1R73A

Solution structure of tm1492, the l29 ribosomal protein from thermotoga maritima
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MKASELRNYTDEELKNLLEEKKRQLMELRFQLAMGQLKNTSLIKLTKRDIARIKTILRERELGIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR for structural proteomics of Thermotoga maritima: Screening and structure determination
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L29
total genus 23
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r73A00
1VQ6V 3CCEV 1VQ4V 1M1KW 1Q86W 1QVGU 3CMEV 3CCRV 3CCUV 1VQ9V 3CD6V 3CMAV 2QEXV 3CCMV 1YI2V 1VQMV 1VQ5V 3CCSV 4WFAV 1YJWV 3G6EV 2QA4V 1N8RW 3CC7V 1R73A 3CPWU 1K73W 1KD1W 3CCVV 3CCJV 1YJ9V 1KC8W 3CXCU 1YHQV 4WFBV 1K9MW 1VQ8V 1S72V 3G71V 3I55V 3I56V 4WF9V 3OW2U 1YITV 1Q7YW 1JJ2U 1YJNV 2OTLV 1VQNV 3CCQV 4WCEV 1W2BU 3CCLV 5DM6V 1NJIW 1VQ7V 1KQSU 1Q81W 2OTJV 1VQPV 1YIJV 1VQOV 1M90W 1QVFU 1K8AW 3CC4V 1VQLV 3CC2V 3G4SV 1Q82W 1VQKV 2D3OW
chains in the Genus database with same CATH superfamily
2EBOA 3SPJA 5LOVB 5LA6A 3CCRV 4Q20A 1BHAA 2BE3A 2P67A 3K5LA 5BR8B 2CTRA 1V9PA 3NXSA 4DV3O 3RGBA 3JAMN 1SRYA 2ODMA 3E22B 3CCJV 2LGWA 1N32B 3L70H 3RWRD 4IIJA 1TVKA 2GHYA 4B3RB 3UO2A 4LCUC 2WPDG 1KECA 4LP8A 5FPRA 4FLZA 1I5XA 3W7SA 4I55A 4B3MB 4O2BA 2QA4V 2YEVA 2PZSA 3AG3C 1FD9A 1AI5A 1PNKA 5H2FZ 4U7OA 1ORQC 1FAFA 1RPOA 4I5SA 1HR0O 4NXNO 3N2GB 2ZM6O 4TV9B 4PDVA 4TWKA 5KMGB 3T4ZA 5J2TB 1QR9A 2IU3A 2FB5A 1AILA 2VRZA 3THOA 1SETA 4CS3A 1NR7A 2P90A 5H6RA 1HDJA 2M6YA 2UXCO 3EXAA 4LFBO 2EZOA 1OHHG 2QWQB 5A2QN 2IBZH 1PKXA 3ASOB 4BR6A 3C3SA 3OE7G 2LP7A 2JGDB 4AILC 3G80A 2CTQA 1QLNA 4UCOA 1SZTA 2F93B 3CJHB 4UXNA 5J2TA 4NTXA 3OW2U 5LHHA 4NYKA 1VQ7V 4AI8A 1VQOV 3ASNB 1M57C 3OM3B 2B5UA 3OTOB 4LF9O 2WA3A 1FFTB 1FFXB 3AK1A 3SDLA 4DV2O 5B3SB 5LGNA 3T1HO 3T1YB 2YI9A 5IYBO 1ZLZA 2LJ2A 4P9OA 1EBOA 1PD3A 2Q5ZA 4RUEA 1JX9A 4KL1A 3HB3B 4WFGA 1Z5VA 3TXQA 1SQFA 2H94A 4RAIA 4EB6B 3CEIA 1J95A 2RNBA 5LBQA 1XBLA 2O57A 3ASNC 3H01A 2PUSA 3VOUA 3RFRA 1DTOA 1NR1A 1GM7A 4IYHA 3TGUH 1K5QA 4PHZA 3ZX6A 2Y4UA 4I7ZB 3BEHA 3JAKA 4K0KO 3JAWB 2E3CA 4I4TB 4LWSA 2QGNA 5DEDA 3G4SV 1IXBA 2IJKA 2XAHA 4NTYA 1VQ4V 4DUZO 1E79G 1QQCA 3UO3A 4DR1O 4JI4B 1BGYH 1K3EA 3FD9A 4DR7B 1OCCC 4J41A 1K9MW 5GONA 2XOKG 4I9QA 4JI8B 1SKVA 4X64B 4J7JA 2C2AA 2HVKC 4XDJA 5JVDB 1IBKO 4LC1A 2XAGA 3FAVA 3AG7A 4UV8A 2WAMA 3AG2C 2NNUA 4I50A 5CA1B 1B3QA 4PDLA 1K4DC 1SF9A 2H3OA 2CTPA 4HYOA 3J80N 2PGGA 1TGOA 1JFFA 2WLLA 4JPRA 2FTKA 2AXTZ 1XHXA 2JEXA 3ABLB 3BABA 1K34A 4NXMB 4DV3B 3WG7C 1PV0A 5LL6Y 3T2MA 3HKEB 1MA1A 4JF3A 1OCZB 4H44B 3E22A 4IHJA 4JV5O 2E74B 3K79A 3ABKC 1IVSA 4JTDB 3RBZA 2F43G 2Q67A 2QDOA 4FVMA 2XNDG 1TAEA 2Q73A 1M93A 3BAAA 2Q0AA 5LXTB 4JYCA 4P9PA 1OCOB 5EK0A 4BAYA 2UUAO 1Q6IA 1XDCA 2NR5A 1CEZA 3HKBB 3FAVB 3FB8C 4LF4O 4Z1MG 4DV2B 1GMGA 2KG7B 2W6IG 1VQMV 1BQ0A 4CZZA 3BA9A 3RYFA 4QE7A 5CA3A 5IYZA 1S72V 1EM1A 2Q69A 5KUKA 2A9HA 2KB1A 1S77D 4IT5A 1M90W 2ZDIA 1RSOB 4JI1O 3K57A 3HKCA 3ZRXA 3BCCH 2Q7EA 1Y74A 3E8FA 1HNWB 2ZDIC 3SYQA 1A32A 1IX9A 3LNNA 4R8CA 2EIKC 4I0XA 1TUBB 1EZJA 2X6CA 1CPYA 3CX5F 4GKJO 3D3QA 2GV9A 5IYZB 1VARA 4FLVA 4TT3G 1YCIA 2ZNIA 3JARA 2F1MA 5EYPB 4GX5A 4OPHA 4H0LB 2VQFO 1R6KA 3FB5C 3U0ZA 2UUBB 1EN5A 3CYOA 4AHCA 1H2GA 1U97A 3SJQC 3IC9A 2UXBO 3M7MX 2A0LA 1SESA 4KP4A 2CDYA 1S5LZ 4YIPA 3WFVA 3CRAA 3E86A 1MABG 3K5MA 1NVPD 1NVPB 1KKDA 2WLIA 3OMIB 4X1KA 3JAWA 4MS2A 5EC2C 4FM0A 2Y48A 5F2VO 3G6EV 4FLXA 2MW2B 5IY5C 3W7TA 3CS5A 3Q4HB 2UXXA 4J7KA 2QM8A 4RQEA 1MNGA 3N2KB 5B1BB 3ZHQA 4UCRA 4UCSA 5BR8O 1Q5OA 3A0RA 1BZKA 4X66O 2ZD9A 1VP7A 3ZHVA 4X62O 4TUYB 3SR2C 1JOYA 1AJPA 4JYAO 3IFXA 2HJFC 3MHHC 2RN9A 2EX3A 3ZHSA 1QVGU 2G38A 3PJSK 5GONB 1J5EO 3K59A 1IBMO 5IJ0A 2P5OA 3ZN1A 5H6QA 4B3TB 1QU7A 1DGSA 4TQFA 5CA1A 1SQVH 2JK5C 4CH5A 1XMOO 4DRXB 5B3SC 3QO8A 2PYLA 3MD0A 1JMKC 2DQ0A 4QPJA 4IL6Z 1YTFB 1YTFD 4O4IB 3QG5A 2HP8A 3X2QB 3ZN0A 2HR3A 3ABUA 4TOIA 4EFBA 1G4YB 4K8ZA 3TETA 1UPGA 1KUQA 4LR3A 3HPLC 1HNZO 2R70A 4RQFA 1WP8A 2YICA 1SA0B 2EJRA 2A79B 4LFBB 1S0VA 5HFLA 5LXTA 1HP8A 3RYCA 2WWWA 2FMLA 1FJGB 4U7NA 1V54C 1XHZA 3OT7A 3JALB 4O4JA 2Q0OC 1NH2D 1NH2B 1DF5A 1FKAO 4CH4A 4DUZB 3TJTA 1QBZA 3SJCC 2GTSA 1Q7YW 1F7YA 2QKCA 5JQGB 5CMUA 1SERA 4YIOA 4YJ3A 5CA0B 1MZFA 1R3KC 3RYCB 3CMEV 3UKMA 1THZA 1DF4A 4JGSA 1WPBA 2EJ7A 4UVBA 1R73A 1AI6A 4GUNA 3LSUA 3H1LH 1X59A 4MVZA 2DOSA 2GDSA 1MSDA 2XHBA 3K5NA 1JVMA 3B2EE 2DE0X 5BZBA 1IBLB 3IC7A 1S5HC 3ETGA 5B1BC 4FLWA 4HBNA 1G6UA 3P30A 1N34O 1N33B 3D8CA 3WG7B 4E4EA 4JYYA 1MG1A 1W2BU 3MHSC 5B5EZ 2DYSB 1JA8A 4QGPA 1YEWA 2GUZB 2YIBD 4BIZA 2F4VO 2EINB 4O2BB 4I9WA 4NVPA 2ZE5A 4QE9A 2LGQA 2LO1A 2V7QG 1YJWV 4IYIA 1AP5A 4MW3A 2UXNA 2UXBB 3ML0A 1VF5B 4X1YA 2UUCO 1M56B 3OUSA 3N2GA 2WLKA 2PTMA 4DUYO 1GKFA 1W59A 1NZ6A 3QF7A 4KUMA 1M4UA 2ATKC 2M7WA 1WP7A 3OGCC 4U3JB 2ZE7A 4ZHQA 3CRQA 5IT9N 1BCCH 5EC1C 3R65A 4TSFG 4O2AA 5KX5A 4UB6Z 2XUMA 3ABMB 1S5JA 4UUJC 4JI5B 3SPCA 2A06H 5KHHA 4BW9A 2OCCC 4JI5O 1KYOF 1HW7A 5L3DA 3OAAG 1E1QG 1WA8B 3TCUA 1AI4A 1GN2A 4HNAA 4MVUA 5LA6B 2PI5A 5BY1A 2Y69C 3FX7A 1F51A 1PPJH 4WFEA 2P6JA 2LFRA 2EULA 1SQXH 3C3TA 1Y67A 3B09A 5C8YA 3RYIB 1NI8A 5IDJA 1LUWA 2JIZG 4DV6O 4JI7O 1AROP 1PP9H 3K06A 3SYCA 4J7ZA 2BSKB 5BXZA 1XMQB 3H1IH 1XMQO 3S3WA 3UT5A 5LOVA 1QLEC 3KCXA 1PL4A 2QWNB 3W7WA 2H8PC 1OCZC 4YJ3B 4LFAO 2ZIMA 4X65B 1M5IA 4FLUA 3OEEG 1K73W 4U3JA 4JI0B 3P32A 1F23A 3B77A 2HFEC 3E8HA 4TV8A 1US6A 4FFBA 4GZRB 5LYJB 1EN6A 1Z5WA 5KMGA 3H1KH 1FPOA 2WLLB 2X7RB 4XDKA 3OD4A 3ABLC 1L1FA 4RUFA 3JD4A 2YC0A 2HJDA 3DC6A 4MVOA 4I50B 4I4TA 4LWSB 4UB8Z 5HFMA 4N21A 4AQYB 2P4VA 4CS4A 1P7BA 3RVYA 1Q8IA 1ZUQA 1KKCA 3ZRVA 1FXHA 2OIGA 1QVFU 3LSQA 2ADQB 1Z2GA 1LUVA 5LMUB 3VBBA 2E5LB 3I5DA 3ZMUA 4ABMA 4U3FH 2ZXWC 1JJOA 1DK1A 4X8AA 4R7CA 3D3IA 3SYPA 3G6BA 3F7YC 4DV4O 1H2LA 3ABTA 2CGOA 3ZMTA 1NTZH 1Q81W 2CK3G 3GB7C 3K0DA 2LFSA 1Q82W 3EFFK 1Y6XA 2IU0A 1BL8A 2DWEC 3TXSA 1ZAUA 4X62B 4DV1O 4DR2O 5TISZ 4DYLA 4ZKIA 3BA8A 4MTOA 2CUGA 5EZYB 1QHTA 2ILMA 4MVMA 2ZE8A 3K3WA 1WPXA 4GX1A 3G71V 4P30A 4FLYA 4JI2O 1WB8A 1UJWB 1YVWA 1EZVH 1N0JA 2Y4TA 3E2EA 4ZBMA 1ZWIC 1MOFA 1H2KA 2QM7A 3AG1C 3QNEA 4JAVA 4JZ2A 5D5PA 2QWPB 4PELA 4NTWA 3CD6V 3IGAC 5JWPA 1F4MA 3OTOO 1Y4MA 2QE7G 5JH7B 3BY6A 1YHQV 2HG5C 3OUFA 2OWOA 4GYCB 4MW8A 1TUBA 1W0JG 3F5WC 3ZCCA 2ZT9B 5JJJB 4K3AA 3EHBB 5JJEB 3HKDA 1VQ5V 4JI0O 2KSDA 3VQWA 5EBWC 5EZYA 2CAZC 5CB4A 3SYAA 5E1AC 1EFRG 2YEVB 3CCLV 2AZ0A 4OX9O 2JJ2G 4DXWA 1ZSPA 1WN7A 2IH3C 3DSQA 4BWAA 3FB7C 5KLVH 1SQQH 4JI3O 3KKYA 4D7TA 1Q6HA 3CJHA 2HHHO 1BMFG 3ICXA 4BIUA 3TK1A 4JYAB 1L0LH 3U11A 3J81N 4ICGA 4B3RO 1P7GA 2PF4E 3H1HH 4J42A 1JPXA 1B06A 4JI3B 4UCTA 4NR1A 3RW0A 2KQXA 5EIBD 4B3SB 1WJZA 1ZTEA 4PA9A 4DR3B 3LUTB 1AP6A 1VQ8V 1AR4A 2YIDA 2P06A 2CTWA 4G28B 4RO2A 2JGUA 5B1NA 1S76D 1KQSU 1R6NA 4DR6B 3U10A 2ZR3A 2L6LA 4LNUA 3ZBHA 3NR7A 1WAZA 2CH7B 2E76B 5LHIA 4DO2A 5LP6A 5J2UB 3VQVA 3E35A 1XL4A 3HKDB 2IH1C 3BRCA 3CHXA 4CH3A 4WF9V 4YHHB 4FK5C 2CE4A 3JAKB 5ITZB 2JEUA 2QSAA 2IJJA 1CXZB 4GCZA 3LDCA 1IDSA 4J11A 4RWUA 4FM1A 2F95B 3AG3B 3DC5A 4EB6A 3QO5A 5BMVA 3CCSV 4FM2A 4PJ0Z 5B66Z 1XNRO 4X66B 1KC8W 4BW5A 3UCSC 1RSOA 2BOBC 3W7XA 4B3TO 1QNMA 4J9ZB 4O4IA 3ZRSA 1SQGA 1BSMA 2CH7A 5LP6B 1COWG 1VQKV 3ASOC 4X64O 2ADPA 1VQ9V 3CMAV 2ITCC 2LQTA 4JI4O 3ABMC 2W0XA 1AR1B 2V4DA 1K5SA 2DYRB 3IAYA 4X1IB 2EILC 1YZBA 2V1DA 2D2CB 4OPAA 2F23A 3ZJZA 1NT2B 4F6RB 3JALA 4PDRA 1GH6A 3AG4B 1KB9F 1PM9A 5GTHZ 1FYJA 4PV1B 4PA3A 4H37A 1Q43A 4GKJB 4X65O 1GK9A 4EKWA 4GX2A 2DWDC 2N05A 3ZMSA 4QJFB 2BSKA 2VQEO 2JS5A 4KXRA 3SPGA 4AQYO 5IYCO 2B1GA 2DJVA 1R3LC 2Q7HA 2ZINA 2XAFA 2F66C 4LF8O 5AG2A 2RJZA 3ZHRA 2QEXV 3Q4HA 1CP9A 4HAMA 2WLMA 4QNHB 4JI7B 4LF4B 3BFRA 3W7UA 1BS3A 4LBEC 1XMOB 1D2DA 1S3JA 2YI8A 4F6RA 2Q7GA 1JCHA 2JDIG 2VQFB 1W0KG 1SC5B 1K8AW 1AVMA 3KCYA 5KA6A 3CSXA 1ZX3A 2EIMC 4BIOA 4R50A 3N27A 4WBNA 3K04A 1TA8A 1GO3F 2NLJC 3L71H 2W0FC 1IBLO 1L8DA 4FZ0A 1VIBA 5L3EA 2YUAA 3SPIA 2VWKA 4LF7O 4DR4B 3WB1A 2ETNA 3A0HZ 5EYPA 3DXRA 1Q86W 1KU9A 2EZPA 1GM9A 4UVAA 3SGIA 3AK2A 1IBMB 5LGUA 2RMKB 4WFFA 1Y76B 1AR5A 1YSCA 3AK3A 4NKGB 4JASA 4DR3O 3RVZA 5H9CA 3HKCB 2HLDG 4L87A 1Y74B 2VQEB 3ABKB 5FL7G 1N4CA 5ITZA 3ETQA 3GWKC 4MVSA 4MVQA 1I5YA 2DMXA 2WLHA 1MSWD 2OCHA 5C93A 5IJ9B 2WSSG 1JQ0A 4O4LA 3G67A 1YJ9V 3JD0A 1SZXA 4A5UB 3AEIA 3JSNA 2R9RB 2FL4A 5LHGA 2IM9A 3VQYA 3X2QC 1HNZB 3CCVV 3O65A 3LSSA 2EIJC 4WFHA 4YHHO 3JSLA 1VQPV 1Q90D 2MK3A 4L8JA 1VEWA 1OV9A 3DXRB 4GLXA 1PNLA 2GSMB 2QWRB 2IJIA 1QCEA 4TV9A 3BVOA 4JI6O 1I08A 3OMAB 4LFCB 4UCUA 3CXCU 4HZ3A 4Z1VA 1NS1A 1YF2A 2PYJA 2OT5A 1UFIA 2LW7A 3WB2A 4LF9B 4PA4A 2YS8A 4FLTA 3OR7C 4X88A 4FPPA 2XAJA 2QKSA 4KFMA 2AW9A 5L3CA 4CH6A 2QWOB 1ZL8B 3ZIAG 4ZI7A 1KD1W 3CWBH 5IWAB 1ENVA 2JVDA 1HNWO 1T5EA 2HVJC 3L72H 5FNVA 2GBOA 3K9AA 3CRCA 4GT1A 5JCOC 5DECA 1I7FA 3P3NA 5CN0A 4EFEA 1H8EG 3ZMVA 1V55B 4TV8B 5IE9A 2ARHA 4DV5O 2XT9A 1N36O 4JZGA 4MSWC 4X1YB 4FJCC 4LF5B 1Q6UA 4G2KA 3D36A 4I55B 2QJ1A 4WCEV 5B1AB 1XNRB 1SA0A 5FNVB 1FXVA 4JV5B 4LF6O 1NTMH 5FLXN 1N34B 2UUCB 4KHPO 1TVKB 1TUEB 2EIKB 2EIJB 1AI7A 3K08A 1BT8A 2AHZA 1R3JC 1B6QA 3B4SA 4PDMA 4O2AB 5KX5B 1ROPA 1J5EB 3JCZA 3CP1A 1VQLV 1NU1H 4R6ZA 4P2ZA 5KHJA 5CBHA 2KKWA 2LW1A 4HNAB 1RFYA 2IJHA 3E8BA 1RM1B 4DR6O 2QR4A 4YY3B 1K33A 4PD4F 2X6BA 5FPOA 3B8NA 4O4HB 3E89A 1KP2A 2B9ZA 2YIAA 4PI2A 3UQ8A 1H2NA 1M57B 4WFAV 1FS0G 4XBFA 3JD1A 4KHPB 3DTUB 4D7SA 4IGGA 4F6EA 3CCQV 4DV6B 3K5OA 4J9YB 2CGNA 2QM4A 4DV7B 5JH7A 3JATA 2WLNA 3T4DA 3APQA 4O4HA 1N0NA 2Q8VA 4K8XA 4F4LA 4H13B 3E8GA 2UUBO 3APOA 2EINC 3AG2B 4DV7O 3ZRWB 3B8MA 1DLBA 2X6AA 5LMNB 1OCRC 3A0BZ 3LDEA 1XOUA 4OGQB 3GWOA 3L74H 4FFKA 2BTOA 4PI0A 2UXDB 3JATB 4N23A 5IWAO 3ZHUA 4DV4B 4JTCB 1H2SB 4LF7B 4DR4O 4I0XB 1PL0A 1XNQB 1IURA 4XDLA 1HWYA 3OTFA 3FB6C 2WA4A 2AGAA 3ETEA 2ZIOA 2JRIA 3FYIB 4G27B 2R9AA 4D6TH 3EVKA 2HHHB 3M8AA 2OIEA 2VS0A 1XREA 1H2MA 3OR6C 2JJ1G 2ZR2A 1VF6A 1OCRB 4LFCO 1IZ3A 4JI6B 2RCVA 4MT8A 3CPWU 4DR1B 2ZNJA 4K35A 4YJ2A 1K4CC 3S3XA 3M99B 5J2UA 2Z3YA 1NJIW 5J9PC 3F7VC 4ZI7B 4X89A 4DW1A 4JI8O 2JGDA 2ITDC 3C90A 2UUAB 1OZ0A 2Y69B 3LNMB 2Z0AA 1D5NA 1O9HA 3UM7A 1NTKH 2Q4PA 3OGIB 3PN1A 4UCVA 1K7DA 5LYJA 4GKKB 4W4LA 2Q6AA 1X4TA 1WLEA 3JASA 2FYUH 3HKBA 2EILB 2XAQA 3MDSA 1B04A 1YXBA 3ZEDA 3E83A 1OCOC 1PNMA 4DV0B 2Q9LA 3RYFB 1VF7A 3F5TA 2ZE6A 2A7WA 2DW4A 3K9SA 5LP6C 3SYOA 1QLEB 5IY5B 3CCEV 3OEHG 4B08A 1K97A 3QVNA 3A2FA 4J10A 2YXHA 4TQDA 5A9GA 5CB4B 5L3GA 2R9IA 1P84F 3H1JH 4LF8B 4JI2B 2OYQA 1RM1C 2Y0PA 3MAQA 4LF6B 4YJ2B 3RYHB 1LR1A 1MZEA 1HNXB 2BOCC 2JS3A 3JASB 1M9NA 1HNXO 3JYCA 3STLC 1AJQA 3AG4C 1H38A 4X20A 4UVCA 4ZOLA 3FKSG 4OX9B 4O4JB 5LMNO 3L75H 1F4NA 2ZM6B 5EBMC 2Q68A 1JJ2U 3I55V 4ASUG 1GM8A 2ZQMA 1U96A 4DW0A 4DK0A 5KAIZ 1N33O 1E1RG 4CC5A 1JR9A 4MVRA 5EBLC 4JI1B 5KHKA 1XQ8A 5L3FA 4MTXA 1L0NH 1I94B 3BHPA 1URFA 3HKEA 4JTAB 3CRRA 1QR8A 4WBNB 1XUQA 3JARB 4B7EA 4FZ1A 4GX0A 4NB5A 4EEQA 4LNUB 3JD2A 4FIPC 2N04A 5DM6V 5BMVB 2XASA 4YXWG 5D5QA 2K9PA 1EN4A 1YDXA 5KA5A 2QTOA 1FXKA 1Y76A 3CXHF 2DQ3A 1GAXA 1VF6C 5JVDA 3ZHTA 2UU9B 1P49A 3HR0A 1SQBH 4IHJB 3B40A 4MTGA 4GKKO 3GVMA 2YDEA 1VMGA 1IBKB 2KG7A 3RYHA 4OXSA 1R1BA 1JFFB 4DR5B 4Z2WA 2BTQA 1BHBA 3ZS8C 3K0GA 1OJHA 3L9DA 4J80A 1MMMA 3CE2A 5B1AC 4DV5B 2Y0IA 1P4RA 4JAAA 1FJGO 1N8RW 2WLJA 3CC7V 1G8MA 3FYEB 4JYBA 4DV0O 5IJ0B 3BPZA 1I94O 2P22C 1YITV 3H9VA 5EIBC 4LH6A 1O9GA 5IYDO 4PA6A 1BQZA 3JD3A 3R66A 4TUYA 3L73H 4CS2A 3T1CA 2XTAA 4QPKA 4C7UA 1N36B 1SS3A 1GRJA 2E75B 4X1IA 1BE3H 5K1XA 1M56C 2IW5A 3STZC 5KAFZ 2K1EA 4ZHQB 1VQNV 4DUYB 2X0LA 4O4LB 1R6TA 4MTFA 2A3QA 1V54B 3A8TA 4DR5O 1FXKB 5B1OA 3VQXA 1YI2V 2DYSC 4FMTA 2UXDO 2VWJA 5L3BA 2EIMB 5LMUO 4X1KB 2E5LO 3RT3C 1H8HG 1KBHA 3WU2Z 4QIWF 4X9QA 3T1HB 3ZMZA 1HR0B 4NXNB 1NKDA 4B3MO 2BTQB 1G1XB 3AG1B 1FXKC 1GN6A 1WA8A 1WB7A 2QKAA 1RP3B 3N2KA 4ZOLB 3FFQA 3SJAC 2B1IA 4WFBV 4Q6GA 2FKXA 3WB0A 4LF5O 2ZCEA 3ZRWA 2WLIB 4E2LA 3DGEA 5DN6G 2RDCA 1VQ6V 2L35A 1XEQA 3UT5B 2P4KA 2R72A 3CCMV 4UV9A 4B7KA 2GTAA 2HKOA 3OMNB 5LGTA 2UXCB 2YSUB 4X20B 2Z5UA 5CBFA 1XILA 5E79Z 3ETDA 5GW7A 1YJNV 3J7AU 1D5AA 5JJNB 2PI4A 2AHYA 3D36C 5KHIA 3JCUZ 1OCCB 2AZ2A 3I56V 2UU9O 4ZIBA 4H33A 1KP3A 3P3PA 2YXYA 2PY5A 1WNSA 2W6JG 1I0HA 3QTCA 4DRXA 2HEPA 5KUMA 4CC6A 5JCOA 4NXMO 3IJ4A 4CBCA 4YY3O 5GTIZ 3CB2A 4FFBB 4DK1A 2ZXWB 4W4KA 5H5NA 1K92A 1R3IC 2RQ6A 1XNQO 5IJ9A 4JAUA 1KMIZ 4PA7A 2P7TC 2DN9A 3CRMA 1V55C 5K1PA 5KHGA 1Q3EA 4DV1B 4DR2B 1Y66A 2GUZA 2NN4A 2YIBA 2DYRC 1N32O 1IXMA 1GN4A 2ZKOA 3LDDA 2BCCH 4K0KB 4DR7O 1FFXA 3SJBC 1XI1A 4UFZA 1LNQA 1M1KW 3SPHA 3CCUV 2F4VB 4B3SO 5CBGA 3RN4A 1AB3A 1RPRA 1GTOA 1NQTA 5CA0A 3QO7A 3KZIZ 2OCCB 1XL6A 3KG2A 1GN3A 4IIJB 1NBMG 3O9OA 1ZL8A 3CC4V 2D3OW 5JQGA 4LFAB 2YXLA 1SQPH 3RYIA 5C8YB 3T1YO 4LH7A 2QTSA 3K03A 3K58A 1AJNA 1YIJV 2N74A 2OTLV 3CC2V 2OTJV 3OFNG
chains in the Genus database with same CATH topology
4GCZA 2EBOA 4U7NA 3SPJA 3OR6C 1V54C 3LDCA 3CCRV 2JJ1G 4Q20A 1BHAA 2P67A 2ZR2A 3AG3B 3QO5A 1NH2D 1NH2B 1OCRB 3CCSV 1DF5A 3NXSA 1SRYA 4MT8A 3CPWU 3CCJV 1KC8W 4BW5A 1QBZA 2BOBC 1K4CC 1Q7YW 3W7XA 3M99B 4J9ZB 2Z3YA 3ZRSA 5J9PC 1NJIW 3F7VC 2GHYA 5CMUA 1COWG 4X89A 1SERA 1VQKV 4LCUC 3ASOC 1R3KC 2ITDC 2WPDG 1KECA 3CMEV 3UKMA 1VQ9V 1THZA 4LP8A 3CMAV 1OZ0A 1DF4A 2Y69B 2ITCC 4JGSA 1I5XA 3LNMB 3W7SA 4UVBA 3ABMC 2QA4V 1AR1B 1R73A 3UM7A 1K5SA 1AI6A 2DYRB 1K7DA 2EILC 2YEVA 4MVZA 2V1DA 3AG3C 3ZJZA 2Q6AA 4PDRA 1WLEA 1AI5A 1JVMA 3AG4B 1PNKA 5BZBA 4U7OA 1ORQC 1RPOA 4I5SA 2EILB 3IC7A 2XAQA 4PDVA 1S5HC 3ETGA 5B1BC 4PA3A 4TWKA 4H37A 3E83A 3T4ZA 3P30A 1GK9A 1QR9A 4EKWA 1OCOC 4GX2A 2IU3A 1PNMA 2DWDC 3WG7B 1SETA 1MG1A 1NR7A 2P90A 5H6RA 3ZMSA 1W2BU 4QJFB 3MHSC 2DW4A 2DYSB 3SPGA 2EZOA 1OHHG 5IYCO 2B1GA 3SYOA 1QLEB 1R3LC 4BIZA 1PKXA 5IY5B 3OEHG 3CCEV 2EINB 2XAFA 1K97A 3ASOB 4I9WA 4QE9A 2QEXV 5L3GA 2R9IA 1CP9A 2V7QG 4HAMA 2WLMA 4QNHB 3OE7G 1YJWV 1RM1C 2LP7A 4MW3A 3W7UA 4LBEC 2UXNA 1QLNA 1SZTA 4UXNA 3OW2U 1S3JA 3ML0A 5LHHA 1VQ7V 1M56B 1JCHA 1VQOV 2BOCC 3ASNB 3OUSA 1M9NA 2JDIG 1W0KG 2WLKA 1M57C 1GKFA 2B5UA 3JYCA 3OM3B 4KUMA 1K8AW 5KA6A 3STLC 1AJQA 3AG4C 1H38A 2EIMC 4UVCA 4R50A 1FFTB 3K04A 2ATKC 2M7WA 3FKSG 5B3SB 5LGNA 3OGCC 5IYBO 1GO3F 1F4NA 2NLJC 4P9OA 2W0FC 1EBOA 5EBMC 1PD3A 2Q68A 1JJ2U 3I55V 4ASUG 4RUEA 1GM8A 2ZQMA 5L3EA 1JX9A 5EC1C 3R65A 3SPIA 4TSFG 3HB3B 4WFGA 1E1RG 4MVRA 5EBLC 2H94A 3ABMB 4UUJC 3SPCA 5L3FA 1Q86W 2OCCC 4MTXA 4RAIA 2EZPA 5L3DA 1J95A 1GM9A 3OAAG 1E1QG 4UVAA 5LBQA 4JTAB 3ASNC 3H01A 1QR8A 3VOUA 3TCUA 1DTOA 1NR1A 1AI4A 1GM7A 4GX0A 5LGUA 4WFFA 1YSCA 4MVUA 1K5QA 2PI5A 3JD2A 4FIPC 4JASA 5DM6V 2XASA 2Y69C 3BEHA 3RVZA 1F51A 4YXWG 5H9CA 4WFEA 2P6JA 2LFRA 2HLDG 4L87A 3ABKB 3G4SV 2IJKA 2XAHA 5FL7G 1VQ4V 4MVSA 4MVQA 1E79G 5KA5A 1I5YA 2QTOA 1FXKA 2DQ3A 2WLHA 5IDJA 1MSWD 5C93A 1K3EA 2JIZG 2WSSG 1JQ0A 1OCCC 1AROP 3K06A 1YJ9V 3SYCA 1K9MW 3JD0A 2XOKG 4MTGA 2C2AA 2HVKC 4XDJA 4OXSA 4LC1A 3AEIA 2XAGA 1QLEC 4UV8A 1BHBA 2WAMA 3AG2C 2NNUA 2R9RB 3K0GA 5LHGA 3W7WA 4PDLA 1K4DC 2H8PC 5B1AC 3X2QC 1OCZC 4HYOA 1P4RA 1N8RW 2WLJA 3OEEG 3CC7V 1G8MA 2WLLA 3FYEB 1K73W 3CCVV 4JYBA 3P32A 2FTKA 4JPRA 1F23A 2JEXA 3ABLB 3LSSA 1K34A 3B77A 1YITV 2HFEC 3E8HA 3WG7C 2EIJC 4WFHA 3T2MA 4JF3A 1OCZB 1VQPV 5IYDO 4PA6A 3JD3A 2MK3A 2WLLB 3K79A 3ABKC 3T1CA 4QPKA 4JTDB 3RBZA 2F43G 2Q67A 2X7RB 4XDKA 1PNLA 2GSMB 3ABLC 1L1FA 4RUFA 3JD4A 2IJIA 2XNDG 1QCEA 4MVOA 3OMAB 1M56C 2IW5A 4JYCA 3CXCU 4HZ3A 4P9PA 1OCOB 4N21A 3STZC 5HFMA 5EK0A 4BAYA 2K1EA 1P7BA 1CEZA 1VQNV 3RVYA 2OT5A 3ZRVA 1FXHA 1QVFU 3LSQA 2X0LA 3FB8C 4PA4A 4Z1MG 3OR7C 3VBBA 4MTFA 4X88A 4FPPA 1V54B 2XAJA 3ZMUA 1GMGA 2QKSA 2ZXWC 2W6IG 1FXKB 4KFMA 5B1OA 1VQMV 1YI2V 2DYSC 5L3CA 4CZZA 4X8AA 3ZIAG 4FMTA 1KD1W 4R7CA 3D3IA 4QE7A 3SYPA 5L3BA 1ENVA 2EIMB 3F7YC 5CA3A 3ABTA 2HVJC 1S72V 3ZMTA 2Q69A 1H8HG 5KUKA 2A9HA 2KB1A 3K9AA 1S77D 1Q81W 2CK3G 1M90W 4GT1A 2ZDIA 4QIWF 3GB7C 3K0DA 2LFSA 3ZMZA 1Q82W 1NKDA 3EFFK 3ZRXA 3E8FA 5CN0A 1H8EG 3AG1B 1FXKC 2IU0A 3ZMVA 1BL8A 1V55B 2DWEC 2ZDIC 3SYQA 4R8CA 2EIKC 4ZKIA 1EZJA 2X6CA 4MTOA 1CPYA 2B1IA 4MSWC 4WFBV 4MVMA 4FJCC 3K3WA 1WPXA 4G2KA 4GX1A 3D36A 4P30A 3G71V 4WCEV 5B1AB 3ZRWA 1UJWB 2WLIB 4E2LA 3DGEA 5DN6G 4TT3G 3E2EA 1FXVA 4ZBMA 1ZWIC 1MOFA 2QM7A 1VQ6V 3AG1C 3QNEA 4GX5A 4JAVA 4PELA 3CD6V 1R6KA 3IGAC 3CCMV 1TUEB 2EIKB 4UV9A 1F4MA 2EIJB 1AI7A 1Y4MA 2HKOA 3FB5C 3K08A 3OMNB 5LGTA 2AHZA 1R3JC 2QE7G 1B6QA 3CYOA 2YSUB 3BY6A 4PDMA 2HG5C 1YHQV 1H2GA 2Z5UA 3OUFA 5CBFA 3SJQC 4MW8A 1W0JG 3ETDA 5GW7A 1YJNV 1ROPA 3F5WC 3JCZA 3ZCCA 2A0LA 1SESA 4KP4A 2PI4A 2AHYA 3CP1A 1OCCB 1VQLV 3I56V 3WFVA 3E86A 1MABG 4H33A 4R6ZA 1KP3A 1NVPD 1NVPB 1KKDA 2WLIA 3OMIB 4P2ZA 3EHBB 4MS2A 5EC2C 5CBHA 1VQ5V 2W6JG 2Y48A 3G6EV 5EBWC 2IJHA 3E8BA 5IY5C 1RM1B 5KUMA 3W7TA 4CBCA 2UXXA 3SYAA 1K33A 5E1AC 1EFRG 2QM8A 2YEVB 2X6BA 4RQEA 3CCLV 2ZXWB 5B1BB 1K92A 1R3IC 3B8NA 2JJ2G 4DXWA 3E89A 4JAUA 2IH3C 4PA7A 1KP2A 2P7TC 1V55C 3A0RA 3FB7C 1M57B 4WFAV 2ZD9A 1FS0G 4XBFA 1Y66A 3JD1A 1JOYA 1AJPA 2DYRC 3DTUB 1BMFG 3IFXA 1IXMA 3TK1A 4BIUA 3CCQV 3LDDA 2HJFC 3MHHC 4J9YB 1QVGU 3PJSK 2WLNA 1JPXA 1LNQA 3T4DA 1M1KW 3SPHA 3RW0A 3CCUV 5CBGA 4F4LA 1RPRA 3ZN1A 5H6QA 1GTOA 1NQTA 3E8GA 4PA9A 3LUTB 1VQ8V 2EINC 3AG2B 3QO7A 2JK5C 3ZRWB 3B8MA 4G28B 2OCCB 1DLBA 4RO2A 2X6AA 5B1NA 1S76D 1XL6A 1KQSU 1OCRC 1R6NA 3KG2A 5B3SC 3QO8A 3LDEA 3MD0A 1NBMG 2ZR3A 2DQ0A 4QPJA 3CC4V 3GWOA 5LHIA 4DO2A 2D3OW 1YTFB 1YTFD 4N23A 3E35A 3X2QB 3ZN0A 2HR3A 4JTCB 3ABUA 1G4YB 3TETA 1XL4A 1PL0A 4XDLA 3HPLC 1HWYA 2IH1C 3FB6C 4RQFA 3ETEA 3K03A 4WF9V 4FK5C 2EJRA 2A79B 2JEUA 1AJNA 3FYIB 4G27B 1YIJV 2IJJA 5HFLA 1S0VA 2OTLV 3CC2V 2OTJV 3OFNG 2WWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 V;  3CCE V;  1VQ4 V;  1M1K W;  1Q86 W;  1QVG U;  3CME V;  3CCR V;  3CCU V;  1VQ9 V;  3CD6 V;  3CMA V;  2QEX V;  3CCM V;  1YI2 V;  1VQM V;  1VQ5 V;  3CCS V;  4WFA V;  1YJW V;  3G6E V;  2QA4 V;  1N8R W;  3CC7 V;  1R73 A;  3CPW U;  1K73 W;  1KD1 W;  3CCV V;  3CCJ V;  1YJ9 V;  1KC8 W;  3CXC U;  1YHQ V;  4WFB V;  1K9M W;  1VQ8 V;  1S72 V;  3G71 V;  3I55 V;  3I56 V;  4WF9 V;  3OW2 U;  1YIT V;  1Q7Y W;  1JJ2 U;  1YJN V;  2OTL V;  1VQN V;  3CCQ V;  4WCE V;  1W2B U;  3CCL V;  5DM6 V;  1NJI W;  1VQ7 V;  1KQS U;  1Q81 W;  2OTJ V;  1VQP V;  1YIJ V;  1VQO V;  1M90 W;  1QVF U;  1K8A W;  3CC4 V;  1VQL V;  3CC2 V;  3G4S V;  1Q82 W;  1VQK V;  2D3O W; 
#chains in the Genus database with same CATH topology
 2EBO A;  3SPJ A;  5LOV B;  5LA6 A;  3CCR V;  4Q20 A;  1BHA A;  2BE3 A;  2P67 A;  3K5L A;  5BR8 B;  2CTR A;  1V9P A;  3NXS A;  4DV3 O;  3RGB A;  3JAM N;  1SRY A;  2ODM A;  3E22 B;  3CCJ V;  2LGW A;  1N32 B;  3L70 H;  3RWR D;  4IIJ A;  1TVK A;  2GHY A;  4B3R B;  3UO2 A;  4LCU C;  2WPD G;  1KEC A;  4LP8 A;  5FPR A;  4FLZ A;  1I5X A;  3W7S A;  4I55 A;  4B3M B;  4O2B A;  2QA4 V;  2YEV A;  2PZS A;  3AG3 C;  1FD9 A;  1AI5 A;  1PNK A;  5H2F Z;  4U7O A;  1ORQ C;  1FAF A;  1RPO A;  4I5S A;  1HR0 O;  4NXN O;  3N2G B;  2ZM6 O;  4TV9 B;  4PDV A;  4TWK A;  5KMG B;  3T4Z A;  5J2T B;  1QR9 A;  2IU3 A;  2FB5 A;  1AIL A;  2VRZ A;  3THO A;  1SET A;  4CS3 A;  1NR7 A;  2P90 A;  5H6R A;  1HDJ A;  2M6Y A;  2UXC O;  3EXA A;  4LFB O;  2EZO A;  1OHH G;  2QWQ B;  5A2Q N;  2IBZ H;  1PKX A;  3ASO B;  4BR6 A;  3C3S A;  3OE7 G;  2LP7 A;  2JGD B;  4AIL C;  3G80 A;  2CTQ A;  1QLN A;  4UCO A;  1SZT A;  2F93 B;  3CJH B;  4UXN A;  5J2T A;  4NTX A;  3OW2 U;  5LHH A;  4NYK A;  1VQ7 V;  4AI8 A;  1VQO V;  3ASN B;  1M57 C;  3OM3 B;  2B5U A;  3OTO B;  4LF9 O;  2WA3 A;  1FFT B;  1FFX B;  3AK1 A;  3SDL A;  4DV2 O;  5B3S B;  5LGN A;  3T1H O;  3T1Y B;  2YI9 A;  5IYB O;  1ZLZ A;  2LJ2 A;  4P9O A;  1EBO A;  1PD3 A;  2Q5Z A;  4RUE A;  1JX9 A;  4KL1 A;  3HB3 B;  4WFG A;  1Z5V A;  3TXQ A;  1SQF A;  2H94 A;  4RAI A;  4EB6 B;  3CEI A;  1J95 A;  2RNB A;  5LBQ A;  1XBL A;  2O57 A;  3ASN C;  3H01 A;  2PUS A;  3VOU A;  3RFR A;  1DTO A;  1NR1 A;  1GM7 A;  4IYH A;  3TGU H;  1K5Q A;  4PHZ A;  3ZX6 A;  2Y4U A;  4I7Z B;  3BEH A;  3JAK A;  4K0K O;  3JAW B;  2E3C A;  4I4T B;  4LWS A;  2QGN A;  5DED A;  3G4S V;  1IXB A;  2IJK A;  2XAH A;  4NTY A;  1VQ4 V;  4DUZ O;  1E79 G;  1QQC A;  3UO3 A;  4DR1 O;  4JI4 B;  1BGY H;  1K3E A;  3FD9 A;  4DR7 B;  1OCC C;  4J41 A;  1K9M W;  5GON A;  2XOK G;  4I9Q A;  4JI8 B;  1SKV A;  4X64 B;  4J7J A;  2C2A A;  2HVK C;  4XDJ A;  5JVD B;  1IBK O;  4LC1 A;  2XAG A;  3FAV A;  3AG7 A;  4UV8 A;  2WAM A;  3AG2 C;  2NNU A;  4I50 A;  5CA1 B;  1B3Q A;  4PDL A;  1K4D C;  1SF9 A;  2H3O A;  2CTP A;  4HYO A;  3J80 N;  2PGG A;  1TGO A;  1JFF A;  2WLL A;  4JPR A;  2FTK A;  2AXT Z;  1XHX A;  2JEX A;  3ABL B;  3BAB A;  1K34 A;  4NXM B;  4DV3 B;  3WG7 C;  1PV0 A;  5LL6 Y;  3T2M A;  3HKE B;  1MA1 A;  4JF3 A;  1OCZ B;  4H44 B;  3E22 A;  4IHJ A;  4JV5 O;  2E74 B;  3K79 A;  3ABK C;  1IVS A;  4JTD B;  3RBZ A;  2F43 G;  2Q67 A;  2QDO A;  4FVM A;  2XND G;  1TAE A;  2Q73 A;  1M93 A;  3BAA A;  2Q0A A;  5LXT B;  4JYC A;  4P9P A;  1OCO B;  5EK0 A;  4BAY A;  2UUA O;  1Q6I A;  1XDC A;  2NR5 A;  1CEZ A;  3HKB B;  3FAV B;  3FB8 C;  4LF4 O;  4Z1M G;  4DV2 B;  1GMG A;  2KG7 B;  2W6I G;  1VQM V;  1BQ0 A;  4CZZ A;  3BA9 A;  3RYF A;  4QE7 A;  5CA3 A;  5IYZ A;  1S72 V;  1EM1 A;  2Q69 A;  5KUK A;  2A9H A;  2KB1 A;  1S77 D;  4IT5 A;  1M90 W;  2ZDI A;  1RSO B;  4JI1 O;  3K57 A;  3HKC A;  3ZRX A;  3BCC H;  2Q7E A;  1Y74 A;  3E8F A;  1HNW B;  2ZDI C;  3SYQ A;  1A32 A;  1IX9 A;  3LNN A;  4R8C A;  2EIK C;  4I0X A;  1TUB B;  1EZJ A;  2X6C A;  1CPY A;  3CX5 F;  4GKJ O;  3D3Q A;  2GV9 A;  5IYZ B;  1VAR A;  4FLV A;  4TT3 G;  1YCI A;  2ZNI A;  3JAR A;  2F1M A;  5EYP B;  4GX5 A;  4OPH A;  4H0L B;  2VQF O;  1R6K A;  3FB5 C;  3U0Z A;  2UUB B;  1EN5 A;  3CYO A;  4AHC A;  1H2G A;  1U97 A;  3SJQ C;  3IC9 A;  2UXB O;  3M7M X;  2A0L A;  1SES A;  4KP4 A;  2CDY A;  1S5L Z;  4YIP A;  3WFV A;  3CRA A;  3E86 A;  1MAB G;  3K5M A;  1NVP D;  1NVP B;  1KKD A;  2WLI A;  3OMI B;  4X1K A;  3JAW A;  4MS2 A;  5EC2 C;  4FM0 A;  2Y48 A;  5F2V O;  3G6E V;  4FLX A;  2MW2 B;  5IY5 C;  3W7T A;  3CS5 A;  3Q4H B;  2UXX A;  4J7K A;  2QM8 A;  4RQE A;  1MNG A;  3N2K B;  5B1B B;  3ZHQ A;  4UCR A;  4UCS A;  5BR8 O;  1Q5O A;  3A0R A;  1BZK A;  4X66 O;  2ZD9 A;  1VP7 A;  3ZHV A;  4X62 O;  4TUY B;  3SR2 C;  1JOY A;  1AJP A;  4JYA O;  3IFX A;  2HJF C;  3MHH C;  2RN9 A;  2EX3 A;  3ZHS A;  1QVG U;  2G38 A;  3PJS K;  5GON B;  1J5E O;  3K59 A;  1IBM O;  5IJ0 A;  2P5O A;  3ZN1 A;  5H6Q A;  4B3T B;  1QU7 A;  1DGS A;  4TQF A;  5CA1 A;  1SQV H;  2JK5 C;  4CH5 A;  1XMO O;  4DRX B;  5B3S C;  3QO8 A;  2PYL A;  3MD0 A;  1JMK C;  2DQ0 A;  4QPJ A;  4IL6 Z;  1YTF B;  1YTF D;  4O4I B;  3QG5 A;  2HP8 A;  3X2Q B;  3ZN0 A;  2HR3 A;  3ABU A;  4TOI A;  4EFB A;  1G4Y B;  4K8Z A;  3TET A;  1UPG A;  1KUQ A;  4LR3 A;  3HPL C;  1HNZ O;  2R70 A;  4RQF A;  1WP8 A;  2YIC A;  1SA0 B;  2EJR A;  2A79 B;  4LFB B;  1S0V A;  5HFL A;  5LXT A;  1HP8 A;  3RYC A;  2WWW A;  2FML A;  1FJG B;  4U7N A;  1V54 C;  1XHZ A;  3OT7 A;  3JAL B;  4O4J A;  2Q0O C;  1NH2 D;  1NH2 B;  1DF5 A;  1FKA O;  4CH4 A;  4DUZ B;  3TJT A;  1QBZ A;  3SJC C;  2GTS A;  1Q7Y W;  1F7Y A;  2QKC A;  5JQG B;  5CMU A;  1SER A;  4YIO A;  4YJ3 A;  5CA0 B;  1MZF A;  1R3K C;  3RYC B;  3CME V;  3UKM A;  1THZ A;  1DF4 A;  4JGS A;  1WPB A;  2EJ7 A;  4UVB A;  1R73 A;  1AI6 A;  4GUN A;  3LSU A;  3H1L H;  1X59 A;  4MVZ A;  2DOS A;  2GDS A;  1MSD A;  2XHB A;  3K5N A;  1JVM A;  3B2E E;  2DE0 X;  5BZB A;  1IBL B;  3IC7 A;  1S5H C;  3ETG A;  5B1B C;  4FLW A;  4HBN A;  1G6U A;  3P30 A;  1N34 O;  1N33 B;  3D8C A;  3WG7 B;  4E4E A;  4JYY A;  1MG1 A;  1W2B U;  3MHS C;  5B5E Z;  2DYS B;  1JA8 A;  4QGP A;  1YEW A;  2GUZ B;  2YIB D;  4BIZ A;  2F4V O;  2EIN B;  4O2B B;  4I9W A;  4NVP A;  2ZE5 A;  4QE9 A;  2LGQ A;  2LO1 A;  2V7Q G;  1YJW V;  4IYI A;  1AP5 A;  4MW3 A;  2UXN A;  2UXB B;  3ML0 A;  1VF5 B;  4X1Y A;  2UUC O;  1M56 B;  3OUS A;  3N2G A;  2WLK A;  2PTM A;  4DUY O;  1GKF A;  1W59 A;  1NZ6 A;  3QF7 A;  4KUM A;  1M4U A;  2ATK C;  2M7W A;  1WP7 A;  3OGC C;  4U3J B;  2ZE7 A;  4ZHQ A;  3CRQ A;  5IT9 N;  1BCC H;  5EC1 C;  3R65 A;  4TSF G;  4O2A A;  5KX5 A;  4UB6 Z;  2XUM A;  3ABM B;  1S5J A;  4UUJ C;  4JI5 B;  3SPC A;  2A06 H;  5KHH A;  4BW9 A;  2OCC C;  4JI5 O;  1KYO F;  1HW7 A;  5L3D A;  3OAA G;  1E1Q G;  1WA8 B;  3TCU A;  1AI4 A;  1GN2 A;  4HNA A;  4MVU A;  5LA6 B;  2PI5 A;  5BY1 A;  2Y69 C;  3FX7 A;  1F51 A;  1PPJ H;  4WFE A;  2P6J A;  2LFR A;  2EUL A;  1SQX H;  3C3T A;  1Y67 A;  3B09 A;  5C8Y A;  3RYI B;  1NI8 A;  5IDJ A;  1LUW A;  2JIZ G;  4DV6 O;  4JI7 O;  1ARO P;  1PP9 H;  3K06 A;  3SYC A;  4J7Z A;  2BSK B;  5BXZ A;  1XMQ B;  3H1I H;  1XMQ O;  3S3W A;  3UT5 A;  5LOV A;  1QLE C;  3KCX A;  1PL4 A;  2QWN B;  3W7W A;  2H8P C;  1OCZ C;  4YJ3 B;  4LFA O;  2ZIM A;  4X65 B;  1M5I A;  4FLU A;  3OEE G;  1K73 W;  4U3J A;  4JI0 B;  3P32 A;  1F23 A;  3B77 A;  2HFE C;  3E8H A;  4TV8 A;  1US6 A;  4FFB A;  4GZR B;  5LYJ B;  1EN6 A;  1Z5W A;  5KMG A;  3H1K H;  1FPO A;  2WLL B;  2X7R B;  4XDK A;  3OD4 A;  3ABL C;  1L1F A;  4RUF A;  3JD4 A;  2YC0 A;  2HJD A;  3DC6 A;  4MVO A;  4I50 B;  4I4T A;  4LWS B;  4UB8 Z;  5HFM A;  4N21 A;  4AQY B;  2P4V A;  4CS4 A;  1P7B A;  3RVY A;  1Q8I A;  1ZUQ A;  1KKC A;  3ZRV A;  1FXH A;  2OIG A;  1QVF U;  3LSQ A;  2ADQ B;  1Z2G A;  1LUV A;  5LMU B;  3VBB A;  2E5L B;  3I5D A;  3ZMU A;  4ABM A;  4U3F H;  2ZXW C;  1JJO A;  1DK1 A;  4X8A A;  4R7C A;  3D3I A;  3SYP A;  3G6B A;  3F7Y C;  4DV4 O;  1H2L A;  3ABT A;  2CGO A;  3ZMT A;  1NTZ H;  1Q81 W;  2CK3 G;  3GB7 C;  3K0D A;  2LFS A;  1Q82 W;  3EFF K;  1Y6X A;  2IU0 A;  1BL8 A;  2DWE C;  3TXS A;  1ZAU A;  4X62 B;  4DV1 O;  4DR2 O;  5TIS Z;  4DYL A;  4ZKI A;  3BA8 A;  4MTO A;  2CUG A;  5EZY B;  1QHT A;  2ILM A;  4MVM A;  2ZE8 A;  3K3W A;  1WPX A;  4GX1 A;  3G71 V;  4P30 A;  4FLY A;  4JI2 O;  1WB8 A;  1UJW B;  1YVW A;  1EZV H;  1N0J A;  2Y4T A;  3E2E A;  4ZBM A;  1ZWI C;  1MOF A;  1H2K A;  2QM7 A;  3AG1 C;  3QNE A;  4JAV A;  4JZ2 A;  5D5P A;  2QWP B;  4PEL A;  4NTW A;  3CD6 V;  3IGA C;  5JWP A;  1F4M A;  3OTO O;  1Y4M A;  2QE7 G;  5JH7 B;  3BY6 A;  1YHQ V;  2HG5 C;  3OUF A;  2OWO A;  4GYC B;  4MW8 A;  1TUB A;  1W0J G;  3F5W C;  3ZCC A;  2ZT9 B;  5JJJ B;  4K3A A;  3EHB B;  5JJE B;  3HKD A;  1VQ5 V;  4JI0 O;  2KSD A;  3VQW A;  5EBW C;  5EZY A;  2CAZ C;  5CB4 A;  3SYA A;  5E1A C;  1EFR G;  2YEV B;  3CCL V;  2AZ0 A;  4OX9 O;  2JJ2 G;  4DXW A;  1ZSP A;  1WN7 A;  2IH3 C;  3DSQ A;  4BWA A;  3FB7 C;  5KLV H;  1SQQ H;  4JI3 O;  3KKY A;  4D7T A;  1Q6H A;  3CJH A;  2HHH O;  1BMF G;  3ICX A;  4BIU A;  3TK1 A;  4JYA B;  1L0L H;  3U11 A;  3J81 N;  4ICG A;  4B3R O;  1P7G A;  2PF4 E;  3H1H H;  4J42 A;  1JPX A;  1B06 A;  4JI3 B;  4UCT A;  4NR1 A;  3RW0 A;  2KQX A;  5EIB D;  4B3S B;  1WJZ A;  1ZTE A;  4PA9 A;  4DR3 B;  3LUT B;  1AP6 A;  1VQ8 V;  1AR4 A;  2YID A;  2P06 A;  2CTW A;  4G28 B;  4RO2 A;  2JGU A;  5B1N A;  1S76 D;  1KQS U;  1R6N A;  4DR6 B;  3U10 A;  2ZR3 A;  2L6L A;  4LNU A;  3ZBH A;  3NR7 A;  1WAZ A;  2CH7 B;  2E76 B;  5LHI A;  4DO2 A;  5LP6 A;  5J2U B;  3VQV A;  3E35 A;  1XL4 A;  3HKD B;  2IH1 C;  3BRC A;  3CHX A;  4CH3 A;  4WF9 V;  4YHH B;  4FK5 C;  2CE4 A;  3JAK B;  5ITZ B;  2JEU A;  2QSA A;  2IJJ A;  1CXZ B;  4GCZ A;  3LDC A;  1IDS A;  4J11 A;  4RWU A;  4FM1 A;  2F95 B;  3AG3 B;  3DC5 A;  4EB6 A;  3QO5 A;  5BMV A;  3CCS V;  4FM2 A;  4PJ0 Z;  5B66 Z;  1XNR O;  4X66 B;  1KC8 W;  4BW5 A;  3UCS C;  1RSO A;  2BOB C;  3W7X A;  4B3T O;  1QNM A;  4J9Z B;  4O4I A;  3ZRS A;  1SQG A;  1BSM A;  2CH7 A;  5LP6 B;  1COW G;  1VQK V;  3ASO C;  4X64 O;  2ADP A;  1VQ9 V;  3CMA V;  2ITC C;  2LQT A;  4JI4 O;  3ABM C;  2W0X A;  1AR1 B;  2V4D A;  1K5S A;  2DYR B;  3IAY A;  4X1I B;  2EIL C;  1YZB A;  2V1D A;  2D2C B;  4OPA A;  2F23 A;  3ZJZ A;  1NT2 B;  4F6R B;  3JAL A;  4PDR A;  1GH6 A;  3AG4 B;  1KB9 F;  1PM9 A;  5GTH Z;  1FYJ A;  4PV1 B;  4PA3 A;  4H37 A;  1Q43 A;  4GKJ B;  4X65 O;  1GK9 A;  4EKW A;  4GX2 A;  2DWD C;  2N05 A;  3ZMS A;  4QJF B;  2BSK A;  2VQE O;  2JS5 A;  4KXR A;  3SPG A;  4AQY O;  5IYC O;  2B1G A;  2DJV A;  1R3L C;  2Q7H A;  2ZIN A;  2XAF A;  2F66 C;  4LF8 O;  5AG2 A;  2RJZ A;  3ZHR A;  2QEX V;  3Q4H A;  1CP9 A;  4HAM A;  2WLM A;  4QNH B;  4JI7 B;  4LF4 B;  3BFR A;  3W7U A;  1BS3 A;  4LBE C;  1XMO B;  1D2D A;  1S3J A;  2YI8 A;  4F6R A;  2Q7G A;  1JCH A;  2JDI G;  2VQF B;  1W0K G;  1SC5 B;  1K8A W;  1AVM A;  3KCY A;  5KA6 A;  3CSX A;  1ZX3 A;  2EIM C;  4BIO A;  4R50 A;  3N27 A;  4WBN A;  3K04 A;  1TA8 A;  1GO3 F;  2NLJ C;  3L71 H;  2W0F C;  1IBL O;  1L8D A;  4FZ0 A;  1VIB A;  5L3E A;  2YUA A;  3SPI A;  2VWK A;  4LF7 O;  4DR4 B;  3WB1 A;  2ETN A;  3A0H Z;  5EYP A;  3DXR A;  1Q86 W;  1KU9 A;  2EZP A;  1GM9 A;  4UVA A;  3SGI A;  3AK2 A;  1IBM B;  5LGU A;  2RMK B;  4WFF A;  1Y76 B;  1AR5 A;  1YSC A;  3AK3 A;  4NKG B;  4JAS A;  4DR3 O;  3RVZ A;  5H9C A;  3HKC B;  2HLD G;  4L87 A;  1Y74 B;  2VQE B;  3ABK B;  5FL7 G;  1N4C A;  5ITZ A;  3ETQ A;  3GWK C;  4MVS A;  4MVQ A;  1I5Y A;  2DMX A;  2WLH A;  1MSW D;  2OCH A;  5C93 A;  5IJ9 B;  2WSS G;  1JQ0 A;  4O4L A;  3G67 A;  1YJ9 V;  3JD0 A;  1SZX A;  4A5U B;  3AEI A;  3JSN A;  2R9R B;  2FL4 A;  5LHG A;  2IM9 A;  3VQY A;  3X2Q C;  1HNZ B;  3CCV V;  3O65 A;  3LSS A;  2EIJ C;  4WFH A;  4YHH O;  3JSL A;  1VQP V;  1Q90 D;  2MK3 A;  4L8J A;  1VEW A;  1OV9 A;  3DXR B;  4GLX A;  1PNL A;  2GSM B;  2QWR B;  2IJI A;  1QCE A;  4TV9 A;  3BVO A;  4JI6 O;  1I08 A;  3OMA B;  4LFC B;  4UCU A;  3CXC U;  4HZ3 A;  4Z1V A;  1NS1 A;  1YF2 A;  2PYJ A;  2OT5 A;  1UFI A;  2LW7 A;  3WB2 A;  4LF9 B;  4PA4 A;  2YS8 A;  4FLT A;  3OR7 C;  4X88 A;  4FPP A;  2XAJ A;  2QKS A;  4KFM A;  2AW9 A;  5L3C A;  4CH6 A;  2QWO B;  1ZL8 B;  3ZIA G;  4ZI7 A;  1KD1 W;  3CWB H;  5IWA B;  1ENV A;  2JVD A;  1HNW O;  1T5E A;  2HVJ C;  3L72 H;  5FNV A;  2GBO A;  3K9A A;  3CRC A;  4GT1 A;  5JCO C;  5DEC A;  1I7F A;  3P3N A;  5CN0 A;  4EFE A;  1H8E G;  3ZMV A;  1V55 B;  4TV8 B;  5IE9 A;  2ARH A;  4DV5 O;  2XT9 A;  1N36 O;  4JZG A;  4MSW C;  4X1Y B;  4FJC C;  4LF5 B;  1Q6U A;  4G2K A;  3D36 A;  4I55 B;  2QJ1 A;  4WCE V;  5B1A B;  1XNR B;  1SA0 A;  5FNV B;  1FXV A;  4JV5 B;  4LF6 O;  1NTM H;  5FLX N;  1N34 B;  2UUC B;  4KHP O;  1TVK B;  1TUE B;  2EIK B;  2EIJ B;  1AI7 A;  3K08 A;  1BT8 A;  2AHZ A;  1R3J C;  1B6Q A;  3B4S A;  4PDM A;  4O2A B;  5KX5 B;  1ROP A;  1J5E B;  3JCZ A;  3CP1 A;  1VQL V;  1NU1 H;  4R6Z A;  4P2Z A;  5KHJ A;  5CBH A;  2KKW A;  2LW1 A;  4HNA B;  1RFY A;  2IJH A;  3E8B A;  1RM1 B;  4DR6 O;  2QR4 A;  4YY3 B;  1K33 A;  4PD4 F;  2X6B A;  5FPO A;  3B8N A;  4O4H B;  3E89 A;  1KP2 A;  2B9Z A;  2YIA A;  4PI2 A;  3UQ8 A;  1H2N A;  1M57 B;  4WFA V;  1FS0 G;  4XBF A;  3JD1 A;  4KHP B;  3DTU B;  4D7S A;  4IGG A;  4F6E A;  3CCQ V;  4DV6 B;  3K5O A;  4J9Y B;  2CGN A;  2QM4 A;  4DV7 B;  5JH7 A;  3JAT A;  2WLN A;  3T4D A;  3APQ A;  4O4H A;  1N0N A;  2Q8V A;  4K8X A;  4F4L A;  4H13 B;  3E8G A;  2UUB O;  3APO A;  2EIN C;  3AG2 B;  4DV7 O;  3ZRW B;  3B8M A;  1DLB A;  2X6A A;  5LMN B;  1OCR C;  3A0B Z;  3LDE A;  1XOU A;  4OGQ B;  3GWO A;  3L74 H;  4FFK A;  2BTO A;  4PI0 A;  2UXD B;  3JAT B;  4N23 A;  5IWA O;  3ZHU A;  4DV4 B;  4JTC B;  1H2S B;  4LF7 B;  4DR4 O;  4I0X B;  1PL0 A;  1XNQ B;  1IUR A;  4XDL A;  1HWY A;  3OTF A;  3FB6 C;  2WA4 A;  2AGA A;  3ETE A;  2ZIO A;  2JRI A;  3FYI B;  4G27 B;  2R9A A;  4D6T H;  3EVK A;  2HHH B;  3M8A A;  2OIE A;  2VS0 A;  1XRE A;  1H2M A;  3OR6 C;  2JJ1 G;  2ZR2 A;  1VF6 A;  1OCR B;  4LFC O;  1IZ3 A;  4JI6 B;  2RCV A;  4MT8 A;  3CPW U;  4DR1 B;  2ZNJ A;  4K35 A;  4YJ2 A;  1K4C C;  3S3X A;  3M99 B;  5J2U A;  2Z3Y A;  1NJI W;  5J9P C;  3F7V C;  4ZI7 B;  4X89 A;  4DW1 A;  4JI8 O;  2JGD A;  2ITD C;  3C90 A;  2UUA B;  1OZ0 A;  2Y69 B;  3LNM B;  2Z0A A;  1D5N A;  1O9H A;  3UM7 A;  1NTK H;  2Q4P A;  3OGI B;  3PN1 A;  4UCV A;  1K7D A;  5LYJ A;  4GKK B;  4W4L A;  2Q6A A;  1X4T A;  1WLE A;  3JAS A;  2FYU H;  3HKB A;  2EIL B;  2XAQ A;  3MDS A;  1B04 A;  1YXB A;  3ZED A;  3E83 A;  1OCO C;  1PNM A;  4DV0 B;  2Q9L A;  3RYF B;  1VF7 A;  3F5T A;  2ZE6 A;  2A7W A;  2DW4 A;  3K9S A;  5LP6 C;  3SYO A;  1QLE B;  5IY5 B;  3CCE V;  3OEH G;  4B08 A;  1K97 A;  3QVN A;  3A2F A;  4J10 A;  2YXH A;  4TQD A;  5A9G A;  5CB4 B;  5L3G A;  2R9I A;  1P84 F;  3H1J H;  4LF8 B;  4JI2 B;  2OYQ A;  1RM1 C;  2Y0P A;  3MAQ A;  4LF6 B;  4YJ2 B;  3RYH B;  1LR1 A;  1MZE A;  1HNX B;  2BOC C;  2JS3 A;  3JAS B;  1M9N A;  1HNX O;  3JYC A;  3STL C;  1AJQ A;  3AG4 C;  1H38 A;  4X20 A;  4UVC A;  4ZOL A;  3FKS G;  4OX9 B;  4O4J B;  5LMN O;  3L75 H;  1F4N A;  2ZM6 B;  5EBM C;  2Q68 A;  1JJ2 U;  3I55 V;  4ASU G;  1GM8 A;  2ZQM A;  1U96 A;  4DW0 A;  4DK0 A;  5KAI Z;  1N33 O;  1E1R G;  4CC5 A;  1JR9 A;  4MVR A;  5EBL C;  4JI1 B;  5KHK A;  1XQ8 A;  5L3F A;  4MTX A;  1L0N H;  1I94 B;  3BHP A;  1URF A;  3HKE A;  4JTA B;  3CRR A;  1QR8 A;  4WBN B;  1XUQ A;  3JAR B;  4B7E A;  4FZ1 A;  4GX0 A;  4NB5 A;  4EEQ A;  4LNU B;  3JD2 A;  4FIP C;  2N04 A;  5DM6 V;  5BMV B;  2XAS A;  4YXW G;  5D5Q A;  2K9P A;  1EN4 A;  1YDX A;  5KA5 A;  2QTO A;  1FXK A;  1Y76 A;  3CXH F;  2DQ3 A;  1GAX A;  1VF6 C;  5JVD A;  3ZHT A;  2UU9 B;  1P49 A;  3HR0 A;  1SQB H;  4IHJ B;  3B40 A;  4MTG A;  4GKK O;  3GVM A;  2YDE A;  1VMG A;  1IBK B;  2KG7 A;  3RYH A;  4OXS A;  1R1B A;  1JFF B;  4DR5 B;  4Z2W A;  2BTQ A;  1BHB A;  3ZS8 C;  3K0G A;  1OJH A;  3L9D A;  4J80 A;  1MMM A;  3CE2 A;  5B1A C;  4DV5 B;  2Y0I A;  1P4R A;  4JAA A;  1FJG O;  1N8R W;  2WLJ A;  3CC7 V;  1G8M A;  3FYE B;  4JYB A;  4DV0 O;  5IJ0 B;  3BPZ A;  1I94 O;  2P22 C;  1YIT V;  3H9V A;  5EIB C;  4LH6 A;  1O9G A;  5IYD O;  4PA6 A;  1BQZ A;  3JD3 A;  3R66 A;  4TUY A;  3L73 H;  4CS2 A;  3T1C A;  2XTA A;  4QPK A;  4C7U A;  1N36 B;  1SS3 A;  1GRJ A;  2E75 B;  4X1I A;  1BE3 H;  5K1X A;  1M56 C;  2IW5 A;  3STZ C;  5KAF Z;  2K1E A;  4ZHQ B;  1VQN V;  4DUY B;  2X0L A;  4O4L B;  1R6T A;  4MTF A;  2A3Q A;  1V54 B;  3A8T A;  4DR5 O;  1FXK B;  5B1O A;  3VQX A;  1YI2 V;  2DYS C;  4FMT A;  2UXD O;  2VWJ A;  5L3B A;  2EIM B;  5LMU O;  4X1K B;  2E5L O;  3RT3 C;  1H8H G;  1KBH A;  3WU2 Z;  4QIW F;  4X9Q A;  3T1H B;  3ZMZ A;  1HR0 B;  4NXN B;  1NKD A;  4B3M O;  2BTQ B;  1G1X B;  3AG1 B;  1FXK C;  1GN6 A;  1WA8 A;  1WB7 A;  2QKA A;  1RP3 B;  3N2K A;  4ZOL B;  3FFQ A;  3SJA C;  2B1I A;  4WFB V;  4Q6G A;  2FKX A;  3WB0 A;  4LF5 O;  2ZCE A;  3ZRW A;  2WLI B;  4E2L A;  3DGE A;  5DN6 G;  2RDC A;  1VQ6 V;  2L35 A;  1XEQ A;  3UT5 B;  2P4K A;  2R72 A;  3CCM V;  4UV9 A;  4B7K A;  2GTA A;  2HKO A;  3OMN B;  5LGT A;  2UXC B;  2YSU B;  4X20 B;  2Z5U A;  5CBF A;  1XIL A;  5E79 Z;  3ETD A;  5GW7 A;  1YJN V;  3J7A U;  1D5A A;  5JJN B;  2PI4 A;  2AHY A;  3D36 C;  5KHI A;  3JCU Z;  1OCC B;  2AZ2 A;  3I56 V;  2UU9 O;  4ZIB A;  4H33 A;  1KP3 A;  3P3P A;  2YXY A;  2PY5 A;  1WNS A;  2W6J G;  1I0H A;  3QTC A;  4DRX A;  2HEP A;  5KUM A;  4CC6 A;  5JCO A;  4NXM O;  3IJ4 A;  4CBC A;  4YY3 O;  5GTI Z;  3CB2 A;  4FFB B;  4DK1 A;  2ZXW B;  4W4K A;  5H5N A;  1K92 A;  1R3I C;  2RQ6 A;  1XNQ O;  5IJ9 A;  4JAU A;  1KMI Z;  4PA7 A;  2P7T C;  2DN9 A;  3CRM A;  1V55 C;  5K1P A;  5KHG A;  1Q3E A;  4DV1 B;  4DR2 B;  1Y66 A;  2GUZ A;  2NN4 A;  2YIB A;  2DYR C;  1N32 O;  1IXM A;  1GN4 A;  2ZKO A;  3LDD A;  2BCC H;  4K0K B;  4DR7 O;  1FFX A;  3SJB C;  1XI1 A;  4UFZ A;  1LNQ A;  1M1K W;  3SPH A;  3CCU V;  2F4V B;  4B3S O;  5CBG A;  3RN4 A;  1AB3 A;  1RPR A;  1GTO A;  1NQT A;  5CA0 A;  3QO7 A;  3KZI Z;  2OCC B;  1XL6 A;  3KG2 A;  1GN3 A;  4IIJ B;  1NBM G;  3O9O A;  1ZL8 A;  3CC4 V;  2D3O W;  5JQG A;  4LFA B;  2YXL A;  1SQP H;  3RYI A;  5C8Y B;  3T1Y O;  4LH7 A;  2QTS A;  3K03 A;  3K58 A;  1AJN A;  1YIJ V;  2N74 A;  2OTL V;  3CC2 V;  2OTJ V;  3OFN G; 
#chains in the Genus database with same CATH homology
 4GCZ A;  2EBO A;  4U7N A;  3SPJ A;  3OR6 C;  1V54 C;  3LDC A;  3CCR V;  2JJ1 G;  4Q20 A;  1BHA A;  2P67 A;  2ZR2 A;  3AG3 B;  3QO5 A;  1NH2 D;  1NH2 B;  1OCR B;  3CCS V;  1DF5 A;  3NXS A;  1SRY A;  4MT8 A;  3CPW U;  3CCJ V;  1KC8 W;  4BW5 A;  1QBZ A;  2BOB C;  1K4C C;  1Q7Y W;  3W7X A;  3M99 B;  4J9Z B;  2Z3Y A;  3ZRS A;  5J9P C;  1NJI W;  3F7V C;  2GHY A;  5CMU A;  1COW G;  4X89 A;  1SER A;  1VQK V;  4LCU C;  3ASO C;  1R3K C;  2ITD C;  2WPD G;  1KEC A;  3CME V;  3UKM A;  1VQ9 V;  1THZ A;  4LP8 A;  3CMA V;  1OZ0 A;  1DF4 A;  2Y69 B;  2ITC C;  4JGS A;  1I5X A;  3LNM B;  3W7S A;  4UVB A;  3ABM C;  2QA4 V;  1AR1 B;  1R73 A;  3UM7 A;  1K5S A;  1AI6 A;  2DYR B;  1K7D A;  2EIL C;  2YEV A;  4MVZ A;  2V1D A;  3AG3 C;  3ZJZ A;  2Q6A A;  4PDR A;  1WLE A;  1AI5 A;  1JVM A;  3AG4 B;  1PNK A;  5BZB A;  4U7O A;  1ORQ C;  1RPO A;  4I5S A;  2EIL B;  3IC7 A;  2XAQ A;  4PDV A;  1S5H C;  3ETG A;  5B1B C;  4PA3 A;  4TWK A;  4H37 A;  3E83 A;  3T4Z A;  3P30 A;  1GK9 A;  1QR9 A;  4EKW A;  1OCO C;  4GX2 A;  2IU3 A;  1PNM A;  2DWD C;  3WG7 B;  1SET A;  1MG1 A;  1NR7 A;  2P90 A;  5H6R A;  3ZMS A;  1W2B U;  4QJF B;  3MHS C;  2DW4 A;  2DYS B;  3SPG A;  2EZO A;  1OHH G;  5IYC O;  2B1G A;  3SYO A;  1QLE B;  1R3L C;  4BIZ A;  1PKX A;  5IY5 B;  3OEH G;  3CCE V;  2EIN B;  2XAF A;  1K97 A;  3ASO B;  4I9W A;  4QE9 A;  2QEX V;  5L3G A;  2R9I A;  1CP9 A;  2V7Q G;  4HAM A;  2WLM A;  4QNH B;  3OE7 G;  1YJW V;  1RM1 C;  2LP7 A;  4MW3 A;  3W7U A;  4LBE C;  2UXN A;  1QLN A;  1SZT A;  4UXN A;  3OW2 U;  1S3J A;  3ML0 A;  5LHH A;  1VQ7 V;  1M56 B;  1JCH A;  1VQO V;  2BOC C;  3ASN B;  3OUS A;  1M9N A;  2JDI G;  1W0K G;  2WLK A;  1M57 C;  1GKF A;  2B5U A;  3JYC A;  3OM3 B;  4KUM A;  1K8A W;  5KA6 A;  3STL C;  1AJQ A;  3AG4 C;  1H38 A;  2EIM C;  4UVC A;  4R50 A;  1FFT B;  3K04 A;  2ATK C;  2M7W A;  3FKS G;  5B3S B;  5LGN A;  3OGC C;  5IYB O;  1GO3 F;  1F4N A;  2NLJ C;  4P9O A;  2W0F C;  1EBO A;  5EBM C;  1PD3 A;  2Q68 A;  1JJ2 U;  3I55 V;  4ASU G;  4RUE A;  1GM8 A;  2ZQM A;  5L3E A;  1JX9 A;  5EC1 C;  3R65 A;  3SPI A;  4TSF G;  3HB3 B;  4WFG A;  1E1R G;  4MVR A;  5EBL C;  2H94 A;  3ABM B;  4UUJ C;  3SPC A;  5L3F A;  1Q86 W;  2OCC C;  4MTX A;  4RAI A;  2EZP A;  5L3D A;  1J95 A;  1GM9 A;  3OAA G;  1E1Q G;  4UVA A;  5LBQ A;  4JTA B;  3ASN C;  3H01 A;  1QR8 A;  3VOU A;  3TCU A;  1DTO A;  1NR1 A;  1AI4 A;  1GM7 A;  4GX0 A;  5LGU A;  4WFF A;  1YSC A;  4MVU A;  1K5Q A;  2PI5 A;  3JD2 A;  4FIP C;  4JAS A;  5DM6 V;  2XAS A;  2Y69 C;  3BEH A;  3RVZ A;  1F51 A;  4YXW G;  5H9C A;  4WFE A;  2P6J A;  2LFR A;  2HLD G;  4L87 A;  3ABK B;  3G4S V;  2IJK A;  2XAH A;  5FL7 G;  1VQ4 V;  4MVS A;  4MVQ A;  1E79 G;  5KA5 A;  1I5Y A;  2QTO A;  1FXK A;  2DQ3 A;  2WLH A;  5IDJ A;  1MSW D;  5C93 A;  1K3E A;  2JIZ G;  2WSS G;  1JQ0 A;  1OCC C;  1ARO P;  3K06 A;  1YJ9 V;  3SYC A;  1K9M W;  3JD0 A;  2XOK G;  4MTG A;  2C2A A;  2HVK C;  4XDJ A;  4OXS A;  4LC1 A;  3AEI A;  2XAG A;  1QLE C;  4UV8 A;  1BHB A;  2WAM A;  3AG2 C;  2NNU A;  2R9R B;  3K0G A;  5LHG A;  3W7W A;  4PDL A;  1K4D C;  2H8P C;  5B1A C;  3X2Q C;  1OCZ C;  4HYO A;  1P4R A;  1N8R W;  2WLJ A;  3OEE G;  3CC7 V;  1G8M A;  2WLL A;  3FYE B;  1K73 W;  3CCV V;  4JYB A;  3P32 A;  2FTK A;  4JPR A;  1F23 A;  2JEX A;  3ABL B;  3LSS A;  1K34 A;  3B77 A;  1YIT V;  2HFE C;  3E8H A;  3WG7 C;  2EIJ C;  4WFH A;  3T2M A;  4JF3 A;  1OCZ B;  1VQP V;  5IYD O;  4PA6 A;  3JD3 A;  2MK3 A;  2WLL B;  3K79 A;  3ABK C;  3T1C A;  4QPK A;  4JTD B;  3RBZ A;  2F43 G;  2Q67 A;  2X7R B;  4XDK A;  1PNL A;  2GSM B;  3ABL C;  1L1F A;  4RUF A;  3JD4 A;  2IJI A;  2XND G;  1QCE A;  4MVO A;  3OMA B;  1M56 C;  2IW5 A;  4JYC A;  3CXC U;  4HZ3 A;  4P9P A;  1OCO B;  4N21 A;  3STZ C;  5HFM A;  5EK0 A;  4BAY A;  2K1E A;  1P7B A;  1CEZ A;  1VQN V;  3RVY A;  2OT5 A;  3ZRV A;  1FXH A;  1QVF U;  3LSQ A;  2X0L A;  3FB8 C;  4PA4 A;  4Z1M G;  3OR7 C;  3VBB A;  4MTF A;  4X88 A;  4FPP A;  1V54 B;  2XAJ A;  3ZMU A;  1GMG A;  2QKS A;  2ZXW C;  2W6I G;  1FXK B;  4KFM A;  5B1O A;  1VQM V;  1YI2 V;  2DYS C;  5L3C A;  4CZZ A;  4X8A A;  3ZIA G;  4FMT A;  1KD1 W;  4R7C A;  3D3I A;  4QE7 A;  3SYP A;  5L3B A;  1ENV A;  2EIM B;  3F7Y C;  5CA3 A;  3ABT A;  2HVJ C;  1S72 V;  3ZMT A;  2Q69 A;  1H8H G;  5KUK A;  2A9H A;  2KB1 A;  3K9A A;  1S77 D;  1Q81 W;  2CK3 G;  1M90 W;  4GT1 A;  2ZDI A;  4QIW F;  3GB7 C;  3K0D A;  2LFS A;  3ZMZ A;  1Q82 W;  1NKD A;  3EFF K;  3ZRX A;  3E8F A;  5CN0 A;  1H8E G;  3AG1 B;  1FXK C;  2IU0 A;  3ZMV A;  1BL8 A;  1V55 B;  2DWE C;  2ZDI C;  3SYQ A;  4R8C A;  2EIK C;  4ZKI A;  1EZJ A;  2X6C A;  4MTO A;  1CPY A;  2B1I A;  4MSW C;  4WFB V;  4MVM A;  4FJC C;  3K3W A;  1WPX A;  4G2K A;  4GX1 A;  3D36 A;  4P30 A;  3G71 V;  4WCE V;  5B1A B;  3ZRW A;  1UJW B;  2WLI B;  4E2L A;  3DGE A;  5DN6 G;  4TT3 G;  3E2E A;  1FXV A;  4ZBM A;  1ZWI C;  1MOF A;  2QM7 A;  1VQ6 V;  3AG1 C;  3QNE A;  4GX5 A;  4JAV A;  4PEL A;  3CD6 V;  1R6K A;  3IGA C;  3CCM V;  1TUE B;  2EIK B;  4UV9 A;  1F4M A;  2EIJ B;  1AI7 A;  1Y4M A;  2HKO A;  3FB5 C;  3K08 A;  3OMN B;  5LGT A;  2AHZ A;  1R3J C;  2QE7 G;  1B6Q A;  3CYO A;  2YSU B;  3BY6 A;  4PDM A;  2HG5 C;  1YHQ V;  1H2G A;  2Z5U A;  3OUF A;  5CBF A;  3SJQ C;  4MW8 A;  1W0J G;  3ETD A;  5GW7 A;  1YJN V;  1ROP A;  3F5W C;  3JCZ A;  3ZCC A;  2A0L A;  1SES A;  4KP4 A;  2PI4 A;  2AHY A;  3CP1 A;  1OCC B;  1VQL V;  3I56 V;  3WFV A;  3E86 A;  1MAB G;  4H33 A;  4R6Z A;  1KP3 A;  1NVP D;  1NVP B;  1KKD A;  2WLI A;  3OMI B;  4P2Z A;  3EHB B;  4MS2 A;  5EC2 C;  5CBH A;  1VQ5 V;  2W6J G;  2Y48 A;  3G6E V;  5EBW C;  2IJH A;  3E8B A;  5IY5 C;  1RM1 B;  5KUM A;  3W7T A;  4CBC A;  2UXX A;  3SYA A;  1K33 A;  5E1A C;  1EFR G;  2QM8 A;  2YEV B;  2X6B A;  4RQE A;  3CCL V;  2ZXW B;  5B1B B;  1K92 A;  1R3I C;  3B8N A;  2JJ2 G;  4DXW A;  3E89 A;  4JAU A;  2IH3 C;  4PA7 A;  1KP2 A;  2P7T C;  1V55 C;  3A0R A;  3FB7 C;  1M57 B;  4WFA V;  2ZD9 A;  1FS0 G;  4XBF A;  1Y66 A;  3JD1 A;  1JOY A;  1AJP A;  2DYR C;  3DTU B;  1BMF G;  3IFX A;  1IXM A;  3TK1 A;  4BIU A;  3CCQ V;  3LDD A;  2HJF C;  3MHH C;  4J9Y B;  1QVG U;  3PJS K;  2WLN A;  1JPX A;  1LNQ A;  3T4D A;  1M1K W;  3SPH A;  3RW0 A;  3CCU V;  5CBG A;  4F4L A;  1RPR A;  3ZN1 A;  5H6Q A;  1GTO A;  1NQT A;  3E8G A;  4PA9 A;  3LUT B;  1VQ8 V;  2EIN C;  3AG2 B;  3QO7 A;  2JK5 C;  3ZRW B;  3B8M A;  4G28 B;  2OCC B;  1DLB A;  4RO2 A;  2X6A A;  5B1N A;  1S76 D;  1XL6 A;  1KQS U;  1OCR C;  1R6N A;  3KG2 A;  5B3S C;  3QO8 A;  3LDE A;  3MD0 A;  1NBM G;  2ZR3 A;  2DQ0 A;  4QPJ A;  3CC4 V;  3GWO A;  5LHI A;  4DO2 A;  2D3O W;  1YTF B;  1YTF D;  4N23 A;  3E35 A;  3X2Q B;  3ZN0 A;  2HR3 A;  4JTC B;  3ABU A;  1G4Y B;  3TET A;  1XL4 A;  1PL0 A;  4XDL A;  3HPL C;  1HWY A;  2IH1 C;  3FB6 C;  4RQF A;  3ETE A;  3K03 A;  4WF9 V;  4FK5 C;  2EJR A;  2A79 B;  2JEU A;  1AJN A;  3FYI B;  4G27 B;  1YIJ V;  2IJJ A;  5HFL A;  1S0V A;  2OTL V;  3CC2 V;  2OTJ V;  3OFN G;  2WWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...