2X6CA

Potassium channel from magnetospirillum magnetotacticum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
288
structure length
264
Chain Sequence
PRILNSDGSSNITRLGHYHDLLTVSWPVFITLITGLYLVTNALFALAYLAGDVIENAFFFSVQTMATIGYGKLIPTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLMMRLANLRIEAIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFLVLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-SENSITIVE INWARD RECTIFIER POTASSIUM CHANNEL 10
publication title Domain Reorientation and Rotation of an Intracellular Assembly Regulate Conduction in Kir Potassium Channels.
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Metal transport
total genus 70
structure length 264
sequence length 288
ec nomenclature
pdb deposition date 2010-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2x6cA01
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 2x6cA02
4MVUA 4WFEA 4PA7A 5KUKA 5J9PC 1V55C 3K0GA 4H33A 1P7BA 3E83A 3RBZA 4G27B 3ATAA 4XDKA 4RAIA 4RO2A 5EC1C 2EILC 2ITCC 2HVKC 2X6AA 1QLEC 2R9RB 3KG2A 3ABLC 2X6CA 4QE7A 4WFGA 4MS2A 4MW3A 4XDJA 3F7YC 3X2QC 3AG2C 2WLLA 2IH1C 2EINC 4J9ZB 3JYCA 4PA6A 3RVZA 3ZRSA 1U4EA 3IFXA 4MVOA 3SYPA 4MSWC 3F7VC 2Q69A 4P30A 4BW5A 1M57C 3LUTB 4MTGA 1N9PA 4X89A 3UM7A 3K04A 3SYAA 3T4ZA 4JTCB 2EIJC 2DYRC 2WLLB 2HG5C 3AUWB 4QNHB 5EK0A 1XL6A 4PA3A 1M56C 3TCUA 3SYCA 5CBGA 2YEVA 4GX0A 4PDMA 4WFHA 3AT8A 3WG7C 3ATFA 4OXSA 2HJFC 4PDLA 2DYSC 3ABKC 3LDEA 3T2MA 3HPLC 3ZJZA 2A9HA 3ABMC 2DWEC 3SPHA 4GX1A 3AG3C 3FB7C 3ATDA 1G4YB 3SJQC 2KB1A 4TWKA 1S5HC 1K4DC 4R8CA 4H37A 3LDDA 3LNMB 1OCOC 4HYOA 4XDLA 4GX2A 2BOCC 2Q6AA 3E8GA 3OR7C 4J9YB 5EBWC 3ATBA 4MW8A 3SPGA 4R6ZA 4X8AA 3E86A 3RVYA 3SPIA 2K1EA 3BEHA 4PDRA 2ZXWC 2WLNA 4MTOA 3SYOA 3OR6C 2QKSA 4X88A 2GIXA 1OCRC 5CBHA 3AGWA 3ASNC 3VOUA 4P9PA 1OCCC 5EBLC 5KUMA 1KKDA 3ASOC 4LBEC 2BOBC 2OCCC 4EKWA 1J95A 2HFEC 3VSQA 4PA4A 4R7CA 3T1CA 2ITDC 1BL8A 2A0LA 1R3KC 1R3IC 3R65A 5EBMC 1ORQC 5E1AC 4QE9A 3LDCA 3IGAC 3K08A 4JTDB 4MVZA 4CBCA 2Q67A 1V54C 3FB8C 4I9WA 4P9OA 2JK5C 2QTOA 2X6BA 3FB6C 3K03A 4MVMA 4R50A 5BZBA 3PJSK 5EC2C 1LNQA 2Y69C 4MVRA 3ATEA 4UUJC 1R3LC 3E8HA 2H8PC 1R3JC 4RUFA 4LCUC 2WLHA 3E8FA 3K06A 2A79B 4ZBMA 2HVJC 4RUEA 3STLC 1XL4A 4DXWA 5B3SC 3E89A 2W0FC 4WFFA 4F4LA 1K4CC 4HZ3A 2WLMA 2WLIA 4MVSA 2DWDC 4JTAB 4KFMA 4MVQA 3STZC 3OGCC 3F5WC 4GX5A 2AHZA 2AHYA 2IH3C 2ZD9A 3AG4C 4P2ZA 3SPCA 1ZWIC 3T4DA 2EIKC 3TETA 5B1AC 1U4FA 2E4FA 2Q68A 3GB7C 2WLKA 3UKMA 4PDVA 3FB5C 2WLJA 4PA9A 2ATKC 2WLIB 5B1BC 4LP8A 5CBFA 4G28B 1JVMA 3RW0A 3SYQA 3AG1C 3OUSA 3OUFA 2EIMC 3AT9A 1OCZC 3E8BA 3K6NA 3EFFK 3SPJA 4MTFA 2P7TC 5IY5C 2NLJC 3K0DA
chains in the Genus database with same CATH superfamily
2F2HA 1CD0A 5HDBE 5KVMC 5IM7B 2DLTA 3GUTB 2EXYC 2EQDA 3ARWA 4PJ7A 1RU9L 2ZX5A 1U3HD 2P5OA 1S2EA 4OFVA 4B9PA 4HOZA 1D5BB 1FI8C 1MAJA 3B2UD 1HVXA 4RQQB 4YXLL 2ETWA 4XPBH 5HYSB 3KG2A 2XPZA 1DQKA 2IAAC 1PFCA 2GB2A 4D9LL 1E67A 1PD6A 2CDFA 4RESB 1Q0YL 5F7EH 5LXTB 3RVZA 5ACZB 4GAAA 1B6DA 3RTLA 3RUGF 4NO5B 3MGTA 6CGTA 4N2OA 1IAMA 2FQGA 3DV6B 3PFQA 1SY6H 4CVXA 4AH2A 3LYRA 1NDGB 5I2IA 3QEQA 5KYYA 2DQTL 3HG0A 5HGGS 1NCTA 5JTWA 3JT0A 2BX5A 4ESKA 1M53A 3L3GA 3DVGB 5AVSB 5D71L 2QGEA 1D7FA 3QDHA 1LDSA 3SSGA 1GZHA 1M5IA 3AK2A 4AVHA 4DZ8B 3ETGA 5JIKA 2A9NH 4XPFL 2O30A 4K9EL 5JQHC 1MJ7H 1UFUA 1ZV9A 4R8CA 3ZKND 2UXDB 1VIBA 2XOTA 4JFOA 3V95A 1E4WL 5DEFA 4GG6A 3MMEA 2PW2B 4DVRH 4DV3B 1ZTXE 1ED3B 1GCYA 4KRPD 1OGTB 4KKBD 5H2FZ 3KXFB 1AR4A 1FFOA 1YEHH 4ZX5A 3ZPDA 1H19A 2W8CA 1VF7A 2B1HH 4AQYB 3FK3A 3S8FB 4U6XA 3NIDF 4L0ZA 1EJ6A 2CGNA 4FJCC 4I5BB 3A0OA 4GRLB 5I16A 1IB5A 1RZQA 2XIDA 1FZOA 4IOIB 1AJQA 1YN6B 3ZUNC 2LW3A 4TT3G 5IFHH 1V54B 4A2MA 4HYTB 2Q67A 3ZRWA 4FLYA 4GKNB 3GSRB 4MFHA 2W94A 3KCPB 3LRSA 1EGJL 5HYJE 4XRCA 4CH6A 5E00B 4DHLA 1I1AB 3S3PA 3OFNG 3IS1X 3D2UB 3QF7A 2AI0H 4BWUA 4EAEA 3ZL4L 1XL4A 2VDRH 1BCIA 4R26H 3ML9A 5FO7B 5FM5O 5D2NC 3QRFM 3TBYB 2WLIA 1BQRA 2YMOA 3ZDZF 4AYBA 1A7OL 4GX5A 5HHQB 4AZ8B 1US6A 3X2QB 4DKDC 1PIGA 3DX6B 1G7MB 4KFZC 5ALBL 5BZDB 1K2DB 3PWPE 1HKLL 5CUSH 1YYML 1U0QA 2XFGB 4OBRA 3P3SA 4PB9L 5FB8A 2GUZB 5K93A 3IJSA 3FTZA 4H8WL 1GGIH 1R5VA 4P59H 4DERA 1VGKA 3MLVL 3AT9A 2YMXL 4PJ8C 3CN2A 4Y88A 3ENEA 3ESPA 4O58H 3S3DB 5J6HA 1TJIH 1S7SA 2P7TC 4UBDC 4WHYH 1TO5A 4OLYH 2K9FB 3UTZB 4DRXA 2PZSA 3SDAB 3J07A 3FU7A 5E4IA 4YSPA 4YR6A 1NANI 1ZVHA 4YX2L 1MWOA 5CEYA 2YXWA 1DF4A 3JALB 3WXWL 3HE7C 4DPAX 2G5BB 1RD6A 1CE6B 2L3BA 4G7YH 1WSST 4Q14A 4ZMTA 4LFAB 2ADGB 3GO1H 2OZNA 2YMTA 1MRDL 2W9EH 2LE9A 4R4FH 2Q8AH 5J3HC 4GMTL 3HNSH 4KK8D 2C4FT 5B1NA 4LQFH 5L8JB 5FYJL 1MCPH 4PS8A 5C3TA 3VWKA 3IJEA 1U3ZA 4MNHB 3EOBA 3QZPA 5E4EB 2F7PA 4OV5A 3O3BA 1D9KC 1IBMO 4P2OC 3X14B 2Z3YA 4GKKO 43C9B 2QMKA 2XBZA 1FNAA 1TZHB 3N40F 4H25B 4Y4HA 1RIHH 2XC8A 4JQIH 5T5FL 3BVXA 1ACYH 3VSTA 1SEQL 2GBUA 2VC2B 4N21A 3ZJAA 2YXMA 1HYSD 2RHEA 2AK4B 2BVPA 1QYGL 2ADQB 4GOSA 4LLMB 3C6SB 2VUOA 3PWLB 1F45A 1NGZA 3WFHA 3QORB 1MHPH 3P2TA 1JYWA 2HVJB 2GSIB 3N50A 3TO4D 2FL5A 3MRCB 4DTGH 3DBXA 2Q0ZX 1LEKB 5E94B 2R4SL 1I8AA 2BNUA 5DJAA 4LPXA 4ZX6A 4H5SB 2BOBC 1MFAL 2V17H 1WGOA 3KXFD 3M7FB 1WA2X 4OKDA 1ETZB 3ROOB 4P07A 1JPTL 4CU6A 4TNEA 3TV8A 1VA9A 4PWEA 2CHWA 4EIZC 1T04B 3N2KA 1RZFH 3LNDA 2YSSB 4F9PA 4YDMA 5F6HJ 4A7TA 1FYTE 4Z7QE 1JPFB 3W0WA 1S7VB 1XF4B 4GRLD 2BP0B 4N0FB 4PM1A 3T4YB 1PKQE 5C7XL 4UUJC 2F15A 2UWEE 5BJTA 1U3NA 3L9YA 1MCWM 2VLMD 3P4LA 1JPSL 1TTAA 4EUPG 5BRPA 1DBKL 1KPVA 4HIIB 1SVZA 3PJSB 1NGPL 1XBLA 2G2PA 2ITCB 4RRPG 5CB4A 1I1AD 5BOZG 4NZRL 5CP3A 3TWCH 5J0BA 2HJDA 3MZGB 5IW1B 4B7IA 4GQZA 4OJFL 3BVTA 2Y0IA 3SQBA 3L2MA 4HEMA 3QCVH 2GITB 2V3FA 3FB5C 4GEIA 4O51B 4Q9QL 1EO7A 4HWUA 4Y9EA 3ARTA 4PD4F 5EF2A 4W68A 5DUJA 3QG7L 4JDVB 4I4TA 3CFQA 2YD2A 2WUCH 4IJ3B 3RZCB 5HI3C 1KELH 4FL4C 3ISWA 4BKLB 3VA2C 1WA8A 2D3LA 4E9XA 4XX5A 2Q5ZA 1KPUB 3K0DA 1PVHA 3GZKA 1KB3A 3TBWB 5CJOH 4OY9A 1RV6X 2HCZX 4Z3JA 5FF6A 4QHKJ 3FMGL 3WJLA 1RZIB 3EYFB 1LEGA 2Q76A 4N3TA 3AMKA 3EKCA 3NGBC 3UZEC 1BG1A 1RCYA 1E43A 4NWTH 5AYUL 5B7MA 5DYOA 1G0XA 3JATA 4FLTA 12E8H 5KG9B 4MHHI 2F8IA 1ZIAA 3SDAD 2WUBH 2DBJA 4MX7B 4TTDD 4BFJA 3APQA 3ZZ1A 5B66Z 5HVHB 4MSWC 4ZAKA 3WFBL 5E2UL 4MTGA 4PAZA 2NTSP 5BS0B 2EEAA 1J9RA 5JH7B 1T22B 2VMJA 2W59A 4LLWB 2Y0PA 4JCMA 2YI9A 3SGIA 3FHEA 4QGTA 2J8OA 2DMXA 4WDIB 2PCFB 4E0RB 3DI3B 5HFLA 2CBOA 3HB3B 1LP9E 2YEVA 3VFGH 1M2VB 2ORBH 2WAMA 4RFOL 3TV3H 1X9UA 1FE8L 1G7PB 2B16A 2FQFA 1A7QH 2WP3T 1NKGA 3PABA 4MCZA 3SGKA 1H3PL 3VXRA 2PMZA 4FQIL 1IGYA 4Y7OC 1GS6X 1O7SA 4A55A 5FFLA 2VL5B 1Q0EA 2AK1H 4JYAB 1CVSC 4MT8A 2VLKA 1E2VA 3HZKA 4N90D 3ZRVA 5LAXA 3SJAC 4LSQL 1YN7A 4HF5H 5EZPA 1XMEB 3KPLB 4WHCA 3GSQB 1B4LA 3TPUA 1OCCB 1ZSPA 3FN0L 5HY9B 3QORD 3BGFC 4AUYA 2OCCC 4ZK8A 1CLOL 1ZWIB 4FM0A 1RK1A 3IJ7A 5KVDH 1ZLVK 4EXPX 5DEDA 5A2CA 2BSTB 1JGEB 3JV6A 5BOJA 4TTGA 4EI0A 3K72B 5KSBA 5KW9H 4QE9A 3CC4V 2AANA 1X4TA 2D9CA 4IU3A 3ULAB 4WJ5B 5I5MA 3LSQA 1IM9A 1N7MH 3DOSB 2WTOA 2DI7A 1CXIA 5AEAA 5HDLA 1TUBB 2HKOA 3QNYA 1TT6A 4DCQB 1MCJA 5C0EA 3EJTA 3KMDA 4FLQA 3OB0H 3E89A 2BSSB 2GJPA 4NT6A 2ISDA 2XX0A 4E42B 2F4VO 4JRYE 4LIQH 2IU3A 4OF5A 5KN5A 3JAWA 1MOEA 2R1WA 5EO0B 3PXLA 4R7NA 5L4MA 4LOEA 4EI6A 2NUPB 4OUUA 1WTLA 1UCTA 2E86A 2QQKH 4ODTH 1KULA 2HWZL 4OJAA 2F7IA 3IF1A 1RKRA 5LVEA 3UGEA 4WU7B 1IC5H 1NICA 5AAMA 4DKEH 3K7UA 4F8OA 3VJ6B 3LPOA 1P6WA 5IB5A 1MRCL 4DF9A 1B0GB 3VWJD 4EN2A 2BNQB 3DX2A 4HWZB 1IAIH 2GK2A 4OD2A 4S11A 1I1CA 3HNVH 5KX5A 1YC7A 5FHBL 4PYGA 1S7TB 2IANE 4O4YH 3GXIA 3ARFB 4IBZA 3V0DA 3G08A 3TNMB 1E7VA 3S4SG 1BE3H 4KKZA 4F92B 4QHMB 1YYCA 3V2AR 1YXBA 2J1WA 5JPMA 1JZIA 3FQWB 1N8ZA 3GPSA 3ZE2B 2XAFA 3FO0L 1JFHA 5A2KH 1OPGH 3RL2B 3BIAX 5ESAB 1AZUA 2LU4A 4JVWA 2KZBA 3GSVB 2N7SA 1YY9D 4EUPB 1SN0A 4PJDB 3OKLB 4JG1L 4AEIH 4I55B 5EK0A 5EU6E 1DK1A 3K5NA 5FPOA 4HMCA 2HFFA 4ZW8A 4QHUA 4XXCA 2CJTA 3L7FB 2IJHA 2PCPB 3IMTA 5CMUA 2DOCA 2WPDG 4OX9O 2BVOA 5BS0D 3U0TB 4CADB 3NH7H 3TF4A 2APWA 1NAKL 3KPNB 4ZS7L 2EEFA 4IK6A 4DUZO 3S98A 5IW6A 3U46B 2NX5A 3O6ML 1QNIA 2WQWA 3QW9A 2EO1A 4M6MH 5L4IA 2ZP0T 1ZHKA 1KV7A 4RX4D 3VGAC 3UAJD 3VU1A 5JUEH 4DV2O 5BZXA 1XEUA 1UJ3A 4B50A 1A14H 3Q4HA 1IJNA 2YZ1A 5KVGL 1NA8A 1VKXB 4G11A 2OAAA 2ATKA 1NC4A 1I94B 5C0BE 3CU7A 3RX9A 3UBFA 4DETA 1AR1D 2P47B 2V9TA 4GEJA 4I4WB 4IRSA 2FX7L 1BFVL 1Y74A 3LRHA 3MACL 1BXUA 4WUUB 2VN3A 1FIEA 5GRWA 5K59F 1R3IL 5DT1H 3IFPA 2FIRT 2VH5L 3GS4A 2Y1AA 3S36L 2D7NA 4GS7B 2GT9A 3C2AL 4OCWL 1V54C 1IBGL 5F2FA 1ZHBA 1BQ5A 4X1IA 1N70A 3M6DA 1XB3A 4B9KC 1XGRB 2Y69C 1PX4A 5CEZE 3FSOA 3JWDL 4JB9H 4JPIA 4JFDB 4NNXA 5C0JB 1B06A 4PGBA 4V1DB 3UO2A 1QHPA 3NJIA 1ZLWH 4J8QA 2RH0A 4KKLD 1XEDA 1VESA 1IC7L 4W1TA 5E1QA 4ODXA 2DWDC 5K1VA 1S9VB 3CFKB 3BZEB 4NLAA 4AEEA 5I1DA 2ZD9A 3FFDB 4PP2B 4E9SA 4UV9A 2IAMC 2ZCLH 2UYLA 4IHJB 4CJ0A 3G6EV 4WW1B 1EBOA 5EH1A 2EECA 4HK0A 2O5ZL 3L1EA 4YXLH 3QFJA 5E2WH 3DK2A 4F57L 3RUGA 3TURA 2GVYA 1SOSA 3S48A 2VM3A 3TL5A 4YGVA 4NNPL 5LMUB 2EDXA 2MHAB 4I18A 5D1XE 3SKJL 4PVBA 2FR4B 4DW2L 3NZ8A 2IOOA 5J2TA 1UWGH 1SERA 4XWGH 5DHYA 1KGYE 1K8DB 3RBGA 4EUPH 1FQ9C 3CZEA 5JNYA 1ES0A 4GI9A 1R34A 4JHBA 3L5WA 4R4NC 3ZQWA 4AENB 2DQTH 4DUYB 25C8H 3ARFD 3KNBB 3ZE0E 5I75B 1O9VA 5HDOA 5D71H 5TTRA 3MUJA 1NIBA 2JJ2G 2CNYA 2OR7A 1UWFA 5J1AB 2XNAA 5IHBA 2EKSB 4A37A 5MERA 5FAAA 2QPEB 1AGEB 1VADA 4XOCA 1U91A 3MJ9L 2X1QA 3ECVA 3U4EA 4JHVA 5E4EC 4P5MB 1KWKA 1H5BC 2NXYC 2VWJA 3WEOA 5EOCJ 4ZNEA 3QXDB 2VW7A 4XMLH 5ICZB 2A4EA 1M6UA 4P57A 1HDMB 1GW6A 1DJYA 5EYPA 2WSKA 2IG2H 1FFTB 2ZIOA 1OB1B 4JY4B 2WBKA 4NEHB 3EXLA 1IQWL 2BIHA 1WPCA 2I25N 2XKNA 3PFUA 5ISZE 1XSIA 3C6LB 4LF9B 3KW7A 3JYBA 3D36C 4N1CA 1ETB1 4NZJA 2XTJD 1J0HA 3P2BA 5C07B 1ZT1B 4AL8L 3RY5A 2MNJB 2WXHA 3BRFA 3ZHNA 2BY2A 3EGDA 3GRWL 3VRJB 1MG2C 2K4WA 4HW6A 3S4SB 4KJYA 1KP3A 3ZO0A 4XC3L 1EANA 3ASOB 2DS4A 1XBRA 3STZB 1KKDA 3G6BA 2J12B 3CCMV 1LO2L 2ZX8A 3LZOA 1KNOA 1I1RA 1NBMG 2VGLM 3V5HA 4FOMA 5EEXA 3ISYA 3HNTH 3UG3A 3ZL4H 4D3CL 3LV3B 5JJEB 1QQCA 3KJ4C 2G38A 4OPAA 4BRVA 1QR9A 4D9QD 4JW3A 4B3SO 1YO4A 3W9DA 4TV3A 3VD4A 4JZJA 3QJFB 4WUUD 4DEWA 1SQVH 3FB6C 1WBYB 5C6TL 2A83A 4GJTB 2Y06H 1FFXA 4LFBB 1NAML 2HVKA 4MQ7A 1R3LC 3ULVH 3UYPB 2DL9A 4HUVA 4G42B 5LG1A 1XGPB 5A7BA 2QLYA 3C2SA 3C60B 1BVOA 1NVPB 2GSMB 5DK0B 1XB6A 5MENA 5IF0B 3MLUL 3JZYA 3OAUL 1MFDL 2DQ3A 4UANA 4XCNA 4F6RB 2BP3A 5JLZA 1OAYH 2QPUA 3HZYB 3DGCR 4JFDD 4WNQB 3TETA 4BKTC 4X7TA 5F7YC 3SJVA 3S8GB 2ZUQB 1YUHA 3O4LB 2AEOA 2CGYA 3IFOA 5KANG 1LNUB 4ZYKB 1A25A 4CN6A 5CBAB 4YHOL 3OW2U 5HGBB 3CB2A 3RI5K 1VQPV 1XZWA 3TH4T 3FHQA 1XFPA 3FW6A 1S9XA 4ASUG 1JDCA 5BVPL 3AACA 1S0VA 5F1IB 3RZCC 2NT1A 2DTMH 3T0ED 4K5OA 4LCCA 4GAYA 4YLQT 1NMCB 3O8XD 3K0GA 5CLZA 3ERXA 3C5SA 4DV7O 4LZKA 2DJMA 1WC7B 4X7EC 2D7TL 5IJ0B 4YDLC 5DCCA 3ARGB 3QSKB 5KVFE 2ZINA 4QCIB 4ZS6C 2BCKA 1EJOH 3VGFA 5ID0A 4IOFC 5I1CL 3II2A 4ZFOL 2G0KA 3JD3A 2ZOKB 4OM1L 2PTTB 4MJ6B 3BCDA 2Y7LA 3NCJL 1J8HA 3QZBA 3DC6A 4WY7L 1A1MB 4MCYB 1MHHB 4F2EA 2MCPL 4JM0A 1CC3A 3ARED 5T5FH 3Q06A 3ETQA 1MI5E 1SEQH 5A1AA 1A9BB 1OWRM 5DXWA 2A73B 4XVTH 5C8YB 1RJLB 1ORQA 1TVBB 2MJWA 3UPAA 5LHHA 1QYGH 3US9A 4L1TA 3HB3C 5FYJD 5JZ7D 3SOBH 2OYMA 2GJJA 1GTNA 5F89A 3LDEA 4NO0D 1TYEB 1U8MB 3PUUA 2BOLA 3HRZA 4UZGA 4D9RD 1HFUA 3ETDA 5AZ2L 2XA3A 1DUZB 3TN0D 1B0WA 4JGUA 2CZNA 2QMJA 2Q6AA 3EADA 2WP3O 4R5TA 3II3A 3ULUH 4G7SB 1SVBA 2A9DA 4O2AB 3RIKA 4ZPVB 2JRIA 4N24A 3ISRA 3KLSA 4LKXA 1JRHI 2EO7A 4OCLC 1K4CB 2R39A 2UXFA 1A4JA 3C6LD 4M5ZH 5CGBA 1QSVA 3RKDC 1UFIA 5HYQA 1OCCC 4ZSOB 5IFAL 3QCUH 4PS7A 5AYQA 4ZUWA 5SWZA 1B6QA 4UVCA 1Y0LB 1S3JA 2D2CB 1JPSH 1RUML 1R33A 3F6IA 1DBKH 4XMPH 3GB7B 4HBNA 3HN3A 1WD9A 3QI9C 3QWNA 2PUQT 2EULA 4HS8L 3FH7A 3RGVC 1PZ5B 3ILEA 4D8OA 1AFVL 5CLXA 5AB9A 5KSUB 4NZRH 4PV9A 1AS8A 3GJEB 3MRMB 3V6OA 2FEDD 1MPAH 2V2XA 1FZKB 3TCLB 3H4FA 3RAJL 3K74B 4OJFH 2AAVA 3JVFC 4PJAE 2ZPKH 4PIBA 4F58H 3MJWA 2XZAH 1QHQA 2UVEA 3B7RL 2M8XA 1E4KA 5DD6B 2VL4A 3NABL 4Y5VC 5DN6G 3GZOA 1UZGA 4Y8DC 3QG7H 3TBTB 5EOTA 3FO9B 4QKXB 2VSMB 1DFBH 1FC2D 3RX7A 1DE4A 3BA9A 4IKLA 3VYPA 4I9QA 5LDSA 1N33O 2WAQA 2XWBB 3S34L 5DMJB 1NBVL 4IOSD 3QQ4A 1DVTA 5DA4A 4QRRE 3T6ZA 5EEVA 4Y19A 1N32O 3KBEA 4JKPL 5CBFA 1X7QA 4DR3B 2BWIA 3RWGB 1BZ9B 1HC1A 2VABB 3D50A 5K9KB 4ZTPL 1XILA 3I6LD 4MD0A 5IMOA 3WKPA 4BZ1H 2Y36H 1WD8A 1TPXB 3OPUA 4PRPA 3L48A 5EZJB 4M5SA 5FYKL 3MRJB 3V55A 2KKQA 3FU0A 1D5MB 5IROC 4HKXA 2GHYA 2L7EA 2WYHA 2EILB 2BOCA 3DJ9A 3GXPA 3KLHD 1I8MA 2R7EB 5ILTL 3CZFB 4C4KT 4NRXB 2ZXEB 3ZMNA 3TJPA 4MS2A 2WVTA 1QFWL 4LLUA 2PP9A 4NRZB 4N6QA 4RFOH 4M1DL 1RI8A 4BZ2L 1VQ9V 3WO3B 1FE8H 3ARGD 4XN4A 1QLNA 3DUUB 4I5SA 4BM7A 5DGRA 2CGZA 1DBML 4XB8A 1AP2B 1NM4A 5E7FA 5JXAH 3RYHA 1MFNA 5F96L 5CKGA 1A6AA 4CKQA 2YKLL 3T3PB 4HKBB 3ZHUA 5K1PA 2XWTA 3L3IB 2H0PA 1TZOA 1TIUA 5DQ9A 3IKCA 4O5LH 5FO9B 3LD8B 3S37H 5F7UA 1UADC 3APDA 4UOZA 2X40A 3GMQA 3MLRL 1OF2A 3QO8A 2WQ8A 3KWWA 2LGNA 3WYRA 2E7BA 4JYCA 2ZKYA 2P8LB 3MJ7B 1E9PB 3FN0H 4YSEA 4FQCL 3ZSTA 4Z7OE 4I8DA 5JIHA 4DSYA 4MA7H 4R3SB 1CLOH 3I55V 1NGWA 3NJLA 2FIKB 4A6YH 2CA3A 4H88L 4KMQA 1I53A 3WEXB 2G5RA 4G8GA 3RT3C 1L9MA 1VACB 4YJ2A 2AJVL 1Z5VA 3QDME 2X42A 3H9HA 4ZBJA 4I3SL 1QOKA 2VDOL 1MFEL 4U6TA 1KN2L 4AQEB 5FDWA 5JCOC 4XNQA 3IVKB 1CDYA 1YVWA 3HKCB 2EIKB 5AVXB 3V4PL 2UUDH 4CKVX 2IALA 5ANMA 3WMSA 1QSZA 4ZDHA 1D5IH 2NY3C 1YDXA 1P5UB 3QEGL 2O5YL 1MW1A 1RK0A 1ZAGA 4FNTA 4PRNA 1YSOA 4QTIH 5E6IC 4UM9B 3RJQB 3SDXF 1YY8A 1C16A 4K3DL 2R9AA 4FNSA 5FKAB 5IT2L 3UO1L 4HIXL 5JJJB 4TLSA 4IYIA 3S36X 3WIHH 3WOVA 2HWZH 3IU3A 1YTFB 5B3JE 3KLAB 5H8DA 3QRGH 1RJZA 1MW2A 2PYEB 4YXHL 6PAZA 4G6MH 5AB0A 2R56L 3P73A 2H6PB 3VFRA 1PNDA 2KH2B 5E5LA 4PMFA 4K3AA 3S2AA 1NFKA 1JJUA 3U11A 4Q6GA 5FHBH 4HETA 3QS2A 1AQKL 3CCUV 3DX8B 2JCWA 2JWYA 4OTXL 3ULVC 3N42F 4JYYA 4O2BB 2IGFL 5C9KA 2HJLB 1FYJA 4Y4FA 1YI2V 1NSNL 2EIMB 5FM8A 4GZRB 4X9IA 3WEAA 3MX0B 1A02N 4XI5D 4KJPC 4JRXA 4L8JA 2W07A 1AGDB 3FO0H 1T0MB 1BBDH 2P44B 5EB9A 5IJVB 1N59B 1M6OB 3BQUC 2VR8A 4NXKA 1KECA 4G9FE 2CKBH 4WSKA 5HPMA 4KKPA 3K6IA 4XHJD 3NPSB 3A6BH 1FA4A 4DR2B 1G7JA 1OSZB 2JB5H 1ODUA 4BK5C 4HUMB 3VVWA 1J5IA 3EBHA 3ARRA 3JVGC 4UMGA 4WHDA 1ZVNA 2AF2A 2Z8RA 1CEZA 1KJ3L 1CQKA 1NAKH 4PW9A 3W39B 3WNMA 1AQHA 1GN3A 4LNUA 1I85C 1TEYA 4YL9A 4MTMA 2YEZA 6TAAA 3HN5A 2BWDA 3O6MH 3H3KA 3SY6A 3WTWA 3CSBA 3SGEI 5INDB 4Y16C 4Y1TA 3PWJB 2WHVA 4NUJA 1NFIA 2VSCA 1JHLH 4B9JA 1TQVA 2WSDA 5EEUA 3ZIAG 1FXVA 3WFVA 3FONB 1FNGB 2TAAA 3EO9L 4A68A 1RMFL 2FX7H 1BFVH 1P7KA 3MACH 3B2MA 3F12B 3LHAA 2E7MA 4IGBC 1R3IH 1JN6B 2B9BA 4FXGC 3RYCB 3RX8A 2XFXA 1KB5A 3HUJF 4LCWA 2UUAO 4N0UB 1DVUA 3QIBA 1RUQH 2ZXCA 1T6WA 4RMRA 1M05A 3GZPA 1LYQA 2Y7QA 4G7VL 4MGXA 3ASOC 1WP6A 3OMIB 3JWDH 3QJUB 4HIHB 4PJXE 5IBTL 5ICYB 4QRTA 2V9UA 1RVFL 2VO8A 3ULUC 1JWSA 1QBAA 2X70B 3FB8C 2IPTL 2NXZB 5BPPA 1ZGLM 2WSSG 3MI6A 1NAMB 3QZWG 3PG2A 4MVRA 2IO5A 1RZGB 4FFVC 4UF7C 2OMBA 3VSUA 4KMTH 4AM0B 3S35H 3WY2A 5HPOA 3B1UA 3RYFA 3OD4A 1IGIH 3C60C 5GGQH 4F4LA 4F57H 2L35A 4L4VB 5CSZA 4NNPH 4NXMO 5FYLL 3SKJH 4L8BA 5T1MA 2VN7A 3BGAA 1T0PB 4MMYB 3UMTA 1JXJA 1NDMA 2PYED 4O02H 4IKIA 1GTFA 2ZUQC 3TVMD 1TZGL 2VKXA 3G6JE 2OXHA 3WMQA 1SFDA 3ESMA 2ZXDA 1AI4A 2AEPL 2B3IA 3VXNB 3U1PA 1HCVA 3L3JA 2YIDA 5LNEA 2VWEE 2AV7B 4J3WA 3MLYL 1FC1A 3JD2A 1PNMA 3HKEB 4PP1C 3RA7L 4JR9L 1Y1DA 1M71B 1PLCA 1DGSA 4TV8B 3VI4F 2GKIA 3NFNB 1Q0XL 1CD9B 3KWXA 2X6AA 2WV3A 4JKWA 4RGMC 5LNGA 1N26A 3RY6C 1J0KA 2PCXA 4ZFOB 5CJXC 4ADIA 5K39A 5LGYA 4PHZA 2QT6A 3A0RA 3LPPA 5EU6B 5FW7A 3WFCL 5G5DB 1MCWW 4NZDA 4AQ8A 4FZ0A 4FQPA 4LBEA 4F33B 2Q69A 5A40E 3DRQA 5DHVA 3SDCB 3T4AC 2EEDA 3EJUA 1IQWH 4HIQA 1HXMA 4IU2B 4TUOA 1GGBL 3TBVA 2QJ1A 3CQPA 2CRYA 3LKNA 1WAEA 3IN0A 4RFEA 4GX0A 1UD8A 3AAZB 4PI0A 2K78A 3ESVF 3OKDA 3WDJA 3I9PA 4AL8H 3K81A 1WCBA 1YECL 2BDNL 4Y2OB 2AW2A 2HT2C 3GRWH 3II1A 3O6FD 3D52A 3ABMC 3RL1A 2P52A 3VMOA 1QA9B 4QWWD 1T0NB 3GXNA 1FDLL 3ZMVA 4JYBA 1LO2H 2R2HB 1F6FB 2F8XC 1GY2A 4OGZA 3BWAA 1TZAA 1RH8A 4M7JL 4XB3A 4D3CH 2KPWA 4JFZL 3HC4L 5IEHA 4OBSA 1R3KA 3H6JA 1EFQA 2FMLA 5DJ2B 1MWAA 1ZS2A 2XV2A 3LPWA 4AYEC 4K5LA 4K5NA 1MJ8H 1EZLA 3BAEH 3X12B 5HVFB 3OX8A 4BUGA 2DDQL 4IBQA 4NVPA 3TCTA 4GI8A 1XGUB 3EFOB 4NIYE 5L4JA 3ZMSA 5GSVA 1INDL 1HINH 5E7BA 3UAAA 4MYWB 1A9EA 3MLUH 4XN8A 4NC0B 4G6AC 1NEPA 2FT6A 5AL0A 3V5KB 4DP1X 4N0YL 1NQTA 5LL6Y 3CJJA 4CMMA 2ZJSL 2ZYSA 4JFEE 2XAHA 1R3JC 1PCXA 4YHOH 1F97A 1CPUA 2GHZA 5JW3L 4M9OA 3HAEH 2HRGA 2NXZD 4FFWC 2QVIA 3L5XH 2ICWI 1PD1A 1N4CA 1CQYA 3TXSA 2OJ1A 4IDLA 4FA8A 3GLZA 2CM6A 1GMEA 1IGFL 1FV1B 3BLPX 2A9ML 3K4ZA 1NWOA 2AXFA 2FJUB 1J12A 1QCEA 4QT5B 3ZK0A 3OXSB 4PS4L 3WY3A 1XGTA 2H9GB 4M4RA 1SQFA 5AZUA 3TM6A 3DJTA 5E2JA 5F7KC 4KY1H 3NSXA 1U8OA 1NBCA 1AGCB 2H1XA 3N0AA 2O57A 1XGYL 5CJ5A 2HFGL 5I1CH 2XTJE 5HFMA 3RVUD 1NC2A 4OM1H 3AUWB 3ILQD 4X80L 4GP4B 4RMTA 1Q9LB 5IYZA 2VITB 3U0PA 2R1YA 2P80D 3C5XA 5D1ZA 1GYUA 4Z0XA 5IHWA 3DOHA 1OGPA 1WIPA 3ESUF 4L0PB 5IWLC 2EILC 2VZTA 2X1WL 2DF3A 1VQ4V 5GRVK 1WAPA 3CFBB 2ED8A 3MBWB 3OSVA 4C56D 1HH9A 1DO6A 3I6KB 3K6SB 2OQJA 3F7PC 1ZEAL 2MOVA 3T8MA 5J7CC 3KCWA 1URZA 4RLDA 1BQLL 2LFSA 4WF9V 1OARL 2FBJL 1NDTA 3QZWB 2PNDA 4P4RB 1CD1B 1E7UA 1OTSD 4BCYA 2LFGA 4JPVL 4C4KO 2NUTB 2YK1L 5AD0B 4QJ3B 1SJMA 5KJ7E 3OD3A 2F1MA 4AVIA 1WJZA 4JJ5A 1HJCA 1W0VB 2UWEF 1MG1A 3L9EA 4NN5B 3FB7A 4UYQA 1T1XA 3L3OB 3GRBA 2KYIA 2ZT9C 4PEEA 2YXYA 1NPNA 3TC9A 1W72H 3LRLA 1XCWA 3VW3L 2QKIC 3IS0X 4G5AA 1CURA 2B2XL 2BNRA 4TQ8A 2VDQL 2M7WA 4LGPB 4XGZB 5AFAA 5IFAH 4DGYL 3LIZL 4XOBA 3TASA 1EQWA 3G5YB 5KS9E 2R0ZH 2DQEL 2OTWA 5IBLC 3GMPB 1CG9B 4PW4A 2ADJA 1RUMH 3MODH 3H9YA 1IKFH 1KB9J 3QDAA 1BOGA 2VQTA 2RCSH 5GGUA 5IMMB 4MDIB 5CEZH 4HS8H 3FCTB 3BUYA 3RTQC 2K70A 4PJFF 1NTMH 2X4QA 3WDIA 1AFVH 1N36O 3CXHJ 1HDJA 1MZYA 2VDOB 3T0EE 5L2JB 3FYIB 1DZBA 4DUVA 3KZ8A 1HU8A 5CBHA 3RAJH 4X1YA 1PG7H 3RWIA 2G4EA 1HNZB 4ZO9A 3D85A 2Z91B 5T1DL 4Z1MG 1U8JB 3V4PB 3ZYJA 4R7CA 1T1ZA 3AW5A 5GONB 3VXOA 4PJGA 5MEOB 5JHDB 1R3IC 1N19A 3R06A 1ZGLA 1CXHA 2BMKA 1P5UC 3D0LB 3QZNA 3IGAC 1KIRA 1JNJA 4FQQA 4JO2L 1AJNA 2OLDA 3QUZD 5D7LE 1UACL 4PV1B 3S34H 2YOCA 3REWA 2AZAA 1NBVH 5KVEL 3T1WA 2E9JA 1BEYH 3ZY7A 4BQCA 4JZNA 1FLRL 3JWDC 5E0FA 4XP1H 2FQDA 4POZD 3TCXA 4JKPH 4DNLA 4B3MB 3FQRA 4TSBL 3EH3B 3PWVA 4KJQC 5EU7E 5IG7B 4J27A 4PJ9A 1IM3B 2WCSA 4OAWA 1MZEA 2YIBA 3HI1B 3K8LA 4O4JB 1E4XL 3SPCA 3DIFA 1M4KA 1M9WA 1ZS8A 3GWJA 3KHOA 3D18B 4FLOA 4J3TA 5A6MA 2ENJA 4XO3A 4M7KL 3EYSL 5TDOB 1ZCRA 5HI5C 1KJMA 1C1EL 4D9RE 4RA3A 2R59A 2NY1C 1L9TA 4Y0GA 5ERWB 43CAA 4ZTOL 1LWRA 4RNRA 1DCEA 3EG9B 2EIMC 1NMBL 1JMZA 1QFWH 5D7IF 2ZG1A 3TIDA 2A0LC 1V3MA 4YHNA 4BZ2H 3K2MC 3IKKA 4RWYH 1INEL 1JQ0A 3SN6N 2LU7A 1KBWA 4D0CB 2GTAA 1YC8A 4OZFG 5DFAA 1ITCA 3QHZH 5D7JB 5ICUA 4GXUM 5EUOB 4OQTH 1EDHA 3OKYA 1KXQE 3B8YA 3NPSC 5GGRA 4WUKL 4F7EB 4NR1A 2XJLA 5FYKD 1TF4A 4DZBA 3CFDB 3LMJL 3ARUA 2XIBA 4L3EB 4K94L 4K8XA 1G1KA 4H0LC 4QO1A 3AVEA 3QJZA 4N1EA 5DS8A 2Q7HA 5GRJH 1Z9SA 2WTRA 3BIKB 4QRQA 2NZ9C 2UZYA 3HLAB 4Q6IC 1W0JG 4LF5B 2KDYA 4HOWA 4UTAH 1JDDA 3BP5A 1AIFB 5IB2B 1E27A 3MBXH 5EOCL 3D8CA 1JVOA 3HFMH 4Y5XA 1BHAA 2EH8H 4H88H 1IGMH 5F93C 1P4LB 4GRWF 3H0TB 5ENWA 3MRHA 4M8QB 5EO1B 1J0JA 5CZKA 3LRGA 4HIEA 4NQEB 5D70L 3D39A 3CRQA 2VDOH 3TO2A 1KCKA 3X13B 1KYOK 3G67A 2C4XA 3IDIB 3SDXA 2JKTM 4JCWA 5H2BB 5LHDA 2EE3A 3L08A 1KCWA 1Y07A 1NEUA 1J11A 2EIEA 2F66C 5KJRL 3BFQG 2Q7NA 3SCMD 2PWEA 2O5YH 1CICA 3CFIC 3IGFA 3QEGH 2EXSA 5AKTA 4FQXD 4AL8C 1TQBB 4K3DH 1PLBA 4MD4B 2F93B 3O2WL 1I9RL 2ZE6A 3IGKA 4PJBB 5EBLC 1W8OA 2C1OA 4JHWL 3H1KH 4YY3O 2QWPB 3RWFA 4GBXB 3ZT7A 1BL8A 5ID1A 5A43C 2V7NB 2BSCA 3P02A 4YXHH 4U05A 4KV5E 3ROLB 5AG9A 1Z6JT 2R56H 3LEYH 3T0WA 5IJDC 1JNNH 1NH2D 2Y3NA 1R1BA 3D0VA 4ODSH 4J3UA 1A6TB 5JHDD 4MNGE 1S7XB 4OTXH 4Y4KB 2IDUA 1LE5A 4BFOA 2P5WB 1J5EO 2EIZA 1A2YA 3VBBA 3BH8A 1NFDB 1NSNH 1A5FH 3P30H 5J6HB 3F5WB 2DIJA 3BRGC 1Y18B 1H8LA 5JPNB 5F9WB 5I1IL 3ZOAA 4KNUA 5BRZB 5AVVB 3TF7C 3HE6A 2V5SA 3BAJA 1IM3D 2R8SL 5FNVB 2XQBH 1XNRO 3NT0A 4N2DA 2ARJQ 2JJTC 1AD9B 4YIPA 2QADC 2HG5B 2BM3A 5T3XD 4DVBA 4R4BB 1JZHA 2XKSA 4J4PA 2P22C 1ZOXA 1TGOA 1UD4A 3Q6FA 4UQ3A 4WWKB 4YHLL 4F6EA 1E8XA 2W6IG 1F90L 1KJ3H 3R19A 4LDLB 4NS0A 3U83A 1UWEH 3KPRA 1OGAA 3FRUB 3O41A 3W57A 1TXKA 2YD1A 5ITZA 1E5ZA 2DLIA 1CFVL 2ZD0A 3DSFL 2H1LM 3NP4A 3DHUA 2UUCO 4FP8H 3ZL1A 1LQSR 1MLBA 5FUOL 2AJYH 4FGMA 4OFIA 4JM2B 4MW3A 4IKKA 2VW6A 1ZV2A 4K07A 2YGNA 4F8QA 1VSCA 4P06A 4XO5A 3GJFK 5E24E 3IFXA 4OFDA 1U30A 2F74A 3EZ8A 1XHHA 1YJDL 1MH5B 3HUJA 3L2NA 2ICWJ 3SDCC 3SKOB 4JTCB 5EA0L 3NIFB 1RMFH 4LLQB 4UT6L 5CGYC 1AIZA 1JMXA 1SS3A 3AG7A 3S96B 5JXEC 4RQFA 3DMMA 4TS6A 1CYWA 5TFSH 5L88L 5FL7G 5HBBA 1QSFA 3FAWA 4JFFB 3A47A 5IK3A 1A7PL 2E7HA 2X9XA 5GTHZ 4LB8A 4G7VH 4ZW6A 3WHXA 1UM6L 2LLNA 4L8CB 1R6VA 2BNUB 4Q89A 3ECBA 1OZUA 4XWOC 4XH2B 3QZMA 5EC2B 3DTXB 2B5UA 2B14A 4NQED 3SDYH 4OZGA 1RVFH 1DL7L 4HK3N 1EHNA 2A6KA 1OV9A 2Z8VC 1VQOV 3MNWA 4HH8A 4YSTA 1LQBC 1MCCA 3WNLA 3KPOB 2F7QA 1KFGA 5GHWL 1A7NL 4OZFB 3QWOB 3BFOA 1KLFA 3IWUA 2AC0A 4FM2A 1H8SA 4WWPA 2V0AA 1AI1H 3JBG7 4J8RA 4M8VA 1SF3A 2O6FA 2JVUA 5IVZA 4KUMA 2X4NA 1FXKB 4XX1E 3X1EA 5E1AC 4UVAA 1RP9A 3FBQA 4HCRL 5J9PA 3Q48A 4U1SA 1N5AB 1JP5A 2DLGA 5FYLH 1L4IA 3RPKA 3VG0L 1MA1A 1Y76A 4GBXD 4X7SH 3M1CA 5I1AA 5BZBA 1FG9C 5KAQG 4H40A 2KQNA 4UDUB 4TOYL 3W1ZA 5KZCB 4Z7UF 2EYTA 4BE6A 2HHHO 5EU4A 1LO3L 2HLDG 5F2VO 4BCZA 1RSFA 4ELMB 1AD0B 2AEPH 4NYLA 1NGQL 3VI4A 3EFFB 2GFBB 4OB5L 2LAAA 4ZW5A 5KSAC 5DWUL 4Y4KD 5FUCE 1P69B 3OGCC 3DVNB 2QPFA 2IV9A 2P5WD 3HG4A 3JARA 4L1BA 3RA7H 3L16A 2JTDA 3CIQA 4ZHQB 3BAYA 2ODHA 5IKCA 1LEGB 4G2KA 2FJGB 1P7QA 1Q0XH 2FB4L 5D1XC 1WEJH 1M2OA 1LEIB 2K7PA 2HFTA 1KG0B 1HL4A 1E8WA 1UOVA 4EO5A 5D5PA 2ZNJA 4I50B 1CF8L 2DM3A 2WO2B 1S8DA 2F5AH 2XBDA 5ABZA 2AJXH 1UWXH 5I73C 4CDGC 2ZCHH 3T2LA 1GA2A 5ESQB 5DRNA 1B3QA 3CFUA 4ZAKB 3TZVB 1AKJB 1TJHH 3RVWC 3SGDH 3MV9A 5KAIZ 4ZXBA 3KBHE 4NGHL 4JHUA 1KIQB 4BFIA 4MHHG 1E2ZA 3ZZQA 3PHSA 2HMID 1FO0A 2X44D 2WXNA 4QYOB 2ZXGA 4XXWC 3T2QA 1PZBA 4WWKD 4MMZB 4HS3A 2XWDA 4PREA 4YDNA 3D3VE 5T1KB 5HDRA 3DO7B 2WXMA 5T3ZL 5J2UA 1IBBA 2W0KA 4MKMA 3V4VA 1YQVH 4UQ2B 4LLVB 4QNPF 3HC0B 4BIKA 1UUNA 1A1OA 3H9ZA 4AEFA 2BTQB 4U1KA 4GFXA 4S0SD 4XNZB 4Y2LA 5AW2B 4F24A 4ZOLB 1HNWO 2O4EA 2R2EA 2B20A 4LPUA 4PRHB 3HPLA 4G70B 4L5FL 3OAWA 3SE3C 2XHBA 3P4MA 1UC6A 4M7JH 4NN5C 1BM3L 4GKZB 4JFZH 3HC4H 2CAZC 1MHCA 2HRHA 4GT7A 4MXQD 4KQ3H 3CX2A 3U1SL 4N28A 1NMAL 3MLXL 4FYTA 2R4RL 3SD5A 2CTWA 1EXUA 2UUBO 2VDQB 2YQ3A 3Q2NA 2MQCA 3P3UA 3FAVA 4YSSA 1K7DA 5CAYB 5CIPH 1IKOP 1CXKA 4X64O 1ZK5A 3BRDA 4F37K 3J2PA 3CBRA 5H35A 3PGFL 1MLCB 2H32H 5LA6A 3ABZA 3S97C 2H45A 3MRLB 4GO6B 1RUKH 1UM5H 2ZNWA 3NZSA 1JWMA 4NHCL 4N0YH 1TFHA 2FD6L 5DDHB 1X3DA 4QY8B 2CXGA 5ECJE 2ADIB 3BT2L 3KYMA 4JZ2A 4NTYA 3W11D 1BVZA 1BWMA 2IXQB 4DV0B 1XREA 2B1AL 1WB8A 3FQ1A 1SDDA 2HTLD 4W70A 5JW3H 1J95A 1G9ML 3CPLB 3FFCA 3I6GA 4R7LA 5C0EB 5IOKA 2ALWA 1UXSA 2NR6A 5FM5M 4ABVA 4QGPA 4B27A 4XNMA 2A6DA 3UTOA 2YD6A 3CBKB 2V2TB 4TSCL 1IGFH 1TMCB 3IDMA 3QIUA 3I2CH 3KPPA 2OJEB 4OI9A 1P5VB 2LHAA 3KPSA 4FQ2L 3M45A 4PV1C 3KPQA 2OSWA 3IXAA 3N41F 3IB4A 4ZMYA 1EJFA 3IF1B 2Z7YA 4LCUC 5HHOE 5BO0D 2E47A 4X1KA 1QHTA 4MXVF 5L4FA 4RUEA 4X20A 2ZUTA 3ULSB 1QW8A 3KM1A 3PDDA 4ZI8A 1G7IB 3QQDA 3V6ZA 4YBLC 3Q3GB 4OZHF 4LCYB 5CA0B 2R0LH 1QFPA 2ROXA 4YHKL 5FA4B 2IFFH 3IGUA 1TITA 4HWBA 2UZXB 4XAWH 5B4MD 5JW4N 5KZCD 2LOEA 2OJZL 2VTFA 2VLLA 2WBWB 4WO4A 4X80H 5KYWB 4PLOB 5IHLB 3W7UA 3B2XA 4GUPB 1INQA 1S7WA 1JYNA 4MA1B 5KHHA 2QSAA 3UABA 1JFFA 4LNVA 3FT9A 5I6MA 3VFMB 1U33A 3T3MF 5C0FB 2X1OA 3MOBH 3PQYA 4PH8A 3OUFA 2COQA 3B7YA 4HT1H 1ZEAH 1RUPH 5LYJB 1BQLH 4NZ8A 1OARH 2FT7A 2A74B 5T5NG 3P0GB 1MCIA 4O2CB 1DTUA 2FDBP 3DROA 5E95B 2UXGA 2C7UA 3S0PA 3OHXA 4DO6A 3CYOA 1XMOO 4U1HB 5DJDA 1G0YR 7TAAA 4WWOA 2ZIDA 1AGFB 4L9DA 2EH7H 1KUQA 5FPRA 2FRGP 3MQIA 4I3RL 4UXNA 4DR7O 2NNXA 4RMVA 1SFHA 5CN0A 2BC4A 5JPNA 2WQRA 3F7YB 2DIBA 4MJHA 4ZAKD 3BO8A 3FTGA 2WLLA 2AQ1A 5I9QB 5CP7A 4KVCL 3ZE1E 2DQJL 4TMPA 1DQQA 1FLTX 1SQQH 3VGHA 1W59A 2B2XH 3QUKA 1JHTB 4JUTA 4PJFA 4YOKA 4G71B 1Q9OA 4PJAF 1OVZA 2J1ZA 3MUUA 3IJYB 1FCGA 2MKWA 1IFHH 2ATPA 3BN9C 3X3GH 3IPEA 3HCVA 4C83A 2YJQA 4H0IA 3VXRD 1LMKA 1NANH 4XXDB 5I8KL 4PRHD 4HCFA 3UTSA 1VQ5V 5E6UB 1MCRA 1D2DA 2HP4A 4WENB 4YNYA 3WHE1 1EEYA 2JK5B 5T1DH 1OLZA 5B38G 1CL7L 5BZZA 4S1SL 3WJMA 4DIXA 4PVNA 2C3HA 5B1JC 1DVSA 2A38A 2F53A 3EAKA 4PJEB 1B90A 2J55A 1QQDB 4JDZB 1N6UA 4LSSH 5TDNA 5GS2D 1VQNV 1SVCP 1YSCA 4JO2H 3IDGB 1TQBC 4DEUA 4F91B 3CD4A 3DURB 4JQXA 1MAML 1VLXA 3O2DH 4ELKB 1WFJA 1FLRH 3E35A 1K3IA 1SMAA 4Z7NB 3M8OL 1CGWA 3CP1A 3CVDA 1KTKE 3DHPA 4TSBH 4C56E 2PF6A 4X7CC 2WZ6A 1Y6NR 1YNKL 2WZ0A 3NSYA 3N2GB 2GBOA 3UX9B 1A4AA 4G8EB 3VE0A 5DSCB 4O00A 4RAHA 3MBEA 5D7IA 4Z7WE 4WV1B 2O61B 2C8NA 4Q9RL 5JO5B 2XBTA 2XRAH 3UBXA 5GGSY 2IJ0C 1UQSB 2E5LB 2FH8A 2Y7SA 4UB0L 4PWHA 5E9DA 3KVDD 3DX7A 3WAJA 3TNNB 1NMBH 2Q5BA 3MNVB 4Z8FL 2VR3A 1JUFA 5FK9B 3NZHL 4OLWL 5I6NA 1G6RA 3F5WC 1G1CA 5E8NA 5DJ8A 1NL0H 1BBJA 4WQOA 3GJFA 1F02I 1UH3A 3NFPA 4ADJA 3N1FC 1ES0B 4BBWA 5LGUA 1ECYA 2V6HA 3CC1A 4G6KL 2BTOA 2X1PA 4KDTA 2F54E 2QQQA 2DB8A 5D5MB 3TO4C 3NIGE 4IBLT 4UZSA 4F15B 2NY4B 9CGTA 3ZVVA 1EZUA 4FK5C 5KYXA 3FOMA 4RISL 1ZX3A 4R90H 1IRAY 1CBJA 2VQ1B 4ICGA 1BQUA 2CTPA 3FU6A 4GB9A 4D6TH 4W9EC 5EOCH 1YEIL 1TJGL 4L9LC 4NNYB 3H1ZA 1EAJA 4JM2C 2FJFB 4BSVB 4Y5YC 4DV6O 3VCLA 3L1FA 5K9OA 4MCMA 4J3BA 3N40P 1KWGA 1K3EA 1EO8H 4N8CH 4X5XA 3ZBMA 3HEIB 5LB1A 1TFPA 5F72S 4Q9BA 3ZQXA 3OKEB 5JW5A 2XPGB 5IMLB 3WNKA 4FTVA 4PGEA 5KJRH 2R9HD 1GCFA 1ZRUA 2B59B 2QGDA 2VR4A 4F93B 1ZD6A 4IBVA 5MI0C 3OTOB 3H1HH 1XV8A 5EU5B 4YEFA 1SESA 2NX5D 3WMPA 5C3LD 3VD7A 1I9RH 3CPWU 3K58A 2CLZB 3NUKA 1MCHA 3O3EB 1CGSH 4JHWH 1WISA 1JZDC 1F23A 1ZHNA 4L4TB 1B0RA 3K6OA 4WI8A 1E5CA 2I9TA 3W5NA 2WB7A 3SHSA 1IL1A 5E0QA 4JQVA 2ZOLA 3QULA 3VFOB 1U42A 3VXSA 1A4KB 2RQ8A 3FO2A 5HHME 4JI6B 3D25B 4AQ1A 1DYZA 1QBML 1C5DB 4LKCB 2RB8A 3LAFA 1XD1A 1JK8B 3OJDA 3QNZA 1OKEA 4X50A 1FVDB 1HR0O 1KGCE 1I7UA 5J12C 2DW4A 2UXBB 4WI3A 5I15H 3GVMA 1T1YA 3GIZL 3MRGB 3AS0A 4NZTL 3FQTB 3ZSSA 5LKNA 2Q20A 3NESA 1QG3A 1QVGU 3FCBA 1N6VA 4W9HC 3WN5A 5I1IH 3T77A 1CDBA 5D2NA 3HLKA 4M5YH 3SJVB 4ZIBA 3DXAA 5I1EL 4M02A 2FSEB 4PGCB 5LGJB 4P2QE 4N6RB 4BYHA 4ZUTA 3P3TA 2WN3A 3MLZL 4KK5C 3VRLE 1LE9A 4R83A 2Q6WA 4N5UA 4UINL 4DOHB 1QRNB 3SEPA 2PGGA 4GKOA 1UB6A 4PJ8A 1MZZA 1F90H 4GIOA 5B38B 3I56V 4FFBB 4H1LG 4NXSA 2TSBA 5AUMA 3JQOB 3ZHDA 4AM0Q 1JCVA 4X8JA 2OK0L 1GM7A 1DVFB 3BQVA 3HG1A 3R1GL 4JG0H 2GY5A 1CFVH 4EIBA 4RAVB 2ADYA 2ZQKA 1AHMA 4HHWA 1FFPB 2XG5A 5D96B 4DGVL 4JFYB 3WS3A 1PS3A 4X5PA 1TVHA 3NTCL 4A2EA 4Z77B 1H38A 1J1OH 2WO3B 3D7PA 1H6TA 2YAPA 4UM8A 1SHSA 1HHGA 3E38A 3MRQA 2J5WA 5ICXB 4IBTA 2R69A 3CC2V 1K5NB 1AAJA 1FHGA 1X5ZA 1YJDH 3I84A 5G55A 4MJIB 3TZVC 4PUBL 5JWPA 3ATAA 3JWNG 4ETQA 3EHBB 4HC1L 4GY4A 3K3QA 2NY4D 2DWSA 1IAOB 3SPVB 2ZX6A 4KO5A 1N68A 4IS6A 2BIQA 4FFZA 4LSRL 5HHNB 3EOYG 4YHPB 5L88H 4YZFF 3JYCA 2XTLA 3NCCB 4FYSA 1F11A 4NN7B 1I7FA 4PG9B 3Q8AA 1A7PH 2ENYA 4AEHH 4I0XA 2VISB 2HB0A 3I02B 5AG2A 1GRWA 1F4MA 1BAWA 4YPGA 1KDJA 5B8CC 1PU0A 2PW1B 3D87B 5H94B 3MRIA 2OTUB 2P8PA 3O2VL 2CH7A 3ECQA 4LWSB 2CGOA 3QT2A 4HHAB 4Y1AB 4XCEB 4B3EA 5DC9B 1KENH 1KJ2L 1QRKA 3FCGA 2LVEA 3THML 2HT4C 2OXGA 1T7VA 1TVKA 1W6LA 4ZMNA 2YS8A 4HLJA 1X5LA 3FTWA 4M93B 4LPCA 1Q82W 2UY7B 4MQTB 4LCVA 4L8SC 5D2LE 1SOXA 3PIQB 1JNLH 2EDYA 1J0IA 4RFNB 4QXGH 4ISVA 4M62L 1TTCA 2BOBA 1ECZA 2C2AA 1W15A 5IMKA 1Q6IA 2CHZA 5DI8A 5E8EA 3E86A 5TH2B 3GSOA 5C3IA 3E6HB 3PDOA 3ZGHA 2P5EB 1AO7E 4PJ7E 5KBPA 5T3XE 3BZDA 4L4TD 4L29B 1HJBC 3QGVA 1NINA 4JI2O 3VXMB 4DV5O 4MS8D 5LXGL 3E22B 1EH9A 5GRYA 2I9LA 3DECA 1Q72H 1HQ4A 3BWSA 1MVUA 1MUJA 4UUJA 1FVEA 1NGQH 4QHLB 2G9KA 4JY6B 3LDCA 4XNUH 3BRCA 2O5NA 1SPDA 4NYKA 1I7TB 1EBAA 2HLFD 4ZUVB 3H01A 3UG5A 3B2VL 3AABA 4ZMXA 3ZHKA 1IBDA 2A6IA 5MEND 1DN0A 2YA0A 4FZ1A 4ENEC 5J1TC 3QEQE 1ZXQA 2FO4B 5CMAA 5CFAA 4J5VA 1HQRB 3O4OC 2CHDA 2EDFA 4DR5O 4OR1A 3FB5A 2Z4QA 3T0VA 2YN3A 3SJVD 5C70A 3KPTA 1FORL 2EEBA 4LF6O 3V4UL 4XP5L 1XCQB 3VFSA 2IIJA 2OR9L 4I2XB 3S5LG 4KROB 5H37H 2VWEC 4GG6E 3CC5A 2G3XA 2QE7G 4KBPA 3BOVA 2QBWA 3F7VB 5D7SL 3EOAA 5FOBA 5D6CB 1M7DB 4DH2A 4LF8B 2XI9A 3VGGA 2DQGH 2XYCA 2G9HA 1R6TA 4JJOA 5LNDA 3CVHA 2W0PA 1JV5B 3PHOB 1T83C 4X6BB 4Z7AA 1DVFD 2NLJC 1ZL8A 1ET5A 3B40A 4FG6C 4BA8A 4ORGB 2OMZB 4FADA 2DLFH 4LLAA 1GIGL 2G2RB 3CZGA 4XVUC 4X9HA 4DP2X 2IGTA 1MMMA 2GAZA 2VQFO 3FFOA 2BSBA 4PY7B 4L5FH 5DFWH 4DN4L 4DGUA 1JZ7A 1U8CB 5GZND 3F7YC 3DETD 1BM3H 3DUHA 3U1SH 1DLFL 3TJEL 3HS0C 1W6WA 4X6DB 1N9PA 2WBJB 3UPRB 2EIJB 3SYAA 4ZFGH 1Z5WA 5T3ZD 1A65A 1KOAA 3KLDA 1XTLA 3SKMA 4ABMA 5CBGA 2OTJV 1QATA 4I7ZC 2VMEA 4FNRA 5GGTH 3TJHD 1QU7A 3FRPA 2FEEL 1LO5A 3AT8A 2OMVA 3WD5L 4H1LB 1IBKO 3EYQC 4WWID 2VE6A 5MEPA 1NUGA 4NQDA 5J6GA 3BT2H 2IPKB 2H1PL 4MA3A 4OD3L 4PJDF 1KC8W 2B1AH 2VR9A 2YPLB 4ZUSA 1GGTA 1W0YT 1G9MH 1LUVA 2NT0A 2K7QA 4HJGA 1QACA 3E80A 4ODWB 3E8GA 5C0CB 4BWTA 1UURA 1X5KA 2RAMA 4RBPK 3DPBA 2JIZG 1C16B 3ETBF 3JWOL 1Z9MA 5SWZD 4RWUA 3DX1A 5GS1C 5A16B 4AJWA 4QPEA 3QB7C 2UX6A 4FQ2H 5CZVH 4OZHA 1D6VH 1QABA 3JCUZ 2Z4TA 2O72A 5F1NA 3AM8C 4EDXB 3UT5B 1LILA 5EG6C 2PKDA 4PLKD 1LK2B 2NYKA 4J41A 1K33A 2I85A 3SE8L 4J39A 3VFRB 4P3DB 5F0PB 1QLRA 4YHKH 5HJBA 4NSKB 2QWRB 1QFUL 3KH3A 3EFDH 1IBZA 1WFUA 3UTTB 5EC1A 3WKML 2LVCA 4HOMA 2GDSA 2WXJA 4HKJB 4XPTL 1MFBL 1UATA 4ZW7A 4KVPA 3RFZB 4OKVA 2FHCA 1GS7A 2JCCA 5E9NA 4QRPB 3QAZB 2IPUK 1KN4L 3Q5OA 4WFFA 4YWGL 4JANB 3GEFA 2GJZB 2Z1PA 4RA0C 3D33A 2Y1YA 5DO2D 4FLRA 1DSFH 4IRJC 3ATEA 4BGLA 2KS0A 1BYNA 1GGCL 3CDGB 4JZOA 5CBEA 3HG3A 3IXTA 3NEEA 1BQHA 1A6WL 1ZAUA 1NKDA 4K0KB 2XTJC 3UGXA 4YHYB 2WLJA 2V9QA 5EWIL 4I3RH 4AW7A 1FNHA 3RVTD 4XBGB 2R29L 5KS9F 3ARDC 5IM7A 2I27N 5BOPA 1OO2A 3GUTA 4UTCA 4MB5A 2EX3A 3BZ4B 3E8BA 2WYZA 3NJNA 4UCTA 1D5BA 1NM9A 4RQQA 4EOWH 4ATTA 1N64L 2JJ1G 1ZK9A 2BVUA 3QFDB 4F15C 2DQJH 2I24N 5CLTA 2OYQA 1ESOA 2YPVH 5HYSA 5L6YH 1EVUA 4U7KA 4XO9A 1L0QA 4LNUB 4HNAB 1QNZH 3ORJA 2CTRA 15C8H 5BUAA 3QDGB 5LXTA 2EXWD 4PD4J 5ACZA 5T8IA 1KXVC 4XP4H 2K45A 3F6LA 2YSUB 2DQDL 4NO5A 3SE6A 2YN5A 4WEBL 3DV6A 5EIVA 3PY9A 3W0WE 1MCDA 2F1BA 5GW7A 5BMVB 1WE5A 1NDGA 2ZOUA 3BP4B 4G43B 3DVIA 4LK4A 4LF4B 3ZHTA 3DVGA 4U31A 2ZNIA 4CZZA 3Q9QA 4CN4A 2HLAA 3UJTL 3VX1A 2DYRC 2ICEB 5LMNO 2QKAA 1P7KB 1CL7H 1AZBA 4OFYA 1AJ7L 3WDHA 4S1SH 3S7GA 1FS0G 1A21A 1VEPA 1NLBL 4DZ8A 2VN5A 5DUBB 1F6AB 4JV5O 2WBJD 3MHZA 4BFFA 5DC4B 3S5LB 3IAQA 4HEME 4Z9KB 2PW2A 8PAZA 2DYSC 2OA9A 5IWAO 1ED3A 1A6VL 1OGTA 3GF8A 5T33L 4HALA 1V8HA 4UQAA 2VXTH 3KXFA 3WNIA 5A2JH 4JQIA 5K1JA 4H37A 1HL5A 4G8GD 2VZSA 5JHLL 2FNWA 4YSUA 1L8DA 3IDYC 1VQ7V 1J9SA 4I5BA 5L8LB 2OL3H 2XWCA 1Q94A 4BK4A 2CK0L 2YPLD 2ZM6B 1WT5A 1YN6A 4IOIA 3OR6C 1UT1A 3ARYA 3L2LA 3OZLA 5C0CD 2CLRB 2XWJB 3EJJX 3ASNC 1CGVA 3DWTA 2DI9A 4GKNA 1AXTH 4M8RA 3N85L 3KCPA 4W6YB 5IVNA 3M86A 2JKIS 2ITDC 1MQKL 3BAXA 5AKVA 3KGSA 2LR4A 5E00A 1GN2A 2J7LA 4Z8FH 1Z9OA 1I1AA 2RMNA 3D2UA 5CSZB 4D8PB 1RFDH 1UD6A 3E2HB 3NZHH 4OLWH 3MO1B 5LMUO 3OMNB 4MVMA 5FO7A 4R50A 5EU7C 2WLYA 2HPOA 2DWDA 3TBYA 4B9FA 2D8KA 3HR5B 5HHQA 2B0SH 4AZ8A 4POYA 1ACCA 1JRHH 5JZ7C 1AHWB 1JWUB 2QV4A 3DX6A 1G7MA 3IMRA 4MVBD 5BZDA 4Y2DB 1K2DA 3QE5A 2A1WL 3BPLB 3UTTD 2W80C 3DGGB 2QTEA 1FP5A 2GUZA 4JMNA 3VXRE 1VPOL 3GMMB 1WYJA 3SDAC 2PABA 2YUWA 3KR3L 5F1OB 4KI5E 4QRPD 1G5GA 1SM3L 5AW1B 3TN0C 5JA8B 4QOKB 2Z31B 4Y4FD 5HHPB 5A2IH 5C2UB 3A0HZ 4YDKL 3L3HB 2VLKE 1WBXB 3UTZA 2N0MA 1GOFA 1T5EA 4YO0B 3SDAA 3WFDL 1GHFL 5EO9B 1CXZB 2XXMB 3QUYB 3H6AA 5B1OA 3AS1A 3F2LA 3Q5TA 2A9AA 4AYFB 3HI5L 5K39B 5D1ZI 3JALA 1PSKL 2G5BA 2R0WH 1LO4L 4OF6A 1CE6A 4M43L 5D7JC 4N22A 2ADGA 4LNRB 3LH8A 4BELD 3BKMH 1JG9A 5KSBE 3EHBC 3RWRD 2V7HB 3QWRA 3K1DA 4WJKB 5GS0D 4X65B 1D6EB 1F1AA 2AMGA 4MNHA 2RQ6A 1VEWA 2WC7A 2Z35B 1A7RH 3BEVB 3QDGD 5GPRA 3Q13A 3U9UB 4NN6B 3K5LA 4LAQL 3X14A 3IAPA 43C9A 2UXCO 2EDNA 2WKLA 4FQJH 4H25A 1OP5H 2F19H 1WUZA 3BUPA 3V7AE 2JLPA 4LFCO 1GM9A 4FABL 1KJ2B 3E7JA 2AK4A 4LLMA 3C6SA 5E99L 5F9JB 3K71A 5DQDL 3S3XA 3QORA 5AWNH 3MXVL 3H1JH 2DQCH 2HVJA 1QBMH 2GSIA 3PGDB 4LFBO 2YXFA 3MRCA 3CDCA 2VNCA 1RM1B 2X5PA 2B9AA 3NSCA 5E94A 2HKAA 5AVRB 3QIBD 1LEKA 3VMPA 3CMOL 2DH3A 4H5SA 4DP9X 2G3ZA 3GIZH 3KW8A 4JI1B 4LCIL 1KV3A 1ETZA 4CGTA 3FU8A 3ROOA 4N2FA 1XSKA 4MAYC 1M1XB 2P4VA 2LV4A 1T04A 2YSSA 3JAMN 1B4RA 1JPFA 4EB6B 1S7VA 2V5MA 2VXVH 5FGBC 2NDFA 2BP0A 4N0FA 4BHUA 2RN9A 1L9SA 1SDYA 3T4YA 5EBMC 1MCFA 2XOKG 5CR1A 4JK0D 4CA4A 5JOEA 4JS7A 1SRDA 1ZMYA 2ZYRA 3ARSA 5D93C 2VM4A 3KPMB 1UUSA 2BVYA 3PJSA 3LS5L 2WIIB 1T66C 2ITCA 3IMWA 1ZGLP 3UJJH 2OK0H 2YOAA 2C4FU 1MREH 3VFVB 1R5IB 1MY7A 2C5DC 4X9BA 2CALA 2VSKB 5IW1A 2GEQA 1S9WB 1JPGB 4W9IC 3WELA 4ABWA 1KLUB 1U8OB 3IWVA 1B4TA 4KKCD 4U1MB 4APXB 4O51A 4FFYH 2ZP9A 3QRLA 4JE4B 4Z7VA 4IIQB 5I71C 1BMWA 4H44C 4JDVA 2F54B 3RZCA 2NX5E 2R1YB 4JI4B 4Y2DD 3KYNB 3P9LB 3O11A 4LOVA 4BKLA 1FH2A 4KROC 1YEFL 1KPUA 4PWJA 3HS9A 3KDMA 3TBWA 4HC1H 1J86A 3EBIA 1RZIA 3EYFA 1ZIBA 3TYFB 2NY2B 3F7KA 4OCRL 4LSRH 2Z31D 3PXHA 4QOKD 1E1QG 5MHSD 4MTFA 2W5PA 3K5OA 4M03A 4BKSC 3JTTB 1KCUH 3MAQA 1I3RB 2HTKD 1NCWH 5KG9A 2ZF9A 4M61A 4KGLA 4NQSB 3QUYD 4MX7A 2D7MA 1OTUD 5AAWA 4HXBL 5I18L 3O2VH 1I1FA 2LT9A 5DR5H 2MPAH 5JH7A 1T22A 4LLWA 4WDIA 2PCFA 3C8KB 4E0RA 4PRDB 1M2VA 2H2PC 3E8VA 5J4MA 2BNRB 2J6EL 2A3QA 2ZX9A 3EJSA 3CIAA 3L71H 3PAYA 2Y2TA 3SKNB 3H1IH 2ZXWB 2EIJC 2XQYG 1G7PA 3UZQB 4RX4A 2OTWB 1UA6H 2CAKA 2XA8L 3UAJA 3SYCA 1CDUA 2VL5A 4I88A 4M62H 5FLXN 4NQUA 1XIWC 1BECA 4PDMA 5H9CA 2FHFA 3BUYB 4A7VA 2X2IA 4GPVA 1TDQA 3ABKB 1CN4A 3FUNA 4UWQB 1GRJA 6FABH 4TKWA 4DPBX 1DQIA 5TQ0L 3F8UB 2KL6A 4HHGA 4Z3HA 3SBPA 3QFJE 5LXGH 5H4YA 3KPLA 1NWPA 4WGKA 3RUGE 3GSQA 1RURL 1E42A 3WLBB 1SC5B 4HYOA 32C2B 2FVNA 2FWOB 4JN1L 5HY9A 4EBQL 5A7EA 1ZGLB 1P6FA 4FQHB 1EEUA 2BMKB 4U1GC 4G3YL 4UNTA 1EPFA 1ZWIA 3JUZA 2BSTA 1JGEA 1QUNB 3SGEH 3QJXA 3K72A 1RIUL 1ITBB 1U2HA 1N12A 1TQUA 2EAEA 1EZSA 4L37B 2D3OW 5BNXD 4H20L 4WJ5A 1S7RB 2GBTA 3DJRA 4HFWB 5CCHE 4GXUN 3EF4A 5TK4A 2XX1A 3J7HA 4HJEA 5CZXC 4A7SA 3DOSA 2WO4A 1JTTA 1D7CA 2OSLB 1U58B 1TUBA 2ZDIC 3AB0C 1P4BH 4Y5VA 1H8HG 4DCQA 1FORH 2NYYC 4K5PA 4EKXA 3DIFB 2BSSA 4TF4A 2NW3B 4XP5H 3LPGA 5CJ8A 3ZDXB 2OR9H 3FT3B 4E42A 4P23C 1DJWA 4PRAB 3U6XS 2OTLV 3LKPB 3NIDE 5AOKA 1XX9C 5EO0A 2W65B 5FUCC 2EYRA 4YDZA 1EN4A 2DQIH 3UEQA 4ACPA 2NUPA 1N0LB 5KHGA 4IMLB 1O9ZA 4PV8B 4O4LB 2LQTA 3ILDA 2EUWA 3OGIB 4IIZA 4NPYB 3T8VA 3U6RB 3ZHVA 4WU7A 4YHNB 3VJ6A 2EP6A 5HJGA 3OWRA 2XXGA 2EICA 3QUML 2RD0A 4KTGA 1B0GA 1PAZA 3B2DC 2BNQA 2VDLL 4HWZA 4Z2WA 2LAGB 3V52L 4L18A 2HR3A 1E50A 1USZA 2LQRA 3TIEB 1VQMV 3SYQA 1S7TA 1NC2D 4YHMH 5LN8A 4DN4H 3ARFA 4WCYL 5DC0A 3LH9A 2Y6SD 4P2RE 3TNMA 1H9DA 5JQGB 2VS0A 1FH5L 1MNUL 3C08H 2WNWA 2HX9A 1RFYA 5K9JH 3POCA 4LHUG 4QHMA 3W2DH 1FNEB 2C34A 3TJEH 4PA7A 4QKTA 4XZUB 3HW7A 3VFUB 3ZDZE 3ARBB 4WZ9A 4YBHA 3FQWA 5K5YA 4NQCA 2NY2D 4OZIB 5K33A 3CMGA 5B22A 3RL2A 2H6UA 1S78D 1FL6B 1VF5B 5C93A 4AV4A 1BQKA 5DMIH 1EZJA 3GSVA 1N0XL 4EUPA 5EEZA 2F58L 4PJDA 2MPVA 3OKLA 3VGBA 4B6ZA 2FTKA 4I55A 7PCYA 1O6VA 3EGSB 4RRPA 4K8RL 4PCYA 4XPHL 3WD5H 3EVKA 4LRNL 4JI7B 4XZ4A 1BREA 2GJ6B 3L7FA 3TO2B 1W91A 2PCPA 3SDDB 2FEJA 4LLYB 2Z3FA 4QIWF 4OD3H 3U7YH 3U0TA 4CADA 5MENE 1V27A 4J42A 4YJ3A 3KPNA 4M48L 4HWEL 4B3RO 4LEOB 2DIEA 1FZJB 2BNRD 1BZEA 4JO1L 5FKPB 1PQZB 3U46A 4EI5B 4EJ1C 3EUDA 1KYUA 3TVMC 4J3SA 1VQLV 1ORSB 3QIWB 1SNRA 1F7YA 4HQQL 4BH8B 3SBWC 4JI0B 4F27A 1OGSA 3JUYA 3FSZA 4YGAB 1VKXA 3OZKA 2JIXB 3X1BA 4WTQA 3EJZC 1GPOL 4I4WA 2HPTA 1MJJB 3SE8H 4HSQA 3SGJA 4WUUA 4P2CG 4AXWB 4Q0XH 1PCSA 3NCFB 1N18A 2WWMD 2ZKWA 1G1YA 2FTAA 2G60L 3V0WL 5I1GH 5KWYC 2J57A 1YZBA 4XPTH 1IU1A 3QUXB 3O3AB 1EGJA 2HJKB 5C0GB 3FQNB 4UQCA 1LM8V 1XGRA 4S0TD 3UQ8A 1J8HE 3GI9L 3H7LA 3ZT6A 4JFDA 4R8WH 5C0JA 4LVNC 4EDWL 2HN7B 4V1DA 3MLTA 4UDTB 3IRPX 1WV7T 3TXQA 3WFZA 2W38A 2X4SB 2QQLH 3M1BB 1I5XA 4P2AA 4LE8A 1WLHA 1LNQA 2JQAA 4A7GF 4FLZA 1JGDB 1BZ7B 1ICTA 1A6WH 1S9VA 3CFKA 1HHHA 4H26B 4ONGL 3BZEA 1FIGH 3FFDA 2YIBD 4PP2A 2Z9TA 4WK0B 5IBUB 5EDSA 1AHWC 4ZODA 1PNLA 1TO4A 1EN6A 4IHJA 1NCGA 1IGCL 2PXYC 4OCNC 1KZYA 1SMDA 4ZMZA 3CU1A 1GS8A 4ZMPA 2MHAA 1H6EA 2FR4A 1ZLDA 3F05A 2PO6B 5I1LB 4GQ9L 3K4DA 5E51A 1PEZA 1H2KA 2WVSA 3IFNL 1GJWA 4HLZG 1OWWA 1K8DA 3A3YB 4WEBH 5CF3A 1X9LA 3PXJA 4BK8A 4AENA 1PIFA 3C5ZC 5SWZE 3RDTC 5CCKL 3MD0A 3KNBA 2QVFB 2A77L 3PRZA 1OP5K 5FUZH 4A67A 1BVNT 4Z1PA 2H0FA 5IQ9B 2C9VA 4FNLL 3VVVA 5C0RL 1CFMA 5J1AA 2WZPD 3M1OA 2JGDB 1I85A 4L2YA 4UI2A 2EKSA 3GNMH 3ZN6A 3I9GH 5LP6B 4JAMB 2AQRA 1AGEA 3MFFB 3RNQB 2AP2A 1WPXA 3WLWD 1PL3A 2NNAB 3ARBD 2LO1A 3FUMA 3KJ6L 3NQKA 3OAYH 3V6OE 1UOKA 4YSAA 4P5MA 1LR1A 2Q2EB 4B3TB 2QVMA 5L9DH 4ZFFB 4JUSA 3ZTJG 5DK2B 5BR8O 3QXDA 2RACA 5ICZA 3QC5X 5ADPH 1QR8A 1VF6A 1XGQB 1R5WB 3WKQA 4FA6A 1HDMA 5T5FA 2DYPB 5JHLH 4P46C 5F70A 1Q1JH 1QI3A 2V33A 4JY4A 1DJSA 1OB1A 1ETJA 3JTSB 3SDDD 4V33A 4ZFZB 3CN4A 3FUEA 2QQNH 3C6LA 3TGUH 4YQXL 1Z5YD 2CK0H 4JFQB 5K9QI 1FHNA 5C07A 4CVUA 5CCJA 3HR0A 1ZT1A 4Y19E 1UPGA 1R75A 2DWEC 2EDJA 4BQBA 4U2YA 3TFKD 4EI5D 3P4NB 3VRJA 4F80A 4YK4B 1EN5A 4YDJA 3S4SA 2DJUA 3MCLL 3WTTA 4ATWA 3KEDA 3OR7B 5FGCE 2X4OB 5JMRA 4KTDH 4DKFL 3SZKC 4PRPE 2C1PB 3STZA 1AXSB 4WW2B 2CUMA 4NRYB 3IGLA 4NBYB 4TQEL 3APNA 1Y76B 3LV3A 4LSDA 3UADA 3L1OH 2JIXD 4F8PA 4GKSB 1XT5A 1O9WA 3MFGB 1CT8B 4BSWB 3QJFA 4PA4A 3RYMA 1WBYA 4JVUA 4Z95L 4N4YB 2A1WH 5HYIA 3UYPA 1I0HA 2DTSA 4ZQKB 4G42A 1XGPA 3F62A 3C60A 5HYEA 3CV5A 1FFRA 4IOSA 5DK0A 3QHFL 5IF0A 2QM7A 4KL1A 3V7AG 4DN3L 1NCDL 3KBFA 4F6RA 3DC0A 3Q8FA 3KLQA 4KH2A 4Y2NA 5DZJA 2YI8A 2ZNXA 4AMKL 3HZYA 3GK8H 4WNQA 4X62B 3O4LA 5CBAA 3WFDH 1GHFH 1LNUA 4ZYKA 3U79A 5HGBA 2ID5A 4R2GB 4QLRA 4MVSA 3HI5H 3FULA 1G1XB 2CIIB 1ASOA 4TM9A 4IIQC 2DJ4A 2FE0A 1LO4H 5TE6H 5F1IA 2YR3A 4PHXA 2YD3A 2DW5A 1KTBA 2EUXA 2KPNA 4FF9A 1BIIB 2GV9A 3FS9A 4XBEH 2EE9A 4EXKA 4G8GE 4J4PD 1WC7A 5HI4C 4L3CB 2VXUH 2ZOTA 5DD5H 2OMXB 4OGQB 2HRLA 4AJYV 5H4ZA 3ARGA 5AW6B 4QCIA 1OGAD 3BVNB 2G75B 2J88H 3RY6A 1JL8A 3JD1A 1X7SA 1MFMA 2PO6D 2W81C 3H55A 1KBVA 3EH4B 4LAQH 5CJXA 4BZ1A 5ANME 2ZOKA 2PTTA 4MJ6A 4OM0L 1IURA 4B9GA 3L3DB 5ACLA 5AL8A 3UYRL 1A1MA 4HIPA 4MCYA 1OOWA 2B77A 1JCHA 2FNBA 3JT2A 3NAAL 3ES6B 3AG3B 4DKAA 1A9BA 2A73A 2XCMC 1S5HB 4FABH 1P7HL 5C8YA 1RJLA 2WINB 3H9SB 3C90A 1TVBA 3QJTB 1F2QA 5JW4Q 2DM2A 3CSXA 2WXFA 1VFOA 1OCWL 1BHGA 3RFRA 3KYOB 1ZLSH 4JI5O 3BZ5A 3U4BL 1K8IB 1HWWA 4U6VL 3WSQL 1DSYA 4HGWB 3BUTA 1NGXA 4S1DD 3WGVB 5PAZA 1HZHH 3S8WA 1U8MA 1QSFD 1HKFA 4PCKA 3D07A 5AAPA 3QPQD 3CMOH 1IKNA 1OP4A 1DUZA 4B9ZA 1MZFA 3QQ3B 4KX7A 5A6IA 5J11C 3ABKC 3KEHA 1SA0A 4O2AA 5SX4I 4QR7A 3QXTA 3GI8L 3VYNA 1EHKB 5L7XL 4A7UA 1ZVYA 3OQ3B 2MKLC 1FNLA 1K4CA 3FFCB 4U6HB 4XPAL 4FNQA 4JO4L 3C3TA 4JRXE 4MXWH 4FMTA 5DGQA 3EUUA 3MV8E 2PYLA 1P1ZB 3OG4B 4Q20A 5HGHB 1Y0LA 4A6YA 5E8DL 4PDRA 3GB7A 2V5RA 3LS5H 1YPZB 2DD8L 4N23A 2OP4L 1PZ5A 3EDDA 3ZDWA 3IAGC 3MTRA 3GJEA 2HFEC 1IC4L 3MRMA 4YFLF 1FZKA 3GSUB 1L9RA 3TCLA 3OGOE 4I0PB 3MRBB 5FO8B 3EJYD 3U82B 3QEHB 5DD6A 2LTQC 4WI0B 3DX0A 2XVLA 4FXKB 2VLLB 2X6BA 3HN8A 3TBTA 3FO9A 1S7QB 4YE4H 3TA3B 1D5XB 3UBXI 3HTLX 1F51A 1YEFH 3F6JA 4L23A 5HYFA 1JGUL 4FZ8L 2XWBA 5HVWA 1LDPH 3PWNB 3L45A 3TONA 1P6AB 3IJ8A 5K59E 1I82A 3WGUB 4OFQA 3PL6B 1F86A 3RWGA 5ALCL 1BZ9A 3PAVA 2APBA 2VABA 5K9KA 4X6EB 2E59A 3IE4A 3QUMB 2C7UB 2VDLB 3O0RL 3U7WL 5DJDB 2Q86A 1JMKC 1CMOA 5FECB 4UV4H 1HCYA 2MH4A 4FQXC 4HXBH 5EZJA 5I18H 3CCSV 3MRJA 3QG6B 1YA5A 4QRBA 1D5MA 1NH6A 3PPSA 3QH3B 4LCWE 4N9GB 4CC4A 4UB6Z 5IHUH 2R7EA 3NSFA 2VLJB 3MV9D 1J0ZA 3LRMA 2A6JA 3WJJA 4XPBL 5E79Z 2BS71 4NRXA 2X6UA 4G1EB 1HHIB 4OIFA 5IJCC 1NCBH 4W9LC 2AQPA 3ZZLA 4KZDL 1P7BA 3ETEA 2FK9A 4NRZA 4G1MB 4K73A 1LVEA 5F7EL 1P84F 4P3CL 5DEGB 5LBSL 4TYUA 1TU2B 1FPTH 3DUUA 1KXHA 4CMHC 3IC9A 2IBBA 1AP2A 2LABA 3GDBA 4K7FA 1C8QA 4JAUA 4FC3E 3BCCH 3RWEB 1SY6L 3L4CA 4ZMAT 4HKBA 4RGNE 5LCVL 3U7AA 3L3IA 1YEKL 5ETUB 3CJHB 2YXVA 5FO9A 4JRLA 3L4VA 4DO5A 4AY0A 3BP6B 1RULL 1MFCL 2H41A 3V0JA 5EUOF 5JA9A 1THCA 4HLZH 4GG8B 3H9SD 4ADGA 3MJ7A 3AU1A 2P8LA 4MA8H 4JN1H 1E9PA 3RURA 3TLRA 1HOEA 3BXNB 2CDYA 1MJ7L 4BIOA 4G3YH 4R3SA 4ZTEA 1CLZL 2PR4L 4AUJA 2FIKA 4UCSA 4RGMB 3QIWC 1BG9A 1N10A 4PJHB 5D1QB 1CS6A 3WEXA 1Y6XA 1UCBH 1VACA 1YEHL 3ATDA 3FUKA 4H20H 5IQLA 4JGJA 4JREB 2B1HL 1VJSA 1L5GB 3B9KB 1FFNA 4AQEA 1A3QA 2XVGA 3IVKA 1PZ2A 4Y9BA 5AVQB 1QVFU 3HKCA 1KY6A 3C12A 3CX5F 5DU7A 4JFHD 1P5UA 3FFCD 4U1NB 2ZXBA 3ME0B 4UM9A 2NR6D 3C3SA 2Z7WA 3VTAA 5FKAA 4AKOA 1R9FA 3FH8A 4MD5B 2OULB 3LRKA 3RWCB 3QUXC 4KY2A 1OE2A 4LEBA 1BP3B 4EKJA 1PLAA 2E4TA 2C9SA 3KPSD 2VZUA 3KLAA 2AI0L 1PY9A 2VDRL 2O1AA 3REVB 2V5YA 4JMXA 4R26L 5CN1A 5E8NB 3DSQA 4PJBF 2H6PA 5D7KE 1EHXA 1WIOA 2VDLH 3V52H 2BZDA 4CU8A 1PF3A 5FW8A 3L73H 2JKXA 2IWKA 2CR3A 1N3NB 3DX8A 3L95B 3O9WB 4WO4D 4HUUB 5CUSL 1NIEA 1MNUH 2BHFA 3TA3D 2J72A 4O2BA 3W7TA 3DVFA 4I89A 2OYPA 2W91A 1BXVA 3UKMA 5KYXB 4KKAD 3ABGA 5AW4B 3CSGA 1X4XA 3MX0A 5GIRB 4QJ4B 2CHNA 4ZG1A 1AGDA 2CJSA 4AE1A 1T0MA 4WSGA 4TPRH 3PL6D 2D7QA 5IJVA 4XBFA 1N59A 2J2ZB 1M6OA 3EDFA 1NFDF 4E5XG 1YAIA 4N68A 4AGLA 4WBNB 1BDYA 1CU4L 2F58H 1IXBA 3NSJA 4LGSB 4Z18A 4XP9H 4I1NB 3U25A 4CILA 1OSZA 4LRNH 4LF7O 4F7PB 1OK0A 3GO1L 4UAOC 4RO2A 1ROCA 4R4FL 4ZUUB 2Q8AL 4B41A 2ZUYA 2VLJD 5CFHA 4J6IA 4LQFL 1P84K 4PLJD 3CAFA 3UERA 3L9RB 3W39A 1MCPL 4XO4A 5JUEL 4OCSH 5LP6C 3MJ9A 3ZCCA 2EINC 4TVSa 2XSKA 2N56A 4X99B 5INDA 3GLEA 1HEZB 1I4FB 4HVBA 1XTMA 3RPBA 3GYRA 3M46A 1AZNA 2KBGA 2JEXA 1M57C 1SJEB 2FL4A 3PWJA 3QCTH 3QQ9D 1Q3EA 4HQQH 3N1GC 4K8RD