1R73A

Solution structure of tm1492, the l29 ribosomal protein from thermotoga maritima
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
b'MKASELRNYTDEELKNLLEEKKRQLMELRFQLAMGQLKNTSLIKLTKRDIARIKTILRERELGIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L29
publication title NMR for structural proteomics of Thermotoga maritima: Screening and structure determination
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r73A00
1YITV 1Q81W 1VQ4V 1W2BU 1QVFU 3CCLV 3G6EV 3CCSV 1JJ2U 4WFBV 2OTJV 1VQ7V 3CCVV 1VQOV 1Q86W 1K8AW 3CD6V 1NJIW 2QA4V 2QEXV 3CCJV 3OW2U 1K73W 1M1KW 3CCMV 4WCEV 1QVGU 3CMAV 2D3OW 5DM6V 4WF9V 3CC2V 3CCQV 1KQSU 1VQMV 3I55V 3G4SV 1YJWV 1VQNV 3CMEV 4WFAV 3CXCU 1VQPV 1VQLV 1S72V 1YIJV 3I56V 1YHQV 1Q82W 1VQ5V 1K9MW 1VQ8V 1R73A 1N8RW 1Q7YW 3CC7V 1KC8W 3CCRV 1VQKV 1M90W 3CPWU 3CCUV 1KD1W 3CCEV 1YI2V 1YJ9V 1VQ9V 1VQ6V 1YJNV 3G71V 2OTLV 3CC4V
chains in the Genus database with same CATH superfamily
1K5SA 2ODMA 5D5PA 2VQEO 2F93B 5IYCO 2B9ZA 3BFRA 3ZRSA 1BQ0A 1GO3F 1ZSPA 2ZKOA 4WFFA 4OGQB 2DQ3A 3TJTA 4MVQA 4J7KA 5L3EA 4IHJB 3B8MA 3B8NA 1Q82W 3K3WA 1BHBA 3DXRB 4AI8A 1TUBB 2ZIOA 1FAFA 1GN3A 1B06A 2WLNA 2NR5A 5L3CA 1XI1A 3DGEA 1JVMA 3CCJV 3CP1A 3JAKB 4U3FH 1BHAA 4U3JB 1US6A 4FFBB 1FS0G 5JJNB 1VARA 3CD6V 2H94A 1W0JG 2ZM6B 3CRQA 1OJHA 3ABKB 5LOVA 2Q7EA 2C2AA 1HNWB 4I50A 3Q4HB 5KHHA 3EVKA 1XOUA 1VQ7V 5DN6G 5CMUA 2Y69B 4MTGA 4DUYB 3CMAV 5J2TB 1JX9A 3QNEA 4PDLA 1D5AA 1F23A 3E22A 5LA6A 3HKCA 2Y4TA 4J9YB 5H6QA 1M4UA 1TGOA 5JJEB 4RUFA 3ZCCA 2EIJB 3JCZA 3K9SA 1AJQA 1SS3A 5FPOA 2GTSA 1WLEA 3JARA 4RAIA 2Q68A 3G80A 1M56B 3JAWA 3HPLC 1S5JA 4RQEA 4ZOLA 4LP8A 2A9HA 3OR7C 2QE7G 1D2DA 5KUMA 2EIKC 3FAVB 3GWOA 2ZCEA 4MVUA 5CBGA 1AJNA 4UCRA 2F95B 2GBOA 2V4DA 3DTUB 4GKJB 1Y74A 5K1PA 2W6JG 4OX9O 4FM1A 3K5MA 1AI7A 3FKSG 1NS1A 1Q3EA 1XNQB 2CGOA 3AG2C 4J42A 4YHHO 4Q6GA 1XDCA 2WAMA 4NXMO 1AR4A 4IL6Z 1Y76B 5CBHA 3ETEA 3ZRXA 5F2VO 4O4LB 2CH7B 2ADQB 1H2NA 4CS3A 5D5QA 4BIUA 1IBLO 3QG5A 1UFIA 2YSUB 2OCCC 5KMGB 2Q69A 1R3KC 1YJNV 1MG1A 5GONA 4NR1A 4DR4B 5KHKA 1G1XB 5KHGA 1JFFA 3JD2A 5LGTA 2HR3A 3SPJA 1P7BA 3OD4A 3VQVA 2IBZH 3CCMV 1AJPA 2D3OW 2UUCO 3VBBA 1AVMA 3CMEV 2ZIMA 3OMNB 2Q67A 2UU9B 1T5EA 1P4RA 3ABMC 1NT2B 4LF9O 1HR0O 3MDSA 2EBOA 4LFCB 3L71H 2YEVB 3WB1A 4UV9A 3ZN1A 1SA0A 5EK0A 2EILC 3AG3C 3CXHF 4F6RA 3ETGA 5LYJB 2F23A 3M99B 2GV9A 4XDKA 4A5UB 3U11A 5LGNA 3K5LA 1VQKV 4JI4O 4MTOA 3M8AA 4B08A 2PI4A 2EIKB 2ZE8A 1XEQA 3ASOC 3CRRA 5EYPA 1JJOA 2YXHA 4DRXB 2JIZG 4YJ2B 1KECA 4DW0A 3E8HA 4NTYA 1RPOA 4X64B 3AG2B 4CH6A 4MTXA 3CSXA 4XDJA 3S3XA 3ZHUA 1S5LZ 3HKEA 4X1KA 2IU3A 2RCVA 3B4SA 3CB2A 3OW2U 3UQ8A 2RJZA 4B3TO 1WJZA 4JI5B 1H2SB 1N34O 5IJ0B 2GSMB 2Z3YA 1SQQH 2OCCB 4JAUA 1EM1A 3OTFA 3BEHA 3SYQA 4LR3A 2K1EA 1RPRA 4I4TB 3RWRD 4O4JB 4DR7B 4KUMA 4EFBA 2JS3A 3UCSC 1MOFA 1Z5WA 1SQBH 3ZMSA 1U96A 2B1GA 2L35A 4JPRA 1RFYA 2VWJA 1XQ8A 2FTKA 2R9RB 2XNDG 1VQLV 3ZMZA 2P90A 1F7YA 1RP3B 1ROPA 2BE3A 3ABMB 3RVZA 5IDJA 2CTQA 4YY3O 2VQFO 1L1FA 1N36B 5E1AC 4FLWA 1PPJH 2RMKB 3EFFK 4GUNA 4R50A 1MSDA 2EILB 1FXKA 1CPYA 3AG3B 3RYIA 5L3GA 1N33O 1WN7A 3D36A 1TUBA 2UXDB 1YIJV 3N27A 2PGGA 1BE3H 1DF4A 1V9PA 5LHHA 4I55A 3F5TA 2IJIA 5LMUO 5LMNB 3OM3B 2JEUA 3W7WA 2EZOA 4I50B 1HNXO 4CH5A 4U7OA 1I94B 1GMGA 5LGUA 2DOSA 2LW7A 3BAAA 2UXCB 3KCYA 1VQ8V 1R73A 4AQYO 4DV2O 2DQ0A 1IX9A 1Z2GA 4FZ1A 5KHIA 3R66A 3A0HZ 3E22B 3ABLC 2N04A 5LA6B 1G4YB 2AZ2A 4NKGB 4B3MO 4I0XB 4KXRA 2DWEC 1YVWA 1S5HC 3G4SV 2QWNB 3H1IH 1WP8A 1XILA 1XMQO 3JARB 4I5SA 3JAWB 2L6LA 2E3CA 4ZOLB 4O4IA 3PJSK 5JJJB 4LFBB 1R6KA 2H8PC 3W7SA 2Q0AA 4HNAA 4UFZA 3ABTA 4DR6O 1Y74B 1FXVA 4JZGA 3FAVA 2HLDG 4KL1A 1XNRO 4DUZB 4FZ0A 4X1YA 1DGSA 3TCUA 1THZA 5CBFA 3H1LH 2AGAA 1V54C 2Q7HA 3LUTB 4DR3O 1GKFA 3HKBB 3I55V 3CXCU 4FMTA 2AHYA 1Y76A 2P6JA 1K34A 3T1YB 1RM1C 3FB8C 3CHXA 2ETNA 4FM2A 3U10A 1EZVH 3ZHTA 1FD9A 2YI8A 3ZN0A 1JFFB 3ML0A 5LXTB 5J2UB 4IYIA 3FX7A 5JH7A 4UVCA 4B3RO 4BIOA 2H3OA 3ABLB 4DV1B 4QPKA 1R3LC 4JI2B 1H2MA 4NXNB 4FLTA 1ZWIC 4ZHQA 4H37A 1BSMA 2JEXA 4B3SB 2WLLA 1SA0B 4E4EA 1FXKC 1GRJA 2UUAO 1B04A 4F6RB 3IC7A 1J5EO 1P7GA 2XASA 2JJ2G 1KUQA 5DEDA 2YEVA 2CE4A 3J81N 3JD4A 3ZMVA 3ZBHA 5A9GA 5JQGA 1PD3A 4K35A 4GKKB 3VOUA 1OCOC 5EYPB 2OWOA 2X6AA 3ABUA 3H1JH 1M57C 1N8RW 4TQDA 4JI7O 1HNWO 2ITCC 4KHPO 3P30A 4C7UA 2R72A 2LGWA 1N4CA 2VRZA 4IGGA 4WFBV 3HKEB 3JATA 2OCHA 4G28B 1V54B 4H0LB 4J10A 4CZZA 4L8JA 3R65A 3S3WA 5LP6C 4TUYA 2UUBB 3AEIA 1K33A 2WA4A 4DW1A 4LFAB 1NTZH 1NR1A 4FM0A 3RBZA 3LNMB 4ASUG 1YXBA 4JZ2A 1R6TA 5GTIZ 3N2GA 1F4NA 1JR9A 3L75H 4JI6B 1VQMV 4D7TA 1KBHA 3LSUA 1FJGB 4X8AA 4LF7O 1A32A 4LF6B 4O4JA 2O57A 4X9QA 4YXWG 5B1NA 5KAFZ 2LW1A 5GTHZ 2XAGA 3F7YC 2DMXA 2G38A 3E89A 4MVMA 1GM9A 3DC6A 3EXAA 3K0GA 2DYRB 4LWSB 1N0JA 2W0FC 4K0KB 4GX0A 3CC2V 1OCZB 1FFTB 2HJDA 2PUSA 5B1BB 4JI8O 2BOCC 1FXKB 4X62B 3MD0A 2YIBA 4MT8A 2LGQA 3RYIB 4MVSA 4LNUA 3GWKC 5KX5A 1UJWB 3SJQC 2WLJA 2F43G 2DW4A 4NVPA 3ZHRA 2K9PA 2LJ2A 4JI3B 4I55B 1YZBA 3BVOA 2QWRB 4P2ZA 4Z1MG 4JTAB 1YJWV 2ZD9A 2W0XA 3K08A 1KC8W 4PA6A 4O2BA 1M90W 4DR4O 3LSSA 1AILA 4LF4B 2OIEA 4DV5B 4DR1B 4X20A 2MW2B 2E5LO 3SJCC 3BABA 3ZJZA 3K0DA 4WF9V 5EC2C 2ZINA 3QTCA 4CBCA 4JAAA 2R9AA 2UXNA 4TT3G 1KD1W 2WLIA 3MHSC 3W7XA 3DSQA 2QDOA 3CCLV 1DF5A 3JYCA 3OGCC 4I0XA 1Q5OA 1IBKB 5JVDA 4O4IB 2YXYA 3GVMA 1TAEA 3IC9A 4ZIBA 3AG1B 2ILMA 3H01A 3OTOO 4JYAB 2LQTA 2HEPA 4HNAB 1RSOA 1DTOA 5KHJA 2EIMC 1TVKA 4LCUC 4TQFA 4FPPA 2X6BA 1K4CC 4GLXA 4X65O 1H2LA 1COWG 5BR8B 4X1YB 1VQOV 1E1RG 2YIBD 4LH6A 1GTOA 3WB2A 2GHYA 5EIBC 4FVMA 4X64O 1ZLZA 3OGIB 2JJ1G 3ZX6A 3WU2Z 4I9WA 2YS8A 3VQYA 3OFNG 4UUJC 4JI0B 3ZRWA 1GK9A 5CA1A 1W2BU 5IYZA 4JI1B 3G6EV 3CCSV 2VQEB 3HKBA 3K58A 1MSWD 1IXMA 3E35A 1OZ0A 1OV9A 4FFKA 4DV7B 4O2AA 4RQFA 4CC5A 2P67A 1S72V 1BL8A 1B6QA 4DV3O 5JH7B 4GYCB 1F4MA 1YEWA 4N21A 1QLEC 4J41A 4B7KA 4MS2A 1IDSA 2RQ6A 2CAZC 1HP8A 4RWUA 1QR9A 2YI9A 1VF7A 5LXTA 5J2UA 2PZSA 4JYYA 4PJ0Z 4HZ3A 1B3QA 5E79Z 4ZHQB 2QWOB 1WB8A 4JYCA 1JMKC 2WLLB 4X66O 1YJ9V 1CEZA 1N36O 3BY6A 4MW3A 4B7EA 4DV0O 1Q86W 2HHHB 1ZX3A 1PL4A 3APQA 3AG4C 1M9NA 2P4KA 4D6TH 1CXZB 5JQGB 2IH1C 3JD3A 3KCXA 1J95A 4FLXA 4DV4O 2CUGA 1KU9A 1BMFG 1PV0A 4PA7A 4UB8Z 5LMNO 5IWAB 2LFSA 2Q4PA 5BMVB 4GX1A 1QLNA 3N2KA 2GTAA 2Q6AA 1BZKA 2KSDA 1KQSU 3JATB 4QNHB 2V7QG 1NU1H 3OT7A 3UO2A 2PY5A 3SYAA 3A2FA 3CCUV 3C90A 4PA9A 4TUYB 4GZRB 5LHGA 1AP6A 3QO7A 3LDDA 1JCHA 2AZ0A 4OX9B 3T1CA 2XAJA 3QO5A 2ARHA 1VQNV 2Q8VA 1LUWA 2Y0IA 3N2GB 2QSAA 1SF9A 2W6IG 3CC7V 4QE9A 4YHHB 1SQFA 1QLEB 4NXMB 4PA4A 2DYSC 1PNMA 1XBLA 3O65A 3D8CA 1L8DA 2QM7A 2ZE5A 2BCCH 5IE9A 1IBLB 1N32O 5HFLA 2FKXA 2Q7GA 3AK2A 2ZE6A 1DLBA 4IT5A 2QKCA 1WNSA 4LWSA 4LNUB 1S0VA 2XAQA 4LF5O 5KX5B 2QA4V 2LFRA 1QVGU 1O9HA 2IW5A 3AG4B 1Y67A 4TV8A 1SQVH 3HR0A 3CRMA 2UUCB 4NTXA 3E86A 4ICGA 4DR5O 3BRCA 1AR5A 3QO8A 3APOA 3TK1A 4BWAA 4O2BB 4IIJA 4PHZA 1H2GA 1PKXA 1HR0B 3ASOB 4O4HA 3P3NA 2EJRA 5KUKA 4DYLA 1ORQC 4X20B 4N23A 3J7AU 2HKOA 1QQCA 4CS4A 3EHBB 2JS5A 2HJFC 2IJHA 1R1BA 5FNVA 3I56V 2QWQB 4QGPA 4DV1O 2AHZA 4JI4B 2ADPA 2A0LA 2WLIB 4NXNO 1NKDA 4P9PA 3RN4A 1I5YA 1YTFD 4JV5O 4BR6A 2EULA 1XMOB 2QWPB 5LP6A 5JVDB 2FL4A 4E2LA 4I7ZB 1I5XA 2ZT9B 2WSSG 1Q90D 1PNLA 2WPDG 2R9IA 5IY5C 1SQPH 1RSOB 2Y48A 4UB6Z 4FLVA 2N05A 5B1AC 1TVKB 3AK3A 5A2QN 5IYBO 1K73W 4MVRA 4UCTA 3NXSA 1M93A 2DWDC 2BTQB 3JASA 1AI4A 1FKAO 4B3TB 1NBMG 2EINC 4DV6O 4JASA 2IJJA 1EFRG 4DR2O 3JALA 1ZAUA 1QBZA 3K5OA 2QR4A 1N34B 5C8YA 5FL7G 1KKCA 4XBFA 3FB7C 3CPWU 3GB7C 2VWKA 4PV1B 3JD1A 4OPAA 4AILC 2XT9A 3FYIB 3ZRWB 2A79B 3T1HO 3K06A 5CA1B 4UVBA 2F4VO 3W7UA 1K7DA 5IYZB 1XREA 1KYOF 4LF8O 3RYCB 1K97A 3B77A 4X88A 3OEEG 4O2AB 4K8XA 1IURA 1G6UA 1HNZO 3K9AA 1FPOA 1IZ3A 2JGDB 3NR7A 4Z1VA 2VQFB 2Q0OC 1HWYA 1K8AW 4G2KA 3RT3C 1GAXA 4WCEV 1ENVA 4P9OA 1NH2B 1IBMB 5LHIA 1OHHG 4UCUA 4LF6O 1URFA 4XDLA 3CRCA 2UXBO 1N33B 2CTRA 2HVKC 3HKDB 1EN6A 1QU7A 3G67A 3SJAC 2VS0A 1WPBA 5BXZA 4YIPA 1YITV 1W59A 1PM9A 2DJVA 5H6RA 1H8EG 3CJHA 4JTCB 4LH7A 4J11A 4U7NA 2NLJC 2QGNA 2JK5C 5H2FZ 4GT1A 5ITZA 1GN4A 5B1OA 2KG7B 4PDRA 2OYQA 2CGNA 1I0HA 2Y4UA 3M7MX 5IY5B 4AQYB 3OEHG 5IYDO 1OCRC 1GN2A 3WFVA 5B1AB 4JI3O 3LDCA 2ZE7A 1XHZA 2P22C 2QM4A 5DM6V 2IJKA 3N2KB 3CE2A 4H44B 1AI5A 2A3QA 4RUEA 2EINB 4MVZA 3H1KH 2ZM6O 1XMQB 5J9PC 4H13B 5BMVA 4DR1O 4L87A 2P5OA 5CA0A 3P32A 4DUYO 3L73H 1NVPD 1P49A 2RNBA 1Q6UA 1M5IA 1S3JA 4BAYA 1PNKA 4DR6B 1KP2A 4JF3A 1N0NA 3CX5F 3L74H 1VQ9V 1YTFB 3RW0A 1RM1B 1WP7A 1XNRB 1ZTEA 3ETDA 1IBKO 4NYKA 3ASNC 4TV9A 1IXBA 4JYBA 4JAVA 3ZS8C 4DR3B 4ZI7A 2XAFA 1L0NH 1VEWA 2BSKA 5HFMA 1EN4A 3SGIA 5BR8O 3KKYA 2PYJA 3IGAC 1MNGA 4GKJO 2RDCA 5C93A 1W0KG 1I7FA 2KQXA 1XNQO 3UO3A 4FJCC 1PP9H 2HG5C 1QR8A 3RYFA 2P7TC 3D3IA 2FB5A 3MHHC 4TV8B 5GW7A 1XHXA 4JI1O 4CH4A 2B1IA 4B3RB 1F51A 1OCRB 3BA8A 5L3BA 4FIPC 2OTJV 3SJBC 1O9GA 1E79G 2FMLA 3A0RA 2YIAA 4IIJB 3RYHA 2Z0AA 4TSFG 4DV7O 3TXQA 1OCOB 4O4HB 1HW7A 3C3SA 2UUAB 4FLZA 1M57B 3UKMA 1J5EB 5EIBD 5FNVB 3RGBA 4J7JA 2P4VA 4J7ZA 1VF5B 4BW5A 2B5UA 4H33A 3E2EA 1TUEB 1M1KW 1R3IC 1K5QA 2ZQMA 3P3PA 3LSQA 2XAHA 4PA3A 5EZYB 3IJ4A 2M7WA 2NNUA 1AP5A 2UU9O 3WB0A 5LP6B 1YHQV 3CRAA 3E83A 1KKDA 2IH3C 3X2QC 3WG7C 4JI7B 4LFCO 1V55C 2HHHO 4KHPB 1TA8A 3ASNB 3JD0A 4YJ3A 2IU0A 1UPGA 3JSLA 3CWBH 4KP4A 3SPHA 2ITDC 2X0LA 2HFEC 3B40A 2YC0A 1VQ5V 1FYJA 3JASB 2IM9A 3FD9A 3OMAB 5IWAO 2Y0PA 2D2CB 1NTKH 3VQXA 3JALB 1R6NA 2BTOA 2AW9A 5C8YB 4Z2WA 3K04A 2YICA 1FFXA 2ZDIC 2BTQA 3OE7G 3T4ZA 1VP7A 3K5NA 4Q20A 3SR2C 1KP3A 3UT5A 5TISZ 2AXTZ 2FYUH 2ZNJA 5B3SC 2OIGA 1MABG 1YCIA 1YDXA 4LF7B 2PI5A 3K57A 1X59A 1NVPB 3ZIAG 1VQ4V 2KKWA 3C3TA 3E8FA 3BCCH 3RYCA 4F4LA 4JI5O 4I9QA 3CCQV 4UCVA 1GN6A 1EZJA 2LP7A 2GDSA 5EBMC 5FLXN 1L0LH 4JI8B 2Z5UA 2EX3A 4UCOA 2JGDA 3CC4V 4FLUA 4DR7O 4BIZA 4R6ZA 4J80A 5JCOC 3KG2A 1JPXA 4X1IA 1WAZA 1WPXA 1S76D 4WFHA 3PN1A 5CN0A 3W7TA 4MSWC 2ZNIA 1BGYH 3HB3B 3E8GA 2GUZB 1Q43A 3CJHB 3IAYA 4WBNA 1SRYA 4WFAV 3HKDA 2R70A 4F6EA 1Q7YW 4ZKIA 2WWWA 3T2MA 5ITZB 3X2QB 3WG7B 1QNMA 3OMIB 1LNQA 3SPGA 1V55B 3A0BZ 3TXSA 4BW9A 4DO2A 1JJ2U 1EN5A 4UXNA 3OAAG 1H8HG 2DE0X 2E5LB 2UXDO 2KG7A 2EZPA 1IVSA 2QKSA 4JTDB 2EIMB 2WA3A 3BA9A 4FK5C 1VF6A 3STZC 4EB6A 1K3EA 1I94O 4W4KA 5CA0B 5KA6A 3OR6C 1ZL8A 2QJ1A 1VMGA 2UXCO 4CH3A 3TGUH 5B3SB 3OTOB 2E76B 2HP8A 1K92A 1AR1B 1X4TA 3SYCA 3G71V 4TOIA 3BHPA 3JSNA 1SZXA 3OUSA 5L3FA 3SPCA 4X65B 1XMOO 3CCVV 2Q5ZA 4J9ZB 1Y4MA 4TV9B 2YDEA 1SESA 5IT9N 3FFQA 4CC6A 4NTWA 2KB1A 3ZMTA 3ETQA 4ZI7B 1NH2D 3FB5C 3JCUZ 4CS2A 4LFBO 4G27B 2BSKB 2X7RB 3SPIA 1JQ0A 2V1DA 1XL6A 2QEXV 2OT5A 1D5NA 2RN9A 1Y66A 3F7VC 4WFGA 4IYHA 3I5DA 2P06A 5KAIZ 1FXHA 2ZR3A 5B66Z 1NTMH 3DC5A 3RYFB 5BY1A 4DUZO 4DV3B 1P84F 3LDEA 3ZHQA 5CB4A 1GM7A 3A8TA 5JWPA 2JRIA 2MK3A 4UVAA 3K59A 4RO2A 1NI8A 1BQZA 3RYHB 2EJ7A 2PF4E 3MAQA 2QTOA 5IJ9A 1WA8A 3T1YO 3TETA 4PELA 1MZEA 1VQ6V 1AB3A 2F1MA 4X66B 1JA8A 1Q8IA 1Y6XA 4PDMA 2YIDA 1QHTA 3F5WC 4DK0A 4LF9B 1H38A 4HAMA 4DV0B 1IBMO 3STLC 4IHJA 4GCZA 3LNNA 1NR7A 1K4DC 3DXRA 2Q9LA 2F66C 1CP9A 3CS5A 1K9MW 3ZEDA 4DV4B 1SKVA 3CCEV 1AI6A 5EC1C 5H9CA 5LOVB 3JAKA 4JI2O 4U3JA 4UCSA 4FFBA 4EEQA 3SYPA 1WB7A 5EZYA 4B3SO 1MZFA 4MW8A 4YJ3B 3CEIA 2QKAA 2DN9A 4GX5A 5LBQA 3O9OA 5FPRA 2CTPA 2JGUA 4HBNA 2LO1A 4PI0A 3Q4HA 4WFEA 3J80N 1G8MA 1XUQA 5K1XA 3HKCB 2YUAA 5J2TA 4GKKO 1SC5B 2DYSB 2XTAA 3QVNA 4R7CA 1VF6C 1FFXB 4K3AA 4MVOA 1VQPV 1Z5VA 2A7WA 3UT5B 2PYLA 1XL4A 5BZBA 3E8BA 2M6YA 1Q6IA 3ZMUA 1GH6A 1VIBA 1YF2A 1QVFU 3ZRVA 3OUFA 3ZHVA 1BCCH 2BOBC 4W4LA 2CDYA 1U97A 4QPJA 5KA5A 1YSCA 2XUMA 4DK1A 3T4DA 4HYOA 2UUBO 2PTMA 3FYEB 1EBOA 1KB9F 4OXSA 4QIWF 1N32B 4ABMA 4LFAO 5EBLC 2N74A 3SYOA 1MA1A 2JDIG 1OCCC 4YY3B 3VQWA 3SDLA 4TWKA 1NZ6A 1BT8A 4LF5B 4PI2A 4JI6O 4X1IB 4UV8A 4LC1A 1I08A 2CTWA 1FJGO 3CYOA 1KMIZ 3U0ZA 1LR1A 4WBNB 5EBWC 2A06H 3CCRV 4DR5B 5CA3A 4O4LA 2CH7A 3ICXA 5GONB 2WLHA 4K0KO 1BS3A 2GUZA 5LMUB 1ZUQA 3QF7A 1HNXB 4X62O 3FB6C 5KMGA 2ZXWC 1QCEA 2WLKA 2YXLA 4GX2A 1NQTA 4LBEC 3UM7A 1PL0A 1HDJA 1YI2V 3B09A 4DV2B 4QJFB 1SQGA 1GM8A 2E75B 2DYRC 5AG2A 4FLYA 5KLVH 4JV5B 1OCZC 4B3MB 4EB6B 5B1BC 3H9VA 1R3JC 1ZL8B 3L72H 1LUVA 2UXXA 1SQXH 3D36C 4YIOA 1MMMA 4MTFA 3D3QA 3THOA 4LF4O 1SZTA 2JVDA 4EKWA 4DV5O 3RFRA 2ZDIA 4P30A 1NJIW 5LYJA 3RVYA 1SERA 2HVJC 1JOYA 3L70H 3IFXA 2QM8A 5DECA 4D7SA 2NN4A 4K8ZA 3B2EE 1E1QG 4DV6B 2XHBA 4DR2B 2X6CA 4PDVA 3ABKC 1S77D 4DRXA 2WLMA 4EFEA 1OCCB 3K79A 4YJ2A 4DXWA 4ZBMA 4X1KB 2Y69C 3T1HB 2F4VB 4JYAO 2CK3G 3JAMN 5LL6Y 2E74B 4PD4F 4LF8B 3AG7A 2ATKC 1SETA 5JCOA 5L3DA 4JGSA 5H5NA 1Q81W 2ZR2A 1Q6HA 1HNZB 3K03A 4OPHA 2EIJC 4AHCA 5CB4B 4X89A 3AK1A 3ZHSA 3AG1C 1DK1A 4R8CA 5IJ0A 3H1HH 4QE7A 2ZXWB 2XOKG 4KFMA 1M56C 3KZIZ 3G6BA 2Q73A 3L9DA 4I4TA 1H2KA 1AROP 4NB5A 4JI0O 2UXBB 2QTSA 5B5EZ 3BPZA 2OTLV 5IJ9B 1WA8B
chains in the Genus database with same CATH topology
1K5SA 4BIZA 4R6ZA 3KG2A 1JPXA 5IYCO 1S0VA 1WPXA 2XAQA 1S76D 4WFHA 3ZN0A 5CN0A 3ZRSA 2QA4V 1GO3F 3W7TA 2LFRA 4MSWC 1QVGU 3ML0A 4WFFA 2IW5A 3AG4B 3HB3B 3E8GA 2DQ3A 4MVQA 5L3EA 4UVCA 3B8MA 1SRYA 4WFAV 3B8NA 3E86A 1Q82W 3K3WA 1Q7YW 1BHBA 3QO8A 4ZKIA 2WWWA 3T2MA 3TK1A 3X2QB 3WG7B 3ABLB 2WLNA 1LNQA 3OMIB 3SPGA 5L3CA 1H2GA 1PKXA 1V55B 1JJ2U 4DO2A 4QPKA 3ASOB 1R3LC 2EJRA 5KUKA 4UXNA 1ORQC 3DGEA 1ZWIC 1H8HG 1JVMA 3OAAG 3CCJV 4H37A 3CP1A 1BHAA 2JEXA 1FS0G 4N23A 2HKOA 2WLLA 1FXKC 2EZPA 3EHBB 2HJFC 2IJHA 3I56V 3IC7A 2QKSA 4JTDB 3CD6V 2H94A 1W0JG 2XASA 2AHZA 2EIMB 3ABKB 2JJ2G 2C2AA 2YEVA 2A0LA 2WLIB 3JD4A 1NKDA 4FK5C 4P9PA 3ZMVA 1I5YA 1PD3A 3STZC 1VQ7V 1K3EA 5DN6G 5CMUA 2Y69B 3VOUA 1YTFD 4MTGA 5KA6A 1OCOC 3OR6C 3CMAV 1JX9A 3QNEA 4E2LA 5B3SB 2X6AA 3ABUA 1I5XA 2WSSG 4PDLA 1F23A 1K92A 1M57C 1N8RW 1AR1B 1PNLA 2WPDG 2R9IA 3SYCA 5IY5C 3G71V 2Y48A 2ITCC 4J9YB 5H6QA 3P30A 5B1AC 3OUSA 5L3FA 3SPCA 4RUFA 3ZCCA 4WFBV 2EIJB 3JCZA 3CCVV 5IYBO 4G28B 1AJQA 1K73W 1V54B 4J9ZB 1Y4MA 4MVRA 1SESA 3NXSA 2DWDC 4CZZA 1WLEA 4RAIA 1AI4A 3R65A 2Q68A 1M56B 1NBMG 2EINC 3HPLC 4RQEA 4JASA 2IJJA 1EFRG 2KB1A 3ZMTA 1QBZA 4LP8A 5FL7G 2A9HA 1K33A 3AEIA 4XBFA 3OR7C 2QE7G 3FB7C 3CPWU 3GB7C 1NH2D 3FB5C 5KUMA 2EIKC 3JD1A 4G27B 3GWOA 3FYIB 2X7RB 3SPIA 1NR1A 4MVUA 5CBGA 3ZRWB 1JQ0A 2A79B 1AJNA 2V1DA 3RBZA 3LNMB 1XL6A 3K06A 4UVBA 4ASUG 3DTUB 3W7UA 1K7DA 2QEXV 2W6JG 2OT5A 1F4NA 1AI7A 1Y66A 3FKSG 1K97A 3F7VC 4WFGA 1VQMV 3B77A 1FXHA 2ZR3A 4X88A 3AG2C 4X8AA 3OEEG 2WAMA 4YXWG 3LDEA 5B1NA 3K9AA 5CBHA 3ETEA 2XAGA 3F7YC 1GM7A 3ZRXA 3E89A 4MVMA 1GM9A 1HWYA 3K0GA 2DYRB 1K8AW 2MK3A 4G2KA 4UVAA 2W0FC 4WCEV 1ENVA 4P9OA 4GX0A 4RO2A 1NH2B 3CC2V 1OCZB 1FFTB 4BIUA 5LHIA 5B1BB 1OHHG 2BOCC 1FXKB 3MD0A 4MT8A 2QTOA 4XDLA 2YSUB 3TETA 2OCCC 2HVKC 4PELA 2Q69A 4MVSA 1VQ6V 1R3KC 1YJNV 1MG1A 1YITV 1UJWB 3SJQC 4PDMA 2WLJA 2F43G 2DW4A 3F5WC 3JD2A 5H6RA 5LGTA 1H38A 1H8EG 2HR3A 4HAMA 4JTCB 3SPJA 1P7BA 3STLC 4GCZA 3CCMV 1AJPA 4P2ZA 2D3OW 4Z1MG 4JTAB 4U7NA 1NR7A 2NLJC 1K4DC 2JK5C 1YJWV 4GT1A 2ZD9A 3VBBA 3CMEV 3OMNB 5B1OA 1CP9A 3K08A 1K9MW 4PDRA 1KC8W 2Q67A 4PA6A 1M90W 1P4RA 3CCEV 5IY5B 3ABMC 3LSSA 1AI6A 3OEHG 5IYDO 1OCRC 3WFVA 5EC1C 5H9CA 5B1AB 2EBOA 3LDCA 2YEVB 4UV9A 3ZN1A 3SYPA 3ZJZA 5EK0A 2EILC 3AG3C 3K0DA 4MW8A 5DM6V 3ETGA 2IJKA 4WF9V 5EC2C 4GX5A 5LBQA 1AI5A 3M99B 4RUEA 4CBCA 2EINB 4MVZA 4XDKA 5LGNA 1VQKV 5J9PC 2UXNA 4TT3G 1KD1W 2WLIA 4MTOA 3MHSC 4WFEA 1G8MA 2PI4A 2EIKB 4L87A 3P32A 3W7XA 3CCLV 3ASOC 1DF5A 3JYCA 3OGCC 2DYSB 4R7CA 2JIZG 1KECA 3AG1B 1NVPD 3H01A 1S3JA 3E8HA 4BAYA 1PNKA 1RPOA 4MVOA 1KP2A 1VQPV 4JF3A 3AG2B 1DTOA 4MTXA 1XL4A 5BZBA 4XDJA 2EIMC 1VQ9V 1YTFB 4LCUC 3E8BA 4FPPA 3RW0A 2X6BA 1RM1B 3ETDA 3ZMUA 1K4CC 1QVFU 1COWG 3ZRVA 2IU3A 3ASNC 3OUFA 2BOBC 4JYBA 1VQOV 1E1RG 4QPJA 1GTOA 3OW2U 5KA5A 1YSCA 2GHYA 4JAVA 3T4DA 2JJ1G 4HYOA 2XAFA 2GSMB 4I9WA 2Z3YA 3FYEB 2OCCB 3OFNG 4JAUA 1EBOA 4OXSA 4QIWF 4UUJC 3ZRWA 3BEHA 3SYQA 5HFMA 5EBLC 1GK9A 2K1EA 1RPRA 3SYOA 1W2BU 2JDIG 1OCCC 3IGAC 4KUMA 3G6EV 3CCSV 5C93A 1W0KG 4TWKA 1MOFA 1MSWD 1IXMA 3ZMSA 3E35A 1OZ0A 2B1GA 4FJCC 4UV8A 4LC1A 4JPRA 2HG5C 1QR8A 4RQFA 2P7TC 3D3IA 2FTKA 2R9RB 2XNDG 2P67A 3CYOA 1BL8A 1VQLV 3MHHC 1S72V 1B6QA 5GW7A 3ZMZA 2P90A 5EBWC 3CCRV 1F4MA 1ROPA 4N21A 3ABMB 5CA3A 3RVZA 5IDJA 2B1IA 1QLEC 1F51A 1OCRB 4MS2A 1L1FA 5E1AC 5L3BA 4FIPC 2OTJV 2WLHA 1E79G 1QR9A 3A0RA 3EFFK 4R50A 4TSFG 2EILB 1FXKA 1CPYA 3AG3B 1OCOB 4HZ3A 3FB6C 2ZXWC 5L3GA 1QCEA 2WLKA 4GX2A 3D36A 1NQTA 4LBEC 4JYCA 3UM7A 1YIJV 1PL0A 2WLLB 1M57B 1YJ9V 3UKMA 1YI2V 1DF4A 1CEZA 3BY6A 4MW3A 4QJFB 5LHHA 1GM8A 2IJIA 2DYRC 3OM3B 4BW5A 1Q86W 2JEUA 3W7WA 2B5UA 2EZOA 4H33A 3E2EA 1TUEB 1M1KW 4U7OA 1GMGA 1R3IC 3AG4C 1M9NA 1OCZC 1K5QA 2ZQMA 5LGUA 5B1BC 3LSQA 2XAHA 2IH1C 4PA3A 1R3JC 2M7WA 3JD3A 1J95A 2NNUA 2UXXA 1YHQV 1VQ8V 1R73A 3E83A 1BMFG 2DQ0A 1KKDA 4PA7A 4MTFA 2IH3C 3X2QC 3WG7C 1SZTA 3ABLC 4EKWA 2LFSA 2ZDIA 4GX1A 1V55C 1QLNA 3ASNB 4P30A 3JD0A 1G4YB 1NJIW 3RVYA 2IU0A 1SERA 2HVJC 1JOYA 2DWEC 3IFXA 2ITDC 2Q6AA 2QM8A 4KP4A 3SPHA 1KQSU 1S5HC 2X0LA 3G4SV 2HFEC 4QNHB 2V7QG 1VQ5V 3SYAA 1E1QG 4I5SA 3CCUV 3OMAB 2X6CA 4PDVA 3ABKC 1S77D 4PA9A 1R6NA 5LHGA 3PJSK 2WLMA 3QO7A 1OCCB 3K79A 3K04A 1R6KA 4DXWA 4ZBMA 3LDDA 2H8PC 2Y69C 2ZDIC 3OE7G 3T4ZA 3W7SA 4Q20A 1JCHA 2CK3G 3ABTA 1KP3A 3T1CA 2XAJA 3QO5A 5B3SC 1VQNV 1FXVA 1MABG 2W6IG 3CC7V 2HLDG 2ATKC 1SETA 4QE9A 5L3DA 2PI5A 4JGSA 1QLEB 1Q81W 2ZR2A 4PA4A 3ZIAG 1NVPB 1VQ4V 3K03A 3TCUA 2DYSC 2EIJC 3E8FA 1PNMA 1THZA 4X89A 5CBFA 4F4LA 1V54C 3AG1C 2QM7A 4R8CA 3LUTB 1GKFA 3CCQV 4QE7A 1EZJA 2LP7A 3I55V 2ZXWB 5EBMC 2XOKG 4KFMA 1M56C 3CXCU 4FMTA 2Z5UA 2AHYA 5HFLA 1AROP 2P6JA 1K34A 1RM1C 3FB8C 2OTLV 3CC4V 1DLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT V;  1Q81 W;  1VQ4 V;  1W2B U;  1QVF U;  3CCL V;  3G6E V;  3CCS V;  1JJ2 U;  4WFB V;  2OTJ V;  1VQ7 V;  3CCV V;  1VQO V;  1Q86 W;  1K8A W;  3CD6 V;  1NJI W;  2QA4 V;  2QEX V;  3CCJ V;  3OW2 U;  1K73 W;  1M1K W;  3CCM V;  4WCE V;  1QVG U;  3CMA V;  2D3O W;  5DM6 V;  4WF9 V;  3CC2 V;  3CCQ V;  1KQS U;  1VQM V;  3I55 V;  3G4S V;  1YJW V;  1VQN V;  3CME V;  4WFA V;  3CXC U;  1VQP V;  1VQL V;  1S72 V;  1YIJ V;  3I56 V;  1YHQ V;  1Q82 W;  1VQ5 V;  1K9M W;  1VQ8 V;  1R73 A;  1N8R W;  1Q7Y W;  3CC7 V;  1KC8 W;  3CCR V;  1VQK V;  1M90 W;  3CPW U;  3CCU V;  1KD1 W;  3CCE V;  1YI2 V;  1YJ9 V;  1VQ9 V;  1VQ6 V;  1YJN V;  3G71 V;  2OTL V;  3CC4 V; 
#chains in the Genus database with same CATH topology
 1K5S A;  2ODM A;  5D5P A;  2VQE O;  2F93 B;  5IYC O;  2B9Z A;  3BFR A;  3ZRS A;  1BQ0 A;  1GO3 F;  1ZSP A;  2ZKO A;  4WFF A;  4OGQ B;  2DQ3 A;  3TJT A;  4MVQ A;  4J7K A;  5L3E A;  4IHJ B;  3B8M A;  3B8N A;  1Q82 W;  3K3W A;  1BHB A;  3DXR B;  4AI8 A;  1TUB B;  2ZIO A;  1FAF A;  1GN3 A;  1B06 A;  2WLN A;  2NR5 A;  5L3C A;  1XI1 A;  3DGE A;  1JVM A;  3CCJ V;  3CP1 A;  3JAK B;  4U3F H;  1BHA A;  4U3J B;  1US6 A;  4FFB B;  1FS0 G;  5JJN B;  1VAR A;  3CD6 V;  2H94 A;  1W0J G;  2ZM6 B;  3CRQ A;  1OJH A;  3ABK B;  5LOV A;  2Q7E A;  2C2A A;  1HNW B;  4I50 A;  3Q4H B;  5KHH A;  3EVK A;  1XOU A;  1VQ7 V;  5DN6 G;  5CMU A;  2Y69 B;  4MTG A;  4DUY B;  3CMA V;  5J2T B;  1JX9 A;  3QNE A;  4PDL A;  1D5A A;  1F23 A;  3E22 A;  5LA6 A;  3HKC A;  2Y4T A;  4J9Y B;  5H6Q A;  1M4U A;  1TGO A;  5JJE B;  4RUF A;  3ZCC A;  2EIJ B;  3JCZ A;  3K9S A;  1AJQ A;  1SS3 A;  5FPO A;  2GTS A;  1WLE A;  3JAR A;  4RAI A;  2Q68 A;  3G80 A;  1M56 B;  3JAW A;  3HPL C;  1S5J A;  4RQE A;  4ZOL A;  4LP8 A;  2A9H A;  3OR7 C;  2QE7 G;  1D2D A;  5KUM A;  2EIK C;  3FAV B;  3GWO A;  2ZCE A;  4MVU A;  5CBG A;  1AJN A;  4UCR A;  2F95 B;  2GBO A;  2V4D A;  3DTU B;  4GKJ B;  1Y74 A;  5K1P A;  2W6J G;  4OX9 O;  4FM1 A;  3K5M A;  1AI7 A;  3FKS G;  1NS1 A;  1Q3E A;  1XNQ B;  2CGO A;  3AG2 C;  4J42 A;  4YHH O;  4Q6G A;  1XDC A;  2WAM A;  4NXM O;  1AR4 A;  4IL6 Z;  1Y76 B;  5CBH A;  3ETE A;  3ZRX A;  5F2V O;  4O4L B;  2CH7 B;  2ADQ B;  1H2N A;  4CS3 A;  5D5Q A;  4BIU A;  1IBL O;  3QG5 A;  1UFI A;  2YSU B;  2OCC C;  5KMG B;  2Q69 A;  1R3K C;  1YJN V;  1MG1 A;  5GON A;  4NR1 A;  4DR4 B;  5KHK A;  1G1X B;  5KHG A;  1JFF A;  3JD2 A;  5LGT A;  2HR3 A;  3SPJ A;  1P7B A;  3OD4 A;  3VQV A;  2IBZ H;  3CCM V;  1AJP A;  2D3O W;  2UUC O;  3VBB A;  1AVM A;  3CME V;  2ZIM A;  3OMN B;  2Q67 A;  2UU9 B;  1T5E A;  1P4R A;  3ABM C;  1NT2 B;  4LF9 O;  1HR0 O;  3MDS A;  2EBO A;  4LFC B;  3L71 H;  2YEV B;  3WB1 A;  4UV9 A;  3ZN1 A;  1SA0 A;  5EK0 A;  2EIL C;  3AG3 C;  3CXH F;  4F6R A;  3ETG A;  5LYJ B;  2F23 A;  3M99 B;  2GV9 A;  4XDK A;  4A5U B;  3U11 A;  5LGN A;  3K5L A;  1VQK V;  4JI4 O;  4MTO A;  3M8A A;  4B08 A;  2PI4 A;  2EIK B;  2ZE8 A;  1XEQ A;  3ASO C;  3CRR A;  5EYP A;  1JJO A;  2YXH A;  4DRX B;  2JIZ G;  4YJ2 B;  1KEC A;  4DW0 A;  3E8H A;  4NTY A;  1RPO A;  4X64 B;  3AG2 B;  4CH6 A;  4MTX A;  3CSX A;  4XDJ A;  3S3X A;  3ZHU A;  1S5L Z;  3HKE A;  4X1K A;  2IU3 A;  2RCV A;  3B4S A;  3CB2 A;  3OW2 U;  3UQ8 A;  2RJZ A;  4B3T O;  1WJZ A;  4JI5 B;  1H2S B;  1N34 O;  5IJ0 B;  2GSM B;  2Z3Y A;  1SQQ H;  2OCC B;  4JAU A;  1EM1 A;  3OTF A;  3BEH A;  3SYQ A;  4LR3 A;  2K1E A;  1RPR A;  4I4T B;  3RWR D;  4O4J B;  4DR7 B;  4KUM A;  4EFB A;  2JS3 A;  3UCS C;  1MOF A;  1Z5W A;  1SQB H;  3ZMS A;  1U96 A;  2B1G A;  2L35 A;  4JPR A;  1RFY A;  2VWJ A;  1XQ8 A;  2FTK A;  2R9R B;  2XND G;  1VQL V;  3ZMZ A;  2P90 A;  1F7Y A;  1RP3 B;  1ROP A;  2BE3 A;  3ABM B;  3RVZ A;  5IDJ A;  2CTQ A;  4YY3 O;  2VQF O;  1L1F A;  1N36 B;  5E1A C;  4FLW A;  1PPJ H;  2RMK B;  3EFF K;  4GUN A;  4R50 A;  1MSD A;  2EIL B;  1FXK A;  1CPY A;  3AG3 B;  3RYI A;  5L3G A;  1N33 O;  1WN7 A;  3D36 A;  1TUB A;  2UXD B;  1YIJ V;  3N27 A;  2PGG A;  1BE3 H;  1DF4 A;  1V9P A;  5LHH A;  4I55 A;  3F5T A;  2IJI A;  5LMU O;  5LMN B;  3OM3 B;  2JEU A;  3W7W A;  2EZO A;  4I50 B;  1HNX O;  4CH5 A;  4U7O A;  1I94 B;  1GMG A;  5LGU A;  2DOS A;  2LW7 A;  3BAA A;  2UXC B;  3KCY A;  1VQ8 V;  1R73 A;  4AQY O;  4DV2 O;  2DQ0 A;  1IX9 A;  1Z2G A;  4FZ1 A;  5KHI A;  3R66 A;  3A0H Z;  3E22 B;  3ABL C;  2N04 A;  5LA6 B;  1G4Y B;  2AZ2 A;  4NKG B;  4B3M O;  4I0X B;  4KXR A;  2DWE C;  1YVW A;  1S5H C;  3G4S V;  2QWN B;  3H1I H;  1WP8 A;  1XIL A;  1XMQ O;  3JAR B;  4I5S A;  3JAW B;  2L6L A;  2E3C A;  4ZOL B;  4O4I A;  3PJS K;  5JJJ B;  4LFB B;  1R6K A;  2H8P C;  3W7S A;  2Q0A A;  4HNA A;  4UFZ A;  3ABT A;  4DR6 O;  1Y74 B;  1FXV A;  4JZG A;  3FAV A;  2HLD G;  4KL1 A;  1XNR O;  4DUZ B;  4FZ0 A;  4X1Y A;  1DGS A;  3TCU A;  1THZ A;  5CBF A;  3H1L H;  2AGA A;  1V54 C;  2Q7H A;  3LUT B;  4DR3 O;  1GKF A;  3HKB B;  3I55 V;  3CXC U;  4FMT A;  2AHY A;  1Y76 A;  2P6J A;  1K34 A;  3T1Y B;  1RM1 C;  3FB8 C;  3CHX A;  2ETN A;  4FM2 A;  3U10 A;  1EZV H;  3ZHT A;  1FD9 A;  2YI8 A;  3ZN0 A;  1JFF B;  3ML0 A;  5LXT B;  5J2U B;  4IYI A;  3FX7 A;  5JH7 A;  4UVC A;  4B3R O;  4BIO A;  2H3O A;  3ABL B;  4DV1 B;  4QPK A;  1R3L C;  4JI2 B;  1H2M A;  4NXN B;  4FLT A;  1ZWI C;  4ZHQ A;  4H37 A;  1BSM A;  2JEX A;  4B3S B;  2WLL A;  1SA0 B;  4E4E A;  1FXK C;  1GRJ A;  2UUA O;  1B04 A;  4F6R B;  3IC7 A;  1J5E O;  1P7G A;  2XAS A;  2JJ2 G;  1KUQ A;  5DED A;  2YEV A;  2CE4 A;  3J81 N;  3JD4 A;  3ZMV A;  3ZBH A;  5A9G A;  5JQG A;  1PD3 A;  4K35 A;  4GKK B;  3VOU A;  1OCO C;  5EYP B;  2OWO A;  2X6A A;  3ABU A;  3H1J H;  1M57 C;  1N8R W;  4TQD A;  4JI7 O;  1HNW O;  2ITC C;  4KHP O;  3P30 A;  4C7U A;  2R72 A;  2LGW A;  1N4C A;  2VRZ A;  4IGG A;  4WFB V;  3HKE B;  3JAT A;  2OCH A;  4G28 B;  1V54 B;  4H0L B;  4J10 A;  4CZZ A;  4L8J A;  3R65 A;  3S3W A;  5LP6 C;  4TUY A;  2UUB B;  3AEI A;  1K33 A;  2WA4 A;  4DW1 A;  4LFA B;  1NTZ H;  1NR1 A;  4FM0 A;  3RBZ A;  3LNM B;  4ASU G;  1YXB A;  4JZ2 A;  1R6T A;  5GTI Z;  3N2G A;  1F4N A;  1JR9 A;  3L75 H;  4JI6 B;  1VQM V;  4D7T A;  1KBH A;  3LSU A;  1FJG B;  4X8A A;  4LF7 O;  1A32 A;  4LF6 B;  4O4J A;  2O57 A;  4X9Q A;  4YXW G;  5B1N A;  5KAF Z;  2LW1 A;  5GTH Z;  2XAG A;  3F7Y C;  2DMX A;  2G38 A;  3E89 A;  4MVM A;  1GM9 A;  3DC6 A;  3EXA A;  3K0G A;  2DYR B;  4LWS B;  1N0J A;  2W0F C;  4K0K B;  4GX0 A;  3CC2 V;  1OCZ B;  1FFT B;  2HJD A;  2PUS A;  5B1B B;  4JI8 O;  2BOC C;  1FXK B;  4X62 B;  3MD0 A;  2YIB A;  4MT8 A;  2LGQ A;  3RYI B;  4MVS A;  4LNU A;  3GWK C;  5KX5 A;  1UJW B;  3SJQ C;  2WLJ A;  2F43 G;  2DW4 A;  4NVP A;  3ZHR A;  2K9P A;  2LJ2 A;  4JI3 B;  4I55 B;  1YZB A;  3BVO A;  2QWR B;  4P2Z A;  4Z1M G;  4JTA B;  1YJW V;  2ZD9 A;  2W0X A;  3K08 A;  1KC8 W;  4PA6 A;  4O2B A;  1M90 W;  4DR4 O;  3LSS A;  1AIL A;  4LF4 B;  2OIE A;  4DV5 B;  4DR1 B;  4X20 A;  2MW2 B;  2E5L O;  3SJC C;  3BAB A;  3ZJZ A;  3K0D A;  4WF9 V;  5EC2 C;  2ZIN A;  3QTC A;  4CBC A;  4JAA A;  2R9A A;  2UXN A;  4TT3 G;  1KD1 W;  2WLI A;  3MHS C;  3W7X A;  3DSQ A;  2QDO A;  3CCL V;  1DF5 A;  3JYC A;  3OGC C;  4I0X A;  1Q5O A;  1IBK B;  5JVD A;  4O4I B;  2YXY A;  3GVM A;  1TAE A;  3IC9 A;  4ZIB A;  3AG1 B;  2ILM A;  3H01 A;  3OTO O;  4JYA B;  2LQT A;  2HEP A;  4HNA B;  1RSO A;  1DTO A;  5KHJ A;  2EIM C;  1TVK A;  4LCU C;  4TQF A;  4FPP A;  2X6B A;  1K4C C;  4GLX A;  4X65 O;  1H2L A;  1COW G;  5BR8 B;  4X1Y B;  1VQO V;  1E1R G;  2YIB D;  4LH6 A;  1GTO A;  3WB2 A;  2GHY A;  5EIB C;  4FVM A;  4X64 O;  1ZLZ A;  3OGI B;  2JJ1 G;  3ZX6 A;  3WU2 Z;  4I9W A;  2YS8 A;  3VQY A;  3OFN G;  4UUJ C;  4JI0 B;  3ZRW A;  1GK9 A;  5CA1 A;  1W2B U;  5IYZ A;  4JI1 B;  3G6E V;  3CCS V;  2VQE B;  3HKB A;  3K58 A;  1MSW D;  1IXM A;  3E35 A;  1OZ0 A;  1OV9 A;  4FFK A;  4DV7 B;  4O2A A;  4RQF A;  4CC5 A;  2P67 A;  1S72 V;  1BL8 A;  1B6Q A;  4DV3 O;  5JH7 B;  4GYC B;  1F4M A;  1YEW A;  4N21 A;  1QLE C;  4J41 A;  4B7K A;  4MS2 A;  1IDS A;  2RQ6 A;  2CAZ C;  1HP8 A;  4RWU A;  1QR9 A;  2YI9 A;  1VF7 A;  5LXT A;  5J2U A;  2PZS A;  4JYY A;  4PJ0 Z;  4HZ3 A;  1B3Q A;  5E79 Z;  4ZHQ B;  2QWO B;  1WB8 A;  4JYC A;  1JMK C;  2WLL B;  4X66 O;  1YJ9 V;  1CEZ A;  1N36 O;  3BY6 A;  4MW3 A;  4B7E A;  4DV0 O;  1Q86 W;  2HHH B;  1ZX3 A;  1PL4 A;  3APQ A;  3AG4 C;  1M9N A;  2P4K A;  4D6T H;  1CXZ B;  5JQG B;  2IH1 C;  3JD3 A;  3KCX A;  1J95 A;  4FLX A;  4DV4 O;  2CUG A;  1KU9 A;  1BMF G;  1PV0 A;  4PA7 A;  4UB8 Z;  5LMN O;  5IWA B;  2LFS A;  2Q4P A;  5BMV B;  4GX1 A;  1QLN A;  3N2K A;  2GTA A;  2Q6A A;  1BZK A;  2KSD A;  1KQS U;  3JAT B;  4QNH B;  2V7Q G;  1NU1 H;  3OT7 A;  3UO2 A;  2PY5 A;  3SYA A;  3A2F A;  3CCU V;  3C90 A;  4PA9 A;  4TUY B;  4GZR B;  5LHG A;  1AP6 A;  3QO7 A;  3LDD A;  1JCH A;  2AZ0 A;  4OX9 B;  3T1C A;  2XAJ A;  3QO5 A;  2ARH A;  1VQN V;  2Q8V A;  1LUW A;  2Y0I A;  3N2G B;  2QSA A;  1SF9 A;  2W6I G;  3CC7 V;  4QE9 A;  4YHH B;  1SQF A;  1QLE B;  4NXM B;  4PA4 A;  2DYS C;  1PNM A;  1XBL A;  3O65 A;  3D8C A;  1L8D A;  2QM7 A;  2ZE5 A;  2BCC H;  5IE9 A;  1IBL B;  1N32 O;  5HFL A;  2FKX A;  2Q7G A;  3AK2 A;  2ZE6 A;  1DLB A;  4IT5 A;  2QKC A;  1WNS A;  4LWS A;  4LNU B;  1S0V A;  2XAQ A;  4LF5 O;  5KX5 B;  2QA4 V;  2LFR A;  1QVG U;  1O9H A;  2IW5 A;  3AG4 B;  1Y67 A;  4TV8 A;  1SQV H;  3HR0 A;  3CRM A;  2UUC B;  4NTX A;  3E86 A;  4ICG A;  4DR5 O;  3BRC A;  1AR5 A;  3QO8 A;  3APO A;  3TK1 A;  4BWA A;  4O2B B;  4IIJ A;  4PHZ A;  1H2G A;  1PKX A;  1HR0 B;  3ASO B;  4O4H A;  3P3N A;  2EJR A;  5KUK A;  4DYL A;  1ORQ C;  4X20 B;  4N23 A;  3J7A U;  2HKO A;  1QQC A;  4CS4 A;  3EHB B;  2JS5 A;  2HJF C;  2IJH A;  1R1B A;  5FNV A;  3I56 V;  2QWQ B;  4QGP A;  4DV1 O;  2AHZ A;  4JI4 B;  2ADP A;  2A0L A;  2WLI B;  4NXN O;  1NKD A;  4P9P A;  3RN4 A;  1I5Y A;  1YTF D;  4JV5 O;  4BR6 A;  2EUL A;  1XMO B;  2QWP B;  5LP6 A;  5JVD B;  2FL4 A;  4E2L A;  4I7Z B;  1I5X A;  2ZT9 B;  2WSS G;  1Q90 D;  1PNL A;  2WPD G;  2R9I A;  5IY5 C;  1SQP H;  1RSO B;  2Y48 A;  4UB6 Z;  4FLV A;  2N05 A;  5B1A C;  1TVK B;  3AK3 A;  5A2Q N;  5IYB O;  1K73 W;  4MVR A;  4UCT A;  3NXS A;  1M93 A;  2DWD C;  2BTQ B;  3JAS A;  1AI4 A;  1FKA O;  4B3T B;  1NBM G;  2EIN C;  4DV6 O;  4JAS A;  2IJJ A;  1EFR G;  4DR2 O;  3JAL A;  1ZAU A;  1QBZ A;  3K5O A;  2QR4 A;  1N34 B;  5C8Y A;  5FL7 G;  1KKC A;  4XBF A;  3FB7 C;  3CPW U;  3GB7 C;  2VWK A;  4PV1 B;  3JD1 A;  4OPA A;  4AIL C;  2XT9 A;  3FYI B;  3ZRW B;  2A79 B;  3T1H O;  3K06 A;  5CA1 B;  4UVB A;  2F4V O;  3W7U A;  1K7D A;  5IYZ B;  1XRE A;  1KYO F;  4LF8 O;  3RYC B;  1K97 A;  3B77 A;  4X88 A;  3OEE G;  4O2A B;  4K8X A;  1IUR A;  1G6U A;  1HNZ O;  3K9A A;  1FPO A;  1IZ3 A;  2JGD B;  3NR7 A;  4Z1V A;  2VQF B;  2Q0O C;  1HWY A;  1K8A W;  4G2K A;  3RT3 C;  1GAX A;  4WCE V;  1ENV A;  4P9O A;  1NH2 B;  1IBM B;  5LHI A;  1OHH G;  4UCU A;  4LF6 O;  1URF A;  4XDL A;  3CRC A;  2UXB O;  1N33 B;  2CTR A;  2HVK C;  3HKD B;  1EN6 A;  1QU7 A;  3G67 A;  3SJA C;  2VS0 A;  1WPB A;  5BXZ A;  4YIP A;  1YIT V;  1W59 A;  1PM9 A;  2DJV A;  5H6R A;  1H8E G;  3CJH A;  4JTC B;  4LH7 A;  4J11 A;  4U7N A;  2NLJ C;  2QGN A;  2JK5 C;  5H2F Z;  4GT1 A;  5ITZ A;  1GN4 A;  5B1O A;  2KG7 B;  4PDR A;  2OYQ A;  2CGN A;  1I0H A;  2Y4U A;  3M7M X;  5IY5 B;  4AQY B;  3OEH G;  5IYD O;  1OCR C;  1GN2 A;  3WFV A;  5B1A B;  4JI3 O;  3LDC A;  2ZE7 A;  1XHZ A;  2P22 C;  2QM4 A;  5DM6 V;  2IJK A;  3N2K B;  3CE2 A;  4H44 B;  1AI5 A;  2A3Q A;  4RUE A;  2EIN B;  4MVZ A;  3H1K H;  2ZM6 O;  1XMQ B;  5J9P C;  4H13 B;  5BMV A;  4DR1 O;  4L87 A;  2P5O A;  5CA0 A;  3P32 A;  4DUY O;  3L73 H;  1NVP D;  1P49 A;  2RNB A;  1Q6U A;  1M5I A;  1S3J A;  4BAY A;  1PNK A;  4DR6 B;  1KP2 A;  4JF3 A;  1N0N A;  3CX5 F;  3L74 H;  1VQ9 V;  1YTF B;  3RW0 A;  1RM1 B;  1WP7 A;  1XNR B;  1ZTE A;  3ETD A;  1IBK O;  4NYK A;  3ASN C;  4TV9 A;  1IXB A;  4JYB A;  4JAV A;  3ZS8 C;  4DR3 B;  4ZI7 A;  2XAF A;  1L0N H;  1VEW A;  2BSK A;  5HFM A;  1EN4 A;  3SGI A;  5BR8 O;  3KKY A;  2PYJ A;  3IGA C;  1MNG A;  4GKJ O;  2RDC A;  5C93 A;  1W0K G;  1I7F A;  2KQX A;  1XNQ O;  3UO3 A;  4FJC C;  1PP9 H;  2HG5 C;  1QR8 A;  3RYF A;  2P7T C;  3D3I A;  2FB5 A;  3MHH C;  4TV8 B;  5GW7 A;  1XHX A;  4JI1 O;  4CH4 A;  2B1I A;  4B3R B;  1F51 A;  1OCR B;  3BA8 A;  5L3B A;  4FIP C;  2OTJ V;  3SJB C;  1O9G A;  1E79 G;  2FML A;  3A0R A;  2YIA A;  4IIJ B;  3RYH A;  2Z0A A;  4TSF G;  4DV7 O;  3TXQ A;  1OCO B;  4O4H B;  1HW7 A;  3C3S A;  2UUA B;  4FLZ A;  1M57 B;  3UKM A;  1J5E B;  5EIB D;  5FNV B;  3RGB A;  4J7J A;  2P4V A;  4J7Z A;  1VF5 B;  4BW5 A;  2B5U A;  4H33 A;  3E2E A;  1TUE B;  1M1K W;  1R3I C;  1K5Q A;  2ZQM A;  3P3P A;  3LSQ A;  2XAH A;  4PA3 A;  5EZY B;  3IJ4 A;  2M7W A;  2NNU A;  1AP5 A;  2UU9 O;  3WB0 A;  5LP6 B;  1YHQ V;  3CRA A;  3E83 A;  1KKD A;  2IH3 C;  3X2Q C;  3WG7 C;  4JI7 B;  4LFC O;  1V55 C;  2HHH O;  4KHP B;  1TA8 A;  3ASN B;  3JD0 A;  4YJ3 A;  2IU0 A;  1UPG A;  3JSL A;  3CWB H;  4KP4 A;  3SPH A;  2ITD C;  2X0L A;  2HFE C;  3B40 A;  2YC0 A;  1VQ5 V;  1FYJ A;  3JAS B;  2IM9 A;  3FD9 A;  3OMA B;  5IWA O;  2Y0P A;  2D2C B;  1NTK H;  3VQX A;  3JAL B;  1R6N A;  2BTO A;  2AW9 A;  5C8Y B;  4Z2W A;  3K04 A;  2YIC A;  1FFX A;  2ZDI C;  2BTQ A;  3OE7 G;  3T4Z A;  1VP7 A;  3K5N A;  4Q20 A;  3SR2 C;  1KP3 A;  3UT5 A;  5TIS Z;  2AXT Z;  2FYU H;  2ZNJ A;  5B3S C;  2OIG A;  1MAB G;  1YCI A;  1YDX A;  4LF7 B;  2PI5 A;  3K57 A;  1X59 A;  1NVP B;  3ZIA G;  1VQ4 V;  2KKW A;  3C3T A;  3E8F A;  3BCC H;  3RYC A;  4F4L A;  4JI5 O;  4I9Q A;  3CCQ V;  4UCV A;  1GN6 A;  1EZJ A;  2LP7 A;  2GDS A;  5EBM C;  5FLX N;  1L0L H;  4JI8 B;  2Z5U A;  2EX3 A;  4UCO A;  2JGD A;  3CC4 V;  4FLU A;  4DR7 O;  4BIZ A;  4R6Z A;  4J80 A;  5JCO C;  3KG2 A;  1JPX A;  4X1I A;  1WAZ A;  1WPX A;  1S76 D;  4WFH A;  3PN1 A;  5CN0 A;  3W7T A;  4MSW C;  2ZNI A;  1BGY H;  3HB3 B;  3E8G A;  2GUZ B;  1Q43 A;  3CJH B;  3IAY A;  4WBN A;  1SRY A;  4WFA V;  3HKD A;  2R70 A;  4F6E A;  1Q7Y W;  4ZKI A;  2WWW A;  3T2M A;  5ITZ B;  3X2Q B;  3WG7 B;  1QNM A;  3OMI B;  1LNQ A;  3SPG A;  1V55 B;  3A0B Z;  3TXS A;  4BW9 A;  4DO2 A;  1JJ2 U;  1EN5 A;  4UXN A;  3OAA G;  1H8H G;  2DE0 X;  2E5L B;  2UXD O;  2KG7 A;  2EZP A;  1IVS A;  2QKS A;  4JTD B;  2EIM B;  2WA3 A;  3BA9 A;  4FK5 C;  1VF6 A;  3STZ C;  4EB6 A;  1K3E A;  1I94 O;  4W4K A;  5CA0 B;  5KA6 A;  3OR6 C;  1ZL8 A;  2QJ1 A;  1VMG A;  2UXC O;  4CH3 A;  3TGU H;  5B3S B;  3OTO B;  2E76 B;  2HP8 A;  1K92 A;  1AR1 B;  1X4T A;  3SYC A;  3G71 V;  4TOI A;  3BHP A;  3JSN A;  1SZX A;  3OUS A;  5L3F A;  3SPC A;  4X65 B;  1XMO O;  3CCV V;  2Q5Z A;  4J9Z B;  1Y4M A;  4TV9 B;  2YDE A;  1SES A;  5IT9 N;  3FFQ A;  4CC6 A;  4NTW A;  2KB1 A;  3ZMT A;  3ETQ A;  4ZI7 B;  1NH2 D;  3FB5 C;  3JCU Z;  4CS2 A;  4LFB O;  4G27 B;  2BSK B;  2X7R B;  3SPI A;  1JQ0 A;  2V1D A;  1XL6 A;  2QEX V;  2OT5 A;  1D5N A;  2RN9 A;  1Y66 A;  3F7V C;  4WFG A;  4IYH A;  3I5D A;  2P06 A;  5KAI Z;  1FXH A;  2ZR3 A;  5B66 Z;  1NTM H;  3DC5 A;  3RYF B;  5BY1 A;  4DUZ O;  4DV3 B;  1P84 F;  3LDE A;  3ZHQ A;  5CB4 A;  1GM7 A;  3A8T A;  5JWP A;  2JRI A;  2MK3 A;  4UVA A;  3K59 A;  4RO2 A;  1NI8 A;  1BQZ A;  3RYH B;  2EJ7 A;  2PF4 E;  3MAQ A;  2QTO A;  5IJ9 A;  1WA8 A;  3T1Y O;  3TET A;  4PEL A;  1MZE A;  1VQ6 V;  1AB3 A;  2F1M A;  4X66 B;  1JA8 A;  1Q8I A;  1Y6X A;  4PDM A;  2YID A;  1QHT A;  3F5W C;  4DK0 A;  4LF9 B;  1H38 A;  4HAM A;  4DV0 B;  1IBM O;  3STL C;  4IHJ A;  4GCZ A;  3LNN A;  1NR7 A;  1K4D C;  3DXR A;  2Q9L A;  2F66 C;  1CP9 A;  3CS5 A;  1K9M W;  3ZED A;  4DV4 B;  1SKV A;  3CCE V;  1AI6 A;  5EC1 C;  5H9C A;  5LOV B;  3JAK A;  4JI2 O;  4U3J A;  4UCS A;  4FFB A;  4EEQ A;  3SYP A;  1WB7 A;  5EZY A;  4B3S O;  1MZF A;  4MW8 A;  4YJ3 B;  3CEI A;  2QKA A;  2DN9 A;  4GX5 A;  5LBQ A;  3O9O A;  5FPR A;  2CTP A;  2JGU A;  4HBN A;  2LO1 A;  4PI0 A;  3Q4H A;  4WFE A;  3J80 N;  1G8M A;  1XUQ A;  5K1X A;  3HKC B;  2YUA A;  5J2T A;  4GKK O;  1SC5 B;  2DYS B;  2XTA A;  3QVN A;  4R7C A;  1VF6 C;  1FFX B;  4K3A A;  4MVO A;  1VQP V;  1Z5V A;  2A7W A;  3UT5 B;  2PYL A;  1XL4 A;  5BZB A;  3E8B A;  2M6Y A;  1Q6I A;  3ZMU A;  1GH6 A;  1VIB A;  1YF2 A;  1QVF U;  3ZRV A;  3OUF A;  3ZHV A;  1BCC H;  2BOB C;  4W4L A;  2CDY A;  1U97 A;  4QPJ A;  5KA5 A;  1YSC A;  2XUM A;  4DK1 A;  3T4D A;  4HYO A;  2UUB O;  2PTM A;  3FYE B;  1EBO A;  1KB9 F;  4OXS A;  4QIW F;  1N32 B;  4ABM A;  4LFA O;  5EBL C;  2N74 A;  3SYO A;  1MA1 A;  2JDI G;  1OCC C;  4YY3 B;  3VQW A;  3SDL A;  4TWK A;  1NZ6 A;  1BT8 A;  4LF5 B;  4PI2 A;  4JI6 O;  4X1I B;  4UV8 A;  4LC1 A;  1I08 A;  2CTW A;  1FJG O;  3CYO A;  1KMI Z;  3U0Z A;  1LR1 A;  4WBN B;  5EBW C;  2A06 H;  3CCR V;  4DR5 B;  5CA3 A;  4O4L A;  2CH7 A;  3ICX A;  5GON B;  2WLH A;  4K0K O;  1BS3 A;  2GUZ A;  5LMU B;  1ZUQ A;  3QF7 A;  1HNX B;  4X62 O;  3FB6 C;  5KMG A;  2ZXW C;  1QCE A;  2WLK A;  2YXL A;  4GX2 A;  1NQT A;  4LBE C;  3UM7 A;  1PL0 A;  1HDJ A;  1YI2 V;  3B09 A;  4DV2 B;  4QJF B;  1SQG A;  1GM8 A;  2E75 B;  2DYR C;  5AG2 A;  4FLY A;  5KLV H;  4JV5 B;  1OCZ C;  4B3M B;  4EB6 B;  5B1B C;  3H9V A;  1R3J C;  1ZL8 B;  3L72 H;  1LUV A;  2UXX A;  1SQX H;  3D36 C;  4YIO A;  1MMM A;  4MTF A;  3D3Q A;  3THO A;  4LF4 O;  1SZT A;  2JVD A;  4EKW A;  4DV5 O;  3RFR A;  2ZDI A;  4P30 A;  1NJI W;  5LYJ A;  3RVY A;  1SER A;  2HVJ C;  1JOY A;  3L70 H;  3IFX A;  2QM8 A;  5DEC A;  4D7S A;  2NN4 A;  4K8Z A;  3B2E E;  1E1Q G;  4DV6 B;  2XHB A;  4DR2 B;  2X6C A;  4PDV A;  3ABK C;  1S77 D;  4DRX A;  2WLM A;  4EFE A;  1OCC B;  3K79 A;  4YJ2 A;  4DXW A;  4ZBM A;  4X1K B;  2Y69 C;  3T1H B;  2F4V B;  4JYA O;  2CK3 G;  3JAM N;  5LL6 Y;  2E74 B;  4PD4 F;  4LF8 B;  3AG7 A;  2ATK C;  1SET A;  5JCO A;  5L3D A;  4JGS A;  5H5N A;  1Q81 W;  2ZR2 A;  1Q6H A;  1HNZ B;  3K03 A;  4OPH A;  2EIJ C;  4AHC A;  5CB4 B;  4X89 A;  3AK1 A;  3ZHS A;  3AG1 C;  1DK1 A;  4R8C A;  5IJ0 A;  3H1H H;  4QE7 A;  2ZXW B;  2XOK G;  4KFM A;  1M56 C;  3KZI Z;  3G6B A;  2Q73 A;  3L9D A;  4I4T A;  1H2K A;  1ARO P;  4NB5 A;  4JI0 O;  2UXB B;  2QTS A;  5B5E Z;  3BPZ A;  2OTL V;  5IJ9 B;  1WA8 B; 
#chains in the Genus database with same CATH homology
 1K5S A;  4BIZ A;  4R6Z A;  3KG2 A;  1JPX A;  5IYC O;  1S0V A;  1WPX A;  2XAQ A;  1S76 D;  4WFH A;  3ZN0 A;  5CN0 A;  3ZRS A;  2QA4 V;  1GO3 F;  3W7T A;  2LFR A;  4MSW C;  1QVG U;  3ML0 A;  4WFF A;  2IW5 A;  3AG4 B;  3HB3 B;  3E8G A;  2DQ3 A;  4MVQ A;  5L3E A;  4UVC A;  3B8M A;  1SRY A;  4WFA V;  3B8N A;  3E86 A;  1Q82 W;  3K3W A;  1Q7Y W;  1BHB A;  3QO8 A;  4ZKI A;  2WWW A;  3T2M A;  3TK1 A;  3X2Q B;  3WG7 B;  3ABL B;  2WLN A;  1LNQ A;  3OMI B;  3SPG A;  5L3C A;  1H2G A;  1PKX A;  1V55 B;  1JJ2 U;  4DO2 A;  4QPK A;  3ASO B;  1R3L C;  2EJR A;  5KUK A;  4UXN A;  1ORQ C;  3DGE A;  1ZWI C;  1H8H G;  1JVM A;  3OAA G;  3CCJ V;  4H37 A;  3CP1 A;  1BHA A;  2JEX A;  1FS0 G;  4N23 A;  2HKO A;  2WLL A;  1FXK C;  2EZP A;  3EHB B;  2HJF C;  2IJH A;  3I56 V;  3IC7 A;  2QKS A;  4JTD B;  3CD6 V;  2H94 A;  1W0J G;  2XAS A;  2AHZ A;  2EIM B;  3ABK B;  2JJ2 G;  2C2A A;  2YEV A;  2A0L A;  2WLI B;  3JD4 A;  1NKD A;  4FK5 C;  4P9P A;  3ZMV A;  1I5Y A;  1PD3 A;  3STZ C;  1VQ7 V;  1K3E A;  5DN6 G;  5CMU A;  2Y69 B;  3VOU A;  1YTF D;  4MTG A;  5KA6 A;  1OCO C;  3OR6 C;  3CMA V;  1JX9 A;  3QNE A;  4E2L A;  5B3S B;  2X6A A;  3ABU A;  1I5X A;  2WSS G;  4PDL A;  1F23 A;  1K92 A;  1M57 C;  1N8R W;  1AR1 B;  1PNL A;  2WPD G;  2R9I A;  3SYC A;  5IY5 C;  3G71 V;  2Y48 A;  2ITC C;  4J9Y B;  5H6Q A;  3P30 A;  5B1A C;  3OUS A;  5L3F A;  3SPC A;  4RUF A;  3ZCC A;  4WFB V;  2EIJ B;  3JCZ A;  3CCV V;  5IYB O;  4G28 B;  1AJQ A;  1K73 W;  1V54 B;  4J9Z B;  1Y4M A;  4MVR A;  1SES A;  3NXS A;  2DWD C;  4CZZ A;  1WLE A;  4RAI A;  1AI4 A;  3R65 A;  2Q68 A;  1M56 B;  1NBM G;  2EIN C;  3HPL C;  4RQE A;  4JAS A;  2IJJ A;  1EFR G;  2KB1 A;  3ZMT A;  1QBZ A;  4LP8 A;  5FL7 G;  2A9H A;  1K33 A;  3AEI A;  4XBF A;  3OR7 C;  2QE7 G;  3FB7 C;  3CPW U;  3GB7 C;  1NH2 D;  3FB5 C;  5KUM A;  2EIK C;  3JD1 A;  4G27 B;  3GWO A;  3FYI B;  2X7R B;  3SPI A;  1NR1 A;  4MVU A;  5CBG A;  3ZRW B;  1JQ0 A;  2A79 B;  1AJN A;  2V1D A;  3RBZ A;  3LNM B;  1XL6 A;  3K06 A;  4UVB A;  4ASU G;  3DTU B;  3W7U A;  1K7D A;  2QEX V;  2W6J G;  2OT5 A;  1F4N A;  1AI7 A;  1Y66 A;  3FKS G;  1K97 A;  3F7V C;  4WFG A;  1VQM V;  3B77 A;  1FXH A;  2ZR3 A;  4X88 A;  3AG2 C;  4X8A A;  3OEE G;  2WAM A;  4YXW G;  3LDE A;  5B1N A;  3K9A A;  5CBH A;  3ETE A;  2XAG A;  3F7Y C;  1GM7 A;  3ZRX A;  3E89 A;  4MVM A;  1GM9 A;  1HWY A;  3K0G A;  2DYR B;  1K8A W;  2MK3 A;  4G2K A;  4UVA A;  2W0F C;  4WCE V;  1ENV A;  4P9O A;  4GX0 A;  4RO2 A;  1NH2 B;  3CC2 V;  1OCZ B;  1FFT B;  4BIU A;  5LHI A;  5B1B B;  1OHH G;  2BOC C;  1FXK B;  3MD0 A;  4MT8 A;  2QTO A;  4XDL A;  2YSU B;  3TET A;  2OCC C;  2HVK C;  4PEL A;  2Q69 A;  4MVS A;  1VQ6 V;  1R3K C;  1YJN V;  1MG1 A;  1YIT V;  1UJW B;  3SJQ C;  4PDM A;  2WLJ A;  2F43 G;  2DW4 A;  3F5W C;  3JD2 A;  5H6R A;  5LGT A;  1H38 A;  1H8E G;  2HR3 A;  4HAM A;  4JTC B;  3SPJ A;  1P7B A;  3STL C;  4GCZ A;  3CCM V;  1AJP A;  4P2Z A;  2D3O W;  4Z1M G;  4JTA B;  4U7N A;  1NR7 A;  2NLJ C;  1K4D C;  2JK5 C;  1YJW V;  4GT1 A;  2ZD9 A;  3VBB A;  3CME V;  3OMN B;  5B1O A;  1CP9 A;  3K08 A;  1K9M W;  4PDR A;  1KC8 W;  2Q67 A;  4PA6 A;  1M90 W;  1P4R A;  3CCE V;  5IY5 B;  3ABM C;  3LSS A;  1AI6 A;  3OEH G;  5IYD O;  1OCR C;  3WFV A;  5EC1 C;  5H9C A;  5B1A B;  2EBO A;  3LDC A;  2YEV B;  4UV9 A;  3ZN1 A;  3SYP A;  3ZJZ A;  5EK0 A;  2EIL C;  3AG3 C;  3K0D A;  4MW8 A;  5DM6 V;  3ETG A;  2IJK A;  4WF9 V;  5EC2 C;  4GX5 A;  5LBQ A;  1AI5 A;  3M99 B;  4RUE A;  4CBC A;  2EIN B;  4MVZ A;  4XDK A;  5LGN A;  1VQK V;  5J9P C;  2UXN A;  4TT3 G;  1KD1 W;  2WLI A;  4MTO A;  3MHS C;  4WFE A;  1G8M A;  2PI4 A;  2EIK B;  4L87 A;  3P32 A;  3W7X A;  3CCL V;  3ASO C;  1DF5 A;  3JYC A;  3OGC C;  2DYS B;  4R7C A;  2JIZ G;  1KEC A;  3AG1 B;  1NVP D;  3H01 A;  1S3J A;  3E8H A;  4BAY A;  1PNK A;  1RPO A;  4MVO A;  1KP2 A;  1VQP V;  4JF3 A;  3AG2 B;  1DTO A;  4MTX A;  1XL4 A;  5BZB A;  4XDJ A;  2EIM C;  1VQ9 V;  1YTF B;  4LCU C;  3E8B A;  4FPP A;  3RW0 A;  2X6B A;  1RM1 B;  3ETD A;  3ZMU A;  1K4C C;  1QVF U;  1COW G;  3ZRV A;  2IU3 A;  3ASN C;  3OUF A;  2BOB C;  4JYB A;  1VQO V;  1E1R G;  4QPJ A;  1GTO A;  3OW2 U;  5KA5 A;  1YSC A;  2GHY A;  4JAV A;  3T4D A;  2JJ1 G;  4HYO A;  2XAF A;  2GSM B;  4I9W A;  2Z3Y A;  3FYE B;  2OCC B;  3OFN G;  4JAU A;  1EBO A;  4OXS A;  4QIW F;  4UUJ C;  3ZRW A;  3BEH A;  3SYQ A;  5HFM A;  5EBL C;  1GK9 A;  2K1E A;  1RPR A;  3SYO A;  1W2B U;  2JDI G;  1OCC C;  3IGA C;  4KUM A;  3G6E V;  3CCS V;  5C93 A;  1W0K G;  4TWK A;  1MOF A;  1MSW D;  1IXM A;  3ZMS A;  3E35 A;  1OZ0 A;  2B1G A;  4FJC C;  4UV8 A;  4LC1 A;  4JPR A;  2HG5 C;  1QR8 A;  4RQF A;  2P7T C;  3D3I A;  2FTK A;  2R9R B;  2XND G;  2P67 A;  3CYO A;  1BL8 A;  1VQL V;  3MHH C;  1S72 V;  1B6Q A;  5GW7 A;  3ZMZ A;  2P90 A;  5EBW C;  3CCR V;  1F4M A;  1ROP A;  4N21 A;  3ABM B;  5CA3 A;  3RVZ A;  5IDJ A;  2B1I A;  1QLE C;  1F51 A;  1OCR B;  4MS2 A;  1L1F A;  5E1A C;  5L3B A;  4FIP C;  2OTJ V;  2WLH A;  1E79 G;  1QR9 A;  3A0R A;  3EFF K;  4R50 A;  4TSF G;  2EIL B;  1FXK A;  1CPY A;  3AG3 B;  1OCO B;  4HZ3 A;  3FB6 C;  2ZXW C;  5L3G A;  1QCE A;  2WLK A;  4GX2 A;  3D36 A;  1NQT A;  4LBE C;  4JYC A;  3UM7 A;  1YIJ V;  1PL0 A;  2WLL B;  1M57 B;  1YJ9 V;  3UKM A;  1YI2 V;  1DF4 A;  1CEZ A;  3BY6 A;  4MW3 A;  4QJF B;  5LHH A;  1GM8 A;  2IJI A;  2DYR C;  3OM3 B;  4BW5 A;  1Q86 W;  2JEU A;  3W7W A;  2B5U A;  2EZO A;  4H33 A;  3E2E A;  1TUE B;  1M1K W;  4U7O A;  1GMG A;  1R3I C;  3AG4 C;  1M9N A;  1OCZ C;  1K5Q A;  2ZQM A;  5LGU A;  5B1B C;  3LSQ A;  2XAH A;  2IH1 C;  4PA3 A;  1R3J C;  2M7W A;  3JD3 A;  1J95 A;  2NNU A;  2UXX A;  1YHQ V;  1VQ8 V;  1R73 A;  3E83 A;  1BMF G;  2DQ0 A;  1KKD A;  4PA7 A;  4MTF A;  2IH3 C;  3X2Q C;  3WG7 C;  1SZT A;  3ABL C;  4EKW A;  2LFS A;  2ZDI A;  4GX1 A;  1V55 C;  1QLN A;  3ASN B;  4P30 A;  3JD0 A;  1G4Y B;  1NJI W;  3RVY A;  2IU0 A;  1SER A;  2HVJ C;  1JOY A;  2DWE C;  3IFX A;  2ITD C;  2Q6A A;  2QM8 A;  4KP4 A;  3SPH A;  1KQS U;  1S5H C;  2X0L A;  3G4S V;  2HFE C;  4QNH B;  2V7Q G;  1VQ5 V;  3SYA A;  1E1Q G;  4I5S A;  3CCU V;  3OMA B;  2X6C A;  4PDV A;  3ABK C;  1S77 D;  4PA9 A;  1R6N A;  5LHG A;  3PJS K;  2WLM A;  3QO7 A;  1OCC B;  3K79 A;  3K04 A;  1R6K A;  4DXW A;  4ZBM A;  3LDD A;  2H8P C;  2Y69 C;  2ZDI C;  3OE7 G;  3T4Z A;  3W7S A;  4Q20 A;  1JCH A;  2CK3 G;  3ABT A;  1KP3 A;  3T1C A;  2XAJ A;  3QO5 A;  5B3S C;  1VQN V;  1FXV A;  1MAB G;  2W6I G;  3CC7 V;  2HLD G;  2ATK C;  1SET A;  4QE9 A;  5L3D A;  2PI5 A;  4JGS A;  1QLE B;  1Q81 W;  2ZR2 A;  4PA4 A;  3ZIA G;  1NVP B;  1VQ4 V;  3K03 A;  3TCU A;  2DYS C;  2EIJ C;  3E8F A;  1PNM A;  1THZ A;  4X89 A;  5CBF A;  4F4L A;  1V54 C;  3AG1 C;  2QM7 A;  4R8C A;  3LUT B;  1GKF A;  3CCQ V;  4QE7 A;  1EZJ A;  2LP7 A;  3I55 V;  2ZXW B;  5EBM C;  2XOK G;  4KFM A;  1M56 C;  3CXC U;  4FMT A;  2Z5U A;  2AHY A;  5HFL A;  1ARO P;  2P6J A;  1K34 A;  1RM1 C;  3FB8 C;  2OTL V;  3CC4 V;  1DLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...