;  1AR1 B;  2H94 A;  1YHQ V;  4DR3 O;  1R3J C;  5B66 Z;  4Z1V A;  5J2U B;  2HLD G;  4K8X A;  4DO2 A;  3CC7 V;  4YXW G;  3VBB A;  3SYO A;  4KHP O;  1GTO A;  2QDO A;  3DXR A;  3ZRW A;  2ADP A;  3R65 A;  1V9P A;  3UT5 B;  2E5L B;  1BHB A;  4DR1 O;  3D3Q A;  2UUB O;  2ZE7 A;  2W6J G;  1Q3E A;  4RUE A;  1M56 C;  3VQV A;  1N32 O;  4YHH O;  4ZKI A;  2ZQM A;  5KHJ A;  1MNG A;  1WJZ A;  5GTH Z;  1M9N A;  2IU0 A;  2F66 C;  5LMU B;  1G4Y B;  3ZHQ A;  4DK0 A;  1QR8 A;  4QPJ A;  5K1P A;  5A2Q N;  4JI7 O;  1D5N A;  3CCL V;  4AQY O;  1BCC H;  3ETE A;  1VQ9 V;  5C8Y B;  1OCR B;  2FYU H;  2JRI A;  1SQV H;  2W6I G;  2PYJ A;  4NTY A;  4EB6 A;  5IWA B;  1LR1 A;  4B3R B;  1K5Q A;  4DV7 B;  2PF4 E;  3OUS A;  3CCQ V;  1WB7 A;  2QA4 V;  4FJC C;  1BE3 H;  4J7J A;  4UCT A;  5JQG B;  3MHH C;  3OEE G;  4DV6 O;  3AEI A;  4O2B A;  3SPC A;  3STZ C;  4J10 A;  2EX3 A;  3CC2 V;  3K9S A;  4O4I B;  3M7M X;  4KP4 A;  2CDY A;  4J7K A;  1QNM A;  5LGU A;  1GN4 A;  4UV8 A;  1OCO C;  3G71 V;  3AG7 A;  5KAF Z;  3CJH B;  4UVB A;  4R7C A;  1HP8 A;  3MHS C;  4FZ1 A;  5LOV A;  1MSW D;  2AHZ A;  2HEP A;  2EIJ B;  4CH6 A;  3UKM A;  2ZM6 B;  2ILM A;  4UVA A;  3ZS8 C;  1H2G A;  5B1B B;  2Y0P A;  3N2G A;  1ZL8 B;  3LSQ A;  3K3W A;  5D5P A;  2WLH A;  2LW7 A;  5BZB A;  4JAS A;  2Q4P A;  4GKK B;  4FLX A;  1PV0 A;  5GW7 A;  3K5M A;  1VF7 A;  3JAW B;  2UXD O;  1BL8 A;  2NNU A;  4JTA B;  3ZRW B;  1JR9 A;  1RPR A;  3U10 A;  3CXH F;  4JI4 B;  1YSC A;  4B7K A;  2B9Z A;  2WLJ A;  2HG5 C;  1RM1 C;  1YEW A;  4JYB A;  4B3T B;  4FPP A;  4GX1 A;  3LDE A;  3VQW A;  4UCU A;  1S5H C;  4ASU G;  4FVM A;  1CEZ A;  2IJH A;  3WB1 A;  3F5T A;  2E3C A;  3F7Y C;  4X65 B;  4IL6 Z;  1OCC C;  4LFA O;  4P9O A;  2P4V A;  2PI5 A;  4JI1 B;  1I94 B;  2EIK C;  3VQX A;  1X59 A;  4J7Z A;  3FYE B;  1JA8 A;  3IJ4 A;  4LNU A;  2K1E A;  3CHX A;  3E22 A;  3T1Y O;  1DTO A;  2LGQ A;  4GUN A;  1WA8 A;  4BIZ A;  1NBM G;  2X6A A;  2ZNJ A;  1EM1 A;  4LH7 A;  1OHH G;  2LJ2 A;  2OCC B;  4EB6 B;  4IYI A;  2IH3 C;  4JTC B;  4WFB V;  5KMG B;  3OM3 B;  3A8T A;  4J11 A;  3SPH A;  3ASO B;  4JAA A;  1MG1 A;  2RCV A;  4UVC A;  3CD6 V;  1AJP A;  4BWA A;  4DR5 B;  1KD1 W;  5CBH A;  4DV1 B;  1QBZ A;  4AIL C;  4O2B B;  5GON A;  3CC4 V;  1H2K A;  1SS3 A;  2VRZ A;  4MTF A;  2IBZ H;  2CAZ C;  1XBL A;  3SJA C;  1W0J G;  3RVY A;  3VOU A;  3OT7 A;  3WB0 A;  2UUC B;  1Y6X A;  4LC1 A;  1PL4 A;  4IT5 A;  1YJ9 V;  3W7W A;  4JF3 A;  1FXK B;  3CB2 A;  2VWJ A;  3OTO B;  4KL1 A;  3GB7 C;  1Q90 D;  5KAI Z;  3TET A;  3FD9 A;  1V54 B;  3ABM C;  2HFE C;  2LGW A;  1VQL V;  1AR5 A;  2BOC C;  2YID A;  1F51 A;  4DK1 A;  1O9G A;  5EBM C;  2PY5 A;  4FMT A;  3BHP A;  1YXB A;  4MVS A;  1FJG B;  2XAG A;  4I9W A;  4JV5 B;  2KG7 A;  4LWS B;  1XQ8 A;  4Z1M G;  1NS1 A;  3JD0 A;  1H2N A;  2KQX A;  1DK1 A;  3BPZ A;  4QPK A;  4N21 A;  4QIW F;  2DYR B;  1P84 F;  2QEX V;  4G2K A;  1KMI Z;  4GLX A;  5LP6 B;  5JJE B;  2A0L A;  1SC5 B;  5J2T A;  5KHG A;  1NI8 A;  1LUW A;  3HKC A;  1B3Q A;  2QKA A;  3B8N A;  5LXT A;  1J5E O;  2RMK B;  1HR0 B;  2IH1 C;  3HR0 A;  1E1Q G;  4LCU C;  2B1G A;  4TT3 G;  5LMN O;  2Y4U A;  4YJ2 A;  2A79 B;  4YIO A;  2GUZ A;  1F4N A;  1HW7 A;  4X9Q A;  1PNL A;  2A9H A;  2EJ7 A;  2IM9 A;  5GON B;  5KA6 A;  4MVZ A;  4I0X A;  3RW0 A;  3CRC A;  4JI5 B;  2QWR B;  3K57 A;  4JAV A;  4GKJ O;  2Q5Z A;  2UUB B;  1SQB H;  2QTO A;  2Y69 B;  2HHH B;  3K08 A;  1VAR A;  1N32 B;  2F43 G;  5EIB C;  4Q20 A;  1QLE B;  1YF2 A;  3CYO A;  4HBN A;  3I55 V;  4O2A A;  4CS4 A;  1NTZ H;  4DR2 O;  2DQ0 A;  1MSD A;  4LH6 A;  2WPD G;  5KUK A;  1S5J A;  1XNQ B;  3ZHR A;  1KUQ A;  3HPL C;  1F4M A;  1EZV H;  3ML0 A;  2R9I A;  2EIN B;  3S3X A;  3C3S A;  3BA9 A;  1ZLZ A;  4H33 A;  5KHH A;  5IYB O;  1FXH A;  2DWE C;  4I9Q A;  1N33 O;  2DYS C;  1V55 C;  2KG7 B;  5E79 Z;  3AG2 C;  3JAS B;  1NU1 H;  1XMO B;  1Q5O A;  4CH3 A;  1SES A;  2M6Y A;  3OD4 A;  4IHJ A;  4PJ0 Z;  3RYF A;  1JFF A;  4LFC O;  4JYC A;  1NT2 B;  2RJZ A;  1I08 A;  2FL4 A;  1EBO A;  3CS5 A;  3H1L H;  5B1A B;  2JJ2 G;  4D6T H;  5J2T B;  1Y76 A;  5BR8 O;  2E74 B;  3HKC B;  5LXT B;  4X1I B;  3H1J H;  3B40 A;  2Q7E A;  5TIS Z;  2EUL A;  2YIA A;  4DR4 B;  5FNV A;  2UXB B;  2N74 A;  1MMM A;  4BIO A;  1SF9 A;  2GUZ B;  1JJO A;  1H38 A;  5LGT A;  4OX9 B;  3ZRS A;  1VQK V;  2UXD B;  3ZRX A;  2ZE8 A;  4FLU A;  3T1H O;  3JAM N;  4PHZ A;  1GKF A;  4JAU A;  3K58 A;  2ADQ B;  2YI8 A;  2ITD C;  3K5O A;  2CTR A;  2ATK C; 
#chains in the Genus database with same CATH homology
 1QR8 A;  3OFN G;  4QPJ A;  4G28 B;  4J9Z B;  3CCL V;  3AG3 C;  3ETE A;  1VQ9 V;  5CA3 A;  1OCR B;  4TWK A;  3JD3 A;  1R3I C;  3ETG A;  3AG4 B;  2W6I G;  1B6Q A;  2EIJ C;  4PDR A;  4RAI A;  3UM7 A;  5KA5 A;  5HFL A;  1NR1 A;  1R3L C;  3SPI A;  3OE7 G;  5B1B C;  1NH2 B;  4X89 A;  1K5Q A;  3FKS G;  3CCS V;  1LNQ A;  4LBE C;  2GSM B;  1K8A W;  2JDI G;  3JD1 A;  3OUS A;  3RBZ A;  4BW5 A;  3CCQ V;  2QM7 A;  4TSF G;  1OZ0 A;  2X0L A;  2QA4 V;  4FJC C;  3LSS A;  1GM8 A;  1M56 B;  1THZ A;  1AJQ A;  3P30 A;  3ZN1 A;  5IYC O;  3MHH C;  1L1F A;  1QLN A;  3OEE G;  3ZMZ A;  3AEI A;  4HYO A;  3SYA A;  3ZMU A;  3SPC A;  1Q7Y W;  3STZ C;  3T4D A;  3CC2 V;  2EBO A;  1PNM A;  2EIK B;  3B77 A;  4F4L A;  2B5U A;  4MTG A;  1JJ2 U;  3FB8 C;  1N8R W;  1ENV A;  3OAA G;  2DWD C;  4KP4 A;  2WAM A;  3QNE A;  1GK9 A;  3ABT A;  4PA9 A;  1VQM V;  2X6B A;  1M1K W;  3F7V C;  5LGU A;  4UV8 A;  1OCO C;  1ZWI C;  3SYQ A;  3G71 V;  2JK5 C;  2C2A A;  3GWO A;  4MS2 A;  5L3B A;  1Q86 W;  4UVB A;  3A0R A;  4R7C A;  3MHS C;  3FYI B;  1I5X A;  1KQS U;  2P67 A;  1MSW D;  2AHZ A;  2WLI A;  1JX9 A;  2EIJ B;  3HB3 B;  2HVJ C;  3OW2 U;  3UKM A;  4UVA A;  5E1A C;  2ZR2 A;  1H2G A;  1R6N A;  5B1B B;  3K0G A;  4CBC A;  3K0D A;  3LSQ A;  3CCE V;  3K3W A;  4MVO A;  2WLH A;  5J9P C;  1K5S A;  4H37 A;  5BZB A;  2PI4 A;  4JAS A;  4RUF A;  5H9C A;  2IU3 A;  2IW5 A;  2P6J A;  3CMA V;  4G27 B;  1DLB A;  5IY5 C;  4GCZ A;  5GW7 A;  1SRY A;  2HR3 A;  2OCC C;  3ABL C;  1YIJ V;  4JGS A;  3W7T A;  1KKD A;  3CME V;  4PDV A;  2QM8 A;  1BL8 A;  2NNU A;  2Y48 A;  2ZDI C;  4JTA B;  3ZRW B;  1SET A;  1RPR A;  3G4S V;  3K9A A;  1NVP B;  1K34 A;  1YSC A;  3M99 B;  1S3J A;  3ASO C;  3SJQ C;  1CP9 A;  4P30 A;  1GM7 A;  2HVK C;  3CCV V;  3JD4 A;  2WLJ A;  2HG5 C;  3CCJ V;  1RM1 C;  3ASN B;  2ITC C;  3ZMS A;  4JYB A;  2OT5 A;  1VQP V;  4FPP A;  3E35 A;  4GX1 A;  3LDE A;  1Y4M A;  2V1D A;  1S5H C;  5CBF A;  2WLL A;  1JOY A;  4ASU G;  1CEZ A;  2IJH A;  1OCO B;  2FTK A;  3DTU B;  1BHA A;  4UXN A;  3F5W C;  3F7Y C;  2WLN A;  5DM6 V;  1AI7 A;  2WWW A;  2JEX A;  4PEL A;  1OCC C;  4X88 A;  2LFS A;  4P9O A;  2PI5 A;  5L3D A;  4GX2 A;  2EIK C;  4U7N A;  5EC1 C;  4DXW A;  2YEV A;  3E86 A;  3FYE B;  3STL C;  2K1E A;  1K9M W;  1DTO A;  5FL7 G;  4BIZ A;  1NBM G;  2X6A A;  4PA6 A;  1H8H G;  2H8P C;  5IY5 B;  1FXK C;  1OHH G;  1Y66 A;  2OCC B;  2OTL V;  1R6K A;  3ABL B;  5EK0 A;  5H6Q A;  1KC8 W;  1NQT A;  2IH3 C;  1K92 A;  4JTC B;  4OXS A;  3X2Q C;  4WFB V;  1I5Y A;  1V54 C;  4BIU A;  4R8C A;  3OM3 B;  1E1R G;  1UJW B;  1JVM A;  4PDM A;  5B1N A;  3SPH A;  3ASO B;  1YI2 V;  3SYP A;  5LHI A;  2KB1 A;  1MG1 A;  4UVC A;  3CD6 V;  4WFH A;  4MTX A;  1RM1 B;  1GM9 A;  3E8B A;  5CN0 A;  4XDJ A;  1AJP A;  3KG2 A;  2OTJ V;  3IFX A;  1VQO V;  4XBF A;  3B8M A;  3D36 A;  4PA4 A;  1KD1 W;  5CBH A;  1QBZ A;  1AI5 A;  3D3I A;  4WCE V;  1HWY A;  3LNM B;  2EZP A;  1EZJ A;  3CC4 V;  2WSS G;  2BOB C;  1YTF D;  3E83 A;  3ABK C;  4MTF A;  1OCC B;  4MVQ A;  2XAH A;  4ZBM A;  5L3G A;  1W0J G;  1G8M A;  1BMF G;  3RVY A;  3VOU A;  3ASN C;  5L3F A;  2Z3Y A;  4WFG A;  1W2B U;  2WLM A;  3OR6 C;  1NJI W;  3ZMT A;  3JD2 A;  4UV9 A;  4LC1 A;  5LHH A;  2DYR C;  2WLI B;  1YJ9 V;  3W7W A;  4GT1 A;  4JF3 A;  2DW4 A;  2CK3 G;  1FXK B;  5EC2 C;  2EZO A;  4J9Y B;  2P90 A;  1F23 A;  3GB7 C;  3DGE A;  1JCH A;  4PA3 A;  3TET A;  5EBL C;  4JTD B;  3X2Q B;  2XAQ A;  1V54 B;  2B1I A;  3QO8 A;  1S77 D;  3ABM C;  1OCZ B;  2HFE C;  4WF9 V;  1VQL V;  1M90 W;  4UUJ C;  3QO5 A;  1VQ7 V;  1NH2 D;  2BOC C;  1XL6 A;  4EKW A;  3T2M A;  2Q69 A;  3W7X A;  1GO3 F;  1FFT B;  1VQ5 V;  2ZXW B;  5LGN A;  3EHB B;  2V7Q G;  1YJW V;  2AHY A;  1F51 A;  1FS0 G;  4JPR A;  4P9P A;  1P7B A;  2WLK A;  5EBM C;  4FMT A;  2EJR A;  3OMI B;  2HJF C;  4MVS A;  3ABK B;  2XAG A;  4I9W A;  4MVU A;  4WFA V;  3BEH A;  2W0F C;  1YJN V;  2WLL B;  4Z1M G;  1AI4 A;  4R50 A;  3W7S A;  1KP2 A;  3ZJZ A;  3JD0 A;  1K3E A;  1G4Y B;  2HKO A;  4QPK A;  4N21 A;  2EIM C;  4QIW F;  4E2L A;  2Y69 C;  1COW G;  2DYR B;  3LUT B;  4QE7 A;  1GMG A;  3ZMV A;  3ZN0 A;  1DF4 A;  2P7T C;  2UXN A;  2X7R B;  1WPX A;  2QEX V;  3FB7 C;  3OEH G;  1R73 A;  4G2K A;  5CMU A;  3W7U A;  1S0V A;  3E8G A;  1PKX A;  1QLE C;  2JEU A;  2XOK G;  2YSU B;  3SPJ A;  5HFM A;  4QE9 A;  1ROP A;  5IDJ A;  4MT8 A;  2EIL C;  2A0L A;  3ABM B;  2IJJ A;  3FB5 C;  3PJS K;  2Q68 A;  4MW8 A;  3P32 A;  3TK1 A;  3B8N A;  1R3K C;  4WFE A;  2IH1 C;  3AG2 B;  1K4C C;  4PA7 A;  1E1Q G;  2ZD9 A;  1QVF U;  4LCU C;  2B1G A;  5CBG A;  3ABU A;  3IGA C;  4PDL A;  4TT3 G;  4HAM A;  4X8A A;  3K04 A;  3SYC A;  2A79 B;  1FXV A;  1S72 V;  3CCR V;  1NR7 A;  4KFM A;  1F4N A;  2EIN C;  1OCZ C;  1NVP D;  4HZ3 A;  1W0K G;  2LP7 A;  4RO2 A;  3CCU V;  1PNL A;  2A9H A;  1VQ6 V;  3AG1 C;  5KA6 A;  4MVZ A;  3RW0 A;  1K97 A;  1Q81 W;  3IC7 A;  4GX5 A;  4JAV A;  3NXS A;  2ZXW C;  1ARO P;  1PNK A;  1PL0 A;  2EIM B;  2QTO A;  2Y69 B;  1JPX A;  3K08 A;  3I56 V;  5B3S C;  3CXC U;  3H01 A;  4LP8 A;  1SER A;  1J95 A;  1S76 D;  1SZT A;  3WG7 B;  4U7O A;  4RQF A;  1QCE A;  5H6R A;  2F43 G;  2XND G;  2DQ3 A;  4Q20 A;  1QLE B;  1JQ0 A;  4KUM A;  2EIL B;  3QO7 A;  2ZDI A;  2NLJ C;  3CYO A;  3K79 A;  3WFV A;  2UXX A;  3I55 V;  3SPG A;  1H8E G;  2R9R B;  3E8F A;  2MK3 A;  2XAS A;  3CPW U;  5L3C A;  1VQ8 V;  2DQ0 A;  1M57 C;  2WPD G;  5KUK A;  1YIT V;  3E8H A;  5B1A C;  3OR7 C;  1K4D C;  3HPL C;  4MW3 A;  4XDL A;  1F4M A;  4RQE A;  3CCM V;  1EFR G;  4R6Z A;  4WFF A;  2GHY A;  3ZCC A;  3ML0 A;  2R9I A;  3FB6 C;  2EIN B;  2QE7 G;  4QNH B;  2XAF A;  4H33 A;  3AG1 B;  1P4R A;  1ORQ C;  2IJK A;  4N23 A;  3EFF K;  5IYB O;  1FXH A;  1NKD A;  2DWE C;  1AJN A;  2DYS C;  1E79 G;  5IYD O;  1V55 C;  4QJF B;  5L3E A;  1QR9 A;  3RVZ A;  4XDK A;  2XAJ A;  3AG2 C;  2IJI A;  3AG3 B;  3OGC C;  4GX0 A;  1K73 W;  3MD0 A;  5B3S B;  4CZZ A;  3ZRV A;  1CPY A;  3LDD A;  1WLE A;  3ZIA G;  5DN6 G;  2JIZ G;  3T4Z A;  1SES A;  1RPO A;  3ETD A;  3K03 A;  5LHG A;  1Q82 W;  2QKS A;  1FXK A;  3E89 A;  3TCU A;  4MSW C;  3E2E A;  2Z5U A;  4I5S A;  4MTO A;  3CP1 A;  1PD3 A;  1DF5 A;  4FK5 C;  4JYC A;  1KP3 A;  1MOF A;  2LFR A;  3JCZ A;  4L87 A;  4MVR A;  4MVM A;  3BY6 A;  4FIP C;  5EBW C;  1M57 B;  1EBO A;  1AR1 B;  1OCR C;  1VQ4 V;  1XL4 A;  1KEC A;  2H94 A;  2X6C A;  5B1O A;  1YHQ V;  5B1A B;  2JJ2 G;  1MAB G;  1TUE B;  1R3J C;  1IXM A;  3AG4 C;  3WG7 C;  2YEV B;  2HLD G;  3G6E V;  4DO2 A;  2ZR3 A;  3CC7 V;  5C93 A;  3T1C A;  2M7W A;  4YXW G;  2D3O W;  3VBB A;  3SYO A;  1GTO A;  3K06 A;  3ZRW A;  2JJ1 G;  4BAY A;  3LDC A;  3R65 A;  2Q67 A;  1BHB A;  2DYS B;  1K33 A;  1V55 B;  1VQN V;  1YTF B;  5LBQ A;  1H38 A;  3JYC A;  2W6J G;  5LGT A;  5KUM A;  1QVG U;  4RUE A;  1M56 C;  3ZRS A;  2Q6A A;  1VQK V;  3ZRX A;  4ZKI A;  2ZQM A;  1GKF A;  4JAU A;  1AI6 A;  1M9N A;  1K7D A;  2IU0 A;  3OUF A;  2ITD C;  2ATK C;  4P2Z A;  3OMN B;  3OMA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...