4JI7O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji7O00
1IBMO 1J5EO 4LFCO 4YHHO 1X59A 1N36O 2VQEO 4JI6O 4DV3O 1HR0O 4DR5O 1XEQA 1N33O 4B3RO 2Z0AA 3J7AU 4DV5O 5IT9N 4LF8O 2DJVA 4JV5O 2HHHO 1XMOO 1AB3A 3T1HO 2ZM6O 4KHPO 1A32A 3M8AA 4DR6O 5LL6Y 4NXNO 5BXZA 4DR2O 2UXCO 1DK1A 2UU9O 3R66A 2E5LO 4NXMO 1AILA 3O65A 2UUCO 4B3TO 4YY3O 4X62O 1XNRO 4GKKO 4JI2O 4JI1O 2JRIA 4LF5O 4DR3O 1FYJA 4X65O 4DV2O 4AQYO 1HNXO 4LFAO 4DR1O 2N74A 2UUAO 4DV7O 4OPAA 1G1XB 5A2QN 4LF4O 1XMQO 4JI0O 4JYAO 1KUQA 2UXDO 4LF9O 1HNWO 4DV1O 5H5NA 2FKXA 4JI4O 2DOSA 2LW7A 1N32O 1FKAO 3RT3C 1HNZO 3T1YO 3J80N 3OTOO 4GKJO 1R6TA 5BR8O 1F7YA 1XNQO 4DV0O 1NS1A 3J81N 5FLXN 4DUZO 4DV6O 4B3SO 1D2DA 4DR4O 4DUYO 3JAMN 1R1BA 4LF6O 4OX9O 5IWAO 4A5UB 2AGAA 4K0KO 1YZBA 4JI5O 4LFBO 4DV4O 2ZKOA 4X64O 4LF7O 2VQFO 3SDLA 2F4VO 2UXBO 1IBLO 2UUBO 1I94O 1N34O 4X66O 5LMNO 4JI3O 4DR7O 3F5TA 1IBKO 4JI7O 5BY1A 4B3MO 1FJGO 4OPHA 4JI8O 5LMUO
chains in the Genus database with same CATH superfamily
3GWKC 4FLVA 2V7QG 4MTXA 4WBNB 3T1YB 2WPDG 4BAYA 1OCOB 1RM1B 2YIBD 1H2MA 1TAEA 3RYIA 2HLDG 2P4VA 2HJFC 4PDVA 4FM0A 3SYOA 3N2GA 2P06A 3TJTA 4X1KA 3ASNB 3ZHRA 3QG5A 5ITZB 5IY5B 2QKCA 1EFRG 4EFEA 4DV4B 1VQ5V 3DC5A 3OUFA 1Y76B 1YJNV 2QA4V 3ETEA 1JX9A 1F23A 3OR6C 1GN3A 3IC9A 1SA0B 2WA3A 3VQYA 2HEPA 1SERA 4DXWA 2IJKA 2ZD9A 3P30A 3KCXA 3R65A 1R6NA 4F4LA 2ARHA 1NR7A 1XREA 4JI2B 3FKSG 5B3SC 3ZRWA 2Y48A 4XDLA 4JI4O 1GK9A 4DR3B 3BVOA 4CH4A 2HHHB 1Q8IA 3ML0A 1YXBA 1NS1A 3SPCA 2UXDB 1SQFA 2OYQA 4BW5A 3LDCA 4DUYO 2Q7HA 2GTAA 3C90A 3BY6A 2XAJA 5D5PA 4CH3A 1AJNA 1K73W 1OZ0A 3E22B 1YF2A 2XAQA 3H1LH 2D3OW 4O4JA 1SS3A 5LMNO 4DW0A 3B77A 4LF6B 1K92A 4HBNA 4MVSA 5B1OA 5CA0A 4OPHA 4NTWA 1M57B 4JI8O 2Y0IA 1EZVH 5KX5A 4UV8A 4WFHA 3HR0A 1ZL8B 3QO7A 1EN4A 1US6A 5H9CA 3CE2A 3AG2B 5JH7A 3T1HO 4U7OA 4KHPO 2DE0X 1A32A 1NVPD 2GUZA 2FL4A 3K04A 3RVYA 3H1KH 4FZ0A 5HFMA 2ZE8A 4YJ2B 4LF8B 1IBLB 3IC7A 5KUMA 3AG2C 4UCSA 5GTHZ 2Q69A 4WBNA 4AQYO 1XBLA 4NXNB 1ORQC 2UXCB 4UVCA 1GN6A 1JVMA 3STLC 2E5LB 2GTSA 2JK5C 4PELA 1KUQA 2IBZH 1NTZH 2R9RB 3CC2V 2BSKB 4DV1O 5HFLA 1QU7A 2LW7A 3H1IH 1WP7A 1YCIA 4LP8A 4DRXB 1AP6A 1SQVH 1WP8A 1Y76A 1ZSPA 4GKJO 4DR2B 1CXZB 4JASA 4GUNA 1Z5VA 2ZDIC 4DR4O 1R1BA 4B3TB 2GBOA 1YEWA 4X62B 2Q68A 4A5UB 4YIPA 1VF5B 3SPJA 1GN4A 2AGAA 1MSWD 3MHSC 3ICXA 2YIDA 5L3FA 4J9ZB 3A0BZ 1YTFB 3CRQA 3HKCB 4ABMA 5J2TA 1GM7A 4O4LB 1JQ0A 2WLHA 3LDEA 4O2AB 5B1AB 4FIPC 2CTWA 5EIBD 3JSLA 2YUAA 3NXSA 4B08A 1MZEA 1PL0A 1M90W 2PYLA 3JD2A 4BR6A 2Q0AA 5CA3A 3DC6A 2ZINA 3GWOA 4B3MB 2KQXA 1IXBA 4ZHQB 3APQA 2Y69B 2VRZA 1N36B 4EKWA 1HWYA 3JARA 3I56V 2PI5A 1GM9A 2BTQB 2YI8A 1FXHA 3RN4A 3L9DA 4WFAV 3D8CA 2IM9A 4CC6A 1M56B 4X66B 3X2QB 3WFVA 4FLUA 4JAAA 3K03A 4LNUB 5LA6B 4MTFA 4DV7O 3ABMB 3A8TA 3B4SA 4JTDB 2P6JA 2DOSA 2JEUA 1OCCB 4O2BA 3ZJZA 2Q8VA 2NLJC 3LNNA 3K58A 1ZWIC 1O9GA 1E1RG 1JJOA 3ZMTA 3JAKB 3MHHC 1YHQV 1S5HC 4ZOLB 4FVMA 4X1YB 4IHJB 1G8MA 2YSUB 4KP4A 1Q43A 1K9MW 5AG2A 1OCCC 1WA8B 4FPPA 5LYJA 4P9PA 2FB5A 3RW0A 2ZDIA 1XDCA 1YZBA 2WAMA 1T5EA 2BSKA 3APOA 4ZI7A 2HKOA 3VQVA 3WG7C 2L35A 1KMIZ 5JCOC 5H6QA 5DN6G 1JA8A 1GAXA 2YIBA 2F95B 4GX5A 2HVKC 5FNVB 2ZXWB 2EULA 3E8HA 1BGYH 4O4HA 3BA8A 2QM8A 4GZRB 2ZQMA 1U96A 2ADPA 3DXRB 2WLKA 3D36C 4JI4B 4IIJB 5EBMC 4E2LA 4XDKA 2Y0PA 3IFXA 3U10A 3AG3C 1WPXA 1H2NA 3L70H 3FB6C 1XUQA 1AR5A 4JI7B 1MOFA 3ETQA 4DUYB 4FFBA 3OAAG 1WPBA 2KG7B 4CH6A 1AR4A 2CDYA 1M93A 2JGDA 1QBZA 1BHAA 1AILA 1YDXA 4MT8A 2V1DA 3P32A 4O2AA 3CS5A 1GN2A 4J9YB 1M9NA 4JI2O 2QGNA 2W0FC 3BA9A 3L71H 4DR3O 4LF5O 1RSOB 3DTUB 5LMNB 1W0JG 3W7XA 1VQOV 3SYCA 1IZ3A 1N0NA 2UUCB 4OPAA 4JI8B 1WB7A 4ZHQA 3G6EV 2UXDO 4WFFA 4K8ZA 5IYCO 5LGTA 3K0DA 3OMNB 3LNMB 5DECA 4KHPB 1FPOA 2YXHA 5CBGA 1E1QG 1FAFA 4LF6O 4LNUA 5LA6A 2KKWA 3JASB 1YJ9V 1Y6XA 1VF6C 5IWAO 1CP9A 2G38A 2HG5C 5J2UB 1AJQA 2FMLA 2YDEA 2Z3YA 4AQYB 4W4LA 1PNLA 4I0XA 1DF4A 3CXCU 1H2GA 4B3SB 4J7ZA 3K0GA 4Z1MG 3W7TA 3GVMA 1KQSU 3B2EE 5JCOA 2VWJA 3FB5C 1KP3A 4TT3G 1WNSA 4DV1B 2NR5A 5C8YB 4IHJA 3AG7A 3HPLC 1V55C 1L0NH 3J7AU 2CTPA 3D36A 4GKJB 3OMAB 4LF8O 3HKEA 5LXTB 3HKDB 2GV9A 4NXNO 2UXCO 4LFCB 5F2VO 2IJHA 2VQEB 2E5LO 4U3JB 4JZ2A 4X88A 4YJ3A 2VWKA 4PI0A 1ZTEA 3TGUH 3TK1A 1DLBA 3EVKA 4O4IB 4UCTA 5IJ0B 5EBLC 4MVUA 4LFAO 4DR1O 2CK3G 1PL4A 3B09A 2UUAO 1BE3H 5A2QN 3S3WA 4YY3B 4LF4O 1W0KG 4LF9O 2KG7A 4MVRA 1W2BU 3P3NA 3SYQA 1VQ6V 3CRRA 3WB2A 1XHZA 2A0LA 4MVQA 4MTGA 1OCZC 5JQGA 2LGQA 4PDMA 4WCEV 4X8AA 1OHHG 4OGQB 1AVMA 2YI9A 2EINB 3IAYA 3BRCA 2ZE6A 3VOUA 3ETDA 1YSCA 5CA1B 4PJ0Z 1R6TA 3W7UA 2ZE7A 4DV6O 1PNMA 5L3EA 3JAMN 3A2FA 4OX9O 4R8CA 2RNBA 2XAFA 4I7ZB 3K9AA 4CC5A 1VF6A 2EILB 4Z2WA 3G80A 3CCVV 1FFXA 1N4CA 5BZBA 4DV7B 5KAIZ 1FXVA 2Z5UA 4G27B 2QSAA 4B3MO 4X1IB 1JFFA 1QVGU 2E74B 2ZR3A 1IX9A 3LUTB 3G67A 1N36O 3JASA 3CB2A 4ICGA 5FPRA 2DW4A 1NTKH 3JATB 4DK1A 2QWNB 4JYYA 3AG4B 3CEIA 3K9SA 3JD3A 4DO2A 3G4SV 3BPZA 2HJDA 2LP7A 1M4UA 2K1EA 4F6RB 4IGGA 2VS0A 2P4KA 4QNHB 1RPOA 3ZS8C 4FLZA 4D7TA 5JWPA 1HR0B 4DR5B 1MG1A 3OR7C 1AI5A 5FPOA 1GH6A 4RAIA 1PD3A 4CZZA 3AG4C 3CXHF 4I50A 4N23A 1GRJA 4X89A 1TA8A 4UV9A 1HP8A 2FTKA 4FM1A 2W0XA 1QNMA 3L72H 4OXSA 3RGBA 5LGNA 5LXTA 3HKDA 2BCCH 2HR3A 5GTIZ 4I5SA 5EC2C 3ASOB 4JI1B 5D5QA 4PHZA 1OCOC 1N32O 1AP5A 1RM1C 2NNUA 4TUYA 2MW2B 4LCUC 4I4TA 2XOKG 3BABA 5JVDA 2R70A 3B8MA 2KSDA 3CCLV 4BW9A 1YTFD 5EYPA 5IYBO 4UVAA 4QGPA 3ASNC 2EIMB 5IY5C 3CMAV 4GCZA 3RYCB 2CTRA 5IE9A 3JCUZ 1QR8A 1AI4A 4R6ZA 4LF5B 4JI5O 2YEVB 1VF7A 2ZKOA 1WLEA 4TV9B 1CEZA 1JPXA 3STZC 2EZPA 3K5MA 2YIAA 4JI7O 5CA1A 2UXNA 2AXTZ 2NN4A 3FX7A 3EXAA 4LC1A 5LMUO 1SRYA 1PM9A 2XAHA 3MD0A 3ZRXA 4ZBMA 4BIOA 3I5DA 5LP6B 2E75B 2Q73A 1IURA 3NR7A 3K79A 3OEHG 2ADQB 2QWOB 2ATKC 5CB4B 1K8AW 1V54B 5KUKA 4EB6A 5IWAB 3CPWU 2A3QA 3RYHA 2UUCO 1HW7A 4TV8A 5IYDO 1MABG 3QTCA 2DQ0A 2IH1C 3OGCC 2JRIA 2QTSA 1R73A 3CRAA 1FYJA 4DYLA 2ZNJA 1NTMH 1BT8A 4AI8A 2HP8A 2WLLB 2DWDC 3OT7A 3FAVA 1M57C 3S3XA 1S5LZ 1EZJA 1ZLZA 2CGOA 3RYFB 4F6EA 1SZTA 1MSDA 1TUEB 3K5LA 3UCSC 3N2KB 3OFNG 5E1AC 1FFTB 3E35A 1Y74B 1DF5A 4B3SO 1PV0A 2E3CA 3IGAC 3U0ZA 4TQFA 1KB9F 5ITZA 4LFAB 1NZ6A 4DR1B 3LSSA 2UUAB 2A9HA 1I5YA 4UB8Z 4LF4B 1IBKO 4TOIA 4LF9B 1IVSA 2M7WA 1SA0A 4CBCA 3CP1A 1K7DA 2FYUH 3JD0A 4LH7A 4TSFG 4LFCO 5H6RA 3B8NA 5JJEB 2VQEO 1P84F 4JI6O 2VQFB 1EBOA 2ZIMA 5IT9N 3CCJV 2B5UA 3T4DA 4CS4A 2XAGA 4DV6B 4LWSB 5LL6Y 4PD4F 4OX9B 4NYKA 5BMVB 5CN0A 1Q82W 3SYAA 1GM8A 1UFIA 4IT5A 4JZGA 4P9OA 4YY3O 4J41A 1XNRO 2PTMA 3Q4HB 3JD1A 2QM4A 1OJHA 2PYJA 3OTFA 4K35A 1YI2V 2PI4A 1IDSA 1BS3A 4W4KA 3E22A 2UU9B 1QLEB 3C3TA 3G6BA 5B1AC 4NB5A 2WLJA 2XUMA 4WFBV 1SQQH 1VQLV 4PA3A 2DN9A 1UJWB 3K5NA 3CJHB 2FKXA 3OD4A 3AK3A 4I9WA 3W7WA 4WFGA 5IYZB 1R3KC 3U11A 2LGWA 1YVWA 1EN6A 3JSNA 1SQPH 3UM7A 5BR8O 2Y69C 5K1PA 1OCRB 1ZL8A 4UCUA 2OCCB 3ZIAG 1XQ8A 4DUZO 2X6AA 4K3AA 4MVZA 1MZFA 3E8GA 3ZHTA 1VQ4V 2ZE5A 1B6QA 1JJ2U 1M56C 3X2QC 5LHIA 2EX3A 3SDLA 3AG1B 2OIEA 5IJ9B 1AR1B 1TVKB 4YJ2A 2OCCC 5EK0A 2OCHA 4UCVA 4IL6Z 2WLNA 3ABMC 3CC7V 4H13B 3N27A 1B3QA 4Q6GA 1P49A 1N32B 5LHGA 1X59A 4X64B 1HR0O 4DR5O 2Q67A 1N33O 2EZOA 2C2AA 2H8PC 4DRXA 4DR6O 3ABLB 3ZBHA 4FJCC 2RDCA 1IBMB 1DK1A 4YHHB 5L3CA 3LDDA 3KZIZ 4B3RB 2XTAA 4H37A 4JI5B 1GMGA 4FM2A 1P4RA 5GW7A 1VP7A 3UT5B 4JI1O 1Q7YW 1B06A 5L3DA 1KKDA 2EIKB 2ZM6B 1XL6A 1KU9A 3JALB 4J7JA 2ZXWC 3BHPA 4UFZA 3ABLC 3SJAC 2PUSA 2L6LA 3E89A 3HKCA 2CGNA 5LMUB 2XT9A 4O4LA 4YXWG 4J10A 3DGEA 1PKXA 4ZKIA 1Y67A 5EBWC 2A06H 1JCHA 4DV2B 1NQTA 4B7EA 1FD9A 5KHGA 3OTOO 1ENVA 4B7KA 2B9ZA 4DV0O 3FYEB 5LGUA 1H38A 5KA6A 1R6KA 3K06A 2O57A 1TUBB 2WLIB 3HKBB 4FLTA 4K0KO 5CBFA 5J9PC 3CHXA 4PI2A 1NJIW 5KLVH 3CJHA 3SPHA 4PA7A 1XILA 2JIZG 4Q20A 2BTQA 1N34O 1AI7A 4HZ3A 4RQEA 1D5NA 4JI3O 3UQ8A 2M6YA 5L3BA 1FJGO 1KC8W 2E76B 4U7NA 2IJIA 4LF7B 1NKDA 1XEQA 1SC5B 5K1XA 2GSMB 1E79G 4KUMA 3UO3A 3A0RA 4WFEA 1JMKC 5A9GA 4X20B 1XMOO 3C3SA 3QVNA 5DEDA 5IJ9A 1TVKA 3JAKA 4PDRA 1FXKB 4DV3B 1THZA 2Y4UA 4ZOLA 1U97A 3SJCC 5B5EZ 4X1YA 4BWAA 3K08A 2Y4TA 1WA8A 2OTLV 2HFEC 4R7CA 5KHIA 1IBKB 1JR9A 2WA4A 4JF3A 1FXKC 3ABKB 2ZCEA 1BCCH 5FNVA 4JI0O 4J80A 3THOA 1NBMG 4CS3A 4JI6B 1KD1W 3ZHQA 3SR2C 3TXQA 3ZN0A 3DXRA 3B40A 1FKAO 2QJ1A 1VQ8V 4IIJA 3BCCH 2EIJB 1M5IA 3N2GB 3BEHA 5KMGB 4X1KB 1F4NA 1XNQO 2LO1A 4JYAB 1KP2A 4JTAB 1L0LH 4LBEC 3CCUV 3E83A 2IU3A 1XNRB 3ZCCA 1AROP 1L1FA 3CWBH 4JAVA 2VQFO 4FLYA 2IH3C 4QIWF 2UUBO 1JOYA 2F66C 4GX2A 4GT1A 1H2KA 1RSOA 5BY1A 3BFRA 3ZRWB 5B1BB 1K33A 1WJZA 3E8FA 1OV9A 2N05A 1TUBA 3UO2A 4DV5O 2EINC 2N04A 2WLIA 3HKBA 5BR8B 3RVZA 2DJVA 2ITDC 4JYBA 1AI6A 4MS2A 1M1KW 4FMTA 4DUZB 2A7WA 3M8AA 5B1BC 1Y4MA 2BOBC 2UU9O 3ZRSA 3ZMZA 4EEQA 2JJ1G 3QO8A 4NTYA 4PA4A 2R9AA 2JDIG 1RPRA 2EILC 5KHKA 1S3JA 1VARA 3E2EA 1Q81W 5J2UA 4FZ1A 5CA0B 3F7YC 3OM3B 4N21A 5LBQA 1I7FA 2LFSA 4X20A 2DYRB 5KX5B 1K5QA 3CCEV 1K97A 1BHBA 3VBBA 1N33B 3K57A 4E4EA 1FXKA 1WAZA 4GX0A 1DGSA 1RFYA 4LR3A 2HVJC 5C8YA 5JH7B 4KL1A 5H2FZ 3MAQA 1Q6UA 2GUZB 4DR6B 1QVFU 2RCVA 1XMQB 3TXSA 3J81N 5GONB 2ZR2A 5FLXN 3ZHVA 3CMEV 4NKGB 3OE7G 1IXMA 5JJNB 3EHBB 1PPJH 2P22C 1VQ9V 4RQFA 3HB3B 4LFBO 2H3OA 4X64O 1Q6HA 4U3JA 1NH2B 4H33A 4CH5A 2RN9A 2YS8A 3PJSK 3KG2A 4O4IA 4QPKA 3ZX6A 3M7MX 3F5TA 5KMGA 5IJ0A 3OEEG 4HAMA 2XHBA 2YC0A 1XL4A 4NVPA 3ASOC 1SQGA 1IBMO 2JJ2G 1J5EO 1S5JA 4YHHO 1YJWV 5IDJA 2JS5A 5B3SB 2Q7GA 1VQMV 4B3RO 3OTOB 4C7UA 1K4CC 2OIGA 4RUFA 4DV0B 3FFQA 2B1IA 4KXRA 2ZM6O 5B66Z 2K9PA 2EIMC 2KB1A 2ETNA 2OTJV 4K0KB 1H8EG 3K5OA 4GKKO 3CCSV 2JVDA 2CAZC 5J2TB 4EFBA 1WN7A 1N34B 1GO3F 4JI3B 4X65O 5C93A 4UXNA 4DV2O 4D7SA 3CYOA 4Z1VA 1FJGB 3ABTA 5E79Z 1I5XA 2P90A 1G1XB 1BL8A 5H5NA 4X1IA 5LP6C 2QWQB 2GDSA 1SF9A 3RT3C 1HNXB 1HNZO 1XMOB 2YXLA 1KYOF 3G71V 3LSUA 4CS2A 3P3PA 2F93B 3JATA 3FYIB 4UCRA 1V54C 3VQWA 1DTOA 3CCQV 4L87A 1ZX3A 4F6RA 3JARB 1K5SA 3CX5F 2P7TC 1GTOA 4MTOA 4ZIBA 1TGOA 2AHZA 4LF7O 3H1JH 2P5OA 3OW2U 2UXBO 3WU2Z 2OWOA 1I94O 3SPGA 2X0LA 2QKSA 1S77D 4JI0B 3L75H 1R3IC 4RO2A 3CD6V 4O2BB 1S0VA 5GONA 4GYCB 1R3JC 4DV3O 1VIBA 4PDLA 2F4VB 3FB8C 3A0HZ 2CUGA 2Z0AA 3SJBC 2RJZA 2DQ3A 5LOVB 1N8RW 4U3FH 1XNQB 3JCZA 5EZYB 1LUWA 2EBOA 3RBZA 5LYJB 1H8HG 4NXMO 4UVBA 1HDJA 4NTXA 3ZRVA 4ZI7B 3F5WC 4JYCA 3RYCA 2UUBB 4QE7A 3VQXA 5KA5A 2XASA 4O4HB 2YXYA 2LW1A 2RQ6A 2YEVA 3DSQA 1QHTA 2N74A 4TV9A 3GB7C 3QNEA 1F51A 4IYHA 4JYAO 2AHYA 2AZ0A 4DV5B 3CRCA 4UCOA 4FFBB 1BQZA 1PP9H 5LP6A 2V4DA 2JGDB 3CCMV 4FFKA 3SJQC 1QR9A 4H44B 2AW9A 1Z5WA 3BAAA 1F4MA 2X6BA 5CB4A 4MVOA 3E86A 4R50A 3O9OA 3ZN1A 1QQCA 1CPYA 2DWEC 1N0JA 1W59A 2ODMA 1LUVA 3JAWB 1QLEC 1SZXA 1LNQA 5KHHA 3TCUA 1FS0G 1MMMA 3IJ4A 2PZSA 3ZMSA 1EM1A 3I55V 4FK5C 3AK2A 2WLLA 2JS3A 1L8DA 1H2SB 3WB1A 2PGGA 4G2KA 4RUEA 1UPGA 5KAFZ 2EJRA 2BOCC 3D3QA 1V9PA 4DR7B 3JD4A 3RYFA 4JV5O 1AB3A 1OCRC 3T2MA 1BSMA 4HNAB 5TISZ 4JPRA 2IU0A 3N2KA 1P7BA 3E8BA 1Y74A 3AK1A 3H9VA 2QTOA 4LFBB 2F1MA 1VEWA 3KCYA 4I0XB 4JAUA 2LQTA 4YIOA 3SGIA 2H94A 3AG1C 4FLXA 5KHJA 3TETA 3WG7B 1NVPB 5LOVA 3OGIB 2EJ7A 3FD9A 4PV1B 3OMIB 1WB8A 2WSSG 4PA9A 4IYIA 5EZYA 4I55B 1XMQO 1J5EB 2LJ2A 1KBHA 1HNWO 2R72A 1GKFA 1YIJV 4PA6A 2Q9LA 3HKEB 1X4TA 3MDSA 3ZEDA 3ZMVA 1Q5OA 3AG3B 1MNGA 3RWRD 3T1YO 2DMXA 3J80N 1NU1H 3EFFK 1F7YA 1H2LA 3T4ZA 2Q5ZA 1D2DA 1G4YB 4YJ3B 2QWPB 1URFA 1Q6IA 2W6IG 1EN5A 2R9IA 1NI8A 3CRMA 4LWSA 4QE9A 2BTOA 1COWG 2YICA 4GKKB 1Y66A 2QEXV 4MW8A 5EC1C 5BMVA 4KFMA 1VQKV 4DV4O 3L73H 3L74H 2EIKC 3JYCA 4X65B 3ZHSA 3UKMA 2QWRB 1BZKA 3Q4HA 4DK0A 4P2ZA 1LR1A 1Q90D 1SESA 3H01A 4G28B 5JQGB 1K3EA 3K3WA 4QPJA 1AJPA 1I0HA 2CTQA 1ZUQA 3KKYA 1HNZB 2F43G 1K34A 4AHCA 1VQPV 1KKCA 4WF9V 2JEXA 3QO5A 3ZMUA 3H1HH 3RFRA 1G6UA 3SYPA 1VQ7V 2HHHO 3PN1A 1ROPA 5IYZA 4LH6A 1RP3B 1Q3EA 1BQ0A 1XI1A 2A79B 2CE4A 3JAWA 5FL7G 2IJJA 4J42A 3ETGA 1SETA 3R66A 1XOUA 1O9HA 3O65A 4P30A 1VMGA 3QF7A 2UXBB 1FFXB 2ZNIA 1D5AA 1I94B 2CH7B 1MA1A 3T1HB 2Q4PA 4X9QA 1JFFB 4JGSA 5EIBC 1HNXO 2F23A 2P67A 3LSQA 2B1GA 1P7GA 2QDOA 4HNAA 1Z2GA 5B1NA 1KECA 2LFRA 1V55B 3F7VC 1Q86W 3ZHUA 1NH2D 3WB0A 4L8JA 1XHXA 4GLXA 4NXMB 3ABUA 2ZT9B 3M99B 4I50B 1K4DC 1R3LC 2GHYA 4I55A 1SQXH 3RYIB 4DW1A 2Q6AA 2ITCC 2OT5A 2D2CB 4FLWA 2F4VO 1IBLO 2Q7EA 2Q0OC 3UT5A 4DR4B 4J11A 5DM6V 3ABKC 1PNKA 2DYSB 3CC4V 3JALA 4UB6Z 1YITV 4K8XA 2QE7G 2WWWA 1VQNV 3CCRV 3AEIA 4TUYB 4ASUG 2X7RB 1J95A 4MW3A 2MK3A 5LHHA 4I4TB 4TQDA 5JVDB 1OCZB 2ILMA 2EIJC 4H0LB 5EYPB 2AZ2A 2JGUA 2DYSC 2QKAA 2W6JG 2XNDG 4I9QA 4J7KA 5BXZA 4DR2O 2QR4A 3SPIA 4HYOA 1B04A 4XBFA 1QCEA 4B3TO 4X62O 1S76D 5L3GA 1QLNA 1SQBH 5CBHA 1SKVA 4UUJC 3T1CA 4QJFB 4NR1A 2QM7A 2RMKB 4TWKA 5JJJB 1NT2B 3W7SA 4MSWC 5CMUA 1ZAUA 4BIZA 4O4JB 4JV5B 4EB6B 2CH7A 4GX1A 3RYHB 2BE3A 4TV8B 4BIUA 4AILC 3CSXA 3FB7C 1NR1A 1BMFG 4MVMA 4JTCB 2ZIOA 2X6CA 4D6TH 3K59A 1I08A 4X66O 3FAVB 4RWUA 2UXXA 4DR7O 2DYRC 3OUSA 2IW5A 3D3IA 1S72V 1HNWB 4XDJA 2PF4E 2PY5A 2WLMA
chains in the Genus database with same CATH topology
1IBMO 1J5EO 4LFCO 4YHHO 1X59A 1N36O 2VQEO 4JI6O 4DV3O 1HR0O 4DR5O 1XEQA 1N33O 4B3RO 2Z0AA 3J7AU 4DV5O 5IT9N 4LF8O 2DJVA 4JV5O 2HHHO 1XMOO 1AB3A 3T1HO 2ZM6O 4KHPO 1A32A 3M8AA 4DR6O 5LL6Y 4NXNO 5BXZA 4DR2O 2UXCO 1DK1A 2UU9O 3R66A 2E5LO 4NXMO 1AILA 3O65A 2UUCO 4B3TO 4YY3O 4X62O 1XNRO 4GKKO 4JI2O 4JI1O 2JRIA 4LF5O 4DR3O 1FYJA 4X65O 4DV2O 4AQYO 1HNXO 4LFAO 4DR1O 2N74A 2UUAO 4DV7O 4OPAA 1G1XB 5A2QN 4LF4O 1XMQO 4JI0O 4JYAO 1KUQA 2UXDO 4LF9O 1HNWO 4DV1O 5H5NA 2FKXA 4JI4O 2DOSA 2LW7A 1N32O 1FKAO 3RT3C 1HNZO 3T1YO 3J80N 3OTOO 4GKJO 1R6TA 5BR8O 1F7YA 1XNQO 4DV0O 1NS1A 3J81N 5FLXN 4DUZO 4DV6O 4B3SO 1D2DA 4DR4O 4DUYO 3JAMN 1R1BA 4LF6O 4OX9O 5IWAO 4A5UB 2AGAA 4K0KO 1YZBA 4JI5O 4LFBO 4DV4O 2ZKOA 4X64O 4LF7O 2VQFO 3SDLA 2F4VO 2UXBO 1IBLO 2UUBO 1I94O 1N34O 4X66O 5LMNO 4JI3O 4DR7O 3F5TA 1IBKO 4JI7O 5BY1A 4B3MO 1FJGO 4OPHA 4JI8O 5LMUO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM O;  1J5E O;  4LFC O;  4YHH O;  1X59 A;  1N36 O;  2VQE O;  4JI6 O;  4DV3 O;  1HR0 O;  4DR5 O;  1XEQ A;  1N33 O;  4B3R O;  2Z0A A;  3J7A U;  4DV5 O;  5IT9 N;  4LF8 O;  2DJV A;  4JV5 O;  2HHH O;  1XMO O;  1AB3 A;  3T1H O;  2ZM6 O;  4KHP O;  1A32 A;  3M8A A;  4DR6 O;  5LL6 Y;  4NXN O;  5BXZ A;  4DR2 O;  2UXC O;  1DK1 A;  2UU9 O;  3R66 A;  2E5L O;  4NXM O;  1AIL A;  3O65 A;  2UUC O;  4B3T O;  4YY3 O;  4X62 O;  1XNR O;  4GKK O;  4JI2 O;  4JI1 O;  2JRI A;  4LF5 O;  4DR3 O;  1FYJ A;  4X65 O;  4DV2 O;  4AQY O;  1HNX O;  4LFA O;  4DR1 O;  2N74 A;  2UUA O;  4DV7 O;  4OPA A;  1G1X B;  5A2Q N;  4LF4 O;  1XMQ O;  4JI0 O;  4JYA O;  1KUQ A;  2UXD O;  4LF9 O;  1HNW O;  4DV1 O;  5H5N A;  2FKX A;  4JI4 O;  2DOS A;  2LW7 A;  1N32 O;  1FKA O;  3RT3 C;  1HNZ O;  3T1Y O;  3J80 N;  3OTO O;  4GKJ O;  1R6T A;  5BR8 O;  1F7Y A;  1XNQ O;  4DV0 O;  1NS1 A;  3J81 N;  5FLX N;  4DUZ O;  4DV6 O;  4B3S O;  1D2D A;  4DR4 O;  4DUY O;  3JAM N;  1R1B A;  4LF6 O;  4OX9 O;  5IWA O;  4A5U B;  2AGA A;  4K0K O;  1YZB A;  4JI5 O;  4LFB O;  4DV4 O;  2ZKO A;  4X64 O;  4LF7 O;  2VQF O;  3SDL A;  2F4V O;  2UXB O;  1IBL O;  2UUB O;  1I94 O;  1N34 O;  4X66 O;  5LMN O;  4JI3 O;  4DR7 O;  3F5T A;  1IBK O;  4JI7 O;  5BY1 A;  4B3M O;  1FJG O;  4OPH A;  4JI8 O;  5LMU O; 
#chains in the Genus database with same CATH topology
 3GWK C;  4FLV A;  2V7Q G;  4MTX A;  4WBN B;  3T1Y B;  2WPD G;  4BAY A;  1OCO B;  1RM1 B;  2YIB D;  1H2M A;  1TAE A;  3RYI A;  2HLD G;  2P4V A;  2HJF C;  4PDV A;  4FM0 A;  3SYO A;  3N2G A;  2P06 A;  3TJT A;  4X1K A;  3ASN B;  3ZHR A;  3QG5 A;  5ITZ B;  5IY5 B;  2QKC A;  1EFR G;  4EFE A;  4DV4 B;  1VQ5 V;  3DC5 A;  3OUF A;  1Y76 B;  1YJN V;  2QA4 V;  3ETE A;  1JX9 A;  1F23 A;  3OR6 C;  1GN3 A;  3IC9 A;  1SA0 B;  2WA3 A;  3VQY A;  2HEP A;  1SER A;  4DXW A;  2IJK A;  2ZD9 A;  3P30 A;  3KCX A;  3R65 A;  1R6N A;  4F4L A;  2ARH A;  1NR7 A;  1XRE A;  4JI2 B;  3FKS G;  5B3S C;  3ZRW A;  2Y48 A;  4XDL A;  4JI4 O;  1GK9 A;  4DR3 B;  3BVO A;  4CH4 A;  2HHH B;  1Q8I A;  3ML0 A;  1YXB A;  1NS1 A;  3SPC A;  2UXD B;  1SQF A;  2OYQ A;  4BW5 A;  3LDC A;  4DUY O;  2Q7H A;  2GTA A;  3C90 A;  3BY6 A;  2XAJ A;  5D5P A;  4CH3 A;  1AJN A;  1K73 W;  1OZ0 A;  3E22 B;  1YF2 A;  2XAQ A;  3H1L H;  2D3O W;  4O4J A;  1SS3 A;  5LMN O;  4DW0 A;  3B77 A;  4LF6 B;  1K92 A;  4HBN A;  4MVS A;  5B1O A;  5CA0 A;  4OPH A;  4NTW A;  1M57 B;  4JI8 O;  2Y0I A;  1EZV H;  5KX5 A;  4UV8 A;  4WFH A;  3HR0 A;  1ZL8 B;  3QO7 A;  1EN4 A;  1US6 A;  5H9C A;  3CE2 A;  3AG2 B;  5JH7 A;  3T1H O;  4U7O A;  4KHP O;  2DE0 X;  1A32 A;  1NVP D;  2GUZ A;  2FL4 A;  3K04 A;  3RVY A;  3H1K H;  4FZ0 A;  5HFM A;  2ZE8 A;  4YJ2 B;  4LF8 B;  1IBL B;  3IC7 A;  5KUM A;  3AG2 C;  4UCS A;  5GTH Z;  2Q69 A;  4WBN A;  4AQY O;  1XBL A;  4NXN B;  1ORQ C;  2UXC B;  4UVC A;  1GN6 A;  1JVM A;  3STL C;  2E5L B;  2GTS A;  2JK5 C;  4PEL A;  1KUQ A;  2IBZ H;  1NTZ H;  2R9R B;  3CC2 V;  2BSK B;  4DV1 O;  5HFL A;  1QU7 A;  2LW7 A;  3H1I H;  1WP7 A;  1YCI A;  4LP8 A;  4DRX B;  1AP6 A;  1SQV H;  1WP8 A;  1Y76 A;  1ZSP A;  4GKJ O;  4DR2 B;  1CXZ B;  4JAS A;  4GUN A;  1Z5V A;  2ZDI C;  4DR4 O;  1R1B A;  4B3T B;  2GBO A;  1YEW A;  4X62 B;  2Q68 A;  4A5U B;  4YIP A;  1VF5 B;  3SPJ A;  1GN4 A;  2AGA A;  1MSW D;  3MHS C;  3ICX A;  2YID A;  5L3F A;  4J9Z B;  3A0B Z;  1YTF B;  3CRQ A;  3HKC B;  4ABM A;  5J2T A;  1GM7 A;  4O4L B;  1JQ0 A;  2WLH A;  3LDE A;  4O2A B;  5B1A B;  4FIP C;  2CTW A;  5EIB D;  3JSL A;  2YUA A;  3NXS A;  4B08 A;  1MZE A;  1PL0 A;  1M90 W;  2PYL A;  3JD2 A;  4BR6 A;  2Q0A A;  5CA3 A;  3DC6 A;  2ZIN A;  3GWO A;  4B3M B;  2KQX A;  1IXB A;  4ZHQ B;  3APQ A;  2Y69 B;  2VRZ A;  1N36 B;  4EKW A;  1HWY A;  3JAR A;  3I56 V;  2PI5 A;  1GM9 A;  2BTQ B;  2YI8 A;  1FXH A;  3RN4 A;  3L9D A;  4WFA V;  3D8C A;  2IM9 A;  4CC6 A;  1M56 B;  4X66 B;  3X2Q B;  3WFV A;  4FLU A;  4JAA A;  3K03 A;  4LNU B;  5LA6 B;  4MTF A;  4DV7 O;  3ABM B;  3A8T A;  3B4S A;  4JTD B;  2P6J A;  2DOS A;  2JEU A;  1OCC B;  4O2B A;  3ZJZ A;  2Q8V A;  2NLJ C;  3LNN A;  3K58 A;  1ZWI C;  1O9G A;  1E1R G;  1JJO A;  3ZMT A;  3JAK B;  3MHH C;  1YHQ V;  1S5H C;  4ZOL B;  4FVM A;  4X1Y B;  4IHJ B;  1G8M A;  2YSU B;  4KP4 A;  1Q43 A;  1K9M W;  5AG2 A;  1OCC C;  1WA8 B;  4FPP A;  5LYJ A;  4P9P A;  2FB5 A;  3RW0 A;  2ZDI A;  1XDC A;  1YZB A;  2WAM A;  1T5E A;  2BSK A;  3APO A;  4ZI7 A;  2HKO A;  3VQV A;  3WG7 C;  2L35 A;  1KMI Z;  5JCO C;  5H6Q A;  5DN6 G;  1JA8 A;  1GAX A;  2YIB A;  2F95 B;  4GX5 A;  2HVK C;  5FNV B;  2ZXW B;  2EUL A;  3E8H A;  1BGY H;  4O4H A;  3BA8 A;  2QM8 A;  4GZR B;  2ZQM A;  1U96 A;  2ADP A;  3DXR B;  2WLK A;  3D36 C;  4JI4 B;  4IIJ B;  5EBM C;  4E2L A;  4XDK A;  2Y0P A;  3IFX A;  3U10 A;  3AG3 C;  1WPX A;  1H2N A;  3L70 H;  3FB6 C;  1XUQ A;  1AR5 A;  4JI7 B;  1MOF A;  3ETQ A;  4DUY B;  4FFB A;  3OAA G;  1WPB A;  2KG7 B;  4CH6 A;  1AR4 A;  2CDY A;  1M93 A;  2JGD A;  1QBZ A;  1BHA A;  1AIL A;  1YDX A;  4MT8 A;  2V1D A;  3P32 A;  4O2A A;  3CS5 A;  1GN2 A;  4J9Y B;  1M9N A;  4JI2 O;  2QGN A;  2W0F C;  3BA9 A;  3L71 H;  4DR3 O;  4LF5 O;  1RSO B;  3DTU B;  5LMN B;  1W0J G;  3W7X A;  1VQO V;  3SYC A;  1IZ3 A;  1N0N A;  2UUC B;  4OPA A;  4JI8 B;  1WB7 A;  4ZHQ A;  3G6E V;  2UXD O;  4WFF A;  4K8Z A;  5IYC O;  5LGT A;  3K0D A;  3OMN B;  3LNM B;  5DEC A;  4KHP B;  1FPO A;  2YXH A;  5CBG A;  1E1Q G;  1FAF A;  4LF6 O;  4LNU A;  5LA6 A;  2KKW A;  3JAS B;  1YJ9 V;  1Y6X A;  1VF6 C;  5IWA O;  1CP9 A;  2G38 A;  2HG5 C;  5J2U B;  1AJQ A;  2FML A;  2YDE A;  2Z3Y A;  4AQY B;  4W4L A;  1PNL A;  4I0X A;  1DF4 A;  3CXC U;  1H2G A;  4B3S B;  4J7Z A;  3K0G A;  4Z1M G;  3W7T A;  3GVM A;  1KQS U;  3B2E E;  5JCO A;  2VWJ A;  3FB5 C;  1KP3 A;  4TT3 G;  1WNS A;  4DV1 B;  2NR5 A;  5C8Y B;  4IHJ A;  3AG7 A;  3HPL C;  1V55 C;  1L0N H;  3J7A U;  2CTP A;  3D36 A;  4GKJ B;  3OMA B;  4LF8 O;  3HKE A;  5LXT B;  3HKD B;  2GV9 A;  4NXN O;  2UXC O;  4LFC B;  5F2V O;  2IJH A;  2VQE B;  2E5L O;  4U3J B;  4JZ2 A;  4X88 A;  4YJ3 A;  2VWK A;  4PI0 A;  1ZTE A;  3TGU H;  3TK1 A;  1DLB A;  3EVK A;  4O4I B;  4UCT A;  5IJ0 B;  5EBL C;  4MVU A;  4LFA O;  4DR1 O;  2CK3 G;  1PL4 A;  3B09 A;  2UUA O;  1BE3 H;  5A2Q N;  3S3W A;  4YY3 B;  4LF4 O;  1W0K G;  4LF9 O;  2KG7 A;  4MVR A;  1W2B U;  3P3N A;  3SYQ A;  1VQ6 V;  3CRR A;  3WB2 A;  1XHZ A;  2A0L A;  4MVQ A;  4MTG A;  1OCZ C;  5JQG A;  2LGQ A;  4PDM A;  4WCE V;  4X8A A;  1OHH G;  4OGQ B;  1AVM A;  2YI9 A;  2EIN B;  3IAY A;  3BRC A;  2ZE6 A;  3VOU A;  3ETD A;  1YSC A;  5CA1 B;  4PJ0 Z;  1R6T A;  3W7U A;  2ZE7 A;  4DV6 O;  1PNM A;  5L3E A;  3JAM N;  3A2F A;  4OX9 O;  4R8C A;  2RNB A;  2XAF A;  4I7Z B;  3K9A A;  4CC5 A;  1VF6 A;  2EIL B;  4Z2W A;  3G80 A;  3CCV V;  1FFX A;  1N4C A;  5BZB A;  4DV7 B;  5KAI Z;  1FXV A;  2Z5U A;  4G27 B;  2QSA A;  4B3M O;  4X1I B;  1JFF A;  1QVG U;  2E74 B;  2ZR3 A;  1IX9 A;  3LUT B;  3G67 A;  1N36 O;  3JAS A;  3CB2 A;  4ICG A;  5FPR A;  2DW4 A;  1NTK H;  3JAT B;  4DK1 A;  2QWN B;  4JYY A;  3AG4 B;  3CEI A;  3K9S A;  3JD3 A;  4DO2 A;  3G4S V;  3BPZ A;  2HJD A;  2LP7 A;  1M4U A;  2K1E A;  4F6R B;  4IGG A;  2VS0 A;  2P4K A;  4QNH B;  1RPO A;  3ZS8 C;  4FLZ A;  4D7T A;  5JWP A;  1HR0 B;  4DR5 B;  1MG1 A;  3OR7 C;  1AI5 A;  5FPO A;  1GH6 A;  4RAI A;  1PD3 A;  4CZZ A;  3AG4 C;  3CXH F;  4I50 A;  4N23 A;  1GRJ A;  4X89 A;  1TA8 A;  4UV9 A;  1HP8 A;  2FTK A;  4FM1 A;  2W0X A;  1QNM A;  3L72 H;  4OXS A;  3RGB A;  5LGN A;  5LXT A;  3HKD A;  2BCC H;  2HR3 A;  5GTI Z;  4I5S A;  5EC2 C;  3ASO B;  4JI1 B;  5D5Q A;  4PHZ A;  1OCO C;  1N32 O;  1AP5 A;  1RM1 C;  2NNU A;  4TUY A;  2MW2 B;  4LCU C;  4I4T A;  2XOK G;  3BAB A;  5JVD A;  2R70 A;  3B8M A;  2KSD A;  3CCL V;  4BW9 A;  1YTF D;  5EYP A;  5IYB O;  4UVA A;  4QGP A;  3ASN C;  2EIM B;  5IY5 C;  3CMA V;  4GCZ A;  3RYC B;  2CTR A;  5IE9 A;  3JCU Z;  1QR8 A;  1AI4 A;  4R6Z A;  4LF5 B;  4JI5 O;  2YEV B;  1VF7 A;  2ZKO A;  1WLE A;  4TV9 B;  1CEZ A;  1JPX A;  3STZ C;  2EZP A;  3K5M A;  2YIA A;  4JI7 O;  5CA1 A;  2UXN A;  2AXT Z;  2NN4 A;  3FX7 A;  3EXA A;  4LC1 A;  5LMU O;  1SRY A;  1PM9 A;  2XAH A;  3MD0 A;  3ZRX A;  4ZBM A;  4BIO A;  3I5D A;  5LP6 B;  2E75 B;  2Q73 A;  1IUR A;  3NR7 A;  3K79 A;  3OEH G;  2ADQ B;  2QWO B;  2ATK C;  5CB4 B;  1K8A W;  1V54 B;  5KUK A;  4EB6 A;  5IWA B;  3CPW U;  2A3Q A;  3RYH A;  2UUC O;  1HW7 A;  4TV8 A;  5IYD O;  1MAB G;  3QTC A;  2DQ0 A;  2IH1 C;  3OGC C;  2JRI A;  2QTS A;  1R73 A;  3CRA A;  1FYJ A;  4DYL A;  2ZNJ A;  1NTM H;  1BT8 A;  4AI8 A;  2HP8 A;  2WLL B;  2DWD C;  3OT7 A;  3FAV A;  1M57 C;  3S3X A;  1S5L Z;  1EZJ A;  1ZLZ A;  2CGO A;  3RYF B;  4F6E A;  1SZT A;  1MSD A;  1TUE B;  3K5L A;  3UCS C;  3N2K B;  3OFN G;  5E1A C;  1FFT B;  3E35 A;  1Y74 B;  1DF5 A;  4B3S O;  1PV0 A;  2E3C A;  3IGA C;  3U0Z A;  4TQF A;  1KB9 F;  5ITZ A;  4LFA B;  1NZ6 A;  4DR1 B;  3LSS A;  2UUA B;  2A9H A;  1I5Y A;  4UB8 Z;  4LF4 B;  1IBK O;  4TOI A;  4LF9 B;  1IVS A;  2M7W A;  1SA0 A;  4CBC A;  3CP1 A;  1K7D A;  2FYU H;  3JD0 A;  4LH7 A;  4TSF G;  4LFC O;  5H6R A;  3B8N A;  5JJE B;  2VQE O;  1P84 F;  4JI6 O;  2VQF B;  1EBO A;  2ZIM A;  5IT9 N;  3CCJ V;  2B5U A;  3T4D A;  4CS4 A;  2XAG A;  4DV6 B;  4LWS B;  5LL6 Y;  4PD4 F;  4OX9 B;  4NYK A;  5BMV B;  5CN0 A;  1Q82 W;  3SYA A;  1GM8 A;  1UFI A;  4IT5 A;  4JZG A;  4P9O A;  4YY3 O;  4J41 A;  1XNR O;  2PTM A;  3Q4H B;  3JD1 A;  2QM4 A;  1OJH A;  2PYJ A;  3OTF A;  4K35 A;  1YI2 V;  2PI4 A;  1IDS A;  1BS3 A;  4W4K A;  3E22 A;  2UU9 B;  1QLE B;  3C3T A;  3G6B A;  5B1A C;  4NB5 A;  2WLJ A;  2XUM A;  4WFB V;  1SQQ H;  1VQL V;  4PA3 A;  2DN9 A;  1UJW B;  3K5N A;  3CJH B;  2FKX A;  3OD4 A;  3AK3 A;  4I9W A;  3W7W A;  4WFG A;  5IYZ B;  1R3K C;  3U11 A;  2LGW A;  1YVW A;  1EN6 A;  3JSN A;  1SQP H;  3UM7 A;  5BR8 O;  2Y69 C;  5K1P A;  1OCR B;  1ZL8 A;  4UCU A;  2OCC B;  3ZIA G;  1XQ8 A;  4DUZ O;  2X6A A;  4K3A A;  4MVZ A;  1MZF A;  3E8G A;  3ZHT A;  1VQ4 V;  2ZE5 A;  1B6Q A;  1JJ2 U;  1M56 C;  3X2Q C;  5LHI A;  2EX3 A;  3SDL A;  3AG1 B;  2OIE A;  5IJ9 B;  1AR1 B;  1TVK B;  4YJ2 A;  2OCC C;  5EK0 A;  2OCH A;  4UCV A;  4IL6 Z;  2WLN A;  3ABM C;  3CC7 V;  4H13 B;  3N27 A;  1B3Q A;  4Q6G A;  1P49 A;  1N32 B;  5LHG A;  1X59 A;  4X64 B;  1HR0 O;  4DR5 O;  2Q67 A;  1N33 O;  2EZO A;  2C2A A;  2H8P C;  4DRX A;  4DR6 O;  3ABL B;  3ZBH A;  4FJC C;  2RDC A;  1IBM B;  1DK1 A;  4YHH B;  5L3C A;  3LDD A;  3KZI Z;  4B3R B;  2XTA A;  4H37 A;  4JI5 B;  1GMG A;  4FM2 A;  1P4R A;  5GW7 A;  1VP7 A;  3UT5 B;  4JI1 O;  1Q7Y W;  1B06 A;  5L3D A;  1KKD A;  2EIK B;  2ZM6 B;  1XL6 A;  1KU9 A;  3JAL B;  4J7J A;  2ZXW C;  3BHP A;  4UFZ A;  3ABL C;  3SJA C;  2PUS A;  2L6L A;  3E89 A;  3HKC A;  2CGN A;  5LMU B;  2XT9 A;  4O4L A;  4YXW G;  4J10 A;  3DGE A;  1PKX A;  4ZKI A;  1Y67 A;  5EBW C;  2A06 H;  1JCH A;  4DV2 B;  1NQT A;  4B7E A;  1FD9 A;  5KHG A;  3OTO O;  1ENV A;  4B7K A;  2B9Z A;  4DV0 O;  3FYE B;  5LGU A;  1H38 A;  5KA6 A;  1R6K A;  3K06 A;  2O57 A;  1TUB B;  2WLI B;  3HKB B;  4FLT A;  4K0K O;  5CBF A;  5J9P C;  3CHX A;  4PI2 A;  1NJI W;  5KLV H;  3CJH A;  3SPH A;  4PA7 A;  1XIL A;  2JIZ G;  4Q20 A;  2BTQ A;  1N34 O;  1AI7 A;  4HZ3 A;  4RQE A;  1D5N A;  4JI3 O;  3UQ8 A;  2M6Y A;  5L3B A;  1FJG O;  1KC8 W;  2E76 B;  4U7N A;  2IJI A;  4LF7 B;  1NKD A;  1XEQ A;  1SC5 B;  5K1X A;  2GSM B;  1E79 G;  4KUM A;  3UO3 A;  3A0R A;  4WFE A;  1JMK C;  5A9G A;  4X20 B;  1XMO O;  3C3S A;  3QVN A;  5DED A;  5IJ9 A;  1TVK A;  3JAK A;  4PDR A;  1FXK B;  4DV3 B;  1THZ A;  2Y4U A;  4ZOL A;  1U97 A;  3SJC C;  5B5E Z;  4X1Y A;  4BWA A;  3K08 A;  2Y4T A;  1WA8 A;  2OTL V;  2HFE C;  4R7C A;  5KHI A;  1IBK B;  1JR9 A;  2WA4 A;  4JF3 A;  1FXK C;  3ABK B;  2ZCE A;  1BCC H;  5FNV A;  4JI0 O;  4J80 A;  3THO A;  1NBM G;  4CS3 A;  4JI6 B;  1KD1 W;  3ZHQ A;  3SR2 C;  3TXQ A;  3ZN0 A;  3DXR A;  3B40 A;  1FKA O;  2QJ1 A;  1VQ8 V;  4IIJ A;  3BCC H;  2EIJ B;  1M5I A;  3N2G B;  3BEH A;  5KMG B;  4X1K B;  1F4N A;  1XNQ O;  2LO1 A;  4JYA B;  1KP2 A;  4JTA B;  1L0L H;  4LBE C;  3CCU V;  3E83 A;  2IU3 A;  1XNR B;  3ZCC A;  1ARO P;  1L1F A;  3CWB H;  4JAV A;  2VQF O;  4FLY A;  2IH3 C;  4QIW F;  2UUB O;  1JOY A;  2F66 C;  4GX2 A;  4GT1 A;  1H2K A;  1RSO A;  5BY1 A;  3BFR A;  3ZRW B;  5B1B B;  1K33 A;  1WJZ A;  3E8F A;  1OV9 A;  2N05 A;  1TUB A;  3UO2 A;  4DV5 O;  2EIN C;  2N04 A;  2WLI A;  3HKB A;  5BR8 B;  3RVZ A;  2DJV A;  2ITD C;  4JYB A;  1AI6 A;  4MS2 A;  1M1K W;  4FMT A;  4DUZ B;  2A7W A;  3M8A A;  5B1B C;  1Y4M A;  2BOB C;  2UU9 O;  3ZRS A;  3ZMZ A;  4EEQ A;  2JJ1 G;  3QO8 A;  4NTY A;  4PA4 A;  2R9A A;  2JDI G;  1RPR A;  2EIL C;  5KHK A;  1S3J A;  1VAR A;  3E2E A;  1Q81 W;  5J2U A;  4FZ1 A;  5CA0 B;  3F7Y C;  3OM3 B;  4N21 A;  5LBQ A;  1I7F A;  2LFS A;  4X20 A;  2DYR B;  5KX5 B;  1K5Q A;  3CCE V;  1K97 A;  1BHB A;  3VBB A;  1N33 B;  3K57 A;  4E4E A;  1FXK A;  1WAZ A;  4GX0 A;  1DGS A;  1RFY A;  4LR3 A;  2HVJ C;  5C8Y A;  5JH7 B;  4KL1 A;  5H2F Z;  3MAQ A;  1Q6U A;  2GUZ B;  4DR6 B;  1QVF U;  2RCV A;  1XMQ B;  3TXS A;  3J81 N;  5GON B;  2ZR2 A;  5FLX N;  3ZHV A;  3CME V;  4NKG B;  3OE7 G;  1IXM A;  5JJN B;  3EHB B;  1PPJ H;  2P22 C;  1VQ9 V;  4RQF A;  3HB3 B;  4LFB O;  2H3O A;  4X64 O;  1Q6H A;  4U3J A;  1NH2 B;  4H33 A;  4CH5 A;  2RN9 A;  2YS8 A;  3PJS K;  3KG2 A;  4O4I A;  4QPK A;  3ZX6 A;  3M7M X;  3F5T A;  5KMG A;  5IJ0 A;  3OEE G;  4HAM A;  2XHB A;  2YC0 A;  1XL4 A;  4NVP A;  3ASO C;  1SQG A;  1IBM O;  2JJ2 G;  1J5E O;  1S5J A;  4YHH O;  1YJW V;  5IDJ A;  2JS5 A;  5B3S B;  2Q7G A;  1VQM V;  4B3R O;  3OTO B;  4C7U A;  1K4C C;  2OIG A;  4RUF A;  4DV0 B;  3FFQ A;  2B1I A;  4KXR A;  2ZM6 O;  5B66 Z;  2K9P A;  2EIM C;  2KB1 A;  2ETN A;  2OTJ V;  4K0K B;  1H8E G;  3K5O A;  4GKK O;  3CCS V;  2JVD A;  2CAZ C;  5J2T B;  4EFB A;  1WN7 A;  1N34 B;  1GO3 F;  4JI3 B;  4X65 O;  5C93 A;  4UXN A;  4DV2 O;  4D7S A;  3CYO A;  4Z1V A;  1FJG B;  3ABT A;  5E79 Z;  1I5X A;  2P90 A;  1G1X B;  1BL8 A;  5H5N A;  4X1I A;  5LP6 C;  2QWQ B;  2GDS A;  1SF9 A;  3RT3 C;  1HNX B;  1HNZ O;  1XMO B;  2YXL A;  1KYO F;  3G71 V;  3LSU A;  4CS2 A;  3P3P A;  2F93 B;  3JAT A;  3FYI B;  4UCR A;  1V54 C;  3VQW A;  1DTO A;  3CCQ V;  4L87 A;  1ZX3 A;  4F6R A;  3JAR B;  1K5S A;  3CX5 F;  2P7T C;  1GTO A;  4MTO A;  4ZIB A;  1TGO A;  2AHZ A;  4LF7 O;  3H1J H;  2P5O A;  3OW2 U;  2UXB O;  3WU2 Z;  2OWO A;  1I94 O;  3SPG A;  2X0L A;  2QKS A;  1S77 D;  4JI0 B;  3L75 H;  1R3I C;  4RO2 A;  3CD6 V;  4O2B B;  1S0V A;  5GON A;  4GYC B;  1R3J C;  4DV3 O;  1VIB A;  4PDL A;  2F4V B;  3FB8 C;  3A0H Z;  2CUG A;  2Z0A A;  3SJB C;  2RJZ A;  2DQ3 A;  5LOV B;  1N8R W;  4U3F H;  1XNQ B;  3JCZ A;  5EZY B;  1LUW A;  2EBO A;  3RBZ A;  5LYJ B;  1H8H G;  4NXM O;  4UVB A;  1HDJ A;  4NTX A;  3ZRV A;  4ZI7 B;  3F5W C;  4JYC A;  3RYC A;  2UUB B;  4QE7 A;  3VQX A;  5KA5 A;  2XAS A;  4O4H B;  2YXY A;  2LW1 A;  2RQ6 A;  2YEV A;  3DSQ A;  1QHT A;  2N74 A;  4TV9 A;  3GB7 C;  3QNE A;  1F51 A;  4IYH A;  4JYA O;  2AHY A;  2AZ0 A;  4DV5 B;  3CRC A;  4UCO A;  4FFB B;  1BQZ A;  1PP9 H;  5LP6 A;  2V4D A;  2JGD B;  3CCM V;  4FFK A;  3SJQ C;  1QR9 A;  4H44 B;  2AW9 A;  1Z5W A;  3BAA A;  1F4M A;  2X6B A;  5CB4 A;  4MVO A;  3E86 A;  4R50 A;  3O9O A;  3ZN1 A;  1QQC A;  1CPY A;  2DWE C;  1N0J A;  1W59 A;  2ODM A;  1LUV A;  3JAW B;  1QLE C;  1SZX A;  1LNQ A;  5KHH A;  3TCU A;  1FS0 G;  1MMM A;  3IJ4 A;  2PZS A;  3ZMS A;  1EM1 A;  3I55 V;  4FK5 C;  3AK2 A;  2WLL A;  2JS3 A;  1L8D A;  1H2S B;  3WB1 A;  2PGG A;  4G2K A;  4RUE A;  1UPG A;  5KAF Z;  2EJR A;  2BOC C;  3D3Q A;  1V9P A;  4DR7 B;  3JD4 A;  3RYF A;  4JV5 O;  1AB3 A;  1OCR C;  3T2M A;  1BSM A;  4HNA B;  5TIS Z;  4JPR A;  2IU0 A;  3N2K A;  1P7B A;  3E8B A;  1Y74 A;  3AK1 A;  3H9V A;  2QTO A;  4LFB B;  2F1M A;  1VEW A;  3KCY A;  4I0X B;  4JAU A;  2LQT A;  4YIO A;  3SGI A;  2H94 A;  3AG1 C;  4FLX A;  5KHJ A;  3TET A;  3WG7 B;  1NVP B;  5LOV A;  3OGI B;  2EJ7 A;  3FD9 A;  4PV1 B;  3OMI B;  1WB8 A;  2WSS G;  4PA9 A;  4IYI A;  5EZY A;  4I55 B;  1XMQ O;  1J5E B;  2LJ2 A;  1KBH A;  1HNW O;  2R72 A;  1GKF A;  1YIJ V;  4PA6 A;  2Q9L A;  3HKE B;  1X4T A;  3MDS A;  3ZED A;  3ZMV A;  1Q5O A;  3AG3 B;  1MNG A;  3RWR D;  3T1Y O;  2DMX A;  3J80 N;  1NU1 H;  3EFF K;  1F7Y A;  1H2L A;  3T4Z A;  2Q5Z A;  1D2D A;  1G4Y B;  4YJ3 B;  2QWP B;  1URF A;  1Q6I A;  2W6I G;  1EN5 A;  2R9I A;  1NI8 A;  3CRM A;  4LWS A;  4QE9 A;  2BTO A;  1COW G;  2YIC A;  4GKK B;  1Y66 A;  2QEX V;  4MW8 A;  5EC1 C;  5BMV A;  4KFM A;  1VQK V;  4DV4 O;  3L73 H;  3L74 H;  2EIK C;  3JYC A;  4X65 B;  3ZHS A;  3UKM A;  2QWR B;  1BZK A;  3Q4H A;  4DK0 A;  4P2Z A;  1LR1 A;  1Q90 D;  1SES A;  3H01 A;  4G28 B;  5JQG B;  1K3E A;  3K3W A;  4QPJ A;  1AJP A;  1I0H A;  2CTQ A;  1ZUQ A;  3KKY A;  1HNZ B;  2F43 G;  1K34 A;  4AHC A;  1VQP V;  1KKC A;  4WF9 V;  2JEX A;  3QO5 A;  3ZMU A;  3H1H H;  3RFR A;  1G6U A;  3SYP A;  1VQ7 V;  2HHH O;  3PN1 A;  1ROP A;  5IYZ A;  4LH6 A;  1RP3 B;  1Q3E A;  1BQ0 A;  1XI1 A;  2A79 B;  2CE4 A;  3JAW A;  5FL7 G;  2IJJ A;  4J42 A;  3ETG A;  1SET A;  3R66 A;  1XOU A;  1O9H A;  3O65 A;  4P30 A;  1VMG A;  3QF7 A;  2UXB B;  1FFX B;  2ZNI A;  1D5A A;  1I94 B;  2CH7 B;  1MA1 A;  3T1H B;  2Q4P A;  4X9Q A;  1JFF B;  4JGS A;  5EIB C;  1HNX O;  2F23 A;  2P67 A;  3LSQ A;  2B1G A;  1P7G A;  2QDO A;  4HNA A;  1Z2G A;  5B1N A;  1KEC A;  2LFR A;  1V55 B;  3F7V C;  1Q86 W;  3ZHU A;  1NH2 D;  3WB0 A;  4L8J A;  1XHX A;  4GLX A;  4NXM B;  3ABU A;  2ZT9 B;  3M99 B;  4I50 B;  1K4D C;  1R3L C;  2GHY A;  4I55 A;  1SQX H;  3RYI B;  4DW1 A;  2Q6A A;  2ITC C;  2OT5 A;  2D2C B;  4FLW A;  2F4V O;  1IBL O;  2Q7E A;  2Q0O C;  3UT5 A;  4DR4 B;  4J11 A;  5DM6 V;  3ABK C;  1PNK A;  2DYS B;  3CC4 V;  3JAL A;  4UB6 Z;  1YIT V;  4K8X A;  2QE7 G;  2WWW A;  1VQN V;  3CCR V;  3AEI A;  4TUY B;  4ASU G;  2X7R B;  1J95 A;  4MW3 A;  2MK3 A;  5LHH A;  4I4T B;  4TQD A;  5JVD B;  1OCZ B;  2ILM A;  2EIJ C;  4H0L B;  5EYP B;  2AZ2 A;  2JGU A;  2DYS C;  2QKA A;  2W6J G;  2XND G;  4I9Q A;  4J7K A;  5BXZ A;  4DR2 O;  2QR4 A;  3SPI A;  4HYO A;  1B04 A;  4XBF A;  1QCE A;  4B3T O;  4X62 O;  1S76 D;  5L3G A;  1QLN A;  1SQB H;  5CBH A;  1SKV A;  4UUJ C;  3T1C A;  4QJF B;  4NR1 A;  2QM7 A;  2RMK B;  4TWK A;  5JJJ B;  1NT2 B;  3W7S A;  4MSW C;  5CMU A;  1ZAU A;  4BIZ A;  4O4J B;  4JV5 B;  4EB6 B;  2CH7 A;  4GX1 A;  3RYH B;  2BE3 A;  4TV8 B;  4BIU A;  4AIL C;  3CSX A;  3FB7 C;  1NR1 A;  1BMF G;  4MVM A;  4JTC B;  2ZIO A;  2X6C A;  4D6T H;  3K59 A;  1I08 A;  4X66 O;  3FAV B;  4RWU A;  2UXX A;  4DR7 O;  2DYR C;  3OUS A;  2IW5 A;  3D3I A;  1S72 V;  1HNW B;  4XDJ A;  2PF4 E;  2PY5 A;  2WLM A; 
#chains in the Genus database with same CATH homology
 1IBM O;  1J5E O;  4LFC O;  4YHH O;  1X59 A;  1N36 O;  2VQE O;  4JI6 O;  4DV3 O;  1HR0 O;  4DR5 O;  1XEQ A;  1N33 O;  4B3R O;  2Z0A A;  3J7A U;  4DV5 O;  5IT9 N;  4LF8 O;  2DJV A;  4JV5 O;  2HHH O;  1XMO O;  1AB3 A;  3T1H O;  2ZM6 O;  4KHP O;  1A32 A;  3M8A A;  4DR6 O;  5LL6 Y;  4NXN O;  5BXZ A;  4DR2 O;  2UXC O;  1DK1 A;  2UU9 O;  3R66 A;  2E5L O;  4NXM O;  1AIL A;  3O65 A;  2UUC O;  4B3T O;  4YY3 O;  4X62 O;  1XNR O;  4GKK O;  4JI2 O;  4JI1 O;  2JRI A;  4LF5 O;  4DR3 O;  1FYJ A;  4X65 O;  4DV2 O;  4AQY O;  1HNX O;  4LFA O;  4DR1 O;  2N74 A;  2UUA O;  4DV7 O;  4OPA A;  1G1X B;  5A2Q N;  4LF4 O;  1XMQ O;  4JI0 O;  4JYA O;  1KUQ A;  2UXD O;  4LF9 O;  1HNW O;  4DV1 O;  5H5N A;  2FKX A;  4JI4 O;  2DOS A;  2LW7 A;  1N32 O;  1FKA O;  3RT3 C;  1HNZ O;  3T1Y O;  3J80 N;  3OTO O;  4GKJ O;  1R6T A;  5BR8 O;  1F7Y A;  1XNQ O;  4DV0 O;  1NS1 A;  3J81 N;  5FLX N;  4DUZ O;  4DV6 O;  4B3S O;  1D2D A;  4DR4 O;  4DUY O;  3JAM N;  1R1B A;  4LF6 O;  4OX9 O;  5IWA O;  4A5U B;  2AGA A;  4K0K O;  1YZB A;  4JI5 O;  4LFB O;  4DV4 O;  2ZKO A;  4X64 O;  4LF7 O;  2VQF O;  3SDL A;  2F4V O;  2UXB O;  1IBL O;  2UUB O;  1I94 O;  1N34 O;  4X66 O;  5LMN O;  4JI3 O;  4DR7 O;  3F5T A;  1IBK O;  4JI7 O;  5BY1 A;  4B3M O;  1FJG O;  4OPH A;  4JI8 O;  5LMU O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...