2Q69A

Crystal structure of nak channel d66n mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGNGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Metal transport, membrane protein
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q69A00
5CBGA 3K04A 2AHYA 3HPLC 4MTGA 2A9HA 4J9YB 4WFFA 4BW5A 3AG3C 3OUSA 2OCCC 1J95A 3OR7C 5EBLC 3OGCC 3ZJZA 1S5HC 2IH1C 4QNHB 4G27B 3SYCA 4PA7A 1M56C 3X2QC 1LNQA 3K0DA 5B3SC 1M57C 3AG2C 4PA4A 2R9RB 3RVYA 2NLJC 4GX2A 2BOBC 2EIJC 2WLMA 3R65A 4X89A 4JTCB 3SPCA 2DYSC 4GX0A 3KG2A 3STLC 3FB7C 4PDVA 2ZD9A 3GB7C 4HYOA 3ASOC 2K1EA 3SPHA 4H33A 4MVMA 3SPIA 1R3IC 3K08A 4P9PA 2Q67A 2QKSA 4MVSA 2JK5C 4MTFA 4XDKA 4RAIA 4PA9A 2EILC 3SPJA 4P30A 4TWKA 3BEHA 3RBZA 4MTOA 5J9PC 1G4YB 3SYOA 3VOUA 1R3JC 5B1BC 5CBHA 1R3LC 5EBMC 4RO2A 2BOCC 4H37A 4X8AA 5IY5C 1V54C 3EFFK 4GX5A 3STZC 3TCUA 3UM7A 4MVOA 3SYQA 3LNMB 2WLNA 4UUJC 1OCRC 4MVZA 3K03A 2EIMC 4XDJA 3AG1C 4MW8A 2DYRC 3K0GA 2Q68A 2A0LA 1K4DC 2ITDC 1OCCC 4R7CA 2ATKC 2IH3C 3UKMA 2X6BA 3K06A 2WLIA 3SJQC 4MS2A 2HFEC 4PA3A 3T2MA 4P2ZA 4OXSA 3ABKC 3ZRSA 2WLJA 3IGAC 3F7VC 2KB1A 3FB5C 3LUTB 4R6ZA 4XDLA 1XL4A 2P7TC 3SPGA 5CBFA 3TETA 4LP8A 4PDRA 2WLLA 4PDMA 2HVKC 2ITCC 4QE7A 4P9OA 4HZ3A 5B1AC 1XL6A 1ORQC 4LBEC 4QE9A 4X88A 1P7BA 5KUMA 5EC2C 2A79B 5EBWC 3RW0A 2QTOA 1V55C 3ABLC 4MVUA 4MW3A 1K4CC 4LCUC 3LDDA 2WLKA 1JVMA 4PDLA 4DXWA 4R8CA 3OR6C 3T4ZA 3FB6C 1QLEC 5KUKA 3LDCA 4F4LA 2HG5C 2HVJC 2HJFC 3IFXA 3LDEA 5EC1C 3T4DA 5BZBA 1KKDA 2Q6AA 2W0FC 1R3KC 4MSWC 3ABMC 4R50A 5EK0A 2X6AA 2H8PC 2YEVA 4WFEA 2DWDC 3E8GA 4I9WA 4JTAB 3OUFA 2WLIB 3ASNC 4JTDB 3T1CA 2Y69C 5E1AC 4KFMA 4J9ZB 3JYCA 4MVRA 2WLHA 3F7YC 3E8HA 4RUFA 3SYAA 3PJSK 4RUEA 2AHZA 4GX1A 4G28B 4ZBMA 1OCOC 4EKWA 3WG7C 1OCZC 2WLLB 3RVZA 4CBCA 3E89A 4MVQA 4WFHA 2Q69A 4PA6A 1ZWIC 3AG4C 3F5WC 2ZXWC 3FB8C 3SYPA 1BL8A 3E8BA 3E8FA 3E86A 2X6CA 2EINC 2EIKC 2DWEC 4WFGA 3E83A
chains in the Genus database with same CATH superfamily
3OT7A 3X2QB 4I5SA 3KZIZ 2EIJB 4GKJO 4ZI7A 3CPWU 1NR7A 1YHQV 2UXBO 1S5HC 1HNWB 4YXWG 3E22A 4PA4A 4WCEV 3G67A 2CUGA 1VP7A 3HKEB 1NT2B 3OFNG 2GTSA 1BSMA 4B7EA 3M8AA 3CP1A 4UV9A 2KSDA 2P90A 2FTKA 4TWKA 2CTRA 4FVMA 1S5JA 3VOUA 4RQEA 3FAVA 5B3SB 5JQGA 5EBMC 3TXSA 1AVMA 5JJJB 1Q82W 2Z3YA 2UUAB 1QLNA 2AGAA 4FM2A 1JA8A 3D3QA 2XAHA 2A0LA 4JZ2A 3QTCA 1R1BA 1HNZB 3SJQC 3D36C 1VQPV 1AP6A 4TV9A 3F7VC 3OEEG 1NTZH 2BE3A 4PDMA 3ZHRA 2EX3A 2ZDIC 2P6JA 4GZRB 1P7BA 1YIJV 2EZOA 3M7MX 4MVUA 2FL4A 1WLEA 4J7ZA 1S72V 3ABKB 5LXTB 3JALA 1FXVA 1SKVA 1NVPB 3LDCA 5JCOA 1GH6A 4LF9O 4DV4B 3K9SA 2H3OA 3HKCB 1YSCA 5J2UB 3CJHB 5IYBO 2CTPA 1IBMO 4OX9B 2ZIMA 1CEZA 1SF9A 1OCZC 3E89A 4LWSB 3F5WC 4FK5C 2CAZC 3JD2A 3K9AA 3HPLC 2QKAA 1J95A 1I0HA 4J80A 4LF8O 3ZN0A 5KX5B 3K59A 1QCEA 5E79Z 5FNVB 4LH6A 4J42A 3NR7A 2E74B 4P30A 5KA5A 2RJZA 3RYIB 4DV1B 2HHHB 1B06A 2V7QG 5LHIA 4X8AA 1YJNV 3EFFK 2UUBB 2PGGA 1ZLZA 5LGNA 5CN0A 4LF6O 5DM6V 1OCRC 5K1PA 2GUZA 1JJ2U 2XAJA 2X0LA 4UCTA 2X6BA 1MZFA 5CB4A 3L71H 1K5QA 1HNWO 1D5AA 3IGAC 1QU7A 4CH5A 3K5MA 4DUZB 4IYHA 1SZTA 5LA6A 1ZSPA 2LJ2A 1JFFB 4JYAB 3CSXA 4MTXA 5L3EA 1JVMA 5IT9N 1QLEC 1SS3A 3AG7A 4F4LA 3CMAV 3P32A 1KMIZ 3UT5A 2LP7A 1W0KG 5DEDA 1TVKA 2UUAO 4BIOA 1NKDA 3T1CA 1IZ3A 1MSWD 4AI8A 1WN7A 1AR4A 4RUEA 2PTMA 1HNZO 2CE4A 2V4DA 4OPAA 1SQQH 4MVQA 2ZXWC 4N23A 4C7UA 1KQSU 3ETEA 4QIWF 4NKGB 5B66Z 1IXMA 3RFRA 3A8TA 2WA3A 3SDLA 2A7WA 1COWG 1HWYA 4FLTA 5JWPA 3X2QC 3CCJV 2DOSA 2EIJC 4X64B 2ILMA 3STLC 3U0ZA 3ASOC 5J2TB 2A06H 3CRRA 2Q67A 1NH2B 1B04A 4LNUB 4PA9A 4K3AA 2EZPA 3OW2U 1RPOA 4X1KA 1A32A 4OX9O 2XT9A 1JJOA 3K03A 3RGBA 1K4DC 1OCCC 3EHBB 2YIBD 2QSAA 2PZSA 1H2GA 3ICXA 2OYQA 3SR2C 2Q5ZA 4JI1B 1MZEA 1ZL8A 4QE7A 2HLDG 2V1DA 5KUMA 1YVWA 4DR6B 3LDDA 1KD1W 4DXWA 4DV1O 2HHHO 2QWQB 4O4IA 1Q6UA 2UUBO 5EC1C 3RN4A 5BZBA 1AJNA 4R50A 5GTIZ 5EYPA 4IIJB 4TUYA 1SQBH 3HKDA 4ABMA 2CDYA 4K0KB 3CRQA 5EIBC 5GONA 4D7SA 2WLLB 3AK3A 2IBZH 1YCIA 3KKYA 4KUMA 3CRCA 1B6QA 3K04A 4DUZO 1DGSA 4ZOLB 2ODMA 4J7KA 3ZS8C 4X20A 4B3SB 4JYAO 5CA1B 2P67A 4X89A 3R65A 3K5NA 3AK2A 2EIKB 4PELA 3S3WA 3IJ4A 5LOVB 1Y74B 2BTQA 2QKSA 2FKXA 3K5OA 4WBNB 3SYOA 3APQA 1OJHA 1GRJA 2QM8A 1BHAA 2YIAA 3HKBB 1HR0B 1IURA 3RYFB 1AP5A 1KECA 3FX7A 1Q3EA 3OMIB 1KYOF 2JIZG 3H1KH 4DV7B 3VQWA 3B4SA 3L9DA 2EBOA 1GN6A 3CD6V 2YI8A 3M99B 1XMQB 4JAAA 3RYHA 1GTOA 4YJ3B 1L1FA 4X64O 5LHHA 1YEWA 2Y0IA 1XL6A 2Y0PA 1SETA 5EC2C 2EULA 3CWBH 1AB3A 1LR1A 2BSKB 2C2AA 1N32B 1WP7A 3FB6C 3FKSG 1XHXA 4J10A 4G2KA 1R3KC 2R72A 5CA0B 4JV5B 1JPXA 1FXKA 1QR8A 4I9WA 3WG7B 4FIPC 5JVDB 5L3GA 3H1JH 3G6EV 4X1IB 1XI1A 1E1RG 1LUWA 1Z5WA 4LF5B 1IVSA 3ZHVA 4JI1O 3ZMTA 3K57A 2AHYA 5IJ0B 1N36B 1V9PA 3K79A 2Q9LA 1QVFU 5LXTA 3ZMVA 3OR7C 2ADQB 4DR6O 1OCZB 4LF7B 4DW1A 3WB1A 4JTCB 3OM3B 1AR5A 4LF4B 2ZD9A 1XOUA 1R3IC 2VRZA 3WU2Z 2L35A 1AILA 4MTFA 1XMOB 3QO5A 2ZR3A 3OE7G 1WPBA 4DR4B 4MTOA 1VQKV 3N2GA 2LQTA 2LFSA 4KXRA 4YHHB 4LWSA 2KG7B 4K0KO 1YI2V 1WA8B 3LNMB 2WSSG 3AG1C 3DXRB 1Z2GA 2Q68A 3D3IA 2XAFA 5ITZB 2HFEC 4P2ZA 3BPZA 5LP6C 1U96A 1E79G 2D2CB 3ZHQA 3W7WA 4B3SO 2Y4UA 3GWKC 1SA0B 3H1HH 1V55B 1S5LZ 1OCRB 2AXTZ 3WB0A 2GSMB 4JI3B 4LBEC 4QE9A 4O2AB 1WAZA 3RYIA 3G6BA 2WLKA 1JOYA 3T4ZA 4DV5B 1SQVH 4CH6A 1GM8A 1HR0O 4X1YA 5EIBD 1VEWA 4IYIA 2JVDA 3W7TA 3BRCA 2HP8A 1R6TA 4DV7O 2WLHA 2R70A 3E8HA 4FLWA 5HFMA 2UU9B 1H8HG 1QLEB 2JGDB 1XMQO 4DR5B 4BAYA 3HR0A 5H6QA 1Y67A 5FPRA 3BVOA 3ZMZA 3ZBHA 1WP8A 4WFGA 4RQFA 1L0LH 3RT3C 4MTGA 1TAEA 2D3OW 2OIGA 3ZRXA 1K5SA 4O4LB 1HW7A 3JSLA 3OTOB 1O9HA 4YJ2B 2ZXWB 1N32O 1JX9A 3FB7C 4QGPA 1KUQA 1RPRA 3CC7V 5IY5B 2UXXA 4JV5O 3R66A 3ZHTA 1G4YB 4I50B 4PD4F 3TK1A 2ZIOA 4NR1A 2CH7B 1KP2A 3ASOB 4DK0A 1M4UA 3N2KA 4NTYA 4LF5O 2MW2B 2DYRC 4EB6B 1FFXA 1TUBB 1N36O 2JDIG 2GV9A 5K1XA 4UVAA 3FB5C 3SPGA 5J2TA 4TSFG 4K8ZA 4LF7O 1Y76B 1K73W 1BGYH 1FS0G 4LF4O 4HNAB 1Q7YW 1OCCB 2YI9A 4U3JA 4I4TB 1XMOO 3DC6A 1SRYA 5IYZB 4DR4O 1PV0A 4JPRA 4YHHO 3J80N 3QF7A 1MOFA 3LDEA 3ZHSA 5LMUB 3IAYA 3ETDA 3E8GA 5IYCO 1Q6HA 2WLIB 2Y69C 2QWPB 5IJ9A 2RNBA 3WG7C 2ZE8A 4QPJA 3FB8C 4FLZA 4CS4A 4I9QA 4JI6B 4BWAA 2O57A 4JI3O 1M9NA 1D5NA 1EFRG 3H1LH 4TV8B 1VQNV 3I55V 3ML0A 3KG2A 4NB5A 4DV5O 1NH2D 4HYOA 2Z5UA 3SPIA 1YTFB 1Q5OA 3K08A 1QHTA 4RAIA 2YDEA 3BEHA 1VQ6V 1EBOA 3JAKB 4IHJB 4GX5A 2UU9O 3JAWB 4D7TA 3OEHG 3RYCA 4DR5O 4FMTA 4HBNA 2OTJV 2ETNA 4ZOLA 1J5EB 4DUYB 2ITDC 4PI0A 4X66B 2QA4V 4OXSA 3ZRSA 3OTOO 1XNQB 2KB1A 2XASA 4JGSA 5CBFA 2QEXV 3ABLB 1Y74A 4EFBA 2ITCC 5JH7A 5IWAB 4FLUA 3E2EA 4X88A 1FAFA 1VQLV 1IBLB 5BR8B 2HEPA 1V55C 4AILC 1DK1A 1DF4A 5BXZA 4DRXA 3CXHF 1VF6C 3ZMUA 3HKBA 3OR6C 3RYFA 5KUKA 1ZX3A 2B9ZA 1WPXA 3ZRWB 5KHGA 2CTWA 1VQMV 4O4JB 1XNRB 1AJQA 2YEVA 4B3RB 4WFEA 2YSUB 3CX5F 2QJ1A 1OHHG 3AG4B 4BR6A 3SYAA 3B09A 2P22C 1FKAO 1B3QA 3A0HZ 4AQYB 4YJ3A 3AG3B 4PA6A 1MMMA 3CRAA 4O4HA 1VQ5V 2ZNJA 4DV6B 3MHSC 5CBGA 2LFRA 2A9HA 2OCCC 1QNMA 3CYOA 2BSKA 1JR9A 3AEIA 1YITV 1FPOA 2B5UA 4TQDA 1I94B 2BOBC 2YIBA 1P7GA 1YJWV 1CP9A 1L0NH 1X59A 3H9VA 3L73H 5LMUO 3SPJA 1ZTEA 5JVDA 1XUQA 3OGIB 2W6JG 2QKCA 3LSUA 1I5XA 1ENVA 5IY5C 2EIMB 5LBQA 1SQFA 2LW1A 1EN5A 2LGWA 3JARA 3CXCU 3QO8A 4XDJA 3K0GA 4ZI7B 5IE9A 1VQ8V 4JI6O 4ZIBA 4X62B 3UKMA 3E22B 3L72H 4DV4O 2FB5A 5F2VO 4MS2A 4X65B 3LSSA 5LMNB 1EN4A 5B1AB 3ABTA 4PJ0Z 2PI4A 1CPYA 3AG1B 2JRIA 1T5EA 1Q8IA 5L3DA 2F66C 2P4KA 1PD3A 2QTOA 1RSOB 3F5TA 3FAVB 3RW0A 5JQGB 3ZCCA 1MABG 1NJIW 1US6A 4CS2A 5LP6B 1H2LA 2LW7A 3JCUZ 4L8JA 1QQCA 5HFLA 1K9MW 3CEIA 2ZINA 1WA8A 2N04A 2HG5C 1IBKB 3IFXA 3W7UA 1YF2A 4MSWC 3CCUV 3JATA 5EK0A 2ZR2A 2H8PC 1F23A 4UCRA 1RM1B 4UCUA 2P06A 1J5EO 4DUYO 1WJZA 3JYCA 4MVRA 2EJ7A 3G4SV 2ZT9B 4TV9B 4X66O 2QWRB 3ETQA 5L3FA 4DR2B 2YS8A 2Z0AA 1F51A 3E35A 2DJVA 4W4LA 4UVBA 1XNQO 3E86A 4O2AA 1N4CA 4BW5A 5IWAO 2PI5A 1IBLO 1NS1A 5BR8O 3JALB 3BY6A 1BE3H 3K0DA 1M57C 2YC0A 4UV8A 2NLJC 3CC4V 4GX2A 3CCLV 2Y48A 4X9QA 4GX0A 4UB8Z 4PDVA 3EVKA 3H01A 4IGGA 2YICA 1FFTB 2IU0A 4F6RA 1XNRO 3BHPA 4B3RO 2OCHA 2JGDA 4H37A 3Q4HB 1SZXA 2NN4A 3UCSC 5LYJA 1QR9A 3SYQA 4AQYO 1G8MA 1XQ8A 1VMGA 4I7ZB 1SQPH 3IC7A 5EZYA 4FLYA 4DV6O 1Y4MA 1SQXH 4O4LA 2YXHA 4B3MB 1WB7A 1KKCA 2M6YA 1K97A 1XL4A 4DR1B 3TETA 3BABA 4I0XB 3TXQA 2DYRB 1BQZA 4HZ3A 2IM9A 1FYJA 1Z5VA 5EBWC 1H2SB 3ABLC 3LNNA 4LCUC 1N8RW 2KQXA 1I08A 2YUAA 3ZN1A 2ADPA 2CH7A 3ETGA 1KU9A 3C3TA 3HKEA 2DW4A 1N34B 2GUZB 2DQ3A 4QJFB 3P3NA 1TUBA 3A2FA 3OUFA 1GN4A 1MSDA 5H5NA 5GTHZ 5CB4B 4J9ZB 2Q0AA 1UPGA 4X62O 2AHZA 2EINB 4ZBMA 1HNXB 2GHYA 4X65O 1Y76A 4B7KA 4WFHA 4NTWA 5LMNO 4UFZA 3AG4C 2VQEB 2Q7EA 5LA6B 4P9PA 5BMVB 1M56B 1SESA 4UCSA 3AG3C 2Y69B 3HB3B 1W0JG 1PNLA 4Z1MG 5IYZA 3CMEV 3JAMN 4PA7A 1BZKA 2IJKA 4CS3A 1WNSA 1TVKB 4MVMA 5KMGB 4YIOA 3ZEDA 1IBKO 1GMGA 4XBFA 4OGQB 3KCXA 2QM4A 5BY1A 1VF7A 1AI5A 3OD4A 3CS5A 5CBHA 4RO2A 2UUCB 3STZC 1AI4A 4DR2O 4MVOA 1Y6XA 2JJ1G 3B40A 4NTXA 4UXNA 2AZ0A 2EIMC 1H2KA 3CCEV 4CH4A 3VQXA 1PL4A 3HKCA 5J2UA 3CJHA 4PA3A 2ZNIA 4FM0A 1AI7A 1GN2A 3NXSA 1L8DA 5B1AC 5A2QN 4IL6Z 3OMNB 1R6NA 3CRMA 4X1KB 1S0VA 4EFEA 4I55B 2GDSA 2PYLA 1SC5B 1YZBA 2Q7GA 5KX5A 3DSQA 4ZKIA 2QR4A 5FNVA 5C93A 1NR1A 1IXBA 4N21A 1H2NA 1P49A 4K35A 4JF3A 4B3MO 1D2DA 1OCOC 4LFBB 1RM1C 5TISZ 3RVZA 4CBCA 3J81N 1ZWIC 2BCCH 1EM1A 4DR1O 1URFA 2F43G 2QTSA 1IX9A 3JD3A 3AG2B 1S76D 1SQGA 3CCSV 3T1HB 4JI5B 1Q90D 1S3JA 5KA6A 1M90W 2XAGA 3BCCH 3ZJZA 2UXCB 2IJHA 4G27B 3SYCA 3MDSA 5KAIZ 4O4IB 4JASA 4KHPB 1YTFD 3SPCA 1KB9F 4LFCB 1OZ0A 2QGNA 3UO3A 1DTOA 2K1EA 4JI7B 5EYPB 5JCOC 1N34O 5KAFZ 2OCCB 1W59A 1MG1A 3CCRV 3HKDB 5J9PC 1JFFA 2ZCEA 5GONB 5B1BC 1V54C 1HNXO 1JCHA 1K33A 4UUJC 5C8YB 2VQEO 3BA8A 3SJBC 5FL7G 1NI8A 4X20B 4HAMA 1KP3A 3K06A 4H0LB 2Q73A 1NTKH 2ZE7A 3N27A 2P4VA 1O9GA 3AK1A 4XDLA 3SJAC 4EEQA 3K58A 2AZ2A 4P9OA 2NNUA 2RDCA 3BFRA 3OAAG 5KHJA 1P4RA 3JD1A 2MK3A 2F93B 5H6RA 4R8CA 1VQ4V 1GM9A 4OPHA 1H38A 3FYIB 2WA4A 1K92A 2UUCO 5KHHA 2OIEA 1K8AW 2Y4TA 3JASB 2P5OA 1TGOA 3JD0A 4JTAB 3GWOA 2DMXA 1JMKC 1FXHA 4LNUA 4KFMA 4DV3B 1YJ9V 2AW9A 4UVCA 4RUFA 3W7XA 4G28B 3RYHB 1F4MA 5LL6Y 4DYLA 3TGUH 1M93A 4ASUG 2X6CA 2EINC 3OMAB 1RSOA 1ZUQA 1Q43A 5LP6A 5KHKA 5EBLC 1JQ0A 2CTQA 1K7DA 1Q86W 1M56C 3U10A 5GW7A 3ZMSA 4B3TB 1VIBA 1EZVH 3GB7C 3SPHA 1FXKB 2CGNA 1G1XB 5KHIA 4CH3A 4KL1A 2M7WA 2E5LB 3DC5A 2E3CA 4J7JA 3SGIA 4NVPA 1M57B 1R3LC 4FLVA 3FFQA 2OWOA 2HJDA 2YIDA 1EZJA 2VQFB 3UO2A 5L3BA 4LFBO 5H9CA 2WLNA 5FPOA 1VQOV 1BQ0A 1GKFA 4CC5A 4MW8A 4FM1A 5KLVH 4R7CA 2ATKC 2IH3C 2XHBA 3T1HO 4WFBV 4JI5O 4GUNA 4IIJA 2F4VB 2UXCO 3K3WA 2WWWA 4KHPO 1DF5A 2WLLA 4LFCO 4BIUA 4U7NA 2HVKC 3B8NA 1BS3A 4DV0B 1ORQC 4JI7O 4CC6A 3N2GB 2QE7G 2IW5A 4BW9A 4U7OA 4NXNB 3Q4HA 3ABMB 3G71V 1G6UA 2WAMA 5CA1A 1GAXA 1RP3B 4AHCA 3THOA 3T4DA 1FJGB 2W0FC 1H2MA 4ZHQB 5LOVA 3A0RA 2Q4PA 1F4NA 4JI2B 1GO3F 2HR3A 3F7YC 4FLXA 4WBNA 3O9OA 1VQ7V 1Q81W 2W6IG 4I0XA 2VS0A 4FFKA 2CGOA 1NBMG 3O65A 4CZZA 2JJ2G 1BT8A 3CCVV 4O2BB 3VQYA 2IH1C 4DV2B 5JJNB 1Q6IA 3FYEB 1YDXA 3AG2C 4WF9V 4DW0A 4X1YB 2EILB 4LC1A 4JI4B 4H33A 3I5DA 3KCYA 4PV1B 4XDKA 1NU1H 1XREA 2Q7HA 1BHBA 2XOKG 2XAQA 3QNEA 4DV3O 3D36A 4K8XA 3UQ8A 5IYDO 4DK1A 5BMVA 3LSQA 3L70H 2ZDIA 2N74A 5CA0A 1PM9A 2L6LA 2UXNA 2GTAA 2RQ6A 1MNGA 1GM7A 2WLJA 4QPKA 1M5IA 4DR7B 2XTAA 2DN9A 4FFBB 4B3TO 1P84F 4X1IA 4LP8A 5KMGA 2QWNB 3FD9A 4PHZA 3T1YB 3DGEA 4Z1VA 3JCZA 5IJ0A 1K4CC 5B5EZ 2E5LO 4ICGA 3B77A 4H44B 3N2KB 4GT1A 4UB6Z 2VQFO 3ASNB 2ZQMA 1KKDA 2F23A 5CMUA 3OTFA 1FFXB 1U97A 4YY3B 4FZ0A 4A5UB 3PJSK 1LUVA 1K3EA 4L87A 4TOIA 2F4VO 1VF5B 1XDCA 1GN3A 1BL8A 2KG7A 1H8EG 4J11A 4U3JB 1EN6A 4WFFA 4DV0O 3OUSA 4GLXA 3DXRA 3ZX6A 2DYSB 4I55A 2Q0OC 3CCMV 3CHXA 2FYUH 4QNHB 1OCOB 5B3SC 4NXNO 2R9RB 4BIZA 3D8CA 5ITZA 4GYCB 2UXDB 3B8MA 1S77D 4JAUA 3EXAA 1SA0A 1TUEB 3CE2A 2A3QA 5FLXN 2QDOA 1FJGO 4MVSA 1YXBA 3ABUA 2ZM6B 1FXKC 1VF6A 5IJ9B 5B1OA 1F7YA 4JI2O 1KC8W 5D5PA 4DR3B 4JI8B 1M1KW 4FZ1A 2XNDG 3BA9A 2VWKA 4F6EA 2IJIA 1ROPA 1CXZB 2XUMA 4Z2WA 4U3FH 2YXLA 3G80A 1MA1A 1XHZA 3P30A 5B1BB 1N0JA 1V54B 3ABKC 3APOA 4NXMB 4DV2O 5JJEB 5LGTA 4R6ZA 3H1IH 4Q6GA 2IU3A 2E75B 4W4KA 1PPJH 3A0BZ 2PF4E 4JI4O 1I7FA 1AR1B 2A79B 1FD9A 2PY5A 4YIPA 5LHGA 2LO1A 4NYKA 2WPDG 1HDJA 1NTMH 4PDLA 2X7RB 4JI0B 3RYCB 2N05A 3SJCC 4YJ2A 5C8YA 3C90A 1WB8A 3ABMC 3JSNA 1PNKA 1I94O 4GKKB 1TA8A 4JTDB 2OT5A 5A9GA 1BMFG 4I50A 4EKWA 2B1IA 4UCOA 5JH7B 4DR7O 2G38A 3E8BA 3QVNA 3QG5A 3CC2V 2DWEC 3E83A 4J41A 2DQ0A 4DRXB 3T1YO 4JYYA 3OGCC 3K5LA 4EB6A 1AROP 2JEXA 2R9IA 1LNQA 2ARHA 2F95B 2B1GA 2RN9A 1KBHA 2W0XA 4LR3A 2YEVB 3JASA 1XBLA 3L75H 2PUSA 1AJPA 2Q8VA 1UJWB 2QM7A 2EILC 4HNAA 1UFIA 4YY3O 1OV9A 2JS5A 4I4TA 1N33B 1XEQA 1XILA 4JYCA 4O4HB 3TCUA 3S3XA 1ZAUA 4GCZA 2RCVA 2R9AA 1NZ6A 2JEUA 4MVZA 3UT5B 1VQ9V 4LFAB 1SERA 5H2FZ 2WLIA 2JGUA 3MHHC 3J7AU 4DO2A 2E76B 1AI6A 3VQVA 3LUTB 5L3CA 2P7TC 3PN1A 2VWJA 2BTOA 3P3PA 2UXDO 3QO7A 4GKJB 1N0NA 3I56V 2UXBB 3DTUB 2ZM6O 3WB2A 2RMKB 2ZE6A 3C3SA 1NQTA 3L74H 3JARB 5DN6G 4DR3O 4JI8O 1W2BU 2IJJA 1Y66A 4TV8A 3ZRVA 4E2LA 4E4EA 3WFVA 2X6AA 2CK3G 3ASNC 5E1AC 4WFAV 1IDSA 2ZKOA 3MAQA 2JS3A 3B2EE 2QWOB 4D6TH 3U11A 3W7SA 3JAKA 4IHJA 4NXMO 5IDJA 3E8FA 2K9PA 3JAWA 4H13B 4J9YB 1R73A 1PKXA 2FMLA 2NR5A 5AG2A 5DECA 4FJCC 1PNMA 3RVYA 4PI2A 4LH7A 4UCVA 2WLMA 2DYSC 4JI0O 2GBOA 3JATB 1THZA 1K34A 4ZHQA 1ZL8B 3JD4A 4Q20A 1I5YA 2JK5C 3RBZA 1QBZA 4GKKO 1R3JC 2BOCC 4KP4A 1E1QG 4TQFA 4LF9B 3UM7A 2ZE5A 2F1MA 2LGQA 3CB2A 3ZRWA 4JZGA 4RWUA 4JYBA 1NVPD 2PYJA 1X4TA 2EJRA 4O2BA 4O4JA 1IBMB 4MT8A 3GVMA 1DLBA 5B1NA 1QVGU 4TUYB 3T2MA 1VARA 5LGUA 2YXYA 2DE0X 5CA3A 2OTLV 4JAVA 4PDRA 3BAAA 1GK9A 1PL0A 4F6RB 5D5QA 3ZIAG 1R6KA 4MW3A 4LF8B 5LYJB 4B08A 1N33O 2HVJC 3RWRD 2HJFC 5EZYB 2H94A 2Q6AA 4IT5A 3VBBA 3CCQV 1PP9H 2DWDC 1BCCH 1HP8A 2BTQB 4TT3G 4LFAO 3IC9A 4GX1A 4FPPA 4FFBA 3TJTA 1RFYA 4LF6B 2Q69A 3ZHUA 3SYPA 2HKOA 2KKWA 3MD0A 2EIKC
chains in the Genus database with same CATH topology
4CZZA 3X2QB 2AHYA 4I5SA 4BW5A 2JJ2G 3K79A 1QVFU 2EIJB 2PI5A 3CCVV 3ZMVA 3OR7C 3CPWU 1NR7A 1YHQV 1S5HC 2IH1C 4YXWG 3BY6A 3FYEB 3K0DA 1OCZB 1M57C 3AG2C 4PA4A 4UV8A 4WCEV 4WF9V 2NLJC 3CC4V 4GX2A 3CCLV 2Y48A 4JTCB 3OFNG 3OM3B 2EILB 4GX0A 4LC1A 4PDVA 2ZD9A 4H33A 3H01A 1R3IC 1FFTB 3CP1A 4MTFA 2IU0A 3QO5A 4XDKA 2ZR3A 4UV9A 2P90A 3OE7G 2FTKA 4TWKA 4MTOA 1VQKV 3VOUA 2XOKG 4RQEA 5B3SB 2XAQA 2LFSA 5EBMC 1BHBA 4H37A 3QNEA 3D36A 1QR9A 3SYQA 5IYDO 1G8MA 1YI2V 1Q82W 3LNMB 2Z3YA 1QLNA 3LSQA 2WSSG 3IC7A 3AG1C 2ZDIA 2Q68A 1Y4MA 2XAHA 2A0LA 3D3IA 2UXNA 2XAFA 3SJQC 2HFEC 4P2ZA 1VQPV 1E79G 2WLJA 1GM7A 4QPKA 3W7WA 1K97A 3F7VC 3OEEG 1XL4A 3TETA 4LP8A 1V55B 4PDMA 1OCRB 2GSMB 2DYRB 4HZ3A 2ZDIC 2P6JA 3DGEA 4LBEC 4QE9A 1P7BA 1YIJV 2EZOA 5EBWC 3JCZA 3ABLC 4MVUA 1K4CC 1WLEA 4LCUC 1S72V 1N8RW 3ABKB 2WLKA 1JOYA 3ZN1A 1FXVA 3T4ZA 3B77A 3ETGA 1NVPB 3LDCA 4GT1A 1GM8A 2ZQMA 2DW4A 3ASNB 1KKDA 2DQ3A 5CMUA 4QJFB 3W7TA 3OUFA 1YSCA 5IYBO 4J9ZB 2WLHA 3E8HA 3PJSK 2AHZA 5HFMA 1K3EA 2EINB 4ZBMA 1H8HG 1QLEB 1CEZA 2GHYA 4L87A 1OCZC 3E89A 4WFHA 5H6QA 4BAYA 3AG4C 3F5WC 3ZMZA 1BL8A 4FK5C 4P9PA 1H8EG 3JD2A 4WFGA 1M56B 4RQFA 3K9AA 1SESA 3HPLC 4MTGA 4WFFA 3AG3C 2Y69B 3HB3B 3OUSA 2D3OW 3ZRXA 2DYSB 1W0JG 1K5SA 1PNLA 1J95A 4Z1MG 3CCMV 3CMEV 4QNHB 4PA7A 1OCOB 5B3SC 2R9RB 3ZN0A 4BIZA 2IJKA 2ZXWB 1QCEA 1JX9A 3B8MA 3FB7C 1S77D 4JAUA 4MVMA 1TUEB 1RPRA 1GMGA 3CC7V 4XBFA 4MVSA 5IY5B 2UXXA 3ABUA 4P30A 5KA5A 1FXKC 1AI5A 1G4YB 5B1OA 5CBHA 4RO2A 2V7QG 5LHIA 4X8AA 1YJNV 1KC8W 3EFFK 1M1KW 2XNDG 3STZC 3TK1A 5LGNA 1AI4A 5CN0A 1KP2A 3ASOB 4MVOA 2IJIA 1ROPA 2JJ1G 5DM6V 1OCRC 4UXNA 2EIMC 1JJ2U 2DYRC 3CCEV 2XAJA 2X0LA 3P30A 5B1BB 2X6BA 1V54B 2JDIG 4PA3A 3ABKC 1K5QA 3IGAC 5LGTA 4UVAA 3FB5C 4R6ZA 3SPGA 4TSFG 1K73W 1AI7A 2IU3A 1FS0G 3NXSA 1SZTA 5B1AC 1AR1B 1Q7YW 1OCCB 2A79B 3OMNB 5LHGA 1R6NA 4MTXA 5L3EA 1S0VA 2WPDG 1SRYA 1JVMA 4PDLA 2X7RB 4JPRA 1QLEC 4F4LA 3CMAV 1MOFA 3LDEA 3P32A 4ZKIA 5C93A 3ABMC 2LP7A 1NR1A 1W0KG 1PNKA 4N21A 3ETDA 3E8GA 1NKDA 2WLIB 5IYCO 3T1CA 4JTDB 2Y69C 1MSWD 2OT5A 4RUEA 4JF3A 1BMFG 1OCOC 4EKWA 3WG7C 1RM1C 3RVZA 4CBCA 4MVQA 1ZWIC 2B1IA 4QPJA 2ZXWC 3FB8C 4N23A 3E8BA 3ETEA 1KQSU 4QIWF 3CC2V 2F43G 3JD3A 2DWEC 3E83A 1IXMA 3AG2B 1S76D 2DQ0A 3CCSV 1S3JA 5KA6A 1COWG 1HWYA 1M90W 2XAGA 3ZJZA 3OGCC 2IJHA 1M9NA 4G27B 1AROP 2JEXA 1EFRG 2R9IA 3SYCA 3X2QC 1LNQA 4JASA 3CCJV 1YTFD 1VQNV 2EIJC 3SPCA 2B1GA 3ML0A 3I55V 3KG2A 3STLC 1OZ0A 1NH2D 1DTOA 4HYOA 3ASOC 2K1EA 2Z5UA 3SPIA 1YTFB 2YEVB 3K08A 2Q67A 1NH2B 1AJPA 2OCCB 1UJWB 1MG1A 2QM7A 4RAIA 4PA9A 2EILC 3CCRV 2EZPA 3BEHA 1VQ6V 5J9PC 5B1BC 1RPOA 3OW2U 1EBOA 1V54C 4GX5A 4JYCA 3TCUA 4GCZA 1JCHA 3OEHG 1K33A 4FMTA 2OTJV 4UUJC 2JEUA 4MVZA 3K03A 1VQ9V 1SERA 1K4DC 2ITDC 5FL7G 1OCCC 3EHBB 4HAMA 1KP3A 3K06A 2WLIA 3MHHC 2QA4V 1H2GA 4DO2A 4OXSA 3ZRSA 1AI6A 2KB1A 3LUTB 2XASA 4JGSA 4XDLA 5CBFA 2P7TC 5L3CA 2QEXV 3ABLB 2ITCC 4QE7A 3QO7A 4P9OA 3E2EA 2HLDG 2V1DA 2NNUA 4X88A 5KUMA 3OAAG 3I56V 1VQLV 1P4RA 3JD1A 1V55C 3DTUB 2MK3A 1DF4A 3LDDA 1KD1W 5H6RA 4DXWA 3ZMUA 4R8CA 3OR6C 1NQTA 1VQ4V 1GM9A 1H38A 5DN6G 5KUKA 3FYIB 1WPXA 1K92A 2IJJA 1Y66A 1W2BU 3ZRWB 5EC1C 5BZBA 1AJNA 1K8AW 4R50A 3ZRVA 4E2LA 1VQMV 1AJQA 3WFVA 2X6AA 2YEVA 4WFEA 3JD0A 4JTAB 2YSUB 2CK3G 3GWOA 3ASNC 1OHHG 5E1AC 1FXHA 4WFAV 4KFMA 3AG4B 1YJ9V 4UVCA 4RUFA 3SYAA 3W7XA 4G28B 1F4MA 3W7SA 2WLLB 3AG3B 4PA6A 5IDJA 4ASUG 1VQ5V 3E8FA 4KUMA 2X6CA 2EINC 3MHSC 5CBGA 2LFRA 1B6QA 3K04A 3OMAB 2A9HA 4J9YB 1R73A 2OCCC 3CYOA 1PKXA 3AEIA 1YITV 5EBLC 1JQ0A 4FJCC 1K7DA 1Q86W 1M56C 1PNMA 5GW7A 2B5UA 3ZMSA 2P67A 3RVYA 4X89A 2BOBC 2WLMA 3R65A 2DYSC 3GB7C 1YJWV 2EIKB 4PELA 1FXKB 1CP9A 3SPHA 1THZA 1K34A 3JD4A 4Q20A 2QKSA 1I5YA 2M7WA 2JK5C 3SPJA 3RBZA 1QBZA 2W6JG 3SYOA 1R3JC 1M57B 1R3LC 1I5XA 2BOCC 4KP4A 1E1QG 2QM8A 1ENVA 5IY5C 1EZJA 2EIMB 5LBQA 1BHAA 3UM7A 5L3BA 1KECA 5H9CA 2WLNA 3CXCU 3QO8A 3OMIB 1VQOV 3ZRWA 1GKFA 4JYBA 4XDJA 2JIZG 4MW8A 3K0GA 1NVPD 2EJRA 1VQ8V 4MT8A 2EBOA 4R7CA 2ATKC 2IH3C 3CD6V 3UKMA 1DLBA 3M99B 4WFBV 5B1NA 1QVGU 4MS2A 3T2MA 3LSSA 5LGUA 5B1AB 3K3WA 5CA3A 2WWWA 1GTOA 2OTLV 3ABTA 4JAVA 1L1FA 4PDRA 1DF5A 2WLLA 1GK9A 1CPYA 4U7NA 4BIUA 2PI4A 2HVKC 1PL0A 3B8NA 3AG1B 5LHHA 3ZIAG 5L3DA 1XL6A 1ORQC 1R6KA 1SETA 5EC2C 3RW0A 1PD3A 2QTOA 1NJIW 2QE7G 3ZCCA 1MABG 2IW5A 4MW3A 4U7OA 2C2AA 3ABMB 5HFLA 3G71V 3FB6C 1K9MW 3FKSG 2WAMA 2HG5C 2HVJC 2HJFC 3IFXA 4G2KA 3W7UA 3T4DA 2H94A 2Q6AA 2W0FC 1R3KC 4MSWC 3VBBA 3CCUV 1JPXA 5EK0A 2ZR2A 1FXKA 3CCQV 2H8PC 1QR8A 1F23A 2DWDC 4I9WA 3WG7B 1RM1B 4TT3G 3A0RA 1F4NA 1GO3F 3JYCA 2HR3A 3F7YC 4FIPC 4MVRA 5L3GA 3G4SV 4GX1A 4FPPA 5L3FA 3G6EV 1VQ7V 1Q81W 1E1RG 1F51A 2W6IG 3E35A 4UVBA 2Q69A 3SYPA 2HKOA 3E86A 3MD0A 2EIKC 3ZMTA 1NBMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBG A;  3K04 A;  2AHY A;  3HPL C;  4MTG A;  2A9H A;  4J9Y B;  4WFF A;  4BW5 A;  3AG3 C;  3OUS A;  2OCC C;  1J95 A;  3OR7 C;  5EBL C;  3OGC C;  3ZJZ A;  1S5H C;  2IH1 C;  4QNH B;  4G27 B;  3SYC A;  4PA7 A;  1M56 C;  3X2Q C;  1LNQ A;  3K0D A;  5B3S C;  1M57 C;  3AG2 C;  4PA4 A;  2R9R B;  3RVY A;  2NLJ C;  4GX2 A;  2BOB C;  2EIJ C;  2WLM A;  3R65 A;  4X89 A;  4JTC B;  3SPC A;  2DYS C;  4GX0 A;  3KG2 A;  3STL C;  3FB7 C;  4PDV A;  2ZD9 A;  3GB7 C;  4HYO A;  3ASO C;  2K1E A;  3SPH A;  4H33 A;  4MVM A;  3SPI A;  1R3I C;  3K08 A;  4P9P A;  2Q67 A;  2QKS A;  4MVS A;  2JK5 C;  4MTF A;  4XDK A;  4RAI A;  4PA9 A;  2EIL C;  3SPJ A;  4P30 A;  4TWK A;  3BEH A;  3RBZ A;  4MTO A;  5J9P C;  1G4Y B;  3SYO A;  3VOU A;  1R3J C;  5B1B C;  5CBH A;  1R3L C;  5EBM C;  4RO2 A;  2BOC C;  4H37 A;  4X8A A;  5IY5 C;  1V54 C;  3EFF K;  4GX5 A;  3STZ C;  3TCU A;  3UM7 A;  4MVO A;  3SYQ A;  3LNM B;  2WLN A;  4UUJ C;  1OCR C;  4MVZ A;  3K03 A;  2EIM C;  4XDJ A;  3AG1 C;  4MW8 A;  2DYR C;  3K0G A;  2Q68 A;  2A0L A;  1K4D C;  2ITD C;  1OCC C;  4R7C A;  2ATK C;  2IH3 C;  3UKM A;  2X6B A;  3K06 A;  2WLI A;  3SJQ C;  4MS2 A;  2HFE C;  4PA3 A;  3T2M A;  4P2Z A;  4OXS A;  3ABK C;  3ZRS A;  2WLJ A;  3IGA C;  3F7V C;  2KB1 A;  3FB5 C;  3LUT B;  4R6Z A;  4XDL A;  1XL4 A;  2P7T C;  3SPG A;  5CBF A;  3TET A;  4LP8 A;  4PDR A;  2WLL A;  4PDM A;  2HVK C;  2ITC C;  4QE7 A;  4P9O A;  4HZ3 A;  5B1A C;  1XL6 A;  1ORQ C;  4LBE C;  4QE9 A;  4X88 A;  1P7B A;  5KUM A;  5EC2 C;  2A79 B;  5EBW C;  3RW0 A;  2QTO A;  1V55 C;  3ABL C;  4MVU A;  4MW3 A;  1K4C C;  4LCU C;  3LDD A;  2WLK A;  1JVM A;  4PDL A;  4DXW A;  4R8C A;  3OR6 C;  3T4Z A;  3FB6 C;  1QLE C;  5KUK A;  3LDC A;  4F4L A;  2HG5 C;  2HVJ C;  2HJF C;  3IFX A;  3LDE A;  5EC1 C;  3T4D A;  5BZB A;  1KKD A;  2Q6A A;  2W0F C;  1R3K C;  4MSW C;  3ABM C;  4R50 A;  5EK0 A;  2X6A A;  2H8P C;  2YEV A;  4WFE A;  2DWD C;  3E8G A;  4I9W A;  4JTA B;  3OUF A;  2WLI B;  3ASN C;  4JTD B;  3T1C A;  2Y69 C;  5E1A C;  4KFM A;  4J9Z B;  3JYC A;  4MVR A;  2WLH A;  3F7Y C;  3E8H A;  4RUF A;  3SYA A;  3PJS K;  4RUE A;  2AHZ A;  4GX1 A;  4G28 B;  4ZBM A;  1OCO C;  4EKW A;  3WG7 C;  1OCZ C;  2WLL B;  3RVZ A;  4CBC A;  3E89 A;  4MVQ A;  4WFH A;  2Q69 A;  4PA6 A;  1ZWI C;  3AG4 C;  3F5W C;  2ZXW C;  3FB8 C;  3SYP A;  1BL8 A;  3E8B A;  3E8F A;  3E86 A;  2X6C A;  2EIN C;  2EIK C;  2DWE C;  4WFG A;  3E83 A; 
#chains in the Genus database with same CATH topology
 3OT7 A;  3X2Q B;  4I5S A;  3KZI Z;  2EIJ B;  4GKJ O;  4ZI7 A;  3CPW U;  1NR7 A;  1YHQ V;  2UXB O;  1S5H C;  1HNW B;  4YXW G;  3E22 A;  4PA4 A;  4WCE V;  3G67 A;  2CUG A;  1VP7 A;  3HKE B;  1NT2 B;  3OFN G;  2GTS A;  1BSM A;  4B7E A;  3M8A A;  3CP1 A;  4UV9 A;  2KSD A;  2P90 A;  2FTK A;  4TWK A;  2CTR A;  4FVM A;  1S5J A;  3VOU A;  4RQE A;  3FAV A;  5B3S B;  5JQG A;  5EBM C;  3TXS A;  1AVM A;  5JJJ B;  1Q82 W;  2Z3Y A;  2UUA B;  1QLN A;  2AGA A;  4FM2 A;  1JA8 A;  3D3Q A;  2XAH A;  2A0L A;  4JZ2 A;  3QTC A;  1R1B A;  1HNZ B;  3SJQ C;  3D36 C;  1VQP V;  1AP6 A;  4TV9 A;  3F7V C;  3OEE G;  1NTZ H;  2BE3 A;  4PDM A;  3ZHR A;  2EX3 A;  2ZDI C;  2P6J A;  4GZR B;  1P7B A;  1YIJ V;  2EZO A;  3M7M X;  4MVU A;  2FL4 A;  1WLE A;  4J7Z A;  1S72 V;  3ABK B;  5LXT B;  3JAL A;  1FXV A;  1SKV A;  1NVP B;  3LDC A;  5JCO A;  1GH6 A;  4LF9 O;  4DV4 B;  3K9S A;  2H3O A;  3HKC B;  1YSC A;  5J2U B;  3CJH B;  5IYB O;  2CTP A;  1IBM O;  4OX9 B;  2ZIM A;  1CEZ A;  1SF9 A;  1OCZ C;  3E89 A;  4LWS B;  3F5W C;  4FK5 C;  2CAZ C;  3JD2 A;  3K9A A;  3HPL C;  2QKA A;  1J95 A;  1I0H A;  4J80 A;  4LF8 O;  3ZN0 A;  5KX5 B;  3K59 A;  1QCE A;  5E79 Z;  5FNV B;  4LH6 A;  4J42 A;  3NR7 A;  2E74 B;  4P30 A;  5KA5 A;  2RJZ A;  3RYI B;  4DV1 B;  2HHH B;  1B06 A;  2V7Q G;  5LHI A;  4X8A A;  1YJN V;  3EFF K;  2UUB B;  2PGG A;  1ZLZ A;  5LGN A;  5CN0 A;  4LF6 O;  5DM6 V;  1OCR C;  5K1P A;  2GUZ A;  1JJ2 U;  2XAJ A;  2X0L A;  4UCT A;  2X6B A;  1MZF A;  5CB4 A;  3L71 H;  1K5Q A;  1HNW O;  1D5A A;  3IGA C;  1QU7 A;  4CH5 A;  3K5M A;  4DUZ B;  4IYH A;  1SZT A;  5LA6 A;  1ZSP A;  2LJ2 A;  1JFF B;  4JYA B;  3CSX A;  4MTX A;  5L3E A;  1JVM A;  5IT9 N;  1QLE C;  1SS3 A;  3AG7 A;  4F4L A;  3CMA V;  3P32 A;  1KMI Z;  3UT5 A;  2LP7 A;  1W0K G;  5DED A;  1TVK A;  2UUA O;  4BIO A;  1NKD A;  3T1C A;  1IZ3 A;  1MSW D;  4AI8 A;  1WN7 A;  1AR4 A;  4RUE A;  2PTM A;  1HNZ O;  2CE4 A;  2V4D A;  4OPA A;  1SQQ H;  4MVQ A;  2ZXW C;  4N23 A;  4C7U A;  1KQS U;  3ETE A;  4QIW F;  4NKG B;  5B66 Z;  1IXM A;  3RFR A;  3A8T A;  2WA3 A;  3SDL A;  2A7W A;  1COW G;  1HWY A;  4FLT A;  5JWP A;  3X2Q C;  3CCJ V;  2DOS A;  2EIJ C;  4X64 B;  2ILM A;  3STL C;  3U0Z A;  3ASO C;  5J2T B;  2A06 H;  3CRR A;  2Q67 A;  1NH2 B;  1B04 A;  4LNU B;  4PA9 A;  4K3A A;  2EZP A;  3OW2 U;  1RPO A;  4X1K A;  1A32 A;  4OX9 O;  2XT9 A;  1JJO A;  3K03 A;  3RGB A;  1K4D C;  1OCC C;  3EHB B;  2YIB D;  2QSA A;  2PZS A;  1H2G A;  3ICX A;  2OYQ A;  3SR2 C;  2Q5Z A;  4JI1 B;  1MZE A;  1ZL8 A;  4QE7 A;  2HLD G;  2V1D A;  5KUM A;  1YVW A;  4DR6 B;  3LDD A;  1KD1 W;  4DXW A;  4DV1 O;  2HHH O;  2QWQ B;  4O4I A;  1Q6U A;  2UUB O;  5EC1 C;  3RN4 A;  5BZB A;  1AJN A;  4R50 A;  5GTI Z;  5EYP A;  4IIJ B;  4TUY A;  1SQB H;  3HKD A;  4ABM A;  2CDY A;  4K0K B;  3CRQ A;  5EIB C;  5GON A;  4D7S A;  2WLL B;  3AK3 A;  2IBZ H;  1YCI A;  3KKY A;  4KUM A;  3CRC A;  1B6Q A;  3K04 A;  4DUZ O;  1DGS A;  4ZOL B;  2ODM A;  4J7K A;  3ZS8 C;  4X20 A;  4B3S B;  4JYA O;  5CA1 B;  2P67 A;  4X89 A;  3R65 A;  3K5N A;  3AK2 A;  2EIK B;  4PEL A;  3S3W A;  3IJ4 A;  5LOV B;  1Y74 B;  2BTQ A;  2QKS A;  2FKX A;  3K5O A;  4WBN B;  3SYO A;  3APQ A;  1OJH A;  1GRJ A;  2QM8 A;  1BHA A;  2YIA A;  3HKB B;  1HR0 B;  1IUR A;  3RYF B;  1AP5 A;  1KEC A;  3FX7 A;  1Q3E A;  3OMI B;  1KYO F;  2JIZ G;  3H1K H;  4DV7 B;  3VQW A;  3B4S A;  3L9D A;  2EBO A;  1GN6 A;  3CD6 V;  2YI8 A;  3M99 B;  1XMQ B;  4JAA A;  3RYH A;  1GTO A;  4YJ3 B;  1L1F A;  4X64 O;  5LHH A;  1YEW A;  2Y0I A;  1XL6 A;  2Y0P A;  1SET A;  5EC2 C;  2EUL A;  3CWB H;  1AB3 A;  1LR1 A;  2BSK B;  2C2A A;  1N32 B;  1WP7 A;  3FB6 C;  3FKS G;  1XHX A;  4J10 A;  4G2K A;  1R3K C;  2R72 A;  5CA0 B;  4JV5 B;  1JPX A;  1FXK A;  1QR8 A;  4I9W A;  3WG7 B;  4FIP C;  5JVD B;  5L3G A;  3H1J H;  3G6E V;  4X1I B;  1XI1 A;  1E1R G;  1LUW A;  1Z5W A;  4LF5 B;  1IVS A;  3ZHV A;  4JI1 O;  3ZMT A;  3K57 A;  2AHY A;  5IJ0 B;  1N36 B;  1V9P A;  3K79 A;  2Q9L A;  1QVF U;  5LXT A;  3ZMV A;  3OR7 C;  2ADQ B;  4DR6 O;  1OCZ B;  4LF7 B;  4DW1 A;  3WB1 A;  4JTC B;  3OM3 B;  1AR5 A;  4LF4 B;  2ZD9 A;  1XOU A;  1R3I C;  2VRZ A;  3WU2 Z;  2L35 A;  1AIL A;  4MTF A;  1XMO B;  3QO5 A;  2ZR3 A;  3OE7 G;  1WPB A;  4DR4 B;  4MTO A;  1VQK V;  3N2G A;  2LQT A;  2LFS A;  4KXR A;  4YHH B;  4LWS A;  2KG7 B;  4K0K O;  1YI2 V;  1WA8 B;  3LNM B;  2WSS G;  3AG1 C;  3DXR B;  1Z2G A;  2Q68 A;  3D3I A;  2XAF A;  5ITZ B;  2HFE C;  4P2Z A;  3BPZ A;  5LP6 C;  1U96 A;  1E79 G;  2D2C B;  3ZHQ A;  3W7W A;  4B3S O;  2Y4U A;  3GWK C;  1SA0 B;  3H1H H;  1V55 B;  1S5L Z;  1OCR B;  2AXT Z;  3WB0 A;  2GSM B;  4JI3 B;  4LBE C;  4QE9 A;  4O2A B;  1WAZ A;  3RYI A;  3G6B A;  2WLK A;  1JOY A;  3T4Z A;  4DV5 B;  1SQV H;  4CH6 A;  1GM8 A;  1HR0 O;  4X1Y A;  5EIB D;  1VEW A;  4IYI A;  2JVD A;  3W7T A;  3BRC A;  2HP8 A;  1R6T A;  4DV7 O;  2WLH A;  2R70 A;  3E8H A;  4FLW A;  5HFM A;  2UU9 B;  1H8H G;  1QLE B;  2JGD B;  1XMQ O;  4DR5 B;  4BAY A;  3HR0 A;  5H6Q A;  1Y67 A;  5FPR A;  3BVO A;  3ZMZ A;  3ZBH A;  1WP8 A;  4WFG A;  4RQF A;  1L0L H;  3RT3 C;  4MTG A;  1TAE A;  2D3O W;  2OIG A;  3ZRX A;  1K5S A;  4O4L B;  1HW7 A;  3JSL A;  3OTO B;  1O9H A;  4YJ2 B;  2ZXW B;  1N32 O;  1JX9 A;  3FB7 C;  4QGP A;  1KUQ A;  1RPR A;  3CC7 V;  5IY5 B;  2UXX A;  4JV5 O;  3R66 A;  3ZHT A;  1G4Y B;  4I50 B;  4PD4 F;  3TK1 A;  2ZIO A;  4NR1 A;  2CH7 B;  1KP2 A;  3ASO B;  4DK0 A;  1M4U A;  3N2K A;  4NTY A;  4LF5 O;  2MW2 B;  2DYR C;  4EB6 B;  1FFX A;  1TUB B;  1N36 O;  2JDI G;  2GV9 A;  5K1X A;  4UVA A;  3FB5 C;  3SPG A;  5J2T A;  4TSF G;  4K8Z A;  4LF7 O;  1Y76 B;  1K73 W;  1BGY H;  1FS0 G;  4LF4 O;  4HNA B;  1Q7Y W;  1OCC B;  2YI9 A;  4U3J A;  4I4T B;  1XMO O;  3DC6 A;  1SRY A;  5IYZ B;  4DR4 O;  1PV0 A;  4JPR A;  4YHH O;  3J80 N;  3QF7 A;  1MOF A;  3LDE A;  3ZHS A;  5LMU B;  3IAY A;  3ETD A;  3E8G A;  5IYC O;  1Q6H A;  2WLI B;  2Y69 C;  2QWP B;  5IJ9 A;  2RNB A;  3WG7 C;  2ZE8 A;  4QPJ A;  3FB8 C;  4FLZ A;  4CS4 A;  4I9Q A;  4JI6 B;  4BWA A;  2O57 A;  4JI3 O;  1M9N A;  1D5N A;  1EFR G;  3H1L H;  4TV8 B;  1VQN V;  3I55 V;  3ML0 A;  3KG2 A;  4NB5 A;  4DV5 O;  1NH2 D;  4HYO A;  2Z5U A;  3SPI A;  1YTF B;  1Q5O A;  3K08 A;  1QHT A;  4RAI A;  2YDE A;  3BEH A;  1VQ6 V;  1EBO A;  3JAK B;  4IHJ B;  4GX5 A;  2UU9 O;  3JAW B;  4D7T A;  3OEH G;  3RYC A;  4DR5 O;  4FMT A;  4HBN A;  2OTJ V;  2ETN A;  4ZOL A;  1J5E B;  4DUY B;  2ITD C;  4PI0 A;  4X66 B;  2QA4 V;  4OXS A;  3ZRS A;  3OTO O;  1XNQ B;  2KB1 A;  2XAS A;  4JGS A;  5CBF A;  2QEX V;  3ABL B;  1Y74 A;  4EFB A;  2ITC C;  5JH7 A;  5IWA B;  4FLU A;  3E2E A;  4X88 A;  1FAF A;  1VQL V;  1IBL B;  5BR8 B;  2HEP A;  1V55 C;  4AIL C;  1DK1 A;  1DF4 A;  5BXZ A;  4DRX A;  3CXH F;  1VF6 C;  3ZMU A;  3HKB A;  3OR6 C;  3RYF A;  5KUK A;  1ZX3 A;  2B9Z A;  1WPX A;  3ZRW B;  5KHG A;  2CTW A;  1VQM V;  4O4J B;  1XNR B;  1AJQ A;  2YEV A;  4B3R B;  4WFE A;  2YSU B;  3CX5 F;  2QJ1 A;  1OHH G;  3AG4 B;  4BR6 A;  3SYA A;  3B09 A;  2P22 C;  1FKA O;  1B3Q A;  3A0H Z;  4AQY B;  4YJ3 A;  3AG3 B;  4PA6 A;  1MMM A;  3CRA A;  4O4H A;  1VQ5 V;  2ZNJ A;  4DV6 B;  3MHS C;  5CBG A;  2LFR A;  2A9H A;  2OCC C;  1QNM A;  3CYO A;  2BSK A;  1JR9 A;  3AEI A;  1YIT V;  1FPO A;  2B5U A;  4TQD A;  1I94 B;  2BOB C;  2YIB A;  1P7G A;  1YJW V;  1CP9 A;  1L0N H;  1X59 A;  3H9V A;  3L73 H;  5LMU O;  3SPJ A;  1ZTE A;  5JVD A;  1XUQ A;  3OGI B;  2W6J G;  2QKC A;  3LSU A;  1I5X A;  1ENV A;  5IY5 C;  2EIM B;  5LBQ A;  1SQF A;  2LW1 A;  1EN5 A;  2LGW A;  3JAR A;  3CXC U;  3QO8 A;  4XDJ A;  3K0G A;  4ZI7 B;  5IE9 A;  1VQ8 V;  4JI6 O;  4ZIB A;  4X62 B;  3UKM A;  3E22 B;  3L72 H;  4DV4 O;  2FB5 A;  5F2V O;  4MS2 A;  4X65 B;  3LSS A;  5LMN B;  1EN4 A;  5B1A B;  3ABT A;  4PJ0 Z;  2PI4 A;  1CPY A;  3AG1 B;  2JRI A;  1T5E A;  1Q8I A;  5L3D A;  2F66 C;  2P4K A;  1PD3 A;  2QTO A;  1RSO B;  3F5T A;  3FAV B;  3RW0 A;  5JQG B;  3ZCC A;  1MAB G;  1NJI W;  1US6 A;  4CS2 A;  5LP6 B;  1H2L A;  2LW7 A;  3JCU Z;  4L8J A;  1QQC A;  5HFL A;  1K9M W;  3CEI A;  2ZIN A;  1WA8 A;  2N04 A;  2HG5 C;  1IBK B;  3IFX A;  3W7U A;  1YF2 A;  4MSW C;  3CCU V;  3JAT A;  5EK0 A;  2ZR2 A;  2H8P C;  1F23 A;  4UCR A;  1RM1 B;  4UCU A;  2P06 A;  1J5E O;  4DUY O;  1WJZ A;  3JYC A;  4MVR A;  2EJ7 A;  3G4S V;  2ZT9 B;  4TV9 B;  4X66 O;  2QWR B;  3ETQ A;  5L3F A;  4DR2 B;  2YS8 A;  2Z0A A;  1F51 A;  3E35 A;  2DJV A;  4W4L A;  4UVB A;  1XNQ O;  3E86 A;  4O2A A;  1N4C A;  4BW5 A;  5IWA O;  2PI5 A;  1IBL O;  1NS1 A;  5BR8 O;  3JAL B;  3BY6 A;  1BE3 H;  3K0D A;  1M57 C;  2YC0 A;  4UV8 A;  2NLJ C;  3CC4 V;  4GX2 A;  3CCL V;  2Y48 A;  4X9Q A;  4GX0 A;  4UB8 Z;  4PDV A;  3EVK A;  3H01 A;  4IGG A;  2YIC A;  1FFT B;  2IU0 A;  4F6R A;  1XNR O;  3BHP A;  4B3R O;  2OCH A;  2JGD A;  4H37 A;  3Q4H B;  1SZX A;  2NN4 A;  3UCS C;  5LYJ A;  1QR9 A;  3SYQ A;  4AQY O;  1G8M A;  1XQ8 A;  1VMG A;  4I7Z B;  1SQP H;  3IC7 A;  5EZY A;  4FLY A;  4DV6 O;  1Y4M A;  1SQX H;  4O4L A;  2YXH A;  4B3M B;  1WB7 A;  1KKC A;  2M6Y A;  1K97 A;  1XL4 A;  4DR1 B;  3TET A;  3BAB A;  4I0X B;  3TXQ A;  2DYR B;  1BQZ A;  4HZ3 A;  2IM9 A;  1FYJ A;  1Z5V A;  5EBW C;  1H2S B;  3ABL C;  3LNN A;  4LCU C;  1N8R W;  2KQX A;  1I08 A;  2YUA A;  3ZN1 A;  2ADP A;  2CH7 A;  3ETG A;  1KU9 A;  3C3T A;  3HKE A;  2DW4 A;  1N34 B;  2GUZ B;  2DQ3 A;  4QJF B;  3P3N A;  1TUB A;  3A2F A;  3OUF A;  1GN4 A;  1MSD A;  5H5N A;  5GTH Z;  5CB4 B;  4J9Z B;  2Q0A A;  1UPG A;  4X62 O;  2AHZ A;  2EIN B;  4ZBM A;  1HNX B;  2GHY A;  4X65 O;  1Y76 A;  4B7K A;  4WFH A;  4NTW A;  5LMN O;  4UFZ A;  3AG4 C;  2VQE B;  2Q7E A;  5LA6 B;  4P9P A;  5BMV B;  1M56 B;  1SES A;  4UCS A;  3AG3 C;  2Y69 B;  3HB3 B;  1W0J G;  1PNL A;  4Z1M G;  5IYZ A;  3CME V;  3JAM N;  4PA7 A;  1BZK A;  2IJK A;  4CS3 A;  1WNS A;  1TVK B;  4MVM A;  5KMG B;  4YIO A;  3ZED A;  1IBK O;  1GMG A;  4XBF A;  4OGQ B;  3KCX A;  2QM4 A;  5BY1 A;  1VF7 A;  1AI5 A;  3OD4 A;  3CS5 A;  5CBH A;  4RO2 A;  2UUC B;  3STZ C;  1AI4 A;  4DR2 O;  4MVO A;  1Y6X A;  2JJ1 G;  3B40 A;  4NTX A;  4UXN A;  2AZ0 A;  2EIM C;  1H2K A;  3CCE V;  4CH4 A;  3VQX A;  1PL4 A;  3HKC A;  5J2U A;  3CJH A;  4PA3 A;  2ZNI A;  4FM0 A;  1AI7 A;  1GN2 A;  3NXS A;  1L8D A;  5B1A C;  5A2Q N;  4IL6 Z;  3OMN B;  1R6N A;  3CRM A;  4X1K B;  1S0V A;  4EFE A;  4I55 B;  2GDS A;  2PYL A;  1SC5 B;  1YZB A;  2Q7G A;  5KX5 A;  3DSQ A;  4ZKI A;  2QR4 A;  5FNV A;  5C93 A;  1NR1 A;  1IXB A;  4N21 A;  1H2N A;  1P49 A;  4K35 A;  4JF3 A;  4B3M O;  1D2D A;  1OCO C;  4LFB B;  1RM1 C;  5TIS Z;  3RVZ A;  4CBC A;  3J81 N;  1ZWI C;  2BCC H;  1EM1 A;  4DR1 O;  1URF A;  2F43 G;  2QTS A;  1IX9 A;  3JD3 A;  3AG2 B;  1S76 D;  1SQG A;  3CCS V;  3T1H B;  4JI5 B;  1Q90 D;  1S3J A;  5KA6 A;  1M90 W;  2XAG A;  3BCC H;  3ZJZ A;  2UXC B;  2IJH A;  4G27 B;  3SYC A;  3MDS A;  5KAI Z;  4O4I B;  4JAS A;  4KHP B;  1YTF D;  3SPC A;  1KB9 F;  4LFC B;  1OZ0 A;  2QGN A;  3UO3 A;  1DTO A;  2K1E A;  4JI7 B;  5EYP B;  5JCO C;  1N34 O;  5KAF Z;  2OCC B;  1W59 A;  1MG1 A;  3CCR V;  3HKD B;  5J9P C;  1JFF A;  2ZCE A;  5GON B;  5B1B C;  1V54 C;  1HNX O;  1JCH A;  1K33 A;  4UUJ C;  5C8Y B;  2VQE O;  3BA8 A;  3SJB C;  5FL7 G;  1NI8 A;  4X20 B;  4HAM A;  1KP3 A;  3K06 A;  4H0L B;  2Q73 A;  1NTK H;  2ZE7 A;  3N27 A;  2P4V A;  1O9G A;  3AK1 A;  4XDL A;  3SJA C;  4EEQ A;  3K58 A;  2AZ2 A;  4P9O A;  2NNU A;  2RDC A;  3BFR A;  3OAA G;  5KHJ A;  1P4R A;  3JD1 A;  2MK3 A;  2F93 B;  5H6R A;  4R8C A;  1VQ4 V;  1GM9 A;  4OPH A;  1H38 A;  3FYI B;  2WA4 A;  1K92 A;  2UUC O;  5KHH A;  2OIE A;  1K8A W;  2Y4T A;  3JAS B;  2P5O A;  1TGO A;  3JD0 A;  4JTA B;  3GWO A;  2DMX A;  1JMK C;  1FXH A;  4LNU A;  4KFM A;  4DV3 B;  1YJ9 V;  2AW9 A;  4UVC A;  4RUF A;  3W7X A;  4G28 B;  3RYH B;  1F4M A;  5LL6 Y;  4DYL A;  3TGU H;  1M93 A;  4ASU G;  2X6C A;  2EIN C;  3OMA B;  1RSO A;  1ZUQ A;  1Q43 A;  5LP6 A;  5KHK A;  5EBL C;  1JQ0 A;  2CTQ A;  1K7D A;  1Q86 W;  1M56 C;  3U10 A;  5GW7 A;  3ZMS A;  4B3T B;  1VIB A;  1EZV H;  3GB7 C;  3SPH A;  1FXK B;  2CGN A;  1G1X B;  5KHI A;  4CH3 A;  4KL1 A;  2M7W A;  2E5L B;  3DC5 A;  2E3C A;  4J7J A;  3SGI A;  4NVP A;  1M57 B;  1R3L C;  4FLV A;  3FFQ A;  2OWO A;  2HJD A;  2YID A;  1EZJ A;  2VQF B;  3UO2 A;  5L3B A;  4LFB O;  5H9C A;  2WLN A;  5FPO A;  1VQO V;  1BQ0 A;  1GKF A;  4CC5 A;  4MW8 A;  4FM1 A;  5KLV H;  4R7C A;  2ATK C;  2IH3 C;  2XHB A;  3T1H O;  4WFB V;  4JI5 O;  4GUN A;  4IIJ A;  2F4V B;  2UXC O;  3K3W A;  2WWW A;  4KHP O;  1DF5 A;  2WLL A;  4LFC O;  4BIU A;  4U7N A;  2HVK C;  3B8N A;  1BS3 A;  4DV0 B;  1ORQ C;  4JI7 O;  4CC6 A;  3N2G B;  2QE7 G;  2IW5 A;  4BW9 A;  4U7O A;  4NXN B;  3Q4H A;  3ABM B;  3G71 V;  1G6U A;  2WAM A;  5CA1 A;  1GAX A;  1RP3 B;  4AHC A;  3THO A;  3T4D A;  1FJG B;  2W0F C;  1H2M A;  4ZHQ B;  5LOV A;  3A0R A;  2Q4P A;  1F4N A;  4JI2 B;  1GO3 F;  2HR3 A;  3F7Y C;  4FLX A;  4WBN A;  3O9O A;  1VQ7 V;  1Q81 W;  2W6I G;  4I0X A;  2VS0 A;  4FFK A;  2CGO A;  1NBM G;  3O65 A;  4CZZ A;  2JJ2 G;  1BT8 A;  3CCV V;  4O2B B;  3VQY A;  2IH1 C;  4DV2 B;  5JJN B;  1Q6I A;  3FYE B;  1YDX A;  3AG2 C;  4WF9 V;  4DW0 A;  4X1Y B;  2EIL B;  4LC1 A;  4JI4 B;  4H33 A;  3I5D A;  3KCY A;  4PV1 B;  4XDK A;  1NU1 H;  1XRE A;  2Q7H A;  1BHB A;  2XOK G;  2XAQ A;  3QNE A;  4DV3 O;  3D36 A;  4K8X A;  3UQ8 A;  5IYD O;  4DK1 A;  5BMV A;  3LSQ A;  3L70 H;  2ZDI A;  2N74 A;  5CA0 A;  1PM9 A;  2L6L A;  2UXN A;  2GTA A;  2RQ6 A;  1MNG A;  1GM7 A;  2WLJ A;  4QPK A;  1M5I A;  4DR7 B;  2XTA A;  2DN9 A;  4FFB B;  4B3T O;  1P84 F;  4X1I A;  4LP8 A;  5KMG A;  2QWN B;  3FD9 A;  4PHZ A;  3T1Y B;  3DGE A;  4Z1V A;  3JCZ A;  5IJ0 A;  1K4C C;  5B5E Z;  2E5L O;  4ICG A;  3B77 A;  4H44 B;  3N2K B;  4GT1 A;  4UB6 Z;  2VQF O;  3ASN B;  2ZQM A;  1KKD A;  2F23 A;  5CMU A;  3OTF A;  1FFX B;  1U97 A;  4YY3 B;  4FZ0 A;  4A5U B;  3PJS K;  1LUV A;  1K3E A;  4L87 A;  4TOI A;  2F4V O;  1VF5 B;  1XDC A;  1GN3 A;  1BL8 A;  2KG7 A;  1H8E G;  4J11 A;  4U3J B;  1EN6 A;  4WFF A;  4DV0 O;  3OUS A;  4GLX A;  3DXR A;  3ZX6 A;  2DYS B;  4I55 A;  2Q0O C;  3CCM V;  3CHX A;  2FYU H;  4QNH B;  1OCO B;  5B3S C;  4NXN O;  2R9R B;  4BIZ A;  3D8C A;  5ITZ A;  4GYC B;  2UXD B;  3B8M A;  1S77 D;  4JAU A;  3EXA A;  1SA0 A;  1TUE B;  3CE2 A;  2A3Q A;  5FLX N;  2QDO A;  1FJG O;  4MVS A;  1YXB A;  3ABU A;  2ZM6 B;  1FXK C;  1VF6 A;  5IJ9 B;  5B1O A;  1F7Y A;  4JI2 O;  1KC8 W;  5D5P A;  4DR3 B;  4JI8 B;  1M1K W;  4FZ1 A;  2XND G;  3BA9 A;  2VWK A;  4F6E A;  2IJI A;  1ROP A;  1CXZ B;  2XUM A;  4Z2W A;  4U3F H;  2YXL A;  3G80 A;  1MA1 A;  1XHZ A;  3P30 A;  5B1B B;  1N0J A;  1V54 B;  3ABK C;  3APO A;  4NXM B;  4DV2 O;  5JJE B;  5LGT A;  4R6Z A;  3H1I H;  4Q6G A;  2IU3 A;  2E75 B;  4W4K A;  1PPJ H;  3A0B Z;  2PF4 E;  4JI4 O;  1I7F A;  1AR1 B;  2A79 B;  1FD9 A;  2PY5 A;  4YIP A;  5LHG A;  2LO1 A;  4NYK A;  2WPD G;  1HDJ A;  1NTM H;  4PDL A;  2X7R B;  4JI0 B;  3RYC B;  2N05 A;  3SJC C;  4YJ2 A;  5C8Y A;  3C90 A;  1WB8 A;  3ABM C;  3JSN A;  1PNK A;  1I94 O;  4GKK B;  1TA8 A;  4JTD B;  2OT5 A;  5A9G A;  1BMF G;  4I50 A;  4EKW A;  2B1I A;  4UCO A;  5JH7 B;  4DR7 O;  2G38 A;  3E8B A;  3QVN A;  3QG5 A;  3CC2 V;  2DWE C;  3E83 A;  4J41 A;  2DQ0 A;  4DRX B;  3T1Y O;  4JYY A;  3OGC C;  3K5L A;  4EB6 A;  1ARO P;  2JEX A;  2R9I A;  1LNQ A;  2ARH A;  2F95 B;  2B1G A;  2RN9 A;  1KBH A;  2W0X A;  4LR3 A;  2YEV B;  3JAS A;  1XBL A;  3L75 H;  2PUS A;  1AJP A;  2Q8V A;  1UJW B;  2QM7 A;  2EIL C;  4HNA A;  1UFI A;  4YY3 O;  1OV9 A;  2JS5 A;  4I4T A;  1N33 B;  1XEQ A;  1XIL A;  4JYC A;  4O4H B;  3TCU A;  3S3X A;  1ZAU A;  4GCZ A;  2RCV A;  2R9A A;  1NZ6 A;  2JEU A;  4MVZ A;  3UT5 B;  1VQ9 V;  4LFA B;  1SER A;  5H2F Z;  2WLI A;  2JGU A;  3MHH C;  3J7A U;  4DO2 A;  2E76 B;  1AI6 A;  3VQV A;  3LUT B;  5L3C A;  2P7T C;  3PN1 A;  2VWJ A;  2BTO A;  3P3P A;  2UXD O;  3QO7 A;  4GKJ B;  1N0N A;  3I56 V;  2UXB B;  3DTU B;  2ZM6 O;  3WB2 A;  2RMK B;  2ZE6 A;  3C3S A;  1NQT A;  3L74 H;  3JAR B;  5DN6 G;  4DR3 O;  4JI8 O;  1W2B U;  2IJJ A;  1Y66 A;  4TV8 A;  3ZRV A;  4E2L A;  4E4E A;  3WFV A;  2X6A A;  2CK3 G;  3ASN C;  5E1A C;  4WFA V;  1IDS A;  2ZKO A;  3MAQ A;  2JS3 A;  3B2E E;  2QWO B;  4D6T H;  3U11 A;  3W7S A;  3JAK A;  4IHJ A;  4NXM O;  5IDJ A;  3E8F A;  2K9P A;  3JAW A;  4H13 B;  4J9Y B;  1R73 A;  1PKX A;  2FML A;  2NR5 A;  5AG2 A;  5DEC A;  4FJC C;  1PNM A;  3RVY A;  4PI2 A;  4LH7 A;  4UCV A;  2WLM A;  2DYS C;  4JI0 O;  2GBO A;  3JAT B;  1THZ A;  1K34 A;  4ZHQ A;  1ZL8 B;  3JD4 A;  4Q20 A;  1I5Y A;  2JK5 C;  3RBZ A;  1QBZ A;  4GKK O;  1R3J C;  2BOC C;  4KP4 A;  1E1Q G;  4TQF A;  4LF9 B;  3UM7 A;  2ZE5 A;  2F1M A;  2LGQ A;  3CB2 A;  3ZRW A;  4JZG A;  4RWU A;  4JYB A;  1NVP D;  2PYJ A;  1X4T A;  2EJR A;  4O2B A;  4O4J A;  1IBM B;  4MT8 A;  3GVM A;  1DLB A;  5B1N A;  1QVG U;  4TUY B;  3T2M A;  1VAR A;  5LGU A;  2YXY A;  2DE0 X;  5CA3 A;  2OTL V;  4JAV A;  4PDR A;  3BAA A;  1GK9 A;  1PL0 A;  4F6R B;  5D5Q A;  3ZIA G;  1R6K A;  4MW3 A;  4LF8 B;  5LYJ B;  4B08 A;  1N33 O;  2HVJ C;  3RWR D;  2HJF C;  5EZY B;  2H94 A;  2Q6A A;  4IT5 A;  3VBB A;  3CCQ V;  1PP9 H;  2DWD C;  1BCC H;  1HP8 A;  2BTQ B;  4TT3 G;  4LFA O;  3IC9 A;  4GX1 A;  4FPP A;  4FFB A;  3TJT A;  1RFY A;  4LF6 B;  2Q69 A;  3ZHU A;  3SYP A;  2HKO A;  2KKW A;  3MD0 A;  2EIK C; 
#chains in the Genus database with same CATH homology
 4CZZ A;  3X2Q B;  2AHY A;  4I5S A;  4BW5 A;  2JJ2 G;  3K79 A;  1QVF U;  2EIJ B;  2PI5 A;  3CCV V;  3ZMV A;  3OR7 C;  3CPW U;  1NR7 A;  1YHQ V;  1S5H C;  2IH1 C;  4YXW G;  3BY6 A;  3FYE B;  3K0D A;  1OCZ B;  1M57 C;  3AG2 C;  4PA4 A;  4UV8 A;  4WCE V;  4WF9 V;  2NLJ C;  3CC4 V;  4GX2 A;  3CCL V;  2Y48 A;  4JTC B;  3OFN G;  3OM3 B;  2EIL B;  4GX0 A;  4LC1 A;  4PDV A;  2ZD9 A;  4H33 A;  3H01 A;  1R3I C;  1FFT B;  3CP1 A;  4MTF A;  2IU0 A;  3QO5 A;  4XDK A;  2ZR3 A;  4UV9 A;  2P90 A;  3OE7 G;  2FTK A;  4TWK A;  4MTO A;  1VQK V;  3VOU A;  2XOK G;  4RQE A;  5B3S B;  2XAQ A;  2LFS A;  5EBM C;  1BHB A;  4H37 A;  3QNE A;  3D36 A;  1QR9 A;  3SYQ A;  5IYD O;  1G8M A;  1YI2 V;  1Q82 W;  3LNM B;  2Z3Y A;  1QLN A;  3LSQ A;  2WSS G;  3IC7 A;  3AG1 C;  2ZDI A;  2Q68 A;  1Y4M A;  2XAH A;  2A0L A;  3D3I A;  2UXN A;  2XAF A;  3SJQ C;  2HFE C;  4P2Z A;  1VQP V;  1E79 G;  2WLJ A;  1GM7 A;  4QPK A;  3W7W A;  1K97 A;  3F7V C;  3OEE G;  1XL4 A;  3TET A;  4LP8 A;  1V55 B;  4PDM A;  1OCR B;  2GSM B;  2DYR B;  4HZ3 A;  2ZDI C;  2P6J A;  3DGE A;  4LBE C;  4QE9 A;  1P7B A;  1YIJ V;  2EZO A;  5EBW C;  3JCZ A;  3ABL C;  4MVU A;  1K4C C;  1WLE A;  4LCU C;  1S72 V;  1N8R W;  3ABK B;  2WLK A;  1JOY A;  3ZN1 A;  1FXV A;  3T4Z A;  3B77 A;  3ETG A;  1NVP B;  3LDC A;  4GT1 A;  1GM8 A;  2ZQM A;  2DW4 A;  3ASN B;  1KKD A;  2DQ3 A;  5CMU A;  4QJF B;  3W7T A;  3OUF A;  1YSC A;  5IYB O;  4J9Z B;  2WLH A;  3E8H A;  3PJS K;  2AHZ A;  5HFM A;  1K3E A;  2EIN B;  4ZBM A;  1H8H G;  1QLE B;  1CEZ A;  2GHY A;  4L87 A;  1OCZ C;  3E89 A;  4WFH A;  5H6Q A;  4BAY A;  3AG4 C;  3F5W C;  3ZMZ A;  1BL8 A;  4FK5 C;  4P9P A;  1H8E G;  3JD2 A;  4WFG A;  1M56 B;  4RQF A;  3K9A A;  1SES A;  3HPL C;  4MTG A;  4WFF A;  3AG3 C;  2Y69 B;  3HB3 B;  3OUS A;  2D3O W;  3ZRX A;  2DYS B;  1W0J G;  1K5S A;  1PNL A;  1J95 A;  4Z1M G;  3CCM V;  3CME V;  4QNH B;  4PA7 A;  1OCO B;  5B3S C;  2R9R B;  3ZN0 A;  4BIZ A;  2IJK A;  2ZXW B;  1QCE A;  1JX9 A;  3B8M A;  3FB7 C;  1S77 D;  4JAU A;  4MVM A;  1TUE B;  1RPR A;  1GMG A;  3CC7 V;  4XBF A;  4MVS A;  5IY5 B;  2UXX A;  3ABU A;  4P30 A;  5KA5 A;  1FXK C;  1AI5 A;  1G4Y B;  5B1O A;  5CBH A;  4RO2 A;  2V7Q G;  5LHI A;  4X8A A;  1YJN V;  1KC8 W;  3EFF K;  1M1K W;  2XND G;  3STZ C;  3TK1 A;  5LGN A;  1AI4 A;  5CN0 A;  1KP2 A;  3ASO B;  4MVO A;  2IJI A;  1ROP A;  2JJ1 G;  5DM6 V;  1OCR C;  4UXN A;  2EIM C;  1JJ2 U;  2DYR C;  3CCE V;  2XAJ A;  2X0L A;  3P30 A;  5B1B B;  2X6B A;  1V54 B;  2JDI G;  4PA3 A;  3ABK C;  1K5Q A;  3IGA C;  5LGT A;  4UVA A;  3FB5 C;  4R6Z A;  3SPG A;  4TSF G;  1K73 W;  1AI7 A;  2IU3 A;  1FS0 G;  3NXS A;  1SZT A;  5B1A C;  1AR1 B;  1Q7Y W;  1OCC B;  2A79 B;  3OMN B;  5LHG A;  1R6N A;  4MTX A;  5L3E A;  1S0V A;  2WPD G;  1SRY A;  1JVM A;  4PDL A;  2X7R B;  4JPR A;  1QLE C;  4F4L A;  3CMA V;  1MOF A;  3LDE A;  3P32 A;  4ZKI A;  5C93 A;  3ABM C;  2LP7 A;  1NR1 A;  1W0K G;  1PNK A;  4N21 A;  3ETD A;  3E8G A;  1NKD A;  2WLI B;  5IYC O;  3T1C A;  4JTD B;  2Y69 C;  1MSW D;  2OT5 A;  4RUE A;  4JF3 A;  1BMF G;  1OCO C;  4EKW A;  3WG7 C;  1RM1 C;  3RVZ A;  4CBC A;  4MVQ A;  1ZWI C;  2B1I A;  4QPJ A;  2ZXW C;  3FB8 C;  4N23 A;  3E8B A;  3ETE A;  1KQS U;  4QIW F;  3CC2 V;  2F43 G;  3JD3 A;  2DWE C;  3E83 A;  1IXM A;  3AG2 B;  1S76 D;  2DQ0 A;  3CCS V;  1S3J A;  5KA6 A;  1COW G;  1HWY A;  1M90 W;  2XAG A;  3ZJZ A;  3OGC C;  2IJH A;  1M9N A;  4G27 B;  1ARO P;  2JEX A;  1EFR G;  2R9I A;  3SYC A;  3X2Q C;  1LNQ A;  4JAS A;  3CCJ V;  1YTF D;  1VQN V;  2EIJ C;  3SPC A;  2B1G A;  3ML0 A;  3I55 V;  3KG2 A;  3STL C;  1OZ0 A;  1NH2 D;  1DTO A;  4HYO A;  3ASO C;  2K1E A;  2Z5U A;  3SPI A;  1YTF B;  2YEV B;  3K08 A;  2Q67 A;  1NH2 B;  1AJP A;  2OCC B;  1UJW B;  1MG1 A;  2QM7 A;  4RAI A;  4PA9 A;  2EIL C;  3CCR V;  2EZP A;  3BEH A;  1VQ6 V;  5J9P C;  5B1B C;  1RPO A;  3OW2 U;  1EBO A;  1V54 C;  4GX5 A;  4JYC A;  3TCU A;  4GCZ A;  1JCH A;  3OEH G;  1K33 A;  4FMT A;  2OTJ V;  4UUJ C;  2JEU A;  4MVZ A;  3K03 A;  1VQ9 V;  1SER A;  1K4D C;  2ITD C;  5FL7 G;  1OCC C;  3EHB B;  4HAM A;  1KP3 A;  3K06 A;  2WLI A;  3MHH C;  2QA4 V;  1H2G A;  4DO2 A;  4OXS A;  3ZRS A;  1AI6 A;  2KB1 A;  3LUT B;  2XAS A;  4JGS A;  4XDL A;  5CBF A;  2P7T C;  5L3C A;  2QEX V;  3ABL B;  2ITC C;  4QE7 A;  3QO7 A;  4P9O A;  3E2E A;  2HLD G;  2V1D A;  2NNU A;  4X88 A;  5KUM A;  3OAA G;  3I56 V;  1VQL V;  1P4R A;  3JD1 A;  1V55 C;  3DTU B;  2MK3 A;  1DF4 A;  3LDD A;  1KD1 W;  5H6R A;  4DXW A;  3ZMU A;  4R8C A;  3OR6 C;  1NQT A;  1VQ4 V;  1GM9 A;  1H38 A;  5DN6 G;  5KUK A;  3FYI B;  1WPX A;  1K92 A;  2IJJ A;  1Y66 A;  1W2B U;  3ZRW B;  5EC1 C;  5BZB A;  1AJN A;  1K8A W;  4R50 A;  3ZRV A;  4E2L A;  1VQM V;  1AJQ A;  3WFV A;  2X6A A;  2YEV A;  4WFE A;  3JD0 A;  4JTA B;  2YSU B;  2CK3 G;  3GWO A;  3ASN C;  1OHH G;  5E1A C;  1FXH A;  4WFA V;  4KFM A;  3AG4 B;  1YJ9 V;  4UVC A;  4RUF A;  3SYA A;  3W7X A;  4G28 B;  1F4M A;  3W7S A;  2WLL B;  3AG3 B;  4PA6 A;  5IDJ A;  4ASU G;  1VQ5 V;  3E8F A;  4KUM A;  2X6C A;  2EIN C;  3MHS C;  5CBG A;  2LFR A;  1B6Q A;  3K04 A;  3OMA B;  2A9H A;  4J9Y B;  1R73 A;  2OCC C;  3CYO A;  1PKX A;  3AEI A;  1YIT V;  5EBL C;  1JQ0 A;  4FJC C;  1K7D A;  1Q86 W;  1M56 C;  1PNM A;  5GW7 A;  2B5U A;  3ZMS A;  2P67 A;  3RVY A;  4X89 A;  2BOB C;  2WLM A;  3R65 A;  2DYS C;  3GB7 C;  1YJW V;  2EIK B;  4PEL A;  1FXK B;  1CP9 A;  3SPH A;  1THZ A;  1K34 A;  3JD4 A;  4Q20 A;  2QKS A;  1I5Y A;  2M7W A;  2JK5 C;  3SPJ A;  3RBZ A;  1QBZ A;  2W6J G;  3SYO A;  1R3J C;  1M57 B;  1R3L C;  1I5X A;  2BOC C;  4KP4 A;  1E1Q G;  2QM8 A;  1ENV A;  5IY5 C;  1EZJ A;  2EIM B;  5LBQ A;  1BHA A;  3UM7 A;  5L3B A;  1KEC A;  5H9C A;  2WLN A;  3CXC U;  3QO8 A;  3OMI B;  1VQO V;  3ZRW A;  1GKF A;  4JYB A;  4XDJ A;  2JIZ G;  4MW8 A;  3K0G A;  1NVP D;  2EJR A;  1VQ8 V;  4MT8 A;  2EBO A;  4R7C A;  2ATK C;  2IH3 C;  3CD6 V;  3UKM A;  1DLB A;  3M99 B;  4WFB V;  5B1N A;  1QVG U;  4MS2 A;  3T2M A;  3LSS A;  5LGU A;  5B1A B;  3K3W A;  5CA3 A;  2WWW A;  1GTO A;  2OTL V;  3ABT A;  4JAV A;  1L1F A;  4PDR A;  1DF5 A;  2WLL A;  1GK9 A;  1CPY A;  4U7N A;  4BIU A;  2PI4 A;  2HVK C;  1PL0 A;  3B8N A;  3AG1 B;  5LHH A;  3ZIA G;  5L3D A;  1XL6 A;  1ORQ C;  1R6K A;  1SET A;  5EC2 C;  3RW0 A;  1PD3 A;  2QTO A;  1NJI W;  2QE7 G;  3ZCC A;  1MAB G;  2IW5 A;  4MW3 A;  4U7O A;  2C2A A;  3ABM B;  5HFL A;  3G71 V;  3FB6 C;  1K9M W;  3FKS G;  2WAM A;  2HG5 C;  2HVJ C;  2HJF C;  3IFX A;  4G2K A;  3W7U A;  3T4D A;  2H94 A;  2Q6A A;  2W0F C;  1R3K C;  4MSW C;  3VBB A;  3CCU V;  1JPX A;  5EK0 A;  2ZR2 A;  1FXK A;  3CCQ V;  2H8P C;  1QR8 A;  1F23 A;  2DWD C;  4I9W A;  3WG7 B;  1RM1 B;  4TT3 G;  3A0R A;  1F4N A;  1GO3 F;  3JYC A;  2HR3 A;  3F7Y C;  4FIP C;  4MVR A;  5L3G A;  3G4S V;  4GX1 A;  4FPP A;  5L3F A;  3G6E V;  1VQ7 V;  1Q81 W;  1E1R G;  1F51 A;  2W6I G;  3E35 A;  4UVB A;  2Q69 A;  3SYP A;  2HKO A;  3E86 A;  3MD0 A;  2EIK C;  3ZMT A;  1NBM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...