3ZCCA

High resolution structure of the asymmetric r333g hamp-dhp mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
110
structure length
110
Chain Sequence
STITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDGTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords HAMP, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Structure of Mutant of Hamp-Dhp Fusion
rcsb
source organism Archaeoglobus fulgidus
total genus 45
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2012-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zccA00
2FTKA 2LFSA 2LFRA 4QPJA 4U7OA 3P32A 4QPKA 4Q20A 3A0RA 4JAUA 2QM7A 3MD0A 4JYCA 4BIUA 4GCZA 4MT8A 4BIZA 4GT1A 3D36A 4JASA 3ZRWB 3DGEA 3TK1A 2QM8A 4JYBA 2C2AA 4JAVA 3NXSA 4FMTA 3ZCCA 4ZKIA 1IXMA 2P67A 4LC1A 4MTXA 5B1NA 1JOYA 4I5SA 2WWWA 5C93A 5IDJA 3ZRWA 4KP4A 3ZRVA 3ZRXA 4U7NA 4FPPA 5B1OA 1F51A
chains in the Genus database with same CATH superfamily
1GM8A 4FLVA 3QNEA 3SJAC 4CH3A 3P30A 3IC7A 5H2FZ 3CXCU 1B04A 5GONA 1S76D 1M9NA 4TWKA 2CDYA 4W4LA 3PN1A 1YSCA 4HNAB 2ADQB 3A2FA 5LP6C 1ZAUA 2UUBO 2JJ2G 4WCEV 4AQYO 5LP6B 1DTOA 3RT3C 4G28B 1JCHA 1TAEA 5TISZ 2QEXV 1HR0B 4JI5B 4JYCA 5KMGB 2H8PC 3JATA 3QVNA 3ZMZA 1F7YA 2UUCO 2DN9A 4JYBA 2Y69C 1RM1C 1Q82W 2OT5A 4J7ZA 3DTUB 2QSAA 4XBFA 2Y69B 4IIJA 2JJ1G 4O2AA 4I55A 1IBKB 4CS2A 2EILC 4JI7O 1IXBA 3RVZA 1I94B 4X1IB 1SQFA 3UCSC 3H1LH 5JCOA 1QLEC 4DR7O 5LHHA 2EILB 1K5SA 2DJVA 3OM3B 1QLEB 1S5HC 1OV9A 1FFXA 4DV0B 3L75H 3FYIB 1DK1A 3HKBA 1YI2V 2VQFO 1VARA 5B66Z 3B8NA 4IYHA 5GW7A 4DV2O 4LNUA 3D36A 3K0GA 3GB7C 5KHJA 4JAAA 2HJDA 1AB3A 4ZKIA 1TVKA 5BMVA 1SF9A 4UCTA 5C8YA 3RFRA 2CH7A 1H2NA 2LJ2A 4DRXA 1FD9A 3QO8A 2ZIMA 1WB8A 3SYPA 3JATB 3H9VA 1PNMA 3OAAG 2OCCC 2QM4A 2OWOA 1XREA 5CBFA 2M6YA 4FM1A 4JI2O 1NH2B 4BIUA 1H2GA 1NJIW 5LYJA 3W7TA 4D7SA 3JD0A 4O2AB 3LDEA 4FM2A 2CAZC 4OGQB 3BY6A 3F5WC 3UO3A 2IH3C 1K97A 4I9QA 5JCOC 2ADPA 2Q4PA 4LFAO 2ZE5A 1LR1A 1AP5A 1J5EO 2JEUA 1K4DC 5JH7B 1SZTA 2HR3A 2FKXA 2YS8A 1VQ6V 1GRJA 3HB3B 4TQDA 3CCRV 3ABUA 4FLTA 3HKEA 2F4VB 1T5EA 3N2GA 3C3TA 1SQBH 1EM1A 1R6NA 2EBOA 1GN3A 1P49A 3T1HB 3JD4A 1Y76B 1PNLA 2EINB 4LNUB 1JPXA 1XL4A 4NYKA 2IH1C 5CA0A 3K5LA 1MMMA 2YXYA 4ZIBA 1IBMO 1EZJA 2JGUA 4HZ3A 1FKAO 2P90A 1M57C 3ASNC 4B3MO 4F4LA 4B3SB 4JI6B 1Y67A 2C2AA 1RP3B 2EIJB 3ASNB 2DWEC 2GDSA 2D3OW 4X62B 5FNVA 1NVPB 1PKXA 3JAWB 1GK9A 4LH7A 1BL8A 2UXCO 1VP7A 3JAKB 5BXZA 1JFFA 4CZZA 1JR9A 2W6IG 4X1YA 2LO1A 4LF9O 1G6UA 5ITZA 4NR1A 4XDLA 5EIBC 2GSMB 2F66C 2YDEA 3ZRXA 3QO5A 1JX9A 1NR7A 5B3SB 1DF4A 1Q3EA 4BWAA 3K79A 2XAJA 3G6BA 3ZHRA 3RYHA 1QQCA 5H6QA 1ZTEA 1W59A 3W7UA 4IHJA 4FMTA 1SQVH 1B3QA 4DUYO 2ZM6O 4ZI7A 2R72A 1N33B 3AG1C 1K34A 4UV9A 4TV8A 3L74H 1S72V 2ITCC 2Q0OC 4J7KA 1GAXA 1BHAA 4I4TB 3HKDB 1DF5A 1KKCA 2AHYA 1VQLV 4J9ZB 1SQXH 1WPBA 2CGNA 5FNVB 4JI4B 2EX3A 2KKWA 2WLHA 4X9QA 3BHPA 1PV0A 3ZMUA 2MW2B 2PYLA 1HW7A 2Q7GA 3CRMA 2H94A 3CRRA 3OR7C 3CRAA 3K5NA 2PZSA 2B5UA 3CB2A 4JI0O 2N05A 1GH6A 5KLVH 3BVOA 3DXRA 3AK3A 1SA0A 3ZN0A 3ZBHA 1Z2GA 4MW8A 1F4NA 4DV7B 5IYBO 3L70H 1M93A 5IT9N 3K59A 3SYCA 4O4IB 2F23A 3P32A 2D2CB 2FB5A 4UXNA 1COWG 1H2SB 2KG7B 3ZMVA 1RPOA 4I0XA 5JQGB 1WAZA 1WN7A 2NN4A 3CXHF 1KYOF 1R73A 1CP9A 3JCZA 2EJRA 1NQTA 1EFRG 5LGNA 1NZ6A 2LFRA 1SERA 4BIOA 3MHHC 5CA1A 2O57A 3S3XA 2LW1A 4X88A 3LDDA 1MSDA 1B06A 5K1XA 4RUEA 1VQ8V 5EYPA 5C93A 2DOSA 5EC2C 1D5AA 4FLXA 4J10A 1QCEA 3APOA 4DR4B 4O4HB 1LUWA 4PDMA 3CC7V 2M7WA 2QKCA 1F23A 3D3QA 3DXRB 1GM7A 3SYQA 4LF7B 3ABLC 1PPJH 2RNBA 1VQ9V 1Q81W 3W7WA 1BE3H 4AILC 3TK1A 4PJ0Z 1X4TA 3ABLB 3N2KA 4MS2A 4DR2B 4AHCA 5LMUB 4RO2A 1N0JA 4H44B 2IU0A 2DYSC 1FS0G 4I0XB 1H2KA 5IJ0B 4CBCA 4PD4F 2B1IA 2N04A 4DV4B 2QGNA 3AG7A 4O4LA 4CC6A 3T2MA 5E79Z 3VQYA 2NNUA 5EK0A 2P7TC 1OCCB 2HVKC 1ROPA 4YHHO 1NKDA 4GKKB 1L8DA 3VBBA 5J9PC 4KHPO 1N34O 4X65B 4B7EA 2ZD9A 4YY3B 4X66O 4ZHQA 3OR6C 4MT8A 1H38A 1XBLA 2VQEO 3B8MA 5H6RA 2HVJC 4HYOA 2XUMA 1HNXO 2VWJA 4J41A 3FD9A 1R1BA 4NXMO 3SPGA 1W0JG 1IX9A 4H37A 5E1AC 2ILMA 3VQVA 1WA8B 4LF5O 3FAVA 4J42A 5KAIZ 2E5LO 4GT1A 4EB6B 1PM9A 2CTQA 3AK2A 5IYCO 3G80A 4O4LB 3UT5B 3E83A 3BFRA 4IL6Z 3SPCA 3E8GA 2V7QG 4PDLA 4X1KA 1RSOA 4AQYB 1OCZC 3OGCC 3SJCC 2XAFA 3VQWA 3IJ4A 2DWDC 3OMNB 3L9DA 2BTOA 1OCZB 4PA9A 1OZ0A 4MVQA 2A06H 2UUCB 2UU9O 1BMFG 1VQ7V 3K3WA 2YIBA 1OCRC 4Q6GA 3M7MX 1TA8A 1I5YA 2CUGA 1XILA 2Q6AA 1OCRB 5IYDO 3U10A 4CH6A 2BOCC 3FX7A 4JI7B 1BQ0A 1OCOC 5KHIA 2L35A 4K0KO 2IU3A 2PF4E 2E74B 4CC5A 4WBNA 4DR3B 1YZBA 1OCOB 1KQSU 1QNMA 3FB5C 1HNZB 1YVWA 2ZCEA 5DEDA 5B1OA 1SESA 3ETQA 1O9HA 1NH2D 2KQXA 4IYIA 4H33A 4DR5O 1THZA 1XMQO 2HHHO 2EZOA 4DV2B 5A9GA 4RQFA 4JI3O 3KZIZ 2EULA 2K9PA 5D5QA 4H0LB 1EN6A 1Q8IA 2GV9A 3JASA 2RMKB 2Z0AA 1MZEA 1G8MA 4FLWA 4DW0A 1KB9F 4ASUG 2UXDO 3Q4HA 4DK0A 2FMLA 2B9ZA 4U3FH 1XDCA 4JI2B 2ZIOA 4Z1MG 4O4JA 2XAHA 4K3AA 4P9OA 5D5PA 2Q5ZA 4KUMA 3ZRWA 4KP4A 1HNWB 4DV6B 5J2TB 4R50A 1MSWD 5IYZB 3ZRSA 1IVSA 3WB0A 2UUAB 2GBOA 1E1RG 4U7OA 3SJQC 1AROP 1H2MA 2ZDIA 4UV8A 4WBNB 2ZT9B 2BTQB 3GWOA 1NTMH 5CMUA 1Y4MA 3KG2A 1IURA 2IM9A 1Y66A 4PA7A 1NVPD 2LW7A 1AR5A 2QR4A 3E22A 4FK5C 5LA6B 4OX9O 2P4KA 3PJSK 1X59A 1YEWA 3CHXA 1K3EA 3OT7A 4LWSA 4FM0A 4LF6O 1IBLB 4PDRA 1SZXA 3O9OA 3CJHA 1KMIZ 2ZR3A 1NT2B 2Z5UA 3K08A 1ZWIC 3JSLA 5EIBD 1MZFA 3RYFB 1RM1B 2R70A 4ZOLB 1N32O 2IJIA 4UCVA 4DR6O 3APQA 3H1HH 3U0ZA 3B09A 3A0RA 5EBWC 3MD0A 1KU9A 2UXCB 3ZRWB 1VQOV 5BR8B 1YIJV 3N27A 3ZMSA 2ZDIC 1VIBA 3T1CA 3LNMB 3O65A 1JJOA 2PYJA 4EKWA 4U7NA 2RN9A 5GONB 2P4VA 4DYLA 5L3GA 4GX0A 4TOIA 5L3FA 4WFAV 2X0LA 3RYCA 1A32A 3K57A 1ORQC 3ML0A 2R9RB 1GN4A 2ETNA 4L87A 2Y0IA 1AP6A 2PTMA 3L73H 3T1YO 4MTOA 1N36B 4GCZA 3M99B 1PL0A 3G67A 2QA4V 2QWQB 2AXTZ 4LFCB 2QJ1A 1AR4A 2OTLV 2QE7G 4GKJB 1R3LC 3JALA 1WP8A 4UVCA 3WB1A 4DUYB 1I7FA 4UCUA 4X20A 3J81N 3JARA 3AG3C 3GVMA 5KAFZ 2IJKA 2P6JA 4PELA 4JYAO 5J2UA 2JIZG 3L71H 1Q5OA 3F7YC 1AJPA 1MG1A 2OCCB 4IIJB 2ARHA 1US6A 4I55B 2Q67A 4LC1A 2FL4A 3EFFK 1FJGO 2LP7A 2JS3A 5IWAO 5EBLC 1SQGA 2GTAA 2QTSA 4KFMA 1FPOA 4JZ2A 2EIMC 3UQ8A 4L8JA 4DV3O 3ZHSA 1YXBA 2ITDC 1XNQB 4QJFB 1RPRA 1FFXB 3OEHG 1AI7A 5BZBA 2EIMB 4LF4O 3HKBB 4LH6A 1XMOO 4IGGA 4GZRB 2CE4A 2P22C 3D36C 2YEVA 3JSNA 2RCVA 2Q68A 3SYAA 1N0NA 2HLDG 2PGGA 2XTAA 1XNRB 3ZEDA 1TVKB 5BMVB 5C8YB 2CH7B 4NXNB 3CX5F 4DRXB 3RBZA 5B1NA 1M57B 2CTWA 3K06A 3TGUH 1TGOA 2A0LA 3AG4C 3I56V 1HR0O 5LMNB 5LYJB 1XHXA 2JEXA 5A2QN 5FLXN 3IFXA 1KP2A 3D3IA 1I08A 4B7KA 1S0VA 1IZ3A 5GTHZ 1H2LA 5JWPA 2VS0A 1IBKO 3I55V 3RN4A 2Q0AA 2Q69A 4B3TO 3HKEB 4A5UB 3N2GB 4JGSA 1Q90D 4WFBV 3L72H 4BW5A 2UXBB 2ZE8A 3BAAA 2EIKC 4JASA 4JV5B 1XQ8A 2X6BA 2YEVB 4DV0O 1ZL8A 1QHTA 3CWBH 5JJEB 2JVDA 1P84F 5CA0B 3FB8C 4X64B 3U11A 1M56C 4K8XA 4XDKA 2DQ0A 5LXTA 4DUZB 3AG1B 1VQKV 4J11A 3IAYA 5B1BC 5L3EA 4MTGA 3EVKA 1LNQA 5B1BB 3G6EV 4YIPA 1K8AW 4BR6A 3CCEV 4MW3A 1YF2A 3CC4V 1JFFB 1NS1A 1L1FA 2IW5A 4X1YB 3QTCA 3FB7C 1KD1W 4WFFA 3AG2C 3CRCA 5ITZB 1FXKA 5KX5A 3TXSA 1P7GA 2JGDA 5EZYA 3WU2Z 3AG2B 1SC5B 2ODMA 4TT3G 1D2DA 4JI8O 4LFBO 1GO3F 1WP7A 2RQ6A 1G1XB 2AGAA 1HNXB 4B3RB 3KCXA 3RYHB 4GX5A 1N4CA 4X8AA 4YJ3A 3STLC 3OTFA 2OIGA 4NXMB 4IHJB 1ZL8B 4DV5B 4YJ2A 1GKFA 4JAUA 2WAMA 3T1HO 4ZI7B 1E1QG 4QE9A 3B2EE 2CTPA 3OTOO 3RYIA 1Y74A 4TV8B 5KHGA 2RDCA 1BCCH 1MA1A 2KB1A 4XDJA 1GN2A 2DQ3A 1YITV 1XEQA 4B3SO 4HBNA 1K7DA 3B4SA 1XHZA 4MVRA 3JYCA 3KKYA 3C3SA 4JI1O 1FFTB 5IY5C 4X62O 2P67A 3CCQV 4UB6Z 2QKSA 2ZXWC 1QBZA 3JD3A 4UB8Z 3OUSA 5KUKA 3QF7A 2P06A 4FLZA 4G2KA 1S3JA 4P9PA 3SGIA 4U3JA 3BEHA 4TV9A 1ZX3A 4DV1B 1HDJA 3OD4A 3H1IH 3D8CA 3MAQA 5KUMA 2H3OA 1SA0B 4OXSA 4QGPA 1JA8A 2YICA 2QWOB 4I9WA 1ZLZA 4J80A 4LF8O 5LOVA 2Y48A 2CGOA 3BRCA 3VQXA 1VEWA 1JMKC 2WLKA 3ZMTA 5KA6A 1QR9A 2ATKC 1S77D 3ASOC 2DYSB 4WFGA 1BS3A 1R3JC 1N33O 1FYJA 3K04A 1CEZA 2AZ0A 4MVOA 3JD1A 3HKCA 3MDSA 3CYOA 5CA1B 3C90A 4WF9V 5CB4A 2XT9A 1MABG 1KBHA 4JI4O 3CRQA 4BAYA 1BGYH 5EYPB 3QO7A 5LGUA 2K1EA 2PI5A 2ZR2A 3UO2A 2GUZA 3WG7C 4U3JB 1V54C 3VOUA 4O2BA 1YTFD 3CP1A 1V9PA 1VMGA 2WLIA 1V54B 2X7RB 1EZVH 4D6TH 4DO2A 1L0LH 3CCUV 4FLYA 5IJ9A 3IGAC 5LOVB 1U97A 3N2KB 4JTDB 3BCCH 2DYRC 3H1KH 1XI1A 1WPXA 2JK5C 4F6RA 4DV7O 1R6KA 3EXAA 4NB5A 4K8ZA 1FXVA 4JZGA 2DYRB 4FPPA 5DN6G 1R6TA 3K5MA 2Q8VA 4OX9B 2UUBB 2W0XA 4C7UA 2PUSA 2HKOA 2OCHA 3A8TA 4FVMA 4BW9A 1N8RW 1VF5B 3KCYA 2WLLA 3TJTA 2EZPA 1CXZB 2BE3A 5CBGA 4ZHQB 1HWYA 2GTSA 1BSMA 1WJZA 1YCIA 5B5EZ 2GHYA 2G38A 3X2QC 3H01A 2ZINA 4GX2A 3K0DA 4TSFG 2YUAA 4DW1A 3S3WA 5H5NA 4DR7B 3JD2A 2YIAA 2MK3A 2PY5A 3WFVA 4JPRA 1NR1A 4DR4O 4PA3A 4PDVA 3FAVB 4QPKA 1ENVA 4LF7O 2L6LA 3RWRD 2VQFB 4KL1A 4FIPC 1XL6A 2ZKOA 1AI6A 3CCLV 3K9AA 2QDOA 2V1DA 4CH4A 1B6QA 3SR2C 4DR2O 5LMUO 1KECA 4MVZA 4X1KB 1RSOB 4HAMA 3RVYA 3E86A 4NVPA 3SPJA 4HNAA 4DV4O 4GX1A 4P30A 2XHBA 4YIOA 1HP8A 5LP6A 3BPZA 4EFBA 1CPYA 4LR3A 2UXNA 4GKKO 1WNSA 5KMGA 4MTXA 3UM7A 4X65O 3K58A 4YY3O 2QKAA 1JVMA 1SETA 2ZQMA 4LFAB 2LGWA 2LFSA 2YXHA 2ZE7A 1J5EB 4I50A 4JYYA 2QM7A 3CMAV 4DV3B 4KXRA 4X1IA 5JVDA 4JAVA 2R9AA 3ZCCA 4QE7A 1NU1H 3CMEV 1VQ5V 2ZNIA 3OE7G 1OJHA 3T4DA 1QU7A 5LHIA 1FAFA 1M1KW 1YTFB 3E89A 1NTZH 5L3DA 2JRIA 1PL4A 3THOA 5LGTA 1IBMB 4OPHA 2XNDG 1QVFU 3E2EA 2QM8A 3JASB 3LNNA 4W4KA 4B3MB 1P4RA 3FYEB 4UCRA 2DW4A 3Q4HB 1BQZA 3T4ZA 3ZX6A 2HFEC 1AI4A 4O4JB 2XOKG 1AJNA 4LCUC 4AI8A 2QTOA 2PI4A 3ZHQA 1IXMA 2Y0PA 1L0NH 4I50B 2XASA 4LF9B 3OUFA 1BT8A 1LUVA 3AEIA 1WLEA 4NTWA 1Q43A 3J7AU 5FPOA 5JVDB 5L3CA 4B3TB 5JH7A 4UCSA 3OMIB 5LL6Y 1PD3A 4DR3O 3E22B 4NTYA 3E8BA 1WB7A 2ZE6A 4GLXA 1R3KC 1HNZO 4H13B 2W0FC 3BA9A 1K5QA 1EN5A 2YI8A 2QWPB 4LWSB 2ZM6B 4MVSA 5JJNB 1Y76A 2DE0X 3CCJV 2YXLA 4J9YB 3CJHB 1GTOA 4PHZA 5EBMC 4UVAA 4I7ZB 3AG3B 3TETA 3ZHUA 4WFEA 1XUQA 1PP9H 1U96A 4GYCB 2NLJC 1I0HA 1TUEB 3HPLC 1JQ0A 1Q6HA 1VQPV 2A9HA 2HP8A 3JAWA 4MVMA 3M8AA 2WPDG 1QVGU 1UJWB 4N21A 4QNHB 3JAKA 5CA3A 1HNWO 4JI0B 4DV6O 3DC5A 4GUNA 3CC2V 4DR1O 3F5TA 3ZJZA 3RYCB 2UUAO 2F1MA 4JI8B 3LSUA 4LFBB 5KHKA 2E75B 1SQQH 2E3CA 3AK1A 1AR1B 2VRZA 1Z5VA 4R8CA 3ABMC 3JCUZ 2Q7EA 1K92A 1BZKA 2EINC 3JALB 4X20B 3ABMB 5L3BA 1KC8W 3JARB 1MOFA 3OTOB 1NBMG 3OFNG 5J2UB 1YJNV 5DM6V 1IBLO 2AZ2A 2F95B 4JI5O 1GN6A 3NR7A 3AG4B 4MTFA 2EIJC 1KKDA 3G71V 3SDLA 3NXSA 4I4TA 4JI1B 2HEPA 3HKDA 4K35A 2LGQA 1VQ4V 1JJ2U 3W7SA 2WLMA 1GM9A 5K1PA 3ABTA 3TCUA 2V4DA 1I94O 4MSWC 1DGSA 3CEIA 2X6CA 4IT5A 5CBHA 2QWNB 5BR8O 4RAIA 1AVMA 4UVBA 3OW2U 3A0HZ 1ZSPA 1GMGA 5B3SC 1SKVA 4D7TA 4UCOA 2EIKB 3EHBB 3QG5A 4LF8B 1EBOA 3ETDA 1Y6XA 3LSSA 3TXQA 4PA4A 3LSQA 2OTJV 2UXXA 4DXWA 1N36O 3W7XA 4ZBMA 1M56B 3P3NA 4LFCO 2ZNJA 1K33A 1MNGA 4Z2WA 4O4IA 3CD6V 4GKJO 3LDCA 1F4MA 2YIDA 1M5IA 2KG7A 1UPGA 3R65A 3RGBA 1KP3A 5JQGA 1DLBA 3A0BZ 4YHHB 4CS3A 4WFHA 5JJJB 3G4SV 4KHPB 1N34B 2CTRA 3ETGA 4X66B 1SQPH 4PA6A 3OEEG 3DGEA 5FPRA 3DC6A 4MVUA 1VQMV 1OHHG 2N74A 3GWKC 3ZIAG 1JOYA 3B77A 1J95A 1P7BA 4I5SA 2WWWA 2VQEB 1QR8A 1W0KG 3OGIB 2WSSG 1XNQO 3BABA 3ABKC 1H8HG 4P2ZA 2F4VO 5CN0A 4JTAB 1NTKH 4BIZA 3ABKB 4O4HA 4LF5B 3CSXA 4FJCC 2E5LB 1URFA 1O9GA 5LXTB 4EEQA 4NKGB 5AG2A 1XNRO 4E4EA 3JAMN 1H8EG 4PI0A 4FFBA 4NXNO 1VQNV 3HR0A 1I5XA 5LBQA 4JI6O 5H9CA 4R7CA 5HFMA 2JS5A 1NI8A 5IJ0A 1V55C 3CS5A 2B1GA 3LUTB 4X89A 4FLUA 4FFKA 1QLNA 1V55B 1FXKC 3ICXA 4ICGA 5LMNO 4J7JA 5IY5B 4TUYA 1K4CC 3SPHA 2UU9B 2E76B 2ZXWB 1FXKB 3E8HA 4EFEA 5KX5B 1XOUA 2P5OA 1AI5A 2JGDB 2VWKA 5EZYB 1K73W 3P3PA 1TUBA 1Z5WA 2XAQA 1BHBA 3MHSC 1RFYA 4CS4A 2HJFC 1VF6A 4UUJC 4K0KB 4YJ3B 3ETEA 2LQTA 4YJ2B 3FB6C 1ZUQA 1AILA 1IDSA 2UXBO 4JV5O 5FL7G 3RYIB 3ZHVA 5HFLA 4E2LA 1Y74B 1YDXA 2YIBD 4DR5B 5KHHA 5IE9A 1WA8A 4X64O 1XMQB 2HHHB 2A3QA 3ASOB 3BA8A 1PNKA 4JI3B 4EB6A 4FFBB 3E8FA 3R66A 1W2BU 4DUZO 1KUQA 2CK3G 2F93B 2Q7HA 2KSDA 5BY1A 3UT5A 4OPAA 2YC0A 1OCCC 1K9MW 1SS3A 4R6ZA 1FXHA 2UXDB 3F7VC 2A7WA 4N23A 4TUYB 4DK1A 3CCMV 4TV9B 3CPWU 2Y4TA 2OYQA 1F51A 4G27B 3WG7B 2FTKA 1TUBB 1VF6C 5B1AC 4FZ1A 4Z1VA 4QPJA 3OMAB 5KA5A 5B1AB 5EC1C 1S5LZ 4B08A 2WA3A 4B3RO 2YSUB 2JDIG 3ZRVA 3FKSG 4DV5O 2Z3YA 3IC9A 1YJ9V 1YJWV 3CCSV 3E35A 3RW0A 2Q9LA 4YXWG 1M90W 4LF6B 1SRYA 3HKCB 4F6EA 3DSQA 2RJZA 1E79G 3SJBC 5CB4B 3B40A 2HG5C 2DMXA 3K03A 4NTXA 2WA4A 3H1JH 3SPIA 1N32B 2BSKA 1Q86W 1UFIA 2Y4UA 4DR6B 2GUZB 2FYUH 4O2BB 3K9SA 3X2QB 3ZHTA 2BCCH 2WLIB 3STZC 1R3IC 2IJHA 1VF7A 1Q6UA 3ZN1A 4QIWF 2WLJA 4DV1O 5GTIZ 2XAGA 5IJ9B 3I5DA 4FZ0A 5LHGA 5J2TA 4Q20A 3K5OA 4ABMA 5IYZA 2EJ7A 3CE2A 2OIEA 1D5NA 4F6RB 3WB2A 1AJQA 1S5JA 3CCVV 3T1YB 1Q7YW 2BTQA 4LBEC 2F43G 5IDJA 4RUFA 4RQEA 3ZS8C 5LA6A 4JTCB 2WLLB 2W6JG 1Q6IA 4LP8A 4JYAB 4PV1B 3FFQA 2IJJA 4PI2A 2IBZH 1M4UA 2AW9A 2BSKB 1EN4A 4CH5A 1FJGB 4JF3A 2WLNA 2QWRB 3UKMA 3RYFA 2R9IA 4RWUA 4ZOLA 5IWAB 2NR5A 5F2VO 4UFZA 2Q73A 2AHZA 5DECA 2YI9A 2X6AA 3SYOA 1YHQV 1G4YB 4TQFA 2BOBC 2A79B 4LF4B 3J80N 4DR1B 1XMOB
chains in the Genus database with same CATH topology
3SPGA 4GX5A 1GM8A 4X8AA 1W0JG 3QNEA 3STLC 1AR1B 3P30A 3IC7A 4H37A 5E1AC 3CXCU 1S76D 1GKFA 4JAUA 4R8CA 1M9NA 2WAMA 3ABMC 4TWKA 4GT1A 1K92A 1E1QG 4QE9A 2EINC 1YSCA 5L3BA 3ABMB 1KC8W 1MOFA 2JJ2G 1NBMG 5IYCO 4WCEV 2KB1A 3OFNG 4XDJA 3E83A 1YJNV 5DM6V 1DTOA 2DQ3A 4G28B 3SPCA 1JCHA 3E8GA 2V7QG 4PDLA 1YITV 1OCZC 1K7DA 3OGCC 2QEXV 2XAFA 3AG4B 4MTFA 2DWDC 2EIJC 4MVRA 3JYCA 3OMNB 4JYCA 2H8PC 1FFTB 1OCZB 3ZMZA 3G71V 4PA9A 1KKDA 4JYBA 2Y69C 1RM1C 1Q82W 3NXSA 5IY5C 2OT5A 1OZ0A 2P67A 3CCQV 4MVQA 2QKSA 2ZXWC 1QBZA 1BMFG 3DTUB 3W7SA 3JD3A 4XBFA 1JJ2U 2Y69B 2WLMA 1GM9A 2JJ1G 3OUSA 5KUKA 3K3WA 1VQ7V 3ABTA 3TCUA 1OCRC 4G2KA 1S3JA 4P9PA 4MSWC 3BEHA 1I5YA 2EILC 2X6CA 3RVZA 5CBHA 2Q6AA 1OCRB 1VQ4V 5IYDO 4RAIA 2BOCC 1QLEC 4UVBA 3OW2U 5LHHA 2EILB 1OCOC 5KUMA 4OXSA 1K5SA 2IU3A 3OM3B 4I9WA 1GMGA 5B3SC 1QLEB 1S5HC 1OCOB 1KQSU 2EIKB 2Y48A 3FB5C 3EHBB 3FYIB 1YI2V 1EBOA 3ETDA 3LSSA 2WLKA 5B1OA 3B8NA 3LSQA 4PA4A 2OTJV 2UXXA 3ZMTA 1SESA 4DXWA 1NH2D 5KA6A 3W7XA 4H33A 1QR9A 4ZBMA 2ATKC 5GW7A 1M56B 1S77D 1THZA 3ASOC 1K33A 2EZOA 2DYSB 3D36A 4WFGA 3CD6V 3K0GA 3GB7C 4RQFA 3LDCA 1F4MA 1R3JC 4ZKIA 3K04A 3R65A 1CEZA 1KP3A 1DLBA 4MVOA 3JD1A 3QO8A 1G8MA 3CYOA 3SYPA 4WF9V 1PNMA 3OAAG 4WFHA 2OCCC 4ASUG 3G4SV 3ETGA 1MABG 5CBFA 1NH2B 4BIUA 4BAYA 4PA6A 1H2GA 3OEEG 3QO7A 5LGUA 1NJIW 3W7TA 3DGEA 3JD0A 2K1EA 4MVUA 2PI5A 3LDEA 1VQMV 2ZR2A 1OHHG 4Z1MG 2XAHA 3BY6A 3F5WC 4P9OA 3ZIAG 3WG7C 2IH3C 1K97A 1JOYA 3B77A 1J95A 1P7BA 1V54C 4I5SA 2WWWA 3VOUA 4KUMA 1QR8A 3ZRWA 4KP4A 1YTFD 3CP1A 2JEUA 2WLIA 1W0KG 4R50A 1MSWD 1K4DC 1SZTA 3ZRSA 1V54B 2WSSG 2HR3A 2X7RB 3ABKC 1H8HG 4P2ZA 1E1RG 4U7OA 3SJQC 1VQ6V 1AROP 2ZDIA 4DO2A 3HB3B 4UV8A 5CN0A 3CCRV 3GWOA 4JTAB 3ABUA 3CCUV 5CMUA 1Y4MA 3KG2A 3ABKB 3IGAC 4BIZA 1R6NA 1Y66A 4JTDB 2EBOA 4PA7A 4FJCC 2DYRC 1NVPD 3JD4A 4FK5C 1WPXA 2JK5C 1R6KA 1PNLA 2EINB 3PJSK 1FXVA 2DYRB 4FPPA 1JPXA 1XL4A 5DN6G 2IH1C 1H8EG 2HKOA 1K3EA 1VQNV 1I5XA 1EZJA 5LBQA 5H9CA 4PDRA 4R7CA 4HZ3A 5HFMA 1N8RW 2P90A 1M57C 3ASNC 4F4LA 1V55C 2WLLA 2C2AA 2B1GA 2ZR3A 3LUTB 2Z5UA 2EIJB 2EZPA 4X89A 3K08A 1ZWIC 3ASNB 1QLNA 1V55B 2DWEC 2D3OW 1FXKC 5CBGA 1RM1B 5IY5B 1NVPB 1K4CC 1PKXA 3SPHA 2IJIA 1HWYA 2ZXWB 2GHYA 1FXKB 1GK9A 3E8HA 3X2QC 1BL8A 3H01A 3A0RA 4GX2A 1AI5A 3K0DA 4TSFG 5EBWC 1K73W 3MD0A 3ZRWB 2XAQA 4CZZA 1VQOV 1YIJV 2W6IG 1BHBA 3ZMSA 3MHSC 2ZDIC 3JD2A 2HJFC 2MK3A 3T1CA 3LNMB 4UUJC 3WFVA 4JPRA 4XDLA 2GSMB 1NR1A 3ETEA 4EKWA 3ZRXA 3QO5A 1JX9A 1NR7A 4PA3A 4PDVA 4U7NA 5B3SB 5L3GA 3FB6C 4QPKA 4GX0A 1DF4A 5L3FA 4WFAV 1ENVA 2X0LA 3K79A 2XAJA 1ORQC 3ML0A 2R9RB 4L87A 5FL7G 4FIPC 1XL6A 5H6QA 1AI6A 4E2LA 5HFLA 4MTOA 3CCLV 4GCZA 3M99B 3K9AA 3W7UA 1PL0A 2QA4V 2V1DA 1B6QA 4FMTA 3ASOB 2OTLV 2QE7G 1KECA 1PNKA 4MVZA 1R3LC 4HAMA 3RVYA 3E86A 4UVCA 3E8FA 3AG1C 1W2BU 1K34A 4UV9A 3SPJA 2CK3G 4GX1A 1S72V 3AG3C 4P30A 2ITCC 2IJKA 2P6JA 4PELA 1BHAA 2JIZG 1OCCC 1DF5A 2AHYA 1K9MW 1VQLV 4R6ZA 1FXHA 1CPYA 4J9ZB 2UXNA 1AJPA 1MG1A 3F7YC 2OCCB 3F7VC 4N23A 3CCMV 2Q67A 2WLHA 4LC1A 4MTXA 3UM7A 3EFFK 3ZMUA 2LP7A 3CPWU 1JVMA 1SETA 2ZQMA 1F51A 4G27B 5EBLC 3WG7B 2FTKA 2LFSA 2H94A 3OR7C 4KFMA 5B1AC 4QPJA 2EIMC 2B5UA 2ITDC 3OMAB 2QM7A 4QJFB 5KA5A 3CMAV 5B1AB 1RPRA 5EC1C 3OEHG 1AI7A 5BZBA 2EIMB 4JAVA 3ZCCA 4QE7A 3CMEV 2YSUB 1VQ5V 3OE7G 2JDIG 3ZN0A 2YEVA 3ZRVA 3FKSG 4MW8A 3T4DA 2Q68A 1F4NA 3SYAA 2HLDG 5IYBO 5LHIA 1M1KW 1YTFB 2Z3YA 3SYCA 3P32A 1YJ9V 3E89A 4UXNA 5L3DA 1COWG 1YJWV 5LGTA 3CCSV 3E35A 2XNDG 3RW0A 3ZMVA 1QVFU 3E2EA 1RPOA 4YXWG 1M90W 2QM8A 1SRYA 3RBZA 1R73A 1P4RA 1CP9A 3FYEB 5B1NA 1E79G 1M57B 3JCZA 2EJRA 3K06A 1NQTA 1EFRG 2A0LA 3AG4C 5LGNA 2DW4A 2HG5C 3K03A 3I56V 3T4ZA 2LFRA 1SERA 3SPIA 2JEXA 2HFEC 1AI4A 3MHHC 1Q86W 3IFXA 1KP2A 3D3IA 2XOKG 1AJNA 4LCUC 2QTOA 4X88A 3LDDA 3X2QB 1S0VA 2PI4A 1IXMA 2WLIB 4RUEA 3STZC 1VQ8V 1R3IC 2IJHA 5C93A 5EC2C 2XASA 3OUFA 3I55V 3ZN1A 1QCEA 4QIWF 2WLJA 3AEIA 2Q69A 2XAGA 1WLEA 4PDMA 3CC7V 2M7WA 5L3CA 5LHGA 4JGSA 4Q20A 1F23A 1GM7A 3OMIB 3SYQA 3ABLC 4WFBV 1VQ9V 4BW5A 1PD3A 1Q81W 2EIKC 3E8BA 4JASA 3W7WA 3TK1A 1R3KC 2X6BA 2YEVB 1AJQA 3CCVV 1Q7YW 3ABLB 4LBEC 2F43G 2W0FC 3FB8C 5IDJA 1K5QA 4MS2A 4RUFA 1M56C 4RQEA 4RO2A 4MVSA 4XDKA 2IU0A 2DYSC 1FS0G 2DQ0A 4JTCB 4J9YB 3CCJV 4CBCA 2B1IA 2WLLB 1GTOA 2W6JG 3AG1B 5EBMC 4UVAA 1VQKV 3T2MA 4LP8A 5B1BC 3AG3B 5L3EA 4MTGA 3TETA 2NNUA 2IJJA 5EK0A 4WFEA 2P7TC 1OCCB 1LNQA 2HVKC 1ROPA 5B1BB 1NKDA 2NLJC 3VBBA 3G6EV 5J9PC 1K8AW 1TUEB 3CCEV 3HPLC 1JQ0A 4MW3A 1VQPV 2A9HA 2ZD9A 4JF3A 3CC4V 2WLNA 3UKMA 2R9IA 1L1FA 2IW5A 4MVMA 3FB7C 1KD1W 4WFFA 3AG2C 2WPDG 3OR6C 4MT8A 1H38A 1FXKA 1QVGU 1UJWB 2AHZA 4N21A 3B8MA 4QNHB 5H6RA 5CA3A 3AG2B 4TT3G 2X6AA 2HVJC 4HYOA 3SYOA 3CC2V 1YHQV 1G4YB 1GO3F 3ZJZA 2BOBC 2A79B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FTK A;  2LFS A;  2LFR A;  4QPJ A;  4U7O A;  3P32 A;  4QPK A;  4Q20 A;  3A0R A;  4JAU A;  2QM7 A;  3MD0 A;  4JYC A;  4BIU A;  4GCZ A;  4MT8 A;  4BIZ A;  4GT1 A;  3D36 A;  4JAS A;  3ZRW B;  3DGE A;  3TK1 A;  2QM8 A;  4JYB A;  2C2A A;  4JAV A;  3NXS A;  4FMT A;  3ZCC A;  4ZKI A;  1IXM A;  2P67 A;  4LC1 A;  4MTX A;  5B1N A;  1JOY A;  4I5S A;  2WWW A;  5C93 A;  5IDJ A;  3ZRW A;  4KP4 A;  3ZRV A;  3ZRX A;  4U7N A;  4FPP A;  5B1O A;  1F51 A; 
#chains in the Genus database with same CATH topology
 1GM8 A;  4FLV A;  3QNE A;  3SJA C;  4CH3 A;  3P30 A;  3IC7 A;  5H2F Z;  3CXC U;  1B04 A;  5GON A;  1S76 D;  1M9N A;  4TWK A;  2CDY A;  4W4L A;  3PN1 A;  1YSC A;  4HNA B;  2ADQ B;  3A2F A;  5LP6 C;  1ZAU A;  2UUB O;  2JJ2 G;  4WCE V;  4AQY O;  5LP6 B;  1DTO A;  3RT3 C;  4G28 B;  1JCH A;  1TAE A;  5TIS Z;  2QEX V;  1HR0 B;  4JI5 B;  4JYC A;  5KMG B;  2H8P C;  3JAT A;  3QVN A;  3ZMZ A;  1F7Y A;  2UUC O;  2DN9 A;  4JYB A;  2Y69 C;  1RM1 C;  1Q82 W;  2OT5 A;  4J7Z A;  3DTU B;  2QSA A;  4XBF A;  2Y69 B;  4IIJ A;  2JJ1 G;  4O2A A;  4I55 A;  1IBK B;  4CS2 A;  2EIL C;  4JI7 O;  1IXB A;  3RVZ A;  1I94 B;  4X1I B;  1SQF A;  3UCS C;  3H1L H;  5JCO A;  1QLE C;  4DR7 O;  5LHH A;  2EIL B;  1K5S A;  2DJV A;  3OM3 B;  1QLE B;  1S5H C;  1OV9 A;  1FFX A;  4DV0 B;  3L75 H;  3FYI B;  1DK1 A;  3HKB A;  1YI2 V;  2VQF O;  1VAR A;  5B66 Z;  3B8N A;  4IYH A;  5GW7 A;  4DV2 O;  4LNU A;  3D36 A;  3K0G A;  3GB7 C;  5KHJ A;  4JAA A;  2HJD A;  1AB3 A;  4ZKI A;  1TVK A;  5BMV A;  1SF9 A;  4UCT A;  5C8Y A;  3RFR A;  2CH7 A;  1H2N A;  2LJ2 A;  4DRX A;  1FD9 A;  3QO8 A;  2ZIM A;  1WB8 A;  3SYP A;  3JAT B;  3H9V A;  1PNM A;  3OAA G;  2OCC C;  2QM4 A;  2OWO A;  1XRE A;  5CBF A;  2M6Y A;  4FM1 A;  4JI2 O;  1NH2 B;  4BIU A;  1H2G A;  1NJI W;  5LYJ A;  3W7T A;  4D7S A;  3JD0 A;  4O2A B;  3LDE A;  4FM2 A;  2CAZ C;  4OGQ B;  3BY6 A;  3F5W C;  3UO3 A;  2IH3 C;  1K97 A;  4I9Q A;  5JCO C;  2ADP A;  2Q4P A;  4LFA O;  2ZE5 A;  1LR1 A;  1AP5 A;  1J5E O;  2JEU A;  1K4D C;  5JH7 B;  1SZT A;  2HR3 A;  2FKX A;  2YS8 A;  1VQ6 V;  1GRJ A;  3HB3 B;  4TQD A;  3CCR V;  3ABU A;  4FLT A;  3HKE A;  2F4V B;  1T5E A;  3N2G A;  3C3T A;  1SQB H;  1EM1 A;  1R6N A;  2EBO A;  1GN3 A;  1P49 A;  3T1H B;  3JD4 A;  1Y76 B;  1PNL A;  2EIN B;  4LNU B;  1JPX A;  1XL4 A;  4NYK A;  2IH1 C;  5CA0 A;  3K5L A;  1MMM A;  2YXY A;  4ZIB A;  1IBM O;  1EZJ A;  2JGU A;  4HZ3 A;  1FKA O;  2P90 A;  1M57 C;  3ASN C;  4B3M O;  4F4L A;  4B3S B;  4JI6 B;  1Y67 A;  2C2A A;  1RP3 B;  2EIJ B;  3ASN B;  2DWE C;  2GDS A;  2D3O W;  4X62 B;  5FNV A;  1NVP B;  1PKX A;  3JAW B;  1GK9 A;  4LH7 A;  1BL8 A;  2UXC O;  1VP7 A;  3JAK B;  5BXZ A;  1JFF A;  4CZZ A;  1JR9 A;  2W6I G;  4X1Y A;  2LO1 A;  4LF9 O;  1G6U A;  5ITZ A;  4NR1 A;  4XDL A;  5EIB C;  2GSM B;  2F66 C;  2YDE A;  3ZRX A;  3QO5 A;  1JX9 A;  1NR7 A;  5B3S B;  1DF4 A;  1Q3E A;  4BWA A;  3K79 A;  2XAJ A;  3G6B A;  3ZHR A;  3RYH A;  1QQC A;  5H6Q A;  1ZTE A;  1W59 A;  3W7U A;  4IHJ A;  4FMT A;  1SQV H;  1B3Q A;  4DUY O;  2ZM6 O;  4ZI7 A;  2R72 A;  1N33 B;  3AG1 C;  1K34 A;  4UV9 A;  4TV8 A;  3L74 H;  1S72 V;  2ITC C;  2Q0O C;  4J7K A;  1GAX A;  1BHA A;  4I4T B;  3HKD B;  1DF5 A;  1KKC A;  2AHY A;  1VQL V;  4J9Z B;  1SQX H;  1WPB A;  2CGN A;  5FNV B;  4JI4 B;  2EX3 A;  2KKW A;  2WLH A;  4X9Q A;  3BHP A;  1PV0 A;  3ZMU A;  2MW2 B;  2PYL A;  1HW7 A;  2Q7G A;  3CRM A;  2H94 A;  3CRR A;  3OR7 C;  3CRA A;  3K5N A;  2PZS A;  2B5U A;  3CB2 A;  4JI0 O;  2N05 A;  1GH6 A;  5KLV H;  3BVO A;  3DXR A;  3AK3 A;  1SA0 A;  3ZN0 A;  3ZBH A;  1Z2G A;  4MW8 A;  1F4N A;  4DV7 B;  5IYB O;  3L70 H;  1M93 A;  5IT9 N;  3K59 A;  3SYC A;  4O4I B;  2F23 A;  3P32 A;  2D2C B;  2FB5 A;  4UXN A;  1COW G;  1H2S B;  2KG7 B;  3ZMV A;  1RPO A;  4I0X A;  5JQG B;  1WAZ A;  1WN7 A;  2NN4 A;  3CXH F;  1KYO F;  1R73 A;  1CP9 A;  3JCZ A;  2EJR A;  1NQT A;  1EFR G;  5LGN A;  1NZ6 A;  2LFR A;  1SER A;  4BIO A;  3MHH C;  5CA1 A;  2O57 A;  3S3X A;  2LW1 A;  4X88 A;  3LDD A;  1MSD A;  1B06 A;  5K1X A;  4RUE A;  1VQ8 V;  5EYP A;  5C93 A;  2DOS A;  5EC2 C;  1D5A A;  4FLX A;  4J10 A;  1QCE A;  3APO A;  4DR4 B;  4O4H B;  1LUW A;  4PDM A;  3CC7 V;  2M7W A;  2QKC A;  1F23 A;  3D3Q A;  3DXR B;  1GM7 A;  3SYQ A;  4LF7 B;  3ABL C;  1PPJ H;  2RNB A;  1VQ9 V;  1Q81 W;  3W7W A;  1BE3 H;  4AIL C;  3TK1 A;  4PJ0 Z;  1X4T A;  3ABL B;  3N2K A;  4MS2 A;  4DR2 B;  4AHC A;  5LMU B;  4RO2 A;  1N0J A;  4H44 B;  2IU0 A;  2DYS C;  1FS0 G;  4I0X B;  1H2K A;  5IJ0 B;  4CBC A;  4PD4 F;  2B1I A;  2N04 A;  4DV4 B;  2QGN A;  3AG7 A;  4O4L A;  4CC6 A;  3T2M A;  5E79 Z;  3VQY A;  2NNU A;  5EK0 A;  2P7T C;  1OCC B;  2HVK C;  1ROP A;  4YHH O;  1NKD A;  4GKK B;  1L8D A;  3VBB A;  5J9P C;  4KHP O;  1N34 O;  4X65 B;  4B7E A;  2ZD9 A;  4YY3 B;  4X66 O;  4ZHQ A;  3OR6 C;  4MT8 A;  1H38 A;  1XBL A;  2VQE O;  3B8M A;  5H6R A;  2HVJ C;  4HYO A;  2XUM A;  1HNX O;  2VWJ A;  4J41 A;  3FD9 A;  1R1B A;  4NXM O;  3SPG A;  1W0J G;  1IX9 A;  4H37 A;  5E1A C;  2ILM A;  3VQV A;  1WA8 B;  4LF5 O;  3FAV A;  4J42 A;  5KAI Z;  2E5L O;  4GT1 A;  4EB6 B;  1PM9 A;  2CTQ A;  3AK2 A;  5IYC O;  3G80 A;  4O4L B;  3UT5 B;  3E83 A;  3BFR A;  4IL6 Z;  3SPC A;  3E8G A;  2V7Q G;  4PDL A;  4X1K A;  1RSO A;  4AQY B;  1OCZ C;  3OGC C;  3SJC C;  2XAF A;  3VQW A;  3IJ4 A;  2DWD C;  3OMN B;  3L9D A;  2BTO A;  1OCZ B;  4PA9 A;  1OZ0 A;  4MVQ A;  2A06 H;  2UUC B;  2UU9 O;  1BMF G;  1VQ7 V;  3K3W A;  2YIB A;  1OCR C;  4Q6G A;  3M7M X;  1TA8 A;  1I5Y A;  2CUG A;  1XIL A;  2Q6A A;  1OCR B;  5IYD O;  3U10 A;  4CH6 A;  2BOC C;  3FX7 A;  4JI7 B;  1BQ0 A;  1OCO C;  5KHI A;  2L35 A;  4K0K O;  2IU3 A;  2PF4 E;  2E74 B;  4CC5 A;  4WBN A;  4DR3 B;  1YZB A;  1OCO B;  1KQS U;  1QNM A;  3FB5 C;  1HNZ B;  1YVW A;  2ZCE A;  5DED A;  5B1O A;  1SES A;  3ETQ A;  1O9H A;  1NH2 D;  2KQX A;  4IYI A;  4H33 A;  4DR5 O;  1THZ A;  1XMQ O;  2HHH O;  2EZO A;  4DV2 B;  5A9G A;  4RQF A;  4JI3 O;  3KZI Z;  2EUL A;  2K9P A;  5D5Q A;  4H0L B;  1EN6 A;  1Q8I A;  2GV9 A;  3JAS A;  2RMK B;  2Z0A A;  1MZE A;  1G8M A;  4FLW A;  4DW0 A;  1KB9 F;  4ASU G;  2UXD O;  3Q4H A;  4DK0 A;  2FML A;  2B9Z A;  4U3F H;  1XDC A;  4JI2 B;  2ZIO A;  4Z1M G;  4O4J A;  2XAH A;  4K3A A;  4P9O A;  5D5P A;  2Q5Z A;  4KUM A;  3ZRW A;  4KP4 A;  1HNW B;  4DV6 B;  5J2T B;  4R50 A;  1MSW D;  5IYZ B;  3ZRS A;  1IVS A;  3WB0 A;  2UUA B;  2GBO A;  1E1R G;  4U7O A;  3SJQ C;  1ARO P;  1H2M A;  2ZDI A;  4UV8 A;  4WBN B;  2ZT9 B;  2BTQ B;  3GWO A;  1NTM H;  5CMU A;  1Y4M A;  3KG2 A;  1IUR A;  2IM9 A;  1Y66 A;  4PA7 A;  1NVP D;  2LW7 A;  1AR5 A;  2QR4 A;  3E22 A;  4FK5 C;  5LA6 B;  4OX9 O;  2P4K A;  3PJS K;  1X59 A;  1YEW A;  3CHX A;  1K3E A;  3OT7 A;  4LWS A;  4FM0 A;  4LF6 O;  1IBL B;  4PDR A;  1SZX A;  3O9O A;  3CJH A;  1KMI Z;  2ZR3 A;  1NT2 B;  2Z5U A;  3K08 A;  1ZWI C;  3JSL A;  5EIB D;  1MZF A;  3RYF B;  1RM1 B;  2R70 A;  4ZOL B;  1N32 O;  2IJI A;  4UCV A;  4DR6 O;  3APQ A;  3H1H H;  3U0Z A;  3B09 A;  3A0R A;  5EBW C;  3MD0 A;  1KU9 A;  2UXC B;  3ZRW B;  1VQO V;  5BR8 B;  1YIJ V;  3N27 A;  3ZMS A;  2ZDI C;  1VIB A;  3T1C A;  3LNM B;  3O65 A;  1JJO A;  2PYJ A;  4EKW A;  4U7N A;  2RN9 A;  5GON B;  2P4V A;  4DYL A;  5L3G A;  4GX0 A;  4TOI A;  5L3F A;  4WFA V;  2X0L A;  3RYC A;  1A32 A;  3K57 A;  1ORQ C;  3ML0 A;  2R9R B;  1GN4 A;  2ETN A;  4L87 A;  2Y0I A;  1AP6 A;  2PTM A;  3L73 H;  3T1Y O;  4MTO A;  1N36 B;  4GCZ A;  3M99 B;  1PL0 A;  3G67 A;  2QA4 V;  2QWQ B;  2AXT Z;  4LFC B;  2QJ1 A;  1AR4 A;  2OTL V;  2QE7 G;  4GKJ B;  1R3L C;  3JAL A;  1WP8 A;  4UVC A;  3WB1 A;  4DUY B;  1I7F A;  4UCU A;  4X20 A;  3J81 N;  3JAR A;  3AG3 C;  3GVM A;  5KAF Z;  2IJK A;  2P6J A;  4PEL A;  4JYA O;  5J2U A;  2JIZ G;  3L71 H;  1Q5O A;  3F7Y C;  1AJP A;  1MG1 A;  2OCC B;  4IIJ B;  2ARH A;  1US6 A;  4I55 B;  2Q67 A;  4LC1 A;  2FL4 A;  3EFF K;  1FJG O;  2LP7 A;  2JS3 A;  5IWA O;  5EBL C;  1SQG A;  2GTA A;  2QTS A;  4KFM A;  1FPO A;  4JZ2 A;  2EIM C;  3UQ8 A;  4L8J A;  4DV3 O;  3ZHS A;  1YXB A;  2ITD C;  1XNQ B;  4QJF B;  1RPR A;  1FFX B;  3OEH G;  1AI7 A;  5BZB A;  2EIM B;  4LF4 O;  3HKB B;  4LH6 A;  1XMO O;  4IGG A;  4GZR B;  2CE4 A;  2P22 C;  3D36 C;  2YEV A;  3JSN A;  2RCV A;  2Q68 A;  3SYA A;  1N0N A;  2HLD G;  2PGG A;  2XTA A;  1XNR B;  3ZED A;  1TVK B;  5BMV B;  5C8Y B;  2CH7 B;  4NXN B;  3CX5 F;  4DRX B;  3RBZ A;  5B1N A;  1M57 B;  2CTW A;  3K06 A;  3TGU H;  1TGO A;  2A0L A;  3AG4 C;  3I56 V;  1HR0 O;  5LMN B;  5LYJ B;  1XHX A;  2JEX A;  5A2Q N;  5FLX N;  3IFX A;  1KP2 A;  3D3I A;  1I08 A;  4B7K A;  1S0V A;  1IZ3 A;  5GTH Z;  1H2L A;  5JWP A;  2VS0 A;  1IBK O;  3I55 V;  3RN4 A;  2Q0A A;  2Q69 A;  4B3T O;  3HKE B;  4A5U B;  3N2G B;  4JGS A;  1Q90 D;  4WFB V;  3L72 H;  4BW5 A;  2UXB B;  2ZE8 A;  3BAA A;  2EIK C;  4JAS A;  4JV5 B;  1XQ8 A;  2X6B A;  2YEV B;  4DV0 O;  1ZL8 A;  1QHT A;  3CWB H;  5JJE B;  2JVD A;  1P84 F;  5CA0 B;  3FB8 C;  4X64 B;  3U11 A;  1M56 C;  4K8X A;  4XDK A;  2DQ0 A;  5LXT A;  4DUZ B;  3AG1 B;  1VQK V;  4J11 A;  3IAY A;  5B1B C;  5L3E A;  4MTG A;  3EVK A;  1LNQ A;  5B1B B;  3G6E V;  4YIP A;  1K8A W;  4BR6 A;  3CCE V;  4MW3 A;  1YF2 A;  3CC4 V;  1JFF B;  1NS1 A;  1L1F A;  2IW5 A;  4X1Y B;  3QTC A;  3FB7 C;  1KD1 W;  4WFF A;  3AG2 C;  3CRC A;  5ITZ B;  1FXK A;  5KX5 A;  3TXS A;  1P7G A;  2JGD A;  5EZY A;  3WU2 Z;  3AG2 B;  1SC5 B;  2ODM A;  4TT3 G;  1D2D A;  4JI8 O;  4LFB O;  1GO3 F;  1WP7 A;  2RQ6 A;  1G1X B;  2AGA A;  1HNX B;  4B3R B;  3KCX A;  3RYH B;  4GX5 A;  1N4C A;  4X8A A;  4YJ3 A;  3STL C;  3OTF A;  2OIG A;  4NXM B;  4IHJ B;  1ZL8 B;  4DV5 B;  4YJ2 A;  1GKF A;  4JAU A;  2WAM A;  3T1H O;  4ZI7 B;  1E1Q G;  4QE9 A;  3B2E E;  2CTP A;  3OTO O;  3RYI A;  1Y74 A;  4TV8 B;  5KHG A;  2RDC A;  1BCC H;  1MA1 A;  2KB1 A;  4XDJ A;  1GN2 A;  2DQ3 A;  1YIT V;  1XEQ A;  4B3S O;  4HBN A;  1K7D A;  3B4S A;  1XHZ A;  4MVR A;  3JYC A;  3KKY A;  3C3S A;  4JI1 O;  1FFT B;  5IY5 C;  4X62 O;  2P67 A;  3CCQ V;  4UB6 Z;  2QKS A;  2ZXW C;  1QBZ A;  3JD3 A;  4UB8 Z;  3OUS A;  5KUK A;  3QF7 A;  2P06 A;  4FLZ A;  4G2K A;  1S3J A;  4P9P A;  3SGI A;  4U3J A;  3BEH A;  4TV9 A;  1ZX3 A;  4DV1 B;  1HDJ A;  3OD4 A;  3H1I H;  3D8C A;  3MAQ A;  5KUM A;  2H3O A;  1SA0 B;  4OXS A;  4QGP A;  1JA8 A;  2YIC A;  2QWO B;  4I9W A;  1ZLZ A;  4J80 A;  4LF8 O;  5LOV A;  2Y48 A;  2CGO A;  3BRC A;  3VQX A;  1VEW A;  1JMK C;  2WLK A;  3ZMT A;  5KA6 A;  1QR9 A;  2ATK C;  1S77 D;  3ASO C;  2DYS B;  4WFG A;  1BS3 A;  1R3J C;  1N33 O;  1FYJ A;  3K04 A;  1CEZ A;  2AZ0 A;  4MVO A;  3JD1 A;  3HKC A;  3MDS A;  3CYO A;  5CA1 B;  3C90 A;  4WF9 V;  5CB4 A;  2XT9 A;  1MAB G;  1KBH A;  4JI4 O;  3CRQ A;  4BAY A;  1BGY H;  5EYP B;  3QO7 A;  5LGU A;  2K1E A;  2PI5 A;  2ZR2 A;  3UO2 A;  2GUZ A;  3WG7 C;  4U3J B;  1V54 C;  3VOU A;  4O2B A;  1YTF D;  3CP1 A;  1V9P A;  1VMG A;  2WLI A;  1V54 B;  2X7R B;  1EZV H;  4D6T H;  4DO2 A;  1L0L H;  3CCU V;  4FLY A;  5IJ9 A;  3IGA C;  5LOV B;  1U97 A;  3N2K B;  4JTD B;  3BCC H;  2DYR C;  3H1K H;  1XI1 A;  1WPX A;  2JK5 C;  4F6R A;  4DV7 O;  1R6K A;  3EXA A;  4NB5 A;  4K8Z A;  1FXV A;  4JZG A;  2DYR B;  4FPP A;  5DN6 G;  1R6T A;  3K5M A;  2Q8V A;  4OX9 B;  2UUB B;  2W0X A;  4C7U A;  2PUS A;  2HKO A;  2OCH A;  3A8T A;  4FVM A;  4BW9 A;  1N8R W;  1VF5 B;  3KCY A;  2WLL A;  3TJT A;  2EZP A;  1CXZ B;  2BE3 A;  5CBG A;  4ZHQ B;  1HWY A;  2GTS A;  1BSM A;  1WJZ A;  1YCI A;  5B5E Z;  2GHY A;  2G38 A;  3X2Q C;  3H01 A;  2ZIN A;  4GX2 A;  3K0D A;  4TSF G;  2YUA A;  4DW1 A;  3S3W A;  5H5N A;  4DR7 B;  3JD2 A;  2YIA A;  2MK3 A;  2PY5 A;  3WFV A;  4JPR A;  1NR1 A;  4DR4 O;  4PA3 A;  4PDV A;  3FAV B;  4QPK A;  1ENV A;  4LF7 O;  2L6L A;  3RWR D;  2VQF B;  4KL1 A;  4FIP C;  1XL6 A;  2ZKO A;  1AI6 A;  3CCL V;  3K9A A;  2QDO A;  2V1D A;  4CH4 A;  1B6Q A;  3SR2 C;  4DR2 O;  5LMU O;  1KEC A;  4MVZ A;  4X1K B;  1RSO B;  4HAM A;  3RVY A;  3E86 A;  4NVP A;  3SPJ A;  4HNA A;  4DV4 O;  4GX1 A;  4P30 A;  2XHB A;  4YIO A;  1HP8 A;  5LP6 A;  3BPZ A;  4EFB A;  1CPY A;  4LR3 A;  2UXN A;  4GKK O;  1WNS A;  5KMG A;  4MTX A;  3UM7 A;  4X65 O;  3K58 A;  4YY3 O;  2QKA A;  1JVM A;  1SET A;  2ZQM A;  4LFA B;  2LGW A;  2LFS A;  2YXH A;  2ZE7 A;  1J5E B;  4I50 A;  4JYY A;  2QM7 A;  3CMA V;  4DV3 B;  4KXR A;  4X1I A;  5JVD A;  4JAV A;  2R9A A;  3ZCC A;  4QE7 A;  1NU1 H;  3CME V;  1VQ5 V;  2ZNI A;  3OE7 G;  1OJH A;  3T4D A;  1QU7 A;  5LHI A;  1FAF A;  1M1K W;  1YTF B;  3E89 A;  1NTZ H;  5L3D A;  2JRI A;  1PL4 A;  3THO A;  5LGT A;  1IBM B;  4OPH A;  2XND G;  1QVF U;  3E2E A;  2QM8 A;  3JAS B;  3LNN A;  4W4K A;  4B3M B;  1P4R A;  3FYE B;  4UCR A;  2DW4 A;  3Q4H B;  1BQZ A;  3T4Z A;  3ZX6 A;  2HFE C;  1AI4 A;  4O4J B;  2XOK G;  1AJN A;  4LCU C;  4AI8 A;  2QTO A;  2PI4 A;  3ZHQ A;  1IXM A;  2Y0P A;  1L0N H;  4I50 B;  2XAS A;  4LF9 B;  3OUF A;  1BT8 A;  1LUV A;  3AEI A;  1WLE A;  4NTW A;  1Q43 A;  3J7A U;  5FPO A;  5JVD B;  5L3C A;  4B3T B;  5JH7 A;  4UCS A;  3OMI B;  5LL6 Y;  1PD3 A;  4DR3 O;  3E22 B;  4NTY A;  3E8B A;  1WB7 A;  2ZE6 A;  4GLX A;  1R3K C;  1HNZ O;  4H13 B;  2W0F C;  3BA9 A;  1K5Q A;  1EN5 A;  2YI8 A;  2QWP B;  4LWS B;  2ZM6 B;  4MVS A;  5JJN B;  1Y76 A;  2DE0 X;  3CCJ V;  2YXL A;  4J9Y B;  3CJH B;  1GTO A;  4PHZ A;  5EBM C;  4UVA A;  4I7Z B;  3AG3 B;  3TET A;  3ZHU A;  4WFE A;  1XUQ A;  1PP9 H;  1U96 A;  4GYC B;  2NLJ C;  1I0H A;  1TUE B;  3HPL C;  1JQ0 A;  1Q6H A;  1VQP V;  2A9H A;  2HP8 A;  3JAW A;  4MVM A;  3M8A A;  2WPD G;  1QVG U;  1UJW B;  4N21 A;  4QNH B;  3JAK A;  5CA3 A;  1HNW O;  4JI0 B;  4DV6 O;  3DC5 A;  4GUN A;  3CC2 V;  4DR1 O;  3F5T A;  3ZJZ A;  3RYC B;  2UUA O;  2F1M A;  4JI8 B;  3LSU A;  4LFB B;  5KHK A;  2E75 B;  1SQQ H;  2E3C A;  3AK1 A;  1AR1 B;  2VRZ A;  1Z5V A;  4R8C A;  3ABM C;  3JCU Z;  2Q7E A;  1K92 A;  1BZK A;  2EIN C;  3JAL B;  4X20 B;  3ABM B;  5L3B A;  1KC8 W;  3JAR B;  1MOF A;  3OTO B;  1NBM G;  3OFN G;  5J2U B;  1YJN V;  5DM6 V;  1IBL O;  2AZ2 A;  2F95 B;  4JI5 O;  1GN6 A;  3NR7 A;  3AG4 B;  4MTF A;  2EIJ C;  1KKD A;  3G71 V;  3SDL A;  3NXS A;  4I4T A;  4JI1 B;  2HEP A;  3HKD A;  4K35 A;  2LGQ A;  1VQ4 V;  1JJ2 U;  3W7S A;  2WLM A;  1GM9 A;  5K1P A;  3ABT A;  3TCU A;  2V4D A;  1I94 O;  4MSW C;  1DGS A;  3CEI A;  2X6C A;  4IT5 A;  5CBH A;  2QWN B;  5BR8 O;  4RAI A;  1AVM A;  4UVB A;  3OW2 U;  3A0H Z;  1ZSP A;  1GMG A;  5B3S C;  1SKV A;  4D7T A;  4UCO A;  2EIK B;  3EHB B;  3QG5 A;  4LF8 B;  1EBO A;  3ETD A;  1Y6X A;  3LSS A;  3TXQ A;  4PA4 A;  3LSQ A;  2OTJ V;  2UXX A;  4DXW A;  1N36 O;  3W7X A;  4ZBM A;  1M56 B;  3P3N A;  4LFC O;  2ZNJ A;  1K33 A;  1MNG A;  4Z2W A;  4O4I A;  3CD6 V;  4GKJ O;  3LDC A;  1F4M A;  2YID A;  1M5I A;  2KG7 A;  1UPG A;  3R65 A;  3RGB A;  1KP3 A;  5JQG A;  1DLB A;  3A0B Z;  4YHH B;  4CS3 A;  4WFH A;  5JJJ B;  3G4S V;  4KHP B;  1N34 B;  2CTR A;  3ETG A;  4X66 B;  1SQP H;  4PA6 A;  3OEE G;  3DGE A;  5FPR A;  3DC6 A;  4MVU A;  1VQM V;  1OHH G;  2N74 A;  3GWK C;  3ZIA G;  1JOY A;  3B77 A;  1J95 A;  1P7B A;  4I5S A;  2WWW A;  2VQE B;  1QR8 A;  1W0K G;  3OGI B;  2WSS G;  1XNQ O;  3BAB A;  3ABK C;  1H8H G;  4P2Z A;  2F4V O;  5CN0 A;  4JTA B;  1NTK H;  4BIZ A;  3ABK B;  4O4H A;  4LF5 B;  3CSX A;  4FJC C;  2E5L B;  1URF A;  1O9G A;  5LXT B;  4EEQ A;  4NKG B;  5AG2 A;  1XNR O;  4E4E A;  3JAM N;  1H8E G;  4PI0 A;  4FFB A;  4NXN O;  1VQN V;  3HR0 A;  1I5X A;  5LBQ A;  4JI6 O;  5H9C A;  4R7C A;  5HFM A;  2JS5 A;  1NI8 A;  5IJ0 A;  1V55 C;  3CS5 A;  2B1G A;  3LUT B;  4X89 A;  4FLU A;  4FFK A;  1QLN A;  1V55 B;  1FXK C;  3ICX A;  4ICG A;  5LMN O;  4J7J A;  5IY5 B;  4TUY A;  1K4C C;  3SPH A;  2UU9 B;  2E76 B;  2ZXW B;  1FXK B;  3E8H A;  4EFE A;  5KX5 B;  1XOU A;  2P5O A;  1AI5 A;  2JGD B;  2VWK A;  5EZY B;  1K73 W;  3P3P A;  1TUB A;  1Z5W A;  2XAQ A;  1BHB A;  3MHS C;  1RFY A;  4CS4 A;  2HJF C;  1VF6 A;  4UUJ C;  4K0K B;  4YJ3 B;  3ETE A;  2LQT A;  4YJ2 B;  3FB6 C;  1ZUQ A;  1AIL A;  1IDS A;  2UXB O;  4JV5 O;  5FL7 G;  3RYI B;  3ZHV A;  5HFL A;  4E2L A;  1Y74 B;  1YDX A;  2YIB D;  4DR5 B;  5KHH A;  5IE9 A;  1WA8 A;  4X64 O;  1XMQ B;  2HHH B;  2A3Q A;  3ASO B;  3BA8 A;  1PNK A;  4JI3 B;  4EB6 A;  4FFB B;  3E8F A;  3R66 A;  1W2B U;  4DUZ O;  1KUQ A;  2CK3 G;  2F93 B;  2Q7H A;  2KSD A;  5BY1 A;  3UT5 A;  4OPA A;  2YC0 A;  1OCC C;  1K9M W;  1SS3 A;  4R6Z A;  1FXH A;  2UXD B;  3F7V C;  2A7W A;  4N23 A;  4TUY B;  4DK1 A;  3CCM V;  4TV9 B;  3CPW U;  2Y4T A;  2OYQ A;  1F51 A;  4G27 B;  3WG7 B;  2FTK A;  1TUB B;  1VF6 C;  5B1A C;  4FZ1 A;  4Z1V A;  4QPJ A;  3OMA B;  5KA5 A;  5B1A B;  5EC1 C;  1S5L Z;  4B08 A;  2WA3 A;  4B3R O;  2YSU B;  2JDI G;  3ZRV A;  3FKS G;  4DV5 O;  2Z3Y A;  3IC9 A;  1YJ9 V;  1YJW V;  3CCS V;  3E35 A;  3RW0 A;  2Q9L A;  4YXW G;  1M90 W;  4LF6 B;  1SRY A;  3HKC B;  4F6E A;  3DSQ A;  2RJZ A;  1E79 G;  3SJB C;  5CB4 B;  3B40 A;  2HG5 C;  2DMX A;  3K03 A;  4NTX A;  2WA4 A;  3H1J H;  3SPI A;  1N32 B;  2BSK A;  1Q86 W;  1UFI A;  2Y4U A;  4DR6 B;  2GUZ B;  2FYU H;  4O2B B;  3K9S A;  3X2Q B;  3ZHT A;  2BCC H;  2WLI B;  3STZ C;  1R3I C;  2IJH A;  1VF7 A;  1Q6U A;  3ZN1 A;  4QIW F;  2WLJ A;  4DV1 O;  5GTI Z;  2XAG A;  5IJ9 B;  3I5D A;  4FZ0 A;  5LHG A;  5J2T A;  4Q20 A;  3K5O A;  4ABM A;  5IYZ A;  2EJ7 A;  3CE2 A;  2OIE A;  1D5N A;  4F6R B;  3WB2 A;  1AJQ A;  1S5J A;  3CCV V;  3T1Y B;  1Q7Y W;  2BTQ A;  4LBE C;  2F43 G;  5IDJ A;  4RUF A;  4RQE A;  3ZS8 C;  5LA6 A;  4JTC B;  2WLL B;  2W6J G;  1Q6I A;  4LP8 A;  4JYA B;  4PV1 B;  3FFQ A;  2IJJ A;  4PI2 A;  2IBZ H;  1M4U A;  2AW9 A;  2BSK B;  1EN4 A;  4CH5 A;  1FJG B;  4JF3 A;  2WLN A;  2QWR B;  3UKM A;  3RYF A;  2R9I A;  4RWU A;  4ZOL A;  5IWA B;  2NR5 A;  5F2V O;  4UFZ A;  2Q73 A;  2AHZ A;  5DEC A;  2YI9 A;  2X6A A;  3SYO A;  1YHQ V;  1G4Y B;  4TQF A;  2BOB C;  2A79 B;  4LF4 B;  3J80 N;  4DR1 B;  1XMO B; 
#chains in the Genus database with same CATH homology
 3SPG A;  4GX5 A;  1GM8 A;  4X8A A;  1W0J G;  3QNE A;  3STL C;  1AR1 B;  3P30 A;  3IC7 A;  4H37 A;  5E1A C;  3CXC U;  1S76 D;  1GKF A;  4JAU A;  4R8C A;  1M9N A;  2WAM A;  3ABM C;  4TWK A;  4GT1 A;  1K92 A;  1E1Q G;  4QE9 A;  2EIN C;  1YSC A;  5L3B A;  3ABM B;  1KC8 W;  1MOF A;  2JJ2 G;  1NBM G;  5IYC O;  4WCE V;  2KB1 A;  3OFN G;  4XDJ A;  3E83 A;  1YJN V;  5DM6 V;  1DTO A;  2DQ3 A;  4G28 B;  3SPC A;  1JCH A;  3E8G A;  2V7Q G;  4PDL A;  1YIT V;  1OCZ C;  1K7D A;  3OGC C;  2QEX V;  2XAF A;  3AG4 B;  4MTF A;  2DWD C;  2EIJ C;  4MVR A;  3JYC A;  3OMN B;  4JYC A;  2H8P C;  1FFT B;  1OCZ B;  3ZMZ A;  3G71 V;  4PA9 A;  1KKD A;  4JYB A;  2Y69 C;  1RM1 C;  1Q82 W;  3NXS A;  5IY5 C;  2OT5 A;  1OZ0 A;  2P67 A;  3CCQ V;  4MVQ A;  2QKS A;  2ZXW C;  1QBZ A;  1BMF G;  3DTU B;  3W7S A;  3JD3 A;  4XBF A;  1JJ2 U;  2Y69 B;  2WLM A;  1GM9 A;  2JJ1 G;  3OUS A;  5KUK A;  3K3W A;  1VQ7 V;  3ABT A;  3TCU A;  1OCR C;  4G2K A;  1S3J A;  4P9P A;  4MSW C;  3BEH A;  1I5Y A;  2EIL C;  2X6C A;  3RVZ A;  5CBH A;  2Q6A A;  1OCR B;  1VQ4 V;  5IYD O;  4RAI A;  2BOC C;  1QLE C;  4UVB A;  3OW2 U;  5LHH A;  2EIL B;  1OCO C;  5KUM A;  4OXS A;  1K5S A;  2IU3 A;  3OM3 B;  4I9W A;  1GMG A;  5B3S C;  1QLE B;  1S5H C;  1OCO B;  1KQS U;  2EIK B;  2Y48 A;  3FB5 C;  3EHB B;  3FYI B;  1YI2 V;  1EBO A;  3ETD A;  3LSS A;  2WLK A;  5B1O A;  3B8N A;  3LSQ A;  4PA4 A;  2OTJ V;  2UXX A;  3ZMT A;  1SES A;  4DXW A;  1NH2 D;  5KA6 A;  3W7X A;  4H33 A;  1QR9 A;  4ZBM A;  2ATK C;  5GW7 A;  1M56 B;  1S77 D;  1THZ A;  3ASO C;  1K33 A;  2EZO A;  2DYS B;  3D36 A;  4WFG A;  3CD6 V;  3K0G A;  3GB7 C;  4RQF A;  3LDC A;  1F4M A;  1R3J C;  4ZKI A;  3K04 A;  3R65 A;  1CEZ A;  1KP3 A;  1DLB A;  4MVO A;  3JD1 A;  3QO8 A;  1G8M A;  3CYO A;  3SYP A;  4WF9 V;  1PNM A;  3OAA G;  4WFH A;  2OCC C;  4ASU G;  3G4S V;  3ETG A;  1MAB G;  5CBF A;  1NH2 B;  4BIU A;  4BAY A;  4PA6 A;  1H2G A;  3OEE G;  3QO7 A;  5LGU A;  1NJI W;  3W7T A;  3DGE A;  3JD0 A;  2K1E A;  4MVU A;  2PI5 A;  3LDE A;  1VQM V;  2ZR2 A;  1OHH G;  4Z1M G;  2XAH A;  3BY6 A;  3F5W C;  4P9O A;  3ZIA G;  3WG7 C;  2IH3 C;  1K97 A;  1JOY A;  3B77 A;  1J95 A;  1P7B A;  1V54 C;  4I5S A;  2WWW A;  3VOU A;  4KUM A;  1QR8 A;  3ZRW A;  4KP4 A;  1YTF D;  3CP1 A;  2JEU A;  2WLI A;  1W0K G;  4R50 A;  1MSW D;  1K4D C;  1SZT A;  3ZRS A;  1V54 B;  2WSS G;  2HR3 A;  2X7R B;  3ABK C;  1H8H G;  4P2Z A;  1E1R G;  4U7O A;  3SJQ C;  1VQ6 V;  1ARO P;  2ZDI A;  4DO2 A;  3HB3 B;  4UV8 A;  5CN0 A;  3CCR V;  3GWO A;  4JTA B;  3ABU A;  3CCU V;  5CMU A;  1Y4M A;  3KG2 A;  3ABK B;  3IGA C;  4BIZ A;  1R6N A;  1Y66 A;  4JTD B;  2EBO A;  4PA7 A;  4FJC C;  2DYR C;  1NVP D;  3JD4 A;  4FK5 C;  1WPX A;  2JK5 C;  1R6K A;  1PNL A;  2EIN B;  3PJS K;  1FXV A;  2DYR B;  4FPP A;  1JPX A;  1XL4 A;  5DN6 G;  2IH1 C;  1H8E G;  2HKO A;  1K3E A;  1VQN V;  1I5X A;  1EZJ A;  5LBQ A;  5H9C A;  4PDR A;  4R7C A;  4HZ3 A;  5HFM A;  1N8R W;  2P90 A;  1M57 C;  3ASN C;  4F4L A;  1V55 C;  2WLL A;  2C2A A;  2B1G A;  2ZR3 A;  3LUT B;  2Z5U A;  2EIJ B;  2EZP A;  4X89 A;  3K08 A;  1ZWI C;  3ASN B;  1QLN A;  1V55 B;  2DWE C;  2D3O W;  1FXK C;  5CBG A;  1RM1 B;  5IY5 B;  1NVP B;  1K4C C;  1PKX A;  3SPH A;  2IJI A;  1HWY A;  2ZXW B;  2GHY A;  1FXK B;  1GK9 A;  3E8H A;  3X2Q C;  1BL8 A;  3H01 A;  3A0R A;  4GX2 A;  1AI5 A;  3K0D A;  4TSF G;  5EBW C;  1K73 W;  3MD0 A;  3ZRW B;  2XAQ A;  4CZZ A;  1VQO V;  1YIJ V;  2W6I G;  1BHB A;  3ZMS A;  3MHS C;  2ZDI C;  3JD2 A;  2HJF C;  2MK3 A;  3T1C A;  3LNM B;  4UUJ C;  3WFV A;  4JPR A;  4XDL A;  2GSM B;  1NR1 A;  3ETE A;  4EKW A;  3ZRX A;  3QO5 A;  1JX9 A;  1NR7 A;  4PA3 A;  4PDV A;  4U7N A;  5B3S B;  5L3G A;  3FB6 C;  4QPK A;  4GX0 A;  1DF4 A;  5L3F A;  4WFA V;  1ENV A;  2X0L A;  3K79 A;  2XAJ A;  1ORQ C;  3ML0 A;  2R9R B;  4L87 A;  5FL7 G;  4FIP C;  1XL6 A;  5H6Q A;  1AI6 A;  4E2L A;  5HFL A;  4MTO A;  3CCL V;  4GCZ A;  3M99 B;  3K9A A;  3W7U A;  1PL0 A;  2QA4 V;  2V1D A;  1B6Q A;  4FMT A;  3ASO B;  2OTL V;  2QE7 G;  1KEC A;  1PNK A;  4MVZ A;  1R3L C;  4HAM A;  3RVY A;  3E86 A;  4UVC A;  3E8F A;  3AG1 C;  1W2B U;  1K34 A;  4UV9 A;  3SPJ A;  2CK3 G;  4GX1 A;  1S72 V;  3AG3 C;  4P30 A;  2ITC C;  2IJK A;  2P6J A;  4PEL A;  1BHA A;  2JIZ G;  1OCC C;  1DF5 A;  2AHY A;  1K9M W;  1VQL V;  4R6Z A;  1FXH A;  1CPY A;  4J9Z B;  2UXN A;  1AJP A;  1MG1 A;  3F7Y C;  2OCC B;  3F7V C;  4N23 A;  3CCM V;  2Q67 A;  2WLH A;  4LC1 A;  4MTX A;  3UM7 A;  3EFF K;  3ZMU A;  2LP7 A;  3CPW U;  1JVM A;  1SET A;  2ZQM A;  1F51 A;  4G27 B;  5EBL C;  3WG7 B;  2FTK A;  2LFS A;  2H94 A;  3OR7 C;  4KFM A;  5B1A C;  4QPJ A;  2EIM C;  2B5U A;  2ITD C;  3OMA B;  2QM7 A;  4QJF B;  5KA5 A;  3CMA V;  5B1A B;  1RPR A;  5EC1 C;  3OEH G;  1AI7 A;  5BZB A;  2EIM B;  4JAV A;  3ZCC A;  4QE7 A;  3CME V;  2YSU B;  1VQ5 V;  3OE7 G;  2JDI G;  3ZN0 A;  2YEV A;  3ZRV A;  3FKS G;  4MW8 A;  3T4D A;  2Q68 A;  1F4N A;  3SYA A;  2HLD G;  5IYB O;  5LHI A;  1M1K W;  1YTF B;  2Z3Y A;  3SYC A;  3P32 A;  1YJ9 V;  3E89 A;  4UXN A;  5L3D A;  1COW G;  1YJW V;  5LGT A;  3CCS V;  3E35 A;  2XND G;  3RW0 A;  3ZMV A;  1QVF U;  3E2E A;  1RPO A;  4YXW G;  1M90 W;  2QM8 A;  1SRY A;  3RBZ A;  1R73 A;  1P4R A;  1CP9 A;  3FYE B;  5B1N A;  1E79 G;  1M57 B;  3JCZ A;  2EJR A;  3K06 A;  1NQT A;  1EFR G;  2A0L A;  3AG4 C;  5LGN A;  2DW4 A;  2HG5 C;  3K03 A;  3I56 V;  3T4Z A;  2LFR A;  1SER A;  3SPI A;  2JEX A;  2HFE C;  1AI4 A;  3MHH C;  1Q86 W;  3IFX A;  1KP2 A;  3D3I A;  2XOK G;  1AJN A;  4LCU C;  2QTO A;  4X88 A;  3LDD A;  3X2Q B;  1S0V A;  2PI4 A;  1IXM A;  2WLI B;  4RUE A;  3STZ C;  1VQ8 V;  1R3I C;  2IJH A;  5C93 A;  5EC2 C;  2XAS A;  3OUF A;  3I55 V;  3ZN1 A;  1QCE A;  4QIW F;  2WLJ A;  3AEI A;  2Q69 A;  2XAG A;  1WLE A;  4PDM A;  3CC7 V;  2M7W A;  5L3C A;  5LHG A;  4JGS A;  4Q20 A;  1F23 A;  1GM7 A;  3OMI B;  3SYQ A;  3ABL C;  4WFB V;  1VQ9 V;  4BW5 A;  1PD3 A;  1Q81 W;  2EIK C;  3E8B A;  4JAS A;  3W7W A;  3TK1 A;  1R3K C;  2X6B A;  2YEV B;  1AJQ A;  3CCV V;  1Q7Y W;  3ABL B;  4LBE C;  2F43 G;  2W0F C;  3FB8 C;  5IDJ A;  1K5Q A;  4MS2 A;  4RUF A;  1M56 C;  4RQE A;  4RO2 A;  4MVS A;  4XDK A;  2IU0 A;  2DYS C;  1FS0 G;  2DQ0 A;  4JTC B;  4J9Y B;  3CCJ V;  4CBC A;  2B1I A;  2WLL B;  1GTO A;  2W6J G;  3AG1 B;  5EBM C;  4UVA A;  1VQK V;  3T2M A;  4LP8 A;  5B1B C;  3AG3 B;  5L3E A;  4MTG A;  3TET A;  2NNU A;  2IJJ A;  5EK0 A;  4WFE A;  2P7T C;  1OCC B;  1LNQ A;  2HVK C;  1ROP A;  5B1B B;  1NKD A;  2NLJ C;  3VBB A;  3G6E V;  5J9P C;  1K8A W;  1TUE B;  3CCE V;  3HPL C;  1JQ0 A;  4MW3 A;  1VQP V;  2A9H A;  2ZD9 A;  4JF3 A;  3CC4 V;  2WLN A;  3UKM A;  2R9I A;  1L1F A;  2IW5 A;  4MVM A;  3FB7 C;  1KD1 W;  4WFF A;  3AG2 C;  2WPD G;  3OR6 C;  4MT8 A;  1H38 A;  1FXK A;  1QVG U;  1UJW B;  2AHZ A;  4N21 A;  3B8M A;  4QNH B;  5H6R A;  5CA3 A;  3AG2 B;  4TT3 G;  2X6A A;  2HVJ C;  4HYO A;  3SYO A;  3CC2 V;  1YHQ V;  1G4Y B;  1GO3 F;  3ZJZ A;  2BOB C;  2A79 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...