3T4DA

Crystal structure of nak2k channel y55f mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
b'DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALFFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3t4dA00
3SJQC 4MW3A 2A0LA 2DYRC 4H37A 4LP8A 5IY5C 3LDEA 3K08A 4J9YB 4RAIA 5BZBA 3STLC 4MVZA 1R3JC 2QTOA 2WLKA 2ITCC 4R6ZA 4XDKA 4XDJA 5EK0A 5EBMC 3JYCA 4MTOA 3F7YC 3LUTB 3E83A 5KUMA 2WLHA 2IH3C 3AG2C 3F7VC 4MS2A 4MVUA 3STZC 5CBGA 4MTFA 1OCZC 4JTAB 1OCRC 5B1BC 3UM7A 3K04A 4EKWA 1KKDA 3ABLC 3F5WC 4J9ZB 4GX2A 2DWDC 3K0DA 5EC2C 2WLLA 3SYOA 2W0FC 2R9RB 4WFFA 2Q69A 2HG5C 1QLEC 4PA4A 2EIMC 4PDMA 5B3SC 3RVZA 2WLMA 3SYPA 3HPLC 2A9HA 2X6BA 4JTCB 4OXSA 4MSWC 1P7BA 4MVSA 5B1AC 3SPIA 3T1CA 1OCOC 4MVRA 3R65A 1ZWIC 2AHZA 3K03A 4GX0A 4PDRA 2EIKC 4JTDB 2HJFC 4RUFA 4TWKA 5CBFA 2IH1C 3E8BA 4MVMA 2WLIA 4QE9A 3ZJZA 3IGAC 4PA9A 4GX5A 4WFGA 5E1AC 3SPHA 3LDCA 3X2QC 1S5HC 2EIJC 5J9PC 3FB6C 3SPCA 3SYQA 3RBZA 3UKMA 1K4DC 2Q68A 3LNMB 4G27B 4R8CA 4RUEA 3ZRSA 2HFEC 2Y69C 3ABKC 4MVOA 3OR6C 5EBWC 2X6CA 1JVMA 2EILC 2Q6AA 2DYSC 1LNQA 4LBEC 3TETA 2H8PC 2BOCC 3T4ZA 2ZD9A 2ZXWC 3OUFA 3T2MA 4KFMA 5EBLC 3ABMC 3SYCA 3E86A 3AG3C 4CBCA 2ATKC 2DWEC 1R3LC 4MVQA 1BL8A 1V55C 2JK5C 2P7TC 3AG1C 1XL6A 3E8FA 2A79B 3OGCC 4GX1A 4XDLA 2QKSA 1M56C 4PDLA 5EC1C 2Q67A 1K4CC 3K06A 3E89A 3SYAA 2WLIB 3OR7C 4P9OA 4ZBMA 1J95A 4F4LA 3E8GA 3OUSA 2WLJA 4X8AA 3ASNC 4HYOA 1R3KC 2KB1A 2WLNA 2YEVA 4PA3A 4PDVA 4R50A 3RVYA 3E8HA 2WLLB 3RW0A 3SPGA 3TCUA 4WFEA 5CBHA 1M57C 2AHYA 2BOBC 4X88A 2HVJC 4MTGA 2OCCC 3KG2A 4X89A 2X6AA 4HZ3A 2K1EA 4P2ZA 1ORQC 3VOUA 4UUJC 1XL4A 2EINC 3IFXA 3LDDA 1OCCC 3AG4C 4WFHA 3GB7C 4I9WA 1V54C 4R7CA 4BW5A 2HVKC 4QNHB 4PA7A 4H33A 3FB7C 5KUKA 1G4YB 3EFFK 4P9PA 4RO2A 4LCUC 4QE7A 3FB8C 4PA6A 4G28B 3SPJA 1R3IC 3WG7C 4DXWA 4P30A 3ASOC 3K0GA 3BEHA 2NLJC 2ITDC 3PJSK 3T4DA 4MW8A 3FB5C
chains in the Genus database with same CATH superfamily
2MW2B 1XHZA 1NH2D 4N21A 1L0NH 1QBZA 3CJHB 3LDEA 1IBKO 2A7WA 1Q6IA 2XT9A 1VQ9V 1I0HA 2LW7A 5KX5A 3FYIB 3CX5F 2H3OA 5CBGA 2EBOA 5IJ9A 5EC2C 1VQ8V 1GRJA 4LFCO 4GKKO 1XNRB 2VQFO 4PDMA 5CA1B 2F4VO 1DF4A 2X6BA 1QU7A 3ZMVA 5H2FZ 2V1DA 4MT8A 2AHZA 4GX0A 1I94O 3CXHF 4UV9A 3G71V 1S5LZ 3BY6A 4MTXA 4DV6O 2B9ZA 3G80A 4JI4O 1H38A 3KCYA 4UB6Z 4BIZA 2ZD9A 4H13B 3M7MX 2PUSA 5CA0B 5LXTA 3E86A 3AG3C 2CK3G 2CGOA 3RYHA 1XL6A 3ASOB 4PDLA 3ZEDA 1VARA 4IHJB 3SYAA 2EX3A 4JAVA 3Q4HB 3FAVB 3JALB 3J81N 3TK1A 4JI5O 3T1HO 2OYQA 3OGIB 4NVPA 1PM9A 1YTFB 3IFXA 3PN1A 3G6EV 1TVKB 2DW4A 1IVSA 2DMXA 4BW5A 2YXLA 5IYBO 3RFRA 1ENVA 3K58A 3RYCA 2ZE5A 3P3PA 4LF8B 3SR2C 3SPJA 5GONA 4N23A 3O65A 4CC6A 4ZHQB 2Y4TA 4FLUA 2CH7A 4LP8A 5IY5C 2EIKB 2BTQB 1BSMA 4JI1O 4DUYO 4B3SO 5KUMA 4YXWG 4MVUA 5LHHA 5EZYA 2N04A 4GLXA 1KP2A 1EZVH 2KG7B 3F5WC 4UCTA 1S0VA 4HNAA 1AJPA 3H01A 2R9RB 3WB1A 4WFFA 1Q82W 2WLMA 3VQWA 2CTWA 4OXSA 3K5MA 1RM1B 2DQ3A 5B1AC 5KX5B 4CC5A 3B2EE 2L6LA 4E4EA 2W6IG 3A0BZ 4CH5A 4NB5A 5IJ9B 1TGOA 1WNSA 2EINB 2ZIOA 2HFEC 1QVGU 2UXBB 2X6CA 4PELA 5C93A 1CP9A 4KHPB 3BPZA 4ZI7A 1SA0A 1Z5VA 3OUFA 3SYCA 5ITZA 2JVDA 4NXMO 3QF7A 5FPRA 4DR5B 3JD1A 3T1YO 4J80A 2LGWA 1N34B 1QLNA 1YJWV 1FXHA 1Y66A 4FK5C 5DEDA 3ZHUA 4RQEA 5B1AB 2KSDA 2HVJC 4UV8A 4HZ3A 3I56V 4FM1A 1Y74B 1I5YA 3K5NA 2HHHO 4DK1A 1I7FA 1S72V 2ZE7A 5LOVA 4JI6O 1GN4A 4I4TB 3WG7C 2UUCB 2XAJA 2Q4PA 1O9GA 1YZBA 1F4NA 4MW3A 2VQEO 2MK3A 3UT5A 1PNMA 4DO2A 3BFRA 2RDCA 3MDSA 2P67A 1VQNV 1NTKH 4GKJO 3JYCA 1RFYA 3CCQV 1FD9A 2UXCB 1KC8W 1MSWD 1U97A 1HNWO 3AG2C 2Y69B 1R1BA 4MTFA 4NR1A 3UM7A 4AHCA 3CB2A 4DUZO 3CEIA 1U96A 2CH7B 4IL6Z 2ZIMA 3LSSA 3JAKA 4NYKA 4DR6O 2RQ6A 1E1RG 3QO8A 5B1OA 2PGGA 1N0NA 4MSWC 1MG1A 3T1CA 5EIBC 3K03A 3SDLA 1NKDA 2IH1C 1D5AA 3ZJZA 4DV3B 2DN9A 4IT5A 4U7OA 4LFBB 4HNAB 3L71H 2GBOA 4O4LA 1XDCA 3DXRA 1MMMA 3W7UA 4CS2A 4FLVA 5IYZA 1N4CA 5LP6C 2GHYA 1H8HG 3E8FA 3OGCC 4X1YA 1YJ9V 1M56C 1EM1A 1KMIZ 4DV1O 2Y48A 3THOA 4TQFA 3CCVV 1SKVA 4DV5B 1IURA 2NNUA 1M90W 4I0XB 1THZA 2YXHA 4DR2B 5LMNB 4ZI7B 1SA0B 1VQ7V 3R66A 5ITZB 3FYEB 2UUBO 3K5OA 1FJGB 2OIGA 3L75H 2E75B 5CA3A 1AB3A 1G4YB 2CGNA 2HJDA 2UXDO 1TUBA 1Q3EA 2UXNA 2ITDC 3E22B 3CWBH 1YF2A 2A0LA 1H2LA 1M56B 2E5LO 2CDYA 2ODMA 1XNQB 2V7QG 4CH4A 4JI3B 1AI4A 3O9OA 4X1IB 1K97A 4O4JB 2XUMA 1QQCA 5B1BC 3HKEA 2C2AA 3ZHTA 1GN2A 4ABMA 3UT5B 2NN4A 5LMUO 3GVMA 3AG1B 4JTCB 4PI0A 4DW1A 3JD0A 3ZMZA 4JI8O 1AJNA 5IE9A 1RSOB 1K8AW 4RUFA 2IBZH 5TISZ 2Q7EA 4Q6GA 2XNDG 5CB4A 2Q8VA 4DV2B 1PNLA 1FFXA 1AROP 1SF9A 1S5HC 4J10A 1Y6XA 4G27B 1KKCA 2DJVA 4DV4B 1MA1A 4MVOA 5EBWC 5C8YB 4YY3B 2XASA 4FLXA 3JAKB 4EB6B 1FXKA 3T4ZA 2FL4A 5KAIZ 1R3LC 1DF5A 4BIUA 4GX1A 2PF4E 3K06A 3S3XA 5FL7G 5K1XA 2R9AA 3ABUA 3E8GA 1G6UA 5BR8O 2JGDA 2UU9O 4O4LB 2YIAA 2ZM6B 3CHXA 3U10A 4Z2WA 3ETDA 3H1KH 5FLXN 1YCIA 5IDJA 1I5XA 1N32B 3K9AA 4HAMA 5L3BA 3I55V 5JVDB 3RT3C 1WN7A 1QLEB 1S3JA 3FB8C 4DXWA 5BXZA 4B3TO 4X65B 4LF5B 4B3MB 5FPOA 2DYRC 1M9NA 4QPKA 4CZZA 4FLTA 4LWSA 2QKCA 1L0LH 3C90A 5EBMC 2P6JA 2WLHA 2YICA 5HFLA 1TUBB 4DRXA 3CP1A 1J5EO 4X66O 4ZKIA 4LF9O 3EVKA 1P7BA 4NXNO 4JI2B 1PD3A 5KHHA 1Q7YW 4WBNB 2JRIA 3M99B 3D8CA 1FXKC 1H2MA 2OTJV 5KA6A 2WLIA 2XAFA 1BE3H 2VRZA 1Q90D 3A0RA 1P84F 4WFGA 4JYAO 1B6QA 3HKEB 2K9PA 3ETQA 3MHHC 2CTPA 4EFBA 4QPJA 2WA4A 2Q9LA 1GM9A 1V54B 1GN6A 4TV9A 2FKXA 3T2MA 4IYIA 4JF3A 3ZN1A 5FNVA 1QR8A 3CCJV 1SS3A 1D2DA 2BTOA 1HP8A 4ZBMA 3TXSA 1OJHA 4I7ZB 3OUSA 1QCEA 3ASNC 1AI6A 2AZ2A 2YEVA 4DR3B 3ZHRA 1VQ5V 2WAMA 1WJZA 4RWUA 3JD3A 1XMOB 4X62B 2QSAA 2BOBC 1S5JA 2WSSG 4I5SA 2O57A 2Z3YA 1NTZH 4UUJC 1K73W 4B3RO 3JARB 4I55B 1DTOA 1XHXA 2NR5A 4K0KO 3ETGA 1H2KA 1HNXB 3FB7C 1M4UA 4JV5O 1SC5B 1Y76B 5EYPA 4UFZA 3RGBA 2NLJC 3CC2V 3M8AA 2F95B 2FB5A 2Q73A 4Q20A 2EJ7A 4DR1O 4JYYA 3OM3B 5GW7A 4JAAA 1GM7A 3GWOA 2QWNB 5J2UB 4D7SA 1ROPA 2LGQA 3RWRD 3NR7A 3QG5A 3F7VC 4FPPA 2Z5UA 4J9ZB 3K0DA 2W0FC 5LHGA 1G1XB 1XMQB 3RVZA 4ZOLA 4FM0A 1VIBA 2D3OW 4LWSB 3RN4A 4U3FH 3CC4V 3E8BA 4MVMA 2GV9A 1N33O 2YIDA 2YI8A 2KQXA 4GX5A 4J7KA 3X2QC 4DRXB 4FM2A 3ZRSA 1CPYA 1OCCB 4LNUA 2FYUH 1MZFA 1BHBA 4MVQA 2Q0OC 4XDLA 1IX9A 2WLIB 5JQGA 1K92A 5JH7A 4X8AA 1P4RA 2GSMB 3ZIAG 1SQGA 2WLLB 4O2BB 3QTCA 2ZE8A 4UCVA 4YJ2A 4X64O 4P2ZA 1XL4A 2XAGA 3AG4C 5FNVB 3P32A 1JR9A 3RYIB 1R6NA 1P7GA 1F4MA 2YEVB 3BEHA 1NI8A 2AZ0A 4GCZA 4LF4O 4H44B 1HR0O 2HEPA 4FLZA 1VF7A 3JCZA 4J9YB 5BY1A 4JI7B 3DC6A 5BZBA 2PYLA 1XUQA 5EK0A 1WB8A 1KUQA 1AJQA 4J41A 1IBKB 1AR5A 4CH6A 1US6A 3FD9A 3CCEV 4AQYO 3AG3B 4WFAV 2ILMA 1EN4A 2RN9A 2IU0A 2YS8A 2BSKA 1R73A 3ZS8C 3K59A 1GK9A 3H9VA 1XREA 1GO3F 4OPAA 3BABA 3CRMA 2VQFB 4JPRA 4JTDB 2F4VB 3VQYA 2WWWA 3IGAC 3CRAA 2LO1A 5E1AC 3JASA 2VWKA 4O2AA 4RUEA 5LA6B 5HFMA 1I94B 3ABKC 4UB8Z 1VQPV 2BE3A 3BA8A 2Q6AA 2EILC 3APOA 1KBHA 3CSXA 2BOCC 4JI0B 3H1HH 4KFMA 5EBLC 2M7WA 4DV7O 4UCSA 4JI4B 4LF7O 3OMIB 1TUEB 5L3FA 1IBLO 2WLJA 5IY5B 1Q8IA 1NZ6A 3TCUA 3E8HA 3SPGA 2OTLV 4UVAA 4DR7O 2OCCC 4JI5B 2X6AA 1N36O 4GT1A 4LNUB 4FFBA 1JA8A 2GUZA 1AR1B 2HVKC 4FLYA 1VQLV 2CE4A 5KMGA 2R70A 1SERA 3I5DA 1BT8A 3AK1A 2HLDG 4LFAO 1H2SB 5IWAO 1YTFD 2PYJA 4DR4O 3UO3A 5LP6A 4YJ2B 1E1QG 3ABTA 2QJ1A 4RAIA 3ZMUA 2F93B 5LXTB 3QO5A 4LFBO 1PL0A 3RYHB 1WLEA 1PPJH 4QGPA 1XILA 4BAYA 1L1FA 1ZLZA 2OWOA 3EXAA 3G67A 4JI1B 3TXQA 1OCRC 2JJ2G 1YXBA 2Q7GA 1EN5A 3CRQA 3K04A 3ABLC 4DUYB 1YHQV 4B3SB 1NJIW 2EIMC 4FZ0A 1QR9A 5KLVH 2P22C 1LUWA 4LH7A 4NTWA 4HBNA 4YIOA 1ZWIC 1BZKA 5GTHZ 3NXSA 1Q6HA 3RYCB 5LMNO 3UCSC 2EIJC 5J9PC 3SPCA 5GONB 5JWPA 2Q68A 2F66C 4JASA 3CMAV 2A06H 5L3DA 2BSKB 1KECA 1RP3B 3AG7A 4TUYA 2YIBA 2ATKC 4LH6A 2CTQA 4DYLA 3WG7B 5L3EA 3A8TA 1ZX3A 4DK0A 3F5TA 1K4CC 5JJNB 3E89A 1GKFA 3OR7C 1J95A 3CYOA 5EZYB 3JASB 2Q5ZA 4R50A 3RW0A 4NXMB 1M57C 3IC7A 3T1YB 1K7DA 2WPDG 1VF6A 2ZT9B 2ADPA 3N2KA 4W4KA 2LFSA 3AG2B 3K79A 1SQQH 2YXYA 1EFRG 2W6JG 4PA7A 2M6YA 3HKBA 4RO2A 2HHHB 4PA6A 1R3IC 1WA8A 3ZRXA 3HKDA 4FJCC 1MSDA 4MW8A 1AVMA 2G38A 2RCVA 4X20A 4JI6B 2P90A 5F2VO 1DGSA 4DV2O 1KU9A 2V4DA 4C7UA 1KB9F 2QTOA 4XDJA 5GTIZ 3LUTB 3CS5A 4DV4O 4J7JA 1VQOV 4JTAB 4EKWA 2FTKA 1VQKV 2JJ1G 4GKJB 4GX2A 4UVCA 2XHBA 4YHHO 5LP6B 3ML0A 3A2FA 4PV1B 3U0ZA 2QEXV 1HNWB 1VEWA 1NQTA 3ZCCA 1ZSPA 5IJ0A 3HR0A 1UJWB 2X7RB 4MVSA 4E2LA 2ZM6O 4DR6B 5LHIA 5LOVB 1JJ2U 2ARHA 2P5OA 5BMVA 4PD4F 3JSNA 1SQPH 2R9IA 1KP3A 4GZRB 2F43G 2QWRB 4LF5O 3JATA 2A79B 1K3EA 2QKSA 1VF6C 4A5UB 5KHIA 2YDEA 3W7WA 1URFA 4DV1B 3ICXA 4NTXA 4X88A 1P49A 4IIJA 2ZR3A 4TUYB 3OTFA 1NU1H 5DN6G 4WFHA 3GB7C 5B1BB 1NTMH 3GWKC 5H6QA 2QWPB 3VBBA 2ZDIA 4H33A 3UO2A 2CAZC 4UXNA 5H9CA 2UUBB 3IAYA 1NVPB 2LFRA 4LR3A 3CXCU 2UXDB 2BCCH 3DXRB 3K08A 1MNGA 3STLC 3OMAB 5B1NA 5IYZB 1KQSU 1FKAO 2DOSA 1S77D 1NBMG 4X1YB 2E5LB 3HKBB 1I08A 2LW1A 4W4LA 1KKDA 1W0JG 3FX7A 3J80N 3HKDB 3OAAG 3SYOA 1XBLA 1PV0A 1VQ6V 1GMGA 2XTAA 2HG5C 2HP8A 2IJKA 3CCUV 1JFFA 3BVOA 5LBQA 3HKCA 5LMUB 3RYFA 4GYCB 4K35A 3JAWA 4PA9A 4J7ZA 1W2BU 1BQZA 4J11A 3ZMTA 4NTYA 4JI8B 4OX9O 3FB6C 3P30A 3UKMA 2QWQB 4PI2A 3B40A 4EFEA 1H8EG 1IBMO 3CJHA 2DYSC 4LBEC 5IJ0B 1H2GA 3OTOB 4PJ0Z 3LNNA 5LGTA 1BL8A 3KKYA 1TA8A 2JEUA 5EC1C 2FMLA 1GM8A 2QKAA 3SJCC 1WPXA 3CRCA 1V9PA 2DYRB 1PNKA 4UCRA 3RVYA 2R72A 2ZDIC 2JDIG 1F23A 2LP7A 3N27A 5CA1A 3B77A 5D5PA 3VOUA 5BR8B 1NVPD 5H6RA 3DSQA 2UU9B 1UFIA 2OCHA 1NH2B 1K5SA 1AP5A 5DM6V 4LF6B 1HNZB 5CB4B 1FFXB 3K0GA 4OGQB 5H5NA 4RQFA 4JGSA 3SJQC 4IIJB 1SZTA 1FXKB 5CA0A 4B3TB 2RJZA 1JPXA 2GDSA 4CS4A 3DC5A 4MTOA 4B7EA 1XNRO 4KL1A 3JALA 5B66Z 1SQXH 1IDSA 2AW9A 5IT9N 4EEQA 1FFTB 2JGDB 1XQ8A 2E3CA 2F1MA 4F6RA 3K3WA 4TQDA 4PA4A 2QGNA 1TAEA 4L8JA 3W7SA 1WAZA 1JOYA 1EBOA 2VS0A 3APQA 1AI5A 3ASNB 4UCOA 1AI7A 2CTRA 4PDRA 1XEQA 2JS3A 3E35A 4JZGA 4LF9B 1NR1A 2YUAA 4NXNB 2HKOA 4O4IA 4AI8A 4ZHQA 2LJ2A 1AR4A 5LYJA 1JFFB 4I50A 3C3TA 5E79Z 2BTQA 1UPGA 4JYAB 3ABMC 4ZIBA 4L87A 4BWAA 4AILC 1FS0G 4DV0B 4F4LA 1YJNV 1D5NA 2QR4A 2KG7A 4HYOA 3SJAC 1R3KC 2WLNA 2UXXA 1MZEA 3JSLA 5CBHA 1BQ0A 1ZAUA 3G6BA 3JCUZ 1M1KW 2QTSA 4LF8O 1PKXA 4K8ZA 1BHAA 1BGYH 1EN6A 1FAFA 4R7CA 2JIZG 3D3QA 1VMGA 3IC9A 2F23A 1FYJA 3QVNA 4B3RB 4PHZA 3ASOC 4IGGA 3ABMB 4K0KB 3FB5C 4JV5B 1VQ4V 4QIWF 4TV9B 4NKGB 4R6ZA 4CS3A 3X2QB 1COWG 3HB3B 2UUAB 4BIOA 5LGUA 4DR1B 3J7AU 5J2TA 4MS2A 3ZRWA 3CCSV 4J42A 1WB7A 5IYDO 1OCZC 4K3AA 4FLWA 3OT7A 4JI0O 4X1KA 2QE7G 4TV8A 1H2NA 1DK1A 2A9HA 1Y74A 2AGAA 3CD6V 3OD4A 3IJ4A 3W7XA 1O9HA 3R65A 2OIEA 2EIKC 5CBFA 1Z5WA 4I4TA 2B5UA 2UXBO 3WU2Z 5EYPB 4KHPO 4KXRA 1YI2V 1WPBA 3S3WA 4F6RB 4B08A 3AG4B 1N33B 1X59A 1JVMA 3K9SA 4DR5O 2EJRA 2IJJA 2H8PC 3TETA 2DE0X 1N34O 2DWEC 1OCZB 2PI4A 4LFCB 4GKKB 4O4HA 1VQMV 4TOIA 1RM1C 5JJJB 2XAQA 4O4IB 1N8RW 5LYJB 3L9DA 4MTGA 4I50B 2JEXA 3KG2A 4IYHA 1NS1A 4ZOLB 1MOFA 1BS3A 2EINC 2UUCO 4DV6B 2RMKB 2P06A 4I9WA 3B8MA 4QNHB 4X64B 4P9PA 3EFFK 3N2GA 4G28B 4FFKA 1OZ0A 4LC1A 4WCEV 4H37A 2UXCO 1SQVH 1W59A 1ZL8A 3BHPA 3SGIA 1YIJV 3D3IA 1XOUA 3T1HB 4LF4B 1BMFG 1HWYA 1HR0B 5B5EZ 3WB0A 4H0LB 2IH3C 4XBFA 3ABKB 1A32A 5JQGB 3SJBC 5JH7B 2EILB 1RPOA 2IM9A 3ZHQA 4I0XA 3CMEV 2ETNA 2XOKG 2ZR2A 2QWOB 3C3SA 3LSUA 3SYPA 1CEZA 3CCRV 4DV3O 4AQYB 1N0JA 2P4KA 5KA5A 1FPOA 2A3QA 1OCOC 1SRYA 5J2TB 3ZRWB 1M93A 1F7YA 3SPHA 2OCCB 4X1KB 4Z1MG 3E22A 1K4DC 3U11A 2Y69C 1T5EA 4TV8B 2PTMA 1K33A 2ADQB 3OR6C 5A2QN 1LNQA 3BRCA 4CBCA 4DV5O 2P7TC 4GUNA 1JJOA 1JX9A 4X1IA 4O4JA 1YVWA 3ZHSA 1Q81W 3D36A 3G4SV 3B4SA 4DR2O 1IXBA 2D2CB 3AEIA 4DV7B 3FFQA 2VWJA 4PA3A 4PDVA 3UQ8A 3L74H 4LF7B 4WF9V 1FJGO 4D6TH 2AHYA 1OCOB 2ZINA 3L70H 2LQTA 2QA4V 1IBLB 2K1EA 4YJ3A 5JCOA 1GAXA 1RSOA 1OCRB 4O4HB 4Z1VA 3ABLB 4DR7B 2H94A 2QM4A 3JAMN 3WB2A 1N36B 1R6TA 3H1JH 2EIMB 2WA3A 1BCCH 1S76D 2PI5A 1XNQO 4O2AB 1GN3A 1L8DA 3K5LA 3CCLV 5C8YA 4JI3O 1XI1A 4EB6A 4LFAB 1X4TA 5IWAB 4DR4B 4WFBV 2EIJB 3E83A 3B8NA 5L3CA 1EZJA 1NT2B 4KP4A 3N2GB 3JD2A 2DWDC 2QM7A 2GTAA 3H1IH 3OMNB 1OV9A 1ZL8B 1B06A 5CN0A 4FFBB 1KYOF 1JCHA 2GUZB 4MVRA 2VQEB 3ZHVA 5A9GA 4TWKA 5JVDA 4BR6A 1M57B 5KMGB 4YY3O 3WFVA 1F51A 1YITV 2N74A 3SYQA 4R8CA 2IW5A 3D36C 2EZPA 4K8XA 4CH3A 2W0XA 1MABG 4DUZB 3AG1C 2L35A 4D7TA 1Z2GA 1AP6A 5JCOC 4P9OA 1GTOA 1B3QA 3VQXA 2KB1A 1N32O 1YDXA 4X89A 4QJFB 2IJIA 1ORQC 3BAAA 2EULA 3KZIZ 4X65O 1JQ0A 4WBNA 1Q86W 4KUMA 1QHTA 1Q5OA 4B3MO 2ZNJA 3AK3A 4QE7A 2ZQMA 2ZCEA 1R6KA 3AK2A 3T4DA 1E79G 2CUGA 5JJEB 2Y0IA 2KKWA 1K5QA 4B7KA 5KHKA 5LL6Y 4YJ3B 3OFNG 1R3JC 2IJHA 2Z0AA 2WLKA 1GH6A 2ITCC 5D5QA 4FIPC 3F7YC 5L3GA 5EIBD 3STZC 3OTOO 2E74B 5KHJA 1Y67A 1JMKC 4I9QA 3MAQA 4JI2O 1QLEC 1SQFA 3HPLC 3CPWU 1LR1A 2Y0PA 3N2KB 2RNBA 3JARA 4I55A 4U3JA 4YIPA 4YHHB 2PY5A 2XAHA 3EHBB 2HJFC 1Y76A 2PZSA 1NR7A 3P3NA 3QO7A 1WA8B 4JYBA 3LNMB 1QVFU 3ZRVA 1SQBH 5AG2A 4X20B 4LF6O 1HNZO 3A0HZ 4ICGA 2YI9A 5J2UA 3E2EA 4UCUA 1ZUQA 1V55C 3LSQA 1Q6UA 3MHSC 1SESA 3L72H 4DR3O 1OHHG 1PP9H 1WP7A 1XMOO 3W7TA 4X62O 2P4VA 1CXZB 1RPRA 4ASUG 1DLBA 4JYCA 2HR3A 2OT5A 1YSCA 3CCMV 2N05A 5KAFZ 1HNXO 3BCCH 2IU3A 2ZKOA 2YSUB 5KHGA 1V54C 1SETA 2JGUA 1IXMA 2Q7HA 5KUKA 5CMUA 4FVMA 5BMVB 3DTUB 3OEEG 1ZTEA 2YIBD 4P30A 4UVBA 1M5IA 4U7NA 3PJSK 3FKSG 5LGNA 3LDCA 1V55B 2GTSA 4MVZA 3L73H 3K57A 4XDKA 4BW9A 3JATB 3KCXA 3TGUH 1PL4A 1XMQO 3BA9A 1Q43A 1G8MA 3ZMSA 1AILA 3TJTA 2DYSB 2WLLA 4O2BA 2AXTZ 2Y4UA 4JZ2A 2QM8A 2Q69A 1VP7A 4F6EA 5B3SC 4DV0O 2E76B 1B04A 1K34A 2B1GA 3SPIA 3VQVA 3RYIA 4DW0A 3MD0A 3CC7V 1LUVA 4IHJA 4QE9A 1QNMA 3Q4HA 1FXVA 1WP8A 3FAVA 3JD4A 1KD1W 1YEWA 3RBZA 3CRRA 1VF5B 3CE2A 2EZOA 3B09A 2YC0A 2X0LA 3ZN0A 3OE7G 5K1PA 2ZXWC 4OX9B 2B1IA 2Q0AA 4FZ1A 3DGEA 1J5EB 3OEHG 4U3JB 1TVKA 2JK5C 1Y4MA 3ZBHA 1SZXA 2JS5A 1IBMB 2Q67A 4X66B 1W0KG 5B3SB 2DQ0A 1HW7A 4WFEA 3H1LH 3QNEA 2UUAO 4OPHA 4JAUA 4TT3G 5DECA 2ZE6A 5IYCO 4TSFG 3OW2U 3LDDA 1OCCC 4X9QA 3ZX6A 2QDOA 1K9MW 3HKCB 4FMTA 4G2KA 3RYFB 2ZNIA 3JAWB 4LCUC 3ETEA 4JI7O 2ZXWB 1HDJA 5LA6A 1IZ3A
chains in the Genus database with same CATH topology
1NH2D 4N21A 4WCEV 2DYRC 4H37A 1M9NA 1YIJV 4QPKA 1QBZA 2P90A 3D3IA 3LDEA 4CZZA 1VQ9V 2QTOA 4XDJA 5EBMC 1BMFG 1HWYA 3LUTB 3FYIB 2P6JA 2WLHA 2IH3C 4XBFA 3ABKB 5HFLA 1VQOV 5CBGA 2EBOA 4JTAB 4EKWA 2FTKA 1VQKV 2JJ1G 2EILB 4GX2A 3CP1A 5EC2C 1VQ8V 1RPOA 4UVCA 3CMEV 3ML0A 2QEXV 2XOKG 2ZR2A 4PDMA 1NQTA 3ZCCA 3SYPA 1CEZA 4ZKIA 1DF4A 2X6BA 3CCRV 1UJWB 1P7BA 2X7RB 3ZMVA 5KA5A 4MVSA 4E2LA 1OCOC 1PD3A 1SRYA 2V1DA 4MT8A 2AHZA 1Q7YW 4GX0A 3M99B 1FXKC 2OTJV 5KA6A 3ZRWB 2WLIA 5LHIA 2XAFA 1JJ2U 3A0RA 4UV9A 4WFGA 3SPHA 2OCCB 3G71V 4Z1MG 3BY6A 1B6QA 1K4DC 3MHHC 4MTXA 2R9IA 2Y69C 4QPJA 1H38A 1K33A 3OR6C 1GM9A 1V54B 1KP3A 1LNQA 4BIZA 2ZD9A 3T2MA 3E86A 3AG3C 4JF3A 2CK3G 3ZN1A 4CBCA 2F43G 2P7TC 1QR8A 1XL6A 2A79B 1JX9A 1K3EA 3CCJV 3ASOB 2QKSA 4PDLA 3SYAA 4JAVA 4ZBMA 1Q81W 3D36A 3G4SV 3TK1A 3OUSA 1QCEA 3AEIA 3ASNC 1AI6A 3W7WA 4PA3A 2YEVA 4PDVA 1VQ5V 4WF9V 2WAMA 3JD3A 2AHYA 2BOBC 4X88A 1OCOB 2WSSG 2ZR3A 2QA4V 2K1EA 4I5SA 2Z3YA 4UUJC 1K73W 1YTFB 3IFXA 5DN6G 4WFHA 3G6EV 3GB7C 1OCRB 2DW4A 1DTOA 5B1BB 4BW5A 3ABLB 5H6QA 3VBBA 3ETGA 2ZDIA 2H94A 4H33A 5IYBO 3FB7C 1ENVA 2EIMB 4UXNA 5H9CA 3SPJA 1S76D 2PI5A 4N23A 2NLJC 1NVPB 3CC2V 2LFRA 3CXCU 3CCLV 4LP8A 5IY5C 4Q20A 3OM3B 3K08A 2EIKB 5GW7A 3STLC 1GM7A 3GWOA 3OMAB 5B1NA 1KQSU 1ROPA 4WFBV 1S77D 2EIJB 3E83A 5KUMA 1NBMG 3B8NA 4YXWG 3F7VC 4MVUA 5L3CA 5LHHA 1EZJA 4FPPA 4KP4A 2Z5UA 1KKDA 1KP2A 1W0JG 3JD2A 3F5WC 4J9ZB 1S0VA 2DWDC 3K0DA 3OAAG 3SYOA 2QM7A 1VQ6V 1GMGA 2W0FC 1AJPA 5LHGA 3H01A 2R9RB 4WFFA 1Q82W 3OMNB 2HG5C 2IJKA 3CCUV 3RVZA 2WLMA 5CN0A 2D3OW 1RM1B 4OXSA 1JCHA 2DQ3A 5B1AC 5LBQA 4MVRA 4TWKA 3CC4V 3E8BA 4MVMA 1M57B 3WFVA 1F51A 2W6IG 4PA9A 1W2BU 4GX5A 1YITV 3ZMTA 3X2QC 3FB6C 3SYQA 3P30A 3UKMA 3ZRSA 4R8CA 2EINB 2HFEC 2IW5A 1CPYA 1H8EG 1OCCB 1QVGU 2EZPA 2X6CA 4PELA 5C93A 2DYSC 4LBEC 1CP9A 1H2GA 3OUFA 1BHBA 3SYCA 5LGTA 4MVQA 1BL8A 1MABG 3AG1C 4XDLA 2JEUA 5EC1C 1GM8A 2WLIB 3JD1A 4P9OA 1GTOA 1K92A 1WPXA 1QLNA 2DYRB 1PNKA 4X8AA 1P4RA 2GSMB 1YJWV 3ZIAG 2KB1A 1FXHA 3RVYA 2ZDIC 2WLLB 1Y66A 4FK5C 4RQEA 2JDIG 1F23A 5B1AB 2LP7A 2HVJC 4UV8A 3B77A 4X89A 4QJFB 2IJIA 4HZ3A 3I56V 4P2ZA 1ORQC 3VOUA 1XL4A 2XAGA 1I5YA 1NVPD 5H6RA 3AG4C 3P32A 1S72V 1JQ0A 1Q86W 4KUMA 1NH2B 1K5SA 1R6NA 5DM6V 4QE7A 2ZQMA 1F4MA 3WG7C 1R6KA 3K0GA 2YEVB 3BEHA 2XAJA 3T4DA 1E79G 4GCZA 4RQFA 1F4NA 4JGSA 4MW3A 3SJQC 1K5QA 2MK3A 1PNMA 3JCZA 4DO2A 1SZTA 4J9YB 1VQNV 1FXKB 2P67A 3OFNG 5BZBA 1R3JC 1JPXA 2IJHA 2WLKA 2ITCC 5EK0A 4FIPC 3JYCA 4MTOA 3F7YC 3CCQV 1KC8W 1AJQA 5L3GA 1MSWD 3AG2C 3STZC 2Y69B 4MTFA 3UM7A 3CCEV 1FFTB 3AG3B 4WFAV 1QLEC 3K3WA 4PA4A 2IU0A 3LSSA 1R73A 3HPLC 1GK9A 1E1RG 3CPWU 3QO8A 5B1OA 3W7SA 4MSWC 1JOYA 1GO3F 1EBOA 1MG1A 3T1CA 2XAHA 4JPRA 1AI5A 3ASNB 3EHBB 3K03A 1AI7A 4PDRA 4JTDB 1NKDA 2HJFC 2IH1C 3E35A 3ZJZA 2WWWA 3IGAC 1NR1A 5E1AC 1NR7A 3QO7A 4U7OA 2HKOA 4JYBA 3LNMB 1QVFU 4RUEA 5HFMA 3ZRVA 3ABKC 1VQPV 2Q6AA 2EILC 3W7UA 2BOCC 4KFMA 5EBLC 3ABMC 2M7WA 3E2EA 2GHYA 1H8HG 1V55C 3E8FA 3LSQA 3MHSC 1SESA 4L87A 3OGCC 1OHHG 1YJ9V 1M56C 3OMIB 3W7TA 1FS0G 1RPRA 2Y48A 1TUEB 4F4LA 5L3FA 1YJNV 3CCVV 4ASUG 2WLJA 1DLBA 5IY5B 4HYOA 4JYCA 2HR3A 2OT5A 1R3KC 2WLNA 2UXXA 3TCUA 2NNUA 1YSCA 3E8HA 3SPGA 5CBHA 3CCMV 1M90W 1THZA 2OTLV 4UVAA 1M1KW 2OCCC 2X6AA 2IU3A 4GT1A 1PKXA 1VQ7V 3FYEB 1BHAA 2YSUB 1AR1B 1V54C 4R7CA 2JIZG 2HVKC 5CA3A 1VQLV 1SETA 1IXMA 5KUKA 1SERA 1G4YB 2HLDG 5CMUA 1YTFD 3DTUB 3OEEG 4P30A 3ASOC 4UVBA 2UXNA 4U7NA 3PJSK 2ITDC 3FKSG 5LGNA 3ABMB 3FB5C 3LDCA 1V55B 2A0LA 1E1QG 1VQ4V 1M56B 3ABTA 4QIWF 4RAIA 3ZMUA 2V7QG 4MVZA 3QO5A 4R6ZA 4XDKA 1PL0A 1WLEA 3X2QB 1AI4A 1COWG 3HB3B 5LGUA 4BAYA 1K97A 4MS2A 1L1FA 3ZRWA 3CCSV 1G8MA 3ZMSA 5IYDO 1OCZC 1OCRC 5B1BC 2JJ2G 3K04A 3ABLC 2DYSB 2WLLA 1YHQV 2C2AA 2QE7G 2QM8A 2Q69A 1NJIW 2EIMC 3AG1B 5B3SC 2A9HA 1QR9A 4JTCB 3CD6V 1K34A 3JD0A 2B1GA 3ZMZA 3W7XA 1AJNA 3SPIA 3R65A 1ZWIC 3MD0A 3CC7V 1K8AW 2EIKC 4RUFA 5CBFA 3NXSA 4QE9A 2B5UA 1FXVA 2XNDG 3JD4A 1PNLA 1AROP 1S5HC 1YI2V 2EIJC 5J9PC 3SPCA 1KD1W 3RBZA 2Q68A 4G27B 4JASA 3CMAV 2EZOA 3AG4B 4MVOA 5EBWC 2X0LA 3ZN0A 2XASA 5L3DA 1JVMA 1KECA 2EJRA 1FXKA 2H8PC 2IJJA 3T4ZA 3TETA 3OE7G 2ZXWC 2B1IA 3DGEA 2ATKC 1OCZB 2DWEC 1R3LC 2PI4A 3OEHG 1DF5A 4BIUA 2JK5C 1Y4MA 3WG7B 5L3EA 1VQMV 4GX1A 2Q67A 1K4CC 3K06A 3E89A 1GKFA 5FL7G 3OR7C 1RM1C 1J95A 3ABUA 3CYOA 2XAQA 3E8GA 1W0KG 5B3SB 2DQ0A 4R50A 1N8RW 3RW0A 4WFEA 1M57C 3IC7A 3QNEA 1K7DA 4MTGA 2WPDG 3ETDA 2JEXA 3KG2A 4JAUA 4TT3G 1MOFA 5IYCO 5IDJA 2EINC 2LFSA 3AG2B 3K79A 4TSFG 3OW2U 3LDDA 1OCCC 1I5XA 1K9MW 4I9WA 4FMTA 1EFRG 3K9AA 3B8MA 4G2KA 4HAMA 2W6JG 4PA7A 4QNHB 5L3BA 3I55V 4P9PA 3EFFK 4RO2A 1QLEB 1S3JA 4LCUC 3FB8C 4PA6A 4G28B 4DXWA 1R3IC 3ETEA 3ZRXA 2ZXWB 1OZ0A 4LC1A 4FJCC 4MW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJQ C;  4MW3 A;  2A0L A;  2DYR C;  4H37 A;  4LP8 A;  5IY5 C;  3LDE A;  3K08 A;  4J9Y B;  4RAI A;  5BZB A;  3STL C;  4MVZ A;  1R3J C;  2QTO A;  2WLK A;  2ITC C;  4R6Z A;  4XDK A;  4XDJ A;  5EK0 A;  5EBM C;  3JYC A;  4MTO A;  3F7Y C;  3LUT B;  3E83 A;  5KUM A;  2WLH A;  2IH3 C;  3AG2 C;  3F7V C;  4MS2 A;  4MVU A;  3STZ C;  5CBG A;  4MTF A;  1OCZ C;  4JTA B;  1OCR C;  5B1B C;  3UM7 A;  3K04 A;  4EKW A;  1KKD A;  3ABL C;  3F5W C;  4J9Z B;  4GX2 A;  2DWD C;  3K0D A;  5EC2 C;  2WLL A;  3SYO A;  2W0F C;  2R9R B;  4WFF A;  2Q69 A;  2HG5 C;  1QLE C;  4PA4 A;  2EIM C;  4PDM A;  5B3S C;  3RVZ A;  2WLM A;  3SYP A;  3HPL C;  2A9H A;  2X6B A;  4JTC B;  4OXS A;  4MSW C;  1P7B A;  4MVS A;  5B1A C;  3SPI A;  3T1C A;  1OCO C;  4MVR A;  3R65 A;  1ZWI C;  2AHZ A;  3K03 A;  4GX0 A;  4PDR A;  2EIK C;  4JTD B;  2HJF C;  4RUF A;  4TWK A;  5CBF A;  2IH1 C;  3E8B A;  4MVM A;  2WLI A;  4QE9 A;  3ZJZ A;  3IGA C;  4PA9 A;  4GX5 A;  4WFG A;  5E1A C;  3SPH A;  3LDC A;  3X2Q C;  1S5H C;  2EIJ C;  5J9P C;  3FB6 C;  3SPC A;  3SYQ A;  3RBZ A;  3UKM A;  1K4D C;  2Q68 A;  3LNM B;  4G27 B;  4R8C A;  4RUE A;  3ZRS A;  2HFE C;  2Y69 C;  3ABK C;  4MVO A;  3OR6 C;  5EBW C;  2X6C A;  1JVM A;  2EIL C;  2Q6A A;  2DYS C;  1LNQ A;  4LBE C;  3TET A;  2H8P C;  2BOC C;  3T4Z A;  2ZD9 A;  2ZXW C;  3OUF A;  3T2M A;  4KFM A;  5EBL C;  3ABM C;  3SYC A;  3E86 A;  3AG3 C;  4CBC A;  2ATK C;  2DWE C;  1R3L C;  4MVQ A;  1BL8 A;  1V55 C;  2JK5 C;  2P7T C;  3AG1 C;  1XL6 A;  3E8F A;  2A79 B;  3OGC C;  4GX1 A;  4XDL A;  2QKS A;  1M56 C;  4PDL A;  5EC1 C;  2Q67 A;  1K4C C;  3K06 A;  3E89 A;  3SYA A;  2WLI B;  3OR7 C;  4P9O A;  4ZBM A;  1J95 A;  4F4L A;  3E8G A;  3OUS A;  2WLJ A;  4X8A A;  3ASN C;  4HYO A;  1R3K C;  2KB1 A;  2WLN A;  2YEV A;  4PA3 A;  4PDV A;  4R50 A;  3RVY A;  3E8H A;  2WLL B;  3RW0 A;  3SPG A;  3TCU A;  4WFE A;  5CBH A;  1M57 C;  2AHY A;  2BOB C;  4X88 A;  2HVJ C;  4MTG A;  2OCC C;  3KG2 A;  4X89 A;  2X6A A;  4HZ3 A;  2K1E A;  4P2Z A;  1ORQ C;  3VOU A;  4UUJ C;  1XL4 A;  2EIN C;  3IFX A;  3LDD A;  1OCC C;  3AG4 C;  4WFH A;  3GB7 C;  4I9W A;  1V54 C;  4R7C A;  4BW5 A;  2HVK C;  4QNH B;  4PA7 A;  4H33 A;  3FB7 C;  5KUK A;  1G4Y B;  3EFF K;  4P9P A;  4RO2 A;  4LCU C;  4QE7 A;  3FB8 C;  4PA6 A;  4G28 B;  3SPJ A;  1R3I C;  3WG7 C;  4DXW A;  4P30 A;  3ASO C;  3K0G A;  3BEH A;  2NLJ C;  2ITD C;  3PJS K;  3T4D A;  4MW8 A;  3FB5 C; 
#chains in the Genus database with same CATH topology
 2MW2 B;  1XHZ A;  1NH2 D;  4N21 A;  1L0N H;  1QBZ A;  3CJH B;  3LDE A;  1IBK O;  2A7W A;  1Q6I A;  2XT9 A;  1VQ9 V;  1I0H A;  2LW7 A;  5KX5 A;  3FYI B;  3CX5 F;  2H3O A;  5CBG A;  2EBO A;  5IJ9 A;  5EC2 C;  1VQ8 V;  1GRJ A;  4LFC O;  4GKK O;  1XNR B;  2VQF O;  4PDM A;  5CA1 B;  2F4V O;  1DF4 A;  2X6B A;  1QU7 A;  3ZMV A;  5H2F Z;  2V1D A;  4MT8 A;  2AHZ A;  4GX0 A;  1I94 O;  3CXH F;  4UV9 A;  3G71 V;  1S5L Z;  3BY6 A;  4MTX A;  4DV6 O;  2B9Z A;  3G80 A;  4JI4 O;  1H38 A;  3KCY A;  4UB6 Z;  4BIZ A;  2ZD9 A;  4H13 B;  3M7M X;  2PUS A;  5CA0 B;  5LXT A;  3E86 A;  3AG3 C;  2CK3 G;  2CGO A;  3RYH A;  1XL6 A;  3ASO B;  4PDL A;  3ZED A;  1VAR A;  4IHJ B;  3SYA A;  2EX3 A;  4JAV A;  3Q4H B;  3FAV B;  3JAL B;  3J81 N;  3TK1 A;  4JI5 O;  3T1H O;  2OYQ A;  3OGI B;  4NVP A;  1PM9 A;  1YTF B;  3IFX A;  3PN1 A;  3G6E V;  1TVK B;  2DW4 A;  1IVS A;  2DMX A;  4BW5 A;  2YXL A;  5IYB O;  3RFR A;  1ENV A;  3K58 A;  3RYC A;  2ZE5 A;  3P3P A;  4LF8 B;  3SR2 C;  3SPJ A;  5GON A;  4N23 A;  3O65 A;  4CC6 A;  4ZHQ B;  2Y4T A;  4FLU A;  2CH7 A;  4LP8 A;  5IY5 C;  2EIK B;  2BTQ B;  1BSM A;  4JI1 O;  4DUY O;  4B3S O;  5KUM A;  4YXW G;  4MVU A;  5LHH A;  5EZY A;  2N04 A;  4GLX A;  1KP2 A;  1EZV H;  2KG7 B;  3F5W C;  4UCT A;  1S0V A;  4HNA A;  1AJP A;  3H01 A;  2R9R B;  3WB1 A;  4WFF A;  1Q82 W;  2WLM A;  3VQW A;  2CTW A;  4OXS A;  3K5M A;  1RM1 B;  2DQ3 A;  5B1A C;  5KX5 B;  4CC5 A;  3B2E E;  2L6L A;  4E4E A;  2W6I G;  3A0B Z;  4CH5 A;  4NB5 A;  5IJ9 B;  1TGO A;  1WNS A;  2EIN B;  2ZIO A;  2HFE C;  1QVG U;  2UXB B;  2X6C A;  4PEL A;  5C93 A;  1CP9 A;  4KHP B;  3BPZ A;  4ZI7 A;  1SA0 A;  1Z5V A;  3OUF A;  3SYC A;  5ITZ A;  2JVD A;  4NXM O;  3QF7 A;  5FPR A;  4DR5 B;  3JD1 A;  3T1Y O;  4J80 A;  2LGW A;  1N34 B;  1QLN A;  1YJW V;  1FXH A;  1Y66 A;  4FK5 C;  5DED A;  3ZHU A;  4RQE A;  5B1A B;  2KSD A;  2HVJ C;  4UV8 A;  4HZ3 A;  3I56 V;  4FM1 A;  1Y74 B;  1I5Y A;  3K5N A;  2HHH O;  4DK1 A;  1I7F A;  1S72 V;  2ZE7 A;  5LOV A;  4JI6 O;  1GN4 A;  4I4T B;  3WG7 C;  2UUC B;  2XAJ A;  2Q4P A;  1O9G A;  1YZB A;  1F4N A;  4MW3 A;  2VQE O;  2MK3 A;  3UT5 A;  1PNM A;  4DO2 A;  3BFR A;  2RDC A;  3MDS A;  2P67 A;  1VQN V;  1NTK H;  4GKJ O;  3JYC A;  1RFY A;  3CCQ V;  1FD9 A;  2UXC B;  1KC8 W;  1MSW D;  1U97 A;  1HNW O;  3AG2 C;  2Y69 B;  1R1B A;  4MTF A;  4NR1 A;  3UM7 A;  4AHC A;  3CB2 A;  4DUZ O;  3CEI A;  1U96 A;  2CH7 B;  4IL6 Z;  2ZIM A;  3LSS A;  3JAK A;  4NYK A;  4DR6 O;  2RQ6 A;  1E1R G;  3QO8 A;  5B1O A;  2PGG A;  1N0N A;  4MSW C;  1MG1 A;  3T1C A;  5EIB C;  3K03 A;  3SDL A;  1NKD A;  2IH1 C;  1D5A A;  3ZJZ A;  4DV3 B;  2DN9 A;  4IT5 A;  4U7O A;  4LFB B;  4HNA B;  3L71 H;  2GBO A;  4O4L A;  1XDC A;  3DXR A;  1MMM A;  3W7U A;  4CS2 A;  4FLV A;  5IYZ A;  1N4C A;  5LP6 C;  2GHY A;  1H8H G;  3E8F A;  3OGC C;  4X1Y A;  1YJ9 V;  1M56 C;  1EM1 A;  1KMI Z;  4DV1 O;  2Y48 A;  3THO A;  4TQF A;  3CCV V;  1SKV A;  4DV5 B;  1IUR A;  2NNU A;  1M90 W;  4I0X B;  1THZ A;  2YXH A;  4DR2 B;  5LMN B;  4ZI7 B;  1SA0 B;  1VQ7 V;  3R66 A;  5ITZ B;  3FYE B;  2UUB O;  3K5O A;  1FJG B;  2OIG A;  3L75 H;  2E75 B;  5CA3 A;  1AB3 A;  1G4Y B;  2CGN A;  2HJD A;  2UXD O;  1TUB A;  1Q3E A;  2UXN A;  2ITD C;  3E22 B;  3CWB H;  1YF2 A;  2A0L A;  1H2L A;  1M56 B;  2E5L O;  2CDY A;  2ODM A;  1XNQ B;  2V7Q G;  4CH4 A;  4JI3 B;  1AI4 A;  3O9O A;  4X1I B;  1K97 A;  4O4J B;  2XUM A;  1QQC A;  5B1B C;  3HKE A;  2C2A A;  3ZHT A;  1GN2 A;  4ABM A;  3UT5 B;  2NN4 A;  5LMU O;  3GVM A;  3AG1 B;  4JTC B;  4PI0 A;  4DW1 A;  3JD0 A;  3ZMZ A;  4JI8 O;  1AJN A;  5IE9 A;  1RSO B;  1K8A W;  4RUF A;  2IBZ H;  5TIS Z;  2Q7E A;  4Q6G A;  2XND G;  5CB4 A;  2Q8V A;  4DV2 B;  1PNL A;  1FFX A;  1ARO P;  1SF9 A;  1S5H C;  4J10 A;  1Y6X A;  4G27 B;  1KKC A;  2DJV A;  4DV4 B;  1MA1 A;  4MVO A;  5EBW C;  5C8Y B;  4YY3 B;  2XAS A;  4FLX A;  3JAK B;  4EB6 B;  1FXK A;  3T4Z A;  2FL4 A;  5KAI Z;  1R3L C;  1DF5 A;  4BIU A;  4GX1 A;  2PF4 E;  3K06 A;  3S3X A;  5FL7 G;  5K1X A;  2R9A A;  3ABU A;  3E8G A;  1G6U A;  5BR8 O;  2JGD A;  2UU9 O;  4O4L B;  2YIA A;  2ZM6 B;  3CHX A;  3U10 A;  4Z2W A;  3ETD A;  3H1K H;  5FLX N;  1YCI A;  5IDJ A;  1I5X A;  1N32 B;  3K9A A;  4HAM A;  5L3B A;  3I55 V;  5JVD B;  3RT3 C;  1WN7 A;  1QLE B;  1S3J A;  3FB8 C;  4DXW A;  5BXZ A;  4B3T O;  4X65 B;  4LF5 B;  4B3M B;  5FPO A;  2DYR C;  1M9N A;  4QPK A;  4CZZ A;  4FLT A;  4LWS A;  2QKC A;  1L0L H;  3C90 A;  5EBM C;  2P6J A;  2WLH A;  2YIC A;  5HFL A;  1TUB B;  4DRX A;  3CP1 A;  1J5E O;  4X66 O;  4ZKI A;  4LF9 O;  3EVK A;  1P7B A;  4NXN O;  4JI2 B;  1PD3 A;  5KHH A;  1Q7Y W;  4WBN B;  2JRI A;  3M99 B;  3D8C A;  1FXK C;  1H2M A;  2OTJ V;  5KA6 A;  2WLI A;  2XAF A;  1BE3 H;  2VRZ A;  1Q90 D;  3A0R A;  1P84 F;  4WFG A;  4JYA O;  1B6Q A;  3HKE B;  2K9P A;  3ETQ A;  3MHH C;  2CTP A;  4EFB A;  4QPJ A;  2WA4 A;  2Q9L A;  1GM9 A;  1V54 B;  1GN6 A;  4TV9 A;  2FKX A;  3T2M A;  4IYI A;  4JF3 A;  3ZN1 A;  5FNV A;  1QR8 A;  3CCJ V;  1SS3 A;  1D2D A;  2BTO A;  1HP8 A;  4ZBM A;  3TXS A;  1OJH A;  4I7Z B;  3OUS A;  1QCE A;  3ASN C;  1AI6 A;  2AZ2 A;  2YEV A;  4DR3 B;  3ZHR A;  1VQ5 V;  2WAM A;  1WJZ A;  4RWU A;  3JD3 A;  1XMO B;  4X62 B;  2QSA A;  2BOB C;  1S5J A;  2WSS G;  4I5S A;  2O57 A;  2Z3Y A;  1NTZ H;  4UUJ C;  1K73 W;  4B3R O;  3JAR B;  4I55 B;  1DTO A;  1XHX A;  2NR5 A;  4K0K O;  3ETG A;  1H2K A;  1HNX B;  3FB7 C;  1M4U A;  4JV5 O;  1SC5 B;  1Y76 B;  5EYP A;  4UFZ A;  3RGB A;  2NLJ C;  3CC2 V;  3M8A A;  2F95 B;  2FB5 A;  2Q73 A;  4Q20 A;  2EJ7 A;  4DR1 O;  4JYY A;  3OM3 B;  5GW7 A;  4JAA A;  1GM7 A;  3GWO A;  2QWN B;  5J2U B;  4D7S A;  1ROP A;  2LGQ A;  3RWR D;  3NR7 A;  3QG5 A;  3F7V C;  4FPP A;  2Z5U A;  4J9Z B;  3K0D A;  2W0F C;  5LHG A;  1G1X B;  1XMQ B;  3RVZ A;  4ZOL A;  4FM0 A;  1VIB A;  2D3O W;  4LWS B;  3RN4 A;  4U3F H;  3CC4 V;  3E8B A;  4MVM A;  2GV9 A;  1N33 O;  2YID A;  2YI8 A;  2KQX A;  4GX5 A;  4J7K A;  3X2Q C;  4DRX B;  4FM2 A;  3ZRS A;  1CPY A;  1OCC B;  4LNU A;  2FYU H;  1MZF A;  1BHB A;  4MVQ A;  2Q0O C;  4XDL A;  1IX9 A;  2WLI B;  5JQG A;  1K92 A;  5JH7 A;  4X8A A;  1P4R A;  2GSM B;  3ZIA G;  1SQG A;  2WLL B;  4O2B B;  3QTC A;  2ZE8 A;  4UCV A;  4YJ2 A;  4X64 O;  4P2Z A;  1XL4 A;  2XAG A;  3AG4 C;  5FNV B;  3P32 A;  1JR9 A;  3RYI B;  1R6N A;  1P7G A;  1F4M A;  2YEV B;  3BEH A;  1NI8 A;  2AZ0 A;  4GCZ A;  4LF4 O;  4H44 B;  1HR0 O;  2HEP A;  4FLZ A;  1VF7 A;  3JCZ A;  4J9Y B;  5BY1 A;  4JI7 B;  3DC6 A;  5BZB A;  2PYL A;  1XUQ A;  5EK0 A;  1WB8 A;  1KUQ A;  1AJQ A;  4J41 A;  1IBK B;  1AR5 A;  4CH6 A;  1US6 A;  3FD9 A;  3CCE V;  4AQY O;  3AG3 B;  4WFA V;  2ILM A;  1EN4 A;  2RN9 A;  2IU0 A;  2YS8 A;  2BSK A;  1R73 A;  3ZS8 C;  3K59 A;  1GK9 A;  3H9V A;  1XRE A;  1GO3 F;  4OPA A;  3BAB A;  3CRM A;  2VQF B;  4JPR A;  4JTD B;  2F4V B;  3VQY A;  2WWW A;  3IGA C;  3CRA A;  2LO1 A;  5E1A C;  3JAS A;  2VWK A;  4O2A A;  4RUE A;  5LA6 B;  5HFM A;  1I94 B;  3ABK C;  4UB8 Z;  1VQP V;  2BE3 A;  3BA8 A;  2Q6A A;  2EIL C;  3APO A;  1KBH A;  3CSX A;  2BOC C;  4JI0 B;  3H1H H;  4KFM A;  5EBL C;  2M7W A;  4DV7 O;  4UCS A;  4JI4 B;  4LF7 O;  3OMI B;  1TUE B;  5L3F A;  1IBL O;  2WLJ A;  5IY5 B;  1Q8I A;  1NZ6 A;  3TCU A;  3E8H A;  3SPG A;  2OTL V;  4UVA A;  4DR7 O;  2OCC C;  4JI5 B;  2X6A A;  1N36 O;  4GT1 A;  4LNU B;  4FFB A;  1JA8 A;  2GUZ A;  1AR1 B;  2HVK C;  4FLY A;  1VQL V;  2CE4 A;  5KMG A;  2R70 A;  1SER A;  3I5D A;  1BT8 A;  3AK1 A;  2HLD G;  4LFA O;  1H2S B;  5IWA O;  1YTF D;  2PYJ A;  4DR4 O;  3UO3 A;  5LP6 A;  4YJ2 B;  1E1Q G;  3ABT A;  2QJ1 A;  4RAI A;  3ZMU A;  2F93 B;  5LXT B;  3QO5 A;  4LFB O;  1PL0 A;  3RYH B;  1WLE A;  1PPJ H;  4QGP A;  1XIL A;  4BAY A;  1L1F A;  1ZLZ A;  2OWO A;  3EXA A;  3G67 A;  4JI1 B;  3TXQ A;  1OCR C;  2JJ2 G;  1YXB A;  2Q7G A;  1EN5 A;  3CRQ A;  3K04 A;  3ABL C;  4DUY B;  1YHQ V;  4B3S B;  1NJI W;  2EIM C;  4FZ0 A;  1QR9 A;  5KLV H;  2P22 C;  1LUW A;  4LH7 A;  4NTW A;  4HBN A;  4YIO A;  1ZWI C;  1BZK A;  5GTH Z;  3NXS A;  1Q6H A;  3RYC B;  5LMN O;  3UCS C;  2EIJ C;  5J9P C;  3SPC A;  5GON B;  5JWP A;  2Q68 A;  2F66 C;  4JAS A;  3CMA V;  2A06 H;  5L3D A;  2BSK B;  1KEC A;  1RP3 B;  3AG7 A;  4TUY A;  2YIB A;  2ATK C;  4LH6 A;  2CTQ A;  4DYL A;  3WG7 B;  5L3E A;  3A8T A;  1ZX3 A;  4DK0 A;  3F5T A;  1K4C C;  5JJN B;  3E89 A;  1GKF A;  3OR7 C;  1J95 A;  3CYO A;  5EZY B;  3JAS B;  2Q5Z A;  4R50 A;  3RW0 A;  4NXM B;  1M57 C;  3IC7 A;  3T1Y B;  1K7D A;  2WPD G;  1VF6 A;  2ZT9 B;  2ADP A;  3N2K A;  4W4K A;  2LFS A;  3AG2 B;  3K79 A;  1SQQ H;  2YXY A;  1EFR G;  2W6J G;  4PA7 A;  2M6Y A;  3HKB A;  4RO2 A;  2HHH B;  4PA6 A;  1R3I C;  1WA8 A;  3ZRX A;  3HKD A;  4FJC C;  1MSD A;  4MW8 A;  1AVM A;  2G38 A;  2RCV A;  4X20 A;  4JI6 B;  2P90 A;  5F2V O;  1DGS A;  4DV2 O;  1KU9 A;  2V4D A;  4C7U A;  1KB9 F;  2QTO A;  4XDJ A;  5GTI Z;  3LUT B;  3CS5 A;  4DV4 O;  4J7J A;  1VQO V;  4JTA B;  4EKW A;  2FTK A;  1VQK V;  2JJ1 G;  4GKJ B;  4GX2 A;  4UVC A;  2XHB A;  4YHH O;  5LP6 B;  3ML0 A;  3A2F A;  4PV1 B;  3U0Z A;  2QEX V;  1HNW B;  1VEW A;  1NQT A;  3ZCC A;  1ZSP A;  5IJ0 A;  3HR0 A;  1UJW B;  2X7R B;  4MVS A;  4E2L A;  2ZM6 O;  4DR6 B;  5LHI A;  5LOV B;  1JJ2 U;  2ARH A;  2P5O A;  5BMV A;  4PD4 F;  3JSN A;  1SQP H;  2R9I A;  1KP3 A;  4GZR B;  2F43 G;  2QWR B;  4LF5 O;  3JAT A;  2A79 B;  1K3E A;  2QKS A;  1VF6 C;  4A5U B;  5KHI A;  2YDE A;  3W7W A;  1URF A;  4DV1 B;  3ICX A;  4NTX A;  4X88 A;  1P49 A;  4IIJ A;  2ZR3 A;  4TUY B;  3OTF A;  1NU1 H;  5DN6 G;  4WFH A;  3GB7 C;  5B1B B;  1NTM H;  3GWK C;  5H6Q A;  2QWP B;  3VBB A;  2ZDI A;  4H33 A;  3UO2 A;  2CAZ C;  4UXN A;  5H9C A;  2UUB B;  3IAY A;  1NVP B;  2LFR A;  4LR3 A;  3CXC U;  2UXD B;  2BCC H;  3DXR B;  3K08 A;  1MNG A;  3STL C;  3OMA B;  5B1N A;  5IYZ B;  1KQS U;  1FKA O;  2DOS A;  1S77 D;  1NBM G;  4X1Y B;  2E5L B;  3HKB B;  1I08 A;  2LW1 A;  4W4L A;  1KKD A;  1W0J G;  3FX7 A;  3J80 N;  3HKD B;  3OAA G;  3SYO A;  1XBL A;  1PV0 A;  1VQ6 V;  1GMG A;  2XTA A;  2HG5 C;  2HP8 A;  2IJK A;  3CCU V;  1JFF A;  3BVO A;  5LBQ A;  3HKC A;  5LMU B;  3RYF A;  4GYC B;  4K35 A;  3JAW A;  4PA9 A;  4J7Z A;  1W2B U;  1BQZ A;  4J11 A;  3ZMT A;  4NTY A;  4JI8 B;  4OX9 O;  3FB6 C;  3P30 A;  3UKM A;  2QWQ B;  4PI2 A;  3B40 A;  4EFE A;  1H8E G;  1IBM O;  3CJH A;  2DYS C;  4LBE C;  5IJ0 B;  1H2G A;  3OTO B;  4PJ0 Z;  3LNN A;  5LGT A;  1BL8 A;  3KKY A;  1TA8 A;  2JEU A;  5EC1 C;  2FML A;  1GM8 A;  2QKA A;  3SJC C;  1WPX A;  3CRC A;  1V9P A;  2DYR B;  1PNK A;  4UCR A;  3RVY A;  2R72 A;  2ZDI C;  2JDI G;  1F23 A;  2LP7 A;  3N27 A;  5CA1 A;  3B77 A;  5D5P A;  3VOU A;  5BR8 B;  1NVP D;  5H6R A;  3DSQ A;  2UU9 B;  1UFI A;  2OCH A;  1NH2 B;  1K5S A;  1AP5 A;  5DM6 V;  4LF6 B;  1HNZ B;  5CB4 B;  1FFX B;  3K0G A;  4OGQ B;  5H5N A;  4RQF A;  4JGS A;  3SJQ C;  4IIJ B;  1SZT A;  1FXK B;  5CA0 A;  4B3T B;  2RJZ A;  1JPX A;  2GDS A;  4CS4 A;  3DC5 A;  4MTO A;  4B7E A;  1XNR O;  4KL1 A;  3JAL A;  5B66 Z;  1SQX H;  1IDS A;  2AW9 A;  5IT9 N;  4EEQ A;  1FFT B;  2JGD B;  1XQ8 A;  2E3C A;  2F1M A;  4F6R A;  3K3W A;  4TQD A;  4PA4 A;  2QGN A;  1TAE A;  4L8J A;  3W7S A;  1WAZ A;  1JOY A;  1EBO A;  2VS0 A;  3APQ A;  1AI5 A;  3ASN B;  4UCO A;  1AI7 A;  2CTR A;  4PDR A;  1XEQ A;  2JS3 A;  3E35 A;  4JZG A;  4LF9 B;  1NR1 A;  2YUA A;  4NXN B;  2HKO A;  4O4I A;  4AI8 A;  4ZHQ A;  2LJ2 A;  1AR4 A;  5LYJ A;  1JFF B;  4I50 A;  3C3T A;  5E79 Z;  2BTQ A;  1UPG A;  4JYA B;  3ABM C;  4ZIB A;  4L87 A;  4BWA A;  4AIL C;  1FS0 G;  4DV0 B;  4F4L A;  1YJN V;  1D5N A;  2QR4 A;  2KG7 A;  4HYO A;  3SJA C;  1R3K C;  2WLN A;  2UXX A;  1MZE A;  3JSL A;  5CBH A;  1BQ0 A;  1ZAU A;  3G6B A;  3JCU Z;  1M1K W;  2QTS A;  4LF8 O;  1PKX A;  4K8Z A;  1BHA A;  1BGY H;  1EN6 A;  1FAF A;  4R7C A;  2JIZ G;  3D3Q A;  1VMG A;  3IC9 A;  2F23 A;  1FYJ A;  3QVN A;  4B3R B;  4PHZ A;  3ASO C;  4IGG A;  3ABM B;  4K0K B;  3FB5 C;  4JV5 B;  1VQ4 V;  4QIW F;  4TV9 B;  4NKG B;  4R6Z A;  4CS3 A;  3X2Q B;  1COW G;  3HB3 B;  2UUA B;  4BIO A;  5LGU A;  4DR1 B;  3J7A U;  5J2T A;  4MS2 A;  3ZRW A;  3CCS V;  4J42 A;  1WB7 A;  5IYD O;  1OCZ C;  4K3A A;  4FLW A;  3OT7 A;  4JI0 O;  4X1K A;  2QE7 G;  4TV8 A;  1H2N A;  1DK1 A;  2A9H A;  1Y74 A;  2AGA A;  3CD6 V;  3OD4 A;  3IJ4 A;  3W7X A;  1O9H A;  3R65 A;  2OIE A;  2EIK C;  5CBF A;  1Z5W A;  4I4T A;  2B5U A;  2UXB O;  3WU2 Z;  5EYP B;  4KHP O;  4KXR A;  1YI2 V;  1WPB A;  3S3W A;  4F6R B;  4B08 A;  3AG4 B;  1N33 B;  1X59 A;  1JVM A;  3K9S A;  4DR5 O;  2EJR A;  2IJJ A;  2H8P C;  3TET A;  2DE0 X;  1N34 O;  2DWE C;  1OCZ B;  2PI4 A;  4LFC B;  4GKK B;  4O4H A;  1VQM V;  4TOI A;  1RM1 C;  5JJJ B;  2XAQ A;  4O4I B;  1N8R W;  5LYJ B;  3L9D A;  4MTG A;  4I50 B;  2JEX A;  3KG2 A;  4IYH A;  1NS1 A;  4ZOL B;  1MOF A;  1BS3 A;  2EIN C;  2UUC O;  4DV6 B;  2RMK B;  2P06 A;  4I9W A;  3B8M A;  4QNH B;  4X64 B;  4P9P A;  3EFF K;  3N2G A;  4G28 B;  4FFK A;  1OZ0 A;  4LC1 A;  4WCE V;  4H37 A;  2UXC O;  1SQV H;  1W59 A;  1ZL8 A;  3BHP A;  3SGI A;  1YIJ V;  3D3I A;  1XOU A;  3T1H B;  4LF4 B;  1BMF G;  1HWY A;  1HR0 B;  5B5E Z;  3WB0 A;  4H0L B;  2IH3 C;  4XBF A;  3ABK B;  1A32 A;  5JQG B;  3SJB C;  5JH7 B;  2EIL B;  1RPO A;  2IM9 A;  3ZHQ A;  4I0X A;  3CME V;  2ETN A;  2XOK G;  2ZR2 A;  2QWO B;  3C3S A;  3LSU A;  3SYP A;  1CEZ A;  3CCR V;  4DV3 O;  4AQY B;  1N0J A;  2P4K A;  5KA5 A;  1FPO A;  2A3Q A;  1OCO C;  1SRY A;  5J2T B;  3ZRW B;  1M93 A;  1F7Y A;  3SPH A;  2OCC B;  4X1K B;  4Z1M G;  3E22 A;  1K4D C;  3U11 A;  2Y69 C;  1T5E A;  4TV8 B;  2PTM A;  1K33 A;  2ADQ B;  3OR6 C;  5A2Q N;  1LNQ A;  3BRC A;  4CBC A;  4DV5 O;  2P7T C;  4GUN A;  1JJO A;  1JX9 A;  4X1I A;  4O4J A;  1YVW A;  3ZHS A;  1Q81 W;  3D36 A;  3G4S V;  3B4S A;  4DR2 O;  1IXB A;  2D2C B;  3AEI A;  4DV7 B;  3FFQ A;  2VWJ A;  4PA3 A;  4PDV A;  3UQ8 A;  3L74 H;  4LF7 B;  4WF9 V;  1FJG O;  4D6T H;  2AHY A;  1OCO B;  2ZIN A;  3L70 H;  2LQT A;  2QA4 V;  1IBL B;  2K1E A;  4YJ3 A;  5JCO A;  1GAX A;  1RSO A;  1OCR B;  4O4H B;  4Z1V A;  3ABL B;  4DR7 B;  2H94 A;  2QM4 A;  3JAM N;  3WB2 A;  1N36 B;  1R6T A;  3H1J H;  2EIM B;  2WA3 A;  1BCC H;  1S76 D;  2PI5 A;  1XNQ O;  4O2A B;  1GN3 A;  1L8D A;  3K5L A;  3CCL V;  5C8Y A;  4JI3 O;  1XI1 A;  4EB6 A;  4LFA B;  1X4T A;  5IWA B;  4DR4 B;  4WFB V;  2EIJ B;  3E83 A;  3B8N A;  5L3C A;  1EZJ A;  1NT2 B;  4KP4 A;  3N2G B;  3JD2 A;  2DWD C;  2QM7 A;  2GTA A;  3H1I H;  3OMN B;  1OV9 A;  1ZL8 B;  1B06 A;  5CN0 A;  4FFB B;  1KYO F;  1JCH A;  2GUZ B;  4MVR A;  2VQE B;  3ZHV A;  5A9G A;  4TWK A;  5JVD A;  4BR6 A;  1M57 B;  5KMG B;  4YY3 O;  3WFV A;  1F51 A;  1YIT V;  2N74 A;  3SYQ A;  4R8C A;  2IW5 A;  3D36 C;  2EZP A;  4K8X A;  4CH3 A;  2W0X A;  1MAB G;  4DUZ B;  3AG1 C;  2L35 A;  4D7T A;  1Z2G A;  1AP6 A;  5JCO C;  4P9O A;  1GTO A;  1B3Q A;  3VQX A;  2KB1 A;  1N32 O;  1YDX A;  4X89 A;  4QJF B;  2IJI A;  1ORQ C;  3BAA A;  2EUL A;  3KZI Z;  4X65 O;  1JQ0 A;  4WBN A;  1Q86 W;  4KUM A;  1QHT A;  1Q5O A;  4B3M O;  2ZNJ A;  3AK3 A;  4QE7 A;  2ZQM A;  2ZCE A;  1R6K A;  3AK2 A;  3T4D A;  1E79 G;  2CUG A;  5JJE B;  2Y0I A;  2KKW A;  1K5Q A;  4B7K A;  5KHK A;  5LL6 Y;  4YJ3 B;  3OFN G;  1R3J C;  2IJH A;  2Z0A A;  2WLK A;  1GH6 A;  2ITC C;  5D5Q A;  4FIP C;  3F7Y C;  5L3G A;  5EIB D;  3STZ C;  3OTO O;  2E74 B;  5KHJ A;  1Y67 A;  1JMK C;  4I9Q A;  3MAQ A;  4JI2 O;  1QLE C;  1SQF A;  3HPL C;  3CPW U;  1LR1 A;  2Y0P A;  3N2K B;  2RNB A;  3JAR A;  4I55 A;  4U3J A;  4YIP A;  4YHH B;  2PY5 A;  2XAH A;  3EHB B;  2HJF C;  1Y76 A;  2PZS A;  1NR7 A;  3P3N A;  3QO7 A;  1WA8 B;  4JYB A;  3LNM B;  1QVF U;  3ZRV A;  1SQB H;  5AG2 A;  4X20 B;  4LF6 O;  1HNZ O;  3A0H Z;  4ICG A;  2YI9 A;  5J2U A;  3E2E A;  4UCU A;  1ZUQ A;  1V55 C;  3LSQ A;  1Q6U A;  3MHS C;  1SES A;  3L72 H;  4DR3 O;  1OHH G;  1PP9 H;  1WP7 A;  1XMO O;  3W7T A;  4X62 O;  2P4V A;  1CXZ B;  1RPR A;  4ASU G;  1DLB A;  4JYC A;  2HR3 A;  2OT5 A;  1YSC A;  3CCM V;  2N05 A;  5KAF Z;  1HNX O;  3BCC H;  2IU3 A;  2ZKO A;  2YSU B;  5KHG A;  1V54 C;  1SET A;  2JGU A;  1IXM A;  2Q7H A;  5KUK A;  5CMU A;  4FVM A;  5BMV B;  3DTU B;  3OEE G;  1ZTE A;  2YIB D;  4P30 A;  4UVB A;  1M5I A;  4U7N A;  3PJS K;  3FKS G;  5LGN A;  3LDC A;  1V55 B;  2GTS A;  4MVZ A;  3L73 H;  3K57 A;  4XDK A;  4BW9 A;  3JAT B;  3KCX A;  3TGU H;  1PL4 A;  1XMQ O;  3BA9 A;  1Q43 A;  1G8M A;  3ZMS A;  1AIL A;  3TJT A;  2DYS B;  2WLL A;  4O2B A;  2AXT Z;  2Y4U A;  4JZ2 A;  2QM8 A;  2Q69 A;  1VP7 A;  4F6E A;  5B3S C;  4DV0 O;  2E76 B;  1B04 A;  1K34 A;  2B1G A;  3SPI A;  3VQV A;  3RYI A;  4DW0 A;  3MD0 A;  3CC7 V;  1LUV A;  4IHJ A;  4QE9 A;  1QNM A;  3Q4H A;  1FXV A;  1WP8 A;  3FAV A;  3JD4 A;  1KD1 W;  1YEW A;  3RBZ A;  3CRR A;  1VF5 B;  3CE2 A;  2EZO A;  3B09 A;  2YC0 A;  2X0L A;  3ZN0 A;  3OE7 G;  5K1P A;  2ZXW C;  4OX9 B;  2B1I A;  2Q0A A;  4FZ1 A;  3DGE A;  1J5E B;  3OEH G;  4U3J B;  1TVK A;  2JK5 C;  1Y4M A;  3ZBH A;  1SZX A;  2JS5 A;  1IBM B;  2Q67 A;  4X66 B;  1W0K G;  5B3S B;  2DQ0 A;  1HW7 A;  4WFE A;  3H1L H;  3QNE A;  2UUA O;  4OPH A;  4JAU A;  4TT3 G;  5DEC A;  2ZE6 A;  5IYC O;  4TSF G;  3OW2 U;  3LDD A;  1OCC C;  4X9Q A;  3ZX6 A;  2QDO A;  1K9M W;  3HKC B;  4FMT A;  4G2K A;  3RYF B;  2ZNI A;  3JAW B;  4LCU C;  3ETE A;  4JI7 O;  2ZXW B;  1HDJ A;  5LA6 A;  1IZ3 A; 
#chains in the Genus database with same CATH homology
 1NH2 D;  4N21 A;  4WCE V;  2DYR C;  4H37 A;  1M9N A;  1YIJ V;  4QPK A;  1QBZ A;  2P90 A;  3D3I A;  3LDE A;  4CZZ A;  1VQ9 V;  2QTO A;  4XDJ A;  5EBM C;  1BMF G;  1HWY A;  3LUT B;  3FYI B;  2P6J A;  2WLH A;  2IH3 C;  4XBF A;  3ABK B;  5HFL A;  1VQO V;  5CBG A;  2EBO A;  4JTA B;  4EKW A;  2FTK A;  1VQK V;  2JJ1 G;  2EIL B;  4GX2 A;  3CP1 A;  5EC2 C;  1VQ8 V;  1RPO A;  4UVC A;  3CME V;  3ML0 A;  2QEX V;  2XOK G;  2ZR2 A;  4PDM A;  1NQT A;  3ZCC A;  3SYP A;  1CEZ A;  4ZKI A;  1DF4 A;  2X6B A;  3CCR V;  1UJW B;  1P7B A;  2X7R B;  3ZMV A;  5KA5 A;  4MVS A;  4E2L A;  1OCO C;  1PD3 A;  1SRY A;  2V1D A;  4MT8 A;  2AHZ A;  1Q7Y W;  4GX0 A;  3M99 B;  1FXK C;  2OTJ V;  5KA6 A;  3ZRW B;  2WLI A;  5LHI A;  2XAF A;  1JJ2 U;  3A0R A;  4UV9 A;  4WFG A;  3SPH A;  2OCC B;  3G71 V;  4Z1M G;  3BY6 A;  1B6Q A;  1K4D C;  3MHH C;  4MTX A;  2R9I A;  2Y69 C;  4QPJ A;  1H38 A;  1K33 A;  3OR6 C;  1GM9 A;  1V54 B;  1KP3 A;  1LNQ A;  4BIZ A;  2ZD9 A;  3T2M A;  3E86 A;  3AG3 C;  4JF3 A;  2CK3 G;  3ZN1 A;  4CBC A;  2F43 G;  2P7T C;  1QR8 A;  1XL6 A;  2A79 B;  1JX9 A;  1K3E A;  3CCJ V;  3ASO B;  2QKS A;  4PDL A;  3SYA A;  4JAV A;  4ZBM A;  1Q81 W;  3D36 A;  3G4S V;  3TK1 A;  3OUS A;  1QCE A;  3AEI A;  3ASN C;  1AI6 A;  3W7W A;  4PA3 A;  2YEV A;  4PDV A;  1VQ5 V;  4WF9 V;  2WAM A;  3JD3 A;  2AHY A;  2BOB C;  4X88 A;  1OCO B;  2WSS G;  2ZR3 A;  2QA4 V;  2K1E A;  4I5S A;  2Z3Y A;  4UUJ C;  1K73 W;  1YTF B;  3IFX A;  5DN6 G;  4WFH A;  3G6E V;  3GB7 C;  1OCR B;  2DW4 A;  1DTO A;  5B1B B;  4BW5 A;  3ABL B;  5H6Q A;  3VBB A;  3ETG A;  2ZDI A;  2H94 A;  4H33 A;  5IYB O;  3FB7 C;  1ENV A;  2EIM B;  4UXN A;  5H9C A;  3SPJ A;  1S76 D;  2PI5 A;  4N23 A;  2NLJ C;  1NVP B;  3CC2 V;  2LFR A;  3CXC U;  3CCL V;  4LP8 A;  5IY5 C;  4Q20 A;  3OM3 B;  3K08 A;  2EIK B;  5GW7 A;  3STL C;  1GM7 A;  3GWO A;  3OMA B;  5B1N A;  1KQS U;  1ROP A;  4WFB V;  1S77 D;  2EIJ B;  3E83 A;  5KUM A;  1NBM G;  3B8N A;  4YXW G;  3F7V C;  4MVU A;  5L3C A;  5LHH A;  1EZJ A;  4FPP A;  4KP4 A;  2Z5U A;  1KKD A;  1KP2 A;  1W0J G;  3JD2 A;  3F5W C;  4J9Z B;  1S0V A;  2DWD C;  3K0D A;  3OAA G;  3SYO A;  2QM7 A;  1VQ6 V;  1GMG A;  2W0F C;  1AJP A;  5LHG A;  3H01 A;  2R9R B;  4WFF A;  1Q82 W;  3OMN B;  2HG5 C;  2IJK A;  3CCU V;  3RVZ A;  2WLM A;  5CN0 A;  2D3O W;  1RM1 B;  4OXS A;  1JCH A;  2DQ3 A;  5B1A C;  5LBQ A;  4MVR A;  4TWK A;  3CC4 V;  3E8B A;  4MVM A;  1M57 B;  3WFV A;  1F51 A;  2W6I G;  4PA9 A;  1W2B U;  4GX5 A;  1YIT V;  3ZMT A;  3X2Q C;  3FB6 C;  3SYQ A;  3P30 A;  3UKM A;  3ZRS A;  4R8C A;  2EIN B;  2HFE C;  2IW5 A;  1CPY A;  1H8E G;  1OCC B;  1QVG U;  2EZP A;  2X6C A;  4PEL A;  5C93 A;  2DYS C;  4LBE C;  1CP9 A;  1H2G A;  3OUF A;  1BHB A;  3SYC A;  5LGT A;  4MVQ A;  1BL8 A;  1MAB G;  3AG1 C;  4XDL A;  2JEU A;  5EC1 C;  1GM8 A;  2WLI B;  3JD1 A;  4P9O A;  1GTO A;  1K92 A;  1WPX A;  1QLN A;  2DYR B;  1PNK A;  4X8A A;  1P4R A;  2GSM B;  1YJW V;  3ZIA G;  2KB1 A;  1FXH A;  3RVY A;  2ZDI C;  2WLL B;  1Y66 A;  4FK5 C;  4RQE A;  2JDI G;  1F23 A;  5B1A B;  2LP7 A;  2HVJ C;  4UV8 A;  3B77 A;  4X89 A;  4QJF B;  2IJI A;  4HZ3 A;  3I56 V;  4P2Z A;  1ORQ C;  3VOU A;  1XL4 A;  2XAG A;  1I5Y A;  1NVP D;  5H6R A;  3AG4 C;  3P32 A;  1S72 V;  1JQ0 A;  1Q86 W;  4KUM A;  1NH2 B;  1K5S A;  1R6N A;  5DM6 V;  4QE7 A;  2ZQM A;  1F4M A;  3WG7 C;  1R6K A;  3K0G A;  2YEV B;  3BEH A;  2XAJ A;  3T4D A;  1E79 G;  4GCZ A;  4RQF A;  1F4N A;  4JGS A;  4MW3 A;  3SJQ C;  1K5Q A;  2MK3 A;  1PNM A;  3JCZ A;  4DO2 A;  1SZT A;  4J9Y B;  1VQN V;  1FXK B;  2P67 A;  3OFN G;  5BZB A;  1R3J C;  1JPX A;  2IJH A;  2WLK A;  2ITC C;  5EK0 A;  4FIP C;  3JYC A;  4MTO A;  3F7Y C;  3CCQ V;  1KC8 W;  1AJQ A;  5L3G A;  1MSW D;  3AG2 C;  3STZ C;  2Y69 B;  4MTF A;  3UM7 A;  3CCE V;  1FFT B;  3AG3 B;  4WFA V;  1QLE C;  3K3W A;  4PA4 A;  2IU0 A;  3LSS A;  1R73 A;  3HPL C;  1GK9 A;  1E1R G;  3CPW U;  3QO8 A;  5B1O A;  3W7S A;  4MSW C;  1JOY A;  1GO3 F;  1EBO A;  1MG1 A;  3T1C A;  2XAH A;  4JPR A;  1AI5 A;  3ASN B;  3EHB B;  3K03 A;  1AI7 A;  4PDR A;  4JTD B;  1NKD A;  2HJF C;  2IH1 C;  3E35 A;  3ZJZ A;  2WWW A;  3IGA C;  1NR1 A;  5E1A C;  1NR7 A;  3QO7 A;  4U7O A;  2HKO A;  4JYB A;  3LNM B;  1QVF U;  4RUE A;  5HFM A;  3ZRV A;  3ABK C;  1VQP V;  2Q6A A;  2EIL C;  3W7U A;  2BOC C;  4KFM A;  5EBL C;  3ABM C;  2M7W A;  3E2E A;  2GHY A;  1H8H G;  1V55 C;  3E8F A;  3LSQ A;  3MHS C;  1SES A;  4L87 A;  3OGC C;  1OHH G;  1YJ9 V;  1M56 C;  3OMI B;  3W7T A;  1FS0 G;  1RPR A;  2Y48 A;  1TUE B;  4F4L A;  5L3F A;  1YJN V;  3CCV V;  4ASU G;  2WLJ A;  1DLB A;  5IY5 B;  4HYO A;  4JYC A;  2HR3 A;  2OT5 A;  1R3K C;  2WLN A;  2UXX A;  3TCU A;  2NNU A;  1YSC A;  3E8H A;  3SPG A;  5CBH A;  3CCM V;  1M90 W;  1THZ A;  2OTL V;  4UVA A;  1M1K W;  2OCC C;  2X6A A;  2IU3 A;  4GT1 A;  1PKX A;  1VQ7 V;  3FYE B;  1BHA A;  2YSU B;  1AR1 B;  1V54 C;  4R7C A;  2JIZ G;  2HVK C;  5CA3 A;  1VQL V;  1SET A;  1IXM A;  5KUK A;  1SER A;  1G4Y B;  2HLD G;  5CMU A;  1YTF D;  3DTU B;  3OEE G;  4P30 A;  3ASO C;  4UVB A;  2UXN A;  4U7N A;  3PJS K;  2ITD C;  3FKS G;  5LGN A;  3ABM B;  3FB5 C;  3LDC A;  1V55 B;  2A0L A;  1E1Q G;  1VQ4 V;  1M56 B;  3ABT A;  4QIW F;  4RAI A;  3ZMU A;  2V7Q G;  4MVZ A;  3QO5 A;  4R6Z A;  4XDK A;  1PL0 A;  1WLE A;  3X2Q B;  1AI4 A;  1COW G;  3HB3 B;  5LGU A;  4BAY A;  1K97 A;  4MS2 A;  1L1F A;  3ZRW A;  3CCS V;  1G8M A;  3ZMS A;  5IYD O;  1OCZ C;  1OCR C;  5B1B C;  2JJ2 G;  3K04 A;  3ABL C;  2DYS B;  2WLL A;  1YHQ V;  2C2A A;  2QE7 G;  2QM8 A;  2Q69 A;  1NJI W;  2EIM C;  3AG1 B;  5B3S C;  2A9H A;  1QR9 A;  4JTC B;  3CD6 V;  1K34 A;  3JD0 A;  2B1G A;  3ZMZ A;  3W7X A;  1AJN A;  3SPI A;  3R65 A;  1ZWI C;  3MD0 A;  3CC7 V;  1K8A W;  2EIK C;  4RUF A;  5CBF A;  3NXS A;  4QE9 A;  2B5U A;  1FXV A;  2XND G;  3JD4 A;  1PNL A;  1ARO P;  1S5H C;  1YI2 V;  2EIJ C;  5J9P C;  3SPC A;  1KD1 W;  3RBZ A;  2Q68 A;  4G27 B;  4JAS A;  3CMA V;  2EZO A;  3AG4 B;  4MVO A;  5EBW C;  2X0L A;  3ZN0 A;  2XAS A;  5L3D A;  1JVM A;  1KEC A;  2EJR A;  1FXK A;  2H8P C;  2IJJ A;  3T4Z A;  3TET A;  3OE7 G;  2ZXW C;  2B1I A;  3DGE A;  2ATK C;  1OCZ B;  2DWE C;  1R3L C;  2PI4 A;  3OEH G;  1DF5 A;  4BIU A;  2JK5 C;  1Y4M A;  3WG7 B;  5L3E A;  1VQM V;  4GX1 A;  2Q67 A;  1K4C C;  3K06 A;  3E89 A;  1GKF A;  5FL7 G;  3OR7 C;  1RM1 C;  1J95 A;  3ABU A;  3CYO A;  2XAQ A;  3E8G A;  1W0K G;  5B3S B;  2DQ0 A;  4R50 A;  1N8R W;  3RW0 A;  4WFE A;  1M57 C;  3IC7 A;  3QNE A;  1K7D A;  4MTG A;  2WPD G;  3ETD A;  2JEX A;  3KG2 A;  4JAU A;  4TT3 G;  1MOF A;  5IYC O;  5IDJ A;  2EIN C;  2LFS A;  3AG2 B;  3K79 A;  4TSF G;  3OW2 U;  3LDD A;  1OCC C;  1I5X A;  1K9M W;  4I9W A;  4FMT A;  1EFR G;  3K9A A;  3B8M A;  4G2K A;  4HAM A;  2W6J G;  4PA7 A;  4QNH B;  5L3B A;  3I55 V;  4P9P A;  3EFF K;  4RO2 A;  1QLE B;  1S3J A;  4LCU C;  3FB8 C;  4PA6 A;  4G28 B;  4DXW A;  1R3I C;  3ETE A;  3ZRX A;  2ZXW B;  1OZ0 A;  4LC1 A;  4FJC C;  4MW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...