3T4DA

Crystal structure of nak2k channel y55f mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALFFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3t4dA00
3OUSA 3F5WC 5EK0A 3LDEA 2ZD9A 3STZC 2Q68A 2WLLB 5E1AC 3RVYA 4WFHA 2EIMC 3JYCA 3FB8C 4QE9A 2WLKA 4XDJA 4MVSA 5EBMC 2KB1A 3SPJA 4OXSA 5EBWC 2Q67A 2Q6AA 3E8BA 5CBGA 4R7CA 4J9ZB 4JTAB 5EC2C 3K04A 1J95A 3SYCA 3UKMA 2A79B 4ZBMA 3FB7C 1R3JC 2DWDC 2AHZA 4RUFA 1LNQA 2QTOA 4PDMA 4QE7A 4X88A 3ZJZA 1G4YB 3F7VC 1V55C 3E89A 4JTDB 3ZRSA 2ITCC 4WFEA 4P9PA 3E83A 4X89A 4XDKA 3TCUA 3SYQA 3F7YC 2X6AA 4QNHB 1K4DC 2BOBC 3SYAA 2WLJA 2P7TC 1R3IC 4RAIA 4GX1A 1OCCC 5KUMA 4GX5A 4RO2A 2IH1C 2JK5C 2WLIA 4MW8A 4RUEA 2WLLA 2HVKC 1OCZC 3OR6C 2EILC 4UUJC 3E86A 2HVJC 3LDDA 1M57C 4MVZA 3PJSK 4MTGA 4GX2A 3FB6C 4WFFA 3SYPA 4MTFA 1R3LC 3T4ZA 4BW5A 2WLNA 3ASNC 4PA4A 3SPCA 3HPLC 4F4LA 4H37A 2HG5C 1ZWIC 3AG4C 4MVUA 5KUKA 2HFEC 2HJFC 3EFFK 4KFMA 5CBFA 4GX0A 3IGAC 2BOCC 4PA7A 5CBHA 5J9PC 2YEVA 4P2ZA 3BEHA 2QKSA 3T2MA 3SPHA 2IH3C 4DXWA 2OCCC 4R8CA 5IY5C 4MVRA 1XL6A 2EIKC 3SPGA 1OCRC 3SPIA 5B1BC 3T1CA 2NLJC 4P9OA 4PA6A 1BL8A 1R3KC 2Y69C 3RVZA 3STLC 4HZ3A 3E8FA 4I9WA 2WLHA 3ASOC 3OGCC 3R65A 3AG1C 3K0DA 2H8PC 2ZXWC 3K0GA 3OUFA 5B1AC 1XL4A 3SYOA 3ABLC 4MVMA 4MSWC 3RW0A 5EC1C 3ABMC 3TETA 2X6BA 5BZBA 3RBZA 3VOUA 2ITDC 1V54C 3T4DA 4R50A 4MVQA 4P30A 4PDLA 1S5HC 3OR7C 3SJQC 4G28B 4MVOA 3AG2C 2AHYA 2DYSC 4WFGA 4LBEC 4MS2A 1M56C 4G27B 4X8AA 3AG3C 4HYOA 2X6CA 1ORQC 2DYRC 4CBCA 4XDLA 4PA9A 1KKDA 3K03A 3WG7C 3LNMB 1K4CC 2ATKC 4H33A 3KG2A 2Q69A 3FB5C 3UM7A 2A9HA 2DWEC 2WLIB 4LP8A 3GB7C 4J9YB 4MTOA 4JTCB 4R6ZA 5EBLC 3X2QC 2W0FC 4PA3A 4MW3A 4LCUC 2R9RB 1QLEC 3E8GA 4TWKA 3K06A 2EINC 3LUTB 2A0LA 3K08A 1P7BA 4PDVA 5B3SC 3E8HA 3IFXA 3LDCA 2K1EA 4EKWA 1OCOC 3ABKC 1JVMA 2WLMA 4PDRA 2EIJC
chains in the Genus database with same CATH superfamily
3OUSA 1JOYA 1XHXA 1ZTEA 4J7JA 1GMGA 3STZC 2FL4A 2PYJA 1PM9A 1AI4A 3SPJA 4TQDA 4F6RB 4DO2A 3AG1B 4Z1MG 5L3EA 1J95A 4DUZB 1KD1W 4RUFA 4ZHQB 3THOA 5EZYA 2H94A 2IJHA 4DV0O 3ZRSA 1JR9A 1JA8A 4X89A 5L3GA 1OCRB 1J5EB 4X62B 1Q43A 2WLJA 3K9AA 4DV2O 2L35A 3CCVV 1X59A 4CC6A 1U96A 1Q6HA 2XNDG 3RYCB 3ASNC 1WJZA 3CC4V 3EFFK 3CB2A 1QR8A 2X0LA 3VQWA 5IYZB 4LF4O 5IY5C 3OFNG 1GO3F 1P4RA 4EB6A 2EZPA 1BL8A 1K97A 4FJCC 5CA0A 4I9WA 4YHHB 4X1IB 2BTQB 3JARB 5GONB 4I5SA 1N8RW 3CCQV 4DW1A 4LFCO 5B3SB 2ITDC 2JRIA 4GKJO 4JI7B 3N27A 1Y74B 3HKDA 4GYCB 3FFQA 3A0RA 2OWOA 1B04A 2MK3A 1N0NA 1CEZA 2P06A 4O4IA 1VF7A 1LUVA 3CHXA 2Q73A 5FL7G 1IXBA 1OJHA 3BPZA 5GTHZ 4MTOA 3X2QC 2MW2B 2QKCA 1HNWO 1V55B 1SS3A 4FVMA 5K1PA 2QM4A 1IBKB 4YY3B 1R6NA 4GZRB 4JAVA 3B4SA 3CC2V 4YIPA 3JAKA 1KYOF 1HNZB 4IIJA 4OXSA 3ZMUA 2FKXA 3HR0A 4FZ0A 4JTAB 4O4IB 5JJEB 3GWKC 2DWDC 4AI8A 2QWQB 3W7SA 1HR0O 1K7DA 1GM8A 2HP8A 4QNHB 3AG3B 1HNXO 1FXVA 4DV3O 2YXHA 1CPYA 1D2DA 1VQOV 3D36C 2WLIA 1SC5B 3CMEV 2QWNB 2PY5A 4MVZA 1F7YA 1NS1A 5KLVH 2ZT9B 2W0XA 1AI6A 3RYHA 1KECA 1ZSPA 2JGUA 3DXRB 4R8CA 4LR3A 4P9OA 4PA6A 2Y69C 4O4LB 2BE3A 4ZKIA 5DEDA 3JAWB 3QVNA 1MNGA 5DECA 2OYQA 1KUQA 2D2CB 2Q8VA 1R73A 3WG7B 1I94O 1PL4A 5KAIZ 3ZHRA 1IBLB 3K3WA 3AG3C 4LF7B 1ORQC 1SA0B 4ZI7A 1OV9A 3ZEDA 3ZHTA 1K4CC 5J2UA 2QGNA 3CS5A 5HFLA 1Y66A 4JYCA 3RGBA 4DV0B 2JEUA 4PDVA 3JSNA 3JALA 2QWPB 1XBLA 3JCUZ 4QIWF 3BA9A 2YUAA 2EIJC 4B3RB 2NNUA 1H38A 1F51A 4YY3O 3RVYA 4NTYA 3H1JH 5EBMC 5KAFZ 4UB8Z 3K5MA 3CP1A 4PI2A 3K59A 3KCYA 4JV5O 3K04A 1VQ4V 3AK3A 3E22B 4QE7A 1L0NH 2Y4UA 3A2FA 1FJGB 1RSOA 5IJ9A 1BCCH 5IYCO 4FLUA 3UO2A 2QJ1A 1KP2A 4I7ZB 1R3IC 1AILA 5EIBD 2BTOA 1FKAO 2OTLV 4RUEA 4JI8O 2WAMA 2HVJC 1BHBA 1TUBA 1WPBA 3C3SA 3HKCA 3Q4HB 4TT3G 2Q5ZA 2HG5C 4GUNA 1TGOA 1IXMA 1M57B 1FFTB 2FYUH 1EBOA 2F95B 2G38A 1QR9A 3DC5A 5JH7A 1K3EA 1TUBB 2NLJC 3STLC 1VQLV 2JGDA 1VF6C 1ZUQA 5H6RA 1NR7A 3OEHG 1VQNV 2XASA 1K9MW 4F6RA 1R6TA 4DK1A 3ABLC 5JJNB 5B1BB 2VQEB 4LF6B 2ZIMA 1WB7A 5J2TA 2F93B 3W7WA 5GTIZ 4DR5B 1L8DA 1Q3EA 1S5HC 4UV9A 1XI1A 2PUSA 4K3AA 4UVBA 4X20A 3ZRWA 2IW5A 1Q8IA 4CBCA 2R9IA 1RFYA 3RYFB 4JI0B 3WG7C 4H33A 3UM7A 3KG2A 4I0XB 4LP8A 3JATB 4DR4B 2GTSA 5EBLC 1DGSA 5B3SC 5D5PA 3N2GB 2XAHA 1Z2GA 4DR1B 1XILA 2OCCB 4CH3A 4DRXA 4O2BB 5LHIA 4PD4F 5LOVA 4QE9A 3FB8C 4XDJA 1DLBA 4MVSA 3J81N 2Q67A 4X64B 2XAGA 3QNEA 2P67A 1H2KA 4J10A 4LC1A 4OX9O 2HR3A 2FB5A 3E89A 2ITCC 1Y4MA 1YHQV 3ZIAG 3JD4A 3F7YC 1M56B 1TVKA 3L70H 1VQ8V 1Q82W 2DJVA 3TJTA 1SQGA 3OR6C 1M57C 3A8TA 3R66A 1QQCA 1WP8A 2QDOA 3TXQA 4DW0A 2EINB 3ZHQA 1LUWA 3AG7A 5CB4B 1NTZH 4KXRA 1VQKV 4W4LA 4P2ZA 5KHIA 3RN4A 1I7FA 3ZMVA 1H2LA 1SZXA 5A2QN 4JI1B 3HB3B 3H1KH 2PI5A 1B3QA 1BQZA 2N04A 1K8AW 3B8MA 4O4LA 2E74B 1XMOO 2CH7B 4FFBB 1IZ3A 1V54C 4DRXB 4AQYO 2HKOA 2KG7A 1JCHA 3O65A 3SJQC 1S72V 5EIBC 1XDCA 4L87A 1Q81W 5HFMA 1AR5A 2DYRC 5LBQA 3K03A 4NXMO 3JSLA 4ABMA 1FS0G 5IT9N 5GW7A 2WLIB 4B3MB 2EINC 3IC7A 4J7KA 2F23A 3OTFA 4OPAA 4B3TB 1BS3A 4TV9A 2WLMA 1WNSA 5H9CA 3JALB 4KUMA 2R72A 3OD4A 4DV7B 1NH2B 2Q7GA 5LGUA 4BR6A 2JGDB 2NN4A 3SYCA 3CMAV 4CC5A 1N33B 1XMQB 4D7TA 2PI4A 5FLXN 3CRQA 5DN6G 4RQFA 1N36O 4DUYO 2KKWA 3WB2A 2CGOA 4NXMB 2F66C 3JARA 5GONA 4BAYA 5LP6A 3S3WA 4X66B 3APOA 1ENVA 2ADQB 3FAVB 2B9ZA 4KP4A 1NH2D 4ICGA 5IWAB 3PJSK 4GX2A 3G6BA 1XQ8A 4KHPB 4DR5O 2E5LO 3D36A 3CX5F 3AG4C 5JWPA 2Z3YA 1MZFA 3H9VA 2IU0A 3LSUA 2ETNA 1EZVH 3KZIZ 3T1CA 4QPKA 4L8JA 2CUGA 4UCRA 4LH7A 1SQBH 2ZXWC 3K0GA 4LH6A 4X20B 3ZCCA 1MG1A 4UVCA 1ZLZA 3CRCA 3TETA 3VQXA 2IU3A 3RWRD 4RQEA 2VQFB 1O9GA 4LF8B 4HAMA 5KA5A 1V54B 2XUMA 4KL1A 1JJOA 4K35A 4NB5A 1KC8W 2XHBA 2LFRA 3FB5C 2QWOB 4Q6GA 1GRJA 1WB8A 3W7TA 4U3FH 1P7BA 5LGNA 3WFVA 2M6YA 5LMUO 5FNVB 2LJ2A 1SQQH 3LSSA 3SDLA 4FLWA 5E79Z 2WLKA 1GH6A 1MABG 2ZDIC 3GVMA 2Q6AA 2Z0AA 1BGYH 3E8BA 4JI2O 4R7CA 4CS4A 2CE4A 1Y6XA 4X1KB 1H2MA 2Y0IA 2C2AA 5KX5B 3QG5A 2P90A 1KMIZ 5KMGA 3ZBHA 1K73W 2DN9A 2RDCA 1AR4A 2DQ0A 3AG2B 1KBHA 2KQXA 5LYJA 1SF9A 4O4HA 4RO2A 3ABTA 1MMMA 2RNBA 2YIBA 3SYPA 3P30A 4LNUA 4CZZA 3QO7A 5JCOA 3T1HO 3HPLC 4GLXA 3IC9A 1XNQB 4YJ2A 4FLZA 2X7RB 1A32A 3ZRXA 3BEHA 3SPHA 1M4UA 2CH7A 1FAFA 3VQVA 3H01A 4HZ3A 2PYLA 4FLXA 3R65A 1SQVH 2VWKA 1FXHA 3JAMN 2AW9A 4N23A 3NR7A 1D5NA 1GN4A 2X6BA 2XAFA 1GM9A 1B06A 3T4DA 5JVDB 3A0HZ 4X65B 5IYDO 2JS5A 4G27B 2YI8A 2UXCB 2EULA 4LF9B 2GUZA 3OMIB 1PNLA 4TV8B 1NI8A 1XNRB 5D5QA 4JPRA 1U97A 1B6QA 2LQTA 3LNNA 5LMNO 2ZIOA 4R6ZA 1VQ7V 2ZE7A 4DR7O 4DR3B 1N36B 1IBMB 2EIMB 1N32O 5FPOA 1Q86W 3MHHC 1DF4A 1H2NA 3DSQA 3WB0A 3RFRA 2V1DA 4UFZA 4TUYA 1BT8A 2CK3G 4FFKA 3OGIB 2YIBD 3FB7C 1W0KG 2YXLA 1L1FA 5KHKA 2PGGA 3E83A 4JF3A 4IHJA 1X4TA 2BOBC 1XNRO 2F1MA 3A0BZ 3RYCA 1WA8A 3OAAG 4GX5A 1BHAA 4BIUA 4FLTA 2XOKG 2QM7A 1VQ6V 2Q7EA 1EZJA 4MTFA 1IBMO 3SPCA 4TOIA 1FXKA 1SETA 4LFBO 2Q0AA 5LHHA 3MD0A 4QJFB 4GX0A 2LGWA 5C8YB 1NQTA 2Q9LA 2ODMA 4UCVA 2EIKC 2RN9A 4H13B 2QM8A 3CRRA 5J2UB 1S0VA 4JI5O 1AROP 3ASOC 1HNWB 4AQYB 3DTUB 1F4NA 1CXZB 3CEIA 2ZM6B 4B7KA 5C93A 4FPPA 5LA6A 5EC1C 3I55V 3ETDA 1RSOB 5IJ9B 4NVPA 2Y48A 1ZAUA 4PDLA 3JD0A 1VQMV 3BAAA 4GKKB 4IYHA 4JYYA 4WFGA 2ZQMA 4MS2A 3OTOO 1FJGO 3D3QA 4B7EA 5EYPB 2N74A 4I55A 4JASA 4WBNA 1AR1B 1WN7A 2R9AA 5B1AB 3L75H 4LFBB 4JTCB 4I50A 3K79A 3E8GA 4BW9A 1YZBA 3B40A 5KX5A 2WSSG 4UV8A 4LWSA 3F5WC 1S3JA 4HBNA 3JASB 1UFIA 2PZSA 3ZN1A 3T1YO 1FXKC 5LP6B 2QEXV 3FD9A 3RYFA 4J9ZB 2UXBO 1VARA 2XAJA 2Y0PA 5CA1B 4GKKO 1PP9H 2ADPA 4FLYA 2HHHO 3FYEB 3KKYA 1Q6UA 2DYSB 1E1RG 2E76B 3OMNB 3EXAA 2E5LB 4DR3O 3CWBH 4J80A 4UUJC 1IX9A 3E86A 2UUCO 2CDYA 3X2QB 4MT8A 1RM1C 4UCSA 1W2BU 4YJ2B 3QTCA 1YXBA 1M1KW 2QR4A 1JX9A 1PNKA 3OT7A 4LF9O 4XBFA 1F4MA 5AG2A 5B1BC 4LF4B 2OIGA 1R3KC 4BIZA 1E1QG 3E8FA 2QWRB 3OGCC 2UXBB 2W6IG 4N21A 1PL0A 4JI3O 4NXNO 4EFEA 3L73H 2YS8A 4IHJB 4P30A 4YJ3A 5KHJA 3N2GA 2EJRA 1VIBA 2X6CA 1IVSA 1AI5A 4LF5B 4CH6A 1YF2A 3BVOA 4QGPA 3M99B 5JQGA 1GN3A 1NBMG 1AJPA 2ATKC 1FD9A 3CJHB 4K8XA 3ABUA 4UCOA 2R9RB 3LUTB 1YCIA 3WU2Z 5IYZA 4FK5C 4EKWA 1BZKA 5H5NA 5IY5B 4NKGB 4PHZA 4JYAB 5BXZA 3CRMA 3IJ4A 4ASUG 2EIKB 3CE2A 3JD3A 2EIMC 4DV4B 1MSDA 5EBWC 2UUAB 2R70A 3T1YB 1KKCA 4ZI7B 4O4JA 1AP5A 4TV9B 2A79B 1KQSU 2Q7HA 2QTSA 1GKFA 1FXKB 1OCZB 1XUQA 5LP6C 2LW1A 2WA4A 5JVDA 2H3OA 3W7XA 3P3NA 4J41A 1EN6A 2V4DA 1ROPA 3Q4HA 4JYBA 3W7UA 5B1NA 2JK5C 4GT1A 1IURA 1YTFD 2YICA 4IL6Z 2UUBB 2DMXA 2QE7G 2UXNA 2RJZA 1SESA 3OM3B 3SJBC 5KUKA 2IM9A 5J9PC 5BR8B 2YEVB 2D3OW 4DV1O 3JATA 2EBOA 1P49A 1Z5VA 3UO3A 4Z1VA 3HKEB 4KHPO 2LP7A 2WLHA 1YIJV 3OUFA 5B1AC 3SYOA 4MVMA 5IJ0B 3OE7G 3RBZA 4JI4O 1QBZA 2XT9A 3CCRV 2CGNA 3ASOB 2IJIA 1NKDA 4G28B 4MVOA 4O4JB 4FLVA 3CCSV 4XDLA 4G2KA 4OX9B 1IDSA 3LNMB 4PJ0Z 1EFRG 2VRZA 2VQFO 3DC6A 3GB7C 2ZDIA 4JV5B 3K06A 1DTOA 1N34B 3IFXA 3LDCA 5CA1A 1M5IA 5JJJB 2EILB 3ABKC 1WLEA 3SYQA 2Q4PA 1SQPH 2DW4A 5BMVA 4FMTA 1I5XA 4B3RO 2OTJV 3LSQA 3G4SV 3CCUV 2CTWA 1KB9F 1SQXH 1WA8B 2DQ3A 5L3CA 4H44B 1UJWB 2YIAA 4HNAA 3G67A 2O57A 4I50B 3SJCC 3QO8A 1EM1A 1EN5A 4WFBV 4RAIA 3I5DA 2K9PA 4DR6O 4MW8A 1OCZC 2UXDO 1O9HA 3L9DA 2ARHA 4UCUA 3CRAA 1PNMA 2BOCC 1ZX3A 4PA7A 5KMGB 4YIOA 4YJ3B 4LF5O 3AK1A 3L74H 1OCRC 3ZHVA 2F43G 1KU9A 1FFXA 1EN4A 1YITV 5CA3A 2H8PC 4OGQB 4LFCB 1XL4A 2ZNJA 4B3TO 1JJ2U 1MA1A 3TXSA 3ZS8C 4QPJA 4JI2B 3H1IH 3SGIA 5FNVA 4DR2B 2LW7A 1M56C 4X8AA 4DR6B 2B1GA 3ZHUA 1KKDA 5CN0A 1Y67A 4B08A 3BY6A 2Q69A 2YXYA 5LXTA 2EJ7A 2W0FC 3SJAC 4LCUC 3K08A 1VF6A 1G6UA 5C8YA 4BWAA 3E22A 1PKXA 2K1EA 1JFFB 1N33O 3T1HB 1HNZO 1XHZA 1YTFB 5EC2C 3HKCB 2GHYA 1N32B 4IT5A 2E3CA 5LOVB 2ZE5A 4ZBMA 2WA3A 5B66Z 2AHZA 3JASA 3K5OA 1IBKO 2RCVA 1V55C 4K0KB 1NVPB 3G6EV 4P9PA 1AB3A 5LXTB 2UUCB 1GN6A 3O9OA 5FPRA 3MAQA 2P7TC 4Q20A 2HVKC 2P4VA 2OIEA 4JI1O 3K9SA 4JI4B 3ETGA 2XTAA 1LR1A 4TSFG 1ZWIC 1SQFA 5CBHA 1YVWA 3ZHSA 4DXWA 2EZOA 1ZL8A 4DV5O 4F6EA 3CD6V 2DYRB 2OCHA 4H0LB 2P4KA 4NTXA 1QLNA 1FFXB 1H2GA 4MSWC 3ABMC 1TVKB 4EFBA 2GV9A 4UB6Z 1ZL8B 3JCZA 4R50A 1US6A 4IGGA 4EEQA 3ZX6A 1H8HG 4IYIA 1RP3B 2A7WA 2N05A 3CJHA 4X64O 2HLDG 3RYIA 4GKJB 2DWEC 3NXSA 4FM2A 1RM1B 1VP7A 2IJJA 4MW3A 4B3MO 2DOSA 1XMQO 1Q90D 1NJIW 4DV4O 1XNQO 4JZ2A 4DV6B 5EK0A 1K92A 4LFAO 4JI6B 4NTWA 5E1AC 3JYCA 2UXDB 2ZKOA 2KB1A 3K5NA 5BMVB 4E4EA 5CBGA 1AJQA 5KA6A 1JPXA 3RYIB 1BMFG 5IWAO 4PV1B 1W59A 2QTOA 1QLEB 2GTAA 1N4CA 3UT5A 1QU7A 4JTDB 1M93A 5K1XA 1P7GA 4XDKA 3TCUA 1OHHG 1S76D 4X9QA 4J42A 3CC7V 1H8EG 5KHHA 2EX3A 4RWUA 2EILC 3ABKB 3LDDA 4H37A 2HJDA 2YSUB 5CBFA 2F4VO 1KP3A 2AGAA 2ZR3A 4PI0A 5IJ0A 4JI6O 1P84F 1Q5OA 4FZ1A 4W4KA 2RQ6A 4FM1A 3JAWA 5CA0B 2BSKB 2UU9B 5LYJB 1PD3A 3QO5A 4K0KO 4DV3B 3ML0A 3ETQA 3RW0A 3WB1A 3JD1A 4BIOA 1HR0B 1NVPD 3CYOA 1T5EA 1D5AA 2W6JG 3MHSC 3OR7C 5LMNB 2CAZC 4X1KA 3AG2C 4LBEC 2L6LA 3UQ8A 5B1OA 4JI3B 4NXNB 2Y4TA 2VQEO 4LF6O 2A9HA 1YJ9V 1IBLO 4J9YB 1M90W 4CH5A 1YEWA 4X1YB 4ZHQA 3APQA 3S3XA 4UCTA 1OCOC 1OCCC 3ZMZA 2JDIG 1DF5A 3VQYA 5IDJA 1N34O 5H2FZ 1URFA 2Y69B 1MOFA 1W0JG 2BCCH 4LFAB 3J80N 3BFRA 1GAXA 3OEEG 4LF7O 4NR1A 1K33A 4Z2WA 3F5TA 3H1LH 1R3JC 4DR1O 3GWOA 3D8CA 3ZMTA 3C90A 3ZRVA 4AILC 1WPXA 3PN1A 1SZTA 2YC0A 1YI2V 2UUAO 3SYAA 5A9GA 4GX1A 1NR1A 5JCOC 2ZNIA 3B2EE 4ZIBA 4ZOLB 3BHPA 2ZCEA 4MTXA 3DXRA 2ZINA 1HW7A 3HKDB 4JI8B 2IH3C 1Z5WA 3B77A 4MVRA 3CCMV 3ABMB 1YJNV 1UPGA 2ILMA 3RVZA 4CS2A 3FKSG 3U11A 5L3BA 3B8NA 2IBZH 4X66O 1JMKC 2LFSA 1COWG 3TK1A 5H6QA 1VQPV 3SR2C 3BA8A 5LMUB 2WPDG 5BZBA 2Z5UA 3M7MX 2AHYA 2DYSC 2KG7B 1JQ0A 3ICXA 1BE3H 4O2AA 2AZ0A 5BR8O 2UXCO 2F4VB 2BSKA 4D7SA 4TV8A 3CCLV 3P3PA 1HNXB 1NTMH 1AI7A 4DR2O 3H1HH 1OZ0A 1GTOA 1XEQA 2Q0OC 3HKBB 3ABLB 2JIZG 3B09A 5ITZA 3LDEA 1Q7YW 1R6KA 2Q68A 4JZGA 4LF8O 4WFHA 3VBBA 4GCZA 4U3JB 4DV2B 4PELA 2EIJB 4O2BA 1OCCB 1OCOB 3FYIB 3K58A 1NTKH 4JI0O 2M7WA 2PF4E 3ZJZA 1G4YB 3F7VC 1GM7A 4DUZO 1PPJH 2WWWA 4I55B 5KUMA 3CPWU 4LNUB 3G71V 2WLLA 5DM6V 3FX7A 4YXWG 1VQ9V 5BY1A 4WFFA 4MTGA 1FPOA 4JI5B 4K8ZA 3ETEA 1R3LC 5IE9A 1SERA 4O4HB 4UVAA 2JJ2G 4PA4A 3AK2A 2ZM6O 2VWJA 4MVUA 1TAEA 5L3DA 4LWSB 1K5QA 3IGAC 2YEVA 3UCSC 3T2MA 2P6JA 4FFBA 3N2KB 4OPHA 4ZOLA 1AP6A 4TQFA 3DGEA 1SA0A 3JAKB 4I9QA 2FTKA 1XOUA 1GK9A 2XAQA 1I5YA 3VOUA 1HDJA 1YDXA 2ZE6A 4MVQA 3HKBA 5IYBO 3OMAB 2QKAA 2AZ2A 1RPRA 2ZR2A 1SRYA 2AXTZ 1AVMA 5LA6B 1M9NA 4E2LA 3BRCA 3K57A 2A06H 4PA3A 1QLEC 3QF7A 1Y76B 1Y74A 4B3SB 5CMUA 5LGTA 1JVMA 3EVKA 2JJ1G 3E35A 3BCCH 4X1YA 4X65O 2HHHB 1TUEB 3U0ZA 2WLLB 2KSDA 2GDSA 1AJNA 3E2EA 3ZMSA 3ASNB 3HKEA 4CH4A 4NYKA 4X88A 2DE0X 1QNMA 4PDMA 3CCJV 4DR7B 3BABA 4DV7O 2UUBO 3MDSA 5TISZ 2CTPA 1YSCA 2YIDA 1THZA 2GSMB 1HWYA 2HEPA 4WCEV 2IH1C 1S5JA 2OT5A 2GBOA 5JH7B 3FB6C 4BW5A 5B5EZ 5KHGA 3JD2A 4DYLA 3CXCU 4JAAA 2HJFC 1I0HA 1FYJA 4A5UB 2QKSA 3OTOB 5EZYB 5CB4A 5J2TB 3SPGA 1NZ6A 1Y76A 1QVFU 3SPIA 3G80A 4J7ZA 1HP8A 1J5EO 3AG1C 1VQ5V 3M8AA 1I94B 3RYHB 4D6TH 2JEXA 4U7OA 2VS0A 4DR4O 1QCEA 2YDEA 5JQGB 3AG4B 2BTQA 1G1XB 4UXNA 4PA9A 3RT3C 1NU1H 3L71H 4TUYB 4CS3A 2FMLA 4EB6B 4DV5B 1DK1A 1V9PA 1BSMA 1BQ0A 1JFFA 4TWKA 2A0LA 2B5UA 3P32A 3K5LA 4HNAB 1K34A 1SKVA 2IJKA 3TGUH 3IAYA 1G8MA 2ZD9A 2JS3A 1MZEA 4JYAO 1E79G 2P22C 3FAVA 4C7UA 3CSXA 1R1BA 1XMOB 3L72H 2PTMA 2UXXA 1VF5B 2CTRA 2RMKB 3I56V 3UKMA 1XREA 4DV6O 1S77D 1LNQA 4DK0A 3AEIA 1VEWA 4JGSA 1WAZA 4WFAV 2ZE8A 4WFEA 4X62O 1PV0A 4FM0A 1N0JA 2X6AA 1YJWV 3ZN0A 1K4DC 4WF9V 3D3IA 2V7QG 4O2AB 3CCEV 1CP9A 4B3SO 3N2KA 4U3JA 3T4ZA 4IIJB 3U10A 2JVDA 2WLNA 2GUZB 3J7AU 4U7NA 1S5LZ 2HFEC 4KFMA 1MSWD 2B1IA 1VMGA 2NR5A 3UT5B 2OCCC 1XL6A 1WP7A 4YHHO 1I08A 4I4TA 4DV1B 1H2SB 1L0LH 2QA4V 2E75B 3K0DA 3EHBB 5L3FA 1F23A 4JI7O 1QVGU 4DUYB 2YI9A 2LO1A 3KCXA 2ZXWB 1Q6IA 2CTQA 4AHCA 4FIPC 4JAUA 5LHGA 3C3TA 4WBNB 3CXHF 4HYOA 1RPOA 4I0XA 2LGQA 5LL6Y 4I4TB 5ITZB 3ZRWB 4X1IA 2P5OA 5EYPA 2A3QA 4J11A 1K5SA 1GN2A 2UU9O 5F2VO 3E8HA 2QSAA 3OW2U 1TA8A 1QHTA 1NT2B 4PDRA 4F4LA
chains in the Genus database with same CATH topology
1DF5A 3OUSA 5H9CA 5IDJA 4KUMA 1JOYA 4ASUG 2EIKB 3JD3A 1GMGA 3STZC 2Y69B 1AI4A 1MOFA 1W0JG 2EIMC 1NH2B 3SPJA 5EBWC 4DO2A 3AG1B 5LGUA 3OEEG 4Z1MG 1K33A 5L3EA 1J95A 3SYCA 3CMAV 2A79B 1KQSU 2PI4A 1R3JC 1KD1W 4RUFA 3GWOA 3ZMTA 1GKFA 1FXKB 1OCZB 2H94A 3ZRVA 2IJHA 5DN6G 4RQFA 3ZRSA 4X89A 1WPXA 5L3GA 1SZTA 3W7XA 1OCRB 1YI2V 3SYAA 2WLJA 3K9AA 4GX1A 1NR1A 1ROPA 4JYBA 4BAYA 3CCVV 3W7UA 5B1NA 2JK5C 1ENVA 4KP4A 4GT1A 1NH2D 1YTFD 3PJSK 4GX2A 2XNDG 2QE7G 2UXNA 3ASNC 3D36A 1SESA 3OM3B 3CC4V 4MTXA 3AG4C 5KUKA 3EFFK 1QR8A 2Z3YA 5J9PC 2YEVB 2D3OW 2X0LA 2IH3C 2IU0A 5IY5C 3OFNG 3B77A 4MVRA 3CCMV 2EBOA 1GO3F 3ABMB 1P4RA 3T1CA 2EZPA 1YJNV 1BL8A 4QPKA 1K97A 3RVZA 3FKSG 4FJCC 4I9WA 2LP7A 5L3BA 3B8NA 2WLHA 1YIJV 4I5SA 1N8RW 3CCQV 2LFSA 2ZXWC 3K0GA 1COWG 3OUFA 3TK1A 3ZCCA 5B1AC 5H6QA 3SYOA 1MG1A 1VQPV 4MVMA 4UVCA 3TETA 3OE7G 2WPDG 5BZBA 3RBZA 5B3SB 1QBZA 2ITDC 2IU3A 3CCRV 2Z5UA 4RQEA 3ASOB 2IJIA 1NKDA 4G28B 4MVOA 3A0RA 2AHYA 2DYSC 1JQ0A 2MK3A 4HAMA 1CEZA 3CCSV 5KA5A 4XDLA 1V54B 4G2KA 1KC8W 3LNMB 2LFRA 3FB5C 1EFRG 5FL7G 3GB7C 4MTOA 3X2QC 3CCLV 3W7TA 2ZDIA 3K06A 1DTOA 1P7BA 5LGNA 1V55B 3WFVA 3IFXA 3LDCA 1AI7A 1OZ0A 1GTOA 3ABKC 2EILB 1WLEA 3SYQA 3ABLB 1R6NA 3LSSA 4JAVA 2JIZG 3CC2V 2DW4A 3LDEA 1Q7YW 4FMTA 1I5XA 1R6KA 2OTJV 2Q68A 3LSQA 3G4SV 4WFHA 3VBBA 3CCUV 4GCZA 2WLKA 4OXSA 2DQ3A 4PELA 3ZMUA 1MABG 2EIJB 2ZDIC 2Q6AA 1OCCB 1OCOB 3E8BA 4R7CA 3FYIB 4JTAB 5L3CA 1UJWB 2C2AA 2DWDC 2M7WA 3ZJZA 2P90A 1G4YB 3F7VC 1GM7A 3W7SA 5IY5B 1K7DA 1GM8A 3QO8A 1K73W 3AG2B 2DQ0A 4QNHB 3AG3B 1FXVA 4WFBV 2WWWA 4RAIA 1CPYA 1OCOC 5KUMA 3CPWU 1VQOV 4RO2A 3ABTA 2WLIA 4MW8A 3G71V 2WLLA 3CMEV 1OCZC 5DM6V 1VQ9V 4YXWG 4MVZA 4MTGA 4WFFA 3SYPA 3P30A 3ETEA 1R3LC 1SERA 4UVAA 2JJ2G 4CZZA 3QO7A 4PA4A 3HPLC 4MVUA 1AI6A 5L3DA 1K5QA 1PNMA 3IGAC 2BOCC 2X7RB 4PA7A 2YEVA 3ZRXA 1KECA 3BEHA 3T2MA 3SPHA 2P6JA 4R8CA 1OCRC 2F43G 4P9OA 4PA6A 2Y69C 3H01A 4HZ3A 3DGEA 1YITV 3R65A 5CA3A 1FXHA 4ZKIA 2H8PC 2FTKA 1XL4A 4N23A 1JJ2U 1GK9A 2XAQA 1I5YA 2X6BA 2XAFA 1GM9A 3VOUA 3T4DA 4QPJA 4MVQA 1R73A 3WG7B 5IYBO 3OMAB 5IYDO 1RPRA 3K3WA 2ZR2A 1M56C 4G27B 4X8AA 3AG3C 1SRYA 3OMIB 1ORQC 1PNLA 2B1GA 1M9NA 1KKDA 5CN0A 4JPRA 4E2LA 3BY6A 1B6QA 1K4CC 2Q69A 5HFLA 1Y66A 4R6ZA 1VQ7V 2W0FC 4JYCA 4PA3A 4LCUC 1QLEC 2JEUA 4PDVA 3K08A 2EIMB 5CMUA 1PKXA 2K1EA 5LGTA 4QIWF 1Q86W 3MHHC 1DF4A 1JVMA 2EIJC 2JJ1G 3E35A 2NNUA 2V1DA 1H38A 1TUEB 1F51A 2WLLB 3RVYA 1YTFB 5EC2C 5EBMC 2CK3G 3CP1A 2GHYA 1AJNA 3E2EA 3ZMSA 3K04A 1VQ4V 3ASNB 4ZBMA 3FB7C 1W0KG 4X88A 2AHZA 4PDMA 4QE7A 3CCJV 1L1FA 1V55C 1NVPB 3G6EV 5IYCO 4P9PA 3E83A 4JF3A 1YSCA 1KP2A 1THZA 2BOBC 1HWYA 2GSMB 2P7TC 1R3IC 4Q20A 1BHAA 3OAAG 4GX5A 2OTLV 4BIUA 4WCEV 2IH1C 4RUEA 2HVKC 2WAMA 2XOKG 2OT5A 2QM7A 1VQ6V 2HVJC 1BHBA 1EZJA 3FB6C 4MTFA 3ETGA 4BW5A 4TT3G 3JD2A 3SPCA 3CXCU 1FXKA 4TSFG 2HG5C 1SETA 1ZWIC 2HJFC 5LHHA 3MD0A 4QJFB 4GX0A 1IXMA 5CBHA 1M57B 1FFTB 1EBOA 2QKSA 4DXWA 1NQTA 2EZOA 1QR9A 2EIKC 1K3EA 3SPGA 3CD6V 2DYRB 1QVFU 3SPIA 2NLJC 3STLC 1VQLV 2QM8A 1QLNA 1S0VA 1AROP 3ASOC 5H6RA 1NR7A 2WLMA 3AG1C 3DTUB 3OEHG 1VQ5V 1VQNV 1F4NA 2XASA 1H2GA 1K9MW 5C93A 4FPPA 3ABLC 4MSWC 5B1BB 5EC1C 3ABMC 3I55V 3ETDA 3W7WA 3JCZA 4R50A 2Y48A 2JEXA 4U7OA 4PDLA 1S5HC 3JD0A 1VQMV 1QCEA 4UV9A 4WFGA 2ZQMA 4MS2A 4UVBA 1H8HG 3ZRWA 2IW5A 3AG4B 2HLDG 4CBCA 4UXNA 2R9IA 4PA9A 3WG7C 3ZMZA 4JASA 4H33A 3UM7A 3KG2A 1AR1B 2DWEC 3NXSA 4LP8A 5B1AB 1RM1B 4JTCB 2IJJA 5EBLC 4MW3A 3K79A 3E8GA 4TWKA 5B3SC 2A0LA 2B5UA 3P32A 1K34A 1NJIW 2XAHA 2IJKA 2WSSG 4UV8A 2OCCB 3F5WC 1S3JA 5EK0A 5LHIA 1K92A 1G8MA 2ZD9A 1E79G 5E1AC 3JYCA 4QE9A 3FB8C 4XDJA 3ZN1A 1DLBA 4MVSA 1FXKC 2KB1A 2QEXV 2UXXA 2Q67A 2XAGA 3QNEA 1AJQA 5CBGA 1JPXA 5KA6A 4J9ZB 2P67A 1BMFG 3I56V 2XAJA 3UKMA 4LC1A 1S77D 1LNQA 1QLEB 2QTOA 3AEIA 2HR3A 3E89A 4JGSA 4JTDB 3FYEB 2ITCC 4WFAV 1Y4MA 4WFEA 1YHQV 3ZIAG 3JD4A 2DYSB 4XDKA 3TCUA 1E1RG 2X6AA 3F7YC 1YJWV 3ZN0A 1K4DC 4WF9V 1M56B 1OHHG 3D3IA 1S76D 3CC7V 1VQ8V 3OMNB 1Q82W 1H8EG 2V7QG 4UUJC 3OR6C 3CCEV 2EILC 3ABKB 1CP9A 3E86A 3LDDA 1M57C 3T4ZA 3X2QB 4MT8A 2WLNA 1RM1C 2EINB 1W2BU 4H37A 4U7NA 2HFEC 2YSUB 4KFMA 5CBFA 1VQKV 1KP3A 1MSWD 2ZR3A 1M1KW 4P2ZA 2B1IA 1JX9A 1PNKA 4XBFA 2OCCC 3ZMVA 1XL6A 1F4MA 5B1BC 1R3KC 4BIZA 1E1QG 2QA4V 3HB3B 3E8FA 2PI5A 3OGCC 2W6IG 3K0DA 1PD3A 4N21A 1PL0A 3QO5A 3EHBB 1K8AW 5L3FA 3B8MA 3ML0A 1F23A 3RW0A 3JD1A 1QVGU 1V54C 1NVPD 2HKOA 1JCHA 3CYOA 4P30A 2W6JG 3MHSC 2ZXWB 3OR7C 3SJQC 1S72V 4L87A 3AG2C 4FIPC 4JAUA 4LBEC 2EJRA 5HFMA 5LHGA 1Q81W 4HYOA 5B1OA 1RPOA 2X6CA 2DYRC 1AI5A 5LBQA 3K03A 1FS0G 3M99B 1NBMG 1AJPA 2ATKC 3ZRWB 5GW7A 2A9HA 2WLIB 1YJ9V 4J9YB 1M90W 3ABUA 1K5SA 2R9RB 2EINC 3IC7A 3LUTB 3E8HA 4FK5C 4EKWA 3OW2U 1OCCC 2JDIG 4PDRA 4F4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OUS A;  3F5W C;  5EK0 A;  3LDE A;  2ZD9 A;  3STZ C;  2Q68 A;  2WLL B;  5E1A C;  3RVY A;  4WFH A;  2EIM C;  3JYC A;  3FB8 C;  4QE9 A;  2WLK A;  4XDJ A;  4MVS A;  5EBM C;  2KB1 A;  3SPJ A;  4OXS A;  5EBW C;  2Q67 A;  2Q6A A;  3E8B A;  5CBG A;  4R7C A;  4J9Z B;  4JTA B;  5EC2 C;  3K04 A;  1J95 A;  3SYC A;  3UKM A;  2A79 B;  4ZBM A;  3FB7 C;  1R3J C;  2DWD C;  2AHZ A;  4RUF A;  1LNQ A;  2QTO A;  4PDM A;  4QE7 A;  4X88 A;  3ZJZ A;  1G4Y B;  3F7V C;  1V55 C;  3E89 A;  4JTD B;  3ZRS A;  2ITC C;  4WFE A;  4P9P A;  3E83 A;  4X89 A;  4XDK A;  3TCU A;  3SYQ A;  3F7Y C;  2X6A A;  4QNH B;  1K4D C;  2BOB C;  3SYA A;  2WLJ A;  2P7T C;  1R3I C;  4RAI A;  4GX1 A;  1OCC C;  5KUM A;  4GX5 A;  4RO2 A;  2IH1 C;  2JK5 C;  2WLI A;  4MW8 A;  4RUE A;  2WLL A;  2HVK C;  1OCZ C;  3OR6 C;  2EIL C;  4UUJ C;  3E86 A;  2HVJ C;  3LDD A;  1M57 C;  4MVZ A;  3PJS K;  4MTG A;  4GX2 A;  3FB6 C;  4WFF A;  3SYP A;  4MTF A;  1R3L C;  3T4Z A;  4BW5 A;  2WLN A;  3ASN C;  4PA4 A;  3SPC A;  3HPL C;  4F4L A;  4H37 A;  2HG5 C;  1ZWI C;  3AG4 C;  4MVU A;  5KUK A;  2HFE C;  2HJF C;  3EFF K;  4KFM A;  5CBF A;  4GX0 A;  3IGA C;  2BOC C;  4PA7 A;  5CBH A;  5J9P C;  2YEV A;  4P2Z A;  3BEH A;  2QKS A;  3T2M A;  3SPH A;  2IH3 C;  4DXW A;  2OCC C;  4R8C A;  5IY5 C;  4MVR A;  1XL6 A;  2EIK C;  3SPG A;  1OCR C;  3SPI A;  5B1B C;  3T1C A;  2NLJ C;  4P9O A;  4PA6 A;  1BL8 A;  1R3K C;  2Y69 C;  3RVZ A;  3STL C;  4HZ3 A;  3E8F A;  4I9W A;  2WLH A;  3ASO C;  3OGC C;  3R65 A;  3AG1 C;  3K0D A;  2H8P C;  2ZXW C;  3K0G A;  3OUF A;  5B1A C;  1XL4 A;  3SYO A;  3ABL C;  4MVM A;  4MSW C;  3RW0 A;  5EC1 C;  3ABM C;  3TET A;  2X6B A;  5BZB A;  3RBZ A;  3VOU A;  2ITD C;  1V54 C;  3T4D A;  4R50 A;  4MVQ A;  4P30 A;  4PDL A;  1S5H C;  3OR7 C;  3SJQ C;  4G28 B;  4MVO A;  3AG2 C;  2AHY A;  2DYS C;  4WFG A;  4LBE C;  4MS2 A;  1M56 C;  4G27 B;  4X8A A;  3AG3 C;  4HYO A;  2X6C A;  1ORQ C;  2DYR C;  4CBC A;  4XDL A;  4PA9 A;  1KKD A;  3K03 A;  3WG7 C;  3LNM B;  1K4C C;  2ATK C;  4H33 A;  3KG2 A;  2Q69 A;  3FB5 C;  3UM7 A;  2A9H A;  2DWE C;  2WLI B;  4LP8 A;  3GB7 C;  4J9Y B;  4MTO A;  4JTC B;  4R6Z A;  5EBL C;  3X2Q C;  2W0F C;  4PA3 A;  4MW3 A;  4LCU C;  2R9R B;  1QLE C;  3E8G A;  4TWK A;  3K06 A;  2EIN C;  3LUT B;  2A0L A;  3K08 A;  1P7B A;  4PDV A;  5B3S C;  3E8H A;  3IFX A;  3LDC A;  2K1E A;  4EKW A;  1OCO C;  3ABK C;  1JVM A;  2WLM A;  4PDR A;  2EIJ C; 
#chains in the Genus database with same CATH topology
 3OUS A;  1JOY A;  1XHX A;  1ZTE A;  4J7J A;  1GMG A;  3STZ C;  2FL4 A;  2PYJ A;  1PM9 A;  1AI4 A;  3SPJ A;  4TQD A;  4F6R B;  4DO2 A;  3AG1 B;  4Z1M G;  5L3E A;  1J95 A;  4DUZ B;  1KD1 W;  4RUF A;  4ZHQ B;  3THO A;  5EZY A;  2H94 A;  2IJH A;  4DV0 O;  3ZRS A;  1JR9 A;  1JA8 A;  4X89 A;  5L3G A;  1OCR B;  1J5E B;  4X62 B;  1Q43 A;  2WLJ A;  3K9A A;  4DV2 O;  2L35 A;  3CCV V;  1X59 A;  4CC6 A;  1U96 A;  1Q6H A;  2XND G;  3RYC B;  3ASN C;  1WJZ A;  3CC4 V;  3EFF K;  3CB2 A;  1QR8 A;  2X0L A;  3VQW A;  5IYZ B;  4LF4 O;  5IY5 C;  3OFN G;  1GO3 F;  1P4R A;  4EB6 A;  2EZP A;  1BL8 A;  1K97 A;  4FJC C;  5CA0 A;  4I9W A;  4YHH B;  4X1I B;  2BTQ B;  3JAR B;  5GON B;  4I5S A;  1N8R W;  3CCQ V;  4DW1 A;  4LFC O;  5B3S B;  2ITD C;  2JRI A;  4GKJ O;  4JI7 B;  3N27 A;  1Y74 B;  3HKD A;  4GYC B;  3FFQ A;  3A0R A;  2OWO A;  1B04 A;  2MK3 A;  1N0N A;  1CEZ A;  2P06 A;  4O4I A;  1VF7 A;  1LUV A;  3CHX A;  2Q73 A;  5FL7 G;  1IXB A;  1OJH A;  3BPZ A;  5GTH Z;  4MTO A;  3X2Q C;  2MW2 B;  2QKC A;  1HNW O;  1V55 B;  1SS3 A;  4FVM A;  5K1P A;  2QM4 A;  1IBK B;  4YY3 B;  1R6N A;  4GZR B;  4JAV A;  3B4S A;  3CC2 V;  4YIP A;  3JAK A;  1KYO F;  1HNZ B;  4IIJ A;  4OXS A;  3ZMU A;  2FKX A;  3HR0 A;  4FZ0 A;  4JTA B;  4O4I B;  5JJE B;  3GWK C;  2DWD C;  4AI8 A;  2QWQ B;  3W7S A;  1HR0 O;  1K7D A;  1GM8 A;  2HP8 A;  4QNH B;  3AG3 B;  1HNX O;  1FXV A;  4DV3 O;  2YXH A;  1CPY A;  1D2D A;  1VQO V;  3D36 C;  2WLI A;  1SC5 B;  3CME V;  2QWN B;  2PY5 A;  4MVZ A;  1F7Y A;  1NS1 A;  5KLV H;  2ZT9 B;  2W0X A;  1AI6 A;  3RYH A;  1KEC A;  1ZSP A;  2JGU A;  3DXR B;  4R8C A;  4LR3 A;  4P9O A;  4PA6 A;  2Y69 C;  4O4L B;  2BE3 A;  4ZKI A;  5DED A;  3JAW B;  3QVN A;  1MNG A;  5DEC A;  2OYQ A;  1KUQ A;  2D2C B;  2Q8V A;  1R73 A;  3WG7 B;  1I94 O;  1PL4 A;  5KAI Z;  3ZHR A;  1IBL B;  3K3W A;  3AG3 C;  4LF7 B;  1ORQ C;  1SA0 B;  4ZI7 A;  1OV9 A;  3ZED A;  3ZHT A;  1K4C C;  5J2U A;  2QGN A;  3CS5 A;  5HFL A;  1Y66 A;  4JYC A;  3RGB A;  4DV0 B;  2JEU A;  4PDV A;  3JSN A;  3JAL A;  2QWP B;  1XBL A;  3JCU Z;  4QIW F;  3BA9 A;  2YUA A;  2EIJ C;  4B3R B;  2NNU A;  1H38 A;  1F51 A;  4YY3 O;  3RVY A;  4NTY A;  3H1J H;  5EBM C;  5KAF Z;  4UB8 Z;  3K5M A;  3CP1 A;  4PI2 A;  3K59 A;  3KCY A;  4JV5 O;  3K04 A;  1VQ4 V;  3AK3 A;  3E22 B;  4QE7 A;  1L0N H;  2Y4U A;  3A2F A;  1FJG B;  1RSO A;  5IJ9 A;  1BCC H;  5IYC O;  4FLU A;  3UO2 A;  2QJ1 A;  1KP2 A;  4I7Z B;  1R3I C;  1AIL A;  5EIB D;  2BTO A;  1FKA O;  2OTL V;  4RUE A;  4JI8 O;  2WAM A;  2HVJ C;  1BHB A;  1TUB A;  1WPB A;  3C3S A;  3HKC A;  3Q4H B;  4TT3 G;  2Q5Z A;  2HG5 C;  4GUN A;  1TGO A;  1IXM A;  1M57 B;  1FFT B;  2FYU H;  1EBO A;  2F95 B;  2G38 A;  1QR9 A;  3DC5 A;  5JH7 A;  1K3E A;  1TUB B;  2NLJ C;  3STL C;  1VQL V;  2JGD A;  1VF6 C;  1ZUQ A;  5H6R A;  1NR7 A;  3OEH G;  1VQN V;  2XAS A;  1K9M W;  4F6R A;  1R6T A;  4DK1 A;  3ABL C;  5JJN B;  5B1B B;  2VQE B;  4LF6 B;  2ZIM A;  1WB7 A;  5J2T A;  2F93 B;  3W7W A;  5GTI Z;  4DR5 B;  1L8D A;  1Q3E A;  1S5H C;  4UV9 A;  1XI1 A;  2PUS A;  4K3A A;  4UVB A;  4X20 A;  3ZRW A;  2IW5 A;  1Q8I A;  4CBC A;  2R9I A;  1RFY A;  3RYF B;  4JI0 B;  3WG7 C;  4H33 A;  3UM7 A;  3KG2 A;  4I0X B;  4LP8 A;  3JAT B;  4DR4 B;  2GTS A;  5EBL C;  1DGS A;  5B3S C;  5D5P A;  3N2G B;  2XAH A;  1Z2G A;  4DR1 B;  1XIL A;  2OCC B;  4CH3 A;  4DRX A;  4O2B B;  5LHI A;  4PD4 F;  5LOV A;  4QE9 A;  3FB8 C;  4XDJ A;  1DLB A;  4MVS A;  3J81 N;  2Q67 A;  4X64 B;  2XAG A;  3QNE A;  2P67 A;  1H2K A;  4J10 A;  4LC1 A;  4OX9 O;  2HR3 A;  2FB5 A;  3E89 A;  2ITC C;  1Y4M A;  1YHQ V;  3ZIA G;  3JD4 A;  3F7Y C;  1M56 B;  1TVK A;  3L70 H;  1VQ8 V;  1Q82 W;  2DJV A;  3TJT A;  1SQG A;  3OR6 C;  1M57 C;  3A8T A;  3R66 A;  1QQC A;  1WP8 A;  2QDO A;  3TXQ A;  4DW0 A;  2EIN B;  3ZHQ A;  1LUW A;  3AG7 A;  5CB4 B;  1NTZ H;  4KXR A;  1VQK V;  4W4L A;  4P2Z A;  5KHI A;  3RN4 A;  1I7F A;  3ZMV A;  1H2L A;  1SZX A;  5A2Q N;  4JI1 B;  3HB3 B;  3H1K H;  2PI5 A;  1B3Q A;  1BQZ A;  2N04 A;  1K8A W;  3B8M A;  4O4L A;  2E74 B;  1XMO O;  2CH7 B;  4FFB B;  1IZ3 A;  1V54 C;  4DRX B;  4AQY O;  2HKO A;  2KG7 A;  1JCH A;  3O65 A;  3SJQ C;  1S72 V;  5EIB C;  1XDC A;  4L87 A;  1Q81 W;  5HFM A;  1AR5 A;  2DYR C;  5LBQ A;  3K03 A;  4NXM O;  3JSL A;  4ABM A;  1FS0 G;  5IT9 N;  5GW7 A;  2WLI B;  4B3M B;  2EIN C;  3IC7 A;  4J7K A;  2F23 A;  3OTF A;  4OPA A;  4B3T B;  1BS3 A;  4TV9 A;  2WLM A;  1WNS A;  5H9C A;  3JAL B;  4KUM A;  2R72 A;  3OD4 A;  4DV7 B;  1NH2 B;  2Q7G A;  5LGU A;  4BR6 A;  2JGD B;  2NN4 A;  3SYC A;  3CMA V;  4CC5 A;  1N33 B;  1XMQ B;  4D7T A;  2PI4 A;  5FLX N;  3CRQ A;  5DN6 G;  4RQF A;  1N36 O;  4DUY O;  2KKW A;  3WB2 A;  2CGO A;  4NXM B;  2F66 C;  3JAR A;  5GON A;  4BAY A;  5LP6 A;  3S3W A;  4X66 B;  3APO A;  1ENV A;  2ADQ B;  3FAV B;  2B9Z A;  4KP4 A;  1NH2 D;  4ICG A;  5IWA B;  3PJS K;  4GX2 A;  3G6B A;  1XQ8 A;  4KHP B;  4DR5 O;  2E5L O;  3D36 A;  3CX5 F;  3AG4 C;  5JWP A;  2Z3Y A;  1MZF A;  3H9V A;  2IU0 A;  3LSU A;  2ETN A;  1EZV H;  3KZI Z;  3T1C A;  4QPK A;  4L8J A;  2CUG A;  4UCR A;  4LH7 A;  1SQB H;  2ZXW C;  3K0G A;  4LH6 A;  4X20 B;  3ZCC A;  1MG1 A;  4UVC A;  1ZLZ A;  3CRC A;  3TET A;  3VQX A;  2IU3 A;  3RWR D;  4RQE A;  2VQF B;  1O9G A;  4LF8 B;  4HAM A;  5KA5 A;  1V54 B;  2XUM A;  4KL1 A;  1JJO A;  4K35 A;  4NB5 A;  1KC8 W;  2XHB A;  2LFR A;  3FB5 C;  2QWO B;  4Q6G A;  1GRJ A;  1WB8 A;  3W7T A;  4U3F H;  1P7B A;  5LGN A;  3WFV A;  2M6Y A;  5LMU O;  5FNV B;  2LJ2 A;  1SQQ H;  3LSS A;  3SDL A;  4FLW A;  5E79 Z;  2WLK A;  1GH6 A;  1MAB G;  2ZDI C;  3GVM A;  2Q6A A;  2Z0A A;  1BGY H;  3E8B A;  4JI2 O;  4R7C A;  4CS4 A;  2CE4 A;  1Y6X A;  4X1K B;  1H2M A;  2Y0I A;  2C2A A;  5KX5 B;  3QG5 A;  2P90 A;  1KMI Z;  5KMG A;  3ZBH A;  1K73 W;  2DN9 A;  2RDC A;  1AR4 A;  2DQ0 A;  3AG2 B;  1KBH A;  2KQX A;  5LYJ A;  1SF9 A;  4O4H A;  4RO2 A;  3ABT A;  1MMM A;  2RNB A;  2YIB A;  3SYP A;  3P30 A;  4LNU A;  4CZZ A;  3QO7 A;  5JCO A;  3T1H O;  3HPL C;  4GLX A;  3IC9 A;  1XNQ B;  4YJ2 A;  4FLZ A;  2X7R B;  1A32 A;  3ZRX A;  3BEH A;  3SPH A;  1M4U A;  2CH7 A;  1FAF A;  3VQV A;  3H01 A;  4HZ3 A;  2PYL A;  4FLX A;  3R65 A;  1SQV H;  2VWK A;  1FXH A;  3JAM N;  2AW9 A;  4N23 A;  3NR7 A;  1D5N A;  1GN4 A;  2X6B A;  2XAF A;  1GM9 A;  1B06 A;  3T4D A;  5JVD B;  3A0H Z;  4X65 B;  5IYD O;  2JS5 A;  4G27 B;  2YI8 A;  2UXC B;  2EUL A;  4LF9 B;  2GUZ A;  3OMI B;  1PNL A;  4TV8 B;  1NI8 A;  1XNR B;  5D5Q A;  4JPR A;  1U97 A;  1B6Q A;  2LQT A;  3LNN A;  5LMN O;  2ZIO A;  4R6Z A;  1VQ7 V;  2ZE7 A;  4DR7 O;  4DR3 B;  1N36 B;  1IBM B;  2EIM B;  1N32 O;  5FPO A;  1Q86 W;  3MHH C;  1DF4 A;  1H2N A;  3DSQ A;  3WB0 A;  3RFR A;  2V1D A;  4UFZ A;  4TUY A;  1BT8 A;  2CK3 G;  4FFK A;  3OGI B;  2YIB D;  3FB7 C;  1W0K G;  2YXL A;  1L1F A;  5KHK A;  2PGG A;  3E83 A;  4JF3 A;  4IHJ A;  1X4T A;  2BOB C;  1XNR O;  2F1M A;  3A0B Z;  3RYC A;  1WA8 A;  3OAA G;  4GX5 A;  1BHA A;  4BIU A;  4FLT A;  2XOK G;  2QM7 A;  1VQ6 V;  2Q7E A;  1EZJ A;  4MTF A;  1IBM O;  3SPC A;  4TOI A;  1FXK A;  1SET A;  4LFB O;  2Q0A A;  5LHH A;  3MD0 A;  4QJF B;  4GX0 A;  2LGW A;  5C8Y B;  1NQT A;  2Q9L A;  2ODM A;  4UCV A;  2EIK C;  2RN9 A;  4H13 B;  2QM8 A;  3CRR A;  5J2U B;  1S0V A;  4JI5 O;  1ARO P;  3ASO C;  1HNW B;  4AQY B;  3DTU B;  1F4N A;  1CXZ B;  3CEI A;  2ZM6 B;  4B7K A;  5C93 A;  4FPP A;  5LA6 A;  5EC1 C;  3I55 V;  3ETD A;  1RSO B;  5IJ9 B;  4NVP A;  2Y48 A;  1ZAU A;  4PDL A;  3JD0 A;  1VQM V;  3BAA A;  4GKK B;  4IYH A;  4JYY A;  4WFG A;  2ZQM A;  4MS2 A;  3OTO O;  1FJG O;  3D3Q A;  4B7E A;  5EYP B;  2N74 A;  4I55 A;  4JAS A;  4WBN A;  1AR1 B;  1WN7 A;  2R9A A;  5B1A B;  3L75 H;  4LFB B;  4JTC B;  4I50 A;  3K79 A;  3E8G A;  4BW9 A;  1YZB A;  3B40 A;  5KX5 A;  2WSS G;  4UV8 A;  4LWS A;  3F5W C;  1S3J A;  4HBN A;  3JAS B;  1UFI A;  2PZS A;  3ZN1 A;  3T1Y O;  1FXK C;  5LP6 B;  2QEX V;  3FD9 A;  3RYF A;  4J9Z B;  2UXB O;  1VAR A;  2XAJ A;  2Y0P A;  5CA1 B;  4GKK O;  1PP9 H;  2ADP A;  4FLY A;  2HHH O;  3FYE B;  3KKY A;  1Q6U A;  2DYS B;  1E1R G;  2E76 B;  3OMN B;  3EXA A;  2E5L B;  4DR3 O;  3CWB H;  4J80 A;  4UUJ C;  1IX9 A;  3E86 A;  2UUC O;  2CDY A;  3X2Q B;  4MT8 A;  1RM1 C;  4UCS A;  1W2B U;  4YJ2 B;  3QTC A;  1YXB A;  1M1K W;  2QR4 A;  1JX9 A;  1PNK A;  3OT7 A;  4LF9 O;  4XBF A;  1F4M A;  5AG2 A;  5B1B C;  4LF4 B;  2OIG A;  1R3K C;  4BIZ A;  1E1Q G;  3E8F A;  2QWR B;  3OGC C;  2UXB B;  2W6I G;  4N21 A;  1PL0 A;  4JI3 O;  4NXN O;  4EFE A;  3L73 H;  2YS8 A;  4IHJ B;  4P30 A;  4YJ3 A;  5KHJ A;  3N2G A;  2EJR A;  1VIB A;  2X6C A;  1IVS A;  1AI5 A;  4LF5 B;  4CH6 A;  1YF2 A;  3BVO A;  4QGP A;  3M99 B;  5JQG A;  1GN3 A;  1NBM G;  1AJP A;  2ATK C;  1FD9 A;  3CJH B;  4K8X A;  3ABU A;  4UCO A;  2R9R B;  3LUT B;  1YCI A;  3WU2 Z;  5IYZ A;  4FK5 C;  4EKW A;  1BZK A;  5H5N A;  5IY5 B;  4NKG B;  4PHZ A;  4JYA B;  5BXZ A;  3CRM A;  3IJ4 A;  4ASU G;  2EIK B;  3CE2 A;  3JD3 A;  2EIM C;  4DV4 B;  1MSD A;  5EBW C;  2UUA B;  2R70 A;  3T1Y B;  1KKC A;  4ZI7 B;  4O4J A;  1AP5 A;  4TV9 B;  2A79 B;  1KQS U;  2Q7H A;  2QTS A;  1GKF A;  1FXK B;  1OCZ B;  1XUQ A;  5LP6 C;  2LW1 A;  2WA4 A;  5JVD A;  2H3O A;  3W7X A;  3P3N A;  4J41 A;  1EN6 A;  2V4D A;  1ROP A;  3Q4H A;  4JYB A;  3W7U A;  5B1N A;  2JK5 C;  4GT1 A;  1IUR A;  1YTF D;  2YIC A;  4IL6 Z;  2UUB B;  2DMX A;  2QE7 G;  2UXN A;  2RJZ A;  1SES A;  3OM3 B;  3SJB C;  5KUK A;  2IM9 A;  5J9P C;  5BR8 B;  2YEV B;  2D3O W;  4DV1 O;  3JAT A;  2EBO A;  1P49 A;  1Z5V A;  3UO3 A;  4Z1V A;  3HKE B;  4KHP O;  2LP7 A;  2WLH A;  1YIJ V;  3OUF A;  5B1A C;  3SYO A;  4MVM A;  5IJ0 B;  3OE7 G;  3RBZ A;  4JI4 O;  1QBZ A;  2XT9 A;  3CCR V;  2CGN A;  3ASO B;  2IJI A;  1NKD A;  4G28 B;  4MVO A;  4O4J B;  4FLV A;  3CCS V;  4XDL A;  4G2K A;  4OX9 B;  1IDS A;  3LNM B;  4PJ0 Z;  1EFR G;  2VRZ A;  2VQF O;  3DC6 A;  3GB7 C;  2ZDI A;  4JV5 B;  3K06 A;  1DTO A;  1N34 B;  3IFX A;  3LDC A;  5CA1 A;  1M5I A;  5JJJ B;  2EIL B;  3ABK C;  1WLE A;  3SYQ A;  2Q4P A;  1SQP H;  2DW4 A;  5BMV A;  4FMT A;  1I5X A;  4B3R O;  2OTJ V;  3LSQ A;  3G4S V;  3CCU V;  2CTW A;  1KB9 F;  1SQX H;  1WA8 B;  2DQ3 A;  5L3C A;  4H44 B;  1UJW B;  2YIA A;  4HNA A;  3G67 A;  2O57 A;  4I50 B;  3SJC C;  3QO8 A;  1EM1 A;  1EN5 A;  4WFB V;  4RAI A;  3I5D A;  2K9P A;  4DR6 O;  4MW8 A;  1OCZ C;  2UXD O;  1O9H A;  3L9D A;  2ARH A;  4UCU A;  3CRA A;  1PNM A;  2BOC C;  1ZX3 A;  4PA7 A;  5KMG B;  4YIO A;  4YJ3 B;  4LF5 O;  3AK1 A;  3L74 H;  1OCR C;  3ZHV A;  2F43 G;  1KU9 A;  1FFX A;  1EN4 A;  1YIT V;  5CA3 A;  2H8P C;  4OGQ B;  4LFC B;  1XL4 A;  2ZNJ A;  4B3T O;  1JJ2 U;  1MA1 A;  3TXS A;  3ZS8 C;  4QPJ A;  4JI2 B;  3H1I H;  3SGI A;  5FNV A;  4DR2 B;  2LW7 A;  1M56 C;  4X8A A;  4DR6 B;  2B1G A;  3ZHU A;  1KKD A;  5CN0 A;  1Y67 A;  4B08 A;  3BY6 A;  2Q69 A;  2YXY A;  5LXT A;  2EJ7 A;  2W0F C;  3SJA C;  4LCU C;  3K08 A;  1VF6 A;  1G6U A;  5C8Y A;  4BWA A;  3E22 A;  1PKX A;  2K1E A;  1JFF B;  1N33 O;  3T1H B;  1HNZ O;  1XHZ A;  1YTF B;  5EC2 C;  3HKC B;  2GHY A;  1N32 B;  4IT5 A;  2E3C A;  5LOV B;  2ZE5 A;  4ZBM A;  2WA3 A;  5B66 Z;  2AHZ A;  3JAS A;  3K5O A;  1IBK O;  2RCV A;  1V55 C;  4K0K B;  1NVP B;  3G6E V;  4P9P A;  1AB3 A;  5LXT B;  2UUC B;  1GN6 A;  3O9O A;  5FPR A;  3MAQ A;  2P7T C;  4Q20 A;  2HVK C;  2P4V A;  2OIE A;  4JI1 O;  3K9S A;  4JI4 B;  3ETG A;  2XTA A;  1LR1 A;  4TSF G;  1ZWI C;  1SQF A;  5CBH A;  1YVW A;  3ZHS A;  4DXW A;  2EZO A;  1ZL8 A;  4DV5 O;  4F6E A;  3CD6 V;  2DYR B;  2OCH A;  4H0L B;  2P4K A;  4NTX A;  1QLN A;  1FFX B;  1H2G A;  4MSW C;  3ABM C;  1TVK B;  4EFB A;  2GV9 A;  4UB6 Z;  1ZL8 B;  3JCZ A;  4R50 A;  1US6 A;  4IGG A;  4EEQ A;  3ZX6 A;  1H8H G;  4IYI A;  1RP3 B;  2A7W A;  2N05 A;  3CJH A;  4X64 O;  2HLD G;  3RYI A;  4GKJ B;  2DWE C;  3NXS A;  4FM2 A;  1RM1 B;  1VP7 A;  2IJJ A;  4MW3 A;  4B3M O;  2DOS A;  1XMQ O;  1Q90 D;  1NJI W;  4DV4 O;  1XNQ O;  4JZ2 A;  4DV6 B;  5EK0 A;  1K92 A;  4LFA O;  4JI6 B;  4NTW A;  5E1A C;  3JYC A;  2UXD B;  2ZKO A;  2KB1 A;  3K5N A;  5BMV B;  4E4E A;  5CBG A;  1AJQ A;  5KA6 A;  1JPX A;  3RYI B;  1BMF G;  5IWA O;  4PV1 B;  1W59 A;  2QTO A;  1QLE B;  2GTA A;  1N4C A;  3UT5 A;  1QU7 A;  4JTD B;  1M93 A;  5K1X A;  1P7G A;  4XDK A;  3TCU A;  1OHH G;  1S76 D;  4X9Q A;  4J42 A;  3CC7 V;  1H8E G;  5KHH A;  2EX3 A;  4RWU A;  2EIL C;  3ABK B;  3LDD A;  4H37 A;  2HJD A;  2YSU B;  5CBF A;  2F4V O;  1KP3 A;  2AGA A;  2ZR3 A;  4PI0 A;  5IJ0 A;  4JI6 O;  1P84 F;  1Q5O A;  4FZ1 A;  4W4K A;  2RQ6 A;  4FM1 A;  3JAW A;  5CA0 B;  2BSK B;  2UU9 B;  5LYJ B;  1PD3 A;  3QO5 A;  4K0K O;  4DV3 B;  3ML0 A;  3ETQ A;  3RW0 A;  3WB1 A;  3JD1 A;  4BIO A;  1HR0 B;  1NVP D;  3CYO A;  1T5E A;  1D5A A;  2W6J G;  3MHS C;  3OR7 C;  5LMN B;  2CAZ C;  4X1K A;  3AG2 C;  4LBE C;  2L6L A;  3UQ8 A;  5B1O A;  4JI3 B;  4NXN B;  2Y4T A;  2VQE O;  4LF6 O;  2A9H A;  1YJ9 V;  1IBL O;  4J9Y B;  1M90 W;  4CH5 A;  1YEW A;  4X1Y B;  4ZHQ A;  3APQ A;  3S3X A;  4UCT A;  1OCO C;  1OCC C;  3ZMZ A;  2JDI G;  1DF5 A;  3VQY A;  5IDJ A;  1N34 O;  5H2F Z;  1URF A;  2Y69 B;  1MOF A;  1W0J G;  2BCC H;  4LFA B;  3J80 N;  3BFR A;  1GAX A;  3OEE G;  4LF7 O;  4NR1 A;  1K33 A;  4Z2W A;  3F5T A;  3H1L H;  1R3J C;  4DR1 O;  3GWO A;  3D8C A;  3ZMT A;  3C90 A;  3ZRV A;  4AIL C;  1WPX A;  3PN1 A;  1SZT A;  2YC0 A;  1YI2 V;  2UUA O;  3SYA A;  5A9G A;  4GX1 A;  1NR1 A;  5JCO C;  2ZNI A;  3B2E E;  4ZIB A;  4ZOL B;  3BHP A;  2ZCE A;  4MTX A;  3DXR A;  2ZIN A;  1HW7 A;  3HKD B;  4JI8 B;  2IH3 C;  1Z5W A;  3B77 A;  4MVR A;  3CCM V;  3ABM B;  1YJN V;  1UPG A;  2ILM A;  3RVZ A;  4CS2 A;  3FKS G;  3U11 A;  5L3B A;  3B8N A;  2IBZ H;  4X66 O;  1JMK C;  2LFS A;  1COW G;  3TK1 A;  5H6Q A;  1VQP V;  3SR2 C;  3BA8 A;  5LMU B;  2WPD G;  5BZB A;  2Z5U A;  3M7M X;  2AHY A;  2DYS C;  2KG7 B;  1JQ0 A;  3ICX A;  1BE3 H;  4O2A A;  2AZ0 A;  5BR8 O;  2UXC O;  2F4V B;  2BSK A;  4D7S A;  4TV8 A;  3CCL V;  3P3P A;  1HNX B;  1NTM H;  1AI7 A;  4DR2 O;  3H1H H;  1OZ0 A;  1GTO A;  1XEQ A;  2Q0O C;  3HKB B;  3ABL B;  2JIZ G;  3B09 A;  5ITZ A;  3LDE A;  1Q7Y W;  1R6K A;  2Q68 A;  4JZG A;  4LF8 O;  4WFH A;  3VBB A;  4GCZ A;  4U3J B;  4DV2 B;  4PEL A;  2EIJ B;  4O2B A;  1OCC B;  1OCO B;  3FYI B;  3K58 A;  1NTK H;  4JI0 O;  2M7W A;  2PF4 E;  3ZJZ A;  1G4Y B;  3F7V C;  1GM7 A;  4DUZ O;  1PPJ H;  2WWW A;  4I55 B;  5KUM A;  3CPW U;  4LNU B;  3G71 V;  2WLL A;  5DM6 V;  3FX7 A;  4YXW G;  1VQ9 V;  5BY1 A;  4WFF A;  4MTG A;  1FPO A;  4JI5 B;  4K8Z A;  3ETE A;  1R3L C;  5IE9 A;  1SER A;  4O4H B;  4UVA A;  2JJ2 G;  4PA4 A;  3AK2 A;  2ZM6 O;  2VWJ A;  4MVU A;  1TAE A;  5L3D A;  4LWS B;  1K5Q A;  3IGA C;  2YEV A;  3UCS C;  3T2M A;  2P6J A;  4FFB A;  3N2K B;  4OPH A;  4ZOL A;  1AP6 A;  4TQF A;  3DGE A;  1SA0 A;  3JAK B;  4I9Q A;  2FTK A;  1XOU A;  1GK9 A;  2XAQ A;  1I5Y A;  3VOU A;  1HDJ A;  1YDX A;  2ZE6 A;  4MVQ A;  3HKB A;  5IYB O;  3OMA B;  2QKA A;  2AZ2 A;  1RPR A;  2ZR2 A;  1SRY A;  2AXT Z;  1AVM A;  5LA6 B;  1M9N A;  4E2L A;  3BRC A;  3K57 A;  2A06 H;  4PA3 A;  1QLE C;  3QF7 A;  1Y76 B;  1Y74 A;  4B3S B;  5CMU A;  5LGT A;  1JVM A;  3EVK A;  2JJ1 G;  3E35 A;  3BCC H;  4X1Y A;  4X65 O;  2HHH B;  1TUE B;  3U0Z A;  2WLL B;  2KSD A;  2GDS A;  1AJN A;  3E2E A;  3ZMS A;  3ASN B;  3HKE A;  4CH4 A;  4NYK A;  4X88 A;  2DE0 X;  1QNM A;  4PDM A;  3CCJ V;  4DR7 B;  3BAB A;  4DV7 O;  2UUB O;  3MDS A;  5TIS Z;  2CTP A;  1YSC A;  2YID A;  1THZ A;  2GSM B;  1HWY A;  2HEP A;  4WCE V;  2IH1 C;  1S5J A;  2OT5 A;  2GBO A;  5JH7 B;  3FB6 C;  4BW5 A;  5B5E Z;  5KHG A;  3JD2 A;  4DYL A;  3CXC U;  4JAA A;  2HJF C;  1I0H A;  1FYJ A;  4A5U B;  2QKS A;  3OTO B;  5EZY B;  5CB4 A;  5J2T B;  3SPG A;  1NZ6 A;  1Y76 A;  1QVF U;  3SPI A;  3G80 A;  4J7Z A;  1HP8 A;  1J5E O;  3AG1 C;  1VQ5 V;  3M8A A;  1I94 B;  3RYH B;  4D6T H;  2JEX A;  4U7O A;  2VS0 A;  4DR4 O;  1QCE A;  2YDE A;  5JQG B;  3AG4 B;  2BTQ A;  1G1X B;  4UXN A;  4PA9 A;  3RT3 C;  1NU1 H;  3L71 H;  4TUY B;  4CS3 A;  2FML A;  4EB6 B;  4DV5 B;  1DK1 A;  1V9P A;  1BSM A;  1BQ0 A;  1JFF A;  4TWK A;  2A0L A;  2B5U A;  3P32 A;  3K5L A;  4HNA B;  1K34 A;  1SKV A;  2IJK A;  3TGU H;  3IAY A;  1G8M A;  2ZD9 A;  2JS3 A;  1MZE A;  4JYA O;  1E79 G;  2P22 C;  3FAV A;  4C7U A;  3CSX A;  1R1B A;  1XMO B;  3L72 H;  2PTM A;  2UXX A;  1VF5 B;  2CTR A;  2RMK B;  3I56 V;  3UKM A;  1XRE A;  4DV6 O;  1S77 D;  1LNQ A;  4DK0 A;  3AEI A;  1VEW A;  4JGS A;  1WAZ A;  4WFA V;  2ZE8 A;  4WFE A;  4X62 O;  1PV0 A;  4FM0 A;  1N0J A;  2X6A A;  1YJW V;  3ZN0 A;  1K4D C;  4WF9 V;  3D3I A;  2V7Q G;  4O2A B;  3CCE V;  1CP9 A;  4B3S O;  3N2K A;  4U3J A;  3T4Z A;  4IIJ B;  3U10 A;  2JVD A;  2WLN A;  2GUZ B;  3J7A U;  4U7N A;  1S5L Z;  2HFE C;  4KFM A;  1MSW D;  2B1I A;  1VMG A;  2NR5 A;  3UT5 B;  2OCC C;  1XL6 A;  1WP7 A;  4YHH O;  1I08 A;  4I4T A;  4DV1 B;  1H2S B;  1L0L H;  2QA4 V;  2E75 B;  3K0D A;  3EHB B;  5L3F A;  1F23 A;  4JI7 O;  1QVG U;  4DUY B;  2YI9 A;  2LO1 A;  3KCX A;  2ZXW B;  1Q6I A;  2CTQ A;  4AHC A;  4FIP C;  4JAU A;  5LHG A;  3C3T A;  4WBN B;  3CXH F;  4HYO A;  1RPO A;  4I0X A;  2LGQ A;  5LL6 Y;  4I4T B;  5ITZ B;  3ZRW B;  4X1I A;  2P5O A;  5EYP A;  2A3Q A;  4J11 A;  1K5S A;  1GN2 A;  2UU9 O;  5F2V O;  3E8H A;  2QSA A;  3OW2 U;  1TA8 A;  1QHT A;  1NT2 B;  4PDR A;  4F4L A; 
#chains in the Genus database with same CATH homology
 1DF5 A;  3OUS A;  5H9C A;  5IDJ A;  4KUM A;  1JOY A;  4ASU G;  2EIK B;  3JD3 A;  1GMG A;  3STZ C;  2Y69 B;  1AI4 A;  1MOF A;  1W0J G;  2EIM C;  1NH2 B;  3SPJ A;  5EBW C;  4DO2 A;  3AG1 B;  5LGU A;  3OEE G;  4Z1M G;  1K33 A;  5L3E A;  1J95 A;  3SYC A;  3CMA V;  2A79 B;  1KQS U;  2PI4 A;  1R3J C;  1KD1 W;  4RUF A;  3GWO A;  3ZMT A;  1GKF A;  1FXK B;  1OCZ B;  2H94 A;  3ZRV A;  2IJH A;  5DN6 G;  4RQF A;  3ZRS A;  4X89 A;  1WPX A;  5L3G A;  1SZT A;  3W7X A;  1OCR B;  1YI2 V;  3SYA A;  2WLJ A;  3K9A A;  4GX1 A;  1NR1 A;  1ROP A;  4JYB A;  4BAY A;  3CCV V;  3W7U A;  5B1N A;  2JK5 C;  1ENV A;  4KP4 A;  4GT1 A;  1NH2 D;  1YTF D;  3PJS K;  4GX2 A;  2XND G;  2QE7 G;  2UXN A;  3ASN C;  3D36 A;  1SES A;  3OM3 B;  3CC4 V;  4MTX A;  3AG4 C;  5KUK A;  3EFF K;  1QR8 A;  2Z3Y A;  5J9P C;  2YEV B;  2D3O W;  2X0L A;  2IH3 C;  2IU0 A;  5IY5 C;  3OFN G;  3B77 A;  4MVR A;  3CCM V;  2EBO A;  1GO3 F;  3ABM B;  1P4R A;  3T1C A;  2EZP A;  1YJN V;  1BL8 A;  4QPK A;  1K97 A;  3RVZ A;  3FKS G;  4FJC C;  4I9W A;  2LP7 A;  5L3B A;  3B8N A;  2WLH A;  1YIJ V;  4I5S A;  1N8R W;  3CCQ V;  2LFS A;  2ZXW C;  3K0G A;  1COW G;  3OUF A;  3TK1 A;  3ZCC A;  5B1A C;  5H6Q A;  3SYO A;  1MG1 A;  1VQP V;  4MVM A;  4UVC A;  3TET A;  3OE7 G;  2WPD G;  5BZB A;  3RBZ A;  5B3S B;  1QBZ A;  2ITD C;  2IU3 A;  3CCR V;  2Z5U A;  4RQE A;  3ASO B;  2IJI A;  1NKD A;  4G28 B;  4MVO A;  3A0R A;  2AHY A;  2DYS C;  1JQ0 A;  2MK3 A;  4HAM A;  1CEZ A;  3CCS V;  5KA5 A;  4XDL A;  1V54 B;  4G2K A;  1KC8 W;  3LNM B;  2LFR A;  3FB5 C;  1EFR G;  5FL7 G;  3GB7 C;  4MTO A;  3X2Q C;  3CCL V;  3W7T A;  2ZDI A;  3K06 A;  1DTO A;  1P7B A;  5LGN A;  1V55 B;  3WFV A;  3IFX A;  3LDC A;  1AI7 A;  1OZ0 A;  1GTO A;  3ABK C;  2EIL B;  1WLE A;  3SYQ A;  3ABL B;  1R6N A;  3LSS A;  4JAV A;  2JIZ G;  3CC2 V;  2DW4 A;  3LDE A;  1Q7Y W;  4FMT A;  1I5X A;  1R6K A;  2OTJ V;  2Q68 A;  3LSQ A;  3G4S V;  4WFH A;  3VBB A;  3CCU V;  4GCZ A;  2WLK A;  4OXS A;  2DQ3 A;  4PEL A;  3ZMU A;  1MAB G;  2EIJ B;  2ZDI C;  2Q6A A;  1OCC B;  1OCO B;  3E8B A;  4R7C A;  3FYI B;  4JTA B;  5L3C A;  1UJW B;  2C2A A;  2DWD C;  2M7W A;  3ZJZ A;  2P90 A;  1G4Y B;  3F7V C;  1GM7 A;  3W7S A;  5IY5 B;  1K7D A;  1GM8 A;  3QO8 A;  1K73 W;  3AG2 B;  2DQ0 A;  4QNH B;  3AG3 B;  1FXV A;  4WFB V;  2WWW A;  4RAI A;  1CPY A;  1OCO C;  5KUM A;  3CPW U;  1VQO V;  4RO2 A;  3ABT A;  2WLI A;  4MW8 A;  3G71 V;  2WLL A;  3CME V;  1OCZ C;  5DM6 V;  1VQ9 V;  4YXW G;  4MVZ A;  4MTG A;  4WFF A;  3SYP A;  3P30 A;  3ETE A;  1R3L C;  1SER A;  4UVA A;  2JJ2 G;  4CZZ A;  3QO7 A;  4PA4 A;  3HPL C;  4MVU A;  1AI6 A;  5L3D A;  1K5Q A;  1PNM A;  3IGA C;  2BOC C;  2X7R B;  4PA7 A;  2YEV A;  3ZRX A;  1KEC A;  3BEH A;  3T2M A;  3SPH A;  2P6J A;  4R8C A;  1OCR C;  2F43 G;  4P9O A;  4PA6 A;  2Y69 C;  3H01 A;  4HZ3 A;  3DGE A;  1YIT V;  3R65 A;  5CA3 A;  1FXH A;  4ZKI A;  2H8P C;  2FTK A;  1XL4 A;  4N23 A;  1JJ2 U;  1GK9 A;  2XAQ A;  1I5Y A;  2X6B A;  2XAF A;  1GM9 A;  3VOU A;  3T4D A;  4QPJ A;  4MVQ A;  1R73 A;  3WG7 B;  5IYB O;  3OMA B;  5IYD O;  1RPR A;  3K3W A;  2ZR2 A;  1M56 C;  4G27 B;  4X8A A;  3AG3 C;  1SRY A;  3OMI B;  1ORQ C;  1PNL A;  2B1G A;  1M9N A;  1KKD A;  5CN0 A;  4JPR A;  4E2L A;  3BY6 A;  1B6Q A;  1K4C C;  2Q69 A;  5HFL A;  1Y66 A;  4R6Z A;  1VQ7 V;  2W0F C;  4JYC A;  4PA3 A;  4LCU C;  1QLE C;  2JEU A;  4PDV A;  3K08 A;  2EIM B;  5CMU A;  1PKX A;  2K1E A;  5LGT A;  4QIW F;  1Q86 W;  3MHH C;  1DF4 A;  1JVM A;  2EIJ C;  2JJ1 G;  3E35 A;  2NNU A;  2V1D A;  1H38 A;  1TUE B;  1F51 A;  2WLL B;  3RVY A;  1YTF B;  5EC2 C;  5EBM C;  2CK3 G;  3CP1 A;  2GHY A;  1AJN A;  3E2E A;  3ZMS A;  3K04 A;  1VQ4 V;  3ASN B;  4ZBM A;  3FB7 C;  1W0K G;  4X88 A;  2AHZ A;  4PDM A;  4QE7 A;  3CCJ V;  1L1F A;  1V55 C;  1NVP B;  3G6E V;  5IYC O;  4P9P A;  3E83 A;  4JF3 A;  1YSC A;  1KP2 A;  1THZ A;  2BOB C;  1HWY A;  2GSM B;  2P7T C;  1R3I C;  4Q20 A;  1BHA A;  3OAA G;  4GX5 A;  2OTL V;  4BIU A;  4WCE V;  2IH1 C;  4RUE A;  2HVK C;  2WAM A;  2XOK G;  2OT5 A;  2QM7 A;  1VQ6 V;  2HVJ C;  1BHB A;  1EZJ A;  3FB6 C;  4MTF A;  3ETG A;  4BW5 A;  4TT3 G;  3JD2 A;  3SPC A;  3CXC U;  1FXK A;  4TSF G;  2HG5 C;  1SET A;  1ZWI C;  2HJF C;  5LHH A;  3MD0 A;  4QJF B;  4GX0 A;  1IXM A;  5CBH A;  1M57 B;  1FFT B;  1EBO A;  2QKS A;  4DXW A;  1NQT A;  2EZO A;  1QR9 A;  2EIK C;  1K3E A;  3SPG A;  3CD6 V;  2DYR B;  1QVF U;  3SPI A;  2NLJ C;  3STL C;  1VQL V;  2QM8 A;  1QLN A;  1S0V A;  1ARO P;  3ASO C;  5H6R A;  1NR7 A;  2WLM A;  3AG1 C;  3DTU B;  3OEH G;  1VQ5 V;  1VQN V;  1F4N A;  2XAS A;  1H2G A;  1K9M W;  5C93 A;  4FPP A;  3ABL C;  4MSW C;  5B1B B;  5EC1 C;  3ABM C;  3I55 V;  3ETD A;  3W7W A;  3JCZ A;  4R50 A;  2Y48 A;  2JEX A;  4U7O A;  4PDL A;  1S5H C;  3JD0 A;  1VQM V;  1QCE A;  4UV9 A;  4WFG A;  2ZQM A;  4MS2 A;  4UVB A;  1H8H G;  3ZRW A;  2IW5 A;  3AG4 B;  2HLD G;  4CBC A;  4UXN A;  2R9I A;  4PA9 A;  3WG7 C;  3ZMZ A;  4JAS A;  4H33 A;  3UM7 A;  3KG2 A;  1AR1 B;  2DWE C;  3NXS A;  4LP8 A;  5B1A B;  1RM1 B;  4JTC B;  2IJJ A;  5EBL C;  4MW3 A;  3K79 A;  3E8G A;  4TWK A;  5B3S C;  2A0L A;  2B5U A;  3P32 A;  1K34 A;  1NJI W;  2XAH A;  2IJK A;  2WSS G;  4UV8 A;  2OCC B;  3F5W C;  1S3J A;  5EK0 A;  5LHI A;  1K92 A;  1G8M A;  2ZD9 A;  1E79 G;  5E1A C;  3JYC A;  4QE9 A;  3FB8 C;  4XDJ A;  3ZN1 A;  1DLB A;  4MVS A;  1FXK C;  2KB1 A;  2QEX V;  2UXX A;  2Q67 A;  2XAG A;  3QNE A;  1AJQ A;  5CBG A;  1JPX A;  5KA6 A;  4J9Z B;  2P67 A;  1BMF G;  3I56 V;  2XAJ A;  3UKM A;  4LC1 A;  1S77 D;  1LNQ A;  1QLE B;  2QTO A;  3AEI A;  2HR3 A;  3E89 A;  4JGS A;  4JTD B;  3FYE B;  2ITC C;  4WFA V;  1Y4M A;  4WFE A;  1YHQ V;  3ZIA G;  3JD4 A;  2DYS B;  4XDK A;  3TCU A;  1E1R G;  2X6A A;  3F7Y C;  1YJW V;  3ZN0 A;  1K4D C;  4WF9 V;  1M56 B;  1OHH G;  3D3I A;  1S76 D;  3CC7 V;  1VQ8 V;  3OMN B;  1Q82 W;  1H8E G;  2V7Q G;  4UUJ C;  3OR6 C;  3CCE V;  2EIL C;  3ABK B;  1CP9 A;  3E86 A;  3LDD A;  1M57 C;  3T4Z A;  3X2Q B;  4MT8 A;  2WLN A;  1RM1 C;  2EIN B;  1W2B U;  4H37 A;  4U7N A;  2HFE C;  2YSU B;  4KFM A;  5CBF A;  1VQK V;  1KP3 A;  1MSW D;  2ZR3 A;  1M1K W;  4P2Z A;  2B1I A;  1JX9 A;  1PNK A;  4XBF A;  2OCC C;  3ZMV A;  1XL6 A;  1F4M A;  5B1B C;  1R3K C;  4BIZ A;  1E1Q G;  2QA4 V;  3HB3 B;  3E8F A;  2PI5 A;  3OGC C;  2W6I G;  3K0D A;  1PD3 A;  4N21 A;  1PL0 A;  3QO5 A;  3EHB B;  1K8A W;  5L3F A;  3B8M A;  3ML0 A;  1F23 A;  3RW0 A;  3JD1 A;  1QVG U;  1V54 C;  1NVP D;  2HKO A;  1JCH A;  3CYO A;  4P30 A;  2W6J G;  3MHS C;  2ZXW B;  3OR7 C;  3SJQ C;  1S72 V;  4L87 A;  3AG2 C;  4FIP C;  4JAU A;  4LBE C;  2EJR A;  5HFM A;  5LHG A;  1Q81 W;  4HYO A;  5B1O A;  1RPO A;  2X6C A;  2DYR C;  1AI5 A;  5LBQ A;  3K03 A;  1FS0 G;  3M99 B;  1NBM G;  1AJP A;  2ATK C;  3ZRW B;  5GW7 A;  2A9H A;  2WLI B;  1YJ9 V;  4J9Y B;  1M90 W;  3ABU A;  1K5S A;  2R9R B;  2EIN C;  3IC7 A;  3LUT B;  3E8H A;  4FK5 C;  4EKW A;  3OW2 U;  1OCC C;  2JDI G;  4PDR A;  4F4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...