3ZCCA

High resolution structure of the asymmetric r333g hamp-dhp mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
110
structure length
110
Chain Sequence
STITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDGTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HAMP, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Structure of Mutant of Hamp-Dhp Fusion
rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 45
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2012-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zccA00
3ZRVA 4JAVA 2WWWA 4JAUA 4LC1A 4ZKIA 3A0RA 4GT1A 4MT8A 1IXMA 3ZRXA 1JOYA 1F51A 5B1NA 3ZCCA 4I5SA 5C93A 4Q20A 2QM7A 3TK1A 4BIZA 4GCZA 3NXSA 4JYCA 2FTKA 4U7OA 4FPPA 4QPKA 3ZRWA 4JASA 3MD0A 2P67A 2LFRA 2QM8A 4JYBA 4QPJA 3ZRWB 4U7NA 3D36A 2LFSA 5IDJA 5B1OA 4FMTA 3DGEA 3P32A 4KP4A 2C2AA 4MTXA 4BIUA
chains in the Genus database with same CATH superfamily
4AQYO 2N74A 1VF7A 2Z3YA 3L9DA 2VQFB 1N36O 2D2CB 3AK3A 4DR3B 1IXBA 5CN0A 1D5NA 1KMIZ 3DXRB 4H13B 1ZTEA 2A9HA 1PV0A 4MSWC 2K9PA 3WU2Z 4LH7A 2VQFO 4GX2A 4JI8B 4J42A 1KU9A 4DR3O 4HNAA 4KP4A 1ZL8B 3KCYA 2OT5A 4FZ0A 3K79A 2GDSA 2QTOA 3OMAB 5KAIZ 2Z0AA 4J9YB 3SJCC 1R6TA 4JI8O 4PDVA 1WAZA 5B1AB 4LR3A 3OW2U 1KD1W 5CA1A 1Z5WA 5BMVB 4WFAV 4WFBV 2P5OA 2QKSA 5EYPB 1TVKA 1AVMA 1QLEB 2ARHA 5B66Z 4D7TA 1QCEA 2JJ2G 1IBLB 1VF5B 5ITZB 5LXTB 1X4TA 2P4KA 2ILMA 2ZNJA 4NKGB 1SKVA 1HNXB 3OGCC 4R6ZA 3JD1A 3R65A 1IBLO 4X65B 5CA0A 1J5EB 4EB6A 1F4NA 4FLYA 3JAKA 1HNXO 4JV5B 4MTOA 1Y76B 3K08A 4X65O 2FB5A 1J5EO 3K04A 1VEWA 1K5QA 1SQQH 1DGSA 1ZWIC 2ZE7A 3BABA 3IJ4A 1BHBA 3ICXA 1NH2B 2JIZG 4JV5O 3LSUA 3FYIB 3SYOA 4LF5B 4JTCB 4DRXA 1P7GA 2H8PC 5L3EA 5IT9N 2JS5A 5KX5A 2Y4TA 2BTQB 1PNLA 3ZN1A 4DW1A 3CXHF 3LDDA 3UO2A 1PM9A 2JK5C 3RYFB 1MG1A 3T2MA 3CWBH 4LF5O 3C3TA 2BSKB 3ZRWA 1M56B 1H8HG 2UXXA 2WLLA 2LGQA 4U3JA 4O2BB 1R73A 2YIBD 2ATKC 1R3JC 1NVPB 2Q4PA 2QWOB 4G28B 3CE2A 2F95B 3CCMV 4E4EA 2A3QA 4QPKA 1DF5A 1SQBH 1R6KA 2LW7A 4GKJB 4RQFA 4PA9A 4PDLA 5JVDA 4MVUA 1I7FA 4IYHA 3JASB 4GKJO 1KBHA 1N0JA 4J10A 3E22B 4DXWA 2IJIA 2Q0AA 2PZSA 4OX9B 1FXKB 1AJQA 5FNVA 1WJZA 1IDSA 1ZLZA 3CMAV 4JAVA 3RT3C 3CCVV 3N2KB 1FYJA 3WB2A 3IFXA 1YTFD 2ADPA 4OX9O 4HYOA 1XMQB 1TGOA 3SR2C 4DUZB 1WN7A 4GZRB 2QWRB 5GTHZ 5CBHA 4K35A 3ETDA 4GKKB 1H2LA 4K3AA 2QE7G 2EIMC 1XMQO 2KG7B 4F6EA 5B1BC 4DUZO 2HR3A 3JD0A 4Q20A 2VRZA 3UM7A 1SZTA 2DJVA 4GKKO 1B06A 1L1FA 1WPBA 4PA3A 1K34A 5IY5B 1Q3EA 2WLKA 1RSOB 3AK2A 1OV9A 3FFQA 1Q81W 2IJKA 3CCEV 3T4DA 3HKBB 4UB8Z 1D2DA 3ABKC 3DXRA 1WA8B 4Z2WA 5BZBA 3AG2C 4PI2A 3ABMB 5FL7G 3P3NA 1GKFA 4MVSA 1GO3F 1FJGB 4TQFA 1ZUQA 1ZL8A 1OHHG 3D36A 2W6JG 2KQXA 1EM1A 1SZXA 5IJ0B 2XAHA 1VQ4V 5L3FA 1G8MA 3GVMA 1ZAUA 2JEUA 4LBEC 5BMVA 1EFRG 4O4IB 5EYPA 4DV2B 5LL6Y 2IJJA 5D5QA 2QWNB 2Q67A 1PL0A 1QBZA 1NZ6A 1WP7A 1US6A 5ITZA 5LXTA 1PKXA 1JOYA 4DV2O 1FFXB 1L8DA 3CB2A 4X8AA 4DV7B 5GW7A 4X1YB 1MA1A 1M57C 1DF4A 3SDLA 2AXTZ 1OCOB 1EN4A 5CB4A 4LCUC 1Y76A 2XT9A 3ZRSA 3TCUA 4DV7O 2XAQA 3JARB 4L87A 4JI5B 2VQEB 1BGYH 2WPDG 3AK1A 2FTKA 1YTFB 4JASA 3F5TA 4YJ2B 2FYUH 3I5DA 1ZSPA 1WB8A 1SQVH 2BTQA 4JI5O 2VQEO 5EC2C 3RYFA 4HNAB 2BSKA 1RM1B 1BL8A 5K1PA 1VQKV 3CMEV 3QO8A 1V9PA 4PV1B 4UB6Z 1SETA 4O2BA 3B4SA 2P67A 4F4LA 3K5MA 4JYAB 3D36C 3JD2A 2ZQMA 3DC6A 3B8MA 4I55B 2CTWA 3TXQA 1S0VA 4WCEV 3I56V 1H38A 2PI4A 1Q43A 2JGUA 4I7ZB 3VQVA 3A0HZ 4BAYA 3J81N 4AILC 3OT7A 4JYAO 1IX9A 4RWUA 2ZD9A 2F93B 2EIJB 4JYCA 3ZS8C 4UVBA 3E83A 2ZXWB 2Q7HA 1QLEC 3CEIA 3WFVA 1XL4A 3JASA 3OTOB 5KUKA 4LC1A 1H2NA 2ITCC 1CPYA 4EB6B 4WFHA 3E22A 1ORQC 3BFRA 1FXKA 3OTOO 1Y67A 1X59A 4DR6B 4JI3B 4QJFB 3DGEA 2YI9A 4WFGA 3N2KA 1GN4A 2L35A 1VQ9V 4UCSA 1OZ0A 4DR6O 4JI3O 3EXAA 1VQNV 3BA8A 1K73W 1SQPH 2QKAA 1QR8A 1Q90D 4ZI7B 1MNGA 5DECA 2KG7A 3IC7A 3E89A 5LMNB 4BW5A 3OUSA 2BOCC 1VIBA 1M4UA 2Y69B 2A0LA 1URFA 1RSOA 1GN6A 5LMNO 4JYBA 3JSLA 2AGAA 2EZOA 1GM9A 1PNMA 4TSFG 2Q6AA 3B77A 4DR1B 4UCOA 4IIJB 3HKBA 2VWKA 2AZ2A 4ICGA 3G67A 4P30A 5LGUA 1WA8A 4CS3A 3EVKA 5AG2A 4DR7B 3OE7G 1MOFA 1BE3H 2E75B 5LHIA 2A79B 1V55B 1XREA 4DR1O 4UVCA 5DEDA 1VQ8V 2P4VA 2YIBA 1WPXA 1FD9A 3VQWA 4DR7O 3N27A 3SPHA 2UUCB 1P84F 3ABTA 1K8AW 5IJ0A 5KA5A 3H1JH 4QE9A 4FFKA 1IVSA 3ZCCA 4O4IA 1IURA 4GCZA 1JMKC 3NXSA 2UUCO 1FXKC 1V54B 4P9PA 3UKMA 4QPJA 3M8AA 2D3OW 1ROPA 2OIGA 2CTPA 1AI5A 4HZ3A 1H2MA 1HR0B 2QWPB 1K5SA 5J9PC 1CXZB 3GB7C 4JF3A 3LDCA 1WNSA 2JVDA 1KKDA 1TUEB 4JZGA 4X1YA 3K57A 2E74B 1YXBA 4H0LB 1K7DA 1OCCB 1B3QA 4PJ0Z 2HHHB 1HR0O 1G6UA 1K97A 5LGTA 1EZJA 2JRIA 4B3MB 4UCTA 1AR4A 3JARA 4CH4A 3FB6C 2RCVA 1SERA 1GM7A 3TJTA 1COWG 4FLWA 2HHHO 1XOUA 3H9VA 3OMIB 4YJ2A 5IY5C 3QO7A 3R66A 3NR7A 3RVZA 1FXVA 2HVKC 1I5YA 5GTIZ 4B3MO 4JI6O 3AG1C 3LNNA 4O2AB 4I9QA 2HLDG 3LUTB 1KQSU 2B9ZA 4PD4F 1T5EA 3G6BA 3OGIB 3K06A 3ABMC 4Q6GA 3ASOB 4TV9B 2QJ1A 2XAGA 2NR5A 2UU9B 2H94A 4WF9V 2UXNA 2IBZH 4YY3B 1D5AA 3OR6C 1S3JA 4P2ZA 2RN9A 4AI8A 2CH7B 4I55A 4ZBMA 1AB3A 4NR1A 2UU9O 2YIDA 2K1EA 4NTYA 4B7EA 4LFBB 4UVAA 3AG4B 3D8CA 5C8YB 2DQ3A 4IT5A 4YY3O 2HJDA 4FLVA 1S5HC 4O4HB 4K8XA 2HEPA 3O65A 2HG5C 2KB1A 3G80A 1H2KA 4LF9B 3RFRA 4X64B 3ZBHA 4LFBO 2Q68A 4GUNA 1Q8IA 1HWYA 4FLXA 2AHYA 5A2QN 1KC8W 4LWSB 4LF9O 3CCRV 4YIOA 4DV1B 5CB4B 4X64O 2R9AA 2ZR3A 1EN5A 1BHAA 3S3WA 4TUYA 1E1RG 1OCOC 2DE0X 5E79Z 1SS3A 4J7JA 2ZR2A 3ZEDA 4DV1O 2Y4UA 4QE7A 1KYOF 2X6AA 3VQYA 1MABG 5JQGB 4RO2A 4ZI7A 1PL4A 2RMKB 3A2FA 5KUMA 3G71V 1GM8A 2PYLA 2VS0A 5B5EZ 1RM1C 5A9GA 1GH6A 3PJSK 2R70A 3ZRXA 3BRCA 1AR5A 3K3WA 3F7VC 3H1LH 2WLMA 5H6QA 4DK0A 4IIJA 3BEHA 4B3TB 3QG5A 4JZ2A 4JTDB 2X0LA 2YI8A 4X9QA 4DV0B 3K0DA 4PA7A 2Y0IA 2G38A 1LR1A 4XDJA 2EIJC 3H1IH 2PI5A 2CGNA 5IYCO 4B3TO 3HB3B 2JJ1G 2ZXWC 2FL4A 4DV0O 2DW4A 4GX0A 2UXBB 2ZIMA 1I94B 3BCCH 5EZYB 1YJNV 1S72V 2ZKOA 3STZC 4FM0A 2WSSG 3L74H 2Y48A 3ZIAG 2YXYA 2UXBO 2QWQB 1YVWA 2AZ0A 2ZINA 1I94O 4MW8A 5KA6A 5EBLC 3JD3A 1OCZB 3MHHC 3UO3A 1G4YB 4AHCA 2EZPA 4RUFA 4WFEA 1B04A 1HNZB 2Q0OC 3ZN0A 1JFFB 4O4JB 4EKWA 4FLZA 1FAFA 2QA4V 4NTXA 1S5LZ 2F4VB 4X1IB 3WB1A 4KUMA 1BMFG 1QLNA 4MTGA 1M9NA 1HNZO 5L3DA 1W0KG 3E8HA 3JALB 2LGWA 3E35A 2F4VO 4I0XB 2P06A 1AP6A 5FPRA 2XAFA 2JDIG 4FFBB 5E1AC 4QIWF 3FAVB 3J80N 2Y69C 3K5NA 4K0KB 2OIEA 1IXMA 3I55V 1S76D 3CRMA 2ETNA 4E2LA 4O2AA 2HP8A 5IE9A 1VQ5V 4LH6A 2N05A 3AG7A 3L70H 1M90W 4K0KO 2DOSA 2LO1A 1HW7A 1K3EA 1KB9F 4LFAB 1QHTA 1J95A 1SA0B 2IJHA 4GX1A 4TV9A 4A5UB 5KLVH 2QEXV 1V55C 1YDXA 1W59A 4I5SA 1FJGO 1P7BA 3MDSA 2CH7A 3FD9A 3L71H 4F6RB 4KHPB 4LFAO 3WB0A 3RW0A 4B3SB 1F4MA 1AILA 5EIBD 4JI0B 4LNUB 2GTAA 3F7YC 5C8YA 1UPGA 4GLXA 2V7QG 1N34B 4UCVA 4FVMA 4O4HA 2UUAB 3ZHUA 3T4ZA 4KHPO 1N32B 4W4KA 3K58A 4DUYB 1BT8A 1R6NA 4J80A 3VOUA 3CS5A 4B3SO 1V54C 3JAWB 3C3SA 4JI0O 2JGDB 1AP5A 4C7UA 3UT5A 4RAIA 2ZE6A 4IYIA 2WA4A 2DYSB 1N34O 4I4TB 2UUAO 3VBBA 1N32O 4TV8B 2YDEA 1KUQA 4LWSA 3OTFA 3ABUA 2YC0A 4DUYO 2XASA 5B1OA 3P32A 4MVZA 2V4DA 3S3XA 1NU1H 4ASUG 1EZVH 3RGBA 2Q73A 2X6CA 3QNEA 1OCCC 1AI4A 5HFMA 3MD0A 5JJNB 1NTMH 3U11A 3U0ZA 1K92A 1QNMA 2O57A 3F5WC 3QTCA 4CH5A 3H01A 5KMGB 2KSDA 1YI2V 1G1XB 1KKCA 3ZRVA 5IYZB 5LA6B 4MTFA 3DSQA 4X89A 2XUMA 5JQGA 5KHIA 3D3IA 5L3BA 4KXRA 4UCRA 3O9OA 1N0NA 2A06H 1BQZA 2EIKB 4MW3A 3MHSC 5IYDO 3HKCB 1QVGU 1NJIW 1EN6A 3KZIZ 1JX9A 1DTOA 2YICA 2C2AA 3ASOC 2A7WA 2YUAA 3SJQC 3K03A 3AG3B 4R7CA 5B1AC 4J7ZA 3RYHB 3W7SA 3JD4A 1VQMV 2LFRA 5FPOA 1Q7YW 2LFSA 4CC5A 5B3SB 3STLC 3AG4C 3E86A 4BIOA 4P9OA 2HFEC 1DK1A 3LDEA 2DWEC 1SF9A 4TOIA 2PF4E 2ZCEA 1XEQA 3CRAA 2WLIB 3ASNB 1W0JG 5EZYA 3JSNA 4TUYB 1NR7A 3SPIA 3PN1A 5BY1A 1E1QG 4OXSA 2EJRA 3FYEB 1HDJA 1HP8A 5LBQA 4NYKA 5K1XA 3OEHG 2Q7EA 4NXMB 2Y0PA 1SQFA 1VF6A 3G6EV 3P30A 1H8EG 4GX5A 3HKDB 2F66C 5J2UB 1JFFA 4O4JA 2M6YA 3SPCA 3RWRD 1Z5VA 1BZKA 4NXMO 4FM2A 2OCHA 4X1IA 1XNRB 1NKDA 4R50A 3ABLB 4UXNA 2LP7A 3ZHSA 5BR8B 3DC5A 2VWJA 1ZX3A 1JA8A 1M56C 4DR2B 4BIZA 3JALA 2RNBA 4I0XA 3OEEG 4NXNB 1MSWD 1XNRO 3ZMSA 4TT3G 2XOKG 3J7AU 2BTOA 4FFBA 5BR8O 3CC7V 1JVMA 3FAVA 2ZT9B 1FS0G 2PYJA 4DR2O 5IYBO 1VQPV 2EINB 3TETA 2CGOA 3CC2V 4NXNO 3W7UA 2EILB 3JATB 4DV6B 2F1MA 4CS4A 1MSDA 4Z1VA 2Z5UA 2DMXA 4YJ3B 3CCUV 1SA0A 4JYYA 2B1IA 4DV6O 2YXLA 4OPHA 1BQ0A 2DWDC 4F6RA 1KECA 1NBMG 4N21A 2OTJV 1XUQA 2AW9A 3T1YB 4YHHB 1H2SB 3HPLC 4LNUA 3ZHTA 1AI6A 4WFFA 5JCOA 4UV9A 5LHGA 3IAYA 2OCCB 1YZBA 2E5LB 4FLUA 3K5OA 3OR7C 5KHJA 3B8NA 5LYJB 4YHHO 3T1YO 3JCZA 4LF8B 3A0RA 2H3OA 3JAWA 2JGDA 1NT2B 4I4TA 1VF6C 1GN3A 2E5LO 3FKSG 1PPJH 3CHXA 4TV8A 4ZIBA 1HNWB 3ZMTA 4DYLA 2JEXA 1P4RA 2RQ6A 4LF8O 5GONB 3CRCA 1GTOA 2GTSA 5D5PA 2ZDIA 1GMGA 5JH7B 1HNWO 1W2BU 4JAAA 1SQGA 1XMOB 3E8FA 1FPOA 1KP3A 4HBNA 4DR5B 3LSQA 1U96A 1XDCA 5KMGA 2R9IA 1XL6A 2FMLA 4PI0A 3M7MX 1MMMA 5IYZA 5LA6A 3ZX6A 3CYOA 2L6LA 1THZA 3BHPA 3CRRA 3JYCA 1XMOO 1Q6UA 2N04A 2GUZB 3M99B 4DR5O 4ZKIA 4U3FH 5KHHA 3E8GA 4JI7B 4Z1MG 4X62B 2QDOA 1BS3A 3ZMUA 3HR0A 4H37A 3UCSC 3TGUH 4G27B 3HKCA 4U7OA 3RYCB 2MK3A 1XQ8A 2W0XA 1VQ7V 3FB5C 3SPJA 1PD3A 4JI7O 4X62O 5TISZ 1QVFU 3T1HB 3BAAA 3GWOA 2YS8A 4O4LB 3RYHA 2P7TC 1VQOV 2QR4A 5FLXN 1K33A 1FXHA 5LP6B 2M7WA 1OCRB 3TXSA 2HKOA 4XDKA 3L75H 3HKEB 1GAXA 3QF7A 3T1HO 2ZE8A 3UT5B 5JCOC 5IWAB 4I50B 3CPWU 2ZM6B 1GN2A 3L72H 4QGPA 1XI1A 1QU7A 3CCSV 2CDYA 2WLIA 5CBFA 5LOVB 2DYSC 1JPXA 3LNMB 1YHQV 1XHXA 5IWAO 1YF2A 1O9GA 5L3GA 4NTWA 1R3LC 2ZM6O 2Q9LA 1I5XA 1YEWA 2WLHA 2DYRB 2YSUB 3AEIA 2LQTA 3ZHRA 5JJEB 1KP2A 1NS1A 2AHZA 2Q8VA 4JTAB 1YITV 4PDMA 4JPRA 1RFYA 4JGSA 4X66B 2ODMA 3OUFA 2ZDIC 1WB7A 4TWKA 3EHBB 4X20A 1H2GA 5JJJB 1RP3B 1XILA 3HKDA 3WG7B 5J2UA 3K9SA 2GV9A 4XBFA 4X66O 2F43G 3K5LA 4IGGA 4R8CA 4DV4B 3SPGA 1GRJA 4N23A 3FX7A 3THOA 1TA8A 5HFLA 2NLJC 4PHZA 1YCIA 5CA3A 2EIKC 1LUWA 4DK1A 3C90A 1BCCH 2ZE5A 2XAJA 2OYQA 4DV4O 1FKAO 2IH3C 4D6TH 1Q82W 3RVYA 2YEVB 3CCQV 1AROP 4FJCC 1Y74B 3SYPA 4UV8A 3QO5A 2X6BA 4EFBA 3OAAG 2ZNIA 2DN9A 2FKXA 3AG3C 3JATA 3SGIA 1I0HA 4GT1A 3RYIB 2QKCA 1K4CC 4YJ3A 2V1DA 2BE3A 2GSMB 1F7YA 2CE4A 5B3SC 1JR9A 3X2QB 1F23A 5BXZA 4CS2A 2E3CA 5IDJA 1A32A 2IU3A 1R1BA 2NN4A 5J2TA 4FIPC 3K9AA 3JAMN 3BPZA 2HJFC 4DW0A 3ASNC 4H44B 2X7RB 1SRYA 4RQEA 3DTUB 5CBGA 2QM8A 5EIBC 4QNHB 1AI7A 5IJ9B 4MVOA 2QSAA 2DQ0A 5LYJA 4J9ZB 3IC9A 4BIUA 1N4CA 2ZIOA 3OFNG 3RBZA 2XNDG 2EX3A 1M5IA 5GONA 2PUSA 1Y4MA 2LW1A 3ABLC 1UFIA 1CEZA 3FB8C 3OMNB 4WBNB 1QR9A 3CXCU 5JH7A 1MZEA 1LNQA 1L0LH 5DN6G 3TK1A 3QVNA 5LMUB 2Q69A 5H6RA 4DR4B 3H1HH 4X1KB 4YIPA 1R3KC 4EFEA 2P6JA 4CBCA 4FLTA 1R3IC 3AG1B 2EINC 3G4SV 3Q4HB 1VQ6V 2GUZA 1QQCA 2EILC 1PP9H 2GBOA 4JI1B 5LMUO 3KKYA 2Q5ZA 1WLEA 4DR4O 1YIJV 3CSXA 5B1NA 4BW9A 2ITDC 3SYAA 3RYCA 3W7TA 1NQTA 5CMUA 5DM6V 3N2GB 2WLNA 1NI8A 4EEQA 3B40A 4JI1O 1TUBB 3K59A 2LJ2A 1NTKH 2EBOA 4O4LA 2IW5A 1SESA 5H2FZ 4ZOLB 2NNUA 3ZMZA 2UXCB 4LP8A 3W7WA 4MVRA 5LP6A 4OPAA 4G2KA 4IHJB 1VARA 3CJHB 3U10A 2CTQA 3HKEA 4J11A 4DO2A 2EULA 1PNKA 3K0GA 1VMGA 4BWAA 2OCCC 3W7XA 4GYCB 2PY5A 2UXCO 4I50A 3FB7C 1IBKB 4MVQA 1P49A 2UXDB 2E76B 3CP1A 5EBMC 5LOVA 2WWWA 1B6QA 1YSCA 4L8JA 3P3PA 4PA4A 1BSMA 1E79G 1IBKO 3JCUZ 2UXDO 1Q6HA 4D7SA 2IM9A 4JI2B 4UCUA 4OGQB 4ZHQB 4KL1A 3OD4A 4JI4B 4FK5C 3APOA 2KKWA 2WAMA 3ZJZA 3CC4V 4JI2O 4UUJC 3BA9A 2WLJA 2IU0A 3ZHQA 3SYCA 3BVOA 3A8TA 4PDRA 4JI4O 1CP9A 3E8BA 1MZFA 1NR1A 4CZZA 1JQ0A 4HAMA 4NVPA 2P22C 1N33B 1Q5OA 1RPOA 2HVJC 4TQDA 4J41A 5EC1C 3KG2A 2WA3A 2CTRA 3E2EA 2BOBC 4W4LA 5LGNA 1LUVA 4B3RB 2YEVA 2R72A 1Y74A 2Q7GA 1N33O 1IZ3A 4MVMA 4LF7B 1Z2GA 5CA1B 1K4DC 2JS3A 2W6IG 3A0BZ 1TVKB 4JAUA 3RN4A 3CX5F 5LP6C 4B3RO 3D3QA 3RYIA 2QM4A 3B09A 4J7KA 1OCRC 2PTMA 4LF7O 4KFMA 5L3CA 1EBOA 4YXWG 4BR6A 2UUBB 4DV3B 1N8RW 4PA6A 4CH6A 1GK9A 4LFCB 5CA0B 3H1KH 3JAKB 5C93A 2B1GA 2UUBO 2QGNA 4DV3O 2CAZC 1Y6XA 2R9RB 4B7KA 2DYRC 1ENVA 3MAQA 1JJOA 5IJ9A 4X20B 1M93A 4LFCO 4CH3A 3SJAC 1S5JA 2XTAA 1SQXH 2OWOA 1DLBA 3L73H 4UFZA 1Y66A 1S77D 1RPRA 4DRXB 2P90A 5H5NA 3ETQA 4PELA 2EIMB 1F51A 1XNQB 3WG7C 3BY6A 5KX5B 5B1BB 1AJNA 1JJ2U 1JCHA 4FPPA 3GWKC 4RUEA 3UQ8A 3LSSA 4WBNA 3ZRWB 4LF6B 2YXHA 1M1KW 3T1CA 2WLLB 1XNQO 5LHHA 4U3JB 1YJ9V 5KHKA 2BCCH 1Q86W 1K9MW 4MT8A 2OTLV 4LF6O 2QM7A 4X1KA 2CUGA 3EFFK 4H33A 1VQLV 3ABKB 2W0FC 1NTZH 3AG2B 1XHZA 3Q4HA 1SC5B 2RJZA 2ADQB 2F23A 4B08A 5JWPA 2QTSA 2GHYA 5JVDB 5J2TB 1UJWB 4LF4B 3CCJV 1VP7A 2EJ7A 3IGAC 4ABMA 3N2GA 4IL6Z 3X2QC 3ZHVA 4FZ1A 1L0NH 1TUBA 3SYQA 4DV5B 2XHBA 3OM3B 4ZOLA 2PGGA 4LF4O 4X88A 3CRQA 4CC6A 3B2EE 1I08A 1TAEA 4IHJA 5FNVB 3CJHA 4K8ZA 4DV5O 4MS2A 5EK0A 3ETGA 1OCZC 5KAFZ 4NB5A 5F2VO 1XBLA 3KCXA 1O9HA 2YIAA 5KHGA 1NH2D 3VQXA 3APQA 3SJBC 1U97A 3ZMVA 1IBMB 2CK3G 1OJHA 4FMTA 2B5UA 3CD6V 5EBWC 2IH1C 1WP8A 1M57B 3ML0A 1YJWV 2MW2B 1FFTB 1FFXA 4I9WA 4FM1A 1Q6IA 5H9CA 4AQYB 1AR1B 1IBMO 3ETEA 1N36B 4ZHQA 4XDLA 1AJPA 1NVPD 4JI6B 3CCLV 2RDCA 4U7NA 4MTXA
chains in the Genus database with same CATH topology
2V7QG 3AG3C 3T4ZA 1VQLV 2Z3YA 4GT1A 1VQ9V 1R6NA 1OZ0A 3VOUA 1K4CC 1V54C 5CN0A 1VQNV 2V1DA 4RAIA 2DYSB 2GSMB 1K73W 2A9HA 5B3SC 4MSWC 3X2QB 3VBBA 1F23A 1QR8A 4GX2A 3ABUA 5IDJA 2XASA 5B1OA 3IC7A 3P32A 4KP4A 2IU3A 3E89A 4MVZA 4FIPC 2OT5A 3K9AA 4ASUG 3K79A 5KA6A 2QTOA 2HJFC 3OUSA 4BW5A 3OMAB 2BOCC 3ASNC 4J9YB 2Y69B 2X7RB 2X6CA 1SRYA 3QNEA 1OCCC 4PDVA 2A0LA 4RQEA 1AI4A 5HFMA 5B1AB 3DTUB 3MD0A 3OW2U 1KD1W 5CBGA 1K92A 2QM8A 4JYBA 4QNHB 4WFAV 4WFBV 2EZOA 1AI7A 1GM9A 1PNMA 3F5WC 4TSFG 4MVOA 2Q6AA 2QKSA 3B77A 3H01A 2DQ0A 1YI2V 4J9ZB 4BIUA 3ZRVA 1QLEB 4P30A 3OFNG 5LGUA 4MTFA 1QCEA 2JJ2G 4X89A 3OE7G 3RBZA 1MOFA 2XNDG 3D3IA 5L3BA 5LHIA 2A79B 1V55B 2EIKB 4UVCA 3OGCC 4R6ZA 3JD1A 3MHSC 4MW3A 1VQ8V 5IYDO 3R65A 1QVGU 1NJIW 1WPXA 1JX9A 1Y4MA 3ABLC 1DTOA 1CEZA 3FB8C 3OMNB 3SPHA 3ABTA 1F4NA 1K8AW 1QR9A 2C2AA 3CXCU 3ASOC 5KA5A 4QE9A 1LNQA 4MTOA 3SJQC 3K03A 3AG3B 3ZCCA 4R7CA 5B1AC 3K08A 5DN6G 3TK1A 4GCZA 3NXSA 3W7SA 3K04A 3JD4A 1VQMV 1FXKC 2Q69A 5H6RA 1R3KC 1K5QA 1V54B 1ZWIC 2LFRA 4P9PA 3UKMA 1BHBA 1Q7YW 4QPJA 2P6JA 1NH2B 4CBCA 2JIZG 2D3OW 1R3IC 3AG1B 2EINC 2LFSA 3FYIB 3SYOA 5B3SB 3G4SV 4JTCB 3STLC 1VQ6V 3AG4C 3E86A 2H8PC 2EILC 5L3EA 1ROPA 1AI5A 4HZ3A 4P9OA 2HFEC 1WLEA 1K5SA 1PNLA 3LDEA 3ZN1A 5J9PC 2DWEC 1YIJV 3GB7C 3LDDA 4JF3A 5B1NA 3LDCA 1KKDA 1TUEB 2JK5C 2ITDC 3SYAA 1MG1A 2WLIB 3T2MA 3W7TA 1NQTA 3ASNB 5CMUA 3ZRWA 1M56B 1H8HG 1W0JG 1K7DA 5DM6V 1OCCB 2UXXA 2WLNA 2WLLA 1NR7A 1K97A 5LGTA 1EZJA 1R73A 3SPIA 2ATKC 1E1QG 1R3JC 2EBOA 4OXSA 2IW5A 1SESA 2EJRA 1NVPB 3FYEB 3ZMZA 2NNUA 3FB6C 4LP8A 3W7WA 1SERA 4MVRA 4G2KA 1GM7A 4G28B 1COWG 5LBQA 3OEHG 3OMIB 5IY5C 3QO7A 3RVZA 4DO2A 3CCMV 1FXVA 1PNKA 2HVKC 1I5YA 4QPKA 1DF5A 3K0GA 3G6EV 1R6KA 3P30A 3AG1C 2OCCC 3W7XA 1H8EG 4GX5A 3FB7C 2HLDG 4RQFA 4MVQA 4PA9A 3LUTB 4PDLA 3SPCA 1KQSU 4MVUA 1NKDA 4R50A 3ABLB 3CP1A 5EBMC 2WWWA 4UXNA 1B6QA 2LP7A 1YSCA 3K06A 3ABMC 3ASOB 4PA4A 2XAGA 1E79G 1M56C 4BIZA 2H94A 4WF9V 2UXNA 4DXWA 3OEEG 1MSWD 3OR6C 1S3JA 4P2ZA 2XOKG 2IJIA 4TT3G 3ZMSA 4ZBMA 3CC7V 1FXKB 1AJQA 1JVMA 1FS0G 5IYBO 2K1EA 4JAVA 3CMAV 1VQPV 2EINB 4FK5C 4UVAA 3AG4B 3TETA 3CC2V 2DQ3A 2WAMA 3CCVV 3W7UA 3ZJZA 3CC4V 1S5HC 2EILB 4UUJC 2WLJA 3IFXA 2IU0A 1YTFD 4HYOA 2HG5C 2KB1A 3SYCA 4PDRA 2Z5UA 1CP9A 3E8BA 1NR1A 5CBHA 2Q68A 3CCUV 4CZZA 3ETDA 1JQ0A 1HWYA 2AHYA 2B1IA 4HAMA 1KC8W 2QE7G 2EIMC 1RPOA 2HVJC 3CCRV 5B1BC 5EC1C 3KG2A 2DWDC 2HR3A 3JD0A 4Q20A 1KECA 2BOBC 2ZR3A 3E2EA 1NBMG 1SZTA 3UM7A 4N21A 2OTJV 1BHAA 5LGNA 1L1FA 1E1RG 2YEVA 3HPLC 1OCOC 1K34A 4PA3A 5IY5B 4MVMA 1AI6A 4WFFA 2WLKA 2ZR2A 4QE7A 4UV9A 5LHGA 2OCCB 1K4DC 1Q81W 2IJKA 3CCEV 2W6IG 3T4DA 3OR7C 3B8NA 4JAUA 2X6AA 3JCZA 1MABG 3A0RA 1OCRC 3ABKC 5BZBA 3AG2C 3ABMB 4KFMA 5FL7G 5L3CA 1EBOA 3FKSG 4RO2A 1GKFA 4MVSA 1GO3F 4YXWG 3ZMTA 2JEXA 1OHHG 1N8RW 1P4RA 3D36A 4PA6A 5KUMA 2W6JG 1GM8A 3G71V 1GK9A 1RM1C 1GTOA 3PJSK 3ZRXA 2XAHA 1GMGA 2ZDIA 1VQ4V 5L3FA 1G8MA 5C93A 2B1GA 1W2BU 2R9RB 3K3WA 3F7VC 2JEUA 3E8FA 4LBEC 2DYRC 1EFRG 1ENVA 2WLMA 1KP3A 5H6QA 3LSQA 3BEHA 2IJJA 2R9IA 1XL6A 2Q67A 4JTDB 2X0LA 1PL0A 3K0DA 3CYOA 1DLBA 1THZA 1QBZA 3JYCA 4PA7A 1Y66A 1S77D 1RPRA 2P90A 3M99B 1PKXA 4ZKIA 4XDJA 2EIJC 3E8GA 2EIMB 4PELA 4Z1MG 2PI5A 1F51A 1JOYA 3WG7C 3BY6A 5IYCO 3HB3B 1AJNA 2JJ1G 2ZXWC 5B1BB 3ZMUA 4H37A 1JJ2U 1JCHA 4G27B 4U7OA 4FPPA 4RUEA 2DW4A 4GX0A 4X8AA 5GW7A 3LSSA 2MK3A 3ZRWB 1VQ7V 1M57C 1DF4A 3FB5C 3SPJA 1PD3A 1M1KW 1OCOB 3T1CA 2WLLB 5LHHA 1YJNV 1QVFU 1S72V 1YJ9V 4LCUC 3STZC 3GWOA 2WSSG 3ZRSA 2Y48A 3ZIAG 1Q86W 3TCUA 2XAQA 2P7TC 1K9MW 4MT8A 4L87A 2OTLV 1VQOV 2QM7A 1K33A 1FXHA 3EFFK 2M7WA 2WPDG 4H33A 4MW8A 1OCRB 2FTKA 5EBLC 2HKOA 3ABKB 3JD3A 4XDKA 4JASA 1OCZB 1YTFB 2W0FC 3MHHC 3AG2B 1G4YB 2EZPA 4RUFA 4WFEA 3ZN0A 3CPWU 4EKWA 5EC2C 2GHYA 2QA4V 3CCSV 2WLIA 4KUMA 1UJWB 5CBFA 1RM1B 1BL8A 1BMFG 3CCJV 1QLNA 2DYSC 1JPXA 1VQKV 3LNMB 3IGAC 3CMEV 1YHQV 4MTGA 3X2QC 3QO8A 5L3GA 1M9NA 1SETA 1R3LC 5L3DA 3SYQA 1W0KG 3E8HA 1I5XA 2P67A 2WLHA 4F4LA 2DYRB 2YSUB 3AEIA 3E35A 3OM3B 1KP2A 3JD2A 2XAFA 2ZQMA 3B8MA 2AHZA 4JTAB 1YITV 4PDMA 2JDIG 4X88A 1S0VA 4JPRA 5E1AC 4QIWF 4WCEV 4JGSA 2Y69C 4MS2A 3I56V 5EK0A 1H38A 3ETGA 2PI4A 3OUFA 1IXMA 2ZDIC 4BAYA 3I55V 4TWKA 3EHBB 1S76D 1H2GA 1OCZC 4E2LA 2ZD9A 2EIJB 4JYCA 4UVBA 3E83A 3WG7B 1VQ5V 2ZXWB 4XBFA 1NH2D 2F43G 1M90W 1QLEC 3ZMVA 3WFVA 2CK3G 1K3EA 4R8CA 4FMTA 1XL4A 2B5UA 3SPGA 3CD6V 1J95A 5EBWC 2IH1C 3ML0A 1M57B 2IJHA 4N23A 4GX1A 1YJWV 5KUKA 1FFTB 2NLJC 5HFLA 4LC1A 2ITCC 2QEXV 1CPYA 1V55C 4WFHA 5CA3A 2EIKC 4I5SA 4I9WA 1P7BA 5H9CA 1ORQC 1AR1B 2XAJA 3ETEA 2IH3C 1FXKA 1Q82W 3RVYA 3RW0A 4XDLA 2YEVB 3CCQV 1F4MA 1AROP 4FJCC 1AJPA 3SYPA 4UV8A 1NVPD 3QO5A 2X6BA 4QJFB 3DGEA 3F7YC 3CCLV 4U7NA 3OAAG 4MTXA 4WFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRV A;  4JAV A;  2WWW A;  4JAU A;  4LC1 A;  4ZKI A;  3A0R A;  4GT1 A;  4MT8 A;  1IXM A;  3ZRX A;  1JOY A;  1F51 A;  5B1N A;  3ZCC A;  4I5S A;  5C93 A;  4Q20 A;  2QM7 A;  3TK1 A;  4BIZ A;  4GCZ A;  3NXS A;  4JYC A;  2FTK A;  4U7O A;  4FPP A;  4QPK A;  3ZRW A;  4JAS A;  3MD0 A;  2P67 A;  2LFR A;  2QM8 A;  4JYB A;  4QPJ A;  3ZRW B;  4U7N A;  3D36 A;  2LFS A;  5IDJ A;  5B1O A;  4FMT A;  3DGE A;  3P32 A;  4KP4 A;  2C2A A;  4MTX A;  4BIU A; 
#chains in the Genus database with same CATH topology
 4AQY O;  2N74 A;  1VF7 A;  2Z3Y A;  3L9D A;  2VQF B;  1N36 O;  2D2C B;  3AK3 A;  4DR3 B;  1IXB A;  5CN0 A;  1D5N A;  1KMI Z;  3DXR B;  4H13 B;  1ZTE A;  2A9H A;  1PV0 A;  4MSW C;  2K9P A;  3WU2 Z;  4LH7 A;  2VQF O;  4GX2 A;  4JI8 B;  4J42 A;  1KU9 A;  4DR3 O;  4HNA A;  4KP4 A;  1ZL8 B;  3KCY A;  2OT5 A;  4FZ0 A;  3K79 A;  2GDS A;  2QTO A;  3OMA B;  5KAI Z;  2Z0A A;  4J9Y B;  3SJC C;  1R6T A;  4JI8 O;  4PDV A;  1WAZ A;  5B1A B;  4LR3 A;  3OW2 U;  1KD1 W;  5CA1 A;  1Z5W A;  5BMV B;  4WFA V;  4WFB V;  2P5O A;  2QKS A;  5EYP B;  1TVK A;  1AVM A;  1QLE B;  2ARH A;  5B66 Z;  4D7T A;  1QCE A;  2JJ2 G;  1IBL B;  1VF5 B;  5ITZ B;  5LXT B;  1X4T A;  2P4K A;  2ILM A;  2ZNJ A;  4NKG B;  1SKV A;  1HNX B;  3OGC C;  4R6Z A;  3JD1 A;  3R65 A;  1IBL O;  4X65 B;  5CA0 A;  1J5E B;  4EB6 A;  1F4N A;  4FLY A;  3JAK A;  1HNX O;  4JV5 B;  4MTO A;  1Y76 B;  3K08 A;  4X65 O;  2FB5 A;  1J5E O;  3K04 A;  1VEW A;  1K5Q A;  1SQQ H;  1DGS A;  1ZWI C;  2ZE7 A;  3BAB A;  3IJ4 A;  1BHB A;  3ICX A;  1NH2 B;  2JIZ G;  4JV5 O;  3LSU A;  3FYI B;  3SYO A;  4LF5 B;  4JTC B;  4DRX A;  1P7G A;  2H8P C;  5L3E A;  5IT9 N;  2JS5 A;  5KX5 A;  2Y4T A;  2BTQ B;  1PNL A;  3ZN1 A;  4DW1 A;  3CXH F;  3LDD A;  3UO2 A;  1PM9 A;  2JK5 C;  3RYF B;  1MG1 A;  3T2M A;  3CWB H;  4LF5 O;  3C3T A;  2BSK B;  3ZRW A;  1M56 B;  1H8H G;  2UXX A;  2WLL A;  2LGQ A;  4U3J A;  4O2B B;  1R73 A;  2YIB D;  2ATK C;  1R3J C;  1NVP B;  2Q4P A;  2QWO B;  4G28 B;  3CE2 A;  2F95 B;  3CCM V;  4E4E A;  2A3Q A;  4QPK A;  1DF5 A;  1SQB H;  1R6K A;  2LW7 A;  4GKJ B;  4RQF A;  4PA9 A;  4PDL A;  5JVD A;  4MVU A;  1I7F A;  4IYH A;  3JAS B;  4GKJ O;  1KBH A;  1N0J A;  4J10 A;  3E22 B;  4DXW A;  2IJI A;  2Q0A A;  2PZS A;  4OX9 B;  1FXK B;  1AJQ A;  5FNV A;  1WJZ A;  1IDS A;  1ZLZ A;  3CMA V;  4JAV A;  3RT3 C;  3CCV V;  3N2K B;  1FYJ A;  3WB2 A;  3IFX A;  1YTF D;  2ADP A;  4OX9 O;  4HYO A;  1XMQ B;  1TGO A;  3SR2 C;  4DUZ B;  1WN7 A;  4GZR B;  2QWR B;  5GTH Z;  5CBH A;  4K35 A;  3ETD A;  4GKK B;  1H2L A;  4K3A A;  2QE7 G;  2EIM C;  1XMQ O;  2KG7 B;  4F6E A;  5B1B C;  4DUZ O;  2HR3 A;  3JD0 A;  4Q20 A;  2VRZ A;  3UM7 A;  1SZT A;  2DJV A;  4GKK O;  1B06 A;  1L1F A;  1WPB A;  4PA3 A;  1K34 A;  5IY5 B;  1Q3E A;  2WLK A;  1RSO B;  3AK2 A;  1OV9 A;  3FFQ A;  1Q81 W;  2IJK A;  3CCE V;  3T4D A;  3HKB B;  4UB8 Z;  1D2D A;  3ABK C;  3DXR A;  1WA8 B;  4Z2W A;  5BZB A;  3AG2 C;  4PI2 A;  3ABM B;  5FL7 G;  3P3N A;  1GKF A;  4MVS A;  1GO3 F;  1FJG B;  4TQF A;  1ZUQ A;  1ZL8 A;  1OHH G;  3D36 A;  2W6J G;  2KQX A;  1EM1 A;  1SZX A;  5IJ0 B;  2XAH A;  1VQ4 V;  5L3F A;  1G8M A;  3GVM A;  1ZAU A;  2JEU A;  4LBE C;  5BMV A;  1EFR G;  4O4I B;  5EYP A;  4DV2 B;  5LL6 Y;  2IJJ A;  5D5Q A;  2QWN B;  2Q67 A;  1PL0 A;  1QBZ A;  1NZ6 A;  1WP7 A;  1US6 A;  5ITZ A;  5LXT A;  1PKX A;  1JOY A;  4DV2 O;  1FFX B;  1L8D A;  3CB2 A;  4X8A A;  4DV7 B;  5GW7 A;  4X1Y B;  1MA1 A;  1M57 C;  1DF4 A;  3SDL A;  2AXT Z;  1OCO B;  1EN4 A;  5CB4 A;  4LCU C;  1Y76 A;  2XT9 A;  3ZRS A;  3TCU A;  4DV7 O;  2XAQ A;  3JAR B;  4L87 A;  4JI5 B;  2VQE B;  1BGY H;  2WPD G;  3AK1 A;  2FTK A;  1YTF B;  4JAS A;  3F5T A;  4YJ2 B;  2FYU H;  3I5D A;  1ZSP A;  1WB8 A;  1SQV H;  2BTQ A;  4JI5 O;  2VQE O;  5EC2 C;  3RYF A;  4HNA B;  2BSK A;  1RM1 B;  1BL8 A;  5K1P A;  1VQK V;  3CME V;  3QO8 A;  1V9P A;  4PV1 B;  4UB6 Z;  1SET A;  4O2B A;  3B4S A;  2P67 A;  4F4L A;  3K5M A;  4JYA B;  3D36 C;  3JD2 A;  2ZQM A;  3DC6 A;  3B8M A;  4I55 B;  2CTW A;  3TXQ A;  1S0V A;  4WCE V;  3I56 V;  1H38 A;  2PI4 A;  1Q43 A;  2JGU A;  4I7Z B;  3VQV A;  3A0H Z;  4BAY A;  3J81 N;  4AIL C;  3OT7 A;  4JYA O;  1IX9 A;  4RWU A;  2ZD9 A;  2F93 B;  2EIJ B;  4JYC A;  3ZS8 C;  4UVB A;  3E83 A;  2ZXW B;  2Q7H A;  1QLE C;  3CEI A;  3WFV A;  1XL4 A;  3JAS A;  3OTO B;  5KUK A;  4LC1 A;  1H2N A;  2ITC C;  1CPY A;  4EB6 B;  4WFH A;  3E22 A;  1ORQ C;  3BFR A;  1FXK A;  3OTO O;  1Y67 A;  1X59 A;  4DR6 B;  4JI3 B;  4QJF B;  3DGE A;  2YI9 A;  4WFG A;  3N2K A;  1GN4 A;  2L35 A;  1VQ9 V;  4UCS A;  1OZ0 A;  4DR6 O;  4JI3 O;  3EXA A;  1VQN V;  3BA8 A;  1K73 W;  1SQP H;  2QKA A;  1QR8 A;  1Q90 D;  4ZI7 B;  1MNG A;  5DEC A;  2KG7 A;  3IC7 A;  3E89 A;  5LMN B;  4BW5 A;  3OUS A;  2BOC C;  1VIB A;  1M4U A;  2Y69 B;  2A0L A;  1URF A;  1RSO A;  1GN6 A;  5LMN O;  4JYB A;  3JSL A;  2AGA A;  2EZO A;  1GM9 A;  1PNM A;  4TSF G;  2Q6A A;  3B77 A;  4DR1 B;  4UCO A;  4IIJ B;  3HKB A;  2VWK A;  2AZ2 A;  4ICG A;  3G67 A;  4P30 A;  5LGU A;  1WA8 A;  4CS3 A;  3EVK A;  5AG2 A;  4DR7 B;  3OE7 G;  1MOF A;  1BE3 H;  2E75 B;  5LHI A;  2A79 B;  1V55 B;  1XRE A;  4DR1 O;  4UVC A;  5DED A;  1VQ8 V;  2P4V A;  2YIB A;  1WPX A;  1FD9 A;  3VQW A;  4DR7 O;  3N27 A;  3SPH A;  2UUC B;  1P84 F;  3ABT A;  1K8A W;  5IJ0 A;  5KA5 A;  3H1J H;  4QE9 A;  4FFK A;  1IVS A;  3ZCC A;  4O4I A;  1IUR A;  4GCZ A;  1JMK C;  3NXS A;  2UUC O;  1FXK C;  1V54 B;  4P9P A;  3UKM A;  4QPJ A;  3M8A A;  2D3O W;  1ROP A;  2OIG A;  2CTP A;  1AI5 A;  4HZ3 A;  1H2M A;  1HR0 B;  2QWP B;  1K5S A;  5J9P C;  1CXZ B;  3GB7 C;  4JF3 A;  3LDC A;  1WNS A;  2JVD A;  1KKD A;  1TUE B;  4JZG A;  4X1Y A;  3K57 A;  2E74 B;  1YXB A;  4H0L B;  1K7D A;  1OCC B;  1B3Q A;  4PJ0 Z;  2HHH B;  1HR0 O;  1G6U A;  1K97 A;  5LGT A;  1EZJ A;  2JRI A;  4B3M B;  4UCT A;  1AR4 A;  3JAR A;  4CH4 A;  3FB6 C;  2RCV A;  1SER A;  1GM7 A;  3TJT A;  1COW G;  4FLW A;  2HHH O;  1XOU A;  3H9V A;  3OMI B;  4YJ2 A;  5IY5 C;  3QO7 A;  3R66 A;  3NR7 A;  3RVZ A;  1FXV A;  2HVK C;  1I5Y A;  5GTI Z;  4B3M O;  4JI6 O;  3AG1 C;  3LNN A;  4O2A B;  4I9Q A;  2HLD G;  3LUT B;  1KQS U;  2B9Z A;  4PD4 F;  1T5E A;  3G6B A;  3OGI B;  3K06 A;  3ABM C;  4Q6G A;  3ASO B;  4TV9 B;  2QJ1 A;  2XAG A;  2NR5 A;  2UU9 B;  2H94 A;  4WF9 V;  2UXN A;  2IBZ H;  4YY3 B;  1D5A A;  3OR6 C;  1S3J A;  4P2Z A;  2RN9 A;  4AI8 A;  2CH7 B;  4I55 A;  4ZBM A;  1AB3 A;  4NR1 A;  2UU9 O;  2YID A;  2K1E A;  4NTY A;  4B7E A;  4LFB B;  4UVA A;  3AG4 B;  3D8C A;  5C8Y B;  2DQ3 A;  4IT5 A;  4YY3 O;  2HJD A;  4FLV A;  1S5H C;  4O4H B;  4K8X A;  2HEP A;  3O65 A;  2HG5 C;  2KB1 A;  3G80 A;  1H2K A;  4LF9 B;  3RFR A;  4X64 B;  3ZBH A;  4LFB O;  2Q68 A;  4GUN A;  1Q8I A;  1HWY A;  4FLX A;  2AHY A;  5A2Q N;  1KC8 W;  4LWS B;  4LF9 O;  3CCR V;  4YIO A;  4DV1 B;  5CB4 B;  4X64 O;  2R9A A;  2ZR3 A;  1EN5 A;  1BHA A;  3S3W A;  4TUY A;  1E1R G;  1OCO C;  2DE0 X;  5E79 Z;  1SS3 A;  4J7J A;  2ZR2 A;  3ZED A;  4DV1 O;  2Y4U A;  4QE7 A;  1KYO F;  2X6A A;  3VQY A;  1MAB G;  5JQG B;  4RO2 A;  4ZI7 A;  1PL4 A;  2RMK B;  3A2F A;  5KUM A;  3G71 V;  1GM8 A;  2PYL A;  2VS0 A;  5B5E Z;  1RM1 C;  5A9G A;  1GH6 A;  3PJS K;  2R70 A;  3ZRX A;  3BRC A;  1AR5 A;  3K3W A;  3F7V C;  3H1L H;  2WLM A;  5H6Q A;  4DK0 A;  4IIJ A;  3BEH A;  4B3T B;  3QG5 A;  4JZ2 A;  4JTD B;  2X0L A;  2YI8 A;  4X9Q A;  4DV0 B;  3K0D A;  4PA7 A;  2Y0I A;  2G38 A;  1LR1 A;  4XDJ A;  2EIJ C;  3H1I H;  2PI5 A;  2CGN A;  5IYC O;  4B3T O;  3HB3 B;  2JJ1 G;  2ZXW C;  2FL4 A;  4DV0 O;  2DW4 A;  4GX0 A;  2UXB B;  2ZIM A;  1I94 B;  3BCC H;  5EZY B;  1YJN V;  1S72 V;  2ZKO A;  3STZ C;  4FM0 A;  2WSS G;  3L74 H;  2Y48 A;  3ZIA G;  2YXY A;  2UXB O;  2QWQ B;  1YVW A;  2AZ0 A;  2ZIN A;  1I94 O;  4MW8 A;  5KA6 A;  5EBL C;  3JD3 A;  1OCZ B;  3MHH C;  3UO3 A;  1G4Y B;  4AHC A;  2EZP A;  4RUF A;  4WFE A;  1B04 A;  1HNZ B;  2Q0O C;  3ZN0 A;  1JFF B;  4O4J B;  4EKW A;  4FLZ A;  1FAF A;  2QA4 V;  4NTX A;  1S5L Z;  2F4V B;  4X1I B;  3WB1 A;  4KUM A;  1BMF G;  1QLN A;  4MTG A;  1M9N A;  1HNZ O;  5L3D A;  1W0K G;  3E8H A;  3JAL B;  2LGW A;  3E35 A;  2F4V O;  4I0X B;  2P06 A;  1AP6 A;  5FPR A;  2XAF A;  2JDI G;  4FFB B;  5E1A C;  4QIW F;  3FAV B;  3J80 N;  2Y69 C;  3K5N A;  4K0K B;  2OIE A;  1IXM A;  3I55 V;  1S76 D;  3CRM A;  2ETN A;  4E2L A;  4O2A A;  2HP8 A;  5IE9 A;  1VQ5 V;  4LH6 A;  2N05 A;  3AG7 A;  3L70 H;  1M90 W;  4K0K O;  2DOS A;  2LO1 A;  1HW7 A;  1K3E A;  1KB9 F;  4LFA B;  1QHT A;  1J95 A;  1SA0 B;  2IJH A;  4GX1 A;  4TV9 A;  4A5U B;  5KLV H;  2QEX V;  1V55 C;  1YDX A;  1W59 A;  4I5S A;  1FJG O;  1P7B A;  3MDS A;  2CH7 A;  3FD9 A;  3L71 H;  4F6R B;  4KHP B;  4LFA O;  3WB0 A;  3RW0 A;  4B3S B;  1F4M A;  1AIL A;  5EIB D;  4JI0 B;  4LNU B;  2GTA A;  3F7Y C;  5C8Y A;  1UPG A;  4GLX A;  2V7Q G;  1N34 B;  4UCV A;  4FVM A;  4O4H A;  2UUA B;  3ZHU A;  3T4Z A;  4KHP O;  1N32 B;  4W4K A;  3K58 A;  4DUY B;  1BT8 A;  1R6N A;  4J80 A;  3VOU A;  3CS5 A;  4B3S O;  1V54 C;  3JAW B;  3C3S A;  4JI0 O;  2JGD B;  1AP5 A;  4C7U A;  3UT5 A;  4RAI A;  2ZE6 A;  4IYI A;  2WA4 A;  2DYS B;  1N34 O;  4I4T B;  2UUA O;  3VBB A;  1N32 O;  4TV8 B;  2YDE A;  1KUQ A;  4LWS A;  3OTF A;  3ABU A;  2YC0 A;  4DUY O;  2XAS A;  5B1O A;  3P32 A;  4MVZ A;  2V4D A;  3S3X A;  1NU1 H;  4ASU G;  1EZV H;  3RGB A;  2Q73 A;  2X6C A;  3QNE A;  1OCC C;  1AI4 A;  5HFM A;  3MD0 A;  5JJN B;  1NTM H;  3U11 A;  3U0Z A;  1K92 A;  1QNM A;  2O57 A;  3F5W C;  3QTC A;  4CH5 A;  3H01 A;  5KMG B;  2KSD A;  1YI2 V;  1G1X B;  1KKC A;  3ZRV A;  5IYZ B;  5LA6 B;  4MTF A;  3DSQ A;  4X89 A;  2XUM A;  5JQG A;  5KHI A;  3D3I A;  5L3B A;  4KXR A;  4UCR A;  3O9O A;  1N0N A;  2A06 H;  1BQZ A;  2EIK B;  4MW3 A;  3MHS C;  5IYD O;  3HKC B;  1QVG U;  1NJI W;  1EN6 A;  3KZI Z;  1JX9 A;  1DTO A;  2YIC A;  2C2A A;  3ASO C;  2A7W A;  2YUA A;  3SJQ C;  3K03 A;  3AG3 B;  4R7C A;  5B1A C;  4J7Z A;  3RYH B;  3W7S A;  3JD4 A;  1VQM V;  2LFR A;  5FPO A;  1Q7Y W;  2LFS A;  4CC5 A;  5B3S B;  3STL C;  3AG4 C;  3E86 A;  4BIO A;  4P9O A;  2HFE C;  1DK1 A;  3LDE A;  2DWE C;  1SF9 A;  4TOI A;  2PF4 E;  2ZCE A;  1XEQ A;  3CRA A;  2WLI B;  3ASN B;  1W0J G;  5EZY A;  3JSN A;  4TUY B;  1NR7 A;  3SPI A;  3PN1 A;  5BY1 A;  1E1Q G;  4OXS A;  2EJR A;  3FYE B;  1HDJ A;  1HP8 A;  5LBQ A;  4NYK A;  5K1X A;  3OEH G;  2Q7E A;  4NXM B;  2Y0P A;  1SQF A;  1VF6 A;  3G6E V;  3P30 A;  1H8E G;  4GX5 A;  3HKD B;  2F66 C;  5J2U B;  1JFF A;  4O4J A;  2M6Y A;  3SPC A;  3RWR D;  1Z5V A;  1BZK A;  4NXM O;  4FM2 A;  2OCH A;  4X1I A;  1XNR B;  1NKD A;  4R50 A;  3ABL B;  4UXN A;  2LP7 A;  3ZHS A;  5BR8 B;  3DC5 A;  2VWJ A;  1ZX3 A;  1JA8 A;  1M56 C;  4DR2 B;  4BIZ A;  3JAL A;  2RNB A;  4I0X A;  3OEE G;  4NXN B;  1MSW D;  1XNR O;  3ZMS A;  4TT3 G;  2XOK G;  3J7A U;  2BTO A;  4FFB A;  5BR8 O;  3CC7 V;  1JVM A;  3FAV A;  2ZT9 B;  1FS0 G;  2PYJ A;  4DR2 O;  5IYB O;  1VQP V;  2EIN B;  3TET A;  2CGO A;  3CC2 V;  4NXN O;  3W7U A;  2EIL B;  3JAT B;  4DV6 B;  2F1M A;  4CS4 A;  1MSD A;  4Z1V A;  2Z5U A;  2DMX A;  4YJ3 B;  3CCU V;  1SA0 A;  4JYY A;  2B1I A;  4DV6 O;  2YXL A;  4OPH A;  1BQ0 A;  2DWD C;  4F6R A;  1KEC A;  1NBM G;  4N21 A;  2OTJ V;  1XUQ A;  2AW9 A;  3T1Y B;  4YHH B;  1H2S B;  3HPL C;  4LNU A;  3ZHT A;  1AI6 A;  4WFF A;  5JCO A;  4UV9 A;  5LHG A;  3IAY A;  2OCC B;  1YZB A;  2E5L B;  4FLU A;  3K5O A;  3OR7 C;  5KHJ A;  3B8N A;  5LYJ B;  4YHH O;  3T1Y O;  3JCZ A;  4LF8 B;  3A0R A;  2H3O A;  3JAW A;  2JGD A;  1NT2 B;  4I4T A;  1VF6 C;  1GN3 A;  2E5L O;  3FKS G;  1PPJ H;  3CHX A;  4TV8 A;  4ZIB A;  1HNW B;  3ZMT A;  4DYL A;  2JEX A;  1P4R A;  2RQ6 A;  4LF8 O;  5GON B;  3CRC A;  1GTO A;  2GTS A;  5D5P A;  2ZDI A;  1GMG A;  5JH7 B;  1HNW O;  1W2B U;  4JAA A;  1SQG A;  1XMO B;  3E8F A;  1FPO A;  1KP3 A;  4HBN A;  4DR5 B;  3LSQ A;  1U96 A;  1XDC A;  5KMG A;  2R9I A;  1XL6 A;  2FML A;  4PI0 A;  3M7M X;  1MMM A;  5IYZ A;  5LA6 A;  3ZX6 A;  3CYO A;  2L6L A;  1THZ A;  3BHP A;  3CRR A;  3JYC A;  1XMO O;  1Q6U A;  2N04 A;  2GUZ B;  3M99 B;  4DR5 O;  4ZKI A;  4U3F H;  5KHH A;  3E8G A;  4JI7 B;  4Z1M G;  4X62 B;  2QDO A;  1BS3 A;  3ZMU A;  3HR0 A;  4H37 A;  3UCS C;  3TGU H;  4G27 B;  3HKC A;  4U7O A;  3RYC B;  2MK3 A;  1XQ8 A;  2W0X A;  1VQ7 V;  3FB5 C;  3SPJ A;  1PD3 A;  4JI7 O;  4X62 O;  5TIS Z;  1QVF U;  3T1H B;  3BAA A;  3GWO A;  2YS8 A;  4O4L B;  3RYH A;  2P7T C;  1VQO V;  2QR4 A;  5FLX N;  1K33 A;  1FXH A;  5LP6 B;  2M7W A;  1OCR B;  3TXS A;  2HKO A;  4XDK A;  3L75 H;  3HKE B;  1GAX A;  3QF7 A;  3T1H O;  2ZE8 A;  3UT5 B;  5JCO C;  5IWA B;  4I50 B;  3CPW U;  2ZM6 B;  1GN2 A;  3L72 H;  4QGP A;  1XI1 A;  1QU7 A;  3CCS V;  2CDY A;  2WLI A;  5CBF A;  5LOV B;  2DYS C;  1JPX A;  3LNM B;  1YHQ V;  1XHX A;  5IWA O;  1YF2 A;  1O9G A;  5L3G A;  4NTW A;  1R3L C;  2ZM6 O;  2Q9L A;  1I5X A;  1YEW A;  2WLH A;  2DYR B;  2YSU B;  3AEI A;  2LQT A;  3ZHR A;  5JJE B;  1KP2 A;  1NS1 A;  2AHZ A;  2Q8V A;  4JTA B;  1YIT V;  4PDM A;  4JPR A;  1RFY A;  4JGS A;  4X66 B;  2ODM A;  3OUF A;  2ZDI C;  1WB7 A;  4TWK A;  3EHB B;  4X20 A;  1H2G A;  5JJJ B;  1RP3 B;  1XIL A;  3HKD A;  3WG7 B;  5J2U A;  3K9S A;  2GV9 A;  4XBF A;  4X66 O;  2F43 G;  3K5L A;  4IGG A;  4R8C A;  4DV4 B;  3SPG A;  1GRJ A;  4N23 A;  3FX7 A;  3THO A;  1TA8 A;  5HFL A;  2NLJ C;  4PHZ A;  1YCI A;  5CA3 A;  2EIK C;  1LUW A;  4DK1 A;  3C90 A;  1BCC H;  2ZE5 A;  2XAJ A;  2OYQ A;  4DV4 O;  1FKA O;  2IH3 C;  4D6T H;  1Q82 W;  3RVY A;  2YEV B;  3CCQ V;  1ARO P;  4FJC C;  1Y74 B;  3SYP A;  4UV8 A;  3QO5 A;  2X6B A;  4EFB A;  3OAA G;  2ZNI A;  2DN9 A;  2FKX A;  3AG3 C;  3JAT A;  3SGI A;  1I0H A;  4GT1 A;  3RYI B;  2QKC A;  1K4C C;  4YJ3 A;  2V1D A;  2BE3 A;  2GSM B;  1F7Y A;  2CE4 A;  5B3S C;  1JR9 A;  3X2Q B;  1F23 A;  5BXZ A;  4CS2 A;  2E3C A;  5IDJ A;  1A32 A;  2IU3 A;  1R1B A;  2NN4 A;  5J2T A;  4FIP C;  3K9A A;  3JAM N;  3BPZ A;  2HJF C;  4DW0 A;  3ASN C;  4H44 B;  2X7R B;  1SRY A;  4RQE A;  3DTU B;  5CBG A;  2QM8 A;  5EIB C;  4QNH B;  1AI7 A;  5IJ9 B;  4MVO A;  2QSA A;  2DQ0 A;  5LYJ A;  4J9Z B;  3IC9 A;  4BIU A;  1N4C A;  2ZIO A;  3OFN G;  3RBZ A;  2XND G;  2EX3 A;  1M5I A;  5GON A;  2PUS A;  1Y4M A;  2LW1 A;  3ABL C;  1UFI A;  1CEZ A;  3FB8 C;  3OMN B;  4WBN B;  1QR9 A;  3CXC U;  5JH7 A;  1MZE A;  1LNQ A;  1L0L H;  5DN6 G;  3TK1 A;  3QVN A;  5LMU B;  2Q69 A;  5H6R A;  4DR4 B;  3H1H H;  4X1K B;  4YIP A;  1R3K C;  4EFE A;  2P6J A;  4CBC A;  4FLT A;  1R3I C;  3AG1 B;  2EIN C;  3G4S V;  3Q4H B;  1VQ6 V;  2GUZ A;  1QQC A;  2EIL C;  1PP9 H;  2GBO A;  4JI1 B;  5LMU O;  3KKY A;  2Q5Z A;  1WLE A;  4DR4 O;  1YIJ V;  3CSX A;  5B1N A;  4BW9 A;  2ITD C;  3SYA A;  3RYC A;  3W7T A;  1NQT A;  5CMU A;  5DM6 V;  3N2G B;  2WLN A;  1NI8 A;  4EEQ A;  3B40 A;  4JI1 O;  1TUB B;  3K59 A;  2LJ2 A;  1NTK H;  2EBO A;  4O4L A;  2IW5 A;  1SES A;  5H2F Z;  4ZOL B;  2NNU A;  3ZMZ A;  2UXC B;  4LP8 A;  3W7W A;  4MVR A;  5LP6 A;  4OPA A;  4G2K A;  4IHJ B;  1VAR A;  3CJH B;  3U10 A;  2CTQ A;  3HKE A;  4J11 A;  4DO2 A;  2EUL A;  1PNK A;  3K0G A;  1VMG A;  4BWA A;  2OCC C;  3W7X A;  4GYC B;  2PY5 A;  2UXC O;  4I50 A;  3FB7 C;  1IBK B;  4MVQ A;  1P49 A;  2UXD B;  2E76 B;  3CP1 A;  5EBM C;  5LOV A;  2WWW A;  1B6Q A;  1YSC A;  4L8J A;  3P3P A;  4PA4 A;  1BSM A;  1E79 G;  1IBK O;  3JCU Z;  2UXD O;  1Q6H A;  4D7S A;  2IM9 A;  4JI2 B;  4UCU A;  4OGQ B;  4ZHQ B;  4KL1 A;  3OD4 A;  4JI4 B;  4FK5 C;  3APO A;  2KKW A;  2WAM A;  3ZJZ A;  3CC4 V;  4JI2 O;  4UUJ C;  3BA9 A;  2WLJ A;  2IU0 A;  3ZHQ A;  3SYC A;  3BVO A;  3A8T A;  4PDR A;  4JI4 O;  1CP9 A;  3E8B A;  1MZF A;  1NR1 A;  4CZZ A;  1JQ0 A;  4HAM A;  4NVP A;  2P22 C;  1N33 B;  1Q5O A;  1RPO A;  2HVJ C;  4TQD A;  4J41 A;  5EC1 C;  3KG2 A;  2WA3 A;  2CTR A;  3E2E A;  2BOB C;  4W4L A;  5LGN A;  1LUV A;  4B3R B;  2YEV A;  2R72 A;  1Y74 A;  2Q7G A;  1N33 O;  1IZ3 A;  4MVM A;  4LF7 B;  1Z2G A;  5CA1 B;  1K4D C;  2JS3 A;  2W6I G;  3A0B Z;  1TVK B;  4JAU A;  3RN4 A;  3CX5 F;  5LP6 C;  4B3R O;  3D3Q A;  3RYI A;  2QM4 A;  3B09 A;  4J7K A;  1OCR C;  2PTM A;  4LF7 O;  4KFM A;  5L3C A;  1EBO A;  4YXW G;  4BR6 A;  2UUB B;  4DV3 B;  1N8R W;  4PA6 A;  4CH6 A;  1GK9 A;  4LFC B;  5CA0 B;  3H1K H;  3JAK B;  5C93 A;  2B1G A;  2UUB O;  2QGN A;  4DV3 O;  2CAZ C;  1Y6X A;  2R9R B;  4B7K A;  2DYR C;  1ENV A;  3MAQ A;  1JJO A;  5IJ9 A;  4X20 B;  1M93 A;  4LFC O;  4CH3 A;  3SJA C;  1S5J A;  2XTA A;  1SQX H;  2OWO A;  1DLB A;  3L73 H;  4UFZ A;  1Y66 A;  1S77 D;  1RPR A;  4DRX B;  2P90 A;  5H5N A;  3ETQ A;  4PEL A;  2EIM B;  1F51 A;  1XNQ B;  3WG7 C;  3BY6 A;  5KX5 B;  5B1B B;  1AJN A;  1JJ2 U;  1JCH A;  4FPP A;  3GWK C;  4RUE A;  3UQ8 A;  3LSS A;  4WBN A;  3ZRW B;  4LF6 B;  2YXH A;  1M1K W;  3T1C A;  2WLL B;  1XNQ O;  5LHH A;  4U3J B;  1YJ9 V;  5KHK A;  2BCC H;  1Q86 W;  1K9M W;  4MT8 A;  2OTL V;  4LF6 O;  2QM7 A;  4X1K A;  2CUG A;  3EFF K;  4H33 A;  1VQL V;  3ABK B;  2W0F C;  1NTZ H;  3AG2 B;  1XHZ A;  3Q4H A;  1SC5 B;  2RJZ A;  2ADQ B;  2F23 A;  4B08 A;  5JWP A;  2QTS A;  2GHY A;  5JVD B;  5J2T B;  1UJW B;  4LF4 B;  3CCJ V;  1VP7 A;  2EJ7 A;  3IGA C;  4ABM A;  3N2G A;  4IL6 Z;  3X2Q C;  3ZHV A;  4FZ1 A;  1L0N H;  1TUB A;  3SYQ A;  4DV5 B;  2XHB A;  3OM3 B;  4ZOL A;  2PGG A;  4LF4 O;  4X88 A;  3CRQ A;  4CC6 A;  3B2E E;  1I08 A;  1TAE A;  4IHJ A;  5FNV B;  3CJH A;  4K8Z A;  4DV5 O;  4MS2 A;  5EK0 A;  3ETG A;  1OCZ C;  5KAF Z;  4NB5 A;  5F2V O;  1XBL A;  3KCX A;  1O9H A;  2YIA A;  5KHG A;  1NH2 D;  3VQX A;  3APQ A;  3SJB C;  1U97 A;  3ZMV A;  1IBM B;  2CK3 G;  1OJH A;  4FMT A;  2B5U A;  3CD6 V;  5EBW C;  2IH1 C;  1WP8 A;  1M57 B;  3ML0 A;  1YJW V;  2MW2 B;  1FFT B;  1FFX A;  4I9W A;  4FM1 A;  1Q6I A;  5H9C A;  4AQY B;  1AR1 B;  1IBM O;  3ETE A;  1N36 B;  4ZHQ A;  4XDL A;  1AJP A;  1NVP D;  4JI6 B;  3CCL V;  2RDC A;  4U7N A;  4MTX A; 
#chains in the Genus database with same CATH homology
 2V7Q G;  3AG3 C;  3T4Z A;  1VQL V;  2Z3Y A;  4GT1 A;  1VQ9 V;  1R6N A;  1OZ0 A;  3VOU A;  1K4C C;  1V54 C;  5CN0 A;  1VQN V;  2V1D A;  4RAI A;  2DYS B;  2GSM B;  1K73 W;  2A9H A;  5B3S C;  4MSW C;  3X2Q B;  3VBB A;  1F23 A;  1QR8 A;  4GX2 A;  3ABU A;  5IDJ A;  2XAS A;  5B1O A;  3IC7 A;  3P32 A;  4KP4 A;  2IU3 A;  3E89 A;  4MVZ A;  4FIP C;  2OT5 A;  3K9A A;  4ASU G;  3K79 A;  5KA6 A;  2QTO A;  2HJF C;  3OUS A;  4BW5 A;  3OMA B;  2BOC C;  3ASN C;  4J9Y B;  2Y69 B;  2X7R B;  2X6C A;  1SRY A;  3QNE A;  1OCC C;  4PDV A;  2A0L A;  4RQE A;  1AI4 A;  5HFM A;  5B1A B;  3DTU B;  3MD0 A;  3OW2 U;  1KD1 W;  5CBG A;  1K92 A;  2QM8 A;  4JYB A;  4QNH B;  4WFA V;  4WFB V;  2EZO A;  1AI7 A;  1GM9 A;  1PNM A;  3F5W C;  4TSF G;  4MVO A;  2Q6A A;  2QKS A;  3B77 A;  3H01 A;  2DQ0 A;  1YI2 V;  4J9Z B;  4BIU A;  3ZRV A;  1QLE B;  4P30 A;  3OFN G;  5LGU A;  4MTF A;  1QCE A;  2JJ2 G;  4X89 A;  3OE7 G;  3RBZ A;  1MOF A;  2XND G;  3D3I A;  5L3B A;  5LHI A;  2A79 B;  1V55 B;  2EIK B;  4UVC A;  3OGC C;  4R6Z A;  3JD1 A;  3MHS C;  4MW3 A;  1VQ8 V;  5IYD O;  3R65 A;  1QVG U;  1NJI W;  1WPX A;  1JX9 A;  1Y4M A;  3ABL C;  1DTO A;  1CEZ A;  3FB8 C;  3OMN B;  3SPH A;  3ABT A;  1F4N A;  1K8A W;  1QR9 A;  2C2A A;  3CXC U;  3ASO C;  5KA5 A;  4QE9 A;  1LNQ A;  4MTO A;  3SJQ C;  3K03 A;  3AG3 B;  3ZCC A;  4R7C A;  5B1A C;  3K08 A;  5DN6 G;  3TK1 A;  4GCZ A;  3NXS A;  3W7S A;  3K04 A;  3JD4 A;  1VQM V;  1FXK C;  2Q69 A;  5H6R A;  1R3K C;  1K5Q A;  1V54 B;  1ZWI C;  2LFR A;  4P9P A;  3UKM A;  1BHB A;  1Q7Y W;  4QPJ A;  2P6J A;  1NH2 B;  4CBC A;  2JIZ G;  2D3O W;  1R3I C;  3AG1 B;  2EIN C;  2LFS A;  3FYI B;  3SYO A;  5B3S B;  3G4S V;  4JTC B;  3STL C;  1VQ6 V;  3AG4 C;  3E86 A;  2H8P C;  2EIL C;  5L3E A;  1ROP A;  1AI5 A;  4HZ3 A;  4P9O A;  2HFE C;  1WLE A;  1K5S A;  1PNL A;  3LDE A;  3ZN1 A;  5J9P C;  2DWE C;  1YIJ V;  3GB7 C;  3LDD A;  4JF3 A;  5B1N A;  3LDC A;  1KKD A;  1TUE B;  2JK5 C;  2ITD C;  3SYA A;  1MG1 A;  2WLI B;  3T2M A;  3W7T A;  1NQT A;  3ASN B;  5CMU A;  3ZRW A;  1M56 B;  1H8H G;  1W0J G;  1K7D A;  5DM6 V;  1OCC B;  2UXX A;  2WLN A;  2WLL A;  1NR7 A;  1K97 A;  5LGT A;  1EZJ A;  1R73 A;  3SPI A;  2ATK C;  1E1Q G;  1R3J C;  2EBO A;  4OXS A;  2IW5 A;  1SES A;  2EJR A;  1NVP B;  3FYE B;  3ZMZ A;  2NNU A;  3FB6 C;  4LP8 A;  3W7W A;  1SER A;  4MVR A;  4G2K A;  1GM7 A;  4G28 B;  1COW G;  5LBQ A;  3OEH G;  3OMI B;  5IY5 C;  3QO7 A;  3RVZ A;  4DO2 A;  3CCM V;  1FXV A;  1PNK A;  2HVK C;  1I5Y A;  4QPK A;  1DF5 A;  3K0G A;  3G6E V;  1R6K A;  3P30 A;  3AG1 C;  2OCC C;  3W7X A;  1H8E G;  4GX5 A;  3FB7 C;  2HLD G;  4RQF A;  4MVQ A;  4PA9 A;  3LUT B;  4PDL A;  3SPC A;  1KQS U;  4MVU A;  1NKD A;  4R50 A;  3ABL B;  3CP1 A;  5EBM C;  2WWW A;  4UXN A;  1B6Q A;  2LP7 A;  1YSC A;  3K06 A;  3ABM C;  3ASO B;  4PA4 A;  2XAG A;  1E79 G;  1M56 C;  4BIZ A;  2H94 A;  4WF9 V;  2UXN A;  4DXW A;  3OEE G;  1MSW D;  3OR6 C;  1S3J A;  4P2Z A;  2XOK G;  2IJI A;  4TT3 G;  3ZMS A;  4ZBM A;  3CC7 V;  1FXK B;  1AJQ A;  1JVM A;  1FS0 G;  5IYB O;  2K1E A;  4JAV A;  3CMA V;  1VQP V;  2EIN B;  4FK5 C;  4UVA A;  3AG4 B;  3TET A;  3CC2 V;  2DQ3 A;  2WAM A;  3CCV V;  3W7U A;  3ZJZ A;  3CC4 V;  1S5H C;  2EIL B;  4UUJ C;  2WLJ A;  3IFX A;  2IU0 A;  1YTF D;  4HYO A;  2HG5 C;  2KB1 A;  3SYC A;  4PDR A;  2Z5U A;  1CP9 A;  3E8B A;  1NR1 A;  5CBH A;  2Q68 A;  3CCU V;  4CZZ A;  3ETD A;  1JQ0 A;  1HWY A;  2AHY A;  2B1I A;  4HAM A;  1KC8 W;  2QE7 G;  2EIM C;  1RPO A;  2HVJ C;  3CCR V;  5B1B C;  5EC1 C;  3KG2 A;  2DWD C;  2HR3 A;  3JD0 A;  4Q20 A;  1KEC A;  2BOB C;  2ZR3 A;  3E2E A;  1NBM G;  1SZT A;  3UM7 A;  4N21 A;  2OTJ V;  1BHA A;  5LGN A;  1L1F A;  1E1R G;  2YEV A;  3HPL C;  1OCO C;  1K34 A;  4PA3 A;  5IY5 B;  4MVM A;  1AI6 A;  4WFF A;  2WLK A;  2ZR2 A;  4QE7 A;  4UV9 A;  5LHG A;  2OCC B;  1K4D C;  1Q81 W;  2IJK A;  3CCE V;  2W6I G;  3T4D A;  3OR7 C;  3B8N A;  4JAU A;  2X6A A;  3JCZ A;  1MAB G;  3A0R A;  1OCR C;  3ABK C;  5BZB A;  3AG2 C;  3ABM B;  4KFM A;  5FL7 G;  5L3C A;  1EBO A;  3FKS G;  4RO2 A;  1GKF A;  4MVS A;  1GO3 F;  4YXW G;  3ZMT A;  2JEX A;  1OHH G;  1N8R W;  1P4R A;  3D36 A;  4PA6 A;  5KUM A;  2W6J G;  1GM8 A;  3G71 V;  1GK9 A;  1RM1 C;  1GTO A;  3PJS K;  3ZRX A;  2XAH A;  1GMG A;  2ZDI A;  1VQ4 V;  5L3F A;  1G8M A;  5C93 A;  2B1G A;  1W2B U;  2R9R B;  3K3W A;  3F7V C;  2JEU A;  3E8F A;  4LBE C;  2DYR C;  1EFR G;  1ENV A;  2WLM A;  1KP3 A;  5H6Q A;  3LSQ A;  3BEH A;  2IJJ A;  2R9I A;  1XL6 A;  2Q67 A;  4JTD B;  2X0L A;  1PL0 A;  3K0D A;  3CYO A;  1DLB A;  1THZ A;  1QBZ A;  3JYC A;  4PA7 A;  1Y66 A;  1S77 D;  1RPR A;  2P90 A;  3M99 B;  1PKX A;  4ZKI A;  4XDJ A;  2EIJ C;  3E8G A;  2EIM B;  4PEL A;  4Z1M G;  2PI5 A;  1F51 A;  1JOY A;  3WG7 C;  3BY6 A;  5IYC O;  3HB3 B;  1AJN A;  2JJ1 G;  2ZXW C;  5B1B B;  3ZMU A;  4H37 A;  1JJ2 U;  1JCH A;  4G27 B;  4U7O A;  4FPP A;  4RUE A;  2DW4 A;  4GX0 A;  4X8A A;  5GW7 A;  3LSS A;  2MK3 A;  3ZRW B;  1VQ7 V;  1M57 C;  1DF4 A;  3FB5 C;  3SPJ A;  1PD3 A;  1M1K W;  1OCO B;  3T1C A;  2WLL B;  5LHH A;  1YJN V;  1QVF U;  1S72 V;  1YJ9 V;  4LCU C;  3STZ C;  3GWO A;  2WSS G;  3ZRS A;  2Y48 A;  3ZIA G;  1Q86 W;  3TCU A;  2XAQ A;  2P7T C;  1K9M W;  4MT8 A;  4L87 A;  2OTL V;  1VQO V;  2QM7 A;  1K33 A;  1FXH A;  3EFF K;  2M7W A;  2WPD G;  4H33 A;  4MW8 A;  1OCR B;  2FTK A;  5EBL C;  2HKO A;  3ABK B;  3JD3 A;  4XDK A;  4JAS A;  1OCZ B;  1YTF B;  2W0F C;  3MHH C;  3AG2 B;  1G4Y B;  2EZP A;  4RUF A;  4WFE A;  3ZN0 A;  3CPW U;  4EKW A;  5EC2 C;  2GHY A;  2QA4 V;  3CCS V;  2WLI A;  4KUM A;  1UJW B;  5CBF A;  1RM1 B;  1BL8 A;  1BMF G;  3CCJ V;  1QLN A;  2DYS C;  1JPX A;  1VQK V;  3LNM B;  3IGA C;  3CME V;  1YHQ V;  4MTG A;  3X2Q C;  3QO8 A;  5L3G A;  1M9N A;  1SET A;  1R3L C;  5L3D A;  3SYQ A;  1W0K G;  3E8H A;  1I5X A;  2P67 A;  2WLH A;  4F4L A;  2DYR B;  2YSU B;  3AEI A;  3E35 A;  3OM3 B;  1KP2 A;  3JD2 A;  2XAF A;  2ZQM A;  3B8M A;  2AHZ A;  4JTA B;  1YIT V;  4PDM A;  2JDI G;  4X88 A;  1S0V A;  4JPR A;  5E1A C;  4QIW F;  4WCE V;  4JGS A;  2Y69 C;  4MS2 A;  3I56 V;  5EK0 A;  1H38 A;  3ETG A;  2PI4 A;  3OUF A;  1IXM A;  2ZDI C;  4BAY A;  3I55 V;  4TWK A;  3EHB B;  1S76 D;  1H2G A;  1OCZ C;  4E2L A;  2ZD9 A;  2EIJ B;  4JYC A;  4UVB A;  3E83 A;  3WG7 B;  1VQ5 V;  2ZXW B;  4XBF A;  1NH2 D;  2F43 G;  1M90 W;  1QLE C;  3ZMV A;  3WFV A;  2CK3 G;  1K3E A;  4R8C A;  4FMT A;  1XL4 A;  2B5U A;  3SPG A;  3CD6 V;  1J95 A;  5EBW C;  2IH1 C;  3ML0 A;  1M57 B;  2IJH A;  4N23 A;  4GX1 A;  1YJW V;  5KUK A;  1FFT B;  2NLJ C;  5HFL A;  4LC1 A;  2ITC C;  2QEX V;  1CPY A;  1V55 C;  4WFH A;  5CA3 A;  2EIK C;  4I5S A;  4I9W A;  1P7B A;  5H9C A;  1ORQ C;  1AR1 B;  2XAJ A;  3ETE A;  2IH3 C;  1FXK A;  1Q82 W;  3RVY A;  3RW0 A;  4XDL A;  2YEV B;  3CCQ V;  1F4M A;  1ARO P;  4FJC C;  1AJP A;  3SYP A;  4UV8 A;  1NVP D;  3QO5 A;  2X6B A;  4QJF B;  3DGE A;  3F7Y C;  3CCL V;  4U7N A;  3OAA G;  4MTX A;  4WFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...