2X6CA

Potassium channel from magnetospirillum magnetotacticum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
288
structure length
264
Chain Sequence
PRILNSDGSSNITRLGHYHDLLTVSWPVFITLITGLYLVTNALFALAYLAGDVIENAFFFSVQTMATIGYGKLIPTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLMMRLANLRIEAIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFLVLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain Reorientation and Rotation of an Intracellular Assembly Regulate Conduction in Kir Potassium Channels.
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Metal transport
molecule keywords ATP-SENSITIVE INWARD RECTIFIER POTASSIUM CHANNEL 10
total genus 70
structure length 264
sequence length 288
ec nomenclature
pdb deposition date 2010-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2x6cA01
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 2x6cA02
3K0DA 5CBGA 4WFHA 2X6CA 4EKWA 4PA6A 2Q6AA 4J9YB 2A0LA 4J9ZB 4P2ZA 4JTCB 2HVJC 2Q67A 3LNMB 1OCCC 1K4CC 2WLIA 3K04A 3K08A 4QE9A 5EBLC 3ATFA 3HPLC 3OR6C 3ATEA 4MVQA 1JVMA 3IFXA 1V54C 2HVKC 2KB1A 3ASNC 3E8GA 2IH3C 2A79B 2WLNA 3EFFK 3IGAC 3OUFA 3UKMA 4R50A 2R9RB 3AGWA 3AUWB 4JTAB 3VOUA 3RVZA 2WLJA 4PA9A 1M57C 4RUEA 3ZRSA 4X89A 4MVSA 2EILC 4OXSA 3T4ZA 3K06A 4MTOA 3LUTB 2ATKC 4QE7A 3SPIA 1P7BA 3E8FA 3ABMC 4GX1A 3BEHA 2ZXWC 3JYCA 4H37A 1G4YB 4PA4A 3F7VC 4TWKA 3LDEA 4G27B 4PDVA 5B3SC 1KKDA 3OGCC 2E4FA 3SJQC 3VSQA 4UUJC 3E83A 2WLIB 4MVZA 5KUKA 4MTGA 4ZBMA 4RO2A 2WLMA 3GB7C 2NLJC 4RAIA 3AG4C 3ASOC 2AHYA 2DYSC 3E89A 4PA3A 4PA7A 4R8CA 4WFGA 4P30A 3RW0A 3STLC 4GX2A 3KG2A 3SYAA 3SPGA 3SYPA 3K6NA 1ZWIC 2P7TC 3R65A 3LDDA 3OUSA 3AG2C 4HZ3A 3SPHA 4GX0A 5B1AC 2HJFC 1U4FA 2H8PC 4MVRA 1R3LC 5EK0A 4PDRA 3ATAA 3OR7C 4MSWC 2QTOA 3ATDA 2K1EA 1K4DC 2ITCC 3AG3C 2Y69C 4PDMA 4PDLA 5EC2C 3TCUA 5EC1C 3ZJZA 1OCRC 4H33A 3UM7A 4F4LA 3ABKC 4G28B 4MVOA 4P9PA 3F7YC 2EIMC 2Q69A 3PJSK 4QNHB 2DYRC 3ATBA 1LNQA 1QLEC 2W0FC 2WLHA 2YEVA 1S5HC 3T2MA 1U4EA 5BZBA 3FB6C 3SYQA 5E1AC 2X6AA 4WFEA 4X88A 2EINC 3E8BA 4R7CA 1OCZC 1R3IC 4LP8A 5B1BC 5IY5C 2HFEC 4MVUA 3T1CA 3X2QC 4HYOA 4KFMA 2ZD9A 4LBEC 3K03A 3WG7C 4XDLA 5EBMC 2AHZA 3SPJA 3SYOA 2EIJC 3AG1C 4XDKA 4MS2A 1ORQC 2WLKA 3TETA 2Q68A 2A9HA 3FB8C 2X6BA 4MW8A 1N9PA 1XL6A 4BW5A 5CBHA 3AT8A 2BOBC 2JK5C 1M56C 3FB7C 1V55C 3F5WC 4MVMA 3ABLC 4XDJA 4R6ZA 5KUMA 5J9PC 4LCUC 2GIXA 2BOCC 2ITDC 4CBCA 2DWEC 3T4DA 5CBFA 2IH1C 3STZC 1J95A 4MW3A 3SYCA 4I9WA 1OCOC 5EBWC 3AT9A 2OCCC 4JTDB 2HG5C 2DWDC 2WLLA 3SPCA 4DXWA 3E8HA 2QKSA 3E86A 3K0GA 4RUFA 1BL8A 1XL4A 1R3JC 2WLLB 3LDCA 4GX5A 1R3KC 4X8AA 3RBZA 4P9OA 4WFFA 3FB5C 2EIKC 3RVYA 4MTFA
chains in the Genus database with same CATH superfamily
2ZXGA 2ENQA 1NAKH 1KBVA 5SWQB 1S7WA 3TBTB 4JW3A 2KLRA 3LEXB 2BO0A 4NWUL 3U2IA 2WXOA 4JVPA 4X7SH 4C56D 2X4NA 3S36H 4MD0B 5ISZD 5DK0A 3JARB 4YSRA 5CJQL 1RQ5A 1DQMH 2VM9A 1GRJA 2AAAA 5EO0A 4ATTA 3HCVB 5KYWA 3MLPA 2WQXA 4XMZA 3HHMA 3KWTA 4HF5L 3FBQA 3TIEB 5IOPB 1RL1A 2YK1H 3VXSE 1SRDA 2W0XA 5T1LA 3FUMA 2H41A 1A3ZA 3SQOH 2AV7A 2JDIG 1F1DA 2CRMA 2GI7A 1ZSPA 2R1WA 1ZLWK 2M6YA 2R0LH 4PWHA 4XO3A 4GG6F 1WP6A 3C5SB 4XNQB 4BSVB 5EZOL 5BV7B 3OXRB 4QD2E 5KEZA 5INCA 1Q9LB 4JFEA 4RWYL 2VUYA 2O30A 1HL5A 2EJRA 3ZDXE 1I94B 2AEQH 4WI3A 4ZUWA 1SQVH 5ACLA 2Q5BA 3DHMA 4L3EE 2YPLB 2ZNXA 3FAWA 5CJ8A 3S48A 4RFNB 3U1PA 4MYWB 3U82B 5CBAB 2X89A 4RGMC 4WQOA 3VFVB 1EH9A 3AABA 1K3ZA 1T1XB 1A9VA 3AG4C 1S77D 1SOQA 1IGML 3S0PA 1R19A 5D1ZC 3RKPA 1V9PA 1X9LA 4N68A 3KPOB 3I9GH 1KPUA 1DBKL 1T03H 4MD5B 4LU5L 1RPQA 5B1AC 2APVA 2GT9B 4OFYA 5IW1B 1E8ZA 5CA3A 4P5KB 5A2BA 2Z92B 3B9KB 4G72B 4JI5O 4JDZB 4R7NA 3W81A 4I4TA 2XPYA 4TVUA 3GTNA 1RPOA 5FGCB 4DN4H 3EOTL 5A6LA 5B66Z 1E2WA 1NWOA 1R1BA 1OT1A 1QW9A 4KZDH 1I8KA 3I9AA 3MZTA 4LLVA 4WHTB 5IVNA 1ZLVH 1G9NH 2I60L 3NCJL 4NUMA 2NY6C 4M7LL 4XN4A 1HOEA 4ZFOL 1PKXA 1L7TL 1SHMA 2WNXA 4O2EA 1CTNA 5FO9B 2F8IA 1QUNB 3QZPA 4P57B 2Q9OA 4KH9A 1RZ8B 4X5QA 3ZKSD 3U4KA 4NPJA 5FAAA 4U6HB 1H3PH 4PJDB 5CJOH 3U9PH 3VWKB 3P0GB 3H8NA 2G0LA 3ABZA 4D0CB 5JTWA 4JPIB 3MLXH 5J9PC 1MFVA 3QVAA 2Q2LA 2VKWA 1M7DA 1IFGA 2EH8H 3BKYL 1FZMA 3DUHA 4NPKA 4Z7IA 1USZA 4X5XA 2QADD 4ZW6A 3VXME 3JD4A 2R0ZL 3LZPA 3MBXH 3N50A 3DX9B 5JHDB 5K1NA 2B0SL 2C9PA 4QXTB 5G55A 3OAYK 4GKSA 1CLCA 3APDA 2VXVH 4S0SD 1CE1H 5LGTA 3FAVB 1MNUL 3FQUB 1RZ8A 4TNWK 2XOTA 1C7TA 4KKAC 5C0RH 4BIZA 2XPGB 3BIAX 3W5MA 2JKWA 4B3TB 3LNMB 4O2AA 4MXWL 1UH2A 3IEAA 4JGUA 3DRQA 3OR6C 1FVDB 4IEFB 3Q05A 1KDJA 4HIXL 5LDUA 4FXGA 4JI1B 2PP8A 5CKGA 2VO8A 2PY5A 5IVZA 1JZ7A 1GGIL 4L8JA 3ZDXF 4RGOL 1M9SA 4Y2DB 3FRPA 2ESVA 2RDCA 3FUIA 1AZUA 3I50L 2QHLA 1M57C 1MQ8A 1HHGB 4AQEA 2FWOB 3S8GB 3QUYC 4CS3A 5JPMA 2J8HA 4I87A 5I1KL 2DQFA 5TE6H 5C0CE 5IYBO 4B3EA 1GGUA 1GN3A 5JQ6L 3BVTA 1PZDA 4AQ1A 3J81N 3HI6L 1SJHB 3PP3K 2MIZA 2X6VA 1I08A 3NN8B 4U6YA 1OWRM 3CDFA 4FG2A 1IAOA 4NP4H 3D8MA 3WNPA 2J5LB 3MJ7A 1A2YB 3HE7B 4J4PA 4PJHF 4H25A 3BUBA 3EO9H 2G5RA 4IKJA 3V6OC 3HMWH 3QNXA 5DJYA 5D5ME 4LFBO 2JXMB 1MW3A 1WT5A 3RRQA 4IIJB 1XZ0B 2P28B 4J7ZA 3CFEA 4U0QB 5CGTA 4UT6L 2OMWB 2D7PA 1ZJAA 1GSKA 3C6EA 2PR4L 3DBSA 4LPYA 5KAFZ 5IESL 1N6QL 4X9FA 2FT6A 3L3HA 2IJJA 1ZPLA 1F42A 2LLGA 1OP3K 1L9PA 1Z2GA 1KXQE 4GAGL 3QWNA 3RGHA 4U1MB 2RFXA 4NJ9H 1NR7A 3IJSA 2OK0L 1QRKA 4DCQA 4J8QA 1EJ6A 1R5WB 1SHWA 1CN4A 2O6DA 4GH7B 1AFVL 4ZZFA 3DARA 4QHMA 4NGHL 3SDDC 4J42A 2D0HA 3ZSSA 3I6KA 5L2KE 4XVUD 1YEJL 2KUTA 5ALBL 4JO2L 5CP7B 2ZCKH 3ZRWB 1H3UA 4MVUA 1QEWB 5BV7L 1QAWA 4JI5B 4M3HA 3MREB 4B3MO 4KHPB 4TULH 4K07A 4P46C 3TBWA 3CN0A 4QTFA 3UG3A 1F3DJ 4BFIB 1Y7VA 4X7SL 4JFWA 3BFWA 4XP9L 3S36L 3S6CA 1YN6A 4I55A 4JRFA 3STLB 3US9A 2A99A 2RB8A 5E8OA 1WWWX 5GRZA 4XC3L 4GBXD 4HETA 2DIBA 3NTCL 1NMCC 1IQWH 3MV9E 4MNHB 4S1QL 4Q6IC 4ZNEE 5DYFA 1JI1A 1OTSD 2UXDO 3AQYA 4JANA 4BH8A 3A6CH 2ED9A 1E9OA 3WB1A 4JFSA 4TLSA 4K7PH 4EQ2A 2IMNA 1NDTA 4M5YL 4ZTPH 1DFXA 4BK5A 3U2SB 3VE0A 5E8EA 4M9OA 3QUZC 3W7WA 2P24B 5EBLC 3VAEA 2R23B 3MXWH 3PP3H 4QAMB 4F7CB 5KSUA 5I17B 5DJ0B 5CJBA 1E65A 1KN4L 3U6RA 2JLPA 1BOGB 4K23H 3VQLA 4WI2A 2VMEA 1H8OA 1UKSA 1CGWA 4WI0B 4P5TA 1W0KG 1A4BA 1MFEL 2PWHA 4Z7VE 1IURA 1LE5B 3KDMA 3TL5A 1DL7L 1SXBA 2CO7A 3U4BH 4UQ3A 2LT9A 1JVLA 2EEFA 3EYOA 3UBXI 2VNCA 4NRXA 4LSRL 5C0BA 1MCPL 1RUPH 1PY0A 5AG9A 4Z7UA 4ZJ9A 4QOKD 3QO8A 1JMKC 3MOQA 4XOAA 5SX4H 4KUCD 4FP8H 3LZRA 4WENB 4RIRB 3NOIA 3K5OA 2M8XA 4NC1C 4NKOA 2A9NH 1DQKA 2AI0H 3G9AB 4TUOA 5AZ2H 4JN1L 1RFDH 1P5UB 5HHNB 3SQBB 4M7JL 4GS7C 5AVXB 2W88A 1S9XA 3QXDA 1UD3A 2OR9H 2M2DA 3LDDA 3V0WH 3IJYB 2ZKMX 3CHOA 4UTAH 3GUTA 1OVZA 2G30A 4MJ6B 4K35A 4FNLH 5GGSY 2G2PA 3ZY7A 2FBJL 2PN5A 4CGUB 3HTLX 4JL1A 4FI8A 2FB5A 3ARBC 3FN9A 3GM0A 4K7PX 4B9ZA 3PNWA 2YEZA 4DK5A 1PD6A 2XWBB 1NFDA 3IGAA 3BFQG 3QNEA 3AG2B 1I85A 4ZAKD 3VWKC 4DP4X 4LOUD 4WTQA 4EZJA 5IMLA 5LUMA 3L4CA 4LMQI 3PREA 4R4FL 1YG9A 3CJHB 1YEHL 3O6FA 1F4WL 3D4ZA 3RP1A 4ANWA 5CCJA 5MHSE 3LTVA 1NFIB 2ILLA 5AAMC 4O02L 1DGSA 5B1JA 3WGUB 3JTSA 4NQDE 3SDCC 1KXQA 1ZGLA 3BKYH 1CGTA 3CRQA 1UQSA 2C4FU 1Q9LA 1JHKL 3T1CA 4ONHB 1DEDA 3SYOA 1XF5B 2HFTA 2IQAB 1GJIA 3TETA 4O4IB 1QVOA 2CA4A 2PCYA 4QCIB 5DA0B 4EDWH 4U1MA 4WDIA 1AC0A 1XL6A 2E75C 2WW8A 5KN5B 3TK1A 2HLEB 3MAWA 3OHMB 4N8CL 2DH2A 2VZUA 4NYLA 1I94O 1GGYA 3H6JA 4IRJB 2CSPA 4JM2D 4LASL 3BMVA 1WFTA 2WYTA 3V4VB 3ES6A 1SM3L 2PI4A 4UCSA 2A83B 2DTML 4PJEB 4HXBH 3B9KC 1AGCB 1TKWA 2LOEA 2BSRB 3BUIA 3EXJA 1A3QA 3QUZD 1NWPA 4D8PB 4P2OD 3JATB 5B3SB 2DQTL 2VDQH 4BW9A 3VDCA 1Q5OA 1YJDL 3BD5A 1TSRA 1M3JA 2FSEB 3HKZA 2H1PH 4NZFA 4MJJA 4UVCA 1Z0NA 3C60A 1D7FA 3KCPB 4FNQA 4GCZA 1EDHA 2ZR3A 4JJOA 4PBDA 4Q4IA 4CGTA 1E27B 3VXRB 5J13B 1VLXA 2VERA 4N3UA 5F7LB 3VNYA 1NCDL 3SODB 2A0LA 1SFHA 3TEUA 2PXYC 1T5XB 2FZ3A 1FV1B 4M1CD 1VQ5V 4FTVE 1TZ8A 3TO4B 4G6AC 3VB9A 2FJGB 4EAEA 2GCYA 1HOCA 4KQ3H 4P2RA 2G9KA 1BZ9A 3FT2A 4IRJA 1YUHA 4ZMNA 3HI5L 3MV9A 1UXMA 2CH7B 1KP3A 2V17H 4PY8J 5HHOD 3RWFA 4MNHA 3HMWL 4UNUA 3GIVB 3RY6C 1KJ2L 3KS0J 1YEDA 4NO5A 4Y4HD 4UTAA 4LIQE 2CKBB 1U8CA 1NC4D 3ZOAA 2I9LA 2PKDA 5J06A 3EYQD 2XWRA 3HZKA 4GAGH 5J1AB 2LAGB 2Q8BL 3F58H 3UYRH 3MX0A 4FQ1H 4GUOA 1I1YB 3K72B 2ZP0T 4L8SA 2J1ZA 4AYFB 2CUMA 5DEZA 2DQEL 4WU5B 4YDVB 3TESA 1J0KA 3VD2A 2DYSC 1NM9A 1Q90A 4X5XB 4F7TA 2E7CA 3RI5K 2PF6A 5C0CA 4ODUB 4EVNB 4GO8A 4F8LA 5TISZ 4N22A 3SDLA 3CCRV 3ZJAA 2RJZA 4F2FA 2DQIL 1D9KC 2JCWA 3BAXA 4DOHE 4EQ3A 3NSFA 1EFXA 1XGUA 1E7VA 2YD8A 3T6WA 4DH2A 5DJDB 2IXQB 5B1CA 1ZWIA 2Z31C 3RWDA 1J88A 5BRZB 3BY6A 5JW3H 4BGDA 4XP9H 1ZVNA 5E8DL 4W93A 3TNNB 4R4BA 4RIRA 2GJ6D 3DVGA 1M1SA 4JI4O 2O26U 2WINA 4X4ZA 5DEFB 2BY0A 1IM9B 4WLCA 2JKXA 5AW0B 2Q86B 1X9QA 5F1NA 5I6XB 3QIUC 4LCIH 2YIBD 3BP6B 4PIRF 4S1QH 2PYFA 4PJAB 2PW2B 3ILQC 3MV8A 5HJBA 3CRMA 3O8XD 4LEXH 5BZWB 2NX5E 3NIDB 2P8PB 5CHNB 5T3ZH 2PTTB 3VFPA 2NDFA 4L37A 3FN3A 3CU1A 1O9HA 4PJ8C 1PG7W 2A5UA 4GSUA 1L9TA 1JPXA 4BZ1L 1DHKA 2WPDG 3WENA 1Q6IA 5E4EB 2XG4A 4MMZB 4XRCA 1KB5H 1IGIH 1IX9A 4ZHQB 3A0OA 3BKJL 3UZVA 1RZIA 1HILB 1O7DC 1YPZA 1OANA 2C3VB 3EJRA 1CQYA 4OQTA 5AG8A 4GFXA 1C5DA 4X8AA 3P30L 3T4AA 4OIFA 5CMUA 3Q1SL 4IL6Z 3FB5C 1BBDL 2YKLH 1EMTH 3CXDH 5IFJA 3MOAL 3TJEH 3DO4A 3QAZC 5DZLA 3WDHA 2AXFB 3P32A 2ZINA 4RZCB 3QYMA 2FTKA 3T1YO 1I31A 3OM3B 1OGAD 4PB9L 4XPHH 2KDGA 2Q6WB 5JHLA 1KCBA 4Q9RH 2QSCH 1Q0XH 1DBJL 3DX4A 3P2TA 4D7SA 4IM8A 3RNQB 3KG5A 3E8GA 2IH3C 2XQBH 4JHWH 3GSUB 1KB9K 4K94H 1FNFA 2WKGA 1JPFB 1KB5B 5AZ2L 3RIFK 3NZSA 1YCSA 1THAA 2C1OB 4UANA 1SVBA 4Z7UF 1QTPA 1W8NA 2CKBA 2WP3O 4BIKA 3MRJB 1JNHA 2WANA 2JI2A 2JJ2G 4MTOA 3MRQA 1AH1A 4Y1AA 3C6LA 5DUBB 4ZMQA 3D18A 4DO5A 4GXVH 1VDGA 4U2ZA 4JHAL 1NIEA 3TFKC 2L7EA 3QQ4B 3QZBA 4ALAC 3VXSD 5I1DA 3OV6A 1TVKA 3DGEA 3WFHB 1L6PA 2R0KH 1X5ZA 4ZBMA 3FU7B 3ARXA 4ZX5A 1XZWA 4OZFA 1JOYA 5TE7H 3O4LE 3WNNA 2XIBA 5T1KD 5CIPA 1NANI 1RJYA 2AW2A 1FSKB 2DKSA 4MWFB 2H0EA 1U8NB 2EEDA 2WSDA 4OB5L 5SWSB 2Z0UA 1VADB 3N3EA 5FHBL 3QDMA 4HULB 1KEMH 1EX0A 4U1NB 4WJ5A 2IF7A 4Z95L 1INQB 1AQMA 1MA1A 4JFPB 3S96B 3CHPA 4JVUA 2X2HA 3ARQA 1T2XA 5LGHH 3TF4A 5DRNA 4HEPG 4PJ9B 3V5HB 2HRHA 5IJ9B 2HT3D 3N9GH 3ABKC 2L0DA 3GXIA 1MPAL 2IDUA 2PETA 4GFTB 5D1ZB 3VRLF 5I8KH 3DXRA 1XNRB 4OFVA 3CHQA 1S9WA 3DSNB 2B1AH 4JB9H 5DEDA 1YLBB 3FT1A 4NRZB 3FFQA 3CSPA 1K9MW 2UY7A 3JYBA 3UPCA 3HC3H 4HWBH 5FO8B 1ZT1B 2JH2A 3H0TA 4OQTH 5A16A 3F7LA 1GC1H 1UCBH 2NUPA 4M7LT 4RQQA 4X6BB 1QSEA 4Y9GA 5ENWB 2XOKG 1I8LC 3UGEA 3VFMA 1WZMA 1UZGA 1BCIA 1TTBA 1X9UA 35C8L 4KOBA 1FGNL 1PJWA 4XB7A 3UTQA 2K45A 2V7QG 1EAJA 3QUKA 5D5MA 1TUPA 3N1FC 3SY0B 2FSDA 2C7UB 4APXB 4LNRB 5ADPH 5ELIA 2GJZA 4JRYB 3UL4A 1OIOA 1DUYA 4N20A 5F96L 5A2AA 4K5MA 2R2EB 4XE5B 1N5YH 3VACA 5FYKL 3CMOL 2V17L 4HSCX 4YSUA 3VXNB 4M48L 1Q82W 1CIDA 1H8LA 1HYSC 2Y7OA 2GITA 2D3VA 5C0JA 2YMXL 3C6LC 2FJFA 1XAUA 3BAIA 4OGAC 1D5ZA 4OZHE 3D52A 4L8SC 5KVFL 4DK0A 3OR6A 4IMKC 4N0UB 2Z34A 2BM3A 5EPMB 1ZS8B 4UINL 4HIEA 3TN0B 5JLZA 1DJZA 4DPCX 1I8AA 3RVTC 2IXQA 4NC2B 3RWCB 4IKNA 5A3ID 1AP5A 2XTSA 4H40A 3R8BB 1HCZA 3HW7A 2LQTA 3OB0K 4LDLB 2AEOA 3KM2A 1MLCA 2YBRB 3IWUA 1YY8B 2VL5B 3HG1E 1X3DA 4FLOA 2WYZA 4NRYA 4QRSB 1JZ8A 4G8EB 2XV3A 2PTMA 5DJCB 5D1QD 4OT1L 1QYGL 1IKFL 2QV4A 1WAAA 3NFNA 1A4CA 4RDQF 2DW4A 3T1YB 1JWMA 4DEWA 3RYFB 3Q7JA 3GWJA 1G7LB 3LZLA 1FJGB 2UWEA 4TQ8A 4FLUA 2ZUUA 3LNDA 4ZXBD 5H5NA 4X1YB 4HWNA 1HNXB 1FG2A 2NT1A 4N2BA 4W9LC 3LZFH 1N19A 3NIFE 3VSQA 2BLFA 4YHOH 3T2LA 4ZUVB 1YNTA 4NO0A 4QRBA 3FB7A 3QNZB 3F85A 5E1AB 2C9XA 3MJ6A 5IREA 3GSOA 4YDLB 4HLJA 2YXMA 4NRYB 2X53A 5FB8A 3FB5B 4HWBA 3OUSA 3QO1A 3TGUH 1IFHH 3VFSB 3M17B 4JYAB 5C08D 4DV6O 3B2VH 4LEXL 1GOFA 4P2OB 3ARRA 4L3FA 5DVMA 2VN6A 1MXGA 1K2DA 4UQAA 3V4PA 1I3RA 1N33O 4O2CB 3ZDZF 4X9BA 5D1QA 3P3RA 4PG2A 5GGRA 1KZYA 4F4LA 4P9ML 4WUUE 1HAWA 3T4YB 5DU7A 2J1WA 2VITA 1MXDA 5G4OA 1VEOA 4AG4H 1IT9H 3WIHH 4U1JA 2IVFC 4UM8A 4PGZA 1L8DA 1SFDA 3BO8A 1MJJA 1KGCD 3WB0A 3KNBA 2WWWA 3FFOA 3WUWA 4UOZA 4MJIB 1BBDH 4I9WD 3TJEL 4DQAA 1M4UA 1BFVH 2HT4C 3ORJA 4FMKA 4D9RD 1XF4A 2P4VA 1R3HB 1UD5A 5EIQA 4PB9H 3CD4A 4LPTA 4ZUTA 3VMNA 1EAOA 4OI7A 2HEPA 3T3MB 1EQWA 2M1KA 3Q2WA 4YAQA 1Q0XL 1HCVA 2D7OA 4HAKA 4OLYL 1JDAA 3ZT6A 1JZ4A 1IBYA 2DWEC 4RDBA 3U9UA 1K5NA 4NN5C 5C0BD 1NKDA 4GMTL 1TTAA 3NJXA 1DVFA 4N0CC 3K59A 4K0KB 2NZ9D 2FJFB 4K94L 2QGNA 1RUMH 4IQHA 4Q89A 5KG9B 4MAUL 1P9MA 3RBZA 3I85A 2XTJE 4AGLA 5HDLA 2NMSA 2DQDL 1YUKB 2OYKA 4JM0A 2A6KB 4D9QD 4HKXB 2IBZH 4YEFA 1FVEA 2JFCA 5D5MB 4QF1A 1DSFH 1HQRA 4DK1A 4DUZO 3TASA 1IM9A 4Z7NE 3BDBA 1T2QH 1UWXH 2MOGA 2W0PA 2BXYA 1OP4A 1X44A 4N8UA 1QWHA 4TTDC 1PD0A 1OM3L 3PGDA 5JIPA 1SYVA 3EH3B 2XKNB 3ULSB 5I1JL 2CIKB 2WNGA 3QZOA 4LSTH 4XB3A 2AAVA 2B59B 4WGKA 1G9NC 2BSDA 5B39A 2OSLA 4HQQL 2ZIDA 4Y4FD 4OH2A 4OB5H 5BQDA 1ZJBA 1VAHA 5IMOA 3CDZA 3OGIB 5ICXA 3EYFA 4X6CF 1WWCA 1H0DA 1AXSA 4WFGE 4HJIA 4KJYB 3VFOB 3II2A 2GBAA 4YHHO 3VG0L 3W39A 4ENEC 5AOLA 1QNIA 5IQLA 4IEFA 5SX4I 1KTLA 4G9FA 5KVDL 2VLME 4B3RO 5FF6A 1MFDL 2Y2TA 5DMIL 1IAIM 4Z7WF 1VJSA 3RYCA 4U3FH 4JB9L 4UQBA 4IMLB 4Z78A 4XWGH 2HJKB 4MCYB 4PGJA 3DPDA 1KWGA 4D9RE 2AK4E 2AMGA 1PL0A 3FF7A 4M8QB 1YVLA 2VUOA 4KK5D 3UOAB 3ZMUA 1E9PB 2IJHA 3OR7C 4JI0B 4Y5YB 2ZKHH 1UTDA 5L6YH 35C8H 2V5SA 2GBOA 2KKWA 2WVUA 4TVPH 1E4XI 3VFWB 1F4YH 2GUOA 4XMLL 1UH4A 2H0FA 5ADPL 3LKRB 1Q9WB 1LNQA 1KCSH 4JI1O 1N5YL 3CMOH 1X4XA 1T2JA 4PJXF 5AEAA 2QPDB 1T83A 3V95A 1MHPL 2CO6B 1E90A 4HVBA 2LW3A 3H42L 2V6HA 5KS9B 4WWID 2YA1A 2DH3A 5EYPA 1A6ZA 4DO6A 5DMYA 1ERNA 2BP3A 1O7DE 1TQBC 3OL2A 4ANXA 3E9TA 3AT8A 1AYRA 3MRIB 4GRLD 4I2XA 3F5WC 3LSUA 3A21A 2CRIA 5JXAH 2GUOB 2MKWA 2F4VB 3O3BB 4KI5D 1CCZA 1IQDA 2GI0A 3BVDB 4NKMA 4LF6O 4TLUA 4XN1A 1H2KA 2VLKA 4OCYL 3ZE0E 4FQHB 1NFDF 1G6RH 1QR4A 2BNQE 4G6FB 1RHHB 1ASOA 4FA8A 1NZ6A 1T7ZA 1CK0L 1FORH 2P5WA 4WI4A 3GMRA 5IT9N 2BY2A 5HHPA 3OKKA 5BCAA 3BSHA 3U48A 4GQRA 2FO1A 3FBKA 4MMXB 2OL3L 3D0LA 1U3YA 5FO7B 4HPOH 4JFQB 3P2DA 3POCA 2CAZC 2BFGA 3D36A 4YY3O 3LRKA 5IM7B 5D5QA 2AEPL 1N64H 3GXMA 4TUYA 2JMRA 3BZ4B 3ZK0A 4TNFA 2MRYA 4LWSB 3FUEA 4U1HB 3OLEA 2R9RB 1LYQA 4OCRH 4I3SL 1JFHA 1DUZB 4XE0A 3ZUNC 2A6KA 1HHJA 3WI9A 4DZ8B 4UOW0 1WBXA 5CEZD 1MF2L 3HG4A 2FEEI 3SY6A 1NBZB 4OZGB 4U0RB 1ZLUH 4KKLC 1WK0A 4FQCH 3LKSB 2NXZB 4LNVA 4GI9A 3TNNA 4DERA 4FA7B 2VABB 4H88L 5FHAH 5IT2H 1Z5WA 1AXIB 2WWNA 1LDPH 5LHHA 1MELA 3WAJA 1ZSDB 4AITA 5B1BB 1BG1A 4OJYA 2GYSA 3B6SA 1JR9A 4X9QA 3VH8B 4RA0C 3ILEA 1U21A 5CBAA 3I3DA 4FXKC 4WHDA 1VKXB 4GS7B 1ZLSH 1BM3H 4HBCH 5CCHE 5IMMB 1ZRUA 4NXSA 4APQC 3TCXA 2PUSA 4C4KO 2RCSH 2IJ0C 2X9XA 3EW3B 1MFBL 4MVRA 3EFDH 1JDCA 1JK8A 1XR8A 1URZA 3TT3H 5DDHB 4R26L 2P5PA 1ZANH 3F12B 4NUPA 4Q0XL 4Y2OA 3VJ6B 1IILE 3LHPL 5BZDA 3JVFC 1SQBH 3VI4E 4XMPH 4DWHA 1F4AA 4YL4A 1PZ5B 1LR1A 1F6AB 1KCVL 3DO3A 3H7LA 4P2RE 4PB0H 2YPLD 5BRPA 4OLYH 1X6NA 3TNMA 5I15H 1I7TB 2BVEA 3O2DH 1QLNA 3JALA 5E9DE 3W2DL 4N90E 4PU2A 1FXKC 1WO2A 2PLTA 4Y5VA 1RUML 1XTMA 5FDWB 4WY7H 2OYQA 1NH6A 1XSJA 1K33A 1C12A 2ZD9A 1QVOB 1XSKA 2QL1A 5DRXB 1KLGA 3EZJB 1B4JH 2WWMD 3TBYA 2EIJC 4M43L 2Z7WA 3DV4A 3T5WA 4PGEA 3KLAA 2QVFB 1MRCL 3MRIA 5D8JH 3E3QE 3GSRB 1I5YA 2LU5A 5A2IH 4GXUM 5DDHA 1MCDA 3KHOA 1V8HA 2NY5L 4AQ8A 4OAWB 5EO1B 5IBLC 1FVDA 3CJHA 4OD1L 3UBHA 4MX7B 1MJ8L 2BOBA 3LDBB 4MW3A 3NSXA 4JFXB 5KW9H 3KVQA 1U41A 2CDEA 4LSTL 2DWDC 3QWQB 1NBCA 1A4KA 3H9SB 1MWOA 3LZNA 2AJUH 4FFYA 4A6YH 5D2NE 4YBHA 3J2PA 1E6OL 3U25A 1X5GA 4Q7DA 2QADC 3DC6A 1NTZH 3MJ8B 4I77L 3MQIA 3HLKA 4AHCA 3QFJD 1L9RA 1HESA 1UUNA 3U7AA 5B1KA 3QXWA 1MJ7H 3NSDA 4AGOA 4HS6B 3C2AH 1ETA1 1YMMB 5HYSA 5ESVA 1GSMA 5KVDH 3W7SA 5IHZB 1KY6A 1DQML 1Q38A 4HUCA 4Y16D 1IBZA 2FHBA 2JI1A 1CR9H 3LEVH 5GISH 4BSWA 4F6RA 1EO7A 3DXAA 4JUSA 1QPXA 1KNOA 3CN2A 3IBOA 4L4JA 5DHXB 4Y1SA 5E00B 1U8MA 4RRPM 4UM9B 4ZFFB 3HUJF 1MIML 4TSBH 3V0DA 4MRCA 4LBAA 5I8OH 3LNEA 2E7MA 1J0IA 2X4TA 2CTPA 5J6SA 5KSAB 3D08A 2VC2H 2ZKHL 1NPUA 3D4YA 4W9FC 5IVXB 4TNWF 1BHBA 3VD5A 1QFWI 1XCQB 2OMZB 1X4ZA 1P84F 2M7WA 3LS4H 3O11A 4QRAA 4HH9A 5EOTA 4N2AA 3DRTA 1XUQA 3REVB 2CCLA 5JH7B 3PUCA 5C86A 3VDAA 2F2HA 1G7MB 2HJFB 2VDNB 4OLZH 2XN1A 3PQYB 1EXUA 3NZHH 1HCYA 1BOYA 1RU9L 3RKDD 4A2LA 4OIBA 3MMEB 3K4AA 4PJEF 4PP2A 1K92A 4WVRA 1QBZA 4DZ8A 3G5WA 1XIWB 1FIGH 2WAHA 4FHKA 1ID2A 5BRZA 3NJGA 2W1NA 3I9GL 2OW7A 4XAKE 5HDBB 4UV8A 4GAAA 1I1AC 3WN5B 2Q0ZX 4YX2L 4PWKA 4NN5B 2VXSL 3CE2A 3SGKC 2F19L 4ECNA 4PJXA 1AD0B 3WFZA 3CNKA 2GJZB 5IQOA 2XKSA 2CALA 4GRWB 4J3WA 4E0RA 3JASA 2YPLA 3ATBA 4UZGA 2WZ0A 1GAFL 1IEBA 3LRSA 1S5HC 1VQPV 3EOTH 3VSVA 2APFA 4QRUA 2XZCH 4YHYC 4RX4D 1YC8A 1DLHB 4QO1B 1TQTA 1HSBA 4PJ5D 3ULUF 1JE6A 1F58H 5DTFA 4EE2A 3N1QC 3KGSA 3I02B 4KVNL 4MS2A 3MFFA 4NHCL 3SJCC 1BZ7B 1R6NA 3AY2A 5D4JA 1M42A 4PRHB 3WHE0 1CE6A 1ZD6A 4AIOA 4JO1H 1TTFA 2FUTA 3B9KA 1S7SB 1FFOA 4P23C 5T3XE 1XF4B 2RJMA 4M4RB 2OA9A 4PLNC 1O5DT 4XPGL 3T04D 4PJBF 1A4KB 3H9SA 1H6FA 1K4DB 2ITCB 2RGSA 3OKNA 4QDGA 4AKOA 4B3RB 4C57C 1GZPB 2R2HA 4NM8L 1BWMA 1FGVH 2AITA 3IETB 4I3SH 4TUUA 5D4QA 2CHWA 2A06H 3MLVH 3QQXA 4YBLB 2VZTA 5SWQA 2D7NA 2DM2A 1ONQB 2C9AA 3EGSA 2R0ZH 4GIPD 3GSRA 2BVTA 3UC0H 1OTTD 1L0PA 1PCSA 3RWRD 5FK9A 4FQCL 3T2NH 7CGTA 2VXVL 1ES0A 1S9YB 3BKCH 4MAYB 4OZFG 2X0UA 1MAJA 1UA7A 1A22B 2Y5TA 3QEUB 2LFEA 4G43B 4PJ5A 3RIFF 2C7UA 1FZKB 1SYSA 3P4OB 5M94B 3H4HA 1K4DA 2ITCA 1CLOH 3ARDB 2VSKB 3IKKA 3QUMH 4JFFA 4Z7WB 4BA8A 1F0LA 1BE3H 1GGIH 3AT0A 3QDGE 3WUZA 3WU1A 3BT2H 3D48R 4L5FL 4NHUA 4OY9A 5FA4A 4AVJA 5GS0L 4FFYL 3ZEDA 2DWXA 4WDIB 4AH2A 5HD8C 4Z2WA 1DE4A 4NT6B 1SJEA 5FECB 5DK0B 2CJUH 2YPKB 4R26H 2YUVA 1ZANL 3IJSB 5I1KH 3BQUA 4M5ZH 4WI5A 4X6CB 2X3AA 5JQ6H 2A7BA 5ITZB 2NW2B 1HKLL 1KCVH 4NNYB 4LGRB 1FJ1A 3NRQA 1NDGA 4WKZB 4FXGB 4UT6A 4PA7A 3GTTA 4NP4L 3O6FB 3DK0A 5DT1L 5AB0A 4LF4O 2X0LA 3QJFB 4JQXA 1B4RA 4G8EA 5DJCA 2Z31A 1F3JA 2BSTB 4DUYB 1T6VN 4X2UA 2CQVA 2IGFH 4JFPA 3KWVA 2XN9D 2GY5A 3KVDD 3C6LB 4FXLA 3TCTA 1B4JL 2F7PA 1R3KA 1R3LC 4IRZH 4Z5RB 4J2XA 2QTOA 3UEZA 4AXWA 1FP5A 3SDAB 4HKJA 1G8MA 5CGYD 3KWUA 3W0WD 1SS3A 1EAPB 2EDLA 2JCCE 2NY5H 4OZHF 3PAYA 5I6XC 4DQOH 3MKGA 2C5DC 4ZYKA 5LCVL 2V4LA 4NKMB 1I75A 2OP4H 3Q6GH 5D7EA 3HBZA 1RERA 5KW9L 1ZA6A 2X6AA 2FL5B 1IBGH 1JERA 2DJ4A 3NR7A 2IPKA 4P46A 3TOPA 3LNHA 2WTRB 1E6OH 2HT2C 3BVVA 3WHXA 4MS8C 3OJ2C 3WG7C 1ZTMA 5HVFB 1KV3A 2ZCKL 1ETB1 3UAJC 4QHLB 4U6HA 4E9XA 4HIJB 1A3LL 3WIIL 3K9SA 1WPXA 1GYAA 2OKMA 4HIHA 3V4PB 3DBXB 1OM9A 1SESA 4NB5A 3FONA 3LVEA 4U3SB 4AM0Q 3O6LL 1ZLVK 2H2SD 3ZTJH 5JA8B 5KHJA 3JTTA 1S4IA 3A0HZ 3FUKA 4G1EB 4EJ1C 4B9JA 1PPIA 2ICWJ 1NCBL 2X87A 2ZUSA 4WHYH 2BCCH 3IKCA 1EXUB 2PTUA 2V7HB 4XC3H 4PJGA 1UOLA 2P43B 3EJUA 1YNLH 4PJ7B 1YEDB 3EYOB 1HXYB 1MIMH 1ZAGA 2I5YH 4NO5B 5T33H 5C0IA 3C90A 1QASA 4LLMA 4F33A 3QFJE 1Q8MA 2LFRA 2FX9H 4A7VA 3RYHA 5D7LA 2VDMB 2I7OA 4GQZA 1W59A 3C08L 3VNZA 4K7PL 4JZJA 4YFEA 4E9VA 2ZYRA 4CSSA 1SXSA 4I0XA 4B3SB 1NBMG 4DR3B 4F7MA 5A1AA 3U0PA 3NCFB 5C71A 1NR1A 3M7MX 2X9ZA 4HPYH 2Z8SA 2UZIH 2ZX9A 3NZHL 1P4IH 2DMHA 5E6UB 4MAYC 4WGVB 3FC8A 1EXHA 1JVOA 4HJ0C 5B7FA 3ABTA 4ONGH 3IE9A 2XFXA 1OLLA 3HG2A 5ERWA 5GW7A 5KOVC 4JMXA 1P4RA 2YRBA 3HB3C 4G8GD 4PJ7A 3W0WE 2DI8A 3MR9A 5DFVC 3X3FL 4BZYA 4RH4A 1VQNV 4YX2H 1EVUA 4JI4B 1J87A 1PLCA 1S7QB 1UWFA 2VXSH 5FA3B 3V9EA 4R7DB 2CK3G 3UMNA 1MCPH 5GRWA 4DFIA 6PAZA 1NEZB 4RFOL 5IQ9B 2WLMA 4LFHD 1HH9A 2EYSA 3APMA 1DQDH 4ZG1A 1IKOP 2YN3A 1HIML 2NNCA 1JQ0A 2XZCL 3WFDH 3WKPA 2A9NL 3OR7A 4P04A 3L2LA 4JN1H 3N40F 3SR2C 4IJTA 4NQSA 4BFKA 4AH2B 3LXAA 1JZ6A 1F58L 2Z8RA 1ETJA 4QHPA 4DKDC 1TZHB 5EU5A 3KYKL 3HHRB 3O6ML 4FFWC 1MN4A 3W0WB 1H0DB 2OR8A 4XP1L 4UCRA 3QWOA 4JFYA 4JO1L 4KRPD 4OFIA 4RAUA 3SDCB 3VFOA 4ODVH 4GT1A 5L9DH 1MCNA 1RZKL 4I0KA 1JHTA 3FT9A 4NOBA 1CXIA 4FYRA 2Y1VA 2OCFD 3HN5A 3I2CL 3G6DL 3RWCA 4K8RL 1JGDA 4OVVA 3UYPA 4PI2A 3DMMA 4I0PB 4MJ5A 3GXFA 1QQDB 5I6MA 2BERA 4Z7OF 4HCRL 2SEBA 4BHUA 3SDXF 3TFBA 2IALA 1GYWA 4N0RA 1RZIB 4K3EH 1FGVL 3AMLA 1F4WH 4LF8B 1OK0A 2VLMD 5DSCB 5C92A 4AIEA 1NJ9A 3O9OA 3KCPA 3SOBL 1UWGL 5IEHA 3GUTB 3G3LA 2OWOA 3LZQA 3GMQA 3JWNH 4QTHA 3RA7L 2HFFB 4TSCH 1D6VL 2Y5QA 2Z35B 4G3YL 3IJEA 4JAMB 3FFCB 3J7AU 3EBGA 5CD3A 3ZCCA 4ABMA 3FXIC 1JI2A 1T0NA 2DWYA 2VE6A 5FCUL 5I0WA 2HJFA 1LWJA 4EMZA 5IUSA 1WLHA 5KUMA 1A4JB 1B0RB 1S72V 1WUZA 2YR3A 4N8CH 1AR1B 5SWSA 3W9EB 2YD5A 3REWA 3ZKXC 1DSWA 2F93B 1CLOL 2Y22A 3W57A 3TS8A 2J73A 4HXBL 1CGXA 4K0OA 1OHQA 1ZHBB 4Y19D 1I4FA 5E8PA 4J3OH 5GS0H 1AJQA 2PTVA 4RMSA 4QRPE 2VXUH 3QH3B 2CJUL 3AXIA 4QXVA 1RPUA 5K59F 4HD5A 5K9OB 1EWHA 1IEBB 1PY9A 3LRSB 4LFAO 1ZT4A 1LJMA 2ICWI 2WTOA 4NYLB 4F7KA 5FFOA 1UXSB 1UPGA 3PWNB 4OD3L 4IDLA 4KQ3L 3CPWU 3QR2A 2WA3A 5KVGE 3D2UB 4ODUA 1ZAUA 1C5BH 2GBTA 4JAAA 1NKRA 4MWFA 2AJVH 2NY3B 3BKMH 2P06A 2P4KA 3QPQC 4YE0A 3QTCA 1HSAB 4M6OL 1NUNB 4DP6X 5IQ7L 1NL0L 4M61A 5E2TH 3WO4B 4IRSA 1J10A 4FYTA 4TRPH 3PWPA 5J11B 2BJMH 3OQRA 3NCMA 4I0XB 2VQ1A 1JYWA 1MI5A 3CSFA 4OUOA 5T3ZD 5EOTB 3UYRL 4OZIA 3C09B 3OMZA 4FJ6A 3S4SA 5DECA 2AP2A 3ETQA 3ZE1F 3ICXA 3Q6GL 3PFUA 4GP8B 4JLRA 3RDTA 5BMFL 2PW2A 3IFOA 2VR7A 5C0DB 1IBGL 3L3KB 3QP3A 5J0BA 4IRSD 1QSFB 1NCCL 5BXZA 1BQHG 2B9BA 3QCVH 4JFZH 4M8QA 5TF1H 3VXUB 5GS0C 3MOBH 2Y6TE 2OMNA 3PWLA 4KXZH 2WUCH 1Y1UA 1QUNA 2P52A 2YO3A 4P57A 5AVYB 2VDML 4M61B 1KCUL 1GYUA 5E79Z 1K4DC 2ITCC 3TCUA 1B6QA 1FDLH 1KOAA 1M05B 2XV0A 3HG1A 2R29L 4FERA 1HEJC 4ALAL 2IDQA 1IAIH 4WU7B 12E8L 4PRBA 1S7UA 4GG6A 4PRIE 5DZOA 4MDRA 4IJ3C 3NFPB 5MEQA 1KTBA 2PWDA 4RMTA 5IOKA 1IGFL 2WD0A 3MBWB 2C9UA 4UQ9A 2NY6D 4QXGL 5IW3A 5EIIB 4XCNB 2VTFA 1XMWA 1HI6A 3F7PC 3LKNB 4UTCA 1R3IC 4WSGA 4P8QA 1EZLA 3KYOA 2GK0A 5GRVL 4LBEC 3IDUA 4WO4D 4A2HA 3GPEA 4GP5B 5I1LB 2ROYA 1ODAA 5IMOB 4NQCE 5E5MB 4KKQA 4UV7L 2APSA 3WO4C 2X6BA 2LVCA 3KCYA 1S46A 2AS5M 3TO4C 2P5ED 1ZWIB 2FX9L 3RWDB 3IJ9A 4C56E 5F1IB 1UD6A 4O4YH 4WF9V 2YRZA 3WYRA 2YI8A 1MDTA 1XH0A 1URLA 3FO2A 3HRZA 4A63A 1MY5A 3RL2B 4O9HL 3PJSA 5DHDA 3GBNL 3QJHB 5FKPA 1BHGA 3BMWA 5GZOA 5EA0L 2UZIL 2WB1A 2Y24A 2IPTL 4GSDL 4CS2A 2UY6A 4D7BA 1ZGLB 3HG1D 2MK3A 1IGIL 4LE8A 4F58L 1NICA 1U3HC 3VXNA 4NR1A 4PJBB 4CN6A 4TOYH 4ONGL 1PEZA 5FO2A 3N2GB 1O7SA 5G4NA 5JPMB 3OPZH 3TPKA 3CYOA 2IGLA 1ZV2A 3S37X 3QJRB 2BSSB 4PJXE 4ZFZB 1O6VA 2ALAA 2YIAA 4M3KB 3E2HB 4YBQD 2A3QA 1M57B 4LWSA 4B3TO 4XPHL 3HPLC 5AYUH 4GUNA 1SXAA 1PYWB 3C5ZC 3QNYB 2X09A 3GSWA 4H8UA 3RPBA 3JXAA 5HYSG 3R0MA 1YYLH 5H2BB 3VG9C 5EC2A 2Y72A 1HHIB 2J4WL 1ZHNA 2WLJA 2R27A 5I66A 2XQBL 3A24A 3OD4A 3CP1A 2K6ZA 4M62L 5IROA 1BVLB 2ZWSA 4PJFA 1EAQA 1T20B 2ZUWA 4HZ1A 4Z7WA 1MH5A 2XY1A 4MQXD 3ARGB 1K5SA 4DO4A 4LARH 1M1XA 2XWTB 2YD2A 1PEWA 3KPSA 1Q7YW 1I1YA 2DIEA 2ZT9C 4PV8A 1J9CT 4KH2A 3E83A 5L3DA 5IY5B 5FV2A 2F8XC 3IC9A 4DCQB 1IC1A 2Y5EA 5DWUL 4EUPH 3CUPB 2A74A 4AGNA 3II3A 1IGTA 2ZYHA 4I0PC 3RW0A 4QIRA 2HKAA 4HCRH 1TO4A 3C6SB 3ML8A 4KRNA 3MRNB 3ULVF 1J0ZA 3MNWB 1Z66A 1MOEA 2LU4A 2Q76B 4Z9KB 2MHAA 1JG9A 4WI7A 1T7XA 1YEFH 3QO1B 5FHBH 2EUXA 5FLUA 2OCCB 1UENA 4WNSA 2P24A 4OLVL 2R2CA 3D50A 1QRNE 4GYCB 4AUYA 2K1EA 1I7FA 4LNUA 4G3YH 4P2OA 4ADGA 5J57B 1KIPB 1BQZA 3HKBB 1CYXA 1J9QA 3MO1B 1IC7H 2QM8A 2DBJA 2X1WL 3X14B 5DZNA 1T3FA 2A0LD 5IJCC 1EM1A 4DV5B 5E6ID 4JYBA 4K0KO 1XGRA 4ZODA 1H2NA 4TUYB 1SY6A 2JCCA 5EU7E 1F97A 3B40A 1F41A 2DEXX 2E86A 2R83A 5BNXD 5AAWC 4LHUD 1YPZE 1UM6H 3VD4A 2Z64C 1L7IH 5KHKA 3INOA 2WGNB 2P9RA 1JA8A 1KF9B 3FFDA 2AF2A 4YHKH 2CIIB 4Q4EA 4MDJB 2MPAL 4HHAB 4ES8A 4QT5B 5GGRY 1WBZA 4Y0GA 4FF9A 4Q2ZB 2WIMA 2DICA 4DR2O 4JREB 3US1A 1CVSC 1PX3A 3VGAB 4Y9EA 3G6EV 4KVPA 1XR9B 3O81A 3OKLB 1PW3A 5KVEH 4QRSA 4LESA 2UVFA 3PHOB 2NZ9C 1C5DB 4RBPK 4DV2O 1ICTA 2RD0A 2V4DA 2L8AA 4Q6IB 1FN4A 3K8LA 1PDKB 4APQB 5FYKH 1DDHB 1JAEA 4AVHA 5T5FH 1RK1A 5T1LD 4GT7A 1Z0MA 2EDBA 2G60L 1LEIA 4AI8A 2YMXH 4DR5O 5BUGA 4P2AA 2EADA 4XBMA 2C2AA 4UCVA 4QHKJ 5IOPA 3CDGB 5IF0B 5DEGA 4R6UA 1SDDA 1OJHA 3PQYE 4WU7A 4IBLT 4DN3L 3O0RL 1J8HB 4NSKA 3MFGB 5IFAL 1NGQL 1PD3A 5BMFH 3RVZA 1Y18A 1E4HA 1NCJA 5LWYL 3QIBC 3ULAB 1CVRA 4X7TA 4XO9A 1D5IL 4IKLA 3MBEA 4QTHB 3GS7A 3QCVL 4JFZL 5TF1L 1AS7A 4JI0O 1AZBA 3DHUA 3CX5K 3MV7D 5E94A 1KDIA 5J1SC 5T1KA 3SB3A 1KBPA 1RMFL 2VSMB 5KBKA 4G5AA 1AO7A 1DLBA 1Q9KB 2FJHA 2I7SA 2QVKA 3L3OC 3EYVA 3LD8C 3O11B 4LCVA 1OGPA 1FNEB 5TF0A 1NQTA 3REVA 1DANU 2Q87A 2EEXA 4FULA 1OK8A 1HNXO 2QZ5A 3QULA 3EJCA 1W2KT 4WFFD 1N8OE 4LBEA 1TPXC 2FDBP 5I30H 3RLSA 3ZGIA 4KXDA 2CTRA 4U31A 4YHOL 3ULVE 2FBOJ 4EI0A 4BFJA 3MNWA 1IGFH 1SHXA 3WIFA 4ZMVA 1VQLV 5FW8A 4ZQKA 3O8XB 4FQ2H 5EBGA 1MCOL 5JHMA 2KERA 4KHPO 2VLRB 2R69H 4DNLA 5KBDA 1DE4B 1L6XA 1JHLH 4OCSH 4ODSL 2E74C 2OMUA 5J12C 4MLSA 3FO0L 2LGWA 5ACMA 3D3QA 1GKEA 4KO6A 1PG7X 4N2EA 3HE6C 2UVEA 5L8JB 1TDQA 2YPVL 4KPHH 3VXOB 2Y0SA 1CJYA 5HP5A 4ETYA 4KKZA 1F8TL 4X88A 1IT9L 3TA3C 1LP9B 3WIHL 4LSVL 1DSYA 4TOYL 1GN6A 3A4DA 4G8FB 2VLKE 4KI5F 4ZFOB 1RZ7H 2G9HA 3CCHA 4NQXA 2R1WB 3BIKB 3EJYD 1XBLA 3OE7G 1FFOB 1KCRL 1RXLA 4GQQA 1CLZL 1FIEA 4W1TA 2EKSB 3VFNB 1ZTXL 4LF8O 3RWHA 1BFVL 1VQ7V 3N27A 3BWAA 4JYCA 1BV8A 4ZO9A 1BXUA 1H2LA 4JM2F 4MASA 5AYUL 3AMKA 3HS0B 2BNQB 4OM0L 4H44B 3RZCB 4HP5A 3V6ZA 3C12A 4ZMAT 3MRRB 2A83A 4YFDB 3PDGA 3VI4B 4GMTH 4NO2A 1A6TB 1XVSA 2WQRA 3CQFA 4PJCA 5EDXA 4IHBA 4UB6Z 4E41D 3IU4H 2MQ0A 2EE3A 2QPUA 1O75A 2BNRE 3ZL4L 1ACYH 3AG4B 1NFDE 1KIUA 2A1WH 4LLWA 4JG9A 1UZ8B 2VLLA 1OKEA 4OF5A 3O9WC 2RCVA 2KQNA 1H6UA 4KUMA 1DZ0A 3Q6FA 2NW3A 4R5XA 2WCPA 1T2QL 2Y7NA 3UBXB 3VQXA 4JFDB 4XI5D 3U6XS 1JGVH 4G7YH 1YEWA 1JD7A 5C0FB 4NAMA 2WKOA 2P8PA 3GNMH 3GI8L 3MNVB 3LB6C 2VDPB 2QPFA 2Z3FA 4L4VB 1OPGH 1Z5VA 3S35L 2MMXA 4X4XB 5JVDA 3UBXG 3KXFA 5CGMA 2EH7L 5DLML 1IAOB 2QKIB 5EUOE 5HDQH 2DJUA 1KFAL 4MTMA 3B9AA 2Q7YA 4NUGL 2JJSC 4Z3GA 3BDXA 5FKPB 1IC4L 1CPYA 5L8KB 2MQGA 2WSPA 2WINB 4WWNA 3SY0A 3UTZB 1ZT7B 4HLZG 3A0BZ 4RSVA 3RGVB 3C8HA 4N87A 4XNBA 5JPNB 1BIIB 1BQ5A 4KK5C 4XOCA 2GY7B 4IBTA 3LEYH 1NIAA 4HS8L 4GAJL 4K9EL 4X5WB 5DMIH 3K4ZA 3S2AA 3AB0B 1OAZL 4N1CA 5E2JA 5C0EB 3ULVC 2XFXB 3C5ZA 4OBRA 4ZT1A 4BDVB 3D25A 5IHLB 4QJFB 3D39D 1ML0A 3H6AA 3Q8AA 1RULL 5EC2C 1X5XA 1O7VA 3HJEA 5D7LE 3ZJZA 2N7BA 3ZW3A 2AK4A 1G1KA 1YEEL 3CVBA 1F51A 4WW1B 2VQFO 4ZAKB 4XCCL 3EF4A 4BWTA 1SF3A 1GCFA 3WFEH 2H4EA 1CFNA 2W0FC 3EDKA 1T83C 5EBLA 1F4YL 2J2ZB 3ULUL 4GG6E 4IHJB 1TTUA 2AMUA 4DV7B 4PUBH 1CDYA 2HRLA 2P5WB 1T6WA 4M56A 1AIFB 1JXGA 4FZ8L 5BO0D 5LA6A 3NGBC 4GW4B 4KMQA 2XCMC 3O45A 5AD0B 5IB2A 4NQCB 1PU0A 1OL0A 3PWUB 4NHUB 4UZSA 5ESAB 3RWHB 4N0FA 3EJPA 2KG7B 3BYTA 3SDAA 5L3EA 4HJJH 3FHQA 2XX1A 1NANH 1QLEB 5K9OA 1GH7A 1FG9C 1YJDC 4LKCA 4TF4A 2X0WA 3O6FC 2OXGA 1ZDSA 2AQQA 2FECI 5CCGE 4HBQA 3L4VA 4KNUA 4QHMB 4QRQA 4CBCA 4WUKL 4WWKB 4AKPA 3RWFB 5I19L 4FFZH 3P9WB 4H0HB 4QRPB 5I1CH 5H2BA 5CN2A 4JRLA 1RPKA 4YHNA 5HHOE 2HLDG 1MCWW 1KFGA 4P2OC 5D2LA 5GGUB 4RA3A 4H13C 1FKAO 2C4XA 3D4CA 3RIAF 1TQSA 3LPWA 3VTAA 5BR8O 1SOSA 1BQUA 3EVKA 1R33A 1FORL 3SDXA 3WY4A 1AHWB 2YD9A 4LGPB 3FQXB 1DQJA 2BIPA 4NTWA 3BDYL 1M71A 2XZQH 5HHQA 3TP4A 4RWHA 2J72A 1P53A 3IGAC 3X17A 1M4KA 3VXRE 4HUVB 1KBKA 2PYED 2ATPA 5LBSA 4U7NA 4R3SB 1VKXA 4DF9A 5HHXL 1QCEA 2R1XB 2R15A 1RJZB 2HKFL 2QEJA 3VYOA 5DC2A 3MHHC 4YDNA 5IB3A 2EILB 4FQ2L 3V52L 2DWEA 2QA4V 1KENL 5H35B 5I74B 3ZIYA 2HMID 1P7BA 2GTZA 2YOCA 3FCTA 4HUUA 4NM4L 3WXWL 1U8OA 2GQHA 2VRAA 1O6SB 1LUVA 1JHLL 3BX7C 3L5WA 2YWZA 2FQDA 4OCSL 1PSKH 4ODSH 4PY8I 2WWKT 2W0KA 3A5VA 1OB1A 1JXKA 1R3HA 4PW3A 4TVSa 1JZEA 2X7LA 2ZSWB 2OI9C 2YD3A 3JASB 1OGSA 2E9IA 1MAML 2DOSA 3AREA 2O72A 1FWXA 1L6ZA 1FFNB 2IBZY 1UFIA 1NINA 5I6PA 4G5ZL 3V6ZB 5ISZA 4BUHA 5JHBA 2N56A 3CCJV 1AR5A 3L08A 3DOIA 1W91A 3FAVA 2IM9A 2CCVA 1I7ZB 1WITA 2Y0PA 1VADA 1LMIA 3DV6A 3L3IB 1JCKA 2E74B 2H8PC 4PJ5E 3RG1C 3SKJH 5AG2A 1PX8A 5J7CC 4PDRA 4FFVD 4FQLL 4LIQL 1YJNV 4OSUL 4OVUA 5DEJA 7FABH 3DO7A 3HKEA 4O51A 4PJ9D 4PP1D 4ABQA 1HXMB 1MFBH 1SZNA 3EFDL 2AC0A 4MJ5B 3VQMA 3RI5F 2CA3A 3ABGA 4XMPL 2FWSA 3WIHA 4HFUL 1UD2A 4BK4A 1HE7A 1T21B 3THOA 4X80L 3S4SB 5JW4M 3L5XL 5CFAA 3KBHE 5L2JB 2XAHA 4XPBH 4XZUA 5L4MA 4HK3J 4NUJA 3GM8A 5ITBL 4HNAA 3GTVA 1R9FA 2BWDA 2PXYD 4LHUG 5A2FA 3BA8A 3MYJB 2UZXB 4M1GL 4YO0A 5MERA 4I18B 4UQ3B 3QVNA 43C9A 2A1WL 4U3JA 5KVEE 2CR0A 2DS4A 4J2QA 2J43A 1XF3A 2ZCHH 3FO9A 2BOBC 2XPGA 3GLDA 5DMKA 3CLEH 5JW5B 5MEOA 1MREH 3KR3L 2HFGL 2Y36L 3QIWC 1MCHA 3GB7B 1YMMD 4FXTA 3CDGA 4G42A 5FUZH 5HHMD 3HLAB 2WMPB 5LMUB 2EIKB 5HJGA 2YUWA 4PGDA 5IP4A 4G80A 5BW7A 1R17A 3L74H 3AQXA 3FQTB 2QWQB 2NY1D 5DD3H 3M17A 4TSAH 1SXNA 3NCYP 5GTHZ 5C08E 1I7RB 4B9KC 1S7RB 2I9TB 3GI8H 3RVWC 5KVMC 4DGUA 3LKQA 3HPLA 4A6YL 4QJ3B 1B04A 2DLFH 3FOLA 3V5DA 1MSPA 2YARA 3H9SD 4FZ0A 4JI8B 1OT4A 4ELMF 2EH7H 4XBFA 5DI8B 5DLMH 2AJXH 5HDQL 1KIRB 2WLYA 1FAIH 2YQ3A 3K08A 4WJG3 3TN0A 2EO9A 4DR6B 4J6RH 2YC1B 3B5HA 5KHHA 3RWEB 1IC4H 1X5HA 3L6FA 4UCTA 4WW1A 3FTGA 1GN2A 5I1EH 1I0HA 3LY6A 1O9VA 4GMSL 2Z91A 3NZ8B 3Q3GB 2WXFA 2J6WA 1GW0A 1XIWA 3C60B 5J6GB 4J3BA 4GW5A 3P54A 4OF3A 2GJ6E 5IG7B 2OTUA 2B1HL 1NAMB 4I48B 1UM5L 4KKBC 1CGSL 1FO0B 3EGDA 3RX8A 3UZEC 1RULH 2CUHA 2XZZA 1XH1A 3GMQB 4TSBL 5KAQF 5I8OL 5IWLC 4HKJB 5HVWA 2YMTA 4B97A 1XGRB 1VQOV 5JMRA 4KXRA 3K6SA 4MNGE 2Q4PA 4WW2C 1MW0A 1GHFH 4ZS7L 1TJHL 1KBGL 1VESA 1BSIA 3CZFB 5HHVH 3OC8A 3SKOA 3DUSB 4I7ZC 1NGYB 4PUBL 3WKML 4L0PB 4NWTL 1AGBA 5LBSL 1KKCA 2BTQB 1ZSHA 3R4DA 1EFXB 4X5RA 2ZG3A 3QAQA 2LAAA 1J0HA 1U8CB 3ET9F 3ARTA 4Z7VA 1OPOA 3U1QA 3T4AC 1AB3A 1WA8A 2A73B 4F15B 5KSVA 2KBGA 1QFWH 3OKEA 1VF5B 4HJJL 4ICWA 1FL5A 1OB1B 1GR7A 3SPVB 3KHQA 4LNRA 4O2BA 2AFNA 5C0GB 2NW3B 3W11C 3EH4B 2X2JA 3HE6B 3FMGL 2FIRT 1OF2A 1OAUL 1WG3A 2CTWA 3SYQA 1ZOXA 3M7FB 5IB5B 3D9AH 3AWGA 5GRUL 1VGEL 1NAKL 1AYOA 3OF6D 4L4TB 5F0PB 5C0JB 5GIRA 2YLHA 1CEZA 2LGQA 3KKYA 4LF5O 4LF3A 4I8DA 5DJ2A 3O9WD 4C47A 4R96B 2MNUA 5DR5L 5JJJB 1PNMA 5E7BA 5F1IA 4ZFOA 5LVEA 4KHXH 3FZUC 5DD1H 1JPGA 1KSRA 4N90D 5EF3A 2PYLA 4LFCB 1IAMA 2DJSA 4HUNB 1Q3EA 2XRAH 3K74B 4HF5H 4KVNH 4NHCH 5EFIB 4ANUA 5KYYA 1RZFH 2IBGA 4NKOB 4XVJL 4CU7A 3K58A 1Z6JT 4UQDA 1OTSC 1TPXB 5DD0H 1RK0A 3IMWA 3FRPB 5JOFB 4LR3A 5D6DC 4Z23A 2KI6A 1EZVY 2R0LL 3U9UB 4JGNA 4DTGL 3AEIA 4NQEE 5EZOH 1QU7A 2UY7B 4KROC 3QQDA 3L81A 4YVNA 1KLGB 2PWFA 2ZXBA 4YSQA 4PGBB 1KENH 3LNFA 3MV8E 4OZHB 2EZPA 3T08A 4YNYA 5E6RB 3MLVL 3SGEI 3K46A 3IC7A 5INDB 1E1RG 2YXHA 2YD0A 3EDJA 4LPXA 5JNYA 4R7DA 2OTLV 1WP8A 3VXRD 4H5SA 2EX3A 2ZM6B 4IBVA 1V54C 3VVVA 4JV5B 1DQQB 1B06A 2G5BB 4D6TH 1GOGA 8PAZA 4UQ2A 2YAHA 1RUAL 3HKDA 3FFCE 4UBDD 5IHWA 2BS9A 1O9GA 3FS9A 3QUZB 1U8JA 2OQJA 4Z7NB 4HG4K 1P4UA 3DTUB 3SKUD 5TH2B 4B0MM 3GXPA 1N8ZA 4IRJD 3G7TA 3KL5A 4NDMB 1R46A 2VLJE 4J12A 3MCLL 5CEXB 7FABL 3WFHA 4XN7A 4PDVA 3F83A 4R9HA 4TLTA 2WZPD 4KZDL 5LL6Y 1PBYA 4L37B 3GGWB 1BQHB 2NY4B 2Y25A 3B4NA 3PAVA 5ECGA 2VDLL 4FYQA 2GUZB 4OV5A 3LKRA 5KS9F 4M7LH 3BE1H 3D4GA 2VW4A 3NEEA 3EH5B 4X9YA 2YUAA 2XASA 3F5WB 1K9TA 2DLGA 4P30A 4GNKB 2BVPB 5I1HH 3MRJA 2QWOB 3QJHA 1CDUA 1H5BB 4G80B 4G1MB 1XILA 4JRXD 2PPFA 2ZX6A 2PO6B 2X41A 3L8QA 4AILC 2EYRA 3PUUA 4FRWA 5EIIG 1HINH 4F2MB 1CGUA 2C9QA 3RWIA 3MLZL 3L73H 1Y6MR 4HX1B 4K3HA 5JOPE 5JW4N 1HYSD 3CCSV 1XCQA 2K6YA 4JPQA 2KLTA 4LLYB 5J3HD 2Q7AA 2NTSP 3MRDA 4YSPA 1AQ8A 2DE0X 2HFGH 4TV9B 4LLUA 3FN0H 2EH8L 3ZTJG 5EEUA 1NGWB 1CU4L 2GIYA 2XVBA 3ARFB 1UATA 3MBXL 3C09C 2AJZA 1P2CA 4R5VA 3CZEA 4AQAA 1XCWA 2P48B 5LCVH 3FZUD 2OP4L 4HWEL 4Y5YC 4IYIA 4BSWB 5C0RL 2VCOA 2FWUA 2AGJH 3H1HH 4RAVB 5HHPB 3ASNB 4ZOLB 1MCBA 4R0LB 3S97C 1CO1A 2BNRB 5KX5B 4K4KA 2XAQA 1JUFB 1XGQA 4F9PA 2NY0B 3MX0B 4LFAB 3RWIB 1L0XA 2X4QA 5GZOC 4N4YB 1N5AB 2D8KA 1X5MA 2Y23A 4UYPA 5KSUB 1AHWC 3BVNB 3AC0A 2Y3AA 3HE7C 4GLRI 2RH0A 2EDKA 3CHRA 3TBSB 1TTCA 3IFOB 1LQBC 5C0DA 4HCIA 3BGMA 2NY7H 3MC0A 3P2BA 4H1LA 4R7VA 2ATPB 1RV6X 4FG4A 4AYSA 1EN4A 3MXVH 4FFTA 4ZS6C 4OGXL 2X12A 3NIFB 4OUUB 3DOHA 2N7AA 5DFAA 1CDHA 3B7UX 3EJZC 4LDCA 3ARGC 1F4NA 1ZHBA 3SD5A 1QI5A 5I1GL 1OGTA 1VA9A 4CH4A 4JO4H 1E5YA 1CGSH 4LSQL 3U1SH 2I5YL 5T33L 4M02A 3K1DA 4X8XA 3EO9L 1XH3A 4W4OA 3VG9B 1RP9A 1K3IA 2JTDA 5PAZA 1VQ8V 3C08H 3IFNL 2ZJSL 3L1OH 4QGYA 5AOKA 1TNMA 4KK8C 2BX5A 1LO4H 4O02A 1KBGH 3WNIA 4IU2A 3DYOA 1EIBA 4LSSL 3BXNA 2BWIA 3O3AA 4TM9A 4R3SA 2H32A 4XP5L 3V6OA 2DLIA 2WXKA 4J41A 2E0PA 3BAEL 2X28A 3FU0A 3IDNA 3OKDB 4LCWA 4JANB 4NJ9L 3B7SA 3H3KA 4E41E 3FO9B 4ZPTA 4NIYE 2QLYA 3I02A 5CS7A 5B1OA 4WWKD 1BECA 3AVEA 1AFVH 2NTFB 5HVHB 4HAMA 2HLAB 1AS6A 4XB8A 1P49A 4AQ8C 2UUBB 4XHJD 2ZE7A 3IGFA 1NA8A 4Z7VF 4ODHH 5ALBH 1MHCB 4D0CA 4PJFE 4PA3A 1LE9A 3MUHL 3RDTC 3NPSB 2GDSA 1YC7A 2WSSG 1DQDL 3QDJE 3F6LA 4TULL 1WAEA 4JQVC 3CZUB 3MDSA 4DR7B 1MI5D 1YEKH 3MGAA 1RIVL 3GKZA 4OGQC 4IOIA 1MABG 3H9YA 1IJ9A 2WO4A 3PABA 1CXHA 1J1PH 4LGSB 5DD1L 5EORH 3EJQA 1K7DA 3RUGA 3S9DB 3B7TA 5CB4A 3HVDA 1QFUH 3Q06A 3RDTD 1T7WA 3KYKH 3O6MH 4WFEE 5CJ5A 5F6IB 5LHIA 2YLKA 4RMVA 3TONA 4YXHH 1S8DA 3FB7B 1SDYA 3MV7E 4XVJH 1FL6B 2VMJA 3IS1X 5DJXA 2BNUB 7TAAA 3BCDA 3K5LA 3DRQB 5L9DL 2AV1A 2CPCA 3US0A 4YHNB 3E22B 4CC4A 5D7SH 2WAMA 2H9GA 3A6CL 3AAZB 3KEHA 3LXCA 2R9IA 3G08A 4NQDB 3VD1A 1CXLA 5FYJL 4I9WE 4LQ1A 4M5YH 4C4KT 1JUFA 1XGQB 4J8RB 4JZOA 4WNQB 1QSED 4XVSH 1NEUA 2GK0B 4PJAF 3U4EB 1XB3A 3KXFE 5D1QB 2JVDA 4X0KA 3VXQA 1M7IA 2OLDA 3SDDB 3HB3B 3ERXA 3AS2A 5JZ7C 1SF5A 2HVJB 4ZMWA 1KN4H 5T5NG 4P99A 1I7UB 2VDLB 3KBPA 4GINA 4K23L 3S3CB 2XWBA 2EDHA 4PS7A 1M7XA 3HRZC 4F5CE 3QJZA 5FGBA 3TZVA 3TWCL 1XXFC 2F7OA 5F1OB 4NZRH 3QWRD 1OCOC 1T0MA 1UURA 2FL5A 1AR2A 3PV7A 1T22A 4JKWA 2XXGA 1E9QA 2O57A 2BHUA 3GSOB 2VLJD 5HDRA 3RIKA 5J11C 2NR6C 5C0IB 2CJTA 1N0XL 3P4MB 1NBZA 3TBBA 4QWWD 1ZXKA 4UWQB 1RP3B 3CFMA 4DV4B 2CRZA 3LH9A 4BZ2L 3ZHQA 2YFOA 3WJMA 4Z5RA 2WLIA 1LO0H 1ET8A 4TQPA 1I8KB 2VDLH 4R8WL 4N6RA 5AVUB 1O9ZA 3IPEA 4M7JH 1U42A 3MRRA 1S7XB 4Y8AA 3C3SA 3F5TA 3WS6A 2OR9L 1IV8A 3V0WL 5C0FA 2YAEA 3TA3B 3CV5A 4FNLL 2VN7A 3NK4A 3NH7H 3MUJA 1IEAA 2WQSA 3MRNA 5TK4A 5H6QA 3SJAC 1VRSA 3LPGA 4OZGE 3K57A 3IDMB 5CUSL 1YDXA 1ROCA 2AJVL 5J56B 1PNDA 4YLQT 2ETNA 2NTFA 1G4YB 4YK4B 1Z9PA 4HEPA 2EE2A 4L2LA 3RVVC 4X6EB 1NL0H 2NUTB 4F7CA 1KIPA 4R4FH 3S34L 2IH8A 5DD5H 4N2CA 4YJ2A 2UXBB 3D30A 3L2NA 4NNPH 3O4OB 1IBKB 3OB8A 1BYNA 4AK1A 3PWPE 3VTTA 1JHKH 1M2VA 1CU4H 3BH4A 3SGDI 4ZO8A 3RFZA 1J05B 1U8PB 4F7EA 4G71B 5DUMH 1LE5A 2V2TA 3OXSA 4DP0X 4P5MB 4TUJB 5HGAA 1RKRA 3UCSC 1X5LA 1S6NA 3P77B 2AGAA 4DR4B 2ZCLL 3DLQR 3E2EA 4RESB 4P2QE 2R29A 1BVKB 2J20A 5LKNA 4GKZA 5IBUB 4D8OA 4MAYA 3QQ9D 5E2VH 4GKNA 4KAQL 2EDEA 3L3OA 1GZHC 2VWEC 2EIEA 4XTRD 2CE6A 2WUCL 2YGQA 1FL6A 5DJXB 1F90L 1SM3H 5F3HA 2DTMH 4ADJA 3B9KD 1MLCB 2VDMH 2XIIA 1RVFH 3QPQD 2NOYA 1QBML 2DM4A 2F5AH 4XNAA 3HKDB 2WAQA 1IAIL 3FQ1A 4TQEL 4TT3G 2VDQL 12E8H 5CEZH 3UAEA 1MZFA 3OQ3B 1JZDC 3MZGB 3ZE1B 3TTSA 1E3XA 5JOEA 3TEXA 4J23A 1OSPL 1P6WA 2NPLX 4PRIB 1FBIL 1QSFE 4QRRE 3VXUE 5DUPL 5IKCB 1D5RA 4YGVA 4RMWA 3L3IA 4BZ1A 4S11A 1U8HB 5F7EH 1J5OH 4NKDA 3NJIA 3L7EB 1BS3A 3G6JA 4LSQH 4F91B 3U1SL 3KGTA 5K9KB 3X13A 3WTXA 2ATKB 3JAWB 4KITB 2WVVA 3O4LD 1OAXH 3JBG7 1JGDB 2Y5TB 3QEUA 3UYPB 1E28B 5KYXB 3FCSB 3L71H 3F7YA 4PTUB 5A2CA 2ICEC 1G6UA 3K79A 2MW2B 4ILDA 4XCFL 3ZE0B 5K59E 2AW9A 2HJLA 2I69A 3D85B 3HPJB 4LSSH 1SY6L 5B1AB 3BEVA 4GUPB 1T20A 4JZOB 1B0WA 4K5LA 3ULVH 4Y9BA 1II4E 2F1EA 2QGDA 4F58H 3X1BA 3FX7A 1NBQA 4FK5C 3F58L 5DRWB 1IAKB 2Q3XA 1NCWL 3LQAC 4FQ1L 3AGVA 1ZLWH 5CGBA 2ZP8A 4M29A 5JHLH 3WEXB 1BMGA 3OPZL 4UIKL 4A7QA 2GEQA 1EJ8A 5LXGH 4U6YB 4QRQB 2ZE5A 4PJHA 5CLZA 5GZND 3AG1B 3UDWA 3KZ8A 1P7QA 4U7MA 3MHSC 4XNUH 4POUB 1LDSA 2OW6A 3ZGHA 3IDJB 1PAMA 4H44C 2Y2WA 4NIKB 5D70L 1COWG 2WO2B 4DEUA 1YYLL 2WXMA 5HPMA 3DX8A 2BNRA 4FJZA 1RSYA 3CVIH 1AHWA 1S78D 5D6CA 5LA6B 1OZTG 4TQDA 3QR0A 4BRVA 4ZNEA 3WJMB 2IAMB 1OCRB 5EYPB 1A6ZB 1J1PL 3RVXC 3KW8A 3BC9A 4LARL 1UB6B 2OM5A 4AQ1B 3P73A 4DV2B 4YXHL 2GJ6B 2YXYA 3EDFA 1AMYA 2WXPA 4MMZC 3OAWA 1WS7A 4YDIH 2Y7QA 3O41A 3WXVH 4NX0A 2FRGP 1S5HB 4N2KA 4Y5XB 3KXFD 1GXEA 4ZI8A 1IZ3A 5AW7B 2XX0A 1JZIA 3B37A 5T3ZL 2H1XA 4HFWA 5FYJH 5C0AD 3E8UL 4LLMB 4F33B 4LP4A 1U8IB 2V9TA 4KKNA 4YPGA 3WTTA 4RLDA 1AC6A 1UWEH 3RURA 2XV2A 1CLYH 5D1XD 4BZ1H 2OTUB 4MSWC 4EN3C 4MJ4A 2UXBO 2VQ1B 1YEFL 2AXGA 2JJVA 4JM2C 2OTJV 5FNVA 5FWRA 2P67A 3F7YC 1X7SA 3HAEG 3MLSL 2ISDA 3IRPX 3RJOA 2RR3A 5MI0B 2AQ3A 4WO4C 2XWJB 2AZ2A 3QBTB 1KYAA 2PYFB 4PJAA 1EGJL 3M99B 2PR9A 3CUPA 3P30H 4F7EB 3IU3B 1ORQB 2WWOA 1KG0B 5DMJB 3HMXA 3MOAH 3K4DA 4XZUB 2X88A 3QO5A 2IW5A 3DIDA 4ZRGA 4TV8A 2CTQA 1TSHA 1BA9A 5MERB 4JDVA 4XDLA 2HVKB 2AK4D 2OMYB 1F13A 1L7IL 2YXVA 1E3FA 5EZYB 4HC1H 1S9KC 1MFMA 4BZ2H 3JVGC 3KLHC 1DVXA 2QQNL 3TBWB 4PMEA 3V7MA 1AR4A 3VRLE 4JHWL 4XRCB 2AABH 2G4EA 2WV3A 4FQXA 4HXAL 2DF3A 1D5XA 1WDAA 5EEYA 1DN2A 1N5AA 3FQTA 4R4NC 3FT3B 2OXHB 3C5JB 4YDZA 3AS0A 2WK2A 3GSNL 3UBGA 3WD5H 3MGTA 3H1JH 3T1HB 3WY2A 5FPIA 2NSXA 1R3KC 3C75A 3EGXB 5GIRB 4J39A 2JKLA 4Z0XB 5T5FA 3RVWD 3QG6A 5FPRA 1A6TA 3NQKA 5CUSH 5CB4B 3K8KA 4GSXA 2D73A 5L2KB 2BHYA 2HWZL 5JVDB 4HKXA 2DYPA 1HN1A 2G60H 1MFUA 4WFHE 1JK8B 5AVTB 4I1PA 5BVPL 1R6TA 2NY4C 3UACA 4HS3A 5DD5L 3V0VA 5F9WC 2KZBA 1AKJD 1NDGB 5KUKA 2B20A 3QIWD 1JF5A 1N34O 5KYUA 1NCHA 4PWIA 4H2AA 3VYPA 3JWDC 4NZTL 3SCMA 3G80A 3P69A 1T5WB 2B3IA 5DUML 1P69B 4DN3H 4Y16B 4DUYO 1A9EA 5IFAH 1AJ7L 4QRPD 1F4XH 3QQDB 4KX8A 2J8UB 5DURB 1GM7A 3MROB 1IBDA 5DM6V 3QUYD 2TAAA 3N9GL 3L1EA 1J5IA 2HN7B 1BX2A 4YGVB 3KJ4C 3SEPA 3QFJB 5B3SC 4JDEB 2VN4A 1MPAH 3HCVA 2YJLA 3X2QB 3INUH 1OHZA 3DVNA 4WO4A 5FA3A 2P7TA 3WLBB 4B96A 2YDEA 5IQMA 1SYSB 3HC3L 4HWBL 1EDQA 1FHNA 1ZHNB 2PO6C 4NNXB 2IBBA 3Q3GA 3MNZB 3TF7C 3FHAA 4HDIB 2ESVB 1A6VH 5EOCL 1LGVA 4KGJA 3U30C 2W60B 2VQEB 3FQWA 1EERB 1BF8A 1NGZA 4EIGB 4HK0B 5EEWA 3LRGA 1NKOA 3F6JA 3MACL 4FLHA 4N9OB 3MO1A 2PMZA 2YMOA 4OGQB 5IWAB 3AG3C 1E8XA 4AGPA 4B9FA 1MVUB 4QCIA 3SCMD 4M7ZB 3HE6A 4U05A 4YAQB 5F96H 1LWHA 2Q69A 1VPOH 3LRLA 3IVKA 1QO3B 3Q9PA 1H2MA 3CBRA 1EFQA 2FQGA 3G5YB 2VXTH 3KH4A 3AQZA 4XCFH 4C4UA 1A02N 4F7PB 4X5LA 3G6JF 1OAYH 3EOBB 1X4TA 2J55A 4JDVB 2EINC 2YPVH 4KPHL 3A2FA 3RGVD 2R9HD 1UFGA 1U93B 4UINH 3CD6V 1QSFD 4TN9A 3VXUD 3IMBA 1AIFA 3ULVL 3MRKA 4JJ5B 3PWPB 3BVUA 2X4RB 5HHOA 3PHSA 4NZDA 1KMIZ 1NCTA 4YE4H 5JHLL 1NMBL 4U6TA 4HX1A 4F8PA 4CC5A 1MWAB 5IQNA 3G6AB 2QELA 1FZOA 1IGCH 5AQ0A 2H6PB 5LXGL 3U6RB 1WAAE 3U0TA 4L4VD 1CICB 1E4XH 4ICGA 3SJBC 4OT1H 5EEVA 1EZJA 2YQGA 1GGCL 4WWKA 1NGWA 1IGJB 1R0AH 2FQFA 2ZAHA 1VMGA 5ERWB 1JVKA 3FTYA 4NZUL 4MNQD 1ORSB 5HI5C 1SF9A 1OD9A 3MJ9H 3ZDWA 4UIMB 4P3CL 4DEPC 1EXGA 5AVZB 3LZFL 1HAUA 4MZ3A 3ZE1E 4M5TA 1WB8A 1BAWA 2VQ4A 2Q67A 3ML0A 1Y6KR 4DRXB 3MV7A 5GRYA 1CTOA 5IHHA 3CVDA 4MB4A 4PGCB 4GO9A 2OX5A 3QRFM 2CH8A 3MLTB 1NBYB 3E6HA 3KS0H 4XCEA 1U8JB 3WXVL 1TUBB 4E41B 1PNCA 5C9KA 3AZUA 3TYGL 4TTGA 2YGOA 3LSSA 5FPOA 1X7TA 3B2VL 4IIZA 4Q8BA 3NEOA 1L0QA 1CYWA 4JI2B 4A2EA 5J2TA 1J1OH 1E1QG 2WB7A 3EFFB 1WC7B 1FXHA 4YPJA 1TA8A 1BIHA 1M6UA 1KTDA 4Z77A 4A7UA 2H7WA 1I1FA 4P9MH 3CCVV 3UT5A 1YJ9V 4PLOB 4NQED 4X4YB 1OPGL 1UD4A 1JMXA 2XY2A 3FB6A 3T8VA 2UXCB 3AY4C 4JO3L 1Q9WA 1I1RA 4MVZA 3MLSH 3TXSA 4AL8L 3Q5TA 1QLRA 4G11A 4L4VE 5BOZG 3ZKMC 2F7QA 3T0AA 4N8VG 4RVBA 5EUOA 3VMOA 5CR1A 3GSNB 5SWZD 3GXTA 1EGJH 2A9BA 1L9NA 1H2GA 2DLTA 3N43F 1OCWL 5FA4B 2CLRA 3EBIA 3SPHA 3UCRA 4JBSA 3LH8A 1N36B 4GAJH 4K9EH 1IAII 2XJKA 5E95B 2ICWA 4P0DA 3V5KB 1L9OA 5G5DA 5K39A 3UTTE 2OR7A 2E6PA 5L2KA 3L6FB 4KXZI 3ZZLA 1D6EA 3T2PA 1SN2A 4TSFG 1FPTH 2WVVB 1FCCA 2WXNA 3FQ2A 3HE7A 4W9EC 4JZGA 2ID5A 4L9LA 5DD6B 2AV7B 5EO1A 1YEEH 1NOLA 4MAUH 4PJCE 2JELH 3QHZH 1UKQA 3PXLA 1MHCA 4XCCH 1AI1L 2OTWB 4DPRA 4Y16C 4Z7OB 1VHPA 3WTUA 3WD5L 3CCHB 4NQXB 1JD9A 3ZMRA 2PCXA 5HYQA 5I1IL 5IHBA 3HUJB 4NC0B 3QUXD 3NCXA 3CXHK 1OSZB 4FJYA 2JTYA 1HS6A 4OFQA 1LO2H 1CFVH 4LCCA 1DQLL 1MVUA 1C5CH 1C9SA 1E9PA 2HWZH 3VQYA 2X9WA 5HY9A 5BV7C 1BD2D 2NZIA 3BAYA 1CICA 5E6IC 5I1JH 3JSNA 1IKNA 1IM3A 5CZXC 4BA0A 3E6FB 4FNSA 3C3TA 4P4KB 1JF6A 4OZIE 4QHNA 2VIRB 3AG3B 4ZUUB 1QR8A 1DYZA 3C6SA 2V2WB 3GJFH 4IGBB 4FFZA 2BTQA 5DGRA 3FCSA 1QQDA 1WZAA 4NZTH 1ZEAH 2ILMA 1UEMA 2UXDB 5E4AA 5I19H 4I4WB 2R0WH 4U1SB 5IBLD 3C9NA 4KI1A 1BFOA 4UT7L 2I9LB 1E5UI 2D3NA 3A3YB 4GRLA 4PJBA 2H47C 4LH6A 3VG0H 1H9VA 3NABL 3QDGD 4OGYL 4EEEA 1KECA 2CXGA 1N4CA 1M1XB 2ADQB 5JCOA 1Z5LA 1RP8A 3L13A 4RMUA 1KXVA 3ZTDC 4Y2DC 4UCOA 3TJPA 5CCKL 5TDNA 4XCYB 5C07A 1H8HG 2MOQA 2QMKA 2IAMC 4MS6A 1FH5L 3QIBD 1P4LA 4PRHE 1NIFA 4QO1A 3CZFA 1VIBA 3REWB 1S5HA 3PYCA 3OJMB 3VI3A 4URTB 6FABL 5EOCH 2IAAC 4B3VA 2OBGA 5L7XH 4LL9A 5CSGA 1JGIA 3PXJA 1CBVH 1COBA 1S7QA 4TVPL 5A7BA 2CDGA 5L0QB 5B39G 4EEQA 1XF1A 3UO1H 5L3BA 1KKDA 2ZUYA 3HC2A 1ET5A 5JWPA 4K3AA 2FNWA 1VPOL 1PSKL 3ZIMA 2EDJA 2W07A 3GBMH 1UGNA 2NLJC 1X5IA 1D7BA 1SNRA 5IJ0B 4YDJB 4AV4A 4B60A 3RVUD 4D0BB 1G9EA 2HPOA 3DJZA 3ARPA 2MJWA 4DGVH 1CFBA 4YVUA 2C9VA 3VI3F 2ENSA 4NN6B 1JYXA 3L9BA 1J5HA 3SQRA 3VMPA 3SDCA 1YNTF 4P49A 1DVQA 4YIQA 3UJTL 4J4PD 3W9DB 5DJ6B 5AB2A 1SHSA 2HYMA 4TQIA 5FM4A 3SKJL 1OCRC 4HJGB 2HJDA 1NOFA 2FYYA 4OCYH 4AT6A 4P9PA 2XQ0A 4R83A 5IVZB 2Y7SA 1AP6A 3E7JA 1AD0A 4CVUA 5EU6E 1W16A 1GJUA 3GDCA 1QI3A 1Y18B 4PJEE 3SDAD 2EYTA 4I5BB 1WP7A 3V4VH 3WFBL 1FFRA 4X1KB 3OLDA 5E9DB 3N2KA 1X7QB 4F8NA 3IM1A 4WNQA 4HFUH 4R7CA 1TZAA 1B6DA 1BXAA 3BLKA 4HPOL 4P5TB 5C09B 1AZVA 1LO3H 1CGVA 3BD3A 3RPKA 1QD0A 3F8UB 1BGXL 2F74B 4PM1A 1N64L 2W9EL 3CFBB 3U7YH 5I16A 2WZ6A 5K93A 2DD8L 4MXQC 5ITBH 3DO7B 4IYKA 4V11A 2YWYA 3VFMB 2E5LB 1AGEB 1YDPA 1S8DB 5L3GA 2PWGA 3II1A 3UZQB 1WPBA 5I15L 3TIEA 5C08B 2ZCHL 4OCRL 1AD9B 1LP9F 2N1KA 4CVZB 1HH6A 4XBEH 3QRLA 4CSPA 1T21A 4C56B 1J5EB 1HQ4B 5LN4A 3L7FB 3T8MA 1MF2H 2JIXB 4JFOB 2AKRB 1CFSA 3ZE2B 4K9EC 4P9OA 3OHXC 2W0FA 3T77B 1OQOA 4KROD 5C6PB 1S7TA 1J1OL 4XT1C 4DR1O 3CFDB 3KPQA 3S5ZA 3TN0C 1LDPL 3V6OE 1OARL 2YRPA 1NI8A 4KTGA 2TRHA 4HWZA 4U3JB 1OCCC 1LP9E 5F93C 2VDKL 3K3QA 4JO3H