4JI7O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji7O00
5BR8O 2UUCO 4JI0O 4OPAA 3RT3C 5A2QN 1J5EO 4LFCO 1KUQA 2UUAO 1N32O 4DV3O 2VQFO 5LL6Y 4DR6O 4LFBO 4JI6O 2DOSA 2N74A 1AB3A 2JRIA 5BXZA 4DV7O 2UUBO 2ZKOA 3J7AU 4DR3O 4A5UB 4LF5O 1FJGO 1D2DA 3M8AA 1HR0O 4OX9O 4JV5O 4LF4O 4OPHA 1IBLO 5LMNO 4DV6O 1XNRO 2E5LO 3R66A 1N33O 4DUYO 4DV0O 3T1YO 3OTOO 3J81N 4LF6O 1XMOO 4DR4O 3O65A 4DR5O 3JAMN 2VQEO 2LW7A 1A32A 3SDLA 1IBMO 4JI5O 1IBKO 4DV1O 4JI8O 2UXDO 1XNQO 4K0KO 4X66O 3T1HO 4JI1O 4DV5O 4DV2O 4GKJO 2UXCO 4GKKO 1DK1A 1HNXO 1R1BA 4X62O 4JI4O 2HHHO 4LF7O 2FKXA 5IWAO 4JYAO 1F7YA 1I94O 4DR1O 1NS1A 4DR7O 4DUZO 4B3TO 4B3SO 1HNWO 4YHHO 2F4VO 4KHPO 1HNZO 4LFAO 4YY3O 4JI7O 4B3RO 4JI3O 1FKAO 1XEQA 4X64O 4LF8O 4JI2O 5IT9N 4AQYO 3F5TA 4X65O 1X59A 1N36O 4DR2O 2DJVA 4LF9O 2UXBO 2Z0AA 1G1XB 3J80N 4NXNO 1N34O 1FYJA 5BY1A 4DV4O 2UU9O 1R6TA 5LMUO 4B3MO 2AGAA 1XMQO 5H5NA 2ZM6O 1YZBA 4NXMO 1AILA 5FLXN
chains in the Genus database with same CATH superfamily
1SS3A 3STLC 4I7ZB 3GWKC 5KUMA 3APOA 1SRYA 2DQ0A 1N0NA 1AJPA 4DXWA 5DM6V 3J7AU 3BFRA 4PDVA 3W7XA 3CRAA 1FJGO 2XHBA 4U7OA 5LMNO 5JCOC 4MVUA 3R66A 1V9PA 4X20A 1FXKA 2WLLB 4EEQA 1ZL8A 1IZ3A 3ZCCA 1AR4A 3ML0A 3QG5A 4KUMA 4CBCA 3ZHRA 5B1NA 2EIKC 3RBZA 3CCVV 1JX9A 2Z3YA 5HFMA 1AJNA 5IJ0B 4GKJO 3HR0A 4DRXB 5LMNB 4X62O 3DSQA 1PNKA 2HEPA 1BL8A 1K73W 5B1AC 3E8GA 4G2KA 4DR7O 4DUZO 3QO5A 1TGOA 2IW5A 4JI3O 2D3OW 1JQ0A 4YY3B 3CCMV 1NKDA 5FNVB 4NKGB 1T5EA 2YS8A 4CC5A 4QE7A 2EJ7A 2LO1A 3K9SA 4IT5A 1ZTEA 2ZCEA 3LDEA 4X62B 5JVDA 4NXNO 2QKCA 3U0ZA 2C2AA 4LF9B 3CD6V 2UU9O 1XL4A 2XUMA 4NXMO 4DUZB 3MHHC 1VQOV 1QR9A 2OTJV 4LFCO 1MNGA 1Z5VA 4JI3B 3QNEA 4JAVA 2JEXA 1SKVA 1WN7A 2ADQB 2DOSA 2QM4A 4DRXA 2EINB 1B04A 4NTYA 3K04A 4NXNB 3M8AA 2UU9B 2YXHA 1JJOA 4GX5A 1HR0B 1E1QG 3ZMZA 5EBLC 2P90A 1G4YB 1M9NA 4Z1MG 1KU9A 3B2EE 5FNVA 4LFCB 4I50B 5IYZA 3J81N 2RCVA 4TSFG 3ABMB 2BOBC 3IGAC 4YJ2B 1JMKC 2QA4V 2Y0PA 2V4DA 1IBMO 3WB2A 4WBNB 2VQEB 3H9VA 5E1AC 3M99B 2F1MA 2PF4E 4X66O 2ARHA 3JARB 3VQYA 5TISZ 1NH2B 4MW8A 3TXSA 2AHYA 3F7YC 4JI1B 3MD0A 3ZHSA 1GN4A 2EX3A 3JALB 1VF6C 4MVOA 4QPKA 4PI2A 2UXXA 2DYSC 5IWAB 1YI2V 2O57A 1H8HG 2YEVB 1IBMB 1GH6A 2WWWA 1XUQA 2P7TC 4B3RB 3HKEB 1K8AW 2FTKA 2QDOA 4PA6A 3TETA 3AG1B 1V54C 2R70A 2CGOA 2R72A 2YI9A 3JAKA 3A0HZ 4I50A 3QF7A 2ZQMA 2K9PA 2CDYA 4YJ2A 1FXHA 3I56V 3CPWU 2ZM6O 3RFRA 5LOVB 1OCOC 3D8CA 2P6JA 4BW9A 1SQVH 2JGDA 1SQGA 4WFHA 1JR9A 3JARA 3DC5A 3OUFA 1HWYA 1XBLA 2QEXV 1IX9A 2JJ1G 3JALA 3CXHF 4PHZA 2XAGA 1JCHA 1LUWA 3K5NA 2H3OA 4R7CA 1MABG 1OCRC 2YEVA 2R9AA 4TT3G 2E5LB 3OTOO 3JCZA 1XMOO 2ZD9A 1KP3A 1U97A 4QPJA 2JVDA 1I5YA 1HP8A 1KC8W 3FB8C 3UT5B 4MVSA 3JD3A 1WJZA 3VQWA 3KCYA 4GKKO 5LOVA 4X1IB 4MT8A 3SYQA 3WB0A 1I7FA 2OIGA 4B3TO 1PNLA 4MW3A 1Y76B 4NB5A 2LFSA 3BHPA 2F4VB 3K0GA 1YIJV 3ZRSA 3CE2A 1KP2A 1R6NA 1Q7YW 1GN6A 2IU0A 4ZBMA 2GUZB 1US6A 4J7ZA 4GKKB 3TXQA 1EZJA 5L3FA 3CYOA 3H1JH 2XAHA 2CUGA 3OM3B 2N05A 3OMNB 3ASNB 1VQLV 4DV4B 2ZE6A 5BR8O 4F6RB 5F2VO 3I55V 3UT5A 1G6UA 1RSOB 2XASA 5EZYB 2DWDC 5K1PA 3AG3B 4BAYA 4X1IA 3PN1A 2W6IG 3LSSA 2F23A 3W7TA 1DF4A 3E22B 4UCTA 3P32A 2WLHA 3BAAA 3ABTA 3L75H 5BR8B 1M57C 1SQXH 1Y66A 2Q9LA 3APQA 4DV0O 2GUZA 2JS5A 1MZEA 4DR4O 1X4TA 2RNBA 1PL0A 1QVFU 1OCCC 3T4DA 1A32A 2VRZA 4CS2A 3ABKB 1K5SA 1QBZA 3ZEDA 1OJHA 4JI5B 4K0KO 3BEHA 5H9CA 3DC6A 1YTFD 4F6RA 5CA3A 3ETDA 2HP8A 4FLTA 3JATB 1GTOA 1RSOA 2CTWA 5EZYA 3ZJZA 2HFEC 4DV0B 2BTQA 1S72V 5EBWC 3E2EA 3JYCA 1V55C 1HNWO 2QJ1A 4DR4B 3N27A 2PUSA 1HNZO 5B5EZ 3JCUZ 4JI7O 2Y69B 5L3DA 4FLUA 4JTAB 4PV1B 3S3WA 4FK5C 5KHHA 5IT9N 4K0KB 5B3SB 4H33A 5KHGA 2WLMA 5H6QA 1K34A 3X2QC 2AHZA 2LP7A 1FD9A 3CCEV 1E1RG 4ZKIA 3OR7C 1OHHG 3QTCA 1EN6A 4B3MO 1KECA 2AGAA 2Q5ZA 1XMQO 1VARA 1S5HC 4MTOA 5LHHA 2DYRB 1HNZB 3IC7A 4LCUC 2Q7GA 4JI7B 4NVPA 3HKCB 1VQ9V 5JJEB 4F6EA 3G71V 1FS0G 1BHBA 4RUEA 1H2NA 4J7KA 4TUYB 2WLNA 1GO3F 3CMAV 1Z2GA 3FD9A 3JATA 4K35A 1WB8A 2YC0A 1COWG 3BVOA 3OEHG 2Y4TA 1R3LC 2B5UA 1O9GA 3E8BA 1SA0B 1QHTA 1IBLB 2F93B 4WF9V 4IIJB 4QE9A 1FXKC 2OTLV 1UPGA 2QSAA 2W0XA 2QWRB 1TUBB 4D6TH 5J2TB 2R9IA 3B8MA 1NI8A 4FFKA 3R65A 4Z2WA 4JI8O 1FPOA 3C90A 3JASB 3P30A 4DV5O 3E8HA 1XDCA 5LHIA 4I9QA 1K9MW 1HNXB 3RYFB 2W0FC 1NZ6A 1FFXB 3E35A 2ZINA 4O4HB 2B1GA 1VQ7V 4TUYA 4DR1B 3TCUA 4UCSA 2QWOB 1JVMA 1OCZB 3WG7B 5KA5A 1K33A 4X65O 1BE3H 2KG7B 3FX7A 1N36O 1YCIA 3SJAC 2DJVA 2X6CA 3D3QA 3SPIA 4IIJA 5IJ9A 1CEZA 5L3GA 3L70H 1W0KG 2OT5A 4LWSA 3L73H 1TUBA 1EN5A 2ZNJA 3ABLB 3JSLA 4QJFB 5KAIZ 4X20B 1TAEA 1MG1A 1MSDA 1Q86W 1ZL8B 1Y6XA 3JASA 1KKCA 1VIBA 2IM9A 2QTOA 5CMUA 1IXBA 3GWOA 3E83A 4X65B 4J42A 2JRIA 3RWRD 4GYCB 1N36B 4N21A 1Q82W 1Q8IA 3E89A 3RYFA 4A5UB 1FFXA 1D2DA 3A2FA 3B40A 4O4HA 1GAXA 1BQ0A 4OPHA 1BQZA 4YIPA 1K97A 3EHBB 2HVJC 3VQXA 2LW1A 4HAMA 3EXAA 4X1YB 3A8TA 5JQGB 4FM0A 4GT1A 1NTZH 5CBFA 5LP6B 3O65A 3W7SA 2KG7A 5KHIA 4O2BB 1M93A 2IJKA 5JH7B 3RGBA 2W6JG 4FLXA 3PJSK 2QR4A 1Y74A 1LR1A 2DE0X 2FMLA 3P3PA 1H8EG 3ASOB 3IC9A 4LR3A 2CTPA 1PKXA 4J9YB 4K8XA 2CGNA 1KBHA 5CA0A 5JVDB 5HFLA 1K7DA 1GMGA 2Q0AA 2QM8A 2XT9A 1I94B 1SF9A 2EINC 4JZ2A 4YY3O 4FM1A 2XNDG 4O4IB 4TOIA 5GTIZ 2PI5A 4JYYA 4I55B 3F5TA 1AI5A 1SERA 5JJJB 4NTXA 2NNUA 3OD4A 3ZRXA 4LF9O 2UXBO 1Y67A 5KAFZ 5DN6G 1G1XB 1Q43A 2PYJA 4MVQA 1M4UA 4X1YA 5JQGA 2GDSA 1S76D 5BY1A 2NLJC 3FKSG 3ABMC 3AK1A 5LP6A 4J80A 1VQMV 4FJCC 5H5NA 3K5OA 4UFZA 1QNMA 3AK2A 4O2BA 4AILC 1Q6HA 5JH7A 2UUCO 4J10A 4CZZA 3U10A 2CAZC 2WLJA 1SQFA 2RDCA 3E8FA 3RT3C 4PA4A 2CH7B 5IYZB 4MS2A 4B08A 2ODMA 1LUVA 3JD1A 3NXSA 2D2CB 5BXZA 1JJ2U 1ZLZA 5LBQA 2UXBB 2QWNB 4UCUA 3ZHVA 1GM7A 4ZOLB 2XAQA 1HR0O 4MVRA 5EIBC 3SYPA 3OAAG 1S5JA 4O4IA 2YIBA 1N8RW 4D7SA 2UUCB 1Q6UA 4TQFA 4XBFA 4I55A 2YI8A 5EBMC 1AP6A 3AG1C 3JAMN 1N4CA 2VQEO 1H38A 4MTFA 5BMVB 1GKFA 2HJDA 4JAAA 4J11A 1WA8B 4JI1O 2EIMB 3RYCB 3CC7V 1RP3B 4CH5A 4U7NA 1BHAA 4JF3A 1WP8A 5DEDA 4G28B 3JAKB 4I5SA 2CH7A 5IWAO 2KB1A 3CCRV 4GLXA 4B7EA 4UVCA 3T4ZA 4YHHO 3TK1A 2Q68A 4B3RO 2ZE8A 1Q90D 2JGDB 1JFFA 4F4LA 4ZOLA 3QO8A 1VQ6V 2GV9A 2YSUB 4DW1A 4IYHA 5LHGA 4RWUA 1O9HA 1TUEB 2ZIMA 2PI4A 1YF2A 4MTXA 4FZ0A 3KZIZ 3SGIA 3LUTB 5A9GA 1YZBA 5L3BA 4ASUG 1KYOF 4YHHB 4WCEV 3SYCA 4KP4A 5BMVA 1EM1A 2CTRA 2MW2B 2UUAO 1N32O 3CEIA 1WA8A 3BABA 2CK3G 3RYCA 1WPBA 2BSKB 1FAFA 4PA7A 1QLNA 2ZT9B 5KA6A 1U96A 3NR7A 4WFEA 4U3JB 2UUBO 2ZKOA 1XI1A 1LNQA 2EULA 2LQTA 4OX9O 1K5QA 3OR6C 2GTAA 1OV9A 3S3XA 4JPRA 4FZ1A 5EC1C 5C8YB 1AVMA 2E5LO 3Q4HB 3EFFK 2BE3A 2Q4PA 1YJNV 2UUAB 1N32B 1YEWA 1I5XA 2OCCB 1EN4A 5CBHA 3QVNA 4DR5B 2ZE5A 5KX5A 2AW9A 2UUBB 3ASNC 1WNSA 4OX9B 3UM7A 4EKWA 2YXYA 5KLVH 4DV2B 4D7TA 2HKOA 4E4EA 4FM2A 4PJ0Z 3SPCA 4RAIA 2VS0A 3RW0A 4JI4B 3IJ4A 4LF7B 2BSKA 3AG3C 2PZSA 2F4VO 1BCCH 4U3JA 2AZ2A 1FKAO 4LFAB 4ZIBA 5FPOA 3K5LA 1GN2A 3RYHB 5D5PA 5ITZB 1P7GA 5B1BC 5C8YA 3VOUA 4FLWA 3Q4HA 1L1FA 5KUKA 1TVKB 3W7UA 2JS3A 1XOUA 4DV4O 4XDLA 4K8ZA 2P06A 3ABKC 3CX5F 1VP7A 3SYOA 4H37A 2Z5UA 2YDEA 4HBNA 1VF7A 1R6KA 2AZ0A 1UFIA 2NR5A 3OE7G 2N74A 5CN0A 1L0LH 4LFBB 3OFNG 1B3QA 3ABUA 3SJCC 2CTQA 1QQCA 2CE4A 1H2KA 1JPXA 2Q69A 2M6YA 1L0NH 3SJQC 1B06A 1QCEA 3K03A 2Y69C 4ZI7B 1XNRO 3FB5C 3K0DA 3RYHA 4Q6GA 2BTQB 5B3SC 5ITZA 1VQPV 3FAVB 3SJBC 4DW0A 2LW7A 4JI5O 1TVKA 3N2KB 3CB2A 3DTUB 5B1BB 4OGQB 3WU2Z 2UXCO 1P84F 2DYRC 4JTCB 3K5MA 1YHQV 3G6BA 1XNRB 4P30A 1SETA 1YSCA 4GUNA 4U3FH 4J9ZB 1PV0A 4X88A 3C3TA 3P3NA 3ZRVA 4JAUA 3KG2A 2RQ6A 3CCSV 3RN4A 4LNUB 4AQYB 4ZI7A 2UXCB 3M7MX 4NR1A 1KMIZ 2HG5C 1GK9A 1R6TA 2KKWA 2WLIB 5LMUO 2E75B 3FAVA 3F7VC 3ZMUA 2QE7G 4PELA 1HW7A 4H0LB 2OYQA 3CC4V 3WB1A 1EFRG 3O9OA 3N2KA 4DV3O 3CRMA 4TV8B 2YIAA 1TA8A 4J7JA 1NTKH 2WPDG 2Q0OC 2IJHA 3EVKA 1K92A 2L35A 3AG4B 3JSNA 4DR3O 2H94A 1MMMA 1WP7A 2VWKA 5LMUB 2ITDC 1RPOA 3AG2B 1IBLO 3OT7A 1OCZC 3DXRA 3H1KH 2QKAA 4LF4B 4GX1A 3WG7C 2XAJA 2HR3A 1N33O 3TGUH 3CCJV 4IL6Z 4XDJA 4DV3B 2P67A 4LNUA 3T1YB 4LF6B 1RPRA 2EIJB 2YXLA 2GSMB 2JEUA 1RM1B 2Q7EA 4JASA 1IBKB 2WLIA 2P4KA 4W4KA 4FLYA 4DR3B 4BW5A 1D5NA 3ABLC 3CHXA 4BIUA 5IJ9B 1HNXO 5IE9A 1I08A 4LWSB 4TV8A 2MK3A 3LDCA 2ZDIA 1N33B 1W2BU 2Q73A 4QIWF 1ORQC 4DR1O 3CC2V 1JA8A 3H1HH 4JYCA 1XEQA 4FPPA 4WFBV 1DTOA 1NVPB 1XHXA 3AG7A 3WFVA 4AHCA 1XHZA 4FVMA 4JI2B 1P7BA 1F4NA 3RVZA 1M56B 4R50A 2R9RB 4TWKA 4IGGA 1QLEB 1YTFB 5LP6C 1UJWB 1FXVA 1WPXA 2QWQB 4BIZA 1PPJH 2V7QG 3FYEB 4X89A 2EBOA 1H2GA 4BIOA 3AK3A 4UCOA 1R3IC 3ASOC 5LL6Y 1J5EB 3W7WA 1SQPH 2X0LA 4RQFA 3N2GB 5J2UA 4DR6B 3LSQA 3F5WC 1M5IA 1Y74B 4JGSA 1YDXA 5IYDO 5EK0A 4L87A 2RMKB 1AI4A 2AXTZ 5CA0B 3D36A 4DV6B 4QNHB 2A79B 3K3WA 3K79A 5C93A 2IJIA 1ENVA 1MOFA 2XTAA 2UXDO 3DGEA 1XNQO 3SYAA 4TV9A 3CRRA 4IHJA 3T1HB 2E3CA 2JGUA 4YJ3B 1F51A 2RJZA 4O4LA 2FKXA 2IU3A 4BWAA 2HHHB 4KFMA 1I94O 4ZHQA 4G27B 3N2GA 3CSXA 1QU7A 4HZ3A 2GHYA 4KHPB 4FMTA 3ZRWB 1SQQH 2UXDB 1XNQB 1VMGA 3LDDA 3RYIA 3D3IA 1AROP 2ZE7A 4J41A 1S0VA 5B66Z 3OEEG 2E74B 1GN3A 2GTSA 3RVYA 2WA4A 3OW2U 4Q20A 2WLKA 3OMIB 2ETNA 4QGPA 2VQFO 2PGGA 3HPLC 2EIMC 1AI7A 4MVZA 1KKDA 2FB5A 3MHSC 4YJ3A 1NH2D 1W0JG 3CXCU 2KSDA 3HKDA 4PD4F 1VQ8V 1NBMG 2JDIG 4LF5O 1E79G 2YUAA 1FJGB 2JK5C 2LGQA 3B4SA 2Q6AA 1VQ4V 5EIBD 2QGNA 3ZRWA 1PNMA 2WAMA 2VQFB 2ITCC 1Q3EA 3STZC 1BS3A 2ZNIA 2WSSG 5CB4B 4Z1VA 1WAZA 4N23A 1PP9H 5KMGB 1H2LA 3JAWB 1JFFB 2WA3A 2EILC 3GB7C 3U11A 1AI6A 2Q7HA 1XQ8A 4DK0A 3ETEA 4LF5B 2EJRA 3HB3B 3L71H 1R1BA 4UB6Z 4GKJB 3ZHTA 2JIZG 2A0LA 2WLLA 1QVGU 1NS1A 1G8MA 2Y0IA 1P4RA 1ZUQA 3OGCC 2P22C 3CP1A 4DR7B 3SR2C 4NTWA 4MTGA 4HYOA 5E79Z 4LF8O 4CH6A 2QTSA 4WFGA 1ROPA 5EYPB 3G67A 4UCRA 5IJ0A 3ZN0A 2FL4A 2EIKB 3CJHB 2HVKC 5LGTA 1B6QA 3OUSA 4ICGA 3K06A 2OCCC 1QR8A 5CB4A 4GZRB 4NYKA 5J9PC 5KMGA 4LC1A 4OPAA 3JAWA 2EZOA 1M1KW 4NXMB 3C3SA 3G6EV 3CRCA 3G80A 1D5AA 5B1AB 1IXMA 2P4VA 1NT2B 4LF8B 3ZX6A 4HNAB 2LJ2A 4IYIA 3ETGA 4I4TB 3CMEV 5KX5B 2HLDG 5FPRA 2EILB 3K08A 4R6ZA 1DLBA 2B9ZA 2G38A 2X6AA 1NJIW 2A7WA 5LYJB 4MVMA 2PTMA 4PA3A 2RN9A 3HKBB 5IYCO 2ZR2A 1K3EA 5JCOA 1PL4A 5FL7G 3THOA 4DYLA 4DUYO 1IURA 4FLZA 5EYPA 5IDJA 4CS4A 1OZ0A 4KXRA 4W4LA 3UQ8A 1VQKV 4DR5O 1KD1W 1KQSU 5GW7A 2QKSA 3CJHA 4P2ZA 1DF5A 4RQEA 1PM9A 3KCXA 4KL1A 4YXWG 1J95A 1M90W 4DV2O 4X66B 4FFBB 5H6RA 5GTHZ 2EZPA 4JI4O 1YITV 1AR1B 4LF7O 1BZKA 4DUYB 4HNAA 1S3JA 3UO2A 1MZFA 3BCCH 1F23A 4LFAO 1MA1A 4I4TA 4E2LA 4WBNA 3B77A 1GRJA 2Y4UA 3CCLV 5LYJA 4B7KA 3HKBA 2DMXA 4X1KB 4DR2O 3K9AA 1NQTA 4UUJC 3L72H 3ZHQA 2Z0AA 4DO2A 4O2AB 4UV8A 1KB9F 4PDRA 3J80N 1N34O 5L3CA 4P9PA 1ZSPA 1YJ9V 2OIEA 1AP5A 2KQXA 4JI0O 2ZM6B 5BZBA 1H2SB 1VF5B 2BOCC 4LH6A 3GVMA 4LH7A 5LGNA 2XOKG 4L8JA 4LFBO 1BT8A 3HKEA 2DYSB 4JI6O 4FFBA 1AB3A 2FYUH 3LNMB 1SQBH 1EBOA 2YICA 3I5DA 2OCHA 2E76B 3CS5A 4DR2B 3ZIAG 4EFEA 3MAQA 4YIOA 5JWPA 4UV9A 3JD0A 1N34B 1K4DC 1URFA 3A0RA 1V54B 4JI0B 4RUFA 5CA1B 3H1LH 3K57A 3OTOB 5KHJA 3BA9A 4X1KA 4JI6B 1XMOB 2DQ3A 4O2AA 1I0HA 1OCOB 1VQ5V 2A06H 4I9WA 2GBOA 4UVBA 1VEWA 3OTFA 4PA9A 2IH3C 3VBBA 2VWJA 1DK1A 2X7RB 1VF6A 3LNNA 2ZDIC 3JD4A 4JYBA 4MSWC 1F7YA 3BPZA 4B3SO 3OMAB 4X9QA 4BR6A 1Q81W 4B3TB 2V1DA 5IY5C 3AG4C 1OCRB 5LA6B 4PDLA 1SZTA 4AQYO 3ZHUA 1ZX3A 1L8DA 2IH1C 4JTDB 3AG2C 4GX0A 3L74H 5EC2C 1NR1A 3UO3A 3FB6C 4UVAA 3B09A 3UKMA 4AI8A 5CA1A 3OGIB 4WFFA 3SPHA 5CBGA 1YVWA 1F4MA 2K1EA 3DXRB 5FLXN 2EIJC 4B3SB 3ZMTA 1Y76A 2X6BA 4LBEC 2F95B 1PD3A 2Q67A 1RM1C 2F66C 2N04A 1BMFG 1DGSA 4DV7O 1NVPD 2DN9A 3CCQV 2DWEC 1RFYA 2L6LA 4JZGA 3ICXA 1GM9A 1YXBA 1XL6A 5B1OA 1NU1H 3G4SV 4JV5O 4LF4O 4PDMA 4GCZA 2QWPB 4WFAV 1W59A 3D36C 5LA6A 2NN4A 5DECA 3T1YO 2JJ2G 4K3AA 4LF6O 2BTOA 4XDKA 3ZS8C 3FYIB 1CPYA 1IVSA 5IY5B 1M56C 4DV7B 1IBKO 1Q6IA 4LP8A 1QLEC 3BY6A 4PI0A 1R3JC 4JV5B 3E22A 2Y48A 4CC6A 1NTMH 1AJQA 5LGUA 3SPJA 3ETQA 3BRCA 3VQVA 3JD2A 3IFXA 3CCUV 1XREA 3H1IH 1CP9A 2IBZH 3L9DA 3LSUA 1XILA 1HNWB 3E86A 4H44B 2H8PC 4OXSA 4X64O 1ZAUA 2LGWA 2M7WA 1M57B 3QO7A 4H13B 4JI2O 4RO2A 4GX2A 1GM8A 2DW4A 5J2UB 1X59A 1H2MA 3MDSA 1OCCB 3B8NA 1SESA 1WLEA 5GONB 1WB7A 1FYJA 5LXTB 4C7UA 2B1IA 1S77D 2ZXWC 1AILA 4B3MB 1XMQB 4X8AA 1Q5OA 5A2QN 1J5EO 1S5LZ 1KUQA 1K4CC 3FFQA 4X64B 2Q8VA 4DR6O 4I0XB 1MSWD 1NR7A 2QM7A 1V55B 3FB7C 2OWOA 5H2FZ 1BGYH 4O4JB 2PY5A 1IDSA 1AR5A 4R8CA 4CH4A 4TV9B 2P5OA 2F43G 3CWBH 4CS3A 4IHJB 4EB6B 5JJNB 5KHKA 3AEIA 4EFBA 4DV6O 4DK1A 2PYLA 3X2QB 1SC5B 3ZBHA 4O4LB 3TJTA 2ZIOA 4UB8Z 4FIPC 3K58A 3HKCA 3ZMVA 1YJWV 2YIBD 4ZHQB 1VQNV 1Y4MA 5D5QA 4TQDA 1EZVH 5AG2A 3SDLA 1N0JA 3UCSC 5GONA 4P9OA 4FLVA 4DV1O 2A3QA 5LXTA 1R3KC 3RYIB 2ILMA 3T1HO 1ZWIC 4JI8B 3CRQA 2ATKC 1FFTB 2UXNA 1THZA 1SZXA 2YIDA 4DV5B 1CXZB 2XAFA 3ZN1A 1JOYA 3SPGA 1SA0A 2ADPA 2HHHO 2ZR3A 3KKYA 3IAYA 3BA8A 3T2MA 4JYAO 3ZMSA 4I0XA 2ZXWB 4CH3A 4UCVA 3A0BZ 4KHPO 4ABMA 4O4JA 5J2TA 1Z5WA 2A9HA 4UXNA 1FXKB 2BCCH 4DV1B 4EB6A 2IJJA 5K1XA 3HKDB 3T1CA 3K59A 2HJFC 5L3EA 1P49A 1R73A 5IYBO 4JYAB 1BSMA 2LFRA 1HDJA 3H01A
chains in the Genus database with same CATH topology
5BR8O 2UUCO 4JI0O 4OPAA 3RT3C 5A2QN 1J5EO 4LFCO 1KUQA 2UUAO 1N32O 4DV3O 2VQFO 5LL6Y 4DR6O 4LFBO 4JI6O 2DOSA 2N74A 1AB3A 2JRIA 5BXZA 4DV7O 2UUBO 2ZKOA 3J7AU 4DR3O 4A5UB 4LF5O 1FJGO 1D2DA 3M8AA 1HR0O 4OX9O 4JV5O 4LF4O 4OPHA 1IBLO 5LMNO 4DV6O 1XNRO 2E5LO 3R66A 1N33O 4DUYO 4DV0O 3T1YO 3OTOO 3J81N 4LF6O 1XMOO 4DR4O 3O65A 4DR5O 3JAMN 2VQEO 2LW7A 1A32A 3SDLA 1IBMO 4JI5O 1IBKO 4DV1O 4JI8O 2UXDO 1XNQO 4K0KO 4X66O 3T1HO 4JI1O 4DV5O 4DV2O 4GKJO 2UXCO 4GKKO 1DK1A 1HNXO 1R1BA 4X62O 4JI4O 2HHHO 4LF7O 2FKXA 5IWAO 4JYAO 1F7YA 1I94O 4DR1O 1NS1A 4DR7O 4DUZO 4B3TO 4B3SO 1HNWO 4YHHO 2F4VO 4KHPO 1HNZO 4LFAO 4YY3O 4JI7O 4B3RO 4JI3O 1FKAO 1XEQA 4X64O 4LF8O 4JI2O 5IT9N 4AQYO 3F5TA 4X65O 1X59A 1N36O 4DR2O 2DJVA 4LF9O 2UXBO 2Z0AA 1G1XB 3J80N 4NXNO 1N34O 1FYJA 5BY1A 4DV4O 2UU9O 1R6TA 5LMUO 4B3MO 2AGAA 1XMQO 5H5NA 2ZM6O 1YZBA 4NXMO 1AILA 5FLXN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 O;  2UUC O;  4JI0 O;  4OPA A;  3RT3 C;  5A2Q N;  1J5E O;  4LFC O;  1KUQ A;  2UUA O;  1N32 O;  4DV3 O;  2VQF O;  5LL6 Y;  4DR6 O;  4LFB O;  4JI6 O;  2DOS A;  2N74 A;  1AB3 A;  2JRI A;  5BXZ A;  4DV7 O;  2UUB O;  2ZKO A;  3J7A U;  4DR3 O;  4A5U B;  4LF5 O;  1FJG O;  1D2D A;  3M8A A;  1HR0 O;  4OX9 O;  4JV5 O;  4LF4 O;  4OPH A;  1IBL O;  5LMN O;  4DV6 O;  1XNR O;  2E5L O;  3R66 A;  1N33 O;  4DUY O;  4DV0 O;  3T1Y O;  3OTO O;  3J81 N;  4LF6 O;  1XMO O;  4DR4 O;  3O65 A;  4DR5 O;  3JAM N;  2VQE O;  2LW7 A;  1A32 A;  3SDL A;  1IBM O;  4JI5 O;  1IBK O;  4DV1 O;  4JI8 O;  2UXD O;  1XNQ O;  4K0K O;  4X66 O;  3T1H O;  4JI1 O;  4DV5 O;  4DV2 O;  4GKJ O;  2UXC O;  4GKK O;  1DK1 A;  1HNX O;  1R1B A;  4X62 O;  4JI4 O;  2HHH O;  4LF7 O;  2FKX A;  5IWA O;  4JYA O;  1F7Y A;  1I94 O;  4DR1 O;  1NS1 A;  4DR7 O;  4DUZ O;  4B3T O;  4B3S O;  1HNW O;  4YHH O;  2F4V O;  4KHP O;  1HNZ O;  4LFA O;  4YY3 O;  4JI7 O;  4B3R O;  4JI3 O;  1FKA O;  1XEQ A;  4X64 O;  4LF8 O;  4JI2 O;  5IT9 N;  4AQY O;  3F5T A;  4X65 O;  1X59 A;  1N36 O;  4DR2 O;  2DJV A;  4LF9 O;  2UXB O;  2Z0A A;  1G1X B;  3J80 N;  4NXN O;  1N34 O;  1FYJ A;  5BY1 A;  4DV4 O;  2UU9 O;  1R6T A;  5LMU O;  4B3M O;  2AGA A;  1XMQ O;  5H5N A;  2ZM6 O;  1YZB A;  4NXM O;  1AIL A;  5FLX N; 
#chains in the Genus database with same CATH topology
 1SS3 A;  3STL C;  4I7Z B;  3GWK C;  5KUM A;  3APO A;  1SRY A;  2DQ0 A;  1N0N A;  1AJP A;  4DXW A;  5DM6 V;  3J7A U;  3BFR A;  4PDV A;  3W7X A;  3CRA A;  1FJG O;  2XHB A;  4U7O A;  5LMN O;  5JCO C;  4MVU A;  3R66 A;  1V9P A;  4X20 A;  1FXK A;  2WLL B;  4EEQ A;  1ZL8 A;  1IZ3 A;  3ZCC A;  1AR4 A;  3ML0 A;  3QG5 A;  4KUM A;  4CBC A;  3ZHR A;  5B1N A;  2EIK C;  3RBZ A;  3CCV V;  1JX9 A;  2Z3Y A;  5HFM A;  1AJN A;  5IJ0 B;  4GKJ O;  3HR0 A;  4DRX B;  5LMN B;  4X62 O;  3DSQ A;  1PNK A;  2HEP A;  1BL8 A;  1K73 W;  5B1A C;  3E8G A;  4G2K A;  4DR7 O;  4DUZ O;  3QO5 A;  1TGO A;  2IW5 A;  4JI3 O;  2D3O W;  1JQ0 A;  4YY3 B;  3CCM V;  1NKD A;  5FNV B;  4NKG B;  1T5E A;  2YS8 A;  4CC5 A;  4QE7 A;  2EJ7 A;  2LO1 A;  3K9S A;  4IT5 A;  1ZTE A;  2ZCE A;  3LDE A;  4X62 B;  5JVD A;  4NXN O;  2QKC A;  3U0Z A;  2C2A A;  4LF9 B;  3CD6 V;  2UU9 O;  1XL4 A;  2XUM A;  4NXM O;  4DUZ B;  3MHH C;  1VQO V;  1QR9 A;  2OTJ V;  4LFC O;  1MNG A;  1Z5V A;  4JI3 B;  3QNE A;  4JAV A;  2JEX A;  1SKV A;  1WN7 A;  2ADQ B;  2DOS A;  2QM4 A;  4DRX A;  2EIN B;  1B04 A;  4NTY A;  3K04 A;  4NXN B;  3M8A A;  2UU9 B;  2YXH A;  1JJO A;  4GX5 A;  1HR0 B;  1E1Q G;  3ZMZ A;  5EBL C;  2P90 A;  1G4Y B;  1M9N A;  4Z1M G;  1KU9 A;  3B2E E;  5FNV A;  4LFC B;  4I50 B;  5IYZ A;  3J81 N;  2RCV A;  4TSF G;  3ABM B;  2BOB C;  3IGA C;  4YJ2 B;  1JMK C;  2QA4 V;  2Y0P A;  2V4D A;  1IBM O;  3WB2 A;  4WBN B;  2VQE B;  3H9V A;  5E1A C;  3M99 B;  2F1M A;  2PF4 E;  4X66 O;  2ARH A;  3JAR B;  3VQY A;  5TIS Z;  1NH2 B;  4MW8 A;  3TXS A;  2AHY A;  3F7Y C;  4JI1 B;  3MD0 A;  3ZHS A;  1GN4 A;  2EX3 A;  3JAL B;  1VF6 C;  4MVO A;  4QPK A;  4PI2 A;  2UXX A;  2DYS C;  5IWA B;  1YI2 V;  2O57 A;  1H8H G;  2YEV B;  1IBM B;  1GH6 A;  2WWW A;  1XUQ A;  2P7T C;  4B3R B;  3HKE B;  1K8A W;  2FTK A;  2QDO A;  4PA6 A;  3TET A;  3AG1 B;  1V54 C;  2R70 A;  2CGO A;  2R72 A;  2YI9 A;  3JAK A;  3A0H Z;  4I50 A;  3QF7 A;  2ZQM A;  2K9P A;  2CDY A;  4YJ2 A;  1FXH A;  3I56 V;  3CPW U;  2ZM6 O;  3RFR A;  5LOV B;  1OCO C;  3D8C A;  2P6J A;  4BW9 A;  1SQV H;  2JGD A;  1SQG A;  4WFH A;  1JR9 A;  3JAR A;  3DC5 A;  3OUF A;  1HWY A;  1XBL A;  2QEX V;  1IX9 A;  2JJ1 G;  3JAL A;  3CXH F;  4PHZ A;  2XAG A;  1JCH A;  1LUW A;  3K5N A;  2H3O A;  4R7C A;  1MAB G;  1OCR C;  2YEV A;  2R9A A;  4TT3 G;  2E5L B;  3OTO O;  3JCZ A;  1XMO O;  2ZD9 A;  1KP3 A;  1U97 A;  4QPJ A;  2JVD A;  1I5Y A;  1HP8 A;  1KC8 W;  3FB8 C;  3UT5 B;  4MVS A;  3JD3 A;  1WJZ A;  3VQW A;  3KCY A;  4GKK O;  5LOV A;  4X1I B;  4MT8 A;  3SYQ A;  3WB0 A;  1I7F A;  2OIG A;  4B3T O;  1PNL A;  4MW3 A;  1Y76 B;  4NB5 A;  2LFS A;  3BHP A;  2F4V B;  3K0G A;  1YIJ V;  3ZRS A;  3CE2 A;  1KP2 A;  1R6N A;  1Q7Y W;  1GN6 A;  2IU0 A;  4ZBM A;  2GUZ B;  1US6 A;  4J7Z A;  4GKK B;  3TXQ A;  1EZJ A;  5L3F A;  3CYO A;  3H1J H;  2XAH A;  2CUG A;  3OM3 B;  2N05 A;  3OMN B;  3ASN B;  1VQL V;  4DV4 B;  2ZE6 A;  5BR8 O;  4F6R B;  5F2V O;  3I55 V;  3UT5 A;  1G6U A;  1RSO B;  2XAS A;  5EZY B;  2DWD C;  5K1P A;  3AG3 B;  4BAY A;  4X1I A;  3PN1 A;  2W6I G;  3LSS A;  2F23 A;  3W7T A;  1DF4 A;  3E22 B;  4UCT A;  3P32 A;  2WLH A;  3BAA A;  3ABT A;  3L75 H;  5BR8 B;  1M57 C;  1SQX H;  1Y66 A;  2Q9L A;  3APQ A;  4DV0 O;  2GUZ A;  2JS5 A;  1MZE A;  4DR4 O;  1X4T A;  2RNB A;  1PL0 A;  1QVF U;  1OCC C;  3T4D A;  1A32 A;  2VRZ A;  4CS2 A;  3ABK B;  1K5S A;  1QBZ A;  3ZED A;  1OJH A;  4JI5 B;  4K0K O;  3BEH A;  5H9C A;  3DC6 A;  1YTF D;  4F6R A;  5CA3 A;  3ETD A;  2HP8 A;  4FLT A;  3JAT B;  1GTO A;  1RSO A;  2CTW A;  5EZY A;  3ZJZ A;  2HFE C;  4DV0 B;  2BTQ A;  1S72 V;  5EBW C;  3E2E A;  3JYC A;  1V55 C;  1HNW O;  2QJ1 A;  4DR4 B;  3N27 A;  2PUS A;  1HNZ O;  5B5E Z;  3JCU Z;  4JI7 O;  2Y69 B;  5L3D A;  4FLU A;  4JTA B;  4PV1 B;  3S3W A;  4FK5 C;  5KHH A;  5IT9 N;  4K0K B;  5B3S B;  4H33 A;  5KHG A;  2WLM A;  5H6Q A;  1K34 A;  3X2Q C;  2AHZ A;  2LP7 A;  1FD9 A;  3CCE V;  1E1R G;  4ZKI A;  3OR7 C;  1OHH G;  3QTC A;  1EN6 A;  4B3M O;  1KEC A;  2AGA A;  2Q5Z A;  1XMQ O;  1VAR A;  1S5H C;  4MTO A;  5LHH A;  2DYR B;  1HNZ B;  3IC7 A;  4LCU C;  2Q7G A;  4JI7 B;  4NVP A;  3HKC B;  1VQ9 V;  5JJE B;  4F6E A;  3G71 V;  1FS0 G;  1BHB A;  4RUE A;  1H2N A;  4J7K A;  4TUY B;  2WLN A;  1GO3 F;  3CMA V;  1Z2G A;  3FD9 A;  3JAT A;  4K35 A;  1WB8 A;  2YC0 A;  1COW G;  3BVO A;  3OEH G;  2Y4T A;  1R3L C;  2B5U A;  1O9G A;  3E8B A;  1SA0 B;  1QHT A;  1IBL B;  2F93 B;  4WF9 V;  4IIJ B;  4QE9 A;  1FXK C;  2OTL V;  1UPG A;  2QSA A;  2W0X A;  2QWR B;  1TUB B;  4D6T H;  5J2T B;  2R9I A;  3B8M A;  1NI8 A;  4FFK A;  3R65 A;  4Z2W A;  4JI8 O;  1FPO A;  3C90 A;  3JAS B;  3P30 A;  4DV5 O;  3E8H A;  1XDC A;  5LHI A;  4I9Q A;  1K9M W;  1HNX B;  3RYF B;  2W0F C;  1NZ6 A;  1FFX B;  3E35 A;  2ZIN A;  4O4H B;  2B1G A;  1VQ7 V;  4TUY A;  4DR1 B;  3TCU A;  4UCS A;  2QWO B;  1JVM A;  1OCZ B;  3WG7 B;  5KA5 A;  1K33 A;  4X65 O;  1BE3 H;  2KG7 B;  3FX7 A;  1N36 O;  1YCI A;  3SJA C;  2DJV A;  2X6C A;  3D3Q A;  3SPI A;  4IIJ A;  5IJ9 A;  1CEZ A;  5L3G A;  3L70 H;  1W0K G;  2OT5 A;  4LWS A;  3L73 H;  1TUB A;  1EN5 A;  2ZNJ A;  3ABL B;  3JSL A;  4QJF B;  5KAI Z;  4X20 B;  1TAE A;  1MG1 A;  1MSD A;  1Q86 W;  1ZL8 B;  1Y6X A;  3JAS A;  1KKC A;  1VIB A;  2IM9 A;  2QTO A;  5CMU A;  1IXB A;  3GWO A;  3E83 A;  4X65 B;  4J42 A;  2JRI A;  3RWR D;  4GYC B;  1N36 B;  4N21 A;  1Q82 W;  1Q8I A;  3E89 A;  3RYF A;  4A5U B;  1FFX A;  1D2D A;  3A2F A;  3B40 A;  4O4H A;  1GAX A;  1BQ0 A;  4OPH A;  1BQZ A;  4YIP A;  1K97 A;  3EHB B;  2HVJ C;  3VQX A;  2LW1 A;  4HAM A;  3EXA A;  4X1Y B;  3A8T A;  5JQG B;  4FM0 A;  4GT1 A;  1NTZ H;  5CBF A;  5LP6 B;  3O65 A;  3W7S A;  2KG7 A;  5KHI A;  4O2B B;  1M93 A;  2IJK A;  5JH7 B;  3RGB A;  2W6J G;  4FLX A;  3PJS K;  2QR4 A;  1Y74 A;  1LR1 A;  2DE0 X;  2FML A;  3P3P A;  1H8E G;  3ASO B;  3IC9 A;  4LR3 A;  2CTP A;  1PKX A;  4J9Y B;  4K8X A;  2CGN A;  1KBH A;  5CA0 A;  5JVD B;  5HFL A;  1K7D A;  1GMG A;  2Q0A A;  2QM8 A;  2XT9 A;  1I94 B;  1SF9 A;  2EIN C;  4JZ2 A;  4YY3 O;  4FM1 A;  2XND G;  4O4I B;  4TOI A;  5GTI Z;  2PI5 A;  4JYY A;  4I55 B;  3F5T A;  1AI5 A;  1SER A;  5JJJ B;  4NTX A;  2NNU A;  3OD4 A;  3ZRX A;  4LF9 O;  2UXB O;  1Y67 A;  5KAF Z;  5DN6 G;  1G1X B;  1Q43 A;  2PYJ A;  4MVQ A;  1M4U A;  4X1Y A;  5JQG A;  2GDS A;  1S76 D;  5BY1 A;  2NLJ C;  3FKS G;  3ABM C;  3AK1 A;  5LP6 A;  4J80 A;  1VQM V;  4FJC C;  5H5N A;  3K5O A;  4UFZ A;  1QNM A;  3AK2 A;  4O2B A;  4AIL C;  1Q6H A;  5JH7 A;  2UUC O;  4J10 A;  4CZZ A;  3U10 A;  2CAZ C;  2WLJ A;  1SQF A;  2RDC A;  3E8F A;  3RT3 C;  4PA4 A;  2CH7 B;  5IYZ B;  4MS2 A;  4B08 A;  2ODM A;  1LUV A;  3JD1 A;  3NXS A;  2D2C B;  5BXZ A;  1JJ2 U;  1ZLZ A;  5LBQ A;  2UXB B;  2QWN B;  4UCU A;  3ZHV A;  1GM7 A;  4ZOL B;  2XAQ A;  1HR0 O;  4MVR A;  5EIB C;  3SYP A;  3OAA G;  1S5J A;  4O4I A;  2YIB A;  1N8R W;  4D7S A;  2UUC B;  1Q6U A;  4TQF A;  4XBF A;  4I55 A;  2YI8 A;  5EBM C;  1AP6 A;  3AG1 C;  3JAM N;  1N4C A;  2VQE O;  1H38 A;  4MTF A;  5BMV B;  1GKF A;  2HJD A;  4JAA A;  4J11 A;  1WA8 B;  4JI1 O;  2EIM B;  3RYC B;  3CC7 V;  1RP3 B;  4CH5 A;  4U7N A;  1BHA A;  4JF3 A;  1WP8 A;  5DED A;  4G28 B;  3JAK B;  4I5S A;  2CH7 A;  5IWA O;  2KB1 A;  3CCR V;  4GLX A;  4B7E A;  4UVC A;  3T4Z A;  4YHH O;  3TK1 A;  2Q68 A;  4B3R O;  2ZE8 A;  1Q90 D;  2JGD B;  1JFF A;  4F4L A;  4ZOL A;  3QO8 A;  1VQ6 V;  2GV9 A;  2YSU B;  4DW1 A;  4IYH A;  5LHG A;  4RWU A;  1O9H A;  1TUE B;  2ZIM A;  2PI4 A;  1YF2 A;  4MTX A;  4FZ0 A;  3KZI Z;  3SGI A;  3LUT B;  5A9G A;  1YZB A;  5L3B A;  4ASU G;  1KYO F;  4YHH B;  4WCE V;  3SYC A;  4KP4 A;  5BMV A;  1EM1 A;  2CTR A;  2MW2 B;  2UUA O;  1N32 O;  3CEI A;  1WA8 A;  3BAB A;  2CK3 G;  3RYC A;  1WPB A;  2BSK B;  1FAF A;  4PA7 A;  1QLN A;  2ZT9 B;  5KA6 A;  1U96 A;  3NR7 A;  4WFE A;  4U3J B;  2UUB O;  2ZKO A;  1XI1 A;  1LNQ A;  2EUL A;  2LQT A;  4OX9 O;  1K5Q A;  3OR6 C;  2GTA A;  1OV9 A;  3S3X A;  4JPR A;  4FZ1 A;  5EC1 C;  5C8Y B;  1AVM A;  2E5L O;  3Q4H B;  3EFF K;  2BE3 A;  2Q4P A;  1YJN V;  2UUA B;  1N32 B;  1YEW A;  1I5X A;  2OCC B;  1EN4 A;  5CBH A;  3QVN A;  4DR5 B;  2ZE5 A;  5KX5 A;  2AW9 A;  2UUB B;  3ASN C;  1WNS A;  4OX9 B;  3UM7 A;  4EKW A;  2YXY A;  5KLV H;  4DV2 B;  4D7T A;  2HKO A;  4E4E A;  4FM2 A;  4PJ0 Z;  3SPC A;  4RAI A;  2VS0 A;  3RW0 A;  4JI4 B;  3IJ4 A;  4LF7 B;  2BSK A;  3AG3 C;  2PZS A;  2F4V O;  1BCC H;  4U3J A;  2AZ2 A;  1FKA O;  4LFA B;  4ZIB A;  5FPO A;  3K5L A;  1GN2 A;  3RYH B;  5D5P A;  5ITZ B;  1P7G A;  5B1B C;  5C8Y A;  3VOU A;  4FLW A;  3Q4H A;  1L1F A;  5KUK A;  1TVK B;  3W7U A;  2JS3 A;  1XOU A;  4DV4 O;  4XDL A;  4K8Z A;  2P06 A;  3ABK C;  3CX5 F;  1VP7 A;  3SYO A;  4H37 A;  2Z5U A;  2YDE A;  4HBN A;  1VF7 A;  1R6K A;  2AZ0 A;  1UFI A;  2NR5 A;  3OE7 G;  2N74 A;  5CN0 A;  1L0L H;  4LFB B;  3OFN G;  1B3Q A;  3ABU A;  3SJC C;  2CTQ A;  1QQC A;  2CE4 A;  1H2K A;  1JPX A;  2Q69 A;  2M6Y A;  1L0N H;  3SJQ C;  1B06 A;  1QCE A;  3K03 A;  2Y69 C;  4ZI7 B;  1XNR O;  3FB5 C;  3K0D A;  3RYH A;  4Q6G A;  2BTQ B;  5B3S C;  5ITZ A;  1VQP V;  3FAV B;  3SJB C;  4DW0 A;  2LW7 A;  4JI5 O;  1TVK A;  3N2K B;  3CB2 A;  3DTU B;  5B1B B;  4OGQ B;  3WU2 Z;  2UXC O;  1P84 F;  2DYR C;  4JTC B;  3K5M A;  1YHQ V;  3G6B A;  1XNR B;  4P30 A;  1SET A;  1YSC A;  4GUN A;  4U3F H;  4J9Z B;  1PV0 A;  4X88 A;  3C3T A;  3P3N A;  3ZRV A;  4JAU A;  3KG2 A;  2RQ6 A;  3CCS V;  3RN4 A;  4LNU B;  4AQY B;  4ZI7 A;  2UXC B;  3M7M X;  4NR1 A;  1KMI Z;  2HG5 C;  1GK9 A;  1R6T A;  2KKW A;  2WLI B;  5LMU O;  2E75 B;  3FAV A;  3F7V C;  3ZMU A;  2QE7 G;  4PEL A;  1HW7 A;  4H0L B;  2OYQ A;  3CC4 V;  3WB1 A;  1EFR G;  3O9O A;  3N2K A;  4DV3 O;  3CRM A;  4TV8 B;  2YIA A;  1TA8 A;  4J7J A;  1NTK H;  2WPD G;  2Q0O C;  2IJH A;  3EVK A;  1K92 A;  2L35 A;  3AG4 B;  3JSN A;  4DR3 O;  2H94 A;  1MMM A;  1WP7 A;  2VWK A;  5LMU B;  2ITD C;  1RPO A;  3AG2 B;  1IBL O;  3OT7 A;  1OCZ C;  3DXR A;  3H1K H;  2QKA A;  4LF4 B;  4GX1 A;  3WG7 C;  2XAJ A;  2HR3 A;  1N33 O;  3TGU H;  3CCJ V;  4IL6 Z;  4XDJ A;  4DV3 B;  2P67 A;  4LNU A;  3T1Y B;  4LF6 B;  1RPR A;  2EIJ B;  2YXL A;  2GSM B;  2JEU A;  1RM1 B;  2Q7E A;  4JAS A;  1IBK B;  2WLI A;  2P4K A;  4W4K A;  4FLY A;  4DR3 B;  4BW5 A;  1D5N A;  3ABL C;  3CHX A;  4BIU A;  5IJ9 B;  1HNX O;  5IE9 A;  1I08 A;  4LWS B;  4TV8 A;  2MK3 A;  3LDC A;  2ZDI A;  1N33 B;  1W2B U;  2Q73 A;  4QIW F;  1ORQ C;  4DR1 O;  3CC2 V;  1JA8 A;  3H1H H;  4JYC A;  1XEQ A;  4FPP A;  4WFB V;  1DTO A;  1NVP B;  1XHX A;  3AG7 A;  3WFV A;  4AHC A;  1XHZ A;  4FVM A;  4JI2 B;  1P7B A;  1F4N A;  3RVZ A;  1M56 B;  4R50 A;  2R9R B;  4TWK A;  4IGG A;  1QLE B;  1YTF B;  5LP6 C;  1UJW B;  1FXV A;  1WPX A;  2QWQ B;  4BIZ A;  1PPJ H;  2V7Q G;  3FYE B;  4X89 A;  2EBO A;  1H2G A;  4BIO A;  3AK3 A;  4UCO A;  1R3I C;  3ASO C;  5LL6 Y;  1J5E B;  3W7W A;  1SQP H;  2X0L A;  4RQF A;  3N2G B;  5J2U A;  4DR6 B;  3LSQ A;  3F5W C;  1M5I A;  1Y74 B;  4JGS A;  1YDX A;  5IYD O;  5EK0 A;  4L87 A;  2RMK B;  1AI4 A;  2AXT Z;  5CA0 B;  3D36 A;  4DV6 B;  4QNH B;  2A79 B;  3K3W A;  3K79 A;  5C93 A;  2IJI A;  1ENV A;  1MOF A;  2XTA A;  2UXD O;  3DGE A;  1XNQ O;  3SYA A;  4TV9 A;  3CRR A;  4IHJ A;  3T1H B;  2E3C A;  2JGU A;  4YJ3 B;  1F51 A;  2RJZ A;  4O4L A;  2FKX A;  2IU3 A;  4BWA A;  2HHH B;  4KFM A;  1I94 O;  4ZHQ A;  4G27 B;  3N2G A;  3CSX A;  1QU7 A;  4HZ3 A;  2GHY A;  4KHP B;  4FMT A;  3ZRW B;  1SQQ H;  2UXD B;  1XNQ B;  1VMG A;  3LDD A;  3RYI A;  3D3I A;  1ARO P;  2ZE7 A;  4J41 A;  1S0V A;  5B66 Z;  3OEE G;  2E74 B;  1GN3 A;  2GTS A;  3RVY A;  2WA4 A;  3OW2 U;  4Q20 A;  2WLK A;  3OMI B;  2ETN A;  4QGP A;  2VQF O;  2PGG A;  3HPL C;  2EIM C;  1AI7 A;  4MVZ A;  1KKD A;  2FB5 A;  3MHS C;  4YJ3 A;  1NH2 D;  1W0J G;  3CXC U;  2KSD A;  3HKD A;  4PD4 F;  1VQ8 V;  1NBM G;  2JDI G;  4LF5 O;  1E79 G;  2YUA A;  1FJG B;  2JK5 C;  2LGQ A;  3B4S A;  2Q6A A;  1VQ4 V;  5EIB D;  2QGN A;  3ZRW A;  1PNM A;  2WAM A;  2VQF B;  2ITC C;  1Q3E A;  3STZ C;  1BS3 A;  2ZNI A;  2WSS G;  5CB4 B;  4Z1V A;  1WAZ A;  4N23 A;  1PP9 H;  5KMG B;  1H2L A;  3JAW B;  1JFF B;  2WA3 A;  2EIL C;  3GB7 C;  3U11 A;  1AI6 A;  2Q7H A;  1XQ8 A;  4DK0 A;  3ETE A;  4LF5 B;  2EJR A;  3HB3 B;  3L71 H;  1R1B A;  4UB6 Z;  4GKJ B;  3ZHT A;  2JIZ G;  2A0L A;  2WLL A;  1QVG U;  1NS1 A;  1G8M A;  2Y0I A;  1P4R A;  1ZUQ A;  3OGC C;  2P22 C;  3CP1 A;  4DR7 B;  3SR2 C;  4NTW A;  4MTG A;  4HYO A;  5E79 Z;  4LF8 O;  4CH6 A;  2QTS A;  4WFG A;  1ROP A;  5EYP B;  3G67 A;  4UCR A;  5IJ0 A;  3ZN0 A;  2FL4 A;  2EIK B;  3CJH B;  2HVK C;  5LGT A;  1B6Q A;  3OUS A;  4ICG A;  3K06 A;  2OCC C;  1QR8 A;  5CB4 A;  4GZR B;  4NYK A;  5J9P C;  5KMG A;  4LC1 A;  4OPA A;  3JAW A;  2EZO A;  1M1K W;  4NXM B;  3C3S A;  3G6E V;  3CRC A;  3G80 A;  1D5A A;  5B1A B;  1IXM A;  2P4V A;  1NT2 B;  4LF8 B;  3ZX6 A;  4HNA B;  2LJ2 A;  4IYI A;  3ETG A;  4I4T B;  3CME V;  5KX5 B;  2HLD G;  5FPR A;  2EIL B;  3K08 A;  4R6Z A;  1DLB A;  2B9Z A;  2G38 A;  2X6A A;  1NJI W;  2A7W A;  5LYJ B;  4MVM A;  2PTM A;  4PA3 A;  2RN9 A;  3HKB B;  5IYC O;  2ZR2 A;  1K3E A;  5JCO A;  1PL4 A;  5FL7 G;  3THO A;  4DYL A;  4DUY O;  1IUR A;  4FLZ A;  5EYP A;  5IDJ A;  4CS4 A;  1OZ0 A;  4KXR A;  4W4L A;  3UQ8 A;  1VQK V;  4DR5 O;  1KD1 W;  1KQS U;  5GW7 A;  2QKS A;  3CJH A;  4P2Z A;  1DF5 A;  4RQE A;  1PM9 A;  3KCX A;  4KL1 A;  4YXW G;  1J95 A;  1M90 W;  4DV2 O;  4X66 B;  4FFB B;  5H6R A;  5GTH Z;  2EZP A;  4JI4 O;  1YIT V;  1AR1 B;  4LF7 O;  1BZK A;  4DUY B;  4HNA A;  1S3J A;  3UO2 A;  1MZF A;  3BCC H;  1F23 A;  4LFA O;  1MA1 A;  4I4T A;  4E2L A;  4WBN A;  3B77 A;  1GRJ A;  2Y4U A;  3CCL V;  5LYJ A;  4B7K A;  3HKB A;  2DMX A;  4X1K B;  4DR2 O;  3K9A A;  1NQT A;  4UUJ C;  3L72 H;  3ZHQ A;  2Z0A A;  4DO2 A;  4O2A B;  4UV8 A;  1KB9 F;  4PDR A;  3J80 N;  1N34 O;  5L3C A;  4P9P A;  1ZSP A;  1YJ9 V;  2OIE A;  1AP5 A;  2KQX A;  4JI0 O;  2ZM6 B;  5BZB A;  1H2S B;  1VF5 B;  2BOC C;  4LH6 A;  3GVM A;  4LH7 A;  5LGN A;  2XOK G;  4L8J A;  4LFB O;  1BT8 A;  3HKE A;  2DYS B;  4JI6 O;  4FFB A;  1AB3 A;  2FYU H;  3LNM B;  1SQB H;  1EBO A;  2YIC A;  3I5D A;  2OCH A;  2E76 B;  3CS5 A;  4DR2 B;  3ZIA G;  4EFE A;  3MAQ A;  4YIO A;  5JWP A;  4UV9 A;  3JD0 A;  1N34 B;  1K4D C;  1URF A;  3A0R A;  1V54 B;  4JI0 B;  4RUF A;  5CA1 B;  3H1L H;  3K57 A;  3OTO B;  5KHJ A;  3BA9 A;  4X1K A;  4JI6 B;  1XMO B;  2DQ3 A;  4O2A A;  1I0H A;  1OCO B;  1VQ5 V;  2A06 H;  4I9W A;  2GBO A;  4UVB A;  1VEW A;  3OTF A;  4PA9 A;  2IH3 C;  3VBB A;  2VWJ A;  1DK1 A;  2X7R B;  1VF6 A;  3LNN A;  2ZDI C;  3JD4 A;  4JYB A;  4MSW C;  1F7Y A;  3BPZ A;  4B3S O;  3OMA B;  4X9Q A;  4BR6 A;  1Q81 W;  4B3T B;  2V1D A;  5IY5 C;  3AG4 C;  1OCR B;  5LA6 B;  4PDL A;  1SZT A;  4AQY O;  3ZHU A;  1ZX3 A;  1L8D A;  2IH1 C;  4JTD B;  3AG2 C;  4GX0 A;  3L74 H;  5EC2 C;  1NR1 A;  3UO3 A;  3FB6 C;  4UVA A;  3B09 A;  3UKM A;  4AI8 A;  5CA1 A;  3OGI B;  4WFF A;  3SPH A;  5CBG A;  1YVW A;  1F4M A;  2K1E A;  3DXR B;  5FLX N;  2EIJ C;  4B3S B;  3ZMT A;  1Y76 A;  2X6B A;  4LBE C;  2F95 B;  1PD3 A;  2Q67 A;  1RM1 C;  2F66 C;  2N04 A;  1BMF G;  1DGS A;  4DV7 O;  1NVP D;  2DN9 A;  3CCQ V;  2DWE C;  1RFY A;  2L6L A;  4JZG A;  3ICX A;  1GM9 A;  1YXB A;  1XL6 A;  5B1O A;  1NU1 H;  3G4S V;  4JV5 O;  4LF4 O;  4PDM A;  4GCZ A;  2QWP B;  4WFA V;  1W59 A;  3D36 C;  5LA6 A;  2NN4 A;  5DEC A;  3T1Y O;  2JJ2 G;  4K3A A;  4LF6 O;  2BTO A;  4XDK A;  3ZS8 C;  3FYI B;  1CPY A;  1IVS A;  5IY5 B;  1M56 C;  4DV7 B;  1IBK O;  1Q6I A;  4LP8 A;  1QLE C;  3BY6 A;  4PI0 A;  1R3J C;  4JV5 B;  3E22 A;  2Y48 A;  4CC6 A;  1NTM H;  1AJQ A;  5LGU A;  3SPJ A;  3ETQ A;  3BRC A;  3VQV A;  3JD2 A;  3IFX A;  3CCU V;  1XRE A;  3H1I H;  1CP9 A;  2IBZ H;  3L9D A;  3LSU A;  1XIL A;  1HNW B;  3E86 A;  4H44 B;  2H8P C;  4OXS A;  4X64 O;  1ZAU A;  2LGW A;  2M7W A;  1M57 B;  3QO7 A;  4H13 B;  4JI2 O;  4RO2 A;  4GX2 A;  1GM8 A;  2DW4 A;  5J2U B;  1X59 A;  1H2M A;  3MDS A;  1OCC B;  3B8N A;  1SES A;  1WLE A;  5GON B;  1WB7 A;  1FYJ A;  5LXT B;  4C7U A;  2B1I A;  1S77 D;  2ZXW C;  1AIL A;  4B3M B;  1XMQ B;  4X8A A;  1Q5O A;  5A2Q N;  1J5E O;  1S5L Z;  1KUQ A;  1K4C C;  3FFQ A;  4X64 B;  2Q8V A;  4DR6 O;  4I0X B;  1MSW D;  1NR7 A;  2QM7 A;  1V55 B;  3FB7 C;  2OWO A;  5H2F Z;  1BGY H;  4O4J B;  2PY5 A;  1IDS A;  1AR5 A;  4R8C A;  4CH4 A;  4TV9 B;  2P5O A;  2F43 G;  3CWB H;  4CS3 A;  4IHJ B;  4EB6 B;  5JJN B;  5KHK A;  3AEI A;  4EFB A;  4DV6 O;  4DK1 A;  2PYL A;  3X2Q B;  1SC5 B;  3ZBH A;  4O4L B;  3TJT A;  2ZIO A;  4UB8 Z;  4FIP C;  3K58 A;  3HKC A;  3ZMV A;  1YJW V;  2YIB D;  4ZHQ B;  1VQN V;  1Y4M A;  5D5Q A;  4TQD A;  1EZV H;  5AG2 A;  3SDL A;  1N0J A;  3UCS C;  5GON A;  4P9O A;  4FLV A;  4DV1 O;  2A3Q A;  5LXT A;  1R3K C;  3RYI B;  2ILM A;  3T1H O;  1ZWI C;  4JI8 B;  3CRQ A;  2ATK C;  1FFT B;  2UXN A;  1THZ A;  1SZX A;  2YID A;  4DV5 B;  1CXZ B;  2XAF A;  3ZN1 A;  1JOY A;  3SPG A;  1SA0 A;  2ADP A;  2HHH O;  2ZR3 A;  3KKY A;  3IAY A;  3BA8 A;  3T2M A;  4JYA O;  3ZMS A;  4I0X A;  2ZXW B;  4CH3 A;  4UCV A;  3A0B Z;  4KHP O;  4ABM A;  4O4J A;  5J2T A;  1Z5W A;  2A9H A;  4UXN A;  1FXK B;  2BCC H;  4DV1 B;  4EB6 A;  2IJJ A;  5K1X A;  3HKD B;  3T1C A;  3K59 A;  2HJF C;  5L3E A;  1P49 A;  1R73 A;  5IYB O;  4JYA B;  1BSM A;  2LFR A;  1HDJ A;  3H01 A; 
#chains in the Genus database with same CATH homology
 5BR8 O;  2UUC O;  4JI0 O;  4OPA A;  3RT3 C;  5A2Q N;  1J5E O;  4LFC O;  1KUQ A;  2UUA O;  1N32 O;  4DV3 O;  2VQF O;  5LL6 Y;  4DR6 O;  4LFB O;  4JI6 O;  2DOS A;  2N74 A;  1AB3 A;  2JRI A;  5BXZ A;  4DV7 O;  2UUB O;  2ZKO A;  3J7A U;  4DR3 O;  4A5U B;  4LF5 O;  1FJG O;  1D2D A;  3M8A A;  1HR0 O;  4OX9 O;  4JV5 O;  4LF4 O;  4OPH A;  1IBL O;  5LMN O;  4DV6 O;  1XNR O;  2E5L O;  3R66 A;  1N33 O;  4DUY O;  4DV0 O;  3T1Y O;  3OTO O;  3J81 N;  4LF6 O;  1XMO O;  4DR4 O;  3O65 A;  4DR5 O;  3JAM N;  2VQE O;  2LW7 A;  1A32 A;  3SDL A;  1IBM O;  4JI5 O;  1IBK O;  4DV1 O;  4JI8 O;  2UXD O;  1XNQ O;  4K0K O;  4X66 O;  3T1H O;  4JI1 O;  4DV5 O;  4DV2 O;  4GKJ O;  2UXC O;  4GKK O;  1DK1 A;  1HNX O;  1R1B A;  4X62 O;  4JI4 O;  2HHH O;  4LF7 O;  2FKX A;  5IWA O;  4JYA O;  1F7Y A;  1I94 O;  4DR1 O;  1NS1 A;  4DR7 O;  4DUZ O;  4B3T O;  4B3S O;  1HNW O;  4YHH O;  2F4V O;  4KHP O;  1HNZ O;  4LFA O;  4YY3 O;  4JI7 O;  4B3R O;  4JI3 O;  1FKA O;  1XEQ A;  4X64 O;  4LF8 O;  4JI2 O;  5IT9 N;  4AQY O;  3F5T A;  4X65 O;  1X59 A;  1N36 O;  4DR2 O;  2DJV A;  4LF9 O;  2UXB O;  2Z0A A;  1G1X B;  3J80 N;  4NXN O;  1N34 O;  1FYJ A;  5BY1 A;  4DV4 O;  2UU9 O;  1R6T A;  5LMU O;  4B3M O;  2AGA A;  1XMQ O;  5H5N A;  2ZM6 O;  1YZB A;  4NXM O;  1AIL A;  5FLX N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...