4JI7O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji7O00
2JRIA 1IBMO 2UUAO 2Z0AA 4JI5O 1HNWO 5BY1A 5BXZA 1N36O 1A32A 1XNQO 4JI3O 1XEQA 1XMOO 3M8AA 4JI7O 1FYJA 1XMQO 4NXMO 2VQEO 2HHHO 4LF5O 1KUQA 1I94O 4LFCO 5LMNO 4DUZO 4JI0O 5IWAO 5LMUO 4X66O 1D2DA 4JI8O 4LF9O 4LFBO 4DV7O 4GKKO 4AQYO 1F7YA 3R66A 3J80N 4OX9O 2ZKOA 4LF7O 5FLXN 1HNXO 4DR5O 3O65A 3JAMN 4JI6O 4JV5O 5IT9N 3RT3C 4NXNO 1N32O 4X64O 1AB3A 2VQFO 1XNRO 2N74A 2ZM6O 1J5EO 4KHPO 1IBKO 1DK1A 2FKXA 4DV6O 1R1BA 2DOSA 1N34O 1X59A 4LFAO 4B3MO 3SDLA 4A5UB 5BR8O 1NS1A 2DJVA 4B3TO 2UUBO 2UXCO 4DUYO 4X62O 4JI4O 1HNZO 2LW7A 1R6TA 4DR2O 4LF8O 4LF6O 5H5NA 3T1HO 4DV5O 1AILA 4DV3O 4K0KO 1IBLO 4DR4O 5LL6Y 1YZBA 4JI2O 4GKJO 4DV1O 3OTOO 4DV0O 4DR7O 1HR0O 4DR3O 3F5TA 4B3SO 1FJGO 2E5LO 5A2QN 3J7AU 2UUCO 4B3RO 1N33O 4OPHA 2AGAA 4DR1O 3T1YO 4DR6O 4JYAO 2UU9O 4DV2O 4JI1O 4DV4O 4YY3O 1G1XB 2UXDO 2F4VO 3J81N 4X65O 4LF4O 4OPAA 4YHHO 2UXBO 1FKAO
chains in the Genus database with same CATH superfamily
5TISZ 2GUZB 3ZRWB 2FMLA 1YI2V 4UCVA 2V4DA 3H1IH 3K9AA 1N36O 2UUBB 2PTMA 3CXHF 4UB8Z 4JI8B 3SJQC 3JD1A 4MVMA 4DR2B 4L8JA 1E1QG 4U7OA 5KHIA 3B4SA 4PA4A 3E8FA 3P30A 5LYJA 4FM1A 3FYEB 5E79Z 3CXCU 4IHJB 1M9NA 3QO5A 1EZJA 2BOBC 2A0LA 3SYPA 3CCVV 3KCYA 4HNAB 3UM7A 3T1YB 3UO3A 4CH5A 2ZNJA 2OIEA 1PPJH 1U97A 3OAAG 1F4NA 3W7TA 2IJHA 1IBKO 2X6BA 2JGDB 5D5QA 2QM8A 3SYQA 4LFAO 4X64B 4JZGA 1H2GA 5JCOC 1QBZA 3FX7A 2JS3A 5IYZB 4CH4A 2UXXA 5L3BA 4CS3A 1EM1A 1VIBA 3M99B 3ZHQA 2BTQA 3FD9A 2EX3A 4I9WA 3OT7A 4B3TB 5DN6G 4CC6A 5IYZA 5CBGA 3VQVA 1XHXA 1R6NA 4J7ZA 1SQBH 4JI2O 4DV0O 2WA4A 2XASA 4BWAA 2LFSA 4FLVA 4MW3A 4YJ2B 3LNNA 5A2QN 1R73A 3CCQV 2GHYA 2BSKA 2XAFA 4XDJA 5CB4A 1DGSA 4WFBV 1AR5A 3LDCA 4DR7B 4JYCA 1TGOA 1WB8A 3EHBB 4UCSA 2P4KA 3WG7B 2JRIA 2RN9A 1MABG 2YIBD 2EILC 3A8TA 4P2ZA 4UV8A 2EIMB 1PKXA 3RWRD 4JTAB 1GAXA 4IL6Z 3M8AA 3STLC 5GONA 3DC6A 1QVGU 2X7RB 4JTCB 2WLIA 4MT8A 3ZRSA 4MVRA 4JI8O 4LFBO 2EIJC 3IC9A 3OFNG 2Q73A 3P3PA 4FFBB 1QLEC 4CZZA 2EINC 3ZRVA 5IT9N 1AJNA 5EBLC 1MMMA 5KLVH 2BE3A 2CTQA 4DV4B 3RBZA 5IJ0A 1TVKA 1Q82W 1XUQA 4OGQB 2ZE8A 5CA1B 4YHHB 3D3QA 4D7TA 1TUBB 1SRYA 3TJTA 4O4LA 2Y0IA 4JF3A 3GB7C 3T4DA 4PDLA 1NVPB 5GTHZ 3WB2A 1LR1A 3ETDA 1P4RA 5B66Z 1HR0B 3B77A 1M57B 3W7WA 3ASOC 1I08A 3ZJZA 1YZBA 5JH7A 3QO8A 2EULA 4PV1B 2W6JG 3OTOO 3CSXA 3F5TA 1NR1A 4OXSA 4NTYA 2QDOA 1FXHA 2QR4A 1ZL8A 5KMGB 4X1KA 4JI2B 2XUMA 1WLEA 4U7NA 2DYSB 1WA8B 1FXVA 3RYCB 5J2UA 1EZVH 3W7UA 3FAVB 1R3JC 2WLIB 4JI5O 1Z2GA 1L0LH 2E76B 3CE2A 3ABKC 5B3SC 2M7WA 4NYKA 1BS3A 3H1JH 3GWKC 3ZEDA 4LF8B 3AEIA 4O4IA 1K5SA 1KB9F 1QR9A 2DYSC 3CX5F 1VQ4V 2LGWA 4JI7B 4MVZA 2ATKC 4GX5A 2A7WA 2QEXV 1P7BA 3JCUZ 4CBCA 5LHIA 3C3SA 4LF7O 3A2FA 1QHTA 3ZHSA 3ZHRA 5IDJA 4HNAA 3SYAA 1N33B 4LFBB 3JASB 1VF6C 3GVMA 4NXNO 3BEHA 2RDCA 1NR7A 2NN4A 2WLLB 4X1IB 2DOSA 3SYOA 4FLZA 2ZR2A 1Q5OA 2RNBA 4MTOA 5CA3A 3HKEB 1M4UA 2FYUH 1RSOA 4LR3A 5EIBC 3JD2A 4WBNB 4DUYO 3L72H 5IYCO 1O9HA 4WCEV 1NU1H 1XMQB 2P67A 4DR2O 1OHHG 5FNVB 3FAVA 4H0LB 3CC7V 3LSSA 1Y74A 3BY6A 3ZMUA 2AZ2A 4QPKA 2CGNA 3HKCA 5LHGA 3HKDA 1MNGA 5B3SB 1SERA 3K04A 1COWG 4K8XA 3A0RA 4B7KA 2GTSA 5FNVA 5IYDO 4JYYA 4GLXA 3D8CA 4B3SO 2PYLA 4JZ2A 2UUCO 1K33A 3RYIA 2BCCH 1FXKA 4H37A 5KX5A 3T1YO 3JYCA 2UU9O 2EZPA 2R70A 3OMAB 4YY3O 2GSMB 3ABKB 1Q7YW 1GM8A 4LFAB 3AG2B 4PA9A 1WAZA 3G6BA 1FXKC 1W2BU 5EYPA 2IM9A 1XMOO 4WFFA 3CCRV 1HNZB 4RQFA 3K3WA 1VQLV 2XAQA 2WLJA 3SJBC 1KECA 1Q6UA 1HNXB 5CB4B 1FFXA 4ZIBA 2DQ3A 1LUVA 3KZIZ 4EFEA 1Q6IA 1SQQH 1TA8A 4DV0B 3SPCA 2E75B 2RQ6A 3D36A 3ETGA 1MG1A 1AR4A 4WFGA 1G4YB 3RT3C 4J10A 3CCJV 2ZD9A 1B06A 2JK5C 2CAZC 1K5QA 4ZHQB 4GYCB 2EIKC 3W7XA 1XQ8A 3MHHC 3E86A 2L35A 5JVDB 3L74H 5L3CA 4PD4F 4TV9B 1AJQA 3MHSC 4WFAV 1NVPD 3T1HO 4J9YB 3QVNA 1VF7A 1QLNA 4K0KO 2GTAA 1BL8A 4I9QA 1S0VA 3VBBA 4DV7B 3ABMB 1R3LC 5CA1A 1GM9A 3OGIB 5DECA 5E1AC 5CN0A 2ODMA 4FM0A 4TV8A 4LF4B 1KP2A 1PP9H 1KD1W 2IW5A 2Q0AA 1KKCA 4O4LB 3ETEA 4H44B 1GKFA 2QWNB 2PZSA 3OEEG 1XILA 3ZMVA 2R72A 1J5EB 4WBNA 1XREA 4PDRA 2CH7A 2R9IA 1EFRG 3R65A 2UXBO 1JJ2U 2OCHA 2P90A 1BZKA 3E8BA 3K9SA 1K9MW 1A32A 1XNQO 5CA0A 2EJ7A 2H3OA 2Y0PA 1FYJA 3ZMZA 1DLBA 1JPXA 4IYHA 4KL1A 5EZYB 4Z1MG 4GX2A 4JASA 3BCCH 4X1KB 1F4MA 1MZFA 3R66A 4DRXB 1YDXA 3K5NA 2WLKA 4CH3A 3ASNB 5AG2A 4DUZB 1HNXO 3JAKB 2QTSA 1AI7A 2PY5A 4NVPA 4PA6A 3PJSK 2F95B 4UCUA 2N04A 4I5SA 4JYAB 4B3MB 4JAUA 1XOUA 2ITCC 3C90A 4XDKA 3OMIB 2YSUB 1DK1A 3CMAV 5L3EA 3N2GB 2B1IA 2ZIOA 2UUAB 1Y4MA 2A79B 5KAFZ 2CUGA 1KKDA 2ZM6B 1LNQA 3E83A 4DV3B 3JALA 3UT5A 5B1AC 5B5EZ 3OEHG 4JTDB 3OE7G 1ZX3A 1TUEB 1WP8A 2QWQB 1F23A 5IWAB 4JI0B 3HB3B 5LL6Y 3CCSV 3CCEV 1YITV 2ZNIA 1D5AA 1RPOA 1O9GA 4F4LA 3CWBH 1AP6A 2HJDA 3AG1C 1VQKV 3CRRA 1S5LZ 1VQOV 1KBHA 1Y6XA 1GTOA 2A3QA 2YXYA 1N33O 1BQ0A 4R8CA 1OCZC 3RVYA 3DC5A 1OCCC 2ZXWB 5LOVB 2LO1A 1G1XB 4LF4O 1BSMA 4YHHO 3ZRXA 1P84F 2JJ2G 2DWEC 1MSDA 4DXWA 1HNWO 2KG7B 2P4VA 4DUYB 2GDSA 5H6QA 4O4HA 1BT8A 1P7GA 4X20A 4LF5O 1JVMA 4IIJA 3AK3A 2O57A 3CRCA 3DXRA 1XNQB 1JFFB 4F6RA 1M90W 3WB0A 2HVJC 3APQA 4CC5A 4UCRA 2YXHA 3J80N 1D5NA 4OX9O 1NH2D 3ABMC 3JSLA 4PI2A 3G4SV 1PV0A 3JD4A 3O65A 2QE7G 5L3FA 4JI6O 3HKBA 4LF9B 1WNSA 5FL7G 3B2EE 1YEWA 2W0XA 3FB8C 1R1BA 1IDSA 4I50B 4LBEC 5JJJB 4P9OA 4B3MO 3BAAA 2ZCEA 4BIOA 4O2BA 1UPGA 3E2EA 4FFBA 3ZMSA 1YTFB 1YJ9V 4DV5B 2QM4A 2NNUA 4I4TB 3IAYA 4R6ZA 1ZWIC 1SQXH 4JI3B 1PNKA 3H1HH 3FYIB 4K35A 1K3EA 4LF8O 1V54C 3A0BZ 4DYLA 2OYQA 1MA1A 5LXTB 4EFBA 1K4DC 3QNEA 1NH2B 2QWOB 3E22A 5CBHA 3G80A 1VQMV 4JPRA 2QA4V 3SYCA 1VF5B 2DW4A 2OCCC 2HEPA 4H33A 1CEZA 4OPHA 1G6UA 2RMKB 3ZHVA 5JCOA 1N0NA 1XNRB 2WSSG 2YI9A 3STZC 3AG3C 2LJ2A 5JJEB 4IGGA 1QU7A 3JD0A 2V7QG 3OM3B 2YDEA 1IBMO 3RYHB 2GBOA 1L1FA 1MSWD 5BY1A 5B1BC 1P49A 2VS0A 3TXQA 1N0JA 1QR8A 1KUQA 1I94O 1S5HC 3CJHA 3LDDA 1V55B 3CB2A 2FTKA 3EXAA 4ZI7B 1URFA 5F2VO 4MVOA 3CCUV 3SGIA 1RM1B 1E79G 2Q68A 1EN6A 4LNUA 2W6IG 4MS2A 3DSQA 5EC1C 3K59A 3P32A 5LGNA 1SQGA 1BGYH 3JATA 2Y69B 4KUMA 2N74A 1N8RW 2EBOA 4X1YB 4YJ3A 4XBFA 1V55C 2OCCB 2YICA 3JSNA 4DK1A 1YCIA 5H9CA 2ADQB 1IX9A 2Q4PA 1TAEA 4KFMA 1I7FA 4LWSB 5B1BB 4HYOA 1HNZO 4Q20A 2JGUA 2QSAA 1I5XA 2AHZA 4MTFA 5CBFA 2HFEC 4LP8A 1AVMA 5J2UB 1GN2A 1NT2B 4DR6B 3ZIAG 1G8MA 1Q3EA 2LW1A 3BPZA 2F1MA 3CRAA 4MTXA 2AGAA 2CGOA 2ZE5A 2HVKC 4DR1O 4JYAO 1FD9A 4NKGB 4GKJB 5JH7B 4HBNA 2E3CA 3AG2C 4X65O 1V9PA 4NTXA 4IT5A 1JJOA 1FS0G 2AHYA 3TETA 3A0HZ 2UUAO 2FB5A 1M56B 2YIDA 2F93B 2KB1A 4AHCA 1BMFG 2FL4A 1M1KW 1YHQV 1XEQA 4JI4B 4O2AB 4HAMA 3IFXA 1BCCH 3JARB 2VQEO 1IXMA 1B04A 4L87A 4K8ZA 1VQPV 3S3XA 1NTMH 1KQSU 1QNMA 4I55B 4DV7O 4ZKIA 3K5OA 2VQFB 4FLTA 2RJZA 5EZYA 1I94B 4U3JA 3QO7A 5EK0A 3N2KB 3HKBB 1YXBA 3K79A 3SJAC 1N32O 4JYBA 1J5EO 1ENVA 2FKXA 4QGPA 2JS5A 1NQTA 3ZMTA 1OCOC 2DE0X 4X20B 3SDLA 3RYFA 3TCUA 3F7YC 2HR3A 1SETA 1ZAUA 2P22C 4LH7A 1HDJA 1HNWB 1YTFD 1VARA 1BHAA 2CE4A 4FLXA 1EN5A 4MSWC 4G27B 3ZN0A 3U0ZA 3K06A 1ZTEA 1VMGA 4GKKB 1DTOA 3K5LA 1Q90D 1AP5A 5C8YB 2YEVA 3E8GA 5L3DA 4DW1A 4QNHB 3MAQA 4DR5B 2LGQA 4N23A 3UQ8A 1IURA 1H2NA 2ADPA 3OR6C 3E35A 4TUYA 3AK1A 1US6A 3BVOA 4WF9V 4TQFA 4QE7A 1W0JG 1IXBA 1XI1A 2JGDA 4GZRB 3WG7C 5BMVA 2CTRA 2P7TC 5JQGB 3CC2V 4U3JB 4QE9A 1SZXA 4BIUA 5HFMA 2AXTZ 1AR1B 2LP7A 3K57A 4IYIA 4JI0O 5IWAO 2Z5UA 3O9OA 2X0LA 1SQFA 4FFKA 3H1LH 4MVSA 1RFYA 3QG5A 3N2GA 3U10A 1BHBA 2HG5C 4FLUA 1AB3A 1NJIW 2WLLA 1H2SB 2VQFO 1AJPA 4YJ2A 2QWRB 4X9QA 3I55V 3CD6V 4PJ0Z 5CA0B 1JOYA 1EN4A 4W4KA 3UO2A 4GT1A 2K1EA 3LSQA 4DV1B 4LF6O 4PI0A 1VP7A 2LQTA 3DXRB 1SA0B 4DR4O 1CXZB 5GTIZ 4ICGA 4JGSA 1DF5A 5GONB 1WB7A 2RCVA 3JD3A 4OX9B 1HR0O 4YJ3B 2W0FC 3FKSG 2F4VB 5LXTA 2E5LO 3L71H 4JI6B 3J7AU 2H8PC 4FPPA 5J2TB 2Y4TA 1XL4A 1K73W 2JEUA 2ZDIA 3CCMV 3DGEA 3B40A 1N36B 1K97A 4XDLA 2CDYA 2IU0A 2JEXA 3CEIA 4NXMB 4D6TH 2MK3A 2DYRC 2IH3C 3H1KH 1R3KC 2XAGA 4I4TA 4MTGA 1M5IA 3JAWB 4RAIA 2CK3G 3D36C 4JI3O 5LMUB 3L73H 1SESA 3B8NA 3GWOA 4JI5B 3HPLC 1N4CA 4YXWG 1SA0A 4HZ3A 1KMIZ 3ASNC 3SPGA 3K0GA 4G2KA 3ML0A 1XBLA 4X89A 3KKYA 1FFXB 1WPBA 1IBKB 4O2BB 2KSDA 3RGBA 2HKOA 2MW2B 2WPDG 3NR7A 5KHJA 3APOA 4EKWA 1XNRO 2L6LA 1OV9A 4UV9A 4BIZA 1M56C 4YIPA 1MZEA 1NS1A 1IZ3A 1H2KA 4MVUA 4B3TO 4N21A 5C93A 4TOIA 1MOFA 2VWJA 3UCSC 4JI4O 2BSKB 3I56V 1S77D 2YC0A 2XTAA 2VQEB 5EC2C 1YIJV 1AILA 2JVDA 1K92A 5B1NA 1GH6A 2CTPA 5KX5B 4DR7O 1L0NH 3D3IA 3K03A 5FPRA 4O4JA 4MVQA 5KHKA 1FJGO 5IJ9A 3K0DA 3Q4HA 4H13B 1T5EA 2HP8A 4R7CA 2D2CB 4JI1O 1XDCA 1JA8A 3FB6C 3ABLC 3FB5C 4ZBMA 2OIGA 4J80A 3SJCC 5JWPA 2VWKA 1FPOA 4R50A 4P30A 3RN4A 5BZBA 1ZLZA 2F66C 1KYOF 4X62B 2B5UA 4O4HB 3G67A 4NXMO 3HKCB 2HHHO 5KHGA 1PNMA 3OMNB 3MD0A 4I55A 5IY5B 2KG7A 5LP6C 5LMUO 4F6RB 3T1CA 4DO2A 4GX0A 3EFFK 2IU3A 2PYJA 2Y48A 5FLXN 3CP1A 2EIMC 2M6YA 4JV5O 4UCOA 1XHZA 1S76D 4DK0A 4J42A 1AROP 4UVAA 3VQYA 1SZTA 2YXLA 2QJ1A 3BHPA 4DV6O 4GCZA 1YVWA 4J7JA 3ZS8C 1B6QA 1YJNV 3THOA 1Q43A 3T4ZA 2JDIG 4Q6GA 4IHJA 2F23A 4PDVA 5EBWC 4NTWA 4WFHA 1H2MA 3JALB 5DEDA 3UT5B 1SQPH 2Q5ZA 2K9PA 1WA8A 5KUKA 4B3RB 3K5MA 5ITZA 3T1HB 2IBZH 2ETNA 1H2LA 4F6EA 2WAMA 5FPOA 5H2FZ 1S5JA 1RM1C 1UFIA 1N32B 1NZ6A 5IE9A 1S3JA 1KP3A 3FB7C 1R3IC 4IIJB 4DV2O 1AI6A 1ORQC 1X4TA 2A06H 3C3TA 2GV9A 1OCRC 1L8DA 2QM7A 1JCHA 3ASOB 5LOVA 4X1IA 2N05A 2Z0AA 4PA3A 1S72V 1PL0A 2F43G 3ZN1A 2H94A 1WJZA 4I0XA 4UXNA 1JQ0A 3BABA 2UXBB 2P06A 3E22B 4NB5A 4JI7O 5JVDA 4LF7B 4FZ1A 5BMVB 1CPYA 2KQXA 5A9GA 4X66O 5DM6V 3LNMB 4UUJC 4U3FH 1K8AW 4GKKO 2HHHB 2XT9A 3CRMA 1VQ6V 4DR5O 3L75H 3ZBHA 2OTJV 1HP8A 4E4EA 2AW9A 4TV8B 1K34A 4ZOLA 2UXDB 5C8YA 3AG4B 1Z5VA 4JV5B 3ABLB 4DW0A 2ZQMA 1RPRA 1KC8W 4YIOA 3AG1B 2WWWA 5CMUA 4W4LA 2DJVA 4FLWA 3JAKA 3AK2A 1IVSA 1WPXA 2R9AA 1OCCB 2ZXWC 3IC7A 1R6TA 2G38A 5H5NA 3MDSA 5GW7A 3SPIA 4DV3O 4ABMA 3JASA 5B1AB 1CP9A 2UUCB 1VQNV 2IJKA 3ZX6A 3HKDB 2QKAA 5KUMA 3ABUA 4QJFB 4B3RO 2LFRA 3CRQA 3UKMA 3X2QC 2BTQB 1VQ7V 2XNDG 1I5YA 3H9VA 4KP4A 3J81N 1FXKB 3ZCCA 4OPAA 5J2TA 4FIPC 4GUNA 2Q8VA 1M93A 5BR8B 1SQVH 5IJ0B 1DF4A 2AZ0A 2V1DA 2WLHA 5EBMC 2IH1C 5LGTA 5KA5A 1PNLA 3B09A 4AQYB 4EEQA 2JIZG 4WFEA 5LP6A 4TQDA 2DN9A 3OR7C 1VEWA 4X8AA 5EIBD 1GO3F 4DR3B 4EB6A 2E5LB 1SF9A 1FJGB 1GK9A 2XAHA 3AG4C 3JAMN 3TGUH 4X66B 4RUFA 3CCLV 1TUBA 2ZE7A 2OT5A 3OGCC 4LCUC 2EZOA 3CJHB 3DTUB 1N34O 2IJJA 5KAIZ 4FZ0A 3H01A 1YJWV 4E2LA 4CS4A 4CH6A 3W7SA 5JJNB 3OUSA 4K0KB 1Y74B 3RYIB 3EVKA 4BAYA 4X62O 3CHXA 1TVKB 2Q0OC 5LA6B 1J95A 1RP3B 3RYHA 1JFFA 1YF2A 1JX9A 2CH7B 5LGUA 4TWKA 4DV5O 2OTLV 1IBLO 2Q6AA 1NTZH 2ZT9B 4AI8A 1SC5B 3X2QB 5IJ9B 2Z3YA 2XAJA 4RO2A 1EBOA 2YI8A 1GRJA 2X6AA 1ZUQA 1XL6A 4AILC 4K3AA 4ASUG 5IYBO 4FM2A 3VQWA 4UB6Z 3Q4HB 5H6RA 1FFTB 5KA6A 3L70H 1VF6A 2ILMA 5BXZA 5LMNB 2BTOA 2XOKG 4PDMA 3S3WA 1U96A 4PA7A 4Z2WA 4UFZA 2HJFC 3SR2C 1BQZA 3OD4A 4LFCO 1Q8IA 4DUZO 2YUAA 1JR9A 4ZOLB 4P9PA 2Q69A 3M7MX 3PN1A 4AQYO 4NR1A 2CTWA 3E89A 4KHPB 3LUTB 3ZHUA 4TUYB 4FK5C 4UVCA 1M57C 4ZHQA 3HKEA 1ROPA 3SPHA 1AI5A 4JAAA 4JI1B 4DV2B 1Q86W 3IGAC 2ZM6O 3WB1A 2VRZA 4RUEA 2Q67A 2QGNA 3RYCA 2Y69C 2PGGA 4GX1A 1BE3H 2JJ1G 1Q81W 2YIAA 3KCXA 2UUBO 3TK1A 1WP7A 4O4JB 2LW7A 3OW2U 1VQ8V 2ZR3A 3E8HA 1W59A 2E74B 3JATB 2Y4UA 3RVZA 5B1OA 4LH6A 1LUWA 3JCZA 3G71V 2EIJB 5L3GA 4CS2A 2NLJC 4G28B 3CPWU 4TSFG 2B9ZA 4DR6O 4LWSA 1W0KG 4DV4O 5ITZB 2Q9LA 3HR0A 4DV6B 3U11A 4D7SA 1NKDA 4DR1B 4I50A 2ZDIC 5LA6A 1GMGA 4LF5B 2ZINA 4X1YA 1H8HG 2C2AA 2YEVB 1AI4A 3BFRA 5LBQA 4J9ZB 4X88A 1H38A 2DMXA 2IJIA 1H8EG 1Y76B 1FAFA 5LMNO 2OWOA 1ZL8B 5KMGA 1D2DA 4LF9O 1Y67A 3OTOB 5LHHA 3WU2Z 3BRCA 4O4IB 2DWDC 2ZIMA 4I0XB 3G6EV 4I7ZB 3RYFB 4ZI7A 4KHPO 5LYJB 3K08A 1QVFU 2KKWA 2P6JA 5IY5C 4TV9A 1X59A 4LNUB 3SPJA 1UJWB 5BR8O 3BA9A 2DYRB 5K1XA 1OJHA 2WLNA 3N27A 2PUSA 3RFRA 3N2KA 4PELA 3ETQA 2UXCO 2WLMA 3BA8A 1GM7A 1QLEB 1GN4A 1NBMG 5K1PA 4Z1VA 3ZRWA 1Y76A 3F5WC 4LC1A 2NR5A 3AG7A 1R6KA 1RSOB 2ZE6A 2ITDC 4RWUA 5JQGA 1SS3A 1Y66A 3ICXA 1B3QA 3I5DA 2ARHA 4DR3O 1OCOB 3QF7A 3JAWA 2Q7GA 3QTCA 2YIBA 5KHHA 3AG3B 3T2MA 3VOUA 1GN3A 1PD3A 1NTKH 2R9RB 4UCTA 4FLYA 3WFVA 1YSCA 1IBMB 2EJRA 4BW9A 3NXSA 2UXDO 2QKSA 4FVMA 1QCEA 3RW0A 5HFLA 3OUFA 1OCRB 3ABTA 4BW5A 4PHZA 1VQ5V 4J11A 2QWPB 1JMKC 1HWYA 1Z5WA 4B7EA 2X6CA 4QIWF 1E1RG 1XMQO 1OZ0A 1V54B 4MW8A 1I0HA 4C7UA 3FFQA 4B08A 2EIKB 1IBLB 2B1GA 1SKVA 4RQEA 3CC4V 2P5OA 3LDEA 1F7YA 3VQXA 1KU9A 3B8MA 4J7KA 1F51A 2HLDG 2ZKOA 4JAVA 3CYOA 2Q7HA 4B3SB 1NI8A 3P3NA 2A9HA 4QPJA 2Q7EA 4X64O 1ZSPA 1PL4A 2UU9B 2WA3A 4YY3B 5EYPB 2D3OW 1QQCA 3CS5A 3LSUA 2EILB 4A5UB 1WN7A 4O2AA 1K4CC 3JARA 5D5PA 4TT3G 3ZHTA 4FMTA 4J41A 1VQ9V 1THZA 1XMOB 3TXSA 2PI5A 4LFCB 3L9DA 5LP6B 2QKCA 4KXRA 2UXCB 1GN6A 2YS8A 2UXNA 2QTOA 4GKJO 4DV1O 4LF6B 1Q6HA 2PF4E 4EB6B 1HW7A 4DRXA 4DR4B 3KG2A 4UVBA 4X65B 4FJCC 2EINB 3CMEV 4NXNB 2GUZA 3OTFA 5J9PC 1PM9A 3K58A 1K7DA 1OCZB 2DQ0A 3IJ4A 2F4VO 2BOCC 2XHBA 1N34B 3F7VC 4BR6A 2PI4A 1FKAO
chains in the Genus database with same CATH topology
2JRIA 1IBMO 2UUAO 2Z0AA 4JI5O 1HNWO 5BY1A 5BXZA 1N36O 1A32A 1XNQO 4JI3O 1XEQA 1XMOO 3M8AA 4JI7O 1FYJA 1XMQO 4NXMO 2VQEO 2HHHO 4LF5O 1KUQA 1I94O 4LFCO 5LMNO 4DUZO 4JI0O 5IWAO 5LMUO 4X66O 1D2DA 4JI8O 4LF9O 4LFBO 4DV7O 4GKKO 4AQYO 1F7YA 3R66A 3J80N 4OX9O 2ZKOA 4LF7O 5FLXN 1HNXO 4DR5O 3O65A 3JAMN 4JI6O 4JV5O 5IT9N 3RT3C 4NXNO 1N32O 4X64O 1AB3A 2VQFO 1XNRO 2N74A 2ZM6O 1J5EO 4KHPO 1IBKO 1DK1A 2FKXA 4DV6O 1R1BA 2DOSA 1N34O 1X59A 4LFAO 4B3MO 3SDLA 4A5UB 5BR8O 1NS1A 2DJVA 4B3TO 2UUBO 2UXCO 4DUYO 4X62O 4JI4O 1HNZO 2LW7A 1R6TA 4DR2O 4LF8O 4LF6O 5H5NA 3T1HO 4DV5O 1AILA 4DV3O 4K0KO 1IBLO 4DR4O 5LL6Y 1YZBA 4JI2O 4GKJO 4DV1O 3OTOO 4DV0O 4DR7O 1HR0O 4DR3O 3F5TA 4B3SO 1FJGO 2E5LO 5A2QN 3J7AU 2UUCO 4B3RO 1N33O 4OPHA 2AGAA 4DR1O 3T1YO 4DR6O 4JYAO 2UU9O 4DV2O 4JI1O 4DV4O 4YY3O 1G1XB 2UXDO 2F4VO 3J81N 4X65O 4LF4O 4OPAA 4YHHO 2UXBO 1FKAO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI A;  1IBM O;  2UUA O;  2Z0A A;  4JI5 O;  1HNW O;  5BY1 A;  5BXZ A;  1N36 O;  1A32 A;  1XNQ O;  4JI3 O;  1XEQ A;  1XMO O;  3M8A A;  4JI7 O;  1FYJ A;  1XMQ O;  4NXM O;  2VQE O;  2HHH O;  4LF5 O;  1KUQ A;  1I94 O;  4LFC O;  5LMN O;  4DUZ O;  4JI0 O;  5IWA O;  5LMU O;  4X66 O;  1D2D A;  4JI8 O;  4LF9 O;  4LFB O;  4DV7 O;  4GKK O;  4AQY O;  1F7Y A;  3R66 A;  3J80 N;  4OX9 O;  2ZKO A;  4LF7 O;  5FLX N;  1HNX O;  4DR5 O;  3O65 A;  3JAM N;  4JI6 O;  4JV5 O;  5IT9 N;  3RT3 C;  4NXN O;  1N32 O;  4X64 O;  1AB3 A;  2VQF O;  1XNR O;  2N74 A;  2ZM6 O;  1J5E O;  4KHP O;  1IBK O;  1DK1 A;  2FKX A;  4DV6 O;  1R1B A;  2DOS A;  1N34 O;  1X59 A;  4LFA O;  4B3M O;  3SDL A;  4A5U B;  5BR8 O;  1NS1 A;  2DJV A;  4B3T O;  2UUB O;  2UXC O;  4DUY O;  4X62 O;  4JI4 O;  1HNZ O;  2LW7 A;  1R6T A;  4DR2 O;  4LF8 O;  4LF6 O;  5H5N A;  3T1H O;  4DV5 O;  1AIL A;  4DV3 O;  4K0K O;  1IBL O;  4DR4 O;  5LL6 Y;  1YZB A;  4JI2 O;  4GKJ O;  4DV1 O;  3OTO O;  4DV0 O;  4DR7 O;  1HR0 O;  4DR3 O;  3F5T A;  4B3S O;  1FJG O;  2E5L O;  5A2Q N;  3J7A U;  2UUC O;  4B3R O;  1N33 O;  4OPH A;  2AGA A;  4DR1 O;  3T1Y O;  4DR6 O;  4JYA O;  2UU9 O;  4DV2 O;  4JI1 O;  4DV4 O;  4YY3 O;  1G1X B;  2UXD O;  2F4V O;  3J81 N;  4X65 O;  4LF4 O;  4OPA A;  4YHH O;  2UXB O;  1FKA O; 
#chains in the Genus database with same CATH topology
 5TIS Z;  2GUZ B;  3ZRW B;  2FML A;  1YI2 V;  4UCV A;  2V4D A;  3H1I H;  3K9A A;  1N36 O;  2UUB B;  2PTM A;  3CXH F;  4UB8 Z;  4JI8 B;  3SJQ C;  3JD1 A;  4MVM A;  4DR2 B;  4L8J A;  1E1Q G;  4U7O A;  5KHI A;  3B4S A;  4PA4 A;  3E8F A;  3P30 A;  5LYJ A;  4FM1 A;  3FYE B;  5E79 Z;  3CXC U;  4IHJ B;  1M9N A;  3QO5 A;  1EZJ A;  2BOB C;  2A0L A;  3SYP A;  3CCV V;  3KCY A;  4HNA B;  3UM7 A;  3T1Y B;  3UO3 A;  4CH5 A;  2ZNJ A;  2OIE A;  1PPJ H;  1U97 A;  3OAA G;  1F4N A;  3W7T A;  2IJH A;  1IBK O;  2X6B A;  2JGD B;  5D5Q A;  2QM8 A;  3SYQ A;  4LFA O;  4X64 B;  4JZG A;  1H2G A;  5JCO C;  1QBZ A;  3FX7 A;  2JS3 A;  5IYZ B;  4CH4 A;  2UXX A;  5L3B A;  4CS3 A;  1EM1 A;  1VIB A;  3M99 B;  3ZHQ A;  2BTQ A;  3FD9 A;  2EX3 A;  4I9W A;  3OT7 A;  4B3T B;  5DN6 G;  4CC6 A;  5IYZ A;  5CBG A;  3VQV A;  1XHX A;  1R6N A;  4J7Z A;  1SQB H;  4JI2 O;  4DV0 O;  2WA4 A;  2XAS A;  4BWA A;  2LFS A;  4FLV A;  4MW3 A;  4YJ2 B;  3LNN A;  5A2Q N;  1R73 A;  3CCQ V;  2GHY A;  2BSK A;  2XAF A;  4XDJ A;  5CB4 A;  1DGS A;  4WFB V;  1AR5 A;  3LDC A;  4DR7 B;  4JYC A;  1TGO A;  1WB8 A;  3EHB B;  4UCS A;  2P4K A;  3WG7 B;  2JRI A;  2RN9 A;  1MAB G;  2YIB D;  2EIL C;  3A8T A;  4P2Z A;  4UV8 A;  2EIM B;  1PKX A;  3RWR D;  4JTA B;  1GAX A;  4IL6 Z;  3M8A A;  3STL C;  5GON A;  3DC6 A;  1QVG U;  2X7R B;  4JTC B;  2WLI A;  4MT8 A;  3ZRS A;  4MVR A;  4JI8 O;  4LFB O;  2EIJ C;  3IC9 A;  3OFN G;  2Q73 A;  3P3P A;  4FFB B;  1QLE C;  4CZZ A;  2EIN C;  3ZRV A;  5IT9 N;  1AJN A;  5EBL C;  1MMM A;  5KLV H;  2BE3 A;  2CTQ A;  4DV4 B;  3RBZ A;  5IJ0 A;  1TVK A;  1Q82 W;  1XUQ A;  4OGQ B;  2ZE8 A;  5CA1 B;  4YHH B;  3D3Q A;  4D7T A;  1TUB B;  1SRY A;  3TJT A;  4O4L A;  2Y0I A;  4JF3 A;  3GB7 C;  3T4D A;  4PDL A;  1NVP B;  5GTH Z;  3WB2 A;  1LR1 A;  3ETD A;  1P4R A;  5B66 Z;  1HR0 B;  3B77 A;  1M57 B;  3W7W A;  3ASO C;  1I08 A;  3ZJZ A;  1YZB A;  5JH7 A;  3QO8 A;  2EUL A;  4PV1 B;  2W6J G;  3OTO O;  3CSX A;  3F5T A;  1NR1 A;  4OXS A;  4NTY A;  2QDO A;  1FXH A;  2QR4 A;  1ZL8 A;  5KMG B;  4X1K A;  4JI2 B;  2XUM A;  1WLE A;  4U7N A;  2DYS B;  1WA8 B;  1FXV A;  3RYC B;  5J2U A;  1EZV H;  3W7U A;  3FAV B;  1R3J C;  2WLI B;  4JI5 O;  1Z2G A;  1L0L H;  2E76 B;  3CE2 A;  3ABK C;  5B3S C;  2M7W A;  4NYK A;  1BS3 A;  3H1J H;  3GWK C;  3ZED A;  4LF8 B;  3AEI A;  4O4I A;  1K5S A;  1KB9 F;  1QR9 A;  2DYS C;  3CX5 F;  1VQ4 V;  2LGW A;  4JI7 B;  4MVZ A;  2ATK C;  4GX5 A;  2A7W A;  2QEX V;  1P7B A;  3JCU Z;  4CBC A;  5LHI A;  3C3S A;  4LF7 O;  3A2F A;  1QHT A;  3ZHS A;  3ZHR A;  5IDJ A;  4HNA A;  3SYA A;  1N33 B;  4LFB B;  3JAS B;  1VF6 C;  3GVM A;  4NXN O;  3BEH A;  2RDC A;  1NR7 A;  2NN4 A;  2WLL B;  4X1I B;  2DOS A;  3SYO A;  4FLZ A;  2ZR2 A;  1Q5O A;  2RNB A;  4MTO A;  5CA3 A;  3HKE B;  1M4U A;  2FYU H;  1RSO A;  4LR3 A;  5EIB C;  3JD2 A;  4WBN B;  4DUY O;  3L72 H;  5IYC O;  1O9H A;  4WCE V;  1NU1 H;  1XMQ B;  2P67 A;  4DR2 O;  1OHH G;  5FNV B;  3FAV A;  4H0L B;  3CC7 V;  3LSS A;  1Y74 A;  3BY6 A;  3ZMU A;  2AZ2 A;  4QPK A;  2CGN A;  3HKC A;  5LHG A;  3HKD A;  1MNG A;  5B3S B;  1SER A;  3K04 A;  1COW G;  4K8X A;  3A0R A;  4B7K A;  2GTS A;  5FNV A;  5IYD O;  4JYY A;  4GLX A;  3D8C A;  4B3S O;  2PYL A;  4JZ2 A;  2UUC O;  1K33 A;  3RYI A;  2BCC H;  1FXK A;  4H37 A;  5KX5 A;  3T1Y O;  3JYC A;  2UU9 O;  2EZP A;  2R70 A;  3OMA B;  4YY3 O;  2GSM B;  3ABK B;  1Q7Y W;  1GM8 A;  4LFA B;  3AG2 B;  4PA9 A;  1WAZ A;  3G6B A;  1FXK C;  1W2B U;  5EYP A;  2IM9 A;  1XMO O;  4WFF A;  3CCR V;  1HNZ B;  4RQF A;  3K3W A;  1VQL V;  2XAQ A;  2WLJ A;  3SJB C;  1KEC A;  1Q6U A;  1HNX B;  5CB4 B;  1FFX A;  4ZIB A;  2DQ3 A;  1LUV A;  3KZI Z;  4EFE A;  1Q6I A;  1SQQ H;  1TA8 A;  4DV0 B;  3SPC A;  2E75 B;  2RQ6 A;  3D36 A;  3ETG A;  1MG1 A;  1AR4 A;  4WFG A;  1G4Y B;  3RT3 C;  4J10 A;  3CCJ V;  2ZD9 A;  1B06 A;  2JK5 C;  2CAZ C;  1K5Q A;  4ZHQ B;  4GYC B;  2EIK C;  3W7X A;  1XQ8 A;  3MHH C;  3E86 A;  2L35 A;  5JVD B;  3L74 H;  5L3C A;  4PD4 F;  4TV9 B;  1AJQ A;  3MHS C;  4WFA V;  1NVP D;  3T1H O;  4J9Y B;  3QVN A;  1VF7 A;  1QLN A;  4K0K O;  2GTA A;  1BL8 A;  4I9Q A;  1S0V A;  3VBB A;  4DV7 B;  3ABM B;  1R3L C;  5CA1 A;  1GM9 A;  3OGI B;  5DEC A;  5E1A C;  5CN0 A;  2ODM A;  4FM0 A;  4TV8 A;  4LF4 B;  1KP2 A;  1PP9 H;  1KD1 W;  2IW5 A;  2Q0A A;  1KKC A;  4O4L B;  3ETE A;  4H44 B;  1GKF A;  2QWN B;  2PZS A;  3OEE G;  1XIL A;  3ZMV A;  2R72 A;  1J5E B;  4WBN A;  1XRE A;  4PDR A;  2CH7 A;  2R9I A;  1EFR G;  3R65 A;  2UXB O;  1JJ2 U;  2OCH A;  2P90 A;  1BZK A;  3E8B A;  3K9S A;  1K9M W;  1A32 A;  1XNQ O;  5CA0 A;  2EJ7 A;  2H3O A;  2Y0P A;  1FYJ A;  3ZMZ A;  1DLB A;  1JPX A;  4IYH A;  4KL1 A;  5EZY B;  4Z1M G;  4GX2 A;  4JAS A;  3BCC H;  4X1K B;  1F4M A;  1MZF A;  3R66 A;  4DRX B;  1YDX A;  3K5N A;  2WLK A;  4CH3 A;  3ASN B;  5AG2 A;  4DUZ B;  1HNX O;  3JAK B;  2QTS A;  1AI7 A;  2PY5 A;  4NVP A;  4PA6 A;  3PJS K;  2F95 B;  4UCU A;  2N04 A;  4I5S A;  4JYA B;  4B3M B;  4JAU A;  1XOU A;  2ITC C;  3C90 A;  4XDK A;  3OMI B;  2YSU B;  1DK1 A;  3CMA V;  5L3E A;  3N2G B;  2B1I A;  2ZIO A;  2UUA B;  1Y4M A;  2A79 B;  5KAF Z;  2CUG A;  1KKD A;  2ZM6 B;  1LNQ A;  3E83 A;  4DV3 B;  3JAL A;  3UT5 A;  5B1A C;  5B5E Z;  3OEH G;  4JTD B;  3OE7 G;  1ZX3 A;  1TUE B;  1WP8 A;  2QWQ B;  1F23 A;  5IWA B;  4JI0 B;  3HB3 B;  5LL6 Y;  3CCS V;  3CCE V;  1YIT V;  2ZNI A;  1D5A A;  1RPO A;  1O9G A;  4F4L A;  3CWB H;  1AP6 A;  2HJD A;  3AG1 C;  1VQK V;  3CRR A;  1S5L Z;  1VQO V;  1KBH A;  1Y6X A;  1GTO A;  2A3Q A;  2YXY A;  1N33 O;  1BQ0 A;  4R8C A;  1OCZ C;  3RVY A;  3DC5 A;  1OCC C;  2ZXW B;  5LOV B;  2LO1 A;  1G1X B;  4LF4 O;  1BSM A;  4YHH O;  3ZRX A;  1P84 F;  2JJ2 G;  2DWE C;  1MSD A;  4DXW A;  1HNW O;  2KG7 B;  2P4V A;  4DUY B;  2GDS A;  5H6Q A;  4O4H A;  1BT8 A;  1P7G A;  4X20 A;  4LF5 O;  1JVM A;  4IIJ A;  3AK3 A;  2O57 A;  3CRC A;  3DXR A;  1XNQ B;  1JFF B;  4F6R A;  1M90 W;  3WB0 A;  2HVJ C;  3APQ A;  4CC5 A;  4UCR A;  2YXH A;  3J80 N;  1D5N A;  4OX9 O;  1NH2 D;  3ABM C;  3JSL A;  4PI2 A;  3G4S V;  1PV0 A;  3JD4 A;  3O65 A;  2QE7 G;  5L3F A;  4JI6 O;  3HKB A;  4LF9 B;  1WNS A;  5FL7 G;  3B2E E;  1YEW A;  2W0X A;  3FB8 C;  1R1B A;  1IDS A;  4I50 B;  4LBE C;  5JJJ B;  4P9O A;  4B3M O;  3BAA A;  2ZCE A;  4BIO A;  4O2B A;  1UPG A;  3E2E A;  4FFB A;  3ZMS A;  1YTF B;  1YJ9 V;  4DV5 B;  2QM4 A;  2NNU A;  4I4T B;  3IAY A;  4R6Z A;  1ZWI C;  1SQX H;  4JI3 B;  1PNK A;  3H1H H;  3FYI B;  4K35 A;  1K3E A;  4LF8 O;  1V54 C;  3A0B Z;  4DYL A;  2OYQ A;  1MA1 A;  5LXT B;  4EFB A;  1K4D C;  3QNE A;  1NH2 B;  2QWO B;  3E22 A;  5CBH A;  3G80 A;  1VQM V;  4JPR A;  2QA4 V;  3SYC A;  1VF5 B;  2DW4 A;  2OCC C;  2HEP A;  4H33 A;  1CEZ A;  4OPH A;  1G6U A;  2RMK B;  3ZHV A;  5JCO A;  1N0N A;  1XNR B;  2WSS G;  2YI9 A;  3STZ C;  3AG3 C;  2LJ2 A;  5JJE B;  4IGG A;  1QU7 A;  3JD0 A;  2V7Q G;  3OM3 B;  2YDE A;  1IBM O;  3RYH B;  2GBO A;  1L1F A;  1MSW D;  5BY1 A;  5B1B C;  1P49 A;  2VS0 A;  3TXQ A;  1N0J A;  1QR8 A;  1KUQ A;  1I94 O;  1S5H C;  3CJH A;  3LDD A;  1V55 B;  3CB2 A;  2FTK A;  3EXA A;  4ZI7 B;  1URF A;  5F2V O;  4MVO A;  3CCU V;  3SGI A;  1RM1 B;  1E79 G;  2Q68 A;  1EN6 A;  4LNU A;  2W6I G;  4MS2 A;  3DSQ A;  5EC1 C;  3K59 A;  3P32 A;  5LGN A;  1SQG A;  1BGY H;  3JAT A;  2Y69 B;  4KUM A;  2N74 A;  1N8R W;  2EBO A;  4X1Y B;  4YJ3 A;  4XBF A;  1V55 C;  2OCC B;  2YIC A;  3JSN A;  4DK1 A;  1YCI A;  5H9C A;  2ADQ B;  1IX9 A;  2Q4P A;  1TAE A;  4KFM A;  1I7F A;  4LWS B;  5B1B B;  4HYO A;  1HNZ O;  4Q20 A;  2JGU A;  2QSA A;  1I5X A;  2AHZ A;  4MTF A;  5CBF A;  2HFE C;  4LP8 A;  1AVM A;  5J2U B;  1GN2 A;  1NT2 B;  4DR6 B;  3ZIA G;  1G8M A;  1Q3E A;  2LW1 A;  3BPZ A;  2F1M A;  3CRA A;  4MTX A;  2AGA A;  2CGO A;  2ZE5 A;  2HVK C;  4DR1 O;  4JYA O;  1FD9 A;  4NKG B;  4GKJ B;  5JH7 B;  4HBN A;  2E3C A;  3AG2 C;  4X65 O;  1V9P A;  4NTX A;  4IT5 A;  1JJO A;  1FS0 G;  2AHY A;  3TET A;  3A0H Z;  2UUA O;  2FB5 A;  1M56 B;  2YID A;  2F93 B;  2KB1 A;  4AHC A;  1BMF G;  2FL4 A;  1M1K W;  1YHQ V;  1XEQ A;  4JI4 B;  4O2A B;  4HAM A;  3IFX A;  1BCC H;  3JAR B;  2VQE O;  1IXM A;  1B04 A;  4L87 A;  4K8Z A;  1VQP V;  3S3X A;  1NTM H;  1KQS U;  1QNM A;  4I55 B;  4DV7 O;  4ZKI A;  3K5O A;  2VQF B;  4FLT A;  2RJZ A;  5EZY A;  1I94 B;  4U3J A;  3QO7 A;  5EK0 A;  3N2K B;  3HKB B;  1YXB A;  3K79 A;  3SJA C;  1N32 O;  4JYB A;  1J5E O;  1ENV A;  2FKX A;  4QGP A;  2JS5 A;  1NQT A;  3ZMT A;  1OCO C;  2DE0 X;  4X20 B;  3SDL A;  3RYF A;  3TCU A;  3F7Y C;  2HR3 A;  1SET A;  1ZAU A;  2P22 C;  4LH7 A;  1HDJ A;  1HNW B;  1YTF D;  1VAR A;  1BHA A;  2CE4 A;  4FLX A;  1EN5 A;  4MSW C;  4G27 B;  3ZN0 A;  3U0Z A;  3K06 A;  1ZTE A;  1VMG A;  4GKK B;  1DTO A;  3K5L A;  1Q90 D;  1AP5 A;  5C8Y B;  2YEV A;  3E8G A;  5L3D A;  4DW1 A;  4QNH B;  3MAQ A;  4DR5 B;  2LGQ A;  4N23 A;  3UQ8 A;  1IUR A;  1H2N A;  2ADP A;  3OR6 C;  3E35 A;  4TUY A;  3AK1 A;  1US6 A;  3BVO A;  4WF9 V;  4TQF A;  4QE7 A;  1W0J G;  1IXB A;  1XI1 A;  2JGD A;  4GZR B;  3WG7 C;  5BMV A;  2CTR A;  2P7T C;  5JQG B;  3CC2 V;  4U3J B;  4QE9 A;  1SZX A;  4BIU A;  5HFM A;  2AXT Z;  1AR1 B;  2LP7 A;  3K57 A;  4IYI A;  4JI0 O;  5IWA O;  2Z5U A;  3O9O A;  2X0L A;  1SQF A;  4FFK A;  3H1L H;  4MVS A;  1RFY A;  3QG5 A;  3N2G A;  3U10 A;  1BHB A;  2HG5 C;  4FLU A;  1AB3 A;  1NJI W;  2WLL A;  1H2S B;  2VQF O;  1AJP A;  4YJ2 A;  2QWR B;  4X9Q A;  3I55 V;  3CD6 V;  4PJ0 Z;  5CA0 B;  1JOY A;  1EN4 A;  4W4K A;  3UO2 A;  4GT1 A;  2K1E A;  3LSQ A;  4DV1 B;  4LF6 O;  4PI0 A;  1VP7 A;  2LQT A;  3DXR B;  1SA0 B;  4DR4 O;  1CXZ B;  5GTI Z;  4ICG A;  4JGS A;  1DF5 A;  5GON B;  1WB7 A;  2RCV A;  3JD3 A;  4OX9 B;  1HR0 O;  4YJ3 B;  2W0F C;  3FKS G;  2F4V B;  5LXT A;  2E5L O;  3L71 H;  4JI6 B;  3J7A U;  2H8P C;  4FPP A;  5J2T B;  2Y4T A;  1XL4 A;  1K73 W;  2JEU A;  2ZDI A;  3CCM V;  3DGE A;  3B40 A;  1N36 B;  1K97 A;  4XDL A;  2CDY A;  2IU0 A;  2JEX A;  3CEI A;  4NXM B;  4D6T H;  2MK3 A;  2DYR C;  2IH3 C;  3H1K H;  1R3K C;  2XAG A;  4I4T A;  4MTG A;  1M5I A;  3JAW B;  4RAI A;  2CK3 G;  3D36 C;  4JI3 O;  5LMU B;  3L73 H;  1SES A;  3B8N A;  3GWO A;  4JI5 B;  3HPL C;  1N4C A;  4YXW G;  1SA0 A;  4HZ3 A;  1KMI Z;  3ASN C;  3SPG A;  3K0G A;  4G2K A;  3ML0 A;  1XBL A;  4X89 A;  3KKY A;  1FFX B;  1WPB A;  1IBK B;  4O2B B;  2KSD A;  3RGB A;  2HKO A;  2MW2 B;  2WPD G;  3NR7 A;  5KHJ A;  3APO A;  4EKW A;  1XNR O;  2L6L A;  1OV9 A;  4UV9 A;  4BIZ A;  1M56 C;  4YIP A;  1MZE A;  1NS1 A;  1IZ3 A;  1H2K A;  4MVU A;  4B3T O;  4N21 A;  5C93 A;  4TOI A;  1MOF A;  2VWJ A;  3UCS C;  4JI4 O;  2BSK B;  3I56 V;  1S77 D;  2YC0 A;  2XTA A;  2VQE B;  5EC2 C;  1YIJ V;  1AIL A;  2JVD A;  1K92 A;  5B1N A;  1GH6 A;  2CTP A;  5KX5 B;  4DR7 O;  1L0N H;  3D3I A;  3K03 A;  5FPR A;  4O4J A;  4MVQ A;  5KHK A;  1FJG O;  5IJ9 A;  3K0D A;  3Q4H A;  4H13 B;  1T5E A;  2HP8 A;  4R7C A;  2D2C B;  4JI1 O;  1XDC A;  1JA8 A;  3FB6 C;  3ABL C;  3FB5 C;  4ZBM A;  2OIG A;  4J80 A;  3SJC C;  5JWP A;  2VWK A;  1FPO A;  4R50 A;  4P30 A;  3RN4 A;  5BZB A;  1ZLZ A;  2F66 C;  1KYO F;  4X62 B;  2B5U A;  4O4H B;  3G67 A;  4NXM O;  3HKC B;  2HHH O;  5KHG A;  1PNM A;  3OMN B;  3MD0 A;  4I55 A;  5IY5 B;  2KG7 A;  5LP6 C;  5LMU O;  4F6R B;  3T1C A;  4DO2 A;  4GX0 A;  3EFF K;  2IU3 A;  2PYJ A;  2Y48 A;  5FLX N;  3CP1 A;  2EIM C;  2M6Y A;  4JV5 O;  4UCO A;  1XHZ A;  1S76 D;  4DK0 A;  4J42 A;  1ARO P;  4UVA A;  3VQY A;  1SZT A;  2YXL A;  2QJ1 A;  3BHP A;  4DV6 O;  4GCZ A;  1YVW A;  4J7J A;  3ZS8 C;  1B6Q A;  1YJN V;  3THO A;  1Q43 A;  3T4Z A;  2JDI G;  4Q6G A;  4IHJ A;  2F23 A;  4PDV A;  5EBW C;  4NTW A;  4WFH A;  1H2M A;  3JAL B;  5DED A;  3UT5 B;  1SQP H;  2Q5Z A;  2K9P A;  1WA8 A;  5KUK A;  4B3R B;  3K5M A;  5ITZ A;  3T1H B;  2IBZ H;  2ETN A;  1H2L A;  4F6E A;  2WAM A;  5FPO A;  5H2F Z;  1S5J A;  1RM1 C;  1UFI A;  1N32 B;  1NZ6 A;  5IE9 A;  1S3J A;  1KP3 A;  3FB7 C;  1R3I C;  4IIJ B;  4DV2 O;  1AI6 A;  1ORQ C;  1X4T A;  2A06 H;  3C3T A;  2GV9 A;  1OCR C;  1L8D A;  2QM7 A;  1JCH A;  3ASO B;  5LOV A;  4X1I A;  2N05 A;  2Z0A A;  4PA3 A;  1S72 V;  1PL0 A;  2F43 G;  3ZN1 A;  2H94 A;  1WJZ A;  4I0X A;  4UXN A;  1JQ0 A;  3BAB A;  2UXB B;  2P06 A;  3E22 B;  4NB5 A;  4JI7 O;  5JVD A;  4LF7 B;  4FZ1 A;  5BMV B;  1CPY A;  2KQX A;  5A9G A;  4X66 O;  5DM6 V;  3LNM B;  4UUJ C;  4U3F H;  1K8A W;  4GKK O;  2HHH B;  2XT9 A;  3CRM A;  1VQ6 V;  4DR5 O;  3L75 H;  3ZBH A;  2OTJ V;  1HP8 A;  4E4E A;  2AW9 A;  4TV8 B;  1K34 A;  4ZOL A;  2UXD B;  5C8Y A;  3AG4 B;  1Z5V A;  4JV5 B;  3ABL B;  4DW0 A;  2ZQM A;  1RPR A;  1KC8 W;  4YIO A;  3AG1 B;  2WWW A;  5CMU A;  4W4L A;  2DJV A;  4FLW A;  3JAK A;  3AK2 A;  1IVS A;  1WPX A;  2R9A A;  1OCC B;  2ZXW C;  3IC7 A;  1R6T A;  2G38 A;  5H5N A;  3MDS A;  5GW7 A;  3SPI A;  4DV3 O;  4ABM A;  3JAS A;  5B1A B;  1CP9 A;  2UUC B;  1VQN V;  2IJK A;  3ZX6 A;  3HKD B;  2QKA A;  5KUM A;  3ABU A;  4QJF B;  4B3R O;  2LFR A;  3CRQ A;  3UKM A;  3X2Q C;  2BTQ B;  1VQ7 V;  2XND G;  1I5Y A;  3H9V A;  4KP4 A;  3J81 N;  1FXK B;  3ZCC A;  4OPA A;  5J2T A;  4FIP C;  4GUN A;  2Q8V A;  1M93 A;  5BR8 B;  1SQV H;  5IJ0 B;  1DF4 A;  2AZ0 A;  2V1D A;  2WLH A;  5EBM C;  2IH1 C;  5LGT A;  5KA5 A;  1PNL A;  3B09 A;  4AQY B;  4EEQ A;  2JIZ G;  4WFE A;  5LP6 A;  4TQD A;  2DN9 A;  3OR7 C;  1VEW A;  4X8A A;  5EIB D;  1GO3 F;  4DR3 B;  4EB6 A;  2E5L B;  1SF9 A;  1FJG B;  1GK9 A;  2XAH A;  3AG4 C;  3JAM N;  3TGU H;  4X66 B;  4RUF A;  3CCL V;  1TUB A;  2ZE7 A;  2OT5 A;  3OGC C;  4LCU C;  2EZO A;  3CJH B;  3DTU B;  1N34 O;  2IJJ A;  5KAI Z;  4FZ0 A;  3H01 A;  1YJW V;  4E2L A;  4CS4 A;  4CH6 A;  3W7S A;  5JJN B;  3OUS A;  4K0K B;  1Y74 B;  3RYI B;  3EVK A;  4BAY A;  4X62 O;  3CHX A;  1TVK B;  2Q0O C;  5LA6 B;  1J95 A;  1RP3 B;  3RYH A;  1JFF A;  1YF2 A;  1JX9 A;  2CH7 B;  5LGU A;  4TWK A;  4DV5 O;  2OTL V;  1IBL O;  2Q6A A;  1NTZ H;  2ZT9 B;  4AI8 A;  1SC5 B;  3X2Q B;  5IJ9 B;  2Z3Y A;  2XAJ A;  4RO2 A;  1EBO A;  2YI8 A;  1GRJ A;  2X6A A;  1ZUQ A;  1XL6 A;  4AIL C;  4K3A A;  4ASU G;  5IYB O;  4FM2 A;  3VQW A;  4UB6 Z;  3Q4H B;  5H6R A;  1FFT B;  5KA6 A;  3L70 H;  1VF6 A;  2ILM A;  5BXZ A;  5LMN B;  2BTO A;  2XOK G;  4PDM A;  3S3W A;  1U96 A;  4PA7 A;  4Z2W A;  4UFZ A;  2HJF C;  3SR2 C;  1BQZ A;  3OD4 A;  4LFC O;  1Q8I A;  4DUZ O;  2YUA A;  1JR9 A;  4ZOL B;  4P9P A;  2Q69 A;  3M7M X;  3PN1 A;  4AQY O;  4NR1 A;  2CTW A;  3E89 A;  4KHP B;  3LUT B;  3ZHU A;  4TUY B;  4FK5 C;  4UVC A;  1M57 C;  4ZHQ A;  3HKE A;  1ROP A;  3SPH A;  1AI5 A;  4JAA A;  4JI1 B;  4DV2 B;  1Q86 W;  3IGA C;  2ZM6 O;  3WB1 A;  2VRZ A;  4RUE A;  2Q67 A;  2QGN A;  3RYC A;  2Y69 C;  2PGG A;  4GX1 A;  1BE3 H;  2JJ1 G;  1Q81 W;  2YIA A;  3KCX A;  2UUB O;  3TK1 A;  1WP7 A;  4O4J B;  2LW7 A;  3OW2 U;  1VQ8 V;  2ZR3 A;  3E8H A;  1W59 A;  2E74 B;  3JAT B;  2Y4U A;  3RVZ A;  5B1O A;  4LH6 A;  1LUW A;  3JCZ A;  3G71 V;  2EIJ B;  5L3G A;  4CS2 A;  2NLJ C;  4G28 B;  3CPW U;  4TSF G;  2B9Z A;  4DR6 O;  4LWS A;  1W0K G;  4DV4 O;  5ITZ B;  2Q9L A;  3HR0 A;  4DV6 B;  3U11 A;  4D7S A;  1NKD A;  4DR1 B;  4I50 A;  2ZDI C;  5LA6 A;  1GMG A;  4LF5 B;  2ZIN A;  4X1Y A;  1H8H G;  2C2A A;  2YEV B;  1AI4 A;  3BFR A;  5LBQ A;  4J9Z B;  4X88 A;  1H38 A;  2DMX A;  2IJI A;  1H8E G;  1Y76 B;  1FAF A;  5LMN O;  2OWO A;  1ZL8 B;  5KMG A;  1D2D A;  4LF9 O;  1Y67 A;  3OTO B;  5LHH A;  3WU2 Z;  3BRC A;  4O4I B;  2DWD C;  2ZIM A;  4I0X B;  3G6E V;  4I7Z B;  3RYF B;  4ZI7 A;  4KHP O;  5LYJ B;  3K08 A;  1QVF U;  2KKW A;  2P6J A;  5IY5 C;  4TV9 A;  1X59 A;  4LNU B;  3SPJ A;  1UJW B;  5BR8 O;  3BA9 A;  2DYR B;  5K1X A;  1OJH A;  2WLN A;  3N27 A;  2PUS A;  3RFR A;  3N2K A;  4PEL A;  3ETQ A;  2UXC O;  2WLM A;  3BA8 A;  1GM7 A;  1QLE B;  1GN4 A;  1NBM G;  5K1P A;  4Z1V A;  3ZRW A;  1Y76 A;  3F5W C;  4LC1 A;  2NR5 A;  3AG7 A;  1R6K A;  1RSO B;  2ZE6 A;  2ITD C;  4RWU A;  5JQG A;  1SS3 A;  1Y66 A;  3ICX A;  1B3Q A;  3I5D A;  2ARH A;  4DR3 O;  1OCO B;  3QF7 A;  3JAW A;  2Q7G A;  3QTC A;  2YIB A;  5KHH A;  3AG3 B;  3T2M A;  3VOU A;  1GN3 A;  1PD3 A;  1NTK H;  2R9R B;  4UCT A;  4FLY A;  3WFV A;  1YSC A;  1IBM B;  2EJR A;  4BW9 A;  3NXS A;  2UXD O;  2QKS A;  4FVM A;  1QCE A;  3RW0 A;  5HFL A;  3OUF A;  1OCR B;  3ABT A;  4BW5 A;  4PHZ A;  1VQ5 V;  4J11 A;  2QWP B;  1JMK C;  1HWY A;  1Z5W A;  4B7E A;  2X6C A;  4QIW F;  1E1R G;  1XMQ O;  1OZ0 A;  1V54 B;  4MW8 A;  1I0H A;  4C7U A;  3FFQ A;  4B08 A;  2EIK B;  1IBL B;  2B1G A;  1SKV A;  4RQE A;  3CC4 V;  2P5O A;  3LDE A;  1F7Y A;  3VQX A;  1KU9 A;  3B8M A;  4J7K A;  1F51 A;  2HLD G;  2ZKO A;  4JAV A;  3CYO A;  2Q7H A;  4B3S B;  1NI8 A;  3P3N A;  2A9H A;  4QPJ A;  2Q7E A;  4X64 O;  1ZSP A;  1PL4 A;  2UU9 B;  2WA3 A;  4YY3 B;  5EYP B;  2D3O W;  1QQC A;  3CS5 A;  3LSU A;  2EIL B;  4A5U B;  1WN7 A;  4O2A A;  1K4C C;  3JAR A;  5D5P A;  4TT3 G;  3ZHT A;  4FMT A;  4J41 A;  1VQ9 V;  1THZ A;  1XMO B;  3TXS A;  2PI5 A;  4LFC B;  3L9D A;  5LP6 B;  2QKC A;  4KXR A;  2UXC B;  1GN6 A;  2YS8 A;  2UXN A;  2QTO A;  4GKJ O;  4DV1 O;  4LF6 B;  1Q6H A;  2PF4 E;  4EB6 B;  1HW7 A;  4DRX A;  4DR4 B;  3KG2 A;  4UVB A;  4X65 B;  4FJC C;  2EIN B;  3CME V;  4NXN B;  2GUZ A;  3OTF A;  5J9P C;  1PM9 A;  3K58 A;  1K7D A;  1OCZ B;  2DQ0 A;  3IJ4 A;  2F4V O;  2BOC C;  2XHB A;  1N34 B;  3F7V C;  4BR6 A;  2PI4 A;  1FKA O; 
#chains in the Genus database with same CATH homology
 2JRI A;  1IBM O;  2UUA O;  2Z0A A;  4JI5 O;  1HNW O;  5BY1 A;  5BXZ A;  1N36 O;  1A32 A;  1XNQ O;  4JI3 O;  1XEQ A;  1XMO O;  3M8A A;  4JI7 O;  1FYJ A;  1XMQ O;  4NXM O;  2VQE O;  2HHH O;  4LF5 O;  1KUQ A;  1I94 O;  4LFC O;  5LMN O;  4DUZ O;  4JI0 O;  5IWA O;  5LMU O;  4X66 O;  1D2D A;  4JI8 O;  4LF9 O;  4LFB O;  4DV7 O;  4GKK O;  4AQY O;  1F7Y A;  3R66 A;  3J80 N;  4OX9 O;  2ZKO A;  4LF7 O;  5FLX N;  1HNX O;  4DR5 O;  3O65 A;  3JAM N;  4JI6 O;  4JV5 O;  5IT9 N;  3RT3 C;  4NXN O;  1N32 O;  4X64 O;  1AB3 A;  2VQF O;  1XNR O;  2N74 A;  2ZM6 O;  1J5E O;  4KHP O;  1IBK O;  1DK1 A;  2FKX A;  4DV6 O;  1R1B A;  2DOS A;  1N34 O;  1X59 A;  4LFA O;  4B3M O;  3SDL A;  4A5U B;  5BR8 O;  1NS1 A;  2DJV A;  4B3T O;  2UUB O;  2UXC O;  4DUY O;  4X62 O;  4JI4 O;  1HNZ O;  2LW7 A;  1R6T A;  4DR2 O;  4LF8 O;  4LF6 O;  5H5N A;  3T1H O;  4DV5 O;  1AIL A;  4DV3 O;  4K0K O;  1IBL O;  4DR4 O;  5LL6 Y;  1YZB A;  4JI2 O;  4GKJ O;  4DV1 O;  3OTO O;  4DV0 O;  4DR7 O;  1HR0 O;  4DR3 O;  3F5T A;  4B3S O;  1FJG O;  2E5L O;  5A2Q N;  3J7A U;  2UUC O;  4B3R O;  1N33 O;  4OPH A;  2AGA A;  4DR1 O;  3T1Y O;  4DR6 O;  4JYA O;  2UU9 O;  4DV2 O;  4JI1 O;  4DV4 O;  4YY3 O;  1G1X B;  2UXD O;  2F4V O;  3J81 N;  4X65 O;  4LF4 O;  4OPA A;  4YHH O;  2UXB O;  1FKA O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...