3GWOA

Structure of the c-terminal domain of a putative hiv-1 gp41 fusion intermediate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
WDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Envelope glycoprotein gp160
publication title Role of a putative gp41 dimerization domain in human immunodeficiency virus type 1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
total genus 24
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3gwoA00
5HFLA 5CN0A 1MOFA 5CMUA 4JF3A 3MHHC 3GWOA 1K34A 3CP1A 2EBOA 4FJCC 3B77A 3K9AA 1F23A 3WFVA 3H01A 5KA5A 3MHSC 1SZTA 2EZPA 3P30A 4FIPC 2MK3A 4E2LA 2OT5A 1JPXA 1Y66A 4G2KA 2LP7A 1K33A 4N23A 1MG1A 1EBOA 1QCEA 1I5YA 4FK5C 3B8MA 5H9CA 2P6JA 1QR9A 1QR8A 3B8NA 1DF4A 1DLBA 5HFMA 1ENVA 3CYOA 4N21A 5KA6A 1Y4MA 1DF5A 1I5XA 2M7WA 2EZOA 1QBZA 1JQ0A 2X7RB 3M99B 4JGSA 4JPRA
chains in the Genus database with same CATH superfamily
1AR4A 2Q7EA 4YHHO 2LGWA 4J41A 4DUZO 4MW8A 3RVZA 4WFFA 5H5NA 5IY5B 3E86A 1R3IC 1I08A 1WN7A 1IBKO 4X89A 2VS0A 1VQPV 1PV0A 1K5SA 3OMAB 1K5QA 4UCOA 4RAIA 4GKJO 4DV6B 3MHSC 3G80A 4I55B 4NXNO 1WAZA 4P2ZA 4QPKA 1W59A 2CTPA 3LUTB 4GX1A 3KCXA 1CXZB 3L73H 1RM1C 1G6UA 2Z0AA 4CBCA 4JI8B 2XOKG 3EXAA 3HKCA 1N36O 4X65O 2PYJA 3QVNA 5BXZA 4AI8A 1XREA 3C3TA 3ZMTA 2WLIA 4PDLA 2WAMA 3ASOB 2UUCO 2ZNJA 3JASB 3CXCU 1H2SB 1ZAUA 4A5UB 1W2BU 4FLVA 1CPYA 2EINC 1HNZO 2E75B 3ETDA 3SYPA 1SQVH 3JD0A 5KHJA 4FJCC 2PZSA 2OCCB 3HKDB 1SZTA 2CH7A 1XHZA 3RYIA 3T2MA 1ZTEA 1EBOA 1SERA 3VBBA 4DK1A 1DF4A 2EILC 1GKFA 2NN4A 3S3XA 2YXYA 3E22B 5LL6Y 3IJ4A 3OMNB 4I50A 1XUQA 4DR3O 4PELA 3SR2C 4D6TH 4LCUC 5GONB 3RYCB 1WPXA 1F7YA 5TISZ 5JJNB 4DO2A 4H33A 2JJ2G 2VRZA 3GB7C 4DV0O 2ZE5A 3DTUB 3AG4B 5D5QA 4UCRA 2P5OA 2WLKA 4LFBO 2A7WA 3FX7A 2VQEO 1R6KA 1M93A 3UCSC 4OXSA 2X6AA 4KHPB 1JR9A 2XAGA 4BW5A 2V1DA 4I55A 1QHTA 1GM7A 2ZDIA 4DR6B 2CDYA 3CMAV 2DW4A 2QWPB 1KP3A 5JJJB 1QVGU 4MS2A 1H2LA 3KKYA 4JYAO 4LFCB 2EZPA 4H13B 5LHIA 2XUMA 3DGEA 4D7SA 1P49A 3SYCA 3IGAC 3OAAG 4G2KA 5DEDA 1YTFB 1SA0B 1MG1A 2ZT9B 2E3CA 3OGIB 4RO2A 4YJ3B 3AG7A 4W4KA 1LR1A 3CCJV 4U3JA 4JTCB 4NB5A 3BVOA 4EFEA 3C3SA 2UXDB 3K58A 3IC9A 3R65A 3JASA 2ZR3A 5JWPA 2EULA 1AB3A 1IBLB 4MTGA 2YIAA 3L72H 1L0NH 4JI7B 4QE7A 4UB8Z 4B3SO 3HKDA 4O2BB 1OJHA 1HW7A 4DV7O 3HKEB 4CS2A 3L74H 1HNXB 4D7TA 2Z3YA 2DOSA 3SGIA 1NH2B 3U11A 3BA9A 4I4TB 2F66C 3TGUH 3CCQV 4LBEC 4BAYA 1Q82W 4DUYB 1OHHG 2QDOA 3TXQA 3WG7B 2XAJA 4X64O 1M9NA 2ITCC 3S3WA 5HFMA 1GH6A 1MSDA 1AJPA 4UVCA 5GW7A 1M90W 2QM4A 5GONA 3RYCA 2WSSG 5LYJB 1I94B 3P32A 3ZS8C 2HVJC 2Q73A 2UUAO 2QWQB 1D5NA 1H2GA 3CHXA 4JV5O 1GN3A 4JI0B 1IXBA 2XASA 4F4LA 2YICA 3IAYA 4FLTA 2F4VB 3BAAA 2W6JG 2Y0PA 3B77A 1QNMA 5DECA 4B08A 2OIEA 3AG1B 3H1HH 4TSFG 1VP7A 4ASUG 1ZL8B 4X88A 4CS3A 5IWAB 4NXMB 4LWSB 3VQVA 2QSAA 3JAKA 1VQ9V 1SETA 5JVDA 3CCRV 2CAZC 4JZGA 2Y48A 5B1BB 1ZX3A 3THOA 1PNKA 5LMNO 3FYEB 3QO5A 2VWKA 3LSUA 2E76B 1A32A 1VQ8V 3AG3C 4DR5B 4UB6Z 3VQYA 4GX5A 3K79A 3TK1A 2RN9A 2WLNA 5IJ9B 5FL7G 1M56C 2CTRA 4X66O 3QNEA 1R6NA 2QTSA 1ORQC 2QTOA 3SPCA 5IT9N 2YIDA 5LBQA 3TJTA 1WPBA 4B3MO 3L70H 3G4SV 4O2BA 2QWOB 2DYRB 5EYPA 1AR5A 2KQXA 2VQFO 4GX2A 2P6JA 4JI2O 3WB2A 3P3PA 4O4LB 5JCOA 4MTXA 3CCUV 3JD1A 1L0LH 4GT1A 1QLEC 4PA6A 2ZR2A 3ZRXA 1VEWA 4H44B 4J10A 3JD3A 4LC1A 2F23A 2ZE6A 2ZXWC 2QEXV 1N32B 5LYJA 2BTOA 2D2CB 3ZEDA 3SPHA 1R1BA 1VQKV 3APOA 3FB7C 5EBLC 2BE3A 4UVAA 4NTYA 3CRQA 4B3TB 2EIJC 1JPXA 3ABLC 2AHZA 2HLDG 4OPHA 4ZIBA 2P4KA 2CK3G 5EC2C 5IDJA 1YEWA 2YI9A 4DV6O 3HKBB 1R73A 2VWJA 3DXRB 3B40A 1ZL8A 2HR3A 4LWSA 4DR7B 1YHQV 3QTCA 3A0BZ 1Q5OA 5L3GA 2Q69A 2EIMC 1G8MA 5BY1A 1DLBA 2PYLA 4JI8O 1FXKB 1WP7A 1Y4MA 5J2UB 1R6TA 4ZKIA 3E8BA 5CA0B 3G6EV 1V54C 2OWOA 1L1FA 2KG7B 5FPOA 1YVWA 3JCUZ 4RUFA 3QG5A 4YJ2B 4BW9A 1EN4A 1XNQB 1N4CA 2FL4A 2DYSC 4NR1A 5BZBA 4K8ZA 4DV5B 1I5XA 3E8FA 3BCCH 3JARB 1TA8A 1Z2GA 2GUZB 1RPRA 5KA5A 1XMQB 5E79Z 4O4LA 4G27B 3ZRVA 1THZA 4DXWA 1S76D 2V7QG 2GSMB 1S72V 1VF5B 1EN6A 3IC7A 5B3SB 1VQ5V 4WBNB 2W0XA 1G4YB 4PA3A 3WFVA 1YF2A 5LA6B 1PNMA 4PA9A 4K0KB 1F51A 1URFA 1XEQA 4PA7A 2Q0OC 5FNVB 3B2EE 2LJ2A 2QKCA 4EKWA 4DV2O 3ZHTA 5K1PA 3L9DA 1Y76B 1RFYA 4GCZA 4CC5A 1XBLA 1LUVA 1P4RA 2BCCH 4J11A 2WWWA 5GTHZ 4IGGA 2ADQB 4QNHB 1KD1W 2FYUH 4KHPO 1VQMV 2EX3A 1KUQA 4GKKB 1N0JA 4YXWG 2R70A 1E1RG 4MTFA 1M1KW 4LFCO 1JVMA 5IY5C 3O65A 1KMIZ 3T1YB 2UXXA 4BR6A 1BGYH 2RNBA 5J2UA 3RGBA 2CE4A 1VIBA 3J80N 1QR9A 2UXDO 5CA0A 2KG7A 4DR4B 5EK0A 4FMTA 3ZHSA 2ZDIC 4EB6B 1IBLO 4NVPA 5IYBO 3VQWA 4UV8A 2UUBB 1VQOV 1N34B 1RPOA 1YTFD 3DC5A 1K33A 4WFGA 1P84F 3JARA 1YJNV 1HNXO 2GUZA 1DK1A 2ZIMA 3E8HA 1NT2B 1QBZA 2X7RB 3O9OA 3CCMV 1K73W 1OCZB 3OW2U 4DUYO 4L87A 2IH1C 1SQFA 3BPZA 3JALB 2P67A 5IE9A 3BHPA 4BIUA 3HB3B 2E5LB 2QM8A 1UPGA 3A0RA 3W7SA 4AILC 2UXBB 3ZMUA 4JGSA 4LH7A 2OCCC 1NH2D 1XNRB 1I94O 1M5IA 4LFAB 4BWAA 4KUMA 5FNVA 4X62O 4MVOA 2KB1A 4IHJB 3JAMN 2NLJC 1HR0O 4WFAV 1AJQA 5KX5A 3LNMB 4JI0O 3FAVB 1VF6A 3K0DA 2BSKB 2F4VO 2RCVA 2RJZA 2PF4E 1AILA 1FJGO 1VF7A 4F6RA 3A8TA 2JGDB 1AR1B 4FVMA 1SKVA 2QJ1A 5IWAO 2GTSA 4EFBA 1FFXB 4NXMO 4O4IB 4JYYA 3T1HO 1GMGA 3AG4C 3RWRD 4N21A 4CC6A 2BOBC 2P90A 2ATKC 4I7ZB 1RM1B 1BQZA 3KZIZ 1HDJA 4L8JA 2AHYA 2EBOA 5LGTA 2IH3C 3UT5B 4FIPC 4GLXA 2WLLB 3ZCCA 1GM9A 1R3KC 3SPJA 1VQNV 4EB6A 2FB5A 2YDEA 1KBHA 3A2FA 3K08A 1OV9A 4CH4A 1B04A 3CB2A 4MVSA 1NU1H 1EFRG 4JZ2A 4DV3B 4AHCA 1HNWO 3DC6A 2L6LA 3JAWB 3LDCA 5BR8B 4FM1A 2HEPA 5LP6B 1K92A 3PJSK 3APQA 3D3IA 3W7UA 1YIJV 3K5NA 3F5WC 1D2DA 2DWEC 1Q3EA 1SQGA 1LNQA 3UO2A 4X8AA 2UU9O 1NS1A 3ZHRA 1F4NA 1K4CC 1N32O 1IURA 1R3JC 4DYLA 4ICGA 1PL4A 2ZD9A 3OTOB 4J42A 4LF8O 5H9CA 2Q7GA 1EM1A 1SC5B 2DE0X 3SYQA 5KMGB 3P3NA 3K9SA 5JCOC 1ROPA 3RFRA 1OCOB 1XMOO 3GWOA 1EN5A 2Y69B 4DR2B 4WFHA 2FKXA 5L3CA 3WG7C 4QJFB 3K5MA 4JI3B 2QR4A 3D36C 1XL6A 2R9AA 2ZQMA 4X1YB 1BSMA 1RSOB 2F43G 5B1AB 3LDEA 2E74B 1KYOF 1BCCH 1AP6A 4X20B 3K5LA 1VQ4V 2DN9A 4ZOLB 4DR7O 1OCRB 5LXTB 4MT8A 2A06H 3GWKC 1VQ6V 2G38A 1B06A 4FM0A 2HHHO 3E22A 2YI8A 3F7YC 3ZHVA 4HZ3A 3CCSV 2N74A 3CYOA 4R6ZA 3UT5A 4W4LA 2ZNIA 2DQ3A 5KUKA 3ZX6A 4NTXA 1NR7A 2XT9A 4FZ1A 1K34A 1OCCC 1Y74B 3AG1C 1NTMH 5KAIZ 3ZN0A 4TOIA 3RT3C 1XNQO 2LO1A 1W0JG 3E83A 3SJAC 4FLXA 2LP7A 1JJ2U 1S77D 1GN4A 4DV5O 5B1BC 3JAWA 1XMQO 4IT5A 5LP6A 4BIOA 2ZE7A 4OGQB 4WFEA 1WLEA 1XOUA 1Q86W 3T4DA 1JMKC 2RDCA 3LSSA 2P4VA 2Q7HA 3JATB 3B8NA 2UUCB 3E35A 4LNUB 3ZMSA 3CJHB 2JS3A 3RYHB 2M7WA 4P9PA 4KL1A 4K0KO 1FXHA 1HNZB 1SA0A 2GDSA 1VARA 4P30A 4YJ3A 5CA3A 4Q20A 5LOVB 5L3EA 5KMGA 1FKAO 2OT5A 4DV1O 5DN6G 3X2QB 4O2AB 1J95A 2XAQA 3MDSA 4FZ0A 4Q6GA 4JI1B 1TVKB 4QIWF 1KECA 2IBZH 4JASA 4X1YA 1U96A 1ZUQA 4GKKO 1CEZA 3HKEA 2KKWA 4X20A 1BL8A 4UXNA 1X4TA 2AZ2A 3CCLV 4FLUA 4I9WA 5LXTA 4Z1MG 2ZE8A 4I4TA 3JD2A 3Q4HB 5JH7B 1VQLV 1MMMA 1V55C 2PTMA 3T1YO 3ASNC 3STLC 5LHGA 4B7KA 2EJRA 1ZWIC 3D36A 1M57B 1GO3F 1M4UA 5LGNA 3G67A 4OX9O 4J7KA 4RQEA 4IYHA 1Z5WA 2PY5A 3BABA 4DR4O 4HBNA 2Q9LA 3K03A 2ARHA 2X6CA 1BHBA 1M56B 2ADPA 2YUAA 4GUNA 3IFXA 1N34O 4X1KB 1WP8A 1UJWB 2X0LA 4LF4B 2D3OW 4LF5B 1GTOA 3OE7G 1NBMG 1BT8A 1V9PA 5JQGB 3CC7V 1E1QG 2EIKB 2YEVB 2IU0A 1Q6UA 1US6A 4I5SA 3ETGA 4UCUA 1YCIA 1AVMA 1TGOA 3SJBC 5KHKA 2ILMA 3ABKB 4GZRB 4LF7B 1Q90D 2H94A 3H9VA 3MHHC 4PHZA 3JATA 3FD9A 1GM8A 1FXVA 1Z5VA 2E5LO 4LNUA 3H1LH 3CJHA 3PN1A 3ZN1A 1VMGA 2UXBO 5EBMC 1KQSU 1H2KA 3CMEV 4NKGB 2QA4V 1XNRO 2DWDC 4LFAO 2JS5A 3N2KB 2ZKOA 3AG2C 3AEIA 4DV4B 1BMFG 3RYFB 1TAEA 2YXLA 4KFMA 2AGAA 2R9IA 4TUYB 4UFZA 3QO7A 3FKSG 4AQYB 5IJ9A 4LP8A 4O2AA 3MD0A 4PD4F 1Q81W 1TVKA 4TV9B 5B3SC 3ICXA 1O9GA 5J2TB 3ABLB 1KKCA 5EIBD 2YS8A 3B4SA 4XDJA 3N2GB 5KLVH 1S5JA 1MZFA 1B6QA 3OT7A 4QGPA 1S5LZ 4DRXB 3J81N 1IX9A 4WCEV 1JOYA 4JYBA 3UKMA 1GN2A 1K8AW 1XI1A 3HR0A 4G28B 5JH7A 2UXCB 3FYIB 2WA4A 5DM6V 2B9ZA 1YXBA 2Q8VA 2M6YA 3QF7A 3OFNG 3CD6V 2EIMB 1NQTA 3LSQA 4PJ0Z 3CWBH 4JTDB 2QM7A 1FD9A 4JV5B 1VF6C 2LW1A 2JGUA 4OPAA 4TQFA 4U7OA 4LR3A 2A3QA 4JI4B 1FYJA 3M8AA 2RMKB 3QO8A 4R50A 2KSDA 4GX0A 4JI6B 1X59A 4X1KA 2YIBD 3WB0A 1SF9A 1NTZH 1SQPH 2DYSB 3SYOA 3E8GA 1BS3A 3NXSA 4DV3O 2NR5A 1WA8B 3I56V 3ABUA 3M7MX 3H01A 2YEVA 4B3RB 1IDSA 1Q6IA 5LMNB 3P30A 3OTFA 3HKCB 1K97A 3T1CA 3HKBA 4DK0A 4LF6B 3DXRA 4DR6O 2OTJV 3CPWU 2HKOA 4MVRA 5KUMA 5J9PC 1SESA 2F93B 4PV1B 4R7CA 1H38A 3CC4V 1Y67A 2H8PC 5B5EZ 1PD3A 4B3MB 1YZBA 2P7TC 2QKAA 2Y0IA 4FLZA 3N2KA 1FXKA 3GVMA 4YY3B 2B1IA 5C93A 4N23A 1I5YA 1JX9A 2VQFB 4MW3A 2CH7B 4TUYA 3FB6C 1ENVA 5LHHA 1OCZC 4TT3G 3ZBHA 3JSNA 5IYDO 4YJ2A 2DMXA 4JI3O 2PI4A 1WB7A 4B7EA 3AK3A 3ZMZA 5EC1C 2IM9A 2LFRA 4JI7O 3CE2A 2WPDG 4I50B 2OIGA 5EIBC 1K3EA 5CBGA 1T5EA 1NTKH 1S3JA 1MOFA 5F2VO 1HWYA 1WJZA 3ZJZA 5B66Z 3AK2A 1HP8A 3RVYA 3ASOC 4JI5B 1I0HA 1FS0G 1KC8W 3WU2Z 4WBNA 4DW0A 1AJNA 3J7AU 5LA6A 3I5DA 1IBMB 3ABMB 4E4EA 3M99B 5L3BA 1IXMA 3EFFK 1B3QA 4X1IB 2OTLV 1SRYA 3OM3B 2QWNB 2F1MA 2A79B 1Y76A 1YI2V 3K04A 1XQ8A 1NVPB 3DSQA 1WA8A 4FK5C 3T4ZA 1D5AA 4MVMA 4F6EA 4CH6A 1JJOA 2CGOA 2QGNA 3UM7A 5CBHA 2OYQA 1MNGA 1H8HG 2YC0A 4ZI7B 2YSUB 2K9PA 2ZM6B 3AK1A 3RN4A 4PI2A 4U3JB 4X9QA 1SQQH 3ZIAG 1K7DA 3ETEA 2R9RB 4K35A 2FMLA 2WLMA 4NYKA 2IW5A 3G71V 4TWKA 3BRCA 3OEHG 3SPIA 3CC2V 5CN0A 2Q0AA 4LF9B 2Y4UA 3F7VC 1H8EG 4DR5O 5LP6C 1DGSA 2Z5UA 5LMUB 2IJKA 2JDIG 1WB8A 1N33B 3B09A 4JI1O 2YXHA 1ZLZA 1QLNA 4JPRA 3BFRA 1J5EB 3TCUA 3RW0A 1GN6A 3CRAA 3N27A 2EINB 3UQ8A 1N0NA 4YIPA 1BQ0A 2IJJA 4E2LA 4MVQA 2RQ6A 3B8MA 4J7JA 3JCZA 2R72A 3W7XA 3NR7A 4FFBB 4MVZA 4DV2B 5KHHA 1AP5A 3JALA 1OCOC 5JJEB 2Y69C 1R3LC 4J80A 2Q6AA 3BY6A 2EILB 4DR1B 2N04A 4KP4A 4WFBV 2JEUA 4NTWA 1O9HA 5B1AC 3FB5C 3W7TA 3CRCA 4X1IA 2XAHA 2BTQB 1OCRC 4IHJA 4CH3A 4Z1VA 1YSCA 1P7GA 3F5TA 3KCYA 4LF4O 2V4DA 4LF5O 4B3TO 3JAKB 3FAVA 5JVDB 3SDLA 5A2QN 2W6IG 4UCSA 3FFQA 1XL4A 3KG2A 2BSKA 5ITZB 4J9ZB 1FAFA 3OUFA 4ZI7A 4DW1A 3CS5A 3K06A 4ABMA 3TXSA 1AI7A 2ODMA 2JGDA 4LF7O 2Q67A 4H0LB 4PDVA 4J7ZA 1FFXA 4O4IA 1U97A 3K57A 4P9OA 2DQ0A 2PUSA 4YHHB 5CB4B 5B1NA 1SS3A 4IIJB 4DUZB 4C7UA 1QVFU 1BZKA 2YIBA 3RBZA 5BMVB 2JJ1G 5H2FZ 4R8CA 3G6BA 4FLWA 4UVBA 2ITDC 3E89A 5EYPB 2N05A 1LUWA 3ZRWB 4DV4O 1IBKB 3CCEV 2GHYA 1NKDA 3JYCA 3HPLC 1JCHA 4AQYO 2JIZG 4U7NA 2WLLA 3OMIB 3CP1A 2B5UA 2IU3A 3A0HZ 2AW9A 1MSWD 1KP2A 2H3OA 1AI6A 1TUBB 4Z2WA 1RP3B 3ETQA 4RUEA 4GKJB 2LW7A 4K8XA 1MZEA 1IVSA 3CXHF 4NXNB 2XAFA 1FFTB 3W7WA 1PKXA 3ZRSA 5LGUA 1SQBH 1PP9H 1COWG 5EBWC 2BOCC 2UXCO 3OD4A 1K9MW 4X62B 4XDKA 3SJCC 4FFBA 1N36B 4X65B 5CA1B 2IJIA 3H1KH 4JAUA 1E79G 3CCVV 5EZYB 1AI5A 3X2QC 3ZMVA 4HNAB 1L8DA 4TQDA 3WB1A 1HR0B 4IL6Z 3STZC 2LQTA 3OEEG 3SJQC 2CTQA 3TETA 2DYRC 3CX5F 5CMUA 2JEXA 4JI4O 5FPRA 1FJGB 1GAXA 2AXTZ 2JVDA 2HJDA 1OCCB 2BTQA 3LNNA 4ZHQB 4JI6O 3K3WA 3UO3A 2CTWA 1BHAA 4HAMA 3D8CA 4O4HB 5D5PA 4JAVA 1UFIA 3T1HB 1I7FA 2AZ0A 1PNLA 4IYIA 1XILA 3H1JH 2Q68A 1M57C 4UCTA 4B3RO 5ITZA 1NJIW 4RWUA 1RSOA 3FB8C 1MABG 4O4JB 4DR3B 2C2AA 4FM2A 5C8YB 4LF6O 1PPJH 1Y66A 3OR7C 2A9HA 5AG2A 4ZOLA 5CBFA 1PL0A 5GTIZ 1SQXH 3MAQA 5CB4A 4IIJA 2FTKA 5BMVA 4U3FH 4DV0B 4YY3O 5IYCO 1S5HC 3ZRWA 5L3FA 1HNWB 4HYOA 1YITV 4LFBB 3CRMA 2EIKC 1VQ7V 2VQEB 4BIZA 4MVUA 2Y4TA 1NZ6A 1NR1A 3AG3B 4QPJA 1Y74A 1WNSA 3ABKC 1TUBA 1GRJA 1XHXA 2W0FC 1CP9A 1KU9A 1YJ9V 5FLXN 2GV9A 3E2EA 4EEQA 3K9AA 2UUBO 3H1IH 4UCVA 2HG5C 2UU9B 4KXRA 2LGQA 4JYAB 3CEIA 3BA8A 1IZ3A 1FXKC 1ZSPA 1N8RW 3LDDA 4LF8B 4RQFA 1Q6HA 4MSWC 2UXNA 5H6QA 5CA1A 1DF5A 5EZYA 2XNDG 5HFLA 4HNAA 3ML0A 1Q8IA 2WA3A 4JF3A 1OZ0A 1V55B 4JI5O 1PM9A 2HVKC 3ASNB 3U10A 2CUGA 1XMOB 1QLEB 5IJ0B 1NI8A 3RYHA 5IYZB 4JYCA 1IBMO 1XDCA 4TV8B 1QR8A 3JSLA 2ZXWB 3K5OA 4I9QA 1YDXA 3SYAA 1Q43A 4B3SB 5LOVA 4ZHQA 4DV7B 2PI5A 1AROP 2QE7G 3D3QA 4H37A 5KHGA 2OCHA 4I0XB 2ZIOA 4O4HA 4MTOA 2B1GA 2NNUA 2QKSA 3U0ZA 2HHHB 3ABTA 4PA4A 4FPPA 2EIJB 4X64B 3ZHUA 5KA6A 2ZM6O 2Q5ZA 2EZOA 2L35A 4O4JA 1JFFB 5C8YA 2DJVA 3JD4A 3I55V 4JTAB 4FFKA 3K0GA 1BE3H 1H2MA 3EVKA 1H2NA 1YJWV 3L71H 1NVPD 2K1EA 2P22C 3Q4HA 2GTAA 1S0VA 1DTOA 1K4DC 4CH5A 2EJ7A 2PGGA 1FPOA 4K3AA 3VOUA 4J9YB 2UUAB 1AI4A 2F95B 5B1OA 2QWRB 3ZHQA 2MW2B 4LF9O 1GK9A 2A0LA 2XHBA 1QU7A 3BEHA 3AG2B 5LMUO 1G1XB 5H6RA 5KAFZ 2JRIA 2CGNA 1MA1A 5L3DA 2MK3A 1N33O 3OR6C 3L75H 1Q7YW 1V54B 1QCEA 1JA8A 4QE9A 1J5EO 3VQXA 1EZJA 4JAAA 2WLJA 4WF9V 4GYCB 3SPGA 1TUEB 1P7BA 1JQ0A 3EHBB 1QQCA 2HP8A 2GBOA 2ZINA 2JK5C 2HJFC 4CS4A 5JQGA 3K59A 5BR8O 5KHIA 4UUJC 1EZVH 2WLHA 5E1AC 4ZBMA 4UV9A 2IJHA 4DV1B 4CZZA 5IJ0A 4DR1O 4LH6A 2WLIB 2HFEC 5KX5B 4X66B 5IYZA 2Q4PA 4TV8A 3R66A 1F23A 1SZXA 4XBFA 3OTOO 4YIOA 1W0KG 3RYFA 2P06A 4F6RB 4FLYA 2X6BA 4I0XA 3RYIB 2LFSA 4JI2B 4PDRA 1F4MA 2O57A 4DR2O 2ETNA 4TV9A 4XDLA 4PI0A 2ZCEA 1KKDA 5J2TA 1KB9F 1JFFA 3N2GA 3CSXA 3CRRA 3ABMC 1Y6XA 4DRXA 4OX9B 3C90A 2XTAA 4PDMA 5A9GA 5K1XA 3OUSA 3OGCC
chains in the Genus database with same CATH topology
4ZKIA 3E8BA 1FXHA 4P30A 3G6EV 1V54C 1L1FA 5CA3A 4MW8A 4KP4A 3RVZA 4Q20A 2JEUA 4WFFA 4WFBV 5IY5B 5L3EA 3E86A 5B1AC 1R3IC 2OT5A 4RUFA 4X89A 3FB5C 1VQPV 3W7TA 1K5SA 5DN6G 3X2QB 2DYSC 2XAHA 5BZBA 1OCRC 1J95A 2XAQA 1I5XA 3E8FA 3OMAB 1K5QA 1YSCA 4QIWF 1KECA 4JASA 1RPRA 4RAIA 5KA5A 3MHSC 2W6IG 4P2ZA 1CEZA 4QPKA 1XL4A 3KG2A 4G27B 1BL8A 4UXNA 3ZRVA 1THZA 4DXWA 1S76D 4J9ZB 3OUFA 3CCLV 2V7QG 4I9WA 3LUTB 3K06A 4GX1A 4Z1MG 2GSMB 1RM1C 1S72V 1AI7A 3IC7A 3JD2A 5B3SB 1VQLV 1VQ5V 1V55C 4CBCA 2XOKG 3ASNC 2Q67A 1G4YB 4PDVA 3STLC 5LHGA 2EJRA 1ZWIC 3D36A 4PA3A 3WFVA 1M57B 4P9OA 1PNMA 2DQ0A 4PA9A 1F51A 5B1NA 1GO3F 3ZMTA 5LGNA 1QVFU 2WLIA 3RBZA 4PDLA 4PA7A 2WAMA 2JJ1G 3ASOB 4R8CA 3CXCU 4EKWA 4RQEA 4UVBA 2ITDC 3E89A 3ZRWB 1W2BU 3CCEV 2GHYA 1NKDA 3K03A 2X6CA 4GCZA 3JYCA 1BHBA 1CPYA 1M56B 2EINC 3ETDA 3HPLC 3IFXA 1JCHA 3SYPA 2JIZG 4U7NA 3JD0A 1P4RA 2WLLA 2WWWA 3OMIB 3CP1A 4FJCC 2B5UA 2OCCB 2IU3A 1UJWB 1SZTA 1MSWD 1KP2A 4QNHB 2X0LA 1AI6A 2D3OW 1GTOA 3T2MA 1KD1W 4RUEA 3OE7G 1VQMV 1NBMG 1EBOA 1SERA 4YXWG 2XAFA 1FFTB 3VBBA 3CC7V 1E1QG 3W7WA 2EIKB 1PKXA 2YEVB 1DF4A 2EILC 3ZRSA 5LGUA 1GKFA 2IU0A 1E1RG 4MTFA 1M1KW 4I5SA 3ETGA 3ABKB 1COWG 3OMNB 1JVMA 2H94A 3MHHC 5EBWC 5IY5C 2BOCC 1GM8A 1FXVA 1K9MW 4XDKA 2UXXA 4PELA 2IJIA 4JAUA 3CCVV 1E79G 1AI5A 3ZN1A 3X2QC 4LCUC 3ZMVA 5EBMC 1KQSU 1QR9A 3CMEV 1WPXA 2QA4V 2DWDC 3STZC 4DO2A 3OEEG 4H33A 2JJ2G 3SJQC 3AG2C 3GB7C 3AEIA 5EK0A 1BMFG 4KFMA 3TETA 3DTUB 3AG4B 2DYRC 4FMTA 5CMUA 2ZDIC 2JEXA 2R9IA 2WLKA 5IYBO 3QO7A 3FKSG 1R6KA 4LP8A 4UV8A 1OCCB 1VQOV 1RPOA 3MD0A 1YTFD 3K3WA 1Q81W 1K33A 4OXSA 4WFGA 5B3SC 2X6AA 1YJNV 1BHAA 4HAMA 3E8HA 2XAGA 3ABLB 4BW5A 4JAVA 2V1DA 1GM7A 2ZDIA 4XDJA 1QBZA 2X7RB 1PNLA 3CCMV 2Q68A 1M57C 1K73W 1OCZB 1B6QA 3CMAV 2DW4A 1KP3A 3OW2U 1NJIW 4L87A 1QVGU 2IH1C 4MS2A 4WCEV 1JOYA 4JYBA 3UKMA 2EZPA 2P67A 3FB8C 1K8AW 1MABG 5LHIA 3DGEA 4G28B 2C2AA 3FYIB 3SYCA 4BIUA 3HB3B 3IGAC 3OAAG 5DM6V 1Y66A 2QM8A 4G2KA 1YTFB 3OR7C 1MG1A 4RO2A 3OFNG 2A9HA 3CD6V 2EIMB 3A0RA 1NQTA 3LSQA 5CBFA 3W7SA 3ZMUA 1PL0A 4JTDB 2QM7A 3CCJV 4JTCB 4JGSA 2OCCC 1NH2D 2FTKA 4KUMA 3R65A 2ZR3A 4MVOA 5IYCO 1S5HC 4U7OA 3ZRWA 2KB1A 5L3FA 4HYOA 4MTGA 1YITV 2EIKC 2NLJC 3QO8A 1VQ7V 4R50A 4BIZA 4MVUA 4WFAV 1AJQA 4GX0A 1NR1A 3LNMB 3AG3B 4QE7A 4QPJA 3K0DA 3ABKC 2DYSB 2W0FC 1CP9A 3E8GA 3SYOA 3NXSA 2Z3YA 1YJ9V 3E2EA 1NH2B 3I56V 3ABUA 3K9AA 3H01A 2YEVA 3CCQV 4LBEC 2HG5C 4BAYA 1AR1B 3P30A 1Q82W 1K97A 1OHHG 3WG7B 2XAJA 3T1CA 1M9NA 2ITCC 1FXKC 1N8RW 3LDDA 5HFMA 3CPWU 2HKOA 4MSWC 4RQFA 2UXNA 1GMGA 3AG4C 2OTJV 4N21A 5H6QA 1DF5A 2BOBC 4MVRA 2P90A 2ATKC 1RM1B 1AJPA 4UVCA 5GW7A 5KUMA 1M90W 2XNDG 1SESA 5HFLA 5J9PC 3ML0A 4R7CA 4JF3A 1OZ0A 1V55B 2AHYA 2EBOA 2WSSG 2HVKC 3ASNB 3P32A 5LGTA 1H38A 2H8PC 3CC4V 2IH3C 1PD3A 1QLEB 2HVJC 2P7TC 4FIPC 1FXKA 2B1IA 5C93A 4N23A 2WLLB 4JYCA 3ZCCA 1I5YA 1JX9A 1GM9A 1R3KC 4MW3A 3SPJA 1VQNV 1H2GA 1QR8A 3FB6C 1ENVA 2ZXWB 5LHHA 1OCZC 4TT3G 3SYAA 4F4LA 2XASA 3K08A 2PI5A 1AROP 2QE7G 5IYDO 4MVSA 2PI4A 2W6JG 1EFRG 3B77A 4H37A 3ZMZA 5EC1C 4MTOA 2LFRA 3LDCA 3AG1B 2WPDG 2B1GA 4TSFG 2NNUA 2QKSA 1K92A 3ABTA 4PA4A 4ASUG 3PJSK 4X88A 4FPPA 1K3EA 2EIJB 5CBGA 3D3IA 3W7UA 1YIJV 1VQ9V 1S3JA 1SETA 5KA6A 3CCRV 2EZOA 3F5WC 2DWEC 2Y48A 5B1BB 3I55V 3JD4A 1MOFA 4JTAB 1PNKA 1LNQA 3K0GA 3FYEB 3QO5A 1HWYA 3ZJZA 4X8AA 1F4NA 3RVYA 3ASOC 1VQ8V 3AG3C 1YJWV 1K4CC 1NVPD 2K1EA 1FS0G 1R3JC 4GX5A 1S0VA 1KC8W 3K79A 2ZD9A 1DTOA 3TK1A 1K4DC 5H9CA 2WLNA 3VOUA 1AJNA 5FL7G 1M56C 4J9YB 1AI4A 5B1OA 3QNEA 3ABMB 3SYQA 1R6NA 3M99B 5L3BA 1IXMA 3OGCC 1GK9A 2A0LA 1ORQC 2QTOA 3SPCA 1ROPA 3BEHA 3AG2B 3EFFK 1OCOB 5LBQA 3GWOA 3G4SV 2Y69B 4WFHA 5H6RA 2OTLV 5L3CA 3WG7C 4QJFB 1SRYA 2DYRB 3OM3B 5L3DA 2MK3A 2A79B 1YI2V 3K04A 1XL6A 3OR6C 1Q7YW 1V54B 4GX2A 1NVPB 1QCEA 4FK5C 3T4ZA 4QE9A 2P6JA 2ZQMA 4MVMA 2F43G 5B1AB 1EZJA 3LDEA 3UM7A 2WLJA 4WF9V 5CBHA 3SPGA 4MTXA 3CCUV 1TUEB 1P7BA 1JQ0A 1H8HG 3EHBB 1VQ4V 2YSUB 3JD1A 4GT1A 1QLEC 2JK5C 1OCRB 4PA6A 2HJFC 2ZR2A 4MT8A 1VQ6V 3ZRXA 3ZIAG 3JD3A 1K7DA 3ETEA 4LC1A 4UUJC 2R9RB 2ZXWC 2WLHA 5E1AC 2QEXV 2WLMA 3F7YC 2IW5A 3G71V 4HZ3A 4TWKA 4ZBMA 4UV9A 3CCSV 2IJHA 3OEHG 3CYOA 4CZZA 4R6ZA 3SPIA 2DQ3A 2WLIB 3SPHA 2HFEC 1VQKV 5KUKA 3CC2V 5CN0A 1NR7A 3FB7C 5EBLC 3F7VC 1K34A 1H8EG 1OCCC 4UVAA 3AG1C 1F23A 3ZN0A 4XBFA 2Z5UA 2EIJC 1W0JG 3E83A 1JPXA 2IJKA 2JDIG 1W0KG 2LP7A 1JJ2U 1S77D 3ABLC 2AHZA 2HLDG 2X6BA 2CK3G 5EC2C 5IDJA 5B1BC 2LFSA 1QLNA 4JPRA 4PDRA 1F4MA 3TCUA 3RW0A 1R73A 2EINB 4XDLA 2HR3A 4WFEA 1YHQV 2IJJA 1WLEA 5L3GA 1KKDA 1Q86W 2Q69A 4E2LA 3T4DA 2EIMC 4MVQA 1G8MA 3LSSA 3ABMC 3B8MA 3JCZA 3W7XA 3B8NA 1DLBA 3E35A 3ZMSA 1FXKB 4MVZA 1OCOC 1Y4MA 4PDMA 2M7WA 2Y69C 1R3LC 2Q6AA 3OUSA 4P9PA 3BY6A 2EILB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFL A;  5CN0 A;  1MOF A;  5CMU A;  4JF3 A;  3MHH C;  3GWO A;  1K34 A;  3CP1 A;  2EBO A;  4FJC C;  3B77 A;  3K9A A;  1F23 A;  3WFV A;  3H01 A;  5KA5 A;  3MHS C;  1SZT A;  2EZP A;  3P30 A;  4FIP C;  2MK3 A;  4E2L A;  2OT5 A;  1JPX A;  1Y66 A;  4G2K A;  2LP7 A;  1K33 A;  4N23 A;  1MG1 A;  1EBO A;  1QCE A;  1I5Y A;  4FK5 C;  3B8M A;  5H9C A;  2P6J A;  1QR9 A;  1QR8 A;  3B8N A;  1DF4 A;  1DLB A;  5HFM A;  1ENV A;  3CYO A;  4N21 A;  5KA6 A;  1Y4M A;  1DF5 A;  1I5X A;  2M7W A;  2EZO A;  1QBZ A;  1JQ0 A;  2X7R B;  3M99 B;  4JGS A;  4JPR A; 
#chains in the Genus database with same CATH topology
 1AR4 A;  2Q7E A;  4YHH O;  2LGW A;  4J41 A;  4DUZ O;  4MW8 A;  3RVZ A;  4WFF A;  5H5N A;  5IY5 B;  3E86 A;  1R3I C;  1I08 A;  1WN7 A;  1IBK O;  4X89 A;  2VS0 A;  1VQP V;  1PV0 A;  1K5S A;  3OMA B;  1K5Q A;  4UCO A;  4RAI A;  4GKJ O;  4DV6 B;  3MHS C;  3G80 A;  4I55 B;  4NXN O;  1WAZ A;  4P2Z A;  4QPK A;  1W59 A;  2CTP A;  3LUT B;  4GX1 A;  3KCX A;  1CXZ B;  3L73 H;  1RM1 C;  1G6U A;  2Z0A A;  4CBC A;  4JI8 B;  2XOK G;  3EXA A;  3HKC A;  1N36 O;  4X65 O;  2PYJ A;  3QVN A;  5BXZ A;  4AI8 A;  1XRE A;  3C3T A;  3ZMT A;  2WLI A;  4PDL A;  2WAM A;  3ASO B;  2UUC O;  2ZNJ A;  3JAS B;  3CXC U;  1H2S B;  1ZAU A;  4A5U B;  1W2B U;  4FLV A;  1CPY A;  2EIN C;  1HNZ O;  2E75 B;  3ETD A;  3SYP A;  1SQV H;  3JD0 A;  5KHJ A;  4FJC C;  2PZS A;  2OCC B;  3HKD B;  1SZT A;  2CH7 A;  1XHZ A;  3RYI A;  3T2M A;  1ZTE A;  1EBO A;  1SER A;  3VBB A;  4DK1 A;  1DF4 A;  2EIL C;  1GKF A;  2NN4 A;  3S3X A;  2YXY A;  3E22 B;  5LL6 Y;  3IJ4 A;  3OMN B;  4I50 A;  1XUQ A;  4DR3 O;  4PEL A;  3SR2 C;  4D6T H;  4LCU C;  5GON B;  3RYC B;  1WPX A;  1F7Y A;  5TIS Z;  5JJN B;  4DO2 A;  4H33 A;  2JJ2 G;  2VRZ A;  3GB7 C;  4DV0 O;  2ZE5 A;  3DTU B;  3AG4 B;  5D5Q A;  4UCR A;  2P5O A;  2WLK A;  4LFB O;  2A7W A;  3FX7 A;  2VQE O;  1R6K A;  1M93 A;  3UCS C;  4OXS A;  2X6A A;  4KHP B;  1JR9 A;  2XAG A;  4BW5 A;  2V1D A;  4I55 A;  1QHT A;  1GM7 A;  2ZDI A;  4DR6 B;  2CDY A;  3CMA V;  2DW4 A;  2QWP B;  1KP3 A;  5JJJ B;  1QVG U;  4MS2 A;  1H2L A;  3KKY A;  4JYA O;  4LFC B;  2EZP A;  4H13 B;  5LHI A;  2XUM A;  3DGE A;  4D7S A;  1P49 A;  3SYC A;  3IGA C;  3OAA G;  4G2K A;  5DED A;  1YTF B;  1SA0 B;  1MG1 A;  2ZT9 B;  2E3C A;  3OGI B;  4RO2 A;  4YJ3 B;  3AG7 A;  4W4K A;  1LR1 A;  3CCJ V;  4U3J A;  4JTC B;  4NB5 A;  3BVO A;  4EFE A;  3C3S A;  2UXD B;  3K58 A;  3IC9 A;  3R65 A;  3JAS A;  2ZR3 A;  5JWP A;  2EUL A;  1AB3 A;  1IBL B;  4MTG A;  2YIA A;  3L72 H;  1L0N H;  4JI7 B;  4QE7 A;  4UB8 Z;  4B3S O;  3HKD A;  4O2B B;  1OJH A;  1HW7 A;  4DV7 O;  3HKE B;  4CS2 A;  3L74 H;  1HNX B;  4D7T A;  2Z3Y A;  2DOS A;  3SGI A;  1NH2 B;  3U11 A;  3BA9 A;  4I4T B;  2F66 C;  3TGU H;  3CCQ V;  4LBE C;  4BAY A;  1Q82 W;  4DUY B;  1OHH G;  2QDO A;  3TXQ A;  3WG7 B;  2XAJ A;  4X64 O;  1M9N A;  2ITC C;  3S3W A;  5HFM A;  1GH6 A;  1MSD A;  1AJP A;  4UVC A;  5GW7 A;  1M90 W;  2QM4 A;  5GON A;  3RYC A;  2WSS G;  5LYJ B;  1I94 B;  3P32 A;  3ZS8 C;  2HVJ C;  2Q73 A;  2UUA O;  2QWQ B;  1D5N A;  1H2G A;  3CHX A;  4JV5 O;  1GN3 A;  4JI0 B;  1IXB A;  2XAS A;  4F4L A;  2YIC A;  3IAY A;  4FLT A;  2F4V B;  3BAA A;  2W6J G;  2Y0P A;  3B77 A;  1QNM A;  5DEC A;  4B08 A;  2OIE A;  3AG1 B;  3H1H H;  4TSF G;  1VP7 A;  4ASU G;  1ZL8 B;  4X88 A;  4CS3 A;  5IWA B;  4NXM B;  4LWS B;  3VQV A;  2QSA A;  3JAK A;  1VQ9 V;  1SET A;  5JVD A;  3CCR V;  2CAZ C;  4JZG A;  2Y48 A;  5B1B B;  1ZX3 A;  3THO A;  1PNK A;  5LMN O;  3FYE B;  3QO5 A;  2VWK A;  3LSU A;  2E76 B;  1A32 A;  1VQ8 V;  3AG3 C;  4DR5 B;  4UB6 Z;  3VQY A;  4GX5 A;  3K79 A;  3TK1 A;  2RN9 A;  2WLN A;  5IJ9 B;  5FL7 G;  1M56 C;  2CTR A;  4X66 O;  3QNE A;  1R6N A;  2QTS A;  1ORQ C;  2QTO A;  3SPC A;  5IT9 N;  2YID A;  5LBQ A;  3TJT A;  1WPB A;  4B3M O;  3L70 H;  3G4S V;  4O2B A;  2QWO B;  2DYR B;  5EYP A;  1AR5 A;  2KQX A;  2VQF O;  4GX2 A;  2P6J A;  4JI2 O;  3WB2 A;  3P3P A;  4O4L B;  5JCO A;  4MTX A;  3CCU V;  3JD1 A;  1L0L H;  4GT1 A;  1QLE C;  4PA6 A;  2ZR2 A;  3ZRX A;  1VEW A;  4H44 B;  4J10 A;  3JD3 A;  4LC1 A;  2F23 A;  2ZE6 A;  2ZXW C;  2QEX V;  1N32 B;  5LYJ A;  2BTO A;  2D2C B;  3ZED A;  3SPH A;  1R1B A;  1VQK V;  3APO A;  3FB7 C;  5EBL C;  2BE3 A;  4UVA A;  4NTY A;  3CRQ A;  4B3T B;  2EIJ C;  1JPX A;  3ABL C;  2AHZ A;  2HLD G;  4OPH A;  4ZIB A;  2P4K A;  2CK3 G;  5EC2 C;  5IDJ A;  1YEW A;  2YI9 A;  4DV6 O;  3HKB B;  1R73 A;  2VWJ A;  3DXR B;  3B40 A;  1ZL8 A;  2HR3 A;  4LWS A;  4DR7 B;  1YHQ V;  3QTC A;  3A0B Z;  1Q5O A;  5L3G A;  2Q69 A;  2EIM C;  1G8M A;  5BY1 A;  1DLB A;  2PYL A;  4JI8 O;  1FXK B;  1WP7 A;  1Y4M A;  5J2U B;  1R6T A;  4ZKI A;  3E8B A;  5CA0 B;  3G6E V;  1V54 C;  2OWO A;  1L1F A;  2KG7 B;  5FPO A;  1YVW A;  3JCU Z;  4RUF A;  3QG5 A;  4YJ2 B;  4BW9 A;  1EN4 A;  1XNQ B;  1N4C A;  2FL4 A;  2DYS C;  4NR1 A;  5BZB A;  4K8Z A;  4DV5 B;  1I5X A;  3E8F A;  3BCC H;  3JAR B;  1TA8 A;  1Z2G A;  2GUZ B;  1RPR A;  5KA5 A;  1XMQ B;  5E79 Z;  4O4L A;  4G27 B;  3ZRV A;  1THZ A;  4DXW A;  1S76 D;  2V7Q G;  2GSM B;  1S72 V;  1VF5 B;  1EN6 A;  3IC7 A;  5B3S B;  1VQ5 V;  4WBN B;  2W0X A;  1G4Y B;  4PA3 A;  3WFV A;  1YF2 A;  5LA6 B;  1PNM A;  4PA9 A;  4K0K B;  1F51 A;  1URF A;  1XEQ A;  4PA7 A;  2Q0O C;  5FNV B;  3B2E E;  2LJ2 A;  2QKC A;  4EKW A;  4DV2 O;  3ZHT A;  5K1P A;  3L9D A;  1Y76 B;  1RFY A;  4GCZ A;  4CC5 A;  1XBL A;  1LUV A;  1P4R A;  2BCC H;  4J11 A;  2WWW A;  5GTH Z;  4IGG A;  2ADQ B;  4QNH B;  1KD1 W;  2FYU H;  4KHP O;  1VQM V;  2EX3 A;  1KUQ A;  4GKK B;  1N0J A;  4YXW G;  2R70 A;  1E1R G;  4MTF A;  1M1K W;  4LFC O;  1JVM A;  5IY5 C;  3O65 A;  1KMI Z;  3T1Y B;  2UXX A;  4BR6 A;  1BGY H;  2RNB A;  5J2U A;  3RGB A;  2CE4 A;  1VIB A;  3J80 N;  1QR9 A;  2UXD O;  5CA0 A;  2KG7 A;  4DR4 B;  5EK0 A;  4FMT A;  3ZHS A;  2ZDI C;  4EB6 B;  1IBL O;  4NVP A;  5IYB O;  3VQW A;  4UV8 A;  2UUB B;  1VQO V;  1N34 B;  1RPO A;  1YTF D;  3DC5 A;  1K33 A;  4WFG A;  1P84 F;  3JAR A;  1YJN V;  1HNX O;  2GUZ A;  1DK1 A;  2ZIM A;  3E8H A;  1NT2 B;  1QBZ A;  2X7R B;  3O9O A;  3CCM V;  1K73 W;  1OCZ B;  3OW2 U;  4DUY O;  4L87 A;  2IH1 C;  1SQF A;  3BPZ A;  3JAL B;  2P67 A;  5IE9 A;  3BHP A;  4BIU A;  3HB3 B;  2E5L B;  2QM8 A;  1UPG A;  3A0R A;  3W7S A;  4AIL C;  2UXB B;  3ZMU A;  4JGS A;  4LH7 A;  2OCC C;  1NH2 D;  1XNR B;  1I94 O;  1M5I A;  4LFA B;  4BWA A;  4KUM A;  5FNV A;  4X62 O;  4MVO A;  2KB1 A;  4IHJ B;  3JAM N;  2NLJ C;  1HR0 O;  4WFA V;  1AJQ A;  5KX5 A;  3LNM B;  4JI0 O;  3FAV B;  1VF6 A;  3K0D A;  2BSK B;  2F4V O;  2RCV A;  2RJZ A;  2PF4 E;  1AIL A;  1FJG O;  1VF7 A;  4F6R A;  3A8T A;  2JGD B;  1AR1 B;  4FVM A;  1SKV A;  2QJ1 A;  5IWA O;  2GTS A;  4EFB A;  1FFX B;  4NXM O;  4O4I B;  4JYY A;  3T1H O;  1GMG A;  3AG4 C;  3RWR D;  4N21 A;  4CC6 A;  2BOB C;  2P90 A;  2ATK C;  4I7Z B;  1RM1 B;  1BQZ A;  3KZI Z;  1HDJ A;  4L8J A;  2AHY A;  2EBO A;  5LGT A;  2IH3 C;  3UT5 B;  4FIP C;  4GLX A;  2WLL B;  3ZCC A;  1GM9 A;  1R3K C;  3SPJ A;  1VQN V;  4EB6 A;  2FB5 A;  2YDE A;  1KBH A;  3A2F A;  3K08 A;  1OV9 A;  4CH4 A;  1B04 A;  3CB2 A;  4MVS A;  1NU1 H;  1EFR G;  4JZ2 A;  4DV3 B;  4AHC A;  1HNW O;  3DC6 A;  2L6L A;  3JAW B;  3LDC A;  5BR8 B;  4FM1 A;  2HEP A;  5LP6 B;  1K92 A;  3PJS K;  3APQ A;  3D3I A;  3W7U A;  1YIJ V;  3K5N A;  3F5W C;  1D2D A;  2DWE C;  1Q3E A;  1SQG A;  1LNQ A;  3UO2 A;  4X8A A;  2UU9 O;  1NS1 A;  3ZHR A;  1F4N A;  1K4C C;  1N32 O;  1IUR A;  1R3J C;  4DYL A;  4ICG A;  1PL4 A;  2ZD9 A;  3OTO B;  4J42 A;  4LF8 O;  5H9C A;  2Q7G A;  1EM1 A;  1SC5 B;  2DE0 X;  3SYQ A;  5KMG B;  3P3N A;  3K9S A;  5JCO C;  1ROP A;  3RFR A;  1OCO B;  1XMO O;  3GWO A;  1EN5 A;  2Y69 B;  4DR2 B;  4WFH A;  2FKX A;  5L3C A;  3WG7 C;  4QJF B;  3K5M A;  4JI3 B;  2QR4 A;  3D36 C;  1XL6 A;  2R9A A;  2ZQM A;  4X1Y B;  1BSM A;  1RSO B;  2F43 G;  5B1A B;  3LDE A;  2E74 B;  1KYO F;  1BCC H;  1AP6 A;  4X20 B;  3K5L A;  1VQ4 V;  2DN9 A;  4ZOL B;  4DR7 O;  1OCR B;  5LXT B;  4MT8 A;  2A06 H;  3GWK C;  1VQ6 V;  2G38 A;  1B06 A;  4FM0 A;  2HHH O;  3E22 A;  2YI8 A;  3F7Y C;  3ZHV A;  4HZ3 A;  3CCS V;  2N74 A;  3CYO A;  4R6Z A;  3UT5 A;  4W4L A;  2ZNI A;  2DQ3 A;  5KUK A;  3ZX6 A;  4NTX A;  1NR7 A;  2XT9 A;  4FZ1 A;  1K34 A;  1OCC C;  1Y74 B;  3AG1 C;  1NTM H;  5KAI Z;  3ZN0 A;  4TOI A;  3RT3 C;  1XNQ O;  2LO1 A;  1W0J G;  3E83 A;  3SJA C;  4FLX A;  2LP7 A;  1JJ2 U;  1S77 D;  1GN4 A;  4DV5 O;  5B1B C;  3JAW A;  1XMQ O;  4IT5 A;  5LP6 A;  4BIO A;  2ZE7 A;  4OGQ B;  4WFE A;  1WLE A;  1XOU A;  1Q86 W;  3T4D A;  1JMK C;  2RDC A;  3LSS A;  2P4V A;  2Q7H A;  3JAT B;  3B8N A;  2UUC B;  3E35 A;  4LNU B;  3ZMS A;  3CJH B;  2JS3 A;  3RYH B;  2M7W A;  4P9P A;  4KL1 A;  4K0K O;  1FXH A;  1HNZ B;  1SA0 A;  2GDS A;  1VAR A;  4P30 A;  4YJ3 A;  5CA3 A;  4Q20 A;  5LOV B;  5L3E A;  5KMG A;  1FKA O;  2OT5 A;  4DV1 O;  5DN6 G;  3X2Q B;  4O2A B;  1J95 A;  2XAQ A;  3MDS A;  4FZ0 A;  4Q6G A;  4JI1 B;  1TVK B;  4QIW F;  1KEC A;  2IBZ H;  4JAS A;  4X1Y A;  1U96 A;  1ZUQ A;  4GKK O;  1CEZ A;  3HKE A;  2KKW A;  4X20 A;  1BL8 A;  4UXN A;  1X4T A;  2AZ2 A;  3CCL V;  4FLU A;  4I9W A;  5LXT A;  4Z1M G;  2ZE8 A;  4I4T A;  3JD2 A;  3Q4H B;  5JH7 B;  1VQL V;  1MMM A;  1V55 C;  2PTM A;  3T1Y O;  3ASN C;  3STL C;  5LHG A;  4B7K A;  2EJR A;  1ZWI C;  3D36 A;  1M57 B;  1GO3 F;  1M4U A;  5LGN A;  3G67 A;  4OX9 O;  4J7K A;  4RQE A;  4IYH A;  1Z5W A;  2PY5 A;  3BAB A;  4DR4 O;  4HBN A;  2Q9L A;  3K03 A;  2ARH A;  2X6C A;  1BHB A;  1M56 B;  2ADP A;  2YUA A;  4GUN A;  3IFX A;  1N34 O;  4X1K B;  1WP8 A;  1UJW B;  2X0L A;  4LF4 B;  2D3O W;  4LF5 B;  1GTO A;  3OE7 G;  1NBM G;  1BT8 A;  1V9P A;  5JQG B;  3CC7 V;  1E1Q G;  2EIK B;  2YEV B;  2IU0 A;  1Q6U A;  1US6 A;  4I5S A;  3ETG A;  4UCU A;  1YCI A;  1AVM A;  1TGO A;  3SJB C;  5KHK A;  2ILM A;  3ABK B;  4GZR B;  4LF7 B;  1Q90 D;  2H94 A;  3H9V A;  3MHH C;  4PHZ A;  3JAT A;  3FD9 A;  1GM8 A;  1FXV A;  1Z5V A;  2E5L O;  4LNU A;  3H1L H;  3CJH A;  3PN1 A;  3ZN1 A;  1VMG A;  2UXB O;  5EBM C;  1KQS U;  1H2K A;  3CME V;  4NKG B;  2QA4 V;  1XNR O;  2DWD C;  4LFA O;  2JS5 A;  3N2K B;  2ZKO A;  3AG2 C;  3AEI A;  4DV4 B;  1BMF G;  3RYF B;  1TAE A;  2YXL A;  4KFM A;  2AGA A;  2R9I A;  4TUY B;  4UFZ A;  3QO7 A;  3FKS G;  4AQY B;  5IJ9 A;  4LP8 A;  4O2A A;  3MD0 A;  4PD4 F;  1Q81 W;  1TVK A;  4TV9 B;  5B3S C;  3ICX A;  1O9G A;  5J2T B;  3ABL B;  1KKC A;  5EIB D;  2YS8 A;  3B4S A;  4XDJ A;  3N2G B;  5KLV H;  1S5J A;  1MZF A;  1B6Q A;  3OT7 A;  4QGP A;  1S5L Z;  4DRX B;  3J81 N;  1IX9 A;  4WCE V;  1JOY A;  4JYB A;  3UKM A;  1GN2 A;  1K8A W;  1XI1 A;  3HR0 A;  4G28 B;  5JH7 A;  2UXC B;  3FYI B;  2WA4 A;  5DM6 V;  2B9Z A;  1YXB A;  2Q8V A;  2M6Y A;  3QF7 A;  3OFN G;  3CD6 V;  2EIM B;  1NQT A;  3LSQ A;  4PJ0 Z;  3CWB H;  4JTD B;  2QM7 A;  1FD9 A;  4JV5 B;  1VF6 C;  2LW1 A;  2JGU A;  4OPA A;  4TQF A;  4U7O A;  4LR3 A;  2A3Q A;  4JI4 B;  1FYJ A;  3M8A A;  2RMK B;  3QO8 A;  4R50 A;  2KSD A;  4GX0 A;  4JI6 B;  1X59 A;  4X1K A;  2YIB D;  3WB0 A;  1SF9 A;  1NTZ H;  1SQP H;  2DYS B;  3SYO A;  3E8G A;  1BS3 A;  3NXS A;  4DV3 O;  2NR5 A;  1WA8 B;  3I56 V;  3ABU A;  3M7M X;  3H01 A;  2YEV A;  4B3R B;  1IDS A;  1Q6I A;  5LMN B;  3P30 A;  3OTF A;  3HKC B;  1K97 A;  3T1C A;  3HKB A;  4DK0 A;  4LF6 B;  3DXR A;  4DR6 O;  2OTJ V;  3CPW U;  2HKO A;  4MVR A;  5KUM A;  5J9P C;  1SES A;  2F93 B;  4PV1 B;  4R7C A;  1H38 A;  3CC4 V;  1Y67 A;  2H8P C;  5B5E Z;  1PD3 A;  4B3M B;  1YZB A;  2P7T C;  2QKA A;  2Y0I A;  4FLZ A;  3N2K A;  1FXK A;  3GVM A;  4YY3 B;  2B1I A;  5C93 A;  4N23 A;  1I5Y A;  1JX9 A;  2VQF B;  4MW3 A;  2CH7 B;  4TUY A;  3FB6 C;  1ENV A;  5LHH A;  1OCZ C;  4TT3 G;  3ZBH A;  3JSN A;  5IYD O;  4YJ2 A;  2DMX A;  4JI3 O;  2PI4 A;  1WB7 A;  4B7E A;  3AK3 A;  3ZMZ A;  5EC1 C;  2IM9 A;  2LFR A;  4JI7 O;  3CE2 A;  2WPD G;  4I50 B;  2OIG A;  5EIB C;  1K3E A;  5CBG A;  1T5E A;  1NTK H;  1S3J A;  1MOF A;  5F2V O;  1HWY A;  1WJZ A;  3ZJZ A;  5B66 Z;  3AK2 A;  1HP8 A;  3RVY A;  3ASO C;  4JI5 B;  1I0H A;  1FS0 G;  1KC8 W;  3WU2 Z;  4WBN A;  4DW0 A;  1AJN A;  3J7A U;  5LA6 A;  3I5D A;  1IBM B;  3ABM B;  4E4E A;  3M99 B;  5L3B A;  1IXM A;  3EFF K;  1B3Q A;  4X1I B;  2OTL V;  1SRY A;  3OM3 B;  2QWN B;  2F1M A;  2A79 B;  1Y76 A;  1YI2 V;  3K04 A;  1XQ8 A;  1NVP B;  3DSQ A;  1WA8 A;  4FK5 C;  3T4Z A;  1D5A A;  4MVM A;  4F6E A;  4CH6 A;  1JJO A;  2CGO A;  2QGN A;  3UM7 A;  5CBH A;  2OYQ A;  1MNG A;  1H8H G;  2YC0 A;  4ZI7 B;  2YSU B;  2K9P A;  2ZM6 B;  3AK1 A;  3RN4 A;  4PI2 A;  4U3J B;  4X9Q A;  1SQQ H;  3ZIA G;  1K7D A;  3ETE A;  2R9R B;  4K35 A;  2FML A;  2WLM A;  4NYK A;  2IW5 A;  3G71 V;  4TWK A;  3BRC A;  3OEH G;  3SPI A;  3CC2 V;  5CN0 A;  2Q0A A;  4LF9 B;  2Y4U A;  3F7V C;  1H8E G;  4DR5 O;  5LP6 C;  1DGS A;  2Z5U A;  5LMU B;  2IJK A;  2JDI G;  1WB8 A;  1N33 B;  3B09 A;  4JI1 O;  2YXH A;  1ZLZ A;  1QLN A;  4JPR A;  3BFR A;  1J5E B;  3TCU A;  3RW0 A;  1GN6 A;  3CRA A;  3N27 A;  2EIN B;  3UQ8 A;  1N0N A;  4YIP A;  1BQ0 A;  2IJJ A;  4E2L A;  4MVQ A;  2RQ6 A;  3B8M A;  4J7J A;  3JCZ A;  2R72 A;  3W7X A;  3NR7 A;  4FFB B;  4MVZ A;  4DV2 B;  5KHH A;  1AP5 A;  3JAL A;  1OCO C;  5JJE B;  2Y69 C;  1R3L C;  4J80 A;  2Q6A A;  3BY6 A;  2EIL B;  4DR1 B;  2N04 A;  4KP4 A;  4WFB V;  2JEU A;  4NTW A;  1O9H A;  5B1A C;  3FB5 C;  3W7T A;  3CRC A;  4X1I A;  2XAH A;  2BTQ B;  1OCR C;  4IHJ A;  4CH3 A;  4Z1V A;  1YSC A;  1P7G A;  3F5T A;  3KCY A;  4LF4 O;  2V4D A;  4LF5 O;  4B3T O;  3JAK B;  3FAV A;  5JVD B;  3SDL A;  5A2Q N;  2W6I G;  4UCS A;  3FFQ A;  1XL4 A;  3KG2 A;  2BSK A;  5ITZ B;  4J9Z B;  1FAF A;  3OUF A;  4ZI7 A;  4DW1 A;  3CS5 A;  3K06 A;  4ABM A;  3TXS A;  1AI7 A;  2ODM A;  2JGD A;  4LF7 O;  2Q67 A;  4H0L B;  4PDV A;  4J7Z A;  1FFX A;  4O4I A;  1U97 A;  3K57 A;  4P9O A;  2DQ0 A;  2PUS A;  4YHH B;  5CB4 B;  5B1N A;  1SS3 A;  4IIJ B;  4DUZ B;  4C7U A;  1QVF U;  1BZK A;  2YIB A;  3RBZ A;  5BMV B;  2JJ1 G;  5H2F Z;  4R8C A;  3G6B A;  4FLW A;  4UVB A;  2ITD C;  3E89 A;  5EYP B;  2N05 A;  1LUW A;  3ZRW B;  4DV4 O;  1IBK B;  3CCE V;  2GHY A;  1NKD A;  3JYC A;  3HPL C;  1JCH A;  4AQY O;  2JIZ G;  4U7N A;  2WLL A;  3OMI B;  3CP1 A;  2B5U A;  2IU3 A;  3A0H Z;  2AW9 A;  1MSW D;  1KP2 A;  2H3O A;  1AI6 A;  1TUB B;  4Z2W A;  1RP3 B;  3ETQ A;  4RUE A;  4GKJ B;  2LW7 A;  4K8X A;  1MZE A;  1IVS A;  3CXH F;  4NXN B;  2XAF A;  1FFT B;  3W7W A;  1PKX A;  3ZRS A;  5LGU A;  1SQB H;  1PP9 H;  1COW G;  5EBW C;  2BOC C;  2UXC O;  3OD4 A;  1K9M W;  4X62 B;  4XDK A;  3SJC C;  4FFB A;  1N36 B;  4X65 B;  5CA1 B;  2IJI A;  3H1K H;  4JAU A;  1E79 G;  3CCV V;  5EZY B;  1AI5 A;  3X2Q C;  3ZMV A;  4HNA B;  1L8D A;  4TQD A;  3WB1 A;  1HR0 B;  4IL6 Z;  3STZ C;  2LQT A;  3OEE G;  3SJQ C;  2CTQ A;  3TET A;  2DYR C;  3CX5 F;  5CMU A;  2JEX A;  4JI4 O;  5FPR A;  1FJG B;  1GAX A;  2AXT Z;  2JVD A;  2HJD A;  1OCC B;  2BTQ A;  3LNN A;  4ZHQ B;  4JI6 O;  3K3W A;  3UO3 A;  2CTW A;  1BHA A;  4HAM A;  3D8C A;  4O4H B;  5D5P A;  4JAV A;  1UFI A;  3T1H B;  1I7F A;  2AZ0 A;  1PNL A;  4IYI A;  1XIL A;  3H1J H;  2Q68 A;  1M57 C;  4UCT A;  4B3R O;  5ITZ A;  1NJI W;  4RWU A;  1RSO A;  3FB8 C;  1MAB G;  4O4J B;  4DR3 B;  2C2A A;  4FM2 A;  5C8Y B;  4LF6 O;  1PPJ H;  1Y66 A;  3OR7 C;  2A9H A;  5AG2 A;  4ZOL A;  5CBF A;  1PL0 A;  5GTI Z;  1SQX H;  3MAQ A;  5CB4 A;  4IIJ A;  2FTK A;  5BMV A;  4U3F H;  4DV0 B;  4YY3 O;  5IYC O;  1S5H C;  3ZRW A;  5L3F A;  1HNW B;  4HYO A;  1YIT V;  4LFB B;  3CRM A;  2EIK C;  1VQ7 V;  2VQE B;  4BIZ A;  4MVU A;  2Y4T A;  1NZ6 A;  1NR1 A;  3AG3 B;  4QPJ A;  1Y74 A;  1WNS A;  3ABK C;  1TUB A;  1GRJ A;  1XHX A;  2W0F C;  1CP9 A;  1KU9 A;  1YJ9 V;  5FLX N;  2GV9 A;  3E2E A;  4EEQ A;  3K9A A;  2UUB O;  3H1I H;  4UCV A;  2HG5 C;  2UU9 B;  4KXR A;  2LGQ A;  4JYA B;  3CEI A;  3BA8 A;  1IZ3 A;  1FXK C;  1ZSP A;  1N8R W;  3LDD A;  4LF8 B;  4RQF A;  1Q6H A;  4MSW C;  2UXN A;  5H6Q A;  5CA1 A;  1DF5 A;  5EZY A;  2XND G;  5HFL A;  4HNA A;  3ML0 A;  1Q8I A;  2WA3 A;  4JF3 A;  1OZ0 A;  1V55 B;  4JI5 O;  1PM9 A;  2HVK C;  3ASN B;  3U10 A;  2CUG A;  1XMO B;  1QLE B;  5IJ0 B;  1NI8 A;  3RYH A;  5IYZ B;  4JYC A;  1IBM O;  1XDC A;  4TV8 B;  1QR8 A;  3JSL A;  2ZXW B;  3K5O A;  4I9Q A;  1YDX A;  3SYA A;  1Q43 A;  4B3S B;  5LOV A;  4ZHQ A;  4DV7 B;  2PI5 A;  1ARO P;  2QE7 G;  3D3Q A;  4H37 A;  5KHG A;  2OCH A;  4I0X B;  2ZIO A;  4O4H A;  4MTO A;  2B1G A;  2NNU A;  2QKS A;  3U0Z A;  2HHH B;  3ABT A;  4PA4 A;  4FPP A;  2EIJ B;  4X64 B;  3ZHU A;  5KA6 A;  2ZM6 O;  2Q5Z A;  2EZO A;  2L35 A;  4O4J A;  1JFF B;  5C8Y A;  2DJV A;  3JD4 A;  3I55 V;  4JTA B;  4FFK A;  3K0G A;  1BE3 H;  1H2M A;  3EVK A;  1H2N A;  1YJW V;  3L71 H;  1NVP D;  2K1E A;  2P22 C;  3Q4H A;  2GTA A;  1S0V A;  1DTO A;  1K4D C;  4CH5 A;  2EJ7 A;  2PGG A;  1FPO A;  4K3A A;  3VOU A;  4J9Y B;  2UUA B;  1AI4 A;  2F95 B;  5B1O A;  2QWR B;  3ZHQ A;  2MW2 B;  4LF9 O;  1GK9 A;  2A0L A;  2XHB A;  1QU7 A;  3BEH A;  3AG2 B;  5LMU O;  1G1X B;  5H6R A;  5KAF Z;  2JRI A;  2CGN A;  1MA1 A;  5L3D A;  2MK3 A;  1N33 O;  3OR6 C;  3L75 H;  1Q7Y W;  1V54 B;  1QCE A;  1JA8 A;  4QE9 A;  1J5E O;  3VQX A;  1EZJ A;  4JAA A;  2WLJ A;  4WF9 V;  4GYC B;  3SPG A;  1TUE B;  1P7B A;  1JQ0 A;  3EHB B;  1QQC A;  2HP8 A;  2GBO A;  2ZIN A;  2JK5 C;  2HJF C;  4CS4 A;  5JQG A;  3K59 A;  5BR8 O;  5KHI A;  4UUJ C;  1EZV H;  2WLH A;  5E1A C;  4ZBM A;  4UV9 A;  2IJH A;  4DV1 B;  4CZZ A;  5IJ0 A;  4DR1 O;  4LH6 A;  2WLI B;  2HFE C;  5KX5 B;  4X66 B;  5IYZ A;  2Q4P A;  4TV8 A;  3R66 A;  1F23 A;  1SZX A;  4XBF A;  3OTO O;  4YIO A;  1W0K G;  3RYF A;  2P06 A;  4F6R B;  4FLY A;  2X6B A;  4I0X A;  3RYI B;  2LFS A;  4JI2 B;  4PDR A;  1F4M A;  2O57 A;  4DR2 O;  2ETN A;  4TV9 A;  4XDL A;  4PI0 A;  2ZCE A;  1KKD A;  5J2T A;  1KB9 F;  1JFF A;  3N2G A;  3CSX A;  3CRR A;  3ABM C;  1Y6X A;  4DRX A;  4OX9 B;  3C90 A;  2XTA A;  4PDM A;  5A9G A;  5K1X A;  3OUS A;  3OGC C; 
#chains in the Genus database with same CATH homology
 4ZKI A;  3E8B A;  1FXH A;  4P30 A;  3G6E V;  1V54 C;  1L1F A;  5CA3 A;  4MW8 A;  4KP4 A;  3RVZ A;  4Q20 A;  2JEU A;  4WFF A;  4WFB V;  5IY5 B;  5L3E A;  3E86 A;  5B1A C;  1R3I C;  2OT5 A;  4RUF A;  4X89 A;  3FB5 C;  1VQP V;  3W7T A;  1K5S A;  5DN6 G;  3X2Q B;  2DYS C;  2XAH A;  5BZB A;  1OCR C;  1J95 A;  2XAQ A;  1I5X A;  3E8F A;  3OMA B;  1K5Q A;  1YSC A;  4QIW F;  1KEC A;  4JAS A;  1RPR A;  4RAI A;  5KA5 A;  3MHS C;  2W6I G;  4P2Z A;  1CEZ A;  4QPK A;  1XL4 A;  3KG2 A;  4G27 B;  1BL8 A;  4UXN A;  3ZRV A;  1THZ A;  4DXW A;  1S76 D;  4J9Z B;  3OUF A;  3CCL V;  2V7Q G;  4I9W A;  3LUT B;  3K06 A;  4GX1 A;  4Z1M G;  2GSM B;  1RM1 C;  1S72 V;  1AI7 A;  3IC7 A;  3JD2 A;  5B3S B;  1VQL V;  1VQ5 V;  1V55 C;  4CBC A;  2XOK G;  3ASN C;  2Q67 A;  1G4Y B;  4PDV A;  3STL C;  5LHG A;  2EJR A;  1ZWI C;  3D36 A;  4PA3 A;  3WFV A;  1M57 B;  4P9O A;  1PNM A;  2DQ0 A;  4PA9 A;  1F51 A;  5B1N A;  1GO3 F;  3ZMT A;  5LGN A;  1QVF U;  2WLI A;  3RBZ A;  4PDL A;  4PA7 A;  2WAM A;  2JJ1 G;  3ASO B;  4R8C A;  3CXC U;  4EKW A;  4RQE A;  4UVB A;  2ITD C;  3E89 A;  3ZRW B;  1W2B U;  3CCE V;  2GHY A;  1NKD A;  3K03 A;  2X6C A;  4GCZ A;  3JYC A;  1BHB A;  1CPY A;  1M56 B;  2EIN C;  3ETD A;  3HPL C;  3IFX A;  1JCH A;  3SYP A;  2JIZ G;  4U7N A;  3JD0 A;  1P4R A;  2WLL A;  2WWW A;  3OMI B;  3CP1 A;  4FJC C;  2B5U A;  2OCC B;  2IU3 A;  1UJW B;  1SZT A;  1MSW D;  1KP2 A;  4QNH B;  2X0L A;  1AI6 A;  2D3O W;  1GTO A;  3T2M A;  1KD1 W;  4RUE A;  3OE7 G;  1VQM V;  1NBM G;  1EBO A;  1SER A;  4YXW G;  2XAF A;  1FFT B;  3VBB A;  3CC7 V;  1E1Q G;  3W7W A;  2EIK B;  1PKX A;  2YEV B;  1DF4 A;  2EIL C;  3ZRS A;  5LGU A;  1GKF A;  2IU0 A;  1E1R G;  4MTF A;  1M1K W;  4I5S A;  3ETG A;  3ABK B;  1COW G;  3OMN B;  1JVM A;  2H94 A;  3MHH C;  5EBW C;  5IY5 C;  2BOC C;  1GM8 A;  1FXV A;  1K9M W;  4XDK A;  2UXX A;  4PEL A;  2IJI A;  4JAU A;  3CCV V;  1E79 G;  1AI5 A;  3ZN1 A;  3X2Q C;  4LCU C;  3ZMV A;  5EBM C;  1KQS U;  1QR9 A;  3CME V;  1WPX A;  2QA4 V;  2DWD C;  3STZ C;  4DO2 A;  3OEE G;  4H33 A;  2JJ2 G;  3SJQ C;  3AG2 C;  3GB7 C;  3AEI A;  5EK0 A;  1BMF G;  4KFM A;  3TET A;  3DTU B;  3AG4 B;  2DYR C;  4FMT A;  5CMU A;  2ZDI C;  2JEX A;  2R9I A;  2WLK A;  5IYB O;  3QO7 A;  3FKS G;  1R6K A;  4LP8 A;  4UV8 A;  1OCC B;  1VQO V;  1RPO A;  3MD0 A;  1YTF D;  3K3W A;  1Q81 W;  1K33 A;  4OXS A;  4WFG A;  5B3S C;  2X6A A;  1YJN V;  1BHA A;  4HAM A;  3E8H A;  2XAG A;  3ABL B;  4BW5 A;  4JAV A;  2V1D A;  1GM7 A;  2ZDI A;  4XDJ A;  1QBZ A;  2X7R B;  1PNL A;  3CCM V;  2Q68 A;  1M57 C;  1K73 W;  1OCZ B;  1B6Q A;  3CMA V;  2DW4 A;  1KP3 A;  3OW2 U;  1NJI W;  4L87 A;  1QVG U;  2IH1 C;  4MS2 A;  4WCE V;  1JOY A;  4JYB A;  3UKM A;  2EZP A;  2P67 A;  3FB8 C;  1K8A W;  1MAB G;  5LHI A;  3DGE A;  4G28 B;  2C2A A;  3FYI B;  3SYC A;  4BIU A;  3HB3 B;  3IGA C;  3OAA G;  5DM6 V;  1Y66 A;  2QM8 A;  4G2K A;  1YTF B;  3OR7 C;  1MG1 A;  4RO2 A;  3OFN G;  2A9H A;  3CD6 V;  2EIM B;  3A0R A;  1NQT A;  3LSQ A;  5CBF A;  3W7S A;  3ZMU A;  1PL0 A;  4JTD B;  2QM7 A;  3CCJ V;  4JTC B;  4JGS A;  2OCC C;  1NH2 D;  2FTK A;  4KUM A;  3R65 A;  2ZR3 A;  4MVO A;  5IYC O;  1S5H C;  4U7O A;  3ZRW A;  2KB1 A;  5L3F A;  4HYO A;  4MTG A;  1YIT V;  2EIK C;  2NLJ C;  3QO8 A;  1VQ7 V;  4R50 A;  4BIZ A;  4MVU A;  4WFA V;  1AJQ A;  4GX0 A;  1NR1 A;  3LNM B;  3AG3 B;  4QE7 A;  4QPJ A;  3K0D A;  3ABK C;  2DYS B;  2W0F C;  1CP9 A;  3E8G A;  3SYO A;  3NXS A;  2Z3Y A;  1YJ9 V;  3E2E A;  1NH2 B;  3I56 V;  3ABU A;  3K9A A;  3H01 A;  2YEV A;  3CCQ V;  4LBE C;  2HG5 C;  4BAY A;  1AR1 B;  3P30 A;  1Q82 W;  1K97 A;  1OHH G;  3WG7 B;  2XAJ A;  3T1C A;  1M9N A;  2ITC C;  1FXK C;  1N8R W;  3LDD A;  5HFM A;  3CPW U;  2HKO A;  4MSW C;  4RQF A;  2UXN A;  1GMG A;  3AG4 C;  2OTJ V;  4N21 A;  5H6Q A;  1DF5 A;  2BOB C;  4MVR A;  2P90 A;  2ATK C;  1RM1 B;  1AJP A;  4UVC A;  5GW7 A;  5KUM A;  1M90 W;  2XND G;  1SES A;  5HFL A;  5J9P C;  3ML0 A;  4R7C A;  4JF3 A;  1OZ0 A;  1V55 B;  2AHY A;  2EBO A;  2WSS G;  2HVK C;  3ASN B;  3P32 A;  5LGT A;  1H38 A;  2H8P C;  3CC4 V;  2IH3 C;  1PD3 A;  1QLE B;  2HVJ C;  2P7T C;  4FIP C;  1FXK A;  2B1I A;  5C93 A;  4N23 A;  2WLL B;  4JYC A;  3ZCC A;  1I5Y A;  1JX9 A;  1GM9 A;  1R3K C;  4MW3 A;  3SPJ A;  1VQN V;  1H2G A;  1QR8 A;  3FB6 C;  1ENV A;  2ZXW B;  5LHH A;  1OCZ C;  4TT3 G;  3SYA A;  4F4L A;  2XAS A;  3K08 A;  2PI5 A;  1ARO P;  2QE7 G;  5IYD O;  4MVS A;  2PI4 A;  2W6J G;  1EFR G;  3B77 A;  4H37 A;  3ZMZ A;  5EC1 C;  4MTO A;  2LFR A;  3LDC A;  3AG1 B;  2WPD G;  2B1G A;  4TSF G;  2NNU A;  2QKS A;  1K92 A;  3ABT A;  4PA4 A;  4ASU G;  3PJS K;  4X88 A;  4FPP A;  1K3E A;  2EIJ B;  5CBG A;  3D3I A;  3W7U A;  1YIJ V;  1VQ9 V;  1S3J A;  1SET A;  5KA6 A;  3CCR V;  2EZO A;  3F5W C;  2DWE C;  2Y48 A;  5B1B B;  3I55 V;  3JD4 A;  1MOF A;  4JTA B;  1PNK A;  1LNQ A;  3K0G A;  3FYE B;  3QO5 A;  1HWY A;  3ZJZ A;  4X8A A;  1F4N A;  3RVY A;  3ASO C;  1VQ8 V;  3AG3 C;  1YJW V;  1K4C C;  1NVP D;  2K1E A;  1FS0 G;  1R3J C;  4GX5 A;  1S0V A;  1KC8 W;  3K79 A;  2ZD9 A;  1DTO A;  3TK1 A;  1K4D C;  5H9C A;  2WLN A;  3VOU A;  1AJN A;  5FL7 G;  1M56 C;  4J9Y B;  1AI4 A;  5B1O A;  3QNE A;  3ABM B;  3SYQ A;  1R6N A;  3M99 B;  5L3B A;  1IXM A;  3OGC C;  1GK9 A;  2A0L A;  1ORQ C;  2QTO A;  3SPC A;  1ROP A;  3BEH A;  3AG2 B;  3EFF K;  1OCO B;  5LBQ A;  3GWO A;  3G4S V;  2Y69 B;  4WFH A;  5H6R A;  2OTL V;  5L3C A;  3WG7 C;  4QJF B;  1SRY A;  2DYR B;  3OM3 B;  5L3D A;  2MK3 A;  2A79 B;  1YI2 V;  3K04 A;  1XL6 A;  3OR6 C;  1Q7Y W;  1V54 B;  4GX2 A;  1NVP B;  1QCE A;  4FK5 C;  3T4Z A;  4QE9 A;  2P6J A;  2ZQM A;  4MVM A;  2F43 G;  5B1A B;  1EZJ A;  3LDE A;  3UM7 A;  2WLJ A;  4WF9 V;  5CBH A;  3SPG A;  4MTX A;  3CCU V;  1TUE B;  1P7B A;  1JQ0 A;  1H8H G;  3EHB B;  1VQ4 V;  2YSU B;  3JD1 A;  4GT1 A;  1QLE C;  2JK5 C;  1OCR B;  4PA6 A;  2HJF C;  2ZR2 A;  4MT8 A;  1VQ6 V;  3ZRX A;  3ZIA G;  3JD3 A;  1K7D A;  3ETE A;  4LC1 A;  4UUJ C;  2R9R B;  2ZXW C;  2WLH A;  5E1A C;  2QEX V;  2WLM A;  3F7Y C;  2IW5 A;  3G71 V;  4HZ3 A;  4TWK A;  4ZBM A;  4UV9 A;  3CCS V;  2IJH A;  3OEH G;  3CYO A;  4CZZ A;  4R6Z A;  3SPI A;  2DQ3 A;  2WLI B;  3SPH A;  2HFE C;  1VQK V;  5KUK A;  3CC2 V;  5CN0 A;  1NR7 A;  3FB7 C;  5EBL C;  3F7V C;  1K34 A;  1H8E G;  1OCC C;  4UVA A;  3AG1 C;  1F23 A;  3ZN0 A;  4XBF A;  2Z5U A;  2EIJ C;  1W0J G;  3E83 A;  1JPX A;  2IJK A;  2JDI G;  1W0K G;  2LP7 A;  1JJ2 U;  1S77 D;  3ABL C;  2AHZ A;  2HLD G;  2X6B A;  2CK3 G;  5EC2 C;  5IDJ A;  5B1B C;  2LFS A;  1QLN A;  4JPR A;  4PDR A;  1F4M A;  3TCU A;  3RW0 A;  1R73 A;  2EIN B;  4XDL A;  2HR3 A;  4WFE A;  1YHQ V;  2IJJ A;  1WLE A;  5L3G A;  1KKD A;  1Q86 W;  2Q69 A;  4E2L A;  3T4D A;  2EIM C;  4MVQ A;  1G8M A;  3LSS A;  3ABM C;  3B8M A;  3JCZ A;  3W7X A;  3B8N A;  1DLB A;  3E35 A;  3ZMS A;  1FXK B;  4MVZ A;  1OCO C;  1Y4M A;  4PDM A;  2M7W A;  2Y69 C;  1R3L C;  2Q6A A;  3OUS A;  4P9P A;  3BY6 A;  2EIL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...