4JI7O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji7O00
4OPHA 4DR6O 4JI7O 1XEQA 4DV0O 4X66O 2UUCO 2UUAO 1FJGO 5FLXN 1IBMO 4DR7O 1XNQO 2UU9O 4K0KO 4GKJO 1AB3A 4LFAO 4DR3O 1NS1A 2N74A 2Z0AA 4JI2O 2ZM6O 3T1YO 4LF9O 1D2DA 1N34O 4JI8O 1AILA 3T1HO 4DUYO 1F7YA 4LFCO 1R6TA 4LF7O 4JV5O 2FKXA 1FKAO 4NXMO 4GKKO 3SDLA 3R66A 4LF4O 3JAMN 2DOSA 2HHHO 5H5NA 4JI5O 4OPAA 4JI0O 3J80N 2DJVA 4LF6O 1N36O 1HNXO 4OX9O 1N33O 1YZBA 4A5UB 2UXCO 1X59A 2UXDO 5BR8O 2VQFO 1A32A 4B3MO 1IBLO 5BXZA 4JI4O 4DV3O 2JRIA 4JI1O 1I94O 1DK1A 4B3SO 4X62O 1HNWO 4DV4O 4DR1O 2F4VO 4LF8O 4YY3O 1IBKO 1HR0O 1HNZO 4DR4O 4JI3O 3O65A 1J5EO 4DR5O 4DV5O 3J81N 4LF5O 4X65O 2UUBO 3J7AU 4LFBO 1KUQA 3OTOO 5LL6Y 2AGAA 4NXNO 4JYAO 4X64O 4DUZO 2UXBO 4YHHO 1XMOO 4DV7O 2E5LO 4DV6O 1N32O 1XNRO 2LW7A 4DV1O 1G1XB 2VQEO 4DV2O 4B3TO 1R1BA 4AQYO 5IWAO 1FYJA 5BY1A 5LMUO 4JI6O 1XMQO 5LMNO 5A2QN 3RT3C 4DR2O 4B3RO 5IT9N 3F5TA 4KHPO 2ZKOA 3M8AA
chains in the Genus database with same CATH superfamily
2OCCC 1VQNV 2EIMB 3K9AA 5KA5A 1OCRB 1FFXA 2Z3YA 5BR8B 1KP2A 3Q4HB 4YJ2B 1CEZA 2P6JA 1IBKB 2ZIOA 3X2QC 4I0XA 1ZLZA 1AI5A 4JI2O 2E75B 1DLBA 4O4LA 3CX5F 4BWAA 4BR6A 3SDLA 2KB1A 2LP7A 3TGUH 2HHHO 2CTQA 2YSUB 5J9PC 3I56V 3Q4HA 3DC5A 5KLVH 2ZNJA 1R3LC 1F23A 2ZE6A 3OAAG 2XAFA 1YJWV 5KUMA 1H8HG 3K5MA 1YEWA 5JVDA 3JD4A 4RWUA 5LMNB 2BOCC 2Q7GA 3ETEA 1K8AW 2GUZA 1WP8A 1PNKA 4J9YB 4DV0B 1N34B 4Z1VA 1K9MW 2C2AA 4B7EA 1GM7A 2AGAA 2V4DA 3SR2C 3ABMC 4OX9B 4K3AA 3ZN0A 3ZHSA 2E74B 5HFLA 1SQBH 2KG7A 2HJFC 1FPOA 2P22C 4R50A 4B3TO 2O57A 4XDJA 3W7XA 1FYJA 1EFRG 1WB8A 1TGOA 4N21A 2ZXWB 3HKEB 4OPHA 3E22A 2CDYA 1VQ9V 4MT8A 1SQVH 4TWKA 3MDSA 3U11A 2UUAO 1JCHA 1EN6A 1XL6A 4DR4B 2P06A 2LFSA 4K0KO 3W7WA 4LFAO 3AG2B 3BEHA 4O4LB 3BCCH 1K97A 5IJ9B 1R73A 3CCUV 1VQ5V 3CRQA 2QWRB 4FJCC 4DUYO 2W6IG 3M7MX 4I4TA 3UM7A 1HNZB 2W0XA 3G6BA 4UXNA 2WAMA 4EFEA 4LF4O 2YIAA 3MHHC 1M9NA 3UKMA 2JEXA 4NKGB 2H8PC 2GTSA 1ZSPA 2DJVA 5EIBC 4GT1A 3H01A 2PYLA 4KHPB 2CTPA 1A32A 2BTQA 4ZI7B 5B1AB 4DV3O 4QE9A 1JMKC 3D36C 1OCZC 3JATA 1NJIW 1H8EG 3D36A 3JAWB 3T2MA 3B09A 1P49A 5IDJA 2DW4A 3ASOB 5IJ9A 4J41A 4IIJA 1KUQA 2H3OA 4NXNO 3SJCC 5B3SC 3N2KB 1Y66A 1XMOO 3VOUA 4F6EA 5JJJB 1AJQA 4OXSA 2FMLA 4O4IB 1VQMV 1H2GA 3TETA 1VF6A 1YIJV 3AG4B 2Q69A 2IJHA 3K0DA 3APQA 5A2QN 3DTUB 1PL0A 1NU1H 2QWQB 3M8AA 1JPXA 3ABUA 1Q6HA 5FPRA 3LNMB 4JI7O 3LDEA 3A0BZ 4D7TA 5ITZB 3L74H 2UUCO 1FXKA 1IBMO 4I50A 4TSFG 1RM1C 3ZX6A 1NQTA 1GRJA 3G4SV 2ARHA 1I08A 2R9IA 4UB8Z 3AG1C 4O2AB 4PELA 3WB2A 4O4HB 1ROPA 1L1FA 1THZA 3TXQA 1N34O 4I4TB 4DO2A 1Q3EA 4LFCO 2MW2B 3E35A 4Q6GA 3JSNA 4CH4A 4N23A 4CBCA 4PA9A 4NB5A 3AG7A 3ABLB 2WLHA 2Y0IA 3AG2C 3CCSV 1IX9A 1N33O 5IY5C 5KMGB 1Q6UA 4X1IB 2ZIMA 1Q8IA 2QKCA 1I5YA 4EFBA 1IBLO 4LP8A 4QPKA 3E89A 1MG1A 3ABMB 1IVSA 2FTKA 4IGGA 1XMQB 1VF5B 3CCRV 2OT5A 3CWBH 4YY3O 4JV5B 5LYJB 4DR4O 3K79A 5EYPA 2F95B 4LFAB 3D3IA 3FB5C 3L9DA 3UT5A 4QNHB 1LR1A 5B1AC 4BAYA 3G80A 4F6RB 5L3EA 2BOBC 3UQ8A 4X9QA 3FFQA 5H2FZ 3C3SA 5CB4A 1G1XB 2FB5A 4ABMA 1UPGA 2HG5C 1SQXH 4WBNA 3HPLC 4AQYO 4GX2A 2Y69C 5LMUO 2OYQA 4UVBA 1VQ7V 3RN4A 5BMVB 4B3RO 2P4VA 1QHTA 5LP6C 3RW0A 5E1AC 4UCOA 2YIBD 4U3JB 5LGTA 1XI1A 4FLZA 3JARA 2Y4TA 4JAUA 2QWPB 2EJ7A 3QO5A 1FXHA 4DV5B 3UO2A 1OCOC 2XHBA 1VP7A 1N32B 2R9AA 3K06A 1AI6A 3E83A 1K34A 2WWWA 4UFZA 2B1IA 3SJQC 3JAWA 1O9HA 1OCZB 4WFEA 3IAYA 3K5OA 1X59A 3AG3B 2Q7EA 2RMKB 4WFGA 1H2KA 4G28B 1OV9A 5BR8O 1JFFB 5EK0A 2IM9A 3ASOC 3GB7C 4O4JA 1IXMA 3OGIB 4YXWG 5FL7G 5B3SB 2IJKA 2HKOA 4GKJB 5D5QA 2LGQA 3K3WA 2QR4A 1YJ9V 1QNMA 4DW0A 5K1PA 4JZ2A 4KUMA 5IE9A 3SYPA 3K5LA 4LFBO 3H1KH 1L0LH 2D2CB 4X64O 2GV9A 1ENVA 2JS3A 3RYCB 1VQKV 1HNXB 4RUEA 1EBOA 1KU9A 3T1HB 4LFCB 4FIPC 1QVGU 4LR3A 2A79B 1IDSA 4P9OA 4JTDB 2P4KA 1CXZB 4DYLA 3QF7A 4LBEC 4PHZA 5JWPA 1YHQV 3TXSA 4JTCB 3BRCA 1GN4A 5DN6G 4JI0B 1EM1A 1XEQA 4DV0O 3ZEDA 3WG7C 1IBLB 1MSWD 3JARB 1BS3A 1WA8A 3LSSA 3GWOA 4MVQA 2LO1A 2UUBB 2VWJA 1JVMA 4KP4A 3HKDB 3RYHA 1NVPD 2ZM6O 5IY5B 1D2DA 2G38A 3K04A 4EB6A 5C8YB 4LH7A 4JZGA 2DMXA 2HVKC 5IWAB 3L71H 1H2LA 3J80N 1SETA 3OW2U 3H1LH 4PA3A 5FNVA 1XHXA 5H6QA 3DSQA 1YCIA 5KX5A 2BE3A 5LYJA 4J9ZB 3OR6C 5BZBA 3JCZA 4FZ0A 1HNZO 1K5QA 5IYZA 4LF9B 1NKDA 3E22B 4H0LB 3G67A 4X65O 3OT7A 4EEQA 4H13B 3CJHA 2QGNA 2QWNB 3A0HZ 2LGWA 4NTXA 3S3XA 4I7ZB 2WA4A 1N32O 2B9ZA 1LUVA 4PDLA 5LP6B 1TVKB 1TUBA 3STZC 4JF3A 2L6LA 4GX5A 2CK3G 4TQDA 3HKDA 3RYHB 4UV8A 1PNLA 1Y6XA 2RDCA 2Q73A 4DR2O 1M57C 5IT9N 1G8MA 1JJ2U 4LNUB 1WAZA 2Q0OC 1ZL8B 5DEDA 4J7JA 4Z2WA 3FB7C 1OCOB 3CB2A 1VIBA 5HFMA 2YIDA 1OCRC 5LP6A 1AROP 3CCJV 5CA0B 4GKJO 1RSOB 2WLJA 4D7SA 1KBHA 1NS1A 2N74A 1NR7A 4ZI7A 3LDDA 5LHGA 4HNAA 1XL4A 4I0XB 1M93A 3UO3A 5LXTA 1Y76B 4YJ2A 4Q20A 2RNBA 5B1BB 2Q5ZA 1K4CC 2EIJB 1SQGA 1F4NA 5EBWC 1JFFA 1KKDA 1K3EA 5JQGA 4PD4F 2YXYA 4K8XA 4OX9O 2VRZA 1BQ0A 2ZE5A 4UV9A 3SPHA 1NBMG 1IBMB 3B2EE 2PI4A 4DK0A 1GH6A 4B3TB 1I94O 4PDRA 1RPOA 1T5EA 2PUSA 4DR1O 1DF4A 1NH2D 2ILMA 1N4CA 1KKCA 3LDCA 1RSOA 4QIWF 4RQFA 1EZJA 1FFTB 4CS4A 1J95A 5GTIZ 1AR1B 1J5EO 1JR9A 3K59A 2UUBO 3P3NA 4X20B 1YDXA 3ZCCA 3N27A 3DXRB 2B5UA 3B4SA 4U3FH 4FPPA 1QU7A 4FM2A 1DTOA 4WCEV 3AK2A 5J2TA 2P90A 2Z5UA 3WG7B 1GN6A 3JD3A 1R1BA 4ZBMA 3SJBC 2KG7B 1S72V 4J80A 1SF9A 1P4RA 2AHYA 3RWRD 2FL4A 1SQPH 3AK1A 1XREA 1Z2GA 1MSDA 3QVNA 3K03A 3QO7A 3OMNB 5IJ0A 1ZX3A 1VQ8V 2Z0AA 1QBZA 4DV3B 4H33A 3RVZA 3I5DA 1VMGA 4LF5B 4J42A 1K4DC 1Q81W 3OMIB 1W2BU 2V1DA 3G6EV 3HKBA 5TISZ 3N2GA 4B3RB 3D8CA 3HKCA 4BIOA 2B1GA 2KQXA 1JJOA 4K8ZA 5F2VO 1NZ6A 3OD4A 3STLC 3SYCA 3OUSA 2AW9A 5L3CA 4I9WA 4PDMA 5LOVB 3F5WC 1QR9A 3ZHQA 1PNMA 1ZAUA 3HR0A 5L3BA 4JI2B 2XNDG 2X7RB 2DYSC 1JX9A 4ZOLB 4FM0A 3I55V 2GHYA 4X1YB 1TA8A 1Q90D 2GBOA 4FLUA 2QKSA 2WLLA 2ZCEA 2IH1C 3ZJZA 1TAEA 2HHHB 3ZMUA 4F4LA 1K33A 1N36B 3LSQA 4LH6A 3RYIB 1MZEA 1R3IC 1US6A 3CCMV 1W0KG 4ASUG 4QPJA 4UVCA 1FAFA 1V54B 4FLXA 2BTOA 2CTWA 4YIPA 2K9PA 3CCLV 4HYOA 4RUFA 4B08A 3TCUA 1DGSA 4TV9B 4PJ0Z 1JOYA 1VEWA 4AILC 3CC2V 2YC0A 1LUWA 4IHJB 1ORQC 3APOA 5B1BC 4X89A 1G6UA 3N2KA 1SQQH 2EIKB 1RM1B 1WJZA 1S76D 2CGOA 3RYIA 3WB0A 4NTYA 3ZHVA 2HFEC 3OM3B 1S77D 2X6CA 4X20A 2AXTZ 3HKEA 4JV5O 2W0FC 4TUYB 3OMAB 1IURA 4JI3B 4MTFA 2A9HA 2DYRC 1XNRB 3JAMN 4NTWA 4OPAA 4JI0O 5CA3A 1P7BA 2GSMB 5LBQA 1VQLV 3O9OA 2OTJV 3M99B 2ZINA 4XBFA 4O4HA 5JCOA 2DE0X 1M1KW 1DK1A 1FJGB 5KHHA 1XOUA 3PN1A 3W7UA 2R70A 4FFBA 4DV4O 4K0KB 5KUKA 2HVJC 4IT5A 4LC1A 3MHSC 4DR3B 3ZMSA 3CCVV 3ZHUA 1K92A 4DUZO 4MVOA 5IYCO 4NR1A 1KC8W 3AK3A 2KSDA 3GWKC 4JI5B 3N2GB 4MS2A 2ODMA 3JCUZ 2QKAA 4U7OA 1WP7A 1KD1W 2CGNA 3OTFA 4HNAB 3IFXA 3H1HH 4NVPA 4LNUA 5EC2C 4O2BA 1HR0B 4FLTA 4DR6O 2EIMC 3CP1A 5IJ0B 4LF6B 5LOVA 2UXXA 2A3QA 3U0ZA 4GUNA 4IYHA 2X6AA 5EBLC 1BE3H 1B04A 4FK5C 2OCHA 2Q68A 3KCXA 3SPGA 5E79Z 1QCEA 2X0LA 4FZ1A 3CS5A 3SYOA 1NVPB 3X2QB 1M90W 3ZS8C 3BHPA 2XAJA 1I0HA 1XMOB 3ZRSA 5EC1C 1YTFD 3DC6A 1QVFU 1RP3B 3ZIAG 1PPJH 2QWOB 5CN0A 2PF4E 2BCCH 2WSSG 2YS8A 3R66A 4DR2B 5IYBO 4WFBV 1QLEB 5H5NA 1XUQA 4X64B 4CS3A 4JI6B 2YI9A 5CBFA 1N36O 1HNXO 4FM1A 1KECA 5B1OA 4CH5A 4P30A 4FLYA 5GONA 3P32A 2EILC 5JH7A 4J7KA 4JI7B 1VQPV 5CA1B 2XOKG 4DRXA 4JYYA 1M5IA 4DR7B 1HNWO 1GAXA 5H9CA 2F4VO 3EHBB 1S5JA 2Q9LA 3JSLA 3R65A 5DM6V 4FVMA 5KA6A 2RQ6A 1NT2B 3PJSK 4E4EA 1G4YB 1V54C 4QE7A 1KYOF 5LL6Y 2ZE8A 1FFXB 4X1IA 4X88A 3JD2A 5EYPB 5B66Z 4TV8A 2UXCB 1BGYH 3FAVB 3THOA 1SRYA 3ZHRA 3T1YB 1Y67A 4LCUC 5EBMC 1YJNV 1P84F 3D3QA 4JI4B 4O4IA 1S5HC 4JASA 3K57A 1Y76A 3KKYA 3K08A 1M56B 3AEIA 1Z5WA 2KKWA 4GZRB 1NTKH 2ATKC 4B3SB 5LGUA 1J5EB 4X66O 1FJGO 1AP6A 3BFRA 3LNNA 3NXSA 1K73W 1N0NA 1EN5A 4JGSA 4DV6B 4LF8B 1GM9A 1PP9H 1QLNA 3VBBA 2X6BA 1AI4A 5GTHZ 4MSWC 2F93B 2K1EA 4L87A 5EZYA 3VQVA 4DV1B 2FKXA 4JYAB 2F66C 5JJEB 1TUEB 4MVUA 3ASNC 1BT8A 4GKKO 3CC7V 2A7WA 1SESA 1WPBA 5LXTB 2DOSA 4JI5O 3BA8A 1OCCB 4UCUA 5LMUB 3ETQA 1U96A 1VF6C 1YVWA 3B77A 1XQ8A 4O2AA 4QJFB 4ZHQA 1V55C 2EULA 4B3MO 4GX0A 1MNGA 3CC4V 1QLEC 1X4TA 2DWDC 1FXKB 1IXBA 4WFHA 2EZOA 3DGEA 2QA4V 3FYEB 2IU0A 1L0NH 3DXRA 4PV1B 2XASA 3OGCC 4DV5O 3J81N 1V9PA 4H44B 3BA9A 4I55B 5AG2A 5CBGA 3VQXA 2XTAA 1F4MA 3B8MA 4XDLA 4YHHO 2E5LO 1GMGA 1D5AA 3IC7A 2LW7A 3ICXA 3BVOA 2QSAA 2FYUH 2Q4PA 3S3WA 1N8RW 5L3GA 2EINB 4JI6O 1M57B 3AG4C 5KAFZ 3JALB 3ZMVA 4UB6Z 1B06A 3HKCB 1HWYA 5C93A 4GYCB 4CS2A 5L3FA 3RYFB 3JYCA 4DR7O 4JTAB 2ITCC 1HNWB 1WNSA 1I5XA 3ETGA 2YXHA 2JVDA 2Q8VA 2RN9A 3AG1B 1XILA 4YJ3B 2RCVA 4DRXB 1M56C 5LGNA 1E1RG 5B5EZ 3T4ZA 5JH7B 1KP3A 2XAHA 2IBZH 4J10A 3T1HO 5A9GA 5B1NA 3ZRVA 4LF7O 2XAQA 2QTOA 2PTMA 3VQWA 3WU2Z 3ABLC 2EBOA 3K5NA 5C8YA 4DXWA 3CRCA 1K7DA 2UXBB 2YDEA 3H9VA 1NTMH 4JYCA 1XNQB 2NN4A 4IYIA 3K9SA 2YEVA 2JGDA 1SS3A 3OFNG 2NLJC 3RVYA 4G27B 2NNUA 2L35A 4X62O 4B3SO 1WA8B 5L3DA 1L8DA 3IJ4A 4BW5A 4CH3A 2IJIA 1AR5A 4X8AA 2WLLB 4JI3O 1AVMA 4OGQB 1GTOA 2ADPA 3CPWU 3OTOO 2QDOA 2R72A 2GTAA 4DV7O 1FXKC 1S3JA 4TOIA 1AJNA 2QE7G 3JAKB 2JJ2G 4DV1O 1Q7YW 3F7VC 3LSUA 2VQFB 1IZ3A 4GKKB 3ZBHA 2IH3C 4DV2O 2ZR3A 3T4DA 3GVMA 5CBHA 2ZDIA 3H1IH 1KQSU 2WLIA 2Y69B 2WLNA 3CRMA 5FNVB 1B3QA 2QM8A 3ABKB 4KHPO 3L73H 1YXBA 3CRAA 1LNQA 2LJ2A 4B3MB 4RQEA 3MAQA 1NI8A 1TUBB 2JIZG 2EZPA 4DUZB 3ABTA 1YITV 4X65B 5EZYB 1H2MA 2F43G 2VWKA 2YEVB 1XDCA 2E76B 5JCOC 3CRRA 2BSKB 3CEIA 3BAAA 2ZD9A 4P9PA 3ZRWA 4NXNB 1NR1A 3JASB 3CHXA 2OIEA 5CMUA 3NR7A 5KAIZ 3JATB 1B6QA 3CD6V 1WN7A 4IIJB 4MVZA 5CA0A 2CH7B 4LF6O 1YZBA 5CA1A 1S0VA 1QR8A 2OTLV 2BSKA 4JPRA 1ZL8A 1RFYA 3QNEA 4C7UA 5KHJA 3FAVA 1Q43A 2A0LA 2P67A 2UUCB 3T1CA 5BMVA 2OWOA 4MW8A 1W0JG 3CXCU 2EINC 4YJ3A 4DR5O 2F23A 3J7AU 3K58A 3OUFA 3TK1A 1DF5A 1F51A 4BIZA 1MMMA 4RO2A 2WPDG 2AHZA 4ZOLA 1I7FA 4UCSA 3RYFA 3FD9A 2CAZC 2AZ2A 4PA7A 4MTOA 3JALA 4MTGA 4NYKA 1BQZA 1QQCA 5BY1A 1BHAA 4U7NA 4BIUA 2EJRA 5LMNO 2F4VB 3RT3C 2IJJA 4KXRA 2ZXWC 4GCZA 4CC5A 1OJHA 1H2NA 1E79G 5DECA 3P3PA 1E1QG 2EIKC 2YIBA 4E2LA 4PA4A 1ZTEA 1SKVA 4X62B 1VQ4V 2YUAA 2JK5C 1R6KA 1TVKA 1GN3A 2JGDB 3OEHG 5J2TB 3FYIB 4UCVA 3T1YO 3E8HA 3RBZA 4DV4B 3E8BA 4JI8O 2ETNA 3KG2A 2PZSA 3ZMZA 2V7QG 4FMTA 3ZMTA 1K5SA 3OTOB 3CXHF 2WLMA 2GUZB 5J2UA 1VQOV 4NXMO 2LFRA 5GW7A 1D5NA 3E86A 4ZHQB 1SA0A 4FFKA 2WA3A 2UXNA 4KL1A 2D3OW 4CH6A 4LWSA 4JAVA 3CJHB 2AZ0A 1SC5B 2CTRA 2DWEC 4HZ3A 2WLKA 2R9RB 3JAKA 4JI1O 3A8TA 4AI8A 2ZE7A 5LA6A 1VQ6V 4RAIA 3SJAC 1XHZA 3JD0A 1BL8A 4YIOA 4FFBB 5IYDO 1HR0O 4DR6B 2H94A 1OZ0A 4LF5O 3CMAV 2GDSA 3FKSG 4BW9A 1PL4A 2ITDC 2JJ1G 3C3TA 3ABKC 2NR5A 1WB7A 2XUMA 3L72H 1ZUQA 3K0GA 2ZR2A 1ZWIC 4AHCA 3WB1A 2W6JG 1COWG 1MABG 1BSMA 2YI8A 1Q82W 1AR4A 3F5TA 2CE4A 2PGGA 3OE7G 4O2BB 1HDJA 3H1JH 1Y74A 4MW3A 1YSCA 1AB3A 4TV8B 2QM7A 4YHHB 2Q0AA 3BABA 1CP9A 3KZIZ 1MZFA 2ZDIC 1PM9A 4X1YA 3ZN1A 3SYQA 3RYCA 1F7YA 3FX7A 2EIJC 1SQFA 2EX3A 1WLEA 4ICGA 1SA0B 1URFA 4P2ZA 5IYZB 2CUGA 3UT5B 1JQ0A 2UXCO 1CPYA 3BY6A 2EILB 2IU3A 1R6NA 1Q5OA 3IC9A 4JI4O 1M4UA 4JAAA 4K35A 4TUYA 4J7ZA 3WFVA 2IW5A 2UU9B 4MVMA 4CZZA 1P7GA 2DQ3A 2N05A 5LHIA 1O9GA 4DW1A 2M7WA 4PI0A 3B8NA 3BPZA 1FD9A 1JA8A 4UCTA 1GO3F 2UUAB 3SYAA 4PA6A 3JD1A 2ZNIA 3ML0A 2UXBO 4JI8B 4DV6O 2QTSA 2Q7HA 1XNRO 4X1KB 1SZTA 1VF7A 4EKWA 4NXMB 4H37A 5JVDB 4DUYB 4FLWA 4B7KA 2UXDB 5IWAO 1XMQO 5KHKA 4TT3G 3JASA 4LF4B 4IL6Z 3A2FA 1R3KC 1PKXA 4I50B 3L75H 5K1XA 2Y4UA 3FB8C 3UCSC 3RFRA 2DN9A 3HKBB 2RJZA 1Z5VA 1UFIA 4JI1B 3E8GA 3EFFK 3CE2A 5JQGB 2ADQB 4DV7B 4DR3O 3CCEV 4LWSB 3E8FA 1RPRA 3SPJA 2P7TC 4LF9O 1BHBA 3EXAA 4KFMA 1AILA 3ASNB 1FKAO 4PDVA 2VQEB 3CSXA 3E2EA 4XDKA 1OCCC 4R6ZA 4UCRA 3ZRWB 4WFAV 2E5LB 2HEPA 4MTXA 2PI5A 3SPCA 3QG5A 3AG3C 3ZRXA 4D6TH 1V55B 2PYJA 4GLXA 2Y48A 4PI2A 5LHHA 1S5LZ 2CH7A 3CCQV 5KMGA 5JJNB 5BXZA 2F1MA 4FLVA 1SERA 2E3CA 1Y74B 2OIGA 2QJ1A 4L8JA 2LQTA 2BTQB 1IBKO 1H38A 4F6RA 2DYSB 1Q6IA 2HP8A 2MK3A 2JGUA 2P5OA 2HLDG 4U3JA 1MA1A 3HB3B 2A06H 1EZVH 4IHJA 4J11A 2OCCB 2N04A 3OR7C 2JEUA 3W7TA 3G71V 2YICA 4Z1MG 2HR3A 1AJPA 4LF7B 3ETDA 4TQFA 1UJWB 5ITZA 4CC6A 4HAMA 1AI7A 3EVKA 3FB6C 4ZKIA 5EIBD 2ZKOA 2XT9A 2DQ0A 3LUTB 1SZXA 2YXLA 5D5PA 4W4LA 4DR5B 1N33B 1NTZH 4LFBB 4WFFA 4MVRA 1R3JC 1I94B 3L70H 5FLXN 2Y0PA 1XNQO 2UU9O 4R7CA 4DR1B 1YTFB 3P30A 2QM4A 4JYBA 4UUJC 1H2SB 1FS0G 3A0RA 1GM8A 1GKFA 3W7SA 4EB6B 2XAGA 2WLIB 5KHIA 1R6TA 1XBLA 3KCYA 4YY3B 3C90A 5FPOA 4X1KA 1Y4MA 3CMEV 4G2KA 2DYRB 4ZIBA 1HW7A 3ZHTA 1HP8A 1PV0A 1KB9F 2JDIG 3SGIA 4WF9V 1BZKA 3VQYA 4A5UB 2ZT9B 4GX1A 5KHGA 2UXDO 5KX5B 3RGBA 1N0JA 1Q86W 2VQFO 2ZQMA 1W59A 4MVSA 4X66B 1MOFA 3QO8A 3TJTA 1BMFG 4DV2B 1AP5A 2JRIA 4I9QA 4AQYB 3MD0A 2ZM6B 3F7YC 3OEEG 3SPIA 4DK1A 1GK9A 1KMIZ 2HJDA 4LF8O 2PY5A 1GN2A 3B40A 1BCCH 3O65A 5LA6B 1U97A 4HBNA 1NH2B 4QGPA 1EN4A 5GONB 4TV9A 4JYAO 1OHHG 2Q67A 1WPXA 2VS0A 1YF2A 4WBNB 1FXVA 3QTCA 1PD3A 3U10A 2QEXV 4O4JB 5CB4B 2LW1A 2VQEO 2JS5A 4R8CA 5H6RA 2M6YA 2Q6AA 3CYOA 4W4KA 4I5SA 4UVAA 1YI2V 5J2UB 1VARA 4I55A 3IGAC
chains in the Genus database with same CATH topology
4OPHA 4DR6O 4JI7O 1XEQA 4DV0O 4X66O 2UUCO 2UUAO 1FJGO 5FLXN 1IBMO 4DR7O 1XNQO 2UU9O 4K0KO 4GKJO 1AB3A 4LFAO 4DR3O 1NS1A 2N74A 2Z0AA 4JI2O 2ZM6O 3T1YO 4LF9O 1D2DA 1N34O 4JI8O 1AILA 3T1HO 4DUYO 1F7YA 4LFCO 1R6TA 4LF7O 4JV5O 2FKXA 1FKAO 4NXMO 4GKKO 3SDLA 3R66A 4LF4O 3JAMN 2DOSA 2HHHO 5H5NA 4JI5O 4OPAA 4JI0O 3J80N 2DJVA 4LF6O 1N36O 1HNXO 4OX9O 1N33O 1YZBA 4A5UB 2UXCO 1X59A 2UXDO 5BR8O 2VQFO 1A32A 4B3MO 1IBLO 5BXZA 4JI4O 4DV3O 2JRIA 4JI1O 1I94O 1DK1A 4B3SO 4X62O 1HNWO 4DV4O 4DR1O 2F4VO 4LF8O 4YY3O 1IBKO 1HR0O 1HNZO 4DR4O 4JI3O 3O65A 1J5EO 4DR5O 4DV5O 3J81N 4LF5O 4X65O 2UUBO 3J7AU 4LFBO 1KUQA 3OTOO 5LL6Y 2AGAA 4NXNO 4JYAO 4X64O 4DUZO 2UXBO 4YHHO 1XMOO 4DV7O 2E5LO 4DV6O 1N32O 1XNRO 2LW7A 4DV1O 1G1XB 2VQEO 4DV2O 4B3TO 1R1BA 4AQYO 5IWAO 1FYJA 5BY1A 5LMUO 4JI6O 1XMQO 5LMNO 5A2QN 3RT3C 4DR2O 4B3RO 5IT9N 3F5TA 4KHPO 2ZKOA 3M8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPH A;  4DR6 O;  4JI7 O;  1XEQ A;  4DV0 O;  4X66 O;  2UUC O;  2UUA O;  1FJG O;  5FLX N;  1IBM O;  4DR7 O;  1XNQ O;  2UU9 O;  4K0K O;  4GKJ O;  1AB3 A;  4LFA O;  4DR3 O;  1NS1 A;  2N74 A;  2Z0A A;  4JI2 O;  2ZM6 O;  3T1Y O;  4LF9 O;  1D2D A;  1N34 O;  4JI8 O;  1AIL A;  3T1H O;  4DUY O;  1F7Y A;  4LFC O;  1R6T A;  4LF7 O;  4JV5 O;  2FKX A;  1FKA O;  4NXM O;  4GKK O;  3SDL A;  3R66 A;  4LF4 O;  3JAM N;  2DOS A;  2HHH O;  5H5N A;  4JI5 O;  4OPA A;  4JI0 O;  3J80 N;  2DJV A;  4LF6 O;  1N36 O;  1HNX O;  4OX9 O;  1N33 O;  1YZB A;  4A5U B;  2UXC O;  1X59 A;  2UXD O;  5BR8 O;  2VQF O;  1A32 A;  4B3M O;  1IBL O;  5BXZ A;  4JI4 O;  4DV3 O;  2JRI A;  4JI1 O;  1I94 O;  1DK1 A;  4B3S O;  4X62 O;  1HNW O;  4DV4 O;  4DR1 O;  2F4V O;  4LF8 O;  4YY3 O;  1IBK O;  1HR0 O;  1HNZ O;  4DR4 O;  4JI3 O;  3O65 A;  1J5E O;  4DR5 O;  4DV5 O;  3J81 N;  4LF5 O;  4X65 O;  2UUB O;  3J7A U;  4LFB O;  1KUQ A;  3OTO O;  5LL6 Y;  2AGA A;  4NXN O;  4JYA O;  4X64 O;  4DUZ O;  2UXB O;  4YHH O;  1XMO O;  4DV7 O;  2E5L O;  4DV6 O;  1N32 O;  1XNR O;  2LW7 A;  4DV1 O;  1G1X B;  2VQE O;  4DV2 O;  4B3T O;  1R1B A;  4AQY O;  5IWA O;  1FYJ A;  5BY1 A;  5LMU O;  4JI6 O;  1XMQ O;  5LMN O;  5A2Q N;  3RT3 C;  4DR2 O;  4B3R O;  5IT9 N;  3F5T A;  4KHP O;  2ZKO A;  3M8A A; 
#chains in the Genus database with same CATH topology
 2OCC C;  1VQN V;  2EIM B;  3K9A A;  5KA5 A;  1OCR B;  1FFX A;  2Z3Y A;  5BR8 B;  1KP2 A;  3Q4H B;  4YJ2 B;  1CEZ A;  2P6J A;  1IBK B;  2ZIO A;  3X2Q C;  4I0X A;  1ZLZ A;  1AI5 A;  4JI2 O;  2E75 B;  1DLB A;  4O4L A;  3CX5 F;  4BWA A;  4BR6 A;  3SDL A;  2KB1 A;  2LP7 A;  3TGU H;  2HHH O;  2CTQ A;  2YSU B;  5J9P C;  3I56 V;  3Q4H A;  3DC5 A;  5KLV H;  2ZNJ A;  1R3L C;  1F23 A;  2ZE6 A;  3OAA G;  2XAF A;  1YJW V;  5KUM A;  1H8H G;  3K5M A;  1YEW A;  5JVD A;  3JD4 A;  4RWU A;  5LMN B;  2BOC C;  2Q7G A;  3ETE A;  1K8A W;  2GUZ A;  1WP8 A;  1PNK A;  4J9Y B;  4DV0 B;  1N34 B;  4Z1V A;  1K9M W;  2C2A A;  4B7E A;  1GM7 A;  2AGA A;  2V4D A;  3SR2 C;  3ABM C;  4OX9 B;  4K3A A;  3ZN0 A;  3ZHS A;  2E74 B;  5HFL A;  1SQB H;  2KG7 A;  2HJF C;  1FPO A;  2P22 C;  4R50 A;  4B3T O;  2O57 A;  4XDJ A;  3W7X A;  1FYJ A;  1EFR G;  1WB8 A;  1TGO A;  4N21 A;  2ZXW B;  3HKE B;  4OPH A;  3E22 A;  2CDY A;  1VQ9 V;  4MT8 A;  1SQV H;  4TWK A;  3MDS A;  3U11 A;  2UUA O;  1JCH A;  1EN6 A;  1XL6 A;  4DR4 B;  2P06 A;  2LFS A;  4K0K O;  3W7W A;  4LFA O;  3AG2 B;  3BEH A;  4O4L B;  3BCC H;  1K97 A;  5IJ9 B;  1R73 A;  3CCU V;  1VQ5 V;  3CRQ A;  2QWR B;  4FJC C;  4DUY O;  2W6I G;  3M7M X;  4I4T A;  3UM7 A;  1HNZ B;  2W0X A;  3G6B A;  4UXN A;  2WAM A;  4EFE A;  4LF4 O;  2YIA A;  3MHH C;  1M9N A;  3UKM A;  2JEX A;  4NKG B;  2H8P C;  2GTS A;  1ZSP A;  2DJV A;  5EIB C;  4GT1 A;  3H01 A;  2PYL A;  4KHP B;  2CTP A;  1A32 A;  2BTQ A;  4ZI7 B;  5B1A B;  4DV3 O;  4QE9 A;  1JMK C;  3D36 C;  1OCZ C;  3JAT A;  1NJI W;  1H8E G;  3D36 A;  3JAW B;  3T2M A;  3B09 A;  1P49 A;  5IDJ A;  2DW4 A;  3ASO B;  5IJ9 A;  4J41 A;  4IIJ A;  1KUQ A;  2H3O A;  4NXN O;  3SJC C;  5B3S C;  3N2K B;  1Y66 A;  1XMO O;  3VOU A;  4F6E A;  5JJJ B;  1AJQ A;  4OXS A;  2FML A;  4O4I B;  1VQM V;  1H2G A;  3TET A;  1VF6 A;  1YIJ V;  3AG4 B;  2Q69 A;  2IJH A;  3K0D A;  3APQ A;  5A2Q N;  3DTU B;  1PL0 A;  1NU1 H;  2QWQ B;  3M8A A;  1JPX A;  3ABU A;  1Q6H A;  5FPR A;  3LNM B;  4JI7 O;  3LDE A;  3A0B Z;  4D7T A;  5ITZ B;  3L74 H;  2UUC O;  1FXK A;  1IBM O;  4I50 A;  4TSF G;  1RM1 C;  3ZX6 A;  1NQT A;  1GRJ A;  3G4S V;  2ARH A;  1I08 A;  2R9I A;  4UB8 Z;  3AG1 C;  4O2A B;  4PEL A;  3WB2 A;  4O4H B;  1ROP A;  1L1F A;  1THZ A;  3TXQ A;  1N34 O;  4I4T B;  4DO2 A;  1Q3E A;  4LFC O;  2MW2 B;  3E35 A;  4Q6G A;  3JSN A;  4CH4 A;  4N23 A;  4CBC A;  4PA9 A;  4NB5 A;  3AG7 A;  3ABL B;  2WLH A;  2Y0I A;  3AG2 C;  3CCS V;  1IX9 A;  1N33 O;  5IY5 C;  5KMG B;  1Q6U A;  4X1I B;  2ZIM A;  1Q8I A;  2QKC A;  1I5Y A;  4EFB A;  1IBL O;  4LP8 A;  4QPK A;  3E89 A;  1MG1 A;  3ABM B;  1IVS A;  2FTK A;  4IGG A;  1XMQ B;  1VF5 B;  3CCR V;  2OT5 A;  3CWB H;  4YY3 O;  4JV5 B;  5LYJ B;  4DR4 O;  3K79 A;  5EYP A;  2F95 B;  4LFA B;  3D3I A;  3FB5 C;  3L9D A;  3UT5 A;  4QNH B;  1LR1 A;  5B1A C;  4BAY A;  3G80 A;  4F6R B;  5L3E A;  2BOB C;  3UQ8 A;  4X9Q A;  3FFQ A;  5H2F Z;  3C3S A;  5CB4 A;  1G1X B;  2FB5 A;  4ABM A;  1UPG A;  2HG5 C;  1SQX H;  4WBN A;  3HPL C;  4AQY O;  4GX2 A;  2Y69 C;  5LMU O;  2OYQ A;  4UVB A;  1VQ7 V;  3RN4 A;  5BMV B;  4B3R O;  2P4V A;  1QHT A;  5LP6 C;  3RW0 A;  5E1A C;  4UCO A;  2YIB D;  4U3J B;  5LGT A;  1XI1 A;  4FLZ A;  3JAR A;  2Y4T A;  4JAU A;  2QWP B;  2EJ7 A;  3QO5 A;  1FXH A;  4DV5 B;  3UO2 A;  1OCO C;  2XHB A;  1VP7 A;  1N32 B;  2R9A A;  3K06 A;  1AI6 A;  3E83 A;  1K34 A;  2WWW A;  4UFZ A;  2B1I A;  3SJQ C;  3JAW A;  1O9H A;  1OCZ B;  4WFE A;  3IAY A;  3K5O A;  1X59 A;  3AG3 B;  2Q7E A;  2RMK B;  4WFG A;  1H2K A;  4G28 B;  1OV9 A;  5BR8 O;  1JFF B;  5EK0 A;  2IM9 A;  3ASO C;  3GB7 C;  4O4J A;  1IXM A;  3OGI B;  4YXW G;  5FL7 G;  5B3S B;  2IJK A;  2HKO A;  4GKJ B;  5D5Q A;  2LGQ A;  3K3W A;  2QR4 A;  1YJ9 V;  1QNM A;  4DW0 A;  5K1P A;  4JZ2 A;  4KUM A;  5IE9 A;  3SYP A;  3K5L A;  4LFB O;  3H1K H;  1L0L H;  2D2C B;  4X64 O;  2GV9 A;  1ENV A;  2JS3 A;  3RYC B;  1VQK V;  1HNX B;  4RUE A;  1EBO A;  1KU9 A;  3T1H B;  4LFC B;  4FIP C;  1QVG U;  4LR3 A;  2A79 B;  1IDS A;  4P9O A;  4JTD B;  2P4K A;  1CXZ B;  4DYL A;  3QF7 A;  4LBE C;  4PHZ A;  5JWP A;  1YHQ V;  3TXS A;  4JTC B;  3BRC A;  1GN4 A;  5DN6 G;  4JI0 B;  1EM1 A;  1XEQ A;  4DV0 O;  3ZED A;  3WG7 C;  1IBL B;  1MSW D;  3JAR B;  1BS3 A;  1WA8 A;  3LSS A;  3GWO A;  4MVQ A;  2LO1 A;  2UUB B;  2VWJ A;  1JVM A;  4KP4 A;  3HKD B;  3RYH A;  1NVP D;  2ZM6 O;  5IY5 B;  1D2D A;  2G38 A;  3K04 A;  4EB6 A;  5C8Y B;  4LH7 A;  4JZG A;  2DMX A;  2HVK C;  5IWA B;  3L71 H;  1H2L A;  3J80 N;  1SET A;  3OW2 U;  3H1L H;  4PA3 A;  5FNV A;  1XHX A;  5H6Q A;  3DSQ A;  1YCI A;  5KX5 A;  2BE3 A;  5LYJ A;  4J9Z B;  3OR6 C;  5BZB A;  3JCZ A;  4FZ0 A;  1HNZ O;  1K5Q A;  5IYZ A;  4LF9 B;  1NKD A;  3E22 B;  4H0L B;  3G67 A;  4X65 O;  3OT7 A;  4EEQ A;  4H13 B;  3CJH A;  2QGN A;  2QWN B;  3A0H Z;  2LGW A;  4NTX A;  3S3X A;  4I7Z B;  2WA4 A;  1N32 O;  2B9Z A;  1LUV A;  4PDL A;  5LP6 B;  1TVK B;  1TUB A;  3STZ C;  4JF3 A;  2L6L A;  4GX5 A;  2CK3 G;  4TQD A;  3HKD A;  3RYH B;  4UV8 A;  1PNL A;  1Y6X A;  2RDC A;  2Q73 A;  4DR2 O;  1M57 C;  5IT9 N;  1G8M A;  1JJ2 U;  4LNU B;  1WAZ A;  2Q0O C;  1ZL8 B;  5DED A;  4J7J A;  4Z2W A;  3FB7 C;  1OCO B;  3CB2 A;  1VIB A;  5HFM A;  2YID A;  1OCR C;  5LP6 A;  1ARO P;  3CCJ V;  5CA0 B;  4GKJ O;  1RSO B;  2WLJ A;  4D7S A;  1KBH A;  1NS1 A;  2N74 A;  1NR7 A;  4ZI7 A;  3LDD A;  5LHG A;  4HNA A;  1XL4 A;  4I0X B;  1M93 A;  3UO3 A;  5LXT A;  1Y76 B;  4YJ2 A;  4Q20 A;  2RNB A;  5B1B B;  2Q5Z A;  1K4C C;  2EIJ B;  1SQG A;  1F4N A;  5EBW C;  1JFF A;  1KKD A;  1K3E A;  5JQG A;  4PD4 F;  2YXY A;  4K8X A;  4OX9 O;  2VRZ A;  1BQ0 A;  2ZE5 A;  4UV9 A;  3SPH A;  1NBM G;  1IBM B;  3B2E E;  2PI4 A;  4DK0 A;  1GH6 A;  4B3T B;  1I94 O;  4PDR A;  1RPO A;  1T5E A;  2PUS A;  4DR1 O;  1DF4 A;  1NH2 D;  2ILM A;  1N4C A;  1KKC A;  3LDC A;  1RSO A;  4QIW F;  4RQF A;  1EZJ A;  1FFT B;  4CS4 A;  1J95 A;  5GTI Z;  1AR1 B;  1J5E O;  1JR9 A;  3K59 A;  2UUB O;  3P3N A;  4X20 B;  1YDX A;  3ZCC A;  3N27 A;  3DXR B;  2B5U A;  3B4S A;  4U3F H;  4FPP A;  1QU7 A;  4FM2 A;  1DTO A;  4WCE V;  3AK2 A;  5J2T A;  2P90 A;  2Z5U A;  3WG7 B;  1GN6 A;  3JD3 A;  1R1B A;  4ZBM A;  3SJB C;  2KG7 B;  1S72 V;  4J80 A;  1SF9 A;  1P4R A;  2AHY A;  3RWR D;  2FL4 A;  1SQP H;  3AK1 A;  1XRE A;  1Z2G A;  1MSD A;  3QVN A;  3K03 A;  3QO7 A;  3OMN B;  5IJ0 A;  1ZX3 A;  1VQ8 V;  2Z0A A;  1QBZ A;  4DV3 B;  4H33 A;  3RVZ A;  3I5D A;  1VMG A;  4LF5 B;  4J42 A;  1K4D C;  1Q81 W;  3OMI B;  1W2B U;  2V1D A;  3G6E V;  3HKB A;  5TIS Z;  3N2G A;  4B3R B;  3D8C A;  3HKC A;  4BIO A;  2B1G A;  2KQX A;  1JJO A;  4K8Z A;  5F2V O;  1NZ6 A;  3OD4 A;  3STL C;  3SYC A;  3OUS A;  2AW9 A;  5L3C A;  4I9W A;  4PDM A;  5LOV B;  3F5W C;  1QR9 A;  3ZHQ A;  1PNM A;  1ZAU A;  3HR0 A;  5L3B A;  4JI2 B;  2XND G;  2X7R B;  2DYS C;  1JX9 A;  4ZOL B;  4FM0 A;  3I55 V;  2GHY A;  4X1Y B;  1TA8 A;  1Q90 D;  2GBO A;  4FLU A;  2QKS A;  2WLL A;  2ZCE A;  2IH1 C;  3ZJZ A;  1TAE A;  2HHH B;  3ZMU A;  4F4L A;  1K33 A;  1N36 B;  3LSQ A;  4LH6 A;  3RYI B;  1MZE A;  1R3I C;  1US6 A;  3CCM V;  1W0K G;  4ASU G;  4QPJ A;  4UVC A;  1FAF A;  1V54 B;  4FLX A;  2BTO A;  2CTW A;  4YIP A;  2K9P A;  3CCL V;  4HYO A;  4RUF A;  4B08 A;  3TCU A;  1DGS A;  4TV9 B;  4PJ0 Z;  1JOY A;  1VEW A;  4AIL C;  3CC2 V;  2YC0 A;  1LUW A;  4IHJ B;  1ORQ C;  3APO A;  5B1B C;  4X89 A;  1G6U A;  3N2K A;  1SQQ H;  2EIK B;  1RM1 B;  1WJZ A;  1S76 D;  2CGO A;  3RYI A;  3WB0 A;  4NTY A;  3ZHV A;  2HFE C;  3OM3 B;  1S77 D;  2X6C A;  4X20 A;  2AXT Z;  3HKE A;  4JV5 O;  2W0F C;  4TUY B;  3OMA B;  1IUR A;  4JI3 B;  4MTF A;  2A9H A;  2DYR C;  1XNR B;  3JAM N;  4NTW A;  4OPA A;  4JI0 O;  5CA3 A;  1P7B A;  2GSM B;  5LBQ A;  1VQL V;  3O9O A;  2OTJ V;  3M99 B;  2ZIN A;  4XBF A;  4O4H A;  5JCO A;  2DE0 X;  1M1K W;  1DK1 A;  1FJG B;  5KHH A;  1XOU A;  3PN1 A;  3W7U A;  2R70 A;  4FFB A;  4DV4 O;  4K0K B;  5KUK A;  2HVJ C;  4IT5 A;  4LC1 A;  3MHS C;  4DR3 B;  3ZMS A;  3CCV V;  3ZHU A;  1K92 A;  4DUZ O;  4MVO A;  5IYC O;  4NR1 A;  1KC8 W;  3AK3 A;  2KSD A;  3GWK C;  4JI5 B;  3N2G B;  4MS2 A;  2ODM A;  3JCU Z;  2QKA A;  4U7O A;  1WP7 A;  1KD1 W;  2CGN A;  3OTF A;  4HNA B;  3IFX A;  3H1H H;  4NVP A;  4LNU A;  5EC2 C;  4O2B A;  1HR0 B;  4FLT A;  4DR6 O;  2EIM C;  3CP1 A;  5IJ0 B;  4LF6 B;  5LOV A;  2UXX A;  2A3Q A;  3U0Z A;  4GUN A;  4IYH A;  2X6A A;  5EBL C;  1BE3 H;  1B04 A;  4FK5 C;  2OCH A;  2Q68 A;  3KCX A;  3SPG A;  5E79 Z;  1QCE A;  2X0L A;  4FZ1 A;  3CS5 A;  3SYO A;  1NVP B;  3X2Q B;  1M90 W;  3ZS8 C;  3BHP A;  2XAJ A;  1I0H A;  1XMO B;  3ZRS A;  5EC1 C;  1YTF D;  3DC6 A;  1QVF U;  1RP3 B;  3ZIA G;  1PPJ H;  2QWO B;  5CN0 A;  2PF4 E;  2BCC H;  2WSS G;  2YS8 A;  3R66 A;  4DR2 B;  5IYB O;  4WFB V;  1QLE B;  5H5N A;  1XUQ A;  4X64 B;  4CS3 A;  4JI6 B;  2YI9 A;  5CBF A;  1N36 O;  1HNX O;  4FM1 A;  1KEC A;  5B1O A;  4CH5 A;  4P30 A;  4FLY A;  5GON A;  3P32 A;  2EIL C;  5JH7 A;  4J7K A;  4JI7 B;  1VQP V;  5CA1 B;  2XOK G;  4DRX A;  4JYY A;  1M5I A;  4DR7 B;  1HNW O;  1GAX A;  5H9C A;  2F4V O;  3EHB B;  1S5J A;  2Q9L A;  3JSL A;  3R65 A;  5DM6 V;  4FVM A;  5KA6 A;  2RQ6 A;  1NT2 B;  3PJS K;  4E4E A;  1G4Y B;  1V54 C;  4QE7 A;  1KYO F;  5LL6 Y;  2ZE8 A;  1FFX B;  4X1I A;  4X88 A;  3JD2 A;  5EYP B;  5B66 Z;  4TV8 A;  2UXC B;  1BGY H;  3FAV B;  3THO A;  1SRY A;  3ZHR A;  3T1Y B;  1Y67 A;  4LCU C;  5EBM C;  1YJN V;  1P84 F;  3D3Q A;  4JI4 B;  4O4I A;  1S5H C;  4JAS A;  3K57 A;  1Y76 A;  3KKY A;  3K08 A;  1M56 B;  3AEI A;  1Z5W A;  2KKW A;  4GZR B;  1NTK H;  2ATK C;  4B3S B;  5LGU A;  1J5E B;  4X66 O;  1FJG O;  1AP6 A;  3BFR A;  3LNN A;  3NXS A;  1K73 W;  1N0N A;  1EN5 A;  4JGS A;  4DV6 B;  4LF8 B;  1GM9 A;  1PP9 H;  1QLN A;  3VBB A;  2X6B A;  1AI4 A;  5GTH Z;  4MSW C;  2F93 B;  2K1E A;  4L87 A;  5EZY A;  3VQV A;  4DV1 B;  2FKX A;  4JYA B;  2F66 C;  5JJE B;  1TUE B;  4MVU A;  3ASN C;  1BT8 A;  4GKK O;  3CC7 V;  2A7W A;  1SES A;  1WPB A;  5LXT B;  2DOS A;  4JI5 O;  3BA8 A;  1OCC B;  4UCU A;  5LMU B;  3ETQ A;  1U96 A;  1VF6 C;  1YVW A;  3B77 A;  1XQ8 A;  4O2A A;  4QJF B;  4ZHQ A;  1V55 C;  2EUL A;  4B3M O;  4GX0 A;  1MNG A;  3CC4 V;  1QLE C;  1X4T A;  2DWD C;  1FXK B;  1IXB A;  4WFH A;  2EZO A;  3DGE A;  2QA4 V;  3FYE B;  2IU0 A;  1L0N H;  3DXR A;  4PV1 B;  2XAS A;  3OGC C;  4DV5 O;  3J81 N;  1V9P A;  4H44 B;  3BA9 A;  4I55 B;  5AG2 A;  5CBG A;  3VQX A;  2XTA A;  1F4M A;  3B8M A;  4XDL A;  4YHH O;  2E5L O;  1GMG A;  1D5A A;  3IC7 A;  2LW7 A;  3ICX A;  3BVO A;  2QSA A;  2FYU H;  2Q4P A;  3S3W A;  1N8R W;  5L3G A;  2EIN B;  4JI6 O;  1M57 B;  3AG4 C;  5KAF Z;  3JAL B;  3ZMV A;  4UB6 Z;  1B06 A;  3HKC B;  1HWY A;  5C93 A;  4GYC B;  4CS2 A;  5L3F A;  3RYF B;  3JYC A;  4DR7 O;  4JTA B;  2ITC C;  1HNW B;  1WNS A;  1I5X A;  3ETG A;  2YXH A;  2JVD A;  2Q8V A;  2RN9 A;  3AG1 B;  1XIL A;  4YJ3 B;  2RCV A;  4DRX B;  1M56 C;  5LGN A;  1E1R G;  5B5E Z;  3T4Z A;  5JH7 B;  1KP3 A;  2XAH A;  2IBZ H;  4J10 A;  3T1H O;  5A9G A;  5B1N A;  3ZRV A;  4LF7 O;  2XAQ A;  2QTO A;  2PTM A;  3VQW A;  3WU2 Z;  3ABL C;  2EBO A;  3K5N A;  5C8Y A;  4DXW A;  3CRC A;  1K7D A;  2UXB B;  2YDE A;  3H9V A;  1NTM H;  4JYC A;  1XNQ B;  2NN4 A;  4IYI A;  3K9S A;  2YEV A;  2JGD A;  1SS3 A;  3OFN G;  2NLJ C;  3RVY A;  4G27 B;  2NNU A;  2L35 A;  4X62 O;  4B3S O;  1WA8 B;  5L3D A;  1L8D A;  3IJ4 A;  4BW5 A;  4CH3 A;  2IJI A;  1AR5 A;  4X8A A;  2WLL B;  4JI3 O;  1AVM A;  4OGQ B;  1GTO A;  2ADP A;  3CPW U;  3OTO O;  2QDO A;  2R72 A;  2GTA A;  4DV7 O;  1FXK C;  1S3J A;  4TOI A;  1AJN A;  2QE7 G;  3JAK B;  2JJ2 G;  4DV1 O;  1Q7Y W;  3F7V C;  3LSU A;  2VQF B;  1IZ3 A;  4GKK B;  3ZBH A;  2IH3 C;  4DV2 O;  2ZR3 A;  3T4D A;  3GVM A;  5CBH A;  2ZDI A;  3H1I H;  1KQS U;  2WLI A;  2Y69 B;  2WLN A;  3CRM A;  5FNV B;  1B3Q A;  2QM8 A;  3ABK B;  4KHP O;  3L73 H;  1YXB A;  3CRA A;  1LNQ A;  2LJ2 A;  4B3M B;  4RQE A;  3MAQ A;  1NI8 A;  1TUB B;  2JIZ G;  2EZP A;  4DUZ B;  3ABT A;  1YIT V;  4X65 B;  5EZY B;  1H2M A;  2F43 G;  2VWK A;  2YEV B;  1XDC A;  2E76 B;  5JCO C;  3CRR A;  2BSK B;  3CEI A;  3BAA A;  2ZD9 A;  4P9P A;  3ZRW A;  4NXN B;  1NR1 A;  3JAS B;  3CHX A;  2OIE A;  5CMU A;  3NR7 A;  5KAI Z;  3JAT B;  1B6Q A;  3CD6 V;  1WN7 A;  4IIJ B;  4MVZ A;  5CA0 A;  2CH7 B;  4LF6 O;  1YZB A;  5CA1 A;  1S0V A;  1QR8 A;  2OTL V;  2BSK A;  4JPR A;  1ZL8 A;  1RFY A;  3QNE A;  4C7U A;  5KHJ A;  3FAV A;  1Q43 A;  2A0L A;  2P67 A;  2UUC B;  3T1C A;  5BMV A;  2OWO A;  4MW8 A;  1W0J G;  3CXC U;  2EIN C;  4YJ3 A;  4DR5 O;  2F23 A;  3J7A U;  3K58 A;  3OUF A;  3TK1 A;  1DF5 A;  1F51 A;  4BIZ A;  1MMM A;  4RO2 A;  2WPD G;  2AHZ A;  4ZOL A;  1I7F A;  4UCS A;  3RYF A;  3FD9 A;  2CAZ C;  2AZ2 A;  4PA7 A;  4MTO A;  3JAL A;  4MTG A;  4NYK A;  1BQZ A;  1QQC A;  5BY1 A;  1BHA A;  4U7N A;  4BIU A;  2EJR A;  5LMN O;  2F4V B;  3RT3 C;  2IJJ A;  4KXR A;  2ZXW C;  4GCZ A;  4CC5 A;  1OJH A;  1H2N A;  1E79 G;  5DEC A;  3P3P A;  1E1Q G;  2EIK C;  2YIB A;  4E2L A;  4PA4 A;  1ZTE A;  1SKV A;  4X62 B;  1VQ4 V;  2YUA A;  2JK5 C;  1R6K A;  1TVK A;  1GN3 A;  2JGD B;  3OEH G;  5J2T B;  3FYI B;  4UCV A;  3T1Y O;  3E8H A;  3RBZ A;  4DV4 B;  3E8B A;  4JI8 O;  2ETN A;  3KG2 A;  2PZS A;  3ZMZ A;  2V7Q G;  4FMT A;  3ZMT A;  1K5S A;  3OTO B;  3CXH F;  2WLM A;  2GUZ B;  5J2U A;  1VQO V;  4NXM O;  2LFR A;  5GW7 A;  1D5N A;  3E86 A;  4ZHQ B;  1SA0 A;  4FFK A;  2WA3 A;  2UXN A;  4KL1 A;  2D3O W;  4CH6 A;  4LWS A;  4JAV A;  3CJH B;  2AZ0 A;  1SC5 B;  2CTR A;  2DWE C;  4HZ3 A;  2WLK A;  2R9R B;  3JAK A;  4JI1 O;  3A8T A;  4AI8 A;  2ZE7 A;  5LA6 A;  1VQ6 V;  4RAI A;  3SJA C;  1XHZ A;  3JD0 A;  1BL8 A;  4YIO A;  4FFB B;  5IYD O;  1HR0 O;  4DR6 B;  2H94 A;  1OZ0 A;  4LF5 O;  3CMA V;  2GDS A;  3FKS G;  4BW9 A;  1PL4 A;  2ITD C;  2JJ1 G;  3C3T A;  3ABK C;  2NR5 A;  1WB7 A;  2XUM A;  3L72 H;  1ZUQ A;  3K0G A;  2ZR2 A;  1ZWI C;  4AHC A;  3WB1 A;  2W6J G;  1COW G;  1MAB G;  1BSM A;  2YI8 A;  1Q82 W;  1AR4 A;  3F5T A;  2CE4 A;  2PGG A;  3OE7 G;  4O2B B;  1HDJ A;  3H1J H;  1Y74 A;  4MW3 A;  1YSC A;  1AB3 A;  4TV8 B;  2QM7 A;  4YHH B;  2Q0A A;  3BAB A;  1CP9 A;  3KZI Z;  1MZF A;  2ZDI C;  1PM9 A;  4X1Y A;  3ZN1 A;  3SYQ A;  3RYC A;  1F7Y A;  3FX7 A;  2EIJ C;  1SQF A;  2EX3 A;  1WLE A;  4ICG A;  1SA0 B;  1URF A;  4P2Z A;  5IYZ B;  2CUG A;  3UT5 B;  1JQ0 A;  2UXC O;  1CPY A;  3BY6 A;  2EIL B;  2IU3 A;  1R6N A;  1Q5O A;  3IC9 A;  4JI4 O;  1M4U A;  4JAA A;  4K35 A;  4TUY A;  4J7Z A;  3WFV A;  2IW5 A;  2UU9 B;  4MVM A;  4CZZ A;  1P7G A;  2DQ3 A;  2N05 A;  5LHI A;  1O9G A;  4DW1 A;  2M7W A;  4PI0 A;  3B8N A;  3BPZ A;  1FD9 A;  1JA8 A;  4UCT A;  1GO3 F;  2UUA B;  3SYA A;  4PA6 A;  3JD1 A;  2ZNI A;  3ML0 A;  2UXB O;  4JI8 B;  4DV6 O;  2QTS A;  2Q7H A;  1XNR O;  4X1K B;  1SZT A;  1VF7 A;  4EKW A;  4NXM B;  4H37 A;  5JVD B;  4DUY B;  4FLW A;  4B7K A;  2UXD B;  5IWA O;  1XMQ O;  5KHK A;  4TT3 G;  3JAS A;  4LF4 B;  4IL6 Z;  3A2F A;  1R3K C;  1PKX A;  4I50 B;  3L75 H;  5K1X A;  2Y4U A;  3FB8 C;  3UCS C;  3RFR A;  2DN9 A;  3HKB B;  2RJZ A;  1Z5V A;  1UFI A;  4JI1 B;  3E8G A;  3EFF K;  3CE2 A;  5JQG B;  2ADQ B;  4DV7 B;  4DR3 O;  3CCE V;  4LWS B;  3E8F A;  1RPR A;  3SPJ A;  2P7T C;  4LF9 O;  1BHB A;  3EXA A;  4KFM A;  1AIL A;  3ASN B;  1FKA O;  4PDV A;  2VQE B;  3CSX A;  3E2E A;  4XDK A;  1OCC C;  4R6Z A;  4UCR A;  3ZRW B;  4WFA V;  2E5L B;  2HEP A;  4MTX A;  2PI5 A;  3SPC A;  3QG5 A;  3AG3 C;  3ZRX A;  4D6T H;  1V55 B;  2PYJ A;  4GLX A;  2Y48 A;  4PI2 A;  5LHH A;  1S5L Z;  2CH7 A;  3CCQ V;  5KMG A;  5JJN B;  5BXZ A;  2F1M A;  4FLV A;  1SER A;  2E3C A;  1Y74 B;  2OIG A;  2QJ1 A;  4L8J A;  2LQT A;  2BTQ B;  1IBK O;  1H38 A;  4F6R A;  2DYS B;  1Q6I A;  2HP8 A;  2MK3 A;  2JGU A;  2P5O A;  2HLD G;  4U3J A;  1MA1 A;  3HB3 B;  2A06 H;  1EZV H;  4IHJ A;  4J11 A;  2OCC B;  2N04 A;  3OR7 C;  2JEU A;  3W7T A;  3G71 V;  2YIC A;  4Z1M G;  2HR3 A;  1AJP A;  4LF7 B;  3ETD A;  4TQF A;  1UJW B;  5ITZ A;  4CC6 A;  4HAM A;  1AI7 A;  3EVK A;  3FB6 C;  4ZKI A;  5EIB D;  2ZKO A;  2XT9 A;  2DQ0 A;  3LUT B;  1SZX A;  2YXL A;  5D5P A;  4W4L A;  4DR5 B;  1N33 B;  1NTZ H;  4LFB B;  4WFF A;  4MVR A;  1R3J C;  1I94 B;  3L70 H;  5FLX N;  2Y0P A;  1XNQ O;  2UU9 O;  4R7C A;  4DR1 B;  1YTF B;  3P30 A;  2QM4 A;  4JYB A;  4UUJ C;  1H2S B;  1FS0 G;  3A0R A;  1GM8 A;  1GKF A;  3W7S A;  4EB6 B;  2XAG A;  2WLI B;  5KHI A;  1R6T A;  1XBL A;  3KCY A;  4YY3 B;  3C90 A;  5FPO A;  4X1K A;  1Y4M A;  3CME V;  4G2K A;  2DYR B;  4ZIB A;  1HW7 A;  3ZHT A;  1HP8 A;  1PV0 A;  1KB9 F;  2JDI G;  3SGI A;  4WF9 V;  1BZK A;  3VQY A;  4A5U B;  2ZT9 B;  4GX1 A;  5KHG A;  2UXD O;  5KX5 B;  3RGB A;  1N0J A;  1Q86 W;  2VQF O;  2ZQM A;  1W59 A;  4MVS A;  4X66 B;  1MOF A;  3QO8 A;  3TJT A;  1BMF G;  4DV2 B;  1AP5 A;  2JRI A;  4I9Q A;  4AQY B;  3MD0 A;  2ZM6 B;  3F7Y C;  3OEE G;  3SPI A;  4DK1 A;  1GK9 A;  1KMI Z;  2HJD A;  4LF8 O;  2PY5 A;  1GN2 A;  3B40 A;  1BCC H;  3O65 A;  5LA6 B;  1U97 A;  4HBN A;  1NH2 B;  4QGP A;  1EN4 A;  5GON B;  4TV9 A;  4JYA O;  1OHH G;  2Q67 A;  1WPX A;  2VS0 A;  1YF2 A;  4WBN B;  1FXV A;  3QTC A;  1PD3 A;  3U10 A;  2QEX V;  4O4J B;  5CB4 B;  2LW1 A;  2VQE O;  2JS5 A;  4R8C A;  5H6R A;  2M6Y A;  2Q6A A;  3CYO A;  4W4K A;  4I5S A;  4UVA A;  1YI2 V;  5J2U B;  1VAR A;  4I55 A;  3IGA C; 
#chains in the Genus database with same CATH homology
 4OPH A;  4DR6 O;  4JI7 O;  1XEQ A;  4DV0 O;  4X66 O;  2UUC O;  2UUA O;  1FJG O;  5FLX N;  1IBM O;  4DR7 O;  1XNQ O;  2UU9 O;  4K0K O;  4GKJ O;  1AB3 A;  4LFA O;  4DR3 O;  1NS1 A;  2N74 A;  2Z0A A;  4JI2 O;  2ZM6 O;  3T1Y O;  4LF9 O;  1D2D A;  1N34 O;  4JI8 O;  1AIL A;  3T1H O;  4DUY O;  1F7Y A;  4LFC O;  1R6T A;  4LF7 O;  4JV5 O;  2FKX A;  1FKA O;  4NXM O;  4GKK O;  3SDL A;  3R66 A;  4LF4 O;  3JAM N;  2DOS A;  2HHH O;  5H5N A;  4JI5 O;  4OPA A;  4JI0 O;  3J80 N;  2DJV A;  4LF6 O;  1N36 O;  1HNX O;  4OX9 O;  1N33 O;  1YZB A;  4A5U B;  2UXC O;  1X59 A;  2UXD O;  5BR8 O;  2VQF O;  1A32 A;  4B3M O;  1IBL O;  5BXZ A;  4JI4 O;  4DV3 O;  2JRI A;  4JI1 O;  1I94 O;  1DK1 A;  4B3S O;  4X62 O;  1HNW O;  4DV4 O;  4DR1 O;  2F4V O;  4LF8 O;  4YY3 O;  1IBK O;  1HR0 O;  1HNZ O;  4DR4 O;  4JI3 O;  3O65 A;  1J5E O;  4DR5 O;  4DV5 O;  3J81 N;  4LF5 O;  4X65 O;  2UUB O;  3J7A U;  4LFB O;  1KUQ A;  3OTO O;  5LL6 Y;  2AGA A;  4NXN O;  4JYA O;  4X64 O;  4DUZ O;  2UXB O;  4YHH O;  1XMO O;  4DV7 O;  2E5L O;  4DV6 O;  1N32 O;  1XNR O;  2LW7 A;  4DV1 O;  1G1X B;  2VQE O;  4DV2 O;  4B3T O;  1R1B A;  4AQY O;  5IWA O;  1FYJ A;  5BY1 A;  5LMU O;  4JI6 O;  1XMQ O;  5LMN O;  5A2Q N;  3RT3 C;  4DR2 O;  4B3R O;  5IT9 N;  3F5T A;  4KHP O;  2ZKO A;  3M8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...