3ZCCA

High resolution structure of the asymmetric r333g hamp-dhp mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
110
structure length
110
Chain Sequence
b'STITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDGTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HAMP, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Structure of Mutant of Hamp-Dhp Fusion
rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 45
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2012-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zccA00
5C93A 3P32A 4ZKIA 1JOYA 5B1NA 4BIUA 4MTXA 2LFRA 3D36A 5IDJA 2QM8A 2QM7A 1IXMA 4JAUA 4LC1A 5B1OA 3ZCCA 1F51A 4FPPA 2WWWA 3ZRVA 4JASA 4FMTA 4Q20A 2LFSA 3A0RA 4GT1A 3DGEA 4BIZA 4U7NA 4QPJA 4U7OA 3ZRWA 2C2AA 2FTKA 4KP4A 3ZRWB 4JYBA 4MT8A 2P67A 4QPKA 3TK1A 4JYCA 4GCZA 3MD0A 4I5SA 3ZRXA 3NXSA 4JAVA
chains in the Genus database with same CATH superfamily
4DV7B 1AJPA 2XUMA 5B1NA 2PYJA 3QG5A 2ZDIA 4ZOLA 4R8CA 1YVWA 4UXNA 3CS5A 5FPOA 2HP8A 3AG4C 4DV3O 3K79A 4WFAV 1A32A 5L3BA 3K9SA 1K3EA 1F4NA 1NQTA 3DC5A 4B7KA 1SESA 2QKCA 2ADPA 1PM9A 1WAZA 4DV6O 1TUEB 1F23A 1YIJV 2CGNA 3VQYA 1WA8A 2N74A 5ITZA 5LA6A 4X1IA 3FYEB 1R3KC 3OD4A 2JIZG 5EIBD 3ETEA 5AG2A 1QBZA 4PI0A 1M56C 5IJ9A 4JI4O 4JI6B 1NKDA 4DRXA 4DR1O 2YIBA 4NYKA 3K59A 1AI6A 1TVKB 2BSKA 2HHHB 3K5OA 2F66C 5EK0A 2ZNIA 2JEUA 1HR0O 1LUWA 1NVPB 1GN3A 2CH7A 1XNRB 4TUYB 4DV5O 1FJGO 4DR2B 2HKOA 3N2KA 3OAAG 4X88A 1Q6IA 5EIBC 3OR6C 3EFFK 3JALA 2IM9A 4I9QA 2GDSA 2DOSA 3RYFB 2QEXV 4JYYA 1KKDA 4Q20A 1PPJH 4BW9A 2E5LO 2YUAA 2F95B 1AI4A 4HAMA 4LH6A 5EBWC 5J2TB 4I50A 1YJWV 3JASA 2ETNA 1SQGA 3M7MX 4KHPO 3AG3B 5C8YB 2RJZA 4WFGA 2DMXA 1R3LC 4LFBB 3LDCA 1N34O 1NTMH 2XAHA 1FFTB 1XDCA 1P49A 4FM0A 3CCJV 1VQ6V 2ZE8A 4J9YB 3IJ4A 4I9WA 3X2QB 3FD9A 1AP5A 2PY5A 1JFFA 2VRZA 5BZBA 2OCCB 4YIPA 3JARB 4NKGB 4J9ZB 1MSWD 1MSDA 2K1EA 2KKWA 5H6RA 2YS8A 1R3JC 4Z1VA 2LFSA 3CCRV 2Y69C 1Q43A 2UXBB 1OJHA 1Z2GA 3UO2A 1BZKA 1FKAO 1UFIA 2GBOA 1Y6XA 2UU9O 2ILMA 1EBOA 3RBZA 3L9DA 2LFRA 3D3QA 4X65O 4YY3O 1ORQC 1DTOA 1U97A 5IT9N 2YI9A 2ITCC 1FXKC 3DXRB 1R3IC 4O2BB 1QLEC 5LGTA 1RM1B 2CE4A 1J5EB 1I08A 2V7QG 2JK5C 5EBLC 1LNQA 4LFAO 2ZIOA 4YIOA 1D5AA 3ABKC 1VARA 3CCUV 1I5XA 3P3PA 4K0KO 1NTKH 1W59A 5H6QA 2ZM6O 3GWKC 1Q3EA 2Q7EA 3E22B 3G80A 2XOKG 1S5JA 4FFKA 4GX0A 4WF9V 1H2MA 3FB8C 4I55A 1MA1A 2CAZC 3OEHG 3UT5B 5LMNO 2IH3C 1MNGA 1RSOB 3RW0A 5EYPB 2YI8A 4G27B 2ITDC 3JYCA 3RFRA 2YSUB 3CRRA 1FJGB 5GW7A 1OHHG 1G8MA 4DV4O 2P5OA 4DR5B 1QHTA 4IYIA 1SA0B 1XNQB 1K4DC 2HJDA 1LR1A 2QWNB 2YC0A 4JZ2A 3OTOO 3SPGA 2JS5A 1SQBH 1VIBA 1TA8A 1FXVA 3L71H 1W0JG 2YXLA 2YXHA 1WB8A 3HR0A 2PZSA 2IJKA 2GHYA 2NN4A 4JI2B 3WU2Z 1Q90D 2FTKA 1Y67A 4F6RB 5JCOC 5E1AC 1ZUQA 4WBNA 5LOVA 5EC1C 3H1JH 3B2EE 1FFXB 1SZXA 3HKCA 3D3IA 5BY1A 5CMUA 1KP3A 2DYRC 5LGUA 1WP8A 3LNMB 1N8RW 3UO3A 3CXHF 4I0XA 1GKFA 3CRMA 3UCSC 1VF5B 1ZL8B 1GM9A 2QM8A 2GTAA 5IYZA 5KUKA 5D5QA 4MTOA 5KHIA 4X66O 1BS3A 4XBFA 3JATB 2MW2B 4DXWA 3K58A 5CA3A 2P22C 4JZGA 3CPWU 1NS1A 3WB0A 2EZPA 5E79Z 1OCCC 3FB6C 4Z1MG 3SPCA 1K7DA 3G6BA 3ZS8C 2VS0A 2QKSA 3ZMTA 2X7RB 2ADQB 2W6JG 4DK0A 1XMQB 4X1YA 1G4YB 4ZKIA 4UCRA 4LFCO 3OMAB 3E86A 3CB2A 1Y74A 4JI0O 3T4ZA 4J7ZA 3ABLC 4ZOLB 4QIWF 1K5SA 1NU1H 2DE0X 3SJQC 3CSXA 4GKJO 4AQYO 1M5IA 1K4CC 2DJVA 1R6KA 3WG7C 2Q8VA 5BXZA 1JR9A 4PA3A 1KU9A 2D3OW 1M93A 5J2TA 1X59A 1PNLA 3G6EV 3E8GA 4R50A 4UV9A 1AR5A 2Z5UA 5GTIZ 3W7SA 1VQ8V 2LP7A 5KX5A 3AG7A 3JAWA 1N33O 4YJ3A 1WA8B 5ITZB 5LA6B 3ZIAG 4X1IB 2PYLA 4PA9A 3JD4A 4DV2O 3K0GA 4TSFG 4FM2A 2QJ1A 3H1LH 4EKWA 2ZE5A 2ZR3A 2YIDA 5J9PC 4RQFA 2BTQA 4LP8A 3BRCA 1I94B 3SYCA 2R9AA 4AILC 1OV9A 2Z3YA 4J42A 5F2VO 2BSKB 3OTFA 1RFYA 3ABUA 2UXCB 4CH4A 1QU7A 5LXTA 4JYAO 1Y76A 2UUBB 1WNSA 1BMFG 3RGBA 4X9QA 4WCEV 2XTAA 3N2KB 4JAVA 1AI7A 2E3CA 3SYAA 4UVBA 2ZD9A 1EZVH 1ROPA 2A9HA 3JALB 4JI8O 1E79G 5IJ0B 3A0RA 2N05A 3QO8A 2A06H 2Q4PA 2B5UA 4X20A 2EIMC 1THZA 2Q68A 4JTAB 3OR7C 4I50B 5CA1A 1R1BA 4ZI7A 5IE9A 2DW4A 1YCIA 3K57A 3IC7A 2RQ6A 1YTFB 4NXMO 1CEZA 4R6ZA 2DQ3A 2E76B 3JCZA 4O4HA 2Y48A 4GYCB 5FPRA 2CDYA 2UUAO 2HG5C 1JFFB 4DO2A 1CXZB 2XNDG 4MSWC 1H2GA 1JMKC 3ZHUA 4BW5A 4Q6GA 4X1KA 4B3TB 3EXAA 3B77A 2BTOA 4DR6O 3EVKA 3CCMV 3B8MA 1S5LZ 3P32A 4JI0B 1XL4A 2YXYA 1AR4A 1WPXA 4N21A 5H9CA 3HPLC 1NR7A 2F43G 4OPAA 1YJ9V 1WP7A 4LF6O 1N4CA 5DN6G 4JI3O 3L75H 2GV9A 1BQZA 4O4IB 1MMMA 3RWRD 1VQNV 2EILC 4FLTA 2L35A 4FLYA 4MVSA 4RO2A 2B9ZA 3ABMB 2EJ7A 4JASA 4P9OA 3HKBA 4DR7B 1NH2B 4FJCC 2IU0A 4GLXA 2P4VA 4I55B 3ZBHA 2EINC 3A0BZ 3N2GA 3T1HB 5BR8O 3AG2C 1M57C 1KECA 3F7VC 5BMVA 3TJTA 3I56V 4JYAB 3EHBB 1YZBA 3J7AU 4IYHA 4B3RB 2CTWA 4CS4A 3L72H 4RWUA 3TK1A 1H38A 3OGIB 3ZRXA 2DN9A 3OT7A 2PI4A 1IX9A 2IJHA 2PUSA 1BHAA 4CH6A 1K5QA 1WB7A 2CTRA 1W2BU 2BOBC 1AVMA 2HJFC 4QPJA 2F1MA 3T1YB 4RUEA 2VQFO 3WB2A 3OUFA 1K73W 4I5SA 4UCOA 3MAQA 1ZAUA 2RCVA 1VQLV 2WLLA 4WBNB 1EZJA 2CUGA 2L6LA 5LOVB 3BCCH 3CC2V 4K3AA 2WWWA 4FMTA 1PD3A 3B4SA 4P9PA 3HKCB 2EIKC 1XL6A 3B09A 5KAFZ 3APOA 4JYCA 2UUAB 2XAJA 3ML0A 2P90A 1NZ6A 4I0XB 1FAFA 3D36A 3ZRSA 1NR1A 1SQPH 3FYIB 4WFBV 5IYZB 4JI7O 4GX5A 4TQFA 3H01A 4UVAA 1N36B 4DR6B 3S3XA 2A0LA 1KP2A 3BEHA 1SQXH 2ODMA 1N0NA 5L3EA 5JVDA 2B1IA 5KHJA 4X1YB 1YSCA 5IYBO 1K34A 2Q69A 1I0HA 2IH1C 1V54B 2OCHA 3ABTA 1XMOO 1M9NA 1Y74B 1KD1W 4OPHA 5IJ0A 1FXHA 1EN5A 3DSQA 4FLWA 2Q67A 3B40A 4MT8A 1Y4MA 1IURA 3K04A 4PHZA 1H2LA 4L87A 1OCRB 3K5MA 1SQVH 2Y4UA 3G71V 3E8BA 4L8JA 1OCOB 1P84F 1HW7A 5KX5B 2DYSB 3JAWB 2GUZA 4YJ3B 2EZOA 2VWKA 4MVOA 2BTQB 4PDMA 2ZE7A 5LGNA 5EBMC 4YHHO 5JJEB 5EC2C 1NTZH 4X64O 3H1KH 1P7GA 4EFEA 3OMIB 3ASOC 4FK5C 3U11A 5L3DA 2ZXWB 1BE3H 3M8AA 1QVGU 4NXNO 5LXTB 1Y76B 1Z5VA 1FXKA 5IY5B 2B1GA 4U3FH 1L0LH 2QTOA 4JYBA 4O4JA 4HZ3A 5KHHA 2H3OA 2UXDO 2AHYA 3GB7C 3JAMN 3CE2A 1K92A 2QDOA 4P30A 3ASNB 4IIJA 1HDJA 1ZWIC 1H8EG 1N32O 4WFFA 2AZ2A 1HNWO 4DV3B 1GO3F 2CTQA 3LSSA 3T4DA 3JCUZ 2Y0PA 4NVPA 3BFRA 1QR9A 4UUJC 3ICXA 5B1AC 4MW3A 1OCZC 3TXSA 2EIJB 4I4TB 4DV6B 1V55C 4O4IA 4X20B 3OM3B 3STZC 4PV1B 5CA1B 4FM1A 2CK3G 4PDVA 4NTWA 3AEIA 3ZHRA 3BPZA 4F6EA 4W4LA 2LW7A 3K9AA 4ZI7B 4X62O 3JAKA 1S76D 2QWPB 4P2ZA 1U96A 2R72A 4JI4B 4DR1B 4JI1O 5J2UA 4LF8O 5B1BC 4NR1A 4QPKA 2QE7G 2Q0OC 4LNUA 3OMNB 2IJIA 3G67A 5LP6C 3CX5F 1HR0B 4O4HB 1JOYA 2X6BA 4YXWG 1S5HC 1SETA 1X4TA 2H94A 5IWAO 4JI5O 2VWJA 1Q7YW 4DV5B 2W6IG 4X1KB 2BCCH 3ZRWA 3CWBH 3E83A 4GKKO 4B3SO 3LNNA 3K06A 1GRJA 2OWOA 5GTHZ 4QE7A 3AK2A 5D5PA 4F4LA 3UM7A 5JCOA 1OZ0A 4G28B 2Y4TA 4RQEA 3BY6A 3JD1A 2QM4A 4PA4A 1GAXA 1GMGA 3QTCA 2E5LB 2RN9A 4HNAA 3M99B 2IBZH 5K1PA 4DUZO 3SR2C 3LDDA 5KLVH 1WJZA 3K08A 1JA8A 5B3SB 5L3CA 2N04A 1R73A 1IBLO 4OGQB 1HNZO 2A79B 4KHPB 3SJBC 2PGGA 1UJWB 1BT8A 3GWOA 2Q7GA 4PJ0Z 1N34B 4B3MO 4FZ0A 2CTPA 3APQA 3JD3A 3HKBB 1JPXA 3CRCA 5LMUO 4FZ1A 2V1DA 1VQPV 2EBOA 3N2GB 4KXRA 5HFMA 1BSMA 2GSMB 5BMVB 2OT5A 2XHBA 4MVZA 1VQ9V 1S3JA 1FPOA 1QVFU 1VF6C 4IHJA 1YI2V 3T1CA 5CBFA 1NVPD 2RMKB 2R70A 3AG4B 2UU9B 2Q0AA 4W4KA 2F4VO 4Z2WA 4PA7A 4TV8A 1YEWA 2A3QA 2WLHA 2HEPA 4X65B 4YY3B 1EFRG 3VQXA 1VP7A 4RUFA 1R6TA 3J80N 3ZMSA 1AI5A 4H37A 3SJAC 2JRIA 3SYOA 2OIGA 3JD2A 5LYJA 3VQWA 3VOUA 3E8HA 4LFAB 4PI2A 2QWRB 1M56B 1SF9A 4LR3A 5EZYA 4LF5O 1BHBA 3OEEG 4DV1O 1MABG 2LO1A 4K0KB 3FX7A 2WLLB 3TCUA 3UQ8A 2ZM6B 1COWG 4H0LB 1FS0G 3IAYA 1GM7A 4LCUC 4CC6A 3ZJZA 4BIZA 1KBHA 5A2QN 4LF4O 2NLJC 4JI1B 4AI8A 5CB4A 2WLIA 4TT3G 4MS2A 2RDCA 4MVUA 5IYCO 5LMNB 2JGDA 3CD6V 1XREA 1MZFA 1IVSA 1BCCH 2OTJV 1TUBB 4BAYA 2YDEA 3LSUA 1NJIW 3GVMA 4DV4B 1L1FA 3TXQA 2VQEO 1AB3A 4DV0O 2FYUH 1OCRC 1QR8A 4J10A 3AG3C 5GONA 3E35A 4DR3O 4BWAA 3SPJA 1AJQA 3A0HZ 3B8NA 4QE9A 5C93A 1Q6UA 3OTOB 2P06A 3RYIA 5JVDB 2DWEC 4DUYO 5B1OA 3RYCA 3H1HH 3IFXA 1B6QA 2WLNA 4DUZB 1IZ3A 1IBMO 3KKYA 3CJHA 3X2QC 4LF7O 4ZBMA 3JSLA 4NB5A 2OCCC 1IBKO 4I4TA 3CCSV 1JVMA 2X6CA 4RAIA 3C90A 4DV7O 1VQMV 4FLXA 2X0LA 1VQOV 4UCTA 3MHHC 3P3NA 3R65A 2ZKOA 4LBEC 4PD4F 3SDLA 2GUZB 1S77D 4JAAA 4GZRB 2Y69B 1RPOA 5LHIA 4J7JA 1M1KW 2P4KA 4X66B 4GX1A 3KCYA 1TGOA 2XAQA 2LGQA 1RM1C 1PNMA 5KA6A 5DECA 4OXSA 4B7EA 3G4SV 2FB5A 1FXKB 4JI6O 4LF9O 4O4JB 1Q8IA 3OFNG 1QLEB 4LFCB 2HHHO 4FLUA 2XAGA 3RVYA 2MK3A 3Q4HA 4GKJB 4IIJB 4AQYB 4FPPA 2EULA 1ZLZA 5HFLA 3ABKB 1HWYA 2LJ2A 1MG1A 3I55V 3ZHSA 1I7FA 1K97A 1QLNA 1XNRO 3ETDA 2JVDA 2PI5A 3R66A 5K1XA 1G6UA 1PKXA 1SQQH 4PDRA 1HNXO 4IL6Z 3H9VA 3QO5A 2ATKC 4PDLA 2HFEC 3IGAC 4J11A 1KC8W 3ZEDA 3N27A 1N33B 1BGYH 4ICGA 4DV2B 1H8HG 3JAKB 4U7NA 4IT5A 5KHGA 4NTYA 4WFEA 2WLJA 2AHZA 4C7UA 1YF2A 5J2UB 1PNKA 4PELA 1IXBA 3FB5C 1GM8A 4LNUB 3ZMVA 1FD9A 4FIPC 2WSSG 3ZCCA 1E1QG 4GX2A 4DW0A 1F7YA 1M4UA 4KL1A 1SKVA 4TQDA 4LFBO 4DV0B 4JF3A 3KG2A 3AK3A 1K8AW 3FKSG 2H8PC 3ZRWB 3FAVA 4OX9O 1ZX3A 4XDLA 1G1XB 3QVNA 2ARHA 3K0DA 2WLMA 4JI8B 2IW5A 1NT2B 3LSQA 2YIAA 1IBMB 1SRYA 4K8XA 5FNVA 3K5NA 1XBLA 2Q5ZA 4D7TA 4UB6Z 5LL6Y 4HNAB 2Q6AA 4CS3A 1O9GA 2DYRB 2QWQB 5A9GA 3PJSK 4TOIA 4MTXA 1DF4A 1YXBA 4JTDB 1CP9A 3SYQA 4TV9B 3BA9A 3F7YC 1AROP 4EB6A 2QWOB 2IU3A 1JJ2U 4KUMA 4NXMB 2QTSA 1B06A 2LW1A 1J5EO 4EEQA 2ZDIC 1OCCB 1TUBA 3CCLV 4CBCA 3CYOA 4QNHB 3W7TA 2YIBD 5JWPA 1O9HA 4DR4O 1YDXA 3ABLB 1ZTEA 4IHJB 4U7OA 3QO7A 2OTLV 4LF9B 2E75B 1HP8A 1E1RG 3WG7B 3TGUH 4TV8B 3HKEA 4TWKA 3WFVA 2D2CB 5CN0A 4O2AA 1SQFA 4LF6B 1I5YA 4U3JA 2ZNJA 3U0ZA 1DF5A 1HNXB 3A8TA 4JI3B 3K3WA 3D36C 1J95A 5LYJB 4DR5O 1XHZA 1V9PA 1XILA 5JH7A 4CC5A 5EZYB 1XNQO 1D2DA 1ZSPA 3ETQA 3C3TA 2WAMA 1M90W 1JJOA 1R6NA 2NNUA 5KAIZ 3QNEA 1VEWA 1GTOA 3BABA 5CB4B 2WLIB 4JI2O 2NR5A 1Q86W 1QNMA 3A2FA 5BR8B 4O4LA 4R7CA 2JGDB 4H33A 2YEVA 1YTFD 1Q81W 4DW1A 4KFMA 2Q73A 4YJ2A 1F4MA 1SERA 5B66Z 5LHGA 2QGNA 3ZHQA 3L74H 4OX9B 1JCHA 4GCZA 2WA3A 5GONB 5TISZ 2DQ0A 4E2LA 4FFBA 2EIMB 4JAUA 3RYIB 2O57A 4MTGA 1K33A 3RYCB 2R9IA 1F51A 4J80A 3DGEA 1JX9A 3ZMZA 4CH3A 2VQFB 4ZHQA 1YJNV 1DLBA 1Z5WA 3CJHB 1URFA 2AW9A 2PF4E 3K5LA 3OGCC 1XMQO 3F5WC 2XT9A 3HKDA 1NI8A 2RNBA 4LWSA 5KMGA 5LP6A 3AG1B 4GUNA 1AR1B 3H1IH 3CRAA 3BHPA 3E8FA 1DK1A 2CGOA 2JEXA 4AHCA 3DTUB 3BA8A 2Y0IA 1P4RA 2HR3A 1UPGA 1VMGA 1NH2D 1PV0A 3QF7A 1KQSU 3L73H 3SJCC 4EFBA 2F23A 1VQKV 1P7BA 5CA0B 4DR4B 4JI7B 4K8ZA 3RYHB 2DWDC 2KG7A 2ZINA 4A5UB 3KCXA 3CMEV 3DC6A 3CCEV 1AILA 3C3SA 4JGSA 1H2KA 4DYLA 2EJRA 3SPIA 4NTXA 2EX3A 3J81N 1GN4A 4MVRA 1I94O 3CMAV 3ABMC 1BQ0A 4XDKA 2K9PA 3CCQV 5JQGA 4LC1A 1XMOB 3O9OA 2OYQA 2EILB 2UXCO 3SYPA 3Q4HB 3ZN0A 3BAAA 3CRQA 2UUBO 4PA6A 2C2AA 3AK1A 1XQ8A 2WPDG 1XEQA 3RN4A 1YHQV 1PP9H 4UB8Z 2QM7A 3MHSC 1VQ4V 2EINB 2JGUA 3AG2B 1M57B 2G38A 4TV9A 2M7WA 3JD0A 3ZX6A 1KYOF 1VF6A 4UFZA 5FLXN 2P67A 4YHHB 2BOCC 3JSNA 3NXSA 4HBNA 4JTCB 4X64B 4BIUA 1IXMA 3OUSA 3FB7C 1Y66A 1XUQA 4BIOA 4FLVA 2ZQMA 4NXNB 2BE3A 1VF7A 3ZHTA 1WN7A 1KKCA 2WA4A 4JV5O 4KP4A 1TVKA 2UXDB 5L3FA 3CC7V 1US6A 2JJ2G 2XASA 5KA5A 3W7XA 3FAVB 3HB3B 1DGSA 3CHXA 3P30A 4E4EA 1N32B 2AXTZ 1HNWB 3OE7G 2FKXA 4TUYA 4WFHA 5FNVB 4B3TO 4MVMA 2IJJA 5JJNB 4X8AA 3S3WA 3E89A 4HYOA 1QQCA 2EIKB 1H2SB 5H2FZ 2Q7HA 4X89A 1AP6A 4UVCA 3RYFA 1Q82W 4X62B 3SGIA 2ZE6A 3L70H 4LF8B 2XAFA 4EB6B 1YITV 5LHHA 3IC9A 2ZCEA 1K9MW 1Q6HA 4CH5A 1V54C 4DK1A 3CCVV 1CPYA 4BR6A 2QKAA 1GH6A 2UXNA 2AZ0A 3VQVA 5C8YA 3OW2U 3O65A 1VQ7V 4J41A 1L8DA 3ZRVA 4JI5B 5IWAB 1MZEA 2W0FC 3F5TA 3NR7A 4ABMA 4B08A 4DR7O 4GKKB 3U10A 3BVOA 4B3SB 2JJ1G 2X6AA 5IJ9B 4DRXB 3W7UA 5DM6V 4H44B 3MD0A 1PL4A 1OCOC 1RPRA 1EN6A 1MOFA 3JARA 3T1HO 1LUVA 2DYSC 3E2EA 3UKMA 2GTSA 1GN2A 3HKEB 1QCEA 2ZIMA 4O2AB 2CH7B 4B3RO 4U3JB 1B04A 4H13B 2P7TC 2LGWA 1IBLB 1HNZB 3CEIA 2UUCO 4N23A 1L0NH 3WB1A 2ZXWC 5LBQA 4QJFB 5JH7B 3CC4V 3RT3C 2ZR2A 4IGGA 3T2MA 5IY5C 4B3MB 4D7SA 2KQXA 3KZIZ 4CZZA 3DXRA 4FLZA 4GT1A 1AJNA 4O2BA 2P6JA 3ASOB 5LMUB 4MVQA 3W7WA 5CBGA 3T1YO 3MDSA 1SS3A 4J7KA 3ASNC 4ASUG 2FL4A 4I7ZB 3JASB 3SPHA 4O4LB 5CA0A 2YEVB 1ENVA 1NBMG 2KSDA 2PTMA 3E22A 3RYHA 5IYDO 2AGAA 1WLEA 3FFQA 4YJ2B 1T5EA 5KHKA 4JV5B 2EIJC 1KUQA 1SC5B 3CXCU 5CBHA 4QGPA 3ZN1A 2HLDG 3VBBA 3I5DA 3UT5A 2F4VB 3AG1C 1JQ0A 1RSOA 4XDJA 3LDEA 5H5NA 5EYPA 5DEDA 1B3QA 5B1AB 2Q9LA 3CP1A 1OCZB 1XI1A 3ZHVA 2V4DA 1KB9F 3ETGA 4FFBB 1V55B 1GN6A 2FMLA 5L3GA 4UCVA 4LH7A 1D5NA 2QA4V 3K03A 1FYJA 2YICA 2F93B 1IDSA 5KUMA 2LQTA 2R9RB 1S0VA 2KB1A 1N36O 4DR2O 4ZHQB 4UCUA 1GK9A 1SA0A 4LF5B 4DV1B 3STLC 1EN4A 5B1BB 4MTFA 5IDJA 3HKDB 2M6YA 4UCSA 1H2NA 1WPBA 4MW8A 4LWSB 4ZIBA 5KMGB 5LP6B 4LF4B 2HVKC 4K35A 4UV8A 5JJJB 4FVMA 1W0KG 5B5EZ 1BL8A 1N0JA 4F6RA 4G2KA 2WLKA 2HVJC 2OIEA 3PN1A 3THOA 1FFXA 3RVZA 5B3SC 2KG7B 4JPRA 4CS2A 4D6TH 2VQEB 1RP3B 2Z0AA 1SZTA 4DR3B 2E74B 2ZT9B 1KMIZ 2W0XA 1ZL8A 2UXXA 2A7WA 2JDIG 4DUYB 3LUTB 1Q5OA 5JQGB 3JATA 2JS3A 5FL7G 3TETA 1PL0A 1TAEA 2QR4A 4LF7B 3D8CA 1IBKB 1VQ5V 2QSAA 2UXBO 1EM1A 2UUCB 1S72V 1XHXA 3ZMUA 1XOUA
chains in the Genus database with same CATH topology
2DQ0A 1AJPA 2EBOA 4E2LA 5B1NA 2EIMB 2ZDIA 4JAUA 5HFMA 2GSMB 4MTGA 4R8CA 1K33A 4UXNA 2OT5A 2R9IA 1F51A 5CBHA 4MVZA 1VQ9V 1S3JA 1QVFU 3AG4C 3DGEA 1JX9A 3ZMZA 3K79A 2DW4A 1YI2V 3T1CA 4WFAV 5CBFA 1NVPD 5L3BA 3IC7A 1K3EA 1YJNV 1DLBA 3AG4B 1F4NA 1YTFB 1CEZA 1NQTA 4R6ZA 2DQ3A 1SESA 3JCZA 4PA7A 3OGCC 2Y48A 2WLHA 1TUEB 3F5WC 1F23A 1EFRG 2HG5C 1YIJV 3AG1B 4DO2A 2XNDG 4MSWC 4RUFA 1AR1B 1H2GA 3FYEB 4BW5A 3ZMSA 1AI5A 1R3KC 4H37A 2JIZG 3ETEA 3E8FA 3B77A 2JEXA 1QBZA 1M56C 3DTUB 1NKDA 3SYOA 3JD2A 1P4RA 2HR3A 3VOUA 1AI6A 3CCMV 1NH2D 3B8MA 3E8HA 3P32A 1M56B 1KQSU 1BHBA 3OEEG 5EK0A 1MABG 2JEUA 1VQKV 1P7BA 1XL4A 2WLLB 3TCUA 1COWG 1WPXA 4N21A 5H9CA 1FS0G 3HPLC 1GM7A 1NR7A 1NVPB 2DWDC 2F43G 4LCUC 3ZJZA 4BIZA 1YJ9V 3CMEV 2NLJC 3CCEV 2WLIA 4JGSA 4TT3G 2HKOA 4MS2A 2EJRA 3SPIA 4MVUA 5IYCO 5DN6G 3CD6V 3OAAG 4X88A 4MVRA 3CMAV 3ABMC 2OTJV 1VQNV 3OR6C 4XDKA 2EILC 3CCQV 3EFFK 4LC1A 4MVSA 4RO2A 4BAYA 3ABMB 2QEXV 1KKDA 2EILB 4JASA 3SYPA 4Q20A 3ZN0A 4P9OA 1NJIW 4PA6A 1NH2B 1AI4A 4FJCC 1L1FA 2C2AA 2IU0A 1OCRC 1QR8A 4HAMA 3AG3C 5EBWC 3E35A 3SPJA 1AJQA 2EINC 2WPDG 3B8NA 4QE9A 1YJWV 5C93A 3AG2C 1M57C 1YHQV 1KECA 2DWEC 3AG3B 3F7VC 2QM7A 5B1OA 3MHSC 1VQ4V 2EINB 3I56V 3EHBB 3AG2B 1M57B 3IFXA 1B6QA 4WFGA 2WLNA 1R3LC 2M7WA 3LDCA 3JD0A 2XAHA 3X2QC 1FFTB 4ZBMA 2P67A 2OCCC 3TK1A 1H38A 3CCJV 3CCSV 3ZRXA 1JVMA 2BOCC 2X6CA 3NXSA 4J9YB 4RAIA 4I9WA 1VQ6V 3X2QB 2PI4A 4JTCB 4BIUA 1VQMV 5BZBA 2OCCB 2IJHA 2X0LA 1VQOV 1IXMA 1BHAA 3OUSA 3FB7C 1Y66A 4J9ZB 1K5QA 3MHHC 1MSWD 2K1EA 3R65A 2ZQMA 5H6RA 4LBEC 1R3JC 1W2BU 2LFSA 3CCRV 2BOBC 2Y69C 2HJFC 1S77D 4QPJA 1S72V 4RUEA 4KP4A 5L3FA 2Y69B 3OUFA 3CC7V 1K73W 4I5SA 2JJ2G 2XASA 5KA5A 3W7XA 1RPOA 1EBOA 3RBZA 1VQLV 3HB3B 2WLLA 5LHIA 2LFRA 1M1KW 1EZJA 3P30A 4GX1A 2XAQA 1ORQC 1DTOA 3CC2V 3OE7G 1RM1C 1PNMA 2WWWA 5KA6A 4FMTA 2ITCC 1FXKC 1PD3A 4WFHA 4P9PA 2EIKC 4MVMA 1R3IC 1QLEC 1XL6A 4OXSA 5LGTA 1RM1B 3G4SV 2IJJA 1FXKB 4X8AA 3E89A 4HYOA 4JYCA 2V7QG 2EIKB 2JK5C 5EBLC 3OFNG 1QLEB 2XAJA 1LNQA 3ML0A 4X89A 2P90A 3ABKC 3D36A 4UVCA 2XAGA 3ZRSA 1NR1A 3CCUV 1Q82W 3FYIB 1I5XA 3RVYA 2MK3A 4WFBV 5H6QA 4FPPA 5HFLA 3ABKB 4GX5A 1HWYA 2XOKG 3H01A 1MG1A 3I55V 4GX0A 4UVAA 1K97A 1QLNA 4WF9V 2XAFA 1YITV 3FB8C 3ETDA 2PI5A 5LHHA 2A0LA 1KP2A 3BEHA 3OEHG 1PKXA 4PDRA 1K9MW 1V54C 2IH3C 5L3EA 1CPYA 3CCVV 3QO5A 2ATKC 4PDLA 2B1IA 3RW0A 2HFEC 3IGAC 2UXNA 1YSCA 4G27B 1K34A 2Q69A 5IYBO 3OW2U 1KC8W 2IH1C 2ITDC 1V54B 3JYCA 3ABTA 1VQ7V 2YSUB 1M9NA 1KD1W 3ZRVA 1FXHA 2W0FC 1H8HG 4U7NA 5GW7A 1OHHG 2Q67A 4WFEA 1G8MA 2JJ1G 2AHZA 2WLJA 2X6AA 4MT8A 1Y4MA 3W7UA 3K04A 5DM6V 1PNKA 3MD0A 4PELA 3FB5C 1OCOC 1GM8A 1RPRA 1K4DC 1MOFA 4L87A 2DYSC 1OCRB 3SPGA 3ZMVA 3UKMA 3E2EA 4FIPC 3G71V 2WSSG 3E8BA 1OCOB 3ZCCA 1E1QG 4GX2A 1FXVA 2DYSB 1QCEA 1W0JG 2EZOA 4JF3A 2IJKA 2GHYA 3KG2A 2FTKA 2P7TC 1K8AW 3FKSG 2H8PC 3ZRWB 4MVOA 4PDMA 5LGNA 5EBMC 4N23A 5E1AC 5EC2C 5EC1C 4XDLA 2ZXWC 5LBQA 4QJFB 3K0DA 2WLMA 3CC4V 2IW5A 3OMIB 2ZR2A 3LSQA 3T2MA 3ASOC 4FK5C 5IY5C 1SRYA 5L3DA 4CZZA 2ZXWB 3D3IA 1QVGU 4GT1A 1AJNA 5CMUA 2P6JA 1KP3A 2DYRC 1FXKA 3ASOB 5IY5B 2B1GA 5LGUA 4MVQA 3W7WA 2Q6AA 2QTOA 3LNMB 4JYBA 5CBGA 1N8RW 4HZ3A 3ASNC 2DYRB 2AHYA 4ASUG 3GB7C 3PJSK 3SPHA 1GKFA 4MTXA 1K92A 2YEVB 1GM9A 2QM8A 1DF4A 4P30A 3ASNB 5KUKA 4JTDB 1ENVA 4MTOA 1ZWIC 1NBMG 1H8EG 4XBFA 5IYDO 4WFFA 1WLEA 4DXWA 1CP9A 3SYQA 1GO3F 5CA3A 3CPWU 3F7YC 3LSSA 3T4DA 2EIJC 1AROP 2IU3A 1JJ2U 2EZPA 3CXCU 1QR9A 4KUMA 1OCCC 4UUJC 3FB6C 5B1AC 3ZN1A 3SPCA 2HLDG 3VBBA 4MW3A 1K7DA 1OCZC 4Z1MG 2EIJB 2QKSA 3AG1C 3ZMTA 1JQ0A 2X7RB 4XDJA 3LDEA 2W6JG 1V55C 2ZDIC 1OCCB 1G4YB 5B1AB 3CP1A 3OM3B 3STZC 4ZKIA 1OCZB 3CCLV 4CBCA 3CYOA 2CK3G 4PDVA 4QNHB 3AEIA 3OMAB 3E86A 3ETGA 3W7TA 3T4ZA 1V55B 3ABLC 5L3GA 4QIWF 1K5SA 3SJQC 3K9AA 1S76D 2QA4V 3K03A 4P2ZA 1K4CC 1R6KA 3ABLB 5KUMA 3WG7C 2R9RB 1S0VA 4U7OA 2KB1A 3QO7A 2OTLV 4PA3A 5B1BC 2D3OW 4QPKA 2QE7G 1GK9A 1PNLA 3G6EV 1E1RG 3WG7B 3OMNB 2IJIA 3STLC 3E8GA 1JOYA 4R50A 5B1BB 4MTFA 2X6BA 4UV9A 5IDJA 3W7SA 2Z5UA 4YXWG 1S5HC 1VQ8V 1SETA 2LP7A 4TWKA 4MW8A 3WFVA 2H94A 5CN0A 3ZIAG 4PA9A 1I5YA 3JD4A 1Q7YW 2HVKC 2W6IG 3K0GA 4TSFG 4UV8A 1DF5A 3ZRWA 1W0KG 4EKWA 2ZR3A 5J9PC 4RQFA 3E83A 1BL8A 4G2KA 3K3WA 4LP8A 3K06A 3SYCA 1J95A 2WLKA 2Z3YA 4QE7A 2HVJC 4F4LA 3UM7A 3ABUA 1OZ0A 4G28B 4RQEA 3BY6A 3JD1A 4PA4A 2WAMA 1GMGA 1M90W 1R6NA 2NNUA 3RVZA 5B3SC 4JPRA 3QNEA 3M99B 1BMFG 1GTOA 2WLIB 3LDDA 3K08A 1Q86W 1SZTA 4WCEV 5B3SB 5L3CA 1R73A 2A79B 4R7CA 4JAVA 1AI7A 4H33A 3SYAA 2YEVA 1YTFD 2UXXA 1Q81W 2JDIG 4UVBA 3LUTB 1UJWB 3GWOA 4KFMA 2ZD9A 2A9HA 1ROPA 1E79G 5FL7G 1F4MA 3TETA 1PL0A 3A0RA 1SERA 3JD3A 1JPXA 5LHGA 3QO8A 1VQ5V 2B5UA 2V1DA 1JCHA 2EIMC 1VQPV 1THZA 4GCZA 2Q68A 4JTAB 3OR7C 3ZMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C93 A;  3P32 A;  4ZKI A;  1JOY A;  5B1N A;  4BIU A;  4MTX A;  2LFR A;  3D36 A;  5IDJ A;  2QM8 A;  2QM7 A;  1IXM A;  4JAU A;  4LC1 A;  5B1O A;  3ZCC A;  1F51 A;  4FPP A;  2WWW A;  3ZRV A;  4JAS A;  4FMT A;  4Q20 A;  2LFS A;  3A0R A;  4GT1 A;  3DGE A;  4BIZ A;  4U7N A;  4QPJ A;  4U7O A;  3ZRW A;  2C2A A;  2FTK A;  4KP4 A;  3ZRW B;  4JYB A;  4MT8 A;  2P67 A;  4QPK A;  3TK1 A;  4JYC A;  4GCZ A;  3MD0 A;  4I5S A;  3ZRX A;  3NXS A;  4JAV A; 
#chains in the Genus database with same CATH topology
 4DV7 B;  1AJP A;  2XUM A;  5B1N A;  2PYJ A;  3QG5 A;  2ZDI A;  4ZOL A;  4R8C A;  1YVW A;  4UXN A;  3CS5 A;  5FPO A;  2HP8 A;  3AG4 C;  4DV3 O;  3K79 A;  4WFA V;  1A32 A;  5L3B A;  3K9S A;  1K3E A;  1F4N A;  1NQT A;  3DC5 A;  4B7K A;  1SES A;  2QKC A;  2ADP A;  1PM9 A;  1WAZ A;  4DV6 O;  1TUE B;  1F23 A;  1YIJ V;  2CGN A;  3VQY A;  1WA8 A;  2N74 A;  5ITZ A;  5LA6 A;  4X1I A;  3FYE B;  1R3K C;  3OD4 A;  2JIZ G;  5EIB D;  3ETE A;  5AG2 A;  1QBZ A;  4PI0 A;  1M56 C;  5IJ9 A;  4JI4 O;  4JI6 B;  1NKD A;  4DRX A;  4DR1 O;  2YIB A;  4NYK A;  3K59 A;  1AI6 A;  1TVK B;  2BSK A;  2HHH B;  3K5O A;  2F66 C;  5EK0 A;  2ZNI A;  2JEU A;  1HR0 O;  1LUW A;  1NVP B;  1GN3 A;  2CH7 A;  1XNR B;  4TUY B;  4DV5 O;  1FJG O;  4DR2 B;  2HKO A;  3N2K A;  3OAA G;  4X88 A;  1Q6I A;  5EIB C;  3OR6 C;  3EFF K;  3JAL A;  2IM9 A;  4I9Q A;  2GDS A;  2DOS A;  3RYF B;  2QEX V;  4JYY A;  1KKD A;  4Q20 A;  1PPJ H;  4BW9 A;  2E5L O;  2YUA A;  2F95 B;  1AI4 A;  4HAM A;  4LH6 A;  5EBW C;  5J2T B;  4I50 A;  1YJW V;  3JAS A;  2ETN A;  1SQG A;  3M7M X;  4KHP O;  3AG3 B;  5C8Y B;  2RJZ A;  4WFG A;  2DMX A;  1R3L C;  4LFB B;  3LDC A;  1N34 O;  1NTM H;  2XAH A;  1FFT B;  1XDC A;  1P49 A;  4FM0 A;  3CCJ V;  1VQ6 V;  2ZE8 A;  4J9Y B;  3IJ4 A;  4I9W A;  3X2Q B;  3FD9 A;  1AP5 A;  2PY5 A;  1JFF A;  2VRZ A;  5BZB A;  2OCC B;  4YIP A;  3JAR B;  4NKG B;  4J9Z B;  1MSW D;  1MSD A;  2K1E A;  2KKW A;  5H6R A;  2YS8 A;  1R3J C;  4Z1V A;  2LFS A;  3CCR V;  2Y69 C;  1Q43 A;  2UXB B;  1OJH A;  1Z2G A;  3UO2 A;  1BZK A;  1FKA O;  1UFI A;  2GBO A;  1Y6X A;  2UU9 O;  2ILM A;  1EBO A;  3RBZ A;  3L9D A;  2LFR A;  3D3Q A;  4X65 O;  4YY3 O;  1ORQ C;  1DTO A;  1U97 A;  5IT9 N;  2YI9 A;  2ITC C;  1FXK C;  3DXR B;  1R3I C;  4O2B B;  1QLE C;  5LGT A;  1RM1 B;  2CE4 A;  1J5E B;  1I08 A;  2V7Q G;  2JK5 C;  5EBL C;  1LNQ A;  4LFA O;  2ZIO A;  4YIO A;  1D5A A;  3ABK C;  1VAR A;  3CCU V;  1I5X A;  3P3P A;  4K0K O;  1NTK H;  1W59 A;  5H6Q A;  2ZM6 O;  3GWK C;  1Q3E A;  2Q7E A;  3E22 B;  3G80 A;  2XOK G;  1S5J A;  4FFK A;  4GX0 A;  4WF9 V;  1H2M A;  3FB8 C;  4I55 A;  1MA1 A;  2CAZ C;  3OEH G;  3UT5 B;  5LMN O;  2IH3 C;  1MNG A;  1RSO B;  3RW0 A;  5EYP B;  2YI8 A;  4G27 B;  2ITD C;  3JYC A;  3RFR A;  2YSU B;  3CRR A;  1FJG B;  5GW7 A;  1OHH G;  1G8M A;  4DV4 O;  2P5O A;  4DR5 B;  1QHT A;  4IYI A;  1SA0 B;  1XNQ B;  1K4D C;  2HJD A;  1LR1 A;  2QWN B;  2YC0 A;  4JZ2 A;  3OTO O;  3SPG A;  2JS5 A;  1SQB H;  1VIB A;  1TA8 A;  1FXV A;  3L71 H;  1W0J G;  2YXL A;  2YXH A;  1WB8 A;  3HR0 A;  2PZS A;  2IJK A;  2GHY A;  2NN4 A;  4JI2 B;  3WU2 Z;  1Q90 D;  2FTK A;  1Y67 A;  4F6R B;  5JCO C;  5E1A C;  1ZUQ A;  4WBN A;  5LOV A;  5EC1 C;  3H1J H;  3B2E E;  1FFX B;  1SZX A;  3HKC A;  3D3I A;  5BY1 A;  5CMU A;  1KP3 A;  2DYR C;  5LGU A;  1WP8 A;  3LNM B;  1N8R W;  3UO3 A;  3CXH F;  4I0X A;  1GKF A;  3CRM A;  3UCS C;  1VF5 B;  1ZL8 B;  1GM9 A;  2QM8 A;  2GTA A;  5IYZ A;  5KUK A;  5D5Q A;  4MTO A;  5KHI A;  4X66 O;  1BS3 A;  4XBF A;  3JAT B;  2MW2 B;  4DXW A;  3K58 A;  5CA3 A;  2P22 C;  4JZG A;  3CPW U;  1NS1 A;  3WB0 A;  2EZP A;  5E79 Z;  1OCC C;  3FB6 C;  4Z1M G;  3SPC A;  1K7D A;  3G6B A;  3ZS8 C;  2VS0 A;  2QKS A;  3ZMT A;  2X7R B;  2ADQ B;  2W6J G;  4DK0 A;  1XMQ B;  4X1Y A;  1G4Y B;  4ZKI A;  4UCR A;  4LFC O;  3OMA B;  3E86 A;  3CB2 A;  1Y74 A;  4JI0 O;  3T4Z A;  4J7Z A;  3ABL C;  4ZOL B;  4QIW F;  1K5S A;  1NU1 H;  2DE0 X;  3SJQ C;  3CSX A;  4GKJ O;  4AQY O;  1M5I A;  1K4C C;  2DJV A;  1R6K A;  3WG7 C;  2Q8V A;  5BXZ A;  1JR9 A;  4PA3 A;  1KU9 A;  2D3O W;  1M93 A;  5J2T A;  1X59 A;  1PNL A;  3G6E V;  3E8G A;  4R50 A;  4UV9 A;  1AR5 A;  2Z5U A;  5GTI Z;  3W7S A;  1VQ8 V;  2LP7 A;  5KX5 A;  3AG7 A;  3JAW A;  1N33 O;  4YJ3 A;  1WA8 B;  5ITZ B;  5LA6 B;  3ZIA G;  4X1I B;  2PYL A;  4PA9 A;  3JD4 A;  4DV2 O;  3K0G A;  4TSF G;  4FM2 A;  2QJ1 A;  3H1L H;  4EKW A;  2ZE5 A;  2ZR3 A;  2YID A;  5J9P C;  4RQF A;  2BTQ A;  4LP8 A;  3BRC A;  1I94 B;  3SYC A;  2R9A A;  4AIL C;  1OV9 A;  2Z3Y A;  4J42 A;  5F2V O;  2BSK B;  3OTF A;  1RFY A;  3ABU A;  2UXC B;  4CH4 A;  1QU7 A;  5LXT A;  4JYA O;  1Y76 A;  2UUB B;  1WNS A;  1BMF G;  3RGB A;  4X9Q A;  4WCE V;  2XTA A;  3N2K B;  4JAV A;  1AI7 A;  2E3C A;  3SYA A;  4UVB A;  2ZD9 A;  1EZV H;  1ROP A;  2A9H A;  3JAL B;  4JI8 O;  1E79 G;  5IJ0 B;  3A0R A;  2N05 A;  3QO8 A;  2A06 H;  2Q4P A;  2B5U A;  4X20 A;  2EIM C;  1THZ A;  2Q68 A;  4JTA B;  3OR7 C;  4I50 B;  5CA1 A;  1R1B A;  4ZI7 A;  5IE9 A;  2DW4 A;  1YCI A;  3K57 A;  3IC7 A;  2RQ6 A;  1YTF B;  4NXM O;  1CEZ A;  4R6Z A;  2DQ3 A;  2E76 B;  3JCZ A;  4O4H A;  2Y48 A;  4GYC B;  5FPR A;  2CDY A;  2UUA O;  2HG5 C;  1JFF B;  4DO2 A;  1CXZ B;  2XND G;  4MSW C;  1H2G A;  1JMK C;  3ZHU A;  4BW5 A;  4Q6G A;  4X1K A;  4B3T B;  3EXA A;  3B77 A;  2BTO A;  4DR6 O;  3EVK A;  3CCM V;  3B8M A;  1S5L Z;  3P32 A;  4JI0 B;  1XL4 A;  2YXY A;  1AR4 A;  1WPX A;  4N21 A;  5H9C A;  3HPL C;  1NR7 A;  2F43 G;  4OPA A;  1YJ9 V;  1WP7 A;  4LF6 O;  1N4C A;  5DN6 G;  4JI3 O;  3L75 H;  2GV9 A;  1BQZ A;  4O4I B;  1MMM A;  3RWR D;  1VQN V;  2EIL C;  4FLT A;  2L35 A;  4FLY A;  4MVS A;  4RO2 A;  2B9Z A;  3ABM B;  2EJ7 A;  4JAS A;  4P9O A;  3HKB A;  4DR7 B;  1NH2 B;  4FJC C;  2IU0 A;  4GLX A;  2P4V A;  4I55 B;  3ZBH A;  2EIN C;  3A0B Z;  3N2G A;  3T1H B;  5BR8 O;  3AG2 C;  1M57 C;  1KEC A;  3F7V C;  5BMV A;  3TJT A;  3I56 V;  4JYA B;  3EHB B;  1YZB A;  3J7A U;  4IYH A;  4B3R B;  2CTW A;  4CS4 A;  3L72 H;  4RWU A;  3TK1 A;  1H38 A;  3OGI B;  3ZRX A;  2DN9 A;  3OT7 A;  2PI4 A;  1IX9 A;  2IJH A;  2PUS A;  1BHA A;  4CH6 A;  1K5Q A;  1WB7 A;  2CTR A;  1W2B U;  2BOB C;  1AVM A;  2HJF C;  4QPJ A;  2F1M A;  3T1Y B;  4RUE A;  2VQF O;  3WB2 A;  3OUF A;  1K73 W;  4I5S A;  4UCO A;  3MAQ A;  1ZAU A;  2RCV A;  1VQL V;  2WLL A;  4WBN B;  1EZJ A;  2CUG A;  2L6L A;  5LOV B;  3BCC H;  3CC2 V;  4K3A A;  2WWW A;  4FMT A;  1PD3 A;  3B4S A;  4P9P A;  3HKC B;  2EIK C;  1XL6 A;  3B09 A;  5KAF Z;  3APO A;  4JYC A;  2UUA B;  2XAJ A;  3ML0 A;  2P90 A;  1NZ6 A;  4I0X B;  1FAF A;  3D36 A;  3ZRS A;  1NR1 A;  1SQP H;  3FYI B;  4WFB V;  5IYZ B;  4JI7 O;  4GX5 A;  4TQF A;  3H01 A;  4UVA A;  1N36 B;  4DR6 B;  3S3X A;  2A0L A;  1KP2 A;  3BEH A;  1SQX H;  2ODM A;  1N0N A;  5L3E A;  5JVD A;  2B1I A;  5KHJ A;  4X1Y B;  1YSC A;  5IYB O;  1K34 A;  2Q69 A;  1I0H A;  2IH1 C;  1V54 B;  2OCH A;  3ABT A;  1XMO O;  1M9N A;  1Y74 B;  1KD1 W;  4OPH A;  5IJ0 A;  1FXH A;  1EN5 A;  3DSQ A;  4FLW A;  2Q67 A;  3B40 A;  4MT8 A;  1Y4M A;  1IUR A;  3K04 A;  4PHZ A;  1H2L A;  4L87 A;  1OCR B;  3K5M A;  1SQV H;  2Y4U A;  3G71 V;  3E8B A;  4L8J A;  1OCO B;  1P84 F;  1HW7 A;  5KX5 B;  2DYS B;  3JAW B;  2GUZ A;  4YJ3 B;  2EZO A;  2VWK A;  4MVO A;  2BTQ B;  4PDM A;  2ZE7 A;  5LGN A;  5EBM C;  4YHH O;  5JJE B;  5EC2 C;  1NTZ H;  4X64 O;  3H1K H;  1P7G A;  4EFE A;  3OMI B;  3ASO C;  4FK5 C;  3U11 A;  5L3D A;  2ZXW B;  1BE3 H;  3M8A A;  1QVG U;  4NXN O;  5LXT B;  1Y76 B;  1Z5V A;  1FXK A;  5IY5 B;  2B1G A;  4U3F H;  1L0L H;  2QTO A;  4JYB A;  4O4J A;  4HZ3 A;  5KHH A;  2H3O A;  2UXD O;  2AHY A;  3GB7 C;  3JAM N;  3CE2 A;  1K92 A;  2QDO A;  4P30 A;  3ASN B;  4IIJ A;  1HDJ A;  1ZWI C;  1H8E G;  1N32 O;  4WFF A;  2AZ2 A;  1HNW O;  4DV3 B;  1GO3 F;  2CTQ A;  3LSS A;  3T4D A;  3JCU Z;  2Y0P A;  4NVP A;  3BFR A;  1QR9 A;  4UUJ C;  3ICX A;  5B1A C;  4MW3 A;  1OCZ C;  3TXS A;  2EIJ B;  4I4T B;  4DV6 B;  1V55 C;  4O4I A;  4X20 B;  3OM3 B;  3STZ C;  4PV1 B;  5CA1 B;  4FM1 A;  2CK3 G;  4PDV A;  4NTW A;  3AEI A;  3ZHR A;  3BPZ A;  4F6E A;  4W4L A;  2LW7 A;  3K9A A;  4ZI7 B;  4X62 O;  3JAK A;  1S76 D;  2QWP B;  4P2Z A;  1U96 A;  2R72 A;  4JI4 B;  4DR1 B;  4JI1 O;  5J2U A;  4LF8 O;  5B1B C;  4NR1 A;  4QPK A;  2QE7 G;  2Q0O C;  4LNU A;  3OMN B;  2IJI A;  3G67 A;  5LP6 C;  3CX5 F;  1HR0 B;  4O4H B;  1JOY A;  2X6B A;  4YXW G;  1S5H C;  1SET A;  1X4T A;  2H94 A;  5IWA O;  4JI5 O;  2VWJ A;  1Q7Y W;  4DV5 B;  2W6I G;  4X1K B;  2BCC H;  3ZRW A;  3CWB H;  3E83 A;  4GKK O;  4B3S O;  3LNN A;  3K06 A;  1GRJ A;  2OWO A;  5GTH Z;  4QE7 A;  3AK2 A;  5D5P A;  4F4L A;  3UM7 A;  5JCO A;  1OZ0 A;  4G28 B;  2Y4T A;  4RQE A;  3BY6 A;  3JD1 A;  2QM4 A;  4PA4 A;  1GAX A;  1GMG A;  3QTC A;  2E5L B;  2RN9 A;  4HNA A;  3M99 B;  2IBZ H;  5K1P A;  4DUZ O;  3SR2 C;  3LDD A;  5KLV H;  1WJZ A;  3K08 A;  1JA8 A;  5B3S B;  5L3C A;  2N04 A;  1R73 A;  1IBL O;  4OGQ B;  1HNZ O;  2A79 B;  4KHP B;  3SJB C;  2PGG A;  1UJW B;  1BT8 A;  3GWO A;  2Q7G A;  4PJ0 Z;  1N34 B;  4B3M O;  4FZ0 A;  2CTP A;  3APQ A;  3JD3 A;  3HKB B;  1JPX A;  3CRC A;  5LMU O;  4FZ1 A;  2V1D A;  1VQP V;  2EBO A;  3N2G B;  4KXR A;  5HFM A;  1BSM A;  2GSM B;  5BMV B;  2OT5 A;  2XHB A;  4MVZ A;  1VQ9 V;  1S3J A;  1FPO A;  1QVF U;  1VF6 C;  4IHJ A;  1YI2 V;  3T1C A;  5CBF A;  1NVP D;  2RMK B;  2R70 A;  3AG4 B;  2UU9 B;  2Q0A A;  4W4K A;  2F4V O;  4Z2W A;  4PA7 A;  4TV8 A;  1YEW A;  2A3Q A;  2WLH A;  2HEP A;  4X65 B;  4YY3 B;  1EFR G;  3VQX A;  1VP7 A;  4RUF A;  1R6T A;  3J80 N;  3ZMS A;  1AI5 A;  4H37 A;  3SJA C;  2JRI A;  3SYO A;  2OIG A;  3JD2 A;  5LYJ A;  3VQW A;  3VOU A;  3E8H A;  4LFA B;  4PI2 A;  2QWR B;  1M56 B;  1SF9 A;  4LR3 A;  5EZY A;  4LF5 O;  1BHB A;  3OEE G;  4DV1 O;  1MAB G;  2LO1 A;  4K0K B;  3FX7 A;  2WLL B;  3TCU A;  3UQ8 A;  2ZM6 B;  1COW G;  4H0L B;  1FS0 G;  3IAY A;  1GM7 A;  4LCU C;  4CC6 A;  3ZJZ A;  4BIZ A;  1KBH A;  5A2Q N;  4LF4 O;  2NLJ C;  4JI1 B;  4AI8 A;  5CB4 A;  2WLI A;  4TT3 G;  4MS2 A;  2RDC A;  4MVU A;  5IYC O;  5LMN B;  2JGD A;  3CD6 V;  1XRE A;  1MZF A;  1IVS A;  1BCC H;  2OTJ V;  1TUB B;  4BAY A;  2YDE A;  3LSU A;  1NJI W;  3GVM A;  4DV4 B;  1L1F A;  3TXQ A;  2VQE O;  1AB3 A;  4DV0 O;  2FYU H;  1OCR C;  1QR8 A;  4J10 A;  3AG3 C;  5GON A;  3E35 A;  4DR3 O;  4BWA A;  3SPJ A;  1AJQ A;  3A0H Z;  3B8N A;  4QE9 A;  5C93 A;  1Q6U A;  3OTO B;  2P06 A;  3RYI A;  5JVD B;  2DWE C;  4DUY O;  5B1O A;  3RYC A;  3H1H H;  3IFX A;  1B6Q A;  2WLN A;  4DUZ B;  1IZ3 A;  1IBM O;  3KKY A;  3CJH A;  3X2Q C;  4LF7 O;  4ZBM A;  3JSL A;  4NB5 A;  2OCC C;  1IBK O;  4I4T A;  3CCS V;  1JVM A;  2X6C A;  4RAI A;  3C90 A;  4DV7 O;  1VQM V;  4FLX A;  2X0L A;  1VQO V;  4UCT A;  3MHH C;  3P3N A;  3R65 A;  2ZKO A;  4LBE C;  4PD4 F;  3SDL A;  2GUZ B;  1S77 D;  4JAA A;  4GZR B;  2Y69 B;  1RPO A;  5LHI A;  4J7J A;  1M1K W;  2P4K A;  4X66 B;  4GX1 A;  3KCY A;  1TGO A;  2XAQ A;  2LGQ A;  1RM1 C;  1PNM A;  5KA6 A;  5DEC A;  4OXS A;  4B7E A;  3G4S V;  2FB5 A;  1FXK B;  4JI6 O;  4LF9 O;  4O4J B;  1Q8I A;  3OFN G;  1QLE B;  4LFC B;  2HHH O;  4FLU A;  2XAG A;  3RVY A;  2MK3 A;  3Q4H A;  4GKJ B;  4IIJ B;  4AQY B;  4FPP A;  2EUL A;  1ZLZ A;  5HFL A;  3ABK B;  1HWY A;  2LJ2 A;  1MG1 A;  3I55 V;  3ZHS A;  1I7F A;  1K97 A;  1QLN A;  1XNR O;  3ETD A;  2JVD A;  2PI5 A;  3R66 A;  5K1X A;  1G6U A;  1PKX A;  1SQQ H;  4PDR A;  1HNX O;  4IL6 Z;  3H9V A;  3QO5 A;  2ATK C;  4PDL A;  2HFE C;  3IGA C;  4J11 A;  1KC8 W;  3ZED A;  3N27 A;  1N33 B;  1BGY H;  4ICG A;  4DV2 B;  1H8H G;  3JAK B;  4U7N A;  4IT5 A;  5KHG A;  4NTY A;  4WFE A;  2WLJ A;  2AHZ A;  4C7U A;  1YF2 A;  5J2U B;  1PNK A;  4PEL A;  1IXB A;  3FB5 C;  1GM8 A;  4LNU B;  3ZMV A;  1FD9 A;  4FIP C;  2WSS G;  3ZCC A;  1E1Q G;  4GX2 A;  4DW0 A;  1F7Y A;  1M4U A;  4KL1 A;  1SKV A;  4TQD A;  4LFB O;  4DV0 B;  4JF3 A;  3KG2 A;  3AK3 A;  1K8A W;  3FKS G;  2H8P C;  3ZRW B;  3FAV A;  4OX9 O;  1ZX3 A;  4XDL A;  1G1X B;  3QVN A;  2ARH A;  3K0D A;  2WLM A;  4JI8 B;  2IW5 A;  1NT2 B;  3LSQ A;  2YIA A;  1IBM B;  1SRY A;  4K8X A;  5FNV A;  3K5N A;  1XBL A;  2Q5Z A;  4D7T A;  4UB6 Z;  5LL6 Y;  4HNA B;  2Q6A A;  4CS3 A;  1O9G A;  2DYR B;  2QWQ B;  5A9G A;  3PJS K;  4TOI A;  4MTX A;  1DF4 A;  1YXB A;  4JTD B;  1CP9 A;  3SYQ A;  4TV9 B;  3BA9 A;  3F7Y C;  1ARO P;  4EB6 A;  2QWO B;  2IU3 A;  1JJ2 U;  4KUM A;  4NXM B;  2QTS A;  1B06 A;  2LW1 A;  1J5E O;  4EEQ A;  2ZDI C;  1OCC B;  1TUB A;  3CCL V;  4CBC A;  3CYO A;  4QNH B;  3W7T A;  2YIB D;  5JWP A;  1O9H A;  4DR4 O;  1YDX A;  3ABL B;  1ZTE A;  4IHJ B;  4U7O A;  3QO7 A;  2OTL V;  4LF9 B;  2E75 B;  1HP8 A;  1E1R G;  3WG7 B;  3TGU H;  4TV8 B;  3HKE A;  4TWK A;  3WFV A;  2D2C B;  5CN0 A;  4O2A A;  1SQF A;  4LF6 B;  1I5Y A;  4U3J A;  2ZNJ A;  3U0Z A;  1DF5 A;  1HNX B;  3A8T A;  4JI3 B;  3K3W A;  3D36 C;  1J95 A;  5LYJ B;  4DR5 O;  1XHZ A;  1V9P A;  1XIL A;  5JH7 A;  4CC5 A;  5EZY B;  1XNQ O;  1D2D A;  1ZSP A;  3ETQ A;  3C3T A;  2WAM A;  1M90 W;  1JJO A;  1R6N A;  2NNU A;  5KAI Z;  3QNE A;  1VEW A;  1GTO A;  3BAB A;  5CB4 B;  2WLI B;  4JI2 O;  2NR5 A;  1Q86 W;  1QNM A;  3A2F A;  5BR8 B;  4O4L A;  4R7C A;  2JGD B;  4H33 A;  2YEV A;  1YTF D;  1Q81 W;  4DW1 A;  4KFM A;  2Q73 A;  4YJ2 A;  1F4M A;  1SER A;  5B66 Z;  5LHG A;  2QGN A;  3ZHQ A;  3L74 H;  4OX9 B;  1JCH A;  4GCZ A;  2WA3 A;  5GON B;  5TIS Z;  2DQ0 A;  4E2L A;  4FFB A;  2EIM B;  4JAU A;  3RYI B;  2O57 A;  4MTG A;  1K33 A;  3RYC B;  2R9I A;  1F51 A;  4J80 A;  3DGE A;  1JX9 A;  3ZMZ A;  4CH3 A;  2VQF B;  4ZHQ A;  1YJN V;  1DLB A;  1Z5W A;  3CJH B;  1URF A;  2AW9 A;  2PF4 E;  3K5L A;  3OGC C;  1XMQ O;  3F5W C;  2XT9 A;  3HKD A;  1NI8 A;  2RNB A;  4LWS A;  5KMG A;  5LP6 A;  3AG1 B;  4GUN A;  1AR1 B;  3H1I H;  3CRA A;  3BHP A;  3E8F A;  1DK1 A;  2CGO A;  2JEX A;  4AHC A;  3DTU B;  3BA8 A;  2Y0I A;  1P4R A;  2HR3 A;  1UPG A;  1VMG A;  1NH2 D;  1PV0 A;  3QF7 A;  1KQS U;  3L73 H;  3SJC C;  4EFB A;  2F23 A;  1VQK V;  1P7B A;  5CA0 B;  4DR4 B;  4JI7 B;  4K8Z A;  3RYH B;  2DWD C;  2KG7 A;  2ZIN A;  4A5U B;  3KCX A;  3CME V;  3DC6 A;  3CCE V;  1AIL A;  3C3S A;  4JGS A;  1H2K A;  4DYL A;  2EJR A;  3SPI A;  4NTX A;  2EX3 A;  3J81 N;  1GN4 A;  4MVR A;  1I94 O;  3CMA V;  3ABM C;  1BQ0 A;  4XDK A;  2K9P A;  3CCQ V;  5JQG A;  4LC1 A;  1XMO B;  3O9O A;  2OYQ A;  2EIL B;  2UXC O;  3SYP A;  3Q4H B;  3ZN0 A;  3BAA A;  3CRQ A;  2UUB O;  4PA6 A;  2C2A A;  3AK1 A;  1XQ8 A;  2WPD G;  1XEQ A;  3RN4 A;  1YHQ V;  1PP9 H;  4UB8 Z;  2QM7 A;  3MHS C;  1VQ4 V;  2EIN B;  2JGU A;  3AG2 B;  1M57 B;  2G38 A;  4TV9 A;  2M7W A;  3JD0 A;  3ZX6 A;  1KYO F;  1VF6 A;  4UFZ A;  5FLX N;  2P67 A;  4YHH B;  2BOC C;  3JSN A;  3NXS A;  4HBN A;  4JTC B;  4X64 B;  4BIU A;  1IXM A;  3OUS A;  3FB7 C;  1Y66 A;  1XUQ A;  4BIO A;  4FLV A;  2ZQM A;  4NXN B;  2BE3 A;  1VF7 A;  3ZHT A;  1WN7 A;  1KKC A;  2WA4 A;  4JV5 O;  4KP4 A;  1TVK A;  2UXD B;  5L3F A;  3CC7 V;  1US6 A;  2JJ2 G;  2XAS A;  5KA5 A;  3W7X A;  3FAV B;  3HB3 B;  1DGS A;  3CHX A;  3P30 A;  4E4E A;  1N32 B;  2AXT Z;  1HNW B;  3OE7 G;  2FKX A;  4TUY A;  4WFH A;  5FNV B;  4B3T O;  4MVM A;  2IJJ A;  5JJN B;  4X8A A;  3S3W A;  3E89 A;  4HYO A;  1QQC A;  2EIK B;  1H2S B;  5H2F Z;  2Q7H A;  4X89 A;  1AP6 A;  4UVC A;  3RYF A;  1Q82 W;  4X62 B;  3SGI A;  2ZE6 A;  3L70 H;  4LF8 B;  2XAF A;  4EB6 B;  1YIT V;  5LHH A;  3IC9 A;  2ZCE A;  1K9M W;  1Q6H A;  4CH5 A;  1V54 C;  4DK1 A;  3CCV V;  1CPY A;  4BR6 A;  2QKA A;  1GH6 A;  2UXN A;  2AZ0 A;  3VQV A;  5C8Y A;  3OW2 U;  3O65 A;  1VQ7 V;  4J41 A;  1L8D A;  3ZRV A;  4JI5 B;  5IWA B;  1MZE A;  2W0F C;  3F5T A;  3NR7 A;  4ABM A;  4B08 A;  4DR7 O;  4GKK B;  3U10 A;  3BVO A;  4B3S B;  2JJ1 G;  2X6A A;  5IJ9 B;  4DRX B;  3W7U A;  5DM6 V;  4H44 B;  3MD0 A;  1PL4 A;  1OCO C;  1RPR A;  1EN6 A;  1MOF A;  3JAR A;  3T1H O;  1LUV A;  2DYS C;  3E2E A;  3UKM A;  2GTS A;  1GN2 A;  3HKE B;  1QCE A;  2ZIM A;  4O2A B;  2CH7 B;  4B3R O;  4U3J B;  1B04 A;  4H13 B;  2P7T C;  2LGW A;  1IBL B;  1HNZ B;  3CEI A;  2UUC O;  4N23 A;  1L0N H;  3WB1 A;  2ZXW C;  5LBQ A;  4QJF B;  5JH7 B;  3CC4 V;  3RT3 C;  2ZR2 A;  4IGG A;  3T2M A;  5IY5 C;  4B3M B;  4D7S A;  2KQX A;  3KZI Z;  4CZZ A;  3DXR A;  4FLZ A;  4GT1 A;  1AJN A;  4O2B A;  2P6J A;  3ASO B;  5LMU B;  4MVQ A;  3W7W A;  5CBG A;  3T1Y O;  3MDS A;  1SS3 A;  4J7K A;  3ASN C;  4ASU G;  2FL4 A;  4I7Z B;  3JAS B;  3SPH A;  4O4L B;  5CA0 A;  2YEV B;  1ENV A;  1NBM G;  2KSD A;  2PTM A;  3E22 A;  3RYH A;  5IYD O;  2AGA A;  1WLE A;  3FFQ A;  4YJ2 B;  1T5E A;  5KHK A;  4JV5 B;  2EIJ C;  1KUQ A;  1SC5 B;  3CXC U;  5CBH A;  4QGP A;  3ZN1 A;  2HLD G;  3VBB A;  3I5D A;  3UT5 A;  2F4V B;  3AG1 C;  1JQ0 A;  1RSO A;  4XDJ A;  3LDE A;  5H5N A;  5EYP A;  5DED A;  1B3Q A;  5B1A B;  2Q9L A;  3CP1 A;  1OCZ B;  1XI1 A;  3ZHV A;  2V4D A;  1KB9 F;  3ETG A;  4FFB B;  1V55 B;  1GN6 A;  2FML A;  5L3G A;  4UCV A;  4LH7 A;  1D5N A;  2QA4 V;  3K03 A;  1FYJ A;  2YIC A;  2F93 B;  1IDS A;  5KUM A;  2LQT A;  2R9R B;  1S0V A;  2KB1 A;  1N36 O;  4DR2 O;  4ZHQ B;  4UCU A;  1GK9 A;  1SA0 A;  4LF5 B;  4DV1 B;  3STL C;  1EN4 A;  5B1B B;  4MTF A;  5IDJ A;  3HKD B;  2M6Y A;  4UCS A;  1H2N A;  1WPB A;  4MW8 A;  4LWS B;  4ZIB A;  5KMG B;  5LP6 B;  4LF4 B;  2HVK C;  4K35 A;  4UV8 A;  5JJJ B;  4FVM A;  1W0K G;  5B5E Z;  1BL8 A;  1N0J A;  4F6R A;  4G2K A;  2WLK A;  2HVJ C;  2OIE A;  3PN1 A;  3THO A;  1FFX A;  3RVZ A;  5B3S C;  2KG7 B;  4JPR A;  4CS2 A;  4D6T H;  2VQE B;  1RP3 B;  2Z0A A;  1SZT A;  4DR3 B;  2E74 B;  2ZT9 B;  1KMI Z;  2W0X A;  1ZL8 A;  2UXX A;  2A7W A;  2JDI G;  4DUY B;  3LUT B;  1Q5O A;  5JQG B;  3JAT A;  2JS3 A;  5FL7 G;  3TET A;  1PL0 A;  1TAE A;  2QR4 A;  4LF7 B;  3D8C A;  1IBK B;  1VQ5 V;  2QSA A;  2UXB O;  1EM1 A;  2UUC B;  1S72 V;  1XHX A;  3ZMU A;  1XOU A; 
#chains in the Genus database with same CATH homology
 2DQ0 A;  1AJP A;  2EBO A;  4E2L A;  5B1N A;  2EIM B;  2ZDI A;  4JAU A;  5HFM A;  2GSM B;  4MTG A;  4R8C A;  1K33 A;  4UXN A;  2OT5 A;  2R9I A;  1F51 A;  5CBH A;  4MVZ A;  1VQ9 V;  1S3J A;  1QVF U;  3AG4 C;  3DGE A;  1JX9 A;  3ZMZ A;  3K79 A;  2DW4 A;  1YI2 V;  3T1C A;  4WFA V;  5CBF A;  1NVP D;  5L3B A;  3IC7 A;  1K3E A;  1YJN V;  1DLB A;  3AG4 B;  1F4N A;  1YTF B;  1CEZ A;  1NQT A;  4R6Z A;  2DQ3 A;  1SES A;  3JCZ A;  4PA7 A;  3OGC C;  2Y48 A;  2WLH A;  1TUE B;  3F5W C;  1F23 A;  1EFR G;  2HG5 C;  1YIJ V;  3AG1 B;  4DO2 A;  2XND G;  4MSW C;  4RUF A;  1AR1 B;  1H2G A;  3FYE B;  4BW5 A;  3ZMS A;  1AI5 A;  1R3K C;  4H37 A;  2JIZ G;  3ETE A;  3E8F A;  3B77 A;  2JEX A;  1QBZ A;  1M56 C;  3DTU B;  1NKD A;  3SYO A;  3JD2 A;  1P4R A;  2HR3 A;  3VOU A;  1AI6 A;  3CCM V;  1NH2 D;  3B8M A;  3E8H A;  3P32 A;  1M56 B;  1KQS U;  1BHB A;  3OEE G;  5EK0 A;  1MAB G;  2JEU A;  1VQK V;  1P7B A;  1XL4 A;  2WLL B;  3TCU A;  1COW G;  1WPX A;  4N21 A;  5H9C A;  1FS0 G;  3HPL C;  1GM7 A;  1NR7 A;  1NVP B;  2DWD C;  2F43 G;  4LCU C;  3ZJZ A;  4BIZ A;  1YJ9 V;  3CME V;  2NLJ C;  3CCE V;  2WLI A;  4JGS A;  4TT3 G;  2HKO A;  4MS2 A;  2EJR A;  3SPI A;  4MVU A;  5IYC O;  5DN6 G;  3CD6 V;  3OAA G;  4X88 A;  4MVR A;  3CMA V;  3ABM C;  2OTJ V;  1VQN V;  3OR6 C;  4XDK A;  2EIL C;  3CCQ V;  3EFF K;  4LC1 A;  4MVS A;  4RO2 A;  4BAY A;  3ABM B;  2QEX V;  1KKD A;  2EIL B;  4JAS A;  3SYP A;  4Q20 A;  3ZN0 A;  4P9O A;  1NJI W;  4PA6 A;  1NH2 B;  1AI4 A;  4FJC C;  1L1F A;  2C2A A;  2IU0 A;  1OCR C;  1QR8 A;  4HAM A;  3AG3 C;  5EBW C;  3E35 A;  3SPJ A;  1AJQ A;  2EIN C;  2WPD G;  3B8N A;  4QE9 A;  1YJW V;  5C93 A;  3AG2 C;  1M57 C;  1YHQ V;  1KEC A;  2DWE C;  3AG3 B;  3F7V C;  2QM7 A;  5B1O A;  3MHS C;  1VQ4 V;  2EIN B;  3I56 V;  3EHB B;  3AG2 B;  1M57 B;  3IFX A;  1B6Q A;  4WFG A;  2WLN A;  1R3L C;  2M7W A;  3LDC A;  3JD0 A;  2XAH A;  3X2Q C;  1FFT B;  4ZBM A;  2P67 A;  2OCC C;  3TK1 A;  1H38 A;  3CCJ V;  3CCS V;  3ZRX A;  1JVM A;  2BOC C;  2X6C A;  3NXS A;  4J9Y B;  4RAI A;  4I9W A;  1VQ6 V;  3X2Q B;  2PI4 A;  4JTC B;  4BIU A;  1VQM V;  5BZB A;  2OCC B;  2IJH A;  2X0L A;  1VQO V;  1IXM A;  1BHA A;  3OUS A;  3FB7 C;  1Y66 A;  4J9Z B;  1K5Q A;  3MHH C;  1MSW D;  2K1E A;  3R65 A;  2ZQM A;  5H6R A;  4LBE C;  1R3J C;  1W2B U;  2LFS A;  3CCR V;  2BOB C;  2Y69 C;  2HJF C;  1S77 D;  4QPJ A;  1S72 V;  4RUE A;  4KP4 A;  5L3F A;  2Y69 B;  3OUF A;  3CC7 V;  1K73 W;  4I5S A;  2JJ2 G;  2XAS A;  5KA5 A;  3W7X A;  1RPO A;  1EBO A;  3RBZ A;  1VQL V;  3HB3 B;  2WLL A;  5LHI A;  2LFR A;  1M1K W;  1EZJ A;  3P30 A;  4GX1 A;  2XAQ A;  1ORQ C;  1DTO A;  3CC2 V;  3OE7 G;  1RM1 C;  1PNM A;  2WWW A;  5KA6 A;  4FMT A;  2ITC C;  1FXK C;  1PD3 A;  4WFH A;  4P9P A;  2EIK C;  4MVM A;  1R3I C;  1QLE C;  1XL6 A;  4OXS A;  5LGT A;  1RM1 B;  3G4S V;  2IJJ A;  1FXK B;  4X8A A;  3E89 A;  4HYO A;  4JYC A;  2V7Q G;  2EIK B;  2JK5 C;  5EBL C;  3OFN G;  1QLE B;  2XAJ A;  1LNQ A;  3ML0 A;  4X89 A;  2P90 A;  3ABK C;  3D36 A;  4UVC A;  2XAG A;  3ZRS A;  1NR1 A;  3CCU V;  1Q82 W;  3FYI B;  1I5X A;  3RVY A;  2MK3 A;  4WFB V;  5H6Q A;  4FPP A;  5HFL A;  3ABK B;  4GX5 A;  1HWY A;  2XOK G;  3H01 A;  1MG1 A;  3I55 V;  4GX0 A;  4UVA A;  1K97 A;  1QLN A;  4WF9 V;  2XAF A;  1YIT V;  3FB8 C;  3ETD A;  2PI5 A;  5LHH A;  2A0L A;  1KP2 A;  3BEH A;  3OEH G;  1PKX A;  4PDR A;  1K9M W;  1V54 C;  2IH3 C;  5L3E A;  1CPY A;  3CCV V;  3QO5 A;  2ATK C;  4PDL A;  2B1I A;  3RW0 A;  2HFE C;  3IGA C;  2UXN A;  1YSC A;  4G27 B;  1K34 A;  2Q69 A;  5IYB O;  3OW2 U;  1KC8 W;  2IH1 C;  2ITD C;  1V54 B;  3JYC A;  3ABT A;  1VQ7 V;  2YSU B;  1M9N A;  1KD1 W;  3ZRV A;  1FXH A;  2W0F C;  1H8H G;  4U7N A;  5GW7 A;  1OHH G;  2Q67 A;  4WFE A;  1G8M A;  2JJ1 G;  2AHZ A;  2WLJ A;  2X6A A;  4MT8 A;  1Y4M A;  3W7U A;  3K04 A;  5DM6 V;  1PNK A;  3MD0 A;  4PEL A;  3FB5 C;  1OCO C;  1GM8 A;  1RPR A;  1K4D C;  1MOF A;  4L87 A;  2DYS C;  1OCR B;  3SPG A;  3ZMV A;  3UKM A;  3E2E A;  4FIP C;  3G71 V;  2WSS G;  3E8B A;  1OCO B;  3ZCC A;  1E1Q G;  4GX2 A;  1FXV A;  2DYS B;  1QCE A;  1W0J G;  2EZO A;  4JF3 A;  2IJK A;  2GHY A;  3KG2 A;  2FTK A;  2P7T C;  1K8A W;  3FKS G;  2H8P C;  3ZRW B;  4MVO A;  4PDM A;  5LGN A;  5EBM C;  4N23 A;  5E1A C;  5EC2 C;  5EC1 C;  4XDL A;  2ZXW C;  5LBQ A;  4QJF B;  3K0D A;  2WLM A;  3CC4 V;  2IW5 A;  3OMI B;  2ZR2 A;  3LSQ A;  3T2M A;  3ASO C;  4FK5 C;  5IY5 C;  1SRY A;  5L3D A;  4CZZ A;  2ZXW B;  3D3I A;  1QVG U;  4GT1 A;  1AJN A;  5CMU A;  2P6J A;  1KP3 A;  2DYR C;  1FXK A;  3ASO B;  5IY5 B;  2B1G A;  5LGU A;  4MVQ A;  3W7W A;  2Q6A A;  2QTO A;  3LNM B;  4JYB A;  5CBG A;  1N8R W;  4HZ3 A;  3ASN C;  2DYR B;  2AHY A;  4ASU G;  3GB7 C;  3PJS K;  3SPH A;  1GKF A;  4MTX A;  1K92 A;  2YEV B;  1GM9 A;  2QM8 A;  1DF4 A;  4P30 A;  3ASN B;  5KUK A;  4JTD B;  1ENV A;  4MTO A;  1ZWI C;  1NBM G;  1H8E G;  4XBF A;  5IYD O;  4WFF A;  1WLE A;  4DXW A;  1CP9 A;  3SYQ A;  1GO3 F;  5CA3 A;  3CPW U;  3F7Y C;  3LSS A;  3T4D A;  2EIJ C;  1ARO P;  2IU3 A;  1JJ2 U;  2EZP A;  3CXC U;  1QR9 A;  4KUM A;  1OCC C;  4UUJ C;  3FB6 C;  5B1A C;  3ZN1 A;  3SPC A;  2HLD G;  3VBB A;  4MW3 A;  1K7D A;  1OCZ C;  4Z1M G;  2EIJ B;  2QKS A;  3AG1 C;  3ZMT A;  1JQ0 A;  2X7R B;  4XDJ A;  3LDE A;  2W6J G;  1V55 C;  2ZDI C;  1OCC B;  1G4Y B;  5B1A B;  3CP1 A;  3OM3 B;  3STZ C;  4ZKI A;  1OCZ B;  3CCL V;  4CBC A;  3CYO A;  2CK3 G;  4PDV A;  4QNH B;  3AEI A;  3OMA B;  3E86 A;  3ETG A;  3W7T A;  3T4Z A;  1V55 B;  3ABL C;  5L3G A;  4QIW F;  1K5S A;  3SJQ C;  3K9A A;  1S76 D;  2QA4 V;  3K03 A;  4P2Z A;  1K4C C;  1R6K A;  3ABL B;  5KUM A;  3WG7 C;  2R9R B;  1S0V A;  4U7O A;  2KB1 A;  3QO7 A;  2OTL V;  4PA3 A;  5B1B C;  2D3O W;  4QPK A;  2QE7 G;  1GK9 A;  1PNL A;  3G6E V;  1E1R G;  3WG7 B;  3OMN B;  2IJI A;  3STL C;  3E8G A;  1JOY A;  4R50 A;  5B1B B;  4MTF A;  2X6B A;  4UV9 A;  5IDJ A;  3W7S A;  2Z5U A;  4YXW G;  1S5H C;  1VQ8 V;  1SET A;  2LP7 A;  4TWK A;  4MW8 A;  3WFV A;  2H94 A;  5CN0 A;  3ZIA G;  4PA9 A;  1I5Y A;  3JD4 A;  1Q7Y W;  2HVK C;  2W6I G;  3K0G A;  4TSF G;  4UV8 A;  1DF5 A;  3ZRW A;  1W0K G;  4EKW A;  2ZR3 A;  5J9P C;  4RQF A;  3E83 A;  1BL8 A;  4G2K A;  3K3W A;  4LP8 A;  3K06 A;  3SYC A;  1J95 A;  2WLK A;  2Z3Y A;  4QE7 A;  2HVJ C;  4F4L A;  3UM7 A;  3ABU A;  1OZ0 A;  4G28 B;  4RQE A;  3BY6 A;  3JD1 A;  4PA4 A;  2WAM A;  1GMG A;  1M90 W;  1R6N A;  2NNU A;  3RVZ A;  5B3S C;  4JPR A;  3QNE A;  3M99 B;  1BMF G;  1GTO A;  2WLI B;  3LDD A;  3K08 A;  1Q86 W;  1SZT A;  4WCE V;  5B3S B;  5L3C A;  1R73 A;  2A79 B;  4R7C A;  4JAV A;  1AI7 A;  4H33 A;  3SYA A;  2YEV A;  1YTF D;  2UXX A;  1Q81 W;  2JDI G;  4UVB A;  3LUT B;  1UJW B;  3GWO A;  4KFM A;  2ZD9 A;  2A9H A;  1ROP A;  1E79 G;  5FL7 G;  1F4M A;  3TET A;  1PL0 A;  3A0R A;  1SER A;  3JD3 A;  1JPX A;  5LHG A;  3QO8 A;  1VQ5 V;  2B5U A;  2V1D A;  1JCH A;  2EIM C;  1VQP V;  1THZ A;  4GCZ A;  2Q68 A;  4JTA B;  3OR7 C;  3ZMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...