4JI7O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji7O00
1N33O 4JI5O 4JI0O 2UUAO 1XMQO 5IWAO 3SDLA 3T1YO 4LFAO 1IBMO 3RT3C 1IBKO 4DV2O 2UUCO 1YZBA 1G1XB 3O65A 2UU9O 1X59A 2DJVA 4JI3O 4NXMO 1IBLO 5FLXN 4DUZO 3JAMN 2VQFO 1HNWO 3T1HO 1N32O 4X62O 1HNXO 4GKKO 2HHHO 2AGAA 1AILA 4JI7O 4LFBO 1FYJA 4K0KO 2Z0AA 5H5NA 5IT9N 4JI4O 2FKXA 3J81N 4LF6O 4DV6O 1R6TA 4LF5O 4OPAA 4DV5O 4B3TO 4LF9O 1XNRO 5BY1A 4LF7O 2VQEO 4DV0O 4KHPO 4LF8O 1KUQA 4DR4O 5LMUO 4B3MO 3R66A 3F5TA 1HR0O 2LW7A 2N74A 4DV4O 1AB3A 1N34O 4DR5O 4X64O 4OX9O 2UXBO 1A32A 1HNZO 1FKAO 4DR1O 1J5EO 1DK1A 5A2QN 4JV5O 1XNQO 2UUBO 4A5UB 4B3RO 1R1BA 4JI2O 2JRIA 2ZKOA 1F7YA 4AQYO 4JI1O 4JI6O 3J80N 4DR2O 4DV1O 2DOSA 1FJGO 2UXDO 4DV3O 4DR7O 4DV7O 5LMNO 5BR8O 2UXCO 3OTOO 3M8AA 1D2DA 1NS1A 4DUYO 4OPHA 2E5LO 5BXZA 4LF4O 1N36O 4YHHO 4X66O 4DR6O 2F4VO 4JI8O 5LL6Y 4YY3O 2ZM6O 1XEQA 4DR3O 1I94O 4LFCO 3J7AU 4B3SO 4X65O 4GKJO 4NXNO 4JYAO 1XMOO
chains in the Genus database with same CATH superfamily
3T1YO 5JQGB 2QKSA 2BSKB 4FLYA 3A8TA 1N36B 2B1IA 2NNUA 1YITV 3L74H 4TV9B 1Q81W 1XL6A 1GAXA 4C7UA 3OEEG 1RP3B 3CMAV 4BWAA 4PELA 4WFAV 3CRCA 1VQ4V 4X20A 1Y74A 3ZRWB 1IXMA 3C3SA 1KUQA 4ZBMA 4R50A 2RDCA 1Q7YW 2ARHA 3IC9A 4K8ZA 5B1BC 2LW7A 2NLJC 4LFCB 2ZIMA 5KHGA 3ZIAG 2P06A 2P4KA 3K0GA 1EM1A 4ABMA 1MA1A 1O9GA 2Y4TA 4UCTA 1JFFB 4J80A 1VQ9V 1FXKC 4AQYO 4HNAA 3N27A 1QLNA 4JI6O 4DV1O 1BL8A 1V55B 2ADQB 1OZ0A 4TT3G 5EBWC 3W7UA 3K5NA 4YJ3A 2E3CA 1K4DC 5LGUA 3K08A 2DYSC 2W6JG 3CX5F 5C93A 1ZUQA 3EVKA 3CC7V 5KHJA 1N36O 1BE3H 3DXRB 4BIUA 2Q0AA 4HAMA 3E8BA 1IBMB 4ASUG 3ZHTA 4LNUA 5JCOA 3JASA 2WLLB 3A0RA 3JALB 3TXQA 3B4SA 3G6EV 2Q4PA 4HYOA 4WFBV 4JI5O 3UT5B 1UPGA 4LWSA 2UUCO 4UVAA 1EN4A 5JJNB 1I7FA 2YSUB 5J2UA 4GKKO 2BE3A 1KP3A 3CCMV 4GYCB 1ZX3A 3QVNA 3HKBA 4DW1A 1N32B 4LF9O 1AROP 2HFEC 5KHIA 1AI6A 3OD4A 2ODMA 5EYPA 4Q20A 1R3LC 3DC6A 2WWWA 1QBZA 2XOKG 5EC1C 3JD1A 1KKCA 1W59A 4DV1B 2IM9A 2R9IA 1XNQB 4CS2A 3EXAA 3WG7B 2YEVA 1A32A 4QNHB 1MSDA 2W0XA 5ITZB 1GH6A 1J5EO 4FZ1A 2CTPA 4DR5B 1VMGA 2WAMA 1XNQO 1EBOA 5DM6V 2A06H 1MZFA 3AG2B 5E1AC 2EZPA 3B40A 3CP1A 2PF4E 5LGNA 2EINC 1Y6XA 1BQ0A 2IH1C 3ZJZA 4ZOLA 1YDXA 1QHTA 3X2QB 2X6BA 3M99B 3ZRXA 1R6KA 3FYEB 5KA6A 4DUZB 1FAFA 3CC2V 2CAZC 4LF4O 1GN2A 2WLIA 2EZOA 1J5EB 5H6RA 1BMFG 3DC5A 2IH3C 3ETEA 5TISZ 4O4JA 1SA0A 3JD3A 2JEXA 2F93B 4B3SO 4JYAB 2EIJB 3H9VA 2O57A 3ZMVA 4JYAO 5KUKA 3QNEA 1XMQO 3SDLA 1S5HC 1HDJA 5FPRA 2WLLA 3AG2C 2Q7EA 2EIMC 1X59A 1NI8A 3OT7A 5EZYB 4DUZO 5BMVB 3TK1A 3G4SV 5B1AB 5CA1A 4U3FH 4FMTA 3D3IA 4F6RA 5EBLC 5J2TA 3WFVA 4MW3A 1GM8A 3E22B 4OPAA 2HHHB 3OUSA 4B3RB 3TGUH 2JDIG 3RW0A 3K04A 3D8CA 2N04A 2QM7A 3R66A 3K57A 1HR0O 2X6AA 2CGNA 4TV8B 3H1IH 1N34O 4NKGB 1SQBH 2B1GA 5JH7A 4MTFA 2QTSA 1S72V 3FB7C 3KZIZ 3STZC 2ITCC 1TUBA 4OX9B 2BSKA 4NTXA 4UCUA 3UO2A 2JJ2G 5JWPA 1PL0A 2ZE8A 3HKCB 2Y0IA 1VF5B 1JJOA 3CCSV 1BS3A 4ZHQB 2UXCB 1SQQH 4QE9A 2ADPA 2CH7B 2DQ3A 1Z5VA 5IYDO 3F7VC 3SJAC 4GX1A 2Q8VA 5LMNO 1THZA 3FB6C 2UXDB 2CTQA 1EZJA 3N2KB 4L8JA 4P9OA 2R9RB 4DV3B 1NTKH 4DR1B 2E5LO 2UXNA 4DR6O 2DWDC 1H2NA 1PPJH 3WG7C 4U7NA 3APOA 5LP6A 2ZM6O 1DF4A 4LBEC 1JR9A 3T1YB 3B2EE 3MD0A 4JZGA 2EULA 4U3JB 1N34B 4PDLA 1SA0B 2GHYA 3BA8A 4FPPA 3OR7C 4MVRA 1R73A 1N33O 2KG7A 1EN5A 4O2BB 1PL4A 3SYOA 4B3MB 4DV2O 1Y66A 3IFXA 1YZBA 4DRXB 3BY6A 5AG2A 2DJVA 3LDEA 4RUEA 4X1IA 4JZ2A 1R3JC 1WN7A 1B06A 4X62O 2YIDA 2AGAA 3LNNA 4JI7O 1FYJA 4MVOA 4PA4A 1SERA 3WB0A 3FYIB 4PI2A 4LF5O 4B3TO 1W0KG 4RWUA 4X8AA 1K33A 3DXRA 4BW5A 2Q67A 3F5WC 2ZR2A 2EIJC 1VQ6V 2KSDA 1SKVA 5KHKA 1LUWA 3E22A 2GTAA 3CXCU 2CK3G 3APQA 1NBMG 2LFRA 3HPLC 4X64O 1HNZO 4IIJB 4CH4A 3L71H 4EB6A 4F4LA 1WP7A 1WNSA 1ZL8B 4FJCC 4RUFA 4LWSB 4UCSA 3UO3A 2F95B 1GM9A 1YJNV 4DV7B 4XDLA 1SQXH 4YIOA 4FLZA 3ZMUA 1FXKA 1QVGU 2EINB 1WLEA 4X88A 3JATB 1TGOA 1ZAUA 2Z3YA 1JPXA 4EKWA 4I0XB 1L0NH 1L0LH 3B8MA 2AHYA 4RQFA 3OMNB 2D2CB 1NTMH 1WB7A 3ZS8C 2AZ2A 2ZDIC 4FM0A 1BHBA 4J41A 1OCOC 1XEQA 1I94O 5H9CA 4R7CA 4PA3A 1VQOV 2RJZA 5LP6C 5HFLA 4P30A 4QIWF 3T2MA 4AILC 4FLTA 3H1JH 1SESA 1E79G 4WFHA 4FZ0A 1M90W 2YIBD 5B3SB 4PHZA 4FFBA 3OUFA 5KAFZ 2P4VA 4O2AB 1M93A 3N2KA 1IBLO 2Y69C 3KCYA 1BQZA 1NH2D 3OR6C 3T1HO 1N32O 1TA8A 2ZE7A 2LP7A 5IT9N 3I5DA 4UV9A 3OTOB 3HKEB 3BEHA 3JCZA 4W4LA 1NR1A 2YI8A 4IHJB 4GKKB 1FS0G 3S3WA 3LSSA 3LSUA 1B6QA 1E1RG 4LF7O 3AG1C 1BSMA 1M56C 3JSLA 4K8XA 3SPCA 3ZBHA 1Y76B 5LP6B 1B3QA 1HNZB 4N23A 2BOBC 3RVYA 4O4IA 2V4DA 4WBNB 2B9ZA 5FNVA 1R6NA 4EFEA 1Q5OA 1XQ8A 4G28B 4O4JB 3AG4C 1SRYA 4AHCA 3K5OA 1DK1A 4IIJA 1ZLZA 2JGDA 1U97A 4GT1A 3UKMA 2Y69B 4KXRA 2WLHA 3IAYA 4E2LA 1F7YA 1I94B 4PDVA 4WF9V 4GX5A 4QE7A 1VQ5V 4K0KB 3HR0A 5FNVB 3LNMB 1BCCH 1FJGB 3FB8C 1OCRC 3OE7G 4DV5B 1MABG 5J2TB 1S5LZ 2XHBA 4UB8Z 4YHHO 2VWJA 4JI2B 2PI4A 1PKXA 4FVMA 3CRAA 2KKWA 2PTMA 2Z5UA 3KG2A 1XMOB 4QJFB 1COWG 4NXMB 4IYHA 1D5NA 2F1MA 3VQXA 3ABMB 2HG5C 1ROPA 2EJ7A 1JJ2U 4GX2A 1DTOA 1GRJA 5BR8B 4WCEV 3O65A 3CCQV 4FFBB 1P4RA 3N2GB 1SF9A 2YDEA 1YVWA 3OGCC 4TUYB 1Q86W 1KU9A 3N2GA 2VQFO 3H1LH 4XDKA 2RNBA 5IYCO 2LO1A 2C2AA 2FKXA 4NR1A 2Q0OC 1R3IC 4JGSA 2EX3A 4DV5O 2JGUA 2W0FC 2IU3A 1JMKC 4DV0O 3CRRA 2EIKC 1SZXA 1O9HA 1BHAA 3ZN1A 5IJ0B 5KHHA 4Z1MG 4AI8A 2YEVB 3AG3C 1MNGA 3JAWA 4RO2A 2ZR3A 2A7WA 1QVFU 4R6ZA 3EHBB 4XBFA 2UXBO 2GUZA 2R70A 1F4NA 3BPZA 3LSQA 4WFEA 3CJHB 5JVDB 4JI2O 1KKDA 5GONB 5LHHA 2PUSA 1NQTA 4DV0B 3G67A 4YJ3B 1F4MA 3CE2A 3ZCCA 2CTRA 2E5LB 3R65A 1TVKB 1AI4A 4H44B 3LDCA 1Q3EA 5KLVH 2WLIB 4FIPC 3VBBA 5J2UB 5L3FA 3CPWU 3GVMA 5IWAB 3AG3B 2ZQMA 3JALA 1JA8A 3CD6V 3CRMA 3KCXA 3K9SA 1URFA 5J9PC 3RYFA 3GWKC 3ZMSA 3AK3A 4LH6A 2QGNA 1XREA 4QPKA 5KX5B 1M57B 4BW9A 2UUAO 5IWAO 5B3SC 5KUMA 1KECA 3QTCA 3OEHG 2CH7A 3SPGA 2XAJA 3U11A 2RN9A 2ZNJA 2ZXWB 3BAAA 3RYCB 3K0DA 1Z5WA 1EFRG 4I0XA 2JIZG 4LF8B 1NU1H 4PA7A 4X1YB 3J81N 2Q9LA 3TCUA 2XUMA 4MVQA 5JJEB 2P67A 3ETDA 2OTLV 3MDSA 1VQPV 1FXKB 5LMUO 3RN4A 1WA8B 3CMEV 2XTAA 3HKBB 3ETGA 1IXBA 2IJKA 2K9PA 2Q73A 1Z2GA 3SYQA 3ZN0A 4JYBA 4IHJA 3ZMTA 2E75B 5LA6A 3BHPA 3E89A 4MTXA 3SYCA 3OM3B 3QF7A 2HJDA 3ZRWA 4X64B 4X66B 1AJPA 4Z1VA 1HW7A 4BIOA 1SZTA 2WLMA 4P9PA 1H38A 4HNAB 1AP6A 1KBHA 2QM8A 4JI6B 2QM4A 2DYSB 3D3QA 3GB7C 4DV7O 1I5XA 1HWYA 4DO2A 3OTOO 4J7KA 2IU0A 4DR7B 4FLVA 2P22C 1BZKA 2ZT9B 1KMIZ 4K35A 2YICA 2L35A 5IY5C 2EIMB 2LW1A 3JARA 4PA6A 4YY3O 4DR3O 4JTDB 1S5JA 1QR8A 2NR5A 2HKOA 3FFQA 4DR3B 4J7ZA 4O4LA 4J11A 3DTUB 3RYHB 2A0LA 1DF5A 1Y76A 4NXNB 3CC4V 1MZEA 4HZ3A 3E83A 4DK1A 5LHIA 2WA3A 3OGIB 4NVPA 1K3EA 3JD2A 4NTYA 1FFTB 1VP7A 3A0BZ 4JAAA 1JQ0A 4CS4A 4LF6O 1OV9A 2UUBB 4L87A 5IYZA 5F2VO 1OCCC 4LFBB 4JAUA 3ZHUA 5BY1A 1XILA 4JI4B 1ENVA 2VQEO 1HP8A 4ICGA 2PZSA 4LP8A 4CBCA 2UU9B 4GX0A 4DV4B 3FAVB 2WLKA 1RSOA 1XDCA 1M57C 2PGGA 4FLWA 5LMUB 1FXHA 5BZBA 1KD1W 1GN6A 4H0LB 4JASA 3CCLV 4MSWC 2D3OW 1FFXB 2IBZH 4Z2WA 2XT9A 2DQ0A 1NT2B 5L3BA 1GN3A 1M4UA 5KMGA 2WLNA 2JS3A 2ZKOA 4UVCA 3UQ8A 1MOFA 2DOSA 1V54C 2PYLA 4KFMA 1OCZB 4DR7O 1NTZH 3TETA 2UXCO 2EBOA 1H2MA 2VRZA 1ZSPA 3A2FA 1W0JG 2JVDA 2DMXA 2FMLA 2IJHA 5GTHZ 1EZVH 2AHZA 4X62B 1NVPD 4JI0B 3J7AU 1LUVA 2ZNIA 2DYRC 3JCUZ 1GO3F 5CBGA 2F66C 4NXNO 2Q6AA 4B7KA 1XBLA 1UFIA 5K1XA 3JARB 2YC0A 1KYOF 2XNDG 5CB4B 5C8YB 3JSNA 3K58A 4JI3O 5CA1B 2ZE5A 4JTAB 2GTSA 3RBZA 4U7OA 3JAMN 4GLXA 2GUZB 1AILA 4LF9B 3DSQA 4JPRA 4GZRB 4LF7B 4X1IB 3T4DA 4UCOA 3CWBH 4KHPO 3QO5A 2ETNA 2XAGA 4JYCA 4YXWG 3AEIA 3ZHRA 1VQNV 1IZ3A 1W2BU 5CN0A 4LC1A 3M7MX 4YIPA 3CEIA 4EFBA 3T4ZA 1N0JA 1P7GA 2P90A 4DR6B 3OW2U 5EZYA 5A2QN 1Y4MA 4J7JA 3MAQA 3P30A 3BRCA 2Q5ZA 1PV0A 3ETQA 4RQEA 4CC6A 1YXBA 2OCCB 4I4TB 3RYCA 5BR8O 1D2DA 5JCOC 4I55A 1Q43A 4BAYA 2QR4A 1T5EA 3QO7A 4TOIA 1P7BA 4OPHA 1K7DA 1NVPB 3Q4HA 1K9MW 4YJ2A 2Y4UA 3THOA 1AR5A 3STLC 1K8AW 5EIBC 1RM1C 1Q8IA 4U3JA 2Y0PA 2CDYA 4X20B 2GV9A 2Q68A 5LBQA 3I55V 4B3SB 5B5EZ 4I50A 4MVZA 3WU2Z 3ABKC 4N21A 2CTWA 4TQDA 4G27B 4NXMO 3ASOB 1UJWB 4F6EA 1VQLV 2A3QA 1SC5B 1PM9A 4UCVA 1OCRB 2CE4A 1SQVH 3OFNG 4UXNA 3UCSC 2EILC 1K5QA 2MW2B 1N0NA 5EBMC 5BMVA 1AJQA 1S3JA 4LF6B 1AI7A 4F6RB 4BIZA 3F7YC 4DK0A 5JVDA 3G80A 4LNUB 1WP8A 1F51A 4LH7A 3FKSG 2P7TC 3SJQC 3WB2A 3ZHVA 1MG1A 2Q7GA 2OYQA 1HNWB 4DV4O 2QKCA 2HP8A 5CB4A 4GCZA 4PD4F 5LHGA 5IYZB 2FTKA 3CS5A 2X6CA 3ASOC 2YXLA 1XUQA 2ZM6B 4J10A 4P2ZA 5B66Z 1ORQC 5L3DA 2FL4A 1M1KW 1I08A 1V54B 3A0HZ 3B09A 3ZRSA 1B04A 1V9PA 5CA0A 4NTWA 1BT8A 2MK3A 3JASB 1L8DA 1RSOB 1GM7A 2OT5A 3U0ZA 2YIAA 2QSAA 4LFCO 3ASNC 1S76D 4MS2A 5FPOA 4MW8A 1EN6A 4X9QA 5ITZA 1SS3A 3P3NA 1XMOO 4FM2A 2N05A 4QGPA 4B08A 4MT8A 2H3OA 1CP9A 2UU9O 2GSMB 3JATA 2BTOA 3PN1A 4O4HB 4I9WA 1PNKA 3S3XA 3K5LA 4BR6A 4CH6A 4ZOLB 4LFBO 5L3GA 2QDOA 2OCHA 1MMMA 2QWRB 1X4TA 3HKEA 5EIBD 2XAQA 2QE7G 3JAWB 4H37A 4O2AA 2CUGA 2RMKB 4UB6Z 1AR4A 1E1QG 4LF8O 4D6TH 3W7XA 1P49A 1TAEA 3F5TA 4J9ZB 2N74A 2YXHA 2VQFB 3VQVA 5DECA 4AQYB 1FXVA 2KB1A 3JAKA 3CJHA 1S0VA 4UVBA 4YHHB 3RVZA 1FKAO 1Q6HA 3RYHA 3E8GA 1K4CC 4LF5B 4A5UB 2M7WA 2QKAA 4IGGA 3G71V 4TWKA 2LQTA 4JI1O 2E76B 4DR2O 1YF2A 2XAHA 4NYKA 3ZRVA 4B7EA 1IVSA 3D36C 5DN6G 4PDMA 1LNQA 4QPJA 4JAVA 1D5AA 2XAFA 2YIBA 1NS1A 1VF6C 1JOYA 2Q7HA 1OCCB 4DR2B 3ZHQA 3AG4B 4NB5A 3T1HB 4JI8O 5JH7B 4FLUA 1G6UA 3ABUA 3ABMC 3RFRA 3QG5A 4IL6Z 1H2SB 1K92A 2OWOA 1IBMO 3C3TA 1KQSU 2HEPA 2DE0X 2K1EA 1SQGA 2X7RB 5KA5A 4CH3A 5CA0B 2JS5A 1DLBA 1Y74B 1XI1A 4K0KO 3FX7A 4JI8B 1QR9A 2IW5A 5B1OA 2IJIA 4O4HA 1DGSA 3ICXA 1XNRO 2GBOA 4X1YA 3CCUV 3K79A 4KUMA 3IJ4A 3FAVA 2LGQA 1H2GA 4TUYA 3CCEV 2OIGA 3CYOA 5CBHA 2L6LA 2UUCB 4DXWA 3AG7A 4ZI7B 4DW0A 4UUJC 5D5PA 1VARA 3HKCA 2AW9A 5CBFA 3PJSK 4JV5O 5H2FZ 1XHXA 2KQXA 1K97A 1GN4A 2YS8A 5LYJB 1YTFD 4DR4B 5LMNB 3SR2C 5GONA 2PI5A 1JFFA 5E79Z 5LYJA 3DGEA 2RCVA 1CEZA 1HR0B 3E8FA 4DV3O 3L70H 3M8AA 1M5IA 2IJJA 2OTJV 2FYUH 2DN9A 3W7WA 4J9YB 3VQWA 2QEXV 4X66O 1N4CA 1PNLA 2ZIOA 5LL6Y 1IX9A 2FB5A 5LOVA 1YTFB 1WPBA 4JYYA 1SQFA 1VQKV 2JGDB 3BABA 5L3EA 5KX5A 3X2QC 5IJ9A 2OCCC 3ZX6A 2UXBB 1F23A 3CRQA 2ZDIA 3OAAG 3ABLB 3RYFB 2W6IG 5IJ9B 2P5OA 4LFAO 1S77D 3RT3C 1YHQV 1OCOB 3SJCC 1LR1A 4PDRA 5JQGA 1XHZA 4EB6B 2EILB 3AG1B 2ZINA 1TUEB 3JYCA 4PV1B 1RM1B 4FLXA 2DW4A 2HVJC 2QWOB 1WPXA 2Z0AA 1GTOA 2NN4A 5IY5B 2WA4A 5FL7G 2HR3A 5HFMA 4X89A 3FD9A 1TUBB 1ZTEA 4DR4O 4TQFA 2DYRB 2ZE6A 5DEDA 1L1FA 1H2KA 3CCJV 3RYIB 1P84F 5EYPB 4JV5B 1PNMA 2A79B 3CHXA 1QLEC 3SGIA 2M6YA 4JTCB 1IDSA 2QWNB 3B77A 3AK1A 4D7SA 4FFKA 5H6QA 2F23A 1BGYH 3K06A 1XOUA 5LXTA 1FFXA 2X0LA 2YI9A 1SETA 4WFGA 3CB2A 3C90A 4IYIA 3TJTA 4J42A 1H8HG 1N8RW 1OHHG 1I5YA 5B1AC 1YEWA 4K3AA 2XASA 2WSSG 3K5MA 3NR7A 3K03A 4ZKIA 2ZD9A 3MHHC 5IYBO 3P32A 3BVOA 5CA3A 5KAIZ 4DV2B 1JVMA 4CS3A 5B1BB 3OMAB 2QTOA 3O9OA 2HLDG 1J95A 3WB1A 1QLEB 3ABKB 3LUTB 1N33B 1Q90D 4HBNA 1CPYA 3HKDA 4YY3B 4X65B 4MTGA 1G4YB 3ABLC 4JI5B 1NKDA 4MVUA 4O4IB 3W7SA 1YI2V 1QU7A 1GK9A 1YIJV 5A9GA 2PY5A 1WAZA 3JAKB 4I5SA 2VQEB 1R3KC 3B8NA 2QWQB 3SPJA 4RAIA 1Y67A 1RFYA 3HKDB 1VIBA 1IURA 3CXHF 1XMQB 4X1KB 5IE9A 1IBKB 4H33A 1AI5A 4X1KA 3H1HH 3E86A 1VQMV 3SJBC 1K73W 3RYIA 1AR1B 1YJWV 1VQ7V 5IDJA 1K5SA 2H94A 2R72A 3NXSA 4JF3A 1Q6UA 4B3RO 3QO8A 4Q6GA 5GW7A 3G6BA 3VQYA 3E2EA 4TV9A 1OCZC 1VF7A 3IC7A 5LA6B 4D7TA 3Q4HB 3D36A 3L72H 1US6A 2V1DA 5EK0A 1V55C 3ASNB 4I4TA 4DUYO 5KMGB 1Q6IA 3MHSC 3CCRV 2A9HA 3SYPA 4I9QA 1WA8A 3H01A 2OIEA 1PP9H 4I50B 3ZEDA 4X65O 2DWEC 1XL4A 3EFFK 3P3PA 2LGWA 1KB9F 3CCVV 3RGBA 3UM7A 4EEQA 1WJZA 1M56B 4G2KA 1M9NA 2B5UA 3E8HA 1IBKO 1KP2A 5IJ0A 2EIKB 2ITDC 4DUYB 4LCUC 1HNWO 1NR7A 3TXSA 4I7ZB 2UXXA 1HNXO 4LR3A 2BCCH 4B3TB 4FK5C 4E4EA 5H5NA 5K1PA 4WBNA 4JI4O 1GKFA 5EC2C 1R6TA 5GTIZ 1FPOA 1YCIA 1NH2B 2VWKA 2BTQA 5CMUA 4R8CA 3U10A 4CC5A 2P6JA 1KC8W 4ZIBA 1TVKA 1FD9A 3L9DA 1I0HA 1JCHA 4DR5O 1ZL8A 2H8PC 2R9AA 3E35A 2WLJA 5LOVB 4IT5A 3SPIA 2UUBO 4DYLA 1OJHA 3W7TA 3UT5A 3ABTA 4MTOA 3IGAC 5LGTA 1QCEA 1MSWD 1FJGO 3BFRA 5L3CA 1HNXB 1RPRA 1JX9A 4LF4B 3I56V 2RQ6A 5JJJB 2QWPB 5D5QA 2JEUA 1XNRB 1H2LA 4YJ2B 4W4KA 3LDDA 3K9AA 4ZI7A 1IBLB 5LXTB 2F4VO 3ZMZA 3CSXA 2F43G 2Y48A 4OGQB 1WB8A 4LFAB 1K34A 4KL1A 4I55B 3BCCH 4OXSA 2LJ2A 4GKJO 4JI0O 4MVSA 4CH5A 4CZZA 4FM1A 1YSCA 3ML0A 2AXTZ 1G1XB 1GMGA 1Q82W 1RPOA 3T1CA 5FLXN 3HB3B 1NZ6A 1YJ9V 2HJFC 4PA9A 2HHHO 1VEWA 1U96A 1PD3A 3OMIB 4DV6B 4JI3B 1CXZB 3AK2A 2YUAA 4WFFA 4JI7B 2QA4V 4DV6O 1G8MA 3L73H 4PI0A 2WPDG 2JK5C 4DRXA 2VS0A 2ATKC 4UCRA 1H8EG 1AP5A 2PYJA 3K59A 4B3MO 2CGOA 4XDJA 2GDSA 2Q69A 1VF6A 2EJRA 1AB3A 3FB5C 3RWRD 3SYAA 4OX9O 2YXYA 2UUAB 4DR1O 1VQ8V 4KP4A 3JD0A 3K3WA 4O4LB 1R1BA 1AVMA 3H1KH 2JRIA 2F4VB 1QNMA 3L75H 2KG7B 4MVMA 1ZWIC 4O2BA 4KHPB 3J80N 2LFSA 5C8YA 2UXDO 2BOCC 4JI1B 3SPHA 2V7QG 1AJNA 5B1NA 3ZHSA 4GUNA 1QQCA 2ZCEA 3VOUA 3OTFA 2ZXWC 3GWOA 4TSFG 2BTQB 5BXZA 2HVKC 2G38A 2AZ0A 4TV8A 4UV8A 3KKYA 3BA9A 2JJ1G 3JD4A 2QJ1A 2E74B 1NJIW 4H13B 4GKJB 4UFZA 1SQPH 4PJ0Z 4ZHQA 2ILMA
chains in the Genus database with same CATH topology
1N33O 4JI5O 4JI0O 2UUAO 1XMQO 5IWAO 3SDLA 3T1YO 4LFAO 1IBMO 3RT3C 1IBKO 4DV2O 2UUCO 1YZBA 1G1XB 3O65A 2UU9O 1X59A 2DJVA 4JI3O 4NXMO 1IBLO 5FLXN 4DUZO 3JAMN 2VQFO 1HNWO 3T1HO 1N32O 4X62O 1HNXO 4GKKO 2HHHO 2AGAA 1AILA 4JI7O 4LFBO 1FYJA 4K0KO 2Z0AA 5H5NA 5IT9N 4JI4O 2FKXA 3J81N 4LF6O 4DV6O 1R6TA 4LF5O 4OPAA 4DV5O 4B3TO 4LF9O 1XNRO 5BY1A 4LF7O 2VQEO 4DV0O 4KHPO 4LF8O 1KUQA 4DR4O 5LMUO 4B3MO 3R66A 3F5TA 1HR0O 2LW7A 2N74A 4DV4O 1AB3A 1N34O 4DR5O 4X64O 4OX9O 2UXBO 1A32A 1HNZO 1FKAO 4DR1O 1J5EO 1DK1A 5A2QN 4JV5O 1XNQO 2UUBO 4A5UB 4B3RO 1R1BA 4JI2O 2JRIA 2ZKOA 1F7YA 4AQYO 4JI1O 4JI6O 3J80N 4DR2O 4DV1O 2DOSA 1FJGO 2UXDO 4DV3O 4DR7O 4DV7O 5LMNO 5BR8O 2UXCO 3OTOO 3M8AA 1D2DA 1NS1A 4DUYO 4OPHA 2E5LO 5BXZA 4LF4O 1N36O 4YHHO 4X66O 4DR6O 2F4VO 4JI8O 5LL6Y 4YY3O 2ZM6O 1XEQA 4DR3O 1I94O 4LFCO 3J7AU 4B3SO 4X65O 4GKJO 4NXNO 4JYAO 1XMOO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 O;  4JI5 O;  4JI0 O;  2UUA O;  1XMQ O;  5IWA O;  3SDL A;  3T1Y O;  4LFA O;  1IBM O;  3RT3 C;  1IBK O;  4DV2 O;  2UUC O;  1YZB A;  1G1X B;  3O65 A;  2UU9 O;  1X59 A;  2DJV A;  4JI3 O;  4NXM O;  1IBL O;  5FLX N;  4DUZ O;  3JAM N;  2VQF O;  1HNW O;  3T1H O;  1N32 O;  4X62 O;  1HNX O;  4GKK O;  2HHH O;  2AGA A;  1AIL A;  4JI7 O;  4LFB O;  1FYJ A;  4K0K O;  2Z0A A;  5H5N A;  5IT9 N;  4JI4 O;  2FKX A;  3J81 N;  4LF6 O;  4DV6 O;  1R6T A;  4LF5 O;  4OPA A;  4DV5 O;  4B3T O;  4LF9 O;  1XNR O;  5BY1 A;  4LF7 O;  2VQE O;  4DV0 O;  4KHP O;  4LF8 O;  1KUQ A;  4DR4 O;  5LMU O;  4B3M O;  3R66 A;  3F5T A;  1HR0 O;  2LW7 A;  2N74 A;  4DV4 O;  1AB3 A;  1N34 O;  4DR5 O;  4X64 O;  4OX9 O;  2UXB O;  1A32 A;  1HNZ O;  1FKA O;  4DR1 O;  1J5E O;  1DK1 A;  5A2Q N;  4JV5 O;  1XNQ O;  2UUB O;  4A5U B;  4B3R O;  1R1B A;  4JI2 O;  2JRI A;  2ZKO A;  1F7Y A;  4AQY O;  4JI1 O;  4JI6 O;  3J80 N;  4DR2 O;  4DV1 O;  2DOS A;  1FJG O;  2UXD O;  4DV3 O;  4DR7 O;  4DV7 O;  5LMN O;  5BR8 O;  2UXC O;  3OTO O;  3M8A A;  1D2D A;  1NS1 A;  4DUY O;  4OPH A;  2E5L O;  5BXZ A;  4LF4 O;  1N36 O;  4YHH O;  4X66 O;  4DR6 O;  2F4V O;  4JI8 O;  5LL6 Y;  4YY3 O;  2ZM6 O;  1XEQ A;  4DR3 O;  1I94 O;  4LFC O;  3J7A U;  4B3S O;  4X65 O;  4GKJ O;  4NXN O;  4JYA O;  1XMO O; 
#chains in the Genus database with same CATH topology
 3T1Y O;  5JQG B;  2QKS A;  2BSK B;  4FLY A;  3A8T A;  1N36 B;  2B1I A;  2NNU A;  1YIT V;  3L74 H;  4TV9 B;  1Q81 W;  1XL6 A;  1GAX A;  4C7U A;  3OEE G;  1RP3 B;  3CMA V;  4BWA A;  4PEL A;  4WFA V;  3CRC A;  1VQ4 V;  4X20 A;  1Y74 A;  3ZRW B;  1IXM A;  3C3S A;  1KUQ A;  4ZBM A;  4R50 A;  2RDC A;  1Q7Y W;  2ARH A;  3IC9 A;  4K8Z A;  5B1B C;  2LW7 A;  2NLJ C;  4LFC B;  2ZIM A;  5KHG A;  3ZIA G;  2P06 A;  2P4K A;  3K0G A;  1EM1 A;  4ABM A;  1MA1 A;  1O9G A;  2Y4T A;  4UCT A;  1JFF B;  4J80 A;  1VQ9 V;  1FXK C;  4AQY O;  4HNA A;  3N27 A;  1QLN A;  4JI6 O;  4DV1 O;  1BL8 A;  1V55 B;  2ADQ B;  1OZ0 A;  4TT3 G;  5EBW C;  3W7U A;  3K5N A;  4YJ3 A;  2E3C A;  1K4D C;  5LGU A;  3K08 A;  2DYS C;  2W6J G;  3CX5 F;  5C93 A;  1ZUQ A;  3EVK A;  3CC7 V;  5KHJ A;  1N36 O;  1BE3 H;  3DXR B;  4BIU A;  2Q0A A;  4HAM A;  3E8B A;  1IBM B;  4ASU G;  3ZHT A;  4LNU A;  5JCO A;  3JAS A;  2WLL B;  3A0R A;  3JAL B;  3TXQ A;  3B4S A;  3G6E V;  2Q4P A;  4HYO A;  4WFB V;  4JI5 O;  3UT5 B;  1UPG A;  4LWS A;  2UUC O;  4UVA A;  1EN4 A;  5JJN B;  1I7F A;  2YSU B;  5J2U A;  4GKK O;  2BE3 A;  1KP3 A;  3CCM V;  4GYC B;  1ZX3 A;  3QVN A;  3HKB A;  4DW1 A;  1N32 B;  4LF9 O;  1ARO P;  2HFE C;  5KHI A;  1AI6 A;  3OD4 A;  2ODM A;  5EYP A;  4Q20 A;  1R3L C;  3DC6 A;  2WWW A;  1QBZ A;  2XOK G;  5EC1 C;  3JD1 A;  1KKC A;  1W59 A;  4DV1 B;  2IM9 A;  2R9I A;  1XNQ B;  4CS2 A;  3EXA A;  3WG7 B;  2YEV A;  1A32 A;  4QNH B;  1MSD A;  2W0X A;  5ITZ B;  1GH6 A;  1J5E O;  4FZ1 A;  2CTP A;  4DR5 B;  1VMG A;  2WAM A;  1XNQ O;  1EBO A;  5DM6 V;  2A06 H;  1MZF A;  3AG2 B;  5E1A C;  2EZP A;  3B40 A;  3CP1 A;  2PF4 E;  5LGN A;  2EIN C;  1Y6X A;  1BQ0 A;  2IH1 C;  3ZJZ A;  4ZOL A;  1YDX A;  1QHT A;  3X2Q B;  2X6B A;  3M99 B;  3ZRX A;  1R6K A;  3FYE B;  5KA6 A;  4DUZ B;  1FAF A;  3CC2 V;  2CAZ C;  4LF4 O;  1GN2 A;  2WLI A;  2EZO A;  1J5E B;  5H6R A;  1BMF G;  3DC5 A;  2IH3 C;  3ETE A;  5TIS Z;  4O4J A;  1SA0 A;  3JD3 A;  2JEX A;  2F93 B;  4B3S O;  4JYA B;  2EIJ B;  3H9V A;  2O57 A;  3ZMV A;  4JYA O;  5KUK A;  3QNE A;  1XMQ O;  3SDL A;  1S5H C;  1HDJ A;  5FPR A;  2WLL A;  3AG2 C;  2Q7E A;  2EIM C;  1X59 A;  1NI8 A;  3OT7 A;  5EZY B;  4DUZ O;  5BMV B;  3TK1 A;  3G4S V;  5B1A B;  5CA1 A;  4U3F H;  4FMT A;  3D3I A;  4F6R A;  5EBL C;  5J2T A;  3WFV A;  4MW3 A;  1GM8 A;  3E22 B;  4OPA A;  2HHH B;  3OUS A;  4B3R B;  3TGU H;  2JDI G;  3RW0 A;  3K04 A;  3D8C A;  2N04 A;  2QM7 A;  3R66 A;  3K57 A;  1HR0 O;  2X6A A;  2CGN A;  4TV8 B;  3H1I H;  1N34 O;  4NKG B;  1SQB H;  2B1G A;  5JH7 A;  4MTF A;  2QTS A;  1S72 V;  3FB7 C;  3KZI Z;  3STZ C;  2ITC C;  1TUB A;  4OX9 B;  2BSK A;  4NTX A;  4UCU A;  3UO2 A;  2JJ2 G;  5JWP A;  1PL0 A;  2ZE8 A;  3HKC B;  2Y0I A;  1VF5 B;  1JJO A;  3CCS V;  1BS3 A;  4ZHQ B;  2UXC B;  1SQQ H;  4QE9 A;  2ADP A;  2CH7 B;  2DQ3 A;  1Z5V A;  5IYD O;  3F7V C;  3SJA C;  4GX1 A;  2Q8V A;  5LMN O;  1THZ A;  3FB6 C;  2UXD B;  2CTQ A;  1EZJ A;  3N2K B;  4L8J A;  4P9O A;  2R9R B;  4DV3 B;  1NTK H;  4DR1 B;  2E5L O;  2UXN A;  4DR6 O;  2DWD C;  1H2N A;  1PPJ H;  3WG7 C;  4U7N A;  3APO A;  5LP6 A;  2ZM6 O;  1DF4 A;  4LBE C;  1JR9 A;  3T1Y B;  3B2E E;  3MD0 A;  4JZG A;  2EUL A;  4U3J B;  1N34 B;  4PDL A;  1SA0 B;  2GHY A;  3BA8 A;  4FPP A;  3OR7 C;  4MVR A;  1R73 A;  1N33 O;  2KG7 A;  1EN5 A;  4O2B B;  1PL4 A;  3SYO A;  4B3M B;  4DV2 O;  1Y66 A;  3IFX A;  1YZB A;  4DRX B;  3BY6 A;  5AG2 A;  2DJV A;  3LDE A;  4RUE A;  4X1I A;  4JZ2 A;  1R3J C;  1WN7 A;  1B06 A;  4X62 O;  2YID A;  2AGA A;  3LNN A;  4JI7 O;  1FYJ A;  4MVO A;  4PA4 A;  1SER A;  3WB0 A;  3FYI B;  4PI2 A;  4LF5 O;  4B3T O;  1W0K G;  4RWU A;  4X8A A;  1K33 A;  3DXR A;  4BW5 A;  2Q67 A;  3F5W C;  2ZR2 A;  2EIJ C;  1VQ6 V;  2KSD A;  1SKV A;  5KHK A;  1LUW A;  3E22 A;  2GTA A;  3CXC U;  2CK3 G;  3APQ A;  1NBM G;  2LFR A;  3HPL C;  4X64 O;  1HNZ O;  4IIJ B;  4CH4 A;  3L71 H;  4EB6 A;  4F4L A;  1WP7 A;  1WNS A;  1ZL8 B;  4FJC C;  4RUF A;  4LWS B;  4UCS A;  3UO3 A;  2F95 B;  1GM9 A;  1YJN V;  4DV7 B;  4XDL A;  1SQX H;  4YIO A;  4FLZ A;  3ZMU A;  1FXK A;  1QVG U;  2EIN B;  1WLE A;  4X88 A;  3JAT B;  1TGO A;  1ZAU A;  2Z3Y A;  1JPX A;  4EKW A;  4I0X B;  1L0N H;  1L0L H;  3B8M A;  2AHY A;  4RQF A;  3OMN B;  2D2C B;  1NTM H;  1WB7 A;  3ZS8 C;  2AZ2 A;  2ZDI C;  4FM0 A;  1BHB A;  4J41 A;  1OCO C;  1XEQ A;  1I94 O;  5H9C A;  4R7C A;  4PA3 A;  1VQO V;  2RJZ A;  5LP6 C;  5HFL A;  4P30 A;  4QIW F;  3T2M A;  4AIL C;  4FLT A;  3H1J H;  1SES A;  1E79 G;  4WFH A;  4FZ0 A;  1M90 W;  2YIB D;  5B3S B;  4PHZ A;  4FFB A;  3OUF A;  5KAF Z;  2P4V A;  4O2A B;  1M93 A;  3N2K A;  1IBL O;  2Y69 C;  3KCY A;  1BQZ A;  1NH2 D;  3OR6 C;  3T1H O;  1N32 O;  1TA8 A;  2ZE7 A;  2LP7 A;  5IT9 N;  3I5D A;  4UV9 A;  3OTO B;  3HKE B;  3BEH A;  3JCZ A;  4W4L A;  1NR1 A;  2YI8 A;  4IHJ B;  4GKK B;  1FS0 G;  3S3W A;  3LSS A;  3LSU A;  1B6Q A;  1E1R G;  4LF7 O;  3AG1 C;  1BSM A;  1M56 C;  3JSL A;  4K8X A;  3SPC A;  3ZBH A;  1Y76 B;  5LP6 B;  1B3Q A;  1HNZ B;  4N23 A;  2BOB C;  3RVY A;  4O4I A;  2V4D A;  4WBN B;  2B9Z A;  5FNV A;  1R6N A;  4EFE A;  1Q5O A;  1XQ8 A;  4G28 B;  4O4J B;  3AG4 C;  1SRY A;  4AHC A;  3K5O A;  1DK1 A;  4IIJ A;  1ZLZ A;  2JGD A;  1U97 A;  4GT1 A;  3UKM A;  2Y69 B;  4KXR A;  2WLH A;  3IAY A;  4E2L A;  1F7Y A;  1I94 B;  4PDV A;  4WF9 V;  4GX5 A;  4QE7 A;  1VQ5 V;  4K0K B;  3HR0 A;  5FNV B;  3LNM B;  1BCC H;  1FJG B;  3FB8 C;  1OCR C;  3OE7 G;  4DV5 B;  1MAB G;  5J2T B;  1S5L Z;  2XHB A;  4UB8 Z;  4YHH O;  2VWJ A;  4JI2 B;  2PI4 A;  1PKX A;  4FVM A;  3CRA A;  2KKW A;  2PTM A;  2Z5U A;  3KG2 A;  1XMO B;  4QJF B;  1COW G;  4NXM B;  4IYH A;  1D5N A;  2F1M A;  3VQX A;  3ABM B;  2HG5 C;  1ROP A;  2EJ7 A;  1JJ2 U;  4GX2 A;  1DTO A;  1GRJ A;  5BR8 B;  4WCE V;  3O65 A;  3CCQ V;  4FFB B;  1P4R A;  3N2G B;  1SF9 A;  2YDE A;  1YVW A;  3OGC C;  4TUY B;  1Q86 W;  1KU9 A;  3N2G A;  2VQF O;  3H1L H;  4XDK A;  2RNB A;  5IYC O;  2LO1 A;  2C2A A;  2FKX A;  4NR1 A;  2Q0O C;  1R3I C;  4JGS A;  2EX3 A;  4DV5 O;  2JGU A;  2W0F C;  2IU3 A;  1JMK C;  4DV0 O;  3CRR A;  2EIK C;  1SZX A;  1O9H A;  1BHA A;  3ZN1 A;  5IJ0 B;  5KHH A;  4Z1M G;  4AI8 A;  2YEV B;  3AG3 C;  1MNG A;  3JAW A;  4RO2 A;  2ZR3 A;  2A7W A;  1QVF U;  4R6Z A;  3EHB B;  4XBF A;  2UXB O;  2GUZ A;  2R70 A;  1F4N A;  3BPZ A;  3LSQ A;  4WFE A;  3CJH B;  5JVD B;  4JI2 O;  1KKD A;  5GON B;  5LHH A;  2PUS A;  1NQT A;  4DV0 B;  3G67 A;  4YJ3 B;  1F4M A;  3CE2 A;  3ZCC A;  2CTR A;  2E5L B;  3R65 A;  1TVK B;  1AI4 A;  4H44 B;  3LDC A;  1Q3E A;  5KLV H;  2WLI B;  4FIP C;  3VBB A;  5J2U B;  5L3F A;  3CPW U;  3GVM A;  5IWA B;  3AG3 B;  2ZQM A;  3JAL A;  1JA8 A;  3CD6 V;  3CRM A;  3KCX A;  3K9S A;  1URF A;  5J9P C;  3RYF A;  3GWK C;  3ZMS A;  3AK3 A;  4LH6 A;  2QGN A;  1XRE A;  4QPK A;  5KX5 B;  1M57 B;  4BW9 A;  2UUA O;  5IWA O;  5B3S C;  5KUM A;  1KEC A;  3QTC A;  3OEH G;  2CH7 A;  3SPG A;  2XAJ A;  3U11 A;  2RN9 A;  2ZNJ A;  2ZXW B;  3BAA A;  3RYC B;  3K0D A;  1Z5W A;  1EFR G;  4I0X A;  2JIZ G;  4LF8 B;  1NU1 H;  4PA7 A;  4X1Y B;  3J81 N;  2Q9L A;  3TCU A;  2XUM A;  4MVQ A;  5JJE B;  2P67 A;  3ETD A;  2OTL V;  3MDS A;  1VQP V;  1FXK B;  5LMU O;  3RN4 A;  1WA8 B;  3CME V;  2XTA A;  3HKB B;  3ETG A;  1IXB A;  2IJK A;  2K9P A;  2Q73 A;  1Z2G A;  3SYQ A;  3ZN0 A;  4JYB A;  4IHJ A;  3ZMT A;  2E75 B;  5LA6 A;  3BHP A;  3E89 A;  4MTX A;  3SYC A;  3OM3 B;  3QF7 A;  2HJD A;  3ZRW A;  4X64 B;  4X66 B;  1AJP A;  4Z1V A;  1HW7 A;  4BIO A;  1SZT A;  2WLM A;  4P9P A;  1H38 A;  4HNA B;  1AP6 A;  1KBH A;  2QM8 A;  4JI6 B;  2QM4 A;  2DYS B;  3D3Q A;  3GB7 C;  4DV7 O;  1I5X A;  1HWY A;  4DO2 A;  3OTO O;  4J7K A;  2IU0 A;  4DR7 B;  4FLV A;  2P22 C;  1BZK A;  2ZT9 B;  1KMI Z;  4K35 A;  2YIC A;  2L35 A;  5IY5 C;  2EIM B;  2LW1 A;  3JAR A;  4PA6 A;  4YY3 O;  4DR3 O;  4JTD B;  1S5J A;  1QR8 A;  2NR5 A;  2HKO A;  3FFQ A;  4DR3 B;  4J7Z A;  4O4L A;  4J11 A;  3DTU B;  3RYH B;  2A0L A;  1DF5 A;  1Y76 A;  4NXN B;  3CC4 V;  1MZE A;  4HZ3 A;  3E83 A;  4DK1 A;  5LHI A;  2WA3 A;  3OGI B;  4NVP A;  1K3E A;  3JD2 A;  4NTY A;  1FFT B;  1VP7 A;  3A0B Z;  4JAA A;  1JQ0 A;  4CS4 A;  4LF6 O;  1OV9 A;  2UUB B;  4L87 A;  5IYZ A;  5F2V O;  1OCC C;  4LFB B;  4JAU A;  3ZHU A;  5BY1 A;  1XIL A;  4JI4 B;  1ENV A;  2VQE O;  1HP8 A;  4ICG A;  2PZS A;  4LP8 A;  4CBC A;  2UU9 B;  4GX0 A;  4DV4 B;  3FAV B;  2WLK A;  1RSO A;  1XDC A;  1M57 C;  2PGG A;  4FLW A;  5LMU B;  1FXH A;  5BZB A;  1KD1 W;  1GN6 A;  4H0L B;  4JAS A;  3CCL V;  4MSW C;  2D3O W;  1FFX B;  2IBZ H;  4Z2W A;  2XT9 A;  2DQ0 A;  1NT2 B;  5L3B A;  1GN3 A;  1M4U A;  5KMG A;  2WLN A;  2JS3 A;  2ZKO A;  4UVC A;  3UQ8 A;  1MOF A;  2DOS A;  1V54 C;  2PYL A;  4KFM A;  1OCZ B;  4DR7 O;  1NTZ H;  3TET A;  2UXC O;  2EBO A;  1H2M A;  2VRZ A;  1ZSP A;  3A2F A;  1W0J G;  2JVD A;  2DMX A;  2FML A;  2IJH A;  5GTH Z;  1EZV H;  2AHZ A;  4X62 B;  1NVP D;  4JI0 B;  3J7A U;  1LUV A;  2ZNI A;  2DYR C;  3JCU Z;  1GO3 F;  5CBG A;  2F66 C;  4NXN O;  2Q6A A;  4B7K A;  1XBL A;  1UFI A;  5K1X A;  3JAR B;  2YC0 A;  1KYO F;  2XND G;  5CB4 B;  5C8Y B;  3JSN A;  3K58 A;  4JI3 O;  5CA1 B;  2ZE5 A;  4JTA B;  2GTS A;  3RBZ A;  4U7O A;  3JAM N;  4GLX A;  2GUZ B;  1AIL A;  4LF9 B;  3DSQ A;  4JPR A;  4GZR B;  4LF7 B;  4X1I B;  3T4D A;  4UCO A;  3CWB H;  4KHP O;  3QO5 A;  2ETN A;  2XAG A;  4JYC A;  4YXW G;  3AEI A;  3ZHR A;  1VQN V;  1IZ3 A;  1W2B U;  5CN0 A;  4LC1 A;  3M7M X;  4YIP A;  3CEI A;  4EFB A;  3T4Z A;  1N0J A;  1P7G A;  2P90 A;  4DR6 B;  3OW2 U;  5EZY A;  5A2Q N;  1Y4M A;  4J7J A;  3MAQ A;  3P30 A;  3BRC A;  2Q5Z A;  1PV0 A;  3ETQ A;  4RQE A;  4CC6 A;  1YXB A;  2OCC B;  4I4T B;  3RYC A;  5BR8 O;  1D2D A;  5JCO C;  4I55 A;  1Q43 A;  4BAY A;  2QR4 A;  1T5E A;  3QO7 A;  4TOI A;  1P7B A;  4OPH A;  1K7D A;  1NVP B;  3Q4H A;  1K9M W;  4YJ2 A;  2Y4U A;  3THO A;  1AR5 A;  3STL C;  1K8A W;  5EIB C;  1RM1 C;  1Q8I A;  4U3J A;  2Y0P A;  2CDY A;  4X20 B;  2GV9 A;  2Q68 A;  5LBQ A;  3I55 V;  4B3S B;  5B5E Z;  4I50 A;  4MVZ A;  3WU2 Z;  3ABK C;  4N21 A;  2CTW A;  4TQD A;  4G27 B;  4NXM O;  3ASO B;  1UJW B;  4F6E A;  1VQL V;  2A3Q A;  1SC5 B;  1PM9 A;  4UCV A;  1OCR B;  2CE4 A;  1SQV H;  3OFN G;  4UXN A;  3UCS C;  2EIL C;  1K5Q A;  2MW2 B;  1N0N A;  5EBM C;  5BMV A;  1AJQ A;  1S3J A;  4LF6 B;  1AI7 A;  4F6R B;  4BIZ A;  3F7Y C;  4DK0 A;  5JVD A;  3G80 A;  4LNU B;  1WP8 A;  1F51 A;  4LH7 A;  3FKS G;  2P7T C;  3SJQ C;  3WB2 A;  3ZHV A;  1MG1 A;  2Q7G A;  2OYQ A;  1HNW B;  4DV4 O;  2QKC A;  2HP8 A;  5CB4 A;  4GCZ A;  4PD4 F;  5LHG A;  5IYZ B;  2FTK A;  3CS5 A;  2X6C A;  3ASO C;  2YXL A;  1XUQ A;  2ZM6 B;  4J10 A;  4P2Z A;  5B66 Z;  1ORQ C;  5L3D A;  2FL4 A;  1M1K W;  1I08 A;  1V54 B;  3A0H Z;  3B09 A;  3ZRS A;  1B04 A;  1V9P A;  5CA0 A;  4NTW A;  1BT8 A;  2MK3 A;  3JAS B;  1L8D A;  1RSO B;  1GM7 A;  2OT5 A;  3U0Z A;  2YIA A;  2QSA A;  4LFC O;  3ASN C;  1S76 D;  4MS2 A;  5FPO A;  4MW8 A;  1EN6 A;  4X9Q A;  5ITZ A;  1SS3 A;  3P3N A;  1XMO O;  4FM2 A;  2N05 A;  4QGP A;  4B08 A;  4MT8 A;  2H3O A;  1CP9 A;  2UU9 O;  2GSM B;  3JAT A;  2BTO A;  3PN1 A;  4O4H B;  4I9W A;  1PNK A;  3S3X A;  3K5L A;  4BR6 A;  4CH6 A;  4ZOL B;  4LFB O;  5L3G A;  2QDO A;  2OCH A;  1MMM A;  2QWR B;  1X4T A;  3HKE A;  5EIB D;  2XAQ A;  2QE7 G;  3JAW B;  4H37 A;  4O2A A;  2CUG A;  2RMK B;  4UB6 Z;  1AR4 A;  1E1Q G;  4LF8 O;  4D6T H;  3W7X A;  1P49 A;  1TAE A;  3F5T A;  4J9Z B;  2N74 A;  2YXH A;  2VQF B;  3VQV A;  5DEC A;  4AQY B;  1FXV A;  2KB1 A;  3JAK A;  3CJH A;  1S0V A;  4UVB A;  4YHH B;  3RVZ A;  1FKA O;  1Q6H A;  3RYH A;  3E8G A;  1K4C C;  4LF5 B;  4A5U B;  2M7W A;  2QKA A;  4IGG A;  3G71 V;  4TWK A;  2LQT A;  4JI1 O;  2E76 B;  4DR2 O;  1YF2 A;  2XAH A;  4NYK A;  3ZRV A;  4B7E A;  1IVS A;  3D36 C;  5DN6 G;  4PDM A;  1LNQ A;  4QPJ A;  4JAV A;  1D5A A;  2XAF A;  2YIB A;  1NS1 A;  1VF6 C;  1JOY A;  2Q7H A;  1OCC B;  4DR2 B;  3ZHQ A;  3AG4 B;  4NB5 A;  3T1H B;  4JI8 O;  5JH7 B;  4FLU A;  1G6U A;  3ABU A;  3ABM C;  3RFR A;  3QG5 A;  4IL6 Z;  1H2S B;  1K92 A;  2OWO A;  1IBM O;  3C3T A;  1KQS U;  2HEP A;  2DE0 X;  2K1E A;  1SQG A;  2X7R B;  5KA5 A;  4CH3 A;  5CA0 B;  2JS5 A;  1DLB A;  1Y74 B;  1XI1 A;  4K0K O;  3FX7 A;  4JI8 B;  1QR9 A;  2IW5 A;  5B1O A;  2IJI A;  4O4H A;  1DGS A;  3ICX A;  1XNR O;  2GBO A;  4X1Y A;  3CCU V;  3K79 A;  4KUM A;  3IJ4 A;  3FAV A;  2LGQ A;  1H2G A;  4TUY A;  3CCE V;  2OIG A;  3CYO A;  5CBH A;  2L6L A;  2UUC B;  4DXW A;  3AG7 A;  4ZI7 B;  4DW0 A;  4UUJ C;  5D5P A;  1VAR A;  3HKC A;  2AW9 A;  5CBF A;  3PJS K;  4JV5 O;  5H2F Z;  1XHX A;  2KQX A;  1K97 A;  1GN4 A;  2YS8 A;  5LYJ B;  1YTF D;  4DR4 B;  5LMN B;  3SR2 C;  5GON A;  2PI5 A;  1JFF A;  5E79 Z;  5LYJ A;  3DGE A;  2RCV A;  1CEZ A;  1HR0 B;  3E8F A;  4DV3 O;  3L70 H;  3M8A A;  1M5I A;  2IJJ A;  2OTJ V;  2FYU H;  2DN9 A;  3W7W A;  4J9Y B;  3VQW A;  2QEX V;  4X66 O;  1N4C A;  1PNL A;  2ZIO A;  5LL6 Y;  1IX9 A;  2FB5 A;  5LOV A;  1YTF B;  1WPB A;  4JYY A;  1SQF A;  1VQK V;  2JGD B;  3BAB A;  5L3E A;  5KX5 A;  3X2Q C;  5IJ9 A;  2OCC C;  3ZX6 A;  2UXB B;  1F23 A;  3CRQ A;  2ZDI A;  3OAA G;  3ABL B;  3RYF B;  2W6I G;  5IJ9 B;  2P5O A;  4LFA O;  1S77 D;  3RT3 C;  1YHQ V;  1OCO B;  3SJC C;  1LR1 A;  4PDR A;  5JQG A;  1XHZ A;  4EB6 B;  2EIL B;  3AG1 B;  2ZIN A;  1TUE B;  3JYC A;  4PV1 B;  1RM1 B;  4FLX A;  2DW4 A;  2HVJ C;  2QWO B;  1WPX A;  2Z0A A;  1GTO A;  2NN4 A;  5IY5 B;  2WA4 A;  5FL7 G;  2HR3 A;  5HFM A;  4X89 A;  3FD9 A;  1TUB B;  1ZTE A;  4DR4 O;  4TQF A;  2DYR B;  2ZE6 A;  5DED A;  1L1F A;  1H2K A;  3CCJ V;  3RYI B;  1P84 F;  5EYP B;  4JV5 B;  1PNM A;  2A79 B;  3CHX A;  1QLE C;  3SGI A;  2M6Y A;  4JTC B;  1IDS A;  2QWN B;  3B77 A;  3AK1 A;  4D7S A;  4FFK A;  5H6Q A;  2F23 A;  1BGY H;  3K06 A;  1XOU A;  5LXT A;  1FFX A;  2X0L A;  2YI9 A;  1SET A;  4WFG A;  3CB2 A;  3C90 A;  4IYI A;  3TJT A;  4J42 A;  1H8H G;  1N8R W;  1OHH G;  1I5Y A;  5B1A C;  1YEW A;  4K3A A;  2XAS A;  2WSS G;  3K5M A;  3NR7 A;  3K03 A;  4ZKI A;  2ZD9 A;  3MHH C;  5IYB O;  3P32 A;  3BVO A;  5CA3 A;  5KAI Z;  4DV2 B;  1JVM A;  4CS3 A;  5B1B B;  3OMA B;  2QTO A;  3O9O A;  2HLD G;  1J95 A;  3WB1 A;  1QLE B;  3ABK B;  3LUT B;  1N33 B;  1Q90 D;  4HBN A;  1CPY A;  3HKD A;  4YY3 B;  4X65 B;  4MTG A;  1G4Y B;  3ABL C;  4JI5 B;  1NKD A;  4MVU A;  4O4I B;  3W7S A;  1YI2 V;  1QU7 A;  1GK9 A;  1YIJ V;  5A9G A;  2PY5 A;  1WAZ A;  3JAK B;  4I5S A;  2VQE B;  1R3K C;  3B8N A;  2QWQ B;  3SPJ A;  4RAI A;  1Y67 A;  1RFY A;  3HKD B;  1VIB A;  1IUR A;  3CXH F;  1XMQ B;  4X1K B;  5IE9 A;  1IBK B;  4H33 A;  1AI5 A;  4X1K A;  3H1H H;  3E86 A;  1VQM V;  3SJB C;  1K73 W;  3RYI A;  1AR1 B;  1YJW V;  1VQ7 V;  5IDJ A;  1K5S A;  2H94 A;  2R72 A;  3NXS A;  4JF3 A;  1Q6U A;  4B3R O;  3QO8 A;  4Q6G A;  5GW7 A;  3G6B A;  3VQY A;  3E2E A;  4TV9 A;  1OCZ C;  1VF7 A;  3IC7 A;  5LA6 B;  4D7T A;  3Q4H B;  3D36 A;  3L72 H;  1US6 A;  2V1D A;  5EK0 A;  1V55 C;  3ASN B;  4I4T A;  4DUY O;  5KMG B;  1Q6I A;  3MHS C;  3CCR V;  2A9H A;  3SYP A;  4I9Q A;  1WA8 A;  3H01 A;  2OIE A;  1PP9 H;  4I50 B;  3ZED A;  4X65 O;  2DWE C;  1XL4 A;  3EFF K;  3P3P A;  2LGW A;  1KB9 F;  3CCV V;  3RGB A;  3UM7 A;  4EEQ A;  1WJZ A;  1M56 B;  4G2K A;  1M9N A;  2B5U A;  3E8H A;  1IBK O;  1KP2 A;  5IJ0 A;  2EIK B;  2ITD C;  4DUY B;  4LCU C;  1HNW O;  1NR7 A;  3TXS A;  4I7Z B;  2UXX A;  1HNX O;  4LR3 A;  2BCC H;  4B3T B;  4FK5 C;  4E4E A;  5H5N A;  5K1P A;  4WBN A;  4JI4 O;  1GKF A;  5EC2 C;  1R6T A;  5GTI Z;  1FPO A;  1YCI A;  1NH2 B;  2VWK A;  2BTQ A;  5CMU A;  4R8C A;  3U10 A;  4CC5 A;  2P6J A;  1KC8 W;  4ZIB A;  1TVK A;  1FD9 A;  3L9D A;  1I0H A;  1JCH A;  4DR5 O;  1ZL8 A;  2H8P C;  2R9A A;  3E35 A;  2WLJ A;  5LOV B;  4IT5 A;  3SPI A;  2UUB O;  4DYL A;  1OJH A;  3W7T A;  3UT5 A;  3ABT A;  4MTO A;  3IGA C;  5LGT A;  1QCE A;  1MSW D;  1FJG O;  3BFR A;  5L3C A;  1HNX B;  1RPR A;  1JX9 A;  4LF4 B;  3I56 V;  2RQ6 A;  5JJJ B;  2QWP B;  5D5Q A;  2JEU A;  1XNR B;  1H2L A;  4YJ2 B;  4W4K A;  3LDD A;  3K9A A;  4ZI7 A;  1IBL B;  5LXT B;  2F4V O;  3ZMZ A;  3CSX A;  2F43 G;  2Y48 A;  4OGQ B;  1WB8 A;  4LFA B;  1K34 A;  4KL1 A;  4I55 B;  3BCC H;  4OXS A;  2LJ2 A;  4GKJ O;  4JI0 O;  4MVS A;  4CH5 A;  4CZZ A;  4FM1 A;  1YSC A;  3ML0 A;  2AXT Z;  1G1X B;  1GMG A;  1Q82 W;  1RPO A;  3T1C A;  5FLX N;  3HB3 B;  1NZ6 A;  1YJ9 V;  2HJF C;  4PA9 A;  2HHH O;  1VEW A;  1U96 A;  1PD3 A;  3OMI B;  4DV6 B;  4JI3 B;  1CXZ B;  3AK2 A;  2YUA A;  4WFF A;  4JI7 B;  2QA4 V;  4DV6 O;  1G8M A;  3L73 H;  4PI0 A;  2WPD G;  2JK5 C;  4DRX A;  2VS0 A;  2ATK C;  4UCR A;  1H8E G;  1AP5 A;  2PYJ A;  3K59 A;  4B3M O;  2CGO A;  4XDJ A;  2GDS A;  2Q69 A;  1VF6 A;  2EJR A;  1AB3 A;  3FB5 C;  3RWR D;  3SYA A;  4OX9 O;  2YXY A;  2UUA B;  4DR1 O;  1VQ8 V;  4KP4 A;  3JD0 A;  3K3W A;  4O4L B;  1R1B A;  1AVM A;  3H1K H;  2JRI A;  2F4V B;  1QNM A;  3L75 H;  2KG7 B;  4MVM A;  1ZWI C;  4O2B A;  4KHP B;  3J80 N;  2LFS A;  5C8Y A;  2UXD O;  2BOC C;  4JI1 B;  3SPH A;  2V7Q G;  1AJN A;  5B1N A;  3ZHS A;  4GUN A;  1QQC A;  2ZCE A;  3VOU A;  3OTF A;  2ZXW C;  3GWO A;  4TSF G;  2BTQ B;  5BXZ A;  2HVK C;  2G38 A;  2AZ0 A;  4TV8 A;  4UV8 A;  3KKY A;  3BA9 A;  2JJ1 G;  3JD4 A;  2QJ1 A;  2E74 B;  1NJI W;  4H13 B;  4GKJ B;  4UFZ A;  1SQP H;  4PJ0 Z;  4ZHQ A;  2ILM A; 
#chains in the Genus database with same CATH homology
 1N33 O;  4JI5 O;  4JI0 O;  2UUA O;  1XMQ O;  5IWA O;  3SDL A;  3T1Y O;  4LFA O;  1IBM O;  3RT3 C;  1IBK O;  4DV2 O;  2UUC O;  1YZB A;  1G1X B;  3O65 A;  2UU9 O;  1X59 A;  2DJV A;  4JI3 O;  4NXM O;  1IBL O;  5FLX N;  4DUZ O;  3JAM N;  2VQF O;  1HNW O;  3T1H O;  1N32 O;  4X62 O;  1HNX O;  4GKK O;  2HHH O;  2AGA A;  1AIL A;  4JI7 O;  4LFB O;  1FYJ A;  4K0K O;  2Z0A A;  5H5N A;  5IT9 N;  4JI4 O;  2FKX A;  3J81 N;  4LF6 O;  4DV6 O;  1R6T A;  4LF5 O;  4OPA A;  4DV5 O;  4B3T O;  4LF9 O;  1XNR O;  5BY1 A;  4LF7 O;  2VQE O;  4DV0 O;  4KHP O;  4LF8 O;  1KUQ A;  4DR4 O;  5LMU O;  4B3M O;  3R66 A;  3F5T A;  1HR0 O;  2LW7 A;  2N74 A;  4DV4 O;  1AB3 A;  1N34 O;  4DR5 O;  4X64 O;  4OX9 O;  2UXB O;  1A32 A;  1HNZ O;  1FKA O;  4DR1 O;  1J5E O;  1DK1 A;  5A2Q N;  4JV5 O;  1XNQ O;  2UUB O;  4A5U B;  4B3R O;  1R1B A;  4JI2 O;  2JRI A;  2ZKO A;  1F7Y A;  4AQY O;  4JI1 O;  4JI6 O;  3J80 N;  4DR2 O;  4DV1 O;  2DOS A;  1FJG O;  2UXD O;  4DV3 O;  4DR7 O;  4DV7 O;  5LMN O;  5BR8 O;  2UXC O;  3OTO O;  3M8A A;  1D2D A;  1NS1 A;  4DUY O;  4OPH A;  2E5L O;  5BXZ A;  4LF4 O;  1N36 O;  4YHH O;  4X66 O;  4DR6 O;  2F4V O;  4JI8 O;  5LL6 Y;  4YY3 O;  2ZM6 O;  1XEQ A;  4DR3 O;  1I94 O;  4LFC O;  3J7A U;  4B3S O;  4X65 O;  4GKJ O;  4NXN O;  4JYA O;  1XMO O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...