1R73A

Solution structure of tm1492, the l29 ribosomal protein from thermotoga maritima
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MKASELRNYTDEELKNLLEEKKRQLMELRFQLAMGQLKNTSLIKLTKRDIARIKTILRERELGIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR for structural proteomics of Thermotoga maritima: Screening and structure determination
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L29
total genus 23
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r73A00
4WF9V 3CMEV 1S72V 1VQ4V 1VQPV 1Q81W 1Q82W 2OTJV 1VQ9V 4WFBV 1JJ2U 1YJWV 2QA4V 3CMAV 1VQ7V 1YIJV 3CC4V 3CCUV 1Q86W 1N8RW 5DM6V 3CCRV 3CXCU 1W2BU 1M1KW 3CD6V 1NJIW 1YI2V 3CCMV 3CCLV 2QEXV 1VQNV 3G6EV 1VQOV 1KQSU 1KC8W 1K73W 1VQ5V 1YJNV 1QVGU 3CCJV 1VQMV 3I55V 3CC2V 3G71V 3CC7V 1VQ6V 3CCQV 3CCEV 1YHQV 1K9MW 2OTLV 1VQKV 4WCEV 3CPWU 1QVFU 1R73A 3I56V 3CCSV 3CCVV 2D3OW 1YITV 4WFAV 1Q7YW 1M90W 1K8AW 1YJ9V 1VQ8V 3OW2U 3G4SV 1KD1W 1VQLV
chains in the Genus database with same CATH superfamily
1B6QA 4MW8A 1FJGB 4YJ2A 1JVMA 3AG1C 5GTIZ 4RO2A 2YIDA 3FAVB 2F1MA 1GAXA 1Z2GA 1H38A 3CC2V 3LDEA 1S3JA 2Q9LA 4GX2A 3K5MA 1OCCB 4DV0B 1FYJA 1GM8A 3K3WA 1IBMB 4PA4A 3IGAC 3X2QB 3B40A 4FMTA 3ZMSA 4J41A 5IJ9A 4DR6B 3TXQA 1KYOF 1M56B 1G6UA 5LHGA 3O9OA 3JYCA 3ZEDA 1SQVH 2Y0PA 2P6JA 4MVZA 4FFBB 3AK2A 1N36O 2N04A 3LDCA 4BW5A 3B8MA 3P30A 4WF9V 1DK1A 2PI4A 4O4HA 1WA8B 2P4VA 4L87A 1EN6A 4GKKB 2EZOA 4ZKIA 4ZHQB 3JCZA 1OZ0A 4DR2O 2OCHA 3RVZA 3ETQA 1F51A 4W4KA 4K8XA 4KHPB 1NBMG 5LMUB 4LF7O 3THOA 4YY3O 1S5LZ 2ZE8A 3A0BZ 2Q73A 3UO3A 3D36A 1GO3F 4DV4B 4I9QA 3ZBHA 4H13B 5CA0B 5JCOA 1E1RG 3B2EE 2E75B 2Q69A 4HBNA 4R8CA 3N27A 3K04A 3A0HZ 3N2KA 4PHZA 4PDVA 1ROPA 3OGCC 3WB2A 2LGWA 1EFRG 2WLNA 5B5EZ 3VQXA 1DTOA 1K33A 2YSUB 3LNNA 4JI5B 4JYAB 5L3FA 3K9SA 5LHIA 2VQEO 2OTLV 3JALB 1S77D 4X1IB 3FKSG 5FPRA 2XAQA 3R65A 4GT1A 2VRZA 4AQYB 4DK0A 1IXBA 3SPCA 3SPIA 3X2QC 1B06A 2ADPA 1N8RW 4QPJA 1GM7A 4TV9B 1M56C 4L8JA 4LNUA 1JX9A 1PNKA 3AK3A 4AILC 1AR4A 1COWG 4LH7A 3FD9A 1NKDA 1VQMV 4JI4B 2LQTA 2HVKC 1F4MA 2F93B 3CCEV 4H33A 2EILB 4LR3A 3J80N 2JK5C 5H5NA 1AJPA 1SQXH 4J7JA 2YIBD 3G4SV 4LC1A 4DR7O 1FS0G 2WLIB 3SPJA 4WFBV 1B04A 4DR1B 4BIZA 1BSMA 2QKAA 1GKFA 3DC6A 4X8AA 3JASB 3HPLC 1VP7A 1O9GA 5BXZA 4Z2WA 4O4IA 1SQFA 4MVOA 4FLVA 3JD0A 5LP6B 3E35A 1HR0O 1PNMA 2QKSA 1OHHG 2PF4E 2UU9O 1NTKH 1AR1B 4F6RB 2JIZG 5LL6Y 3JAKA 2DYRB 4B3MO 4U3JA 4BIUA 1DF4A 1RSOB 2EJRA 1CXZB 3RYHB 3A2FA 4BR6A 2BSKB 2BOBC 3J7AU 1H8HG 4DV2B 1R6TA 3CX5F 4FM1A 5FPOA 4HZ3A 1DF5A 2ZE6A 3CRCA 3CB2A 2HJFC 3KG2A 2CDYA 3SYPA 1XL6A 4JASA 1WP8A 2EZPA 3TJTA 1SA0B 5C93A 1XHXA 4NTXA 1RP3B 5B1OA 5KHGA 1KC8W 3JARB 4RWUA 4LH6A 4JTCB 2AGAA 1HP8A 3TK1A 3OUSA 1YF2A 2XTAA 3D36C 5KA5A 4QNHB 2BTQA 4NTYA 4EEQA 5B3SC 3OMIB 2IBZH 1V54C 5FLXN 4DV7B 1PKXA 3VQWA 2R9RB 3RYCB 3FYEB 4FLXA 4LWSB 4PI2A 3ZRSA 4CH4A 4OX9O 3W7UA 3AG2B 4MT8A 3F5WC 5FL7G 3RYCA 1JQ0A 1HNZO 4YJ2B 3KCYA 3T4DA 4WBNA 3G6BA 4XDJA 4D6TH 2JJ2G 3CCQV 2UXCB 1N4CA 1R6NA 2IJIA 4EKWA 5L3CA 1ZWIC 4NKGB 1QU7A 1NTZH 5LYJA 4DUYB 1N36B 2O57A 3ZN0A 5IYCO 5FNVB 4I50A 2JEUA 5B1AC 3G71V 1SF9A 1IBKB 1I08A 1NQTA 2M7WA 4B3RB 4LP8A 5GW7A 1NTMH 1CPYA 5GONA 4B08A 2PYJA 3SYOA 2F4VO 4DR2B 3QG5A 2GHYA 5K1PA 1OCZC 1S76D 4I0XB 4YY3B 1JOYA 3E22A 3LNMB 2GSMB 2B9ZA 4LCUC 2HP8A 1US6A 3KKYA 1R3IC 4RQEA 1W0JG 3C3TA 5L3GA 2QTOA 1D2DA 5LXTB 1MSWD 1GMGA 2C2AA 4LF9B 2MW2B 3U11A 1ENVA 2DWDC 5KX5B 2ZNJA 4ABMA 3S3WA 5B3SB 4WBNB 1YCIA 1BL8A 1HDJA 3EVKA 5DEDA 2XUMA 5CBFA 2LFRA 2UXDO 3MHHC 1AR5A 5KHKA 2Q0OC 1Y74A 3K9AA 3F5TA 1DGSA 3SYQA 4X20B 4OPHA 4IHJB 3BCCH 2ZIOA 2BE3A 2JDIG 1XNRO 2RDCA 4ASUG 3APQA 3H1IH 1BT8A 2HJDA 1AI4A 2V4DA 4JI3O 1W0KG 2AHYA 1QCEA 4GKKO 5LYJB 4JAUA 3K79A 2X6BA 3ZHSA 5LMUO 4LF7B 1Q6UA 2ZXWB 2ZIMA 5DECA 4K0KO 3E83A 2E76B 1XNQO 1M90W 1IX9A 1EM1A 4CS3A 1SQGA 2EINB 2W6IG 3VQVA 4BAYA 3CMAV 2XAJA 5F2VO 3QVNA 4I7ZB 4WFFA 5EZYA 4G28B 2IJHA 1HR0B 3IAYA 2EJ7A 5B66Z 2GTSA 4XDLA 3F7YC 1FPOA 1M57B 4J9ZB 4WFAV 1DLBA 5EBLC 4YJ3B 2ZE7A 3ICXA 1P84F 4RAIA 3ZHQA 5AG2A 4DW1A 4DRXA 3K08A 2PUSA 2UUCO 4PJ0Z 1VF6C 3OFNG 3AEIA 2OCCC 5L3DA 4U3JB 1JCHA 4MTGA 4CZZA 1K5QA 1XDCA 4F6RA 2JVDA 1P49A 4DV5B 3SR2C 3JSLA 2ARHA 3BY6A 2Q5ZA 1GN2A 4LF8O 4JPRA 4DR7B 2FL4A 1ZL8B 3ZN1A 3A0RA 3QO8A 1YIJV 3ABMB 3T1HO 2Y48A 1MA1A 3AK1A 5GTHZ 4LFBO 3EXAA 1BZKA 1XI1A 1O9HA 1BE3H 2ZKOA 1TA8A 3AG1B 4FFBA 4KUMA 3FYIB 4FIPC 4I55B 2L35A 2CAZC 3JAWA 1M9NA 3CXHF 3MDSA 5H2FZ 3QO7A 2UXBO 1A32A 3JAWB 2P06A 4EFEA 3QNEA 4NVPA 3BA8A 4OGQB 4JAAA 5H6QA 1BS3A 4FFKA 1MZEA 1BGYH 1JR9A 3CRRA 2IH1C 4C7UA 5CA1B 1URFA 2CTPA 4O4JA 5D5PA 3L9DA 3OTOO 2FMLA 4DO2A 2XASA 3EHBB 3JASA 2PZSA 1JPXA 1ZAUA 4LF6O 1THZA 1BQZA 4CH3A 2UXNA 5B1AB 1YHQV 2LW7A 5KMGA 3DXRA 2EBOA 2OT5A 4TUYB 4JI2B 2EIJB 1WNSA 3ZRXA 2ILMA 1MSDA 4JZ2A 3K5LA 4BIOA 4UV8A 5EBWC 3UM7A 1EZVH 5LOVB 3CCLV 4K35A 2HVJC 4HNAB 2W0FC 2JS3A 4TV9A 2NLJC 2Q68A 2RQ6A 4LFCO 4QE7A 1ZUQA 4DUZB 2V7QG 2F66C 5CBHA 4IL6Z 3K57A 4DR4B 2XOKG 4O4LA 4DR5O 2AHZA 2ZM6O 1VQ9V 1XQ8A 2ODMA 4TQFA 3UKMA 4DXWA 1PNLA 3OR7C 2YIAA 4NXMB 1KECA 4JI4O 2A7WA 1R1BA 4GYCB 3TGUH 4JZGA 5HFMA 2BCCH 2ZE5A 4J10A 4DR1O 3LDDA 2WA4A 4I4TA 1NU1H 3ASOC 4DUYO 1VQNV 1WA8A 1FFTB 2UUAB 4MS2A 1N34B 2ZXWC 1FFXA 3M8AA 2OWOA 3SYCA 1ORQC 2Q67A 1OCRB 4R7CA 2WLLA 4X20A 4GKJB 2E5LO 5C8YB 3BHPA 1JA8A 4X1KA 1K7DA 1Y74B 4UB6Z 1T5EA 4YHHO 2PGGA 4PDLA 1VF6A 4FLZA 4B3MB 2EX3A 5LP6C 4EFBA 1XNQB 4PA6A 4B3SO 3SJAC 5LGNA 1XMOB 1G8MA 4AI8A 5IJ9B 3M7MX 3ABLB 3L71H 2IH3C 1K97A 5JVDB 3ZHUA 4DR3O 2B1IA 1Q7YW 3HB3B 1VQPV 4CH5A 2LW1A 1WP7A 4WFHA 2L6LA 5A2QN 3K5OA 2AXTZ 2JEXA 4J80A 5JVDA 1J5EO 1TVKA 2Y4UA 1M93A 4JF3A 4X66O 2DYSB 2EILC 1YZBA 5LP6A 2QE7G 2HR3A 1KD1W 3L72H 1M4UA 3ABMC 2JS5A 1EN5A 4YIPA 1VQ7V 4ZHQA 4NR1A 4DV7O 3OM3B 3VQYA 3FFQA 3B09A 1XILA 3E8FA 1GRJA 3CWBH 1TUBA 2A06H 5JJJB 2JGDA 2XT9A 5CA3A 5LGUA 4LF4B 3E89A 2CH7A 1SETA 1R3LC 1Y67A 3SGIA 1MG1A 4FLWA 4JI0B 2HG5C 2WLLB 4IIJA 4XBFA 2EULA 1EN4A 4IGGA 2YEVA 2R9AA 5LA6A 1SS3A 1J95A 4KP4A 2XAGA 3D8CA 2GDSA 2ZDIA 3HKEB 3BABA 2K1EA 3JD3A 3ABKB 2H3OA 3W7SA 1Q90D 4FM2A 2F95B 2ATKC 3P3PA 3JD4A 4DV5O 1AROP 1NI8A 1WPXA 3UT5A 2Q7EA 2CGNA 2IM9A 2H8PC 4ZOLB 2IU0A 1YVWA 3CMEV 2OCCB 4O2BA 3E8GA 2HLDG 2RCVA 1SQPH 3ASNC 4DV1O 2QGNA 3J81N 3T1HB 4JI1B 1AJQA 3CD6V 5EYPA 1GTOA 4UV9A 4P2ZA 1XEQA 1NVPB 1WLEA 1MOFA 4LF5B 1VF7A 1P7BA 2Y0IA 2DE0X 3L74H 5IYZA 1Y4MA 3AG2C 3I56V 5KA6A 5JQGA 2BOCC 4DV3O 4Q6GA 5J9PC 1UPGA 3M99B 4MTOA 3B4SA 3H1LH 1NR1A 1H8EG 5KMGB 2ZQMA 3N2KB 4IIJB 2QWPB 5JH7A 2V1DA 2IU3A 3CE2A 1KB9F 4HAMA 1YTFD 3ZX6A 4UCRA 4JI7O 2K9PA 2KKWA 3U0ZA 3DC5A 5IJ0B 2Q8VA 2A79B 4DRXB 3C3SA 1VIBA 3WG7C 5KHHA 4DR6O 5EIBD 2AW9A 2OIEA 4O4HB 3BPZA 3NXSA 5EC1C 3GWOA 1YSCA 2LFSA 4PDRA 3SYAA 4KXRA 5KLVH 3JSNA 1Q3EA 5ITZB 1K3EA 2A0LA 5GONB 1N34O 1AVMA 2NR5A 4R6ZA 4YXWG 2QWNB 3GB7C 2DYRC 4WFEA 1YI2V 2N74A 2DMXA 2LJ2A 1NR7A 1VQ6V 2P67A 4X64B 2QDOA 1WJZA 2FYUH 4E2LA 2E3CA 4DR4O 4JTDB 1E79G 1WB8A 1MMMA 2ZM6B 3ZCCA 4PDMA 1M5IA 1YJWV 4DV4O 1TUBB 1OV9A 5L3BA 4OXSA 2A3QA 1RPOA 1PL0A 2GUZA 3ASNB 4UCOA 4X1KB 4X65O 1QNMA 3SJCC 4FK5C 3E86A 4JV5B 1H2LA 1G4YB 2P22C 4QJFB 2P5OA 3SPHA 3STLC 1BHBA 4TQDA 1AP6A 1FXHA 3Q4HA 2WSSG 3LSSA 2P4KA 4U3FH 4AQYO 2KG7A 4BWAA 2FTKA 4X66B 1BHAA 3ABTA 1QLNA 1SKVA 4JYCA 1KU9A 1VQ4V 2JJ1G 1LR1A 4MSWC 1YXBA 3CYOA 4B3TO 1K92A 1V55C 5EK0A 4LF4O 3PN1A 5LMNO 4TV8B 4X89A 4JI0O 2ITCC 3G80A 3H9VA 5BZBA 2RN9A 2YIBA 3SJBC 2CH7B 1K8AW 2ZD9A 4NYKA 2JGDB 4NB5A 5L3EA 4IYIA 1PL4A 2H94A 3OTOB 2Q7HA 3W7XA 3KZIZ 1IVSA 1EBOA 3T1YO 1FAFA 1EZJA 2VQFO 1H2GA 5IYBO 5JJNB 3ZHRA 1UFIA 4RUEA 4DV2O 3UCSC 3RYIB 5E79Z 2HFEC 2QA4V 1NVPD 1R3KC 4TOIA 1MNGA 3W7WA 2OYQA 3HKEA 4RUFA 2Z0AA 1NT2B 3E22B 2R72A 4LFCB 2WLJA 3T1CA 2Z3YA 3E2EA 1R73A 4I9WA 2W6JG 1OCCC 5CMUA 1X4TA 1JFFA 4JI1O 4AHCA 3T4ZA 5JCOC 2RJZA 1Q86W 3IJ4A 5TISZ 3CSXA 3ZRWA 3ZJZA 2WA3A 4MVUA 4P9OA 4PI0A 4MVRA 2Q0AA 3S3XA 2ITDC 3R66A 4DV0O 4UVAA 4OPAA 1S0VA 1QVFU 1UJWB 1Z5VA 2UUBO 3ZRWB 1HW7A 1IDSA 3K03A 1FFXB 4JTAB 4J7ZA 3L73H 3WG7B 2UXXA 1SRYA 3HKDA 4NXNB 1IBLB 1L0NH 1YJNV 1ZL8A 4U7NA 3B8NA 1Q43A 4GX1A 3K5NA 1LNQA 1HWYA 4CH6A 4D7SA 4UVBA 3H1HH 1OJHA 3BEHA 4DYLA 4R50A 2UXCO 2ZR3A 2LGQA 5KAFZ 1GM9A 2EIKB 1FD9A 2CTWA 2R70A 4YHHB 1L0LH 1VF5B 3ZRVA 1QVGU 5KX5A 2CTRA 4B3SB 1WB7A 2D2CB 3TXSA 4X62B 3GWKC 3WB1A 4DV6O 5BR8B 1CP9A 1R6KA 2EIMB 1M57C 4H0LB 5IWAO 3JATB 4X9QA 1XBLA 2GBOA 1V9PA 2ETNA 4I0XA 3K59A 3HKCB 2CUGA 4K3AA 3AG3B 4CC6A 1J5EB 2AZ0A 2JRIA 1SZXA 3ETDA 3MHSC 2DJVA 2WAMA 4MVSA 5E1AC 4YIOA 1ZX3A 3OT7A 3CC4V 4J7KA 2RNBA 3MD0A 1VEWA 4J9YB 4LF9O 4X1IA 3WB0A 3L75H 1BCCH 2DOSA 2BSKA 2VWJA 3KCXA 2YXHA 2YI9A 2XHBA 2ADQB 2D3OW 5CN0A 4LWSA 3T2MA 3RBZA 4CS2A 4FZ0A 1W59A 5LHHA 3Q4HB 2WLIA 4F4LA 3ZMZA 1XNRB 3CXCU 3BRCA 1RPRA 3I5DA 3OMNB 2GTAA 1HNWO 2CGOA 4X88A 5LXTA 5IT9N 3PJSK 2EINC 4X64O 1PV0A 4B3TB 4LBEC 1QR8A 1VQLV 3WU2Z 4P30A 1RFYA 1NH2D 3OE7G 4JI8O 1L1FA 3E8BA 1MZFA 4X65B 4JV5O 1GN6A 3G67A 4B7KA 3DGEA 1K9MW 3AG7A 1IZ3A 4FLTA 2OTJV 4WFGA 2VQFB 3CHXA 1H2NA 4FJCC 4O2AB 1VARA 4J11A 2YXLA 3CJHB 1BQ0A 3G6EV 4W4LA 2CK3G 2X0LA 1KKCA 5KUMA 2Y69C 1IXMA 5J2TA 2LP7A 2KG7B 3F7VC 3OTFA 1S72V 1XREA 1WN7A 2VWKA 1P4RA 4MW3A 2YI8A 4TSFG 3RFRA 2QWOB 1GH6A 4CC5A 3U10A 5LOVA 3OGIB 2N05A 1VQOV 1I94B 3CRQA 1K34A 3RWRD 2YICA 3LUTB 1HNZB 5B1NA 1Y76A 2WLMA 4JI7B 1FXKB 1XUQA 3IC7A 2P7TC 1LUVA 4FZ1A 3TCUA 4UCTA 4GCZA 3ASOB 5IDJA 1W2BU 1NJIW 5D5QA 4KL1A 1K73W 5IYZB 5KUKA 5CA1A 4UCSA 3CC7V 2PTMA 2UXBB 5CB4A 1L8DA 3AG4B 2XAFA 1S5JA 1IURA 3RGBA 2DWEC 1HNXO 1QQCA 1IBLO 4IT5A 4O2BB 3ZIAG 2FB5A 1OCZB 3ETEA 3MAQA 3AG4C 1V55B 2XAHA 3H01A 3FB5C 5J2UA 3FAVA 3OEEG 4F6EA 1XL4A 4O4LB 3ETGA 1AP5A 3CCSV 4I4TB 2GUZB 3E8HA 2F4VB 4ZI7A 5HFLA 1Q81W 5K1XA 1AI6A 1XMQO 1D5AA 3ABUA 1XOUA 4JI6B 2WLHA 2QSAA 4HNAA 4JYYA 4NTWA 1QR9A 5LGTA 5BR8O 4I5SA 4J42A 5B1BB 3RYFA 4TV8A 5JH7B 3RYIA 4PA3A 2ZT9B 4FPPA 1N32B 2UUBB 2YS8A 1VQ8V 2X7RB 1FJGO 4DUZO 5FNVA 5BY1A 4P9PA 1R3JC 1RM1B 5ITZA 3RYFB 2UXDB 4PELA 4DR5B 1AI7A 3ZMTA 4NXNO 1KQSU 2QWRB 2JGUA 1PD3A 3A8TA 2PY5A 1N33O 4UXNA 4TWKA 3P32A 1TUEB 4IHJA 2CTQA 3UQ8A 4JI3B 1WPBA 2Q4PA 4IYHA 5KHJA 3OMAB 2B5UA 4TUYA 4EB6B 1GN4A 2QTSA 1K4CC 4K0KB 4EB6A 4MVMA 3FB8C 3RT3C 5LMNB 2MK3A 5KAIZ 3D3IA 4DV6B 2UUAO 1FXVA 3K0GA 4LFAB 1YJ9V 1GN3A 4H44B 1KBHA 5IJ0A 1SQQH 3CEIA 5JJEB 4GKJO 2E5LB 5EBMC 1M1KW 3OD4A 4XDKA 2DW4A 5EIBC 4FVMA 3T1YB 1WAZA 3CRMA 1X59A 4CS4A 1XMOO 4X1YA 3B77A 3GVMA 1ZLZA 3QTCA 3NR7A 2HEPA 3STZC 2X6AA 4GZRB 5DM6V 3HKCA 1YTFB 3OEHG 1SA0A 4GX5A 2KB1A 4X1YB 3ZHTA 4UCUA 4JI5O 2P90A 4JYAO 3ABLC 3BVOA 2IW5A 2QJ1A 1S5HC 4E4EA 4LF8B 1SESA 5B1BC 3JAMN 2NN4A 3CCVV 3BFRA 1PPJH 4O4JB 1SQBH 2HHHB 3LSQA 1QHTA 3CCUV 4LFBB 2Y4TA 5H6RA 1Y66A 2PI5A 4PA7A 4O2AA 1VMGA 4Z1MG 5KHIA 5LA6B 3JAKB 1Z5WA 2F43G 1XHZA 4MTFA 4FLUA 3OR6C 2IJKA 3BA9A 4JAVA 4PD4F 1I0HA 1YITV 4H37A 1BMFG 4K8ZA 1AJNA 1V54B 1Q82W 1FXKC 4JI8B 4HYOA 1AB3A 4BW9A 2WPDG 4MVQA 5JQGB 1AILA 2W0XA 3ZS8C 2DQ3A 1SERA 3UO2A 4QPKA 5EYPB 2OIGA 3ABKC 1IBMO 1PP9H 3DTUB 2M6YA 3W7TA 4PA9A 4LF6B 2A9HA 1OCOC 2VS0A 3CCMV 2QEXV 4KFMA 3UT5B 1I5XA 3CCJV 5A9GA 1SZTA 2ZNIA 5JWPA 4JI2O 1JFFB 1H2SB 5EC2C 4Q20A 3AG3C 4X62O 1NZ6A 2FKXA 1OCOB 3JALA 3QO5A 4JYBA 4UVCA 5IWAB 3SDLA 2Z5UA 1RSOA 3CP1A 3ZHVA 2EIJC 1KUQA 5IY5B 3L70H 3WFVA 4B7EA 1P7GA 4ICGA 3K06A 1FKAO 5CA0A 5J2UB 1LUWA 4KHPO 1KKDA 2AZ2A 1F4NA 3K58A 1I7FA 1D5NA 1TGOA 3I55V 5IY5C 3IC9A 4MTXA 3IFXA 4ZIBA 4ZI7B 4D7TA 5C8YA 2ZINA 4NXMO 3JARA 1H2MA 5DN6G 2ZR2A 1N32O 3EFFK 4U7OA 1Q6IA 4G27B 1QLEB 1N0NA 2E74B 2GV9A 5EZYB 3JATA 1VQKV 1NS1A 1ZTEA 3OW2U 3JD1A 2QM8A 2YUAA 3H1JH 3RVYA 3HR0A 4PV1B 4QIWF 3VOUA 3QF7A 5LBQA 2KSDA 1PM9A 4FLYA 3FB6C 3CCRV 3DXRB 4DK1A 5CB4B 2YC0A 4UB8Z 4JGSA 2G38A 2DQ0A 4GLXA 1HNWB 2WWWA 3ZMUA 2XNDG 2LO1A 3ML0A 3RN4A 3SJQC 2KQXA 2Q7GA 1K4DC 1B3QA 4LFAO 1JJOA 2F23A 4N23A 4DR3B 2EIKC 1NH2B 3TETA 3FX7A 5IE9A 1Q6HA 4B3RO 1YEWA 4UUJC 4WCEV 3CJHA 1AI5A 4GUNA 2BTOA 1KP2A 2UU9B 1I5YA 2VQEB 1JJ2U 1YDXA 2EIMC 3RW0A 1F23A 2ZDIC 2YXYA 5J2TB 4LNUB 4ZBMA 1KMIZ 1GK9A 1N33B 2R9IA 5BMVB 2YDEA 3FB7C 1Y6XA 4RQFA 1Q5OA 4QE9A 4GX0A 2DN9A 2DYSC 1N0JA 4CBCA 4FM0A 5H9CA 1H2KA 1FXKA 1KP3A 2NNUA 1Y76B 3OUFA 5IYDO 3DSQA 1U96A 1VQ5V 1G1XB 3K0DA 1MABG 4I50B 4UCVA 1I94O 2X6CA 3ZMVA 2Q6AA 2HHHO 3O65A 1QLEC 4ZOLA 2RMKB 3OAAG 3SPGA 1SC5B 3N2GB 5CBGA 2PYLA 4G2KA 4I55A 1RM1C 1TAEA 3HKBA 4YJ3A 3JCUZ 1K5SA 1CEZA 3CS5A 3HKDB 4TT3G 1U97A 3HKBB 1QBZA 3RYHA 3N2GA 4DW0A 2HKOA 3P3NA 1OCRC 2IJJA 4Z1VA 4A5UB 2B1GA 1TVKB 2YEVB 2QKCA 1HNXB 4QGPA 1JMKC 4UFZA 2BTQB 4O4IB 2QWQB 1F7YA 2Y69B 2CE4A 2QM4A 2ZCEA 3CPWU 3JD2A 5BMVA 4DV1B 2UUCB 3CRAA 1Q8IA 1XMQB 3LSUA 2WLKA 3APOA 4JI6O 4LF5O 3D3QA 4DV3B 1IBKO 2QM7A 3H1KH 3BAAA 1E1QG 4N21A 3C90A 3VBBA 2QR4A 1ZSPA 4OX9B
chains in the Genus database with same CATH topology
1B6QA 4JPRA 1FXHA 4MW8A 4P9PA 1R3JC 2WSSG 3LSSA 3A0RA 3QO8A 3ZN1A 1RM1B 1YIJV 3ABMB 4PELA 1JVMA 3AG1C 1AI7A 2FTKA 4RO2A 1BHAA 2Y48A 3ZMTA 3ABTA 1KQSU 1QLNA 1PD3A 1H38A 3CC2V 3LDEA 1S3JA 4JYCA 4GX2A 4UXNA 4TWKA 3P32A 1TUEB 1S77D 3AG1B 1OCCB 1GM8A 3K3WA 4KUMA 1VQ4V 4PA4A 3IGAC 3FYIB 3X2QB 4FIPC 2JJ1G 4FMTA 4MSWC 3ZMSA 3CYOA 3OMAB 2B5UA 1M9NA 1M56B 3QO7A 1K92A 5LHGA 1V55C 5EK0A 1K4CC 3JYCA 4MVMA 3QNEA 4X89A 2P6JA 3FB8C 4MVZA 2ITCC 2MK3A 3D3IA 1FXVA 3K0GA 5BZBA 3LDCA 4BW5A 3B8MA 5H6QA 1K8AW 1YJ9V 3P30A 2ZD9A 4WF9V 2IH1C 2PI4A 5L3EA 2H94A 4DO2A 2XASA 4L87A 5EBMC 1M1KW 3W7XA 2EZOA 3EHBB 4ZKIA 4XDKA 1JPXA 1EBOA 3JCZA 1EZJA 1OZ0A 2DW4A 3RVZA 1THZA 1F51A 1H2GA 2UXNA 1NBMG 5IYBO 5B1AB 1YHQV 3D36A 2EBOA 2OT5A 3B77A 1GO3F 4RUEA 2EIJB 3ZRXA 1E1RG 2HFEC 3STZC 2QA4V 2Q69A 4R8CA 1NVPD 2X6AA 1R3KC 5DM6V 1YTFB 3K04A 3OEHG 4UV8A 5EBWC 3UM7A 4GX5A 4PDVA 3CCLV 2KB1A 2HVJC 1ROPA 3W7WA 3OGCC 2W0FC 4RUFA 2NLJC 2Q68A 1EFRG 2WLNA 2P90A 1DTOA 3ABLC 1K33A 2YSUB 2IW5A 4QE7A 5L3FA 2WLJA 5LHIA 1S5HC 3T1CA 2OTLV 2Z3YA 1SESA 2V7QG 5B1BC 1R73A 5CBHA 3CCVV 3FKSG 2W6JG 4I9WA 1OCCC 2XAQA 3R65A 4GT1A 5CMUA 2XOKG 3T4ZA 2AHZA 3SPCA 3SPIA 3X2QC 1VQ9V 3LSQA 3CCUV 3UKMA 1Q86W 1N8RW 4QPJA 1GM7A 4DXWA 1M56C 1PNLA 3OR7C 5H6RA 1Y66A 3ZRWA 2PI5A 3ZJZA 1JX9A 1PNKA 4PA7A 4MVUA 4Z1MG 4P9OA 1COWG 4MVRA 1KECA 2F43G 1NKDA 2ITDC 1VQMV 2HVKC 1F4MA 4MTFA 3OR6C 2IJKA 4UVAA 3CCEV 4H33A 1S0VA 4JAVA 1QVFU 2EILB 1UJWB 2JK5C 4H37A 1YITV 1AJPA 3ZRWB 1BMFG 3G4SV 4LC1A 3K03A 1AJNA 1V54B 1FS0G 2WLIB 5HFMA 1Q82W 3SPJA 4WFBV 1FXKC 4HYOA 4JTAB 4BIZA 3LDDA 3WG7B 2UXXA 1GKFA 2WPDG 4X8AA 1SRYA 4MVQA 3ASOC 3HPLC 1VQNV 1YJNV 1FFTB 4U7NA 4MS2A 2DQ3A 3B8NA 2ZXWC 4GX1A 4MVOA 1SERA 1LNQA 3JD0A 3SYCA 3E35A 1ORQC 1HWYA 2Q67A 4QPKA 4UVBA 1PNMA 2QKSA 1OCRB 3BEHA 4R7CA 1OHHG 2WLLA 3ABKC 4R50A 2ZR3A 3DTUB 1AR1B 1K7DA 2JIZG 3W7TA 4PA9A 1GM9A 2DYRB 2EIKB 2A9HA 4BIUA 4PDLA 1OCOC 3CCMV 2QEXV 4KFMA 1DF4A 2EJRA 4PA6A 3ZRVA 1I5XA 5LGNA 3CCJV 1QVGU 1G8MA 1SZTA 2BOBC 3ABLB 1H8HG 2IH3C 1K97A 5EC2C 4Q20A 2B1IA 4HZ3A 1DF5A 3AG3C 1CP9A 3HB3B 1Q7YW 1R6KA 2EIMB 1M57C 1OCOB 2HJFC 3KG2A 3SYPA 3QO5A 4JYBA 1VQPV 1XL6A 4JASA 4UVCA 4WFHA 2EZPA 2Z5UA 3CP1A 2EIJC 5IY5B 3WFVA 5C93A 2JEXA 5B1OA 3AG3B 1KC8W 4JTCB 3K06A 3TK1A 3OUSA 1KKDA 4JF3A 4QNHB 5KA5A 2DYSB 2EILC 3ETDA 1F4NA 3MHSC 5B3SC 2QE7G 2WAMA 3OMIB 3I55V 5IY5C 2HR3A 1KD1W 4MTXA 4MVSA 1V54C 3IFXA 5E1AC 3ABMC 1PKXA 1VQ7V 3CC4V 3OM3B 3MD0A 2R9RB 3FYEB 4J9YB 5DN6G 2ZR2A 3ZRSA 3EFFK 4U7OA 3E8FA 4G27B 1QLEB 5CA3A 1VQKV 3W7UA 5LGUA 3AG2B 2D3OW 3E89A 4MT8A 5CN0A 1SETA 1R3LC 3T2MA 3F5WC 3JD1A 3OW2U 1MG1A 5FL7G 3RBZA 1JQ0A 2QM8A 3RVYA 2HG5C 3VOUA 4QIWF 5LHHA 2WLLB 4XBFA 2WLIA 4F4LA 5LBQA 3ZMZA 3FB6C 3T4DA 3CXCU 3CCRV 1RPRA 3OMNB 4XDJA 4JGSA 2JJ2G 2YEVA 2DQ0A 4X88A 3CCQV 2WWWA 3PJSK 2EINC 3ZMUA 2XNDG 1R6NA 3E2EA 3ML0A 3SJQC 4LBEC 1QR8A 1J95A 2IJIA 1VQLV 4P30A 4EKWA 4KP4A 2XAGA 1NH2D 3OE7G 1L1FA 2ZDIA 5L3CA 2K1EA 1ZWIC 3JD3A 3ABKB 3E8BA 1K4DC 3W7SA 3ZN0A 5IYCO 4N23A 2EIKC 1NH2B 2ATKC 2JEUA 5B1AC 3JD4A 3TETA 3G71V 1AROP 3DGEA 1K9MW 1WPXA 4UUJC 1NQTA 2M7WA 4WCEV 4LP8A 5GW7A 1AI5A 2H8PC 2IU0A 3CMEV 1KP2A 2OCCB 2OTJV 3E8GA 4WFGA 1I5YA 1CPYA 1JJ2U 2HLDG 3ASNC 3SYOA 2EIMC 3RW0A 2GHYA 4FJCC 1OCZC 1S76D 1F23A 2ZDIC 1AJQA 3CD6V 1GTOA 1JOYA 4ZBMA 3G6EV 3LNMB 4UV9A 2GSMB 4P2ZA 2CK3G 2X0LA 1GK9A 1NVPB 5KUMA 1WLEA 1MOFA 2Y69C 4LCUC 2R9IA 1P7BA 1R3IC 4RQEA 1Y4MA 1IXMA 3AG2C 1W0JG 3I56V 5KA6A 2QTOA 5L3GA 2LP7A 2BOCC 3FB7C 1MSWD 3F7VC 1GMGA 2C2AA 5J9PC 4RQFA 1S72V 4GX0A 2DYSC 4QE9A 1P4RA 1ENVA 2DWDC 3M99B 4MW3A 4TSFG 4MTOA 4CBCA 5B3SB 5H9CA 1BL8A 1FXKA 1KP3A 1NR1A 1H8EG 2ZQMA 2NNUA 3OUFA 5CBFA 2LFRA 5IYDO 1VQOV 1VQ5V 3MHHC 3K0DA 1MABG 2V1DA 2IU3A 1K34A 2X6CA 3ZMVA 3K9AA 2Q6AA 3SYQA 3LUTB 4HAMA 1QLEC 1YTFD 5B1NA 3OAAG 3SPGA 2WLMA 2JDIG 1FXKB 5CBGA 4ASUG 2A79B 3IC7A 4G2KA 2P7TC 1AI4A 1RM1C 3TCUA 4GCZA 1W0KG 3ASOB 1K5SA 5IDJA 2AHYA 1CEZA 1QCEA 1W2BU 1NJIW 3WG7C 4TT3G 4JAUA 1K73W 3K79A 1QBZA 5KUKA 2X6BA 3NXSA 5EC1C 3GWOA 3CC7V 1YSCA 2ZXWB 2HKOA 3AG4B 1OCRC 2IJJA 2LFSA 2XAFA 4PDRA 3SYAA 3E83A 1M90W 2B1GA 2DWEC 2EINB 2W6IG 2YEVB 4BAYA 3CMAV 1K3EA 2A0LA 2XAJA 4R6ZA 3ZIAG 1OCZB 4YXWG 3ETEA 3GB7C 2DYRC 4WFEA 3AG4C 1YI2V 4WFFA 1V55B 2XAHA 3H01A 4G28B 2IJHA 3FB5C 1NR7A 2Y69B 1VQ6V 3OEEG 4XDLA 3F7YC 1XL4A 2P67A 3ETGA 3CPWU 3JD2A 3CCSV 1M57B 4J9ZB 4WFAV 4E2LA 3E8HA 1DLBA 5EBLC 4JTDB 1E79G 4RAIA 5HFLA 3ZCCA 1Q81W 1AI6A 3K08A 4PDMA 1YJWV 3OFNG 3ABUA 3AEIA 5L3BA 2WLHA 2OCCC 2WLKA 5L3DA 4OXSA 1JCHA 1QR9A 4MTGA 1RPOA 1PL0A 3ASNB 5LGTA 4CZZA 4I5SA 1K5QA 5B1BB 4FK5C 3E86A 2QM7A 4PA3A 1G4YB 4FPPA 3BY6A 4QJFB 1E1QG 4N21A 3SPHA 3VBBA 1VQ8V 3STLC 1BHBA 2X7RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF9 V;  3CME V;  1S72 V;  1VQ4 V;  1VQP V;  1Q81 W;  1Q82 W;  2OTJ V;  1VQ9 V;  4WFB V;  1JJ2 U;  1YJW V;  2QA4 V;  3CMA V;  1VQ7 V;  1YIJ V;  3CC4 V;  3CCU V;  1Q86 W;  1N8R W;  5DM6 V;  3CCR V;  3CXC U;  1W2B U;  1M1K W;  3CD6 V;  1NJI W;  1YI2 V;  3CCM V;  3CCL V;  2QEX V;  1VQN V;  3G6E V;  1VQO V;  1KQS U;  1KC8 W;  1K73 W;  1VQ5 V;  1YJN V;  1QVG U;  3CCJ V;  1VQM V;  3I55 V;  3CC2 V;  3G71 V;  3CC7 V;  1VQ6 V;  3CCQ V;  3CCE V;  1YHQ V;  1K9M W;  2OTL V;  1VQK V;  4WCE V;  3CPW U;  1QVF U;  1R73 A;  3I56 V;  3CCS V;  3CCV V;  2D3O W;  1YIT V;  4WFA V;  1Q7Y W;  1M90 W;  1K8A W;  1YJ9 V;  1VQ8 V;  3OW2 U;  3G4S V;  1KD1 W;  1VQL V; 
#chains in the Genus database with same CATH topology
 1B6Q A;  4MW8 A;  1FJG B;  4YJ2 A;  1JVM A;  3AG1 C;  5GTI Z;  4RO2 A;  2YID A;  3FAV B;  2F1M A;  1GAX A;  1Z2G A;  1H38 A;  3CC2 V;  3LDE A;  1S3J A;  2Q9L A;  4GX2 A;  3K5M A;  1OCC B;  4DV0 B;  1FYJ A;  1GM8 A;  3K3W A;  1IBM B;  4PA4 A;  3IGA C;  3X2Q B;  3B40 A;  4FMT A;  3ZMS A;  4J41 A;  5IJ9 A;  4DR6 B;  3TXQ A;  1KYO F;  1M56 B;  1G6U A;  5LHG A;  3O9O A;  3JYC A;  3ZED A;  1SQV H;  2Y0P A;  2P6J A;  4MVZ A;  4FFB B;  3AK2 A;  1N36 O;  2N04 A;  3LDC A;  4BW5 A;  3B8M A;  3P30 A;  4WF9 V;  1DK1 A;  2PI4 A;  4O4H A;  1WA8 B;  2P4V A;  4L87 A;  1EN6 A;  4GKK B;  2EZO A;  4ZKI A;  4ZHQ B;  3JCZ A;  1OZ0 A;  4DR2 O;  2OCH A;  3RVZ A;  3ETQ A;  1F51 A;  4W4K A;  4K8X A;  4KHP B;  1NBM G;  5LMU B;  4LF7 O;  3THO A;  4YY3 O;  1S5L Z;  2ZE8 A;  3A0B Z;  2Q73 A;  3UO3 A;  3D36 A;  1GO3 F;  4DV4 B;  4I9Q A;  3ZBH A;  4H13 B;  5CA0 B;  5JCO A;  1E1R G;  3B2E E;  2E75 B;  2Q69 A;  4HBN A;  4R8C A;  3N27 A;  3K04 A;  3A0H Z;  3N2K A;  4PHZ A;  4PDV A;  1ROP A;  3OGC C;  3WB2 A;  2LGW A;  1EFR G;  2WLN A;  5B5E Z;  3VQX A;  1DTO A;  1K33 A;  2YSU B;  3LNN A;  4JI5 B;  4JYA B;  5L3F A;  3K9S A;  5LHI A;  2VQE O;  2OTL V;  3JAL B;  1S77 D;  4X1I B;  3FKS G;  5FPR A;  2XAQ A;  3R65 A;  4GT1 A;  2VRZ A;  4AQY B;  4DK0 A;  1IXB A;  3SPC A;  3SPI A;  3X2Q C;  1B06 A;  2ADP A;  1N8R W;  4QPJ A;  1GM7 A;  4TV9 B;  1M56 C;  4L8J A;  4LNU A;  1JX9 A;  1PNK A;  3AK3 A;  4AIL C;  1AR4 A;  1COW G;  4LH7 A;  3FD9 A;  1NKD A;  1VQM V;  4JI4 B;  2LQT A;  2HVK C;  1F4M A;  2F93 B;  3CCE V;  4H33 A;  2EIL B;  4LR3 A;  3J80 N;  2JK5 C;  5H5N A;  1AJP A;  1SQX H;  4J7J A;  2YIB D;  3G4S V;  4LC1 A;  4DR7 O;  1FS0 G;  2WLI B;  3SPJ A;  4WFB V;  1B04 A;  4DR1 B;  4BIZ A;  1BSM A;  2QKA A;  1GKF A;  3DC6 A;  4X8A A;  3JAS B;  3HPL C;  1VP7 A;  1O9G A;  5BXZ A;  4Z2W A;  4O4I A;  1SQF A;  4MVO A;  4FLV A;  3JD0 A;  5LP6 B;  3E35 A;  1HR0 O;  1PNM A;  2QKS A;  1OHH G;  2PF4 E;  2UU9 O;  1NTK H;  1AR1 B;  4F6R B;  2JIZ G;  5LL6 Y;  3JAK A;  2DYR B;  4B3M O;  4U3J A;  4BIU A;  1DF4 A;  1RSO B;  2EJR A;  1CXZ B;  3RYH B;  3A2F A;  4BR6 A;  2BSK B;  2BOB C;  3J7A U;  1H8H G;  4DV2 B;  1R6T A;  3CX5 F;  4FM1 A;  5FPO A;  4HZ3 A;  1DF5 A;  2ZE6 A;  3CRC A;  3CB2 A;  2HJF C;  3KG2 A;  2CDY A;  3SYP A;  1XL6 A;  4JAS A;  1WP8 A;  2EZP A;  3TJT A;  1SA0 B;  5C93 A;  1XHX A;  4NTX A;  1RP3 B;  5B1O A;  5KHG A;  1KC8 W;  3JAR B;  4RWU A;  4LH6 A;  4JTC B;  2AGA A;  1HP8 A;  3TK1 A;  3OUS A;  1YF2 A;  2XTA A;  3D36 C;  5KA5 A;  4QNH B;  2BTQ A;  4NTY A;  4EEQ A;  5B3S C;  3OMI B;  2IBZ H;  1V54 C;  5FLX N;  4DV7 B;  1PKX A;  3VQW A;  2R9R B;  3RYC B;  3FYE B;  4FLX A;  4LWS B;  4PI2 A;  3ZRS A;  4CH4 A;  4OX9 O;  3W7U A;  3AG2 B;  4MT8 A;  3F5W C;  5FL7 G;  3RYC A;  1JQ0 A;  1HNZ O;  4YJ2 B;  3KCY A;  3T4D A;  4WBN A;  3G6B A;  4XDJ A;  4D6T H;  2JJ2 G;  3CCQ V;  2UXC B;  1N4C A;  1R6N A;  2IJI A;  4EKW A;  5L3C A;  1ZWI C;  4NKG B;  1QU7 A;  1NTZ H;  5LYJ A;  4DUY B;  1N36 B;  2O57 A;  3ZN0 A;  5IYC O;  5FNV B;  4I50 A;  2JEU A;  5B1A C;  3G71 V;  1SF9 A;  1IBK B;  1I08 A;  1NQT A;  2M7W A;  4B3R B;  4LP8 A;  5GW7 A;  1NTM H;  1CPY A;  5GON A;  4B08 A;  2PYJ A;  3SYO A;  2F4V O;  4DR2 B;  3QG5 A;  2GHY A;  5K1P A;  1OCZ C;  1S76 D;  4I0X B;  4YY3 B;  1JOY A;  3E22 A;  3LNM B;  2GSM B;  2B9Z A;  4LCU C;  2HP8 A;  1US6 A;  3KKY A;  1R3I C;  4RQE A;  1W0J G;  3C3T A;  5L3G A;  2QTO A;  1D2D A;  5LXT B;  1MSW D;  1GMG A;  2C2A A;  4LF9 B;  2MW2 B;  3U11 A;  1ENV A;  2DWD C;  5KX5 B;  2ZNJ A;  4ABM A;  3S3W A;  5B3S B;  4WBN B;  1YCI A;  1BL8 A;  1HDJ A;  3EVK A;  5DED A;  2XUM A;  5CBF A;  2LFR A;  2UXD O;  3MHH C;  1AR5 A;  5KHK A;  2Q0O C;  1Y74 A;  3K9A A;  3F5T A;  1DGS A;  3SYQ A;  4X20 B;  4OPH A;  4IHJ B;  3BCC H;  2ZIO A;  2BE3 A;  2JDI G;  1XNR O;  2RDC A;  4ASU G;  3APQ A;  3H1I H;  1BT8 A;  2HJD A;  1AI4 A;  2V4D A;  4JI3 O;  1W0K G;  2AHY A;  1QCE A;  4GKK O;  5LYJ B;  4JAU A;  3K79 A;  2X6B A;  3ZHS A;  5LMU O;  4LF7 B;  1Q6U A;  2ZXW B;  2ZIM A;  5DEC A;  4K0K O;  3E83 A;  2E76 B;  1XNQ O;  1M90 W;  1IX9 A;  1EM1 A;  4CS3 A;  1SQG A;  2EIN B;  2W6I G;  3VQV A;  4BAY A;  3CMA V;  2XAJ A;  5F2V O;  3QVN A;  4I7Z B;  4WFF A;  5EZY A;  4G28 B;  2IJH A;  1HR0 B;  3IAY A;  2EJ7 A;  5B66 Z;  2GTS A;  4XDL A;  3F7Y C;  1FPO A;  1M57 B;  4J9Z B;  4WFA V;  1DLB A;  5EBL C;  4YJ3 B;  2ZE7 A;  3ICX A;  1P84 F;  4RAI A;  3ZHQ A;  5AG2 A;  4DW1 A;  4DRX A;  3K08 A;  2PUS A;  2UUC O;  4PJ0 Z;  1VF6 C;  3OFN G;  3AEI A;  2OCC C;  5L3D A;  4U3J B;  1JCH A;  4MTG A;  4CZZ A;  1K5Q A;  1XDC A;  4F6R A;  2JVD A;  1P49 A;  4DV5 B;  3SR2 C;  3JSL A;  2ARH A;  3BY6 A;  2Q5Z A;  1GN2 A;  4LF8 O;  4JPR A;  4DR7 B;  2FL4 A;  1ZL8 B;  3ZN1 A;  3A0R A;  3QO8 A;  1YIJ V;  3ABM B;  3T1H O;  2Y48 A;  1MA1 A;  3AK1 A;  5GTH Z;  4LFB O;  3EXA A;  1BZK A;  1XI1 A;  1O9H A;  1BE3 H;  2ZKO A;  1TA8 A;  3AG1 B;  4FFB A;  4KUM A;  3FYI B;  4FIP C;  4I55 B;  2L35 A;  2CAZ C;  3JAW A;  1M9N A;  3CXH F;  3MDS A;  5H2F Z;  3QO7 A;  2UXB O;  1A32 A;  3JAW B;  2P06 A;  4EFE A;  3QNE A;  4NVP A;  3BA8 A;  4OGQ B;  4JAA A;  5H6Q A;  1BS3 A;  4FFK A;  1MZE A;  1BGY H;  1JR9 A;  3CRR A;  2IH1 C;  4C7U A;  5CA1 B;  1URF A;  2CTP A;  4O4J A;  5D5P A;  3L9D A;  3OTO O;  2FML A;  4DO2 A;  2XAS A;  3EHB B;  3JAS A;  2PZS A;  1JPX A;  1ZAU A;  4LF6 O;  1THZ A;  1BQZ A;  4CH3 A;  2UXN A;  5B1A B;  1YHQ V;  2LW7 A;  5KMG A;  3DXR A;  2EBO A;  2OT5 A;  4TUY B;  4JI2 B;  2EIJ B;  1WNS A;  3ZRX A;  2ILM A;  1MSD A;  4JZ2 A;  3K5L A;  4BIO A;  4UV8 A;  5EBW C;  3UM7 A;  1EZV H;  5LOV B;  3CCL V;  4K35 A;  2HVJ C;  4HNA B;  2W0F C;  2JS3 A;  4TV9 A;  2NLJ C;  2Q68 A;  2RQ6 A;  4LFC O;  4QE7 A;  1ZUQ A;  4DUZ B;  2V7Q G;  2F66 C;  5CBH A;  4IL6 Z;  3K57 A;  4DR4 B;  2XOK G;  4O4L A;  4DR5 O;  2AHZ A;  2ZM6 O;  1VQ9 V;  1XQ8 A;  2ODM A;  4TQF A;  3UKM A;  4DXW A;  1PNL A;  3OR7 C;  2YIA A;  4NXM B;  1KEC A;  4JI4 O;  2A7W A;  1R1B A;  4GYC B;  3TGU H;  4JZG A;  5HFM A;  2BCC H;  2ZE5 A;  4J10 A;  4DR1 O;  3LDD A;  2WA4 A;  4I4T A;  1NU1 H;  3ASO C;  4DUY O;  1VQN V;  1WA8 A;  1FFT B;  2UUA B;  4MS2 A;  1N34 B;  2ZXW C;  1FFX A;  3M8A A;  2OWO A;  3SYC A;  1ORQ C;  2Q67 A;  1OCR B;  4R7C A;  2WLL A;  4X20 A;  4GKJ B;  2E5L O;  5C8Y B;  3BHP A;  1JA8 A;  4X1K A;  1K7D A;  1Y74 B;  4UB6 Z;  1T5E A;  4YHH O;  2PGG A;  4PDL A;  1VF6 A;  4FLZ A;  4B3M B;  2EX3 A;  5LP6 C;  4EFB A;  1XNQ B;  4PA6 A;  4B3S O;  3SJA C;  5LGN A;  1XMO B;  1G8M A;  4AI8 A;  5IJ9 B;  3M7M X;  3ABL B;  3L71 H;  2IH3 C;  1K97 A;  5JVD B;  3ZHU A;  4DR3 O;  2B1I A;  1Q7Y W;  3HB3 B;  1VQP V;  4CH5 A;  2LW1 A;  1WP7 A;  4WFH A;  2L6L A;  5A2Q N;  3K5O A;  2AXT Z;  2JEX A;  4J80 A;  5JVD A;  1J5E O;  1TVK A;  2Y4U A;  1M93 A;  4JF3 A;  4X66 O;  2DYS B;  2EIL C;  1YZB A;  5LP6 A;  2QE7 G;  2HR3 A;  1KD1 W;  3L72 H;  1M4U A;  3ABM C;  2JS5 A;  1EN5 A;  4YIP A;  1VQ7 V;  4ZHQ A;  4NR1 A;  4DV7 O;  3OM3 B;  3VQY A;  3FFQ A;  3B09 A;  1XIL A;  3E8F A;  1GRJ A;  3CWB H;  1TUB A;  2A06 H;  5JJJ B;  2JGD A;  2XT9 A;  5CA3 A;  5LGU A;  4LF4 B;  3E89 A;  2CH7 A;  1SET A;  1R3L C;  1Y67 A;  3SGI A;  1MG1 A;  4FLW A;  4JI0 B;  2HG5 C;  2WLL B;  4IIJ A;  4XBF A;  2EUL A;  1EN4 A;  4IGG A;  2YEV A;  2R9A A;  5LA6 A;  1SS3 A;  1J95 A;  4KP4 A;  2XAG A;  3D8C A;  2GDS A;  2ZDI A;  3HKE B;  3BAB A;  2K1E A;  3JD3 A;  3ABK B;  2H3O A;  3W7S A;  1Q90 D;  4FM2 A;  2F95 B;  2ATK C;  3P3P A;  3JD4 A;  4DV5 O;  1ARO P;  1NI8 A;  1WPX A;  3UT5 A;  2Q7E A;  2CGN A;  2IM9 A;  2H8P C;  4ZOL B;  2IU0 A;  1YVW A;  3CME V;  2OCC B;  4O2B A;  3E8G A;  2HLD G;  2RCV A;  1SQP H;  3ASN C;  4DV1 O;  2QGN A;  3J81 N;  3T1H B;  4JI1 B;  1AJQ A;  3CD6 V;  5EYP A;  1GTO A;  4UV9 A;  4P2Z A;  1XEQ A;  1NVP B;  1WLE A;  1MOF A;  4LF5 B;  1VF7 A;  1P7B A;  2Y0I A;  2DE0 X;  3L74 H;  5IYZ A;  1Y4M A;  3AG2 C;  3I56 V;  5KA6 A;  5JQG A;  2BOC C;  4DV3 O;  4Q6G A;  5J9P C;  1UPG A;  3M99 B;  4MTO A;  3B4S A;  3H1L H;  1NR1 A;  1H8E G;  5KMG B;  2ZQM A;  3N2K B;  4IIJ B;  2QWP B;  5JH7 A;  2V1D A;  2IU3 A;  3CE2 A;  1KB9 F;  4HAM A;  1YTF D;  3ZX6 A;  4UCR A;  4JI7 O;  2K9P A;  2KKW A;  3U0Z A;  3DC5 A;  5IJ0 B;  2Q8V A;  2A79 B;  4DRX B;  3C3S A;  1VIB A;  3WG7 C;  5KHH A;  4DR6 O;  5EIB D;  2AW9 A;  2OIE A;  4O4H B;  3BPZ A;  3NXS A;  5EC1 C;  3GWO A;  1YSC A;  2LFS A;  4PDR A;  3SYA A;  4KXR A;  5KLV H;  3JSN A;  1Q3E A;  5ITZ B;  1K3E A;  2A0L A;  5GON B;  1N34 O;  1AVM A;  2NR5 A;  4R6Z A;  4YXW G;  2QWN B;  3GB7 C;  2DYR C;  4WFE A;  1YI2 V;  2N74 A;  2DMX A;  2LJ2 A;  1NR7 A;  1VQ6 V;  2P67 A;  4X64 B;  2QDO A;  1WJZ A;  2FYU H;  4E2L A;  2E3C A;  4DR4 O;  4JTD B;  1E79 G;  1WB8 A;  1MMM A;  2ZM6 B;  3ZCC A;  4PDM A;  1M5I A;  1YJW V;  4DV4 O;  1TUB B;  1OV9 A;  5L3B A;  4OXS A;  2A3Q A;  1RPO A;  1PL0 A;  2GUZ A;  3ASN B;  4UCO A;  4X1K B;  4X65 O;  1QNM A;  3SJC C;  4FK5 C;  3E86 A;  4JV5 B;  1H2L A;  1G4Y B;  2P22 C;  4QJF B;  2P5O A;  3SPH A;  3STL C;  1BHB A;  4TQD A;  1AP6 A;  1FXH A;  3Q4H A;  2WSS G;  3LSS A;  2P4K A;  4U3F H;  4AQY O;  2KG7 A;  4BWA A;  2FTK A;  4X66 B;  1BHA A;  3ABT A;  1QLN A;  1SKV A;  4JYC A;  1KU9 A;  1VQ4 V;  2JJ1 G;  1LR1 A;  4MSW C;  1YXB A;  3CYO A;  4B3T O;  1K92 A;  1V55 C;  5EK0 A;  4LF4 O;  3PN1 A;  5LMN O;  4TV8 B;  4X89 A;  4JI0 O;  2ITC C;  3G80 A;  3H9V A;  5BZB A;  2RN9 A;  2YIB A;  3SJB C;  2CH7 B;  1K8A W;  2ZD9 A;  4NYK A;  2JGD B;  4NB5 A;  5L3E A;  4IYI A;  1PL4 A;  2H94 A;  3OTO B;  2Q7H A;  3W7X A;  3KZI Z;  1IVS A;  1EBO A;  3T1Y O;  1FAF A;  1EZJ A;  2VQF O;  1H2G A;  5IYB O;  5JJN B;  3ZHR A;  1UFI A;  4RUE A;  4DV2 O;  3UCS C;  3RYI B;  5E79 Z;  2HFE C;  2QA4 V;  1NVP D;  1R3K C;  4TOI A;  1MNG A;  3W7W A;  2OYQ A;  3HKE A;  4RUF A;  2Z0A A;  1NT2 B;  3E22 B;  2R72 A;  4LFC B;  2WLJ A;  3T1C A;  2Z3Y A;  3E2E A;  1R73 A;  4I9W A;  2W6J G;  1OCC C;  5CMU A;  1X4T A;  1JFF A;  4JI1 O;  4AHC A;  3T4Z A;  5JCO C;  2RJZ A;  1Q86 W;  3IJ4 A;  5TIS Z;  3CSX A;  3ZRW A;  3ZJZ A;  2WA3 A;  4MVU A;  4P9O A;  4PI0 A;  4MVR A;  2Q0A A;  3S3X A;  2ITD C;  3R66 A;  4DV0 O;  4UVA A;  4OPA A;  1S0V A;  1QVF U;  1UJW B;  1Z5V A;  2UUB O;  3ZRW B;  1HW7 A;  1IDS A;  3K03 A;  1FFX B;  4JTA B;  4J7Z A;  3L73 H;  3WG7 B;  2UXX A;  1SRY A;  3HKD A;  4NXN B;  1IBL B;  1L0N H;  1YJN V;  1ZL8 A;  4U7N A;  3B8N A;  1Q43 A;  4GX1 A;  3K5N A;  1LNQ A;  1HWY A;  4CH6 A;  4D7S A;  4UVB A;  3H1H H;  1OJH A;  3BEH A;  4DYL A;  4R50 A;  2UXC O;  2ZR3 A;  2LGQ A;  5KAF Z;  1GM9 A;  2EIK B;  1FD9 A;  2CTW A;  2R70 A;  4YHH B;  1L0L H;  1VF5 B;  3ZRV A;  1QVG U;  5KX5 A;  2CTR A;  4B3S B;  1WB7 A;  2D2C B;  3TXS A;  4X62 B;  3GWK C;  3WB1 A;  4DV6 O;  5BR8 B;  1CP9 A;  1R6K A;  2EIM B;  1M57 C;  4H0L B;  5IWA O;  3JAT B;  4X9Q A;  1XBL A;  2GBO A;  1V9P A;  2ETN A;  4I0X A;  3K59 A;  3HKC B;  2CUG A;  4K3A A;  3AG3 B;  4CC6 A;  1J5E B;  2AZ0 A;  2JRI A;  1SZX A;  3ETD A;  3MHS C;  2DJV A;  2WAM A;  4MVS A;  5E1A C;  4YIO A;  1ZX3 A;  3OT7 A;  3CC4 V;  4J7K A;  2RNB A;  3MD0 A;  1VEW A;  4J9Y B;  4LF9 O;  4X1I A;  3WB0 A;  3L75 H;  1BCC H;  2DOS A;  2BSK A;  2VWJ A;  3KCX A;  2YXH A;  2YI9 A;  2XHB A;  2ADQ B;  2D3O W;  5CN0 A;  4LWS A;  3T2M A;  3RBZ A;  4CS2 A;  4FZ0 A;  1W59 A;  5LHH A;  3Q4H B;  2WLI A;  4F4L A;  3ZMZ A;  1XNR B;  3CXC U;  3BRC A;  1RPR A;  3I5D A;  3OMN B;  2GTA A;  1HNW O;  2CGO A;  4X88 A;  5LXT A;  5IT9 N;  3PJS K;  2EIN C;  4X64 O;  1PV0 A;  4B3T B;  4LBE C;  1QR8 A;  1VQL V;  3WU2 Z;  4P30 A;  1RFY A;  1NH2 D;  3OE7 G;  4JI8 O;  1L1F A;  3E8B A;  1MZF A;  4X65 B;  4JV5 O;  1GN6 A;  3G67 A;  4B7K A;  3DGE A;  1K9M W;  3AG7 A;  1IZ3 A;  4FLT A;  2OTJ V;  4WFG A;  2VQF B;  3CHX A;  1H2N A;  4FJC C;  4O2A B;  1VAR A;  4J11 A;  2YXL A;  3CJH B;  1BQ0 A;  3G6E V;  4W4L A;  2CK3 G;  2X0L A;  1KKC A;  5KUM A;  2Y69 C;  1IXM A;  5J2T A;  2LP7 A;  2KG7 B;  3F7V C;  3OTF A;  1S72 V;  1XRE A;  1WN7 A;  2VWK A;  1P4R A;  4MW3 A;  2YI8 A;  4TSF G;  3RFR A;  2QWO B;  1GH6 A;  4CC5 A;  3U10 A;  5LOV A;  3OGI B;  2N05 A;  1VQO V;  1I94 B;  3CRQ A;  1K34 A;  3RWR D;  2YIC A;  3LUT B;  1HNZ B;  5B1N A;  1Y76 A;  2WLM A;  4JI7 B;  1FXK B;  1XUQ A;  3IC7 A;  2P7T C;  1LUV A;  4FZ1 A;  3TCU A;  4UCT A;  4GCZ A;  3ASO B;  5IDJ A;  1W2B U;  1NJI W;  5D5Q A;  4KL1 A;  1K73 W;  5IYZ B;  5KUK A;  5CA1 A;  4UCS A;  3CC7 V;  2PTM A;  2UXB B;  5CB4 A;  1L8D A;  3AG4 B;  2XAF A;  1S5J A;  1IUR A;  3RGB A;  2DWE C;  1HNX O;  1QQC A;  1IBL O;  4IT5 A;  4O2B B;  3ZIA G;  2FB5 A;  1OCZ B;  3ETE A;  3MAQ A;  3AG4 C;  1V55 B;  2XAH A;  3H01 A;  3FB5 C;  5J2U A;  3FAV A;  3OEE G;  4F6E A;  1XL4 A;  4O4L B;  3ETG A;  1AP5 A;  3CCS V;  4I4T B;  2GUZ B;  3E8H A;  2F4V B;  4ZI7 A;  5HFL A;  1Q81 W;  5K1X A;  1AI6 A;  1XMQ O;  1D5A A;  3ABU A;  1XOU A;  4JI6 B;  2WLH A;  2QSA A;  4HNA A;  4JYY A;  4NTW A;  1QR9 A;  5LGT A;  5BR8 O;  4I5S A;  4J42 A;  5B1B B;  3RYF A;  4TV8 A;  5JH7 B;  3RYI A;  4PA3 A;  2ZT9 B;  4FPP A;  1N32 B;  2UUB B;  2YS8 A;  1VQ8 V;  2X7R B;  1FJG O;  4DUZ O;  5FNV A;  5BY1 A;  4P9P A;  1R3J C;  1RM1 B;  5ITZ A;  3RYF B;  2UXD B;  4PEL A;  4DR5 B;  1AI7 A;  3ZMT A;  4NXN O;  1KQS U;  2QWR B;  2JGU A;  1PD3 A;  3A8T A;  2PY5 A;  1N33 O;  4UXN A;  4TWK A;  3P32 A;  1TUE B;  4IHJ A;  2CTQ A;  3UQ8 A;  4JI3 B;  1WPB A;  2Q4P A;  4IYH A;  5KHJ A;  3OMA B;  2B5U A;  4TUY A;  4EB6 B;  1GN4 A;  2QTS A;  1K4C C;  4K0K B;  4EB6 A;  4MVM A;  3FB8 C;  3RT3 C;  5LMN B;  2MK3 A;  5KAI Z;  3D3I A;  4DV6 B;  2UUA O;  1FXV A;  3K0G A;  4LFA B;  1YJ9 V;  1GN3 A;  4H44 B;  1KBH A;  5IJ0 A;  1SQQ H;  3CEI A;  5JJE B;  4GKJ O;  2E5L B;  5EBM C;  1M1K W;  3OD4 A;  4XDK A;  2DW4 A;  5EIB C;  4FVM A;  3T1Y B;  1WAZ A;  3CRM A;  1X59 A;  4CS4 A;  1XMO O;  4X1Y A;  3B77 A;  3GVM A;  1ZLZ A;  3QTC A;  3NR7 A;  2HEP A;  3STZ C;  2X6A A;  4GZR B;  5DM6 V;  3HKC A;  1YTF B;  3OEH G;  1SA0 A;  4GX5 A;  2KB1 A;  4X1Y B;  3ZHT A;  4UCU A;  4JI5 O;  2P90 A;  4JYA O;  3ABL C;  3BVO A;  2IW5 A;  2QJ1 A;  1S5H C;  4E4E A;  4LF8 B;  1SES A;  5B1B C;  3JAM N;  2NN4 A;  3CCV V;  3BFR A;  1PPJ H;  4O4J B;  1SQB H;  2HHH B;  3LSQ A;  1QHT A;  3CCU V;  4LFB B;  2Y4T A;  5H6R A;  1Y66 A;  2PI5 A;  4PA7 A;  4O2A A;  1VMG A;  4Z1M G;  5KHI A;  5LA6 B;  3JAK B;  1Z5W A;  2F43 G;  1XHZ A;  4MTF A;  4FLU A;  3OR6 C;  2IJK A;  3BA9 A;  4JAV A;  4PD4 F;  1I0H A;  1YIT V;  4H37 A;  1BMF G;  4K8Z A;  1AJN A;  1V54 B;  1Q82 W;  1FXK C;  4JI8 B;  4HYO A;  1AB3 A;  4BW9 A;  2WPD G;  4MVQ A;  5JQG B;  1AIL A;  2W0X A;  3ZS8 C;  2DQ3 A;  1SER A;  3UO2 A;  4QPK A;  5EYP B;  2OIG A;  3ABK C;  1IBM O;  1PP9 H;  3DTU B;  2M6Y A;  3W7T A;  4PA9 A;  4LF6 B;  2A9H A;  1OCO C;  2VS0 A;  3CCM V;  2QEX V;  4KFM A;  3UT5 B;  1I5X A;  3CCJ V;  5A9G A;  1SZT A;  2ZNI A;  5JWP A;  4JI2 O;  1JFF B;  1H2S B;  5EC2 C;  4Q20 A;  3AG3 C;  4X62 O;  1NZ6 A;  2FKX A;  1OCO B;  3JAL A;  3QO5 A;  4JYB A;  4UVC A;  5IWA B;  3SDL A;  2Z5U A;  1RSO A;  3CP1 A;  3ZHV A;  2EIJ C;  1KUQ A;  5IY5 B;  3L70 H;  3WFV A;  4B7E A;  1P7G A;  4ICG A;  3K06 A;  1FKA O;  5CA0 A;  5J2U B;  1LUW A;  4KHP O;  1KKD A;  2AZ2 A;  1F4N A;  3K58 A;  1I7F A;  1D5N A;  1TGO A;  3I55 V;  5IY5 C;  3IC9 A;  4MTX A;  3IFX A;  4ZIB A;  4ZI7 B;  4D7T A;  5C8Y A;  2ZIN A;  4NXM O;  3JAR A;  1H2M A;  5DN6 G;  2ZR2 A;  1N32 O;  3EFF K;  4U7O A;  1Q6I A;  4G27 B;  1QLE B;  1N0N A;  2E74 B;  2GV9 A;  5EZY B;  3JAT A;  1VQK V;  1NS1 A;  1ZTE A;  3OW2 U;  3JD1 A;  2QM8 A;  2YUA A;  3H1J H;  3RVY A;  3HR0 A;  4PV1 B;  4QIW F;  3VOU A;  3QF7 A;  5LBQ A;  2KSD A;  1PM9 A;  4FLY A;  3FB6 C;  3CCR V;  3DXR B;  4DK1 A;  5CB4 B;  2YC0 A;  4UB8 Z;  4JGS A;  2G38 A;  2DQ0 A;  4GLX A;  1HNW B;  2WWW A;  3ZMU A;  2XND G;  2LO1 A;  3ML0 A;  3RN4 A;  3SJQ C;  2KQX A;  2Q7G A;  1K4D C;  1B3Q A;  4LFA O;  1JJO A;  2F23 A;  4N23 A;  4DR3 B;  2EIK C;  1NH2 B;  3TET A;  3FX7 A;  5IE9 A;  1Q6H A;  4B3R O;  1YEW A;  4UUJ C;  4WCE V;  3CJH A;  1AI5 A;  4GUN A;  2BTO A;  1KP2 A;  2UU9 B;  1I5Y A;  2VQE B;  1JJ2 U;  1YDX A;  2EIM C;  3RW0 A;  1F23 A;  2ZDI C;  2YXY A;  5J2T B;  4LNU B;  4ZBM A;  1KMI Z;  1GK9 A;  1N33 B;  2R9I A;  5BMV B;  2YDE A;  3FB7 C;  1Y6X A;  4RQF A;  1Q5O A;  4QE9 A;  4GX0 A;  2DN9 A;  2DYS C;  1N0J A;  4CBC A;  4FM0 A;  5H9C A;  1H2K A;  1FXK A;  1KP3 A;  2NNU A;  1Y76 B;  3OUF A;  5IYD O;  3DSQ A;  1U96 A;  1VQ5 V;  1G1X B;  3K0D A;  1MAB G;  4I50 B;  4UCV A;  1I94 O;  2X6C A;  3ZMV A;  2Q6A A;  2HHH O;  3O65 A;  1QLE C;  4ZOL A;  2RMK B;  3OAA G;  3SPG A;  1SC5 B;  3N2G B;  5CBG A;  2PYL A;  4G2K A;  4I55 A;  1RM1 C;  1TAE A;  3HKB A;  4YJ3 A;  3JCU Z;  1K5S A;  1CEZ A;  3CS5 A;  3HKD B;  4TT3 G;  1U97 A;  3HKB B;  1QBZ A;  3RYH A;  3N2G A;  4DW0 A;  2HKO A;  3P3N A;  1OCR C;  2IJJ A;  4Z1V A;  4A5U B;  2B1G A;  1TVK B;  2YEV B;  2QKC A;  1HNX B;  4QGP A;  1JMK C;  4UFZ A;  2BTQ B;  4O4I B;  2QWQ B;  1F7Y A;  2Y69 B;  2CE4 A;  2QM4 A;  2ZCE A;  3CPW U;  3JD2 A;  5BMV A;  4DV1 B;  2UUC B;  3CRA A;  1Q8I A;  1XMQ B;  3LSU A;  2WLK A;  3APO A;  4JI6 O;  4LF5 O;  3D3Q A;  4DV3 B;  1IBK O;  2QM7 A;  3H1K H;  3BAA A;  1E1Q G;  4N21 A;  3C90 A;  3VBB A;  2QR4 A;  1ZSP A;  4OX9 B; 
#chains in the Genus database with same CATH homology
 1B6Q A;  4JPR A;  1FXH A;  4MW8 A;  4P9P A;  1R3J C;  2WSS G;  3LSS A;  3A0R A;  3QO8 A;  3ZN1 A;  1RM1 B;  1YIJ V;  3ABM B;  4PEL A;  1JVM A;  3AG1 C;  1AI7 A;  2FTK A;  4RO2 A;  1BHA A;  2Y48 A;  3ZMT A;  3ABT A;  1KQS U;  1QLN A;  1PD3 A;  1H38 A;  3CC2 V;  3LDE A;  1S3J A;  4JYC A;  4GX2 A;  4UXN A;  4TWK A;  3P32 A;  1TUE B;  1S77 D;  3AG1 B;  1OCC B;  1GM8 A;  3K3W A;  4KUM A;  1VQ4 V;  4PA4 A;  3IGA C;  3FYI B;  3X2Q B;  4FIP C;  2JJ1 G;  4FMT A;  4MSW C;  3ZMS A;  3CYO A;  3OMA B;  2B5U A;  1M9N A;  1M56 B;  3QO7 A;  1K92 A;  5LHG A;  1V55 C;  5EK0 A;  1K4C C;  3JYC A;  4MVM A;  3QNE A;  4X89 A;  2P6J A;  3FB8 C;  4MVZ A;  2ITC C;  2MK3 A;  3D3I A;  1FXV A;  3K0G A;  5BZB A;  3LDC A;  4BW5 A;  3B8M A;  5H6Q A;  1K8A W;  1YJ9 V;  3P30 A;  2ZD9 A;  4WF9 V;  2IH1 C;  2PI4 A;  5L3E A;  2H94 A;  4DO2 A;  2XAS A;  4L87 A;  5EBM C;  1M1K W;  3W7X A;  2EZO A;  3EHB B;  4ZKI A;  4XDK A;  1JPX A;  1EBO A;  3JCZ A;  1EZJ A;  1OZ0 A;  2DW4 A;  3RVZ A;  1THZ A;  1F51 A;  1H2G A;  2UXN A;  1NBM G;  5IYB O;  5B1A B;  1YHQ V;  3D36 A;  2EBO A;  2OT5 A;  3B77 A;  1GO3 F;  4RUE A;  2EIJ B;  3ZRX A;  1E1R G;  2HFE C;  3STZ C;  2QA4 V;  2Q69 A;  4R8C A;  1NVP D;  2X6A A;  1R3K C;  5DM6 V;  1YTF B;  3K04 A;  3OEH G;  4UV8 A;  5EBW C;  3UM7 A;  4GX5 A;  4PDV A;  3CCL V;  2KB1 A;  2HVJ C;  1ROP A;  3W7W A;  3OGC C;  2W0F C;  4RUF A;  2NLJ C;  2Q68 A;  1EFR G;  2WLN A;  2P90 A;  1DTO A;  3ABL C;  1K33 A;  2YSU B;  2IW5 A;  4QE7 A;  5L3F A;  2WLJ A;  5LHI A;  1S5H C;  3T1C A;  2OTL V;  2Z3Y A;  1SES A;  2V7Q G;  5B1B C;  1R73 A;  5CBH A;  3CCV V;  3FKS G;  2W6J G;  4I9W A;  1OCC C;  2XAQ A;  3R65 A;  4GT1 A;  5CMU A;  2XOK G;  3T4Z A;  2AHZ A;  3SPC A;  3SPI A;  3X2Q C;  1VQ9 V;  3LSQ A;  3CCU V;  3UKM A;  1Q86 W;  1N8R W;  4QPJ A;  1GM7 A;  4DXW A;  1M56 C;  1PNL A;  3OR7 C;  5H6R A;  1Y66 A;  3ZRW A;  2PI5 A;  3ZJZ A;  1JX9 A;  1PNK A;  4PA7 A;  4MVU A;  4Z1M G;  4P9O A;  1COW G;  4MVR A;  1KEC A;  2F43 G;  1NKD A;  2ITD C;  1VQM V;  2HVK C;  1F4M A;  4MTF A;  3OR6 C;  2IJK A;  4UVA A;  3CCE V;  4H33 A;  1S0V A;  4JAV A;  1QVF U;  2EIL B;  1UJW B;  2JK5 C;  4H37 A;  1YIT V;  1AJP A;  3ZRW B;  1BMF G;  3G4S V;  4LC1 A;  3K03 A;  1AJN A;  1V54 B;  1FS0 G;  2WLI B;  5HFM A;  1Q82 W;  3SPJ A;  4WFB V;  1FXK C;  4HYO A;  4JTA B;  4BIZ A;  3LDD A;  3WG7 B;  2UXX A;  1GKF A;  2WPD G;  4X8A A;  1SRY A;  4MVQ A;  3ASO C;  3HPL C;  1VQN V;  1YJN V;  1FFT B;  4U7N A;  4MS2 A;  2DQ3 A;  3B8N A;  2ZXW C;  4GX1 A;  4MVO A;  1SER A;  1LNQ A;  3JD0 A;  3SYC A;  3E35 A;  1ORQ C;  1HWY A;  2Q67 A;  4QPK A;  4UVB A;  1PNM A;  2QKS A;  1OCR B;  3BEH A;  4R7C A;  1OHH G;  2WLL A;  3ABK C;  4R50 A;  2ZR3 A;  3DTU B;  1AR1 B;  1K7D A;  2JIZ G;  3W7T A;  4PA9 A;  1GM9 A;  2DYR B;  2EIK B;  2A9H A;  4BIU A;  4PDL A;  1OCO C;  3CCM V;  2QEX V;  4KFM A;  1DF4 A;  2EJR A;  4PA6 A;  3ZRV A;  1I5X A;  5LGN A;  3CCJ V;  1QVG U;  1G8M A;  1SZT A;  2BOB C;  3ABL B;  1H8H G;  2IH3 C;  1K97 A;  5EC2 C;  4Q20 A;  2B1I A;  4HZ3 A;  1DF5 A;  3AG3 C;  1CP9 A;  3HB3 B;  1Q7Y W;  1R6K A;  2EIM B;  1M57 C;  1OCO B;  2HJF C;  3KG2 A;  3SYP A;  3QO5 A;  4JYB A;  1VQP V;  1XL6 A;  4JAS A;  4UVC A;  4WFH A;  2EZP A;  2Z5U A;  3CP1 A;  2EIJ C;  5IY5 B;  3WFV A;  5C93 A;  2JEX A;  5B1O A;  3AG3 B;  1KC8 W;  4JTC B;  3K06 A;  3TK1 A;  3OUS A;  1KKD A;  4JF3 A;  4QNH B;  5KA5 A;  2DYS B;  2EIL C;  3ETD A;  1F4N A;  3MHS C;  5B3S C;  2QE7 G;  2WAM A;  3OMI B;  3I55 V;  5IY5 C;  2HR3 A;  1KD1 W;  4MTX A;  4MVS A;  1V54 C;  3IFX A;  5E1A C;  3ABM C;  1PKX A;  1VQ7 V;  3CC4 V;  3OM3 B;  3MD0 A;  2R9R B;  3FYE B;  4J9Y B;  5DN6 G;  2ZR2 A;  3ZRS A;  3EFF K;  4U7O A;  3E8F A;  4G27 B;  1QLE B;  5CA3 A;  1VQK V;  3W7U A;  5LGU A;  3AG2 B;  2D3O W;  3E89 A;  4MT8 A;  5CN0 A;  1SET A;  1R3L C;  3T2M A;  3F5W C;  3JD1 A;  3OW2 U;  1MG1 A;  5FL7 G;  3RBZ A;  1JQ0 A;  2QM8 A;  3RVY A;  2HG5 C;  3VOU A;  4QIW F;  5LHH A;  2WLL B;  4XBF A;  2WLI A;  4F4L A;  5LBQ A;  3ZMZ A;  3FB6 C;  3T4D A;  3CXC U;  3CCR V;  1RPR A;  3OMN B;  4XDJ A;  4JGS A;  2JJ2 G;  2YEV A;  2DQ0 A;  4X88 A;  3CCQ V;  2WWW A;  3PJS K;  2EIN C;  3ZMU A;  2XND G;  1R6N A;  3E2E A;  3ML0 A;  3SJQ C;  4LBE C;  1QR8 A;  1J95 A;  2IJI A;  1VQL V;  4P30 A;  4EKW A;  4KP4 A;  2XAG A;  1NH2 D;  3OE7 G;  1L1F A;  2ZDI A;  5L3C A;  2K1E A;  1ZWI C;  3JD3 A;  3ABK B;  3E8B A;  1K4D C;  3W7S A;  3ZN0 A;  5IYC O;  4N23 A;  2EIK C;  1NH2 B;  2ATK C;  2JEU A;  5B1A C;  3JD4 A;  3TET A;  3G71 V;  1ARO P;  3DGE A;  1K9M W;  1WPX A;  4UUJ C;  1NQT A;  2M7W A;  4WCE V;  4LP8 A;  5GW7 A;  1AI5 A;  2H8P C;  2IU0 A;  3CME V;  1KP2 A;  2OCC B;  2OTJ V;  3E8G A;  4WFG A;  1I5Y A;  1CPY A;  1JJ2 U;  2HLD G;  3ASN C;  3SYO A;  2EIM C;  3RW0 A;  2GHY A;  4FJC C;  1OCZ C;  1S76 D;  1F23 A;  2ZDI C;  1AJQ A;  3CD6 V;  1GTO A;  1JOY A;  4ZBM A;  3G6E V;  3LNM B;  4UV9 A;  2GSM B;  4P2Z A;  2CK3 G;  2X0L A;  1GK9 A;  1NVP B;  5KUM A;  1WLE A;  1MOF A;  2Y69 C;  4LCU C;  2R9I A;  1P7B A;  1R3I C;  4RQE A;  1Y4M A;  1IXM A;  3AG2 C;  1W0J G;  3I56 V;  5KA6 A;  2QTO A;  5L3G A;  2LP7 A;  2BOC C;  3FB7 C;  1MSW D;  3F7V C;  1GMG A;  2C2A A;  5J9P C;  4RQF A;  1S72 V;  4GX0 A;  2DYS C;  4QE9 A;  1P4R A;  1ENV A;  2DWD C;  3M99 B;  4MW3 A;  4TSF G;  4MTO A;  4CBC A;  5B3S B;  5H9C A;  1BL8 A;  1FXK A;  1KP3 A;  1NR1 A;  1H8E G;  2ZQM A;  2NNU A;  3OUF A;  5CBF A;  2LFR A;  5IYD O;  1VQO V;  1VQ5 V;  3MHH C;  3K0D A;  1MAB G;  2V1D A;  2IU3 A;  1K34 A;  2X6C A;  3ZMV A;  3K9A A;  2Q6A A;  3SYQ A;  3LUT B;  4HAM A;  1QLE C;  1YTF D;  5B1N A;  3OAA G;  3SPG A;  2WLM A;  2JDI G;  1FXK B;  5CBG A;  4ASU G;  2A79 B;  3IC7 A;  4G2K A;  2P7T C;  1AI4 A;  1RM1 C;  3TCU A;  4GCZ A;  1W0K G;  3ASO B;  1K5S A;  5IDJ A;  2AHY A;  1CEZ A;  1QCE A;  1W2B U;  1NJI W;  3WG7 C;  4TT3 G;  4JAU A;  1K73 W;  3K79 A;  1QBZ A;  5KUK A;  2X6B A;  3NXS A;  5EC1 C;  3GWO A;  3CC7 V;  1YSC A;  2ZXW B;  2HKO A;  3AG4 B;  1OCR C;  2IJJ A;  2LFS A;  2XAF A;  4PDR A;  3SYA A;  3E83 A;  1M90 W;  2B1G A;  2DWE C;  2EIN B;  2W6I G;  2YEV B;  4BAY A;  3CMA V;  1K3E A;  2A0L A;  2XAJ A;  4R6Z A;  3ZIA G;  1OCZ B;  4YXW G;  3ETE A;  3GB7 C;  2DYR C;  4WFE A;  3AG4 C;  1YI2 V;  4WFF A;  1V55 B;  2XAH A;  3H01 A;  4G28 B;  2IJH A;  3FB5 C;  1NR7 A;  2Y69 B;  1VQ6 V;  3OEE G;  4XDL A;  3F7Y C;  1XL4 A;  2P67 A;  3ETG A;  3CPW U;  3JD2 A;  3CCS V;  1M57 B;  4J9Z B;  4WFA V;  4E2L A;  3E8H A;  1DLB A;  5EBL C;  4JTD B;  1E79 G;  4RAI A;  5HFL A;  3ZCC A;  1Q81 W;  1AI6 A;  3K08 A;  4PDM A;  1YJW V;  3OFN G;  3ABU A;  3AEI A;  5L3B A;  2WLH A;  2OCC C;  2WLK A;  5L3D A;  4OXS A;  1JCH A;  1QR9 A;  4MTG A;  1RPO A;  1PL0 A;  3ASN B;  5LGT A;  4CZZ A;  4I5S A;  1K5Q A;  5B1B B;  4FK5 C;  3E86 A;  2QM7 A;  4PA3 A;  1G4Y B;  4FPP A;  3BY6 A;  4QJF B;  1E1Q G;  4N21 A;  3SPH A;  3VBB A;  1VQ8 V;  3STL C;  1BHB A;  2X7R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...