3T4DA

Crystal structure of nak2k channel y55f mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALFFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Potassium channel protein
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3t4dA00
2HG5C 2P7TC 3OUSA 2WLJA 5CBFA 2WLHA 2W0FC 3T4ZA 5E1AC 1R3JC 4MTGA 4RO2A 4WFGA 1JVMA 4R6ZA 4GX5A 2QKSA 3E8FA 3F7VC 3AG2C 4H37A 4MW3A 2QTOA 3STZC 2H8PC 3E8BA 2AHZA 3E8GA 4MVOA 1V55C 4QE9A 2EIMC 3LNMB 2ZXWC 4P9OA 1XL4A 3UKMA 2DWDC 4R7CA 2EINC 3T4DA 2ITDC 3TCUA 3FB6C 3FB7C 3K0GA 2WLIA 4G27B 1LNQA 1K4DC 4HYOA 2ZD9A 2X6AA 3K06A 3LDDA 4PDRA 3SPHA 5CBGA 3SYCA 5J9PC 3ASOC 4PA3A 3SPIA 4WFEA 2WLLA 2ITCC 1M56C 3K04A 1J95A 1R3KC 3K0DA 4KFMA 5B3SC 3EFFK 4PDVA 3RW0A 2HFEC 3OGCC 3E86A 4RAIA 2Q67A 3LDCA 4X8AA 2DYRC 2EIKC 4QNHB 3SPCA 2A9HA 2WLIB 3E8HA 4R50A 3BEHA 4P30A 2NLJC 2X6CA 4LCUC 4X89A 3IGAC 5BZBA 5IY5C 4MVUA 2DWEC 4CBCA 3K08A 3SPJA 5B1BC 3AG1C 2EIJC 4ZBMA 2OCCC 4JTDB 4XDKA 3OR6C 4MVZA 1OCOC 5KUKA 1G4YB 3RVZA 1ZWIC 4P9PA 5KUMA 2DYSC 2Q69A 3F7YC 3OR7C 3OUFA 3TETA 3JYCA 1QLEC 4WFFA 2WLMA 3SYPA 3VOUA 3RBZA 1M57C 1KKDA 3RVYA 2IH1C 4EKWA 3WG7C 5B1AC 2AHYA 4BW5A 3FB8C 4H33A 5EBLC 1ORQC 2A79B 2IH3C 3T2MA 2X6BA 4UUJC 4DXWA 2YEVA 3ABMC 3AG4C 4PA9A 4RUEA 3ZRSA 3IFXA 4JTAB 1OCZC 4MS2A 2HVJC 3F5WC 1XL6A 4PA7A 3SJQC 3PJSK 4TWKA 4WFHA 2BOCC 3E83A 4GX0A 3SYOA 4X88A 4MVRA 4OXSA 2BOBC 2WLLB 4PA4A 3GB7C 4JTCB 3R65A 4LBEC 4MVQA 3ZJZA 1K4CC 4GX1A 3STLC 3SYAA 1R3IC 3SYQA 2R9RB 1OCRC 4MVSA 3ASNC 1BL8A 3LUTB 4RUFA 2JK5C 3UM7A 4XDJA 4F4LA 4MW8A 4J9YB 2K1EA 4MTOA 3HPLC 2HJFC 1V54C 5EBWC 4XDLA 3X2QC 3KG2A 3ABKC 4J9ZB 3AG3C 1R3LC 3FB5C 4R8CA 4G28B 1S5HC 4PDLA 2A0LA 4I9WA 4MSWC 2Y69C 2ATKC 3K03A 4P2ZA 5EBMC 3SPGA 2WLKA 2EILC 2Q6AA 5CBHA 4MTFA 4LP8A 2WLNA 2HVKC 2Q68A 4MVMA 1OCCC 1P7BA 3LDEA 4HZ3A 4PDMA 4QE7A 5EC1C 5EC2C 2KB1A 3E89A 5EK0A 3T1CA 3ABLC 4PA6A 4GX2A
chains in the Genus database with same CATH superfamily
4DV2O 1AJNA 5CA1A 5E1AC 1VQ5V 3U10A 2ZNIA 1WP7A 4H37A 5KLVH 5BR8B 1XI1A 4FM2A 1V55C 5JJNB 1KC8W 4DR3O 1NI8A 1YITV 1DGSA 4X1KB 4J80A 3JD1A 5C8YA 1L0LH 4ZI7B 5J2UB 1BCCH 3T1HO 4FLVA 3OGCC 1Z5VA 1K7DA 4JI6O 4CH3A 4LCUC 1PKXA 2UUBO 2R9AA 4UVAA 4DV5B 3RYIB 2EIJC 2YICA 3ZHRA 3QO7A 2QJ1A 4I0XB 5JH7A 2KG7A 3OUFA 1IBLB 3JATB 1GH6A 2D2CB 1KKDA 2EINB 3CC2V 1VF6A 2OCCB 3CXHF 1HNWB 1JMKC 1EN4A 2E5LB 4X66O 4RUEA 1QLEB 1I94O 3CXCU 4MS2A 1VQ7V 1XQ8A 2VRZA 2JJ2G 4YHHB 4LWSA 3J80N 1ZX3A 4PHZA 5LA6A 1XUQA 2V7QG 4MT8A 4LNUA 3SYAA 1X59A 4NXMB 2YEVB 2BTQB 5B1BB 3AG1B 3AEIA 2H3OA 3E35A 3CCVV 3LUTB 5LMUB 1MOFA 1K3EA 4IIJB 4J9YB 1Y4MA 4LF6O 1A32A 4JYAO 1I0HA 4I9WA 1EN5A 2XHBA 4MTFA 1NTZH 3ZRVA 2Q68A 5A2QN 1WB8A 1WLEA 3E89A 1NQTA 4HAMA 1XNRO 4JAAA 4I50A 2LGWA 2ZR3A 1Z5WA 3ZEDA 4YJ2B 4JI4B 2PGGA 2V1DA 1VQ9V 4J42A 3ZHQA 2P5OA 3D8CA 5JQGA 3ASNB 1MNGA 1ZLZA 2YI8A 1NTMH 5H2FZ 1K73W 2WWWA 1YJ9V 3TK1A 3H1JH 5IJ9B 2DQ3A 2YIBD 2X6AA 3LDDA 4NYKA 3SYCA 4WFEA 3K5NA 4H13B 2UUCO 4DW0A 2XAHA 1Q5OA 5J2TB 3DSQA 3E8HA 2A7WA 2R70A 1MMMA 4I55A 3MHSC 4LF7B 1NJIW 1Y76B 1N8RW 4JI1B 2QA4V 5L3GA 3QO5A 2OT5A 1GM7A 2BSKB 5B5EZ 2AHYA 4JYYA 1YJNV 4EFEA 3AK1A 1WAZA 1AR1B 1N33O 4FZ1A 3ZRSA 4BAYA 1PV0A 3O9OA 3J7AU 1BHAA 3R65A 2PTMA 1IDSA 4HNAB 2CGOA 5CA3A 4MVSA 4I9QA 2EIJB 2UXCB 4DUYB 3UM7A 1TUBB 2ZM6O 4DR1O 4FM0A 2ZE5A 4EFBA 3HPLC 2QGNA 2DOSA 1RPOA 4FIPC 3OAAG 1HNZO 4Z1MG 1GMGA 2VS0A 1M1KW 1VMGA 3RYHA 3ZHTA 1YTFB 5IYDO 1I7FA 1IXBA 3WU2Z 3MDSA 2HG5C 3AG7A 1RP3B 4HBNA 4UXNA 2WLHA 4DR6O 1N0JA 4TV8A 4RO2A 3ZHUA 2CUGA 3ETQA 3CRMA 2FB5A 2ZIMA 1JQ0A 2ZXWC 3K59A 3CCJV 3CS5A 1CXZB 3CWBH 1W2BU 4HYOA 3C3TA 5J9PC 1HDJA 5IDJA 3OMAB 1H2NA 3ZMSA 1NZ6A 3A0HZ 2JGDB 2KKWA 3ZN0A 3E86A 2UXDB 1L0NH 4JI8B 1L1FA 1MSDA 4O4LA 4WFAV 4DR2O 3ABTA 4QGPA 2XAJA 4DRXB 1WPXA 4PI2A 4RQEA 3BPZA 3N27A 4K0KO 5TISZ 2ZE6A 3K9SA 5KA5A 1G4YB 5KUKA 2BE3A 3K57A 1OJHA 2F23A 3B2EE 4LFAO 4DR5O 4BIOA 3SJCC 4JPRA 3AK2A 1DF4A 3KCYA 3BHPA 4DR4O 3CCLV 3K79A 4FPPA 4H0LB 3BFRA 5JVDA 4X1IB 2QTSA 3F5WC 3IC7A 5H5NA 4L8JA 5JCOA 1IURA 2UXBO 2F93B 2VQEB 5B66Z 2F66C 3JALA 2IU0A 1PM9A 2YIDA 1PL4A 1XOUA 1RM1B 2HJFC 4XDLA 3AG3C 1U97A 1KMIZ 3ZN1A 5LHGA 5EZYB 1NT2B 4MSWC 4FLTA 4DV7B 2QWPB 4FLXA 1BE3H 1GM9A 3MD0A 4DV1O 5B1OA 1SQXH 1HW7A 4TUYA 3TXQA 5LYJB 3APOA 2P7TC 4GCZA 4WFGA 2WPDG 3O65A 3ZRWB 1FXVA 3DC6A 4RWUA 5LXTB 4JI5B 1KD1W 4JI3O 2W0XA 1QBZA 1ZTEA 2UUCB 2B1GA 3AG2B 3ZIAG 4X1YB 5H6RA 1LNQA 4FK5C 4W4LA 2ZT9B 4G2KA 3ZHSA 5CBGA 3HR0A 2P4VA 4TV9A 1L8DA 2F1MA 4FFKA 3ZMVA 5C93A 4N23A 3OMNB 2DYRC 1XBLA 4R50A 2JVDA 4NB5A 2Q7EA 4K8ZA 1H8HG 1WA8A 4CH5A 3CRRA 3BA9A 4JGSA 5L3CA 3A2FA 5BR8O 3RYFA 1YCIA 2RMKB 3RVZA 1PNMA 3SR2C 2ZE7A 1BHBA 4GUNA 3DXRA 1XHZA 2IH1C 4NTWA 5B1AC 3CCQV 3JD4A 3UO3A 3OTOB 4LF8B 3OE7G 2YXLA 1FFXB 2RCVA 1LUWA 1ENVA 5CMUA 4IGGA 2QEXV 1GAXA 1G6UA 2ZCEA 2FMLA 1WN7A 1RFYA 5EYPB 3CP1A 1FAFA 4J11A 5L3EA 1FD9A 4F4LA 1QNMA 5EBWC 3HKEA 1YI2V 2VWKA 4OGQB 4DV3O 4DYLA 2JS5A 3SPGA 2PF4E 2EILC 1HNWO 2WLNA 5EC1C 2KB1A 3G6BA 5FNVA 2E5LO 4YJ3B 4O2BA 1AR4A 3BCCH 3FX7A 2W0FC 1S5LZ 4MTGA 4QPKA 4BWAA 3E8FA 3P30A 3STZC 1NR7A 3LNMB 4NXMO 1XL4A 1NVPD 4YIPA 2DJVA 5LMUO 2UXXA 3HKDB 1Y74A 2QR4A 2YXYA 4L87A 3ASOC 3JSLA 1SZXA 2DW4A 5KHIA 5KX5B 4WF9V 3LDCA 4X8AA 4QNHB 4B3TB 4O4IA 1GN6A 2VWJA 3IGAC 1UJWB 4MVUA 2UU9B 4JI4O 5EIBC 3L71H 3CCSV 2OCCC 4XDKA 1GM8A 1K5QA 1VEWA 4DR4B 4X20A 1QLEC 4WFFA 4Q6GA 5KHJA 3VOUA 3FAVB 4K3AA 1W0JG 3FB8C 3NR7A 4IL6Z 2LQTA 4UV9A 3CCUV 2UXBB 1KB9F 1OCZC 3L70H 1H2SB 4X64O 4F6EA 4IYHA 1Y66A 5LL6Y 4WCEV 3GB7C 1DK1A 2DYRB 2F95B 5BXZA 3OTFA 3ZCCA 4X1KA 3L74H 1Q8IA 3ZMTA 5LHHA 4ZI7A 2GUZB 4LH6A 5D5QA 3P32A 4KHPB 3CCEV 3W7TA 1GTOA 3CHXA 4LF5B 3ABKC 4JAVA 2EX3A 4JI1O 3GVMA 2XAQA 5HFLA 2CK3G 4LFBO 3K03A 2ATKC 5B1AB 5CBHA 1HNXB 4O2AB 3LSUA 2Q8VA 4HZ3A 1AILA 3HKBA 3CMEV 3H1LH 5CB4A 2MW2B 5LP6A 2XNDG 1XNQB 3E2EA 4FFBB 1WB7A 3G67A 4I0XA 2PY5A 3B40A 1FXKB 4AQYB 3JATA 1VQLV 3F7VC 3MHHC 2QTOA 1LR1A 2AHZA 5IWAB 4QE9A 2EIMC 1VQMV 4ZKIA 4FMTA 1DLBA 2UXCO 3S3WA 4DUYO 2LW7A 2PI5A 2JIZG 4WFBV 3OW2U 2V4DA 3D36A 2EILB 4GKKB 5B3SC 1EZVH 3JAMN 2D3OW 2ZQMA 1TVKB 3SPCA 5ITZB 5BZBA 2NLJC 1MZEA 2ZE8A 4O4HB 2VQFO 1QCEA 2Y0IA 3OFNG 1TUEB 5A9GA 1JFFB 2WA4A 5H6QA 1RSOA 1QVFU 5GONB 2Q69A 2Y48A 2F4VO 1IBMB 4FLUA 1WPBA 2UUAB 1F4MA 4PA9A 1K9MW 2LP7A 3ASOB 5F2VO 2OTLV 1GRJA 4F6RA 3RN4A 1VQ6V 2UXDO 4DR7B 4JI8O 3ML0A 1AJQA 2Q5ZA 1AI4A 3THOA 1Y6XA 4DV3B 4I7ZB 4NVPA 1YHQV 3CSXA 3GWOA 1UPGA 4PJ0Z 4UCSA 1P4RA 2B1IA 3K3WA 5J2TA 1I5YA 3K5LA 1KBHA 1GO3F 3B8NA 1OCZB 3F5TA 4J41A 3N2KB 4UCOA 2FTKA 5DN6G 4FLZA 1JJOA 2CGNA 2QKSA 4J7KA 3E22A 3CYOA 3CD6V 1UFIA 4BIZA 2VQEO 4DV6B 2EBOA 4LC1A 3FB7C 4ASUG 5H9CA 4IHJB 5E79Z 3CCRV 4U3JA 3ABKB 2ZD9A 1HP8A 1EZJA 2MK3A 5CN0A 1J95A 1R3KC 3B77A 4X65B 3K0DA 4DV7O 3M99B 1R6TA 1S5JA 2A9HA 1SETA 5C8YB 1AP5A 2EZOA 1TUBA 3EVKA 4D6TH 1FFTB 3D3IA 1JA8A 1ZWIC 4UCVA 1Z2GA 2JEUA 2EIMB 4ZIBA 4JI5O 2CTWA 3ZRXA 3RVYA 1KP2A 4X64B 4Z2WA 2QWOB 1ROPA 2IH3C 3QTCA 4CS3A 4FM1A 2UXNA 1SQVH 1U96A 3B09A 1SZTA 5JH7B 4WFHA 2LJ2A 3E83A 5B3SB 2N05A 2FL4A 1Y67A 4OXSA 2IM9A 4MVQA 2E74B 2EJRA 1RM1C 3RYCA 1R6KA 3Q4HA 4LFBB 1BZKA 1BGYH 4JI2B 1H2LA 1KYOF 3RGBA 2Q73A 2BCCH 4H44B 4PI0A 4LWSB 2XTAA 5LA6B 2XAGA 2QE7G 4LNUB 2ARHA 3ZHVA 3DC5A 4IYIA 2HVKC 4ZOLA 2QM4A 3OTOO 3T1CA 4LF8O 4O4JA 1XREA 2WAMA 4GKJB 5L3BA 3CMAV 1H2KA 3I5DA 3AG2C 2Y4TA 3E8GA 4DK1A 1BS3A 1THZA 5BMVB 5FLXN 1B6QA 1TAEA 1N32B 2WLIA 2XT9A 3MAQA 3PN1A 4X1IA 2R72A 2QKCA 1HWYA 2L35A 4D7TA 3K06A 2M6YA 1R1BA 2VQFB 1SQQH 3BAAA 3CB2A 3JAKB 2HFEC 3N2GA 3IAYA 3QNEA 4U7OA 2F4VB 1KUQA 4CBCA 4ZBMA 4JTDB 3UO2A 5EZYA 2EIKB 1GN3A 4DV4O 1NH2D 2PUSA 5KUMA 4BW9A 3DGEA 2CDYA 3SYPA 5LGNA 3K5OA 1YEWA 4GLXA 4CC6A 4UUJC 5HFMA 3AG4C 4I55B 1M5IA 1IX9A 2HHHO 1CP9A 5D5PA 5LGTA 2HJDA 3W7XA 1DTOA 4B3TO 1R3IC 2UU9O 2JK5C 3CRCA 5KHKA 3X2QC 2RNBA 4PELA 4R8CA 4JF3A 2ZIOA 1P84F 2E75B 1YIJV 4CC5A 1COWG 1SRYA 4E2LA 5CA0A 1Q6UA 2Y69B 1CPYA 3LNNA 4NXNB 1JVMA 4R6ZA 3CJHB 4MW3A 2HKOA 1ZL8B 2Q0OC 1Q81W 2YS8A 1EM1A 4K8XA 5FPOA 1MSWD 2OIEA 2O57A 1CEZA 3UT5A 4KHPO 4CS4A 1FPOA 3FD9A 1AROP 1Q7YW 4LF5O 1VQPV 1K5SA 1HNXO 2X7RB 4X9QA 4KFMA 1SQBH 2A3QA 4Z1VA 5IYZB 2JGUA 1E1QG 1M56B 2QWQB 1XNQO 4MTXA 1K97A 4AQYO 2ETNA 1QLNA 1XILA 1BMFG 1TA8A 3F7YC 3I56V 4AI8A 1YVWA 5IWAO 1J5EB 4O4LB 4AILC 2CE4A 4YJ3A 2Q4PA 2HEPA 4NR1A 4TOIA 4UV8A 3WG7B 3PJSK 4GKKO 3J81N 2RN9A 4PA4A 2ODMA 1P7GA 4B08A 5IJ0A 1JOYA 2P6JA 1SF9A 1V9PA 3HKDA 2YSUB 3SJAC 1BL8A 2CTPA 2BTOA 4CH4A 1V54C 5B1NA 1IBMO 1N34B 4TQFA 1Q86W 1WJZA 1AI6A 1PNKA 1FXKC 4PDMA 2UUAO 5EC2C 2KSDA 4TQDA 3AG4B 3TXSA 1Q82W 1NR1A 4W4KA 2ZKOA 5IYCO 3T4ZA 4PD4F 1JCHA 3FAVA 4E4EA 4DR7O 2YXHA 3L75H 4I4TB 5LOVA 1D5NA 1GKFA 5IT9N 2DWDC 2ITDC 4C7UA 1XMOB 3VBBA 3X2QB 1S72V 4LR3A 5KAFZ 4JI7B 4ZHQA 5K1PA 2HP8A 2P4KA 3CX5F 2AXTZ 4PDVA 3CCMV 1G8MA 2GUZA 2CH7B 4FLWA 2ADPA 3JARB 4DV4B 1N36O 1VIBA 2X6CA 1MZFA 3B8MA 2IW5A 1H8EG 4QPJA 1KQSU 4TV9B 1YZBA 1IZ3A 1JPXA 4DO2A 2EZPA 4NTXA 5IY5B 3OR7C 5KMGB 3CE2A 4EB6B 1AI5A 2WLMA 4DV6O 1ZUQA 1XDCA 2P90A 3P3PA 1DF5A 2HHHB 5EBLC 2A79B 4FFBA 2DN9A 2X6BA 5KA6A 1SC5B 2PZSA 3G71V 4X65O 2OYQA 4QIWF 3BA8A 1H38A 1S0VA 3VQVA 3STLC 3UCSC 3SYQA 2ILMA 3L72H 4DUZB 2R9RB 3LSSA 1AJPA 1OV9A 2ADQB 4X62B 5IYBO 2K1EA 4UVCA 1VP7A 2ZR2A 3KG2A 2ZDIC 4JZ2A 3JD0A 1YSCA 2P22C 2P06A 1SA0B 1AVMA 1ZSPA 1JR9A 4MVMA 4O4HA 4UFZA 3WB1A 1R6NA 2NN4A 1JFFA 4KUMA 4PA6A 4UVBA 3OUSA 2QWRB 5J2UA 4B3RB 1BQZA 1OCCB 3ZX6A 1AB3A 3H9VA 3QO8A 3K5MA 1XHXA 1MG1A 1ZAUA 1NU1H 2FKXA 1XMQO 2F43G 5LGUA 3ZS8C 4JI2O 3CEIA 1V54B 3JAWB 3RYIA 2QM8A 1X4TA 2ITCC 3K04A 2CTQA 1FJGB 1MA1A 1QHTA 4J7JA 1NBMG 1NH2B 2H94A 1Y74B 2RQ6A 3FYIB 3SDLA 3T1YB 4GKJO 2Q7GA 1QQCA 4FZ0A 2L6LA 1H2GA 3ETEA 3RBZA 1K33A 3I55V 1VQOV 1N32O 3OT7A 1W59A 4B3SB 5LHIA 1QVGU 2YEVA 3ABMC 2BTQA 1VF6C 4BIUA 1SERA 4GYCB 3JASB 3AK3A 4IIJA 3KCXA 3S3XA 4WBNB 4X88A 1KECA 2WLLB 4UCRA 1I08A 2N74A 1EBOA 1JX9A 3TJTA 3OGIB 2X0LA 4BR6A 4YJ2A 1I5XA 1PL0A 4FJCC 1IBKB 3P3NA 1R3LC 3IC9A 3ZMUA 2Q6AA 2LO1A 3KKYA 4QJFB 2LFSA 1H2MA 5IJ9A 1KP3A 3ZBHA 3H1IH 5DM6V 2Z3YA 3QF7A 1OHHG 4JI0B 4I5SA 3HKBB 1YF2A 5CB4B 5LP6B 5DEDA 4G27B 1K4DC 1WP8A 4FLYA 3APQA 3SPHA 1N36B 4RQFA 2OWOA 1Q43A 1Y76A 3B4SA 3K58A 1PP9H 2ZINA 2IJJA 2EIKC 3VQWA 2BSKA 2CTRA 5GTHZ 1N0NA 1YJWV 4LH7A 4OX9B 5LMNB 2Z5UA 4OPHA 1Q3EA 3SPJA 3ZMZA 3U11A 3HKCB 4NXNO 4LF4B 2PI4A 5CA1B 4J7ZA 2GSMB 5JJEB 1IVSA 4EKWA 1OCOB 2RDCA 4B7KA 1ORQC 4HNAA 4TSFG 1F23A 3M7MX 1M57B 1RSOB 2HVJC 2RJZA 3RFRA 4LFCB 2HLDG 4YXWG 2WA3A 2FYUH 2JJ1G 3VQXA 5BMVA 4GT1A 1F4NA 3H1HH 2ZNJA 1OCRC 2YI9A 4RUFA 4LF9B 4MW8A 2DE0X 4F6RB 3JAKA 1F7YA 1J5EO 2Y69C 3KZIZ 4P2ZA 1G1XB 2WLKA 1VQ4V 2KG7B 4LP8A 2Y0PA 3L9DA 3SGIA 1KU9A 4N21A 4YIOA 1B3QA 3ABMB 2IJIA 4U7NA 4J9ZB 5GTIZ 1XMQB 2PYLA 4YY3B 4GX5A 1FYJA 1Q6IA 2H8PC 3E8BA 4MVOA 4DW1A 1Q6HA 2JGDA 3TCUA 2LW1A 2QM7A 1V55B 4DRXA 1N34O 3E22B 1BT8A 1M56C 3G80A 1B04A 1Q90D 3QVNA 2AZ2A 3EFFK 1NVPB 4DK0A 3RW0A 2P67A 1KKCA 3OM3B 4P30A 4X89A 1BQ0A 2LGQA 4U3JB 4JZGA 4KL1A 2JS3A 4I50B 4MVZA 5KAIZ 3NXSA 1K34A 3WG7C 2GHYA 1P49A 4H33A 2OIGA 1XMOO 2XASA 2Q7HA 3BY6A 5JQGB 2LFRA 4DXWA 2JDIG 1SQFA 5AG2A 2IBZH 3IFXA 4JTAB 4B3MO 2Z0AA 3CJHA 4JASA 4UCUA 4JI7O 4DV2B 1K8AW 1XL6A 3A0BZ 1ZL8A 3SYOA 2XAFA 4MVRA 2BOBC 1T5EA 1FKAO 3CRAA 3BABA 1K4CC 3ICXA 4JAUA 5JCOC 4DR3B 2Y4UA 1MABG 1VF7A 4J10A 4MTOA 5LYJA 1WNSA 3T1HB 5IYZA 4PDLA 5EBMC 2GDSA 1SS3A 3SJBC 1SQGA 3CC4V 3ZRWA 3RYCB 4QE7A 1P7BA 3Q4HB 5LXTA 2E76B 4AHCA 5FL7G 3EHBB 2QSAA 4JI6B 5K1XA 2UUBB 3WFVA 4X1YA 2JRIA 3A8TA 1SKVA 1US6A 4JYBA 4ZOLB 1OCRB 4P9OA 3U0ZA 4DUZO 4R7CA 1GN2A 3T4DA 4O4JB 4Q20A 1K92A 3WB2A 4X62O 1SESA 4X66B 1I94B 2R9IA 5BY1A 1S77D 3WB0A 3G4SV 2IJKA 3EXAA 5GW7A 1EN6A 2OCHA 2WLIB 1O9HA 3BEHA 5IY5C 3RYHB 4B3RO 1VQNV 2N04A 1W0KG 1FFXA 4LF6B 2DYSC 4TV8B 3BRCA 2QKAA 3JYCA 3N2GB 4JYAB 1YXBA 2B9ZA 2PYJA 3OMIB 4BW5A 1URFA 2Q9LA 1S76D 5EYPA 4TT3G 1XNRB 5EIBD 4KP4A 2GBOA 4PA7A 3SJQC 4NTYA 4TWKA 1BSMA 2BOCC 3FYEB 1FJGO 4I4TA 1S3JA 3ZJZA 3W7WA 2NR5A 3D3QA 5KHHA 2M7WA 3T1YO 5DECA 4UB6Z 4XDJA 1HR0O 4JV5O 3CPWU 5L3FA 2QDOA 1S5HC 4XBFA 2CH7A 2GTSA 3JARA 4DV0O 4ABMA 2C2AA 1JJ2U 1OCCC 2YIBA 3LDEA 4B3SO 2WSSG 3ABLC 1N4CA 1GN4A 2WLJA 2HR3A 3BVOA 5KMGA 1R3JC 5JVDB 4EB6A 3G6EV 3M8AA 1E79G 2GV9A 5KX5A 5CA0B 1AR5A 3A0RA 3OD4A 2AZ0A 3JALB 3DTUB 1N33B 1VARA 4PDRA 2QWNB 5LBQA 2ZXWB 1IBKO 3SPIA 2A06H 4PV1B 2XUMA 1QR8A 3JCUZ 5IE9A 4RAIA 3UT5B 3FFQA 3RWRD 3K9AA 4CS2A 2DWEC 3W7UA 4TUYB 3OR6C 2ZM6B 4FVMA 4DR1B 1QU7A 1SA0A 2YIAA 3OEHG 1M4UA 4JI0O 4B3MB 1HNZB 2YC0A 1VF5B 4DV5O 2EJ7A 3IJ4A 2DMXA 1IBLO 2YDEA 4DR6B 1M93A 3JCZA 2CAZC 1TGOA 4U3FH 1B06A 4LBEC 3JD3A 2AGAA 2OTJV 2XOKG 4O2AA 3JSNA 4GX1A 4OX9O 4A5UB 5LMNO 1AP6A 1R73A 3JAWA 1VQKV 3C90A 1E1RG 3TGUH 4YHHO 4NKGB 4LF4O 1WA8B 1FXHA 2DYSB 3H1KH 1FXKA 3FB5C 3RT3C 3RYFB 5IJ0B 4KXRA 2IJHA 1NTKH 3T2MA 3DXRB 3ETDA 3AG3B 1SQPH 3W7SA 1D5AA 3LSQA 4DR2B 1XEQA 4GX2A 5CBFA 4LFCO 4B7EA 3QG5A 4K0KB 1YTFD 5LP6C 3H01A 3UQ8A 4LFAB 4DR5B 2K9PA 2G38A 1LUVA 3UKMA 4CZZA 2EINC 2YUAA 4OPAA 3FB6C 1TVKA 3K0GA 3JASA 5ITZA 4LF9O 4JYCA 1F51A 1M90W 4WBNA 4PA3A 1NKDA 2WLLA 5JJJB 3HKEB 5GONA 2NNUA 5LOVB 3R66A 3VQYA 2Q0AA 4UB8Z 1QR9A 2Q67A 3ABLB 1YDXA 3D36C 3FKSG 3ETGA 2W6IG 3JD2A 1OZ0A 5FNVB 3K08A 4O2BB 5B1BC 3AG1C 4ZHQB 4K35A 4YY3O 2W6JG 1OCOC 2DQ0A 4D7SA 4P9PA 3HB3B 4ICGA 3TETA 2EULA 1O9GA 5KHGA 4GZRB 1M57C 3L73H 4LF7O 2GTAA 4EEQA 4DV1B 3ABUA 5L3DA 2B5UA 1PNLA 1IXMA 1GK9A 1M9NA 2IU3A 3OEEG 2E3CA 4GX0A 3C3SA 1PPJH 1EFRG 2KQXA 4JTCB 1HR0B 4JV5B 5JWPA 3GWKC 2AW9A 1PD3A 4JI3B 2JEXA 3ASNC 2ZDIA 4DV0B 3CRQA 4O4IB 1VQ8V 1FS0G 3N2KA 3CC7V 4CH6A 5FPRA 4G28B 1AI7A 2A0LA 4IT5A 4X20B 4UCTA 1RPRA 5EK0A 1D2DA 3HKCA 1NS1A 4IHJA
chains in the Genus database with same CATH topology
1CPYA 1AJNA 2W0FC 5E1AC 1VQ5V 4MTGA 1JVMA 4R6ZA 4GX5A 4QPKA 3E8FA 4H37A 3P30A 4MW3A 2HKOA 3STZC 2H8PC 3E8BA 4MVOA 1Q81W 1V55C 1NR7A 3LNMB 1KC8W 1MSWD 1XL4A 1NVPD 1CEZA 1YITV 3TCUA 3JD1A 2UXXA 2QM7A 4L87A 1AROP 1V55B 1Q7YW 1VQPV 1K5SA 3ASOC 1M56C 2X7RB 4KFMA 2DW4A 3EFFK 1NVPB 3RW0A 3OGCC 4WF9V 2P67A 1K7DA 3LDCA 4X8AA 4QNHB 3OM3B 4P30A 4LCUC 1E1QG 1PKXA 1M56B 3IGAC 4X89A 4MVUA 4MTXA 1UJWB 1K97A 4UVAA 2EIJC 3CCSV 2OCCC 4XDKA 1GM8A 4MVZA 1K5QA 3QO7A 1QLNA 1BMFG 3F7YC 3NXSA 3OUFA 3I56V 1QLEC 1K34A 4WFFA 3VOUA 1KKDA 2EINB 3CC2V 2OCCB 1W0JG 3WG7C 2GHYA 3FB8C 4H33A 2XASA 4UV9A 3CCUV 3BY6A 2LFRA 4DXWA 2JDIG 4RUEA 1QLEB 3IFXA 4JTAB 1OCZC 3CXCU 4MS2A 4JASA 4UV8A 3WG7B 1VQ7V 1K8AW 1XL6A 3PJSK 3SYOA 2JJ2G 1Y66A 2XAFA 4MVRA 4WCEV 2BOBC 4PA4A 3GB7C 2DYRB 2V7QG 3ZCCA 4MT8A 1JOYA 2P6JA 1K4CC 4JAUA 3SYAA 3ZMTA 5LHHA 2YEVB 2YSUB 3AG1B 5B1BB 3AEIA 3E35A 3P32A 3CCVV 1BL8A 3LUTB 3CCEV 1MOFA 1MABG 1K3EA 3W7TA 4J9YB 1GTOA 4MTOA 1V54C 1Y4MA 5B1NA 3ABKC 4JAVA 4PDLA 2XAQA 5HFLA 1Q86W 2CK3G 4I9WA 3K03A 2ATKC 5EBMC 5B1AB 5CBHA 3CC4V 1AI6A 4MTFA 3ZRWA 3ZRVA 1PNKA 1FXKC 2Q68A 4PDMA 4QE7A 1P7BA 4HZ3A 5EC2C 1WLEA 3AG4B 3E89A 3CMEV 1NQTA 4HAMA 3EHBB 5FL7G 1Q82W 2ZR3A 1NR1A 2XNDG 3E2EA 3WFVA 5IYCO 3T4ZA 1FXKB 1JCHA 2V1DA 1VQLV 3F7VC 3MHHC 1VQ9V 2QTOA 2AHZA 4QE9A 2EIMC 4JYBA 1VQMV 1OCRB 4P9OA 1GKFA 3ASNB 2DWDC 4ZKIA 4R7CA 4FMTA 3T4DA 2ITDC 1K73W 1DLBA 2WWWA 4Q20A 1YJ9V 3TK1A 1K92A 3VBBA 1SESA 2DQ3A 3X2QB 1S72V 2PI5A 2JIZG 2X6AA 4WFBV 3LDDA 3OW2U 3SYCA 4WFEA 2R9IA 3D36A 2EILB 5B3SC 1S77D 4PDVA 3G4SV 3CCMV 1G8MA 2IJKA 2D3OW 2ZQMA 2XAHA 5GW7A 3SPCA 2WLIB 3E8HA 3BEHA 5BZBA 2NLJC 2X6CA 5IY5C 3B8MA 2IW5A 1QCEA 1H8EG 3OFNG 4QPJA 1KQSU 1VQNV 1TUEB 3MHSC 1NJIW 5H6QA 1W0KG 1N8RW 1QVFU 1JPXA 4DO2A 2EZPA 5IY5B 2DYSC 2Q69A 2Y48A 3OR7C 3JYCA 1AI5A 5L3GA 2QA4V 2WLMA 3QO5A 2OT5A 1GM7A 3OMIB 2P90A 2AHYA 4BW5A 1DF5A 1YJNV 5EBLC 2A79B 1S76D 1AR1B 1F4MA 2X6BA 4TT3G 4PA9A 3ZRSA 1K9MW 2LP7A 4BAYA 3ASOB 5KA6A 4KP4A 4PA7A 3SJQC 4TWKA 3G71V 2BOCC 3FYEB 2OTLV 1S3JA 4QIWF 1BHAA 1VQ6V 3R65A 1H38A 3ZJZA 3ML0A 1AJQA 1S0VA 3W7WA 1AI4A 3STLC 3SYQA 5CA3A 2M7WA 2R9RB 4MVSA 3LSSA 1AJPA 2EIJB 1YHQV 3UM7A 4XDJA 3GWOA 5IYBO 2K1EA 4UVCA 2ZR2A 3CPWU 3HPLC 5L3FA 3KG2A 2ZDIC 3JD0A 1RPOA 4FIPC 1YSCA 1S5HC 1P4RA 2B1IA 3OAAG 4XBFA 4Z1MG 3K3WA 1GMGA 1I5YA 2C2AA 1M1KW 1JJ2U 4MVMA 1OCCC 3LDEA 1YTFB 1GO3F 5IYDO 2WSSG 1R6NA 1OCZB 3ABLC 3B8NA 4KUMA 4PA6A 4UVBA 2HG5C 2FTKA 3OUSA 2WLJA 2HR3A 2WLHA 4UXNA 5DN6G 1OCCB 1R3JC 4RO2A 2QKSA 3CYOA 3QO8A 3CD6V 3G6EV 4BIZA 1MG1A 1JQ0A 1E79G 2ZXWC 2EBOA 2F43G 5LGUA 3A0RA 4LC1A 3FB7C 4ASUG 5H9CA 3CCJV 1W2BU 3DTUB 4HYOA 3CCRV 1V54B 3ABKB 2ZD9A 4PDRA 5J9PC 5LBQA 2ZXWB 5IDJA 3SPIA 2QM8A 1EZJA 2MK3A 3OMAB 2ITCC 3K04A 5CN0A 1J95A 1R3KC 3B77A 3K0DA 3ZMSA 1QR8A 3M99B 3ZN0A 3E86A 4RAIA 1NBMG 1L1FA 4WFAV 2A9HA 1SETA 1NH2B 2EZOA 3ABTA 2H94A 3K9AA 3FYIB 2DWEC 3W7UA 2XAJA 1WPXA 4RQEA 3OR6C 1FFTB 1G4YB 3D3IA 5KA5A 5KUKA 1ZWIC 2JEUA 2EIMB 1H2GA 3ETEA 3OEHG 3RBZA 4JPRA 3ZRXA 3RVYA 1KP2A 1K33A 3I55V 1DF4A 1VQOV 1ROPA 2IH3C 3CCLV 3K79A 4FPPA 5LHIA 1QVGU 2YEVA 3ABMC 2UXNA 4BIUA 1SERA 1SZTA 3F5WC 4WFHA 5B3SB 3E83A 3IC7A 3JCZA 4X88A 1KECA 4OXSA 2WLLB 4LBEC 4MVQA 3JD3A 2OTJV 2XOKG 2EJRA 1RM1C 4GX1A 1EBOA 1JX9A 1R6KA 2IU0A 1R73A 1VQKV 1E1RG 2X0LA 1FXHA 2DYSB 2HJFC 1RM1B 4XDLA 1I5XA 1PL0A 4FJCC 1FXKA 3AG3C 1R3LC 3FB5C 3ZN1A 5LHGA 2XAGA 4MSWC 2QE7G 3ZMUA 2IJHA 2Q6AA 2HVKC 3T2MA 1GM9A 4QJFB 3MD0A 2LFSA 3AG3B 3ETDA 5B1OA 3W7SA 3T1CA 3LSQA 4GX2A 2P7TC 2WAMA 5CBFA 4GCZA 5L3BA 3CMAV 4WFGA 1KP3A 1YTFD 2WPDG 3AG2C 5DM6V 2Z3YA 3ZRWB 1FXVA 3H01A 1OHHG 3E8GA 1KD1W 4I5SA 1THZA 3UKMA 1B6QA 1QBZA 4CZZA 2EINC 3FB6C 2B1GA 3AG2B 3K0GA 2WLIA 3ZIAG 5H6RA 4G27B 1LNQA 1K4DC 4FK5C 4G2KA 1HWYA 4JYCA 1F51A 5CBGA 3SPHA 3K06A 1M90W 4PA3A 1NKDA 2WLLA 4RQFA 3ZMVA 2NNUA 5C93A 4N23A 2HFEC 1QR9A 2Q67A 2IJJA 3OMNB 2DYRC 3QNEA 4U7OA 2EIKC 3ABLB 3FKSG 3ETGA 4R50A 1YJWV 2W6IG 3JD2A 1OZ0A 2Z5UA 4CBCA 3K08A 1H8HG 3SPJA 3ZMZA 5B1BC 3AG1C 4ZBMA 4JTDB 4JGSA 2W6JG 1OCOC 5L3CA 2EIKB 2DQ0A 3RVZA 1NH2D 4P9PA 2PI4A 1PNMA 3HB3B 5KUMA 3TETA 3DGEA 1BHBA 2GSMB 3SYPA 5LGNA 1M57C 2IH1C 4EKWA 5B1AC 1OCOB 1ORQC 3CCQV 3JD4A 4TSFG 4UUJC 1F23A 3AG4C 5HFMA 3ABUA 1M57B 3OE7G 5L3DA 2B5UA 1PNLA 2HVJC 1IXMA 1GK9A 1M9NA 2IU3A 2HLDG 1ENVA 3OEEG 4GX0A 5CMUA 1CP9A 4YXWG 2QEXV 2JJ1G 5LGTA 1EFRG 4JTCB 3W7XA 4GT1A 1DTOA 1F4NA 1PD3A 1R3IC 2JEXA 3CP1A 1OCRC 3ASNC 2ZDIA 1VQ8V 4RUFA 5L3EA 2JK5C 4F4LA 4MW8A 1FS0G 3CC7V 3X2QC 5EBWC 1YI2V 4PELA 4R8CA 4G28B 4JF3A 1AI7A 2A0LA 2Y69C 3SPGA 4P2ZA 2WLKA 2EILC 1VQ4V 4LP8A 2WLNA 1YIJV 5EC1C 4N21A 1COWG 1SRYA 2KB1A 1RPRA 3ABMB 4E2LA 5EK0A 2IJIA 4U7NA 2Y69B 4J9ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HG5 C;  2P7T C;  3OUS A;  2WLJ A;  5CBF A;  2WLH A;  2W0F C;  3T4Z A;  5E1A C;  1R3J C;  4MTG A;  4RO2 A;  4WFG A;  1JVM A;  4R6Z A;  4GX5 A;  2QKS A;  3E8F A;  3F7V C;  3AG2 C;  4H37 A;  4MW3 A;  2QTO A;  3STZ C;  2H8P C;  3E8B A;  2AHZ A;  3E8G A;  4MVO A;  1V55 C;  4QE9 A;  2EIM C;  3LNM B;  2ZXW C;  4P9O A;  1XL4 A;  3UKM A;  2DWD C;  4R7C A;  2EIN C;  3T4D A;  2ITD C;  3TCU A;  3FB6 C;  3FB7 C;  3K0G A;  2WLI A;  4G27 B;  1LNQ A;  1K4D C;  4HYO A;  2ZD9 A;  2X6A A;  3K06 A;  3LDD A;  4PDR A;  3SPH A;  5CBG A;  3SYC A;  5J9P C;  3ASO C;  4PA3 A;  3SPI A;  4WFE A;  2WLL A;  2ITC C;  1M56 C;  3K04 A;  1J95 A;  1R3K C;  3K0D A;  4KFM A;  5B3S C;  3EFF K;  4PDV A;  3RW0 A;  2HFE C;  3OGC C;  3E86 A;  4RAI A;  2Q67 A;  3LDC A;  4X8A A;  2DYR C;  2EIK C;  4QNH B;  3SPC A;  2A9H A;  2WLI B;  3E8H A;  4R50 A;  3BEH A;  4P30 A;  2NLJ C;  2X6C A;  4LCU C;  4X89 A;  3IGA C;  5BZB A;  5IY5 C;  4MVU A;  2DWE C;  4CBC A;  3K08 A;  3SPJ A;  5B1B C;  3AG1 C;  2EIJ C;  4ZBM A;  2OCC C;  4JTD B;  4XDK A;  3OR6 C;  4MVZ A;  1OCO C;  5KUK A;  1G4Y B;  3RVZ A;  1ZWI C;  4P9P A;  5KUM A;  2DYS C;  2Q69 A;  3F7Y C;  3OR7 C;  3OUF A;  3TET A;  3JYC A;  1QLE C;  4WFF A;  2WLM A;  3SYP A;  3VOU A;  3RBZ A;  1M57 C;  1KKD A;  3RVY A;  2IH1 C;  4EKW A;  3WG7 C;  5B1A C;  2AHY A;  4BW5 A;  3FB8 C;  4H33 A;  5EBL C;  1ORQ C;  2A79 B;  2IH3 C;  3T2M A;  2X6B A;  4UUJ C;  4DXW A;  2YEV A;  3ABM C;  3AG4 C;  4PA9 A;  4RUE A;  3ZRS A;  3IFX A;  4JTA B;  1OCZ C;  4MS2 A;  2HVJ C;  3F5W C;  1XL6 A;  4PA7 A;  3SJQ C;  3PJS K;  4TWK A;  4WFH A;  2BOC C;  3E83 A;  4GX0 A;  3SYO A;  4X88 A;  4MVR A;  4OXS A;  2BOB C;  2WLL B;  4PA4 A;  3GB7 C;  4JTC B;  3R65 A;  4LBE C;  4MVQ A;  3ZJZ A;  1K4C C;  4GX1 A;  3STL C;  3SYA A;  1R3I C;  3SYQ A;  2R9R B;  1OCR C;  4MVS A;  3ASN C;  1BL8 A;  3LUT B;  4RUF A;  2JK5 C;  3UM7 A;  4XDJ A;  4F4L A;  4MW8 A;  4J9Y B;  2K1E A;  4MTO A;  3HPL C;  2HJF C;  1V54 C;  5EBW C;  4XDL A;  3X2Q C;  3KG2 A;  3ABK C;  4J9Z B;  3AG3 C;  1R3L C;  3FB5 C;  4R8C A;  4G28 B;  1S5H C;  4PDL A;  2A0L A;  4I9W A;  4MSW C;  2Y69 C;  2ATK C;  3K03 A;  4P2Z A;  5EBM C;  3SPG A;  2WLK A;  2EIL C;  2Q6A A;  5CBH A;  4MTF A;  4LP8 A;  2WLN A;  2HVK C;  2Q68 A;  4MVM A;  1OCC C;  1P7B A;  3LDE A;  4HZ3 A;  4PDM A;  4QE7 A;  5EC1 C;  5EC2 C;  2KB1 A;  3E89 A;  5EK0 A;  3T1C A;  3ABL C;  4PA6 A;  4GX2 A; 
#chains in the Genus database with same CATH topology
 4DV2 O;  1AJN A;  5CA1 A;  5E1A C;  1VQ5 V;  3U10 A;  2ZNI A;  1WP7 A;  4H37 A;  5KLV H;  5BR8 B;  1XI1 A;  4FM2 A;  1V55 C;  5JJN B;  1KC8 W;  4DR3 O;  1NI8 A;  1YIT V;  1DGS A;  4X1K B;  4J80 A;  3JD1 A;  5C8Y A;  1L0L H;  4ZI7 B;  5J2U B;  1BCC H;  3T1H O;  4FLV A;  3OGC C;  1Z5V A;  1K7D A;  4JI6 O;  4CH3 A;  4LCU C;  1PKX A;  2UUB O;  2R9A A;  4UVA A;  4DV5 B;  3RYI B;  2EIJ C;  2YIC A;  3ZHR A;  3QO7 A;  2QJ1 A;  4I0X B;  5JH7 A;  2KG7 A;  3OUF A;  1IBL B;  3JAT B;  1GH6 A;  2D2C B;  1KKD A;  2EIN B;  3CC2 V;  1VF6 A;  2OCC B;  3CXH F;  1HNW B;  1JMK C;  1EN4 A;  2E5L B;  4X66 O;  4RUE A;  1QLE B;  1I94 O;  3CXC U;  4MS2 A;  1VQ7 V;  1XQ8 A;  2VRZ A;  2JJ2 G;  4YHH B;  4LWS A;  3J80 N;  1ZX3 A;  4PHZ A;  5LA6 A;  1XUQ A;  2V7Q G;  4MT8 A;  4LNU A;  3SYA A;  1X59 A;  4NXM B;  2YEV B;  2BTQ B;  5B1B B;  3AG1 B;  3AEI A;  2H3O A;  3E35 A;  3CCV V;  3LUT B;  5LMU B;  1MOF A;  1K3E A;  4IIJ B;  4J9Y B;  1Y4M A;  4LF6 O;  1A32 A;  4JYA O;  1I0H A;  4I9W A;  1EN5 A;  2XHB A;  4MTF A;  1NTZ H;  3ZRV A;  2Q68 A;  5A2Q N;  1WB8 A;  1WLE A;  3E89 A;  1NQT A;  4HAM A;  1XNR O;  4JAA A;  4I50 A;  2LGW A;  2ZR3 A;  1Z5W A;  3ZED A;  4YJ2 B;  4JI4 B;  2PGG A;  2V1D A;  1VQ9 V;  4J42 A;  3ZHQ A;  2P5O A;  3D8C A;  5JQG A;  3ASN B;  1MNG A;  1ZLZ A;  2YI8 A;  1NTM H;  5H2F Z;  1K73 W;  2WWW A;  1YJ9 V;  3TK1 A;  3H1J H;  5IJ9 B;  2DQ3 A;  2YIB D;  2X6A A;  3LDD A;  4NYK A;  3SYC A;  4WFE A;  3K5N A;  4H13 B;  2UUC O;  4DW0 A;  2XAH A;  1Q5O A;  5J2T B;  3DSQ A;  3E8H A;  2A7W A;  2R70 A;  1MMM A;  4I55 A;  3MHS C;  4LF7 B;  1NJI W;  1Y76 B;  1N8R W;  4JI1 B;  2QA4 V;  5L3G A;  3QO5 A;  2OT5 A;  1GM7 A;  2BSK B;  5B5E Z;  2AHY A;  4JYY A;  1YJN V;  4EFE A;  3AK1 A;  1WAZ A;  1AR1 B;  1N33 O;  4FZ1 A;  3ZRS A;  4BAY A;  1PV0 A;  3O9O A;  3J7A U;  1BHA A;  3R65 A;  2PTM A;  1IDS A;  4HNA B;  2CGO A;  5CA3 A;  4MVS A;  4I9Q A;  2EIJ B;  2UXC B;  4DUY B;  3UM7 A;  1TUB B;  2ZM6 O;  4DR1 O;  4FM0 A;  2ZE5 A;  4EFB A;  3HPL C;  2QGN A;  2DOS A;  1RPO A;  4FIP C;  3OAA G;  1HNZ O;  4Z1M G;  1GMG A;  2VS0 A;  1M1K W;  1VMG A;  3RYH A;  3ZHT A;  1YTF B;  5IYD O;  1I7F A;  1IXB A;  3WU2 Z;  3MDS A;  2HG5 C;  3AG7 A;  1RP3 B;  4HBN A;  4UXN A;  2WLH A;  4DR6 O;  1N0J A;  4TV8 A;  4RO2 A;  3ZHU A;  2CUG A;  3ETQ A;  3CRM A;  2FB5 A;  2ZIM A;  1JQ0 A;  2ZXW C;  3K59 A;  3CCJ V;  3CS5 A;  1CXZ B;  3CWB H;  1W2B U;  4HYO A;  3C3T A;  5J9P C;  1HDJ A;  5IDJ A;  3OMA B;  1H2N A;  3ZMS A;  1NZ6 A;  3A0H Z;  2JGD B;  2KKW A;  3ZN0 A;  3E86 A;  2UXD B;  1L0N H;  4JI8 B;  1L1F A;  1MSD A;  4O4L A;  4WFA V;  4DR2 O;  3ABT A;  4QGP A;  2XAJ A;  4DRX B;  1WPX A;  4PI2 A;  4RQE A;  3BPZ A;  3N27 A;  4K0K O;  5TIS Z;  2ZE6 A;  3K9S A;  5KA5 A;  1G4Y B;  5KUK A;  2BE3 A;  3K57 A;  1OJH A;  2F23 A;  3B2E E;  4LFA O;  4DR5 O;  4BIO A;  3SJC C;  4JPR A;  3AK2 A;  1DF4 A;  3KCY A;  3BHP A;  4DR4 O;  3CCL V;  3K79 A;  4FPP A;  4H0L B;  3BFR A;  5JVD A;  4X1I B;  2QTS A;  3F5W C;  3IC7 A;  5H5N A;  4L8J A;  5JCO A;  1IUR A;  2UXB O;  2F93 B;  2VQE B;  5B66 Z;  2F66 C;  3JAL A;  2IU0 A;  1PM9 A;  2YID A;  1PL4 A;  1XOU A;  1RM1 B;  2HJF C;  4XDL A;  3AG3 C;  1U97 A;  1KMI Z;  3ZN1 A;  5LHG A;  5EZY B;  1NT2 B;  4MSW C;  4FLT A;  4DV7 B;  2QWP B;  4FLX A;  1BE3 H;  1GM9 A;  3MD0 A;  4DV1 O;  5B1O A;  1SQX H;  1HW7 A;  4TUY A;  3TXQ A;  5LYJ B;  3APO A;  2P7T C;  4GCZ A;  4WFG A;  2WPD G;  3O65 A;  3ZRW B;  1FXV A;  3DC6 A;  4RWU A;  5LXT B;  4JI5 B;  1KD1 W;  4JI3 O;  2W0X A;  1QBZ A;  1ZTE A;  2UUC B;  2B1G A;  3AG2 B;  3ZIA G;  4X1Y B;  5H6R A;  1LNQ A;  4FK5 C;  4W4L A;  2ZT9 B;  4G2K A;  3ZHS A;  5CBG A;  3HR0 A;  2P4V A;  4TV9 A;  1L8D A;  2F1M A;  4FFK A;  3ZMV A;  5C93 A;  4N23 A;  3OMN B;  2DYR C;  1XBL A;  4R50 A;  2JVD A;  4NB5 A;  2Q7E A;  4K8Z A;  1H8H G;  1WA8 A;  4CH5 A;  3CRR A;  3BA9 A;  4JGS A;  5L3C A;  3A2F A;  5BR8 O;  3RYF A;  1YCI A;  2RMK B;  3RVZ A;  1PNM A;  3SR2 C;  2ZE7 A;  1BHB A;  4GUN A;  3DXR A;  1XHZ A;  2IH1 C;  4NTW A;  5B1A C;  3CCQ V;  3JD4 A;  3UO3 A;  3OTO B;  4LF8 B;  3OE7 G;  2YXL A;  1FFX B;  2RCV A;  1LUW A;  1ENV A;  5CMU A;  4IGG A;  2QEX V;  1GAX A;  1G6U A;  2ZCE A;  2FML A;  1WN7 A;  1RFY A;  5EYP B;  3CP1 A;  1FAF A;  4J11 A;  5L3E A;  1FD9 A;  4F4L A;  1QNM A;  5EBW C;  3HKE A;  1YI2 V;  2VWK A;  4OGQ B;  4DV3 O;  4DYL A;  2JS5 A;  3SPG A;  2PF4 E;  2EIL C;  1HNW O;  2WLN A;  5EC1 C;  2KB1 A;  3G6B A;  5FNV A;  2E5L O;  4YJ3 B;  4O2B A;  1AR4 A;  3BCC H;  3FX7 A;  2W0F C;  1S5L Z;  4MTG A;  4QPK A;  4BWA A;  3E8F A;  3P30 A;  3STZ C;  1NR7 A;  3LNM B;  4NXM O;  1XL4 A;  1NVP D;  4YIP A;  2DJV A;  5LMU O;  2UXX A;  3HKD B;  1Y74 A;  2QR4 A;  2YXY A;  4L87 A;  3ASO C;  3JSL A;  1SZX A;  2DW4 A;  5KHI A;  5KX5 B;  4WF9 V;  3LDC A;  4X8A A;  4QNH B;  4B3T B;  4O4I A;  1GN6 A;  2VWJ A;  3IGA C;  1UJW B;  4MVU A;  2UU9 B;  4JI4 O;  5EIB C;  3L71 H;  3CCS V;  2OCC C;  4XDK A;  1GM8 A;  1K5Q A;  1VEW A;  4DR4 B;  4X20 A;  1QLE C;  4WFF A;  4Q6G A;  5KHJ A;  3VOU A;  3FAV B;  4K3A A;  1W0J G;  3FB8 C;  3NR7 A;  4IL6 Z;  2LQT A;  4UV9 A;  3CCU V;  2UXB B;  1KB9 F;  1OCZ C;  3L70 H;  1H2S B;  4X64 O;  4F6E A;  4IYH A;  1Y66 A;  5LL6 Y;  4WCE V;  3GB7 C;  1DK1 A;  2DYR B;  2F95 B;  5BXZ A;  3OTF A;  3ZCC A;  4X1K A;  3L74 H;  1Q8I A;  3ZMT A;  5LHH A;  4ZI7 A;  2GUZ B;  4LH6 A;  5D5Q A;  3P32 A;  4KHP B;  3CCE V;  3W7T A;  1GTO A;  3CHX A;  4LF5 B;  3ABK C;  4JAV A;  2EX3 A;  4JI1 O;  3GVM A;  2XAQ A;  5HFL A;  2CK3 G;  4LFB O;  3K03 A;  2ATK C;  5B1A B;  5CBH A;  1HNX B;  4O2A B;  3LSU A;  2Q8V A;  4HZ3 A;  1AIL A;  3HKB A;  3CME V;  3H1L H;  5CB4 A;  2MW2 B;  5LP6 A;  2XND G;  1XNQ B;  3E2E A;  4FFB B;  1WB7 A;  3G67 A;  4I0X A;  2PY5 A;  3B40 A;  1FXK B;  4AQY B;  3JAT A;  1VQL V;  3F7V C;  3MHH C;  2QTO A;  1LR1 A;  2AHZ A;  5IWA B;  4QE9 A;  2EIM C;  1VQM V;  4ZKI A;  4FMT A;  1DLB A;  2UXC O;  3S3W A;  4DUY O;  2LW7 A;  2PI5 A;  2JIZ G;  4WFB V;  3OW2 U;  2V4D A;  3D36 A;  2EIL B;  4GKK B;  5B3S C;  1EZV H;  3JAM N;  2D3O W;  2ZQM A;  1TVK B;  3SPC A;  5ITZ B;  5BZB A;  2NLJ C;  1MZE A;  2ZE8 A;  4O4H B;  2VQF O;  1QCE A;  2Y0I A;  3OFN G;  1TUE B;  5A9G A;  1JFF B;  2WA4 A;  5H6Q A;  1RSO A;  1QVF U;  5GON B;  2Q69 A;  2Y48 A;  2F4V O;  1IBM B;  4FLU A;  1WPB A;  2UUA B;  1F4M A;  4PA9 A;  1K9M W;  2LP7 A;  3ASO B;  5F2V O;  2OTL V;  1GRJ A;  4F6R A;  3RN4 A;  1VQ6 V;  2UXD O;  4DR7 B;  4JI8 O;  3ML0 A;  1AJQ A;  2Q5Z A;  1AI4 A;  3THO A;  1Y6X A;  4DV3 B;  4I7Z B;  4NVP A;  1YHQ V;  3CSX A;  3GWO A;  1UPG A;  4PJ0 Z;  4UCS A;  1P4R A;  2B1I A;  3K3W A;  5J2T A;  1I5Y A;  3K5L A;  1KBH A;  1GO3 F;  3B8N A;  1OCZ B;  3F5T A;  4J41 A;  3N2K B;  4UCO A;  2FTK A;  5DN6 G;  4FLZ A;  1JJO A;  2CGN A;  2QKS A;  4J7K A;  3E22 A;  3CYO A;  3CD6 V;  1UFI A;  4BIZ A;  2VQE O;  4DV6 B;  2EBO A;  4LC1 A;  3FB7 C;  4ASU G;  5H9C A;  4IHJ B;  5E79 Z;  3CCR V;  4U3J A;  3ABK B;  2ZD9 A;  1HP8 A;  1EZJ A;  2MK3 A;  5CN0 A;  1J95 A;  1R3K C;  3B77 A;  4X65 B;  3K0D A;  4DV7 O;  3M99 B;  1R6T A;  1S5J A;  2A9H A;  1SET A;  5C8Y B;  1AP5 A;  2EZO A;  1TUB A;  3EVK A;  4D6T H;  1FFT B;  3D3I A;  1JA8 A;  1ZWI C;  4UCV A;  1Z2G A;  2JEU A;  2EIM B;  4ZIB A;  4JI5 O;  2CTW A;  3ZRX A;  3RVY A;  1KP2 A;  4X64 B;  4Z2W A;  2QWO B;  1ROP A;  2IH3 C;  3QTC A;  4CS3 A;  4FM1 A;  2UXN A;  1SQV H;  1U96 A;  3B09 A;  1SZT A;  5JH7 B;  4WFH A;  2LJ2 A;  3E83 A;  5B3S B;  2N05 A;  2FL4 A;  1Y67 A;  4OXS A;  2IM9 A;  4MVQ A;  2E74 B;  2EJR A;  1RM1 C;  3RYC A;  1R6K A;  3Q4H A;  4LFB B;  1BZK A;  1BGY H;  4JI2 B;  1H2L A;  1KYO F;  3RGB A;  2Q73 A;  2BCC H;  4H44 B;  4PI0 A;  4LWS B;  2XTA A;  5LA6 B;  2XAG A;  2QE7 G;  4LNU B;  2ARH A;  3ZHV A;  3DC5 A;  4IYI A;  2HVK C;  4ZOL A;  2QM4 A;  3OTO O;  3T1C A;  4LF8 O;  4O4J A;  1XRE A;  2WAM A;  4GKJ B;  5L3B A;  3CMA V;  1H2K A;  3I5D A;  3AG2 C;  2Y4T A;  3E8G A;  4DK1 A;  1BS3 A;  1THZ A;  5BMV B;  5FLX N;  1B6Q A;  1TAE A;  1N32 B;  2WLI A;  2XT9 A;  3MAQ A;  3PN1 A;  4X1I A;  2R72 A;  2QKC A;  1HWY A;  2L35 A;  4D7T A;  3K06 A;  2M6Y A;  1R1B A;  2VQF B;  1SQQ H;  3BAA A;  3CB2 A;  3JAK B;  2HFE C;  3N2G A;  3IAY A;  3QNE A;  4U7O A;  2F4V B;  1KUQ A;  4CBC A;  4ZBM A;  4JTD B;  3UO2 A;  5EZY A;  2EIK B;  1GN3 A;  4DV4 O;  1NH2 D;  2PUS A;  5KUM A;  4BW9 A;  3DGE A;  2CDY A;  3SYP A;  5LGN A;  3K5O A;  1YEW A;  4GLX A;  4CC6 A;  4UUJ C;  5HFM A;  3AG4 C;  4I55 B;  1M5I A;  1IX9 A;  2HHH O;  1CP9 A;  5D5P A;  5LGT A;  2HJD A;  3W7X A;  1DTO A;  4B3T O;  1R3I C;  2UU9 O;  2JK5 C;  3CRC A;  5KHK A;  3X2Q C;  2RNB A;  4PEL A;  4R8C A;  4JF3 A;  2ZIO A;  1P84 F;  2E75 B;  1YIJ V;  4CC5 A;  1COW G;  1SRY A;  4E2L A;  5CA0 A;  1Q6U A;  2Y69 B;  1CPY A;  3LNN A;  4NXN B;  1JVM A;  4R6Z A;  3CJH B;  4MW3 A;  2HKO A;  1ZL8 B;  2Q0O C;  1Q81 W;  2YS8 A;  1EM1 A;  4K8X A;  5FPO A;  1MSW D;  2OIE A;  2O57 A;  1CEZ A;  3UT5 A;  4KHP O;  4CS4 A;  1FPO A;  3FD9 A;  1ARO P;  1Q7Y W;  4LF5 O;  1VQP V;  1K5S A;  1HNX O;  2X7R B;  4X9Q A;  4KFM A;  1SQB H;  2A3Q A;  4Z1V A;  5IYZ B;  2JGU A;  1E1Q G;  1M56 B;  2QWQ B;  1XNQ O;  4MTX A;  1K97 A;  4AQY O;  2ETN A;  1QLN A;  1XIL A;  1BMF G;  1TA8 A;  3F7Y C;  3I56 V;  4AI8 A;  1YVW A;  5IWA O;  1J5E B;  4O4L B;  4AIL C;  2CE4 A;  4YJ3 A;  2Q4P A;  2HEP A;  4NR1 A;  4TOI A;  4UV8 A;  3WG7 B;  3PJS K;  4GKK O;  3J81 N;  2RN9 A;  4PA4 A;  2ODM A;  1P7G A;  4B08 A;  5IJ0 A;  1JOY A;  2P6J A;  1SF9 A;  1V9P A;  3HKD A;  2YSU B;  3SJA C;  1BL8 A;  2CTP A;  2BTO A;  4CH4 A;  1V54 C;  5B1N A;  1IBM O;  1N34 B;  4TQF A;  1Q86 W;  1WJZ A;  1AI6 A;  1PNK A;  1FXK C;  4PDM A;  2UUA O;  5EC2 C;  2KSD A;  4TQD A;  3AG4 B;  3TXS A;  1Q82 W;  1NR1 A;  4W4K A;  2ZKO A;  5IYC O;  3T4Z A;  4PD4 F;  1JCH A;  3FAV A;  4E4E A;  4DR7 O;  2YXH A;  3L75 H;  4I4T B;  5LOV A;  1D5N A;  1GKF A;  5IT9 N;  2DWD C;  2ITD C;  4C7U A;  1XMO B;  3VBB A;  3X2Q B;  1S72 V;  4LR3 A;  5KAF Z;  4JI7 B;  4ZHQ A;  5K1P A;  2HP8 A;  2P4K A;  3CX5 F;  2AXT Z;  4PDV A;  3CCM V;  1G8M A;  2GUZ A;  2CH7 B;  4FLW A;  2ADP A;  3JAR B;  4DV4 B;  1N36 O;  1VIB A;  2X6C A;  1MZF A;  3B8M A;  2IW5 A;  1H8E G;  4QPJ A;  1KQS U;  4TV9 B;  1YZB A;  1IZ3 A;  1JPX A;  4DO2 A;  2EZP A;  4NTX A;  5IY5 B;  3OR7 C;  5KMG B;  3CE2 A;  4EB6 B;  1AI5 A;  2WLM A;  4DV6 O;  1ZUQ A;  1XDC A;  2P90 A;  3P3P A;  1DF5 A;  2HHH B;  5EBL C;  2A79 B;  4FFB A;  2DN9 A;  2X6B A;  5KA6 A;  1SC5 B;  2PZS A;  3G71 V;  4X65 O;  2OYQ A;  4QIW F;  3BA8 A;  1H38 A;  1S0V A;  3VQV A;  3STL C;  3UCS C;  3SYQ A;  2ILM A;  3L72 H;  4DUZ B;  2R9R B;  3LSS A;  1AJP A;  1OV9 A;  2ADQ B;  4X62 B;  5IYB O;  2K1E A;  4UVC A;  1VP7 A;  2ZR2 A;  3KG2 A;  2ZDI C;  4JZ2 A;  3JD0 A;  1YSC A;  2P22 C;  2P06 A;  1SA0 B;  1AVM A;  1ZSP A;  1JR9 A;  4MVM A;  4O4H A;  4UFZ A;  3WB1 A;  1R6N A;  2NN4 A;  1JFF A;  4KUM A;  4PA6 A;  4UVB A;  3OUS A;  2QWR B;  5J2U A;  4B3R B;  1BQZ A;  1OCC B;  3ZX6 A;  1AB3 A;  3H9V A;  3QO8 A;  3K5M A;  1XHX A;  1MG1 A;  1ZAU A;  1NU1 H;  2FKX A;  1XMQ O;  2F43 G;  5LGU A;  3ZS8 C;  4JI2 O;  3CEI A;  1V54 B;  3JAW B;  3RYI A;  2QM8 A;  1X4T A;  2ITC C;  3K04 A;  2CTQ A;  1FJG B;  1MA1 A;  1QHT A;  4J7J A;  1NBM G;  1NH2 B;  2H94 A;  1Y74 B;  2RQ6 A;  3FYI B;  3SDL A;  3T1Y B;  4GKJ O;  2Q7G A;  1QQC A;  4FZ0 A;  2L6L A;  1H2G A;  3ETE A;  3RBZ A;  1K33 A;  3I55 V;  1VQO V;  1N32 O;  3OT7 A;  1W59 A;  4B3S B;  5LHI A;  1QVG U;  2YEV A;  3ABM C;  2BTQ A;  1VF6 C;  4BIU A;  1SER A;  4GYC B;  3JAS B;  3AK3 A;  4IIJ A;  3KCX A;  3S3X A;  4WBN B;  4X88 A;  1KEC A;  2WLL B;  4UCR A;  1I08 A;  2N74 A;  1EBO A;  1JX9 A;  3TJT A;  3OGI B;  2X0L A;  4BR6 A;  4YJ2 A;  1I5X A;  1PL0 A;  4FJC C;  1IBK B;  3P3N A;  1R3L C;  3IC9 A;  3ZMU A;  2Q6A A;  2LO1 A;  3KKY A;  4QJF B;  2LFS A;  1H2M A;  5IJ9 A;  1KP3 A;  3ZBH A;  3H1I H;  5DM6 V;  2Z3Y A;  3QF7 A;  1OHH G;  4JI0 B;  4I5S A;  3HKB B;  1YF2 A;  5CB4 B;  5LP6 B;  5DED A;  4G27 B;  1K4D C;  1WP8 A;  4FLY A;  3APQ A;  3SPH A;  1N36 B;  4RQF A;  2OWO A;  1Q43 A;  1Y76 A;  3B4S A;  3K58 A;  1PP9 H;  2ZIN A;  2IJJ A;  2EIK C;  3VQW A;  2BSK A;  2CTR A;  5GTH Z;  1N0N A;  1YJW V;  4LH7 A;  4OX9 B;  5LMN B;  2Z5U A;  4OPH A;  1Q3E A;  3SPJ A;  3ZMZ A;  3U11 A;  3HKC B;  4NXN O;  4LF4 B;  2PI4 A;  5CA1 B;  4J7Z A;  2GSM B;  5JJE B;  1IVS A;  4EKW A;  1OCO B;  2RDC A;  4B7K A;  1ORQ C;  4HNA A;  4TSF G;  1F23 A;  3M7M X;  1M57 B;  1RSO B;  2HVJ C;  2RJZ A;  3RFR A;  4LFC B;  2HLD G;  4YXW G;  2WA3 A;  2FYU H;  2JJ1 G;  3VQX A;  5BMV A;  4GT1 A;  1F4N A;  3H1H H;  2ZNJ A;  1OCR C;  2YI9 A;  4RUF A;  4LF9 B;  4MW8 A;  2DE0 X;  4F6R B;  3JAK A;  1F7Y A;  1J5E O;  2Y69 C;  3KZI Z;  4P2Z A;  1G1X B;  2WLK A;  1VQ4 V;  2KG7 B;  4LP8 A;  2Y0P A;  3L9D A;  3SGI A;  1KU9 A;  4N21 A;  4YIO A;  1B3Q A;  3ABM B;  2IJI A;  4U7N A;  4J9Z B;  5GTI Z;  1XMQ B;  2PYL A;  4YY3 B;  4GX5 A;  1FYJ A;  1Q6I A;  2H8P C;  3E8B A;  4MVO A;  4DW1 A;  1Q6H A;  2JGD A;  3TCU A;  2LW1 A;  2QM7 A;  1V55 B;  4DRX A;  1N34 O;  3E22 B;  1BT8 A;  1M56 C;  3G80 A;  1B04 A;  1Q90 D;  3QVN A;  2AZ2 A;  3EFF K;  1NVP B;  4DK0 A;  3RW0 A;  2P67 A;  1KKC A;  3OM3 B;  4P30 A;  4X89 A;  1BQ0 A;  2LGQ A;  4U3J B;  4JZG A;  4KL1 A;  2JS3 A;  4I50 B;  4MVZ A;  5KAI Z;  3NXS A;  1K34 A;  3WG7 C;  2GHY A;  1P49 A;  4H33 A;  2OIG A;  1XMO O;  2XAS A;  2Q7H A;  3BY6 A;  5JQG B;  2LFR A;  4DXW A;  2JDI G;  1SQF A;  5AG2 A;  2IBZ H;  3IFX A;  4JTA B;  4B3M O;  2Z0A A;  3CJH A;  4JAS A;  4UCU A;  4JI7 O;  4DV2 B;  1K8A W;  1XL6 A;  3A0B Z;  1ZL8 A;  3SYO A;  2XAF A;  4MVR A;  2BOB C;  1T5E A;  1FKA O;  3CRA A;  3BAB A;  1K4C C;  3ICX A;  4JAU A;  5JCO C;  4DR3 B;  2Y4U A;  1MAB G;  1VF7 A;  4J10 A;  4MTO A;  5LYJ A;  1WNS A;  3T1H B;  5IYZ A;  4PDL A;  5EBM C;  2GDS A;  1SS3 A;  3SJB C;  1SQG A;  3CC4 V;  3ZRW A;  3RYC B;  4QE7 A;  1P7B A;  3Q4H B;  5LXT A;  2E76 B;  4AHC A;  5FL7 G;  3EHB B;  2QSA A;  4JI6 B;  5K1X A;  2UUB B;  3WFV A;  4X1Y A;  2JRI A;  3A8T A;  1SKV A;  1US6 A;  4JYB A;  4ZOL B;  1OCR B;  4P9O A;  3U0Z A;  4DUZ O;  4R7C A;  1GN2 A;  3T4D A;  4O4J B;  4Q20 A;  1K92 A;  3WB2 A;  4X62 O;  1SES A;  4X66 B;  1I94 B;  2R9I A;  5BY1 A;  1S77 D;  3WB0 A;  3G4S V;  2IJK A;  3EXA A;  5GW7 A;  1EN6 A;  2OCH A;  2WLI B;  1O9H A;  3BEH A;  5IY5 C;  3RYH B;  4B3R O;  1VQN V;  2N04 A;  1W0K G;  1FFX A;  4LF6 B;  2DYS C;  4TV8 B;  3BRC A;  2QKA A;  3JYC A;  3N2G B;  4JYA B;  1YXB A;  2B9Z A;  2PYJ A;  3OMI B;  4BW5 A;  1URF A;  2Q9L A;  1S76 D;  5EYP A;  4TT3 G;  1XNR B;  5EIB D;  4KP4 A;  2GBO A;  4PA7 A;  3SJQ C;  4NTY A;  4TWK A;  1BSM A;  2BOC C;  3FYE B;  1FJG O;  4I4T A;  1S3J A;  3ZJZ A;  3W7W A;  2NR5 A;  3D3Q A;  5KHH A;  2M7W A;  3T1Y O;  5DEC A;  4UB6 Z;  4XDJ A;  1HR0 O;  4JV5 O;  3CPW U;  5L3F A;  2QDO A;  1S5H C;  4XBF A;  2CH7 A;  2GTS A;  3JAR A;  4DV0 O;  4ABM A;  2C2A A;  1JJ2 U;  1OCC C;  2YIB A;  3LDE A;  4B3S O;  2WSS G;  3ABL C;  1N4C A;  1GN4 A;  2WLJ A;  2HR3 A;  3BVO A;  5KMG A;  1R3J C;  5JVD B;  4EB6 A;  3G6E V;  3M8A A;  1E79 G;  2GV9 A;  5KX5 A;  5CA0 B;  1AR5 A;  3A0R A;  3OD4 A;  2AZ0 A;  3JAL B;  3DTU B;  1N33 B;  1VAR A;  4PDR A;  2QWN B;  5LBQ A;  2ZXW B;  1IBK O;  3SPI A;  2A06 H;  4PV1 B;  2XUM A;  1QR8 A;  3JCU Z;  5IE9 A;  4RAI A;  3UT5 B;  3FFQ A;  3RWR D;  3K9A A;  4CS2 A;  2DWE C;  3W7U A;  4TUY B;  3OR6 C;  2ZM6 B;  4FVM A;  4DR1 B;  1QU7 A;  1SA0 A;  2YIA A;  3OEH G;  1M4U A;  4JI0 O;  4B3M B;  1HNZ B;  2YC0 A;  1VF5 B;  4DV5 O;  2EJ7 A;  3IJ4 A;  2DMX A;  1IBL O;  2YDE A;  4DR6 B;  1M93 A;  3JCZ A;  2CAZ C;  1TGO A;  4U3F H;  1B06 A;  4LBE C;  3JD3 A;  2AGA A;  2OTJ V;  2XOK G;  4O2A A;  3JSN A;  4GX1 A;  4OX9 O;  4A5U B;  5LMN O;  1AP6 A;  1R73 A;  3JAW A;  1VQK V;  3C90 A;  1E1R G;  3TGU H;  4YHH O;  4NKG B;  4LF4 O;  1WA8 B;  1FXH A;  2DYS B;  3H1K H;  1FXK A;  3FB5 C;  3RT3 C;  3RYF B;  5IJ0 B;  4KXR A;  2IJH A;  1NTK H;  3T2M A;  3DXR B;  3ETD A;  3AG3 B;  1SQP H;  3W7S A;  1D5A A;  3LSQ A;  4DR2 B;  1XEQ A;  4GX2 A;  5CBF A;  4LFC O;  4B7E A;  3QG5 A;  4K0K B;  1YTF D;  5LP6 C;  3H01 A;  3UQ8 A;  4LFA B;  4DR5 B;  2K9P A;  2G38 A;  1LUV A;  3UKM A;  4CZZ A;  2EIN C;  2YUA A;  4OPA A;  3FB6 C;  1TVK A;  3K0G A;  3JAS A;  5ITZ A;  4LF9 O;  4JYC A;  1F51 A;  1M90 W;  4WBN A;  4PA3 A;  1NKD A;  2WLL A;  5JJJ B;  3HKE B;  5GON A;  2NNU A;  5LOV B;  3R66 A;  3VQY A;  2Q0A A;  4UB8 Z;  1QR9 A;  2Q67 A;  3ABL B;  1YDX A;  3D36 C;  3FKS G;  3ETG A;  2W6I G;  3JD2 A;  1OZ0 A;  5FNV B;  3K08 A;  4O2B B;  5B1B C;  3AG1 C;  4ZHQ B;  4K35 A;  4YY3 O;  2W6J G;  1OCO C;  2DQ0 A;  4D7S A;  4P9P A;  3HB3 B;  4ICG A;  3TET A;  2EUL A;  1O9G A;  5KHG A;  4GZR B;  1M57 C;  3L73 H;  4LF7 O;  2GTA A;  4EEQ A;  4DV1 B;  3ABU A;  5L3D A;  2B5U A;  1PNL A;  1IXM A;  1GK9 A;  1M9N A;  2IU3 A;  3OEE G;  2E3C A;  4GX0 A;  3C3S A;  1PPJ H;  1EFR G;  2KQX A;  4JTC B;  1HR0 B;  4JV5 B;  5JWP A;  3GWK C;  2AW9 A;  1PD3 A;  4JI3 B;  2JEX A;  3ASN C;  2ZDI A;  4DV0 B;  3CRQ A;  4O4I B;  1VQ8 V;  1FS0 G;  3N2K A;  3CC7 V;  4CH6 A;  5FPR A;  4G28 B;  1AI7 A;  2A0L A;  4IT5 A;  4X20 B;  4UCT A;  1RPR A;  5EK0 A;  1D2D A;  3HKC A;  1NS1 A;  4IHJ A; 
#chains in the Genus database with same CATH homology
 1CPY A;  1AJN A;  2W0F C;  5E1A C;  1VQ5 V;  4MTG A;  1JVM A;  4R6Z A;  4GX5 A;  4QPK A;  3E8F A;  4H37 A;  3P30 A;  4MW3 A;  2HKO A;  3STZ C;  2H8P C;  3E8B A;  4MVO A;  1Q81 W;  1V55 C;  1NR7 A;  3LNM B;  1KC8 W;  1MSW D;  1XL4 A;  1NVP D;  1CEZ A;  1YIT V;  3TCU A;  3JD1 A;  2UXX A;  2QM7 A;  4L87 A;  1ARO P;  1V55 B;  1Q7Y W;  1VQP V;  1K5S A;  3ASO C;  1M56 C;  2X7R B;  4KFM A;  2DW4 A;  3EFF K;  1NVP B;  3RW0 A;  3OGC C;  4WF9 V;  2P67 A;  1K7D A;  3LDC A;  4X8A A;  4QNH B;  3OM3 B;  4P30 A;  4LCU C;  1E1Q G;  1PKX A;  1M56 B;  3IGA C;  4X89 A;  4MVU A;  4MTX A;  1UJW B;  1K97 A;  4UVA A;  2EIJ C;  3CCS V;  2OCC C;  4XDK A;  1GM8 A;  4MVZ A;  1K5Q A;  3QO7 A;  1QLN A;  1BMF G;  3F7Y C;  3NXS A;  3OUF A;  3I56 V;  1QLE C;  1K34 A;  4WFF A;  3VOU A;  1KKD A;  2EIN B;  3CC2 V;  2OCC B;  1W0J G;  3WG7 C;  2GHY A;  3FB8 C;  4H33 A;  2XAS A;  4UV9 A;  3CCU V;  3BY6 A;  2LFR A;  4DXW A;  2JDI G;  4RUE A;  1QLE B;  3IFX A;  4JTA B;  1OCZ C;  3CXC U;  4MS2 A;  4JAS A;  4UV8 A;  3WG7 B;  1VQ7 V;  1K8A W;  1XL6 A;  3PJS K;  3SYO A;  2JJ2 G;  1Y66 A;  2XAF A;  4MVR A;  4WCE V;  2BOB C;  4PA4 A;  3GB7 C;  2DYR B;  2V7Q G;  3ZCC A;  4MT8 A;  1JOY A;  2P6J A;  1K4C C;  4JAU A;  3SYA A;  3ZMT A;  5LHH A;  2YEV B;  2YSU B;  3AG1 B;  5B1B B;  3AEI A;  3E35 A;  3P32 A;  3CCV V;  1BL8 A;  3LUT B;  3CCE V;  1MOF A;  1MAB G;  1K3E A;  3W7T A;  4J9Y B;  1GTO A;  4MTO A;  1V54 C;  1Y4M A;  5B1N A;  3ABK C;  4JAV A;  4PDL A;  2XAQ A;  5HFL A;  1Q86 W;  2CK3 G;  4I9W A;  3K03 A;  2ATK C;  5EBM C;  5B1A B;  5CBH A;  3CC4 V;  1AI6 A;  4MTF A;  3ZRW A;  3ZRV A;  1PNK A;  1FXK C;  2Q68 A;  4PDM A;  4QE7 A;  1P7B A;  4HZ3 A;  5EC2 C;  1WLE A;  3AG4 B;  3E89 A;  3CME V;  1NQT A;  4HAM A;  3EHB B;  5FL7 G;  1Q82 W;  2ZR3 A;  1NR1 A;  2XND G;  3E2E A;  3WFV A;  5IYC O;  3T4Z A;  1FXK B;  1JCH A;  2V1D A;  1VQL V;  3F7V C;  3MHH C;  1VQ9 V;  2QTO A;  2AHZ A;  4QE9 A;  2EIM C;  4JYB A;  1VQM V;  1OCR B;  4P9O A;  1GKF A;  3ASN B;  2DWD C;  4ZKI A;  4R7C A;  4FMT A;  3T4D A;  2ITD C;  1K73 W;  1DLB A;  2WWW A;  4Q20 A;  1YJ9 V;  3TK1 A;  1K92 A;  3VBB A;  1SES A;  2DQ3 A;  3X2Q B;  1S72 V;  2PI5 A;  2JIZ G;  2X6A A;  4WFB V;  3LDD A;  3OW2 U;  3SYC A;  4WFE A;  2R9I A;  3D36 A;  2EIL B;  5B3S C;  1S77 D;  4PDV A;  3G4S V;  3CCM V;  1G8M A;  2IJK A;  2D3O W;  2ZQM A;  2XAH A;  5GW7 A;  3SPC A;  2WLI B;  3E8H A;  3BEH A;  5BZB A;  2NLJ C;  2X6C A;  5IY5 C;  3B8M A;  2IW5 A;  1QCE A;  1H8E G;  3OFN G;  4QPJ A;  1KQS U;  1VQN V;  1TUE B;  3MHS C;  1NJI W;  5H6Q A;  1W0K G;  1N8R W;  1QVF U;  1JPX A;  4DO2 A;  2EZP A;  5IY5 B;  2DYS C;  2Q69 A;  2Y48 A;  3OR7 C;  3JYC A;  1AI5 A;  5L3G A;  2QA4 V;  2WLM A;  3QO5 A;  2OT5 A;  1GM7 A;  3OMI B;  2P90 A;  2AHY A;  4BW5 A;  1DF5 A;  1YJN V;  5EBL C;  2A79 B;  1S76 D;  1AR1 B;  1F4M A;  2X6B A;  4TT3 G;  4PA9 A;  3ZRS A;  1K9M W;  2LP7 A;  4BAY A;  3ASO B;  5KA6 A;  4KP4 A;  4PA7 A;  3SJQ C;  4TWK A;  3G71 V;  2BOC C;  3FYE B;  2OTL V;  1S3J A;  4QIW F;  1BHA A;  1VQ6 V;  3R65 A;  1H38 A;  3ZJZ A;  3ML0 A;  1AJQ A;  1S0V A;  3W7W A;  1AI4 A;  3STL C;  3SYQ A;  5CA3 A;  2M7W A;  2R9R B;  4MVS A;  3LSS A;  1AJP A;  2EIJ B;  1YHQ V;  3UM7 A;  4XDJ A;  3GWO A;  5IYB O;  2K1E A;  4UVC A;  2ZR2 A;  3CPW U;  3HPL C;  5L3F A;  3KG2 A;  2ZDI C;  3JD0 A;  1RPO A;  4FIP C;  1YSC A;  1S5H C;  1P4R A;  2B1I A;  3OAA G;  4XBF A;  4Z1M G;  3K3W A;  1GMG A;  1I5Y A;  2C2A A;  1M1K W;  1JJ2 U;  4MVM A;  1OCC C;  3LDE A;  1YTF B;  1GO3 F;  5IYD O;  2WSS G;  1R6N A;  1OCZ B;  3ABL C;  3B8N A;  4KUM A;  4PA6 A;  4UVB A;  2HG5 C;  2FTK A;  3OUS A;  2WLJ A;  2HR3 A;  2WLH A;  4UXN A;  5DN6 G;  1OCC B;  1R3J C;  4RO2 A;  2QKS A;  3CYO A;  3QO8 A;  3CD6 V;  3G6E V;  4BIZ A;  1MG1 A;  1JQ0 A;  1E79 G;  2ZXW C;  2EBO A;  2F43 G;  5LGU A;  3A0R A;  4LC1 A;  3FB7 C;  4ASU G;  5H9C A;  3CCJ V;  1W2B U;  3DTU B;  4HYO A;  3CCR V;  1V54 B;  3ABK B;  2ZD9 A;  4PDR A;  5J9P C;  5LBQ A;  2ZXW B;  5IDJ A;  3SPI A;  2QM8 A;  1EZJ A;  2MK3 A;  3OMA B;  2ITC C;  3K04 A;  5CN0 A;  1J95 A;  1R3K C;  3B77 A;  3K0D A;  3ZMS A;  1QR8 A;  3M99 B;  3ZN0 A;  3E86 A;  4RAI A;  1NBM G;  1L1F A;  4WFA V;  2A9H A;  1SET A;  1NH2 B;  2EZO A;  3ABT A;  2H94 A;  3K9A A;  3FYI B;  2DWE C;  3W7U A;  2XAJ A;  1WPX A;  4RQE A;  3OR6 C;  1FFT B;  1G4Y B;  3D3I A;  5KA5 A;  5KUK A;  1ZWI C;  2JEU A;  2EIM B;  1H2G A;  3ETE A;  3OEH G;  3RBZ A;  4JPR A;  3ZRX A;  3RVY A;  1KP2 A;  1K33 A;  3I55 V;  1DF4 A;  1VQO V;  1ROP A;  2IH3 C;  3CCL V;  3K79 A;  4FPP A;  5LHI A;  1QVG U;  2YEV A;  3ABM C;  2UXN A;  4BIU A;  1SER A;  1SZT A;  3F5W C;  4WFH A;  5B3S B;  3E83 A;  3IC7 A;  3JCZ A;  4X88 A;  1KEC A;  4OXS A;  2WLL B;  4LBE C;  4MVQ A;  3JD3 A;  2OTJ V;  2XOK G;  2EJR A;  1RM1 C;  4GX1 A;  1EBO A;  1JX9 A;  1R6K A;  2IU0 A;  1R73 A;  1VQK V;  1E1R G;  2X0L A;  1FXH A;  2DYS B;  2HJF C;  1RM1 B;  4XDL A;  1I5X A;  1PL0 A;  4FJC C;  1FXK A;  3AG3 C;  1R3L C;  3FB5 C;  3ZN1 A;  5LHG A;  2XAG A;  4MSW C;  2QE7 G;  3ZMU A;  2IJH A;  2Q6A A;  2HVK C;  3T2M A;  1GM9 A;  4QJF B;  3MD0 A;  2LFS A;  3AG3 B;  3ETD A;  5B1O A;  3W7S A;  3T1C A;  3LSQ A;  4GX2 A;  2P7T C;  2WAM A;  5CBF A;  4GCZ A;  5L3B A;  3CMA V;  4WFG A;  1KP3 A;  1YTF D;  2WPD G;  3AG2 C;  5DM6 V;  2Z3Y A;  3ZRW B;  1FXV A;  3H01 A;  1OHH G;  3E8G A;  1KD1 W;  4I5S A;  1THZ A;  3UKM A;  1B6Q A;  1QBZ A;  4CZZ A;  2EIN C;  3FB6 C;  2B1G A;  3AG2 B;  3K0G A;  2WLI A;  3ZIA G;  5H6R A;  4G27 B;  1LNQ A;  1K4D C;  4FK5 C;  4G2K A;  1HWY A;  4JYC A;  1F51 A;  5CBG A;  3SPH A;  3K06 A;  1M90 W;  4PA3 A;  1NKD A;  2WLL A;  4RQF A;  3ZMV A;  2NNU A;  5C93 A;  4N23 A;  2HFE C;  1QR9 A;  2Q67 A;  2IJJ A;  3OMN B;  2DYR C;  3QNE A;  4U7O A;  2EIK C;  3ABL B;  3FKS G;  3ETG A;  4R50 A;  1YJW V;  2W6I G;  3JD2 A;  1OZ0 A;  2Z5U A;  4CBC A;  3K08 A;  1H8H G;  3SPJ A;  3ZMZ A;  5B1B C;  3AG1 C;  4ZBM A;  4JTD B;  4JGS A;  2W6J G;  1OCO C;  5L3C A;  2EIK B;  2DQ0 A;  3RVZ A;  1NH2 D;  4P9P A;  2PI4 A;  1PNM A;  3HB3 B;  5KUM A;  3TET A;  3DGE A;  1BHB A;  2GSM B;  3SYP A;  5LGN A;  1M57 C;  2IH1 C;  4EKW A;  5B1A C;  1OCO B;  1ORQ C;  3CCQ V;  3JD4 A;  4TSF G;  4UUJ C;  1F23 A;  3AG4 C;  5HFM A;  3ABU A;  1M57 B;  3OE7 G;  5L3D A;  2B5U A;  1PNL A;  2HVJ C;  1IXM A;  1GK9 A;  1M9N A;  2IU3 A;  2HLD G;  1ENV A;  3OEE G;  4GX0 A;  5CMU A;  1CP9 A;  4YXW G;  2QEX V;  2JJ1 G;  5LGT A;  1EFR G;  4JTC B;  3W7X A;  4GT1 A;  1DTO A;  1F4N A;  1PD3 A;  1R3I C;  2JEX A;  3CP1 A;  1OCR C;  3ASN C;  2ZDI A;  1VQ8 V;  4RUF A;  5L3E A;  2JK5 C;  4F4L A;  4MW8 A;  1FS0 G;  3CC7 V;  3X2Q C;  5EBW C;  1YI2 V;  4PEL A;  4R8C A;  4G28 B;  4JF3 A;  1AI7 A;  2A0L A;  2Y69 C;  3SPG A;  4P2Z A;  2WLK A;  2EIL C;  1VQ4 V;  4LP8 A;  2WLN A;  1YIJ V;  5EC1 C;  4N21 A;  1COW G;  1SRY A;  2KB1 A;  1RPR A;  3ABM B;  4E2L A;  5EK0 A;  2IJI A;  4U7N A;  2Y69 B;  4J9Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...