1R73A

Solution structure of tm1492, the l29 ribosomal protein from thermotoga maritima
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MKASELRNYTDEELKNLLEEKKRQLMELRFQLAMGQLKNTSLIKLTKRDIARIKTILRERELGIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L29
publication title NMR for structural proteomics of Thermotoga maritima: Screening and structure determination
pubmed doi rcsb
total genus 23
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r73A00
1JJ2U 1M1KW 3CCJV 2QEXV 3CC7V 1VQ7V 1YHQV 1Q82W 1VQOV 4WFAV 1YITV 2D3OW 1Q81W 1VQ4V 3CCMV 3CCLV 1VQ9V 3CC4V 3OW2U 3CCSV 1KC8W 1QVGU 1N8RW 1VQ8V 1VQ6V 3CMEV 3I56V 3CXCU 3G4SV 1K8AW 1KQSU 2OTJV 1VQMV 3G6EV 1YJNV 3CCQV 1KD1W 1VQLV 1VQ5V 1QVFU 2OTLV 1VQNV 3CCUV 1K73W 1Q86W 3CCVV 1VQKV 1YI2V 1W2BU 1Q7YW 1YIJV 1VQPV 1NJIW 2QA4V 1S72V 3CCEV 1YJWV 3CC2V 3CPWU 3CCRV 5DM6V 1M90W 4WFBV 1YJ9V 3G71V 1K9MW 4WF9V 1R73A 4WCEV 3CD6V 3I55V 3CMAV
chains in the Genus database with same CATH superfamily
4ZOLB 1FXKA 3RYHA 5EIBD 5EYPB 4BIOA 3L71H 4QPKA 4YXWG 5HFLA 3CJHB 3SR2C 5K1XA 5JVDA 2JRIA 4G27B 1B04A 1EZVH 4ZBMA 4KP4A 2VS0A 1S5HC 4LF7O 1GKFA 4HBNA 4YJ2B 3R65A 3E83A 4LF8O 2NN4A 4P9PA 4CS3A 2F93B 4TQFA 4X64B 3ABKB 4KHPB 2KG7A 2OIEA 3N27A 5LL6Y 1ZAUA 1XMQB 1JA8A 2G38A 1IBKB 2P7TC 3ABMC 3ZMZA 3G80A 3B2EE 1UJWB 3CS5A 1G1XB 1LUVA 4MVMA 5B1OA 2PUSA 4K0KB 1W0JG 4CH5A 1YHQV 2GBOA 4H44B 2WA4A 3JATB 4JI3O 2ZE7A 5JH7B 5H2FZ 1R1BA 2ADPA 1IBLB 1LNQA 4HAMA 2AZ0A 1FD9A 5IE9A 1Q90D 2YIBD 4CH3A 4FMTA 1DF4A 1SS3A 4X20A 1VMGA 3CC7V 3AG2C 3JD1A 4BIUA 4X1YB 3E22B 1Z5VA 3CEIA 4TV9B 2GTSA 2OTLV 1GM7A 1NTMH 3WB2A 2LO1A 4NTXA 3D8CA 3DXRA 3K58A 4YIOA 4NB5A 3JYCA 3I5DA 4DV2B 3Q4HB 5DM6V 2IJJA 4P2ZA 5BMVB 3BA9A 5JJEB 1E79G 4L8JA 4GX0A 3LSUA 2MK3A 2DJVA 3BVOA 3P3PA 3MHHC 3W7XA 2FB5A 1QVFU 1SQPH 1IZ3A 3TETA 1AR4A 3VQYA 5F2VO 3SPHA 2RDCA 1HNZB 3JARB 2QGNA 1YJWV 3AG4B 2IW5A 3E8BA 2AXTZ 3ASNC 5LXTB 3F5WC 2EBOA 3D3IA 2W0XA 1WAZA 2UXCO 3CXHF 3JSLA 4GT1A 4LNUB 1P7GA 1XQ8A 3F5TA 3AG1B 1XBLA 3DC6A 3LSSA 3OEHG 4F6RA 3FB7C 2GUZB 4CZZA 1ZSPA 3HKDA 4I55A 2KB1A 4X8AA 1R6KA 2HJDA 2DE0X 1V54B 1I08A 3WB1A 3HKCA 4TV8A 4TSFG 3OTOO 4AI8A 4PI2A 1T5EA 1FXKB 3RYHB 3H1IH 2ODMA 4JI0O 4EEQA 5EC2C 4DR4B 2EINB 1H2GA 2CAZC 4NTYA 4J10A 3HKBA 2OYQA 2KKWA 5KX5A 2AGAA 1AI5A 1PD3A 4X62O 4DO2A 3LDEA 1H8HG 4XDJA 2BE3A 4WCEV 2E5LB 4PD4F 4LFCO 4I7ZB 1CPYA 2ZE8A 2H3OA 4D7TA 1FXVA 2XNDG 4JTDB 2F4VB 2EIJC 5BXZA 2RN9A 4OPHA 3SYCA 5IYDO 3K04A 2KG7B 3JCUZ 4DV4B 1BSMA 2WPDG 4B08A 1PKXA 4DV1B 3ZMVA 1RPOA 2XASA 4K3AA 1XNRB 5KA6A 4DV5B 4ASUG 4BAYA 2BSKA 3U11A 1IBMO 4UXNA 4UFZA 4PHZA 4UB8Z 3WFVA 4DV7O 4CH6A 1Q86W 4DUZB 3K08A 4G2KA 3RW0A 2EZPA 1M90W 1SESA 2P4VA 5B1AB 4BW5A 3ABLB 1UFIA 1RPRA 5JWPA 3AEIA 2A9HA 1SQGA 4X20B 2OIGA 4DR7B 4QPJA 1YCIA 4TWKA 3ZHQA 2PI4A 5LYJA 3OFNG 4I9WA 1TUBA 5TISZ 1SKVA 3CRRA 1VF5B 2YEVA 3OT7A 3X2QC 4FVMA 1OCCC 1JPXA 1H2MA 3PJSK 1KKDA 2IBZH 4DRXA 3DXRB 2QA4V 4JF3A 4IHJA 1WP8A 2JEUA 5FL7G 5LGTA 2N74A 1N33B 1K33A 3AG3B 3JALB 5IWAO 5CB4A 1YSCA 3O9OA 3FAVB 5CN0A 1JCHA 4P30A 1PPJH 2PTMA 2OWOA 4EFBA 3KCXA 3AG7A 3CE2A 2OT5A 4JTAB 4RAIA 5GONA 3H1LH 2DQ0A 3ZEDA 4J42A 2PYLA 2NR5A 2OTJV 1NT2B 1N32O 1SF9A 4JYYA 4P9OA 1OCOB 4F6RB 3D36C 3SPGA 3SYQA 4FLXA 4DR2B 5EBLC 2CGNA 3HKDB 4I55B 2LFSA 3CC2V 1J5EB 4WFBV 4FFKA 1EN6A 3F7YC 2VWJA 3HKCB 2B5UA 4TV8B 2AHYA 3CWBH 5HFMA 3BEHA 3FD9A 5KLVH 2F1MA 3EVKA 1VF6C 5EC1C 2KQXA 1AI4A 1E1RG 1BS3A 1GN3A 5KX5B 4B3TO 1M4UA 5LHIA 4J7KA 3OE7G 4FLYA 1V55B 2W6IG 2HP8A 2DWEC 1M1KW 2HEPA 2LGWA 4GKKO 5K1PA 3FB6C 1SRYA 1Y66A 3IJ4A 5L3DA 1SQVH 2FL4A 3OUSA 2HHHB 1UPGA 3C3TA 3QVNA 1M93A 1A32A 3O65A 1QNMA 4DR3B 4NXMB 2XAJA 1GAXA 2YSUB 4I50B 4NKGB 4FM0A 2BSKB 4CC5A 1XNRO 5J2UA 2DN9A 2ZCEA 2VWKA 5J9PC 2ZQMA 4X66O 5C8YA 2RMKB 4UV8A 2JIZG 2WLHA 3K57A 1R3KC 1DK1A 1B06A 2WLIB 4TUYA 2WLNA 4J9ZB 4DXWA 5KHJA 2QKSA 1CXZB 3OMNB 2GTAA 1Q6UA 1TUBB 2ZKOA 4YHHB 4FFBA 2YEVB 2BOBC 2XTAA 4AQYO 1VIBA 2E3CA 1ROPA 2EIMC 4DRXB 2CTQA 4JI8B 2QKAA 4C7UA 1JX9A 4IHJB 4EB6A 5FLXN 3FFQA 1O9GA 4IIJA 4CC6A 3FYIB 5CA1A 2PYJA 2N05A 3G6EV 5CB4B 1DLBA 5CBFA 2LJ2A 4AHCA 1I7FA 5CMUA 4DW1A 4GLXA 1IX9A 1Q3EA 2QWNB 3STLC 1K9MW 2CDYA 5JQGA 2W0FC 4FLWA 4U3FH 1DF5A 4ZI7A 4JI2B 5GONB 5DECA 2KSDA 2NNUA 3ABTA 3KKYA 1RSOA 4WFHA 4MVUA 4O2AA 4QJFB 3SDLA 1YF2A 1B6QA 2JJ1G 1MNGA 3CCVV 2BTQA 4RWUA 3RYFA 2HKOA 5LOVA 5LHHA 4JI7O 3CRMA 5KHGA 2EIKC 1J5EO 4LF9O 3M8AA 1I5YA 4MTXA 4FM1A 1Y4MA 4EKWA 4UCSA 1PV0A 4QNHB 4JPRA 4D6TH 4PDMA 1THZA 1XMOB 1AR1B 1BQ0A 4DV6B 5IDJA 3CCSV 3JAKA 4GKJB 1PNKA 1B3QA 3BAAA 1M57C 3B77A 2HHHO 4E2LA 3W7TA 2DYSB 2XAFA 3OGIB 2WLJA 2QTOA 4DR3O 4NXMO 1SC5B 3A0RA 2Y69B 5ITZA 4Q20A 4TQDA 3QO5A 1VQMV 5KHIA 4HYOA 1O9HA 2Y4UA 2QR4A 1R3LC 5J2UB 4ZIBA 2L35A 3OR7C 4MS2A 2XUMA 3MAQA 1TGOA 1JMKC 5C8YB 5JCOA 2L6LA 4CBCA 3SJCC 2EJRA 2AHZA 2YICA 4TUYB 2UXXA 3T1CA 1I94O 5EBWC 1KQSU 1NI8A 5KAIZ 4O4HA 1HR0B 4FFBB 4W4KA 2YDEA 2YS8A 2JS5A 2UUCO 1DGSA 5L3FA 2LGQA 1QCEA 3ZN0A 3HKEA 3E2EA 2PZSA 3UO3A 1NS1A 4DV0B 1FKAO 4R6ZA 4JI8O 3S3XA 1L8DA 5B1BC 2M7WA 1S76D 4EB6B 1XREA 1VQ8V 2ARHA 4IIJB 3ZRWB 2HR3A 4O2BA 4YJ3A 3W7SA 5CA1B 5IJ9A 1H2KA 3AK3A 1N36O 5CBGA 1HNWB 3EFFK 4PJ0Z 3C90A 1XHZA 1P4RA 1FJGO 5LA6A 4X1KA 1BCCH 1P84F 3E35A 3GVMA 1G4YB 2YI9A 5JQGB 2UU9B 4NR1A 4DK1A 2LQTA 4B7EA 2UUAB 4ZI7B 1M56C 1ZUQA 3CCMV 4YY3B 1QR8A 1P49A 1BMFG 1RSOB 1W59A 3B4SA 4O2AB 1Y6XA 5GW7A 1HNXB 3JASA 1NJIW 2BTQB 1MSWD 4RUFA 3RYFB 1K97A 1MA1A 2CUGA 2ZINA 5BR8B 3OR6C 5LOVB 2UUBO 2ZNIA 1ZX3A 3RN4A 2PF4E 4WBNB 2VQFB 4GCZA 5L3CA 5LP6C 3CCUV 5LMUO 2X0LA 1Q8IA 4LF4O 4Z1VA 3IC9A 2IU0A 4DW0A 3I55V 2QJ1A 3E89A 3JD0A 5A2QN 2Q6AA 2ZE5A 4PDRA 4DR5O 3AG1C 3ETGA 1Y76B 3STZC 1K8AW 5J2TA 3BHPA 1KBHA 2BTOA 3UQ8A 4DV6O 3JAKB 4DV3B 3BCCH 1N34B 3WG7B 1OCRC 1URFA 5CA3A 1BT8A 1SERA 1N4CA 5KA5A 5H5NA 1H2LA 2IJKA 1US6A 2JJ2G 3LUTB 2WWWA 1AP6A 1GRJA 2YIDA 1VQ4V 4UB6Z 2UXDB 1YXBA 4R50A 4MTOA 2B9ZA 1JFFA 2ZXWB 5ITZB 3OTFA 2QWRB 1KECA 4K35A 4PELA 3IGAC 4PI0A 5KUMA 4DR1B 4JASA 1BGYH 2HLDG 1NKDA 4ICGA 4J80A 5C93A 2WAMA 3CCJV 2QSAA 4FPPA 2ADQB 2DYRC 4JI1B 1U96A 4LCUC 4LP8A 1WPXA 4JV5B 1EFRG 4QE9A 3L70H 1IVSA 2ZDIC 5GTIZ 1K73W 5JVDB 3LNNA 4O4HB 1JR9A 3E8FA 3K59A 1NVPB 1YTFB 3VOUA 1PM9A 3A0BZ 3ASNB 5IYCO 4DUYB 2IJIA 3HKEB 3P32A 1GMGA 1R3IC 2C2AA 1WLEA 3TXQA 5D5QA 2QM8A 4DV0O 4FK5C 5D5PA 3D36A 4I4TA 4O2BB 4YJ3B 4JYCA 1VP7A 4X64O 3SPJA 4KHPO 2QWQB 1XMQO 5LA6B 4X1KB 1IBKO 1WA8A 2Y0PA 4FJCC 2IU3A 2EX3A 2LFRA 3ETQA 4J7ZA 1VF6A 4K0KO 3CYOA 1Z2GA 1M9NA 2UXBB 1IXMA 4LH6A 1KMIZ 3QF7A 1N0NA 4K8XA 3JASB 2RNBA 3G71V 2MW2B 1HNXO 1IBLO 4QIWF 5KAFZ 5KMGA 2VQEB 3BABA 3RFRA 3AG3C 3H01A 3K06A 1FS0G 1QU7A 1VARA 1Q6IA 5BR8O 2EILC 3TK1A 4B3MB 4UV9A 3T1HB 4L87A 2EIJB 3CRAA 4LFBB 3ASOB 2HVJC 2R70A 1ENVA 1R73A 3ZRVA 4DV2O 2DOSA 3SYOA 2R9IA 1H38A 1YITV 1QHTA 3P3NA 1AB3A 4O4IA 4ZHQA 4MVOA 4DK0A 1F4NA 4NXNB 3OAAG 3J7AU 5DN6G 3FYEB 5FPRA 4CH4A 1YI2V 1K4DC 3N2GA 3FX7A 3K5MA 3RYIA 1HWYA 2FTKA 4UUJC 3CCEV 1NVPD 4DV3O 2PI5A 1YTFD 3U10A 1J95A 1GN2A 2JGUA 1YZBA 4QGPA 1N34O 1HNZO 1BQZA 2Q4PA 1K92A 1XL6A 2Y4TA 4LF5B 3A8TA 3X2QB 3FKSG 5B66Z 3TCUA 1JFFB 1OCCB 4LH7A 2UXDO 2WLLA 2BCCH 4HNAA 2K1EA 3MDSA 4BIZA 3KZIZ 1QLEC 1V55C 4U3JA 1RP3B 1D2DA 2Q5ZA 1GN4A 1KB9F 2HVKC 1YDXA 2P5OA 1D5AA 3A2FA 3CMAV 3CD6V 4DR1O 4NVPA 4B3RB 4B3SB 5IY5B 3G6BA 2ITDC 1X59A 3CC4V 3OW2U 4ZKIA 4JYAB 2H8PC 1GM8A 1GK9A 3QO7A 4X65B 1XILA 4DR4O 2ZNJA 3HKBB 3JD2A 2LW1A 3ZRXA 4N23A 2XHBA 1FFXA 3MHSC 2F66C 3IFXA 1S77D 1NBMG 4U7OA 4JI6B 5LGUA 3OMIB 5KHKA 2X6BA 2E5LO 5A9GA 1HP8A 1HW7A 3GWKC 1PL0A 1OCZC 1FYJA 1BHAA 3RGBA 2IH1C 1XI1A 3APOA 4I4TB 1Q5OA 2F4VO 2EJ7A 2RJZA 3MD0A 3L9DA 2WA3A 2GV9A 3LDCA 2OCCB 1TVKA 4U7NA 4DV4O 2QEXV 5BY1A 1XDCA 4DV1O 4LFAB 3SPIA 2JVDA 1GN6A 3E86A 3TJTA 4DV5O 4OGQB 4XDLA 2Q69A 1K7DA 3RVZA 4QE7A 1VQPV 5CA0A 3F7VC 1NZ6A 4MSWC 5FPOA 2P06A 4DUZO 1R6TA 5GTHZ 2ILMA 3ZHUA 5KMGB 3CX5F 3L74H 4TOIA 2Q0AA 2QM7A 1NR1A 5LYJB 2GSMB 4DR7O 1Y74A 2IH3C 1Q6HA 4B3MO 4LFBO 2XAGA 4UCUA 4PDLA 5DEDA 1S3JA 5EIBC 3RWRD 4JI5B 2ZM6B 4J9YB 3ZHSA 4W4LA 2DWDC 2Z0AA 3D3QA 1CP9A 1SQBH 4O4IB 4ZHQB 1N33O 3P30A 4LF7B 2O57A 4G28B 3BY6A 2CTWA 3RYIB 3BA8A 4IYHA 3ETEA 3DSQA 4H13B 2ZT9B 2ZD9A 1PNLA 3ETDA 1VF7A 3ZS8C 2Q73A 1FXHA 1R3JC 4IYIA 5KHHA 2CTRA 2WLLB 1SZTA 2EIMB 1AJPA 4MTGA 4PA3A 4U3JB 2CH7A 2E74B 4DR2O 1K3EA 3JATA 1K4CC 1Q82W 1SQXH 4LC1A 4KFMA 3CCLV 4ABMA 4B3SO 3HR0A 1KU9A 2QKCA 3J80N 4B7KA 1Q7YW 3VQVA 1AI7A 4MVZA 1S5LZ 5CBHA 1XNQB 2DYSC 5B3SB 1RFYA 3KG2A 1MZFA 4JGSA 1VQ7V 2A7WA 5LBQA 3CRCA 4LBEC 3E22A 3GWOA 4OPAA 1G6UA 1S5JA 2WSSG 1QVGU 1YJNV 1RM1B 2AZ2A 1WJZA 1F4MA 3H1JH 2IJHA 2P22C 3THOA 2CGOA 1NH2B 1Q43A 3SYPA 4UCRA 1NU1H 2CK3G 2ZIMA 4KUMA 1XHXA 2EIKB 3JD3A 2AW9A 4CS2A 2YUAA 1Q81W 5IYBO 1NTKH 1N8RW 2IM9A 2K9PA 1KP2A 5LP6A 4LFAO 2YXHA 4O4JA 1WNSA 1D5NA 1BL8A 3L72H 3JSNA 3T1YB 5LXTA 4JAUA 5CA0B 1TA8A 5E1AC 4KL1A 3K5LA 2A06H 4UCTA 2V7QG 3ZN1A 3A0HZ 2CTPA 3QG5A 2ATKC 3ABKC 1VQLV 2FMLA 3N2KA 5AG2A 5LHGA 1Y74B 4GYCB 3W7UA 3E8HA 4X88A 3OTOB 1KUQA 4FZ0A 4YHHO 2P4KA 1AP5A 3L73H 1YJ9V 4JI0B 1AROP 2XOKG 4H37A 1E1QG 2R9AA 1NTZH 4JI5O 1SQQH 2Q7EA 1XOUA 2B1IA 2ZM6O 4X62B 1KP3A 3VQXA 4FLUA 2JK5C 3TXSA 4LFCB 2V1DA 4WFFA 3LSQA 2ZIOA 1GM9A 3B8NA 3VBBA 2X7RB 1IDSA 3SJAC 3ZHTA 1TUEB 1U97A 2HJFC 2F23A 3JAWA 1K5QA 4XBFA 2E75B 1ZL8A 2ZDIA 4JI2O 4MW8A 1W2BU 3APQA 4PA7A 3JAMN 3C3SA 1NH2D 3OEEG 4PA4A 1IBMB 2CE4A 4X89A 4WFGA 4DV7B 2CH7B 2Y0IA 2N04A 2NLJC 5EBMC 5IJ0A 5B1BB 4MVSA 1L0LH 4CS4A 1ZTEA 3K03A 4JAVA 3T4ZA 3K9SA 3WG7C 2VRZA 3ABMB 3AG4C 4WFAV 2A0LA 3ABUA 5EZYA 1XMOO 1XNQO 3K79A 1LR1A 1M56B 3GB7C 2BOCC 2ZXWC 3WU2Z 5LMNB 2A79B 1VQNV 1MG1A 3RYCA 3JD4A 4H33A 3ZMUA 4GKJO 1V54C 2D3OW 5JCOC 1AVMA 5BZBA 5IWAB 3JALA 4JAAA 3ZMSA 2R72A 3AK2A 1FXKC 3AG2B 3CSXA 4Q6GA 3FAVA 1K5SA 2EINC 3K3WA 4JZ2A 4UVAA 1VQ6V 4UVBA 5LP6B 3SPCA 4GX1A 4O4JB 1YEWA 1F7YA 5IYZA 2FYUH 4NYKA 3T1YO 1BHBA 4MTFA 1N32B 1GO3F 3BPZA 4LWSA 1COWG 3M7MX 1S0VA 2WLMA 4WFEA 3I56V 3N2KB 1QLNA 1WN7A 1OCRB 3U0ZA 1XL4A 3FB8C 2XT9A 1HR0O 1WP7A 4JI4B 3AK1A 1HDJA 4RO2A 4IT5A 2ZR2A 1SETA 2YXYA 2E76B 4A5UB 1GTOA 4X1IA 4B3TB 1JJOA 2H94A 3SJQC 3RBZA 4GKKB 5IJ9B 3ZMTA 2HFEC 3S3WA 5B1AC 1AR5A 3ABLC 1Z5WA 1HNWO 3HB3B 4RQFA 2F43G 3HPLC 1FFTB 1P7BA 2LW7A 2DYRB 3JAWB 4J7JA 3K0DA 4PA9A 1H2SB 4MVRA 1ZL8B 2UU9O 2ITCC 3ASOC 3J81N 2UUAO 1TAEA 4OXSA 2YXLA 4PDVA 4YY3O 4FIPC 5H9CA 4JZGA 1AJQA 4GX2A 2DW4A 2GDSA 1PP9H 4K8ZA 4OX9B 4I50A 4X9QA 4F4LA 4F6EA 2Q9LA 3QTCA 3IC7A 1EM1A 5IJ0B 4X66B 1KYOF 4GUNA 2YI8A 4E4EA 2VQFO 1S72V 2WLIA 2Y48A 3VQWA 2PGGA 3CB2A 4Z2WA 4RQEA 1G8MA 2X6AA 3PN1A 2HG5C 2ETNA 2Z3YA 2A3QA 3IAYA 3ZBHA 3OUFA 2P90A 4UVCA 4IGGA 4AQYB 5EZYB 2B1GA 4FM2A 4FLVA 4D7SA 1OCOC 2QWPB 3SYAA 3DGEA 5J2TB 5LMNO 1X4TA 3RYCB 1OZ0A 3B09A 1NR7A 3CHXA 3B40A 4J11A 5IY5C 3M99B 4EFEA 5IT9N 1LUWA 1YVWA 2EILB 1IURA 4DR6B 3SGIA 4NTWA 3QO8A 1N0JA 2Q7GA 1NQTA 4O4LA 2RCVA 4JTCB 3H9VA 4I0XA 1ZWIC 5FNVA 2P67A 1AILA 5IYZB 3FB5C 4UCVA 1QQCA 3T4DA 1MABG 1SZXA 3UT5A 4BR6A 4LR3A 4GX5A 2UXNA 4LWSB 1AJNA 1I5XA 4FLTA 1WB7A 2QDOA 3JCZA 4JI1O 4JV5O 1H8EG 2F95B 4JI7B 1F51A 3H1HH 1GH6A 3CP1A 3CRQA 4R8CA 4LF9B 1JQ0A 2OCCC 3G67A 1JJ2U 1MMMA 1IXBA 2JGDA 3OD4A 2JDIG 4I9QA 1XEQA 4JI4O 4DUYO 1AI6A 1JVMA 4FZ1A 1BZKA 2X6CA 3H1KH 4X1IB 3RVYA 5L3BA 5LGNA 4HZ3A 1MZEA 4MT8A 1QLEB 3L75H 3KCYA 2LP7A 2Q67A 3NR7A 3DC5A 4AILC 2QWOB 5E79Z 1L1FA 1OJHA 1PNMA 1BE3H 1WA8B 1ZLZA 1SA0A 5B5EZ 2RQ6A 3RT3C 1KC8W 2XAHA 3CMEV 3TGUH 5L3GA 1KD1W 2YIBA 1VQKV 1ORQC 1EZJA 4LF6B 1Y67A 2UXBO 3ML0A 4Z1MG 2V4DA 4OX9O 1OHHG 1OCZB 2VQEO 3R66A 1EN4A 1I0HA 2Q68A 2JS3A 1W0KG 4XDKA 3LDDA 3T1HO 4ZOLA 5EYPA 2PY5A 3BFRA 1EN5A 3UO2A 1I94B 2ZR3A 3ZHVA 3OM3B 3CJHA 1VQOV 1QR9A 2Q8VA 1FAFA 2JEXA 2UUCB 1XUQA 5JJJB 1EBOA 3UM7A 5KUKA 2XAQA 2W6JG 4NXNO 5L3EA 4J41A 3N2GB 3OMAB 1V9PA 4DYLA 4YJ2A 4WF9V 3CCQV 4LF8B 3ZCCA 1KKCA 4H0LB 5EK0A 3B8MA 4IL6Z 4RUEA 2GHYA 3ZRWA 1PL4A 2WLKA 1N36B 1M5IA 3K5NA 3E8GA 1FJGB 4LF5O 2FKXA 2M6YA 4BW9A 5B1NA 4TT3G 4DR6O 4HNAB 3K0GA 4O4LB 1VEWA 4KXRA 5B3SC 3ZHRA 4JI3B 4I0XB 5FNVB 2P6JA 3ZX6A 5JH7A 4B3RO 4I5SA 1RM1C 2R9RB 3UT5B 2EULA 2EZOA 1OV9A 1WPBA 4JYAO 2UUBB 4X65O 3K9AA 1JOYA 2Z5UA 3T2MA 1FFXB 2OCHA 2Q0OC 2YC0A 4WBNA 1FPOA 3EXAA 5LMUB 2JGDB 4X1YA 4TV9A 1VQ9V 4JI6O 2Y69C 4BWAA 3DTUB 3G4SV 3W7WA 1VQ5V 4LF4B 1L0NH 1F23A 2DQ3A 3ICXA 1MOFA 3Q4HA 4JYBA 2D2CB 5H6QA 4R7CA 3CPWU 5BMVA 5JJNB 4DR5B 3K5OA 4N21A 2ZE6A 1Y76A 3UCSC 2QM4A 4MW3A 1TVKB 3QNEA 3OGCC 3ZRSA 1WB8A 4PV1B 1SA0B 3SJBC 4YIPA 3ZIAG 4FLZA 3JARA 1SQFA 4UCOA 1DTOA 2UXCB 2QE7G 3NXSA 3ZJZA 2QTSA 2DMXA 1QBZA 4LF6O 1H2NA 3UKMA 4PA6A 4LNUA 1R6NA 1CEZA 2YIAA 4GZRB 3CXCU 2GUZA 3EHBB 5H6RA 3WB0A 1MSDA 1K34A 2Q7HA 1YIJV 3BRCA 3CCRV 3LNMB 1M57B 4MVQA
chains in the Genus database with same CATH topology
1FXKA 1BHBA 1JX9A 4MTFA 1K92A 1XL6A 1GO3F 4QPKA 4YXWG 1COWG 5HFLA 1S0VA 2WLMA 3FYIB 4WFEA 3I56V 3G6EV 3X2QB 3FKSG 1DLBA 4G27B 3TCUA 5CBFA 1OCCB 2WLLA 4ZBMA 5CMUA 2K1EA 1QLNA 4KP4A 1OCRB 1S5HC 4BIZA 1XL4A 1QLEC 1V55C 3FB8C 3STLC 2HVKC 1K9MW 1GKFA 3CMAV 3CD6V 2W0FC 3R65A 1DF5A 5IY5B 4RO2A 3E83A 2ITDC 2NNUA 3ABTA 2ZR2A 4P9PA 1SETA 3CC4V 3OW2U 4WFHA 4MVUA 4ZKIA 1GTOA 2H8PC 4QJFB 1GM8A 1GK9A 3ABKB 3QO7A 2H94A 1B6QA 2JJ1G 3CCVV 3SJQC 3RBZA 3JD2A 2P7TC 3ZRXA 3ABMC 4N23A 3MHSC 3ZMZA 3IFXA 3ZMTA 1UJWB 2HFEC 2HKOA 4MVMA 5B1OA 1S77D 5B1AC 1NBMG 5LHHA 3ABLC 4U7OA 5LGUA 1W0JG 3HB3B 4RQFA 3OMIB 2EIKC 2F43G 3HPLC 1FFTB 1YHQV 1P7BA 2X6BA 2DYRB 3K0DA 1PL0A 4PA9A 4MVRA 1I5YA 1OCZC 4MTXA 2ITCC 3ASOC 1BHAA 2IH1C 1Y4MA 4EKWA 4OXSA 4PDVA 4QNHB 1LNQA 4JPRA 4HAMA 4PDMA 4FIPC 5H9CA 1AJQA 3MD0A 4GX2A 1THZA 4FMTA 2DW4A 1DF4A 3LDCA 2OCCB 1AR1B 4U7NA 4F4LA 2QEXV 3CC7V 3AG2C 3JD1A 4BIUA 3IC7A 3SPIA 5IDJA 3E86A 3CCSV 2OTLV 1GM7A 1PNKA 4XDLA 2Q69A 1K7DA 3RVZA 4QE7A 1VQPV 1S72V 3F7VC 3JYCA 1M57C 3B77A 4E2LA 4MSWC 5DM6V 2WLIA 2Y48A 2IJJA 4P2ZA 4RQEA 1G8MA 2X6AA 3W7TA 2HG5C 2DYSB 2Z3YA 2XAFA 2WLJA 2QTOA 1E79G 3OUFA 2P90A 3A0RA 4UVCA 4GX0A 2MK3A 2B1GA 2Y69B 4Q20A 2QM7A 1NR1A 3MHHC 3QO5A 3W7XA 1VQMV 4HYOA 1OCOC 1QVFU 2GSMB 3SYAA 1R3LC 3TETA 3DGEA 2IH3C 3OR7C 3SPHA 4MS2A 2XAGA 1YJWV 1OZ0A 1NR7A 3AG4B 2IW5A 3E8BA 4PDLA 3ASNC 3F5WC 2EBOA 3D3IA 4CBCA 1S3JA 5IY5C 3M99B 2EJRA 2AHZA 4J9YB 2UXXA 4GT1A 3T1CA 2DWDC 2EILB 3AG1B 5EBWC 1KQSU 3LSSA 1CP9A 3OEHG 3FB7C 3P30A 4CZZA 3QO8A 4G28B 1NQTA 2KB1A 3BY6A 5L3FA 4X8AA 1R6KA 1QCEA 3ZN0A 4JTCB 3E2EA 1V54B 1ZWIC 3ETEA 2P67A 3FB5C 4TSFG 3T4DA 1MABG 4R6ZA 1FXKB 5B1BC 2M7WA 1S76D 5EC2C 2EINB 1VQ8V 1H2GA 2ZD9A 4GX5A 2UXNA 1AJNA 2HR3A 3ZRWB 1I5XA 1PNLA 3ETDA 3W7SA 3JCZA 1FXHA 1H8EG 1F51A 1AI5A 1R3JC 5CBGA 1PD3A 2WLLB 3EFFK 1SZTA 1P4RA 2EIMB 1AJPA 3CP1A 4MTGA 4DO2A 3LDEA 1H8HG 4R8CA 4XDJA 1JQ0A 2OCCC 4WCEV 4PA3A 1JJ2U 3E35A 1G4YB 1CPYA 1K3EA 1K4CC 2JDIG 1Q82W 1FXVA 1M56C 4LC1A 4KFMA 3CCLV 3CCMV 1AI6A 1QR8A 1JVMA 2XNDG 4JTDB 2X6CA 1BMFG 2EIJC 5GW7A 3RVYA 1Q7YW 3SYCA 5L3BA 5IYDO 5LGNA 3K04A 4HZ3A 1NJIW 1AI7A 2WPDG 4MT8A 1MSWD 1QLEB 4RUFA 1PKXA 2LP7A 4MVZA 2Q67A 1K97A 5CBHA 3ZMVA 1RPOA 2DYSC 3OR6C 5B3SB 2XASA 1L1FA 3KG2A 5KA6A 4JGSA 1VQ7V 4ASUG 4BAYA 5LBQA 1PNMA 4LBEC 3GWOA 4UXNA 3WFVA 1KC8W 2WSSG 1QVGU 2XAHA 3CMEV 4GCZA 5L3GA 1YJNV 1KD1W 5L3CA 1RM1B 3CCUV 1F4MA 1Q86W 2X0LA 1VQKV 3K08A 1ORQC 4G2KA 2IJHA 3RW0A 2EZPA 1EZJA 1NH2B 3SYPA 1M90W 1SESA 2CK3G 2IU0A 3I55V 5B1AB 4BW5A 3ABLB 3ML0A 3E89A 3JD0A 4KUMA 4Z1MG 1RPRA 2Q6AA 3AEIA 2A9HA 2EIKB 3JD3A 4PDRA 4QPJA 4TWKA 2PI4A 3AG1C 3ETGA 5IYBO 3STZC 1Q81W 3OFNG 4I9WA 1N8RW 1K8AW 1KP2A 2YEVA 1OHHG 1OCZB 3X2QC 2Q68A 1OCCC 1JPXA 1BL8A 1W0KG 1OCRC 3PJSK 3WG7B 2QA4V 1KKDA 4XDKA 3LDDA 5CA3A 4JAUA 4JF3A 1SERA 5E1AC 5KA5A 2JEUA 5LGTA 5FL7G 2IJKA 2ZR3A 2JJ2G 3OM3B 3LUTB 1K33A 1QR9A 2WWWA 3AG3B 1VQOV 2V7QG 3ZN1A 1VQ4V 4R50A 4MTOA 2JEXA 1YSCA 3ABKC 2ATKC 1JCHA 2ZXWB 5CN0A 1VQLV 1EBOA 3UM7A 4P30A 1KECA 4PELA 5KUKA 2XAQA 3IGAC 5LHGA 2W6JG 3W7UA 5KUMA 3E8HA 4X88A 4JASA 5L3EA 2HLDG 3OMAB 1YJ9V 1NKDA 4WF9V 3CCQV 2OT5A 3ZCCA 1AROP 2XOKG 4JTAB 4RAIA 5C93A 2WAMA 3CCJV 5EK0A 3B8MA 4RUEA 2DQ0A 2DYRC 4FPPA 4H37A 1E1QG 4LCUC 2GHYA 4LP8A 3ZRWA 1WPXA 1EFRG 2WLKA 4QE9A 2B1IA 2OTJV 2ZDIC 1KP3A 3E8GA 4P9OA 1OCOB 2JK5C 1K73W 3SPGA 5B1NA 3SYQA 5EBLC 2V1DA 4WFFA 3LSQA 1GM9A 2LFSA 3B8NA 3E8FA 4TT3G 3VBBA 1NVPB 3CC2V 2X7RB 3K0GA 1YTFB 4WFBV 3VOUA 1TUEB 5B3SC 3ASNB 3F7YC 5IYCO 2HJFC 2IJIA 3P32A 1GMGA 2P6JA 1K5QA 4XBFA 1R3IC 2B5UA 2C2AA 2AHYA 1WLEA 5HFMA 2ZDIA 3BEHA 2QM8A 4I5SA 4FK5C 1RM1C 3D36A 2R9RB 2EZOA 5EC1C 1AI4A 1E1RG 4MW8A 1W2BU 4JYCA 4PA7A 3SPJA 1NH2D 3OEEG 5LHIA 4PA4A 3OE7G 1V55B 2W6IG 3K9AA 4X89A 1JOYA 2Z5UA 3T2MA 2DWEC 1M1KW 4WFGA 3FB6C 2NLJC 4FJCC 2IU3A 5EBMC 2LFRA 1SRYA 5B1BB 1Y66A 1VQ9V 2Y69C 4MVSA 3DTUB 5L3DA 3G4SV 3W7WA 3OUSA 1VQ5V 3K03A 4JAVA 3CYOA 1F23A 2DQ3A 3T4ZA 1M9NA 3WG7C 1IXMA 1MOFA 4JYBA 5H6QA 4R7CA 3CPWU 3ABMB 3AG4C 3G71V 4QIWF 4WFAV 4N21A 2A0LA 2XAJA 2YSUB 3ABUA 3AG3C 4MW3A 3H01A 3K06A 1FS0G 3K79A 3OGCC 3QNEA 3ZRSA 1M56B 2EILC 3TK1A 3GB7C 2BOCC 2ZXWC 4UV9A 4L87A 2EIJB 2A79B 3ASOB 1VQNV 2HVJC 3ZIAG 1MG1A 3JD4A 4H33A 5J9PC 2ZQMA 4UV8A 1ENVA 1DTOA 3ZMUA 2JIZG 2QE7G 1V54C 2WLHA 1R73A 3NXSA 2D3OW 3ZJZA 1R3KC 3ZRVA 1QBZA 5BZBA 2WLIB 3UKMA 3ZMSA 4PA6A 2WLNA 3SYOA 1R6NA 4J9ZB 1FXKC 2R9IA 3AG2B 4DXWA 1YITV 1H38A 1CEZA 2QKSA 1K5SA 2EINC 3K3WA 4MVOA 4UVAA 3OMNB 1VQ6V 1F4NA 3CXCU 3OAAG 4UVBA 5DN6G 2YEVB 3EHBB 3FYEB 5H6RA 3SPCA 2BOBC 4GX1A 1YI2V 1K4DC 1K34A 1YIJV 1HWYA 2FTKA 4UUJC 1ROPA 3CCEV 2EIMC 1NVPD 3CCRV 2PI5A 3LNMB 1M57B 1YTFD 1J95A 4MVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 U;  1M1K W;  3CCJ V;  2QEX V;  3CC7 V;  1VQ7 V;  1YHQ V;  1Q82 W;  1VQO V;  4WFA V;  1YIT V;  2D3O W;  1Q81 W;  1VQ4 V;  3CCM V;  3CCL V;  1VQ9 V;  3CC4 V;  3OW2 U;  3CCS V;  1KC8 W;  1QVG U;  1N8R W;  1VQ8 V;  1VQ6 V;  3CME V;  3I56 V;  3CXC U;  3G4S V;  1K8A W;  1KQS U;  2OTJ V;  1VQM V;  3G6E V;  1YJN V;  3CCQ V;  1KD1 W;  1VQL V;  1VQ5 V;  1QVF U;  2OTL V;  1VQN V;  3CCU V;  1K73 W;  1Q86 W;  3CCV V;  1VQK V;  1YI2 V;  1W2B U;  1Q7Y W;  1YIJ V;  1VQP V;  1NJI W;  2QA4 V;  1S72 V;  3CCE V;  1YJW V;  3CC2 V;  3CPW U;  3CCR V;  5DM6 V;  1M90 W;  4WFB V;  1YJ9 V;  3G71 V;  1K9M W;  4WF9 V;  1R73 A;  4WCE V;  3CD6 V;  3I55 V;  3CMA V; 
#chains in the Genus database with same CATH topology
 4ZOL B;  1FXK A;  3RYH A;  5EIB D;  5EYP B;  4BIO A;  3L71 H;  4QPK A;  4YXW G;  5HFL A;  3CJH B;  3SR2 C;  5K1X A;  5JVD A;  2JRI A;  4G27 B;  1B04 A;  1EZV H;  4ZBM A;  4KP4 A;  2VS0 A;  1S5H C;  4LF7 O;  1GKF A;  4HBN A;  4YJ2 B;  3R65 A;  3E83 A;  4LF8 O;  2NN4 A;  4P9P A;  4CS3 A;  2F93 B;  4TQF A;  4X64 B;  3ABK B;  4KHP B;  2KG7 A;  2OIE A;  3N27 A;  5LL6 Y;  1ZAU A;  1XMQ B;  1JA8 A;  2G38 A;  1IBK B;  2P7T C;  3ABM C;  3ZMZ A;  3G80 A;  3B2E E;  1UJW B;  3CS5 A;  1G1X B;  1LUV A;  4MVM A;  5B1O A;  2PUS A;  4K0K B;  1W0J G;  4CH5 A;  1YHQ V;  2GBO A;  4H44 B;  2WA4 A;  3JAT B;  4JI3 O;  2ZE7 A;  5JH7 B;  5H2F Z;  1R1B A;  2ADP A;  1IBL B;  1LNQ A;  4HAM A;  2AZ0 A;  1FD9 A;  5IE9 A;  1Q90 D;  2YIB D;  4CH3 A;  4FMT A;  1DF4 A;  1SS3 A;  4X20 A;  1VMG A;  3CC7 V;  3AG2 C;  3JD1 A;  4BIU A;  4X1Y B;  3E22 B;  1Z5V A;  3CEI A;  4TV9 B;  2GTS A;  2OTL V;  1GM7 A;  1NTM H;  3WB2 A;  2LO1 A;  4NTX A;  3D8C A;  3DXR A;  3K58 A;  4YIO A;  4NB5 A;  3JYC A;  3I5D A;  4DV2 B;  3Q4H B;  5DM6 V;  2IJJ A;  4P2Z A;  5BMV B;  3BA9 A;  5JJE B;  1E79 G;  4L8J A;  4GX0 A;  3LSU A;  2MK3 A;  2DJV A;  3BVO A;  3P3P A;  3MHH C;  3W7X A;  2FB5 A;  1QVF U;  1SQP H;  1IZ3 A;  3TET A;  1AR4 A;  3VQY A;  5F2V O;  3SPH A;  2RDC A;  1HNZ B;  3JAR B;  2QGN A;  1YJW V;  3AG4 B;  2IW5 A;  3E8B A;  2AXT Z;  3ASN C;  5LXT B;  3F5W C;  2EBO A;  3D3I A;  2W0X A;  1WAZ A;  2UXC O;  3CXH F;  3JSL A;  4GT1 A;  4LNU B;  1P7G A;  1XQ8 A;  3F5T A;  3AG1 B;  1XBL A;  3DC6 A;  3LSS A;  3OEH G;  4F6R A;  3FB7 C;  2GUZ B;  4CZZ A;  1ZSP A;  3HKD A;  4I55 A;  2KB1 A;  4X8A A;  1R6K A;  2HJD A;  2DE0 X;  1V54 B;  1I08 A;  3WB1 A;  3HKC A;  4TV8 A;  4TSF G;  3OTO O;  4AI8 A;  4PI2 A;  1T5E A;  1FXK B;  3RYH B;  3H1I H;  2ODM A;  4JI0 O;  4EEQ A;  5EC2 C;  4DR4 B;  2EIN B;  1H2G A;  2CAZ C;  4NTY A;  4J10 A;  3HKB A;  2OYQ A;  2KKW A;  5KX5 A;  2AGA A;  1AI5 A;  1PD3 A;  4X62 O;  4DO2 A;  3LDE A;  1H8H G;  4XDJ A;  2BE3 A;  4WCE V;  2E5L B;  4PD4 F;  4LFC O;  4I7Z B;  1CPY A;  2ZE8 A;  2H3O A;  4D7T A;  1FXV A;  2XND G;  4JTD B;  2F4V B;  2EIJ C;  5BXZ A;  2RN9 A;  4OPH A;  3SYC A;  5IYD O;  3K04 A;  2KG7 B;  3JCU Z;  4DV4 B;  1BSM A;  2WPD G;  4B08 A;  1PKX A;  4DV1 B;  3ZMV A;  1RPO A;  2XAS A;  4K3A A;  1XNR B;  5KA6 A;  4DV5 B;  4ASU G;  4BAY A;  2BSK A;  3U11 A;  1IBM O;  4UXN A;  4UFZ A;  4PHZ A;  4UB8 Z;  3WFV A;  4DV7 O;  4CH6 A;  1Q86 W;  4DUZ B;  3K08 A;  4G2K A;  3RW0 A;  2EZP A;  1M90 W;  1SES A;  2P4V A;  5B1A B;  4BW5 A;  3ABL B;  1UFI A;  1RPR A;  5JWP A;  3AEI A;  2A9H A;  1SQG A;  4X20 B;  2OIG A;  4DR7 B;  4QPJ A;  1YCI A;  4TWK A;  3ZHQ A;  2PI4 A;  5LYJ A;  3OFN G;  4I9W A;  1TUB A;  5TIS Z;  1SKV A;  3CRR A;  1VF5 B;  2YEV A;  3OT7 A;  3X2Q C;  4FVM A;  1OCC C;  1JPX A;  1H2M A;  3PJS K;  1KKD A;  2IBZ H;  4DRX A;  3DXR B;  2QA4 V;  4JF3 A;  4IHJ A;  1WP8 A;  2JEU A;  5FL7 G;  5LGT A;  2N74 A;  1N33 B;  1K33 A;  3AG3 B;  3JAL B;  5IWA O;  5CB4 A;  1YSC A;  3O9O A;  3FAV B;  5CN0 A;  1JCH A;  4P30 A;  1PPJ H;  2PTM A;  2OWO A;  4EFB A;  3KCX A;  3AG7 A;  3CE2 A;  2OT5 A;  4JTA B;  4RAI A;  5GON A;  3H1L H;  2DQ0 A;  3ZED A;  4J42 A;  2PYL A;  2NR5 A;  2OTJ V;  1NT2 B;  1N32 O;  1SF9 A;  4JYY A;  4P9O A;  1OCO B;  4F6R B;  3D36 C;  3SPG A;  3SYQ A;  4FLX A;  4DR2 B;  5EBL C;  2CGN A;  3HKD B;  4I55 B;  2LFS A;  3CC2 V;  1J5E B;  4WFB V;  4FFK A;  1EN6 A;  3F7Y C;  2VWJ A;  3HKC B;  2B5U A;  4TV8 B;  2AHY A;  3CWB H;  5HFM A;  3BEH A;  3FD9 A;  5KLV H;  2F1M A;  3EVK A;  1VF6 C;  5EC1 C;  2KQX A;  1AI4 A;  1E1R G;  1BS3 A;  1GN3 A;  5KX5 B;  4B3T O;  1M4U A;  5LHI A;  4J7K A;  3OE7 G;  4FLY A;  1V55 B;  2W6I G;  2HP8 A;  2DWE C;  1M1K W;  2HEP A;  2LGW A;  4GKK O;  5K1P A;  3FB6 C;  1SRY A;  1Y66 A;  3IJ4 A;  5L3D A;  1SQV H;  2FL4 A;  3OUS A;  2HHH B;  1UPG A;  3C3T A;  3QVN A;  1M93 A;  1A32 A;  3O65 A;  1QNM A;  4DR3 B;  4NXM B;  2XAJ A;  1GAX A;  2YSU B;  4I50 B;  4NKG B;  4FM0 A;  2BSK B;  4CC5 A;  1XNR O;  5J2U A;  2DN9 A;  2ZCE A;  2VWK A;  5J9P C;  2ZQM A;  4X66 O;  5C8Y A;  2RMK B;  4UV8 A;  2JIZ G;  2WLH A;  3K57 A;  1R3K C;  1DK1 A;  1B06 A;  2WLI B;  4TUY A;  2WLN A;  4J9Z B;  4DXW A;  5KHJ A;  2QKS A;  1CXZ B;  3OMN B;  2GTA A;  1Q6U A;  1TUB B;  2ZKO A;  4YHH B;  4FFB A;  2YEV B;  2BOB C;  2XTA A;  4AQY O;  1VIB A;  2E3C A;  1ROP A;  2EIM C;  4DRX B;  2CTQ A;  4JI8 B;  2QKA A;  4C7U A;  1JX9 A;  4IHJ B;  4EB6 A;  5FLX N;  3FFQ A;  1O9G A;  4IIJ A;  4CC6 A;  3FYI B;  5CA1 A;  2PYJ A;  2N05 A;  3G6E V;  5CB4 B;  1DLB A;  5CBF A;  2LJ2 A;  4AHC A;  1I7F A;  5CMU A;  4DW1 A;  4GLX A;  1IX9 A;  1Q3E A;  2QWN B;  3STL C;  1K9M W;  2CDY A;  5JQG A;  2W0F C;  4FLW A;  4U3F H;  1DF5 A;  4ZI7 A;  4JI2 B;  5GON B;  5DEC A;  2KSD A;  2NNU A;  3ABT A;  3KKY A;  1RSO A;  4WFH A;  4MVU A;  4O2A A;  4QJF B;  3SDL A;  1YF2 A;  1B6Q A;  2JJ1 G;  1MNG A;  3CCV V;  2BTQ A;  4RWU A;  3RYF A;  2HKO A;  5LOV A;  5LHH A;  4JI7 O;  3CRM A;  5KHG A;  2EIK C;  1J5E O;  4LF9 O;  3M8A A;  1I5Y A;  4MTX A;  4FM1 A;  1Y4M A;  4EKW A;  4UCS A;  1PV0 A;  4QNH B;  4JPR A;  4D6T H;  4PDM A;  1THZ A;  1XMO B;  1AR1 B;  1BQ0 A;  4DV6 B;  5IDJ A;  3CCS V;  3JAK A;  4GKJ B;  1PNK A;  1B3Q A;  3BAA A;  1M57 C;  3B77 A;  2HHH O;  4E2L A;  3W7T A;  2DYS B;  2XAF A;  3OGI B;  2WLJ A;  2QTO A;  4DR3 O;  4NXM O;  1SC5 B;  3A0R A;  2Y69 B;  5ITZ A;  4Q20 A;  4TQD A;  3QO5 A;  1VQM V;  5KHI A;  4HYO A;  1O9H A;  2Y4U A;  2QR4 A;  1R3L C;  5J2U B;  4ZIB A;  2L35 A;  3OR7 C;  4MS2 A;  2XUM A;  3MAQ A;  1TGO A;  1JMK C;  5C8Y B;  5JCO A;  2L6L A;  4CBC A;  3SJC C;  2EJR A;  2AHZ A;  2YIC A;  4TUY B;  2UXX A;  3T1C A;  1I94 O;  5EBW C;  1KQS U;  1NI8 A;  5KAI Z;  4O4H A;  1HR0 B;  4FFB B;  4W4K A;  2YDE A;  2YS8 A;  2JS5 A;  2UUC O;  1DGS A;  5L3F A;  2LGQ A;  1QCE A;  3ZN0 A;  3HKE A;  3E2E A;  2PZS A;  3UO3 A;  1NS1 A;  4DV0 B;  1FKA O;  4R6Z A;  4JI8 O;  3S3X A;  1L8D A;  5B1B C;  2M7W A;  1S76 D;  4EB6 B;  1XRE A;  1VQ8 V;  2ARH A;  4IIJ B;  3ZRW B;  2HR3 A;  4O2B A;  4YJ3 A;  3W7S A;  5CA1 B;  5IJ9 A;  1H2K A;  3AK3 A;  1N36 O;  5CBG A;  1HNW B;  3EFF K;  4PJ0 Z;  3C90 A;  1XHZ A;  1P4R A;  1FJG O;  5LA6 A;  4X1K A;  1BCC H;  1P84 F;  3E35 A;  3GVM A;  1G4Y B;  2YI9 A;  5JQG B;  2UU9 B;  4NR1 A;  4DK1 A;  2LQT A;  4B7E A;  2UUA B;  4ZI7 B;  1M56 C;  1ZUQ A;  3CCM V;  4YY3 B;  1QR8 A;  1P49 A;  1BMF G;  1RSO B;  1W59 A;  3B4S A;  4O2A B;  1Y6X A;  5GW7 A;  1HNX B;  3JAS A;  1NJI W;  2BTQ B;  1MSW D;  4RUF A;  3RYF B;  1K97 A;  1MA1 A;  2CUG A;  2ZIN A;  5BR8 B;  3OR6 C;  5LOV B;  2UUB O;  2ZNI A;  1ZX3 A;  3RN4 A;  2PF4 E;  4WBN B;  2VQF B;  4GCZ A;  5L3C A;  5LP6 C;  3CCU V;  5LMU O;  2X0L A;  1Q8I A;  4LF4 O;  4Z1V A;  3IC9 A;  2IU0 A;  4DW0 A;  3I55 V;  2QJ1 A;  3E89 A;  3JD0 A;  5A2Q N;  2Q6A A;  2ZE5 A;  4PDR A;  4DR5 O;  3AG1 C;  3ETG A;  1Y76 B;  3STZ C;  1K8A W;  5J2T A;  3BHP A;  1KBH A;  2BTO A;  3UQ8 A;  4DV6 O;  3JAK B;  4DV3 B;  3BCC H;  1N34 B;  3WG7 B;  1OCR C;  1URF A;  5CA3 A;  1BT8 A;  1SER A;  1N4C A;  5KA5 A;  5H5N A;  1H2L A;  2IJK A;  1US6 A;  2JJ2 G;  3LUT B;  2WWW A;  1AP6 A;  1GRJ A;  2YID A;  1VQ4 V;  4UB6 Z;  2UXD B;  1YXB A;  4R50 A;  4MTO A;  2B9Z A;  1JFF A;  2ZXW B;  5ITZ B;  3OTF A;  2QWR B;  1KEC A;  4K35 A;  4PEL A;  3IGA C;  4PI0 A;  5KUM A;  4DR1 B;  4JAS A;  1BGY H;  2HLD G;  1NKD A;  4ICG A;  4J80 A;  5C93 A;  2WAM A;  3CCJ V;  2QSA A;  4FPP A;  2ADQ B;  2DYR C;  4JI1 B;  1U96 A;  4LCU C;  4LP8 A;  1WPX A;  4JV5 B;  1EFR G;  4QE9 A;  3L70 H;  1IVS A;  2ZDI C;  5GTI Z;  1K73 W;  5JVD B;  3LNN A;  4O4H B;  1JR9 A;  3E8F A;  3K59 A;  1NVP B;  1YTF B;  3VOU A;  1PM9 A;  3A0B Z;  3ASN B;  5IYC O;  4DUY B;  2IJI A;  3HKE B;  3P32 A;  1GMG A;  1R3I C;  2C2A A;  1WLE A;  3TXQ A;  5D5Q A;  2QM8 A;  4DV0 O;  4FK5 C;  5D5P A;  3D36 A;  4I4T A;  4O2B B;  4YJ3 B;  4JYC A;  1VP7 A;  4X64 O;  3SPJ A;  4KHP O;  2QWQ B;  1XMQ O;  5LA6 B;  4X1K B;  1IBK O;  1WA8 A;  2Y0P A;  4FJC C;  2IU3 A;  2EX3 A;  2LFR A;  3ETQ A;  4J7Z A;  1VF6 A;  4K0K O;  3CYO A;  1Z2G A;  1M9N A;  2UXB B;  1IXM A;  4LH6 A;  1KMI Z;  3QF7 A;  1N0N A;  4K8X A;  3JAS B;  2RNB A;  3G71 V;  2MW2 B;  1HNX O;  1IBL O;  4QIW F;  5KAF Z;  5KMG A;  2VQE B;  3BAB A;  3RFR A;  3AG3 C;  3H01 A;  3K06 A;  1FS0 G;  1QU7 A;  1VAR A;  1Q6I A;  5BR8 O;  2EIL C;  3TK1 A;  4B3M B;  4UV9 A;  3T1H B;  4L87 A;  2EIJ B;  3CRA A;  4LFB B;  3ASO B;  2HVJ C;  2R70 A;  1ENV A;  1R73 A;  3ZRV A;  4DV2 O;  2DOS A;  3SYO A;  2R9I A;  1H38 A;  1YIT V;  1QHT A;  3P3N A;  1AB3 A;  4O4I A;  4ZHQ A;  4MVO A;  4DK0 A;  1F4N A;  4NXN B;  3OAA G;  3J7A U;  5DN6 G;  3FYE B;  5FPR A;  4CH4 A;  1YI2 V;  1K4D C;  3N2G A;  3FX7 A;  3K5M A;  3RYI A;  1HWY A;  2FTK A;  4UUJ C;  3CCE V;  1NVP D;  4DV3 O;  2PI5 A;  1YTF D;  3U10 A;  1J95 A;  1GN2 A;  2JGU A;  1YZB A;  4QGP A;  1N34 O;  1HNZ O;  1BQZ A;  2Q4P A;  1K92 A;  1XL6 A;  2Y4T A;  4LF5 B;  3A8T A;  3X2Q B;  3FKS G;  5B66 Z;  3TCU A;  1JFF B;  1OCC B;  4LH7 A;  2UXD O;  2WLL A;  2BCC H;  4HNA A;  2K1E A;  3MDS A;  4BIZ A;  3KZI Z;  1QLE C;  1V55 C;  4U3J A;  1RP3 B;  1D2D A;  2Q5Z A;  1GN4 A;  1KB9 F;  2HVK C;  1YDX A;  2P5O A;  1D5A A;  3A2F A;  3CMA V;  3CD6 V;  4DR1 O;  4NVP A;  4B3R B;  4B3S B;  5IY5 B;  3G6B A;  2ITD C;  1X59 A;  3CC4 V;  3OW2 U;  4ZKI A;  4JYA B;  2H8P C;  1GM8 A;  1GK9 A;  3QO7 A;  4X65 B;  1XIL A;  4DR4 O;  2ZNJ A;  3HKB B;  3JD2 A;  2LW1 A;  3ZRX A;  4N23 A;  2XHB A;  1FFX A;  3MHS C;  2F66 C;  3IFX A;  1S77 D;  1NBM G;  4U7O A;  4JI6 B;  5LGU A;  3OMI B;  5KHK A;  2X6B A;  2E5L O;  5A9G A;  1HP8 A;  1HW7 A;  3GWK C;  1PL0 A;  1OCZ C;  1FYJ A;  1BHA A;  3RGB A;  2IH1 C;  1XI1 A;  3APO A;  4I4T B;  1Q5O A;  2F4V O;  2EJ7 A;  2RJZ A;  3MD0 A;  3L9D A;  2WA3 A;  2GV9 A;  3LDC A;  2OCC B;  1TVK A;  4U7N A;  4DV4 O;  2QEX V;  5BY1 A;  1XDC A;  4DV1 O;  4LFA B;  3SPI A;  2JVD A;  1GN6 A;  3E86 A;  3TJT A;  4DV5 O;  4OGQ B;  4XDL A;  2Q69 A;  1K7D A;  3RVZ A;  4QE7 A;  1VQP V;  5CA0 A;  3F7V C;  1NZ6 A;  4MSW C;  5FPO A;  2P06 A;  4DUZ O;  1R6T A;  5GTH Z;  2ILM A;  3ZHU A;  5KMG B;  3CX5 F;  3L74 H;  4TOI A;  2Q0A A;  2QM7 A;  1NR1 A;  5LYJ B;  2GSM B;  4DR7 O;  1Y74 A;  2IH3 C;  1Q6H A;  4B3M O;  4LFB O;  2XAG A;  4UCU A;  4PDL A;  5DED A;  1S3J A;  5EIB C;  3RWR D;  4JI5 B;  2ZM6 B;  4J9Y B;  3ZHS A;  4W4L A;  2DWD C;  2Z0A A;  3D3Q A;  1CP9 A;  1SQB H;  4O4I B;  4ZHQ B;  1N33 O;  3P30 A;  4LF7 B;  2O57 A;  4G28 B;  3BY6 A;  2CTW A;  3RYI B;  3BA8 A;  4IYH A;  3ETE A;  3DSQ A;  4H13 B;  2ZT9 B;  2ZD9 A;  1PNL A;  3ETD A;  1VF7 A;  3ZS8 C;  2Q73 A;  1FXH A;  1R3J C;  4IYI A;  5KHH A;  2CTR A;  2WLL B;  1SZT A;  2EIM B;  1AJP A;  4MTG A;  4PA3 A;  4U3J B;  2CH7 A;  2E74 B;  4DR2 O;  1K3E A;  3JAT A;  1K4C C;  1Q82 W;  1SQX H;  4LC1 A;  4KFM A;  3CCL V;  4ABM A;  4B3S O;  3HR0 A;  1KU9 A;  2QKC A;  3J80 N;  4B7K A;  1Q7Y W;  3VQV A;  1AI7 A;  4MVZ A;  1S5L Z;  5CBH A;  1XNQ B;  2DYS C;  5B3S B;  1RFY A;  3KG2 A;  1MZF A;  4JGS A;  1VQ7 V;  2A7W A;  5LBQ A;  3CRC A;  4LBE C;  3E22 A;  3GWO A;  4OPA A;  1G6U A;  1S5J A;  2WSS G;  1QVG U;  1YJN V;  1RM1 B;  2AZ2 A;  1WJZ A;  1F4M A;  3H1J H;  2IJH A;  2P22 C;  3THO A;  2CGO A;  1NH2 B;  1Q43 A;  3SYP A;  4UCR A;  1NU1 H;  2CK3 G;  2ZIM A;  4KUM A;  1XHX A;  2EIK B;  3JD3 A;  2AW9 A;  4CS2 A;  2YUA A;  1Q81 W;  5IYB O;  1NTK H;  1N8R W;  2IM9 A;  2K9P A;  1KP2 A;  5LP6 A;  4LFA O;  2YXH A;  4O4J A;  1WNS A;  1D5N A;  1BL8 A;  3L72 H;  3JSN A;  3T1Y B;  5LXT A;  4JAU A;  5CA0 B;  1TA8 A;  5E1A C;  4KL1 A;  3K5L A;  2A06 H;  4UCT A;  2V7Q G;  3ZN1 A;  3A0H Z;  2CTP A;  3QG5 A;  2ATK C;  3ABK C;  1VQL V;  2FML A;  3N2K A;  5AG2 A;  5LHG A;  1Y74 B;  4GYC B;  3W7U A;  3E8H A;  4X88 A;  3OTO B;  1KUQ A;  4FZ0 A;  4YHH O;  2P4K A;  1AP5 A;  3L73 H;  1YJ9 V;  4JI0 B;  1ARO P;  2XOK G;  4H37 A;  1E1Q G;  2R9A A;  1NTZ H;  4JI5 O;  1SQQ H;  2Q7E A;  1XOU A;  2B1I A;  2ZM6 O;  4X62 B;  1KP3 A;  3VQX A;  4FLU A;  2JK5 C;  3TXS A;  4LFC B;  2V1D A;  4WFF A;  3LSQ A;  2ZIO A;  1GM9 A;  3B8N A;  3VBB A;  2X7R B;  1IDS A;  3SJA C;  3ZHT A;  1TUE B;  1U97 A;  2HJF C;  2F23 A;  3JAW A;  1K5Q A;  4XBF A;  2E75 B;  1ZL8 A;  2ZDI A;  4JI2 O;  4MW8 A;  1W2B U;  3APQ A;  4PA7 A;  3JAM N;  3C3S A;  1NH2 D;  3OEE G;  4PA4 A;  1IBM B;  2CE4 A;  4X89 A;  4WFG A;  4DV7 B;  2CH7 B;  2Y0I A;  2N04 A;  2NLJ C;  5EBM C;  5IJ0 A;  5B1B B;  4MVS A;  1L0L H;  4CS4 A;  1ZTE A;  3K03 A;  4JAV A;  3T4Z A;  3K9S A;  3WG7 C;  2VRZ A;  3ABM B;  3AG4 C;  4WFA V;  2A0L A;  3ABU A;  5EZY A;  1XMO O;  1XNQ O;  3K79 A;  1LR1 A;  1M56 B;  3GB7 C;  2BOC C;  2ZXW C;  3WU2 Z;  5LMN B;  2A79 B;  1VQN V;  1MG1 A;  3RYC A;  3JD4 A;  4H33 A;  3ZMU A;  4GKJ O;  1V54 C;  2D3O W;  5JCO C;  1AVM A;  5BZB A;  5IWA B;  3JAL A;  4JAA A;  3ZMS A;  2R72 A;  3AK2 A;  1FXK C;  3AG2 B;  3CSX A;  4Q6G A;  3FAV A;  1K5S A;  2EIN C;  3K3W A;  4JZ2 A;  4UVA A;  1VQ6 V;  4UVB A;  5LP6 B;  3SPC A;  4GX1 A;  4O4J B;  1YEW A;  1F7Y A;  5IYZ A;  2FYU H;  4NYK A;  3T1Y O;  1BHB A;  4MTF A;  1N32 B;  1GO3 F;  3BPZ A;  4LWS A;  1COW G;  3M7M X;  1S0V A;  2WLM A;  4WFE A;  3I56 V;  3N2K B;  1QLN A;  1WN7 A;  1OCR B;  3U0Z A;  1XL4 A;  3FB8 C;  2XT9 A;  1HR0 O;  1WP7 A;  4JI4 B;  3AK1 A;  1HDJ A;  4RO2 A;  4IT5 A;  2ZR2 A;  1SET A;  2YXY A;  2E76 B;  4A5U B;  1GTO A;  4X1I A;  4B3T B;  1JJO A;  2H94 A;  3SJQ C;  3RBZ A;  4GKK B;  5IJ9 B;  3ZMT A;  2HFE C;  3S3W A;  5B1A C;  1AR5 A;  3ABL C;  1Z5W A;  1HNW O;  3HB3 B;  4RQF A;  2F43 G;  3HPL C;  1FFT B;  1P7B A;  2LW7 A;  2DYR B;  3JAW B;  4J7J A;  3K0D A;  4PA9 A;  1H2S B;  4MVR A;  1ZL8 B;  2UU9 O;  2ITC C;  3ASO C;  3J81 N;  2UUA O;  1TAE A;  4OXS A;  2YXL A;  4PDV A;  4YY3 O;  4FIP C;  5H9C A;  4JZG A;  1AJQ A;  4GX2 A;  2DW4 A;  2GDS A;  1PP9 H;  4K8Z A;  4OX9 B;  4I50 A;  4X9Q A;  4F4L A;  4F6E A;  2Q9L A;  3QTC A;  3IC7 A;  1EM1 A;  5IJ0 B;  4X66 B;  1KYO F;  4GUN A;  2YI8 A;  4E4E A;  2VQF O;  1S72 V;  2WLI A;  2Y48 A;  3VQW A;  2PGG A;  3CB2 A;  4Z2W A;  4RQE A;  1G8M A;  2X6A A;  3PN1 A;  2HG5 C;  2ETN A;  2Z3Y A;  2A3Q A;  3IAY A;  3ZBH A;  3OUF A;  2P90 A;  4UVC A;  4IGG A;  4AQY B;  5EZY B;  2B1G A;  4FM2 A;  4FLV A;  4D7S A;  1OCO C;  2QWP B;  3SYA A;  3DGE A;  5J2T B;  5LMN O;  1X4T A;  3RYC B;  1OZ0 A;  3B09 A;  1NR7 A;  3CHX A;  3B40 A;  4J11 A;  5IY5 C;  3M99 B;  4EFE A;  5IT9 N;  1LUW A;  1YVW A;  2EIL B;  1IUR A;  4DR6 B;  3SGI A;  4NTW A;  3QO8 A;  1N0J A;  2Q7G A;  1NQT A;  4O4L A;  2RCV A;  4JTC B;  3H9V A;  4I0X A;  1ZWI C;  5FNV A;  2P67 A;  1AIL A;  5IYZ B;  3FB5 C;  4UCV A;  1QQC A;  3T4D A;  1MAB G;  1SZX A;  3UT5 A;  4BR6 A;  4LR3 A;  4GX5 A;  2UXN A;  4LWS B;  1AJN A;  1I5X A;  4FLT A;  1WB7 A;  2QDO A;  3JCZ A;  4JI1 O;  4JV5 O;  1H8E G;  2F95 B;  4JI7 B;  1F51 A;  3H1H H;  1GH6 A;  3CP1 A;  3CRQ A;  4R8C A;  4LF9 B;  1JQ0 A;  2OCC C;  3G67 A;  1JJ2 U;  1MMM A;  1IXB A;  2JGD A;  3OD4 A;  2JDI G;  4I9Q A;  1XEQ A;  4JI4 O;  4DUY O;  1AI6 A;  1JVM A;  4FZ1 A;  1BZK A;  2X6C A;  3H1K H;  4X1I B;  3RVY A;  5L3B A;  5LGN A;  4HZ3 A;  1MZE A;  4MT8 A;  1QLE B;  3L75 H;  3KCY A;  2LP7 A;  2Q67 A;  3NR7 A;  3DC5 A;  4AIL C;  2QWO B;  5E79 Z;  1L1F A;  1OJH A;  1PNM A;  1BE3 H;  1WA8 B;  1ZLZ A;  1SA0 A;  5B5E Z;  2RQ6 A;  3RT3 C;  1KC8 W;  2XAH A;  3CME V;  3TGU H;  5L3G A;  1KD1 W;  2YIB A;  1VQK V;  1ORQ C;  1EZJ A;  4LF6 B;  1Y67 A;  2UXB O;  3ML0 A;  4Z1M G;  2V4D A;  4OX9 O;  1OHH G;  1OCZ B;  2VQE O;  3R66 A;  1EN4 A;  1I0H A;  2Q68 A;  2JS3 A;  1W0K G;  4XDK A;  3LDD A;  3T1H O;  4ZOL A;  5EYP A;  2PY5 A;  3BFR A;  1EN5 A;  3UO2 A;  1I94 B;  2ZR3 A;  3ZHV A;  3OM3 B;  3CJH A;  1VQO V;  1QR9 A;  2Q8V A;  1FAF A;  2JEX A;  2UUC B;  1XUQ A;  5JJJ B;  1EBO A;  3UM7 A;  5KUK A;  2XAQ A;  2W6J G;  4NXN O;  5L3E A;  4J41 A;  3N2G B;  3OMA B;  1V9P A;  4DYL A;  4YJ2 A;  4WF9 V;  3CCQ V;  4LF8 B;  3ZCC A;  1KKC A;  4H0L B;  5EK0 A;  3B8M A;  4IL6 Z;  4RUE A;  2GHY A;  3ZRW A;  1PL4 A;  2WLK A;  1N36 B;  1M5I A;  3K5N A;  3E8G A;  1FJG B;  4LF5 O;  2FKX A;  2M6Y A;  4BW9 A;  5B1N A;  4TT3 G;  4DR6 O;  4HNA B;  3K0G A;  4O4L B;  1VEW A;  4KXR A;  5B3S C;  3ZHR A;  4JI3 B;  4I0X B;  5FNV B;  2P6J A;  3ZX6 A;  5JH7 A;  4B3R O;  4I5S A;  1RM1 C;  2R9R B;  3UT5 B;  2EUL A;  2EZO A;  1OV9 A;  1WPB A;  4JYA O;  2UUB B;  4X65 O;  3K9A A;  1JOY A;  2Z5U A;  3T2M A;  1FFX B;  2OCH A;  2Q0O C;  2YC0 A;  4WBN A;  1FPO A;  3EXA A;  5LMU B;  2JGD B;  4X1Y A;  4TV9 A;  1VQ9 V;  4JI6 O;  2Y69 C;  4BWA A;  3DTU B;  3G4S V;  3W7W A;  1VQ5 V;  4LF4 B;  1L0N H;  1F23 A;  2DQ3 A;  3ICX A;  1MOF A;  3Q4H A;  4JYB A;  2D2C B;  5H6Q A;  4R7C A;  3CPW U;  5BMV A;  5JJN B;  4DR5 B;  3K5O A;  4N21 A;  2ZE6 A;  1Y76 A;  3UCS C;  2QM4 A;  4MW3 A;  1TVK B;  3QNE A;  3OGC C;  3ZRS A;  1WB8 A;  4PV1 B;  1SA0 B;  3SJB C;  4YIP A;  3ZIA G;  4FLZ A;  3JAR A;  1SQF A;  4UCO A;  1DTO A;  2UXC B;  2QE7 G;  3NXS A;  3ZJZ A;  2QTS A;  2DMX A;  1QBZ A;  4LF6 O;  1H2N A;  3UKM A;  4PA6 A;  4LNU A;  1R6N A;  1CEZ A;  2YIA A;  4GZR B;  3CXC U;  2GUZ A;  3EHB B;  5H6R A;  3WB0 A;  1MSD A;  1K34 A;  2Q7H A;  1YIJ V;  3BRC A;  3CCR V;  3LNM B;  1M57 B;  4MVQ A; 
#chains in the Genus database with same CATH homology
 1FXK A;  1BHB A;  1JX9 A;  4MTF A;  1K92 A;  1XL6 A;  1GO3 F;  4QPK A;  4YXW G;  1COW G;  5HFL A;  1S0V A;  2WLM A;  3FYI B;  4WFE A;  3I56 V;  3G6E V;  3X2Q B;  3FKS G;  1DLB A;  4G27 B;  3TCU A;  5CBF A;  1OCC B;  2WLL A;  4ZBM A;  5CMU A;  2K1E A;  1QLN A;  4KP4 A;  1OCR B;  1S5H C;  4BIZ A;  1XL4 A;  1QLE C;  1V55 C;  3FB8 C;  3STL C;  2HVK C;  1K9M W;  1GKF A;  3CMA V;  3CD6 V;  2W0F C;  3R65 A;  1DF5 A;  5IY5 B;  4RO2 A;  3E83 A;  2ITD C;  2NNU A;  3ABT A;  2ZR2 A;  4P9P A;  1SET A;  3CC4 V;  3OW2 U;  4WFH A;  4MVU A;  4ZKI A;  1GTO A;  2H8P C;  4QJF B;  1GM8 A;  1GK9 A;  3ABK B;  3QO7 A;  2H94 A;  1B6Q A;  2JJ1 G;  3CCV V;  3SJQ C;  3RBZ A;  3JD2 A;  2P7T C;  3ZRX A;  3ABM C;  4N23 A;  3MHS C;  3ZMZ A;  3IFX A;  3ZMT A;  1UJW B;  2HFE C;  2HKO A;  4MVM A;  5B1O A;  1S77 D;  5B1A C;  1NBM G;  5LHH A;  3ABL C;  4U7O A;  5LGU A;  1W0J G;  3HB3 B;  4RQF A;  3OMI B;  2EIK C;  2F43 G;  3HPL C;  1FFT B;  1YHQ V;  1P7B A;  2X6B A;  2DYR B;  3K0D A;  1PL0 A;  4PA9 A;  4MVR A;  1I5Y A;  1OCZ C;  4MTX A;  2ITC C;  3ASO C;  1BHA A;  2IH1 C;  1Y4M A;  4EKW A;  4OXS A;  4PDV A;  4QNH B;  1LNQ A;  4JPR A;  4HAM A;  4PDM A;  4FIP C;  5H9C A;  1AJQ A;  3MD0 A;  4GX2 A;  1THZ A;  4FMT A;  2DW4 A;  1DF4 A;  3LDC A;  2OCC B;  1AR1 B;  4U7N A;  4F4L A;  2QEX V;  3CC7 V;  3AG2 C;  3JD1 A;  4BIU A;  3IC7 A;  3SPI A;  5IDJ A;  3E86 A;  3CCS V;  2OTL V;  1GM7 A;  1PNK A;  4XDL A;  2Q69 A;  1K7D A;  3RVZ A;  4QE7 A;  1VQP V;  1S72 V;  3F7V C;  3JYC A;  1M57 C;  3B77 A;  4E2L A;  4MSW C;  5DM6 V;  2WLI A;  2Y48 A;  2IJJ A;  4P2Z A;  4RQE A;  1G8M A;  2X6A A;  3W7T A;  2HG5 C;  2DYS B;  2Z3Y A;  2XAF A;  2WLJ A;  2QTO A;  1E79 G;  3OUF A;  2P90 A;  3A0R A;  4UVC A;  4GX0 A;  2MK3 A;  2B1G A;  2Y69 B;  4Q20 A;  2QM7 A;  1NR1 A;  3MHH C;  3QO5 A;  3W7X A;  1VQM V;  4HYO A;  1OCO C;  1QVF U;  2GSM B;  3SYA A;  1R3L C;  3TET A;  3DGE A;  2IH3 C;  3OR7 C;  3SPH A;  4MS2 A;  2XAG A;  1YJW V;  1OZ0 A;  1NR7 A;  3AG4 B;  2IW5 A;  3E8B A;  4PDL A;  3ASN C;  3F5W C;  2EBO A;  3D3I A;  4CBC A;  1S3J A;  5IY5 C;  3M99 B;  2EJR A;  2AHZ A;  4J9Y B;  2UXX A;  4GT1 A;  3T1C A;  2DWD C;  2EIL B;  3AG1 B;  5EBW C;  1KQS U;  3LSS A;  1CP9 A;  3OEH G;  3FB7 C;  3P30 A;  4CZZ A;  3QO8 A;  4G28 B;  1NQT A;  2KB1 A;  3BY6 A;  5L3F A;  4X8A A;  1R6K A;  1QCE A;  3ZN0 A;  4JTC B;  3E2E A;  1V54 B;  1ZWI C;  3ETE A;  2P67 A;  3FB5 C;  4TSF G;  3T4D A;  1MAB G;  4R6Z A;  1FXK B;  5B1B C;  2M7W A;  1S76 D;  5EC2 C;  2EIN B;  1VQ8 V;  1H2G A;  2ZD9 A;  4GX5 A;  2UXN A;  1AJN A;  2HR3 A;  3ZRW B;  1I5X A;  1PNL A;  3ETD A;  3W7S A;  3JCZ A;  1FXH A;  1H8E G;  1F51 A;  1AI5 A;  1R3J C;  5CBG A;  1PD3 A;  2WLL B;  3EFF K;  1SZT A;  1P4R A;  2EIM B;  1AJP A;  3CP1 A;  4MTG A;  4DO2 A;  3LDE A;  1H8H G;  4R8C A;  4XDJ A;  1JQ0 A;  2OCC C;  4WCE V;  4PA3 A;  1JJ2 U;  3E35 A;  1G4Y B;  1CPY A;  1K3E A;  1K4C C;  2JDI G;  1Q82 W;  1FXV A;  1M56 C;  4LC1 A;  4KFM A;  3CCL V;  3CCM V;  1AI6 A;  1QR8 A;  1JVM A;  2XND G;  4JTD B;  2X6C A;  1BMF G;  2EIJ C;  5GW7 A;  3RVY A;  1Q7Y W;  3SYC A;  5L3B A;  5IYD O;  5LGN A;  3K04 A;  4HZ3 A;  1NJI W;  1AI7 A;  2WPD G;  4MT8 A;  1MSW D;  1QLE B;  4RUF A;  1PKX A;  2LP7 A;  4MVZ A;  2Q67 A;  1K97 A;  5CBH A;  3ZMV A;  1RPO A;  2DYS C;  3OR6 C;  5B3S B;  2XAS A;  1L1F A;  3KG2 A;  5KA6 A;  4JGS A;  1VQ7 V;  4ASU G;  4BAY A;  5LBQ A;  1PNM A;  4LBE C;  3GWO A;  4UXN A;  3WFV A;  1KC8 W;  2WSS G;  1QVG U;  2XAH A;  3CME V;  4GCZ A;  5L3G A;  1YJN V;  1KD1 W;  5L3C A;  1RM1 B;  3CCU V;  1F4M A;  1Q86 W;  2X0L A;  1VQK V;  3K08 A;  1ORQ C;  4G2K A;  2IJH A;  3RW0 A;  2EZP A;  1EZJ A;  1NH2 B;  3SYP A;  1M90 W;  1SES A;  2CK3 G;  2IU0 A;  3I55 V;  5B1A B;  4BW5 A;  3ABL B;  3ML0 A;  3E89 A;  3JD0 A;  4KUM A;  4Z1M G;  1RPR A;  2Q6A A;  3AEI A;  2A9H A;  2EIK B;  3JD3 A;  4PDR A;  4QPJ A;  4TWK A;  2PI4 A;  3AG1 C;  3ETG A;  5IYB O;  3STZ C;  1Q81 W;  3OFN G;  4I9W A;  1N8R W;  1K8A W;  1KP2 A;  2YEV A;  1OHH G;  1OCZ B;  3X2Q C;  2Q68 A;  1OCC C;  1JPX A;  1BL8 A;  1W0K G;  1OCR C;  3PJS K;  3WG7 B;  2QA4 V;  1KKD A;  4XDK A;  3LDD A;  5CA3 A;  4JAU A;  4JF3 A;  1SER A;  5E1A C;  5KA5 A;  2JEU A;  5LGT A;  5FL7 G;  2IJK A;  2ZR3 A;  2JJ2 G;  3OM3 B;  3LUT B;  1K33 A;  1QR9 A;  2WWW A;  3AG3 B;  1VQO V;  2V7Q G;  3ZN1 A;  1VQ4 V;  4R50 A;  4MTO A;  2JEX A;  1YSC A;  3ABK C;  2ATK C;  1JCH A;  2ZXW B;  5CN0 A;  1VQL V;  1EBO A;  3UM7 A;  4P30 A;  1KEC A;  4PEL A;  5KUK A;  2XAQ A;  3IGA C;  5LHG A;  2W6J G;  3W7U A;  5KUM A;  3E8H A;  4X88 A;  4JAS A;  5L3E A;  2HLD G;  3OMA B;  1YJ9 V;  1NKD A;  4WF9 V;  3CCQ V;  2OT5 A;  3ZCC A;  1ARO P;  2XOK G;  4JTA B;  4RAI A;  5C93 A;  2WAM A;  3CCJ V;  5EK0 A;  3B8M A;  4RUE A;  2DQ0 A;  2DYR C;  4FPP A;  4H37 A;  1E1Q G;  4LCU C;  2GHY A;  4LP8 A;  3ZRW A;  1WPX A;  1EFR G;  2WLK A;  4QE9 A;  2B1I A;  2OTJ V;  2ZDI C;  1KP3 A;  3E8G A;  4P9O A;  1OCO B;  2JK5 C;  1K73 W;  3SPG A;  5B1N A;  3SYQ A;  5EBL C;  2V1D A;  4WFF A;  3LSQ A;  1GM9 A;  2LFS A;  3B8N A;  3E8F A;  4TT3 G;  3VBB A;  1NVP B;  3CC2 V;  2X7R B;  3K0G A;  1YTF B;  4WFB V;  3VOU A;  1TUE B;  5B3S C;  3ASN B;  3F7Y C;  5IYC O;  2HJF C;  2IJI A;  3P32 A;  1GMG A;  2P6J A;  1K5Q A;  4XBF A;  1R3I C;  2B5U A;  2C2A A;  2AHY A;  1WLE A;  5HFM A;  2ZDI A;  3BEH A;  2QM8 A;  4I5S A;  4FK5 C;  1RM1 C;  3D36 A;  2R9R B;  2EZO A;  5EC1 C;  1AI4 A;  1E1R G;  4MW8 A;  1W2B U;  4JYC A;  4PA7 A;  3SPJ A;  1NH2 D;  3OEE G;  5LHI A;  4PA4 A;  3OE7 G;  1V55 B;  2W6I G;  3K9A A;  4X89 A;  1JOY A;  2Z5U A;  3T2M A;  2DWE C;  1M1K W;  4WFG A;  3FB6 C;  2NLJ C;  4FJC C;  2IU3 A;  5EBM C;  2LFR A;  1SRY A;  5B1B B;  1Y66 A;  1VQ9 V;  2Y69 C;  4MVS A;  3DTU B;  5L3D A;  3G4S V;  3W7W A;  3OUS A;  1VQ5 V;  3K03 A;  4JAV A;  3CYO A;  1F23 A;  2DQ3 A;  3T4Z A;  1M9N A;  3WG7 C;  1IXM A;  1MOF A;  4JYB A;  5H6Q A;  4R7C A;  3CPW U;  3ABM B;  3AG4 C;  3G71 V;  4QIW F;  4WFA V;  4N21 A;  2A0L A;  2XAJ A;  2YSU B;  3ABU A;  3AG3 C;  4MW3 A;  3H01 A;  3K06 A;  1FS0 G;  3K79 A;  3OGC C;  3QNE A;  3ZRS A;  1M56 B;  2EIL C;  3TK1 A;  3GB7 C;  2BOC C;  2ZXW C;  4UV9 A;  4L87 A;  2EIJ B;  2A79 B;  3ASO B;  1VQN V;  2HVJ C;  3ZIA G;  1MG1 A;  3JD4 A;  4H33 A;  5J9P C;  2ZQM A;  4UV8 A;  1ENV A;  1DTO A;  3ZMU A;  2JIZ G;  2QE7 G;  1V54 C;  2WLH A;  1R73 A;  3NXS A;  2D3O W;  3ZJZ A;  1R3K C;  3ZRV A;  1QBZ A;  5BZB A;  2WLI B;  3UKM A;  3ZMS A;  4PA6 A;  2WLN A;  3SYO A;  1R6N A;  4J9Z B;  1FXK C;  2R9I A;  3AG2 B;  4DXW A;  1YIT V;  1H38 A;  1CEZ A;  2QKS A;  1K5S A;  2EIN C;  3K3W A;  4MVO A;  4UVA A;  3OMN B;  1VQ6 V;  1F4N A;  3CXC U;  3OAA G;  4UVB A;  5DN6 G;  2YEV B;  3EHB B;  3FYE B;  5H6R A;  3SPC A;  2BOB C;  4GX1 A;  1YI2 V;  1K4D C;  1K34 A;  1YIJ V;  1HWY A;  2FTK A;  4UUJ C;  1ROP A;  3CCE V;  2EIM C;  1NVP D;  3CCR V;  2PI5 A;  3LNM B;  1M57 B;  1YTF D;  1J95 A;  4MVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...