3GWOA

Structure of the c-terminal domain of a putative hiv-1 gp41 fusion intermediate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
b'WDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Role of a putative gp41 dimerization domain in human immunodeficiency virus type 1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
molecule tags Viral protein
total genus 24
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3gwoA00
3MHSC 1EBOA 3B8NA 1DF4A 3GWOA 4JGSA 5CMUA 2X7RB 3MHHC 1Y4MA 3B77A 4FIPC 5H9CA 1JQ0A 2EZOA 3P30A 2P6JA 4G2KA 5KA6A 2OT5A 4N23A 3WFVA 5HFLA 3CP1A 5CN0A 4N21A 1Y66A 1I5YA 1QCEA 2EBOA 2MK3A 4E2LA 1K34A 2EZPA 3CYOA 4JF3A 1QR9A 3B8MA 1QBZA 1F23A 1ENVA 1SZTA 1QR8A 1JPXA 4FJCC 1MG1A 2M7WA 4FK5C 1MOFA 5KA5A 1I5XA 1K33A 3M99B 3K9AA 2LP7A 3H01A 1DF5A 1DLBA 5HFMA 4JPRA
chains in the Genus database with same CATH superfamily
2Z5UA 4DUYB 4JGSA 4FIPC 3RYIA 2XTAA 4TUYB 1N0NA 2G38A 1MSDA 4DR1B 3ZRSA 2ZQMA 3CJHA 4KFMA 4NTXA 1O9HA 2LFRA 3LNMB 2YSUB 5GTIZ 4D6TH 4JI8B 2V7QG 3L9DA 2PF4E 3OT7A 2PY5A 1PNMA 3HKCA 4I0XB 4J11A 4GX5A 1JQ0A 1N36O 3ZMUA 1DK1A 1B6QA 3FB7C 5KX5B 1KB9F 2C2AA 4F6EA 5LHHA 2ILMA 1IXMA 1VQPV 5LGNA 4LF7O 3UO2A 3K03A 2KB1A 1CP9A 4HAMA 1FXVA 4NR1A 1WPBA 4WFBV 1FFXB 2PYJA 3ABMC 2UUCO 1KC8W 3BA8A 3SJQC 1SQGA 1KECA 1F4NA 4I7ZB 3ZMVA 1OCZC 2RMKB 2XT9A 3HKBA 5EIBD 3CCMV 3JALA 4X62B 1EN4A 3L71H 3T1YO 3SPJA 1R73A 1BS3A 2ZE7A 4I9QA 3ABUA 2YUAA 4I4TB 4QJFB 4J41A 4P9OA 4TV9A 5GONA 2IH3C 4JPRA 1COWG 3H1LH 4DV5B 3AG4B 1Y76B 2VQFB 1XDCA 4N21A 4RWUA 4JI3O 4AQYB 1SKVA 2MK3A 1RPRA 4JYBA 3E8BA 4X66O 3BY6A 3AEIA 5KHKA 2QGNA 1CPYA 2YXYA 1X59A 2NN4A 5LYJA 1R1BA 4I5SA 4YIOA 1YZBA 4JI7O 4D7TA 5FPOA 3GB7C 1G6UA 1PL4A 4NKGB 1FKAO 4IHJB 4WFAV 1K3EA 4JI2B 1H2NA 3J81N 1B3QA 1YXBA 3ABMB 2IU3A 3RYCB 4DR2B 4WBNA 2FTKA 1OCZB 1BQ0A 4AILC 4JYAB 5CMUA 1TUBA 1FS0G 2F1MA 5EIBC 3UO3A 5F2VO 5IJ9A 5IYZA 1VQMV 2JEXA 3C90A 4E2LA 4FLWA 4GKJO 2UUAB 4K8XA 2OCCC 3MDSA 4RAIA 3G71V 2BOBC 3A2FA 2ZCEA 2IM9A 3GVMA 1SRYA 5JJEB 3K5NA 1AROP 1R6NA 4BW5A 2LW7A 1M57C 1XBLA 3LDEA 1VQ6V 3K04A 1MZFA 2JS3A 1OZ0A 4DRXB 5J2UB 1IVSA 3ETEA 1THZA 1WN7A 5B1NA 2K9PA 4HNAA 1I5XA 2F93B 2EIJC 1VIBA 4KXRA 2PI4A 4LFCO 4PDLA 3FYEB 5CA0A 3BHPA 3CRCA 4JI6B 4B7EA 5KAIZ 5JVDB 5KUKA 4I50A 4YJ2A 3IFXA 1KD1W 2YIAA 1QBZA 3E8HA 4QPKA 4ZBMA 1JA8A 2O57A 1FXKC 5BY1A 4DV3B 3TJTA 1EN6A 1IBLB 3JCZA 1BMFG 2VWKA 2Y0PA 1JFFA 3BEHA 2GHYA 2QKAA 4K8ZA 2ZD9A 1K34A 2F4VB 2OCCB 3AG7A 5KLVH 1BQZA 1WP7A 3EHBB 3EXAA 1M57B 1MMMA 3MAQA 4YJ3A 4DV7B 3B77A 4DUYO 2XNDG 2P6JA 2OWOA 1VQLV 1QQCA 2GUZB 5J2TB 3CCRV 1ZTEA 4AI8A 5CB4A 2E5LB 3ETDA 4WFHA 4P2ZA 5L3DA 1SA0A 5IJ0B 4FPPA 4QIWF 1YVWA 3CS5A 4ASUG 1MZEA 2Q8VA 3K3WA 3S3XA 1K97A 1KU9A 3PN1A 3N2GA 1AR1B 2OIGA 4MVSA 1JMKC 4J10A 3QNEA 5B1AC 3W7TA 4B3TB 4HYOA 1RPOA 4PA9A 5JJNB 1VQNV 3T4DA 2GBOA 2H3OA 1FXKB 1J5EB 2ZR2A 2JGUA 3G67A 1K92A 1BZKA 1I0HA 5BXZA 4DR5O 4GX2A 1Q86W 3E22A 3FAVB 2UXDO 1NI8A 2WLNA 3I56V 2QWPB 1Q81W 3ZRWB 4GX0A 4A5UB 1GTOA 1ZUQA 1Q8IA 1SQQH 4KUMA 1N8RW 1X4TA 2Y69C 5TISZ 2WLIB 4X62O 1NU1H 1ENVA 3HKEB 1S5LZ 4DW0A 1IBKO 2UU9B 1GM7A 5LOVA 1XNRO 5A9GA 5L3FA 3C3TA 4L8JA 2Q7GA 3Q4HA 4DV0O 4OXSA 4DV5O 2R70A 3BFRA 2VQFO 4UUJC 2HEPA 3CCJV 2DQ0A 4AQYO 1M56B 3CYOA 2EILC 1GM8A 1ZL8B 4LCUC 2QM4A 3AG2C 3ASOB 2DYRC 4LNUB 5KHIA 3X2QB 1D5NA 1LNQA 1L0NH 4LWSB 2HVKC 5B1AB 1K5QA 4LF9B 4WFEA 1GN4A 3LSQA 2EZOA 4F6RA 3CRAA 3E83A 4IYHA 3AG3B 5JQGA 4LC1A 3CD6V 2QA4V 2OCHA 4WFGA 2DOSA 1VARA 4KL1A 4F4LA 4JI2O 4QE9A 5LXTB 5E1AC 2AZ0A 4ZHQB 4PELA 3FFQA 4MTOA 4FM2A 4MTFA 4KP4A 2YIBA 4Q6GA 4O4IB 2CH7A 1Q6HA 1Y74B 5CBHA 2A79B 3JD4A 3AK2A 1KP2A 3OMIB 1Y6XA 1JOYA 1XHZA 3RYHA 4ZI7A 1OCOC 2D2CB 2Q69A 2UXBB 2KG7B 3WFVA 4JI3B 1Z5VA 4K0KB 2BTQA 4X1IB 2ITCC 4X66B 2EILB 3SYAA 4X9QA 3AG2B 1Q3EA 1YIJV 4LF5B 3JARA 1KKCA 1GH6A 3B4SA 2LW1A 3QO5A 3QTCA 1IBMB 2CDYA 1N32B 4DR3B 4PI2A 4P30A 5L3BA 4JI7B 3OR6C 3RYIB 1JCHA 4FLZA 2PUSA 1YITV 3P3NA 4X1KA 4U3FH 4Z1VA 1TUEB 4X20A 4JI6O 3J80N 1P4RA 3JYCA 3CJHB 3N27A 1UJWB 1PNLA 1TAEA 3ZJZA 1M4UA 1TGOA 2R72A 1PV0A 3K59A 4LFBB 2A9HA 5FPRA 1XNQO 4DV3O 4GCZA 3HKCB 4BW9A 2B5UA 5IWAB 1IBLO 1DGSA 3JATA 3WU2Z 3OW2U 4GKJB 2A7WA 2P06A 3ZEDA 4JASA 4DR4O 4LFAB 2LGWA 1XL6A 4MSWC 1OCOB 3CB2A 4YIPA 5LP6A 4ZOLA 3A8TA 2YICA 4X65B 1MA1A 2X6AA 5JCOA 3P30A 2BTOA 3RGBA 4DV7O 4EB6A 4OPAA 5LA6A 1FAFA 3HKBB 1MNGA 2HFEC 3T1HB 3JALB 1YTFD 1AI5A 1PNKA 2BCCH 2QWQB 1UPGA 1K4CC 4XDLA 3R65A 4TT3G 1JX9A 4TV9B 1GMGA 2Z3YA 5GONB 4LFCB 5LGTA 5B3SC 1XHXA 2BOCC 4IL6Z 5LGUA 3RN4A 2JS5A 1V9PA 2JEUA 4LP8A 3DGEA 2ZINA 1OHHG 2WLHA 4R8CA 3KCXA 2F95B 1PM9A 1VMGA 1DF5A 3JD0A 1S72V 3MHSC 1SQFA 1KYOF 1GO3F 3SDLA 2VWJA 2V1DA 1BGYH 1HW7A 3FX7A 4LF6O 3B8MA 3FKSG 5FL7G 2BSKA 3MD0A 4O2AA 3BRCA 1I7FA 2E75B 3T2MA 1S5JA 4WBNB 5EK0A 2F23A 3CRQA 2UU9O 3DC5A 5H2FZ 1U97A 5IT9N 1TUBB 5IJ9B 5IYZB 4YHHO 1QLEC 1Y66A 2HR3A 5EZYA 1FXHA 3K5MA 3L72H 4UXNA 2R9IA 3IGAC 3LDCA 5L3EA 1CEZA 5KMGB 2ZIMA 1RFYA 2A06H 5B3SB 1HNWB 4O4JA 2V4DA 4FLTA 1JVMA 1TVKB 3KZIZ 2JVDA 1ZWIC 4LF9O 4PHZA 4B3RB 4DXWA 5CN0A 1R6TA 2WAMA 3K08A 1G8MA 2UXNA 1NR1A 3VQYA 2Q68A 4UV8A 4DUZO 2M7WA 1WA8A 4HNAB 2ZXWC 4XDJA 4DR5B 5C8YA 2UXDB 2DE0X 1EN5A 2ETNA 3TGUH 3ABKC 4B7KA 3FB6C 2P4KA 1MSWD 5CA0B 1NVPD 1SQXH 1KMIZ 4I50B 3RVYA 3JAKA 4YJ2B 3P3PA 1VQ7V 1Z5WA 4NB5A 2UXCO 3FB5C 1IBKB 5LMNB 2H8PC 3ZHQA 2P22C 4UCTA 1KBHA 3K0GA 4L87A 1XNRB 2NNUA 4LF8O 3RW0A 4DV0B 2UXBO 4MVQA 1QCEA 1JFFB 2HLDG 2RN9A 4K0KO 1RM1C 1ORQC 3SYOA 5IDJA 2DWEC 2YIBD 1AB3A 4LF5O 2Z0AA 1IBMO 2ADPA 3BAAA 4UVBA 1N32O 4DR3O 4LH7A 4CS3A 4EFEA 1AI7A 3ETGA 2AZ2A 4J9YB 1G1XB 5CB4B 3GWKC 1SERA 1E79G 1SA0B 2ZXWB 1BHAA 2XAHA 1W0JG 3CCLV 4LFBO 4JYYA 1N0JA 1H8HG 3N2GB 3DXRA 1GAXA 3O65A 3RVZA 2AW9A 1AR5A 3UT5A 2P4VA 2IJIA 4G28B 2Y0IA 5IWAO 2Y4TA 3OEHG 4GX1A 1KP3A 1OV9A 2XHBA 3JSNA 3CRMA 3LNNA 4LFAO 4W4LA 2XUMA 3E22B 3ETQA 3UCSC 1WB8A 1ZAUA 3LSUA 1WJZA 1S76D 1S3JA 5B1BC 4FZ0A 1IXBA 1KKDA 2DMXA 4X65O 1RM1B 3K0DA 1QHTA 3ICXA 3T1HO 3BPZA 2B9ZA 2NR5A 4UFZA 3JAMN 2QTSA 2CTQA 4J7ZA 1V54C 1HWYA 1R6KA 2CTWA 2CAZC 4EEQA 4GKKB 4FLYA 1JR9A 4X64B 1PPJH 1AP5A 5FNVA 5LOVB 4PDRA 3DC6A 3SPCA 4DR6B 3Q4HB 3W7WA 4UCSA 1EZJA 2IBZH 2ZM6O 3ZHRA 3QVNA 2F43G 2GV9A 3T1CA 4FZ1A 2WLMA 4UB8Z 1XNQB 4DYLA 3OMNB 4LH6A 5CA1A 5GW7A 1J95A 1NVPB 5H9CA 2W6JG 1NS1A 3OFNG 2Q7EA 5GTHZ 4F6RB 4X89A 3WB1A 3E8FA 1VP7A 2IJHA 4JZ2A 5JQGB 5KHJA 1RSOA 4DR4B 3OMAB 1CXZB 5J9PC 3S3WA 4XDKA 3T4ZA 2PZSA 2HP8A 5B1BB 4RQFA 3SYPA 3B40A 5K1PA 1GN3A 4BIUA 4FMTA 4MVUA 1AP6A 1NR7A 1K5SA 4JV5B 4MT8A 2QWOB 3K58A 4H13B 3HPLC 2YXHA 1QR9A 2CH7B 3F7VC 4Z1MG 1VQ5V 1F23A 1BHBA 2WWWA 2EIJB 4JTAB 3FD9A 2WA3A 2N04A 4Z2WA 1HNWO 1EBOA 1N34B 4BIOA 4ZI7B 3CCVV 1AR4A 1NTMH 4KHPB 2M6YA 2KSDA 4DV6B 5LP6C 4O2BA 3SJBC 4B3RO 2BTQB 4JI1O 2ZDIA 2ZIOA 3HKDB 5JCOC 1M1KW 1H2KA 1V55C 4I55A 4PDMA 2E3CA 1LR1A 4TWKA 4IT5A 2HKOA 3SPHA 1AJQA 4MS2A 5DECA 4UCOA 4YY3B 5CBGA 3JD2A 5KA6A 3JASB 2JRIA 2PYLA 4LF6B 4X1KB 4X20B 4RUEA 2B1GA 1JPXA 2DN9A 3CCSV 1SESA 3ZHTA 3CC2V 1IX9A 3OR7C 1M5IA 5LMNO 2EIKC 2FMLA 3B8NA 3RWRD 1QNMA 1AI6A 4YHHB 4UVCA 3FB8C 3JATB 2WLLA 3BVOA 2DWDC 4FM0A 1XREA 2IW5A 4OPHA 2ZT9B 1H2SB 4JI4B 1EM1A 4GUNA 1HP8A 5KA5A 1M9NA 3L74H 4CS4A 4BAYA 4ZOLB 2A3QA 2W0XA 2JJ2G 5H6RA 5ITZA 1V55B 4EB6B 3SR2C 5LA6B 1VQKV 4U3JB 3EVKA 2JGDA 1BE3H 4DUZB 2WSSG 1HNZB 3EFFK 2X6CA 3CE2A 3LSSA 4R50A 4QNHB 5KHGA 5EBMC 4B3MB 3RYFA 1R3JC 4DV4O 2CUGA 3K57A 4DV2B 1AJNA 2YI9A 2Y69B 2YC0A 3ZN1A 2EBOA 2EJ7A 1I08A 2HHHO 4PI0A 2PI5A 3ML0A 2UXCB 3OD4A 4BR6A 3A0RA 1HR0B 1H2LA 2LP7A 2H94A 3TK1A 1PL0A 4LF8B 1SQBH 4H37A 2QDOA 3ZRXA 1Y4MA 1RP3B 2P7TC 5JH7A 3ZS8C 4UCVA 4DR7B 3ZMTA 2IH1C 1TA8A 3OAAG 2DYRB 4JAUA 1QR8A 2BSKB 4DK0A 4O2AB 1UFIA 1Q90D 4PD4F 2YEVA 3H01A 4UVAA 3OUSA 3QO7A 2X6BA 5BR8B 3G4SV 3ZN0A 3VOUA 4GKKO 5IE9A 1NT2B 1HDJA 4X64O 5EYPA 2K1EA 4P9PA 4DR6O 2VRZA 3TXQA 5IYDO 3CMAV 4DK1A 2DQ3A 5EZYB 3L73H 2E76B 3DSQA 4MVOA 1BT8A 4FK5C 3I55V 2YDEA 1OCCC 1M90W 4QPJA 1FPOA 3ASNC 4UCUA 1VF6A 4IIJA 4O4JB 3QO8A 2ZE6A 2EINC 1NQTA 4K3AA 3BA9A 2OIEA 4MVMA 4XBFA 4DV1O 3HKEA 5H5NA 3CC7V 1WPXA 3AK3A 3L75H 5E79Z 3ZMSA 1O9GA 2FKXA 1U96A 2AGAA 3B2EE 4HBNA 3OTOB 5C8YB 1YDXA 4JYCA 2P67A 1VQ4V 4JTDB 3CHXA 4D7SA 3E89A 4FLXA 4JV5O 4QGPA 1SQPH 2XAQA 1KUQA 2ADQB 3JAKB 2LQTA 4PA4A 4K35A 4X1YA 2N74A 2NLJC 3JSLA 4LBEC 1WB7A 5LHIA 1N34O 3HR0A 4E4EA 3K5LA 2ZE8A 4KHPO 4H44B 4J7JA 2W6IG 4DV6O 2P5OA 2ZM6B 5BMVA 1OCCB 3D3QA 3ASNB 4PA7A 5KAFZ 3JCUZ 3VQXA 4R6ZA 2PGGA 2EINB 2FB5A 1YJNV 4NYKA 1K9MW 5LYJB 1F4MA 4YY3O 1NTZH 1R3IC 3IJ4A 5LL6Y 2Q6AA 1K73W 4O4IA 3BCCH 4FFBA 3AG1C 2DJVA 3D36A 4NVPA 3UKMA 5JWPA 1XMQO 1YJWV 1YI2V 3ZX6A 1K33A 1OCRC 4EFBA 1BCCH 1XI1A 3DXRB 2FL4A 4FFKA 1EFRG 3O9OA 4NTWA 1HNXB 2ODMA 1YF2A 1ROPA 2CK3G 3UT5B 1H8EG 4CZZA 2CGOA 4PA3A 4NXNB 4JF3A 4J7KA 3K9SA 2RQ6A 1MOFA 3TXSA 3ZBHA 2XAJA 3ZHVA 2XAGA 3CXCU 4JI4O 4I9WA 2VQEB 3FYIB 2RDCA 4O4LA 2ZE5A 1S77D 1Q7YW 4JI1B 3QG5A 4R7CA 3AG4C 2FYUH 2JK5C 3NXSA 1QLNA 3JD3A 4O4HA 1VQ9V 4MW8A 1QU7A 1GN6A 1SZTA 3SGIA 3E35A 2ITDC 2UUBB 1HNZO 2VS0A 1Q6IA 4B3MO 2HVJC 3I5DA 2QR4A 3ZIAG 1N33O 5FNVB 3J7AU 1XMOB 3AG1B 5L3GA 2YXLA 1JJOA 3H1KH 4DV2O 1URFA 5LHGA 4DO2A 2JJ1G 2ZDIC 1OCRB 1R3KC 4NXMO 4UCRA 5EC2C 5DM6V 1HR0O 2IJJA 3CX5F 4FM1A 3JAWA 1BSMA 3MHHC 5CA1B 1QLEB 3OGIB 1YTFB 3CCQV 1WAZA 5HFLA 4DR7O 4AHCA 1MABG 1GRJA 3SPGA 1RSOB 3ZHUA 2GSMB 1L0LH 3U11A 5B66Z 3CEIA 5BZBA 5BR8O 3M7MX 4YJ3B 3C3SA 2HJFC 3E8GA 4B08A 2XAFA 2B1IA 3NR7A 1MG1A 4CC6A 2RNBA 2EJRA 2DYSC 2L35A 3W7XA 5FLXN 3ABKB 4DV4B 1VEWA 4JZGA 1AVMA 4G27B 3STLC 3F5WC 2LO1A 4CH3A 4JI0B 3IAYA 3N2KA 4U7OA 2HHHB 4O2BB 3M8AA 1P49A 2JIZG 4I55B 4BIZA 4H33A 4ABMA 4TV8A 1PD3A 3OTOO 4MTGA 4TUYA 3WB2A 3APQA 3WB0A 3UM7A 1AJPA 3KCYA 5KMGA 1ZSPA 3JD1A 3ZCCA 1FFTB 2AXTZ 3OEEG 1TVKA 3IC9A 3DTUB 4I0XA 1P7BA 1NTKH 1B04A 4QE7A 2RJZA 3VQWA 1GN2A 2P90A 5KX5A 3ABTA 1L1FA 3SJAC 3H1JH 2WLLB 1YJ9V 2DYSB 3U10A 3RBZA 1FFXA 2HJDA 1I94B 4RQEA 2OTJV 1FJGO 2IJKA 2XOKG 1ZLZA 1K4DC 3APOA 5ITZB 5LMUB 2Q4PA 1DTOA 4DV1B 4B3SB 4OX9B 4CH6A 2JGDB 3LDDA 3RT3C 4I4TA 2ZR3A 3G80A 1Q82W 3L70H 4TOIA 3RYFB 3VBBA 2EULA 1XUQA 3GWOA 1US6A 1WLEA 4IYIA 1VF6C 1Y76A 4JAAA 4G2KA 5JJJB 4FLUA 1HNXO 2HG5C 2QSAA 5EC1C 2GDSA 2QEXV 3VQVA 1PKXA 3CCUV 4NXNO 1IZ3A 5AG2A 2WLJA 1V54B 1K7DA 3R66A 1WNSA 4J9ZB 1YEWA 3RYHB 2QE7G 2VQEO 1GK9A 1NH2D 4N23A 5JH7B 4C7UA 1S0VA 1LUWA 3KG2A 4DR1O 4IHJA 3HB3B 1Q5OA 2EZPA 1F7YA 1Y67A 1E1RG 1M56C 3U0ZA 3SYCA 3RYCA 4LF4B 3AK1A 3JARB 3OE7G 3F5TA 4YXWG 4JI8O 2UUBO 3ASOC 2YEVB 5A2QN 3X2QC 3OUFA 1XQ8A 1G4YB 4CH5A 3W7UA 3OGCC 3TCUA 2ZKOA 5EYPB 1SQVH 2GTAA 3H1HH 1H2MA 1XMOO 5EBWC 1T5EA 2D3OW 2GTSA 1YSCA 2Y4UA 4PA6A 2ARHA 3K79A 5KUMA 1M93A 2N05A 3AG3C 1FD9A 2PTMA 4TQFA 3ZHSA 1W59A 3SYQA 4CBCA 1XMQB 1VQ8V 4MVZA 1N4CA 3CRRA 3WG7C 4IIJB 4JI5B 4WF9V 4GLXA 4EKWA 3W7SA 1JJ2U 4DRXA 5J2UA 2BE3A 1GM9A 2Q0OC 1XL4A 3BABA 3P32A 4FJCC 4PJ0Z 3D36C 2OYQA 3SPIA 2JDIG 5B5EZ 2R9RB 2Q5ZA 4Q20A 4GYCB 5LP6B 2OTLV 2F66C 2LJ2A 5JVDA 5CBFA 2MW2B 2ZNIA 1VF7A 2QWRB 4CH4A 4RO2A 2ATKC 4MVRA 2YS8A 1Q6UA 5B1OA 4LR3A 2RCVA 1KQSU 3CPWU 2W0FC 4X1YB 1XOUA 1E1QG 1W2BU 1DF4A 1N36B 1N33B 1IDSA 1A32A 1QVFU 2CTRA 1Z2GA 1NZ6A 4LF7B 1IURA 4JAVA 4JI0O 3IC7A 2IU0A 3E2EA 1XEQA 4NXMB 1BL8A 5BMVB 2ZNJA 3WG7B 1S5HC 2UUCB 2QM8A 1DLBA 2EIKB 3G6BA 3CCEV 4DR2O 1NBMG 2LFSA 1ZX3A 1SZXA 3ZRVA 2A0LA 4GT1A 2R9AA 4JYAO 4J80A 3F7YC 5IYBO 1EZVH 1PP9H 2GUZA 5J2TA 3CSXA 3CXHF 3T1YB 2E74B 4CS2A 3A0HZ 4FFBB 5IJ0A 2WPDG 1L8DA 2UUAO 5KHHA 2X0LA 4PDVA 4UB6Z 2Q9LA 1WP8A 5IYCO 1NH2B 1P7GA 3G6EV 5C93A 2LGQA 4X88A 2EX3A 2Q0AA 3HKDA 1AI4A 3D8CA 1FXKA 3H1IH 1FYJA 2Q73A 3TETA 1R3LC 1SETA 3K5OA 3FAVA 4ZKIA 4TQDA 1VF5B 1XILA 3ZRWA 1QVGU 2Q7HA 2X7RB 1I94O 3CC4V 3JASA 1P84F 4O4LB 4MW3A 2Y48A 1K8AW 4JTCB 1SF9A 2EIMC 1SC5B 5DEDA 5LMUO 1H38A 1SS3A 2WLIA 4O4HB 4B3SO 2QKCA 4UV9A 4OX9O 4HZ3A 5IY5C 4TSFG 3ABLC 3K9AA 4MTXA 1WA8B 5HFMA 3D3IA 4WCEV 3A0BZ 2DW4A 4ICGA 4CC5A 5L3CA 2WLKA 1W0KG 3CMEV 2QWNB 2F4VO 3PJSK 1ZL8A 1Q43A 4DW1A 4LNUA 4U7NA 4LWSA 4J42A 1GKFA 1AILA 4X8AA 3H9VA 2YIDA 4OGQB 3JAWB 3OTFA 1NJIW 4U3JA 2CGNA 2QTOA 2YI8A 4IGGA 2E5LO 3UQ8A 1YCIA 2Q67A 3CWBH 1OJHA 2KKWA 5LXTA 2KQXA 4ZHQA 4LF4O 3KKYA 5LBQA 5CA3A 1D2DA 3LUTB 3E86A 1FJGB 3K06A 3B09A 5K1XA 5EBLC 5D5PA 2EIMB 3QF7A 3ZMZA 3CP1A 1I5YA 4B3TO 2AHZA 1Y74A 2CE4A 2XASA 2WA4A 4W4KA 5D5QA 3THOA 4RUFA 4BWAA 5IY5B 4FLVA 1YHQV 3ABLB 1J5EO 2QKSA 1LUVA 4NTYA 4GZRB 1D5AA 1B06A 2QM7A 1H2GA 1VQOV 2KG7A 3OM3B 4JI5O 4PV1B 2CTPA 4H0LB 4ZIBA 2QJ1A 2OT5A 4WFFA 2L6LA 4X1IA 5DN6G 1F51A 3N2KB 1NKDA 3SJCC 3STZC 5H6QA 2AHYA 3M99B 3RFRA 2UXXA 4FVMA 4TV8B
chains in the Genus database with same CATH topology
4MS2A 2Z5UA 4MTGA 5L3BA 4JGSA 4FIPC 3OR6C 3JD2A 1JCHA 5CBGA 5KA6A 1YITV 3UM7A 1TUEB 3ZRSA 2ZQMA 1AJPA 4KFMA 1P4RA 4RUEA 3JYCA 2B1GA 1UJWB 2LFRA 1PNLA 1JPXA 3LNMB 3ZJZA 2YSUB 3JD1A 3ZCCA 1FFTB 3CCSV 1SESA 2A9HA 3OEEG 3CC2V 2V7QG 3DTUB 3OR7C 1PNMA 2EIKC 3B8NA 1P7BA 4GCZA 4GX5A 4QE7A 1JQ0A 1AI6A 2B5UA 4UVCA 2P90A 3ZMUA 3FB8C 1B6QA 3ABTA 3FB7C 2C2AA 5LHHA 3OW2U 2WLLA 1L1FA 1IXMA 1VQPV 5LGNA 2WLLB 2DWDC 3K03A 2KB1A 1YJ9V 2DYSB 4JASA 1CP9A 1XL6A 2IW5A 3RBZA 4HAMA 4MSWC 1FXVA 1OCOB 5KA5A 4WFBV 3ABMC 1KC8W 1M9NA 3SJQC 4BAYA 4RQEA 1KECA 1F4NA 2OTJV 2X6AA 3ZMVA 3P30A 2IJKA 1OCZC 2XOKG 2JJ2G 5H6RA 1K4DC 1V55B 3CCMV 1VQKV 2HFEC 1DTOA 1YTFD 1AI5A 1PNKA 3SPJA 3LDDA 1R73A 1K4CC 2WSSG 4XDLA 3ABUA 3EFFK 2X6CA 2ZR3A 3LSSA 3R65A 4R50A 4TT3G 4QNHB 5EBMC 1JX9A 4QJFB 1Q82W 4P9OA 1R3JC 3VBBA 2IH3C 4JPRA 1GMGA 2Z3YA 5LGTA 5B3SC 1COWG 3GWOA 1WLEA 2BOCC 5LGUA 4G2KA 1AJNA 3AG4B 4N21A 2HG5C 2Y69B 3ZN1A 2JEUA 2EBOA 1RPRA 2MK3A 3DGEA 4JYBA 3E8BA 4LP8A 5EC1C 1OHHG 3BY6A 2QEXV 2PI5A 2WLHA 1PKXA 4R8CA 3AEIA 3CCUV 3ML0A 1CPYA 2WLJA 1V54B 1K7DA 3A0RA 2LP7A 2H94A 1DF5A 3JD0A 3TK1A 1PL0A 1S72V 4H37A 3MHSC 4I5SA 4J9ZB 3ZRXA 1Y4MA 2P7TC 2QE7G 1GK9A 1NH2D 4N23A 1GO3F 3ZMTA 1S0VA 2V1DA 3GB7C 3KG2A 2IH1C 3HB3B 2EZPA 4WFAV 1K3EA 3B8MA 1E1RG 3FKSG 3OAAG 2DYRB 4JAUA 5FL7G 1M56C 1QR8A 3SYCA 3MD0A 3ABMB 2IU3A 3OE7G 2YEVA 3H01A 4UVAA 3T2MA 4YXWG 3OUSA 3ASOC 2YEVB 3QO7A 2X6BA 3G4SV 3X2QC 3ZN0A 5EK0A 2FTKA 1OCZB 3OUFA 3VOUA 3W7UA 1G4YB 5CMUA 1VQMV 1FS0G 3OGCC 3TCUA 2K1EA 1QLEC 1Y66A 4P9PA 2JEXA 5EBWC 2HR3A 2D3OW 1FXHA 5IYDO 1YSCA 4PA6A 4E2LA 2DQ3A 3CMAV 3K79A 5KUMA 3AG3C 4UXNA 2R9IA 3IGAC 3LDCA 4MVOA 3SYQA 4CBCA 5L3EA 4FK5C 2OCCC 3I55V 1VQ8V 1CEZA 4MVZA 4RAIA 3G71V 1OCCC 2BOBC 4QPJA 1M90W 5B3SB 3ASNC 1SRYA 1AROP 1R6NA 3WG7C 4BW5A 4WF9V 1JVMA 3QO8A 1ZWIC 1M57C 2EINC 1NQTA 3LDEA 4EKWA 3K04A 3W7SA 4DXWA 1JJ2U 5CN0A 1VQ6V 2WAMA 3K08A 1G8MA 1OZ0A 2UXNA 4MVMA 4XBFA 1NR1A 3ETEA 1THZA 2Q68A 1GM9A 4UV8A 3CC7V 1XL4A 3P32A 4FJCC 1WPXA 5B1NA 2M7WA 1I5XA 3ZMSA 2ZXWC 4XDJA 2EIJC 3SPIA 2PI4A 2JDIG 3ABKC 3FB6C 4JYCA 2R9RB 4Q20A 2P67A 1VQ4V 2OTLV 4PDLA 3FYEB 1MSWD 5CBFA 4JTDB 5KUKA 3E89A 4RO2A 1NVPD 3IFXA 2ATKC 3RVYA 2XAQA 4MVRA 5B1OA 1KD1W 1QBZA 1VQ7V 4PA4A 3E8HA 4QPKA 4ZBMA 1KQSU 1FXKC 2NLJC 3FB5C 3CPWU 2W0FC 2H8PC 1E1QG 1W2BU 4LBEC 3K0GA 4L87A 2NNUA 1DF4A 5LHIA 1QVFU 3RW0A 3JCZA 1BMFG 4MVQA 1QCEA 3BEHA 2GHYA 4JAVA 2W6IG 2ZD9A 1K34A 2HLDG 3IC7A 2IU0A 2OCCB 1RM1C 1ORQC 1OCCB 3E2EA 1BL8A 3ASNB 3SYOA 5IDJA 4PA7A 2DWEC 3WG7B 1S5HC 3EHBB 2QM8A 1DLBA 2EIKB 3CCEV 1M57B 4UVBA 4R6ZA 1NBMG 2EINB 2LFSA 3ZRVA 1YJNV 1K9MW 2A0LA 4GT1A 3B77A 1F4MA 1AI7A 2XNDG 3F7YC 5IYBO 2P6JA 3ETGA 1VQLV 3CCRV 1R3IC 4J9YB 2Q6AA 1K73W 3ETDA 4WFHA 2WPDG 3AG1C 4P2ZA 5L3DA 1SERA 4FPPA 3D36A 1E79G 2ZXWB 4QIWF 2X0LA 3UKMA 1YJWV 4PDVA 1YI2V 4ASUG 1K33A 5IYCO 3K3WA 1NH2B 1OCRC 1K97A 1BHAA 2XAHA 1W0JG 3G6EV 3CCLV 5C93A 1AR1B 1H8HG 4MVSA 4X88A 3QNEA 5B1AC 1EFRG 3RVZA 3W7TA 2IJIA 1ROPA 2CK3G 4HYOA 1H8EG 1RPOA 4CZZA 4G28B 4PA9A 4PA3A 1AI4A 1VQNV 3OEHG 4JF3A 1FXKA 3T4DA 4GX1A 1FXKB 2ZR2A 1KP3A 1MOFA 1K92A 3TETA 1R3LC 1SETA 2XAJA 2XAGA 4ZKIA 1Q86W 4GX2A 3CXCU 2WLNA 4I9WA 3ZRWA 3I56V 1QVGU 1Q81W 3ZRWB 2X7RB 4GX0A 3CC4V 1S76D 1S3JA 3FYIB 5B1BC 1GTOA 1KKDA 1S77D 4MW3A 1RM1B 4KUMA 2Y48A 1Q7YW 1N8RW 4R7CA 1K8AW 4JTCB 3AG4C 3K0DA 2EIMC 2JK5C 3NXSA 1QLNA 2Y69C 1H38A 3JD3A 2WLIA 1VQ9V 4MW8A 2WLIB 4UV9A 1ENVA 1SZTA 3E35A 4HZ3A 2ITDC 5IY5C 4TSFG 3ABLC 3K9AA 1V54C 1HWYA 4MTXA 1R6KA 5HFMA 2HVJC 3D3IA 4WCEV 2DW4A 1GM7A 5L3FA 3ZIAG 4PDRA 3SPCA 5L3CA 4OXSA 3W7WA 3AG1B 5L3GA 2WLKA 1W0KG 3CMEV 4UUJC 1EZJA 3CCJV 5LHGA 2DQ0A 4DO2A 1M56B 3CYOA 3PJSK 2EILC 2JJ1G 1GM8A 1OCRB 1R3KC 2F43G 2ZDIC 4LCUC 3T1CA 3AG2C 3ASOB 2DYRC 4U7NA 3X2QB 1GKFA 5EC2C 2WLMA 1LNQA 2HVKC 4X8AA 5B1AB 5DM6V 2IJJA 1K5QA 4WFEA 3OMNB 5GW7A 1J95A 3LSQA 3MHHC 5H9CA 1QLEB 2EZOA 1NVPB 2W6JG 1YTFB 3CCQV 5HFLA 3OFNG 3E83A 1NJIW 4X89A 3E8FA 3AG3B 2QTOA 2IJHA 4LC1A 3CD6V 1MABG 2QA4V 2Q67A 3SPGA 4WFGA 3OMAB 4F4LA 5J9PC 4XDKA 3T4ZA 2GSMB 4QE9A 5E1AC 5LBQA 4PELA 5B1BB 5CA3A 4RQFA 3SYPA 5BZBA 3LUTB 3E86A 3K06A 4MTOA 4BIUA 5EBLC 4FMTA 2EIMB 4MVUA 1NR7A 3ZMZA 3CP1A 1K5SA 4MT8A 4MTFA 2HJFC 1I5YA 4KP4A 3E8GA 2AHZA 2XASA 3HPLC 2XAFA 1QR9A 4RUFA 5IY5B 1YHQV 3F7VC 4Z1MG 2B1IA 3ABLB 5CBHA 1VQ5V 1F23A 1BHBA 2A79B 2WWWA 3JD4A 1MG1A 2EIJB 4JTAB 2QKSA 2EJRA 1KP2A 2DYSC 3W7XA 3OMIB 3ABKB 1JOYA 2QM7A 1H2GA 4G27B 1VQOV 1EBOA 3STLC 1OCOC 3F5WC 2Q69A 3OM3B 3CCVV 2OT5A 4WFFA 3WFVA 5DN6G 1F51A 4U7OA 2ITCC 2EILB 2ZDIA 2JIZG 1NKDA 3SYAA 1M1KW 3STZC 1V55C 5H6QA 3AG2B 2AHYA 1YIJV 4PDMA 4TWKA 3QO5A 4BIZA 2HKOA 3M99B 4H33A 3SPHA 2UXXA 1AJQA 1PD3A 4P30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS C;  1EBO A;  3B8N A;  1DF4 A;  3GWO A;  4JGS A;  5CMU A;  2X7R B;  3MHH C;  1Y4M A;  3B77 A;  4FIP C;  5H9C A;  1JQ0 A;  2EZO A;  3P30 A;  2P6J A;  4G2K A;  5KA6 A;  2OT5 A;  4N23 A;  3WFV A;  5HFL A;  3CP1 A;  5CN0 A;  4N21 A;  1Y66 A;  1I5Y A;  1QCE A;  2EBO A;  2MK3 A;  4E2L A;  1K34 A;  2EZP A;  3CYO A;  4JF3 A;  1QR9 A;  3B8M A;  1QBZ A;  1F23 A;  1ENV A;  1SZT A;  1QR8 A;  1JPX A;  4FJC C;  1MG1 A;  2M7W A;  4FK5 C;  1MOF A;  5KA5 A;  1I5X A;  1K33 A;  3M99 B;  3K9A A;  2LP7 A;  3H01 A;  1DF5 A;  1DLB A;  5HFM A;  4JPR A; 
#chains in the Genus database with same CATH topology
 2Z5U A;  4DUY B;  4JGS A;  4FIP C;  3RYI A;  2XTA A;  4TUY B;  1N0N A;  2G38 A;  1MSD A;  4DR1 B;  3ZRS A;  2ZQM A;  3CJH A;  4KFM A;  4NTX A;  1O9H A;  2LFR A;  3LNM B;  2YSU B;  5GTI Z;  4D6T H;  4JI8 B;  2V7Q G;  3L9D A;  2PF4 E;  3OT7 A;  2PY5 A;  1PNM A;  3HKC A;  4I0X B;  4J11 A;  4GX5 A;  1JQ0 A;  1N36 O;  3ZMU A;  1DK1 A;  1B6Q A;  3FB7 C;  5KX5 B;  1KB9 F;  2C2A A;  4F6E A;  5LHH A;  2ILM A;  1IXM A;  1VQP V;  5LGN A;  4LF7 O;  3UO2 A;  3K03 A;  2KB1 A;  1CP9 A;  4HAM A;  1FXV A;  4NR1 A;  1WPB A;  4WFB V;  1FFX B;  2PYJ A;  3ABM C;  2UUC O;  1KC8 W;  3BA8 A;  3SJQ C;  1SQG A;  1KEC A;  1F4N A;  4I7Z B;  3ZMV A;  1OCZ C;  2RMK B;  2XT9 A;  3HKB A;  5EIB D;  3CCM V;  3JAL A;  4X62 B;  1EN4 A;  3L71 H;  3T1Y O;  3SPJ A;  1R73 A;  1BS3 A;  2ZE7 A;  4I9Q A;  3ABU A;  2YUA A;  4I4T B;  4QJF B;  4J41 A;  4P9O A;  4TV9 A;  5GON A;  2IH3 C;  4JPR A;  1COW G;  3H1L H;  4DV5 B;  3AG4 B;  1Y76 B;  2VQF B;  1XDC A;  4N21 A;  4RWU A;  4JI3 O;  4AQY B;  1SKV A;  2MK3 A;  1RPR A;  4JYB A;  3E8B A;  4X66 O;  3BY6 A;  3AEI A;  5KHK A;  2QGN A;  1CPY A;  2YXY A;  1X59 A;  2NN4 A;  5LYJ A;  1R1B A;  4I5S A;  4YIO A;  1YZB A;  4JI7 O;  4D7T A;  5FPO A;  3GB7 C;  1G6U A;  1PL4 A;  4NKG B;  1FKA O;  4IHJ B;  4WFA V;  1K3E A;  4JI2 B;  1H2N A;  3J81 N;  1B3Q A;  1YXB A;  3ABM B;  2IU3 A;  3RYC B;  4DR2 B;  4WBN A;  2FTK A;  1OCZ B;  1BQ0 A;  4AIL C;  4JYA B;  5CMU A;  1TUB A;  1FS0 G;  2F1M A;  5EIB C;  3UO3 A;  5F2V O;  5IJ9 A;  5IYZ A;  1VQM V;  2JEX A;  3C90 A;  4E2L A;  4FLW A;  4GKJ O;  2UUA B;  4K8X A;  2OCC C;  3MDS A;  4RAI A;  3G71 V;  2BOB C;  3A2F A;  2ZCE A;  2IM9 A;  3GVM A;  1SRY A;  5JJE B;  3K5N A;  1ARO P;  1R6N A;  4BW5 A;  2LW7 A;  1M57 C;  1XBL A;  3LDE A;  1VQ6 V;  3K04 A;  1MZF A;  2JS3 A;  1OZ0 A;  4DRX B;  5J2U B;  1IVS A;  3ETE A;  1THZ A;  1WN7 A;  5B1N A;  2K9P A;  4HNA A;  1I5X A;  2F93 B;  2EIJ C;  1VIB A;  4KXR A;  2PI4 A;  4LFC O;  4PDL A;  3FYE B;  5CA0 A;  3BHP A;  3CRC A;  4JI6 B;  4B7E A;  5KAI Z;  5JVD B;  5KUK A;  4I50 A;  4YJ2 A;  3IFX A;  1KD1 W;  2YIA A;  1QBZ A;  3E8H A;  4QPK A;  4ZBM A;  1JA8 A;  2O57 A;  1FXK C;  5BY1 A;  4DV3 B;  3TJT A;  1EN6 A;  1IBL B;  3JCZ A;  1BMF G;  2VWK A;  2Y0P A;  1JFF A;  3BEH A;  2GHY A;  2QKA A;  4K8Z A;  2ZD9 A;  1K34 A;  2F4V B;  2OCC B;  3AG7 A;  5KLV H;  1BQZ A;  1WP7 A;  3EHB B;  3EXA A;  1M57 B;  1MMM A;  3MAQ A;  4YJ3 A;  4DV7 B;  3B77 A;  4DUY O;  2XND G;  2P6J A;  2OWO A;  1VQL V;  1QQC A;  2GUZ B;  5J2T B;  3CCR V;  1ZTE A;  4AI8 A;  5CB4 A;  2E5L B;  3ETD A;  4WFH A;  4P2Z A;  5L3D A;  1SA0 A;  5IJ0 B;  4FPP A;  4QIW F;  1YVW A;  3CS5 A;  4ASU G;  1MZE A;  2Q8V A;  3K3W A;  3S3X A;  1K97 A;  1KU9 A;  3PN1 A;  3N2G A;  1AR1 B;  2OIG A;  4MVS A;  1JMK C;  4J10 A;  3QNE A;  5B1A C;  3W7T A;  4B3T B;  4HYO A;  1RPO A;  4PA9 A;  5JJN B;  1VQN V;  3T4D A;  2GBO A;  2H3O A;  1FXK B;  1J5E B;  2ZR2 A;  2JGU A;  3G67 A;  1K92 A;  1BZK A;  1I0H A;  5BXZ A;  4DR5 O;  4GX2 A;  1Q86 W;  3E22 A;  3FAV B;  2UXD O;  1NI8 A;  2WLN A;  3I56 V;  2QWP B;  1Q81 W;  3ZRW B;  4GX0 A;  4A5U B;  1GTO A;  1ZUQ A;  1Q8I A;  1SQQ H;  4KUM A;  1N8R W;  1X4T A;  2Y69 C;  5TIS Z;  2WLI B;  4X62 O;  1NU1 H;  1ENV A;  3HKE B;  1S5L Z;  4DW0 A;  1IBK O;  2UU9 B;  1GM7 A;  5LOV A;  1XNR O;  5A9G A;  5L3F A;  3C3T A;  4L8J A;  2Q7G A;  3Q4H A;  4DV0 O;  4OXS A;  4DV5 O;  2R70 A;  3BFR A;  2VQF O;  4UUJ C;  2HEP A;  3CCJ V;  2DQ0 A;  4AQY O;  1M56 B;  3CYO A;  2EIL C;  1GM8 A;  1ZL8 B;  4LCU C;  2QM4 A;  3AG2 C;  3ASO B;  2DYR C;  4LNU B;  5KHI A;  3X2Q B;  1D5N A;  1LNQ A;  1L0N H;  4LWS B;  2HVK C;  5B1A B;  1K5Q A;  4LF9 B;  4WFE A;  1GN4 A;  3LSQ A;  2EZO A;  4F6R A;  3CRA A;  3E83 A;  4IYH A;  3AG3 B;  5JQG A;  4LC1 A;  3CD6 V;  2QA4 V;  2OCH A;  4WFG A;  2DOS A;  1VAR A;  4KL1 A;  4F4L A;  4JI2 O;  4QE9 A;  5LXT B;  5E1A C;  2AZ0 A;  4ZHQ B;  4PEL A;  3FFQ A;  4MTO A;  4FM2 A;  4MTF A;  4KP4 A;  2YIB A;  4Q6G A;  4O4I B;  2CH7 A;  1Q6H A;  1Y74 B;  5CBH A;  2A79 B;  3JD4 A;  3AK2 A;  1KP2 A;  3OMI B;  1Y6X A;  1JOY A;  1XHZ A;  3RYH A;  4ZI7 A;  1OCO C;  2D2C B;  2Q69 A;  2UXB B;  2KG7 B;  3WFV A;  4JI3 B;  1Z5V A;  4K0K B;  2BTQ A;  4X1I B;  2ITC C;  4X66 B;  2EIL B;  3SYA A;  4X9Q A;  3AG2 B;  1Q3E A;  1YIJ V;  4LF5 B;  3JAR A;  1KKC A;  1GH6 A;  3B4S A;  2LW1 A;  3QO5 A;  3QTC A;  1IBM B;  2CDY A;  1N32 B;  4DR3 B;  4PI2 A;  4P30 A;  5L3B A;  4JI7 B;  3OR6 C;  3RYI B;  1JCH A;  4FLZ A;  2PUS A;  1YIT V;  3P3N A;  4X1K A;  4U3F H;  4Z1V A;  1TUE B;  4X20 A;  4JI6 O;  3J80 N;  1P4R A;  3JYC A;  3CJH B;  3N27 A;  1UJW B;  1PNL A;  1TAE A;  3ZJZ A;  1M4U A;  1TGO A;  2R72 A;  1PV0 A;  3K59 A;  4LFB B;  2A9H A;  5FPR A;  1XNQ O;  4DV3 O;  4GCZ A;  3HKC B;  4BW9 A;  2B5U A;  5IWA B;  1IBL O;  1DGS A;  3JAT A;  3WU2 Z;  3OW2 U;  4GKJ B;  2A7W A;  2P06 A;  3ZED A;  4JAS A;  4DR4 O;  4LFA B;  2LGW A;  1XL6 A;  4MSW C;  1OCO B;  3CB2 A;  4YIP A;  5LP6 A;  4ZOL A;  3A8T A;  2YIC A;  4X65 B;  1MA1 A;  2X6A A;  5JCO A;  3P30 A;  2BTO A;  3RGB A;  4DV7 O;  4EB6 A;  4OPA A;  5LA6 A;  1FAF A;  3HKB B;  1MNG A;  2HFE C;  3T1H B;  3JAL B;  1YTF D;  1AI5 A;  1PNK A;  2BCC H;  2QWQ B;  1UPG A;  1K4C C;  4XDL A;  3R65 A;  4TT3 G;  1JX9 A;  4TV9 B;  1GMG A;  2Z3Y A;  5GON B;  4LFC B;  5LGT A;  5B3S C;  1XHX A;  2BOC C;  4IL6 Z;  5LGU A;  3RN4 A;  2JS5 A;  1V9P A;  2JEU A;  4LP8 A;  3DGE A;  2ZIN A;  1OHH G;  2WLH A;  4R8C A;  3KCX A;  2F95 B;  1PM9 A;  1VMG A;  1DF5 A;  3JD0 A;  1S72 V;  3MHS C;  1SQF A;  1KYO F;  1GO3 F;  3SDL A;  2VWJ A;  2V1D A;  1BGY H;  1HW7 A;  3FX7 A;  4LF6 O;  3B8M A;  3FKS G;  5FL7 G;  2BSK A;  3MD0 A;  4O2A A;  3BRC A;  1I7F A;  2E75 B;  3T2M A;  1S5J A;  4WBN B;  5EK0 A;  2F23 A;  3CRQ A;  2UU9 O;  3DC5 A;  5H2F Z;  1U97 A;  5IT9 N;  1TUB B;  5IJ9 B;  5IYZ B;  4YHH O;  1QLE C;  1Y66 A;  2HR3 A;  5EZY A;  1FXH A;  3K5M A;  3L72 H;  4UXN A;  2R9I A;  3IGA C;  3LDC A;  5L3E A;  1CEZ A;  5KMG B;  2ZIM A;  1RFY A;  2A06 H;  5B3S B;  1HNW B;  4O4J A;  2V4D A;  4FLT A;  1JVM A;  1TVK B;  3KZI Z;  2JVD A;  1ZWI C;  4LF9 O;  4PHZ A;  4B3R B;  4DXW A;  5CN0 A;  1R6T A;  2WAM A;  3K08 A;  1G8M A;  2UXN A;  1NR1 A;  3VQY A;  2Q68 A;  4UV8 A;  4DUZ O;  2M7W A;  1WA8 A;  4HNA B;  2ZXW C;  4XDJ A;  4DR5 B;  5C8Y A;  2UXD B;  2DE0 X;  1EN5 A;  2ETN A;  3TGU H;  3ABK C;  4B7K A;  3FB6 C;  2P4K A;  1MSW D;  5CA0 B;  1NVP D;  1SQX H;  1KMI Z;  4I50 B;  3RVY A;  3JAK A;  4YJ2 B;  3P3P A;  1VQ7 V;  1Z5W A;  4NB5 A;  2UXC O;  3FB5 C;  1IBK B;  5LMN B;  2H8P C;  3ZHQ A;  2P22 C;  4UCT A;  1KBH A;  3K0G A;  4L87 A;  1XNR B;  2NNU A;  4LF8 O;  3RW0 A;  4DV0 B;  2UXB O;  4MVQ A;  1QCE A;  1JFF B;  2HLD G;  2RN9 A;  4K0K O;  1RM1 C;  1ORQ C;  3SYO A;  5IDJ A;  2DWE C;  2YIB D;  1AB3 A;  4LF5 O;  2Z0A A;  1IBM O;  2ADP A;  3BAA A;  4UVB A;  1N32 O;  4DR3 O;  4LH7 A;  4CS3 A;  4EFE A;  1AI7 A;  3ETG A;  2AZ2 A;  4J9Y B;  1G1X B;  5CB4 B;  3GWK C;  1SER A;  1E79 G;  1SA0 B;  2ZXW B;  1BHA A;  2XAH A;  1W0J G;  3CCL V;  4LFB O;  4JYY A;  1N0J A;  1H8H G;  3N2G B;  3DXR A;  1GAX A;  3O65 A;  3RVZ A;  2AW9 A;  1AR5 A;  3UT5 A;  2P4V A;  2IJI A;  4G28 B;  2Y0I A;  5IWA O;  2Y4T A;  3OEH G;  4GX1 A;  1KP3 A;  1OV9 A;  2XHB A;  3JSN A;  3CRM A;  3LNN A;  4LFA O;  4W4L A;  2XUM A;  3E22 B;  3ETQ A;  3UCS C;  1WB8 A;  1ZAU A;  3LSU A;  1WJZ A;  1S76 D;  1S3J A;  5B1B C;  4FZ0 A;  1IXB A;  1KKD A;  2DMX A;  4X65 O;  1RM1 B;  3K0D A;  1QHT A;  3ICX A;  3T1H O;  3BPZ A;  2B9Z A;  2NR5 A;  4UFZ A;  3JAM N;  2QTS A;  2CTQ A;  4J7Z A;  1V54 C;  1HWY A;  1R6K A;  2CTW A;  2CAZ C;  4EEQ A;  4GKK B;  4FLY A;  1JR9 A;  4X64 B;  1PPJ H;  1AP5 A;  5FNV A;  5LOV B;  4PDR A;  3DC6 A;  3SPC A;  4DR6 B;  3Q4H B;  3W7W A;  4UCS A;  1EZJ A;  2IBZ H;  2ZM6 O;  3ZHR A;  3QVN A;  2F43 G;  2GV9 A;  3T1C A;  4FZ1 A;  2WLM A;  4UB8 Z;  1XNQ B;  4DYL A;  3OMN B;  4LH6 A;  5CA1 A;  5GW7 A;  1J95 A;  1NVP B;  5H9C A;  2W6J G;  1NS1 A;  3OFN G;  2Q7E A;  5GTH Z;  4F6R B;  4X89 A;  3WB1 A;  3E8F A;  1VP7 A;  2IJH A;  4JZ2 A;  5JQG B;  5KHJ A;  1RSO A;  4DR4 B;  3OMA B;  1CXZ B;  5J9P C;  3S3W A;  4XDK A;  3T4Z A;  2PZS A;  2HP8 A;  5B1B B;  4RQF A;  3SYP A;  3B40 A;  5K1P A;  1GN3 A;  4BIU A;  4FMT A;  4MVU A;  1AP6 A;  1NR7 A;  1K5S A;  4JV5 B;  4MT8 A;  2QWO B;  3K58 A;  4H13 B;  3HPL C;  2YXH A;  1QR9 A;  2CH7 B;  3F7V C;  4Z1M G;  1VQ5 V;  1F23 A;  1BHB A;  2WWW A;  2EIJ B;  4JTA B;  3FD9 A;  2WA3 A;  2N04 A;  4Z2W A;  1HNW O;  1EBO A;  1N34 B;  4BIO A;  4ZI7 B;  3CCV V;  1AR4 A;  1NTM H;  4KHP B;  2M6Y A;  2KSD A;  4DV6 B;  5LP6 C;  4O2B A;  3SJB C;  4B3R O;  2BTQ B;  4JI1 O;  2ZDI A;  2ZIO A;  3HKD B;  5JCO C;  1M1K W;  1H2K A;  1V55 C;  4I55 A;  4PDM A;  2E3C A;  1LR1 A;  4TWK A;  4IT5 A;  2HKO A;  3SPH A;  1AJQ A;  4MS2 A;  5DEC A;  4UCO A;  4YY3 B;  5CBG A;  3JD2 A;  5KA6 A;  3JAS B;  2JRI A;  2PYL A;  4LF6 B;  4X1K B;  4X20 B;  4RUE A;  2B1G A;  1JPX A;  2DN9 A;  3CCS V;  1SES A;  3ZHT A;  3CC2 V;  1IX9 A;  3OR7 C;  1M5I A;  5LMN O;  2EIK C;  2FML A;  3B8N A;  3RWR D;  1QNM A;  1AI6 A;  4YHH B;  4UVC A;  3FB8 C;  3JAT B;  2WLL A;  3BVO A;  2DWD C;  4FM0 A;  1XRE A;  2IW5 A;  4OPH A;  2ZT9 B;  1H2S B;  4JI4 B;  1EM1 A;  4GUN A;  1HP8 A;  5KA5 A;  1M9N A;  3L74 H;  4CS4 A;  4BAY A;  4ZOL B;  2A3Q A;  2W0X A;  2JJ2 G;  5H6R A;  5ITZ A;  1V55 B;  4EB6 B;  3SR2 C;  5LA6 B;  1VQK V;  4U3J B;  3EVK A;  2JGD A;  1BE3 H;  4DUZ B;  2WSS G;  1HNZ B;  3EFF K;  2X6C A;  3CE2 A;  3LSS A;  4R50 A;  4QNH B;  5KHG A;  5EBM C;  4B3M B;  3RYF A;  1R3J C;  4DV4 O;  2CUG A;  3K57 A;  4DV2 B;  1AJN A;  2YI9 A;  2Y69 B;  2YC0 A;  3ZN1 A;  2EBO A;  2EJ7 A;  1I08 A;  2HHH O;  4PI0 A;  2PI5 A;  3ML0 A;  2UXC B;  3OD4 A;  4BR6 A;  3A0R A;  1HR0 B;  1H2L A;  2LP7 A;  2H94 A;  3TK1 A;  1PL0 A;  4LF8 B;  1SQB H;  4H37 A;  2QDO A;  3ZRX A;  1Y4M A;  1RP3 B;  2P7T C;  5JH7 A;  3ZS8 C;  4UCV A;  4DR7 B;  3ZMT A;  2IH1 C;  1TA8 A;  3OAA G;  2DYR B;  4JAU A;  1QR8 A;  2BSK B;  4DK0 A;  4O2A B;  1UFI A;  1Q90 D;  4PD4 F;  2YEV A;  3H01 A;  4UVA A;  3OUS A;  3QO7 A;  2X6B A;  5BR8 B;  3G4S V;  3ZN0 A;  3VOU A;  4GKK O;  5IE9 A;  1NT2 B;  1HDJ A;  4X64 O;  5EYP A;  2K1E A;  4P9P A;  4DR6 O;  2VRZ A;  3TXQ A;  5IYD O;  3CMA V;  4DK1 A;  2DQ3 A;  5EZY B;  3L73 H;  2E76 B;  3DSQ A;  4MVO A;  1BT8 A;  4FK5 C;  3I55 V;  2YDE A;  1OCC C;  1M90 W;  4QPJ A;  1FPO A;  3ASN C;  4UCU A;  1VF6 A;  4IIJ A;  4O4J B;  3QO8 A;  2ZE6 A;  2EIN C;  1NQT A;  4K3A A;  3BA9 A;  2OIE A;  4MVM A;  4XBF A;  4DV1 O;  3HKE A;  5H5N A;  3CC7 V;  1WPX A;  3AK3 A;  3L75 H;  5E79 Z;  3ZMS A;  1O9G A;  2FKX A;  1U96 A;  2AGA A;  3B2E E;  4HBN A;  3OTO B;  5C8Y B;  1YDX A;  4JYC A;  2P67 A;  1VQ4 V;  4JTD B;  3CHX A;  4D7S A;  3E89 A;  4FLX A;  4JV5 O;  4QGP A;  1SQP H;  2XAQ A;  1KUQ A;  2ADQ B;  3JAK B;  2LQT A;  4PA4 A;  4K35 A;  4X1Y A;  2N74 A;  2NLJ C;  3JSL A;  4LBE C;  1WB7 A;  5LHI A;  1N34 O;  3HR0 A;  4E4E A;  3K5L A;  2ZE8 A;  4KHP O;  4H44 B;  4J7J A;  2W6I G;  4DV6 O;  2P5O A;  2ZM6 B;  5BMV A;  1OCC B;  3D3Q A;  3ASN B;  4PA7 A;  5KAF Z;  3JCU Z;  3VQX A;  4R6Z A;  2PGG A;  2EIN B;  2FB5 A;  1YJN V;  4NYK A;  1K9M W;  5LYJ B;  1F4M A;  4YY3 O;  1NTZ H;  1R3I C;  3IJ4 A;  5LL6 Y;  2Q6A A;  1K73 W;  4O4I A;  3BCC H;  4FFB A;  3AG1 C;  2DJV A;  3D36 A;  4NVP A;  3UKM A;  5JWP A;  1XMQ O;  1YJW V;  1YI2 V;  3ZX6 A;  1K33 A;  1OCR C;  4EFB A;  1BCC H;  1XI1 A;  3DXR B;  2FL4 A;  4FFK A;  1EFR G;  3O9O A;  4NTW A;  1HNX B;  2ODM A;  1YF2 A;  1ROP A;  2CK3 G;  3UT5 B;  1H8E G;  4CZZ A;  2CGO A;  4PA3 A;  4NXN B;  4JF3 A;  4J7K A;  3K9S A;  2RQ6 A;  1MOF A;  3TXS A;  3ZBH A;  2XAJ A;  3ZHV A;  2XAG A;  3CXC U;  4JI4 O;  4I9W A;  2VQE B;  3FYI B;  2RDC A;  4O4L A;  2ZE5 A;  1S77 D;  1Q7Y W;  4JI1 B;  3QG5 A;  4R7C A;  3AG4 C;  2FYU H;  2JK5 C;  3NXS A;  1QLN A;  3JD3 A;  4O4H A;  1VQ9 V;  4MW8 A;  1QU7 A;  1GN6 A;  1SZT A;  3SGI A;  3E35 A;  2ITD C;  2UUB B;  1HNZ O;  2VS0 A;  1Q6I A;  4B3M O;  2HVJ C;  3I5D A;  2QR4 A;  3ZIA G;  1N33 O;  5FNV B;  3J7A U;  1XMO B;  3AG1 B;  5L3G A;  2YXL A;  1JJO A;  3H1K H;  4DV2 O;  1URF A;  5LHG A;  4DO2 A;  2JJ1 G;  2ZDI C;  1OCR B;  1R3K C;  4NXM O;  4UCR A;  5EC2 C;  5DM6 V;  1HR0 O;  2IJJ A;  3CX5 F;  4FM1 A;  3JAW A;  1BSM A;  3MHH C;  5CA1 B;  1QLE B;  3OGI B;  1YTF B;  3CCQ V;  1WAZ A;  5HFL A;  4DR7 O;  4AHC A;  1MAB G;  1GRJ A;  3SPG A;  1RSO B;  3ZHU A;  2GSM B;  1L0L H;  3U11 A;  5B66 Z;  3CEI A;  5BZB A;  5BR8 O;  3M7M X;  4YJ3 B;  3C3S A;  2HJF C;  3E8G A;  4B08 A;  2XAF A;  2B1I A;  3NR7 A;  1MG1 A;  4CC6 A;  2RNB A;  2EJR A;  2DYS C;  2L35 A;  3W7X A;  5FLX N;  3ABK B;  4DV4 B;  1VEW A;  4JZG A;  1AVM A;  4G27 B;  3STL C;  3F5W C;  2LO1 A;  4CH3 A;  4JI0 B;  3IAY A;  3N2K A;  4U7O A;  2HHH B;  4O2B B;  3M8A A;  1P49 A;  2JIZ G;  4I55 B;  4BIZ A;  4H33 A;  4ABM A;  4TV8 A;  1PD3 A;  3OTO O;  4MTG A;  4TUY A;  3WB2 A;  3APQ A;  3WB0 A;  3UM7 A;  1AJP A;  3KCY A;  5KMG A;  1ZSP A;  3JD1 A;  3ZCC A;  1FFT B;  2AXT Z;  3OEE G;  1TVK A;  3IC9 A;  3DTU B;  4I0X A;  1P7B A;  1NTK H;  1B04 A;  4QE7 A;  2RJZ A;  3VQW A;  1GN2 A;  2P90 A;  5KX5 A;  3ABT A;  1L1F A;  3SJA C;  3H1J H;  2WLL B;  1YJ9 V;  2DYS B;  3U10 A;  3RBZ A;  1FFX A;  2HJD A;  1I94 B;  4RQE A;  2OTJ V;  1FJG O;  2IJK A;  2XOK G;  1ZLZ A;  1K4D C;  3APO A;  5ITZ B;  5LMU B;  2Q4P A;  1DTO A;  4DV1 B;  4B3S B;  4OX9 B;  4CH6 A;  2JGD B;  3LDD A;  3RT3 C;  4I4T A;  2ZR3 A;  3G80 A;  1Q82 W;  3L70 H;  4TOI A;  3RYF B;  3VBB A;  2EUL A;  1XUQ A;  3GWO A;  1US6 A;  1WLE A;  4IYI A;  1VF6 C;  1Y76 A;  4JAA A;  4G2K A;  5JJJ B;  4FLU A;  1HNX O;  2HG5 C;  2QSA A;  5EC1 C;  2GDS A;  2QEX V;  3VQV A;  1PKX A;  3CCU V;  4NXN O;  1IZ3 A;  5AG2 A;  2WLJ A;  1V54 B;  1K7D A;  3R66 A;  1WNS A;  4J9Z B;  1YEW A;  3RYH B;  2QE7 G;  2VQE O;  1GK9 A;  1NH2 D;  4N23 A;  5JH7 B;  4C7U A;  1S0V A;  1LUW A;  3KG2 A;  4DR1 O;  4IHJ A;  3HB3 B;  1Q5O A;  2EZP A;  1F7Y A;  1Y67 A;  1E1R G;  1M56 C;  3U0Z A;  3SYC A;  3RYC A;  4LF4 B;  3AK1 A;  3JAR B;  3OE7 G;  3F5T A;  4YXW G;  4JI8 O;  2UUB O;  3ASO C;  2YEV B;  5A2Q N;  3X2Q C;  3OUF A;  1XQ8 A;  1G4Y B;  4CH5 A;  3W7U A;  3OGC C;  3TCU A;  2ZKO A;  5EYP B;  1SQV H;  2GTA A;  3H1H H;  1H2M A;  1XMO O;  5EBW C;  1T5E A;  2D3O W;  2GTS A;  1YSC A;  2Y4U A;  4PA6 A;  2ARH A;  3K79 A;  5KUM A;  1M93 A;  2N05 A;  3AG3 C;  1FD9 A;  2PTM A;  4TQF A;  3ZHS A;  1W59 A;  3SYQ A;  4CBC A;  1XMQ B;  1VQ8 V;  4MVZ A;  1N4C A;  3CRR A;  3WG7 C;  4IIJ B;  4JI5 B;  4WF9 V;  4GLX A;  4EKW A;  3W7S A;  1JJ2 U;  4DRX A;  5J2U A;  2BE3 A;  1GM9 A;  2Q0O C;  1XL4 A;  3BAB A;  3P32 A;  4FJC C;  4PJ0 Z;  3D36 C;  2OYQ A;  3SPI A;  2JDI G;  5B5E Z;  2R9R B;  2Q5Z A;  4Q20 A;  4GYC B;  5LP6 B;  2OTL V;  2F66 C;  2LJ2 A;  5JVD A;  5CBF A;  2MW2 B;  2ZNI A;  1VF7 A;  2QWR B;  4CH4 A;  4RO2 A;  2ATK C;  4MVR A;  2YS8 A;  1Q6U A;  5B1O A;  4LR3 A;  2RCV A;  1KQS U;  3CPW U;  2W0F C;  4X1Y B;  1XOU A;  1E1Q G;  1W2B U;  1DF4 A;  1N36 B;  1N33 B;  1IDS A;  1A32 A;  1QVF U;  2CTR A;  1Z2G A;  1NZ6 A;  4LF7 B;  1IUR A;  4JAV A;  4JI0 O;  3IC7 A;  2IU0 A;  3E2E A;  1XEQ A;  4NXM B;  1BL8 A;  5BMV B;  2ZNJ A;  3WG7 B;  1S5H C;  2UUC B;  2QM8 A;  1DLB A;  2EIK B;  3G6B A;  3CCE V;  4DR2 O;  1NBM G;  2LFS A;  1ZX3 A;  1SZX A;  3ZRV A;  2A0L A;  4GT1 A;  2R9A A;  4JYA O;  4J80 A;  3F7Y C;  5IYB O;  1EZV H;  1PP9 H;  2GUZ A;  5J2T A;  3CSX A;  3CXH F;  3T1Y B;  2E74 B;  4CS2 A;  3A0H Z;  4FFB B;  5IJ0 A;  2WPD G;  1L8D A;  2UUA O;  5KHH A;  2X0L A;  4PDV A;  4UB6 Z;  2Q9L A;  1WP8 A;  5IYC O;  1NH2 B;  1P7G A;  3G6E V;  5C93 A;  2LGQ A;  4X88 A;  2EX3 A;  2Q0A A;  3HKD A;  1AI4 A;  3D8C A;  1FXK A;  3H1I H;  1FYJ A;  2Q73 A;  3TET A;  1R3L C;  1SET A;  3K5O A;  3FAV A;  4ZKI A;  4TQD A;  1VF5 B;  1XIL A;  3ZRW A;  1QVG U;  2Q7H A;  2X7R B;  1I94 O;  3CC4 V;  3JAS A;  1P84 F;  4O4L B;  4MW3 A;  2Y48 A;  1K8A W;  4JTC B;  1SF9 A;  2EIM C;  1SC5 B;  5DED A;  5LMU O;  1H38 A;  1SS3 A;  2WLI A;  4O4H B;  4B3S O;  2QKC A;  4UV9 A;  4OX9 O;  4HZ3 A;  5IY5 C;  4TSF G;  3ABL C;  3K9A A;  4MTX A;  1WA8 B;  5HFM A;  3D3I A;  4WCE V;  3A0B Z;  2DW4 A;  4ICG A;  4CC5 A;  5L3C A;  2WLK A;  1W0K G;  3CME V;  2QWN B;  2F4V O;  3PJS K;  1ZL8 A;  1Q43 A;  4DW1 A;  4LNU A;  4U7N A;  4LWS A;  4J42 A;  1GKF A;  1AIL A;  4X8A A;  3H9V A;  2YID A;  4OGQ B;  3JAW B;  3OTF A;  1NJI W;  4U3J A;  2CGN A;  2QTO A;  2YI8 A;  4IGG A;  2E5L O;  3UQ8 A;  1YCI A;  2Q67 A;  3CWB H;  1OJH A;  2KKW A;  5LXT A;  2KQX A;  4ZHQ A;  4LF4 O;  3KKY A;  5LBQ A;  5CA3 A;  1D2D A;  3LUT B;  3E86 A;  1FJG B;  3K06 A;  3B09 A;  5K1X A;  5EBL C;  5D5P A;  2EIM B;  3QF7 A;  3ZMZ A;  3CP1 A;  1I5Y A;  4B3T O;  2AHZ A;  1Y74 A;  2CE4 A;  2XAS A;  2WA4 A;  4W4K A;  5D5Q A;  3THO A;  4RUF A;  4BWA A;  5IY5 B;  4FLV A;  1YHQ V;  3ABL B;  1J5E O;  2QKS A;  1LUV A;  4NTY A;  4GZR B;  1D5A A;  1B06 A;  2QM7 A;  1H2G A;  1VQO V;  2KG7 A;  3OM3 B;  4JI5 O;  4PV1 B;  2CTP A;  4H0L B;  4ZIB A;  2QJ1 A;  2OT5 A;  4WFF A;  2L6L A;  4X1I A;  5DN6 G;  1F51 A;  3N2K B;  1NKD A;  3SJC C;  3STZ C;  5H6Q A;  2AHY A;  3M99 B;  3RFR A;  2UXX A;  4FVM A;  4TV8 B; 
#chains in the Genus database with same CATH homology
 4MS2 A;  2Z5U A;  4MTG A;  5L3B A;  4JGS A;  4FIP C;  3OR6 C;  3JD2 A;  1JCH A;  5CBG A;  5KA6 A;  1YIT V;  3UM7 A;  1TUE B;  3ZRS A;  2ZQM A;  1AJP A;  4KFM A;  1P4R A;  4RUE A;  3JYC A;  2B1G A;  1UJW B;  2LFR A;  1PNL A;  1JPX A;  3LNM B;  3ZJZ A;  2YSU B;  3JD1 A;  3ZCC A;  1FFT B;  3CCS V;  1SES A;  2A9H A;  3OEE G;  3CC2 V;  2V7Q G;  3DTU B;  3OR7 C;  1PNM A;  2EIK C;  3B8N A;  1P7B A;  4GCZ A;  4GX5 A;  4QE7 A;  1JQ0 A;  1AI6 A;  2B5U A;  4UVC A;  2P90 A;  3ZMU A;  3FB8 C;  1B6Q A;  3ABT A;  3FB7 C;  2C2A A;  5LHH A;  3OW2 U;  2WLL A;  1L1F A;  1IXM A;  1VQP V;  5LGN A;  2WLL B;  2DWD C;  3K03 A;  2KB1 A;  1YJ9 V;  2DYS B;  4JAS A;  1CP9 A;  1XL6 A;  2IW5 A;  3RBZ A;  4HAM A;  4MSW C;  1FXV A;  1OCO B;  5KA5 A;  4WFB V;  3ABM C;  1KC8 W;  1M9N A;  3SJQ C;  4BAY A;  4RQE A;  1KEC A;  1F4N A;  2OTJ V;  2X6A A;  3ZMV A;  3P30 A;  2IJK A;  1OCZ C;  2XOK G;  2JJ2 G;  5H6R A;  1K4D C;  1V55 B;  3CCM V;  1VQK V;  2HFE C;  1DTO A;  1YTF D;  1AI5 A;  1PNK A;  3SPJ A;  3LDD A;  1R73 A;  1K4C C;  2WSS G;  4XDL A;  3ABU A;  3EFF K;  2X6C A;  2ZR3 A;  3LSS A;  3R65 A;  4R50 A;  4TT3 G;  4QNH B;  5EBM C;  1JX9 A;  4QJF B;  1Q82 W;  4P9O A;  1R3J C;  3VBB A;  2IH3 C;  4JPR A;  1GMG A;  2Z3Y A;  5LGT A;  5B3S C;  1COW G;  3GWO A;  1WLE A;  2BOC C;  5LGU A;  4G2K A;  1AJN A;  3AG4 B;  4N21 A;  2HG5 C;  2Y69 B;  3ZN1 A;  2JEU A;  2EBO A;  1RPR A;  2MK3 A;  3DGE A;  4JYB A;  3E8B A;  4LP8 A;  5EC1 C;  1OHH G;  3BY6 A;  2QEX V;  2PI5 A;  2WLH A;  1PKX A;  4R8C A;  3AEI A;  3CCU V;  3ML0 A;  1CPY A;  2WLJ A;  1V54 B;  1K7D A;  3A0R A;  2LP7 A;  2H94 A;  1DF5 A;  3JD0 A;  3TK1 A;  1PL0 A;  1S72 V;  4H37 A;  3MHS C;  4I5S A;  4J9Z B;  3ZRX A;  1Y4M A;  2P7T C;  2QE7 G;  1GK9 A;  1NH2 D;  4N23 A;  1GO3 F;  3ZMT A;  1S0V A;  2V1D A;  3GB7 C;  3KG2 A;  2IH1 C;  3HB3 B;  2EZP A;  4WFA V;  1K3E A;  3B8M A;  1E1R G;  3FKS G;  3OAA G;  2DYR B;  4JAU A;  5FL7 G;  1M56 C;  1QR8 A;  3SYC A;  3MD0 A;  3ABM B;  2IU3 A;  3OE7 G;  2YEV A;  3H01 A;  4UVA A;  3T2M A;  4YXW G;  3OUS A;  3ASO C;  2YEV B;  3QO7 A;  2X6B A;  3G4S V;  3X2Q C;  3ZN0 A;  5EK0 A;  2FTK A;  1OCZ B;  3OUF A;  3VOU A;  3W7U A;  1G4Y B;  5CMU A;  1VQM V;  1FS0 G;  3OGC C;  3TCU A;  2K1E A;  1QLE C;  1Y66 A;  4P9P A;  2JEX A;  5EBW C;  2HR3 A;  2D3O W;  1FXH A;  5IYD O;  1YSC A;  4PA6 A;  4E2L A;  2DQ3 A;  3CMA V;  3K79 A;  5KUM A;  3AG3 C;  4UXN A;  2R9I A;  3IGA C;  3LDC A;  4MVO A;  3SYQ A;  4CBC A;  5L3E A;  4FK5 C;  2OCC C;  3I55 V;  1VQ8 V;  1CEZ A;  4MVZ A;  4RAI A;  3G71 V;  1OCC C;  2BOB C;  4QPJ A;  1M90 W;  5B3S B;  3ASN C;  1SRY A;  1ARO P;  1R6N A;  3WG7 C;  4BW5 A;  4WF9 V;  1JVM A;  3QO8 A;  1ZWI C;  1M57 C;  2EIN C;  1NQT A;  3LDE A;  4EKW A;  3K04 A;  3W7S A;  4DXW A;  1JJ2 U;  5CN0 A;  1VQ6 V;  2WAM A;  3K08 A;  1G8M A;  1OZ0 A;  2UXN A;  4MVM A;  4XBF A;  1NR1 A;  3ETE A;  1THZ A;  2Q68 A;  1GM9 A;  4UV8 A;  3CC7 V;  1XL4 A;  3P32 A;  4FJC C;  1WPX A;  5B1N A;  2M7W A;  1I5X A;  3ZMS A;  2ZXW C;  4XDJ A;  2EIJ C;  3SPI A;  2PI4 A;  2JDI G;  3ABK C;  3FB6 C;  4JYC A;  2R9R B;  4Q20 A;  2P67 A;  1VQ4 V;  2OTL V;  4PDL A;  3FYE B;  1MSW D;  5CBF A;  4JTD B;  5KUK A;  3E89 A;  4RO2 A;  1NVP D;  3IFX A;  2ATK C;  3RVY A;  2XAQ A;  4MVR A;  5B1O A;  1KD1 W;  1QBZ A;  1VQ7 V;  4PA4 A;  3E8H A;  4QPK A;  4ZBM A;  1KQS U;  1FXK C;  2NLJ C;  3FB5 C;  3CPW U;  2W0F C;  2H8P C;  1E1Q G;  1W2B U;  4LBE C;  3K0G A;  4L87 A;  2NNU A;  1DF4 A;  5LHI A;  1QVF U;  3RW0 A;  3JCZ A;  1BMF G;  4MVQ A;  1QCE A;  3BEH A;  2GHY A;  4JAV A;  2W6I G;  2ZD9 A;  1K34 A;  2HLD G;  3IC7 A;  2IU0 A;  2OCC B;  1RM1 C;  1ORQ C;  1OCC B;  3E2E A;  1BL8 A;  3ASN B;  3SYO A;  5IDJ A;  4PA7 A;  2DWE C;  3WG7 B;  1S5H C;  3EHB B;  2QM8 A;  1DLB A;  2EIK B;  3CCE V;  1M57 B;  4UVB A;  4R6Z A;  1NBM G;  2EIN B;  2LFS A;  3ZRV A;  1YJN V;  1K9M W;  2A0L A;  4GT1 A;  3B77 A;  1F4M A;  1AI7 A;  2XND G;  3F7Y C;  5IYB O;  2P6J A;  3ETG A;  1VQL V;  3CCR V;  1R3I C;  4J9Y B;  2Q6A A;  1K73 W;  3ETD A;  4WFH A;  2WPD G;  3AG1 C;  4P2Z A;  5L3D A;  1SER A;  4FPP A;  3D36 A;  1E79 G;  2ZXW B;  4QIW F;  2X0L A;  3UKM A;  1YJW V;  4PDV A;  1YI2 V;  4ASU G;  1K33 A;  5IYC O;  3K3W A;  1NH2 B;  1OCR C;  1K97 A;  1BHA A;  2XAH A;  1W0J G;  3G6E V;  3CCL V;  5C93 A;  1AR1 B;  1H8H G;  4MVS A;  4X88 A;  3QNE A;  5B1A C;  1EFR G;  3RVZ A;  3W7T A;  2IJI A;  1ROP A;  2CK3 G;  4HYO A;  1H8E G;  1RPO A;  4CZZ A;  4G28 B;  4PA9 A;  4PA3 A;  1AI4 A;  1VQN V;  3OEH G;  4JF3 A;  1FXK A;  3T4D A;  4GX1 A;  1FXK B;  2ZR2 A;  1KP3 A;  1MOF A;  1K92 A;  3TET A;  1R3L C;  1SET A;  2XAJ A;  2XAG A;  4ZKI A;  1Q86 W;  4GX2 A;  3CXC U;  2WLN A;  4I9W A;  3ZRW A;  3I56 V;  1QVG U;  1Q81 W;  3ZRW B;  2X7R B;  4GX0 A;  3CC4 V;  1S76 D;  1S3J A;  3FYI B;  5B1B C;  1GTO A;  1KKD A;  1S77 D;  4MW3 A;  1RM1 B;  4KUM A;  2Y48 A;  1Q7Y W;  1N8R W;  4R7C A;  1K8A W;  4JTC B;  3AG4 C;  3K0D A;  2EIM C;  2JK5 C;  3NXS A;  1QLN A;  2Y69 C;  1H38 A;  3JD3 A;  2WLI A;  1VQ9 V;  4MW8 A;  2WLI B;  4UV9 A;  1ENV A;  1SZT A;  3E35 A;  4HZ3 A;  2ITD C;  5IY5 C;  4TSF G;  3ABL C;  3K9A A;  1V54 C;  1HWY A;  4MTX A;  1R6K A;  5HFM A;  2HVJ C;  3D3I A;  4WCE V;  2DW4 A;  1GM7 A;  5L3F A;  3ZIA G;  4PDR A;  3SPC A;  5L3C A;  4OXS A;  3W7W A;  3AG1 B;  5L3G A;  2WLK A;  1W0K G;  3CME V;  4UUJ C;  1EZJ A;  3CCJ V;  5LHG A;  2DQ0 A;  4DO2 A;  1M56 B;  3CYO A;  3PJS K;  2EIL C;  2JJ1 G;  1GM8 A;  1OCR B;  1R3K C;  2F43 G;  2ZDI C;  4LCU C;  3T1C A;  3AG2 C;  3ASO B;  2DYR C;  4U7N A;  3X2Q B;  1GKF A;  5EC2 C;  2WLM A;  1LNQ A;  2HVK C;  4X8A A;  5B1A B;  5DM6 V;  2IJJ A;  1K5Q A;  4WFE A;  3OMN B;  5GW7 A;  1J95 A;  3LSQ A;  3MHH C;  5H9C A;  1QLE B;  2EZO A;  1NVP B;  2W6J G;  1YTF B;  3CCQ V;  5HFL A;  3OFN G;  3E83 A;  1NJI W;  4X89 A;  3E8F A;  3AG3 B;  2QTO A;  2IJH A;  4LC1 A;  3CD6 V;  1MAB G;  2QA4 V;  2Q67 A;  3SPG A;  4WFG A;  3OMA B;  4F4L A;  5J9P C;  4XDK A;  3T4Z A;  2GSM B;  4QE9 A;  5E1A C;  5LBQ A;  4PEL A;  5B1B B;  5CA3 A;  4RQF A;  3SYP A;  5BZB A;  3LUT B;  3E86 A;  3K06 A;  4MTO A;  4BIU A;  5EBL C;  4FMT A;  2EIM B;  4MVU A;  1NR7 A;  3ZMZ A;  3CP1 A;  1K5S A;  4MT8 A;  4MTF A;  2HJF C;  1I5Y A;  4KP4 A;  3E8G A;  2AHZ A;  2XAS A;  3HPL C;  2XAF A;  1QR9 A;  4RUF A;  5IY5 B;  1YHQ V;  3F7V C;  4Z1M G;  2B1I A;  3ABL B;  5CBH A;  1VQ5 V;  1F23 A;  1BHB A;  2A79 B;  2WWW A;  3JD4 A;  1MG1 A;  2EIJ B;  4JTA B;  2QKS A;  2EJR A;  1KP2 A;  2DYS C;  3W7X A;  3OMI B;  3ABK B;  1JOY A;  2QM7 A;  1H2G A;  4G27 B;  1VQO V;  1EBO A;  3STL C;  1OCO C;  3F5W C;  2Q69 A;  3OM3 B;  3CCV V;  2OT5 A;  4WFF A;  3WFV A;  5DN6 G;  1F51 A;  4U7O A;  2ITC C;  2EIL B;  2ZDI A;  2JIZ G;  1NKD A;  3SYA A;  1M1K W;  3STZ C;  1V55 C;  5H6Q A;  3AG2 B;  2AHY A;  1YIJ V;  4PDM A;  4TWK A;  3QO5 A;  4BIZ A;  2HKO A;  3M99 B;  4H33 A;  3SPH A;  2UXX A;  1AJQ A;  1PD3 A;  4P30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...