4JI7O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji7O00
4KHPO 2LW7A 4DV3O 3T1YO 4X66O 1AILA 4A5UB 1R6TA 4B3TO 5H5NA 4X65O 3JAMN 5IT9N 2UUCO 4LF6O 3RT3C 4DR7O 4DR1O 1IBLO 1N33O 4DR2O 5BR8O 4NXNO 3O65A 2JRIA 5LL6Y 3M8AA 4LFAO 3J80N 4K0KO 1X59A 1XMQO 1G1XB 2UUAO 4DV7O 1N36O 5IWAO 4LF4O 4DUZO 4JI7O 4NXMO 1NS1A 1D2DA 5LMUO 4LF7O 4DV0O 5FLXN 4X62O 4DV4O 5BXZA 4JI6O 4DR5O 4LF9O 1I94O 2UXBO 3OTOO 2AGAA 4JI3O 1FKAO 1XNRO 2UXCO 2F4VO 4B3SO 1HNWO 4B3MO 4YHHO 2ZM6O 4OX9O 4GKJO 1J5EO 2UU9O 4LFBO 1N32O 4AQYO 4JI8O 1N34O 1IBMO 1IBKO 4DR3O 1DK1A 2UUBO 1XNQO 4DR6O 1HR0O 1FYJA 4LFCO 4DR4O 4OPAA 4JI0O 2VQFO 3F5TA 2DJVA 1HNZO 4GKKO 2FKXA 4OPHA 4JI2O 1HNXO 4JV5O 1YZBA 5LMNO 4DUYO 2ZKOA 4DV1O 2Z0AA 4LF5O 5A2QN 2HHHO 4JYAO 3SDLA 4JI1O 1AB3A 3J7AU 4YY3O 4X64O 1XEQA 2UXDO 1XMOO 2DOSA 1FJGO 2E5LO 3R66A 5BY1A 2VQEO 4DV5O 3T1HO 4DV6O 4JI5O 1KUQA 1R1BA 1A32A 1F7YA 2N74A 4JI4O 3J81N 4B3RO 4LF8O 4DV2O
chains in the Genus database with same CATH superfamily
1M57C 3W7WA 3SJQC 1OCCB 3N2GB 5IYZB 3CXCU 2EJ7A 4MTXA 4JTAB 4KL1A 4PDVA 1BZKA 3CC2V 3CSXA 5LA6B 4DR1O 2ETNA 1ZWIC 1EBOA 4LF4B 2WA4A 1H8EG 5EIBC 1W0JG 3C3TA 2RCVA 4K0KO 2UUAO 2HKOA 1YHQV 3CC7V 3F7VC 3CCLV 3CCJV 5EYPA 1S76D 5J2TB 3E8GA 4B3SB 1NTKH 4NXNB 4DR5O 4LF9O 1I94O 2YI9A 1ZX3A 5LP6B 1AR4A 3N27A 5EBMC 2EJRA 5E1AC 2R70A 1BSMA 3IAYA 2DN9A 1Q3EA 3ZHVA 4GX0A 4DV4B 2QR4A 1L8DA 3DGEA 3JAKA 1M5IA 4J7ZA 1YDXA 3JCUZ 2ZINA 3OMIB 1IXMA 4WBNA 3JASB 1B06A 4OX9B 5FPRA 1BGYH 5LMNO 5BZBA 1TGOA 2IW5A 4JI1O 5JJJB 5K1XA 3N2KB 3VQYA 4UVAA 5CN0A 5IY5B 1FJGO 3H01A 2E5LO 2QM7A 3AG3C 2F23A 3B77A 3ZMSA 1OCOB 2OCCC 4TSFG 5EBWC 2N04A 1KUQA 1RSOA 2JVDA 1R3KC 3BEHA 3ZMUA 4NVPA 1OCCC 5CB4A 1FFTB 4KUMA 4O4HA 1WNSA 3CXHF 3CX5F 2YSUB 3K79A 3RVZA 2HG5C 1WAZA 1WJZA 3ABMB 4H0LB 4UB8Z 2VWJA 5BR8O 2R9RB 1MA1A 5D5QA 5J2UA 1LR1A 4GUNA 1EN4A 4X65B 1Y74B 1M9NA 4LF4O 2P6JA 3MDSA 2BE3A 1CEZA 5HFLA 1FXHA 3HKCB 2XHBA 2IH1C 4DR2B 4AI8A 5BXZA 3L71H 4YHHB 4LH6A 1HDJA 1QR8A 1PL0A 1N32B 4B3SO 4YJ3A 1YXBA 3PJSK 4ZHQA 1HNWO 4O4LB 1W59A 2ZM6O 2OWOA 1IX9A 3ZRWA 2DYRB 1KKCA 3GWKC 4CBCA 2YICA 1AJQA 2WLNA 1OZ0A 1YIJV 1E1RG 3R65A 2QWNB 2V1DA 2QWQB 1P49A 1QNMA 1XBLA 3UT5B 3E8BA 3P3PA 1IVSA 5DEDA 1FXKB 1Y4MA 5JWPA 1OCOC 3ZBHA 1VF6A 1XI1A 4JF3A 2QWRB 4KXRA 3EHBB 1ZUQA 4K8ZA 3FB8C 2DWEC 3T1HO 3BPZA 4MVMA 1IZ3A 1MABG 1R1BA 3OEEG 1TAEA 5IE9A 1AR5A 4FMTA 1W2BU 4LF8O 3MD0A 4AHCA 3VQVA 1WP8A 1F51A 3GVMA 5B1BC 4MW8A 3SPIA 2CGOA 2IJHA 5JJEB 4DV6B 5LXTB 1K97A 4B3RB 3JD2A 1O9GA 4LH7A 2KG7B 3I5DA 4EKWA 2WLLA 1NH2D 2XNDG 2JJ2G 4PI0A 5CBGA 1KBHA 1VQLV 1S5JA 1KQSU 1N0NA 4CH6A 3ICXA 1B6QA 5AG2A 1MMMA 2IM9A 1SKVA 2YEVB 1GN6A 2EIMB 4MTFA 2AXTZ 2RQ6A 1NR7A 1J5EB 1T5EA 5LHGA 2DYRC 4K3AA 2LFSA 5CA3A 2ARHA 4DUZB 1JJ2U 4YHHO 1XNQB 4DR6B 1N32O 1XUQA 3HKBB 4TWKA 1UPGA 3HB3B 5HFMA 1Z5VA 3QVNA 3K58A 4JI3B 4I4TB 4X1YB 4CH4A 3B8NA 2DJVA 4PDMA 4PV1B 3RYIB 5IYDO 3JD3A 3WG7C 2ZE7A 2UU9B 4MTOA 1RM1B 3OUSA 5J9PC 3QF7A 4U3JA 3CCSV 3STZC 2M7WA 5IYBO 4X20A 4EEQA 2F93B 3ETQA 2WPDG 1XMOO 2XT9A 3AG2C 4QGPA 2GDSA 4HBNA 3CD6V 4DV5O 1R3LC 2E3CA 4FLWA 5KLVH 2HHHB 1X4TA 1L1FA 2N74A 3ZRXA 4DV3B 3QNEA 1K4CC 3VQWA 1H2NA 1H38A 1M93A 2PY5A 1AJPA 2X6BA 3L74H 5GTHZ 4Z1VA 1VQMV 2M6YA 4A5UB 1E1QG 3RYHA 1YI2V 3B09A 4JI5B 2CK3G 3ABKB 2DMXA 4NTYA 2DW4A 2BSKB 5C8YB 3OT7A 4GX2A 4UXNA 1QHTA 2JS3A 3M8AA 3B40A 4JI7B 4QIWF 4TQFA 3THOA 2Q7EA 3SJAC 5CA0B 1Q6IA 4B3TB 2PF4E 3K0DA 3OEHG 4I55B 1I5YA 2EIMC 3BA8A 2GSMB 1I08A 4MW3A 5JQGB 2EINB 5L3DA 2CDYA 1I0HA 5CMUA 3VOUA 3AG4C 1TUEB 3HR0A 3Q4HA 1SQPH 1XL6A 3RYCA 2QJ1A 3IGAC 1MNGA 2RNBA 2IBZH 1SQFA 4NR1A 1J5EO 3K3WA 4R6ZA 2AHYA 3TXQA 2QTOA 2ZCEA 2ZD9A 3CC4V 5LGNA 4RUEA 4PDRA 1XNQO 1AI4A 4DR6O 2OIGA 1HR0O 4GLXA 1OHHG 1RM1C 3K0GA 1XREA 4F6RA 2AHZA 3OGCC 2QA4V 3F5WC 1WPXA 4X1IA 3TGUH 2CTRA 5L3BA 4FLYA 2Z0AA 4WFEA 5KUMA 1IBKB 3CCEV 3APQA 4LNUA 1K8AW 5KMGA 1D5NA 3E86A 2NLJC 2Q0OC 5LYJB 1F4NA 3FAVB 2QKSA 1H2MA 3K5MA 1BL8A 4JZ2A 3SYOA 2L35A 1ZL8A 3ZRSA 3ASOB 2XAJA 1EZJA 2ZIOA 3LSQA 4W4LA 4ASUG 2B9ZA 1NTZH 2K9PA 4DV3O 3B8MA 4JAUA 3G6EV 3T1YO 1AILA 3ZMVA 2DWDC 4FJCC 1QVGU 1IBLB 1GMGA 3K5NA 2JEXA 2JGDA 3U10A 4FLTA 1NBMG 3RT3C 2EULA 3BABA 5KA6A 3MHHC 4PA7A 1S5HC 2IU0A 3LDEA 2P06A 2Q5ZA 1B04A 1RFYA 5H9CA 1Y76A 1BT8A 4J41A 3SGIA 4JI7O 3FB6C 4WFHA 3H1IH 1G6UA 4YJ2B 3CPWU 3CCQV 4DR1B 4LF7O 4UCTA 5FLXN 3CB2A 4OXSA 1JJOA 1BMFG 4K0KB 3CJHB 2CH7B 2HFEC 2FB5A 4B3MO 2WA3A 1AP6A 3C3SA 3WFVA 2QWOB 3AK2A 2Q4PA 3EVKA 1I94B 2JEUA 2Y4UA 4KFMA 4LWSA 4YXWG 5JVDB 3ZN0A 3D8CA 2XAHA 4DRXA 1AI7A 1F4MA 2XTAA 3E22A 3KCXA 4O2BA 1V54C 2ZKOA 2OCHA 2Q7GA 3ABTA 4CS2A 5L3CA 1BCCH 4TUYA 2ZE6A 2EZOA 1M4UA 1Q43A 4LBEC 3RVYA 2IJJA 4GX5A 3T4ZA 4LCUC 1NI8A 1BQ0A 3ZN1A 3ASOC 1PKXA 4B08A 3N2GA 4QPJA 1YVWA 5IYZA 1QR9A 3R66A 4FLUA 1Y67A 1NR1A 2RJZA 2YDEA 3H1JH 2YXLA 5LA6A 1VMGA 4JI1B 5GTIZ 2ZE5A 1Y6XA 4IYIA 4UCSA 1ZSPA 1ENVA 3OMAB 1U97A 2QWPB 4FZ0A 4EFBA 1GK9A 2HVKC 5KX5B 2HJFC 4DO2A 4H33A 1D5AA 2PZSA 2RMKB 2BTOA 1IBLO 1R73A 3E8HA 1QU7A 2WLIB 5J2TA 4F6EA 3CYOA 1N36B 2FTKA 4LC1A 4J7KA 5LP6A 3SR2C 1R3JC 2NR5A 4OGQB 1G1XB 1WPBA 3UKMA 3T2MA 1Z5WA 1Q90D 2EILB 5KHIA 1JR9A 4IGGA 1K9MW 5KHJA 1JA8A 1TUBB 5BR8B 3RN4A 1PV0A 3TJTA 1GTOA 1H8HG 1FKAO 1XNRO 3OW2U 4ZKIA 2CTWA 3JARB 3A2FA 1N34B 2RDCA 4P9OA 3JASA 2CUGA 1SZTA 2YIAA 1HWYA 3BFRA 2P5OA 3SYAA 2MW2B 2QTSA 1V55B 1SESA 1FYJA 3G71V 3N2KA 1J95A 2EIJB 4QE7A 2P22C 1Q8IA 4MVSA 1HNWB 5B3SB 2ZM6B 1JPXA 4EB6B 1LUVA 4MTGA 5GONB 2VRZA 3FX7A 2Q73A 3CMEV 2W0XA 4HYOA 2QSAA 2VQEB 2DOSA 2YS8A 5IJ0B 2GV9A 1P7GA 4I50B 4X8AA 5JCOC 5BY1A 4MVRA 3JYCA 5B1AB 1XHZA 5H6QA 3BHPA 4RUFA 2F1MA 5DM6V 1DF4A 4PA4A 1WP7A 3O9OA 4CS4A 4ZI7B 1JX9A 1BQZA 1Y74A 3T1HB 1VIBA 2Q67A 2YXYA 4BW9A 4PD4F 2HP8A 4MVUA 1QLEC 4LF8B 3HKCA 2Z3YA 3AK3A 4LP8A 4PDLA 1FD9A 3K59A 4RWUA 3O65A 1GN2A 2F95B 4NXMB 5ITZB 3LNNA 1X59A 3CRRA 1N36O 3WB2A 4O4LA 3E35A 3WU2Z 3LNMB 2B1IA 4XDLA 3ZHQA 1FAFA 4FVMA 2UXCO 1SQBH 4QNHB 5D5PA 2Q0AA 1V55C 3SYQA 2KSDA 1OV9A 2XOKG 4D7TA 4DR4B 2EIJC 1G8MA 1N34O 4CH5A 1FXKA 4WBNB 3GB7C 5LP6C 4LFCO 4GKKB 4JZGA 3DTUB 1JOYA 1K4DC 3RFRA 1H2LA 4LR3A 1VQ9V 2EIKB 4BWAA 4PHZA 1YZBA 4ZOLA 2Q68A 3MAQA 1KKDA 3G67A 3K04A 2GTSA 2VQEO 3KG2A 1GRJA 1K73W 5LXTA 4TV8B 1A32A 1VQ4V 3NR7A 4IT5A 1P84F 4D6TH 2KG7A 5IY5C 1XMOB 4QE9A 4W4KA 1DGSA 4E4EA 4FZ1A 3E83A 2YUAA 3ZX6A 2JGUA 4DV5B 4UFZA 2RN9A 4LF6O 2BTQB 2O57A 1N33O 3P32A 2YEVA 1VQKV 5IWAB 1U96A 4Q6GA 1P7BA 1JMKC 2WLHA 3ML0A 5JJNB 4NXMO 3ABMC 2DYSB 2GUZA 4U3FH 1Q86W 3RWRD 3HKBA 5DN6G 1WB8A 5EC2C 3UM7A 3OTOO 1GN4A 3B4SA 4X1YA 4I4TA 4FFKA 3STLC 1KU9A 2P67A 3RYIA 2A0LA 1KC8W 2EZPA 4LFBO 3D3QA 4AQYO 4DW0A 1DTOA 3AG1B 1O9HA 2LJ2A 3HKEB 3CCMV 3E8FA 4DK1A 4DR3O 3CS5A 1JVMA 2EIKC 3IFXA 2UUBO 1GH6A 1YITV 4DR4O 4CZZA 3ZEDA 2JS5A 3S3XA 1RPOA 1DLBA 4BW5A 1URFA 4DUYB 2UXNA 2G38A 1QLNA 2CE4A 3JSLA 4GKKO 3K9SA 3W7UA 2PYLA 4MVZA 4X88A 4X64B 1Q82W 5EZYB 3ZJZA 1HR0B 1M56B 1QBZA 4RAIA 3SYPA 2ATKC 1MOFA 1NQTA 4UUJC 2ADPA 2KQXA 3IC7A 4U7OA 3LDDA 1SQVH 5LGTA 4JAAA 3JCZA 2E76B 1FXKC 2UXXA 4X1KB 1S77D 4FM1A 5C8YA 2BSKA 4I5SA 2H8PC 1S3JA 3CP1A 3D36C 1G4YB 2BCCH 5CA0A 3CMAV 5H5NA 4O4JB 2QDOA 4I55A 3JAMN 4DR7B 5KUKA 2WLMA 5JQGA 1SS3A 2W6IG 5F2VO 4UV8A 3H1LH 4FLVA 4IHJB 5FNVB 3T1YB 4LFAO 2Q6AA 3SPCA 5CBFA 2ODMA 3J80N 1PP9H 2OT5A 4I9QA 4DK0A 5IWAO 4X62B 3ZHRA 5BMVB 1SC5B 4L8JA 1Q81W 4QJFB 1AJNA 1SQQH 4TOIA 4GKJB 3TXSA 3AG1C 1SA0B 2KB1A 3D3IA 3CCRV 2QKCA 4LF7B 4ZIBA 2PI5A 4IIJB 2JK5C 4JYAB 3FAVA 5LBQA 1OCZB 1CPYA 2FKXA 4B3MB 4DUYO 4I7ZB 4YY3B 5IDJA 3OD4A 3H9VA 3SDLA 3ABLB 3L73H 3M7MX 4X64O 4R7CA 4J10A 3UO3A 2H94A 1ORQC 1I5XA 2ZR3A 1R6KA 2ZQMA 4X66B 4K35A 5KHKA 2Y69B 3ABUA 4O4IB 4JYYA 2F66C 4HNAB 1VF5B 2WWWA 4GYCB 5LOVB 3DC6A 1XQ8A 4NYKA 1LUWA 2YI8A 2HR3A 4BIOA 2IU3A 4YJ2A 3TETA 3HKDA 4YIOA 4DR7O 2OYQA 3JATB 2IH3C 4E2LA 1P4RA 3RBZA 5LL6Y 1VF7A 1R3IC 2LGQA 2LFRA 3CJHA 2CH7A 3CHXA 3RYFB 2Y48A 4G28B 1JFFB 3ABKC 4N23A 4HAMA 4Z1MG 4X62O 2Q69A 3BCCH 3FYEB 3OFNG 1QQCA 1WA8B 4FFBB 5JVDA 4G27B 3JALB 3CWBH 3DXRB 4GKJO 4MT8A 4TV9B 1TVKB 2EINC 4BIUA 1PNKA 3OM3B 1RPRA 3QO8A 1NT2B 1VQ6V 1NTMH 1VEWA 4NB5A 4I9WA 1XNRB 3BVOA 2R72A 2BOCC 2E75B 1S5LZ 4JV5O 2VS0A 5JH7B 4JYAO 3OTFA 2KKWA 5JCOA 4FPPA 1Q7YW 4YY3O 1L0NH 4UVCA 1NZ6A 3WB0A 5B1NA 5KX5A 1VQOV 1COWG 1MSDA 3SPHA 3ZMTA 3G6BA 4R50A 3K9AA 2Y69C 3OMNB 2PI4A 4GZRB 1VQ8V 3TK1A 2WLIA 3ZCCA 4UCOA 1Q5OA 2QM8A 3QG5A 3SYCA 1YEWA 4X66O 4WFFA 1V9PA 4IYHA 4O2AB 1KD1W 5IT9N 1MG1A 2B5UA 2UUCO 2Z5UA 2Y0IA 4ABMA 1NVPB 4RQEA 1TUBA 4DV7B 2VWKA 3ZIAG 2A3QA 2CTPA 2LQTA 3LSSA 3JARA 3UO2A 3OGIB 3ZHSA 5IJ9B 3MHSC 2C2AA 4YIPA 2P90A 2JIZG 1S72V 3F7YC 4XBFA 4FM2A 4ICGA 5H6RA 2JDIG 1VQNV 1QLEB 3ZHUA 2F4VO 4JI8B 2WAMA 4CC6A 2ZXWB 3CRMA 3OR7C 4H37A 4FM0A 5CA1B 2VQFB 5GONA 1GM8A 5K1PA 1L0LH 1DK1A 4K8XA 1HNZB 1PPJH 3IJ4A 3CRCA 2X6AA 4Q20A 3I55V 2UXCB 4LF5B 2ZNIA 5IJ0A 5KHHA 4JGSA 4I0XB 4I50A 4OPHA 4JI2O 4CH3A 4FK5C 2ZDIA 3JAWB 2ILMA 2OCCB 4TQDA 1JCHA 2V7QG 3FFQA 5CBHA 3CCUV 1AB3A 4LFCB 4JASA 3J7AU 5L3GA 1IDSA 4ZI7A 1FFXB 3K06A 2DE0X 5A9GA 4NKGB 3RGBA 1MSWD 3J81N 1YF2A 4DV2O 2LW7A 1N4CA 1YJNV 3DC5A 5ITZA 4J80A 4UCVA 2NNUA 4N21A 1Q6UA 1NJIW 3H1KH 5B5EZ 2D2CB 1SRYA 4MSWC 4XDKA 1YTFB 2Q7HA 3IC9A 1QVFU 3W7XA 4AILC 4PA3A 1XDCA 1FPOA 1XMQO 4DV7O 2WLKA 3W7TA 4LF6B 2UXBB 3AK1A 4PJ0Z 1EN5A 1N33B 2HEPA 3P30A 2ZXWC 2NN4A 1GKFA 1KB9F 3BA9A 3ZS8C 1M1KW 2QKAA 3FYIB 5C93A 2EILC 2XAQA 1PL4A 4JI8O 5EYPB 3OTOB 5DECA 4B7KA 3FB5C 2VQFO 2GBOA 1YJWV 1HNZO 1MZFA 4MVOA 1VQ5V 2W6JG 4LFBB 4AQYB 4DV1O 4LF5O 2P7TC 4TV8A 4UVBA 4DR3B 2UUBB 4JYBA 5EC1C 1K92A 3UT5A 3VBBA 3JAKB 2YXHA 4TT3G 5B3SC 2W0FC 5B1BB 2N05A 3QO7A 3D36A 2MK3A 3KCYA 4JAVA 2Y4TA 4J9YB 4UCRA 2WSSG 3G80A 1F7YA 2BTQA 1H2GA 4R8CA 2OIEA 3KKYA 1BHBA 1VP7A 2XASA 4J7JA 3C90A 1XOUA 1NU1H 1WB7A 4KP4A 5B1AC 1SETA 2ZDIC 4BAYA 1RSOB 3OR6C 1LNQA 3T4DA 4DXWA 2LO1A 1IURA 5CB4B 4RQFA 4JPRA 4NXNO 4O4HB 3X2QB 5E79Z 1H2SB 1KYOF 1OJHA 3K5LA 3CCVV 4CC5A 5IYCO 1RP3B 3APOA 3HKEA 4DV4O 1S0VA 2UXBO 4LFAB 3LDCA 5J2UB 4PELA 1AI6A 2H3OA 2X6CA 3ASNB 3K03A 4OX9O 1PNMA 3WG7B 3UQ8A 3NXSA 4X9QA 4JI0B 4F4LA 5EZYA 2ITDC 3JSNA 4B7EA 1HP8A 4MVQA 4OPAA 5FL7G 1HNXB 2JJ1G 2CTQA 4ZOLB 4YJ3B 3LSUA 4ZHQB 3AG2B 1ZTEA 2GTAA 1WLEA 3L9DA 3ZRWB 2Y0PA 5FPOA 4X1KA 3E2EA 1Y66A 4P2ZA 4H13B 4EFEA 3L75H 5B1OA 4WFAV 1K34A 4Z2WA 2A79B 1BS3A 2F43G 3T1CA 4O4JA 3I56V 1K3EA 1ZLZA 1Q6HA 4IHJA 3EFFK 5FNVA 2AZ2A 1JQ0A 3JD4A 3UCSC 2A9HA 1R6TA 3CRAA 3L70H 4X65O 5KAFZ 3BY6A 5L3FA 5BMVA 3X2QC 4PA9A 3FB7C 4DR2O 2QM4A 2JRIA 4P30A 1W0KG 2IJIA 3AG4B 5LHHA 1FS0G 2GUZB 1SA0A 2EBOA 5EIBD 3ZRVA 2E74B 2IJKA 4DV0B 4DW1A 1THZA 2AZ0A 3GWOA 3ETGA 5B66Z 4U7NA 1NVPD 5L3EA 2L6LA 4IIJA 3U0ZA 3ASNC 2WLLB 1F23A 2QE7G 4FLXA 2ZR2A 2DYSC 4PI2A 2GHYA 3W7SA 1GM9A 2XUMA 4JI0O 5KHGA 2ZNJA 4MS2A 3SPJA 1SQGA 5LGUA 2XAGA 4UCUA 2DQ3A 1HNXO 2K1EA 3JD0A 2LP7A 2UXDB 4JTDB 1BHAA 1OCRB 2HVJC 1ROPA 1PNLA 1US6A 1AR1B 4XDJA 4O4IA 4UB6Z 1N8RW 1NKDA 2CGNA 4HNAA 5LOVA 4JI4B 4J42A 3B2EE 2CAZC 1MZEA 1BE3H 2DQ0A 3H1HH 4JV5B 2PYJA 4PA6A 4DV6O 4KHPB 5LYJA 1VF6C 2HJDA 1GAXA 4B3RO 2FYUH 1M56C 4U3JB 1B3QA 4X20B 3PN1A 4D7SA 3JATA 1EM1A 4NTWA 4JYCA 3SPGA 4QPKA 2HLDG 4WF9V 1GN3A 3RYFA 5H2FZ 1JFFA 2YIBD 1SERA 1KP2A 4J11A 1EFRG 3RW0A 3LUTB 1K5SA 1SQXH 4WFGA 1EZVH 1WA8A 2Q8VA 4FFBA 3BRCA 5LHIA 5LMUB 2ZIMA 3JALA 3RYHB 4WFBV 2D3OW 4DUZO 3DXRA 3EXAA 3K08A 1UJWB 2UUCB 4JI6B 4TV9A 1NS1A 1YSCA 1TVKA 2PTMA 1FXVA 4DV0O 1KECA 1AROP 4BIZA 1YTFD 4GX1A 4JI3O 1QCEA 2X7RB 1K7DA 4P9PA 1CXZB 4J9ZB 1EN6A 1XILA 1IBMB 2ZE8A 1YCIA 3BAAA 1HW7A 1VQ7V 2UU9O 1V54B 5JH7A 3OAAG 1VQPV 1XHXA 5EK0A 1XL4A 1GO3F 3CEIA 4GT1A 2XAFA 3Q4HB 3A8TA 2F4VB 5TISZ 3ETEA 3RYCB 4GCZA 1OCRC 2R9AA 1KMIZ 2FMLA 2ITCC 1KP3A 1K5QA 1UFIA 3FD9A 2HHHO 5GW7A 2LW1A 3A0RA 4JTCB 3QTCA 2UXDO 2B1GA 3ZHTA 2YIDA 2QGNA 3M99B 4G2KA 4HZ3A 4F6RB 1OCZC 1AVMA 2V4DA 4O2AA 2OTJV 4JI2B 4X1IB 3K57A 1PM9A 3S3WA 4UV9A 4H44B 4JI5O 1GM7A 3SJBC 2BOBC 2OTLV 2R9IA 3U11A 4JI4O 3ABLC 3CRQA 2Q9LA 4LNUB 4C7UA 4KHPO 1NH2B 4NTXA 4WCEV 3VQXA 5KMGB 2ADQB 1AP5A 3QO5A 1ZAUA 4B3TO 1M57B 1YJ9V 3HKDB 2X0LA 1WN7A 2LGWA 3OE7G 4IL6Z 5IJ9A 1ZL8B 3A0HZ 4DV2B 2AW9A 4ZBMA 2ZT9B 2UUAB 4X89A 2PUSA 3AEIA 1E79G 1SZXA 2JGDB 4DR5B 4LF9B 4FLZA 1D2DA 5LMUO 2A7WA 2P4KA 4FIPC 5CA1A 3WB1A 4BR6A 5EBLC 2A06H 3ETDA 3SJCC 4JI6O 1VARA 3G4SV 2AGAA 1I7FA 1XMQB 4I0XA 1Y76B 3ZMZA 1R6NA 1PD3A 3JD1A 1M90W 1CP9A 1IXBA 3JAWA 1TA8A 1IBMO 1IBKO 2PGGA 3L72H 3P3NA 1DF5A 4DYLA 1H2KA 2P4VA 3KZIZ 3HPLC 5LMNB 3FKSG 3TCUA 1Z2GA 3F5TA 1FFXA 3AG7A 1AI5A 2YIBA 3CE2A 4CS3A 1SF9A 4RO2A 5A2QN 1FJGB 2E5LB 4EB6A 1N0JA 3K5OA 2WLJA 1XEQA 2EX3A 4LWSB 1K33A 4DRXB 2FL4A 2YC0A 4L87A 5KAIZ 3E22B 4O2BB 3OUFA 4DV1B 3E89A 3A0BZ 3DSQA 5KA5A 2QEXV 3AG3B 4TUYB
chains in the Genus database with same CATH topology
4KHPO 2LW7A 4DV3O 3T1YO 4X66O 1AILA 4A5UB 1R6TA 4B3TO 5H5NA 4X65O 3JAMN 5IT9N 2UUCO 4LF6O 3RT3C 4DR7O 4DR1O 1IBLO 1N33O 4DR2O 5BR8O 4NXNO 3O65A 2JRIA 5LL6Y 3M8AA 4LFAO 3J80N 4K0KO 1X59A 1XMQO 1G1XB 2UUAO 4DV7O 1N36O 5IWAO 4LF4O 4DUZO 4JI7O 4NXMO 1NS1A 1D2DA 5LMUO 4LF7O 4DV0O 5FLXN 4X62O 4DV4O 5BXZA 4JI6O 4DR5O 4LF9O 1I94O 2UXBO 3OTOO 2AGAA 4JI3O 1FKAO 1XNRO 2UXCO 2F4VO 4B3SO 1HNWO 4B3MO 4YHHO 2ZM6O 4OX9O 4GKJO 1J5EO 2UU9O 4LFBO 1N32O 4AQYO 4JI8O 1N34O 1IBMO 1IBKO 4DR3O 1DK1A 2UUBO 1XNQO 4DR6O 1HR0O 1FYJA 4LFCO 4DR4O 4OPAA 4JI0O 2VQFO 3F5TA 2DJVA 1HNZO 4GKKO 2FKXA 4OPHA 4JI2O 1HNXO 4JV5O 1YZBA 5LMNO 4DUYO 2ZKOA 4DV1O 2Z0AA 4LF5O 5A2QN 2HHHO 4JYAO 3SDLA 4JI1O 1AB3A 3J7AU 4YY3O 4X64O 1XEQA 2UXDO 1XMOO 2DOSA 1FJGO 2E5LO 3R66A 5BY1A 2VQEO 4DV5O 3T1HO 4DV6O 4JI5O 1KUQA 1R1BA 1A32A 1F7YA 2N74A 4JI4O 3J81N 4B3RO 4LF8O 4DV2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP O;  2LW7 A;  4DV3 O;  3T1Y O;  4X66 O;  1AIL A;  4A5U B;  1R6T A;  4B3T O;  5H5N A;  4X65 O;  3JAM N;  5IT9 N;  2UUC O;  4LF6 O;  3RT3 C;  4DR7 O;  4DR1 O;  1IBL O;  1N33 O;  4DR2 O;  5BR8 O;  4NXN O;  3O65 A;  2JRI A;  5LL6 Y;  3M8A A;  4LFA O;  3J80 N;  4K0K O;  1X59 A;  1XMQ O;  1G1X B;  2UUA O;  4DV7 O;  1N36 O;  5IWA O;  4LF4 O;  4DUZ O;  4JI7 O;  4NXM O;  1NS1 A;  1D2D A;  5LMU O;  4LF7 O;  4DV0 O;  5FLX N;  4X62 O;  4DV4 O;  5BXZ A;  4JI6 O;  4DR5 O;  4LF9 O;  1I94 O;  2UXB O;  3OTO O;  2AGA A;  4JI3 O;  1FKA O;  1XNR O;  2UXC O;  2F4V O;  4B3S O;  1HNW O;  4B3M O;  4YHH O;  2ZM6 O;  4OX9 O;  4GKJ O;  1J5E O;  2UU9 O;  4LFB O;  1N32 O;  4AQY O;  4JI8 O;  1N34 O;  1IBM O;  1IBK O;  4DR3 O;  1DK1 A;  2UUB O;  1XNQ O;  4DR6 O;  1HR0 O;  1FYJ A;  4LFC O;  4DR4 O;  4OPA A;  4JI0 O;  2VQF O;  3F5T A;  2DJV A;  1HNZ O;  4GKK O;  2FKX A;  4OPH A;  4JI2 O;  1HNX O;  4JV5 O;  1YZB A;  5LMN O;  4DUY O;  2ZKO A;  4DV1 O;  2Z0A A;  4LF5 O;  5A2Q N;  2HHH O;  4JYA O;  3SDL A;  4JI1 O;  1AB3 A;  3J7A U;  4YY3 O;  4X64 O;  1XEQ A;  2UXD O;  1XMO O;  2DOS A;  1FJG O;  2E5L O;  3R66 A;  5BY1 A;  2VQE O;  4DV5 O;  3T1H O;  4DV6 O;  4JI5 O;  1KUQ A;  1R1B A;  1A32 A;  1F7Y A;  2N74 A;  4JI4 O;  3J81 N;  4B3R O;  4LF8 O;  4DV2 O; 
#chains in the Genus database with same CATH topology
 1M57 C;  3W7W A;  3SJQ C;  1OCC B;  3N2G B;  5IYZ B;  3CXC U;  2EJ7 A;  4MTX A;  4JTA B;  4KL1 A;  4PDV A;  1BZK A;  3CC2 V;  3CSX A;  5LA6 B;  4DR1 O;  2ETN A;  1ZWI C;  1EBO A;  4LF4 B;  2WA4 A;  1H8E G;  5EIB C;  1W0J G;  3C3T A;  2RCV A;  4K0K O;  2UUA O;  2HKO A;  1YHQ V;  3CC7 V;  3F7V C;  3CCL V;  3CCJ V;  5EYP A;  1S76 D;  5J2T B;  3E8G A;  4B3S B;  1NTK H;  4NXN B;  4DR5 O;  4LF9 O;  1I94 O;  2YI9 A;  1ZX3 A;  5LP6 B;  1AR4 A;  3N27 A;  5EBM C;  2EJR A;  5E1A C;  2R70 A;  1BSM A;  3IAY A;  2DN9 A;  1Q3E A;  3ZHV A;  4GX0 A;  4DV4 B;  2QR4 A;  1L8D A;  3DGE A;  3JAK A;  1M5I A;  4J7Z A;  1YDX A;  3JCU Z;  2ZIN A;  3OMI B;  1IXM A;  4WBN A;  3JAS B;  1B06 A;  4OX9 B;  5FPR A;  1BGY H;  5LMN O;  5BZB A;  1TGO A;  2IW5 A;  4JI1 O;  5JJJ B;  5K1X A;  3N2K B;  3VQY A;  4UVA A;  5CN0 A;  5IY5 B;  1FJG O;  3H01 A;  2E5L O;  2QM7 A;  3AG3 C;  2F23 A;  3B77 A;  3ZMS A;  1OCO B;  2OCC C;  4TSF G;  5EBW C;  2N04 A;  1KUQ A;  1RSO A;  2JVD A;  1R3K C;  3BEH A;  3ZMU A;  4NVP A;  1OCC C;  5CB4 A;  1FFT B;  4KUM A;  4O4H A;  1WNS A;  3CXH F;  3CX5 F;  2YSU B;  3K79 A;  3RVZ A;  2HG5 C;  1WAZ A;  1WJZ A;  3ABM B;  4H0L B;  4UB8 Z;  2VWJ A;  5BR8 O;  2R9R B;  1MA1 A;  5D5Q A;  5J2U A;  1LR1 A;  4GUN A;  1EN4 A;  4X65 B;  1Y74 B;  1M9N A;  4LF4 O;  2P6J A;  3MDS A;  2BE3 A;  1CEZ A;  5HFL A;  1FXH A;  3HKC B;  2XHB A;  2IH1 C;  4DR2 B;  4AI8 A;  5BXZ A;  3L71 H;  4YHH B;  4LH6 A;  1HDJ A;  1QR8 A;  1PL0 A;  1N32 B;  4B3S O;  4YJ3 A;  1YXB A;  3PJS K;  4ZHQ A;  1HNW O;  4O4L B;  1W59 A;  2ZM6 O;  2OWO A;  1IX9 A;  3ZRW A;  2DYR B;  1KKC A;  3GWK C;  4CBC A;  2YIC A;  1AJQ A;  2WLN A;  1OZ0 A;  1YIJ V;  1E1R G;  3R65 A;  2QWN B;  2V1D A;  2QWQ B;  1P49 A;  1QNM A;  1XBL A;  3UT5 B;  3E8B A;  3P3P A;  1IVS A;  5DED A;  1FXK B;  1Y4M A;  5JWP A;  1OCO C;  3ZBH A;  1VF6 A;  1XI1 A;  4JF3 A;  2QWR B;  4KXR A;  3EHB B;  1ZUQ A;  4K8Z A;  3FB8 C;  2DWE C;  3T1H O;  3BPZ A;  4MVM A;  1IZ3 A;  1MAB G;  1R1B A;  3OEE G;  1TAE A;  5IE9 A;  1AR5 A;  4FMT A;  1W2B U;  4LF8 O;  3MD0 A;  4AHC A;  3VQV A;  1WP8 A;  1F51 A;  3GVM A;  5B1B C;  4MW8 A;  3SPI A;  2CGO A;  2IJH A;  5JJE B;  4DV6 B;  5LXT B;  1K97 A;  4B3R B;  3JD2 A;  1O9G A;  4LH7 A;  2KG7 B;  3I5D A;  4EKW A;  2WLL A;  1NH2 D;  2XND G;  2JJ2 G;  4PI0 A;  5CBG A;  1KBH A;  1VQL V;  1S5J A;  1KQS U;  1N0N A;  4CH6 A;  3ICX A;  1B6Q A;  5AG2 A;  1MMM A;  2IM9 A;  1SKV A;  2YEV B;  1GN6 A;  2EIM B;  4MTF A;  2AXT Z;  2RQ6 A;  1NR7 A;  1J5E B;  1T5E A;  5LHG A;  2DYR C;  4K3A A;  2LFS A;  5CA3 A;  2ARH A;  4DUZ B;  1JJ2 U;  4YHH O;  1XNQ B;  4DR6 B;  1N32 O;  1XUQ A;  3HKB B;  4TWK A;  1UPG A;  3HB3 B;  5HFM A;  1Z5V A;  3QVN A;  3K58 A;  4JI3 B;  4I4T B;  4X1Y B;  4CH4 A;  3B8N A;  2DJV A;  4PDM A;  4PV1 B;  3RYI B;  5IYD O;  3JD3 A;  3WG7 C;  2ZE7 A;  2UU9 B;  4MTO A;  1RM1 B;  3OUS A;  5J9P C;  3QF7 A;  4U3J A;  3CCS V;  3STZ C;  2M7W A;  5IYB O;  4X20 A;  4EEQ A;  2F93 B;  3ETQ A;  2WPD G;  1XMO O;  2XT9 A;  3AG2 C;  4QGP A;  2GDS A;  4HBN A;  3CD6 V;  4DV5 O;  1R3L C;  2E3C A;  4FLW A;  5KLV H;  2HHH B;  1X4T A;  1L1F A;  2N74 A;  3ZRX A;  4DV3 B;  3QNE A;  1K4C C;  3VQW A;  1H2N A;  1H38 A;  1M93 A;  2PY5 A;  1AJP A;  2X6B A;  3L74 H;  5GTH Z;  4Z1V A;  1VQM V;  2M6Y A;  4A5U B;  1E1Q G;  3RYH A;  1YI2 V;  3B09 A;  4JI5 B;  2CK3 G;  3ABK B;  2DMX A;  4NTY A;  2DW4 A;  2BSK B;  5C8Y B;  3OT7 A;  4GX2 A;  4UXN A;  1QHT A;  2JS3 A;  3M8A A;  3B40 A;  4JI7 B;  4QIW F;  4TQF A;  3THO A;  2Q7E A;  3SJA C;  5CA0 B;  1Q6I A;  4B3T B;  2PF4 E;  3K0D A;  3OEH G;  4I55 B;  1I5Y A;  2EIM C;  3BA8 A;  2GSM B;  1I08 A;  4MW3 A;  5JQG B;  2EIN B;  5L3D A;  2CDY A;  1I0H A;  5CMU A;  3VOU A;  3AG4 C;  1TUE B;  3HR0 A;  3Q4H A;  1SQP H;  1XL6 A;  3RYC A;  2QJ1 A;  3IGA C;  1MNG A;  2RNB A;  2IBZ H;  1SQF A;  4NR1 A;  1J5E O;  3K3W A;  4R6Z A;  2AHY A;  3TXQ A;  2QTO A;  2ZCE A;  2ZD9 A;  3CC4 V;  5LGN A;  4RUE A;  4PDR A;  1XNQ O;  1AI4 A;  4DR6 O;  2OIG A;  1HR0 O;  4GLX A;  1OHH G;  1RM1 C;  3K0G A;  1XRE A;  4F6R A;  2AHZ A;  3OGC C;  2QA4 V;  3F5W C;  1WPX A;  4X1I A;  3TGU H;  2CTR A;  5L3B A;  4FLY A;  2Z0A A;  4WFE A;  5KUM A;  1IBK B;  3CCE V;  3APQ A;  4LNU A;  1K8A W;  5KMG A;  1D5N A;  3E86 A;  2NLJ C;  2Q0O C;  5LYJ B;  1F4N A;  3FAV B;  2QKS A;  1H2M A;  3K5M A;  1BL8 A;  4JZ2 A;  3SYO A;  2L35 A;  1ZL8 A;  3ZRS A;  3ASO B;  2XAJ A;  1EZJ A;  2ZIO A;  3LSQ A;  4W4L A;  4ASU G;  2B9Z A;  1NTZ H;  2K9P A;  4DV3 O;  3B8M A;  4JAU A;  3G6E V;  3T1Y O;  1AIL A;  3ZMV A;  2DWD C;  4FJC C;  1QVG U;  1IBL B;  1GMG A;  3K5N A;  2JEX A;  2JGD A;  3U10 A;  4FLT A;  1NBM G;  3RT3 C;  2EUL A;  3BAB A;  5KA6 A;  3MHH C;  4PA7 A;  1S5H C;  2IU0 A;  3LDE A;  2P06 A;  2Q5Z A;  1B04 A;  1RFY A;  5H9C A;  1Y76 A;  1BT8 A;  4J41 A;  3SGI A;  4JI7 O;  3FB6 C;  4WFH A;  3H1I H;  1G6U A;  4YJ2 B;  3CPW U;  3CCQ V;  4DR1 B;  4LF7 O;  4UCT A;  5FLX N;  3CB2 A;  4OXS A;  1JJO A;  1BMF G;  4K0K B;  3CJH B;  2CH7 B;  2HFE C;  2FB5 A;  4B3M O;  2WA3 A;  1AP6 A;  3C3S A;  3WFV A;  2QWO B;  3AK2 A;  2Q4P A;  3EVK A;  1I94 B;  2JEU A;  2Y4U A;  4KFM A;  4LWS A;  4YXW G;  5JVD B;  3ZN0 A;  3D8C A;  2XAH A;  4DRX A;  1AI7 A;  1F4M A;  2XTA A;  3E22 A;  3KCX A;  4O2B A;  1V54 C;  2ZKO A;  2OCH A;  2Q7G A;  3ABT A;  4CS2 A;  5L3C A;  1BCC H;  4TUY A;  2ZE6 A;  2EZO A;  1M4U A;  1Q43 A;  4LBE C;  3RVY A;  2IJJ A;  4GX5 A;  3T4Z A;  4LCU C;  1NI8 A;  1BQ0 A;  3ZN1 A;  3ASO C;  1PKX A;  4B08 A;  3N2G A;  4QPJ A;  1YVW A;  5IYZ A;  1QR9 A;  3R66 A;  4FLU A;  1Y67 A;  1NR1 A;  2RJZ A;  2YDE A;  3H1J H;  2YXL A;  5LA6 A;  1VMG A;  4JI1 B;  5GTI Z;  2ZE5 A;  1Y6X A;  4IYI A;  4UCS A;  1ZSP A;  1ENV A;  3OMA B;  1U97 A;  2QWP B;  4FZ0 A;  4EFB A;  1GK9 A;  2HVK C;  5KX5 B;  2HJF C;  4DO2 A;  4H33 A;  1D5A A;  2PZS A;  2RMK B;  2BTO A;  1IBL O;  1R73 A;  3E8H A;  1QU7 A;  2WLI B;  5J2T A;  4F6E A;  3CYO A;  1N36 B;  2FTK A;  4LC1 A;  4J7K A;  5LP6 A;  3SR2 C;  1R3J C;  2NR5 A;  4OGQ B;  1G1X B;  1WPB A;  3UKM A;  3T2M A;  1Z5W A;  1Q90 D;  2EIL B;  5KHI A;  1JR9 A;  4IGG A;  1K9M W;  5KHJ A;  1JA8 A;  1TUB B;  5BR8 B;  3RN4 A;  1PV0 A;  3TJT A;  1GTO A;  1H8H G;  1FKA O;  1XNR O;  3OW2 U;  4ZKI A;  2CTW A;  3JAR B;  3A2F A;  1N34 B;  2RDC A;  4P9O A;  3JAS A;  2CUG A;  1SZT A;  2YIA A;  1HWY A;  3BFR A;  2P5O A;  3SYA A;  2MW2 B;  2QTS A;  1V55 B;  1SES A;  1FYJ A;  3G71 V;  3N2K A;  1J95 A;  2EIJ B;  4QE7 A;  2P22 C;  1Q8I A;  4MVS A;  1HNW B;  5B3S B;  2ZM6 B;  1JPX A;  4EB6 B;  1LUV A;  4MTG A;  5GON B;  2VRZ A;  3FX7 A;  2Q73 A;  3CME V;  2W0X A;  4HYO A;  2QSA A;  2VQE B;  2DOS A;  2YS8 A;  5IJ0 B;  2GV9 A;  1P7G A;  4I50 B;  4X8A A;  5JCO C;  5BY1 A;  4MVR A;  3JYC A;  5B1A B;  1XHZ A;  5H6Q A;  3BHP A;  4RUF A;  2F1M A;  5DM6 V;  1DF4 A;  4PA4 A;  1WP7 A;  3O9O A;  4CS4 A;  4ZI7 B;  1JX9 A;  1BQZ A;  1Y74 A;  3T1H B;  1VIB A;  2Q67 A;  2YXY A;  4BW9 A;  4PD4 F;  2HP8 A;  4MVU A;  1QLE C;  4LF8 B;  3HKC A;  2Z3Y A;  3AK3 A;  4LP8 A;  4PDL A;  1FD9 A;  3K59 A;  4RWU A;  3O65 A;  1GN2 A;  2F95 B;  4NXM B;  5ITZ B;  3LNN A;  1X59 A;  3CRR A;  1N36 O;  3WB2 A;  4O4L A;  3E35 A;  3WU2 Z;  3LNM B;  2B1I A;  4XDL A;  3ZHQ A;  1FAF A;  4FVM A;  2UXC O;  1SQB H;  4QNH B;  5D5P A;  2Q0A A;  1V55 C;  3SYQ A;  2KSD A;  1OV9 A;  2XOK G;  4D7T A;  4DR4 B;  2EIJ C;  1G8M A;  1N34 O;  4CH5 A;  1FXK A;  4WBN B;  3GB7 C;  5LP6 C;  4LFC O;  4GKK B;  4JZG A;  3DTU B;  1JOY A;  1K4D C;  3RFR A;  1H2L A;  4LR3 A;  1VQ9 V;  2EIK B;  4BWA A;  4PHZ A;  1YZB A;  4ZOL A;  2Q68 A;  3MAQ A;  1KKD A;  3G67 A;  3K04 A;  2GTS A;  2VQE O;  3KG2 A;  1GRJ A;  1K73 W;  5LXT A;  4TV8 B;  1A32 A;  1VQ4 V;  3NR7 A;  4IT5 A;  1P84 F;  4D6T H;  2KG7 A;  5IY5 C;  1XMO B;  4QE9 A;  4W4K A;  1DGS A;  4E4E A;  4FZ1 A;  3E83 A;  2YUA A;  3ZX6 A;  2JGU A;  4DV5 B;  4UFZ A;  2RN9 A;  4LF6 O;  2BTQ B;  2O57 A;  1N33 O;  3P32 A;  2YEV A;  1VQK V;  5IWA B;  1U96 A;  4Q6G A;  1P7B A;  1JMK C;  2WLH A;  3ML0 A;  5JJN B;  4NXM O;  3ABM C;  2DYS B;  2GUZ A;  4U3F H;  1Q86 W;  3RWR D;  3HKB A;  5DN6 G;  1WB8 A;  5EC2 C;  3UM7 A;  3OTO O;  1GN4 A;  3B4S A;  4X1Y A;  4I4T A;  4FFK A;  3STL C;  1KU9 A;  2P67 A;  3RYI A;  2A0L A;  1KC8 W;  2EZP A;  4LFB O;  3D3Q A;  4AQY O;  4DW0 A;  1DTO A;  3AG1 B;  1O9H A;  2LJ2 A;  3HKE B;  3CCM V;  3E8F A;  4DK1 A;  4DR3 O;  3CS5 A;  1JVM A;  2EIK C;  3IFX A;  2UUB O;  1GH6 A;  1YIT V;  4DR4 O;  4CZZ A;  3ZED A;  2JS5 A;  3S3X A;  1RPO A;  1DLB A;  4BW5 A;  1URF A;  4DUY B;  2UXN A;  2G38 A;  1QLN A;  2CE4 A;  3JSL A;  4GKK O;  3K9S A;  3W7U A;  2PYL A;  4MVZ A;  4X88 A;  4X64 B;  1Q82 W;  5EZY B;  3ZJZ A;  1HR0 B;  1M56 B;  1QBZ A;  4RAI A;  3SYP A;  2ATK C;  1MOF A;  1NQT A;  4UUJ C;  2ADP A;  2KQX A;  3IC7 A;  4U7O A;  3LDD A;  1SQV H;  5LGT A;  4JAA A;  3JCZ A;  2E76 B;  1FXK C;  2UXX A;  4X1K B;  1S77 D;  4FM1 A;  5C8Y A;  2BSK A;  4I5S A;  2H8P C;  1S3J A;  3CP1 A;  3D36 C;  1G4Y B;  2BCC H;  5CA0 A;  3CMA V;  5H5N A;  4O4J B;  2QDO A;  4I55 A;  3JAM N;  4DR7 B;  5KUK A;  2WLM A;  5JQG A;  1SS3 A;  2W6I G;  5F2V O;  4UV8 A;  3H1L H;  4FLV A;  4IHJ B;  5FNV B;  3T1Y B;  4LFA O;  2Q6A A;  3SPC A;  5CBF A;  2ODM A;  3J80 N;  1PP9 H;  2OT5 A;  4I9Q A;  4DK0 A;  5IWA O;  4X62 B;  3ZHR A;  5BMV B;  1SC5 B;  4L8J A;  1Q81 W;  4QJF B;  1AJN A;  1SQQ H;  4TOI A;  4GKJ B;  3TXS A;  3AG1 C;  1SA0 B;  2KB1 A;  3D3I A;  3CCR V;  2QKC A;  4LF7 B;  4ZIB A;  2PI5 A;  4IIJ B;  2JK5 C;  4JYA B;  3FAV A;  5LBQ A;  1OCZ B;  1CPY A;  2FKX A;  4B3M B;  4DUY O;  4I7Z B;  4YY3 B;  5IDJ A;  3OD4 A;  3H9V A;  3SDL A;  3ABL B;  3L73 H;  3M7M X;  4X64 O;  4R7C A;  4J10 A;  3UO3 A;  2H94 A;  1ORQ C;  1I5X A;  2ZR3 A;  1R6K A;  2ZQM A;  4X66 B;  4K35 A;  5KHK A;  2Y69 B;  3ABU A;  4O4I B;  4JYY A;  2F66 C;  4HNA B;  1VF5 B;  2WWW A;  4GYC B;  5LOV B;  3DC6 A;  1XQ8 A;  4NYK A;  1LUW A;  2YI8 A;  2HR3 A;  4BIO A;  2IU3 A;  4YJ2 A;  3TET A;  3HKD A;  4YIO A;  4DR7 O;  2OYQ A;  3JAT B;  2IH3 C;  4E2L A;  1P4R A;  3RBZ A;  5LL6 Y;  1VF7 A;  1R3I C;  2LGQ A;  2LFR A;  3CJH A;  2CH7 A;  3CHX A;  3RYF B;  2Y48 A;  4G28 B;  1JFF B;  3ABK C;  4N23 A;  4HAM A;  4Z1M G;  4X62 O;  2Q69 A;  3BCC H;  3FYE B;  3OFN G;  1QQC A;  1WA8 B;  4FFB B;  5JVD A;  4G27 B;  3JAL B;  3CWB H;  3DXR B;  4GKJ O;  4MT8 A;  4TV9 B;  1TVK B;  2EIN C;  4BIU A;  1PNK A;  3OM3 B;  1RPR A;  3QO8 A;  1NT2 B;  1VQ6 V;  1NTM H;  1VEW A;  4NB5 A;  4I9W A;  1XNR B;  3BVO A;  2R72 A;  2BOC C;  2E75 B;  1S5L Z;  4JV5 O;  2VS0 A;  5JH7 B;  4JYA O;  3OTF A;  2KKW A;  5JCO A;  4FPP A;  1Q7Y W;  4YY3 O;  1L0N H;  4UVC A;  1NZ6 A;  3WB0 A;  5B1N A;  5KX5 A;  1VQO V;  1COW G;  1MSD A;  3SPH A;  3ZMT A;  3G6B A;  4R50 A;  3K9A A;  2Y69 C;  3OMN B;  2PI4 A;  4GZR B;  1VQ8 V;  3TK1 A;  2WLI A;  3ZCC A;  4UCO A;  1Q5O A;  2QM8 A;  3QG5 A;  3SYC A;  1YEW A;  4X66 O;  4WFF A;  1V9P A;  4IYH A;  4O2A B;  1KD1 W;  5IT9 N;  1MG1 A;  2B5U A;  2UUC O;  2Z5U A;  2Y0I A;  4ABM A;  1NVP B;  4RQE A;  1TUB A;  4DV7 B;  2VWK A;  3ZIA G;  2A3Q A;  2CTP A;  2LQT A;  3LSS A;  3JAR A;  3UO2 A;  3OGI B;  3ZHS A;  5IJ9 B;  3MHS C;  2C2A A;  4YIP A;  2P90 A;  2JIZ G;  1S72 V;  3F7Y C;  4XBF A;  4FM2 A;  4ICG A;  5H6R A;  2JDI G;  1VQN V;  1QLE B;  3ZHU A;  2F4V O;  4JI8 B;  2WAM A;  4CC6 A;  2ZXW B;  3CRM A;  3OR7 C;  4H37 A;  4FM0 A;  5CA1 B;  2VQF B;  5GON A;  1GM8 A;  5K1P A;  1L0L H;  1DK1 A;  4K8X A;  1HNZ B;  1PPJ H;  3IJ4 A;  3CRC A;  2X6A A;  4Q20 A;  3I55 V;  2UXC B;  4LF5 B;  2ZNI A;  5IJ0 A;  5KHH A;  4JGS A;  4I0X B;  4I50 A;  4OPH A;  4JI2 O;  4CH3 A;  4FK5 C;  2ZDI A;  3JAW B;  2ILM A;  2OCC B;  4TQD A;  1JCH A;  2V7Q G;  3FFQ A;  5CBH A;  3CCU V;  1AB3 A;  4LFC B;  4JAS A;  3J7A U;  5L3G A;  1IDS A;  4ZI7 A;  1FFX B;  3K06 A;  2DE0 X;  5A9G A;  4NKG B;  3RGB A;  1MSW D;  3J81 N;  1YF2 A;  4DV2 O;  2LW7 A;  1N4C A;  1YJN V;  3DC5 A;  5ITZ A;  4J80 A;  4UCV A;  2NNU A;  4N21 A;  1Q6U A;  1NJI W;  3H1K H;  5B5E Z;  2D2C B;  1SRY A;  4MSW C;  4XDK A;  1YTF B;  2Q7H A;  3IC9 A;  1QVF U;  3W7X A;  4AIL C;  4PA3 A;  1XDC A;  1FPO A;  1XMQ O;  4DV7 O;  2WLK A;  3W7T A;  4LF6 B;  2UXB B;  3AK1 A;  4PJ0 Z;  1EN5 A;  1N33 B;  2HEP A;  3P30 A;  2ZXW C;  2NN4 A;  1GKF A;  1KB9 F;  3BA9 A;  3ZS8 C;  1M1K W;  2QKA A;  3FYI B;  5C93 A;  2EIL C;  2XAQ A;  1PL4 A;  4JI8 O;  5EYP B;  3OTO B;  5DEC A;  4B7K A;  3FB5 C;  2VQF O;  2GBO A;  1YJW V;  1HNZ O;  1MZF A;  4MVO A;  1VQ5 V;  2W6J G;  4LFB B;  4AQY B;  4DV1 O;  4LF5 O;  2P7T C;  4TV8 A;  4UVB A;  4DR3 B;  2UUB B;  4JYB A;  5EC1 C;  1K92 A;  3UT5 A;  3VBB A;  3JAK B;  2YXH A;  4TT3 G;  5B3S C;  2W0F C;  5B1B B;  2N05 A;  3QO7 A;  3D36 A;  2MK3 A;  3KCY A;  4JAV A;  2Y4T A;  4J9Y B;  4UCR A;  2WSS G;  3G80 A;  1F7Y A;  2BTQ A;  1H2G A;  4R8C A;  2OIE A;  3KKY A;  1BHB A;  1VP7 A;  2XAS A;  4J7J A;  3C90 A;  1XOU A;  1NU1 H;  1WB7 A;  4KP4 A;  5B1A C;  1SET A;  2ZDI C;  4BAY A;  1RSO B;  3OR6 C;  1LNQ A;  3T4D A;  4DXW A;  2LO1 A;  1IUR A;  5CB4 B;  4RQF A;  4JPR A;  4NXN O;  4O4H B;  3X2Q B;  5E79 Z;  1H2S B;  1KYO F;  1OJH A;  3K5L A;  3CCV V;  4CC5 A;  5IYC O;  1RP3 B;  3APO A;  3HKE A;  4DV4 O;  1S0V A;  2UXB O;  4LFA B;  3LDC A;  5J2U B;  4PEL A;  1AI6 A;  2H3O A;  2X6C A;  3ASN B;  3K03 A;  4OX9 O;  1PNM A;  3WG7 B;  3UQ8 A;  3NXS A;  4X9Q A;  4JI0 B;  4F4L A;  5EZY A;  2ITD C;  3JSN A;  4B7E A;  1HP8 A;  4MVQ A;  4OPA A;  5FL7 G;  1HNX B;  2JJ1 G;  2CTQ A;  4ZOL B;  4YJ3 B;  3LSU A;  4ZHQ B;  3AG2 B;  1ZTE A;  2GTA A;  1WLE A;  3L9D A;  3ZRW B;  2Y0P A;  5FPO A;  4X1K A;  3E2E A;  1Y66 A;  4P2Z A;  4H13 B;  4EFE A;  3L75 H;  5B1O A;  4WFA V;  1K34 A;  4Z2W A;  2A79 B;  1BS3 A;  2F43 G;  3T1C A;  4O4J A;  3I56 V;  1K3E A;  1ZLZ A;  1Q6H A;  4IHJ A;  3EFF K;  5FNV A;  2AZ2 A;  1JQ0 A;  3JD4 A;  3UCS C;  2A9H A;  1R6T A;  3CRA A;  3L70 H;  4X65 O;  5KAF Z;  3BY6 A;  5L3F A;  5BMV A;  3X2Q C;  4PA9 A;  3FB7 C;  4DR2 O;  2QM4 A;  2JRI A;  4P30 A;  1W0K G;  2IJI A;  3AG4 B;  5LHH A;  1FS0 G;  2GUZ B;  1SA0 A;  2EBO A;  5EIB D;  3ZRV A;  2E74 B;  2IJK A;  4DV0 B;  4DW1 A;  1THZ A;  2AZ0 A;  3GWO A;  3ETG A;  5B66 Z;  4U7N A;  1NVP D;  5L3E A;  2L6L A;  4IIJ A;  3U0Z A;  3ASN C;  2WLL B;  1F23 A;  2QE7 G;  4FLX A;  2ZR2 A;  2DYS C;  4PI2 A;  2GHY A;  3W7S A;  1GM9 A;  2XUM A;  4JI0 O;  5KHG A;  2ZNJ A;  4MS2 A;  3SPJ A;  1SQG A;  5LGU A;  2XAG A;  4UCU A;  2DQ3 A;  1HNX O;  2K1E A;  3JD0 A;  2LP7 A;  2UXD B;  4JTD B;  1BHA A;  1OCR B;  2HVJ C;  1ROP A;  1PNL A;  1US6 A;  1AR1 B;  4XDJ A;  4O4I A;  4UB6 Z;  1N8R W;  1NKD A;  2CGN A;  4HNA A;  5LOV A;  4JI4 B;  4J42 A;  3B2E E;  2CAZ C;  1MZE A;  1BE3 H;  2DQ0 A;  3H1H H;  4JV5 B;  2PYJ A;  4PA6 A;  4DV6 O;  4KHP B;  5LYJ A;  1VF6 C;  2HJD A;  1GAX A;  4B3R O;  2FYU H;  1M56 C;  4U3J B;  1B3Q A;  4X20 B;  3PN1 A;  4D7S A;  3JAT A;  1EM1 A;  4NTW A;  4JYC A;  3SPG A;  4QPK A;  2HLD G;  4WF9 V;  1GN3 A;  3RYF A;  5H2F Z;  1JFF A;  2YIB D;  1SER A;  1KP2 A;  4J11 A;  1EFR G;  3RW0 A;  3LUT B;  1K5S A;  1SQX H;  4WFG A;  1EZV H;  1WA8 A;  2Q8V A;  4FFB A;  3BRC A;  5LHI A;  5LMU B;  2ZIM A;  3JAL A;  3RYH B;  4WFB V;  2D3O W;  4DUZ O;  3DXR A;  3EXA A;  3K08 A;  1UJW B;  2UUC B;  4JI6 B;  4TV9 A;  1NS1 A;  1YSC A;  1TVK A;  2PTM A;  1FXV A;  4DV0 O;  1KEC A;  1ARO P;  4BIZ A;  1YTF D;  4GX1 A;  4JI3 O;  1QCE A;  2X7R B;  1K7D A;  4P9P A;  1CXZ B;  4J9Z B;  1EN6 A;  1XIL A;  1IBM B;  2ZE8 A;  1YCI A;  3BAA A;  1HW7 A;  1VQ7 V;  2UU9 O;  1V54 B;  5JH7 A;  3OAA G;  1VQP V;  1XHX A;  5EK0 A;  1XL4 A;  1GO3 F;  3CEI A;  4GT1 A;  2XAF A;  3Q4H B;  3A8T A;  2F4V B;  5TIS Z;  3ETE A;  3RYC B;  4GCZ A;  1OCR C;  2R9A A;  1KMI Z;  2FML A;  2ITC C;  1KP3 A;  1K5Q A;  1UFI A;  3FD9 A;  2HHH O;  5GW7 A;  2LW1 A;  3A0R A;  4JTC B;  3QTC A;  2UXD O;  2B1G A;  3ZHT A;  2YID A;  2QGN A;  3M99 B;  4G2K A;  4HZ3 A;  4F6R B;  1OCZ C;  1AVM A;  2V4D A;  4O2A A;  2OTJ V;  4JI2 B;  4X1I B;  3K57 A;  1PM9 A;  3S3W A;  4UV9 A;  4H44 B;  4JI5 O;  1GM7 A;  3SJB C;  2BOB C;  2OTL V;  2R9I A;  3U11 A;  4JI4 O;  3ABL C;  3CRQ A;  2Q9L A;  4LNU B;  4C7U A;  4KHP O;  1NH2 B;  4NTX A;  4WCE V;  3VQX A;  5KMG B;  2ADQ B;  1AP5 A;  3QO5 A;  1ZAU A;  4B3T O;  1M57 B;  1YJ9 V;  3HKD B;  2X0L A;  1WN7 A;  2LGW A;  3OE7 G;  4IL6 Z;  5IJ9 A;  1ZL8 B;  3A0H Z;  4DV2 B;  2AW9 A;  4ZBM A;  2ZT9 B;  2UUA B;  4X89 A;  2PUS A;  3AEI A;  1E79 G;  1SZX A;  2JGD B;  4DR5 B;  4LF9 B;  4FLZ A;  1D2D A;  5LMU O;  2A7W A;  2P4K A;  4FIP C;  5CA1 A;  3WB1 A;  4BR6 A;  5EBL C;  2A06 H;  3ETD A;  3SJC C;  4JI6 O;  1VAR A;  3G4S V;  2AGA A;  1I7F A;  1XMQ B;  4I0X A;  1Y76 B;  3ZMZ A;  1R6N A;  1PD3 A;  3JD1 A;  1M90 W;  1CP9 A;  1IXB A;  3JAW A;  1TA8 A;  1IBM O;  1IBK O;  2PGG A;  3L72 H;  3P3N A;  1DF5 A;  4DYL A;  1H2K A;  2P4V A;  3KZI Z;  3HPL C;  5LMN B;  3FKS G;  3TCU A;  1Z2G A;  3F5T A;  1FFX A;  3AG7 A;  1AI5 A;  2YIB A;  3CE2 A;  4CS3 A;  1SF9 A;  4RO2 A;  5A2Q N;  1FJG B;  2E5L B;  4EB6 A;  1N0J A;  3K5O A;  2WLJ A;  1XEQ A;  2EX3 A;  4LWS B;  1K33 A;  4DRX B;  2FL4 A;  2YC0 A;  4L87 A;  5KAI Z;  3E22 B;  4O2B B;  3OUF A;  4DV1 B;  3E89 A;  3A0B Z;  3DSQ A;  5KA5 A;  2QEX V;  3AG3 B;  4TUY B; 
#chains in the Genus database with same CATH homology
 4KHP O;  2LW7 A;  4DV3 O;  3T1Y O;  4X66 O;  1AIL A;  4A5U B;  1R6T A;  4B3T O;  5H5N A;  4X65 O;  3JAM N;  5IT9 N;  2UUC O;  4LF6 O;  3RT3 C;  4DR7 O;  4DR1 O;  1IBL O;  1N33 O;  4DR2 O;  5BR8 O;  4NXN O;  3O65 A;  2JRI A;  5LL6 Y;  3M8A A;  4LFA O;  3J80 N;  4K0K O;  1X59 A;  1XMQ O;  1G1X B;  2UUA O;  4DV7 O;  1N36 O;  5IWA O;  4LF4 O;  4DUZ O;  4JI7 O;  4NXM O;  1NS1 A;  1D2D A;  5LMU O;  4LF7 O;  4DV0 O;  5FLX N;  4X62 O;  4DV4 O;  5BXZ A;  4JI6 O;  4DR5 O;  4LF9 O;  1I94 O;  2UXB O;  3OTO O;  2AGA A;  4JI3 O;  1FKA O;  1XNR O;  2UXC O;  2F4V O;  4B3S O;  1HNW O;  4B3M O;  4YHH O;  2ZM6 O;  4OX9 O;  4GKJ O;  1J5E O;  2UU9 O;  4LFB O;  1N32 O;  4AQY O;  4JI8 O;  1N34 O;  1IBM O;  1IBK O;  4DR3 O;  1DK1 A;  2UUB O;  1XNQ O;  4DR6 O;  1HR0 O;  1FYJ A;  4LFC O;  4DR4 O;  4OPA A;  4JI0 O;  2VQF O;  3F5T A;  2DJV A;  1HNZ O;  4GKK O;  2FKX A;  4OPH A;  4JI2 O;  1HNX O;  4JV5 O;  1YZB A;  5LMN O;  4DUY O;  2ZKO A;  4DV1 O;  2Z0A A;  4LF5 O;  5A2Q N;  2HHH O;  4JYA O;  3SDL A;  4JI1 O;  1AB3 A;  3J7A U;  4YY3 O;  4X64 O;  1XEQ A;  2UXD O;  1XMO O;  2DOS A;  1FJG O;  2E5L O;  3R66 A;  5BY1 A;  2VQE O;  4DV5 O;  3T1H O;  4DV6 O;  4JI5 O;  1KUQ A;  1R1B A;  1A32 A;  1F7Y A;  2N74 A;  4JI4 O;  3J81 N;  4B3R O;  4LF8 O;  4DV2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...