2Q69A

Crystal structure of nak channel d66n mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGNGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport, membrane protein
molecule keywords Potassium channel protein
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q69A00
3KG2A 3T4DA 3K06A 4HYOA 3SPJA 4P2ZA 4G28B 1R3KC 4EKWA 5CBHA 1OCZC 4QNHB 1V55C 4MW8A 4J9YB 3E8GA 3VOUA 2X6BA 3RW0A 5EBWC 3FB7C 1K4DC 4H37A 4P30A 5E1AC 5IY5C 3RBZA 2DWDC 3E8HA 3SPGA 4I9WA 4R7CA 3SYQA 1XL4A 4LP8A 3TETA 4WFGA 2EIMC 3ABKC 1V54C 2NLJC 4MS2A 1XL6A 4MTOA 2DYRC 2QKSA 4PDMA 1JVMA 2EINC 4MSWC 4BW5A 4X88A 3ZJZA 4P9OA 2AHZA 3K0GA 2WLIA 5J9PC 4P9PA 4TWKA 4UUJC 3RVZA 2OCCC 5KUKA 3AG1C 3ABMC 3ZRSA 4MVSA 1K4CC 3SYOA 2P7TC 3AG3C 4PA4A 3PJSK 2WLLB 4PDVA 2A9HA 1QLEC 3SPIA 1BL8A 4QE7A 4ZBMA 4JTDB 2EIKC 2WLMA 2WLKA 1J95A 3UM7A 5EC1C 3AG2C 2KB1A 3FB8C 2AHYA 4XDKA 5EC2C 3LUTB 2A79B 4MVMA 3F7YC 4CBCA 2Q69A 2ZXWC 4G27B 2WLJA 3K08A 4PDLA 4RUFA 4DXWA 5BZBA 2HVJC 3IFXA 2Y69C 4R8CA 3SYPA 1OCOC 2IH3C 3K04A 2ITDC 2QTOA 4OXSA 2X6AA 3K0DA 4HZ3A 3EFFK 4R6ZA 5EBLC 2YEVA 4GX2A 4RUEA 3LDEA 3LDCA 1S5HC 3ASOC 3SYAA 3ABLC 2W0FC 2BOBC 4XDJA 3SYCA 2Q6AA 2HFEC 3SJQC 3T1CA 4PDRA 5CBFA 4RO2A 3R65A 1M57C 3TCUA 3WG7C 5CBGA 4LCUC 2Q67A 4GX5A 4JTCB 4WFHA 4MVQA 4F4LA 2H8PC 4X8AA 3OR6C 2HVKC 2WLNA 4MW3A 5EK0A 2ZD9A 3STLC 3STZC 3OUSA 4MTGA 3E86A 2DYSC 1LNQA 4XDLA 2ITCC 3LNMB 2WLIB 4KFMA 4X89A 3OUFA 2R9RB 4R50A 3JYCA 3OR7C 4PA7A 3E8BA 4QE9A 3HPLC 2Q68A 4PA9A 2JK5C 5B1AC 4WFFA 1R3LC 3FB5C 5KUMA 1OCRC 2HG5C 2X6CA 3SPCA 3T4ZA 5EBMC 3F7VC 1ORQC 3SPHA 4MTFA 1R3IC 4JTAB 3BEHA 4WFEA 4LBEC 5B3SC 1M56C 4MVUA 4RAIA 2WLLA 3FB6C 3ASNC 3F5WC 3GB7C 3E8FA 2BOCC 3IGAC 4J9ZB 2ATKC 2K1EA 4PA3A 1KKDA 2A0LA 4H33A 5B1BC 4PA6A 4MVZA 1ZWIC 3K03A 2IH1C 2WLHA 2EIJC 3OGCC 4GX0A 3UKMA 1R3JC 3LDDA 2HJFC 3AG4C 1P7BA 1OCCC 3X2QC 2DWEC 3T2MA 1G4YB 4MVOA 3E89A 4MVRA 3E83A 2EILC 4GX1A 3RVYA
chains in the Genus database with same CATH superfamily
3T4DA 4HYOA 3L72H 3OMAB 4Q20A 5IY5C 4DV2O 2DWDC 3K5OA 4O2AB 4JI5O 3S3XA 3ABKC 2NLJC 4MTOA 5JJNB 1IBLB 1GMGA 1VIBA 3JARA 1XDCA 4OX9B 3SJBC 1B6QA 4PDVA 1BL8A 1JFFA 2WLMA 3JCZA 4NTWA 3W7XA 1ZSPA 4JI3B 2Y0IA 2IH3C 4AILC 4JI2B 4NXMO 3RT3C 1R6KA 3ZRVA 1VQOV 5LMUO 1PNKA 3P3NA 1L0LH 3VQVA 4LCUC 4X8AA 3L74H 3ZMUA 3QO7A 2HR3A 2LFSA 3LNMB 3Q4HA 5JCOA 3OUFA 4KXRA 4FPPA 2E75B 5C93A 1OCRC 2AZ2A 3T1YB 5L3EA 3TGUH 4ZI7B 3F5WC 3IGAC 4IGGA 1YDXA 2K1EA 5KHIA 2JGDA 2PUSA 4X20A 2CGNA 5CA3A 5H9CA 4GLXA 3IC7A 3OEEG 1NH2D 1ZX3A 1BZKA 4FVMA 4P2ZA 5CA1B 2C2AA 2Y69B 2OIEA 3B77A 4JYAO 2GHYA 4BIZA 3K5MA 2QM8A 4GKJO 3CCEV 1XQ8A 1KYOF 5ITZA 4B3RO 5HFLA 3THOA 4UUJC 2ZQMA 3B8NA 4J7JA 2UXDB 2RN9A 1XBLA 1VQLV 4UCVA 4B3MB 2GDSA 1QLEC 2VRZA 4LF6B 1X59A 3UM7A 4J80A 2B1GA 3CRRA 5KX5B 5BR8O 1GN3A 5D5PA 1FJGB 1AI7A 1JMKC 4JI6B 4TV9A 1PM9A 4G27B 5BZBA 2Q0AA 1O9GA 3JD4A 4FK5C 4LF5O 1FXKA 3DC6A 3ABLC 1NR7A 2DYRB 3DTUB 2EINB 3T1CA 2JJ2G 4RWUA 3TCUA 1AB3A 4CS3A 3ZHTA 3FYEB 5D5QA 2WLNA 2CUGA 2RQ6A 3UQ8A 5C8YA 3OE7G 4WBNB 1Q82W 2LW1A 4NXNB 3CSXA 2UXXA 1VQ5V 3FAVA 2QGNA 2IU3A 1VF6A 1ORQC 4X1KA 4JTAB 4RAIA 3AEIA 2HP8A 4X1IB 2A0LA 4JI3O 3KCXA 4UCRA 3G4SV 4FIPC 1M57B 4GX0A 1F23A 2P90A 2KG7A 4WFBV 2WA3A 3E89A 3U10A 2VQEB 3K06A 2LJ2A 3K58A 1Z5WA 4ABMA 2G38A 4PI0A 4JI1B 3E22A 5IYDO 4TUYA 4ZOLB 3JD0A 1Y74B 3RW0A 4ZKIA 3WB1A 1KBHA 5EZYB 4LP8A 4NYKA 1MOFA 3CMEV 2ETNA 4MS2A 1FD9A 1QCEA 4J42A 3WG7B 3ZJZA 2DMXA 2QDOA 4DUYO 3CXHF 3HKDB 5L3DA 5J2UB 1G8MA 2LFRA 2XAGA 5B66Z 1P49A 1WPXA 3BHPA 3T1YO 1COWG 2YICA 4YJ2B 1U97A 4NTYA 2YIAA 1I94B 1Q6IA 2IM9A 5EC2C 3H1IH 4ZHQB 4JV5B 4IIJB 4J41A 2HVJC 2IJHA 2Y69C 3SYPA 2AZ0A 1THZA 3E35A 1XNRO 4TQDA 4CH4A 4GX2A 2YXLA 3ASOC 4LF7B 1YZBA 5GONA 3OMNB 4UB8Z 3OR6C 2HVKC 1I08A 1PP9H 1Y67A 2ITCC 2X7RB 2HHHB 5B1NA 1JQ0A 5FNVB 4FJCC 4PA7A 3B4SA 5L3FA 4DV7B 3VQWA 2V4DA 4WFFA 2UXDO 5KUMA 1N8RW 4B3MO 1KU9A 4JI4O 1JA8A 2JJ1G 1SS3A 2B1IA 1S5LZ 2PI5A 4TOIA 4J9ZB 4O4JA 5LP6B 4FM1A 4JI6O 2CDYA 2QTSA 4TSFG 1RPOA 3RVYA 1KC8W 3KG2A 2XAFA 1XHZA 1D5AA 4KHPO 3WB2A 3AG7A 4EKWA 5LA6A 3C90A 2ZNIA 4X62B 1M1KW 3FB7C 5E79Z 1VQ7V 3OEHG 4I9WA 2O57A 1ZL8B 2D3OW 3K9SA 1VQ6V 4TWKA 4MTXA 2YEVB 3JAWB 1K4CC 4DR2O 1JCHA 1Z5VA 2KKWA 2L35A 3TXQA 4OPHA 2A9HA 3DXRB 3SPIA 3MHSC 2WA4A 4AQYB 1HWYA 1OHHG 3JALB 3N2GB 2AHYA 3C3SA 5FL7G 3ZHSA 4K8ZA 4LF4B 4MVMA 2VWJA 4B3SB 2YI9A 1QR8A 2PTMA 3K08A 4R8CA 2QTOA 1RP3B 4DV3B 1OZ0A 4I0XB 2FL4A 4XDJA 1L8DA 3SJQC 1F4MA 2UUAB 3WG7C 2Q67A 3TK1A 4JI0B 4LFBO 2ZR2A 2Y4TA 2FKXA 2N74A 1MNGA 4KFMA 3K5NA 2ZCEA 4LF8O 1PV0A 3RYHB 3ZEDA 3HPLC 3VBBA 4JAAA 4PJ0Z 1R3LC 3FB5C 2CK3G 3FX7A 2YXHA 3CCUV 4I5SA 5AG2A 1M56C 1NBMG 4JZ2A 1SQPH 1R6TA 1SETA 1BGYH 3RYFA 3K03A 4DV2B 5GTHZ 4LR3A 4CZZA 1P4RA 2HJFC 3LDDA 3ZCCA 3AK1A 4WF9V 2F1MA 2ADPA 1HW7A 4LF7O 1Q43A 1A32A 3SGIA 2CTQA 3ZS8C 3CC2V 1YHQV 2YDEA 4F6RB 3A8TA 3SDLA 1GO3F 4UCUA 4O4IA 2ADQB 3D36C 2UU9B 2OCHA 2AHZA 5LGUA 2PYJA 2QWNB 4QPKA 5EYPB 1D2DA 3EVKA 5LP6C 3QG5A 4MVSA 3JD2A 4NXMB 2YSUB 2EIJB 4DUZO 3ZHRA 5LMUB 2QEXV 3JAKA 5CA1A 4FZ0A 4YY3O 1RM1B 1IXMA 2LGWA 5B1AB 1IDSA 1IBMO 5BXZA 4BAYA 4JF3A 4DXWA 1VQKV 2E76B 5IJ9B 5F2VO 3K0DA 5EBLC 2XAJA 1YI2V 5B1BB 3A2FA 2XOKG 4FZ1A 2Q7EA 4X62O 4DV6B 3X2QB 1BSMA 1NTKH 4MW3A 1BT8A 4D7SA 2UUBB 4X89A 4YXWG 2R9RB 2OTLV 2HG5C 1EN4A 4FFKA 4O2BB 1GK9A 1OCOB 4RQEA 1RPRA 2CH7A 3ETDA 2PI4A 4QJFB 4LF4O 1R1BA 1I5XA 4DR7O 4MVZA 1ZWIC 2F95B 4GKKO 2IH1C 1NVPB 3OD4A 4GKJB 1FXVA 4WBNA 4DV3O 1BHAA 3T2MA 4YIOA 4B3RB 4U3JB 2PGGA 1EFRG 2EX3A 3CCRV 4JYCA 2ZDIC 1K92A 1FPOA 3J7AU 2XAQA 5E1AC 4X1IA 1TVKB 2EIMC 3CHXA 4UB6Z 3VQYA 4FLTA 4BW5A 5LOVB 4X66B 1HR0B 5DM6V 3CCLV 4B7EA 3LSUA 4EFBA 4HNAA 4LF5B 1CP9A 4HBNA 2DJVA 3OM3B 2GUZB 3HKEA 1IVSA 5LGTA 1XMOB 4ZOLA 3UT5A 1M93A 1IURA 2CE4A 4H44B 1Y74A 2WPDG 2KQXA 2LP7A 5EZYA 2ZXWC 1V55B 1AILA 4TV8B 2WAMA 1GTOA 2WSSG 1OJHA 4K0KB 4BIUA 2GV9A 3CWBH 5H6RA 2W0FC 3CC4V 2HFEC 5J2UA 1WJZA 4RO2A 3RYCB 2UXBO 1TUBB 3AG3B 1CXZB 1MSWD 1X4TA 2YS8A 4R50A 3RN4A 2UU9O 4LWSB 2ZR3A 2QKCA 5B1AC 1NI8A 1NT2B 1XOUA 5EBMC 1SQVH 4LC1A 2JGUA 3BEHA 2MW2B 4MVUA 2BSKB 2IJKA 1QHTA 1K5SA 1WA8A 4PA3A 2OT5A 3CRQA 5B1BC 1QR9A 5KA5A 1GN6A 4LFAB 2Q9LA 1QU7A 1B06A 3M8AA 5FNVA 3X2QC 4KL1A 1G1XB 4MVOA 3I56V 4X1YA 4I4TB 4NR1A 4DUYB 3OW2U 2CTRA 4DV6O 3VOUA 2ILMA 3D36A 1L1FA 4OGQB 4AHCA 1KMIZ 2UUBO 1H2NA 5LP6A 3SYQA 1KD1W 1IBKB 5A9GA 2ZM6O 2OWOA 2QWPB 1ZAUA 5JVDA 1XNRB 3ABMC 2R70A 3HKCA 4DYLA 2GTSA 4JI8O 3ABTA 2WLLB 4JPRA 1KB9F 4QE7A 1YXBA 1B04A 4JGSA 1DTOA 2IJJA 5J2TB 4Q6GA 3QTCA 2A79B 3RYIB 2DE0X 3R66A 2QKAA 2QWQB 3MAQA 2Y4UA 3U0ZA 1N32B 1K7DA 3U11A 1QVGU 4DW0A 4DK0A 2YEVA 3JAWA 5IYZB 2OIGA 1GM7A 2A3QA 4JI4B 2L6LA 3TJTA 5B5EZ 4DRXA 3DXRA 5CA0B 3EXAA 1XEQA 1EN6A 3N2GA 1S77D 2WLIB 4D7TA 4X66O 4JZGA 1HR0O 3G80A 1XMQB 1E79G 4LF9O 5KA6A 2E5LO 1K33A 1SERA 1YEWA 3L73H 1YTFB 2X6CA 3SPCA 3JSLA 3KKYA 4YIPA 3DC5A 4I0XA 4MTFA 4KHPB 3B8MA 1HDJA 4UVAA 1XMOO 3CMAV 3G6BA 2NNUA 5IJ0B 1I5YA 1GM8A 3CP1A 5BY1A 2R9AA 1R3JC 4K0KO 3PN1A 4GYCB 5KMGB 1H2GA 4IYHA 4Z1VA 4YJ3A 3ZBHA 2ZDIA 4I50B 4MVRA 3OMIB 2DYSB 2P4VA 2D2CB 2LW7A 3UCSC 4DR2B 1AI6A 5CBHA 4H0LB 5JH7B 3LNNA 2F66C 3RFRA 3ABUA 4IHJB 1N4CA 5IWAB 3BAAA 4OPAA 3HR0A 1SQFA 2W6JG 4XBFA 4GUNA 1Y66A 3CXCU 5J9PC 3M7MX 3CCSV 4JAUA 4DR4B 1I0HA 1S5JA 3RVZA 4NVPA 1VQNV 1XNQO 3ZX6A 1HNXO 4Z2WA 1W2BU 3KZIZ 4PD4F 2GSMB 4DR1O 1VF5B 1SESA 2KB1A 4LFBB 2X0LA 5LYJB 2VQFB 3EHBB 3ZHUA 4EEQA 1Y76B 4FLZA 4LFAO 1IXBA 2WLJA 4RUFA 1GM9A 2JS5A 1PD3A 4LF8B 3W7SA 3EFFK 1P84F 4K8XA 5EYPA 1BMFG 2Q0OC 1LUVA 4CS2A 4EB6A 1RSOA 1SQBH 4JTCB 2AXTZ 2JS3A 3ZRWA 1BQ0A 4WFHA 4F4LA 1N34O 2OCCB 2EILB 4MTGA 1F4NA 1IX9A 1IBKO 1TUEB 1XUQA 3QF7A 3WU2Z 1AJQA 3UO2A 4B08A 2QE7G 2Y48A 4O4LB 1K97A 1JFFB 1JOYA 3GVMA 4DV1B 1ZUQA 1YCIA 3NXSA 1N0NA 4EFEA 2H3OA 2QSAA 3CYOA 4DV5O 2P6JA 3ETEA 4DV4O 2F93B 1NU1H 1N32O 2EIKB 2DWEC 2UUCB 1VMGA 3O9OA 3K57A 2NN4A 3CJHA 4JYBA 2A06H 5CB4A 4MW8A 4DUZB 5DEDA 4O2BA 3M99B 4YY3B 2FB5A 4PDMA 2DYRC 2AW9A 1IBMB 2EINC 4TQFA 1XMQO 5LBQA 4P9PA 2A7WA 5LMNO 1KQSU 2XHBA 3RWRD 2K9PA 3VQXA 3ZRSA 4O4HA 3JAMN 2E3CA 3IAYA 1OCCB 2P4KA 5H6QA 5K1XA 2AGAA 4FLXA 3FB8C 2JGDB 4CBCA 2BCCH 2Q69A 1TVKA 3IFXA 2CGOA 3APOA 3ETGA 4UV8A 5LOVA 4TT3G 2GBOA 3MHHC 1W59A 2UXCO 3LDEA 5CN0A 3TXSA 2YC0A 1YJNV 1M57C 2M7WA 3CRAA 2GUZA 3FYIB 3AG1B 5GW7A 5IWAO 1SF9A 2F23A 3J80N 4MT8A 1H38A 3H1LH 4CH5A 5ITZB 2N04A 2YIBD 4DR7B 4GKKB 4K3AA 4O2AA 2PF4E 2LGQA 3JYCA 3HB3B 3B09A 2YIDA 3AG2B 4TV8A 1I7FA 4DR4O 4QE9A 1FS0G 1Q86W 3QNEA 4DW1A 2B9ZA 2YUAA 3QO5A 3ZN0A 1YIJV 5KAFZ 3H1HH 4TV9B 1AI4A 1KKDA 1M5IA 4HAMA 2VQFO 1MG1A 4DR3O 1TUBA 2BE3A 3ZMVA 4GT1A 4J7ZA 3W7UA 1FXKB 3C3TA 2EILC 4LWSA 4LFCB 2EZOA 3FKSG 5LHGA 5FPRA 1YF2A 4H37A 2VWKA 3RBZA 1PL0A 3CRMA 1UFIA 4QIWF 3ETQA 2ODMA 2DQ3A 4E2LA 5L3CA 2HJDA 3SYOA 4X1KB 2PZSA 4PA4A 4J7KA 3WB0A 2GTAA 4B3TB 4DV1O 4KUMA 4JTDB 2EIKC 1H8HG 2WLKA 1J95A 2QM4A 4ZI7A 4DV0O 2UXBB 4XDKA 3MDSA 2V1DA 2KG7B 1GKFA 3UO3A 2Z3YA 2Z5UA 1PPJH 2DW4A 3L70H 2UUCO 1EBOA 4HZ3A 5IY5B 4JAVA 1R73A 3E22B 3JATB 4TUYB 1Q5OA 3SYCA 1BQZA 5H2FZ 4PDRA 5CBFA 3AG4B 4GX5A 5DN6G 5EK0A 2DN9A 3E86A 5J2TA 3L75H 1GAXA 5IT9N 5LL6Y 4FM0A 3DSQA 4LNUB 3OAAG 3IC9A 3QVNA 1EZVH 3E8BA 1E1RG 1G6UA 2DQ0A 1AJPA 1URFA 3JASB 5LXTB 3WFVA 3ZMSA 1XHXA 2CAZC 1WLEA 4PA6A 1KP3A 5KX5A 5BMVB 1NTZH 2ZM6B 1VARA 3APQA 1WPBA 1HP8A 4JASA 4B7KA 1H2LA 1AP6A 1OV9A 4GX1A 5GONB 3D8CA 1R6NA 1GH6A 4X9QA 4JI8B 4PI2A 1FYJA 3SJAC 3JSNA 4UXNA 3ZHVA 1JPXA 5IJ0A 1VQ4V 2HEPA 1MZEA 3IJ4A 2W6IG 1MABG 4I50A 3CCJV 3MD0A 2EJRA 3KCYA 4LH6A 4O4JB 1PNMA 3H9VA 4DR5O 3A0BZ 2PY5A 1UPGA 1WAZA 5KLVH 4FLUA 2RMKB 1AR1B 4NB5A 1D5NA 5B3SB 2HLDG 4I9QA 2XAHA 1QVFU 2XUMA 2LO1A 2P5OA 1QQCA 4LF9B 4LFCO 2CTPA 2E5LB 2XNDG 3A0RA 1FFXB 3R65A 3LSSA 5JQGB 1N36O 2ZNJA 2P06A 1S0VA 1S76D 2B5UA 3ZMTA 4DK1A 3J81N 1NVPD 2E74B 3OGIB 4BR6A 4D6TH 2JEUA 3JD3A 1Q6HA 1GN4A 1V9PA 4BW9A 4BWAA 2IBZH 3HKDA 3SPHA 4B3TO 1R3IC 5HFMA 3FB6C 1Q7YW 3OFNG 2OYQA 4YJ2A 2P22C 3ABLB 4H33A 1E1QG 2JIZG 3LSQA 5B1OA 2EIJC 1XREA 4ZHQA 3AG4C 4IIJA 4UVCA 3T4ZA 4L8JA 1RM1C 1TGOA 4PELA 1XNQB 1YJ9V 4G28B 3CRCA 2YI8A 1R3KC 4O4LA 1HNXB 2Q73A 1W0JG 3QO8A 5IYBO 2R9IA 3CE2A 4DR1B 3BPZA 1MA1A 4FM2A 1XL4A 1SA0B 4WFGA 3N27A 2P67A 1S3JA 2QKSA 1F7YA 2Q7HA 4FMTA 1Y6XA 1AR5A 3D3QA 2RDCA 4W4LA 1WB8A 4U7OA 4RQFA 1NJIW 5L3BA 1NH2B 1ZLZA 1VEWA 3PJSK 4ASUG 1RFYA 3N2KB 3RYFB 4F6EA 2ZE7A 1N34B 4I55B 3F7YC 1OCOC 2Z0AA 2YIBA 3K04A 1VQMV 1KECA 1M4UA 1YSCA 2FYUH 3BA8A 4DR6B 2R72A 1WP8A 4UCSA 1K3EA 5KHJA 4FLVA 2QJ1A 4O4IB 3OUSA 1FXHA 4DV5B 4XDLA 4JI7O 3CCVV 1HNWB 4DV4B 1OCZB 4ICGA 4CH6A 1KUQA 1KKCA 2XASA 1ZL8A 3G6EV 2MK3A 3ZHQA 1Q3EA 3JAKB 3F7VC 4U3FH 4X65O 4WFEA 5B3SC 3B40A 3GB7C 1TA8A 3E8FA 1K9MW 2ATKC 1KP2A 3ASOB 1CEZA 1K5QA 3JALA 3UKMA 1BS3A 1M9NA 1P7BA 2F4VB 1N0JA 3E83A 5LMNB 1QBZA 1AR4A 1AROP 1V55C 2LQTA 3E8GA 3ZRXA 2X6BA 1NQTA 1HNZO 2YXYA 4FFBB 4FLWA 2ZT9B 1K73W 1XILA 1N33B 2BTOA 3ICXA 1H2KA 3H1KH 4X88A 1NKDA 3K0GA 3O65A 5H5NA 2QA4V 3RYHA 3AK3A 5IYCO 3JCUZ 4A5UB 2P7TC 3CCQV 3AG3C 2UXCB 2CH7B 3GWKC 4LH7A 4K35A 1MMMA 3CX5F 3CCMV 2FMLA 1IBLO 1NR1A 3HKBB 1XI1A 1GRJA 1SQGA 4OX9O 3CD6V 2N05A 3K5LA 1MZFA 1Q8IA 4FLYA 2QR4A 1YTFD 2Q6AA 1H8EG 3S3WA 3P3PA 5CBGA 1WNSA 4MVQA 2H8PC 2M6YA 4L87A 2ZIOA 3STLC 1AP5A 4QGPA 2BTQB 2ZINA 4F6RA 4DR3B 4JI2O 2FTKA 2ZE8A 3OR7C 5GTIZ 4E4EA 4HNAB 2Q68A 1F51A 3HKEB 5KHHA 4YHHB 3JATA 3UT5B 1Q6UA 1EN5A 1LR1A 4Z1MG 3W7WA 3SJCC 1Z2GA 3K3WA 2ZKOA 2JRIA 5K1PA 3JARB 3G67A 1BCCH 2EJ7A 5IJ9A 4LNUA 3H01A 3FFQA 5CMUA 3GWOA 4DR6O 4I7ZB 3SPJA 1NS1A 4IT5A 1OCZC 4QNHB 3CB2A 1VQPV 3JASA 5LXTA 1BE3H 5EBWC 1VF7A 1K4DC 1US6A 4DV0B 1HNWO 4X64B 1P7GA 1M56B 1JVMA 5BMVA 4WCEV 3I55V 5IDJA 2JEXA 3CC7V 4CC6A 1JR9A 2OTJV 1PL4A 3OTFA 2Q5ZA 3B2EE 5FLXN 1DK1A 2IJIA 1WA8B 4PV1B 2XTAA 5EC1C 1JX9A 4J10A 1JJ2U 3LUTB 3FD9A 3Q4HB 1WP7A 2RCVA 2Y0PA 3CEIA 2PYLA 2Q7GA 4X1YB 2RJZA 4OXSA 2F4VO 2X6AA 1NTMH 5DECA 4R6ZA 3L71H 3NR7A 2H94A 3SYAA 4BIOA 2BOBC 4U3JA 4LF6O 3BFRA 3CS5A 2JVDA 4DO2A 2UXNA 3STZC 1FJGO 2DOSA 2ZD9A 1N33O 4GCZA 2DYSC 4X20B 5JVDB 2HKOA 1FFTB 3HKCB 1K8AW 4WFAV 4PA9A 1V54B 3P32A 4UVBA 2ZE5A 4N21A 4LBEC 1UJWB 1FFXA 5JQGA 3ZIAG 1EZJA 1L0NH 2WLHA 3OGCC 4NXNO 2ARHA 2ZE6A 4UCTA 5IE9A 3JD1A 4AI8A 2EZPA 4DRXB 3AK2A 5LGNA 4J9YB 5A2QN 1YVWA 3RYCA 4DR5B 4IL6Z 3OTOB 3W7TA 4P9OA 1K34A 2VQEO 2OCCC 5KUKA 1ROPA 1SRYA 1J5EB 4JI1O 4YHHO 3BCCH 3ZN1A 1W0KG 1PNLA 1DF5A 5KAIZ 5C8YB 2BSKA 1N36B 1DLBA 4NKGB 1SA0A 2F43G 5LHHA 4YJ3B 2RNBA 5KHKA 3K79A 3BY6A 3ASNB 5TISZ 3FAVB 2Q4PA 2EIMB 3F5TA 3T1HB 5JJEB 1SKVA 4I4TA 1ENVA 1O9HA 1I94O 3N2KA 1Q81W 1VQ8V 4X64O 4JV5O 4I55A 4JI5B 1TAEA 4GZRB 1QNMA 3BABA 4CH3A 3BA9A 4JYYA 2ZXWB 5JCOC 3ABKB 1U96A 4W4KA 1WN7A 1PKXA 2WLLA 1EM1A 2W0XA 1VP7A 1GN2A 4CC5A 2BOCC 2QWOB 2HHHO 5LHIA 1JJOA 3RYIA 1H2MA 5L3GA 4DV7O 4ZIBA 1B3QA 1OCCC 1G4YB 4QPJA 3P30A 4N23A 4EB6B 4CS4A 4J11A 5EIBD 1RSOB 3A0HZ 3ZRWB 1LUWA 4H13B 3OT7A 5IYZA 1WB7A 4C7UA 4IYIA 4P30A 1CPYA 1H2SB 1Y4MA 5CA0A 3TETA 3E8HA 3SPGA 4R7CA 4UV9A 1V54C 3ZMZA 1XL6A 1NZ6A 3I5DA 1M90W 4MSWC 4PHZA 2VS0A 3G71V 1T5EA 2WLIA 1AJNA 2ZIMA 1YJWV 1SZTA 3E2EA 3AG1C 2V7QG 1DF4A 1IZ3A 4G2KA 4ZBMA 2EBOA 3AG2C 1YITV 1AI5A 4FFBA 1OCRB 4PDLA 4UFZA 4JI7B 3D3IA 4NTXA 3K59A 2ITDC 1BHBA 3CJHB 5KHGA 2WWWA 2QM7A 4RUEA 5CB4B 5KMGA 3LDCA 1S5HC 1Q90D 4U7NA 1MSDA 1FKAO 3ML0A 4AQYO 4UCOA 2QWRB 4X65B 1FXKC 2JDIG 2Q8VA 4JYAB 3ABMB 3BVOA 1FAFA 3RGBA 5FPOA 5JH7A 4B3SO 1S72V 3BRCA 1LNQA 1SZXA 4IHJA 1SQXH 2CTWA 5JWPA 3CPWU 3OTOO 4KP4A 1SC5B 3HKBA 3SR2C 3L9DA 4O4HB 1VQ9V 2JK5C 1J5EO 1QLNA 2XT9A 5LA6B 3K9AA 2UUAO 2NR5A 2IW5A 4JI0O 5JJJB 1AVMA 3ASNC 3DGEA 2KSDA 1ZTEA 5BR8B 2IU0A 1HNZB 1DGSA 1VF6C 5EIBC 5LYJA 2BTQA 1QLEB 1Y76A 3H1JH 2EULA 1SQQH 3T1HO
chains in the Genus database with same CATH topology
1QBZA 3T4DA 4HYOA 4JYBA 1AROP 1V55C 4MW8A 3E8GA 3ZRXA 2X6BA 3M99B 3OMAB 4Q20A 1NQTA 3CC2V 1YHQV 5IY5C 1K73W 2DWDC 3ABKC 1GO3F 2NLJC 4MTOA 4PDMA 2DYRC 2EINC 4X88A 1GMGA 1NKDA 5LBQA 2AHZA 3K0GA 5LGUA 4QPKA 4P9PA 1KQSU 2QA4V 5IYCO 3ZRSA 4MVSA 3JD2A 1B6QA 2P7TC 2YSUB 3CCQV 2EIJB 3AG3C 4PDVA 2QEXV 1BL8A 1OCCB 5H6QA 2WLMA 3JCZA 1RM1B 1IXMA 3FB8C 3W7XA 5B1AB 3CCMV 4CBCA 2Q69A 4BAYA 4JF3A 4DXWA 1NR1A 1VQKV 3IFXA 2IH3C 3K0DA 3ETGA 4UV8A 3CD6V 5EBLC 4TT3G 2XAJA 1R6KA 1YI2V 5B1BB 3MHHC 3ZRVA 3LDEA 2XOKG 5CN0A 1VQOV 1YTFD 1PNKA 2Q6AA 1YJNV 1H8EG 1M57C 5CBGA 4LCUC 3X2QB 2M7WA 4MVQA 2H8PC 3FYIB 3AG1B 4L87A 4X8AA 5GW7A 3STLC 4MW3A 3ZMUA 3QO7A 2HR3A 2LFSA 1H38A 4MT8A 3LNMB 4X89A 4YXWG 3OUFA 2R9RB 4FPPA 3JYCA 2FTKA 3HB3B 3OR7C 2OTLV 3AG2B 4QE9A 2Q68A 1F51A 1FS0G 5C93A 1Q86W 3QNEA 1OCRC 2HG5C 3QO5A 3ZN0A 1YIJV 1GK9A 1OCOB 5L3EA 4RQEA 1RPRA 3F5WC 3ETDA 2PI4A 4QJFB 3IGAC 4Z1MG 1AI4A 2K1EA 3W7WA 1KKDA 4HAMA 1I5XA 1MG1A 4MVZA 1ZWIC 2IH1C 3K3WA 1NVPB 3ZMVA 1FXVA 4GT1A 5CA3A 3W7UA 1FXKB 1BHAA 5H9CA 3T2MA 2EILC 3H01A 3IC7A 5CMUA 3OEEG 1NH2D 3GWOA 2EZOA 3SPJA 4P2ZA 3FKSG 1EFRG 1OCZC 4QNHB 3CCRV 4JYCA 1VQPV 2C2AA 2Y69B 2ZDIC 5LHGA 3B77A 1K92A 5EBWC 1K4DC 4H37A 2XAQA 5E1AC 2GHYA 3RBZA 4BIZA 1PL0A 2QM8A 2EIMC 4QIWF 3CCEV 1M56B 1JVMA 2DQ3A 4E2LA 4WCEV 4BW5A 5IDJA 3I55V 5L3CA 2JEXA 5DM6V 5HFLA 3CC7V 2OTJV 4UUJC 3CCLV 2ZQMA 3B8NA 3SYOA 4PA4A 1VQLV 1CP9A 1QLEC 3OM3B 2IJIA 4KUMA 4JTDB 2EIKC 1H8HG 2WLKA 1J95A 2B1GA 5EC1C 3UM7A 5LGTA 1JX9A 4XDKA 1JJ2U 2WPDG 3LUTB 1AI7A 2LP7A 2V1DA 2ZXWC 1V55B 4G27B 1GKFA 5BZBA 2Z3YA 2Z5UA 2WAMA 1GTOA 2WSSG 2DW4A 4OXSA 2X6AA 1EBOA 4HZ3A 4BIUA 5IY5B 4R6ZA 3JD4A 4FK5C 4JAVA 1FXKA 1R73A 5H6RA 2H94A 3SYAA 3ABLC 2W0FC 2BOBC 1NR7A 2DYRB 3SYCA 3DTUB 3CC4V 2HFEC 2EINB 3T1CA 2JJ2G 4PDRA 5CBFA 4RO2A 3TCUA 3AG4B 4GX5A 3FYEB 5DN6G 4DO2A 2UXNA 3STZC 5EK0A 2WLNA 2ZD9A 3E86A 3AG3B 4GCZA 2DYSC 3OE7G 1MSWD 1Q82W 4R50A 2HKOA 1FFTB 3OAAG 2ZR3A 1K8AW 4WFAV 3E8BA 2UXXA 4PA9A 1E1RG 5B1AC 1VQ5V 2DQ0A 1AJPA 2IU3A 1V54B 3P32A 5EBMC 4UVBA 4LC1A 1ORQC 4N21A 3WFVA 4JTAB 3BEHA 3ZMSA 4LBEC 4MVUA 4RAIA 3AEIA 2IJKA 1UJWB 1K5SA 4PA3A 2OT5A 2A0LA 1WLEA 5B1BC 4PA6A 1KP3A 3ZIAG 1EZJA 2WLHA 1QR9A 3G4SV 5KA5A 4FIPC 3OGCC 1M57B 4GX0A 1F23A 2P90A 4JASA 3X2QC 4WFBV 4MVOA 3I56V 3E89A 4GX1A 3JD1A 3K06A 1R6NA 2EZPA 5LGNA 5IYDO 3OW2U 4J9YB 3VOUA 3JD0A 3D36A 3RW0A 1L1FA 4ZKIA 4UXNA 3SYQA 4LP8A 1MOFA 1KD1W 3CMEV 1JPXA 4MS2A 1QCEA 3W7TA 3WG7B 1VQ4V 3ZJZA 4P9OA 1K34A 2W6IG 2OCCC 5KUKA 1ROPA 1SRYA 3ABMC 1MABG 5L3DA 1G8MA 3CCJV 3MD0A 2EJRA 3ABTA 2LFRA 2XAGA 3ZN1A 2WLLB 1W0KG 4JPRA 1PNLA 1WPXA 4QE7A 1COWG 4JGSA 1PNMA 1DF5A 1DTOA 2IJJA 5EC2C 2A79B 1DLBA 1AR1B 2F43G 5LHHA 2HVJC 2IJHA 5B3SB 2Y69C 2HLDG 3SYPA 3K79A 3BY6A 1THZA 1K7DA 3ASNB 3E35A 2XAHA 1QVFU 1QVGU 2YEVA 4GX2A 2EIMB 3ASOC 1ENVA 2XNDG 3A0RA 3OMNB 1GM7A 3R65A 3LSSA 1Q81W 3OR6C 2HVKC 1VQ8V 1S0VA 1S76D 2B5UA 3ZMTA 2ITCC 1S77D 1NVPD 2WLIB 2X7RB 5B1NA 1JQ0A 4FJCC 4PA7A 5L3FA 1E79G 2JEUA 5KA6A 3JD3A 1K33A 1SERA 4WFFA 2ZXWB 5KUMA 3ABKB 1YTFB 2X6CA 3SPCA 1N8RW 3SPHA 4MTFA 3B8MA 1R3IC 1PKXA 2JJ1G 2WLLA 3FB6C 4UVAA 5HFMA 1Q7YW 3CMAV 2B1IA 2PI5A 2BOCC 4J9ZB 3OFNG 3ABLB 2NNUA 4H33A 1I5YA 5LHIA 1E1QG 2JIZG 1GM8A 3LSQA 4TSFG 5B1OA 3CP1A 2EIJC 1RPOA 1R3JC 3AG4C 5L3GA 1OCCC 1H2GA 4UVCA 1G4YB 4QPJA 3P30A 2ZDIA 4N23A 4MVRA 3T4ZA 1RM1C 3RVYA 3OMIB 2DYSB 4PELA 1KC8W 3KG2A 2XAFA 1YJ9V 4G28B 1AI6A 1R3KC 3ZRWB 4EKWA 5CBHA 1W0JG 3QO8A 5IYBO 2R9IA 1M1KW 3FB7C 3ABUA 4P30A 1CPYA 1VQ7V 1Y4MA 3OEHG 3TETA 3E8HA 3SPGA 4I9WA 4R7CA 1XL4A 4WFGA 4UV9A 1V54C 2P67A 2W6JG 1S3JA 4XBFA 3ZMZA 1XL6A 2QKSA 1Y66A 3CXCU 4MSWC 4FMTA 1M90W 2D3OW 3G71V 2WLIA 1VQ6V 5J9PC 4TWKA 4JAUA 1AJNA 4MTXA 3CCSV 1YJWV 1SZTA 2YEVB 3E2EA 4U7OA 3RVZA 4RQFA 1VQNV 3AG1C 1NJIW 2V7QG 1DF4A 1K4CC 5L3BA 1NH2B 1JCHA 1W2BU 3PJSK 4ASUG 2A9HA 3SPIA 3MHSC 4G2KA 4ZBMA 2GSMB 2EBOA 3AG2C 1HWYA 1OHHG 1SESA 2KB1A 2AHYA 5FL7G 2X0LA 1YITV 1AI5A 4MVMA 3F7YC 1OCRB 3EHBB 1QR8A 2WLJA 3K08A 4PDLA 4RUFA 1GM9A 4R8CA 3D3IA 1PD3A 1OCOC 3K04A 2ITDC 2QTOA 1BHBA 3W7SA 1OZ0A 3EFFK 1BMFG 2WWWA 2QM7A 4RUEA 1VQMV 1KECA 1YSCA 3LDCA 1S5HC 4U7NA 4XDJA 3SJQC 1F4MA 3ML0A 3WG7C 1K3EA 2Q67A 4JTCB 3ZRWA 4WFHA 3TK1A 4F4LA 2OCCB 1FXKC 2JDIG 3ABMB 2EILB 2ZR2A 3OUSA 4MTGA 1F4NA 1S72V 1FXHA 1LNQA 4XDLA 3CCVV 1TUEB 1OCZB 4KFMA 3CPWU 4KP4A 1AJQA 2XASA 3G6EV 3HPLC 2MK3A 3VBBA 1VQ9V 2QE7G 2JK5C 2Y48A 1QLNA 1R3LC 3FB5C 3K9AA 1K97A 2CK3G 3CCUV 3F7VC 1JOYA 2IW5A 4WFEA 5B3SC 4I5SA 1M56C 1NBMG 3NXSA 3ASNC 3GB7C 1SETA 3DGEA 3E8FA 1K9MW 3CYOA 2ATKC 1KP2A 3ASOB 2IU0A 1CEZA 2P6JA 3ETEA 3K03A 1K5QA 4CZZA 1QLEB 3UKMA 1P4RA 2HJFC 1M9NA 3LDDA 3ZCCA 1P7BA 2EIKB 2DWEC 4WF9V 3E83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KG2 A;  3T4D A;  3K06 A;  4HYO A;  3SPJ A;  4P2Z A;  4G28 B;  1R3K C;  4EKW A;  5CBH A;  1OCZ C;  4QNH B;  1V55 C;  4MW8 A;  4J9Y B;  3E8G A;  3VOU A;  2X6B A;  3RW0 A;  5EBW C;  3FB7 C;  1K4D C;  4H37 A;  4P30 A;  5E1A C;  5IY5 C;  3RBZ A;  2DWD C;  3E8H A;  3SPG A;  4I9W A;  4R7C A;  3SYQ A;  1XL4 A;  4LP8 A;  3TET A;  4WFG A;  2EIM C;  3ABK C;  1V54 C;  2NLJ C;  4MS2 A;  1XL6 A;  4MTO A;  2DYR C;  2QKS A;  4PDM A;  1JVM A;  2EIN C;  4MSW C;  4BW5 A;  4X88 A;  3ZJZ A;  4P9O A;  2AHZ A;  3K0G A;  2WLI A;  5J9P C;  4P9P A;  4TWK A;  4UUJ C;  3RVZ A;  2OCC C;  5KUK A;  3AG1 C;  3ABM C;  3ZRS A;  4MVS A;  1K4C C;  3SYO A;  2P7T C;  3AG3 C;  4PA4 A;  3PJS K;  2WLL B;  4PDV A;  2A9H A;  1QLE C;  3SPI A;  1BL8 A;  4QE7 A;  4ZBM A;  4JTD B;  2EIK C;  2WLM A;  2WLK A;  1J95 A;  3UM7 A;  5EC1 C;  3AG2 C;  2KB1 A;  3FB8 C;  2AHY A;  4XDK A;  5EC2 C;  3LUT B;  2A79 B;  4MVM A;  3F7Y C;  4CBC A;  2Q69 A;  2ZXW C;  4G27 B;  2WLJ A;  3K08 A;  4PDL A;  4RUF A;  4DXW A;  5BZB A;  2HVJ C;  3IFX A;  2Y69 C;  4R8C A;  3SYP A;  1OCO C;  2IH3 C;  3K04 A;  2ITD C;  2QTO A;  4OXS A;  2X6A A;  3K0D A;  4HZ3 A;  3EFF K;  4R6Z A;  5EBL C;  2YEV A;  4GX2 A;  4RUE A;  3LDE A;  3LDC A;  1S5H C;  3ASO C;  3SYA A;  3ABL C;  2W0F C;  2BOB C;  4XDJ A;  3SYC A;  2Q6A A;  2HFE C;  3SJQ C;  3T1C A;  4PDR A;  5CBF A;  4RO2 A;  3R65 A;  1M57 C;  3TCU A;  3WG7 C;  5CBG A;  4LCU C;  2Q67 A;  4GX5 A;  4JTC B;  4WFH A;  4MVQ A;  4F4L A;  2H8P C;  4X8A A;  3OR6 C;  2HVK C;  2WLN A;  4MW3 A;  5EK0 A;  2ZD9 A;  3STL C;  3STZ C;  3OUS A;  4MTG A;  3E86 A;  2DYS C;  1LNQ A;  4XDL A;  2ITC C;  3LNM B;  2WLI B;  4KFM A;  4X89 A;  3OUF A;  2R9R B;  4R50 A;  3JYC A;  3OR7 C;  4PA7 A;  3E8B A;  4QE9 A;  3HPL C;  2Q68 A;  4PA9 A;  2JK5 C;  5B1A C;  4WFF A;  1R3L C;  3FB5 C;  5KUM A;  1OCR C;  2HG5 C;  2X6C A;  3SPC A;  3T4Z A;  5EBM C;  3F7V C;  1ORQ C;  3SPH A;  4MTF A;  1R3I C;  4JTA B;  3BEH A;  4WFE A;  4LBE C;  5B3S C;  1M56 C;  4MVU A;  4RAI A;  2WLL A;  3FB6 C;  3ASN C;  3F5W C;  3GB7 C;  3E8F A;  2BOC C;  3IGA C;  4J9Z B;  2ATK C;  2K1E A;  4PA3 A;  1KKD A;  2A0L A;  4H33 A;  5B1B C;  4PA6 A;  4MVZ A;  1ZWI C;  3K03 A;  2IH1 C;  2WLH A;  2EIJ C;  3OGC C;  4GX0 A;  3UKM A;  1R3J C;  3LDD A;  2HJF C;  3AG4 C;  1P7B A;  1OCC C;  3X2Q C;  2DWE C;  3T2M A;  1G4Y B;  4MVO A;  3E89 A;  4MVR A;  3E83 A;  2EIL C;  4GX1 A;  3RVY A; 
#chains in the Genus database with same CATH topology
 3T4D A;  4HYO A;  3L72 H;  3OMA B;  4Q20 A;  5IY5 C;  4DV2 O;  2DWD C;  3K5O A;  4O2A B;  4JI5 O;  3S3X A;  3ABK C;  2NLJ C;  4MTO A;  5JJN B;  1IBL B;  1GMG A;  1VIB A;  3JAR A;  1XDC A;  4OX9 B;  3SJB C;  1B6Q A;  4PDV A;  1BL8 A;  1JFF A;  2WLM A;  3JCZ A;  4NTW A;  3W7X A;  1ZSP A;  4JI3 B;  2Y0I A;  2IH3 C;  4AIL C;  4JI2 B;  4NXM O;  3RT3 C;  1R6K A;  3ZRV A;  1VQO V;  5LMU O;  1PNK A;  3P3N A;  1L0L H;  3VQV A;  4LCU C;  4X8A A;  3L74 H;  3ZMU A;  3QO7 A;  2HR3 A;  2LFS A;  3LNM B;  3Q4H A;  5JCO A;  3OUF A;  4KXR A;  4FPP A;  2E75 B;  5C93 A;  1OCR C;  2AZ2 A;  3T1Y B;  5L3E A;  3TGU H;  4ZI7 B;  3F5W C;  3IGA C;  4IGG A;  1YDX A;  2K1E A;  5KHI A;  2JGD A;  2PUS A;  4X20 A;  2CGN A;  5CA3 A;  5H9C A;  4GLX A;  3IC7 A;  3OEE G;  1NH2 D;  1ZX3 A;  1BZK A;  4FVM A;  4P2Z A;  5CA1 B;  2C2A A;  2Y69 B;  2OIE A;  3B77 A;  4JYA O;  2GHY A;  4BIZ A;  3K5M A;  2QM8 A;  4GKJ O;  3CCE V;  1XQ8 A;  1KYO F;  5ITZ A;  4B3R O;  5HFL A;  3THO A;  4UUJ C;  2ZQM A;  3B8N A;  4J7J A;  2UXD B;  2RN9 A;  1XBL A;  1VQL V;  4UCV A;  4B3M B;  2GDS A;  1QLE C;  2VRZ A;  4LF6 B;  1X59 A;  3UM7 A;  4J80 A;  2B1G A;  3CRR A;  5KX5 B;  5BR8 O;  1GN3 A;  5D5P A;  1FJG B;  1AI7 A;  1JMK C;  4JI6 B;  4TV9 A;  1PM9 A;  4G27 B;  5BZB A;  2Q0A A;  1O9G A;  3JD4 A;  4FK5 C;  4LF5 O;  1FXK A;  3DC6 A;  3ABL C;  1NR7 A;  2DYR B;  3DTU B;  2EIN B;  3T1C A;  2JJ2 G;  4RWU A;  3TCU A;  1AB3 A;  4CS3 A;  3ZHT A;  3FYE B;  5D5Q A;  2WLN A;  2CUG A;  2RQ6 A;  3UQ8 A;  5C8Y A;  3OE7 G;  4WBN B;  1Q82 W;  2LW1 A;  4NXN B;  3CSX A;  2UXX A;  1VQ5 V;  3FAV A;  2QGN A;  2IU3 A;  1VF6 A;  1ORQ C;  4X1K A;  4JTA B;  4RAI A;  3AEI A;  2HP8 A;  4X1I B;  2A0L A;  4JI3 O;  3KCX A;  4UCR A;  3G4S V;  4FIP C;  1M57 B;  4GX0 A;  1F23 A;  2P90 A;  2KG7 A;  4WFB V;  2WA3 A;  3E89 A;  3U10 A;  2VQE B;  3K06 A;  2LJ2 A;  3K58 A;  1Z5W A;  4ABM A;  2G38 A;  4PI0 A;  4JI1 B;  3E22 A;  5IYD O;  4TUY A;  4ZOL B;  3JD0 A;  1Y74 B;  3RW0 A;  4ZKI A;  3WB1 A;  1KBH A;  5EZY B;  4LP8 A;  4NYK A;  1MOF A;  3CME V;  2ETN A;  4MS2 A;  1FD9 A;  1QCE A;  4J42 A;  3WG7 B;  3ZJZ A;  2DMX A;  2QDO A;  4DUY O;  3CXH F;  3HKD B;  5L3D A;  5J2U B;  1G8M A;  2LFR A;  2XAG A;  5B66 Z;  1P49 A;  1WPX A;  3BHP A;  3T1Y O;  1COW G;  2YIC A;  4YJ2 B;  1U97 A;  4NTY A;  2YIA A;  1I94 B;  1Q6I A;  2IM9 A;  5EC2 C;  3H1I H;  4ZHQ B;  4JV5 B;  4IIJ B;  4J41 A;  2HVJ C;  2IJH A;  2Y69 C;  3SYP A;  2AZ0 A;  1THZ A;  3E35 A;  1XNR O;  4TQD A;  4CH4 A;  4GX2 A;  2YXL A;  3ASO C;  4LF7 B;  1YZB A;  5GON A;  3OMN B;  4UB8 Z;  3OR6 C;  2HVK C;  1I08 A;  1PP9 H;  1Y67 A;  2ITC C;  2X7R B;  2HHH B;  5B1N A;  1JQ0 A;  5FNV B;  4FJC C;  4PA7 A;  3B4S A;  5L3F A;  4DV7 B;  3VQW A;  2V4D A;  4WFF A;  2UXD O;  5KUM A;  1N8R W;  4B3M O;  1KU9 A;  4JI4 O;  1JA8 A;  2JJ1 G;  1SS3 A;  2B1I A;  1S5L Z;  2PI5 A;  4TOI A;  4J9Z B;  4O4J A;  5LP6 B;  4FM1 A;  4JI6 O;  2CDY A;  2QTS A;  4TSF G;  1RPO A;  3RVY A;  1KC8 W;  3KG2 A;  2XAF A;  1XHZ A;  1D5A A;  4KHP O;  3WB2 A;  3AG7 A;  4EKW A;  5LA6 A;  3C90 A;  2ZNI A;  4X62 B;  1M1K W;  3FB7 C;  5E79 Z;  1VQ7 V;  3OEH G;  4I9W A;  2O57 A;  1ZL8 B;  2D3O W;  3K9S A;  1VQ6 V;  4TWK A;  4MTX A;  2YEV B;  3JAW B;  1K4C C;  4DR2 O;  1JCH A;  1Z5V A;  2KKW A;  2L35 A;  3TXQ A;  4OPH A;  2A9H A;  3DXR B;  3SPI A;  3MHS C;  2WA4 A;  4AQY B;  1HWY A;  1OHH G;  3JAL B;  3N2G B;  2AHY A;  3C3S A;  5FL7 G;  3ZHS A;  4K8Z A;  4LF4 B;  4MVM A;  2VWJ A;  4B3S B;  2YI9 A;  1QR8 A;  2PTM A;  3K08 A;  4R8C A;  2QTO A;  1RP3 B;  4DV3 B;  1OZ0 A;  4I0X B;  2FL4 A;  4XDJ A;  1L8D A;  3SJQ C;  1F4M A;  2UUA B;  3WG7 C;  2Q67 A;  3TK1 A;  4JI0 B;  4LFB O;  2ZR2 A;  2Y4T A;  2FKX A;  2N74 A;  1MNG A;  4KFM A;  3K5N A;  2ZCE A;  4LF8 O;  1PV0 A;  3RYH B;  3ZED A;  3HPL C;  3VBB A;  4JAA A;  4PJ0 Z;  1R3L C;  3FB5 C;  2CK3 G;  3FX7 A;  2YXH A;  3CCU V;  4I5S A;  5AG2 A;  1M56 C;  1NBM G;  4JZ2 A;  1SQP H;  1R6T A;  1SET A;  1BGY H;  3RYF A;  3K03 A;  4DV2 B;  5GTH Z;  4LR3 A;  4CZZ A;  1P4R A;  2HJF C;  3LDD A;  3ZCC A;  3AK1 A;  4WF9 V;  2F1M A;  2ADP A;  1HW7 A;  4LF7 O;  1Q43 A;  1A32 A;  3SGI A;  2CTQ A;  3ZS8 C;  3CC2 V;  1YHQ V;  2YDE A;  4F6R B;  3A8T A;  3SDL A;  1GO3 F;  4UCU A;  4O4I A;  2ADQ B;  3D36 C;  2UU9 B;  2OCH A;  2AHZ A;  5LGU A;  2PYJ A;  2QWN B;  4QPK A;  5EYP B;  1D2D A;  3EVK A;  5LP6 C;  3QG5 A;  4MVS A;  3JD2 A;  4NXM B;  2YSU B;  2EIJ B;  4DUZ O;  3ZHR A;  5LMU B;  2QEX V;  3JAK A;  5CA1 A;  4FZ0 A;  4YY3 O;  1RM1 B;  1IXM A;  2LGW A;  5B1A B;  1IDS A;  1IBM O;  5BXZ A;  4BAY A;  4JF3 A;  4DXW A;  1VQK V;  2E76 B;  5IJ9 B;  5F2V O;  3K0D A;  5EBL C;  2XAJ A;  1YI2 V;  5B1B B;  3A2F A;  2XOK G;  4FZ1 A;  2Q7E A;  4X62 O;  4DV6 B;  3X2Q B;  1BSM A;  1NTK H;  4MW3 A;  1BT8 A;  4D7S A;  2UUB B;  4X89 A;  4YXW G;  2R9R B;  2OTL V;  2HG5 C;  1EN4 A;  4FFK A;  4O2B B;  1GK9 A;  1OCO B;  4RQE A;  1RPR A;  2CH7 A;  3ETD A;  2PI4 A;  4QJF B;  4LF4 O;  1R1B A;  1I5X A;  4DR7 O;  4MVZ A;  1ZWI C;  2F95 B;  4GKK O;  2IH1 C;  1NVP B;  3OD4 A;  4GKJ B;  1FXV A;  4WBN A;  4DV3 O;  1BHA A;  3T2M A;  4YIO A;  4B3R B;  4U3J B;  2PGG A;  1EFR G;  2EX3 A;  3CCR V;  4JYC A;  2ZDI C;  1K92 A;  1FPO A;  3J7A U;  2XAQ A;  5E1A C;  4X1I A;  1TVK B;  2EIM C;  3CHX A;  4UB6 Z;  3VQY A;  4FLT A;  4BW5 A;  5LOV B;  4X66 B;  1HR0 B;  5DM6 V;  3CCL V;  4B7E A;  3LSU A;  4EFB A;  4HNA A;  4LF5 B;  1CP9 A;  4HBN A;  2DJV A;  3OM3 B;  2GUZ B;  3HKE A;  1IVS A;  5LGT A;  1XMO B;  4ZOL A;  3UT5 A;  1M93 A;  1IUR A;  2CE4 A;  4H44 B;  1Y74 A;  2WPD G;  2KQX A;  2LP7 A;  5EZY A;  2ZXW C;  1V55 B;  1AIL A;  4TV8 B;  2WAM A;  1GTO A;  2WSS G;  1OJH A;  4K0K B;  4BIU A;  2GV9 A;  3CWB H;  5H6R A;  2W0F C;  3CC4 V;  2HFE C;  5J2U A;  1WJZ A;  4RO2 A;  3RYC B;  2UXB O;  1TUB B;  3AG3 B;  1CXZ B;  1MSW D;  1X4T A;  2YS8 A;  4R50 A;  3RN4 A;  2UU9 O;  4LWS B;  2ZR3 A;  2QKC A;  5B1A C;  1NI8 A;  1NT2 B;  1XOU A;  5EBM C;  1SQV H;  4LC1 A;  2JGU A;  3BEH A;  2MW2 B;  4MVU A;  2BSK B;  2IJK A;  1QHT A;  1K5S A;  1WA8 A;  4PA3 A;  2OT5 A;  3CRQ A;  5B1B C;  1QR9 A;  5KA5 A;  1GN6 A;  4LFA B;  2Q9L A;  1QU7 A;  1B06 A;  3M8A A;  5FNV A;  3X2Q C;  4KL1 A;  1G1X B;  4MVO A;  3I56 V;  4X1Y A;  4I4T B;  4NR1 A;  4DUY B;  3OW2 U;  2CTR A;  4DV6 O;  3VOU A;  2ILM A;  3D36 A;  1L1F A;  4OGQ B;  4AHC A;  1KMI Z;  2UUB O;  1H2N A;  5LP6 A;  3SYQ A;  1KD1 W;  1IBK B;  5A9G A;  2ZM6 O;  2OWO A;  2QWP B;  1ZAU A;  5JVD A;  1XNR B;  3ABM C;  2R70 A;  3HKC A;  4DYL A;  2GTS A;  4JI8 O;  3ABT A;  2WLL B;  4JPR A;  1KB9 F;  4QE7 A;  1YXB A;  1B04 A;  4JGS A;  1DTO A;  2IJJ A;  5J2T B;  4Q6G A;  3QTC A;  2A79 B;  3RYI B;  2DE0 X;  3R66 A;  2QKA A;  2QWQ B;  3MAQ A;  2Y4U A;  3U0Z A;  1N32 B;  1K7D A;  3U11 A;  1QVG U;  4DW0 A;  4DK0 A;  2YEV A;  3JAW A;  5IYZ B;  2OIG A;  1GM7 A;  2A3Q A;  4JI4 B;  2L6L A;  3TJT A;  5B5E Z;  4DRX A;  3DXR A;  5CA0 B;  3EXA A;  1XEQ A;  1EN6 A;  3N2G A;  1S77 D;  2WLI B;  4D7T A;  4X66 O;  4JZG A;  1HR0 O;  3G80 A;  1XMQ B;  1E79 G;  4LF9 O;  5KA6 A;  2E5L O;  1K33 A;  1SER A;  1YEW A;  3L73 H;  1YTF B;  2X6C A;  3SPC A;  3JSL A;  3KKY A;  4YIP A;  3DC5 A;  4I0X A;  4MTF A;  4KHP B;  3B8M A;  1HDJ A;  4UVA A;  1XMO O;  3CMA V;  3G6B A;  2NNU A;  5IJ0 B;  1I5Y A;  1GM8 A;  3CP1 A;  5BY1 A;  2R9A A;  1R3J C;  4K0K O;  3PN1 A;  4GYC B;  5KMG B;  1H2G A;  4IYH A;  4Z1V A;  4YJ3 A;  3ZBH A;  2ZDI A;  4I50 B;  4MVR A;  3OMI B;  2DYS B;  2P4V A;  2D2C B;  2LW7 A;  3UCS C;  4DR2 B;  1AI6 A;  5CBH A;  4H0L B;  5JH7 B;  3LNN A;  2F66 C;  3RFR A;  3ABU A;  4IHJ B;  1N4C A;  5IWA B;  3BAA A;  4OPA A;  3HR0 A;  1SQF A;  2W6J G;  4XBF A;  4GUN A;  1Y66 A;  3CXC U;  5J9P C;  3M7M X;  3CCS V;  4JAU A;  4DR4 B;  1I0H A;  1S5J A;  3RVZ A;  4NVP A;  1VQN V;  1XNQ O;  3ZX6 A;  1HNX O;  4Z2W A;  1W2B U;  3KZI Z;  4PD4 F;  2GSM B;  4DR1 O;  1VF5 B;  1SES A;  2KB1 A;  4LFB B;  2X0L A;  5LYJ B;  2VQF B;  3EHB B;  3ZHU A;  4EEQ A;  1Y76 B;  4FLZ A;  4LFA O;  1IXB A;  2WLJ A;  4RUF A;  1GM9 A;  2JS5 A;  1PD3 A;  4LF8 B;  3W7S A;  3EFF K;  1P84 F;  4K8X A;  5EYP A;  1BMF G;  2Q0O C;  1LUV A;  4CS2 A;  4EB6 A;  1RSO A;  1SQB H;  4JTC B;  2AXT Z;  2JS3 A;  3ZRW A;  1BQ0 A;  4WFH A;  4F4L A;  1N34 O;  2OCC B;  2EIL B;  4MTG A;  1F4N A;  1IX9 A;  1IBK O;  1TUE B;  1XUQ A;  3QF7 A;  3WU2 Z;  1AJQ A;  3UO2 A;  4B08 A;  2QE7 G;  2Y48 A;  4O4L B;  1K97 A;  1JFF B;  1JOY A;  3GVM A;  4DV1 B;  1ZUQ A;  1YCI A;  3NXS A;  1N0N A;  4EFE A;  2H3O A;  2QSA A;  3CYO A;  4DV5 O;  2P6J A;  3ETE A;  4DV4 O;  2F93 B;  1NU1 H;  1N32 O;  2EIK B;  2DWE C;  2UUC B;  1VMG A;  3O9O A;  3K57 A;  2NN4 A;  3CJH A;  4JYB A;  2A06 H;  5CB4 A;  4MW8 A;  4DUZ B;  5DED A;  4O2B A;  3M99 B;  4YY3 B;  2FB5 A;  4PDM A;  2DYR C;  2AW9 A;  1IBM B;  2EIN C;  4TQF A;  1XMQ O;  5LBQ A;  4P9P A;  2A7W A;  5LMN O;  1KQS U;  2XHB A;  3RWR D;  2K9P A;  3VQX A;  3ZRS A;  4O4H A;  3JAM N;  2E3C A;  3IAY A;  1OCC B;  2P4K A;  5H6Q A;  5K1X A;  2AGA A;  4FLX A;  3FB8 C;  2JGD B;  4CBC A;  2BCC H;  2Q69 A;  1TVK A;  3IFX A;  2CGO A;  3APO A;  3ETG A;  4UV8 A;  5LOV A;  4TT3 G;  2GBO A;  3MHH C;  1W59 A;  2UXC O;  3LDE A;  5CN0 A;  3TXS A;  2YC0 A;  1YJN V;  1M57 C;  2M7W A;  3CRA A;  2GUZ A;  3FYI B;  3AG1 B;  5GW7 A;  5IWA O;  1SF9 A;  2F23 A;  3J80 N;  4MT8 A;  1H38 A;  3H1L H;  4CH5 A;  5ITZ B;  2N04 A;  2YIB D;  4DR7 B;  4GKK B;  4K3A A;  4O2A A;  2PF4 E;  2LGQ A;  3JYC A;  3HB3 B;  3B09 A;  2YID A;  3AG2 B;  4TV8 A;  1I7F A;  4DR4 O;  4QE9 A;  1FS0 G;  1Q86 W;  3QNE A;  4DW1 A;  2B9Z A;  2YUA A;  3QO5 A;  3ZN0 A;  1YIJ V;  5KAF Z;  3H1H H;  4TV9 B;  1AI4 A;  1KKD A;  1M5I A;  4HAM A;  2VQF O;  1MG1 A;  4DR3 O;  1TUB A;  2BE3 A;  3ZMV A;  4GT1 A;  4J7Z A;  3W7U A;  1FXK B;  3C3T A;  2EIL C;  4LWS A;  4LFC B;  2EZO A;  3FKS G;  5LHG A;  5FPR A;  1YF2 A;  4H37 A;  2VWK A;  3RBZ A;  1PL0 A;  3CRM A;  1UFI A;  4QIW F;  3ETQ A;  2ODM A;  2DQ3 A;  4E2L A;  5L3C A;  2HJD A;  3SYO A;  4X1K B;  2PZS A;  4PA4 A;  4J7K A;  3WB0 A;  2GTA A;  4B3T B;  4DV1 O;  4KUM A;  4JTD B;  2EIK C;  1H8H G;  2WLK A;  1J95 A;  2QM4 A;  4ZI7 A;  4DV0 O;  2UXB B;  4XDK A;  3MDS A;  2V1D A;  2KG7 B;  1GKF A;  3UO3 A;  2Z3Y A;  2Z5U A;  1PPJ H;  2DW4 A;  3L70 H;  2UUC O;  1EBO A;  4HZ3 A;  5IY5 B;  4JAV A;  1R73 A;  3E22 B;  3JAT B;  4TUY B;  1Q5O A;  3SYC A;  1BQZ A;  5H2F Z;  4PDR A;  5CBF A;  3AG4 B;  4GX5 A;  5DN6 G;  5EK0 A;  2DN9 A;  3E86 A;  5J2T A;  3L75 H;  1GAX A;  5IT9 N;  5LL6 Y;  4FM0 A;  3DSQ A;  4LNU B;  3OAA G;  3IC9 A;  3QVN A;  1EZV H;  3E8B A;  1E1R G;  1G6U A;  2DQ0 A;  1AJP A;  1URF A;  3JAS B;  5LXT B;  3WFV A;  3ZMS A;  1XHX A;  2CAZ C;  1WLE A;  4PA6 A;  1KP3 A;  5KX5 A;  5BMV B;  1NTZ H;  2ZM6 B;  1VAR A;  3APQ A;  1WPB A;  1HP8 A;  4JAS A;  4B7K A;  1H2L A;  1AP6 A;  1OV9 A;  4GX1 A;  5GON B;  3D8C A;  1R6N A;  1GH6 A;  4X9Q A;  4JI8 B;  4PI2 A;  1FYJ A;  3SJA C;  3JSN A;  4UXN A;  3ZHV A;  1JPX A;  5IJ0 A;  1VQ4 V;  2HEP A;  1MZE A;  3IJ4 A;  2W6I G;  1MAB G;  4I50 A;  3CCJ V;  3MD0 A;  2EJR A;  3KCY A;  4LH6 A;  4O4J B;  1PNM A;  3H9V A;  4DR5 O;  3A0B Z;  2PY5 A;  1UPG A;  1WAZ A;  5KLV H;  4FLU A;  2RMK B;  1AR1 B;  4NB5 A;  1D5N A;  5B3S B;  2HLD G;  4I9Q A;  2XAH A;  1QVF U;  2XUM A;  2LO1 A;  2P5O A;  1QQC A;  4LF9 B;  4LFC O;  2CTP A;  2E5L B;  2XND G;  3A0R A;  1FFX B;  3R65 A;  3LSS A;  5JQG B;  1N36 O;  2ZNJ A;  2P06 A;  1S0V A;  1S76 D;  2B5U A;  3ZMT A;  4DK1 A;  3J81 N;  1NVP D;  2E74 B;  3OGI B;  4BR6 A;  4D6T H;  2JEU A;  3JD3 A;  1Q6H A;  1GN4 A;  1V9P A;  4BW9 A;  4BWA A;  2IBZ H;  3HKD A;  3SPH A;  4B3T O;  1R3I C;  5HFM A;  3FB6 C;  1Q7Y W;  3OFN G;  2OYQ A;  4YJ2 A;  2P22 C;  3ABL B;  4H33 A;  1E1Q G;  2JIZ G;  3LSQ A;  5B1O A;  2EIJ C;  1XRE A;  4ZHQ A;  3AG4 C;  4IIJ A;  4UVC A;  3T4Z A;  4L8J A;  1RM1 C;  1TGO A;  4PEL A;  1XNQ B;  1YJ9 V;  4G28 B;  3CRC A;  2YI8 A;  1R3K C;  4O4L A;  1HNX B;  2Q73 A;  1W0J G;  3QO8 A;  5IYB O;  2R9I A;  3CE2 A;  4DR1 B;  3BPZ A;  1MA1 A;  4FM2 A;  1XL4 A;  1SA0 B;  4WFG A;  3N27 A;  2P67 A;  1S3J A;  2QKS A;  1F7Y A;  2Q7H A;  4FMT A;  1Y6X A;  1AR5 A;  3D3Q A;  2RDC A;  4W4L A;  1WB8 A;  4U7O A;  4RQF A;  1NJI W;  5L3B A;  1NH2 B;  1ZLZ A;  1VEW A;  3PJS K;  4ASU G;  1RFY A;  3N2K B;  3RYF B;  4F6E A;  2ZE7 A;  1N34 B;  4I55 B;  3F7Y C;  1OCO C;  2Z0A A;  2YIB A;  3K04 A;  1VQM V;  1KEC A;  1M4U A;  1YSC A;  2FYU H;  3BA8 A;  4DR6 B;  2R72 A;  1WP8 A;  4UCS A;  1K3E A;  5KHJ A;  4FLV A;  2QJ1 A;  4O4I B;  3OUS A;  1FXH A;  4DV5 B;  4XDL A;  4JI7 O;  3CCV V;  1HNW B;  4DV4 B;  1OCZ B;  4ICG A;  4CH6 A;  1KUQ A;  1KKC A;  2XAS A;  1ZL8 A;  3G6E V;  2MK3 A;  3ZHQ A;  1Q3E A;  3JAK B;  3F7V C;  4U3F H;  4X65 O;  4WFE A;  5B3S C;  3B40 A;  3GB7 C;  1TA8 A;  3E8F A;  1K9M W;  2ATK C;  1KP2 A;  3ASO B;  1CEZ A;  1K5Q A;  3JAL A;  3UKM A;  1BS3 A;  1M9N A;  1P7B A;  2F4V B;  1N0J A;  3E83 A;  5LMN B;  1QBZ A;  1AR4 A;  1ARO P;  1V55 C;  2LQT A;  3E8G A;  3ZRX A;  2X6B A;  1NQT A;  1HNZ O;  2YXY A;  4FFB B;  4FLW A;  2ZT9 B;  1K73 W;  1XIL A;  1N33 B;  2BTO A;  3ICX A;  1H2K A;  3H1K H;  4X88 A;  1NKD A;  3K0G A;  3O65 A;  5H5N A;  2QA4 V;  3RYH A;  3AK3 A;  5IYC O;  3JCU Z;  4A5U B;  2P7T C;  3CCQ V;  3AG3 C;  2UXC B;  2CH7 B;  3GWK C;  4LH7 A;  4K35 A;  1MMM A;  3CX5 F;  3CCM V;  2FML A;  1IBL O;  1NR1 A;  3HKB B;  1XI1 A;  1GRJ A;  1SQG A;  4OX9 O;  3CD6 V;  2N05 A;  3K5L A;  1MZF A;  1Q8I A;  4FLY A;  2QR4 A;  1YTF D;  2Q6A A;  1H8E G;  3S3W A;  3P3P A;  5CBG A;  1WNS A;  4MVQ A;  2H8P C;  2M6Y A;  4L87 A;  2ZIO A;  3STL C;  1AP5 A;  4QGP A;  2BTQ B;  2ZIN A;  4F6R A;  4DR3 B;  4JI2 O;  2FTK A;  2ZE8 A;  3OR7 C;  5GTI Z;  4E4E A;  4HNA B;  2Q68 A;  1F51 A;  3HKE B;  5KHH A;  4YHH B;  3JAT A;  3UT5 B;  1Q6U A;  1EN5 A;  1LR1 A;  4Z1M G;  3W7W A;  3SJC C;  1Z2G A;  3K3W A;  2ZKO A;  2JRI A;  5K1P A;  3JAR B;  3G67 A;  1BCC H;  2EJ7 A;  5IJ9 A;  4LNU A;  3H01 A;  3FFQ A;  5CMU A;  3GWO A;  4DR6 O;  4I7Z B;  3SPJ A;  1NS1 A;  4IT5 A;  1OCZ C;  4QNH B;  3CB2 A;  1VQP V;  3JAS A;  5LXT A;  1BE3 H;  5EBW C;  1VF7 A;  1K4D C;  1US6 A;  4DV0 B;  1HNW O;  4X64 B;  1P7G A;  1M56 B;  1JVM A;  5BMV A;  4WCE V;  3I55 V;  5IDJ A;  2JEX A;  3CC7 V;  4CC6 A;  1JR9 A;  2OTJ V;  1PL4 A;  3OTF A;  2Q5Z A;  3B2E E;  5FLX N;  1DK1 A;  2IJI A;  1WA8 B;  4PV1 B;  2XTA A;  5EC1 C;  1JX9 A;  4J10 A;  1JJ2 U;  3LUT B;  3FD9 A;  3Q4H B;  1WP7 A;  2RCV A;  2Y0P A;  3CEI A;  2PYL A;  2Q7G A;  4X1Y B;  2RJZ A;  4OXS A;  2F4V O;  2X6A A;  1NTM H;  5DEC A;  4R6Z A;  3L71 H;  3NR7 A;  2H94 A;  3SYA A;  4BIO A;  2BOB C;  4U3J A;  4LF6 O;  3BFR A;  3CS5 A;  2JVD A;  4DO2 A;  2UXN A;  3STZ C;  1FJG O;  2DOS A;  2ZD9 A;  1N33 O;  4GCZ A;  2DYS C;  4X20 B;  5JVD B;  2HKO A;  1FFT B;  3HKC B;  1K8A W;  4WFA V;  4PA9 A;  1V54 B;  3P32 A;  4UVB A;  2ZE5 A;  4N21 A;  4LBE C;  1UJW B;  1FFX A;  5JQG A;  3ZIA G;  1EZJ A;  1L0N H;  2WLH A;  3OGC C;  4NXN O;  2ARH A;  2ZE6 A;  4UCT A;  5IE9 A;  3JD1 A;  4AI8 A;  2EZP A;  4DRX B;  3AK2 A;  5LGN A;  4J9Y B;  5A2Q N;  1YVW A;  3RYC A;  4DR5 B;  4IL6 Z;  3OTO B;  3W7T A;  4P9O A;  1K34 A;  2VQE O;  2OCC C;  5KUK A;  1ROP A;  1SRY A;  1J5E B;  4JI1 O;  4YHH O;  3BCC H;  3ZN1 A;  1W0K G;  1PNL A;  1DF5 A;  5KAI Z;  5C8Y B;  2BSK A;  1N36 B;  1DLB A;  4NKG B;  1SA0 A;  2F43 G;  5LHH A;  4YJ3 B;  2RNB A;  5KHK A;  3K79 A;  3BY6 A;  3ASN B;  5TIS Z;  3FAV B;  2Q4P A;  2EIM B;  3F5T A;  3T1H B;  5JJE B;  1SKV A;  4I4T A;  1ENV A;  1O9H A;  1I94 O;  3N2K A;  1Q81 W;  1VQ8 V;  4X64 O;  4JV5 O;  4I55 A;  4JI5 B;  1TAE A;  4GZR B;  1QNM A;  3BAB A;  4CH3 A;  3BA9 A;  4JYY A;  2ZXW B;  5JCO C;  3ABK B;  1U96 A;  4W4K A;  1WN7 A;  1PKX A;  2WLL A;  1EM1 A;  2W0X A;  1VP7 A;  1GN2 A;  4CC5 A;  2BOC C;  2QWO B;  2HHH O;  5LHI A;  1JJO A;  3RYI A;  1H2M A;  5L3G A;  4DV7 O;  4ZIB A;  1B3Q A;  1OCC C;  1G4Y B;  4QPJ A;  3P30 A;  4N23 A;  4EB6 B;  4CS4 A;  4J11 A;  5EIB D;  1RSO B;  3A0H Z;  3ZRW B;  1LUW A;  4H13 B;  3OT7 A;  5IYZ A;  1WB7 A;  4C7U A;  4IYI A;  4P30 A;  1CPY A;  1H2S B;  1Y4M A;  5CA0 A;  3TET A;  3E8H A;  3SPG A;  4R7C A;  4UV9 A;  1V54 C;  3ZMZ A;  1XL6 A;  1NZ6 A;  3I5D A;  1M90 W;  4MSW C;  4PHZ A;  2VS0 A;  3G71 V;  1T5E A;  2WLI A;  1AJN A;  2ZIM A;  1YJW V;  1SZT A;  3E2E A;  3AG1 C;  2V7Q G;  1DF4 A;  1IZ3 A;  4G2K A;  4ZBM A;  2EBO A;  3AG2 C;  1YIT V;  1AI5 A;  4FFB A;  1OCR B;  4PDL A;  4UFZ A;  4JI7 B;  3D3I A;  4NTX A;  3K59 A;  2ITD C;  1BHB A;  3CJH B;  5KHG A;  2WWW A;  2QM7 A;  4RUE A;  5CB4 B;  5KMG A;  3LDC A;  1S5H C;  1Q90 D;  4U7N A;  1MSD A;  1FKA O;  3ML0 A;  4AQY O;  4UCO A;  2QWR B;  4X65 B;  1FXK C;  2JDI G;  2Q8V A;  4JYA B;  3ABM B;  3BVO A;  1FAF A;  3RGB A;  5FPO A;  5JH7 A;  4B3S O;  1S72 V;  3BRC A;  1LNQ A;  1SZX A;  4IHJ A;  1SQX H;  2CTW A;  5JWP A;  3CPW U;  3OTO O;  4KP4 A;  1SC5 B;  3HKB A;  3SR2 C;  3L9D A;  4O4H B;  1VQ9 V;  2JK5 C;  1J5E O;  1QLN A;  2XT9 A;  5LA6 B;  3K9A A;  2UUA O;  2NR5 A;  2IW5 A;  4JI0 O;  5JJJ B;  1AVM A;  3ASN C;  3DGE A;  2KSD A;  1ZTE A;  5BR8 B;  2IU0 A;  1HNZ B;  1DGS A;  1VF6 C;  5EIB C;  5LYJ A;  2BTQ A;  1QLE B;  1Y76 A;  3H1J H;  2EUL A;  1SQQ H;  3T1H O; 
#chains in the Genus database with same CATH homology
 1QBZ A;  3T4D A;  4HYO A;  4JYB A;  1ARO P;  1V55 C;  4MW8 A;  3E8G A;  3ZRX A;  2X6B A;  3M99 B;  3OMA B;  4Q20 A;  1NQT A;  3CC2 V;  1YHQ V;  5IY5 C;  1K73 W;  2DWD C;  3ABK C;  1GO3 F;  2NLJ C;  4MTO A;  4PDM A;  2DYR C;  2EIN C;  4X88 A;  1GMG A;  1NKD A;  5LBQ A;  2AHZ A;  3K0G A;  5LGU A;  4QPK A;  4P9P A;  1KQS U;  2QA4 V;  5IYC O;  3ZRS A;  4MVS A;  3JD2 A;  1B6Q A;  2P7T C;  2YSU B;  3CCQ V;  2EIJ B;  3AG3 C;  4PDV A;  2QEX V;  1BL8 A;  1OCC B;  5H6Q A;  2WLM A;  3JCZ A;  1RM1 B;  1IXM A;  3FB8 C;  3W7X A;  5B1A B;  3CCM V;  4CBC A;  2Q69 A;  4BAY A;  4JF3 A;  4DXW A;  1NR1 A;  1VQK V;  3IFX A;  2IH3 C;  3K0D A;  3ETG A;  4UV8 A;  3CD6 V;  5EBL C;  4TT3 G;  2XAJ A;  1R6K A;  1YI2 V;  5B1B B;  3MHH C;  3ZRV A;  3LDE A;  2XOK G;  5CN0 A;  1VQO V;  1YTF D;  1PNK A;  2Q6A A;  1YJN V;  1H8E G;  1M57 C;  5CBG A;  4LCU C;  3X2Q B;  2M7W A;  4MVQ A;  2H8P C;  3FYI B;  3AG1 B;  4L87 A;  4X8A A;  5GW7 A;  3STL C;  4MW3 A;  3ZMU A;  3QO7 A;  2HR3 A;  2LFS A;  1H38 A;  4MT8 A;  3LNM B;  4X89 A;  4YXW G;  3OUF A;  2R9R B;  4FPP A;  3JYC A;  2FTK A;  3HB3 B;  3OR7 C;  2OTL V;  3AG2 B;  4QE9 A;  2Q68 A;  1F51 A;  1FS0 G;  5C93 A;  1Q86 W;  3QNE A;  1OCR C;  2HG5 C;  3QO5 A;  3ZN0 A;  1YIJ V;  1GK9 A;  1OCO B;  5L3E A;  4RQE A;  1RPR A;  3F5W C;  3ETD A;  2PI4 A;  4QJF B;  3IGA C;  4Z1M G;  1AI4 A;  2K1E A;  3W7W A;  1KKD A;  4HAM A;  1I5X A;  1MG1 A;  4MVZ A;  1ZWI C;  2IH1 C;  3K3W A;  1NVP B;  3ZMV A;  1FXV A;  4GT1 A;  5CA3 A;  3W7U A;  1FXK B;  1BHA A;  5H9C A;  3T2M A;  2EIL C;  3H01 A;  3IC7 A;  5CMU A;  3OEE G;  1NH2 D;  3GWO A;  2EZO A;  3SPJ A;  4P2Z A;  3FKS G;  1EFR G;  1OCZ C;  4QNH B;  3CCR V;  4JYC A;  1VQP V;  2C2A A;  2Y69 B;  2ZDI C;  5LHG A;  3B77 A;  1K92 A;  5EBW C;  1K4D C;  4H37 A;  2XAQ A;  5E1A C;  2GHY A;  3RBZ A;  4BIZ A;  1PL0 A;  2QM8 A;  2EIM C;  4QIW F;  3CCE V;  1M56 B;  1JVM A;  2DQ3 A;  4E2L A;  4WCE V;  4BW5 A;  5IDJ A;  3I55 V;  5L3C A;  2JEX A;  5DM6 V;  5HFL A;  3CC7 V;  2OTJ V;  4UUJ C;  3CCL V;  2ZQM A;  3B8N A;  3SYO A;  4PA4 A;  1VQL V;  1CP9 A;  1QLE C;  3OM3 B;  2IJI A;  4KUM A;  4JTD B;  2EIK C;  1H8H G;  2WLK A;  1J95 A;  2B1G A;  5EC1 C;  3UM7 A;  5LGT A;  1JX9 A;  4XDK A;  1JJ2 U;  2WPD G;  3LUT B;  1AI7 A;  2LP7 A;  2V1D A;  2ZXW C;  1V55 B;  4G27 B;  1GKF A;  5BZB A;  2Z3Y A;  2Z5U A;  2WAM A;  1GTO A;  2WSS G;  2DW4 A;  4OXS A;  2X6A A;  1EBO A;  4HZ3 A;  4BIU A;  5IY5 B;  4R6Z A;  3JD4 A;  4FK5 C;  4JAV A;  1FXK A;  1R73 A;  5H6R A;  2H94 A;  3SYA A;  3ABL C;  2W0F C;  2BOB C;  1NR7 A;  2DYR B;  3SYC A;  3DTU B;  3CC4 V;  2HFE C;  2EIN B;  3T1C A;  2JJ2 G;  4PDR A;  5CBF A;  4RO2 A;  3TCU A;  3AG4 B;  4GX5 A;  3FYE B;  5DN6 G;  4DO2 A;  2UXN A;  3STZ C;  5EK0 A;  2WLN A;  2ZD9 A;  3E86 A;  3AG3 B;  4GCZ A;  2DYS C;  3OE7 G;  1MSW D;  1Q82 W;  4R50 A;  2HKO A;  1FFT B;  3OAA G;  2ZR3 A;  1K8A W;  4WFA V;  3E8B A;  2UXX A;  4PA9 A;  1E1R G;  5B1A C;  1VQ5 V;  2DQ0 A;  1AJP A;  2IU3 A;  1V54 B;  3P32 A;  5EBM C;  4UVB A;  4LC1 A;  1ORQ C;  4N21 A;  3WFV A;  4JTA B;  3BEH A;  3ZMS A;  4LBE C;  4MVU A;  4RAI A;  3AEI A;  2IJK A;  1UJW B;  1K5S A;  4PA3 A;  2OT5 A;  2A0L A;  1WLE A;  5B1B C;  4PA6 A;  1KP3 A;  3ZIA G;  1EZJ A;  2WLH A;  1QR9 A;  3G4S V;  5KA5 A;  4FIP C;  3OGC C;  1M57 B;  4GX0 A;  1F23 A;  2P90 A;  4JAS A;  3X2Q C;  4WFB V;  4MVO A;  3I56 V;  3E89 A;  4GX1 A;  3JD1 A;  3K06 A;  1R6N A;  2EZP A;  5LGN A;  5IYD O;  3OW2 U;  4J9Y B;  3VOU A;  3JD0 A;  3D36 A;  3RW0 A;  1L1F A;  4ZKI A;  4UXN A;  3SYQ A;  4LP8 A;  1MOF A;  1KD1 W;  3CME V;  1JPX A;  4MS2 A;  1QCE A;  3W7T A;  3WG7 B;  1VQ4 V;  3ZJZ A;  4P9O A;  1K34 A;  2W6I G;  2OCC C;  5KUK A;  1ROP A;  1SRY A;  3ABM C;  1MAB G;  5L3D A;  1G8M A;  3CCJ V;  3MD0 A;  2EJR A;  3ABT A;  2LFR A;  2XAG A;  3ZN1 A;  2WLL B;  1W0K G;  4JPR A;  1PNL A;  1WPX A;  4QE7 A;  1COW G;  4JGS A;  1PNM A;  1DF5 A;  1DTO A;  2IJJ A;  5EC2 C;  2A79 B;  1DLB A;  1AR1 B;  2F43 G;  5LHH A;  2HVJ C;  2IJH A;  5B3S B;  2Y69 C;  2HLD G;  3SYP A;  3K79 A;  3BY6 A;  1THZ A;  1K7D A;  3ASN B;  3E35 A;  2XAH A;  1QVF U;  1QVG U;  2YEV A;  4GX2 A;  2EIM B;  3ASO C;  1ENV A;  2XND G;  3A0R A;  3OMN B;  1GM7 A;  3R65 A;  3LSS A;  1Q81 W;  3OR6 C;  2HVK C;  1VQ8 V;  1S0V A;  1S76 D;  2B5U A;  3ZMT A;  2ITC C;  1S77 D;  1NVP D;  2WLI B;  2X7R B;  5B1N A;  1JQ0 A;  4FJC C;  4PA7 A;  5L3F A;  1E79 G;  2JEU A;  5KA6 A;  3JD3 A;  1K33 A;  1SER A;  4WFF A;  2ZXW B;  5KUM A;  3ABK B;  1YTF B;  2X6C A;  3SPC A;  1N8R W;  3SPH A;  4MTF A;  3B8M A;  1R3I C;  1PKX A;  2JJ1 G;  2WLL A;  3FB6 C;  4UVA A;  5HFM A;  1Q7Y W;  3CMA V;  2B1I A;  2PI5 A;  2BOC C;  4J9Z B;  3OFN G;  3ABL B;  2NNU A;  4H33 A;  1I5Y A;  5LHI A;  1E1Q G;  2JIZ G;  1GM8 A;  3LSQ A;  4TSF G;  5B1O A;  3CP1 A;  2EIJ C;  1RPO A;  1R3J C;  3AG4 C;  5L3G A;  1OCC C;  1H2G A;  4UVC A;  1G4Y B;  4QPJ A;  3P30 A;  2ZDI A;  4N23 A;  4MVR A;  3T4Z A;  1RM1 C;  3RVY A;  3OMI B;  2DYS B;  4PEL A;  1KC8 W;  3KG2 A;  2XAF A;  1YJ9 V;  4G28 B;  1AI6 A;  1R3K C;  3ZRW B;  4EKW A;  5CBH A;  1W0J G;  3QO8 A;  5IYB O;  2R9I A;  1M1K W;  3FB7 C;  3ABU A;  4P30 A;  1CPY A;  1VQ7 V;  1Y4M A;  3OEH G;  3TET A;  3E8H A;  3SPG A;  4I9W A;  4R7C A;  1XL4 A;  4WFG A;  4UV9 A;  1V54 C;  2P67 A;  2W6J G;  1S3J A;  4XBF A;  3ZMZ A;  1XL6 A;  2QKS A;  1Y66 A;  3CXC U;  4MSW C;  4FMT A;  1M90 W;  2D3O W;  3G71 V;  2WLI A;  1VQ6 V;  5J9P C;  4TWK A;  4JAU A;  1AJN A;  4MTX A;  3CCS V;  1YJW V;  1SZT A;  2YEV B;  3E2E A;  4U7O A;  3RVZ A;  4RQF A;  1VQN V;  3AG1 C;  1NJI W;  2V7Q G;  1DF4 A;  1K4C C;  5L3B A;  1NH2 B;  1JCH A;  1W2B U;  3PJS K;  4ASU G;  2A9H A;  3SPI A;  3MHS C;  4G2K A;  4ZBM A;  2GSM B;  2EBO A;  3AG2 C;  1HWY A;  1OHH G;  1SES A;  2KB1 A;  2AHY A;  5FL7 G;  2X0L A;  1YIT V;  1AI5 A;  4MVM A;  3F7Y C;  1OCR B;  3EHB B;  1QR8 A;  2WLJ A;  3K08 A;  4PDL A;  4RUF A;  1GM9 A;  4R8C A;  3D3I A;  1PD3 A;  1OCO C;  3K04 A;  2ITD C;  2QTO A;  1BHB A;  3W7S A;  1OZ0 A;  3EFF K;  1BMF G;  2WWW A;  2QM7 A;  4RUE A;  1VQM V;  1KEC A;  1YSC A;  3LDC A;  1S5H C;  4U7N A;  4XDJ A;  3SJQ C;  1F4M A;  3ML0 A;  3WG7 C;  1K3E A;  2Q67 A;  4JTC B;  3ZRW A;  4WFH A;  3TK1 A;  4F4L A;  2OCC B;  1FXK C;  2JDI G;  3ABM B;  2EIL B;  2ZR2 A;  3OUS A;  4MTG A;  1F4N A;  1S72 V;  1FXH A;  1LNQ A;  4XDL A;  3CCV V;  1TUE B;  1OCZ B;  4KFM A;  3CPW U;  4KP4 A;  1AJQ A;  2XAS A;  3G6E V;  3HPL C;  2MK3 A;  3VBB A;  1VQ9 V;  2QE7 G;  2JK5 C;  2Y48 A;  1QLN A;  1R3L C;  3FB5 C;  3K9A A;  1K97 A;  2CK3 G;  3CCU V;  3F7V C;  1JOY A;  2IW5 A;  4WFE A;  5B3S C;  4I5S A;  1M56 C;  1NBM G;  3NXS A;  3ASN C;  3GB7 C;  1SET A;  3DGE A;  3E8F A;  1K9M W;  3CYO A;  2ATK C;  1KP2 A;  3ASO B;  2IU0 A;  1CEZ A;  2P6J A;  3ETE A;  3K03 A;  1K5Q A;  4CZZ A;  1QLE B;  3UKM A;  1P4R A;  2HJF C;  1M9N A;  3LDD A;  3ZCC A;  1P7B A;  2EIK B;  2DWE C;  4WF9 V;  3E83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...