3GWOA

Structure of the c-terminal domain of a putative hiv-1 gp41 fusion intermediate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
WDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Role of a putative gp41 dimerization domain in human immunodeficiency virus type 1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
molecule tags Viral protein
total genus 24
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3gwoA00
5HFLA 2EZOA 1Y4MA 3B8NA 3MHSC 4FJCC 5HFMA 1MOFA 1QR8A 1DF5A 2LP7A 3M99B 1DF4A 1DLBA 1QBZA 2X7RB 5H9CA 5KA5A 2MK3A 2M7WA 3P30A 4JPRA 3B8MA 3K9AA 5CMUA 3GWOA 3WFVA 1ENVA 1SZTA 4FIPC 2EBOA 4FK5C 1EBOA 1I5XA 3H01A 1K34A 4JGSA 3CYOA 3B77A 5CN0A 1I5YA 4JF3A 4N21A 1K33A 1F23A 1QR9A 5KA6A 1QCEA 1Y66A 2OT5A 4N23A 2P6JA 4E2LA 3CP1A 2EZPA 1MG1A 3MHHC 1JQ0A 1JPXA 4G2KA
chains in the Genus database with same CATH superfamily
2LGWA 2JS3A 2DWEC 3CCEV 4RUEA 3C3SA 4MW8A 3X2QC 4LFBO 5B1AC 4LFAO 4HAMA 1JJOA 3CMEV 3E2EA 4IIJB 5LMUO 5EBWC 4WFEA 4YIOA 1Q6UA 2EIJC 4PA9A 4OPHA 5L3GA 3F5TA 1EN6A 1SQXH 1MOFA 3JARB 4GT1A 3JAWA 1QU7A 5IDJA 2QWQB 2PI4A 1VQ8V 3CS5A 4CS3A 4GX2A 5AG2A 1EZVH 2Y69B 1M1KW 1N36B 4TV9A 3T4ZA 2XNDG 3IC7A 4DV0B 2ADPA 4X88A 5EYPA 2GSMB 3BA8A 5HFLA 4L8JA 4I55A 5LOVA 2UXCO 2JS5A 4U3JA 4I0XA 1SZXA 1W59A 2F23A 1NR7A 1P7BA 4EFEA 2ZIOA 5LP6A 1BQZA 4JI6B 4WFBV 4J41A 1Z5VA 2WLMA 1BHBA 1IBLB 4J9YB 4MTFA 4E4EA 4TWKA 3L71H 1F51A 4MVUA 4LF8O 3SYOA 2W0FC 2X7RB 5IJ0B 1GN2A 4RUFA 5FL7G 3G6EV 2UXDB 1DGSA 4IL6Z 1YF2A 3FYEB 2WLIA 4QGPA 1K97A 2CGNA 3MHHC 4AHCA 1HWYA 5JH7B 2UUCB 3HPLC 2Q68A 1GO3F 1GKFA 1BS3A 4HNAB 1AI7A 3X2QB 3W7UA 3NR7A 1L1FA 2BTOA 4LFCO 5IJ9B 4EB6B 2FB5A 2UUAB 3CJHA 4WFFA 1MSWD 4JYBA 1XMQO 2K1EA 3RGBA 3CCMV 2EIJB 1N33O 4FM0A 1AVMA 1M56B 4X89A 2AXTZ 4O4JB 2HFEC 3SJBC 5IYCO 3SPCA 2WLKA 2GV9A 4MW3A 3LSSA 4NXMB 2A7WA 3QO5A 4LBEC 2XHBA 5FNVB 1WP8A 1VF6C 1EM1A 4QE7A 1UJWB 2Q8VA 4X1YB 3G67A 5F2VO 3DXRB 2NN4A 3H1LH 4LFBB 4LFAB 1Y76B 2DYSC 3JALA 2Q9LA 4DV1O 2ZXWB 4OXSA 5LMUB 4X20A 1H8EG 3W7XA 3TXSA 1VQOV 1XNQO 1AI5A 2N05A 4ICGA 1Z5WA 1TGOA 2ETNA 5GW7A 5B66Z 3ZHVA 2GUZB 1VARA 3JSLA 1JVMA 2PY5A 2LW7A 1J95A 4CC6A 1S72V 2CH7B 2YIDA 3HKBA 3E22A 4W4LA 2WWWA 2ZD9A 3BABA 4NXNO 4DR5O 1EZJA 5CN0A 4UCTA 2LW1A 3K58A 2Q0OC 1KBHA 2QM7A 2UXCB 3AEIA 3O9OA 3CCSV 1HNXO 2VQFO 4O4LB 3RN4A 1DF4A 3K9AA 1G4YB 1OCZC 1NU1H 4JYCA 4DR7O 1G6UA 3QG5A 3OEHG 1WAZA 1F23A 1LNQA 1QVFU 3W7WA 2CTRA 1PV0A 3SYPA 4LF8B 1YEWA 2VS0A 3MHSC 2ZKOA 3DGEA 1ZL8A 4QNHB 3N2GA 3DC5A 4NTXA 2QKAA 2XTAA 4ZOLA 2WPDG 3ZMSA 4DK0A 1J5EO 3C3TA 3OM3B 1XILA 1K73W 1BZKA 5LMNO 1XMOO 2PI5A 2LO1A 2DYSB 4LFCB 2A79B 4Q6GA 1R3JC 2UXNA 1H8HG 5C8YA 5BMVA 1K33A 1Q3EA 1OJHA 4LF4B 1N33B 2VQEO 4JYAO 2CE4A 2V1DA 5BR8O 2ZT9B 4ZHQA 4UCVA 2AHYA 1JMKC 2EX3A 3AG3C 2Z3YA 2FL4A 3QTCA 4MT8A 1SQFA 2AGAA 3K5OA 1HW7A 1VQPV 3T4DA 2IU0A 4J80A 3RYFA 1M5IA 1FFTB 4B08A 4B3SO 1HNZO 1BT8A 2WA3A 1WB8A 3HKDB 3L72H 1AP5A 4IT5A 2XAJA 2YDEA 1RSOB 3ZRXA 2ZM6O 1M57C 3K0DA 4UXNA 4DV1B 3FB6C 2A9HA 4FPPA 3K3WA 4YHHO 3LNMB 1NVPD 5L3CA 5CA1A 4WBNA 1XNQB 1IXBA 4NVPA 4AQYO 2W0XA 1SRYA 5B1BB 1OCCC 2RN9A 1H2MA 2JK5C 1LUVA 3IC9A 4KXRA 2EIKC 2RJZA 5IT9N 2HP8A 2QJ1A 2X0LA 3P30A 3ZJZA 4YIPA 1YXBA 1NBMG 5L3EA 4NXNB 4DR5B 3ABMB 4X66O 1V9PA 5DM6V 4DV4O 4DUYO 3CD6V 2QWNB 5IWAO 3E8HA 4UCRA 3SR2C 1QQCA 3ICXA 3O65A 3K0GA 2VQFB 3T1YB 3RWRD 3FAVA 2OCCB 4DR2O 1AILA 2XAGA 1PNMA 3AG1C 4DR7B 1JFFA 2WAMA 1F4MA 3H01A 4CH4A 3UT5B 3JATA 1Q90D 1SC5B 3CC2V 5KHHA 2LJ2A 2ZNJA 3ZN1A 1JCHA 3OT7A 1AROP 3CCJV 3E89A 3OMNB 4ZIBA 2DYRB 2QWOB 1WN7A 3B2EE 4GKJO 3AG3B 3AG2C 4MVZA 4H37A 3FKSG 1WLEA 3CSXA 4HZ3A 3WB2A 1PNLA 5EIBD 2OCHA 3BVOA 3OE7G 4BIZA 3OR6C 1SESA 1Q43A 1J5EB 4KP4A 4RQEA 3JAKA 5LMNB 2P7TC 4UCSA 2RMKB 5CBHA 5IYZB 3U10A 2XOKG 4LR3A 4DR4O 2GBOA 2BTQA 3RYIA 3D36A 1CEZA 2IJHA 4IHJB 4TSFG 2VQEB 4JYAB 5B3SC 5BR8B 1OCCB 4MVRA 4X62O 2Y0IA 3OTOO 1FPOA 4FLTA 1YIJV 5EZYB 2XT9A 4YXWG 4LWSA 2EIKB 5EBLC 1VQKV 3RBZA 1K3EA 2ZCEA 4LF7O 3HKEB 4X1KB 1FAFA 1FXKA 1RM1C 1VQ4V 2P22C 4B3SB 1HNZB 3ABLC 4UB6Z 4WCEV 3F5WC 4FFBB 3CB2A 2ZM6B 4X64O 3QO8A 4I4TA 2GTAA 3FYIB 3AG1B 2CDYA 2O57A 2YSUB 4YHHB 5KA5A 3P3PA 1OHHG 3JYCA 3CCVV 1SQQH 3GB7C 3BCCH 3JSNA 4U7OA 3ZN0A 4AQYB 5EC1C 1IDSA 2DQ0A 2JVDA 3RYHB 4LP8A 1QNMA 3T1CA 4JYYA 5LP6C 4DRXA 1ZWIC 1I08A 4D7TA 4PI0A 1TUBB 3RW0A 3CC4V 4X66B 4DV4B 2A06H 4DUYB 3ABTA 3G4SV 3ZRWB 1GRJA 5IWAB 2HEPA 2R9AA 1H2KA 2WSSG 4LF6O 3OTFA 2F95B 5LXTA 1W0JG 2QA4V 4Q20A 4DR2B 1WA8A 2ZR3A 3THOA 2FKXA 4CZZA 2ILMA 1PP9H 1QBZA 2EINC 1NTZH 4K3AA 5LA6A 3GVMA 4JPRA 4BW5A 1FS0G 3LNNA 2Y4TA 3BEHA 1VEWA 5B3SB 4GX0A 2JRIA 1QLEC 2C2AA 2IJIA 3ZMUA 1AJNA 4PDMA 4DV2O 4FZ0A 4GKJB 1I94O 3K08A 1V55C 4PDVA 3SYCA 1YJNV 1U96A 3H1IH 3OUSA 3STLC 4DUZO 2JIZG 3ZMTA 3K9SA 3ETEA 3N2KA 3ETDA 1QHTA 4ZKIA 1YSCA 3ASNC 2EJ7A 3K03A 1R3KC 3ABLB 1NKDA 2H94A 2HJFC 1KB9F 1NZ6A 1GH6A 1BSMA 1PM9A 2EULA 3ZRVA 4DR4B 4AILC 4TUYA 3N27A 2F66C 4UUJC 3UCSC 3WG7B 5GTIZ 1YI2V 1S76D 5EYPB 5KUKA 4DXWA 3CMAV 2D3OW 5LOVB 4DV3B 1AR4A 1FFXA 4U3JB 4X62B 1NR1A 4I0XB 4ZBMA 4N23A 3OTOB 2HVKC 4PI2A 5L3BA 4PHZA 2KG7A 5GONA 3IFXA 1NS1A 4IIJA 3TXQA 1VP7A 1D2DA 2Q6AA 4YY3B 4LF7B 3J81N 4OGQB 3ZX6A 1R1BA 2EILC 3LDEA 4ASUG 3K59A 2L35A 4YJ2B 1ZTEA 1F7YA 1PPJH 1CPYA 2DMXA 4X64B 5LHHA 2IJKA 3OAAG 1SA0B 2GHYA 2WLIB 1COWG 2PUSA 1F4NA 3IAYA 5J2TB 4TV8B 1WNSA 3SJQC 3CYOA 3HB3B 1WJZA 2N04A 1K5SA 4G27B 1XL4A 1N34O 1VF7A 3CJHB 4J7JA 1PL4A 2DQ3A 4GCZA 4EEQA 1H38A 1KUQA 5A2QN 5B1AB 5CBFA 3FB7C 1TVKB 3ASNB 4FFKA 3JCZA 4Z1MG 4O2AB 4NYKA 1KYOF 1HNWO 4F6RB 4LF6B 3CXHF 3DC6A 3OR7C 4IYHA 3OMIB 5KHIA 1GAXA 3CCLV 3L74H 2YC0A 4NB5A 1GM9A 3RT3C 5JH7A 5IE9A 4HNAA 3ZBHA 5KX5A 3JALB 4KHPO 3OEEG 1D5NA 3FD9A 1KKDA 4DV6O 4X20B 4EB6A 4MTXA 4DUZB 1Y4MA 3QF7A 3TETA 5EK0A 1QLNA 2QM8A 2QGNA 4FLZA 2BOCC 2IM9A 3QNEA 4DR1O 4R50A 1YZBA 2ZE5A 4DW0A 4MVSA 1XL6A 3SYAA 1YTFB 2E3CA 3HKBB 3H1HH 3E22B 5FNVA 2UUBO 3E8BA 1XDCA 4BW9A 4QE9A 3T2MA 1IBKO 1B6QA 1ENVA 1SZTA 3DXRA 4JI7O 4UVCA 4IGGA 4N21A 2PTMA 4PD4F 3OGCC 4P2ZA 1Y76A 2P6JA 5CB4B 2LFSA 2DOSA 1JQ0A 4O4HA 4JI3O 3R65A 4ZI7B 4C7UA 3MD0A 4I9WA 4B3TO 2QTSA 3P3NA 3JCUZ 5IYBO 5DEDA 2HKOA 1KKCA 1I5XA 3B77A 2M6YA 5J9PC 1S77D 3ZEDA 2WLLA 3MDSA 2OYQA 2DJVA 3H9VA 4O2BA 1Y74B 1FD9A 4OPAA 1ZX3A 1XHXA 1KD1W 2JGDB 4I50B 2HJDA 3VBBA 4O4LA 2QTOA 4JTDB 5J2UA 1UPGA 2A0LA 1KU9A 4O4IA 5C8YB 3M7MX 2F4VO 5BMVB 1FJGO 2FMLA 4RWUA 1M93A 1R3IC 2XASA 2ZR2A 3LDDA 1W2BU 1VQMV 1R73A 4I9QA 2IU3A 1XMQB 4GLXA 1M9NA 2ZE7A 3ABKC 1HR0O 4TOIA 5KAFZ 1NT2B 1I7FA 5KAIZ 1L0LH 4UVAA 5IYDO 2KQXA 1MA1A 3F7YC 4LNUA 4EFBA 1YJ9V 2AHZA 3H1JH 3ZHRA 1AR5A 4DW1A 2YXLA 4KHPB 3K57A 3W7SA 4JI2O 4DV6B 5TISZ 3BA9A 2HG5C 3AK3A 1VMGA 4JI0O 3CPWU 3RVYA 5EIBC 4FLWA 1K92A 2OWOA 3D36C 3FB8C 4J7KA 2P06A 4MVMA 2ODMA 2E5LO 4IYIA 3STZC 2BE3A 4R8CA 2JEUA 1BL8A 3VOUA 4DR1B 1OCZB 2RNBA 3KG2A 5KHJA 3A2FA 1FYJA 1FXVA 3ZHTA 1Q82W 4JV5O 1JA8A 2NNUA 5K1PA 4PDLA 4K8ZA 1VQ7V 2EJRA 1E79G 3KKYA 2UUBB 1JPXA 1XEQA 3OD4A 4U7NA 1FXKC 1Q6HA 4LC1A 1IBKB 1SQGA 4FZ1A 1Q7YW 2AZ0A 5LL6Y 4DO2A 4JI7B 3HKDA 1BGYH 2XAQA 4WFGA 1RSOA 1VF5B 4B7EA 4BR6A 3OUFA 4JI3B 5JCOC 2WLHA 1IURA 3JATB 1HNXB 4J9ZB 3I5DA 4CS4A 4B3TB 1DF5A 4I7ZB 3B4SA 3CRRA 4UV9A 4UCUA 1P84F 3KCYA 3SGIA 3ABKB 1M90W 2XUMA 3AK1A 3D3QA 2OT5A 3CRQA 4P9OA 2BSKA 2YEVA 2VWJA 2YXYA 1CXZB 4CH5A 1WB7A 3A0BZ 5CA0A 4G2KA 2JDIG 3WU2Z 2F93B 2UU9O 2PGGA 1KC8W 3JAKB 5LHIA 2Y4UA 5JQGB 2PZSA 2BOBC 2ZDIA 2BTQB 3RYIB 2EZPA 2BCCH 2F4VB 3T1HO 1GN4A 3RFRA 1XMOB 1FJGB 1MABG 1SETA 3UT5A 1M57B 2EIMC 4UB8Z 5BXZA 4XDKA 5JVDA 2CAZC 3GWOA 3IGAC 4EKWA 4X1IB 4PV1B 2QWPB 2E76B 2CGOA 2CTWA 1IVSA 4PELA 4OX9O 5LGUA 1MZFA 1GMGA 1FXKB 3IJ4A 3Q4HB 1IZ3A 3EHBB 4LF9O 2M7WA 3AG4C 2YXHA 3SJAC 1RPOA 5H6QA 3R66A 5IYZA 1VQ9V 1BQ0A 4JI2B 4GKKO 2V7QG 4JI0B 1N36O 4R6ZA 4FLVA 1SQVH 2ZIMA 2Z5UA 4DV0O 1B3QA 1RFYA 2E5LB 4IHJA 5LBQA 4FLUA 4FJCC 4DR3O 4YJ3B 3CC7V 1LR1A 5LYJB 3BHPA 4AI8A 5JCOA 4KUMA 2GDSA 4JGSA 4JV5B 5GTHZ 1FXHA 3I56V 3CRMA 2CTQA 2QR4A 1XOUA 1GN3A 1NI8A 3HKEA 2Y48A 3OFNG 3CCRV 4F4LA 3AG2B 2ZINA 3JD4A 3P32A 4RQFA 4DR6O 2YS8A 5BY1A 1YVWA 5ITZA 4CS2A 3ZHSA 2Z0AA 2QSAA 2AW9A 1MMMA 2QKSA 4UV8A 1K4CC 4G28B 5LA6B 1WPXA 3EFFK 2EZOA 3BY6A 4DK1A 4ABMA 1XQ8A 5KHGA 1A32A 4GX1A 1WP7A 3VQYA 1NH2D 2R70A 4JTAB 3UM7A 3RYCB 1OV9A 1AI4A 3RYHA 4JZGA 2ADQB 2G38A 1EFRG 3L70H 1XBLA 1JR9A 2B1GA 1GM7A 1YDXA 4Z2WA 1TUBA 2X6BA 3PJSK 1BMFG 1KP2A 3ZRWA 4K8XA 1N0JA 2UU9B 2FYUH 2F1MA 1M4UA 2Y0PA 3AG4B 2W6IG 1AP6A 4J10A 4GUNA 1SF9A 3JASA 4B7KA 3E83A 3CCQV 3ASOC 3HKCA 2YI9A 1RM1B 5KMGA 4R7CA 4LF5O 4XDLA 1YTFD 2R72A 3JAWB 4TQDA 4MS2A 2ITDC 3J7AU 2UXBO 2PYJA 1FFXB 1OZ0A 2QWRB 2MW2B 4JI8O 5KLVH 3OMAB 2KG7B 4TV9B 4H44B 5GONB 1G8MA 2R9RB 4QPKA 3K06A 2Q7EA 3LUTB 4MSWC 4I55B 4OX9B 1O9HA 4J42A 4BIOA 2A3QA 1PKXA 5LP6B 1M56C 1XUQA 1DTOA 4JAVA 4H33A 4LF9B 4JI5O 3L75H 1YJWV 3CE2A 1S3JA 2DW4A 2OIGA 4J7ZA 4GKKB 1K5QA 3BRCA 2RQ6A 3E35A 3JARA 2B1IA 5KUMA 1O9GA 4XDJA 3CWBH 5H5NA 3EVKA 4FMTA 4DR3B 1ZAUA 5C93A 2EINB 3K5LA 1MZEA 1W0KG 3JD2A 2ZXWC 4XBFA 4X9QA 3JAMN 4B3MO 1N32O 2PYLA 1QLEB 1Y66A 1N0NA 1THZA 4D6TH 3S3XA 2VRZA 4QPJA 3KZIZ 4JASA 1V55B 1BE3H 2YIAA 2X6CA 1JOYA 4DR6B 5HFMA 4YJ2A 1QR8A 1XHZA 2CTPA 2Q73A 1R3LC 3ASOB 2ZQMA 3B09A 4FLYA 3UO2A 1TA8A 1SA0A 4B3RO 4WFHA 1ROPA 4QIWF 1QR9A 2WLNA 4FM1A 1XI1A 1GK9A 5J2TA 4TV8A 1Q81W 3JD1A 5IJ0A 1N4CA 3G80A 5JJEB 3WB1A 1V54C 2IBZH 1SQBH 4K0KO 4MTGA 5KX5B 4KFMA 2LFRA 4KL1A 3CXCU 1AI6A 1E1QG 1L0NH 2RCVA 2N74A 1VQ5V 1S5LZ 3DSQA 5DECA 4A5UB 2OTLV 3ETGA 2B5UA 4DV2B 4LF4O 2Q67A 1I0HA 1TVKA 1I94B 2E75B 4O2AA 5IJ9A 3SPHA 4F6RA 4QJFB 3ZMVA 1R6KA 1IBMO 3RVZA 3TK1A 2H8PC 5IY5C 1K8AW 2EILB 4LF5B 1H2LA 4FK5C 1NJIW 1K34A 3FX7A 2QEXV 2JJ2G 3AG7A 4O4JA 3ZHQA 1Q5OA 5H2FZ 5H6RA 3PN1A 2UXBB 4FVMA 4U3FH 3EXAA 5EC2C 2Q7GA 4W4KA 2P4KA 1ZUQA 4JI8B 3BPZA 3S3WA 2V4DA 1PNKA 3NXSA 2CUGA 2PF4E 2QKCA 4X1YA 1H2GA 4O4HB 1S5JA 4P9PA 1VQLV 1IXMA 4FIPC 4BIUA 2YI8A 5FPRA 1TUEB 5L3FA 2XAHA 4GZRB 4MVOA 2IH1C 4NTWA 3B8NA 4JI5B 2WLLB 4JTCB 1YCIA 3G6BA 3CEIA 4O2BB 1RP3B 1K7DA 4HBNA 2GUZA 1ZL8B 2JEXA 3SYQA 5KA6A 1MSDA 3JD0A 3N2GB 4E2LA 2R9IA 1NQTA 2CH7A 1V54B 1KQSU 1X59A 1HP8A 1NTKH 1XREA 2WLJA 1H2SB 3T1YO 4ZOLB 3DTUB 5J2UB 4DV7O 1URFA 5A9GA 5CB4A 4O4IB 4CH6A 4B3MB 2Q5ZA 1N32B 4ZI7A 5L3DA 1GM8A 1Q6IA 3HR0A 1N34B 1AJQA 1QCEA 1XNRO 5B1BC 4DV5O 2E74B 3ZCCA 1Q86W 2P90A 2QM4A 3LDCA 1B04A 3M99B 4RO2A 5IY5B 2DWDC 1Y74A 4ZHQB 3I55V 1S0VA 1HNWB 4B3RB 2EBOA 3ABMC 3W7TA 3CHXA 3CRAA 2KSDA 1Q8IA 1FKAO 3L9DA 4LNUB 5JJJB 1G1XB 2P4VA 4GYCB 4PJ0Z 2JGDA 5KHKA 5E79Z 2HLDG 4K0KB 2L6LA 2X6AA 4I50A 1VF6A 2ZDIC 3OW2U 1KECA 2OCCC 3RYFB 3UO3A 2LP7A 1JX9A 1P4RA 3ETQA 4H13B 1AJPA 1B06A 2LQTA 4CH3A 3J80N 3SDLA 3B40A 3FB5C 3A0RA 2Q69A 3LSUA 4X65O 3ML0A 5B1OA 5E1AC 2B9ZA 2OTJV 2DYRC 5CA1B 4WBNB 1OCRC 2RDCA 1IBMB 2DE0X 4NR1A 2DN9A 2IH3C 1P49A 1L8DA 2K9PA 1Y67A 3SPIA 3A0HZ 3F7VC 4RAIA 5CMUA 2ZE8A 3ZIAG 2Q0AA 3A8TA 3KCXA 2KB1A 1US6A 1NVPB 2JGUA 1MG1A 4L87A 1UFIA 4WF9V 5D5QA 3D8CA 2LGQA 5JWPA 1KMIZ 3ZS8C 4PA3A 5H9CA 5JJNB 1SERA 4LH7A 1JJ2U 5D5PA 4D7SA 3GWKC 3FAVB 5K1XA 1EN4A 1OCOC 5B5EZ 2ZNIA 1VQ6V 3D3IA 1JFFB 1DK1A 4H0LB 1SS3A 1N8RW 3APOA 4JAAA 4FLXA 2ATKC 3VQWA 3E8FA 4P30A 1RPRA 1VIBA 2BSKB 2YEVB 1AR1B 5CA0B 3G71V 1MNGA 4GX5A 2P67A 1EBOA 1GTOA 1K9MW 4JI1O 3K04A 1CP9A 2AZ2A 4LH6A 3CX5F 5DN6G 2YICA 3MAQA 4DV7B 2QE7G 1SQPH 1DLBA 4F6EA 2NLJC 4UFZA 3CRCA 5B1NA 2UXXA 2XAFA 4NKGB 4WFAV 2HHHO 2Q4PA 4J11A 4NTYA 2D2CB 1XNRB 3TJTA 4PA7A 4DV5B 1D5AA 3QO7A 3CP1A 5JVDB 1Y6XA 1OCRB 3AK2A 4JI4O 1GN6A 1P7GA 4UVBA 3ZHUA 2F43G 2WA4A 2MK3A 4X8AA 3LSQA 3BFRA 1H2NA 4PDRA 4LWSB 1HR0B 1AB3A 3L73H 4PA6A 5JQGA 3E86A 2JJ1G 3TGUH 2P5OA 2YIBD 3JD3A 1ZSPA 3BAAA 3K79A 3WB0A 1T5EA 1WPBA 3B8MA 3U0ZA 5BZBA 1S5HC 4CC5A 1HDJA 1EN5A 2HVJC 4FM2A 4I4TB 4X65B 4DV3O 1OCOB 4JZ2A 5CBGA 4TQFA 4DYLA 2GTSA 1ORQC 3TCUA 3UQ8A 4X1IA 2YIBA 2KKWA 2W6JG 2IW5A 1R6NA 5LHGA 1SKVA 3CCUV 2NR5A 2H3OA 2YUAA 4YY3O 5LGNA 3Q4HA 2FTKA 4DRXB 5CA3A 1NTMH 5EZYA 1X4TA 4JF3A 4JI6O 3U11A 3ZRSA 2IJJA 5ITZB 4X1KA 1IBLO 4K35A 1IX9A 4MTOA 3UKMA 3QVNA 3WG7C 4BWAA 1E1RG 1LUWA 3SJCC 1R6TA 5LXTB 4HYOA 3WFVA 4FFBA 3VQVA 1WA8B 3E8GA 3M8AA 1I5YA 2UXDO 1YHQV 2Y69C 4YJ3A 1PD3A 1ZLZA 2OIEA 1QVGU 2VWKA 5LYJA 2Q7HA 5EBMC 3OGIB 3APQA 1Z2GA 2HR3A 4I5SA 2ITCC 3K5MA 1VQNV 2UUCO 2CK3G 2EIMB 2QDOA 4PA4A 2ZE6A 3ZMZA 1TAEA 2ARHA 1NH2B 4MVQA 4JAUA 4JI1B 4Z1VA 4BAYA 4TT3G 2UUAO 3K5NA 1U97A 3FFQA 3SPJA 4CBCA 3ABUA 3C90A 3JASB 4LCUC 3N2KB 3HKCB 5KMGB 1K4DC 3VQXA 1BHAA 5LGTA 2HHHB 1BCCH 3H1KH 5FLXN 3SPGA 4NXMO 4TUYB 4UCOA 5FPOA 1YITV 3RYCA 3T1HB 1PL0A 4JI4B 1KP3A
chains in the Genus database with same CATH topology
5CBHA 3SPHA 2DWEC 3CCEV 4RUEA 4UVAA 4QJFB 5IYDO 2XOKG 3ZMVA 1R6KA 3F7YC 4MW8A 3RVZA 3TK1A 3X2QC 1YJ9V 2AHZA 2H8PC 5IY5C 5B1AC 1K8AW 2EILB 4HAMA 4FK5C 1NJIW 3D36A 1K34A 3CMEV 3E2EA 1CEZA 2IJHA 5EBWC 4WFEA 2QEXV 4TSFG 2JJ2G 3W7SA 5B3SC 1OCCB 5H6RA 2HG5C 4MVRA 5EC2C 2EIJC 3CPWU 4PA9A 3RVYA 1YIJV 5L3GA 1K92A 4YXWG 3FB8C 2EIKB 1PNKA 5EBLC 3NXSA 1MOFA 4GT1A 4MVMA 1VQKV 3STZC 4R8CA 2JEUA 3RBZA 1K3EA 5IDJA 1VQ8V 1H2GA 2PI4A 1BL8A 4P9PA 4GX2A 1OCZB 3VOUA 1VQLV 1IXMA 3KG2A 4FIPC 1FXKA 1RM1C 1FXVA 1VQ4V 4BIUA 1Q82W 2Y69B 1M1KW 2NNUA 1TUEB 3ABLC 4PDLA 3T4ZA 5L3FA 1VQ7V 2XNDG 3IC7A 2EJRA 1E79G 2XAHA 4X88A 4WCEV 1JPXA 4MVOA 2GSMB 5HFLA 3F5WC 2IH1C 4U7NA 3B8NA 1FXKC 3QO8A 2WLLB 3FYIB 3AG1B 4JTCB 4LC1A 2YSUB 5KA5A 1Q7YW 1NR7A 4DO2A 1K7DA 1OHHG 1P7BA 3JYCA 3CCVV 3GB7C 4U7OA 3ZN0A 5EC1C 2XAQA 2DQ0A 4WFGA 4WFBV 2JEXA 3SYQA 5KA6A 3JD0A 3OUFA 4E2LA 2R9IA 4LP8A 2WLMA 3T1CA 1BHBA 1NQTA 4J9YB 1V54B 2WLHA 1KQSU 4MTFA 4TWKA 1F51A 2WLJA 4MVUA 4J9ZB 1ZWIC 3SYOA 3DTUB 1DF5A 2W0FC 2X7RB 3RW0A 3CC4V 4RUFA 4UV9A 3ABTA 3G4SV 5FL7G 3ZRWB 3G6EV 3FYEB 5L3DA 1GM8A 3ABKB 1M90W 2WLIA 1AJQA 1QCEA 2WSSG 2OT5A 1K97A 5B1BC 4P9OA 2YEVA 3ZCCA 1Q86W 3MHHC 1HWYA 4G2KA 1W0JG 2QA4V 3HPLC 2Q68A 4Q20A 2P90A 1GO3F 1GKFA 2JDIG 2ZR3A 1AI7A 3X2QB 4CZZA 3LDCA 3W7UA 3M99B 4RO2A 5IY5B 1L1FA 1QBZA 2EINC 1KC8W 4BW5A 4JPRA 5LHIA 2DWDC 3I55V 1FS0G 1S0VA 2EBOA 3BEHA 3ABMC 3W7TA 4WFFA 1MSWD 2BOBC 2ZDIA 4JYBA 5B3SB 4GX0A 1QLEC 2C2AA 2IJIA 2K1EA 3CCMV 3ZMUA 2EZPA 2EIJB 1AJNA 4PDMA 2HLDG 1M56B 3K08A 1MABG 1V55C 1SETA 2X6AA 4PDVA 3SYCA 4X89A 1YJNV 3OW2U 2ZDIC 3OUSA 1KECA 3STLC 1M57B 2JIZG 2HFEC 3ZMTA 2OCCC 2EIMC 2LP7A 1JX9A 1P4RA 4XDKA 3SPCA 3ETEA 5IYCO 2WLKA 1AJPA 3GWOA 4MW3A 3LSSA 3ETDA 3IGAC 4EKWA 4ZKIA 1YSCA 3QO5A 4LBEC 3ASNC 3FB5C 3A0RA 3K03A 1R3KC 2Q69A 3ABLB 1NKDA 4PELA 4QE7A 2H94A 1UJWB 2HJFC 3ML0A 5B1OA 5E1AC 5LGUA 2OTJV 1GMGA 3ZRVA 1FXKB 2DYRC 1OCRC 2IH3C 3EHBB 4UUJC 3WG7B 2DYSC 3SPIA 3F7VC 2M7WA 4RAIA 3AG4C 5CMUA 1YI2V 1S76D 2ZXWB 4OXSA 3ZIAG 5KUKA 4DXWA 3CMAV 1H8EG 1RPOA 2D3OW 3W7XA 5H6QA 1VQOV 1VQ9V 2KB1A 2V7QG 1AI5A 1NR1A 4ZBMA 4N23A 2HVKC 1NVPB 5L3BA 4R6ZA 1MG1A 4L87A 2Z5UA 5GW7A 3IFXA 4WF9V 5LBQA 4FJCC 4PA3A 1JVMA 2Q6AA 5H9CA 3CC7V 1SERA 1JJ2U 1J95A 1S72V 4KUMA 2EILC 3LDEA 4ASUG 4JGSA 2WWWA 2ZD9A 1EZJA 5CN0A 1FXHA 3I56V 1OCOC 1VQ6V 3D3IA 1CPYA 2QM7A 2Y48A 5LHHA 2IJKA 3OFNG 3AEIA 1N8RW 3CCRV 3OAAG 2GHYA 2WLIB 1COWG 3CCSV 2ATKC 4F4LA 3AG2B 1F4NA 3E8FA 1DF4A 3JD4A 3P32A 4P30A 1RPRA 4RQFA 2YEVB 3K9AA 1G4YB 1AR1B 3G71V 1OCZC 4GX5A 3SJQC 2P67A 4JYCA 1EBOA 3CYOA 3HB3B 3OEHG 1GTOA 1F23A 2QKSA 1K5SA 4G27B 4UV8A 1K9MW 1K4CC 1XL4A 4G28B 1LNQA 1WPXA 1QVFU 3K04A 1CP9A 3W7WA 3EFFK 2EZOA 3SYPA 3BY6A 5DN6G 4GX1A 3MHSC 2QE7G 2DQ3A 1NH2D 3DGEA 4GCZA 1H38A 4JTAB 3UM7A 1DLBA 4QNHB 1AI4A 2NLJC 5B1AB 5CBFA 5B1NA 2UXXA 2XAFA 3FB7C 1EFRG 3ASNB 3JCZA 4Z1MG 4WFAV 3OR7C 2B1GA 1GM7A 2WPDG 3ZMSA 4PA7A 2X6BA 3QO7A 3PJSK 3CP1A 3OMIB 1BMFG 1KP2A 3OM3B 1K73W 1OCRB 3ZRWA 2PI5A 3CCLV 4UVBA 2DYSB 3AG4B 2F43G 2W6IG 2MK3A 2A79B 4X8AA 3LSQA 3E83A 3CCQV 3ASOC 4PDRA 1R3JC 2UXNA 1RM1B 1GM9A 1H8HG 4R7CA 4XDLA 1YTFD 1K33A 3OEEG 2V1DA 4MS2A 2ITDC 4PA6A 3E86A 2JJ1G 1KKDA 4MTXA 1Y4MA 2AHYA 1OZ0A 3JD3A 3AG3C 3OMAB 3K79A 3TETA 2Z3YA 5EK0A 4MT8A 1QLNA 3B8MA 5BZBA 1S5HC 1G8MA 2QM8A 2R9RB 4QPKA 3K06A 3LUTB 2BOCC 3QNEA 2HVJC 4MSWC 1VQPV 4R50A 3T4DA 2IU0A 1OCOB 5CBGA 1FFTB 4MVSA 1XL6A 3SYAA 1YTFB 1ORQC 3TCUA 1PKXA 1M56C 1DTOA 2IW5A 2W6JG 2XAJA 3E8BA 3ZRXA 4JAVA 4H33A 1R6NA 5LHGA 1M57C 3K0DA 3CCUV 4UXNA 3FB6C 2A9HA 1YJWV 4FPPA 4QE9A 3T2MA 1S3JA 3K3WA 5LGNA 2DW4A 1B6QA 1ENVA 1SZTA 3LNMB 1NVPD 5L3CA 2FTKA 4UVCA 5CA3A 1K5QA 4JF3A 4N21A 3OGCC 3E35A 2B1IA 1SRYA 2P6JA 4P2ZA 5B1BB 2LFSA 5KUMA 1OCCC 4XDJA 1JQ0A 3ZRSA 2IJJA 2JK5C 3R65A 4FMTA 4MTOA 3UKMA 5C93A 2EIKC 3MD0A 4I9WA 2EINB 3WG7C 1E1RG 1W0KG 2X0LA 3P30A 3ZJZA 4HYOA 1NBMG 3JD2A 3WFVA 5L3EA 2ZXWC 5IYBO 2HKOA 3ABMB 4XBFA 5DM6V 1I5XA 3B77A 3E8GA 5J9PC 1I5YA 3CD6V 1S77D 1QLEB 2WLLA 1Y66A 1THZA 2Y69C 1YHQV 4QPJA 1PD3A 3E8HA 1QVGU 5EBMC 4JASA 1V55B 2HR3A 3K0GA 4I5SA 2X6CA 1JOYA 2ITCC 2OCCB 1VQNV 2CK3G 2EIMB 5HFMA 1QR8A 2XAGA 1PNMA 3AG1C 4PA4A 3ZMZA 1KD1W 1R3LC 3ASOB 2ZQMA 2WAMA 1NH2B 1F4MA 3H01A 4MVQA 4JAUA 4WFHA 4BAYA 4TT3G 1ROPA 3CC2V 3VBBA 4QIWF 1QR9A 2WLNA 2QTOA 3SPJA 3ZN1A 4CBCA 4JTDB 1JCHA 3ABUA 1GK9A 1AROP 3CCJV 4LCUC 1Q81W 3JD1A 2A0LA 3E89A 3OMNB 2DYRB 1V54C 1K4DC 4MTGA 3AG3B 4KFMA 1BHAA 2LFRA 3AG2C 4MVZA 1R3IC 2XASA 2ZR2A 1AI6A 4H37A 3CXCU 1E1QG 5LGTA 3FKSG 3LDDA 1WLEA 1W2BU 1VQMV 1R73A 1VQ5V 2IU3A 3SPGA 4HZ3A 1PNLA 1M9NA 2OTLV 3ABKC 3ETGA 1YITV 3OE7G 4BIZA 2B5UA 1SESA 3OR6C 2Q67A 4KP4A 1PL0A 4RQEA 1KP3A 2P7TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFL A;  2EZO A;  1Y4M A;  3B8N A;  3MHS C;  4FJC C;  5HFM A;  1MOF A;  1QR8 A;  1DF5 A;  2LP7 A;  3M99 B;  1DF4 A;  1DLB A;  1QBZ A;  2X7R B;  5H9C A;  5KA5 A;  2MK3 A;  2M7W A;  3P30 A;  4JPR A;  3B8M A;  3K9A A;  5CMU A;  3GWO A;  3WFV A;  1ENV A;  1SZT A;  4FIP C;  2EBO A;  4FK5 C;  1EBO A;  1I5X A;  3H01 A;  1K34 A;  4JGS A;  3CYO A;  3B77 A;  5CN0 A;  1I5Y A;  4JF3 A;  4N21 A;  1K33 A;  1F23 A;  1QR9 A;  5KA6 A;  1QCE A;  1Y66 A;  2OT5 A;  4N23 A;  2P6J A;  4E2L A;  3CP1 A;  2EZP A;  1MG1 A;  3MHH C;  1JQ0 A;  1JPX A;  4G2K A; 
#chains in the Genus database with same CATH topology
 2LGW A;  2JS3 A;  2DWE C;  3CCE V;  4RUE A;  3C3S A;  4MW8 A;  3X2Q C;  4LFB O;  5B1A C;  4LFA O;  4HAM A;  1JJO A;  3CME V;  3E2E A;  4IIJ B;  5LMU O;  5EBW C;  4WFE A;  4YIO A;  1Q6U A;  2EIJ C;  4PA9 A;  4OPH A;  5L3G A;  3F5T A;  1EN6 A;  1SQX H;  1MOF A;  3JAR B;  4GT1 A;  3JAW A;  1QU7 A;  5IDJ A;  2QWQ B;  2PI4 A;  1VQ8 V;  3CS5 A;  4CS3 A;  4GX2 A;  5AG2 A;  1EZV H;  2Y69 B;  1M1K W;  1N36 B;  4TV9 A;  3T4Z A;  2XND G;  3IC7 A;  4DV0 B;  2ADP A;  4X88 A;  5EYP A;  2GSM B;  3BA8 A;  5HFL A;  4L8J A;  4I55 A;  5LOV A;  2UXC O;  2JS5 A;  4U3J A;  4I0X A;  1SZX A;  1W59 A;  2F23 A;  1NR7 A;  1P7B A;  4EFE A;  2ZIO A;  5LP6 A;  1BQZ A;  4JI6 B;  4WFB V;  4J41 A;  1Z5V A;  2WLM A;  1BHB A;  1IBL B;  4J9Y B;  4MTF A;  4E4E A;  4TWK A;  3L71 H;  1F51 A;  4MVU A;  4LF8 O;  3SYO A;  2W0F C;  2X7R B;  5IJ0 B;  1GN2 A;  4RUF A;  5FL7 G;  3G6E V;  2UXD B;  1DGS A;  4IL6 Z;  1YF2 A;  3FYE B;  2WLI A;  4QGP A;  1K97 A;  2CGN A;  3MHH C;  4AHC A;  1HWY A;  5JH7 B;  2UUC B;  3HPL C;  2Q68 A;  1GO3 F;  1GKF A;  1BS3 A;  4HNA B;  1AI7 A;  3X2Q B;  3W7U A;  3NR7 A;  1L1F A;  2BTO A;  4LFC O;  5IJ9 B;  4EB6 B;  2FB5 A;  2UUA B;  3CJH A;  4WFF A;  1MSW D;  4JYB A;  1XMQ O;  2K1E A;  3RGB A;  3CCM V;  2EIJ B;  1N33 O;  4FM0 A;  1AVM A;  1M56 B;  4X89 A;  2AXT Z;  4O4J B;  2HFE C;  3SJB C;  5IYC O;  3SPC A;  2WLK A;  2GV9 A;  4MW3 A;  3LSS A;  4NXM B;  2A7W A;  3QO5 A;  4LBE C;  2XHB A;  5FNV B;  1WP8 A;  1VF6 C;  1EM1 A;  4QE7 A;  1UJW B;  2Q8V A;  4X1Y B;  3G67 A;  5F2V O;  3DXR B;  2NN4 A;  3H1L H;  4LFB B;  4LFA B;  1Y76 B;  2DYS C;  3JAL A;  2Q9L A;  4DV1 O;  2ZXW B;  4OXS A;  5LMU B;  4X20 A;  1H8E G;  3W7X A;  3TXS A;  1VQO V;  1XNQ O;  1AI5 A;  2N05 A;  4ICG A;  1Z5W A;  1TGO A;  2ETN A;  5GW7 A;  5B66 Z;  3ZHV A;  2GUZ B;  1VAR A;  3JSL A;  1JVM A;  2PY5 A;  2LW7 A;  1J95 A;  4CC6 A;  1S72 V;  2CH7 B;  2YID A;  3HKB A;  3E22 A;  4W4L A;  2WWW A;  2ZD9 A;  3BAB A;  4NXN O;  4DR5 O;  1EZJ A;  5CN0 A;  4UCT A;  2LW1 A;  3K58 A;  2Q0O C;  1KBH A;  2QM7 A;  2UXC B;  3AEI A;  3O9O A;  3CCS V;  1HNX O;  2VQF O;  4O4L B;  3RN4 A;  1DF4 A;  3K9A A;  1G4Y B;  1OCZ C;  1NU1 H;  4JYC A;  4DR7 O;  1G6U A;  3QG5 A;  3OEH G;  1WAZ A;  1F23 A;  1LNQ A;  1QVF U;  3W7W A;  2CTR A;  1PV0 A;  3SYP A;  4LF8 B;  1YEW A;  2VS0 A;  3MHS C;  2ZKO A;  3DGE A;  1ZL8 A;  4QNH B;  3N2G A;  3DC5 A;  4NTX A;  2QKA A;  2XTA A;  4ZOL A;  2WPD G;  3ZMS A;  4DK0 A;  1J5E O;  3C3T A;  3OM3 B;  1XIL A;  1K73 W;  1BZK A;  5LMN O;  1XMO O;  2PI5 A;  2LO1 A;  2DYS B;  4LFC B;  2A79 B;  4Q6G A;  1R3J C;  2UXN A;  1H8H G;  5C8Y A;  5BMV A;  1K33 A;  1Q3E A;  1OJH A;  4LF4 B;  1N33 B;  2VQE O;  4JYA O;  2CE4 A;  2V1D A;  5BR8 O;  2ZT9 B;  4ZHQ A;  4UCV A;  2AHY A;  1JMK C;  2EX3 A;  3AG3 C;  2Z3Y A;  2FL4 A;  3QTC A;  4MT8 A;  1SQF A;  2AGA A;  3K5O A;  1HW7 A;  1VQP V;  3T4D A;  2IU0 A;  4J80 A;  3RYF A;  1M5I A;  1FFT B;  4B08 A;  4B3S O;  1HNZ O;  1BT8 A;  2WA3 A;  1WB8 A;  3HKD B;  3L72 H;  1AP5 A;  4IT5 A;  2XAJ A;  2YDE A;  1RSO B;  3ZRX A;  2ZM6 O;  1M57 C;  3K0D A;  4UXN A;  4DV1 B;  3FB6 C;  2A9H A;  4FPP A;  3K3W A;  4YHH O;  3LNM B;  1NVP D;  5L3C A;  5CA1 A;  4WBN A;  1XNQ B;  1IXB A;  4NVP A;  4AQY O;  2W0X A;  1SRY A;  5B1B B;  1OCC C;  2RN9 A;  1H2M A;  2JK5 C;  1LUV A;  3IC9 A;  4KXR A;  2EIK C;  2RJZ A;  5IT9 N;  2HP8 A;  2QJ1 A;  2X0L A;  3P30 A;  3ZJZ A;  4YIP A;  1YXB A;  1NBM G;  5L3E A;  4NXN B;  4DR5 B;  3ABM B;  4X66 O;  1V9P A;  5DM6 V;  4DV4 O;  4DUY O;  3CD6 V;  2QWN B;  5IWA O;  3E8H A;  4UCR A;  3SR2 C;  1QQC A;  3ICX A;  3O65 A;  3K0G A;  2VQF B;  3T1Y B;  3RWR D;  3FAV A;  2OCC B;  4DR2 O;  1AIL A;  2XAG A;  1PNM A;  3AG1 C;  4DR7 B;  1JFF A;  2WAM A;  1F4M A;  3H01 A;  4CH4 A;  3UT5 B;  3JAT A;  1Q90 D;  1SC5 B;  3CC2 V;  5KHH A;  2LJ2 A;  2ZNJ A;  3ZN1 A;  1JCH A;  3OT7 A;  1ARO P;  3CCJ V;  3E89 A;  3OMN B;  4ZIB A;  2DYR B;  2QWO B;  1WN7 A;  3B2E E;  4GKJ O;  3AG3 B;  3AG2 C;  4MVZ A;  4H37 A;  3FKS G;  1WLE A;  3CSX A;  4HZ3 A;  3WB2 A;  1PNL A;  5EIB D;  2OCH A;  3BVO A;  3OE7 G;  4BIZ A;  3OR6 C;  1SES A;  1Q43 A;  1J5E B;  4KP4 A;  4RQE A;  3JAK A;  5LMN B;  2P7T C;  4UCS A;  2RMK B;  5CBH A;  5IYZ B;  3U10 A;  2XOK G;  4LR3 A;  4DR4 O;  2GBO A;  2BTQ A;  3RYI A;  3D36 A;  1CEZ A;  2IJH A;  4IHJ B;  4TSF G;  2VQE B;  4JYA B;  5B3S C;  5BR8 B;  1OCC B;  4MVR A;  4X62 O;  2Y0I A;  3OTO O;  1FPO A;  4FLT A;  1YIJ V;  5EZY B;  2XT9 A;  4YXW G;  4LWS A;  2EIK B;  5EBL C;  1VQK V;  3RBZ A;  1K3E A;  2ZCE A;  4LF7 O;  3HKE B;  4X1K B;  1FAF A;  1FXK A;  1RM1 C;  1VQ4 V;  2P22 C;  4B3S B;  1HNZ B;  3ABL C;  4UB6 Z;  4WCE V;  3F5W C;  4FFB B;  3CB2 A;  2ZM6 B;  4X64 O;  3QO8 A;  4I4T A;  2GTA A;  3FYI B;  3AG1 B;  2CDY A;  2O57 A;  2YSU B;  4YHH B;  5KA5 A;  3P3P A;  1OHH G;  3JYC A;  3CCV V;  1SQQ H;  3GB7 C;  3BCC H;  3JSN A;  4U7O A;  3ZN0 A;  4AQY B;  5EC1 C;  1IDS A;  2DQ0 A;  2JVD A;  3RYH B;  4LP8 A;  1QNM A;  3T1C A;  4JYY A;  5LP6 C;  4DRX A;  1ZWI C;  1I08 A;  4D7T A;  4PI0 A;  1TUB B;  3RW0 A;  3CC4 V;  4X66 B;  4DV4 B;  2A06 H;  4DUY B;  3ABT A;  3G4S V;  3ZRW B;  1GRJ A;  5IWA B;  2HEP A;  2R9A A;  1H2K A;  2WSS G;  4LF6 O;  3OTF A;  2F95 B;  5LXT A;  1W0J G;  2QA4 V;  4Q20 A;  4DR2 B;  1WA8 A;  2ZR3 A;  3THO A;  2FKX A;  4CZZ A;  2ILM A;  1PP9 H;  1QBZ A;  2EIN C;  1NTZ H;  4K3A A;  5LA6 A;  3GVM A;  4JPR A;  4BW5 A;  1FS0 G;  3LNN A;  2Y4T A;  3BEH A;  1VEW A;  5B3S B;  4GX0 A;  2JRI A;  1QLE C;  2C2A A;  2IJI A;  3ZMU A;  1AJN A;  4PDM A;  4DV2 O;  4FZ0 A;  4GKJ B;  1I94 O;  3K08 A;  1V55 C;  4PDV A;  3SYC A;  1YJN V;  1U96 A;  3H1I H;  3OUS A;  3STL C;  4DUZ O;  2JIZ G;  3ZMT A;  3K9S A;  3ETE A;  3N2K A;  3ETD A;  1QHT A;  4ZKI A;  1YSC A;  3ASN C;  2EJ7 A;  3K03 A;  1R3K C;  3ABL B;  1NKD A;  2H94 A;  2HJF C;  1KB9 F;  1NZ6 A;  1GH6 A;  1BSM A;  1PM9 A;  2EUL A;  3ZRV A;  4DR4 B;  4AIL C;  4TUY A;  3N27 A;  2F66 C;  4UUJ C;  3UCS C;  3WG7 B;  5GTI Z;  1YI2 V;  1S76 D;  5EYP B;  5KUK A;  4DXW A;  3CMA V;  2D3O W;  5LOV B;  4DV3 B;  1AR4 A;  1FFX A;  4U3J B;  4X62 B;  1NR1 A;  4I0X B;  4ZBM A;  4N23 A;  3OTO B;  2HVK C;  4PI2 A;  5L3B A;  4PHZ A;  2KG7 A;  5GON A;  3IFX A;  1NS1 A;  4IIJ A;  3TXQ A;  1VP7 A;  1D2D A;  2Q6A A;  4YY3 B;  4LF7 B;  3J81 N;  4OGQ B;  3ZX6 A;  1R1B A;  2EIL C;  3LDE A;  4ASU G;  3K59 A;  2L35 A;  4YJ2 B;  1ZTE A;  1F7Y A;  1PPJ H;  1CPY A;  2DMX A;  4X64 B;  5LHH A;  2IJK A;  3OAA G;  1SA0 B;  2GHY A;  2WLI B;  1COW G;  2PUS A;  1F4N A;  3IAY A;  5J2T B;  4TV8 B;  1WNS A;  3SJQ C;  3CYO A;  3HB3 B;  1WJZ A;  2N04 A;  1K5S A;  4G27 B;  1XL4 A;  1N34 O;  1VF7 A;  3CJH B;  4J7J A;  1PL4 A;  2DQ3 A;  4GCZ A;  4EEQ A;  1H38 A;  1KUQ A;  5A2Q N;  5B1A B;  5CBF A;  3FB7 C;  1TVK B;  3ASN B;  4FFK A;  3JCZ A;  4Z1M G;  4O2A B;  4NYK A;  1KYO F;  1HNW O;  4F6R B;  4LF6 B;  3CXH F;  3DC6 A;  3OR7 C;  4IYH A;  3OMI B;  5KHI A;  1GAX A;  3CCL V;  3L74 H;  2YC0 A;  4NB5 A;  1GM9 A;  3RT3 C;  5JH7 A;  5IE9 A;  4HNA A;  3ZBH A;  5KX5 A;  3JAL B;  4KHP O;  3OEE G;  1D5N A;  3FD9 A;  1KKD A;  4DV6 O;  4X20 B;  4EB6 A;  4MTX A;  4DUZ B;  1Y4M A;  3QF7 A;  3TET A;  5EK0 A;  1QLN A;  2QM8 A;  2QGN A;  4FLZ A;  2BOC C;  2IM9 A;  3QNE A;  4DR1 O;  4R50 A;  1YZB A;  2ZE5 A;  4DW0 A;  4MVS A;  1XL6 A;  3SYA A;  1YTF B;  2E3C A;  3HKB B;  3H1H H;  3E22 B;  5FNV A;  2UUB O;  3E8B A;  1XDC A;  4BW9 A;  4QE9 A;  3T2M A;  1IBK O;  1B6Q A;  1ENV A;  1SZT A;  3DXR A;  4JI7 O;  4UVC A;  4IGG A;  4N21 A;  2PTM A;  4PD4 F;  3OGC C;  4P2Z A;  1Y76 A;  2P6J A;  5CB4 B;  2LFS A;  2DOS A;  1JQ0 A;  4O4H A;  4JI3 O;  3R65 A;  4ZI7 B;  4C7U A;  3MD0 A;  4I9W A;  4B3T O;  2QTS A;  3P3N A;  3JCU Z;  5IYB O;  5DED A;  2HKO A;  1KKC A;  1I5X A;  3B77 A;  2M6Y A;  5J9P C;  1S77 D;  3ZED A;  2WLL A;  3MDS A;  2OYQ A;  2DJV A;  3H9V A;  4O2B A;  1Y74 B;  1FD9 A;  4OPA A;  1ZX3 A;  1XHX A;  1KD1 W;  2JGD B;  4I50 B;  2HJD A;  3VBB A;  4O4L A;  2QTO A;  4JTD B;  5J2U A;  1UPG A;  2A0L A;  1KU9 A;  4O4I A;  5C8Y B;  3M7M X;  2F4V O;  5BMV B;  1FJG O;  2FML A;  4RWU A;  1M93 A;  1R3I C;  2XAS A;  2ZR2 A;  3LDD A;  1W2B U;  1VQM V;  1R73 A;  4I9Q A;  2IU3 A;  1XMQ B;  4GLX A;  1M9N A;  2ZE7 A;  3ABK C;  1HR0 O;  4TOI A;  5KAF Z;  1NT2 B;  1I7F A;  5KAI Z;  1L0L H;  4UVA A;  5IYD O;  2KQX A;  1MA1 A;  3F7Y C;  4LNU A;  4EFB A;  1YJ9 V;  2AHZ A;  3H1J H;  3ZHR A;  1AR5 A;  4DW1 A;  2YXL A;  4KHP B;  3K57 A;  3W7S A;  4JI2 O;  4DV6 B;  5TIS Z;  3BA9 A;  2HG5 C;  3AK3 A;  1VMG A;  4JI0 O;  3CPW U;  3RVY A;  5EIB C;  4FLW A;  1K92 A;  2OWO A;  3D36 C;  3FB8 C;  4J7K A;  2P06 A;  4MVM A;  2ODM A;  2E5L O;  4IYI A;  3STZ C;  2BE3 A;  4R8C A;  2JEU A;  1BL8 A;  3VOU A;  4DR1 B;  1OCZ B;  2RNB A;  3KG2 A;  5KHJ A;  3A2F A;  1FYJ A;  1FXV A;  3ZHT A;  1Q82 W;  4JV5 O;  1JA8 A;  2NNU A;  5K1P A;  4PDL A;  4K8Z A;  1VQ7 V;  2EJR A;  1E79 G;  3KKY A;  2UUB B;  1JPX A;  1XEQ A;  3OD4 A;  4U7N A;  1FXK C;  1Q6H A;  4LC1 A;  1IBK B;  1SQG A;  4FZ1 A;  1Q7Y W;  2AZ0 A;  5LL6 Y;  4DO2 A;  4JI7 B;  3HKD A;  1BGY H;  2XAQ A;  4WFG A;  1RSO A;  1VF5 B;  4B7E A;  4BR6 A;  3OUF A;  4JI3 B;  5JCO C;  2WLH A;  1IUR A;  3JAT B;  1HNX B;  4J9Z B;  3I5D A;  4CS4 A;  4B3T B;  1DF5 A;  4I7Z B;  3B4S A;  3CRR A;  4UV9 A;  4UCU A;  1P84 F;  3KCY A;  3SGI A;  3ABK B;  1M90 W;  2XUM A;  3AK1 A;  3D3Q A;  2OT5 A;  3CRQ A;  4P9O A;  2BSK A;  2YEV A;  2VWJ A;  2YXY A;  1CXZ B;  4CH5 A;  1WB7 A;  3A0B Z;  5CA0 A;  4G2K A;  2JDI G;  3WU2 Z;  2F93 B;  2UU9 O;  2PGG A;  1KC8 W;  3JAK B;  5LHI A;  2Y4U A;  5JQG B;  2PZS A;  2BOB C;  2ZDI A;  2BTQ B;  3RYI B;  2EZP A;  2BCC H;  2F4V B;  3T1H O;  1GN4 A;  3RFR A;  1XMO B;  1FJG B;  1MAB G;  1SET A;  3UT5 A;  1M57 B;  2EIM C;  4UB8 Z;  5BXZ A;  4XDK A;  5JVD A;  2CAZ C;  3GWO A;  3IGA C;  4EKW A;  4X1I B;  4PV1 B;  2QWP B;  2E76 B;  2CGO A;  2CTW A;  1IVS A;  4PEL A;  4OX9 O;  5LGU A;  1MZF A;  1GMG A;  1FXK B;  3IJ4 A;  3Q4H B;  1IZ3 A;  3EHB B;  4LF9 O;  2M7W A;  3AG4 C;  2YXH A;  3SJA C;  1RPO A;  5H6Q A;  3R66 A;  5IYZ A;  1VQ9 V;  1BQ0 A;  4JI2 B;  4GKK O;  2V7Q G;  4JI0 B;  1N36 O;  4R6Z A;  4FLV A;  1SQV H;  2ZIM A;  2Z5U A;  4DV0 O;  1B3Q A;  1RFY A;  2E5L B;  4IHJ A;  5LBQ A;  4FLU A;  4FJC C;  4DR3 O;  4YJ3 B;  3CC7 V;  1LR1 A;  5LYJ B;  3BHP A;  4AI8 A;  5JCO A;  4KUM A;  2GDS A;  4JGS A;  4JV5 B;  5GTH Z;  1FXH A;  3I56 V;  3CRM A;  2CTQ A;  2QR4 A;  1XOU A;  1GN3 A;  1NI8 A;  3HKE A;  2Y48 A;  3OFN G;  3CCR V;  4F4L A;  3AG2 B;  2ZIN A;  3JD4 A;  3P32 A;  4RQF A;  4DR6 O;  2YS8 A;  5BY1 A;  1YVW A;  5ITZ A;  4CS2 A;  3ZHS A;  2Z0A A;  2QSA A;  2AW9 A;  1MMM A;  2QKS A;  4UV8 A;  1K4C C;  4G28 B;  5LA6 B;  1WPX A;  3EFF K;  2EZO A;  3BY6 A;  4DK1 A;  4ABM A;  1XQ8 A;  5KHG A;  1A32 A;  4GX1 A;  1WP7 A;  3VQY A;  1NH2 D;  2R70 A;  4JTA B;  3UM7 A;  3RYC B;  1OV9 A;  1AI4 A;  3RYH A;  4JZG A;  2ADQ B;  2G38 A;  1EFR G;  3L70 H;  1XBL A;  1JR9 A;  2B1G A;  1GM7 A;  1YDX A;  4Z2W A;  1TUB A;  2X6B A;  3PJS K;  1BMF G;  1KP2 A;  3ZRW A;  4K8X A;  1N0J A;  2UU9 B;  2FYU H;  2F1M A;  1M4U A;  2Y0P A;  3AG4 B;  2W6I G;  1AP6 A;  4J10 A;  4GUN A;  1SF9 A;  3JAS A;  4B7K A;  3E83 A;  3CCQ V;  3ASO C;  3HKC A;  2YI9 A;  1RM1 B;  5KMG A;  4R7C A;  4LF5 O;  4XDL A;  1YTF D;  2R72 A;  3JAW B;  4TQD A;  4MS2 A;  2ITD C;  3J7A U;  2UXB O;  2PYJ A;  1FFX B;  1OZ0 A;  2QWR B;  2MW2 B;  4JI8 O;  5KLV H;  3OMA B;  2KG7 B;  4TV9 B;  4H44 B;  5GON B;  1G8M A;  2R9R B;  4QPK A;  3K06 A;  2Q7E A;  3LUT B;  4MSW C;  4I55 B;  4OX9 B;  1O9H A;  4J42 A;  4BIO A;  2A3Q A;  1PKX A;  5LP6 B;  1M56 C;  1XUQ A;  1DTO A;  4JAV A;  4H33 A;  4LF9 B;  4JI5 O;  3L75 H;  1YJW V;  3CE2 A;  1S3J A;  2DW4 A;  2OIG A;  4J7Z A;  4GKK B;  1K5Q A;  3BRC A;  2RQ6 A;  3E35 A;  3JAR A;  2B1I A;  5KUM A;  1O9G A;  4XDJ A;  3CWB H;  5H5N A;  3EVK A;  4FMT A;  4DR3 B;  1ZAU A;  5C93 A;  2EIN B;  3K5L A;  1MZE A;  1W0K G;  3JD2 A;  2ZXW C;  4XBF A;  4X9Q A;  3JAM N;  4B3M O;  1N32 O;  2PYL A;  1QLE B;  1Y66 A;  1N0N A;  1THZ A;  4D6T H;  3S3X A;  2VRZ A;  4QPJ A;  3KZI Z;  4JAS A;  1V55 B;  1BE3 H;  2YIA A;  2X6C A;  1JOY A;  4DR6 B;  5HFM A;  4YJ2 A;  1QR8 A;  1XHZ A;  2CTP A;  2Q73 A;  1R3L C;  3ASO B;  2ZQM A;  3B09 A;  4FLY A;  3UO2 A;  1TA8 A;  1SA0 A;  4B3R O;  4WFH A;  1ROP A;  4QIW F;  1QR9 A;  2WLN A;  4FM1 A;  1XI1 A;  1GK9 A;  5J2T A;  4TV8 A;  1Q81 W;  3JD1 A;  5IJ0 A;  1N4C A;  3G80 A;  5JJE B;  3WB1 A;  1V54 C;  2IBZ H;  1SQB H;  4K0K O;  4MTG A;  5KX5 B;  4KFM A;  2LFR A;  4KL1 A;  3CXC U;  1AI6 A;  1E1Q G;  1L0N H;  2RCV A;  2N74 A;  1VQ5 V;  1S5L Z;  3DSQ A;  5DEC A;  4A5U B;  2OTL V;  3ETG A;  2B5U A;  4DV2 B;  4LF4 O;  2Q67 A;  1I0H A;  1TVK A;  1I94 B;  2E75 B;  4O2A A;  5IJ9 A;  3SPH A;  4F6R A;  4QJF B;  3ZMV A;  1R6K A;  1IBM O;  3RVZ A;  3TK1 A;  2H8P C;  5IY5 C;  1K8A W;  2EIL B;  4LF5 B;  1H2L A;  4FK5 C;  1NJI W;  1K34 A;  3FX7 A;  2QEX V;  2JJ2 G;  3AG7 A;  4O4J A;  3ZHQ A;  1Q5O A;  5H2F Z;  5H6R A;  3PN1 A;  2UXB B;  4FVM A;  4U3F H;  3EXA A;  5EC2 C;  2Q7G A;  4W4K A;  2P4K A;  1ZUQ A;  4JI8 B;  3BPZ A;  3S3W A;  2V4D A;  1PNK A;  3NXS A;  2CUG A;  2PF4 E;  2QKC A;  4X1Y A;  1H2G A;  4O4H B;  1S5J A;  4P9P A;  1VQL V;  1IXM A;  4FIP C;  4BIU A;  2YI8 A;  5FPR A;  1TUE B;  5L3F A;  2XAH A;  4GZR B;  4MVO A;  2IH1 C;  4NTW A;  3B8N A;  4JI5 B;  2WLL B;  4JTC B;  1YCI A;  3G6B A;  3CEI A;  4O2B B;  1RP3 B;  1K7D A;  4HBN A;  2GUZ A;  1ZL8 B;  2JEX A;  3SYQ A;  5KA6 A;  1MSD A;  3JD0 A;  3N2G B;  4E2L A;  2R9I A;  1NQT A;  2CH7 A;  1V54 B;  1KQS U;  1X59 A;  1HP8 A;  1NTK H;  1XRE A;  2WLJ A;  1H2S B;  3T1Y O;  4ZOL B;  3DTU B;  5J2U B;  4DV7 O;  1URF A;  5A9G A;  5CB4 A;  4O4I B;  4CH6 A;  4B3M B;  2Q5Z A;  1N32 B;  4ZI7 A;  5L3D A;  1GM8 A;  1Q6I A;  3HR0 A;  1N34 B;  1AJQ A;  1QCE A;  1XNR O;  5B1B C;  4DV5 O;  2E74 B;  3ZCC A;  1Q86 W;  2P90 A;  2QM4 A;  3LDC A;  1B04 A;  3M99 B;  4RO2 A;  5IY5 B;  2DWD C;  1Y74 A;  4ZHQ B;  3I55 V;  1S0V A;  1HNW B;  4B3R B;  2EBO A;  3ABM C;  3W7T A;  3CHX A;  3CRA A;  2KSD A;  1Q8I A;  1FKA O;  3L9D A;  4LNU B;  5JJJ B;  1G1X B;  2P4V A;  4GYC B;  4PJ0 Z;  2JGD A;  5KHK A;  5E79 Z;  2HLD G;  4K0K B;  2L6L A;  2X6A A;  4I50 A;  1VF6 A;  2ZDI C;  3OW2 U;  1KEC A;  2OCC C;  3RYF B;  3UO3 A;  2LP7 A;  1JX9 A;  1P4R A;  3ETQ A;  4H13 B;  1AJP A;  1B06 A;  2LQT A;  4CH3 A;  3J80 N;  3SDL A;  3B40 A;  3FB5 C;  3A0R A;  2Q69 A;  3LSU A;  4X65 O;  3ML0 A;  5B1O A;  5E1A C;  2B9Z A;  2OTJ V;  2DYR C;  5CA1 B;  4WBN B;  1OCR C;  2RDC A;  1IBM B;  2DE0 X;  4NR1 A;  2DN9 A;  2IH3 C;  1P49 A;  1L8D A;  2K9P A;  1Y67 A;  3SPI A;  3A0H Z;  3F7V C;  4RAI A;  5CMU A;  2ZE8 A;  3ZIA G;  2Q0A A;  3A8T A;  3KCX A;  2KB1 A;  1US6 A;  1NVP B;  2JGU A;  1MG1 A;  4L87 A;  1UFI A;  4WF9 V;  5D5Q A;  3D8C A;  2LGQ A;  5JWP A;  1KMI Z;  3ZS8 C;  4PA3 A;  5H9C A;  5JJN B;  1SER A;  4LH7 A;  1JJ2 U;  5D5P A;  4D7S A;  3GWK C;  3FAV B;  5K1X A;  1EN4 A;  1OCO C;  5B5E Z;  2ZNI A;  1VQ6 V;  3D3I A;  1JFF B;  1DK1 A;  4H0L B;  1SS3 A;  1N8R W;  3APO A;  4JAA A;  4FLX A;  2ATK C;  3VQW A;  3E8F A;  4P30 A;  1RPR A;  1VIB A;  2BSK B;  2YEV B;  1AR1 B;  5CA0 B;  3G71 V;  1MNG A;  4GX5 A;  2P67 A;  1EBO A;  1GTO A;  1K9M W;  4JI1 O;  3K04 A;  1CP9 A;  2AZ2 A;  4LH6 A;  3CX5 F;  5DN6 G;  2YIC A;  3MAQ A;  4DV7 B;  2QE7 G;  1SQP H;  1DLB A;  4F6E A;  2NLJ C;  4UFZ A;  3CRC A;  5B1N A;  2UXX A;  2XAF A;  4NKG B;  4WFA V;  2HHH O;  2Q4P A;  4J11 A;  4NTY A;  2D2C B;  1XNR B;  3TJT A;  4PA7 A;  4DV5 B;  1D5A A;  3QO7 A;  3CP1 A;  5JVD B;  1Y6X A;  1OCR B;  3AK2 A;  4JI4 O;  1GN6 A;  1P7G A;  4UVB A;  3ZHU A;  2F43 G;  2WA4 A;  2MK3 A;  4X8A A;  3LSQ A;  3BFR A;  1H2N A;  4PDR A;  4LWS B;  1HR0 B;  1AB3 A;  3L73 H;  4PA6 A;  5JQG A;  3E86 A;  2JJ1 G;  3TGU H;  2P5O A;  2YIB D;  3JD3 A;  1ZSP A;  3BAA A;  3K79 A;  3WB0 A;  1T5E A;  1WPB A;  3B8M A;  3U0Z A;  5BZB A;  1S5H C;  4CC5 A;  1HDJ A;  1EN5 A;  2HVJ C;  4FM2 A;  4I4T B;  4X65 B;  4DV3 O;  1OCO B;  4JZ2 A;  5CBG A;  4TQF A;  4DYL A;  2GTS A;  1ORQ C;  3TCU A;  3UQ8 A;  4X1I A;  2YIB A;  2KKW A;  2W6J G;  2IW5 A;  1R6N A;  5LHG A;  1SKV A;  3CCU V;  2NR5 A;  2H3O A;  2YUA A;  4YY3 O;  5LGN A;  3Q4H A;  2FTK A;  4DRX B;  5CA3 A;  1NTM H;  5EZY A;  1X4T A;  4JF3 A;  4JI6 O;  3U11 A;  3ZRS A;  2IJJ A;  5ITZ B;  4X1K A;  1IBL O;  4K35 A;  1IX9 A;  4MTO A;  3UKM A;  3QVN A;  3WG7 C;  4BWA A;  1E1R G;  1LUW A;  3SJC C;  1R6T A;  5LXT B;  4HYO A;  3WFV A;  4FFB A;  3VQV A;  1WA8 B;  3E8G A;  3M8A A;  1I5Y A;  2UXD O;  1YHQ V;  2Y69 C;  4YJ3 A;  1PD3 A;  1ZLZ A;  2OIE A;  1QVG U;  2VWK A;  5LYJ A;  2Q7H A;  5EBM C;  3OGI B;  3APQ A;  1Z2G A;  2HR3 A;  4I5S A;  2ITC C;  3K5M A;  1VQN V;  2UUC O;  2CK3 G;  2EIM B;  2QDO A;  4PA4 A;  2ZE6 A;  3ZMZ A;  1TAE A;  2ARH A;  1NH2 B;  4MVQ A;  4JAU A;  4JI1 B;  4Z1V A;  4BAY A;  4TT3 G;  2UUA O;  3K5N A;  1U97 A;  3FFQ A;  3SPJ A;  4CBC A;  3ABU A;  3C90 A;  3JAS B;  4LCU C;  3N2K B;  3HKC B;  5KMG B;  1K4D C;  3VQX A;  1BHA A;  5LGT A;  2HHH B;  1BCC H;  3H1K H;  5FLX N;  3SPG A;  4NXM O;  4TUY B;  4UCO A;  5FPO A;  1YIT V;  3RYC A;  3T1H B;  1PL0 A;  4JI4 B;  1KP3 A; 
#chains in the Genus database with same CATH homology
 5CBH A;  3SPH A;  2DWE C;  3CCE V;  4RUE A;  4UVA A;  4QJF B;  5IYD O;  2XOK G;  3ZMV A;  1R6K A;  3F7Y C;  4MW8 A;  3RVZ A;  3TK1 A;  3X2Q C;  1YJ9 V;  2AHZ A;  2H8P C;  5IY5 C;  5B1A C;  1K8A W;  2EIL B;  4HAM A;  4FK5 C;  1NJI W;  3D36 A;  1K34 A;  3CME V;  3E2E A;  1CEZ A;  2IJH A;  5EBW C;  4WFE A;  2QEX V;  4TSF G;  2JJ2 G;  3W7S A;  5B3S C;  1OCC B;  5H6R A;  2HG5 C;  4MVR A;  5EC2 C;  2EIJ C;  3CPW U;  4PA9 A;  3RVY A;  1YIJ V;  5L3G A;  1K92 A;  4YXW G;  3FB8 C;  2EIK B;  1PNK A;  5EBL C;  3NXS A;  1MOF A;  4GT1 A;  4MVM A;  1VQK V;  3STZ C;  4R8C A;  2JEU A;  3RBZ A;  1K3E A;  5IDJ A;  1VQ8 V;  1H2G A;  2PI4 A;  1BL8 A;  4P9P A;  4GX2 A;  1OCZ B;  3VOU A;  1VQL V;  1IXM A;  3KG2 A;  4FIP C;  1FXK A;  1RM1 C;  1FXV A;  1VQ4 V;  4BIU A;  1Q82 W;  2Y69 B;  1M1K W;  2NNU A;  1TUE B;  3ABL C;  4PDL A;  3T4Z A;  5L3F A;  1VQ7 V;  2XND G;  3IC7 A;  2EJR A;  1E79 G;  2XAH A;  4X88 A;  4WCE V;  1JPX A;  4MVO A;  2GSM B;  5HFL A;  3F5W C;  2IH1 C;  4U7N A;  3B8N A;  1FXK C;  3QO8 A;  2WLL B;  3FYI B;  3AG1 B;  4JTC B;  4LC1 A;  2YSU B;  5KA5 A;  1Q7Y W;  1NR7 A;  4DO2 A;  1K7D A;  1OHH G;  1P7B A;  3JYC A;  3CCV V;  3GB7 C;  4U7O A;  3ZN0 A;  5EC1 C;  2XAQ A;  2DQ0 A;  4WFG A;  4WFB V;  2JEX A;  3SYQ A;  5KA6 A;  3JD0 A;  3OUF A;  4E2L A;  2R9I A;  4LP8 A;  2WLM A;  3T1C A;  1BHB A;  1NQT A;  4J9Y B;  1V54 B;  2WLH A;  1KQS U;  4MTF A;  4TWK A;  1F51 A;  2WLJ A;  4MVU A;  4J9Z B;  1ZWI C;  3SYO A;  3DTU B;  1DF5 A;  2W0F C;  2X7R B;  3RW0 A;  3CC4 V;  4RUF A;  4UV9 A;  3ABT A;  3G4S V;  5FL7 G;  3ZRW B;  3G6E V;  3FYE B;  5L3D A;  1GM8 A;  3ABK B;  1M90 W;  2WLI A;  1AJQ A;  1QCE A;  2WSS G;  2OT5 A;  1K97 A;  5B1B C;  4P9O A;  2YEV A;  3ZCC A;  1Q86 W;  3MHH C;  1HWY A;  4G2K A;  1W0J G;  2QA4 V;  3HPL C;  2Q68 A;  4Q20 A;  2P90 A;  1GO3 F;  1GKF A;  2JDI G;  2ZR3 A;  1AI7 A;  3X2Q B;  4CZZ A;  3LDC A;  3W7U A;  3M99 B;  4RO2 A;  5IY5 B;  1L1F A;  1QBZ A;  2EIN C;  1KC8 W;  4BW5 A;  4JPR A;  5LHI A;  2DWD C;  3I55 V;  1FS0 G;  1S0V A;  2EBO A;  3BEH A;  3ABM C;  3W7T A;  4WFF A;  1MSW D;  2BOB C;  2ZDI A;  4JYB A;  5B3S B;  4GX0 A;  1QLE C;  2C2A A;  2IJI A;  2K1E A;  3CCM V;  3ZMU A;  2EZP A;  2EIJ B;  1AJN A;  4PDM A;  2HLD G;  1M56 B;  3K08 A;  1MAB G;  1V55 C;  1SET A;  2X6A A;  4PDV A;  3SYC A;  4X89 A;  1YJN V;  3OW2 U;  2ZDI C;  3OUS A;  1KEC A;  3STL C;  1M57 B;  2JIZ G;  2HFE C;  3ZMT A;  2OCC C;  2EIM C;  2LP7 A;  1JX9 A;  1P4R A;  4XDK A;  3SPC A;  3ETE A;  5IYC O;  2WLK A;  1AJP A;  3GWO A;  4MW3 A;  3LSS A;  3ETD A;  3IGA C;  4EKW A;  4ZKI A;  1YSC A;  3QO5 A;  4LBE C;  3ASN C;  3FB5 C;  3A0R A;  3K03 A;  1R3K C;  2Q69 A;  3ABL B;  1NKD A;  4PEL A;  4QE7 A;  2H94 A;  1UJW B;  2HJF C;  3ML0 A;  5B1O A;  5E1A C;  5LGU A;  2OTJ V;  1GMG A;  3ZRV A;  1FXK B;  2DYR C;  1OCR C;  2IH3 C;  3EHB B;  4UUJ C;  3WG7 B;  2DYS C;  3SPI A;  3F7V C;  2M7W A;  4RAI A;  3AG4 C;  5CMU A;  1YI2 V;  1S76 D;  2ZXW B;  4OXS A;  3ZIA G;  5KUK A;  4DXW A;  3CMA V;  1H8E G;  1RPO A;  2D3O W;  3W7X A;  5H6Q A;  1VQO V;  1VQ9 V;  2KB1 A;  2V7Q G;  1AI5 A;  1NR1 A;  4ZBM A;  4N23 A;  2HVK C;  1NVP B;  5L3B A;  4R6Z A;  1MG1 A;  4L87 A;  2Z5U A;  5GW7 A;  3IFX A;  4WF9 V;  5LBQ A;  4FJC C;  4PA3 A;  1JVM A;  2Q6A A;  5H9C A;  3CC7 V;  1SER A;  1JJ2 U;  1J95 A;  1S72 V;  4KUM A;  2EIL C;  3LDE A;  4ASU G;  4JGS A;  2WWW A;  2ZD9 A;  1EZJ A;  5CN0 A;  1FXH A;  3I56 V;  1OCO C;  1VQ6 V;  3D3I A;  1CPY A;  2QM7 A;  2Y48 A;  5LHH A;  2IJK A;  3OFN G;  3AEI A;  1N8R W;  3CCR V;  3OAA G;  2GHY A;  2WLI B;  1COW G;  3CCS V;  2ATK C;  4F4L A;  3AG2 B;  1F4N A;  3E8F A;  1DF4 A;  3JD4 A;  3P32 A;  4P30 A;  1RPR A;  4RQF A;  2YEV B;  3K9A A;  1G4Y B;  1AR1 B;  3G71 V;  1OCZ C;  4GX5 A;  3SJQ C;  2P67 A;  4JYC A;  1EBO A;  3CYO A;  3HB3 B;  3OEH G;  1GTO A;  1F23 A;  2QKS A;  1K5S A;  4G27 B;  4UV8 A;  1K9M W;  1K4C C;  1XL4 A;  4G28 B;  1LNQ A;  1WPX A;  1QVF U;  3K04 A;  1CP9 A;  3W7W A;  3EFF K;  2EZO A;  3SYP A;  3BY6 A;  5DN6 G;  4GX1 A;  3MHS C;  2QE7 G;  2DQ3 A;  1NH2 D;  3DGE A;  4GCZ A;  1H38 A;  4JTA B;  3UM7 A;  1DLB A;  4QNH B;  1AI4 A;  2NLJ C;  5B1A B;  5CBF A;  5B1N A;  2UXX A;  2XAF A;  3FB7 C;  1EFR G;  3ASN B;  3JCZ A;  4Z1M G;  4WFA V;  3OR7 C;  2B1G A;  1GM7 A;  2WPD G;  3ZMS A;  4PA7 A;  2X6B A;  3QO7 A;  3PJS K;  3CP1 A;  3OMI B;  1BMF G;  1KP2 A;  3OM3 B;  1K73 W;  1OCR B;  3ZRW A;  2PI5 A;  3CCL V;  4UVB A;  2DYS B;  3AG4 B;  2F43 G;  2W6I G;  2MK3 A;  2A79 B;  4X8A A;  3LSQ A;  3E83 A;  3CCQ V;  3ASO C;  4PDR A;  1R3J C;  2UXN A;  1RM1 B;  1GM9 A;  1H8H G;  4R7C A;  4XDL A;  1YTF D;  1K33 A;  3OEE G;  2V1D A;  4MS2 A;  2ITD C;  4PA6 A;  3E86 A;  2JJ1 G;  1KKD A;  4MTX A;  1Y4M A;  2AHY A;  1OZ0 A;  3JD3 A;  3AG3 C;  3OMA B;  3K79 A;  3TET A;  2Z3Y A;  5EK0 A;  4MT8 A;  1QLN A;  3B8M A;  5BZB A;  1S5H C;  1G8M A;  2QM8 A;  2R9R B;  4QPK A;  3K06 A;  3LUT B;  2BOC C;  3QNE A;  2HVJ C;  4MSW C;  1VQP V;  4R50 A;  3T4D A;  2IU0 A;  1OCO B;  5CBG A;  1FFT B;  4MVS A;  1XL6 A;  3SYA A;  1YTF B;  1ORQ C;  3TCU A;  1PKX A;  1M56 C;  1DTO A;  2IW5 A;  2W6J G;  2XAJ A;  3E8B A;  3ZRX A;  4JAV A;  4H33 A;  1R6N A;  5LHG A;  1M57 C;  3K0D A;  3CCU V;  4UXN A;  3FB6 C;  2A9H A;  1YJW V;  4FPP A;  4QE9 A;  3T2M A;  1S3J A;  3K3W A;  5LGN A;  2DW4 A;  1B6Q A;  1ENV A;  1SZT A;  3LNM B;  1NVP D;  5L3C A;  2FTK A;  4UVC A;  5CA3 A;  1K5Q A;  4JF3 A;  4N21 A;  3OGC C;  3E35 A;  2B1I A;  1SRY A;  2P6J A;  4P2Z A;  5B1B B;  2LFS A;  5KUM A;  1OCC C;  4XDJ A;  1JQ0 A;  3ZRS A;  2IJJ A;  2JK5 C;  3R65 A;  4FMT A;  4MTO A;  3UKM A;  5C93 A;  2EIK C;  3MD0 A;  4I9W A;  2EIN B;  3WG7 C;  1E1R G;  1W0K G;  2X0L A;  3P30 A;  3ZJZ A;  4HYO A;  1NBM G;  3JD2 A;  3WFV A;  5L3E A;  2ZXW C;  5IYB O;  2HKO A;  3ABM B;  4XBF A;  5DM6 V;  1I5X A;  3B77 A;  3E8G A;  5J9P C;  1I5Y A;  3CD6 V;  1S77 D;  1QLE B;  2WLL A;  1Y66 A;  1THZ A;  2Y69 C;  1YHQ V;  4QPJ A;  1PD3 A;  3E8H A;  1QVG U;  5EBM C;  4JAS A;  1V55 B;  2HR3 A;  3K0G A;  4I5S A;  2X6C A;  1JOY A;  2ITC C;  2OCC B;  1VQN V;  2CK3 G;  2EIM B;  5HFM A;  1QR8 A;  2XAG A;  1PNM A;  3AG1 C;  4PA4 A;  3ZMZ A;  1KD1 W;  1R3L C;  3ASO B;  2ZQM A;  2WAM A;  1NH2 B;  1F4M A;  3H01 A;  4MVQ A;  4JAU A;  4WFH A;  4BAY A;  4TT3 G;  1ROP A;  3CC2 V;  3VBB A;  4QIW F;  1QR9 A;  2WLN A;  2QTO A;  3SPJ A;  3ZN1 A;  4CBC A;  4JTD B;  1JCH A;  3ABU A;  1GK9 A;  1ARO P;  3CCJ V;  4LCU C;  1Q81 W;  3JD1 A;  2A0L A;  3E89 A;  3OMN B;  2DYR B;  1V54 C;  1K4D C;  4MTG A;  3AG3 B;  4KFM A;  1BHA A;  2LFR A;  3AG2 C;  4MVZ A;  1R3I C;  2XAS A;  2ZR2 A;  1AI6 A;  4H37 A;  3CXC U;  1E1Q G;  5LGT A;  3FKS G;  3LDD A;  1WLE A;  1W2B U;  1VQM V;  1R73 A;  1VQ5 V;  2IU3 A;  3SPG A;  4HZ3 A;  1PNL A;  1M9N A;  2OTL V;  3ABK C;  3ETG A;  1YIT V;  3OE7 G;  4BIZ A;  2B5U A;  1SES A;  3OR6 C;  2Q67 A;  4KP4 A;  1PL0 A;  4RQE A;  1KP3 A;  2P7T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...