3ZCCA

High resolution structure of the asymmetric r333g hamp-dhp mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
110
structure length
110
Chain Sequence
STITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDGTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Mutant of Hamp-Dhp Fusion
rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords HAMP, OSMOLARITY SENSOR PROTEIN ENVZ
total genus 45
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2012-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zccA00
2WWWA 1JOYA 2LFSA 4FPPA 4KP4A 4U7OA 2QM8A 5C93A 3ZRVA 4MTXA 3A0RA 3ZRWA 5IDJA 4I5SA 4JAUA 4QPKA 2C2AA 4MT8A 2FTKA 2QM7A 4Q20A 2P67A 2LFRA 4LC1A 3P32A 4JYCA 3MD0A 4FMTA 5B1NA 4GCZA 4JASA 3ZRXA 3NXSA 4GT1A 1IXMA 4QPJA 3D36A 3DGEA 4BIZA 4JYBA 4U7NA 1F51A 3TK1A 3ZRWB 3ZCCA 4BIUA 4JAVA 4ZKIA 5B1OA
chains in the Genus database with same CATH superfamily
2EIMC 1JFFA 4FJCC 3HPLC 1NT2B 3Q4HA 2CDYA 4Z1VA 4DR1B 1YF2A 4PD4F 1MMMA 4PHZA 1Y76A 2H8PC 3FB6C 5LMUB 4DUZO 2LGWA 1QU7A 2ZDIA 3CC2V 4JAAA 4BWAA 2CUGA 5IJ9B 4WFGA 3CMEV 4DV3B 1H2MA 1ORQC 2NNUA 5B3SC 1IX9A 4OX9B 2X6CA 4J9ZB 4MVRA 1VQ6V 1RSOB 1J5EB 4NTYA 1SQBH 4ZOLB 4FFBB 3ZCCA 4WCEV 1N34O 1FD9A 4JI0O 4H33A 1M56B 1ZLZA 2XNDG 5LMNO 3W7SA 3ZRVA 1KECA 3BRCA 5EZYA 4RQFA 4X65B 4B3TO 4I9QA 5CA0B 4PA9A 3SPGA 1W59A 3EVKA 4FMTA 2B5UA 2OTLV 1YDXA 4IT5A 5LOVB 4TSFG 1F4NA 3CSXA 2BTQA 2ARHA 3IJ4A 2CTQA 5FLXN 1YITV 1ZWIC 1R3IC 1E79G 4JGSA 1OCRC 2MW2B 4X9QA 4KUMA 2YIBA 2QE7G 2P67A 1M5IA 3IGAC 5CB4B 2WLKA 2P22C 3K59A 1SC5B 3RN4A 1VP7A 3ASOC 4DK1A 1M9NA 3SYOA 2QKSA 1QVGU 4LFBO 1NR7A 3JSNA 3S3WA 1MG1A 2WLLA 2ZNIA 2ZM6B 1B06A 2Y48A 1R3KC 1NR1A 3K57A 1NTKH 1EBOA 3K5OA 4FLVA 3DGEA 3RYFB 5BMVB 3B8MA 4PELA 4IL6Z 1SETA 3T1YO 1IBLB 1SQGA 4B3RB 1Q6UA 4I4TA 3RVYA 2UXCB 5JVDA 2UXDB 1VARA 1JJ2U 3ETQA 1SQQH 3ZHRA 1YIJV 2WLIB 3E22B 4JZGA 2GV9A 1AP6A 3D8CA 3E35A 3FFQA 2FL4A 1QHTA 4X62O 4RUEA 1MSDA 3JD2A 1S5JA 1Q43A 4JI1B 3GWKC 1BZKA 4X66B 2CH7B 2QGNA 4N23A 3A8TA 5D5PA 2UUAB 5HFMA 3A0BZ 4B3RO 2WLLB 2DOSA 3IC7A 5EBLC 1IURA 2N05A 4B3MO 1ZL8A 2IU0A 1ROPA 4JYAB 1R73A 1MA1A 4UFZA 1SA0A 3B77A 2P4VA 3A0RA 2DE0X 1XNQO 1N0JA 2EIKC 1M57C 2ZQMA 1R6NA 1TVKB 3A0HZ 2QKCA 2EIJC 3OD4A 4G28B 2LO1A 2ZCEA 2X6BA 4JI8B 2FYUH 1O9HA 3G6BA 1U96A 1KP2A 2UUCB 3CCLV 4TUYA 2Q68A 4GKJB 1BSMA 5IT9N 1DF5A 2X7RB 4G2KA 1JPXA 1KUQA 2WLIA 2IJJA 3NR7A 1FXKC 5CA0A 5IWAO 2Z3YA 4H37A 2HR3A 1QVFU 3ZJZA 1K8AW 2Y4UA 1F4MA 2ETNA 5JVDB 1NI8A 4DV0O 1KKCA 2OIEA 5DEDA 3LDDA 3OR7C 1RP3B 5B1AB 1OCCB 1RPOA 2UU9O 4JI2O 4DV4O 3CHXA 1YXBA 1NH2D 1TUBA 5IE9A 3L70H 4U3FH 1TUEB 3FB7C 3ZMVA 5KLVH 3ZHTA 3SPJA 1V54B 2QWPB 4NTXA 1QLNA 3T4DA 3Q4HB 3RVZA 2QWRB 2V1DA 1RM1B 3X2QC 2PZSA 2JS3A 4O2BB 2N04A 2IBZH 2DYSB 3RYHA 2WLJA 3T1HO 2ZXWC 4B3SB 3JD0A 3B09A 4BIOA 5JQGA 2XAHA 1VEWA 3SYCA 1BS3A 2MK3A 1HR0B 4ZI7B 5KHGA 3GWOA 2F23A 1PNMA 4JI6O 1QLEC 3L71H 4ZHQA 1V9PA 3I55V 2QWOB 4IYHA 1EM1A 5L3BA 4UUJC 2Q8VA 1Q82W 1FAFA 1M90W 2Q7EA 5EZYB 4HBNA 5KAIZ 5LBQA 4OXSA 3CWBH 3L74H 1HDJA 4YIPA 4H44B 4NKGB 4FFBA 4X20A 2PYLA 2K9PA 1RSOA 4MW8A 4DR6B 1JCHA 4LF7B 3WB1A 4HNAA 3CPWU 4I0XB 5B1NA 3ABMB 1ZTEA 2RN9A 3O9OA 5IJ9A 3ZHSA 1PL0A 4U7NA 1ZUQA 4PDMA 2H3OA 1Y76B 2QTOA 2Q0OC 1HNZO 3ZMZA 1JFFB 2KQXA 4A5UB 1SERA 1GN3A 4FLXA 1SRYA 1OZ0A 3OAAG 3AG4B 4CH6A 1NU1H 3K9AA 2Q7HA 4MVQA 1Q3EA 2B1IA 3AG1C 1WA8A 2AXTZ 3P3PA 4PA7A 4TT3G 4AQYB 3R66A 1R6TA 3OTFA 3JATA 3G67A 5LMUO 3ABTA 4KHPO 3OMIB 3K5LA 1CXZB 2EIKB 4DV3O 3JALB 4F6EA 3CRAA 2KSDA 1UPGA 1JJOA 4FIPC 4K8ZA 4GUNA 1BHAA 3BFRA 1Y74A 1Q7YW 3B8NA 1SZTA 4MVMA 4K0KO 5BY1A 2H94A 2YEVB 4PA4A 3CX5F 4X65O 5EBMC 3K58A 1AJQA 3B2EE 1KMIZ 1L1FA 1U97A 2PI4A 3P3NA 1K34A 5JCOA 3RYIB 4LH6A 2VQEB 2YIAA 3K03A 4YY3O 1DK1A 1M1KW 2HP8A 5JH7A 4FLTA 4MTOA 2XAFA 4YY3B 2XAJA 2PUSA 1S3JA 3OE7G 4YJ2A 2O57A 4LF5B 4TOIA 3ABKC 2AW9A 3ZS8C 2UXNA 2EILB 3CD6V 2Q5ZA 4DXWA 1DLBA 3H9VA 1XQ8A 4JYCA 4XDLA 1PV0A 3KKYA 4IGGA 1PL4A 4EKWA 5A2QN 3H1IH 1H2KA 2ADQB 4DV6B 1PM9A 1QCEA 4MTFA 1JVMA 1IBMO 5CBFA 2X6AA 1IBMB 1NTMH 4WFBV 2B1GA 4DR2O 5LA6B 4J7ZA 4OX9O 1R1BA 1FKAO 1J5EO 3K5NA 1WPBA 4DR4O 1XEQA 1XMOO 3PJSK 4PI0A 2PF4E 1RM1C 2GBOA 3KCXA 4WFFA 3EXAA 4DV1O 1VQ7V 4JPRA 5EYPA 1LUWA 1QNMA 2GUZA 1EZVH 4D7TA 4B3TB 5TISZ 4X1KB 1D5NA 3M99B 1K4DC 4FK5C 2QKAA 2N74A 3RBZA 1JR9A 1EZJA 1FFXA 2L6LA 2P6JA 3CCMV 2NR5A 3OT7A 1NH2B 2ITCC 2YI9A 4JI5O 3ETGA 2PYJA 1BE3H 3EFFK 4NXNB 4JV5O 2Y0PA 1E1RG 1FXKB 1I7FA 1OHHG 1K97A 3JAWB 3ZIAG 5B1OA 4QE7A 1AP5A 1G4YB 3QVNA 2QWQB 1XL6A 2IH1C 4ASUG 4RQEA 1WB7A 2QM8A 4I55A 3SR2C 2BOBC 3MAQA 1WJZA 1G6UA 1T5EA 3CRCA 3SPIA 3AG1B 4MS2A 1TA8A 2JRIA 3OUFA 1KYOF 3N2KA 2KG7B 5IYCO 4JYBA 4WF9V 1Z2GA 4TQFA 4JI5B 1BMFG 4CBCA 1S5HC 4OPHA 2UXBO 4O2AA 1XREA 2VS0A 2HVJC 2CE4A 4GZRB 4P2ZA 2GTAA 5E1AC 4YJ3A 4RWUA 3K9SA 3JASB 2NN4A 2LW1A 2Q9LA 3K3WA 2Y4TA 1PD3A 2UXXA 4EFEA 2JEXA 3SYAA 4DV7O 3JASA 3UO2A 3UM7A 5C8YA 3OTOB 1Q6HA 1H2SB 1SF9A 3B40A 4X1IB 1R6KA 4LFCB 3J7AU 2E75B 1K92A 1QR9A 3RW0A 4MTXA 1VQPV 4FZ0A 3OW2U 3U11A 3N2KB 3MHHC 3L73H 4Q20A 2ZE8A 2UUBO 4N21A 2BCCH 4QPJA 2Q73A 1GM7A 4FLUA 1WP7A 2UUAO 3CCEV 2WWWA 1PKXA 4ZIBA 1YJ9V 1N4CA 1M56C 4WFHA 3CYOA 3JARA 1TAEA 3JAWA 5LHGA 4OPAA 1WPXA 1XOUA 3WG7C 1W0JG 3AEIA 5E79Z 3FYIB 2ZE7A 2LQTA 1YCIA 3ZN1A 4DR3O 2ZXWB 3MDSA 1JA8A 3L9DA 4GYCB 3T4ZA 5F2VO 4J7KA 4GX1A 4X64O 1YJNV 2IH3C 1FFXB 4FLYA 5IYZA 3VQVA 4JAUA 4E4EA 1IBKO 3C90A 2CTPA 3WG7B 2FKXA 3VOUA 2OIGA 2JGDA 4RAIA 5IY5B 3HKDA 2HFEC 4B3SO 3F7VC 2IM9A 1LNQA 2DMXA 4O2AB 4QGPA 4XDJA 2F66C 5B1BB 1AB3A 5GONA 5FNVB 1XHXA 4JZ2A 1XNRB 3ICXA 3ZN0A 3G71V 1AR5A 2E5LB 3K0DA 3QG5A 3TJTA 3OM3B 3D3IA 3ZBHA 2LW7A 3F7YC 4I55B 2Q67A 4PA6A 3ZX6A 1S76D 4CS2A 4MVSA 4Z1MG 5LXTA 4KL1A 4HAMA 4UV8A 4OGQB 4MVZA 2BSKB 3BY6A 1HNWB 1FJGO 2VQFO 3JD4A 4X62B 4UB8Z 2M6YA 3JD3A 4JASA 3JAMN 3ASNB 1FJGB 1HNWO 4CZZA 1EFRG 2QJ1A 5B5EZ 2KB1A 1S5LZ 3CCUV 4JI1O 4DW0A 1VF7A 2HJDA 2BOCC 4YJ2B 4DRXA 1AJNA 4CS3A 3AG2B 2JGUA 2WA4A 3H1LH 1SS3A 3P30A 1FPOA 4X1KA 2GUZB 3H1JH 5ITZA 4UCUA 5K1PA 1YEWA 4BIUA 1US6A 1V55C 1GTOA 5L3CA 2IU3A 3E8BA 3AK3A 3K79A 4BW5A 2DQ3A 1AI5A 1AR1B 5EC2C 3CRMA 5IDJA 3CB2A 3HKCB 3WB0A 2RMKB 1K3EA 2RQ6A 3K06A 2YC0A 4ICGA 4LF8B 2QM4A 3T1CA 2L35A 1XDCA 4GKJO 1AI7A 3STLC 1I94O 1KD1W 2ZNJA 1H2GA 3JATB 5L3GA 1N34B 4JI0B 5FPRA 5IYDO 4PDVA 5KA5A 1YJWV 2CTWA 1L0LH 4QIWF 4E2LA 4D7SA 5GTHZ 2RNBA 4EFBA 2JK5C 2P06A 4JI7O 1H8EG 3KG2A 3C3TA 4DV6O 1Q8IA 2LGQA 5L3EA 4DR1O 1K33A 4AQYO 4KFMA 1VQMV 4TV8A 4DV4B 1Q81W 3C3SA 1H38A 3ZRWA 4DR7B 4IIJB 2Z0AA 3SJQC 5IJ0A 4I0XA 4LF8O 4LBEC 1Z5WA 4DR7O 1AILA 3AG7A 2WLMA 1XL4A 3HR0A 3IAYA 4X20B 2QR4A 3H1KH 2F93B 3KCYA 5EK0A 1S0VA 3QNEA 2M7WA 4DR5B 1PNLA 5EC1C 4TV9A 3ZRSA 4WFEA 5B1AC 1GH6A 4JI3B 3LSQA 4J80A 1E1QG 3AG3B 3OUSA 1I5YA 1FXHA 1CPYA 3ZEDA 2VWKA 2ZINA 3G6EV 4ZHQB 2V4DA 2P90A 1NQTA 4ABMA 2YI8A 4YHHO 4ZI7A 1Q86W 3DXRB 5JQGB 3U10A 5EBWC 1OCZB 2QWNB 3RYHB 2EBOA 4X1YA 1OV9A 4BIZA 4C7UA 5H5NA 2G38A 5LYJB 4QNHB 1XHZA 4IHJA 4FLZA 1D2DA 5H2FZ 3KZIZ 3RT3C 4GLXA 2FB5A 1TUBB 1JMKC 4HNAB 3P32A 4NB5A 4DV2B 2DYRB 4XBFA 3JSLA 5LGNA 4YHHB 2GHYA 4DR2B 1K9MW 1MABG 1BGYH 1IVSA 5CA3A 4CS4A 1I0HA 1WB8A 4JTAB 3TETA 1NTZH 5H6RA 1H8HG 3UQ8A 3LSUA 3SJAC 3MHSC 1LUVA 4LR3A 4MTGA 4FM1A 2Q69A 1KQSU 1XUQA 2RJZA 4TUYB 3DC5A 5IY5C 4BW9A 2QDOA 5JJJB 3WFVA 1GKFA 2DWDC 3OGCC 2QM7A 4U3JB 4O4IB 2ZE5A 1Y66A 2PTMA 1TVKA 3MD0A 1K5SA 4YXWG 1HW7A 5BR8O 3ZMTA 1V54C 1SA0B 5A9GA 3VBBA 3E83A 2JVDA 3F5WC 5J2UA 2ITDC 1KKDA 1XNQB 1FXVA 1P7GA 2XHBA 2OCHA 2P4KA 4DV5O 4RUFA 4DV0B 4D6TH 1OCRB 2OCCB 3ABLC 2HHHO 4R8CA 3THOA 2YDEA 2QSAA 2CH7A 2AHZA 2Q0AA 2HHHB 1S72V 2A0LA 1N33B 3M7MX 4JAVA 4O4JB 1HWYA 3SGIA 1N33O 4UCVA 1IBKB 3T2MA 1H2LA 4NR1A 3APOA 4EB6B 5GW7A 2FTKA 3SYPA 3EHBB 5CBHA 1Q5OA 3CEIA 1HP8A 3D3QA 2OWOA 1QR8A 2A06H 4EB6A 1MOFA 4R50A 2P5OA 2ZDIC 3CRQA 4DV7B 4DUZB 2ZD9A 2JS5A 4O4JA 1B6QA 2UU9B 4JI2B 2E5LO 2A7WA 4X64B 1RFYA 4UCRA 4MT8A 1R3JC 2RDCA 1ZX3A 4MW3A 2EZPA 3OR6C 4ZBMA 1B3QA 1PPJH 2F4VB 4LNUA 3ZHQA 1YTFD 2XAQA 4K35A 5J2UB 3QO5A 2F4VO 1ZL8B 4LNUB 1GN4A 3CC7V 4R7CA 3OEEG 4KXRA 5CB4A 2ZM6O 3SJBC 4O4IA 4DUYB 2DYRC 1XMQB 4QJFB 2Y0IA 4CH4A 4UCOA 4DR3B 2AGAA 2R9IA 5AG2A 2IJHA 2JIZG 2IJIA 2ZR2A 1DF4A 5HFLA 4FLWA 1VQ4V 1IBLO 3AG2C 1GO3F 4I7ZB 4I9WA 1YI2V 2HEPA 3E22A 4LF9O 2HG5C 3RFRA 2DW4A 2DWEC 3W7XA 3SPCA 3HB3B 2VWJA 4I4TB 4H0LB 1K73W 1GN2A 1IXBA 4LH7A 4LF7O 4JF3A 3ML0A 4ZOLA 1QBZA 3RYFA 5BMVA 4KHPB 1XMQO 2QTSA 3FKSG 1KB9F 3BHPA 1CP9A 1BQZA 1AI6A 1I5XA 3TGUH 4W4KA 4IHJB 2BTOA 2E76B 3CRRA 2HVKC 4K0KB 3R65A 2AHYA 5LYJA 4QPKA 1YSCA 2PI5A 3F5TA 2GSMB 1AROP 5LGUA 2PGGA 2Y69C 1XI1A 2ILMA 3VQXA 4U3JA 1EN6A 1F51A 3B4SA 2LP7A 1NVPD 3CJHB 5DM6V 4NYKA 2BTQB 4MVUA 5B1BC 4KP4A 1SESA 5EIBD 3IC9A 2UUBB 2OCCC 5LOVA 4LF6B 2JJ2G 3E86A 3ETEA 4GCZA 4AI8A 3FYEB 4JI4O 1NJIW 1N36B 2OYQA 2HJFC 4IYIA 3UT5B 1W2BU 4GKKB 4UCTA 2ZR3A 1AI4A 2WAMA 4J9YB 1Q90D 1VMGA 2Z5UA 4FZ1A 4LF4B 2XTAA 4J41A 4GT1A 4LF4O 2YXLA 1IZ3A 2UUCO 1AJPA 3ZRWB 2EJ7A 1KC8W 2F1MA 2R9AA 5LL6Y 4TWKA 2CTRA 3WB2A 1LR1A 4QE9A 3CC4V 1X4TA 2JDIG 2WLNA 1VQNV 4X1YB 1S77D 1N32B 5LMNB 3QTCA 2HKOA 1IDSA 3LUTB 3DXRA 1VQOV 2PY5A 4GX2A 1F23A 3JAKB 4LP8A 5KAFZ 4CH3A 4P9PA 2A9HA 4BAYA 4O4LA 1DTOA 4WBNB 4CH5A 5IYBO 1WP8A 4NXNO 4NXMO 2A79B 4NXMB 1THZA 1SKVA 1GAXA 3M8AA 4TV9B 1SQXH 1UFIA 5JJEB 4B7EA 4FPPA 3K0GA 2R70A 2CGNA 2WLHA 1L0NH 2NLJC 2VQFB 1MSWD 1ENVA 1A32A 2WSSG 3DTUB 5KUKA 2LFRA 2AZ2A 4DR6O 5IJ0B 3CE2A 4IIJA 3BA9A 4PJ0Z 3CCJV 3ASNC 4GX5A 2OT5A 1AR4A 4TV8B 3FD9A 1SQFA 2ZE6A 3T1YB 2C2AA 3JCUZ 4HYOA 4Z2WA 1MZFA 2EINC 3L75H 1VQKV 1KBHA 2D3OW 1JQ0A 3W7TA 4DYLA 2ZIMA 3RGBA 3HKEA 3UCSC 1GK9A 3GVMA 4LWSB 3LNMB 1BHBA 5LHHA 4WFAV 1VF6A 4MSWC 2X0LA 4F6RA 2D2CB 3BAAA 3ZMUA 3ZHUA 1QQCA 2W6JG 1NVPB 2DJVA 3HKCA 1MNGA 2CAZC 3BCCH 5K1XA 2ZKOA 2W0XA 3A2FA 5CA1B 1VQLV 3HKDB 1Z5VA 4Q6GA 2JGDB 2DYSC 5ITZB 2EIJB 1GM8A 1XILA 2FMLA 2KKWA 1NS1A 2W6IG 2YXHA 1KP3A 5FL7G 2VQEO 3UO3A 3TK1A 5BXZA 4DRXB 2GDSA 5GTIZ 3CCVV 1GM9A 2EILC 1WN7A 2YICA 3FAVB 3JYCA 5KX5A 3E2EA 3G80A 5CN0A 1B04A 3N27A 2EINB 1M57B 4PV1B 2BSKA 2Y69B 3NXSA 3QO8A 4DR5O 3RYCA 5JCOC 1G1XB 1VIBA 1JX9A 5LXTB 4EEQA 3JARB 2LJ2A 3LNNA 5BR8B 4JI3O 5BZBA 1X59A 3VQWA 3N2GA 1P84F 5J2TA 3CCRV 4DV5B 4DW1A 4DO2A 1EN4A 4F4LA 1CEZA 3TCUA 1IXMA 3OEHG 4PDRA 5FNVA 1G8MA 3HKBA 3QO7A 5GONB 2UXDO 2YIDA 1NKDA 3ZMSA 1VF5B 4UV9A 4MVOA 1Y6XA 3OMNB 3JD1A 4X89A 2V7QG 3E8HA 2XT9A 4FVMA 3TXSA 1NBMG 4NVPA 5B3SB 1YHQV 3AG3C 4BR6A 4UB6Z 3J81N 2K1EA 4CC5A 4B7KA 1H2NA 5KMGB 3OFNG 4I50B 5CBGA 4LFBB 3T1HB 5IYZB 3GB7C 4DUYO 3BEHA 3QF7A 1JOYA 1M4UA 1WLEA 2YUAA 4O4HA 2EIMB 4FM2A 1XNRO 1GMGA 5C93A 3ABUA 3HKBB 3SYQA 2R72A 1WAZA 2RCVA 4RO2A 2EZOA 1K4CC 3SJCC 5LP6B 3W7UA 2EULA 3CCSV 4L8JA 5B66Z 4JV5B 3IFXA 4DK0A 3E89A 2Q6AA 3D36A 2WA3A 1GN6A 5J2TB 5J9PC 1OCOB 1VF6C 4UVBA 3VQYA 3STZC 1OJHA 1BL8A 1VQ9V 2CK3G 2Q7GA 3BVOA 4J7JA 1P7BA 5CMUA 3WU2Z 4HZ3A 5JJNB 1TGOA 2A3QA 4H13B 2JJ1G 5LP6A 1SZXA 4JI8O 5KA6A 2XASA 5KX5B 4PA3A 2DN9A 4O4HB 4X1IA 4G27B 3AK2A 1YVWA 3E8GA 1DGSA 3DSQA 5DECA 1XBLA 4UXNA 4FM0A 5C8YB 3K08A 3H1HH 2UXCO 4I50A 4J42A 4UVAA 5KMGA 2YIBD 3G4SV 1N8RW 3CXHF 5IWAB 3ZHVA 3BA8A 4B3MB 5EYPB 1K5QA 1AVMA 3APQA 1PNKA 4LF9B 3ABMC 4AILC 4YJ3B 1K7DA 3JCZA 1V55B 3ASOB 2LFSA 3OTOO 4TQDA 2XUMA 5H9CA 1UJWB 3ABKB 1SQPH 1YTFB 4LFCO 2OTJV 1O9GA 4PI2A 2KG7A 1F7YA 3BPZA 4XDKA 1MZEA 3E8FA 4LC1A 4X8AA 4X66O 4LF6O 2HLDG 3I5DA 4F6RB 1OCOC 1ZAUA 3AK1A 3N2GB 2ZT9B 3LDCA 4J10A 4W4LA 4P30A 2DQ0A 5FPOA 1VQ8V 4YIOA 3HKEB 2YSUB 5LP6C 1N32O 4JTCB 4JYAO 3RYCB 4GKKO 1WNSA 2VRZA 5H6QA 1FS0G 1FXKA 5LGTA 4JI7B 1HR0O 4K8XA 5DN6G 5KHJA 3FAVA 1P4RA 3OGIB 3L72H 4L87A 5D5QA 2E3CA 3DC6A 1M93A 3TXQA 1I08A 4LCUC 5JH7B 4LF5O 5L3FA 3O65A 4AHCA 1GRJA 1W0KG 4JTDB 3SDLA 3UKMA 4ZKIA 2XAGA 5CA1A 4X88A 4JYYA 1EN5A 2XOKG 2YS8A 1N36O 2CGOA 3CXCU 3AG4C 1RPRA 4B08A 5LA6A 3K5MA 5EIBC 1L8DA 4K3AA 2IJKA 3CP1A 1YZBA 3JALA 1BT8A 5JWPA 1HNZB 4LWSA 1NZ6A 4DV2O 2YXYA 5KHIA 4FFKA 3JAKA 2IW5A 5LHIA 4GX0A 2QA4V 4DR4B 1KU9A 1XMOB 1WA8B 3FB5C 1FYJA 4DV1B 3ABLB 2B9ZA 2GTSA 3CMAV 1FFTB 3BABA 1URFA 2WPDG 3OMAB 3S3XA 3FX7A 1QLEB 3U0ZA 3CS5A 3W7WA 4JI6B 1R3LC 4I5SA 2F95B 1J95A 1OCZC 4R6ZA 3RYIA 2ADPA 2ZIOA 3ZRXA 1N0NA 3H01A 1BCCH 5L3DA 3I56V 2W0FC 1ZSPA 3PN1A 1D5AA 4CC6A 2YEVA 3UT5A 2QEXV 2BE3A 3K04A 4NTWA 1OCCC 4PDLA 1Y74B 3RWRD 4LFAO 2ATKC 4WBNA 2Q4PA 4O4LB 4LFAB 1P49A 1Y67A 5KHHA 2P7TC 1BQ0A 2R9RB 1Q6IA 1SQVH 2EX3A 3LDEA 5KHKA 3FB8C 3J80N 1HNXO 3LSSA 3SPHA 2AZ0A 3CJHA 1COWG 4P9OA 1HNXB 4U7OA 1I94B 3ETDA 4UVCA 3X2QB 2UXBB 2EJRA 1PP9H 2F43G 1VQ5V 3D36C 3CCQV 2JEUA 4UCSA 4JI4B 2ODMA 4O2BA 5KUMA 4J11A 1Y4MA 2E74B
chains in the Genus database with same CATH topology
2EIMC 4FJCC 3HPLC 1GK9A 1QCEA 3LNMB 1BHBA 5LHHA 2H8PC 3FB6C 4WFAV 4MSWC 2X0LA 2ZDIA 1JVMA 4MTFA 3CC2V 5CBFA 4WFGA 3CMEV 3ZMUA 2X6AA 2NNUA 1ORQC 5B3SC 3P32A 2X6CA 2W6JG 4J9ZB 4MVRA 4WFBV 2B1GA 1NVPB 1VQ6V 2DYRB 4XBFA 4WCEV 3ZCCA 5LGNA 2GHYA 1K9MW 1MABG 4H33A 1M56B 5CA3A 2XNDG 3PJSK 1RM1C 1VQLV 4JTAB 4WFFA 3W7SA 3ZRVA 1KECA 3TETA 1VQ7V 4RQFA 2DYSC 5H6RA 1H8HG 4JPRA 4PA9A 3MHSC 2EIJB 1GM8A 3SPGA 4MTGA 4FMTA 2W6IG 2B5UA 3M99B 1K4DC 1KP3A 2Q69A 4FK5C 5FL7G 1KQSU 2OTLV 3TK1A 3RBZA 4TSFG 1F4NA 5IY5C 1EZJA 2P6JA 3CCMV 1NH2B 2ITCC 1YITV 1ZWIC 3ETGA 1R3IC 1E79G 1GM9A 2EILC 3CCVV 3JYCA 4JGSA 1OCRC 3E2EA 3WFVA 1GKFA 3EFFK 2DWDC 4KUMA 2QE7G 3OGCC 2QM7A 5CN0A 2P67A 1E1RG 3IGAC 1FXKB 2EINB 1M57B 1Y66A 2WLKA 3MD0A 1K5SA 1OHHG 2Y69B 3NXSA 3QO8A 4YXWG 3ZMTA 1K97A 1JX9A 1V54C 3ASOC 3ZIAG 5B1OA 4QE7A 1M9NA 1G4YB 3VBBA 3SYOA 3E83A 3F5WC 5BZBA 2QKSA 1QVGU 1XL6A 2ITDC 2IH1C 4ASUG 4RQEA 1FXVA 2QM8A 1KKDA 1NR7A 1MG1A 2WLLA 4RUFA 2BOBC 3CCRV 1OCRB 2Y48A 2OCCB 1R3KC 1NR1A 3ABLC 3SPIA 4DO2A 3AG1B 4MS2A 4R8CA 4F4LA 1EBOA 3OUFA 1CEZA 2AHZA 3TCUA 1IXMA 3DGEA 3OEHG 4PDRA 5IYCO 1S72V 2A0LA 4JYBA 3B8MA 4PELA 4WF9V 4JAVA 1BMFG 1G8MA 3QO7A 4CBCA 1S5HC 1SETA 1NKDA 3ZMSA 4UV9A 1HWYA 4MVOA 3OMNB 3RVYA 2HVJC 4P2ZA 3T2MA 5E1AC 3JD1A 4X89A 2V7QG 3E8HA 1YHQV 1NBMG 5B3SB 5GW7A 2FTKA 3AG3C 3SYPA 3EHBB 1JJ2U 2K1EA 5CBHA 3K3WA 1YIJV 2WLIB 1PD3A 2UXXA 1QR8A 2JEXA 3OFNG 3SYAA 1MOFA 4R50A 3E35A 3UM7A 5CBGA 2ZDIC 3GB7C 3BEHA 2ZD9A 1JOYA 1R6KA 1WLEA 4RUEA 2EIMB 3JD2A 1B6QA 1GMGA 1K92A 1QR9A 3ABUA 3SYQA 5C93A 3RW0A 4MTXA 1VQPV 4RO2A 2EZOA 1K4CC 3OW2U 3W7UA 4MT8A 3MHHC 1R3JC 4Q20A 4N23A 4MW3A 3CCSV 2EZPA 4N21A 3IFXA 3OR6C 3E89A 2Q6AA 5HFMA 4QPJA 3D36A 1GM7A 4ZBMA 2WLLB 3IC7A 5J9PC 5EBLC 1OCOB 4UVBA 3CCEV 2WWWA 2IU0A 3STZC 1PKXA 1YTFD 2XAQA 1YJ9V 1ROPA 1BL8A 1R73A 1M56C 3QO5A 1VQ9V 4WFHA 3CYOA 3B77A 5LHGA 1WPXA 2CK3G 3A0RA 2EIKC 3WG7C 1M57C 3CC7V 2ZQMA 1P7BA 1R6NA 1W0JG 3AEIA 4HZ3A 4R7CA 5CMUA 3FYIB 3OEEG 3ZN1A 2EIJC 2JJ1G 2ZXWB 2DYRC 4G28B 4QJFB 5KA6A 2XASA 3T4ZA 4PA3A 2X6BA 2R9IA 4GX1A 2IJHA 1YJNV 2IH3C 4G27B 2JIZG 1KP2A 3E8GA 2IJIA 3CCLV 2ZR2A 1DF4A 5HFLA 4UXNA 1VQ4V 2Q68A 3AG2C 3K08A 1GO3F 4JAUA 1DF5A 4UVAA 2X7RB 4G2KA 4I9WA 3G4SV 1N8RW 1JPXA 3WG7B 1YI2V 2WLIA 2HG5C 3VOUA 2DW4A 2IJJA 1K5QA 1FXKC 1PNKA 2Z3YA 3ABMC 2HR3A 4H37A 3ZJZA 1QVFU 1K8AW 1F4MA 4RAIA 5IY5B 2DWEC 3W7XA 2HFEC 1K7DA 3SPCA 3F7VC 3HB3B 3JCZA 1V55B 1LNQA 3ASOB 2LFSA 1K73W 4XDJA 5B1BB 5H9CA 1UJWB 3LDDA 3OR7C 3ABKB 1YTFB 4JF3A 5B1AB 3ML0A 1OCCB 2OTJV 1QBZA 1RPOA 3ZN0A 3G71V 4XDKA 3K0DA 3FKSG 1NH2D 3OM3B 3D3IA 3E8FA 4LC1A 1TUEB 3FB7C 4X8AA 3ZMVA 1CP9A 2HLDG 1OCOC 3SPJA 1V54B 3F7YC 1AI6A 1I5XA 3LDCA 4P30A 2Q67A 4PA6A 1QLNA 1S76D 3T4DA 2DQ0A 1VQ8V 4MVSA 3RVZA 4Z1MG 2HVKC 2YSUB 2V1DA 2AHYA 3R65A 1RM1B 4JTCB 3X2QC 4QPKA 1YSCA 2PI5A 2GSMB 1AROP 4HAMA 4MVZA 4UV8A 5LGUA 5H6QA 1FS0G 3BY6A 2Y69C 1FXKA 2DYSB 5LGTA 2WLJA 3JD4A 2ZXWC 3JD3A 4JASA 3JD0A 3ASNB 2XAHA 3SYCA 2MK3A 5DN6G 1F51A 4CZZA 1EFRG 1P4RA 4L87A 2KB1A 3GWOA 3CCUV 2LP7A 1PNMA 1NVPD 5DM6V 2BOCC 5B1BC 4MVUA 4KP4A 1SESA 1AJNA 1QLEC 3AG2B 3I55V 2OCCC 4LCUC 5L3BA 4UUJC 5L3FA 2JJ2G 3P30A 1Q82W 3E86A 3ETEA 4GCZA 1M90W 1W0KG 4JTDB 3UKMA 5LBQA 4OXSA 3FYEB 4BIUA 4ZKIA 1NJIW 1V55C 2HJFC 1GTOA 2XAGA 4X88A 2IU3A 3E8BA 5L3CA 1W2BU 3K79A 4BW5A 2XOKG 2ZR3A 2DQ3A 1AI4A 2WAMA 1AI5A 3CXCU 3AG4C 1AR1B 5EC2C 4J9YB 5IDJA 1RPRA 2Z5UA 4MW8A 1JCHA 1K3EA 2IJKA 3CPWU 3CP1A 5B1NA 3K06A 3ABMB 4GT1A 1PL0A 4U7NA 1AJPA 4PDMA 3ZRWB 1KC8W 3T1CA 2QTOA 1AI7A 4TWKA 3STLC 1KD1W 1H2GA 3ZMZA 2IW5A 5LHIA 5L3GA 1SERA 4QE9A 1SRYA 4GX0A 2QA4V 3CC4V 1OZ0A 3OAAG 4PDVA 5IYDO 3AG4B 3K9AA 5KA5A 1YJWV 2JDIG 3FB5C 2WLNA 1VQNV 1S77D 4QIWF 4MVQA 4E2LA 2HKOA 3ABLB 2B1IA 2JK5C 3AG1C 3LUTB 4PA7A 3CMAV 4TT3G 1H8EG 3KG2A 1FFTB 1VQOV 5L3EA 2WPDG 4GX2A 1K33A 3OMAB 1F23A 3ABTA 4KFMA 1VQMV 3OMIB 4LP8A 1QLEB 1Q81W 1H38A 3W7WA 2EIKB 3ZRWA 1R3LC 4I5SA 4P9PA 2A9HA 4BAYA 3SJQC 1DTOA 4FIPC 4LBEC 1J95A 1OCZC 4R6ZA 5IYBO 1BHAA 3ZRXA 2WLMA 2A79B 1Q7YW 3H01A 1XL4A 3B8NA 5L3DA 3I56V 1SZTA 4MVMA 1THZA 2W0FC 5EK0A 1S0VA 3QNEA 2M7WA 2H94A 2YEVB 1PNLA 2YEVA 4FPPA 4PA4A 3K0GA 2QEXV 5EC1C 3K04A 5EBMC 2WLHA 3ZRSA 4WFEA 1AJQA 5B1AC 2NLJC 1OCCC 4PDLA 1L1FA 2PI4A 3LSQA 1MSWD 1ENVA 1E1QG 1K34A 3AG3B 2WSSG 3DTUB 5KUKA 2ATKC 2LFRA 3K03A 3OUSA 1I5YA 1M1KW 1FXHA 1CPYA 2P7TC 4MTOA 3CCJV 2XAFA 2R9RB 3G6EV 3ASNC 2XAJA 4GX5A 2OT5A 1S3JA 3LDEA 3OE7G 3FB8C 2P90A 3LSSA 3SPHA 1NQTA 3ABKC 1COWG 4P9OA 4U7OA 3ETDA 1Q86W 2UXNA 4UVCA 3X2QB 2EILB 3CD6V 2C2AA 2EJRA 2F43G 4HYOA 4DXWA 1DLBA 1VQ5V 5EBWC 1OCZB 3CCQV 2JEUA 2EBOA 2EINC 4JYCA 4XDLA 1VQKV 2D3OW 1JQ0A 5KUMA 3W7TA 4BIZA 1Y4MA 4EKWA 4QNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WWW A;  1JOY A;  2LFS A;  4FPP A;  4KP4 A;  4U7O A;  2QM8 A;  5C93 A;  3ZRV A;  4MTX A;  3A0R A;  3ZRW A;  5IDJ A;  4I5S A;  4JAU A;  4QPK A;  2C2A A;  4MT8 A;  2FTK A;  2QM7 A;  4Q20 A;  2P67 A;  2LFR A;  4LC1 A;  3P32 A;  4JYC A;  3MD0 A;  4FMT A;  5B1N A;  4GCZ A;  4JAS A;  3ZRX A;  3NXS A;  4GT1 A;  1IXM A;  4QPJ A;  3D36 A;  3DGE A;  4BIZ A;  4JYB A;  4U7N A;  1F51 A;  3TK1 A;  3ZRW B;  3ZCC A;  4BIU A;  4JAV A;  4ZKI A;  5B1O A; 
#chains in the Genus database with same CATH topology
 2EIM C;  1JFF A;  4FJC C;  3HPL C;  1NT2 B;  3Q4H A;  2CDY A;  4Z1V A;  4DR1 B;  1YF2 A;  4PD4 F;  1MMM A;  4PHZ A;  1Y76 A;  2H8P C;  3FB6 C;  5LMU B;  4DUZ O;  2LGW A;  1QU7 A;  2ZDI A;  3CC2 V;  4JAA A;  4BWA A;  2CUG A;  5IJ9 B;  4WFG A;  3CME V;  4DV3 B;  1H2M A;  1ORQ C;  2NNU A;  5B3S C;  1IX9 A;  4OX9 B;  2X6C A;  4J9Z B;  4MVR A;  1VQ6 V;  1RSO B;  1J5E B;  4NTY A;  1SQB H;  4ZOL B;  4FFB B;  3ZCC A;  4WCE V;  1N34 O;  1FD9 A;  4JI0 O;  4H33 A;  1M56 B;  1ZLZ A;  2XND G;  5LMN O;  3W7S A;  3ZRV A;  1KEC A;  3BRC A;  5EZY A;  4RQF A;  4X65 B;  4B3T O;  4I9Q A;  5CA0 B;  4PA9 A;  3SPG A;  1W59 A;  3EVK A;  4FMT A;  2B5U A;  2OTL V;  1YDX A;  4IT5 A;  5LOV B;  4TSF G;  1F4N A;  3CSX A;  2BTQ A;  2ARH A;  3IJ4 A;  2CTQ A;  5FLX N;  1YIT V;  1ZWI C;  1R3I C;  1E79 G;  4JGS A;  1OCR C;  2MW2 B;  4X9Q A;  4KUM A;  2YIB A;  2QE7 G;  2P67 A;  1M5I A;  3IGA C;  5CB4 B;  2WLK A;  2P22 C;  3K59 A;  1SC5 B;  3RN4 A;  1VP7 A;  3ASO C;  4DK1 A;  1M9N A;  3SYO A;  2QKS A;  1QVG U;  4LFB O;  1NR7 A;  3JSN A;  3S3W A;  1MG1 A;  2WLL A;  2ZNI A;  2ZM6 B;  1B06 A;  2Y48 A;  1R3K C;  1NR1 A;  3K57 A;  1NTK H;  1EBO A;  3K5O A;  4FLV A;  3DGE A;  3RYF B;  5BMV B;  3B8M A;  4PEL A;  4IL6 Z;  1SET A;  3T1Y O;  1IBL B;  1SQG A;  4B3R B;  1Q6U A;  4I4T A;  3RVY A;  2UXC B;  5JVD A;  2UXD B;  1VAR A;  1JJ2 U;  3ETQ A;  1SQQ H;  3ZHR A;  1YIJ V;  2WLI B;  3E22 B;  4JZG A;  2GV9 A;  1AP6 A;  3D8C A;  3E35 A;  3FFQ A;  2FL4 A;  1QHT A;  4X62 O;  4RUE A;  1MSD A;  3JD2 A;  1S5J A;  1Q43 A;  4JI1 B;  3GWK C;  1BZK A;  4X66 B;  2CH7 B;  2QGN A;  4N23 A;  3A8T A;  5D5P A;  2UUA B;  5HFM A;  3A0B Z;  4B3R O;  2WLL B;  2DOS A;  3IC7 A;  5EBL C;  1IUR A;  2N05 A;  4B3M O;  1ZL8 A;  2IU0 A;  1ROP A;  4JYA B;  1R73 A;  1MA1 A;  4UFZ A;  1SA0 A;  3B77 A;  2P4V A;  3A0R A;  2DE0 X;  1XNQ O;  1N0J A;  2EIK C;  1M57 C;  2ZQM A;  1R6N A;  1TVK B;  3A0H Z;  2QKC A;  2EIJ C;  3OD4 A;  4G28 B;  2LO1 A;  2ZCE A;  2X6B A;  4JI8 B;  2FYU H;  1O9H A;  3G6B A;  1U96 A;  1KP2 A;  2UUC B;  3CCL V;  4TUY A;  2Q68 A;  4GKJ B;  1BSM A;  5IT9 N;  1DF5 A;  2X7R B;  4G2K A;  1JPX A;  1KUQ A;  2WLI A;  2IJJ A;  3NR7 A;  1FXK C;  5CA0 A;  5IWA O;  2Z3Y A;  4H37 A;  2HR3 A;  1QVF U;  3ZJZ A;  1K8A W;  2Y4U A;  1F4M A;  2ETN A;  5JVD B;  1NI8 A;  4DV0 O;  1KKC A;  2OIE A;  5DED A;  3LDD A;  3OR7 C;  1RP3 B;  5B1A B;  1OCC B;  1RPO A;  2UU9 O;  4JI2 O;  4DV4 O;  3CHX A;  1YXB A;  1NH2 D;  1TUB A;  5IE9 A;  3L70 H;  4U3F H;  1TUE B;  3FB7 C;  3ZMV A;  5KLV H;  3ZHT A;  3SPJ A;  1V54 B;  2QWP B;  4NTX A;  1QLN A;  3T4D A;  3Q4H B;  3RVZ A;  2QWR B;  2V1D A;  1RM1 B;  3X2Q C;  2PZS A;  2JS3 A;  4O2B B;  2N04 A;  2IBZ H;  2DYS B;  3RYH A;  2WLJ A;  3T1H O;  2ZXW C;  4B3S B;  3JD0 A;  3B09 A;  4BIO A;  5JQG A;  2XAH A;  1VEW A;  3SYC A;  1BS3 A;  2MK3 A;  1HR0 B;  4ZI7 B;  5KHG A;  3GWO A;  2F23 A;  1PNM A;  4JI6 O;  1QLE C;  3L71 H;  4ZHQ A;  1V9P A;  3I55 V;  2QWO B;  4IYH A;  1EM1 A;  5L3B A;  4UUJ C;  2Q8V A;  1Q82 W;  1FAF A;  1M90 W;  2Q7E A;  5EZY B;  4HBN A;  5KAI Z;  5LBQ A;  4OXS A;  3CWB H;  3L74 H;  1HDJ A;  4YIP A;  4H44 B;  4NKG B;  4FFB A;  4X20 A;  2PYL A;  2K9P A;  1RSO A;  4MW8 A;  4DR6 B;  1JCH A;  4LF7 B;  3WB1 A;  4HNA A;  3CPW U;  4I0X B;  5B1N A;  3ABM B;  1ZTE A;  2RN9 A;  3O9O A;  5IJ9 A;  3ZHS A;  1PL0 A;  4U7N A;  1ZUQ A;  4PDM A;  2H3O A;  1Y76 B;  2QTO A;  2Q0O C;  1HNZ O;  3ZMZ A;  1JFF B;  2KQX A;  4A5U B;  1SER A;  1GN3 A;  4FLX A;  1SRY A;  1OZ0 A;  3OAA G;  3AG4 B;  4CH6 A;  1NU1 H;  3K9A A;  2Q7H A;  4MVQ A;  1Q3E A;  2B1I A;  3AG1 C;  1WA8 A;  2AXT Z;  3P3P A;  4PA7 A;  4TT3 G;  4AQY B;  3R66 A;  1R6T A;  3OTF A;  3JAT A;  3G67 A;  5LMU O;  3ABT A;  4KHP O;  3OMI B;  3K5L A;  1CXZ B;  2EIK B;  4DV3 O;  3JAL B;  4F6E A;  3CRA A;  2KSD A;  1UPG A;  1JJO A;  4FIP C;  4K8Z A;  4GUN A;  1BHA A;  3BFR A;  1Y74 A;  1Q7Y W;  3B8N A;  1SZT A;  4MVM A;  4K0K O;  5BY1 A;  2H94 A;  2YEV B;  4PA4 A;  3CX5 F;  4X65 O;  5EBM C;  3K58 A;  1AJQ A;  3B2E E;  1KMI Z;  1L1F A;  1U97 A;  2PI4 A;  3P3N A;  1K34 A;  5JCO A;  3RYI B;  4LH6 A;  2VQE B;  2YIA A;  3K03 A;  4YY3 O;  1DK1 A;  1M1K W;  2HP8 A;  5JH7 A;  4FLT A;  4MTO A;  2XAF A;  4YY3 B;  2XAJ A;  2PUS A;  1S3J A;  3OE7 G;  4YJ2 A;  2O57 A;  4LF5 B;  4TOI A;  3ABK C;  2AW9 A;  3ZS8 C;  2UXN A;  2EIL B;  3CD6 V;  2Q5Z A;  4DXW A;  1DLB A;  3H9V A;  1XQ8 A;  4JYC A;  4XDL A;  1PV0 A;  3KKY A;  4IGG A;  1PL4 A;  4EKW A;  5A2Q N;  3H1I H;  1H2K A;  2ADQ B;  4DV6 B;  1PM9 A;  1QCE A;  4MTF A;  1JVM A;  1IBM O;  5CBF A;  2X6A A;  1IBM B;  1NTM H;  4WFB V;  2B1G A;  4DR2 O;  5LA6 B;  4J7Z A;  4OX9 O;  1R1B A;  1FKA O;  1J5E O;  3K5N A;  1WPB A;  4DR4 O;  1XEQ A;  1XMO O;  3PJS K;  4PI0 A;  2PF4 E;  1RM1 C;  2GBO A;  3KCX A;  4WFF A;  3EXA A;  4DV1 O;  1VQ7 V;  4JPR A;  5EYP A;  1LUW A;  1QNM A;  2GUZ A;  1EZV H;  4D7T A;  4B3T B;  5TIS Z;  4X1K B;  1D5N A;  3M99 B;  1K4D C;  4FK5 C;  2QKA A;  2N74 A;  3RBZ A;  1JR9 A;  1EZJ A;  1FFX A;  2L6L A;  2P6J A;  3CCM V;  2NR5 A;  3OT7 A;  1NH2 B;  2ITC C;  2YI9 A;  4JI5 O;  3ETG A;  2PYJ A;  1BE3 H;  3EFF K;  4NXN B;  4JV5 O;  2Y0P A;  1E1R G;  1FXK B;  1I7F A;  1OHH G;  1K97 A;  3JAW B;  3ZIA G;  5B1O A;  4QE7 A;  1AP5 A;  1G4Y B;  3QVN A;  2QWQ B;  1XL6 A;  2IH1 C;  4ASU G;  4RQE A;  1WB7 A;  2QM8 A;  4I55 A;  3SR2 C;  2BOB C;  3MAQ A;  1WJZ A;  1G6U A;  1T5E A;  3CRC A;  3SPI A;  3AG1 B;  4MS2 A;  1TA8 A;  2JRI A;  3OUF A;  1KYO F;  3N2K A;  2KG7 B;  5IYC O;  4JYB A;  4WF9 V;  1Z2G A;  4TQF A;  4JI5 B;  1BMF G;  4CBC A;  1S5H C;  4OPH A;  2UXB O;  4O2A A;  1XRE A;  2VS0 A;  2HVJ C;  2CE4 A;  4GZR B;  4P2Z A;  2GTA A;  5E1A C;  4YJ3 A;  4RWU A;  3K9S A;  3JAS B;  2NN4 A;  2LW1 A;  2Q9L A;  3K3W A;  2Y4T A;  1PD3 A;  2UXX A;  4EFE A;  2JEX A;  3SYA A;  4DV7 O;  3JAS A;  3UO2 A;  3UM7 A;  5C8Y A;  3OTO B;  1Q6H A;  1H2S B;  1SF9 A;  3B40 A;  4X1I B;  1R6K A;  4LFC B;  3J7A U;  2E75 B;  1K92 A;  1QR9 A;  3RW0 A;  4MTX A;  1VQP V;  4FZ0 A;  3OW2 U;  3U11 A;  3N2K B;  3MHH C;  3L73 H;  4Q20 A;  2ZE8 A;  2UUB O;  4N21 A;  2BCC H;  4QPJ A;  2Q73 A;  1GM7 A;  4FLU A;  1WP7 A;  2UUA O;  3CCE V;  2WWW A;  1PKX A;  4ZIB A;  1YJ9 V;  1N4C A;  1M56 C;  4WFH A;  3CYO A;  3JAR A;  1TAE A;  3JAW A;  5LHG A;  4OPA A;  1WPX A;  1XOU A;  3WG7 C;  1W0J G;  3AEI A;  5E79 Z;  3FYI B;  2ZE7 A;  2LQT A;  1YCI A;  3ZN1 A;  4DR3 O;  2ZXW B;  3MDS A;  1JA8 A;  3L9D A;  4GYC B;  3T4Z A;  5F2V O;  4J7K A;  4GX1 A;  4X64 O;  1YJN V;  2IH3 C;  1FFX B;  4FLY A;  5IYZ A;  3VQV A;  4JAU A;  4E4E A;  1IBK O;  3C90 A;  2CTP A;  3WG7 B;  2FKX A;  3VOU A;  2OIG A;  2JGD A;  4RAI A;  5IY5 B;  3HKD A;  2HFE C;  4B3S O;  3F7V C;  2IM9 A;  1LNQ A;  2DMX A;  4O2A B;  4QGP A;  4XDJ A;  2F66 C;  5B1B B;  1AB3 A;  5GON A;  5FNV B;  1XHX A;  4JZ2 A;  1XNR B;  3ICX A;  3ZN0 A;  3G71 V;  1AR5 A;  2E5L B;  3K0D A;  3QG5 A;  3TJT A;  3OM3 B;  3D3I A;  3ZBH A;  2LW7 A;  3F7Y C;  4I55 B;  2Q67 A;  4PA6 A;  3ZX6 A;  1S76 D;  4CS2 A;  4MVS A;  4Z1M G;  5LXT A;  4KL1 A;  4HAM A;  4UV8 A;  4OGQ B;  4MVZ A;  2BSK B;  3BY6 A;  1HNW B;  1FJG O;  2VQF O;  3JD4 A;  4X62 B;  4UB8 Z;  2M6Y A;  3JD3 A;  4JAS A;  3JAM N;  3ASN B;  1FJG B;  1HNW O;  4CZZ A;  1EFR G;  2QJ1 A;  5B5E Z;  2KB1 A;  1S5L Z;  3CCU V;  4JI1 O;  4DW0 A;  1VF7 A;  2HJD A;  2BOC C;  4YJ2 B;  4DRX A;  1AJN A;  4CS3 A;  3AG2 B;  2JGU A;  2WA4 A;  3H1L H;  1SS3 A;  3P30 A;  1FPO A;  4X1K A;  2GUZ B;  3H1J H;  5ITZ A;  4UCU A;  5K1P A;  1YEW A;  4BIU A;  1US6 A;  1V55 C;  1GTO A;  5L3C A;  2IU3 A;  3E8B A;  3AK3 A;  3K79 A;  4BW5 A;  2DQ3 A;  1AI5 A;  1AR1 B;  5EC2 C;  3CRM A;  5IDJ A;  3CB2 A;  3HKC B;  3WB0 A;  2RMK B;  1K3E A;  2RQ6 A;  3K06 A;  2YC0 A;  4ICG A;  4LF8 B;  2QM4 A;  3T1C A;  2L35 A;  1XDC A;  4GKJ O;  1AI7 A;  3STL C;  1I94 O;  1KD1 W;  2ZNJ A;  1H2G A;  3JAT B;  5L3G A;  1N34 B;  4JI0 B;  5FPR A;  5IYD O;  4PDV A;  5KA5 A;  1YJW V;  2CTW A;  1L0L H;  4QIW F;  4E2L A;  4D7S A;  5GTH Z;  2RNB A;  4EFB A;  2JK5 C;  2P06 A;  4JI7 O;  1H8E G;  3KG2 A;  3C3T A;  4DV6 O;  1Q8I A;  2LGQ A;  5L3E A;  4DR1 O;  1K33 A;  4AQY O;  4KFM A;  1VQM V;  4TV8 A;  4DV4 B;  1Q81 W;  3C3S A;  1H38 A;  3ZRW A;  4DR7 B;  4IIJ B;  2Z0A A;  3SJQ C;  5IJ0 A;  4I0X A;  4LF8 O;  4LBE C;  1Z5W A;  4DR7 O;  1AIL A;  3AG7 A;  2WLM A;  1XL4 A;  3HR0 A;  3IAY A;  4X20 B;  2QR4 A;  3H1K H;  2F93 B;  3KCY A;  5EK0 A;  1S0V A;  3QNE A;  2M7W A;  4DR5 B;  1PNL A;  5EC1 C;  4TV9 A;  3ZRS A;  4WFE A;  5B1A C;  1GH6 A;  4JI3 B;  3LSQ A;  4J80 A;  1E1Q G;  3AG3 B;  3OUS A;  1I5Y A;  1FXH A;  1CPY A;  3ZED A;  2VWK A;  2ZIN A;  3G6E V;  4ZHQ B;  2V4D A;  2P90 A;  1NQT A;  4ABM A;  2YI8 A;  4YHH O;  4ZI7 A;  1Q86 W;  3DXR B;  5JQG B;  3U10 A;  5EBW C;  1OCZ B;  2QWN B;  3RYH B;  2EBO A;  4X1Y A;  1OV9 A;  4BIZ A;  4C7U A;  5H5N A;  2G38 A;  5LYJ B;  4QNH B;  1XHZ A;  4IHJ A;  4FLZ A;  1D2D A;  5H2F Z;  3KZI Z;  3RT3 C;  4GLX A;  2FB5 A;  1TUB B;  1JMK C;  4HNA B;  3P32 A;  4NB5 A;  4DV2 B;  2DYR B;  4XBF A;  3JSL A;  5LGN A;  4YHH B;  2GHY A;  4DR2 B;  1K9M W;  1MAB G;  1BGY H;  1IVS A;  5CA3 A;  4CS4 A;  1I0H A;  1WB8 A;  4JTA B;  3TET A;  1NTZ H;  5H6R A;  1H8H G;  3UQ8 A;  3LSU A;  3SJA C;  3MHS C;  1LUV A;  4LR3 A;  4MTG A;  4FM1 A;  2Q69 A;  1KQS U;  1XUQ A;  2RJZ A;  4TUY B;  3DC5 A;  5IY5 C;  4BW9 A;  2QDO A;  5JJJ B;  3WFV A;  1GKF A;  2DWD C;  3OGC C;  2QM7 A;  4U3J B;  4O4I B;  2ZE5 A;  1Y66 A;  2PTM A;  1TVK A;  3MD0 A;  1K5S A;  4YXW G;  1HW7 A;  5BR8 O;  3ZMT A;  1V54 C;  1SA0 B;  5A9G A;  3VBB A;  3E83 A;  2JVD A;  3F5W C;  5J2U A;  2ITD C;  1KKD A;  1XNQ B;  1FXV A;  1P7G A;  2XHB A;  2OCH A;  2P4K A;  4DV5 O;  4RUF A;  4DV0 B;  4D6T H;  1OCR B;  2OCC B;  3ABL C;  2HHH O;  4R8C A;  3THO A;  2YDE A;  2QSA A;  2CH7 A;  2AHZ A;  2Q0A A;  2HHH B;  1S72 V;  2A0L A;  1N33 B;  3M7M X;  4JAV A;  4O4J B;  1HWY A;  3SGI A;  1N33 O;  4UCV A;  1IBK B;  3T2M A;  1H2L A;  4NR1 A;  3APO A;  4EB6 B;  5GW7 A;  2FTK A;  3SYP A;  3EHB B;  5CBH A;  1Q5O A;  3CEI A;  1HP8 A;  3D3Q A;  2OWO A;  1QR8 A;  2A06 H;  4EB6 A;  1MOF A;  4R50 A;  2P5O A;  2ZDI C;  3CRQ A;  4DV7 B;  4DUZ B;  2ZD9 A;  2JS5 A;  4O4J A;  1B6Q A;  2UU9 B;  4JI2 B;  2E5L O;  2A7W A;  4X64 B;  1RFY A;  4UCR A;  4MT8 A;  1R3J C;  2RDC A;  1ZX3 A;  4MW3 A;  2EZP A;  3OR6 C;  4ZBM A;  1B3Q A;  1PPJ H;  2F4V B;  4LNU A;  3ZHQ A;  1YTF D;  2XAQ A;  4K35 A;  5J2U B;  3QO5 A;  2F4V O;  1ZL8 B;  4LNU B;  1GN4 A;  3CC7 V;  4R7C A;  3OEE G;  4KXR A;  5CB4 A;  2ZM6 O;  3SJB C;  4O4I A;  4DUY B;  2DYR C;  1XMQ B;  4QJF B;  2Y0I A;  4CH4 A;  4UCO A;  4DR3 B;  2AGA A;  2R9I A;  5AG2 A;  2IJH A;  2JIZ G;  2IJI A;  2ZR2 A;  1DF4 A;  5HFL A;  4FLW A;  1VQ4 V;  1IBL O;  3AG2 C;  1GO3 F;  4I7Z B;  4I9W A;  1YI2 V;  2HEP A;  3E22 A;  4LF9 O;  2HG5 C;  3RFR A;  2DW4 A;  2DWE C;  3W7X A;  3SPC A;  3HB3 B;  2VWJ A;  4I4T B;  4H0L B;  1K73 W;  1GN2 A;  1IXB A;  4LH7 A;  4LF7 O;  4JF3 A;  3ML0 A;  4ZOL A;  1QBZ A;  3RYF A;  5BMV A;  4KHP B;  1XMQ O;  2QTS A;  3FKS G;  1KB9 F;  3BHP A;  1CP9 A;  1BQZ A;  1AI6 A;  1I5X A;  3TGU H;  4W4K A;  4IHJ B;  2BTO A;  2E76 B;  3CRR A;  2HVK C;  4K0K B;  3R65 A;  2AHY A;  5LYJ A;  4QPK A;  1YSC A;  2PI5 A;  3F5T A;  2GSM B;  1ARO P;  5LGU A;  2PGG A;  2Y69 C;  1XI1 A;  2ILM A;  3VQX A;  4U3J A;  1EN6 A;  1F51 A;  3B4S A;  2LP7 A;  1NVP D;  3CJH B;  5DM6 V;  4NYK A;  2BTQ B;  4MVU A;  5B1B C;  4KP4 A;  1SES A;  5EIB D;  3IC9 A;  2UUB B;  2OCC C;  5LOV A;  4LF6 B;  2JJ2 G;  3E86 A;  3ETE A;  4GCZ A;  4AI8 A;  3FYE B;  4JI4 O;  1NJI W;  1N36 B;  2OYQ A;  2HJF C;  4IYI A;  3UT5 B;  1W2B U;  4GKK B;  4UCT A;  2ZR3 A;  1AI4 A;  2WAM A;  4J9Y B;  1Q90 D;  1VMG A;  2Z5U A;  4FZ1 A;  4LF4 B;  2XTA A;  4J41 A;  4GT1 A;  4LF4 O;  2YXL A;  1IZ3 A;  2UUC O;  1AJP A;  3ZRW B;  2EJ7 A;  1KC8 W;  2F1M A;  2R9A A;  5LL6 Y;  4TWK A;  2CTR A;  3WB2 A;  1LR1 A;  4QE9 A;  3CC4 V;  1X4T A;  2JDI G;  2WLN A;  1VQN V;  4X1Y B;  1S77 D;  1N32 B;  5LMN B;  3QTC A;  2HKO A;  1IDS A;  3LUT B;  3DXR A;  1VQO V;  2PY5 A;  4GX2 A;  1F23 A;  3JAK B;  4LP8 A;  5KAF Z;  4CH3 A;  4P9P A;  2A9H A;  4BAY A;  4O4L A;  1DTO A;  4WBN B;  4CH5 A;  5IYB O;  1WP8 A;  4NXN O;  4NXM O;  2A79 B;  4NXM B;  1THZ A;  1SKV A;  1GAX A;  3M8A A;  4TV9 B;  1SQX H;  1UFI A;  5JJE B;  4B7E A;  4FPP A;  3K0G A;  2R70 A;  2CGN A;  2WLH A;  1L0N H;  2NLJ C;  2VQF B;  1MSW D;  1ENV A;  1A32 A;  2WSS G;  3DTU B;  5KUK A;  2LFR A;  2AZ2 A;  4DR6 O;  5IJ0 B;  3CE2 A;  4IIJ A;  3BA9 A;  4PJ0 Z;  3CCJ V;  3ASN C;  4GX5 A;  2OT5 A;  1AR4 A;  4TV8 B;  3FD9 A;  1SQF A;  2ZE6 A;  3T1Y B;  2C2A A;  3JCU Z;  4HYO A;  4Z2W A;  1MZF A;  2EIN C;  3L75 H;  1VQK V;  1KBH A;  2D3O W;  1JQ0 A;  3W7T A;  4DYL A;  2ZIM A;  3RGB A;  3HKE A;  3UCS C;  1GK9 A;  3GVM A;  4LWS B;  3LNM B;  1BHB A;  5LHH A;  4WFA V;  1VF6 A;  4MSW C;  2X0L A;  4F6R A;  2D2C B;  3BAA A;  3ZMU A;  3ZHU A;  1QQC A;  2W6J G;  1NVP B;  2DJV A;  3HKC A;  1MNG A;  2CAZ C;  3BCC H;  5K1X A;  2ZKO A;  2W0X A;  3A2F A;  5CA1 B;  1VQL V;  3HKD B;  1Z5V A;  4Q6G A;  2JGD B;  2DYS C;  5ITZ B;  2EIJ B;  1GM8 A;  1XIL A;  2FML A;  2KKW A;  1NS1 A;  2W6I G;  2YXH A;  1KP3 A;  5FL7 G;  2VQE O;  3UO3 A;  3TK1 A;  5BXZ A;  4DRX B;  2GDS A;  5GTI Z;  3CCV V;  1GM9 A;  2EIL C;  1WN7 A;  2YIC A;  3FAV B;  3JYC A;  5KX5 A;  3E2E A;  3G80 A;  5CN0 A;  1B04 A;  3N27 A;  2EIN B;  1M57 B;  4PV1 B;  2BSK A;  2Y69 B;  3NXS A;  3QO8 A;  4DR5 O;  3RYC A;  5JCO C;  1G1X B;  1VIB A;  1JX9 A;  5LXT B;  4EEQ A;  3JAR B;  2LJ2 A;  3LNN A;  5BR8 B;  4JI3 O;  5BZB A;  1X59 A;  3VQW A;  3N2G A;  1P84 F;  5J2T A;  3CCR V;  4DV5 B;  4DW1 A;  4DO2 A;  1EN4 A;  4F4L A;  1CEZ A;  3TCU A;  1IXM A;  3OEH G;  4PDR A;  5FNV A;  1G8M A;  3HKB A;  3QO7 A;  5GON B;  2UXD O;  2YID A;  1NKD A;  3ZMS A;  1VF5 B;  4UV9 A;  4MVO A;  1Y6X A;  3OMN B;  3JD1 A;  4X89 A;  2V7Q G;  3E8H A;  2XT9 A;  4FVM A;  3TXS A;  1NBM G;  4NVP A;  5B3S B;  1YHQ V;  3AG3 C;  4BR6 A;  4UB6 Z;  3J81 N;  2K1E A;  4CC5 A;  4B7K A;  1H2N A;  5KMG B;  3OFN G;  4I50 B;  5CBG A;  4LFB B;  3T1H B;  5IYZ B;  3GB7 C;  4DUY O;  3BEH A;  3QF7 A;  1JOY A;  1M4U A;  1WLE A;  2YUA A;  4O4H A;  2EIM B;  4FM2 A;  1XNR O;  1GMG A;  5C93 A;  3ABU A;  3HKB B;  3SYQ A;  2R72 A;  1WAZ A;  2RCV A;  4RO2 A;  2EZO A;  1K4C C;  3SJC C;  5LP6 B;  3W7U A;  2EUL A;  3CCS V;  4L8J A;  5B66 Z;  4JV5 B;  3IFX A;  4DK0 A;  3E89 A;  2Q6A A;  3D36 A;  2WA3 A;  1GN6 A;  5J2T B;  5J9P C;  1OCO B;  1VF6 C;  4UVB A;  3VQY A;  3STZ C;  1OJH A;  1BL8 A;  1VQ9 V;  2CK3 G;  2Q7G A;  3BVO A;  4J7J A;  1P7B A;  5CMU A;  3WU2 Z;  4HZ3 A;  5JJN B;  1TGO A;  2A3Q A;  4H13 B;  2JJ1 G;  5LP6 A;  1SZX A;  4JI8 O;  5KA6 A;  2XAS A;  5KX5 B;  4PA3 A;  2DN9 A;  4O4H B;  4X1I A;  4G27 B;  3AK2 A;  1YVW A;  3E8G A;  1DGS A;  3DSQ A;  5DEC A;  1XBL A;  4UXN A;  4FM0 A;  5C8Y B;  3K08 A;  3H1H H;  2UXC O;  4I50 A;  4J42 A;  4UVA A;  5KMG A;  2YIB D;  3G4S V;  1N8R W;  3CXH F;  5IWA B;  3ZHV A;  3BA8 A;  4B3M B;  5EYP B;  1K5Q A;  1AVM A;  3APQ A;  1PNK A;  4LF9 B;  3ABM C;  4AIL C;  4YJ3 B;  1K7D A;  3JCZ A;  1V55 B;  3ASO B;  2LFS A;  3OTO O;  4TQD A;  2XUM A;  5H9C A;  1UJW B;  3ABK B;  1SQP H;  1YTF B;  4LFC O;  2OTJ V;  1O9G A;  4PI2 A;  2KG7 A;  1F7Y A;  3BPZ A;  4XDK A;  1MZE A;  3E8F A;  4LC1 A;  4X8A A;  4X66 O;  4LF6 O;  2HLD G;  3I5D A;  4F6R B;  1OCO C;  1ZAU A;  3AK1 A;  3N2G B;  2ZT9 B;  3LDC A;  4J10 A;  4W4L A;  4P30 A;  2DQ0 A;  5FPO A;  1VQ8 V;  4YIO A;  3HKE B;  2YSU B;  5LP6 C;  1N32 O;  4JTC B;  4JYA O;  3RYC B;  4GKK O;  1WNS A;  2VRZ A;  5H6Q A;  1FS0 G;  1FXK A;  5LGT A;  4JI7 B;  1HR0 O;  4K8X A;  5DN6 G;  5KHJ A;  3FAV A;  1P4R A;  3OGI B;  3L72 H;  4L87 A;  5D5Q A;  2E3C A;  3DC6 A;  1M93 A;  3TXQ A;  1I08 A;  4LCU C;  5JH7 B;  4LF5 O;  5L3F A;  3O65 A;  4AHC A;  1GRJ A;  1W0K G;  4JTD B;  3SDL A;  3UKM A;  4ZKI A;  2XAG A;  5CA1 A;  4X88 A;  4JYY A;  1EN5 A;  2XOK G;  2YS8 A;  1N36 O;  2CGO A;  3CXC U;  3AG4 C;  1RPR A;  4B08 A;  5LA6 A;  3K5M A;  5EIB C;  1L8D A;  4K3A A;  2IJK A;  3CP1 A;  1YZB A;  3JAL A;  1BT8 A;  5JWP A;  1HNZ B;  4LWS A;  1NZ6 A;  4DV2 O;  2YXY A;  5KHI A;  4FFK A;  3JAK A;  2IW5 A;  5LHI A;  4GX0 A;  2QA4 V;  4DR4 B;  1KU9 A;  1XMO B;  1WA8 B;  3FB5 C;  1FYJ A;  4DV1 B;  3ABL B;  2B9Z A;  2GTS A;  3CMA V;  1FFT B;  3BAB A;  1URF A;  2WPD G;  3OMA B;  3S3X A;  3FX7 A;  1QLE B;  3U0Z A;  3CS5 A;  3W7W A;  4JI6 B;  1R3L C;  4I5S A;  2F95 B;  1J95 A;  1OCZ C;  4R6Z A;  3RYI A;  2ADP A;  2ZIO A;  3ZRX A;  1N0N A;  3H01 A;  1BCC H;  5L3D A;  3I56 V;  2W0F C;  1ZSP A;  3PN1 A;  1D5A A;  4CC6 A;  2YEV A;  3UT5 A;  2QEX V;  2BE3 A;  3K04 A;  4NTW A;  1OCC C;  4PDL A;  1Y74 B;  3RWR D;  4LFA O;  2ATK C;  4WBN A;  2Q4P A;  4O4L B;  4LFA B;  1P49 A;  1Y67 A;  5KHH A;  2P7T C;  1BQ0 A;  2R9R B;  1Q6I A;  1SQV H;  2EX3 A;  3LDE A;  5KHK A;  3FB8 C;  3J80 N;  1HNX O;  3LSS A;  3SPH A;  2AZ0 A;  3CJH A;  1COW G;  4P9O A;  1HNX B;  4U7O A;  1I94 B;  3ETD A;  4UVC A;  3X2Q B;  2UXB B;  2EJR A;  1PP9 H;  2F43 G;  1VQ5 V;  3D36 C;  3CCQ V;  2JEU A;  4UCS A;  4JI4 B;  2ODM A;  4O2B A;  5KUM A;  4J11 A;  1Y4M A;  2E74 B; 
#chains in the Genus database with same CATH homology
 2EIM C;  4FJC C;  3HPL C;  1GK9 A;  1QCE A;  3LNM B;  1BHB A;  5LHH A;  2H8P C;  3FB6 C;  4WFA V;  4MSW C;  2X0L A;  2ZDI A;  1JVM A;  4MTF A;  3CC2 V;  5CBF A;  4WFG A;  3CME V;  3ZMU A;  2X6A A;  2NNU A;  1ORQ C;  5B3S C;  3P32 A;  2X6C A;  2W6J G;  4J9Z B;  4MVR A;  4WFB V;  2B1G A;  1NVP B;  1VQ6 V;  2DYR B;  4XBF A;  4WCE V;  3ZCC A;  5LGN A;  2GHY A;  1K9M W;  1MAB G;  4H33 A;  1M56 B;  5CA3 A;  2XND G;  3PJS K;  1RM1 C;  1VQL V;  4JTA B;  4WFF A;  3W7S A;  3ZRV A;  1KEC A;  3TET A;  1VQ7 V;  4RQF A;  2DYS C;  5H6R A;  1H8H G;  4JPR A;  4PA9 A;  3MHS C;  2EIJ B;  1GM8 A;  3SPG A;  4MTG A;  4FMT A;  2W6I G;  2B5U A;  3M99 B;  1K4D C;  1KP3 A;  2Q69 A;  4FK5 C;  5FL7 G;  1KQS U;  2OTL V;  3TK1 A;  3RBZ A;  4TSF G;  1F4N A;  5IY5 C;  1EZJ A;  2P6J A;  3CCM V;  1NH2 B;  2ITC C;  1YIT V;  1ZWI C;  3ETG A;  1R3I C;  1E79 G;  1GM9 A;  2EIL C;  3CCV V;  3JYC A;  4JGS A;  1OCR C;  3E2E A;  3WFV A;  1GKF A;  3EFF K;  2DWD C;  4KUM A;  2QE7 G;  3OGC C;  2QM7 A;  5CN0 A;  2P67 A;  1E1R G;  3IGA C;  1FXK B;  2EIN B;  1M57 B;  1Y66 A;  2WLK A;  3MD0 A;  1K5S A;  1OHH G;  2Y69 B;  3NXS A;  3QO8 A;  4YXW G;  3ZMT A;  1K97 A;  1JX9 A;  1V54 C;  3ASO C;  3ZIA G;  5B1O A;  4QE7 A;  1M9N A;  1G4Y B;  3VBB A;  3SYO A;  3E83 A;  3F5W C;  5BZB A;  2QKS A;  1QVG U;  1XL6 A;  2ITD C;  2IH1 C;  4ASU G;  4RQE A;  1FXV A;  2QM8 A;  1KKD A;  1NR7 A;  1MG1 A;  2WLL A;  4RUF A;  2BOB C;  3CCR V;  1OCR B;  2Y48 A;  2OCC B;  1R3K C;  1NR1 A;  3ABL C;  3SPI A;  4DO2 A;  3AG1 B;  4MS2 A;  4R8C A;  4F4L A;  1EBO A;  3OUF A;  1CEZ A;  2AHZ A;  3TCU A;  1IXM A;  3DGE A;  3OEH G;  4PDR A;  5IYC O;  1S72 V;  2A0L A;  4JYB A;  3B8M A;  4PEL A;  4WF9 V;  4JAV A;  1BMF G;  1G8M A;  3QO7 A;  4CBC A;  1S5H C;  1SET A;  1NKD A;  3ZMS A;  4UV9 A;  1HWY A;  4MVO A;  3OMN B;  3RVY A;  2HVJ C;  4P2Z A;  3T2M A;  5E1A C;  3JD1 A;  4X89 A;  2V7Q G;  3E8H A;  1YHQ V;  1NBM G;  5B3S B;  5GW7 A;  2FTK A;  3AG3 C;  3SYP A;  3EHB B;  1JJ2 U;  2K1E A;  5CBH A;  3K3W A;  1YIJ V;  2WLI B;  1PD3 A;  2UXX A;  1QR8 A;  2JEX A;  3OFN G;  3SYA A;  1MOF A;  4R50 A;  3E35 A;  3UM7 A;  5CBG A;  2ZDI C;  3GB7 C;  3BEH A;  2ZD9 A;  1JOY A;  1R6K A;  1WLE A;  4RUE A;  2EIM B;  3JD2 A;  1B6Q A;  1GMG A;  1K92 A;  1QR9 A;  3ABU A;  3SYQ A;  5C93 A;  3RW0 A;  4MTX A;  1VQP V;  4RO2 A;  2EZO A;  1K4C C;  3OW2 U;  3W7U A;  4MT8 A;  3MHH C;  1R3J C;  4Q20 A;  4N23 A;  4MW3 A;  3CCS V;  2EZP A;  4N21 A;  3IFX A;  3OR6 C;  3E89 A;  2Q6A A;  5HFM A;  4QPJ A;  3D36 A;  1GM7 A;  4ZBM A;  2WLL B;  3IC7 A;  5J9P C;  5EBL C;  1OCO B;  4UVB A;  3CCE V;  2WWW A;  2IU0 A;  3STZ C;  1PKX A;  1YTF D;  2XAQ A;  1YJ9 V;  1ROP A;  1BL8 A;  1R73 A;  1M56 C;  3QO5 A;  1VQ9 V;  4WFH A;  3CYO A;  3B77 A;  5LHG A;  1WPX A;  2CK3 G;  3A0R A;  2EIK C;  3WG7 C;  1M57 C;  3CC7 V;  2ZQM A;  1P7B A;  1R6N A;  1W0J G;  3AEI A;  4HZ3 A;  4R7C A;  5CMU A;  3FYI B;  3OEE G;  3ZN1 A;  2EIJ C;  2JJ1 G;  2ZXW B;  2DYR C;  4G28 B;  4QJF B;  5KA6 A;  2XAS A;  3T4Z A;  4PA3 A;  2X6B A;  2R9I A;  4GX1 A;  2IJH A;  1YJN V;  2IH3 C;  4G27 B;  2JIZ G;  1KP2 A;  3E8G A;  2IJI A;  3CCL V;  2ZR2 A;  1DF4 A;  5HFL A;  4UXN A;  1VQ4 V;  2Q68 A;  3AG2 C;  3K08 A;  1GO3 F;  4JAU A;  1DF5 A;  4UVA A;  2X7R B;  4G2K A;  4I9W A;  3G4S V;  1N8R W;  1JPX A;  3WG7 B;  1YI2 V;  2WLI A;  2HG5 C;  3VOU A;  2DW4 A;  2IJJ A;  1K5Q A;  1FXK C;  1PNK A;  2Z3Y A;  3ABM C;  2HR3 A;  4H37 A;  3ZJZ A;  1QVF U;  1K8A W;  1F4M A;  4RAI A;  5IY5 B;  2DWE C;  3W7X A;  2HFE C;  1K7D A;  3SPC A;  3F7V C;  3HB3 B;  3JCZ A;  1V55 B;  1LNQ A;  3ASO B;  2LFS A;  1K73 W;  4XDJ A;  5B1B B;  5H9C A;  1UJW B;  3LDD A;  3OR7 C;  3ABK B;  1YTF B;  4JF3 A;  5B1A B;  3ML0 A;  1OCC B;  2OTJ V;  1QBZ A;  1RPO A;  3ZN0 A;  3G71 V;  4XDK A;  3K0D A;  3FKS G;  1NH2 D;  3OM3 B;  3D3I A;  3E8F A;  4LC1 A;  1TUE B;  3FB7 C;  4X8A A;  3ZMV A;  1CP9 A;  2HLD G;  1OCO C;  3SPJ A;  1V54 B;  3F7Y C;  1AI6 A;  1I5X A;  3LDC A;  4P30 A;  2Q67 A;  4PA6 A;  1QLN A;  1S76 D;  3T4D A;  2DQ0 A;  1VQ8 V;  4MVS A;  3RVZ A;  4Z1M G;  2HVK C;  2YSU B;  2V1D A;  2AHY A;  3R65 A;  1RM1 B;  4JTC B;  3X2Q C;  4QPK A;  1YSC A;  2PI5 A;  2GSM B;  1ARO P;  4HAM A;  4MVZ A;  4UV8 A;  5LGU A;  5H6Q A;  1FS0 G;  3BY6 A;  2Y69 C;  1FXK A;  2DYS B;  5LGT A;  2WLJ A;  3JD4 A;  2ZXW C;  3JD3 A;  4JAS A;  3JD0 A;  3ASN B;  2XAH A;  3SYC A;  2MK3 A;  5DN6 G;  1F51 A;  4CZZ A;  1EFR G;  1P4R A;  4L87 A;  2KB1 A;  3GWO A;  3CCU V;  2LP7 A;  1PNM A;  1NVP D;  5DM6 V;  2BOC C;  5B1B C;  4MVU A;  4KP4 A;  1SES A;  1AJN A;  1QLE C;  3AG2 B;  3I55 V;  2OCC C;  4LCU C;  5L3B A;  4UUJ C;  5L3F A;  2JJ2 G;  3P30 A;  1Q82 W;  3E86 A;  3ETE A;  4GCZ A;  1M90 W;  1W0K G;  4JTD B;  3UKM A;  5LBQ A;  4OXS A;  3FYE B;  4BIU A;  4ZKI A;  1NJI W;  1V55 C;  2HJF C;  1GTO A;  2XAG A;  4X88 A;  2IU3 A;  3E8B A;  5L3C A;  1W2B U;  3K79 A;  4BW5 A;  2XOK G;  2ZR3 A;  2DQ3 A;  1AI4 A;  2WAM A;  1AI5 A;  3CXC U;  3AG4 C;  1AR1 B;  5EC2 C;  4J9Y B;  5IDJ A;  1RPR A;  2Z5U A;  4MW8 A;  1JCH A;  1K3E A;  2IJK A;  3CPW U;  3CP1 A;  5B1N A;  3K06 A;  3ABM B;  4GT1 A;  1PL0 A;  4U7N A;  1AJP A;  4PDM A;  3ZRW B;  1KC8 W;  3T1C A;  2QTO A;  1AI7 A;  4TWK A;  3STL C;  1KD1 W;  1H2G A;  3ZMZ A;  2IW5 A;  5LHI A;  5L3G A;  1SER A;  4QE9 A;  1SRY A;  4GX0 A;  2QA4 V;  3CC4 V;  1OZ0 A;  3OAA G;  4PDV A;  5IYD O;  3AG4 B;  3K9A A;  5KA5 A;  1YJW V;  2JDI G;  3FB5 C;  2WLN A;  1VQN V;  1S77 D;  4QIW F;  4MVQ A;  4E2L A;  2HKO A;  3ABL B;  2B1I A;  2JK5 C;  3AG1 C;  3LUT B;  4PA7 A;  3CMA V;  4TT3 G;  1H8E G;  3KG2 A;  1FFT B;  1VQO V;  5L3E A;  2WPD G;  4GX2 A;  1K33 A;  3OMA B;  1F23 A;  3ABT A;  4KFM A;  1VQM V;  3OMI B;  4LP8 A;  1QLE B;  1Q81 W;  1H38 A;  3W7W A;  2EIK B;  3ZRW A;  1R3L C;  4I5S A;  4P9P A;  2A9H A;  4BAY A;  3SJQ C;  1DTO A;  4FIP C;  4LBE C;  1J95 A;  1OCZ C;  4R6Z A;  5IYB O;  1BHA A;  3ZRX A;  2WLM A;  2A79 B;  1Q7Y W;  3H01 A;  1XL4 A;  3B8N A;  5L3D A;  3I56 V;  1SZT A;  4MVM A;  1THZ A;  2W0F C;  5EK0 A;  1S0V A;  3QNE A;  2M7W A;  2H94 A;  2YEV B;  1PNL A;  2YEV A;  4FPP A;  4PA4 A;  3K0G A;  2QEX V;  5EC1 C;  3K04 A;  5EBM C;  2WLH A;  3ZRS A;  4WFE A;  1AJQ A;  5B1A C;  2NLJ C;  1OCC C;  4PDL A;  1L1F A;  2PI4 A;  3LSQ A;  1MSW D;  1ENV A;  1E1Q G;  1K34 A;  3AG3 B;  2WSS G;  3DTU B;  5KUK A;  2ATK C;  2LFR A;  3K03 A;  3OUS A;  1I5Y A;  1M1K W;  1FXH A;  1CPY A;  2P7T C;  4MTO A;  3CCJ V;  2XAF A;  2R9R B;  3G6E V;  3ASN C;  2XAJ A;  4GX5 A;  2OT5 A;  1S3J A;  3LDE A;  3OE7 G;  3FB8 C;  2P90 A;  3LSS A;  3SPH A;  1NQT A;  3ABK C;  1COW G;  4P9O A;  4U7O A;  3ETD A;  1Q86 W;  2UXN A;  4UVC A;  3X2Q B;  2EIL B;  3CD6 V;  2C2A A;  2EJR A;  2F43 G;  4HYO A;  4DXW A;  1DLB A;  1VQ5 V;  5EBW C;  1OCZ B;  3CCQ V;  2JEU A;  2EBO A;  2EIN C;  4JYC A;  4XDL A;  1VQK V;  2D3O W;  1JQ0 A;  5KUM A;  3W7T A;  4BIZ A;  1Y4M A;  4EKW A;  4QNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...