2Q69A

Crystal structure of nak channel d66n mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
b'MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGNGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Metal transport, membrane protein
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q69A00
1OCZC 2IH1C 1P7BA 4MTGA 4HZ3A 1ORQC 3T4DA 4GX0A 4XDKA 1R3JC 2ITCC 2R9RB 3F5WC 2WLIB 4WFHA 3SPGA 4HYOA 1OCOC 4X88A 3SPIA 3STZC 5EK0A 2A9HA 2WLHA 3OUFA 3FB7C 4WFFA 3LNMB 4QE9A 2QTOA 2AHYA 4LP8A 4RUEA 3ZJZA 2QKSA 2X6BA 3ASOC 2EINC 5IY5C 1K4CC 3T2MA 5EBMC 3BEHA 1R3LC 3E8GA 4KFMA 2WLLA 2EIMC 2BOBC 4MVUA 4TWKA 5EC2C 2YEVA 3EFFK 2DYRC 4PA3A 4R50A 2ZXWC 4PDRA 4RUFA 5EC1C 3ASNC 5CBFA 2BOCC 4J9ZB 3E8HA 3K06A 1XL4A 3RBZA 3K0DA 4MVZA 4CBCA 2Q67A 4P9PA 3TCUA 3R65A 5KUMA 2DWDC 1OCRC 1M57C 2P7TC 2HJFC 4PA9A 3SYOA 3T4ZA 2A0LA 5EBWC 3FB8C 3AG2C 3E8BA 4R8CA 3T1CA 4DXWA 3OR6C 3SYPA 1R3IC 3FB5C 4JTCB 1OCCC 1S5HC 1XL6A 4P30A 1ZWIC 5CBHA 3E8FA 4J9YB 4MW8A 4MS2A 4R7CA 3SYQA 5KUKA 2HFEC 2HVJC 2X6CA 2ZD9A 2WLJA 4H33A 2ITDC 4X89A 3E86A 2ATKC 4MSWC 4X8AA 3SPCA 3SYCA 4R6ZA 3TETA 3F7VC 4ZBMA 4MW3A 3WG7C 4MVSA 4XDLA 5B1BC 3E89A 4PA7A 1K4DC 3ABLC 1M56C 2HG5C 2K1EA 2Q69A 2Y69C 3PJSK 4G27B 4GX2A 4I9WA 4PA4A 4PDLA 1J95A 2DWEC 5EBLC 1BL8A 2EIJC 3RW0A 4PA6A 3K0GA 1JVMA 4LBEC 5E1AC 2A79B 1QLEC 2WLNA 2X6AA 3ZRSA 3STLC 4EKWA 4MTOA 5CBGA 5B3SC 3HPLC 2EIKC 2Q68A 2WLIA 3SPJA 4G28B 4GX1A 3RVZA 3X2QC 3GB7C 2OCCC 3ABKC 3IFXA 1KKDA 2AHZA 3UKMA 2WLMA 3AG4C 3OGCC 4JTAB 2Q6AA 3K03A 1G4YB 4JTDB 4MVOA 4QE7A 4BW5A 2KB1A 2JK5C 3LDCA 5B1AC 4XDJA 4H37A 2WLKA 3RVYA 4GX5A 3UM7A 2H8PC 1V54C 3LUTB 4RAIA 4WFEA 5BZBA 4P9OA 4OXSA 3SYAA 4RO2A 3JYCA 3AG3C 4LCUC 3VOUA 4UUJC 4QNHB 1LNQA 4PDMA 3FB6C 3LDEA 3LDDA 2W0FC 4MVMA 3AG1C 2WLLB 2EILC 1R3KC 3OR7C 4WFGA 2HVKC 3SPHA 4F4LA 3F7YC 2DYSC 4MVRA 3K08A 3ABMC 5J9PC 4PDVA 3OUSA 1V55C 3K04A 3IGAC 4MTFA 4MVQA 4P2ZA 3KG2A 3SJQC 2IH3C 3E83A 2NLJC
chains in the Genus database with same CATH superfamily
4JYYA 4MTGA 1VARA 1ORQC 2AXTZ 2PI5A 4JV5B 2ZR2A 1EZJA 4YJ2A 1OCZB 4DV6O 1OCOC 2VQFO 2QM4A 2EJ7A 2ZCEA 1B06A 5FNVA 2Q0OC 5LXTA 4DUZB 4LWSA 2LW7A 5JWPA 1S72V 2CTQA 4QGPA 2UU9O 1HWYA 1TUEB 4KFMA 4JI0O 2HLDG 2FTKA 2EINB 5JJEB 1KP3A 3W7XA 4UVCA 1Y67A 1SF9A 2A7WA 3RYCB 2A0LA 4LF8B 3OR6C 3BABA 1FXKB 4I5SA 2Y4UA 3ZRVA 1OCCB 2OT5A 4I4TB 4H33A 4LF6O 4LF4B 4YIPA 3UT5A 5JVDB 2E3CA 4XDLA 4WF9V 4LFAB 5CA0B 5GONB 1M56C 2CK3G 5BR8B 4I9WA 2R70A 4CC5A 5JJNB 2WLNA 1AJPA 3DSQA 3STLC 4U3JB 1QBZA 1XMQO 4F6EA 2E74B 4DW1A 1LUWA 1HW7A 3ZMSA 5DECA 4CH4A 1G8MA 1ZUQA 3T1YO 1G4YB 4CS3A 5IJ0A 4FZ1A 3AG4B 1E1RG 3E2EA 1YI2V 2F1MA 1D2DA 1QNMA 1ROPA 1IBLO 1YXBA 1IZ3A 3A0BZ 4B3SB 2BTQB 2LO1A 1W0JG 3RYIB 5IYZB 4I9QA 3B77A 4RWUA 1IDSA 2UUAO 3CCRV 3CRMA 5LMNB 3AK3A 1OCZC 1NH2D 1AVMA 4KHPO 2JJ2G 2JGDA 4B3TB 3JD3A 4WFHA 3RYHA 5IJ9A 2WLHA 1TUBA 3M8AA 4NVPA 1NKDA 3OE7G 4QE9A 1VF7A 2Q73A 1EFRG 4JI6B 4JI8B 2KKWA 1MMMA 1G6UA 2EINC 3T1HO 3JARB 2CDYA 2HKOA 1QR9A 2WWWA 2YC0A 1HNWB 5EC1C 2VWJA 3S3XA 4J7ZA 3RBZA 1R73A 2Q67A 1GM7A 2IJHA 2DWDC 1PD3A 4O2BA 4UCVA 2P7TC 3WB1A 4CS2A 3LSUA 2LJ2A 1OCCC 4OX9O 1VEWA 1XMOB 3AG2B 2PY5A 1FD9A 1XNQO 3SYQA 2HVJC 4MSWC 3ZRWB 1Q81W 1IBKB 1Y6XA 1HNXO 4W4LA 2ODMA 3BVOA 4MW3A 4K0KO 2Y4TA 3BPZA 2BSKA 4IIJA 3FKSG 4J7KA 4DR1O 5JQGA 2Q9LA 4PDLA 3K0GA 3ABLB 5CBGA 3EXAA 1JR9A 5KA5A 1YTFB 1VF6C 3ABKC 1L1FA 5KA6A 2LFRA 2WLMA 4JI7B 3WFVA 3AG4C 4LF6B 3KCXA 4D6TH 4MVOA 1RFYA 5LOVB 4CH6A 1WAZA 1RSOB 5B1AB 4I7ZB 5AG2A 5LMUB 3JSNA 1SZTA 2GUZA 4DV5B 1I94B 2QWPB 2Q0AA 1SQVH 3RYFA 4YJ3A 2PZSA 3ABUA 2UXNA 1RPOA 4UVAA 1SQFA 4Q20A 1FS0G 4O4LB 3T1YB 1GMGA 4XBFA 1IURA 1YDXA 1H2NA 2H94A 3JATB 4TUYA 1JCHA 2QDOA 2DMXA 2GV9A 2GDSA 2BTOA 2QKSA 4JYBA 4MVUA 2BOBC 1RP3B 2C2AA 4R50A 1KMIZ 5KHKA 4RUFA 4BIZA 1F51A 3QTCA 2DJVA 3ZX6A 3AG2C 1SA0B 1Z5VA 3SYPA 1QVGU 5LYJB 3DGEA 2YDEA 3A2FA 2MK3A 2HFEC 2X6CA 2ZINA 2ITDC 1K3EA 4DYLA 1URFA 3KZIZ 2QM8A 1M5IA 2ZNIA 1CP9A 3ABLC 5B1BB 2Q69A 1U97A 2L35A 2PF4E 4PA6A 2XNDG 3ZRSA 3SPJA 4FLZA 4FM0A 1AROP 3X2QC 1FXHA 4PELA 1G1XB 3GB7C 2XT9A 4FMTA 3AEIA 4GKJB 4X66B 1XNRB 4UFZA 4TV8B 2F43G 5B1AC 2Q8VA 2QWQB 4RAIA 4DR1B 4P9OA 4OXSA 4K8ZA 1LNQA 1S3JA 1KQSU 1S77D 1AI4A 1AJQA 1N0JA 2LFSA 4I50A 4X1KA 4YHHB 2GTAA 3JAWB 3CPWU 2UUBO 1FJGO 1BE3H 3CCMV 4LFCO 2N74A 3N2KA 4ZOLA 2NLJC 3ZIAG 1YVWA 3A0HZ 1NJIW 3JCUZ 3N2GA 3DXRB 4NTXA 4DR3O 1GN3A 1QCEA 3FB7C 2JDIG 4AHCA 5H5NA 1M4UA 4RUEA 4I55A 5EIBD 2PUSA 4O4IA 2QEXV 3CJHA 2OYQA 3UO2A 3DC5A 2CGOA 4DV7O 2WA4A 5D5QA 4EFBA 3CCQV 2YXYA 3E8BA 2QSAA 1VF5B 3W7SA 1S5LZ 3KCYA 5HFLA 3OTOO 3TJTA 2KQXA 4FVMA 4LNUA 1ZTEA 4ZHQB 3O9OA 3L73H 5B1BC 4KXRA 3B4SA 2F4VB 1BHBA 5B5EZ 3CX5F 4UB8Z 3ZMUA 4JI3O 3CWBH 1GO3F 2W0XA 3A0RA 1VQ8V 5B3SC 2WLIA 2EIJB 5CB4A 2OCCC 3S3WA 1FYJA 2YICA 2ZKOA 4NTWA 2P67A 1MG1A 3AG1B 4JI4B 5IWAB 1X59A 3BA9A 2Y48A 5LGUA 2OCHA 4J42A 1F4MA 3TXQA 1ZL8A 1HP8A 1YCIA 4DUYB 1QVFU 1X4TA 1NVPB 5LA6A 1SQBH 4DV1O 3QF7A 5LBQA 3HKBA 4JZ2A 1W59A 4MVRA 3CE2A 2AZ2A 3G6EV 1BZKA 4HZ3A 1J5EO 3HKDA 5J2UB 1KU9A 5LHIA 4JV5O 2B5UA 3JD0A 4HNAB 1KUQA 4JASA 4BAYA 4DUZO 4PD4F 1A32A 4Z1MG 2X6BA 3P3NA 1GM9A 1GKFA 1K97A 5EBMC 3BY6A 3CMAV 3SR2C 1E1QG 1WPBA 1F4NA 4LF8O 4FIPC 5IYDO 2HJFC 1KECA 2IJJA 4DXWA 3HKEB 4Z1VA 2OWOA 5BMVA 4P30A 2YXHA 4J9YB 4MW8A 2CH7B 2X7RB 2FB5A 1XBLA 4JYCA 1N8RW 4LF4O 5L3DA 1XQ8A 5H6RA 2OTJV 4BWAA 2IBZH 1IBMB 3RFRA 4LFAO 2ZE7A 5BR8O 4DK1A 3DC6A 3EHBB 2EIJC 5JH7B 1OJHA 3RYCA 1B04A 5FPOA 4ZIBA 3P32A 4GT1A 1GK9A 2DE0X 5KHIA 5DN6G 2CAZC 4I4TA 2CTPA 2XUMA 3L75H 5L3FA 1SQPH 4FLWA 3B8NA 1FXVA 1P4RA 4J7JA 4RO2A 4B3SO 2HJDA 5CMUA 5ITZB 2Y0PA 3M99B 4J80A 3QO5A 2X0LA 3ASOB 2RQ6A 3DTUB 5LMNO 3ZS8C 1QQCA 2YIBA 1M90W 3FAVB 1NU1H 4B3TO 5EYPB 1Q8IA 1SZXA 1UFIA 1WA8B 3LNMB 3ZHVA 2QWRB 2B1IA 4JI6O 2AHYA 4LP8A 1NS1A 4JI8O 2A06H 2BTQA 3D3QA 1K4CC 2XAQA 1HNWO 3E8GA 1R3LC 1E79G 2ZR3A 2ZE6A 2UXDB 4PDRA 4DRXB 3R65A 1N34B 5TISZ 3IC7A 1NH2B 1J5EB 2L6LA 3CS5A 2V7QG 1YJWV 3D36C 1XMOO 4LC1A 3WB2A 2RNBA 1FFXB 1EZVH 2HR3A 4TOIA 1SC5B 3C3TA 5IYCO 5IE9A 2WLJA 1IBKO 5K1PA 4NKGB 5CA1B 1SETA 4IYIA 4JAUA 4MVSA 4C7UA 3JARA 1AP5A 3CCJV 4X62O 1Y74A 4GX2A 4G27B 5LP6B 4PI2A 2AGAA 4UCRA 4IHJB 3H1LH 2Y69B 4EKWA 4MTOA 1H2LA 4X65B 1QHTA 3IFXA 4JI7O 1YEWA 2EILB 2FMLA 4KUMA 4DR6B 2DN9A 1JA8A 2LGQA 2JEXA 3K9SA 3ML0A 4EB6B 4X64B 4NYKA 5LMUO 2ADPA 4O4JB 2KSDA 3FB6C 1Q86W 4DV5O 3ZHQA 1I94O 3K3WA 3OAAG 2MW2B 1NT2B 4FLUA 1NR7A 4LF9B 1SERA 1MSDA 3E83A 3RN4A 1ZSPA 2VRZA 5LOVA 3ZHTA 1JJOA 2F66C 2ZDIC 1OHHG 2R9RB 2DW4A 3E22B 3JALB 4UV9A 4NXNB 1NQTA 3LSQA 1Y76B 4TWKA 4L8JA 2YEVA 5CBFA 5LHGA 2BOCC 3ETEA 4N21A 2JVDA 5H6QA 3CRRA 5DEDA 3THOA 3ZMTA 3ASNB 4O4LA 3I56V 5J2TA 4D7TA 1S5JA 3E8FA 1YJ9V 2P5OA 1BQ0A 3QG5A 3L71H 1LR1A 1F7YA 1RPRA 3L70H 3TGUH 2ZE8A 5LP6C 3L9DA 3TK1A 2OTLV 3MD0A 2QR4A 1VIBA 4H13B 4JI1B 2Y69C 3CC4V 3PJSK 4IT5A 1FXKC 1DGSA 1FAFA 4NR1A 1N36B 2PTMA 3OTFA 1SA0A 4ZI7B 3HPLC 2O57A 2LP7A 4TQFA 3CHXA 2JJ1G 4GKJO 1GH6A 4X66O 1DF5A 3I55V 5JCOC 1XNRO 1IXBA 1GN4A 2JEUA 3P3PA 1ENVA 3OMNB 4H37A 2QWNB 4B3RB 4X62B 1US6A 1GTOA 1MOFA 4U3FH 4UCTA 2JS3A 1XUQA 3H9VA 3UT5B 2R9IA 4YHHO 3GWOA 4WFGA 1K5SA 3FYIB 4FJCC 3F7YC 4JGSA 4AQYB 4GKKB 2ETNA 4QPJA 1CEZA 1NTZH 4K3AA 4DV0O 1L8DA 1P7BA 3B40A 1HNZB 4X1YA 1BGYH 5KX5B 1THZA 2WPDG 4NTYA 1PNKA 3OFNG 3STZC 4KL1A 4FPPA 1AB3A 4DR2B 1KP2A 1MSWD 4UCOA 1M1KW 4B7KA 1R6TA 5CA3A 1N0NA 3I5DA 2PI4A 3BEHA 2Q7HA 2YUAA 3G80A 4Z2WA 3JAWA 3ASNC 3K06A 3G67A 1JJ2U 5KUMA 2IU0A 2CE4A 2QGNA 4FM2A 3T4ZA 1B6QA 3DXRA 2CUGA 3LSSA 2E75B 2ZT9B 3F7VC 1QLNA 2LGWA 4TV9B 2JGDB 2QTSA 3RYHB 2W6JG 2F4VO 1CPYA 4BR6A 1I7FA 4PA4A 3ZBHA 1F23A 2E5LB 5L3EA 1YF2A 4LBEC 3J80N 1N32B 2PYJA 3JAKA 2GTSA 2HEPA 1ZX3A 4JI4O 5IWAO 3QVNA 1TAEA 1Q43A 4DV3B 3Q4HB 4O2BB 4DR4O 4JI5O 5FPRA 2OIGA 4DUYO 1PPJH 1WB8A 4O4HB 3VOUA 3CC7V 1ZLZA 1YZBA 4PI0A 4DV2B 4B3MB 4AI8A 3H1IH 3SPHA 1XHZA 2IJIA 2M6YA 1P7GA 2VWKA 4IIJB 4N23A 4PDVA 1DK1A 3G4SV 3K04A 2N04A 5JQGB 4P2ZA 3K59A 4UXNA 3IJ4A 3SJQC 1KKDA 1RM1B 1V55B 1HR0B 2N05A 2Z0AA 3SJCC 1GM8A 1M57B 4XDKA 3SPGA 1K8AW 3K58A 4CZZA 3SPIA 2UXCB 3NR7A 3JAMN 1EN4A 1H2MA 3K57A 1SESA 4GUNA 2UUCO 3HKCB 5GTIZ 3ZN0A 1AR1B 3D3IA 3BHPA 3K79A 3R66A 2RMKB 2WSSG 2EIMB 5LGTA 1JPXA 4DV0B 4DR5B 2P22C 1SRYA 2Q7EA 3K5OA 2BE3A 1Z5WA 3A8TA 5EIBC 4YJ3B 2IW5A 4R7CA 2ZQMA 3E86A 3PN1A 3SPCA 3U11A 3BRCA 4ZBMA 1IBMO 4TUYB 3E89A 3SJBC 4DV4B 1KYOF 2K1EA 1WJZA 1AJNA 1J95A 4ABMA 1PL4A 3H01A 3ABTA 3D36A 3NXSA 1QR8A 2EIKB 2CH7A 4I0XA 1K7DA 3QO7A 5EZYB 3UKMA 1NZ6A 4BIUA 3C3SA 3OGCC 4WBNA 1I0HA 3K03A 4D7SA 5CN0A 1L0LH 2AZ0A 4WFEA 1K9MW 4FLXA 2R72A 4JAAA 1JFFA 4QJFB 1V54B 1KB9F 5JH7A 4GZRB 4GYCB 4MVMA 2WLLB 2VS0A 5KHJA 2HHHB 1MA1A 2IM9A 2YSUB 4U7OA 1RM1C 1V55C 3CC2V 2Y0IA 4X1IB 3K0DA 4QIWF 1M57C 4DR4B 4JI5B 3P30A 2PYLA 2YIAA 2ITCC 3OEEG 4HYOA 3CSXA 1EN5A 4QPKA 1AR5A 3ZJZA 2PGGA 1P84F 4TQDA 1BS3A 4FLVA 2EIMC 2UXDO 4J11A 4CS4A 2HP8A 1N34O 4CBCA 1BHAA 2BCCH 4X20B 1I5XA 1SQGA 1P49A 4FLTA 2IU3A 3CD6V 1XDCA 1DTOA 5B1OA 4I50B 4X1KB 1Q6IA 4F6RA 4JPRA 2CTRA 2XAHA 3BCCH 2FKXA 1VQMV 4EFEA 3N2KB 4ZOLB 2UUCB 2F23A 3ZHUA 2ZIOA 3WG7B 5KMGB 1GAXA 2DWEC 4FFKA 3CCSV 4I55B 1B3QA 4O4IB 1XHXA 2EIKC 3FFQA 4DO2A 4X65O 3RVZA 5KHHA 3CJHB 1FFXA 2QM7A 1OV9A 4DR6O 4FFBB 2E76B 2W6IG 4QE7A 3B09A 5CA1A 2QKCA 3TXSA 2JK5C 4J41A 2P90A 1UPGA 4X64O 2H8PC 1V54C 2DOSA 5B1NA 2QWOB 4QNHB 5LP6A 4IHJA 2VQEB 3CB2A 3AG1C 2EZPA 1FXKA 5L3CA 5JJJB 3VBBA 3IGAC 4LF9O 1PM9A 2JGUA 4K8XA 5JVDA 2ZIMA 2LQTA 2WLIB 4NXNO 4X88A 5CA0A 5GONA 1D5AA 1R1BA 1BT8A 3APOA 3FYEB 1CXZB 3T2MA 1Q6UA 4U3JA 1ZL8B 3CXCU 3K5NA 5IY5B 1IVSA 1JMKC 1Y66A 3SGIA 1VF6A 4O2AB 3JASB 2ZXWB 1EBOA 1TVKB 2P4VA 5LA6B 4PA9A 1U96A 5A2QN 3CRQA 2P06A 1O9GA 1VQOV 4JI2B 3SJAC 1ZWIC 2Z3YA 1WLEA 4HBNA 1IXMA 3ZHRA 3FD9A 1BCCH 4X89A 3UQ8A 4L87A 2GSMB 3TETA 3JSLA 3RYIA 5IYZA 4CH3A 3WG7C 1Y76A 3JD1A 1NBMG 3W7WA 1D5NA 3CMEV 2XASA 4JI1O 4CC6A 2HG5C 3CEIA 1N36O 3RW0A 4LFBB 4JYAB 2A79B 4E4EA 1BSMA 3B8MA 3JD2A 1I5YA 2Q68A 5L3BA 2XAGA 3CXHF 3MHHC 2AHZA 1WNSA 3LDCA 4LH6A 3OGIB 4B3RO 1WP7A 5BMVB 1K5QA 2RCVA 3K9AA 1YJNV 3JYCA 1VMGA 4J10A 4PDMA 1NTKH 2H3OA 1PV0A 3AG3B 4GKKO 4ZI7A 4AQYO 1R3KC 1H2GA 5L3GA 3OUSA 3ETDA 2DYSB 3ZRWA 5C8YB 3LNNA 1HNZO 1JOYA 1SKVA 3GWKC 3OW2U 2B9ZA 4YY3B 1N4CA 2KG7B 4DR2O 1YITV 3QO8A 2V1DA 3CCEV 4DR7B 4LF5B 2QTOA 2K9PA 1PP9H 1QU7A 5K1XA 3ASOC 3ZHSA 5IY5C 3M7MX 4G2KA 3EFFK 4BIOA 5DM6V 1H8EG 2ZXWC 5IDJA 4J9ZB 3E8HA 3JCZA 4NXMB 1COWG 5BY1A 4P9PA 3T1CA 2AW9A 4JTCB 5KX5A 1S5HC 1RSOA 1GN6A 1AP6A 2QKAA 2ZNJA 4OGQB 3K5LA 2NNUA 2Z5UA 3F5TA 4LH7A 1N33B 1H2SB 4JAVA 4E2LA 3FX7A 3ABKB 2G38A 4LF7B 2EJRA 4FLYA 1KKCA 2V4DA 2FL4A 1MNGA 2UXXA 2E5LO 2DQ3A 1FFTB 4CH5A 1V9PA 1N32O 3JATA 4GX1A 5H2FZ 1QLEB 1ZAUA 4FM1A 4DV3O 2IJKA 3CCUV 1MZEA 4U7NA 1AILA 2EULA 3WU2Z 2NR5A 4YJ2B 4TV9A 1OZ0A 5FNVB 3W7UA 5LXTB 3AG3C 4LWSB 4UUJC 1M9NA 4DV2O 5LHHA 4B3MO 5LYJA 2UXBB 2EILC 2RJZA 4DK0A 2DYSC 1I08A 2ZM6B 2P6JA 1Y74B 4R8CA 2IH3C 1HR0O 1S76D 3Q4HA 1H38A 1AI7A 2UXCO 4GX0A 1PKXA 1R3JC 3F5WC 2ILMA 1GN2A 3E35A 3OUFA 4DV6B 2VQFB 4NB5A 2LW1A 4O4HA 1PNMA 4DW0A 2YIDA 1VQNV 2UU9B 3CP1A 4LR3A 4JI0B 1YIJV 5KLVH 2Q5ZA 3TCUA 2JIZG 4DR5O 2A3QA 4TV8A 3FB8C 2QA4V 3FB5C 3L74H 1XL6A 3VQWA 4UCUA 3WB0A 4X9QA 4MS2A 1IX9A 3D8CA 1Q5OA 3C90A 2FYUH 3HB3B 4Q6GA 3X2QB 5IJ0B 2YIBD 3HKCA 3OD4A 4DV4O 2GHYA 1K4DC 4UCSA 5F2VO 1NR1A 3ETGA 3EVKA 1YSCA 3H1JH 1VQ6V 4OPAA 1QLEC 5J9PC 2YI8A 3ICXA 4IYHA 3OEHG 4G28B 3VQVA 2YEVB 4IL6Z 1XMQB 1EN6A 3JD4A 3BA8A 3L72H 1DLBA 1EM1A 1W0KG 2Q6AA 5J2TB 2RDCA 1H8HG 4YIOA 5IJ9B 2YXLA 3UM7A 1TUBB 1PNLA 4A5UB 1KC8W 5GW7A 2YS8A 1IBLB 3LDEA 3RT3C 1MZFA 2HHHO 3OR7C 3UCSC 4TSFG 4UV8A 1R6NA 1Z2GA 3AK2A 2OIEA 5EZYA 2UUAB 3KG2A 2EX3A 1WB7A 2RN9A 4ZHQA 1VQ4V 1K73W 3T4DA 4AILC 4MT8A 2WA3A 4KHPB 3MDSA 1GRJA 3CRAA 1UJWB 2A9HA 4WFFA 4OPHA 4B08A 2P4KA 2CGNA 1SQXH 3T1HB 4UVBA 2BSKB 2WLLA 3CCLV 1Q90D 5H9CA 1JX9A 4UB6Z 2DYRB 4H0LB 1WN7A 4X1IA 1FKAO 1Q6HA 3SYOA 2M7WA 1W2BU 3AK1A 3AG7A 5GTHZ 3ZRXA 4OX9B 5CBHA 1YTFD 3J7AU 2YI9A 2ZD9A 1XNQB 2QE7G 5B3SB 4X8AA 1DF4A 1HDJA 4R6ZA 2OCCB 3IAYA 5FLXN 1Q7YW 1HNXB 4X1YB 4K0KB 4FK5C 4YXWG 4PA7A 1L0NH 1MABG 3GVMA 3OM3B 3VQYA 2GUZB 5J2UA 5EBLC 4X20A 1JVMA 5E79Z 3RYFB 4HNAA 1VQ7V 4BW9A 1VQLV 4HAMA 1SS3A 3RGBA 3K5MA 4JTDB 1M93A 5A9GA 2KB1A 4EEQA 4JZGA 3RVYA 4WFAV 2CTWA 3LUTB 2XTAA 1K92A 5KMGA 2VQEO 1Q82W 4FZ0A 3HKEA 3B2EE 3N27A 1TA8A 1XEQA 4MTFA 3O65A 4WFBV 3J81N 4FFBA 2ADQB 2IH1C 3UO3A 3QNEA 1BMFG 1H2KA 1K33A 1WP8A 3JAKB 1BQZA 1K34A 4PV1B 4WCEV 2EBOA 5IYBO 3ZN1A 1VP7A 1VQPV 4H44B 1AI5A 3OT7A 2DYRC 5FL7G 1WPXA 1VQKV 4ASUG 4MVZA 1XILA 4GLXA 5LL6Y 4JI2O 1KD1W 1R3IC 1OCRB 2B1GA 1XREA 3G71V 2WAMA 5ITZA 5IT9N 3SYCA 3CYOA 2Q4PA 2XOKG 2XAJA 3KKYA 1PL0A 2XHBA 2ZE5A 3IC9A 5KHGA 1Y4MA 2F95B 3ZMVA 1YHQV 3H1HH 5C93A 4LFBO 4O2AA 3JASA 1TVKA 1BL8A 4RQEA 4JYAO 3FAVA 5EYPA 2X6AA 5HFMA 1WA8A 4K35A 2ZDIA 3MHSC 2EZOA 2QJ1A 2DQ0A 3N2GB 4BW5A 4XDJA 1LUVA 5BZBA 4DRXA 3SDLA 5D5PA 2JRIA 4LCUC 1T5EA 3ZEDA 3LDDA 2W0FC 2HVKC 5KAIZ 3K08A 4PHZA 1FJGB 2UUBB 1VQ5V 4MVQA 3ABMB 3VQXA 4LFCB 1XOUA 4YY3O 1TGOA 5LGNA 1KBHA 4TT3G 2R9AA 4MTXA 2Q7GA 1S0VA 4KP4A 5EK0A 4DR3B 4DR7O 3CCVV 4LF5O 4W4KA 3ETQA 4I0XB 1OCOB 4B7EA 5B66Z 4LNUB 4WBNB 5EC2C 3CRCA 4PA3A 3HR0A 3MAQA 4NXMO 1XL4A 3RWRD 3U10A 3U0ZA 4DV7B 3H1KH 1JFFB 1OCRC 4JF3A 5C8YA 5EBWC 5JCOA 1R6KA 3G6BA 5CB4B 4EB6A 1FPOA 2KG7A 3OMAB 4O4JA 5KUKA 4GCZA 1N33O 2ATKC 5KAFZ 2GBOA 3OTOB 2JS5A 3ZCCA 1VQ9V 4LF7O 3APQA 5BXZA 4RQFA 3OMIB 1NVPD 5E1AC 4JI3B 1M56B 1SQQH 1NTMH 3HKBB 1AR4A 1JQ0A 3E22A 4ICGA 3JALA 1NI8A 3W7TA 3HKDB 4JTAB 1Q3EA 3ZMZA 2ARHA 4IGGA 2WLKA 2D3OW 4GX5A 4ZKIA 2D2CB 1O9HA 2F93B 4F6RB 1AI6A 3SYAA 4PJ0Z 2XAFA 4DV1B 2UXBO 3BFRA 4F4LA 3BAAA 3ABMC 2ZM6O 2NN4A 1XI1A
chains in the Genus database with same CATH topology
1H38A 5LHIA 4MTGA 1AI7A 1ORQC 2PI5A 2B5UA 2ZR2A 1EZJA 1GM8A 1M57B 1PKXA 1R3JC 3F5WC 3JD0A 1OCZB 4GX0A 3E35A 1OCOC 3SPGA 3SPIA 4CZZA 4JASA 3OUFA 4BAYA 1SESA 1PNMA 4Z1MG 1S72V 2X6BA 1GM9A 1GKFA 1K97A 1VQNV 1HWYA 5EBMC 3ZN0A 1TUEB 3BY6A 4KFMA 1AR1B 3CMAV 2HLDG 2FTKA 3D3IA 3CP1A 2EINB 3K79A 1YIJV 1KP3A 1E1QG 3W7XA 2WSSG 4UVCA 2EIMB 1F4NA 5LGTA 1JPXA 3TCUA 2JIZG 4FIPC 5IYDO 2HJFC 1SRYA 2A0LA 1KECA 3FB8C 2IJJA 4R8CA 4DXWA 3OR6C 2QA4V 3FB5C 1XL6A 4P30A 1FXKB 4I5SA 4J9YB 4MW8A 4MS2A 3ZRVA 2IW5A 1OCCB 2X7RB 4JYCA 2OT5A 4R7CA 1N8RW 4H33A 5L3DA 2ZQMA 3E86A 3SPCA 3HB3B 5H6RA 3X2QB 2OTJV 4ZBMA 4XDLA 4WF9V 3E89A 2GHYA 1K4DC 1NR1A 1M56C 2K1EA 2CK3G 3ETGA 4I9WA 1AJNA 1J95A 3EHBB 2EIJC 1YSCA 1VQ6V 3H01A 1QLEC 2WLNA 1AJPA 5J9PC 3STLC 3ABTA 1QBZA 3OEHG 4G28B 3P32A 4GT1A 1GK9A 2YEVB 3JD4A 3D36A 3NXSA 1QR8A 1KKDA 2EIKB 5DN6G 1K7DA 3QO7A 3UKMA 4BIUA 3ZMSA 1DLBA 1G8MA 3OGCC 1W0KG 2Q6AA 3K03A 1G4YB 5L3FA 5CN0A 3AG4B 1E1RG 1H8HG 3B8NA 3E2EA 1FXVA 3UM7A 4WFEA 1YI2V 1PNLA 1K9MW 1P4RA 1KC8W 1ROPA 4RO2A 5GW7A 4QJFB 1V54B 5CMUA 3LDEA 1W0JG 4MVMA 2WLLB 3M99B 3OR7C 4TSFG 3QO5A 4UV8A 2YSUB 4U7OA 1RM1C 2X0LA 1R6NA 1V55C 3ASOB 3B77A 3CC2V 3DTUB 3CCRV 3KG2A 3K0DA 4QIWF 1M57C 1OCZC 1M90W 1NH2D 3P30A 1VQ4V 2JJ2G 1K73W 3T4DA 4MT8A 2ITCC 3OEEG 3JD3A 4WFHA 4HYOA 1UJWB 2A9HA 2WLHA 4WFFA 3LNMB 1NKDA 2B1IA 3OE7G 4QE9A 2AHYA 4LP8A 1EFRG 4QPKA 3ZJZA 2EINC 1K4CC 2XAQA 1R3LC 2WWWA 2HKOA 1E79G 1QR9A 2EIMC 2WLLA 3E8GA 4UVBA 2ZR3A 3CCLV 4PDRA 5EC1C 3RBZA 5H9CA 1R73A 1JX9A 4CBCA 1BHAA 2Q67A 1GM7A 3R65A 2IJHA 2DWDC 1PD3A 2DYRB 3IC7A 1NH2B 2P7TC 1I5XA 3SYOA 2V7QG 1YJWV 2IU3A 3CD6V 2M7WA 1W2BU 1DTOA 1OCCC 5B1OA 4LC1A 3ZRXA 5CBHA 3AG2B 2HR3A 1YTFD 4JPRA 2XAHA 3SYQA 2HVJC 5IYCO 2ZD9A 2QE7G 2WLJA 5B3SB 4MSWC 3ZRWB 1VQMV 4X8AA 1Q81W 1DF4A 4R6ZA 1SETA 2OCCB 1Q7YW 4MW3A 4JAUA 4MVSA 4FK5C 4YXWG 4PA7A 3FKSG 3CCJV 1MABG 3OM3B 4XDKA 3WG7B 4GX2A 4G27B 4PDLA 2DWEC 5EBLC 3CCSV 3K0GA 1JVMA 3ABLB 2Y69B 5CBGA 4EKWA 5KA5A 4MTOA 1YTFB 2EIKC 4DO2A 1VQ7V 3RVZA 1VQLV 4HAMA 3ABKC 3IFXA 1L1FA 2QM7A 5KA6A 2LFRA 2WLMA 2EILB 3WFVA 3AG4C 4KUMA 2W6IG 4QE7A 4MVOA 4JTDB 2KB1A 2JK5C 2P90A 2JEXA 3RVYA 3ML0A 4WFAV 2H8PC 1V54C 3LUTB 5B1AB 5B1NA 1K92A 4QNHB 1SZTA 3FB6C 1Q86W 1Q82W 3K3WA 3OAAG 3AG1C 2EZPA 1FXKA 3ABUA 2UXNA 5L3CA 1RPOA 3VBBA 3IGAC 4MTFA 4UVAA 1NR7A 4Q20A 1SERA 1FS0G 4WFBV 3E83A 2IH1C 1GMGA 4XBFA 2H94A 3QNEA 2ZDIC 1JCHA 1BMFG 1OHHG 2R9RB 2WLIB 2DW4A 4X88A 1K33A 4UV9A 1NQTA 1K34A 3LSQA 2QKSA 4WCEV 2EBOA 3FYEB 5IYBO 3T2MA 3ZN1A 4JYBA 3CXCU 1VQPV 4MVUA 4TWKA 1AI5A 2BOBC 2C2AA 2YEVA 2DYRC 5FL7G 4R50A 1WPXA 4RUFA 5CBFA 5IY5B 4BIZA 1F51A 1Y66A 2BOCC 5LHGA 1VQKV 3ETEA 4MVZA 4N21A 4ASUG 5H6QA 2ZXWB 1EBOA 3ZMTA 3ASNB 4PA9A 3I56V 3AG2C 3SYPA 1KD1W 1R3IC 1OCRB 1QVGU 1VQOV 1ZWIC 3DGEA 3E8FA 1YJ9V 2B1GA 2Z3YA 3G71V 1WLEA 2MK3A 1IXMA 2HFEC 2X6CA 2ITDC 2WAMA 1K3EA 4X89A 4L87A 3SYCA 1RPRA 2GSMB 3CYOA 3TETA 2QM8A 2XOKG 2XAJA 3WG7C 1PL0A 1CP9A 3JD1A 1NBMG 3W7WA 3CMEV 2XASA 3TK1A 2OTLV 3MD0A 1K8AW 1Y4MA 1YHQV 3ZMVA 5C93A 3ABLC 5B1BB 2Y69C 2HG5C 2Q69A 3CC4V 3PJSK 1FXKC 4RQEA 1BL8A 3RW0A 4PA6A 2XNDG 2A79B 2X6AA 3ZRSA 3B8MA 3JD2A 5HFMA 1I5YA 3HPLC 2Q68A 3SPJA 5L3BA 1AROP 2LP7A 2XAGA 3X2QC 1FXHA 4PELA 3GB7C 2JJ1G 2ZDIA 4FMTA 3MHHC 3MHSC 2AHZA 2EZOA 1DF5A 3AEIA 3I55V 2DQ0A 2JEUA 4BW5A 2F43G 3LDCA 5B1AC 1ENVA 3OMNB 4XDJA 4H37A 5BZBA 1K5QA 3K9AA 4RAIA 4P9OA 4OXSA 1YJNV 1GTOA 1MOFA 3JYCA 4LCUC 1LNQA 1S3JA 4PDMA 1KQSU 1S77D 2R9IA 1AI4A 2W0FC 3LDDA 1AJQA 3AG3B 3GWOA 4WFGA 1K5SA 1R3KC 2LFSA 3FYIB 2HVKC 4FJCC 3F7YC 4JGSA 1H2GA 3K08A 3CPWU 5L3GA 3OUSA 3ETDA 4QPJA 3CCMV 1VQ5V 1CEZA 4MVQA 2DYSB 3ZRWA 3ABMB 2NLJC 3ZIAG 1NJIW 1P7BA 1JOYA 5LGNA 3OW2U 1THZA 4TT3G 4MTXA 1S0VA 2WPDG 1PNKA 4KP4A 3OFNG 3STZC 5EK0A 1QCEA 4FPPA 3QO8A 3FB7C 2V1DA 1YITV 2JDIG 3CCEV 3CCVV 1KP2A 2QTOA 1MSWD 1OCOB 1M1KW 4RUEA 5CA3A 3ASOC 5IY5C 2PI4A 3BEHA 4G2KA 2QEXV 5EC2C 3EFFK 4PA3A 5DM6V 1H8EG 2ZXWC 5IDJA 3ASNC 4J9ZB 3E8HA 3JCZA 1XL4A 3K06A 1COWG 4P9PA 1JJ2U 5KUMA 2IU0A 1OCRC 4JF3A 3CCQV 3T4ZA 1B6QA 5EBWC 3T1CA 3E8BA 1R6KA 4JTCB 1S5HC 3W7SA 3OMAB 2NNUA 5HFLA 5KUKA 4GCZA 2Z5UA 3LSSA 2ATKC 4JAVA 4E2LA 3ABKB 3F7VC 3ZCCA 1VQ9V 1QLNA 2EJRA 5B1BC 2W6JG 1CPYA 2UXXA 4PA4A 4RQFA 1BHBA 1F23A 2DQ3A 3ZMUA 3OMIB 1NVPD 1FFTB 5L3EA 4LBEC 5E1AC 1GO3F 1M56B 3A0RA 1VQ8V 5B3SC 2WLIA 2EIJB 1JQ0A 4GX1A 1QLEB 2OCCC 3W7TA 2IJKA 2P67A 1MG1A 3AG1B 3CCUV 4U7NA 4JTAB 5LGUA 2Y48A 3ZMZA 1F4MA 2WLKA 2D3OW 4GX5A 1QVFU 1OZ0A 4ZKIA 1AI6A 3SYAA 3W7UA 1NVPB 2XAFA 3AG3C 3VOUA 3CC7V 4UUJC 1M9NA 5LHHA 3SPHA 2EILC 5LBQA 2IJIA 4F4LA 2DYSC 4MVRA 3ABMC 4N23A 4PDVA 3G4SV 3K04A 4P2ZA 3G6EV 2P6JA 4UXNA 4HZ3A 3SJQC 2IH3C 1RM1B 1S76D 1V55B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCZ C;  2IH1 C;  1P7B A;  4MTG A;  4HZ3 A;  1ORQ C;  3T4D A;  4GX0 A;  4XDK A;  1R3J C;  2ITC C;  2R9R B;  3F5W C;  2WLI B;  4WFH A;  3SPG A;  4HYO A;  1OCO C;  4X88 A;  3SPI A;  3STZ C;  5EK0 A;  2A9H A;  2WLH A;  3OUF A;  3FB7 C;  4WFF A;  3LNM B;  4QE9 A;  2QTO A;  2AHY A;  4LP8 A;  4RUE A;  3ZJZ A;  2QKS A;  2X6B A;  3ASO C;  2EIN C;  5IY5 C;  1K4C C;  3T2M A;  5EBM C;  3BEH A;  1R3L C;  3E8G A;  4KFM A;  2WLL A;  2EIM C;  2BOB C;  4MVU A;  4TWK A;  5EC2 C;  2YEV A;  3EFF K;  2DYR C;  4PA3 A;  4R50 A;  2ZXW C;  4PDR A;  4RUF A;  5EC1 C;  3ASN C;  5CBF A;  2BOC C;  4J9Z B;  3E8H A;  3K06 A;  1XL4 A;  3RBZ A;  3K0D A;  4MVZ A;  4CBC A;  2Q67 A;  4P9P A;  3TCU A;  3R65 A;  5KUM A;  2DWD C;  1OCR C;  1M57 C;  2P7T C;  2HJF C;  4PA9 A;  3SYO A;  3T4Z A;  2A0L A;  5EBW C;  3FB8 C;  3AG2 C;  3E8B A;  4R8C A;  3T1C A;  4DXW A;  3OR6 C;  3SYP A;  1R3I C;  3FB5 C;  4JTC B;  1OCC C;  1S5H C;  1XL6 A;  4P30 A;  1ZWI C;  5CBH A;  3E8F A;  4J9Y B;  4MW8 A;  4MS2 A;  4R7C A;  3SYQ A;  5KUK A;  2HFE C;  2HVJ C;  2X6C A;  2ZD9 A;  2WLJ A;  4H33 A;  2ITD C;  4X89 A;  3E86 A;  2ATK C;  4MSW C;  4X8A A;  3SPC A;  3SYC A;  4R6Z A;  3TET A;  3F7V C;  4ZBM A;  4MW3 A;  3WG7 C;  4MVS A;  4XDL A;  5B1B C;  3E89 A;  4PA7 A;  1K4D C;  3ABL C;  1M56 C;  2HG5 C;  2K1E A;  2Q69 A;  2Y69 C;  3PJS K;  4G27 B;  4GX2 A;  4I9W A;  4PA4 A;  4PDL A;  1J95 A;  2DWE C;  5EBL C;  1BL8 A;  2EIJ C;  3RW0 A;  4PA6 A;  3K0G A;  1JVM A;  4LBE C;  5E1A C;  2A79 B;  1QLE C;  2WLN A;  2X6A A;  3ZRS A;  3STL C;  4EKW A;  4MTO A;  5CBG A;  5B3S C;  3HPL C;  2EIK C;  2Q68 A;  2WLI A;  3SPJ A;  4G28 B;  4GX1 A;  3RVZ A;  3X2Q C;  3GB7 C;  2OCC C;  3ABK C;  3IFX A;  1KKD A;  2AHZ A;  3UKM A;  2WLM A;  3AG4 C;  3OGC C;  4JTA B;  2Q6A A;  3K03 A;  1G4Y B;  4JTD B;  4MVO A;  4QE7 A;  4BW5 A;  2KB1 A;  2JK5 C;  3LDC A;  5B1A C;  4XDJ A;  4H37 A;  2WLK A;  3RVY A;  4GX5 A;  3UM7 A;  2H8P C;  1V54 C;  3LUT B;  4RAI A;  4WFE A;  5BZB A;  4P9O A;  4OXS A;  3SYA A;  4RO2 A;  3JYC A;  3AG3 C;  4LCU C;  3VOU A;  4UUJ C;  4QNH B;  1LNQ A;  4PDM A;  3FB6 C;  3LDE A;  3LDD A;  2W0F C;  4MVM A;  3AG1 C;  2WLL B;  2EIL C;  1R3K C;  3OR7 C;  4WFG A;  2HVK C;  3SPH A;  4F4L A;  3F7Y C;  2DYS C;  4MVR A;  3K08 A;  3ABM C;  5J9P C;  4PDV A;  3OUS A;  1V55 C;  3K04 A;  3IGA C;  4MTF A;  4MVQ A;  4P2Z A;  3KG2 A;  3SJQ C;  2IH3 C;  3E83 A;  2NLJ C; 
#chains in the Genus database with same CATH topology
 4JYY A;  4MTG A;  1VAR A;  1ORQ C;  2AXT Z;  2PI5 A;  4JV5 B;  2ZR2 A;  1EZJ A;  4YJ2 A;  1OCZ B;  4DV6 O;  1OCO C;  2VQF O;  2QM4 A;  2EJ7 A;  2ZCE A;  1B06 A;  5FNV A;  2Q0O C;  5LXT A;  4DUZ B;  4LWS A;  2LW7 A;  5JWP A;  1S72 V;  2CTQ A;  4QGP A;  2UU9 O;  1HWY A;  1TUE B;  4KFM A;  4JI0 O;  2HLD G;  2FTK A;  2EIN B;  5JJE B;  1KP3 A;  3W7X A;  4UVC A;  1Y67 A;  1SF9 A;  2A7W A;  3RYC B;  2A0L A;  4LF8 B;  3OR6 C;  3BAB A;  1FXK B;  4I5S A;  2Y4U A;  3ZRV A;  1OCC B;  2OT5 A;  4I4T B;  4H33 A;  4LF6 O;  4LF4 B;  4YIP A;  3UT5 A;  5JVD B;  2E3C A;  4XDL A;  4WF9 V;  4LFA B;  5CA0 B;  5GON B;  1M56 C;  2CK3 G;  5BR8 B;  4I9W A;  2R70 A;  4CC5 A;  5JJN B;  2WLN A;  1AJP A;  3DSQ A;  3STL C;  4U3J B;  1QBZ A;  1XMQ O;  4F6E A;  2E74 B;  4DW1 A;  1LUW A;  1HW7 A;  3ZMS A;  5DEC A;  4CH4 A;  1G8M A;  1ZUQ A;  3T1Y O;  1G4Y B;  4CS3 A;  5IJ0 A;  4FZ1 A;  3AG4 B;  1E1R G;  3E2E A;  1YI2 V;  2F1M A;  1D2D A;  1QNM A;  1ROP A;  1IBL O;  1YXB A;  1IZ3 A;  3A0B Z;  4B3S B;  2BTQ B;  2LO1 A;  1W0J G;  3RYI B;  5IYZ B;  4I9Q A;  3B77 A;  4RWU A;  1IDS A;  2UUA O;  3CCR V;  3CRM A;  5LMN B;  3AK3 A;  1OCZ C;  1NH2 D;  1AVM A;  4KHP O;  2JJ2 G;  2JGD A;  4B3T B;  3JD3 A;  4WFH A;  3RYH A;  5IJ9 A;  2WLH A;  1TUB A;  3M8A A;  4NVP A;  1NKD A;  3OE7 G;  4QE9 A;  1VF7 A;  2Q73 A;  1EFR G;  4JI6 B;  4JI8 B;  2KKW A;  1MMM A;  1G6U A;  2EIN C;  3T1H O;  3JAR B;  2CDY A;  2HKO A;  1QR9 A;  2WWW A;  2YC0 A;  1HNW B;  5EC1 C;  2VWJ A;  3S3X A;  4J7Z A;  3RBZ A;  1R73 A;  2Q67 A;  1GM7 A;  2IJH A;  2DWD C;  1PD3 A;  4O2B A;  4UCV A;  2P7T C;  3WB1 A;  4CS2 A;  3LSU A;  2LJ2 A;  1OCC C;  4OX9 O;  1VEW A;  1XMO B;  3AG2 B;  2PY5 A;  1FD9 A;  1XNQ O;  3SYQ A;  2HVJ C;  4MSW C;  3ZRW B;  1Q81 W;  1IBK B;  1Y6X A;  1HNX O;  4W4L A;  2ODM A;  3BVO A;  4MW3 A;  4K0K O;  2Y4T A;  3BPZ A;  2BSK A;  4IIJ A;  3FKS G;  4J7K A;  4DR1 O;  5JQG A;  2Q9L A;  4PDL A;  3K0G A;  3ABL B;  5CBG A;  3EXA A;  1JR9 A;  5KA5 A;  1YTF B;  1VF6 C;  3ABK C;  1L1F A;  5KA6 A;  2LFR A;  2WLM A;  4JI7 B;  3WFV A;  3AG4 C;  4LF6 B;  3KCX A;  4D6T H;  4MVO A;  1RFY A;  5LOV B;  4CH6 A;  1WAZ A;  1RSO B;  5B1A B;  4I7Z B;  5AG2 A;  5LMU B;  3JSN A;  1SZT A;  2GUZ A;  4DV5 B;  1I94 B;  2QWP B;  2Q0A A;  1SQV H;  3RYF A;  4YJ3 A;  2PZS A;  3ABU A;  2UXN A;  1RPO A;  4UVA A;  1SQF A;  4Q20 A;  1FS0 G;  4O4L B;  3T1Y B;  1GMG A;  4XBF A;  1IUR A;  1YDX A;  1H2N A;  2H94 A;  3JAT B;  4TUY A;  1JCH A;  2QDO A;  2DMX A;  2GV9 A;  2GDS A;  2BTO A;  2QKS A;  4JYB A;  4MVU A;  2BOB C;  1RP3 B;  2C2A A;  4R50 A;  1KMI Z;  5KHK A;  4RUF A;  4BIZ A;  1F51 A;  3QTC A;  2DJV A;  3ZX6 A;  3AG2 C;  1SA0 B;  1Z5V A;  3SYP A;  1QVG U;  5LYJ B;  3DGE A;  2YDE A;  3A2F A;  2MK3 A;  2HFE C;  2X6C A;  2ZIN A;  2ITD C;  1K3E A;  4DYL A;  1URF A;  3KZI Z;  2QM8 A;  1M5I A;  2ZNI A;  1CP9 A;  3ABL C;  5B1B B;  2Q69 A;  1U97 A;  2L35 A;  2PF4 E;  4PA6 A;  2XND G;  3ZRS A;  3SPJ A;  4FLZ A;  4FM0 A;  1ARO P;  3X2Q C;  1FXH A;  4PEL A;  1G1X B;  3GB7 C;  2XT9 A;  4FMT A;  3AEI A;  4GKJ B;  4X66 B;  1XNR B;  4UFZ A;  4TV8 B;  2F43 G;  5B1A C;  2Q8V A;  2QWQ B;  4RAI A;  4DR1 B;  4P9O A;  4OXS A;  4K8Z A;  1LNQ A;  1S3J A;  1KQS U;  1S77 D;  1AI4 A;  1AJQ A;  1N0J A;  2LFS A;  4I50 A;  4X1K A;  4YHH B;  2GTA A;  3JAW B;  3CPW U;  2UUB O;  1FJG O;  1BE3 H;  3CCM V;  4LFC O;  2N74 A;  3N2K A;  4ZOL A;  2NLJ C;  3ZIA G;  1YVW A;  3A0H Z;  1NJI W;  3JCU Z;  3N2G A;  3DXR B;  4NTX A;  4DR3 O;  1GN3 A;  1QCE A;  3FB7 C;  2JDI G;  4AHC A;  5H5N A;  1M4U A;  4RUE A;  4I55 A;  5EIB D;  2PUS A;  4O4I A;  2QEX V;  3CJH A;  2OYQ A;  3UO2 A;  3DC5 A;  2CGO A;  4DV7 O;  2WA4 A;  5D5Q A;  4EFB A;  3CCQ V;  2YXY A;  3E8B A;  2QSA A;  1VF5 B;  3W7S A;  1S5L Z;  3KCY A;  5HFL A;  3OTO O;  3TJT A;  2KQX A;  4FVM A;  4LNU A;  1ZTE A;  4ZHQ B;  3O9O A;  3L73 H;  5B1B C;  4KXR A;  3B4S A;  2F4V B;  1BHB A;  5B5E Z;  3CX5 F;  4UB8 Z;  3ZMU A;  4JI3 O;  3CWB H;  1GO3 F;  2W0X A;  3A0R A;  1VQ8 V;  5B3S C;  2WLI A;  2EIJ B;  5CB4 A;  2OCC C;  3S3W A;  1FYJ A;  2YIC A;  2ZKO A;  4NTW A;  2P67 A;  1MG1 A;  3AG1 B;  4JI4 B;  5IWA B;  1X59 A;  3BA9 A;  2Y48 A;  5LGU A;  2OCH A;  4J42 A;  1F4M A;  3TXQ A;  1ZL8 A;  1HP8 A;  1YCI A;  4DUY B;  1QVF U;  1X4T A;  1NVP B;  5LA6 A;  1SQB H;  4DV1 O;  3QF7 A;  5LBQ A;  3HKB A;  4JZ2 A;  1W59 A;  4MVR A;  3CE2 A;  2AZ2 A;  3G6E V;  1BZK A;  4HZ3 A;  1J5E O;  3HKD A;  5J2U B;  1KU9 A;  5LHI A;  4JV5 O;  2B5U A;  3JD0 A;  4HNA B;  1KUQ A;  4JAS A;  4BAY A;  4DUZ O;  4PD4 F;  1A32 A;  4Z1M G;  2X6B A;  3P3N A;  1GM9 A;  1GKF A;  1K97 A;  5EBM C;  3BY6 A;  3CMA V;  3SR2 C;  1E1Q G;  1WPB A;  1F4N A;  4LF8 O;  4FIP C;  5IYD O;  2HJF C;  1KEC A;  2IJJ A;  4DXW A;  3HKE B;  4Z1V A;  2OWO A;  5BMV A;  4P30 A;  2YXH A;  4J9Y B;  4MW8 A;  2CH7 B;  2X7R B;  2FB5 A;  1XBL A;  4JYC A;  1N8R W;  4LF4 O;  5L3D A;  1XQ8 A;  5H6R A;  2OTJ V;  4BWA A;  2IBZ H;  1IBM B;  3RFR A;  4LFA O;  2ZE7 A;  5BR8 O;  4DK1 A;  3DC6 A;  3EHB B;  2EIJ C;  5JH7 B;  1OJH A;  3RYC A;  1B04 A;  5FPO A;  4ZIB A;  3P32 A;  4GT1 A;  1GK9 A;  2DE0 X;  5KHI A;  5DN6 G;  2CAZ C;  4I4T A;  2CTP A;  2XUM A;  3L75 H;  5L3F A;  1SQP H;  4FLW A;  3B8N A;  1FXV A;  1P4R A;  4J7J A;  4RO2 A;  4B3S O;  2HJD A;  5CMU A;  5ITZ B;  2Y0P A;  3M99 B;  4J80 A;  3QO5 A;  2X0L A;  3ASO B;  2RQ6 A;  3DTU B;  5LMN O;  3ZS8 C;  1QQC A;  2YIB A;  1M90 W;  3FAV B;  1NU1 H;  4B3T O;  5EYP B;  1Q8I A;  1SZX A;  1UFI A;  1WA8 B;  3LNM B;  3ZHV A;  2QWR B;  2B1I A;  4JI6 O;  2AHY A;  4LP8 A;  1NS1 A;  4JI8 O;  2A06 H;  2BTQ A;  3D3Q A;  1K4C C;  2XAQ A;  1HNW O;  3E8G A;  1R3L C;  1E79 G;  2ZR3 A;  2ZE6 A;  2UXD B;  4PDR A;  4DRX B;  3R65 A;  1N34 B;  5TIS Z;  3IC7 A;  1NH2 B;  1J5E B;  2L6L A;  3CS5 A;  2V7Q G;  1YJW V;  3D36 C;  1XMO O;  4LC1 A;  3WB2 A;  2RNB A;  1FFX B;  1EZV H;  2HR3 A;  4TOI A;  1SC5 B;  3C3T A;  5IYC O;  5IE9 A;  2WLJ A;  1IBK O;  5K1P A;  4NKG B;  5CA1 B;  1SET A;  4IYI A;  4JAU A;  4MVS A;  4C7U A;  3JAR A;  1AP5 A;  3CCJ V;  4X62 O;  1Y74 A;  4GX2 A;  4G27 B;  5LP6 B;  4PI2 A;  2AGA A;  4UCR A;  4IHJ B;  3H1L H;  2Y69 B;  4EKW A;  4MTO A;  1H2L A;  4X65 B;  1QHT A;  3IFX A;  4JI7 O;  1YEW A;  2EIL B;  2FML A;  4KUM A;  4DR6 B;  2DN9 A;  1JA8 A;  2LGQ A;  2JEX A;  3K9S A;  3ML0 A;  4EB6 B;  4X64 B;  4NYK A;  5LMU O;  2ADP A;  4O4J B;  2KSD A;  3FB6 C;  1Q86 W;  4DV5 O;  3ZHQ A;  1I94 O;  3K3W A;  3OAA G;  2MW2 B;  1NT2 B;  4FLU A;  1NR7 A;  4LF9 B;  1SER A;  1MSD A;  3E83 A;  3RN4 A;  1ZSP A;  2VRZ A;  5LOV A;  3ZHT A;  1JJO A;  2F66 C;  2ZDI C;  1OHH G;  2R9R B;  2DW4 A;  3E22 B;  3JAL B;  4UV9 A;  4NXN B;  1NQT A;  3LSQ A;  1Y76 B;  4TWK A;  4L8J A;  2YEV A;  5CBF A;  5LHG A;  2BOC C;  3ETE A;  4N21 A;  2JVD A;  5H6Q A;  3CRR A;  5DED A;  3THO A;  3ZMT A;  3ASN B;  4O4L A;  3I56 V;  5J2T A;  4D7T A;  1S5J A;  3E8F A;  1YJ9 V;  2P5O A;  1BQ0 A;  3QG5 A;  3L71 H;  1LR1 A;  1F7Y A;  1RPR A;  3L70 H;  3TGU H;  2ZE8 A;  5LP6 C;  3L9D A;  3TK1 A;  2OTL V;  3MD0 A;  2QR4 A;  1VIB A;  4H13 B;  4JI1 B;  2Y69 C;  3CC4 V;  3PJS K;  4IT5 A;  1FXK C;  1DGS A;  1FAF A;  4NR1 A;  1N36 B;  2PTM A;  3OTF A;  1SA0 A;  4ZI7 B;  3HPL C;  2O57 A;  2LP7 A;  4TQF A;  3CHX A;  2JJ1 G;  4GKJ O;  1GH6 A;  4X66 O;  1DF5 A;  3I55 V;  5JCO C;  1XNR O;  1IXB A;  1GN4 A;  2JEU A;  3P3P A;  1ENV A;  3OMN B;  4H37 A;  2QWN B;  4B3R B;  4X62 B;  1US6 A;  1GTO A;  1MOF A;  4U3F H;  4UCT A;  2JS3 A;  1XUQ A;  3H9V A;  3UT5 B;  2R9I A;  4YHH O;  3GWO A;  4WFG A;  1K5S A;  3FYI B;  4FJC C;  3F7Y C;  4JGS A;  4AQY B;  4GKK B;  2ETN A;  4QPJ A;  1CEZ A;  1NTZ H;  4K3A A;  4DV0 O;  1L8D A;  1P7B A;  3B40 A;  1HNZ B;  4X1Y A;  1BGY H;  5KX5 B;  1THZ A;  2WPD G;  4NTY A;  1PNK A;  3OFN G;  3STZ C;  4KL1 A;  4FPP A;  1AB3 A;  4DR2 B;  1KP2 A;  1MSW D;  4UCO A;  1M1K W;  4B7K A;  1R6T A;  5CA3 A;  1N0N A;  3I5D A;  2PI4 A;  3BEH A;  2Q7H A;  2YUA A;  3G80 A;  4Z2W A;  3JAW A;  3ASN C;  3K06 A;  3G67 A;  1JJ2 U;  5KUM A;  2IU0 A;  2CE4 A;  2QGN A;  4FM2 A;  3T4Z A;  1B6Q A;  3DXR A;  2CUG A;  3LSS A;  2E75 B;  2ZT9 B;  3F7V C;  1QLN A;  2LGW A;  4TV9 B;  2JGD B;  2QTS A;  3RYH B;  2W6J G;  2F4V O;  1CPY A;  4BR6 A;  1I7F A;  4PA4 A;  3ZBH A;  1F23 A;  2E5L B;  5L3E A;  1YF2 A;  4LBE C;  3J80 N;  1N32 B;  2PYJ A;  3JAK A;  2GTS A;  2HEP A;  1ZX3 A;  4JI4 O;  5IWA O;  3QVN A;  1TAE A;  1Q43 A;  4DV3 B;  3Q4H B;  4O2B B;  4DR4 O;  4JI5 O;  5FPR A;  2OIG A;  4DUY O;  1PPJ H;  1WB8 A;  4O4H B;  3VOU A;  3CC7 V;  1ZLZ A;  1YZB A;  4PI0 A;  4DV2 B;  4B3M B;  4AI8 A;  3H1I H;  3SPH A;  1XHZ A;  2IJI A;  2M6Y A;  1P7G A;  2VWK A;  4IIJ B;  4N23 A;  4PDV A;  1DK1 A;  3G4S V;  3K04 A;  2N04 A;  5JQG B;  4P2Z A;  3K59 A;  4UXN A;  3IJ4 A;  3SJQ C;  1KKD A;  1RM1 B;  1V55 B;  1HR0 B;  2N05 A;  2Z0A A;  3SJC C;  1GM8 A;  1M57 B;  4XDK A;  3SPG A;  1K8A W;  3K58 A;  4CZZ A;  3SPI A;  2UXC B;  3NR7 A;  3JAM N;  1EN4 A;  1H2M A;  3K57 A;  1SES A;  4GUN A;  2UUC O;  3HKC B;  5GTI Z;  3ZN0 A;  1AR1 B;  3D3I A;  3BHP A;  3K79 A;  3R66 A;  2RMK B;  2WSS G;  2EIM B;  5LGT A;  1JPX A;  4DV0 B;  4DR5 B;  2P22 C;  1SRY A;  2Q7E A;  3K5O A;  2BE3 A;  1Z5W A;  3A8T A;  5EIB C;  4YJ3 B;  2IW5 A;  4R7C A;  2ZQM A;  3E86 A;  3PN1 A;  3SPC A;  3U11 A;  3BRC A;  4ZBM A;  1IBM O;  4TUY B;  3E89 A;  3SJB C;  4DV4 B;  1KYO F;  2K1E A;  1WJZ A;  1AJN A;  1J95 A;  4ABM A;  1PL4 A;  3H01 A;  3ABT A;  3D36 A;  3NXS A;  1QR8 A;  2EIK B;  2CH7 A;  4I0X A;  1K7D A;  3QO7 A;  5EZY B;  3UKM A;  1NZ6 A;  4BIU A;  3C3S A;  3OGC C;  4WBN A;  1I0H A;  3K03 A;  4D7S A;  5CN0 A;  1L0L H;  2AZ0 A;  4WFE A;  1K9M W;  4FLX A;  2R72 A;  4JAA A;  1JFF A;  4QJF B;  1V54 B;  1KB9 F;  5JH7 A;  4GZR B;  4GYC B;  4MVM A;  2WLL B;  2VS0 A;  5KHJ A;  2HHH B;  1MA1 A;  2IM9 A;  2YSU B;  4U7O A;  1RM1 C;  1V55 C;  3CC2 V;  2Y0I A;  4X1I B;  3K0D A;  4QIW F;  1M57 C;  4DR4 B;  4JI5 B;  3P30 A;  2PYL A;  2YIA A;  2ITC C;  3OEE G;  4HYO A;  3CSX A;  1EN5 A;  4QPK A;  1AR5 A;  3ZJZ A;  2PGG A;  1P84 F;  4TQD A;  1BS3 A;  4FLV A;  2EIM C;  2UXD O;  4J11 A;  4CS4 A;  2HP8 A;  1N34 O;  4CBC A;  1BHA A;  2BCC H;  4X20 B;  1I5X A;  1SQG A;  1P49 A;  4FLT A;  2IU3 A;  3CD6 V;  1XDC A;  1DTO A;  5B1O A;  4I50 B;  4X1K B;  1Q6I A;  4F6R A;  4JPR A;  2CTR A;  2XAH A;  3BCC H;  2FKX A;  1VQM V;  4EFE A;  3N2K B;  4ZOL B;  2UUC B;  2F23 A;  3ZHU A;  2ZIO A;  3WG7 B;  5KMG B;  1GAX A;  2DWE C;  4FFK A;  3CCS V;  4I55 B;  1B3Q A;  4O4I B;  1XHX A;  2EIK C;  3FFQ A;  4DO2 A;  4X65 O;  3RVZ A;  5KHH A;  3CJH B;  1FFX A;  2QM7 A;  1OV9 A;  4DR6 O;  4FFB B;  2E76 B;  2W6I G;  4QE7 A;  3B09 A;  5CA1 A;  2QKC A;  3TXS A;  2JK5 C;  4J41 A;  2P90 A;  1UPG A;  4X64 O;  2H8P C;  1V54 C;  2DOS A;  5B1N A;  2QWO B;  4QNH B;  5LP6 A;  4IHJ A;  2VQE B;  3CB2 A;  3AG1 C;  2EZP A;  1FXK A;  5L3C A;  5JJJ B;  3VBB A;  3IGA C;  4LF9 O;  1PM9 A;  2JGU A;  4K8X A;  5JVD A;  2ZIM A;  2LQT A;  2WLI B;  4NXN O;  4X88 A;  5CA0 A;  5GON A;  1D5A A;  1R1B A;  1BT8 A;  3APO A;  3FYE B;  1CXZ B;  3T2M A;  1Q6U A;  4U3J A;  1ZL8 B;  3CXC U;  3K5N A;  5IY5 B;  1IVS A;  1JMK C;  1Y66 A;  3SGI A;  1VF6 A;  4O2A B;  3JAS B;  2ZXW B;  1EBO A;  1TVK B;  2P4V A;  5LA6 B;  4PA9 A;  1U96 A;  5A2Q N;  3CRQ A;  2P06 A;  1O9G A;  1VQO V;  4JI2 B;  3SJA C;  1ZWI C;  2Z3Y A;  1WLE A;  4HBN A;  1IXM A;  3ZHR A;  3FD9 A;  1BCC H;  4X89 A;  3UQ8 A;  4L87 A;  2GSM B;  3TET A;  3JSL A;  3RYI A;  5IYZ A;  4CH3 A;  3WG7 C;  1Y76 A;  3JD1 A;  1NBM G;  3W7W A;  1D5N A;  3CME V;  2XAS A;  4JI1 O;  4CC6 A;  2HG5 C;  3CEI A;  1N36 O;  3RW0 A;  4LFB B;  4JYA B;  2A79 B;  4E4E A;  1BSM A;  3B8M A;  3JD2 A;  1I5Y A;  2Q68 A;  5L3B A;  2XAG A;  3CXH F;  3MHH C;  2AHZ A;  1WNS A;  3LDC A;  4LH6 A;  3OGI B;  4B3R O;  1WP7 A;  5BMV B;  1K5Q A;  2RCV A;  3K9A A;  1YJN V;  3JYC A;  1VMG A;  4J10 A;  4PDM A;  1NTK H;  2H3O A;  1PV0 A;  3AG3 B;  4GKK O;  4ZI7 A;  4AQY O;  1R3K C;  1H2G A;  5L3G A;  3OUS A;  3ETD A;  2DYS B;  3ZRW A;  5C8Y B;  3LNN A;  1HNZ O;  1JOY A;  1SKV A;  3GWK C;  3OW2 U;  2B9Z A;  4YY3 B;  1N4C A;  2KG7 B;  4DR2 O;  1YIT V;  3QO8 A;  2V1D A;  3CCE V;  4DR7 B;  4LF5 B;  2QTO A;  2K9P A;  1PP9 H;  1QU7 A;  5K1X A;  3ASO C;  3ZHS A;  5IY5 C;  3M7M X;  4G2K A;  3EFF K;  4BIO A;  5DM6 V;  1H8E G;  2ZXW C;  5IDJ A;  4J9Z B;  3E8H A;  3JCZ A;  4NXM B;  1COW G;  5BY1 A;  4P9P A;  3T1C A;  2AW9 A;  4JTC B;  5KX5 A;  1S5H C;  1RSO A;  1GN6 A;  1AP6 A;  2QKA A;  2ZNJ A;  4OGQ B;  3K5L A;  2NNU A;  2Z5U A;  3F5T A;  4LH7 A;  1N33 B;  1H2S B;  4JAV A;  4E2L A;  3FX7 A;  3ABK B;  2G38 A;  4LF7 B;  2EJR A;  4FLY A;  1KKC A;  2V4D A;  2FL4 A;  1MNG A;  2UXX A;  2E5L O;  2DQ3 A;  1FFT B;  4CH5 A;  1V9P A;  1N32 O;  3JAT A;  4GX1 A;  5H2F Z;  1QLE B;  1ZAU A;  4FM1 A;  4DV3 O;  2IJK A;  3CCU V;  1MZE A;  4U7N A;  1AIL A;  2EUL A;  3WU2 Z;  2NR5 A;  4YJ2 B;  4TV9 A;  1OZ0 A;  5FNV B;  3W7U A;  5LXT B;  3AG3 C;  4LWS B;  4UUJ C;  1M9N A;  4DV2 O;  5LHH A;  4B3M O;  5LYJ A;  2UXB B;  2EIL C;  2RJZ A;  4DK0 A;  2DYS C;  1I08 A;  2ZM6 B;  2P6J A;  1Y74 B;  4R8C A;  2IH3 C;  1HR0 O;  1S76 D;  3Q4H A;  1H38 A;  1AI7 A;  2UXC O;  4GX0 A;  1PKX A;  1R3J C;  3F5W C;  2ILM A;  1GN2 A;  3E35 A;  3OUF A;  4DV6 B;  2VQF B;  4NB5 A;  2LW1 A;  4O4H A;  1PNM A;  4DW0 A;  2YID A;  1VQN V;  2UU9 B;  3CP1 A;  4LR3 A;  4JI0 B;  1YIJ V;  5KLV H;  2Q5Z A;  3TCU A;  2JIZ G;  4DR5 O;  2A3Q A;  4TV8 A;  3FB8 C;  2QA4 V;  3FB5 C;  3L74 H;  1XL6 A;  3VQW A;  4UCU A;  3WB0 A;  4X9Q A;  4MS2 A;  1IX9 A;  3D8C A;  1Q5O A;  3C90 A;  2FYU H;  3HB3 B;  4Q6G A;  3X2Q B;  5IJ0 B;  2YIB D;  3HKC A;  3OD4 A;  4DV4 O;  2GHY A;  1K4D C;  4UCS A;  5F2V O;  1NR1 A;  3ETG A;  3EVK A;  1YSC A;  3H1J H;  1VQ6 V;  4OPA A;  1QLE C;  5J9P C;  2YI8 A;  3ICX A;  4IYH A;  3OEH G;  4G28 B;  3VQV A;  2YEV B;  4IL6 Z;  1XMQ B;  1EN6 A;  3JD4 A;  3BA8 A;  3L72 H;  1DLB A;  1EM1 A;  1W0K G;  2Q6A A;  5J2T B;  2RDC A;  1H8H G;  4YIO A;  5IJ9 B;  2YXL A;  3UM7 A;  1TUB B;  1PNL A;  4A5U B;  1KC8 W;  5GW7 A;  2YS8 A;  1IBL B;  3LDE A;  3RT3 C;  1MZF A;  2HHH O;  3OR7 C;  3UCS C;  4TSF G;  4UV8 A;  1R6N A;  1Z2G A;  3AK2 A;  2OIE A;  5EZY A;  2UUA B;  3KG2 A;  2EX3 A;  1WB7 A;  2RN9 A;  4ZHQ A;  1VQ4 V;  1K73 W;  3T4D A;  4AIL C;  4MT8 A;  2WA3 A;  4KHP B;  3MDS A;  1GRJ A;  3CRA A;  1UJW B;  2A9H A;  4WFF A;  4OPH A;  4B08 A;  2P4K A;  2CGN A;  1SQX H;  3T1H B;  4UVB A;  2BSK B;  2WLL A;  3CCL V;  1Q90 D;  5H9C A;  1JX9 A;  4UB6 Z;  2DYR B;  4H0L B;  1WN7 A;  4X1I A;  1FKA O;  1Q6H A;  3SYO A;  2M7W A;  1W2B U;  3AK1 A;  3AG7 A;  5GTH Z;  3ZRX A;  4OX9 B;  5CBH A;  1YTF D;  3J7A U;  2YI9 A;  2ZD9 A;  1XNQ B;  2QE7 G;  5B3S B;  4X8A A;  1DF4 A;  1HDJ A;  4R6Z A;  2OCC B;  3IAY A;  5FLX N;  1Q7Y W;  1HNX B;  4X1Y B;  4K0K B;  4FK5 C;  4YXW G;  4PA7 A;  1L0N H;  1MAB G;  3GVM A;  3OM3 B;  3VQY A;  2GUZ B;  5J2U A;  5EBL C;  4X20 A;  1JVM A;  5E79 Z;  3RYF B;  4HNA A;  1VQ7 V;  4BW9 A;  1VQL V;  4HAM A;  1SS3 A;  3RGB A;  3K5M A;  4JTD B;  1M93 A;  5A9G A;  2KB1 A;  4EEQ A;  4JZG A;  3RVY A;  4WFA V;  2CTW A;  3LUT B;  2XTA A;  1K92 A;  5KMG A;  2VQE O;  1Q82 W;  4FZ0 A;  3HKE A;  3B2E E;  3N27 A;  1TA8 A;  1XEQ A;  4MTF A;  3O65 A;  4WFB V;  3J81 N;  4FFB A;  2ADQ B;  2IH1 C;  3UO3 A;  3QNE A;  1BMF G;  1H2K A;  1K33 A;  1WP8 A;  3JAK B;  1BQZ A;  1K34 A;  4PV1 B;  4WCE V;  2EBO A;  5IYB O;  3ZN1 A;  1VP7 A;  1VQP V;  4H44 B;  1AI5 A;  3OT7 A;  2DYR C;  5FL7 G;  1WPX A;  1VQK V;  4ASU G;  4MVZ A;  1XIL A;  4GLX A;  5LL6 Y;  4JI2 O;  1KD1 W;  1R3I C;  1OCR B;  2B1G A;  1XRE A;  3G71 V;  2WAM A;  5ITZ A;  5IT9 N;  3SYC A;  3CYO A;  2Q4P A;  2XOK G;  2XAJ A;  3KKY A;  1PL0 A;  2XHB A;  2ZE5 A;  3IC9 A;  5KHG A;  1Y4M A;  2F95 B;  3ZMV A;  1YHQ V;  3H1H H;  5C93 A;  4LFB O;  4O2A A;  3JAS A;  1TVK A;  1BL8 A;  4RQE A;  4JYA O;  3FAV A;  5EYP A;  2X6A A;  5HFM A;  1WA8 A;  4K35 A;  2ZDI A;  3MHS C;  2EZO A;  2QJ1 A;  2DQ0 A;  3N2G B;  4BW5 A;  4XDJ A;  1LUV A;  5BZB A;  4DRX A;  3SDL A;  5D5P A;  2JRI A;  4LCU C;  1T5E A;  3ZED A;  3LDD A;  2W0F C;  2HVK C;  5KAI Z;  3K08 A;  4PHZ A;  1FJG B;  2UUB B;  1VQ5 V;  4MVQ A;  3ABM B;  3VQX A;  4LFC B;  1XOU A;  4YY3 O;  1TGO A;  5LGN A;  1KBH A;  4TT3 G;  2R9A A;  4MTX A;  2Q7G A;  1S0V A;  4KP4 A;  5EK0 A;  4DR3 B;  4DR7 O;  3CCV V;  4LF5 O;  4W4K A;  3ETQ A;  4I0X B;  1OCO B;  4B7E A;  5B66 Z;  4LNU B;  4WBN B;  5EC2 C;  3CRC A;  4PA3 A;  3HR0 A;  3MAQ A;  4NXM O;  1XL4 A;  3RWR D;  3U10 A;  3U0Z A;  4DV7 B;  3H1K H;  1JFF B;  1OCR C;  4JF3 A;  5C8Y A;  5EBW C;  5JCO A;  1R6K A;  3G6B A;  5CB4 B;  4EB6 A;  1FPO A;  2KG7 A;  3OMA B;  4O4J A;  5KUK A;  4GCZ A;  1N33 O;  2ATK C;  5KAF Z;  2GBO A;  3OTO B;  2JS5 A;  3ZCC A;  1VQ9 V;  4LF7 O;  3APQ A;  5BXZ A;  4RQF A;  3OMI B;  1NVP D;  5E1A C;  4JI3 B;  1M56 B;  1SQQ H;  1NTM H;  3HKB B;  1AR4 A;  1JQ0 A;  3E22 A;  4ICG A;  3JAL A;  1NI8 A;  3W7T A;  3HKD B;  4JTA B;  1Q3E A;  3ZMZ A;  2ARH A;  4IGG A;  2WLK A;  2D3O W;  4GX5 A;  4ZKI A;  2D2C B;  1O9H A;  2F93 B;  4F6R B;  1AI6 A;  3SYA A;  4PJ0 Z;  2XAF A;  4DV1 B;  2UXB O;  3BFR A;  4F4L A;  3BAA A;  3ABM C;  2ZM6 O;  2NN4 A;  1XI1 A; 
#chains in the Genus database with same CATH homology
 1H38 A;  5LHI A;  4MTG A;  1AI7 A;  1ORQ C;  2PI5 A;  2B5U A;  2ZR2 A;  1EZJ A;  1GM8 A;  1M57 B;  1PKX A;  1R3J C;  3F5W C;  3JD0 A;  1OCZ B;  4GX0 A;  3E35 A;  1OCO C;  3SPG A;  3SPI A;  4CZZ A;  4JAS A;  3OUF A;  4BAY A;  1SES A;  1PNM A;  4Z1M G;  1S72 V;  2X6B A;  1GM9 A;  1GKF A;  1K97 A;  1VQN V;  1HWY A;  5EBM C;  3ZN0 A;  1TUE B;  3BY6 A;  4KFM A;  1AR1 B;  3CMA V;  2HLD G;  2FTK A;  3D3I A;  3CP1 A;  2EIN B;  3K79 A;  1YIJ V;  1KP3 A;  1E1Q G;  3W7X A;  2WSS G;  4UVC A;  2EIM B;  1F4N A;  5LGT A;  1JPX A;  3TCU A;  2JIZ G;  4FIP C;  5IYD O;  2HJF C;  1SRY A;  2A0L A;  1KEC A;  3FB8 C;  2IJJ A;  4R8C A;  4DXW A;  3OR6 C;  2QA4 V;  3FB5 C;  1XL6 A;  4P30 A;  1FXK B;  4I5S A;  4J9Y B;  4MW8 A;  4MS2 A;  3ZRV A;  2IW5 A;  1OCC B;  2X7R B;  4JYC A;  2OT5 A;  4R7C A;  1N8R W;  4H33 A;  5L3D A;  2ZQM A;  3E86 A;  3SPC A;  3HB3 B;  5H6R A;  3X2Q B;  2OTJ V;  4ZBM A;  4XDL A;  4WF9 V;  3E89 A;  2GHY A;  1K4D C;  1NR1 A;  1M56 C;  2K1E A;  2CK3 G;  3ETG A;  4I9W A;  1AJN A;  1J95 A;  3EHB B;  2EIJ C;  1YSC A;  1VQ6 V;  3H01 A;  1QLE C;  2WLN A;  1AJP A;  5J9P C;  3STL C;  3ABT A;  1QBZ A;  3OEH G;  4G28 B;  3P32 A;  4GT1 A;  1GK9 A;  2YEV B;  3JD4 A;  3D36 A;  3NXS A;  1QR8 A;  1KKD A;  2EIK B;  5DN6 G;  1K7D A;  3QO7 A;  3UKM A;  4BIU A;  3ZMS A;  1DLB A;  1G8M A;  3OGC C;  1W0K G;  2Q6A A;  3K03 A;  1G4Y B;  5L3F A;  5CN0 A;  3AG4 B;  1E1R G;  1H8H G;  3B8N A;  3E2E A;  1FXV A;  3UM7 A;  4WFE A;  1YI2 V;  1PNL A;  1K9M W;  1P4R A;  1KC8 W;  1ROP A;  4RO2 A;  5GW7 A;  4QJF B;  1V54 B;  5CMU A;  3LDE A;  1W0J G;  4MVM A;  2WLL B;  3M99 B;  3OR7 C;  4TSF G;  3QO5 A;  4UV8 A;  2YSU B;  4U7O A;  1RM1 C;  2X0L A;  1R6N A;  1V55 C;  3ASO B;  3B77 A;  3CC2 V;  3DTU B;  3CCR V;  3KG2 A;  3K0D A;  4QIW F;  1M57 C;  1OCZ C;  1M90 W;  1NH2 D;  3P30 A;  1VQ4 V;  2JJ2 G;  1K73 W;  3T4D A;  4MT8 A;  2ITC C;  3OEE G;  3JD3 A;  4WFH A;  4HYO A;  1UJW B;  2A9H A;  2WLH A;  4WFF A;  3LNM B;  1NKD A;  2B1I A;  3OE7 G;  4QE9 A;  2AHY A;  4LP8 A;  1EFR G;  4QPK A;  3ZJZ A;  2EIN C;  1K4C C;  2XAQ A;  1R3L C;  2WWW A;  2HKO A;  1E79 G;  1QR9 A;  2EIM C;  2WLL A;  3E8G A;  4UVB A;  2ZR3 A;  3CCL V;  4PDR A;  5EC1 C;  3RBZ A;  5H9C A;  1R73 A;  1JX9 A;  4CBC A;  1BHA A;  2Q67 A;  1GM7 A;  3R65 A;  2IJH A;  2DWD C;  1PD3 A;  2DYR B;  3IC7 A;  1NH2 B;  2P7T C;  1I5X A;  3SYO A;  2V7Q G;  1YJW V;  2IU3 A;  3CD6 V;  2M7W A;  1W2B U;  1DTO A;  1OCC C;  5B1O A;  4LC1 A;  3ZRX A;  5CBH A;  3AG2 B;  2HR3 A;  1YTF D;  4JPR A;  2XAH A;  3SYQ A;  2HVJ C;  5IYC O;  2ZD9 A;  2QE7 G;  2WLJ A;  5B3S B;  4MSW C;  3ZRW B;  1VQM V;  4X8A A;  1Q81 W;  1DF4 A;  4R6Z A;  1SET A;  2OCC B;  1Q7Y W;  4MW3 A;  4JAU A;  4MVS A;  4FK5 C;  4YXW G;  4PA7 A;  3FKS G;  3CCJ V;  1MAB G;  3OM3 B;  4XDK A;  3WG7 B;  4GX2 A;  4G27 B;  4PDL A;  2DWE C;  5EBL C;  3CCS V;  3K0G A;  1JVM A;  3ABL B;  2Y69 B;  5CBG A;  4EKW A;  5KA5 A;  4MTO A;  1YTF B;  2EIK C;  4DO2 A;  1VQ7 V;  3RVZ A;  1VQL V;  4HAM A;  3ABK C;  3IFX A;  1L1F A;  2QM7 A;  5KA6 A;  2LFR A;  2WLM A;  2EIL B;  3WFV A;  3AG4 C;  4KUM A;  2W6I G;  4QE7 A;  4MVO A;  4JTD B;  2KB1 A;  2JK5 C;  2P90 A;  2JEX A;  3RVY A;  3ML0 A;  4WFA V;  2H8P C;  1V54 C;  3LUT B;  5B1A B;  5B1N A;  1K92 A;  4QNH B;  1SZT A;  3FB6 C;  1Q86 W;  1Q82 W;  3K3W A;  3OAA G;  3AG1 C;  2EZP A;  1FXK A;  3ABU A;  2UXN A;  5L3C A;  1RPO A;  3VBB A;  3IGA C;  4MTF A;  4UVA A;  1NR7 A;  4Q20 A;  1SER A;  1FS0 G;  4WFB V;  3E83 A;  2IH1 C;  1GMG A;  4XBF A;  2H94 A;  3QNE A;  2ZDI C;  1JCH A;  1BMF G;  1OHH G;  2R9R B;  2WLI B;  2DW4 A;  4X88 A;  1K33 A;  4UV9 A;  1NQT A;  1K34 A;  3LSQ A;  2QKS A;  4WCE V;  2EBO A;  3FYE B;  5IYB O;  3T2M A;  3ZN1 A;  4JYB A;  3CXC U;  1VQP V;  4MVU A;  4TWK A;  1AI5 A;  2BOB C;  2C2A A;  2YEV A;  2DYR C;  5FL7 G;  4R50 A;  1WPX A;  4RUF A;  5CBF A;  5IY5 B;  4BIZ A;  1F51 A;  1Y66 A;  2BOC C;  5LHG A;  1VQK V;  3ETE A;  4MVZ A;  4N21 A;  4ASU G;  5H6Q A;  2ZXW B;  1EBO A;  3ZMT A;  3ASN B;  4PA9 A;  3I56 V;  3AG2 C;  3SYP A;  1KD1 W;  1R3I C;  1OCR B;  1QVG U;  1VQO V;  1ZWI C;  3DGE A;  3E8F A;  1YJ9 V;  2B1G A;  2Z3Y A;  3G71 V;  1WLE A;  2MK3 A;  1IXM A;  2HFE C;  2X6C A;  2ITD C;  2WAM A;  1K3E A;  4X89 A;  4L87 A;  3SYC A;  1RPR A;  2GSM B;  3CYO A;  3TET A;  2QM8 A;  2XOK G;  2XAJ A;  3WG7 C;  1PL0 A;  1CP9 A;  3JD1 A;  1NBM G;  3W7W A;  3CME V;  2XAS A;  3TK1 A;  2OTL V;  3MD0 A;  1K8A W;  1Y4M A;  1YHQ V;  3ZMV A;  5C93 A;  3ABL C;  5B1B B;  2Y69 C;  2HG5 C;  2Q69 A;  3CC4 V;  3PJS K;  1FXK C;  4RQE A;  1BL8 A;  3RW0 A;  4PA6 A;  2XND G;  2A79 B;  2X6A A;  3ZRS A;  3B8M A;  3JD2 A;  5HFM A;  1I5Y A;  3HPL C;  2Q68 A;  3SPJ A;  5L3B A;  1ARO P;  2LP7 A;  2XAG A;  3X2Q C;  1FXH A;  4PEL A;  3GB7 C;  2JJ1 G;  2ZDI A;  4FMT A;  3MHH C;  3MHS C;  2AHZ A;  2EZO A;  1DF5 A;  3AEI A;  3I55 V;  2DQ0 A;  2JEU A;  4BW5 A;  2F43 G;  3LDC A;  5B1A C;  1ENV A;  3OMN B;  4XDJ A;  4H37 A;  5BZB A;  1K5Q A;  3K9A A;  4RAI A;  4P9O A;  4OXS A;  1YJN V;  1GTO A;  1MOF A;  3JYC A;  4LCU C;  1LNQ A;  1S3J A;  4PDM A;  1KQS U;  1S77 D;  2R9I A;  1AI4 A;  2W0F C;  3LDD A;  1AJQ A;  3AG3 B;  3GWO A;  4WFG A;  1K5S A;  1R3K C;  2LFS A;  3FYI B;  2HVK C;  4FJC C;  3F7Y C;  4JGS A;  1H2G A;  3K08 A;  3CPW U;  5L3G A;  3OUS A;  3ETD A;  4QPJ A;  3CCM V;  1VQ5 V;  1CEZ A;  4MVQ A;  2DYS B;  3ZRW A;  3ABM B;  2NLJ C;  3ZIA G;  1NJI W;  1P7B A;  1JOY A;  5LGN A;  3OW2 U;  1THZ A;  4TT3 G;  4MTX A;  1S0V A;  2WPD G;  1PNK A;  4KP4 A;  3OFN G;  3STZ C;  5EK0 A;  1QCE A;  4FPP A;  3QO8 A;  3FB7 C;  2V1D A;  1YIT V;  2JDI G;  3CCE V;  3CCV V;  1KP2 A;  2QTO A;  1MSW D;  1OCO B;  1M1K W;  4RUE A;  5CA3 A;  3ASO C;  5IY5 C;  2PI4 A;  3BEH A;  4G2K A;  2QEX V;  5EC2 C;  3EFF K;  4PA3 A;  5DM6 V;  1H8E G;  2ZXW C;  5IDJ A;  3ASN C;  4J9Z B;  3E8H A;  3JCZ A;  1XL4 A;  3K06 A;  1COW G;  4P9P A;  1JJ2 U;  5KUM A;  2IU0 A;  1OCR C;  4JF3 A;  3CCQ V;  3T4Z A;  1B6Q A;  5EBW C;  3T1C A;  3E8B A;  1R6K A;  4JTC B;  1S5H C;  3W7S A;  3OMA B;  2NNU A;  5HFL A;  5KUK A;  4GCZ A;  2Z5U A;  3LSS A;  2ATK C;  4JAV A;  4E2L A;  3ABK B;  3F7V C;  3ZCC A;  1VQ9 V;  1QLN A;  2EJR A;  5B1B C;  2W6J G;  1CPY A;  2UXX A;  4PA4 A;  4RQF A;  1BHB A;  1F23 A;  2DQ3 A;  3ZMU A;  3OMI B;  1NVP D;  1FFT B;  5L3E A;  4LBE C;  5E1A C;  1GO3 F;  1M56 B;  3A0R A;  1VQ8 V;  5B3S C;  2WLI A;  2EIJ B;  1JQ0 A;  4GX1 A;  1QLE B;  2OCC C;  3W7T A;  2IJK A;  2P67 A;  1MG1 A;  3AG1 B;  3CCU V;  4U7N A;  4JTA B;  5LGU A;  2Y48 A;  3ZMZ A;  1F4M A;  2WLK A;  2D3O W;  4GX5 A;  1QVF U;  1OZ0 A;  4ZKI A;  1AI6 A;  3SYA A;  3W7U A;  1NVP B;  2XAF A;  3AG3 C;  3VOU A;  3CC7 V;  4UUJ C;  1M9N A;  5LHH A;  3SPH A;  2EIL C;  5LBQ A;  2IJI A;  4F4L A;  2DYS C;  4MVR A;  3ABM C;  4N23 A;  4PDV A;  3G4S V;  3K04 A;  4P2Z A;  3G6E V;  2P6J A;  4UXN A;  4HZ3 A;  3SJQ C;  2IH3 C;  1RM1 B;  1S76 D;  1V55 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...