2X6CA

Potassium channel from magnetospirillum magnetotacticum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
288
structure length
264
Chain Sequence
PRILNSDGSSNITRLGHYHDLLTVSWPVFITLITGLYLVTNALFALAYLAGDVIENAFFFSVQTMATIGYGKLIPTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLMMRLANLRIEAIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFLVLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-SENSITIVE INWARD RECTIFIER POTASSIUM CHANNEL 10
publication title Domain Reorientation and Rotation of an Intracellular Assembly Regulate Conduction in Kir Potassium Channels.
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Metal transport
total genus 70
structure length 264
sequence length 288
ec nomenclature
pdb deposition date 2010-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2x6cA01
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 2x6cA02
2Q67A 3R65A 4G28B 4P30A 3OR7C 1ZWIC 4LCUC 3ZJZA 1U4FA 2DYRC 4GX2A 1R3KC 5B1AC 3K0DA 3IGAC 4PA4A 4EKWA 5E1AC 4J9YB 4GX5A 3T2MA 1M56C 4MS2A 4R50A 3ATBA 2WLJA 3ATFA 5EC2C 4XDLA 4OXSA 4WFHA 3T4DA 4KFMA 5B3SC 1OCRC 4MVUA 4F4LA 3AGWA 3RW0A 1XL4A 5KUKA 4MSWC 2AHZA 5KUMA 3ABKC 2KB1A 5EC1C 3T4ZA 2Q68A 2WLIB 1S5HC 1K4CC 3FB5C 2BOCC 4ZBMA 4MVMA 3FB7C 3K06A 2DWDC 2K1EA 4MVQA 5B1BC 4GX1A 3SJQC 3STZC 4R8CA 1KKDA 5EBMC 3SYQA 4JTCB 2WLLB 2ITCC 2ITDC 3K04A 1OCZC 2EILC 2W0FC 1J95A 2Q69A 2ZD9A 5CBFA 4RO2A 2YEVA 2HG5C 3TETA 2A9HA 3SPIA 1R3LC 4X89A 3ZRSA 4X88A 4PA3A 4PDLA 3RVZA 3SYAA 3AT8A 2R9RB 4GX0A 4QE9A 2DYSC 3E8FA 3SPHA 3SPJA 3SYOA 3LNMB 4JTDB 3OUSA 1R3IC 2A0LA 4PA6A 4MTGA 4R6ZA 4MVRA 2EINC 3WG7C 4CBCA 3HPLC 2HVKC 3RVYA 3AT9A 4LBEC 2DWEC 4P9OA 2JK5C 3K08A 4MVZA 3VSQA 3SYCA 1BL8A 2EIMC 3OGCC 4WFFA 2X6CA 4RUEA 4MVOA 3ATAA 4I9WA 3FB6C 4PDMA 2E4FA 1OCCC 3SYPA 5CBGA 4X8AA 1OCOC 2WLKA 3F5WC 3K03A 3AG1C 2GIXA 1LNQA 4MW8A 2EIJC 5EK0A 2HVJC 1N9PA 1XL6A 1U4EA 3ATDA 4WFEA 4P2ZA 4MW3A 3VOUA 3SPCA 3RBZA 5IY5C 4UUJC 4H37A 2IH1C 3E8BA 5EBLC 3T1CA 3E8HA 3LDEA 4DXWA 4JTAB 4P9PA 3ASOC 3IFXA 4PDVA 3E86A 3UM7A 4PDRA 3TCUA 4G27B 4WFGA 3ABLC 3ASNC 2A79B 4BW5A 3OR6C 2OCCC 4RUFA 4HZ3A 4RAIA 2WLNA 3ABMC 3E83A 2AHYA 3AG2C 3LDDA 3AG4C 4PA7A 1ORQC 4MTOA 5EBWC 3UKMA 2EIKC 3EFFK 4XDJA 3AUWB 3K6NA 2HJFC 2HFEC 5J9PC 3LDCA 5CBHA 2IH3C 1R3JC 2QKSA 3FB8C 1K4DC 3E89A 3OUFA 3AG3C 2WLHA 4R7CA 3X2QC 1V54C 3GB7C 3PJSK 4HYOA 3JYCA 4QE7A 4PA9A 2X6AA 1JVMA 4LP8A 3STLC 2H8PC 4J9ZB 4H33A 5BZBA 3F7VC 1M57C 2BOBC 2WLMA 2P7TC 2WLIA 3KG2A 1QLEC 4MTFA 3ATEA 2Q6AA 3BEHA 2Y69C 2ZXWC 3F7YC 4XDKA 4QNHB 2X6BA 1G4YB 1P7BA 2NLJC 3E8GA 4TWKA 2QTOA 2ATKC 2WLLA 3LUTB 3K0GA 3SPGA 4MVSA 1V55C
chains in the Genus database with same CATH superfamily
2ZCLL 2C7UB 3OJMB 1KIRB 4XWOC 1KV3A 5HHQA 5IMLB 2YFOA 4HH9B 1H6EA 1A7RH 4HYTB 4XBPB 3NH7L 1ZHNB 3QEQB 3B3IA 3RWJB 4S1RH 1HZHL 4X6CE 5EC2C 1QA9A 2OS7A 4WGVB 4H1LA 2Y2WA 1AILA 1SNRA 4XPAL 5I30H 4XX1E 5CHNA 5MENA 5DVKA 1SETA 2BNUB 3G5YA 1A7RL 3FKUS 5IQ7H 1UZGA 3HPLA 1PP9H 1OWWA 2NZ9C 3OD3A 3T0EB 3CVDA 4NQCE 1ZSHA 3FZUC 1A1OB 1QI4A 4S1RL 4OUUA 5DMGD 1L9TA 1J8HA 4IDJH 3N2GA 4WJ5B 5BRZA 4S0TD 1P2CA 2K3HA 5FWQA 5I30L 1GC1H 1MLCA 4LE8A 3JWOL 2ZAGA 4RMVA 1HKLH 3EAKA 3PL6A 3D3VE 1AOZA 4RDQG 5IQ7L 3P32A 2CM6A 1Y0LB 1FVEB 3BCCH 1DK1A 2XCMC 1ZT1A 4OFVA 3VFSA 3RAJH 5K1NA 4BKLB 2LW3A 4IDJL 3GC3A 3W1ZA 4P2OA 3T6WA 4JPQA 1GC1L 3G6AB 4QOKA 3E8UH 3UIZA 3UG4A 4B9IA 1BHGA 1G7QA 1HKLL 2APWA 2H32B 4P2QE 3CFUA 1AQDA 4D7SA 3TJHC 5BJTB 3MX0A 3CSXA 1JHTB 3AG1C 4WHCA 1MG2C 3RAJL 3SDCA 1RJZB 4Y9EA 2DLTA 4QRAA 1BBJB 2ZOWA 2ZSWB 2R9IA 3ZKND 4YDIH 4GAYB 3E8UL 3KMDA 5CR8A 5F2FA 2WWNA 4CSZA 1ZLEA 3QULA 5DMJB 1SDYA 3Q0HA 5E6ID 1N4XH 2QDOA 3NIFB 3GMQB 4W4OA 2WVVB 4URKA 4EI0A 2AXFA 5C0DA 3HRZB 4KL1A 3HE7B 1QFHA 5CLXA 2N59A 4L0YA 4YDIL 2N0KA 5EOTA 4QO1A 4LF5O 2A6IA 3NA4A 5CJ8A 1N4XL 1EXGA 2WVUA 4LAJH 3HMWL 2CG9X 1K9MW 2PTTA 3D69A 3ME0B 4X4YB 1QLEH 5LGJB 4DFIA 1KJVA 2AGJH 3OX8A 4CGUB 2UWEF 4Z7AA 4WKZB 4Y2DB 2MTPA 2PPDA 4Z3JA 1V54C 5J3HD 4IBWA 2CH7B 2OTPA 4JO8A 1H2GA 5GRWA 5E00B 1MAMH 3GSRB 3H1ZA 3BH8A 2RNBA 4RNRB 5GPRA 4PA9A 2R2BB 4Y5YC 2ISDA 3GYRA 1TJHH 1US6A 3MLUH 1QLEL 3WDIA 2Z0AA 3BEHA 2AGJL 2HJLA 3NCWA 2DDQH 4I7ZB 3MCKA 4Z7VF 1U8MB 1UA6H 4G8GD 1ADQA 3QQ9D 5I74B 4BSVB 1CFBA 3PJNA 1B9KA 1EWHA 5C0AB 3VGGA 4XMXA 1TJHL 3BEVA 5E4IA 2DQ0A 4G8EB 5PCYA 2BRQA 3JZ7A 1M53A 3MLUL 3MMEB 1HNFA 1ZVHA 2FAUA 3FUFA 2J56A 4PREB 4TSBL 4DR7O 2DDQL 1SXAA 4OZ4B 1UA6L 4J3BA 2LGNA 2NY0B 1MZZA 1JGIA 2YAHA 2Z8RA 3DJSA 1I7UB 4RMWA 3BZEA 4XN8A 3CZEA 4MA3A 3U25A 3FF8A 4J4PD 4ZTEA 3ETGA 1QX1A 1AQ8A 4QXTA 1NGXA 4FLVA 5IT2L 3VVVA 3ABKB 2VAAB 4G8AC 2D03H 2RDCA 2WO3B 3OPUA 4N28A 2X4UB 2EKSA 4RO2A 4MB1A 2PWFA 4RMTA 25C8H 4RAHA 3T0XA 5C0IB 1EEUA 1MCWM 1GGUA 3OKNA 5HHMD 4JTDB 3FMGL 1Y67A 3QUMH 3RUGB 4EXKA 4HT1H 4OLXH 3VFOB 3ZE2E 2JJ1G 2D03L 4HFWA 1BQLL 1W72H 1AI4A 3FCUB 4YBQC 2YZ1A 4F8TA 2W91A 1SEQH 25C8L 2F58H 5EFIB 1Q1PA 1S9YA 3CDZA 1C08B 3HE6B 3WLWC 4BQ8A 4LKXA 3BN9C 3NSFA 4OD3H 4JANB 3EUUA 3QUML 1H2NA 1WJ3A 4FG0A 3HG0A 4WQOA 4OLXL 1BVLB 3UTTA 1HSBA 2A0LC 1KYDA 1VFBA 2NT0A 2VMEA 3D4GA 1W72L 3SBQA 5A1AA 5KAQG 1OHHG 2H26A 5GW7A 3D39A 4AGPA 1SEQL 2F58L 5H4ZA 2AXJA 2UXTA 5FHBH 3UTOA 4JKLA 2ENQA 5MEQA 4OD3L 4HJEA 5I6XB 3TEWA 1KZYA 3QRGH 4FJZA 5FYJD 3TEXA 1MEXL 5F7NC 3RYFA 2YIBA 2NY5C 2IW5A 3KBFA 4U7NA 2BLFA 4MBOA 1FYTD 2Y6SD 2LLGA 4NBZB 1CICB 1CDCA 1T20A 3FQTA 5FHBL 1YLBB 2NN4A 3SDDA 5JXEA 3L1OH 5IB5B 3VXRA 3QRGL 4L9DA 3RIFF 3ZDYE 4N9GB 2VR6A 4JHWL 3ABMB 1WGVA 2HJDA 4MNQA 4R7CA 1DZBA 1FPTH 4UV9A 3TT3H 2HN7A 4OPAA 2IBZX 3V0AC 1DO5A 1MMMA 1M3IA 1W2BU 3OAYH 4Z5RA 4ZDHA 1Q81W 1J9RA 4JVUA 4U3XA 3L1OL 5IMOA 4J3OC 2F54A 2OXHB 2NX5B 3B8YA 2AITA 4I0CC 4KK5C 4CC6A 1KBHA 3DVFA 4MAYD 4L8JA 2P48B 3EOTH 4W9CC 5CU5A 4ZHQA 1FPTL 2IG2H 3UZVA 2LHAA 3B1UA 3TT3L 2J55A 3MLWH 5HDWA 2UVEA 3MRDB 5AD0A 2DJMA 43C9B 5AOZA 1U4FA 2R1WB 4JAMA 2B7DT 3PS6A 4EAEA 3CJJA 1AZUA 2GK0B 3EOTL 1A9EB 3WIHA 4DO4A 1KJ3H 2R51A 3OF6D 2EDXA 2IG2L 3GHEH 2QVFB 3HCVA 3FU5A 2XN2A 3MLWL 1KXVA 3TH2T 3MGOA 5SWZA 3JAWA 1D6EA 3ARDA 1U3ZA 1FFNA 2O6FA 3M17B 1UZ6F 2BOCC 3TBSB 1MZEA 1IXBA 1R1CA 1S7RA 3LNEA 1KOAA 2AXTZ 4M56A 4LF6B 1XF2B 3IAYA 3RWHA 5GS2H 1TLKA 3BPLC 3TP4A 4R8CA 1KJ3L 2ZUQB 3GHEL 3ZDZB 4MGXA 3QIWB 4AVJA 8PAZA 2WC7A 4CH6A 2DQ6A 1OM9A 3K72B 4LPWA 4LF3A 4ODXA 2RJMA 2QSCH 4OZGA 2JSFA 1QLRA 1T4KA 2J6EH 4A63A 3CXFA 2CIKB 1OARH 5JCOA 1RCYA 4ZFQA 3QGVA 4FDWA 3BPCB 1QQCA 2XKSA 4P2RA 3RDJA 3NPZB 1SHXA 3GMLA 1JNHA 3I6KA 3AU1A 3KYAA 4L4TD 2QSCL 3KPSE 4F57H 2EX3A 2J6EL 2GJ6D 2JK5B 1OARL 2LABA 4XX5A 1GM7A 1NVPD 2VDNB 4O00A 4QD2E 5D1QD 1FL6B 4URTB 5CILH 5IROA 3UG5A 3U7YH 1JGLH 4J3SA 1JNNH 4GT0A 3PWPD 1Z2KA 4FE9A 4JFFA 3VFMA 3B7TA 2WQXA 4QRRA 5J6HB 1YEEH 2XTJB 1G9NC 1KYOJ 4HHWA 2PUQT 5D7IF 3CSYA 3BVDB 3MLSH 5DUPH 4F57L 1I85C 4HLZG 3ZOAA 5AOLA 1FO0B 3UDWC 5DQ9A 5CILL 1OGAD 4OF7A 1S9XB 3U7YL 1JGLL 1OGPA 3H7LA 4NP4H 2JIXB 1CG9B 4CJ1A 4XO3A 5IYBO 1YEEL 4BH8B 1MWAL 5DUPL 1LDPH 3MLSL 2H8PA 3BAYA 3AG2C 2APSA 3H01A 5ESAB 4Y19A 3ZQWA 4I4TB 5T5FA 4N22A 3OKEA 4UDTB 2M8XA 4WJG3 1ZXQA 4NAJA 2IBGA 4HKBB 1Z32X 5CS7A 3RYIA 4NP4L 2EE6A 3UTSB 1XILA 1JPFB 2VO8A 4JFYB 1LDPL 3P40A 5DJZA 3MUUA 2X6AA 1WA8A 1PVHA 3SE3A 5GZOC 3VFGH 5JXAH 1GM9A 1DBMH 4JYAB 3BWAB 4KO7A 2UXFA 3W0WE 2UZYB 3VD1A 4IGBC 1DE4B 3TZVD 2GHWB 2IXQA 2X6BA 3K6DA 2ADFH 4RQEA 1WZ1H 3BZFB 2HB0A 4X7FC 2JJSA 4F6EA 2WUBH 3D0VB 4JM2B 3F7YB 4AI8A 4NQSB 3FL7A 3VFGL 5JXAL 1DBML 1KGCE 1ZHLB 5ENWB 2N74A 4KH2A 3OKOA 1VF7A 1WZ1L 4DPRA 2YBRA 4KFMA 1M2VA 3C9NA 4PIRF 2WUBL 2BHUA 2A9MH 1FFOB 2R27A 3WTSA 1K3IA 4WWOA 2WXOA 4KHTH 3O4LA 3C6EA 2JXMB 1XEUA 3Q8AA 4YSSA 5CSZB 35C8H 4HBQA 4HWBA 3L4VA 4PRPA 1AGBB 1GN3A 5CBFA 2EC9T 2RMNA 1QHPA 2Z91B 4ZQTA 2VDKB 4JGUA 1L8DA 1NCUA 4HD9A 1WK0A 3QJRB 4CN4A 1NKDA 3KPRB 3WTXA 3SYOA 4KHTL 3JV0A 3FSAA 2JS5A 35C8L 4EN3C 3ZTJH 3WNIA 5ITFA 4NN5B 1U92A 5F7AA 1QYGH 2BSEA 4P57A 3OHXC 4NT6B 4YSPA 4B53A 1NEPA 1U8CB 4GRLA 3MRPB 1MY5A 2KS0A 2HVKB 1NINA 2MJWA 5DLMH 1O5PA 3P4MB 4PJ7E 1HCZA 3PGFH 2XOKG 5ADPH 4G6AD 4BDVB 2X1OA 3VCLB 1QYGL 4X6DA 5A2CA 2Q0OC 3CZFB 1KKCA 1H3UA 2RCSH 1T7YA 3Q43A 1AHKA 2Z9TA 4TYUA 1G7PB 1T04A 3FFCD 2VWJA 2IH1C 3CHRA 3KJ4C 1R33A 2ARJB 5DLML 3VB9A 1A6VH 1LWJA 2GBVA 5ADPL 4Z7WA 4M6OH 4CMHB 3VGEA 3FW6A 2I9LB 1WFUA 2YMOA 1M1KW 4N1EA 5JO5A 2RCSL 1NC4B 1DYZA 1K97A 3GJFB 2YMXH 1YNKH 3IKCB 1BZOA 1DQQA 1F1DA 1Z66A 3EYOA 3EGDA 2BY0A 1UB5A 4JJHA 2FYYA 5IQLA 2VN7A 4UDUA 1A6VL 1J8RA 2MQ0A 5SWQB 1FI8C 4DEUA 4M6OL 1IU1A 1B4RA 5HFMA 3EJCA 3GWKC 4R5XA 2EDBA 3RWDA 4IJ3C 2W07B 4QEGA 4XI5D 4IQHA 1IEAA 2YMXL 1YNKL 3FUMA 3G08B 2X4OA 4OUOA 3AS3A 5HYQA 4FXKB 4DP2X 4K3AA 3MNZA 5D7LE 5BR8O 2BOBC 4DR3O 4Y4KD 4DR4B 3OZLA 5G5DA 3DA0A 1XGZA 1SEBA 3HMXA 4U6YA 2OYMA 2VJ8A 4G6FB 2AXGB 3VI4F 1FFTB 2F4VO 2R9HC 3MYJA 4RESB 3FB5A 1RUPH 4ZPVB 1YTFD 3EHBD 3IBEA 4LPCA 2G4EA 1F4XL 2HLDG 2VXTH 4KC3B 3D85B 4OVUA 3BXNB 1E30A 4BFIB 1YNTF 4DV6B 4PJAA 2DW4A 5EN2A 2ZE8A 3JATB 1MHHA 4PVNA 1KP2A 3VNZA 3M1BB 4IL6Z 1IAII 2EULA 1RUPL 2PW2B 2LW1A 3KHQA 4CN6A 4UCFA 2F9BT 2Z6FA 1ZV9A 5LKNA 1I8MA 1CE1H 2IAAC 1XWVA 4HWNA 1SN5A 2AJYH 2VXTL 4RFNB 1LE5B 4X99A 3E22B 1EO7A 3DJRA 4EF3A 4GT1A 2NR5A 5F44A 4W4LA 1D9KB 5J13B 1ETB1 3NPSC 4WI5A 4HIPA 4Y2LA 2XKNA 1UXWB 4N68A 1WT5A 5BZDA 1HL4A 5ICZA 1HHHA 5BVPH 4RWUA 2AJYL 4WGWB 1S6NA 1KPRA 3MO1B 2Y7LA 1CCZA 2X1WL 4TULH 5HJ3A 3H3PH 4G11A 1ZV2A 3ARFB 1A6WL 4IDLA 4NQCD 2E3CA 5L4IA 3VWKD 3KXFD 4CADB 3PABB 3HAEB 3TJEL 3TX4A 4YJZL 1AR1C 3BPZA 3PHQA 3WHXA 5D2NC 1SY6A 4L3EB 5BVPL 2R7EA 1CI3M 5I73B 2ZOKB 3OC5A 2EIMB 1EV2E 4TULL 4ZFOB 2OZ4A 1G84A 2Z31B 4OQTH 4RMQA 1BOGA 5LNDA 4HIIA 3UPAA 4UM9B 1MFEH 1E4KC 2VLJA 3VGDA 2NZ1A 1ZLUH 3C5ZD 4JI5O 1QBLH 2F1BA 4NP9A 3FQWA 2ZDIA 2QWQB 1TIUA 4KH9A 1I3GH 4G6KH 2TAAA 5ANMB 4OQTL 4UOJA 4I0PC 4MMZA 3LQZB 2FEDD 2UUAB 3CFNA 1MFEL 3QUYA 4QRUB 1EFQA 1F6FB 2VUKA 2HRHA 1QBLL 4QHPA 1FFQA 5JQHC 3G5ZA 2PW1A 3VD0A 3AG4C 4OZIA 1I3GL 2DEWX 4G6KL 3OMAB 4TLUA 5C8YA 4PJCE 2ADGB 3DV4B 4K3EH 5DD1H 5C7ZA 4ZFGH 4K3DH 4FN0A 4HS8H 3WEXB 3UCRA 3QQ3B 3EJPA 5KS9F 5KBPA 3D36A 3KPNA 4GXUN 4U2ZA 4B9PA 2WY3B 3CN1A 3GLDA 2P4VA 1UKSA 2NY4D 2NNFA 2WWMD 1Y76B 3UZEC 2ARWA 4K3EL 4KNTA 4X4MA 4F91B 5DD1L 4ZFGL 4HHAB 4K3DL 4HS8L 2Q6AA 2YJLA 5CZXC 4ZPTB 3W5MA 1JGEB 1N34B 2ICCA 3AQXA 4PRHB 3U46B 3CU7A 4LFBO 1T83C 3LOWA 3T1YB 1IGMH 1SJEA 5IQ9A 3NXSA 3VWJA 3UQ8A 2AMUA 2YRLA 1GKEA 4A2GA 2P90A 3DNKA 1GW0A 4PQXA 5ABDE 3EXLA 1AG6A 3TF7C 1P5UB 1ZWIC 4M7ZC 3DSQA 4MD4A 4AK2A 4J9YB 3QIBC 5ETUB 5J6SA 3BHBA 1FKAO 1FFRA 1PTZA 3TJPA 3WKML 1IILE 2ZF9A 4N5ED 2J2ZA 4C4BA 1IGML 3VFNA 3MRIA 5T3XE 2X0UA 3CXHJ 2IU0A 4MJIB 2ZPKL 1MN4A 3JAKB 2I24N 3QWRD 1OZUA 3LCYA 5F6IC 1SQQH 3VJ6B 4D7PA 5IHZA 2P06A 1BM7A 2WLLB 4Z7QB 1EERB 1IGFH 4WLCA 3J8F7 3S36H 1HYRC 2ZXDA 4KITB 1OGSA 1OP5H 3SD2A 2P45B 4QHNA 3ETDA 3MJ9H 2F8XC 5AVWB 4LDLB 3WJJC 2HT4C 5FB8A 1NGQH 5T3ZH 4DEPC 2B9AA 2WTOA 4OVVA 4J8RB 4WVRA 1SESA 1ZSDB 2ARJQ 1IGFL 3NDYE 3FT2A 4G70B 1VFOA 1UD8A 3S36L 4F8PA 1A02N 2Q86A 4LCCB 4Y4HB 2FGZA 4Y89A 5G55A 4YGAB 4B08A 2Z65C 2ATPA 3MJ9L 4UCRA 3KGTA 2WINA 4FXLA 3IETA 1NGQL 5T3ZL 2GTWA 5GGRA 1OF2A 2OR8A 3DXAA 5FK9A 4GSDH 4WWKA 1WB8A 3WJMA 1VEPA 1EHKB 2L3BA 2MHAB 5SX5K 3TURA 3VXSD 5E4EC 1VZHA 4GB9A 3G3LA 1PYWB 5TF1H 5B7FA 1QRNA 1FNGB 1EMTH 1X44A 1SBSH 2CUIA 3SPVA 2FR4A 1I9RH 3FUKA 1R3JA 1K2DB 1A65A 1P9MA 2NY5L 1PF3A 2WN2A 4RMSA 2XX1A 1I0HA 4LU5H 1U36A 3UABA 5TF1L 4FG6D 1OAUH 3W2DH 3E1F1 5D7JC 1EMTL 4JI7B 1FV1B 1SBSL 5LP6B 2XFXA 3CLEH 2VQ4A 1B6DA 3GMOA 4L48A 4PYHA 5MERB 3VXTA 4JK0D 1I9RL 2EDTA 2WVSA 2GG1A 3E6HA 2O26U 4J3OH 3OV6A 1RUAH 1JZ8A 2UXVA 1RUMH 1XGUA 3VXQB 3UGUA 1JD9A 2WQVA 3W2DL 7CGTA 1OAUL 3K9AA 1MCDA 4TS6A 4YAQB 3LRKA 4ZMZA 4Z78A 3H9ZA 3CLEL 4F7MA 3IRPX 3OT7A 4JRWA 4H2AA 4MNGA 3ZQXA 2QQQA 3FFOA 5I15H 4IBUA 3BAEL 5TH2B 1NIBA 1TVKA 1RUAL 1TA8A 1JVKA 2Z8SA 1C5DA 1RUML 5EIBD 4MD0B 4S1SH 1J88A 2H3KA 3I02B 1B6UA 2VN6A 2W65B 1D5BA 4X5PA 1JF1B 3CN0A 3FJTA 5FA4B 1URFA 1PG7H 3KDMA 2EYTA 1QFOA 3BKJH 3E80A 4U1GC 5I15L 3BVXA 4I1RA 5BRPA 4EKWA 1ZT4A 3L5WB 2FMLA 4PTTA 3I75A 3FT3B 3ZVVA 4YPJA 4YN3A 4IOIB 1DTOA 2WXJA 4AZUA 3BVVA 4UU9A 4WKXA 4APQB 1OK8A 2VQ1A 1SJXA 2KL6A 1TNMA 3HKDB 3Q7JA 3D05A 1M56B 1FAIH 1PG7L 5I66B 3BKJL 5JW4M 2FBOJ 1SZNA 3PRZA 4QHKI 2EIDA 1VFMA 1BVZA 4WW2B 4CH5A 3SPJA 4IRJD 1IM9B 4P5MA 4OCMC 4W9HC 5D1ZI 1IEBB 3BP6A 4PN6A 1V3KA 5IF0B 3V4VA 3NMEA 1MCPH 2JGDB 5KTEH 1FAIL 3WN5B 4BCZA 1MRDH 4NC1C 3MRCB 2CXKA 3AAZA 4AW7A 3WENA 2PNDA 5F7DB 4HWEH 1YN7A 3VRJB 2WNKA 5A2QN 1CB4A 3D51A 5IJDC 2FEJA 1JV2A 2QR0B 2CR0A 4B60A 1MCPL 3BP4A 3QJQB 4GIOA 5AW6B 1MRDL 1MNNA 4MAUH 5EU7E 3VXUD 3WJLA 2BOLA 4PGBB 5FUZH 2Q9OA 3T2PA 1F13A 2DQCH 4HULB 2E5LO 1JK8A 5JIDA 5EK0A 5BXFA 3PHOB 4HWEL 3REVB 3QORC 2VXQH 3NSJA 4X9IA 2O72A 4XVUD 1BIHA 1NSNH 1UUNA 1FNEB 1U21A 4ZS6D 1RLWA 1T0NA 4MAUL 2LR4A 5E70A 1BFVH 4Q6IC 5AKRA 2GJZA 5FKPA 1MW0A 3BCDA 5FUZL 4TNGA 3Q1SH 2JKLA 2DQCL 3KPSD 4L8DA 5CIPA 3SCMC 2E7LC 3EJZC 4XTRD 1MI5A 3T09A 2VXQL 4P46D 1VEMA 2GITA 1NSNL 2HRGA 4ZXBA 2P5WB 3PDDA 1KLUB 1OZ0A 1SJMA 4NO0A 2V17H 1KLFB 1BFVL 1T5WB 5DEGA 5FECB 4XN1A 4GO8A 3W7SA 3Q1SL 5C07B 3DMMB 2IAMC 2FK9A 3LDCA 3TFKD 3PLYA 4BELD 5IVNA 3O3AA 3KGUA 2ZCEA 4JAUA 5KAIZ 2YA2A 3LXBA 1AS8A 1H0DB 5AOMA 3OAZH 5D5MA 1DVSA 2K8MA 4GNKB 5JORA 4OM1H 2L4OA 3VTMA 1II4E 5D93C 2XQYG 5JOEA 4U6XA 1TITA 3DX0A 3SHSA 3VQ1C 3ZE0B 4XPFH 2BVPB 4EIUA 1NH2B 4JN1H 3QJHA 1C7TA 1NFDF 4I18C 1UT9A 4GKSB 4QDGA 3VQXA 2NSMA 2QHRH 4OM1L 2YC1B 1T66C 3P73B 5DS2A 1JZ2A 2P8MB 3F12B 3BIKB 2YPLE 3GMPA 4JI0O 2SODB 3LSQA 3HI5H 4X66O 4XPFL 5DUBB 4N0UB 4JN1L 5AW2B 5IK3A 3S35H 3AQZA 4XBPA 1U91A 2FL5A 2YXHA 1ONQB 3WS6C 3ZO0A 2O6EA 1CXZB 1GVIA 2AHZA 3OGIB 3HR0A 3QQNA 1LP9B 2IALB 3HI5L 3LD8C 2P52A 4JN2B 1IGJA 3CUPA 1BQHB 3QZBA 4F2FA 1KGCD 4A2HA 1UD4A 2Q4PA 5LA6B 2G9HB 3H53A 2O1AA 4JTCB 1MKFA 4MWFB 1JNJA 3RN4A 3K71A 1PJ9A 1ASQA 4JUTA 2D3LA 1DLFH 1KJMA 2YAFA 3D2TA 1KCBA 1R19A 1CTMA 4YK4B 5EIQA 4GX0A 4WUKH 1B0RB 1TTGA 4PJEB 4ZG1A 2Q2LA 3UL4A 4FXGA 4JGMA 3PJSB 4Y8DC 2K6ZA 2DI8A 1R46A 3QFJA 1YEJL 4YNYA 4Z18A 5IKCA 3UH8A 1HK6A 4JJ5A 5E8NB 3L3DA 1E27B 5E95B 5GS1C 3S37X 4LLDA 3X12B 1YMHA 4F8NA 5CD5C 1DLFL 4EUPH 4MS8D 3CQFA 1U8OB 1I82A 1XB8A 3FHEA 5LGYA 2FHFA 3P54A 1NTZH 1E9QA 4IRSB 3R0NA 3FFDA 2UZXA 1JHTA 1R5IB 3JASB 2YOAA 5L3CA 4R7XA 1MCNA 3R8QA 1CR9L 2OK0H 4U1LB 3IXTB 2PPFA 3NIGF 1NANI 4UTAL 1JWUA 5C0AE 4F9LC 1NCIA 2C9QA 1TQBB 1FL5B 4PD4F 4WI2A 2IH3A 2X4QB 4FQQA 1EJOH 1ODAA 1V54B 4DK0A 1E43A 1MVFA 1OTTD 1UOVA 1V9PA 3GMQA 4LEEA 5F7EH 1A6UH 2HAZA 2UWEA 1Q43A 1Z0MA 5I2IA 1O6TA 4GYBA 3HE7A 5K1XA 1D5XA 3H2WA 2OK0L 5E0FA 4WAFA 5DJYA 1UEMA 4K2UH 2Q7HA 1WFJA 4QCIA 3RIKA 2WBKA 3BFOA 4U1MB 2IDUA 3F7VA 1H5BB 4LCWB 2YN3A 4NO3A 3UROR 1EJOL 4CZZA 2CK0H 5DO8A 5F9JA 4HOMA 5TE6L 4LC1A 5F7EL 1A6UL 4Z7VA 4HJ0C 3WFDH 2A2QT 5DSCA 2AW9A 3B2PA 5I26A 2XTSA 2N04A 1IKNC 2MPAH 5I1LB 3AB0C 4K2UL 2L7QA 4C4KT 2UZPA 4OKVA 5A16A 3P2BA 4GG6F 2YGQA 3LRGA 3RGVA 2YEZA 2VMCA 4FTDA 1KYFA 2CK0L 5TGBB 2QV2A 1DQJA 1A4KA 1A6AA 1URLA 1M4KA 2W9DH 3BQUC 5GRXG 3WFDL 3RUGE 3ZTCC 2ZE6A 2WXPA 2MPAL 1KT2B 2A1WH 3QDMA 2OYLA 1VQLV 2ZXBA 3ZL4H 2PCPA 1T7XA 2P44B 3BC9A 4HIQA 3A0OA 3VW3H 5INCB 5F71A 2DYRC 3AW5A 1QABA 3I50H 3TVMC 5D7LD 2A7WA 4FQ2H 2E7MA 2ITCA 2HA1A 2W9DL 4UVCA 4KKCD 1QVGU 1U8LA 2W0FA 5IUCA 5ISZE 1V55B 3VMPA 5EIIB 2A1WL 5B1AB 5J2UA 1T5XA 4NSKB 3ZL4L 2XU9A 4AENB 1WCBA 4GQPH 2AJVH 5IIEB 2AHIA 5CLYA 4QXGH 3VW3L 1IFHH 2EXYC 3MV9A 5BVJB 3I50L 4YGVB 3KL0A 4FQ2L 3AWGA 4PWIA 4KI5E 3CBJB 1WPBA 2QZQA 3K1DA 2BSTB 4HX1A 2YEVA 1KNOB 3SN6N 1ODUA 2X4UA 2H1XA 2C7FA 4JL2A 2UV3A 4JZOB 4PDLA 4DR2B 2AJVL 1KBGH 4JHZA 4QXGL 1CFQB 1IFHL 1T7ZA 3AREC 3RVVD 1QBMH 2PXYB 4BH7A 4O2AA 2YWZA 3QUZB 3BUYB 2BC4A 1BPVA 3PFUA 2WMPA 3C6SB 4U1NA 3KNBB 2CTWA 1GR7A 1G6RH 3C60C 4PBDA 1X5FA 3H1HH 3LSSA 1UWFA 1ZLZA 1KBGL 2YSSB 1BX2B 5TK2A 1F3DH 1QBML 3HNSH 3HHMA 5C2UB 1XCXA 2MOVA 2W94A 3ROLB 4JFDA 3ZUCA 4WSJA 4PYGA 5IEHA 2UY6B 4M6NH 4FM2A 1G6RL 2VZ1A 1KXTA 2QFRA 4KV5F 4RSVA 1YEKH 5ICYB 4MA1C 4EI6B 3MRMB 4F24A 1HAWA 5F0PB 1OCOB 1S3KH 5DLLA 4OLWH 1J5HA 1ZA3A 3HNSL 1U0QA 1JJUA 2O61B 1CN4A 4I1NB 4W9LC 1GN4A 4M6NL 2LE9A 4FFKA 2A3TA 3EYQD 4PJIB 5BS0B 1YEKL 3QRLA 5LMUB 3HG5A 5EO9B 4B27A 1XCTA 4F5CA 4MQ7A 1S3KL 4OLWL 4XP1H 4YSAA 1I8IB 1KJ2B 2FEEI 5DGQA 3K79A 3WIFA 4W6YB 1KF9B 5JPMC 2ZINA 4HUUA 1VF5C 5LHHA 4U49A 3KR3H 4XNZC 3WOVA 2NY3B 4TLKA 2AI0H 5T1KB 3BZDA 2BSDA 3VGBA 1MJUL 3MKGA 2WGXA 5KYWA 3CMOH 3S4SB 5IOPA 4XP1L 2HVBA 2YSTA 2MCPH 2OMTA 4LO9A 8CGTA 5E94B 4J3OF 2PYFA 3KR3L 2FLRT 3CIQA 5EEVA 2Y7SA 2ZKYA 4OPHA 2AI0L 3UAJA 1D7FA 2UY7B 5DD5H 2NX5A 4OF0A 2CD0A 2WBWB 1CIDA 4BQ6A 3CMOL 1CS6A 2WOBA 1I7TB 2F53B 2MCPL 4Z77A 5FO9B 3Q05A 1HEZA 3BPLB 3ISRA 3BEWB 1WEJH 2ED6A 1KBBA 2RCVA 4OLZH 5B66Z 4FULA 5DD5L 3GTTA 3OKYA 2GK0A 4ZOBA 4DV3B 1A9EA 4GQ9L 3NCYP 3RTQD 4LPXA 4UANA 2KYIA 3CFMA 3Q8EA 1CFTA 2WXMA 4ODVH 3ZKXB 4N2CA 2DLFH 3MLZH 2LFGA 3BVTA 4XXWA 5IWLA 2YD1A 1T3FB 1TG8A 4Y4FD 3TN0C 4MDJB 1KWKA 4OLZL 3TBSA 1G87A 3BSZA 4QHMA 1QO3B 4MSWB 5HGHA 1F8TH 5E9DE 2E7HA 3BHPA 2VLME 1S5HB 3FU8A 3N44F 4J27A 4JHAH 2PUSA 1NAMH 3FT1A 1MVUA 3FAVB 3CC5B 3LPGA 4XPBH 2DWDB 4ODVL 2QM8A 1YCIA 4JKPL 3KGRA 1E4XI 4GG8B 2DLFL 3MLZL 4P5RA 4PJHE 5T3XD 1AGDA 2EAEA 5KVGE 4E9WA 1JI1A 3MNVA 3ZPDA 1PG7W 1F8TL 2FIRT 2EDOA 4TNWF 4JHAL 5DMGC 4IU3B 4UUJA 1NAML 4XPBL 3UTSE 4Z23A 4WFFA 3TGUH 3MR9A 5D7IA 3LZRA 3LQMA 3PGDB 3SGEI 3WCYA 3W56A 1YY9D 1QEWB 1SLXA 4OSUH 3K58A 5EO0A 5C0BB 3UJIH 4U0RC 5IMMA 1FL6A 4JO3H 4JI3B 5CGBA 3LNNA 3RBZA 5AZEL 4FMTA 1ZLWH 4X4XB 5IW1A 3QVAA 2WZ6A 1T0PB 3FO1A 4JR9H 3DBSA 4OSUL 4JTAB 5J9PA 2GEEA 3LH9A 2VM3A 3UJIL 2NUPB 4CC4A 4Z8FH 1S9XA 2XG5B 5JQGB 4GYCB 2D7TH 3QZPA 4TNFA 1T7WA 4V2CB 3EYUH 1PIGA 1ENVA 4FI8A 2XAFA 3I3EA 3QI9A 3OQRA 3STLA 5JNYA 4KKAD 1M93A 4P5TA 4JR9L 3B43A 4JCWA 2EVJA 5ESAA 4D9LH 4PJFE 4JFTA 2IPKB 4W9FC 4Z8FL 3TPKA 2CHXA 1CMOA 2D7TL 4L5FE 4NKOB 1QTSA 3K5OA 4Q74A 3QYMA 3NCCB 4KP4A 1XHZA 3CX5J 2JNZA 4KO6A 3CSGA 4HHGA 4JAAA 2OMVB 5BZBA 1OB1B 4D9LL 2HWZH 3ZN0A 4HCGA 3QB7C 4Z7NB 5MEPA 3CHPA 2P28B 1HEJC 1AR5A 4JLRB 5D2LF 3GSXB 4ADIA 3ZIAG 1GGBH 4KTEH 2N1KA 4X64B 3QPXH 4WUUB 1HNZO 5EUOF 3TOPA 4PWKA 2A74B 2ZKMX 2K45A 5DC9B 4LVHC 5GZNA 2UZIH 4PJ8D 2R56H 2ZNJA 2HWZL 2QWPB 2WZ0A 2XPGA 4WO4B 1S7TB 4LF4B 1OPOA 1NBVH 5ENWA 3NP3A 4G59C 1GGBL 4KTEL 2H7WA 4MZ2A 3AXHA 4RDBA 3JALB 3DI3B 4M29A 3QQXA 2UZIL 4HJGB 2R56L 2CUAA 5EUKB 3UG3A 4Z3GA 2D2CC 4ZO7A 5ESVA 3FH5A 2X2UA 1NBVL 4BZ2H 5ERWB 4P4KC 2BNRD 2K70A 4PFEA 5F7MC 3QNEA 2Y07H 2QADC 3COOA 1XI1A 4EI5A 4OFIA 5JR1H 4OF3A 1AC6A 2QV4A 2Q69A 1CWVA 5MENE 1X7SA 2IEPA 2V2WA 1A7OH 3KLAB 3PNWA 4PJDB 4ETQB 3CFEA 3WS3A 3BP7A 4TQPA 5DK2B 4B96A 2FTKA 5DTFA 3CMEV 3SPHA 1MPAH 3VFUA 4G42A 4BZ2L 5EF2A 2KH2B 4NHUB 1A4CA 5E1IA 5F6HI 1J8HE 3O8XD 2Y07L 3WFZA 1NKGA 5BRZE 5TF0A 5JR1L 3M7MX 4Q2ZB 4OJDH 5D5PA 3QCVH 3SQRA 1Y74A 1QBAA 3IU4H 3QFGA 4JKWA 1A7OL 4JZNA 3SYCA 4MHHI 1CE6B 4P23B 1FCCA 3RVXC 1U6AH 4Y9FA 3UTQA 1S5LZ 8FABB 4GUPA 2G3MA 4AVHA 5AUMB 1ZKAA 3VXMA 2P6JA 5E8PB 3MJ7A 2OMUA 1UWEH 1NCJA 4MJ6A 4ELMB 1J8KA 1LVEA 3FOLB 3QCVL 1CO1A 4B9CA 5D9SB 4MB4A 3HIZA 1FQ9C 1YG9A 5HHVH 3VCLA 3KL5A 1A6ZB 1HI6A 4YHNB 1K85A 2O4EA 2XOTA 1U6AL 3EZ8A 1Q94A 2G2NA 1SGKA 4DN3H 3B5GA 2HJFA 4Y9GA 4IJ3B 4QNPE 3MGTB 4JPIB 1S2EA 2N7SA 1UWEL 3FSWA 5D1XD 3O9WB 2H9GA 4OZHF 4G5ZL 3HAEG 5HHVL 3RX7A 4GQRA 3C6LA 4NQVB 1YMMB 2X09A 4UV4H 5H94A 1ZAGA 4UTCA 3RX5A 3V6ZB 2Q0ZX 4NX0A 4DN3L 1BREA 3CFJB 2BMKB 4R4BB 2RD0A 4PRBB 2CO6B 3AUWB 3BX7C 1P84J 3UBHA 4CC1A 3CH1B 2HLFD 3VI4A 2KLRA 1KB9F 2ALWA 1E5CA 3QEQD 3MACH 1DEDA 2Y6SC 2IBBA 4PLNC 4ODWA 2FQFA 4LP8A 4NAMA 1JRHH 2CDYA 2EDYA 4AIZB 5HVHB 1OK0A 2VH5H 1MFUA 2DQMA 3A6CH 4QIRA 3HS0B 4KJYA 3EIFA 1FZJA 1P7KA 4MVBC 5T1LA 3MTXA 4JFXA 4LFHG 4PJBB 1YNTA 3QDHA 5GRVL 3T0ED 3MACL 1E9PB 4Y1SA 4Z0XA 4OD2B 3JD2A 2Y3NA 5I24A 3ZDXB 4R6ZA 5DJCB 1PPJH 4ZUUA 1JRHL 4NIYE 4ZPVA 2VH5L 4OCXH 4L3EE 4OCRH 1YPZB 5KYUA 1KCKA 4MAYC 4YIQA 2OSLB 2DN7A 2C9RA 3L1GA 3VGHA 3CB2A 1J5EO 4JPWH 4C56B 2GFBA 1IAKB 3NJFA 4U3SB 4H44B 4OCXL 4UAOB 1G1CA 4I55B 4OCRL 4AGNA 5KYYB 1TZHA 1CT8B 1Q86W 4GX1A 1M71A 5LGNA 1P7QD 5ANME 1Y7VA 1RQ5A 4FFWD 5D2NB 3QHFL 4YY3B 2HG5C 4YLQT 4JPWL 3SPIA 1Z5LA 1YA5A 3NJJA 4IBTA 2P5PA 5EBMB 2XN9B 1AD9B 1KTJA 3QUMA 2QPFA 1WAEA 1BXXA 3MA7B 4H5SB 1R3IC 1BZ9A 1K8DA 2E74B 1W72A 2A6JB 3KVPA 5AYUH 1E1RG 2QFPA 5IB2A 1M7IB 3U9UB 4LRIA 3SJVA 2ENYA 1HWYA 1AO7B 2EINB 4G8FB 5LAXA 3PE9A 3P02A 2V9UA 4LBEB 1PBYA 4IYHA 1KTDB 2NXZC 1WUNT 3KYNB 4U0QB 1CBJA 1TZAA 2Y7OA 2Z31A 1H3PH 3ZX1A 1BEYH 5ELIA 3G5VB 1XBDA 3LNDA 4OZFG 3E6FA 4JI4O 2AQTA 2OI9B 3JSNA 4Y2DD 2WIIB 3CPWU 3ZRWA 4JFUA 3APQA 3PWUB 2K9FB 2PETA 4JRFA 4PV9B 1TEYA 1H3PL 2B3IA 4IKLA 1BEYL 2EXWD 4CUCA 1QVOA 4HMEA 5KS9A 4X0NA 3VH8A 5H9CA 4TQIA 5F3FA 5LGTA 1CEZA 1XCQA 2FATH 4MYWB 3NG5A 5EU4B 4A7TA 3LDDA 5INDB 3QHZH 4ZMLA 5C0AD 4NQEE 5CEXA 1HZKA 1LJMA 4RFEB 1RSOA 3UX9B 3F5TA 2J43A 3US9A 3QIUD 2VOTA 4OLUH 4Z7QE 3MZGB 4OJCA 4H26A 2FATL 5DHVB 5TE7H 5C8JA 4KNQA 3IGAA 1M3JA 1R6VA 3SKJH 5C3IA 4XNMA 3EH2A 1NPJA 4MNQE 4MXQD 4DV2O 5GGVY 1T1ZA 4NI3A 1KCSH 5GIRA 4PHZA 3CJHB 2FJHA 1BHBA 1VGEH 4Z3IA 4NO2A 4OLUL 1B06A 1GTOA 1VA9A 1RV6X 4XGZA 3GDBA 3UPCA 4FLSA 2VDMB 2F54E 3SKJL 2M83A 1T80A 5E8EB 4DTGH 3UXFA 4YMPA 2QPEB 3O3DA 3QXUA 4X42A 1KCSL 3B9KB 3AQDA 4YDVA 1HDMB 2Y1AA 3DJZA 4RQFA 4E41A 3NSXA 4N6QA 1VGEL 3HLAA 3OR7B 3D06A 2BH0A 2PO6A 1ET5A 1EQWA 2XJLA 3BRGC 4GP8B 1ZLVH 3HLKA 1NR1A 1MF2H 1XGTB 2RR3A 2J8UB 1M9WA 3QWOB 4QYOB 4Y5VC 3RY5A 4AQEB 4F20A 5L2JB 1XMOB 5KVDE 1ECYA 3EBIA 4ZO6A 5SWZE 1DN2A 5ISZD 2DV6A 2QGCA 4YR6B 1C9SA 5EV7A 1A8ZA 3K81A 4F7KA 1MF2L 2XWJB 2BVEA 4OZFA 1QPPA 1XIWC 3GXIA 4HJTA 5I0WA 2QJDA 4DOHB 4JG0H 2J8UF 3IPEA 3UO1L 2J5WA 1VIBA 3BA8A 2BNQA 2CA3A 5TFSH 1EEYA 1P4BH 3U4EB 1JIBA 2BTQA 1UA7A 4J8RA 5DHYA 4KI5D 1T1WA 4LVNB 3AG7A 1HH9B 3G80A 1TPXC 3V9EA 3ARYA 3FB6C 4GRWF 4NTWA 3FO0H 3L5JA 4JG0L 3BWUC 4P2RE 3OTOB 1BQ5A 3MLXH 5TFSL 2Y7NA 1P4BL 2OIEA 3HHSA 4H7VA 2QZ5A 1MWAA 1LMKA 3R0MA 2MHAA 2UX6A 4F6RB 3BLPX 4X50A 2WA3A 4DW1A 3TYGL 1KDIA 2OCHA 3FO0L 4QLWA 5D1ZD 3MLXL 3CYOA 4JFFE 1DQTA 5CD3A 3HR6A 2AJ3A 1I1AD 4GFTB 4QRRE 4Y16D 4PDRA 2VDPH 4IS6A 4RGNE 5EEWA 2WQ8A 1S9VA 3W39A 1EH9A 1OW0C 2AXHA 1BQSA 3GSNB 3RFZC 3GRBA 1HSAB 1OEZW 5ES4B 4OI9A 1FV1A 4B9YA 1RIVH 3Q6FA 1EIBA 3ESMA 4GXFA 3N0PB 4S0SD 1WTGT 1NC2D 1Z9LA 1YEHH 3FB8C 5DFTA 2VDPL 3N2JA 1X7QA 4NCDA 3ZSTA 2BIMA 1L0YA 1YEIL 3ZBHA 1K73W 3CFTA 3LEXA 1BLNA 4EQ2A 3MRQB 4Y19E 4G3YH 4G9DA 4P5KB 3V0FA 2X88A 4AHCA 1RIVL 3FSZA 1AJPA 3OLDA 4CVXA 5IB3A 4KHPO 1AQMA 4DP9X 1PJWA 1GM8A 1YEHL 1RD6A 3BGFB 5LGKA 4XI5C 3EJYC 5IT9N 4CKQA 4YSEA 2PWEA 4X9FA 5LNGA 4QI3A 4W6WB 3U82B 2QVTA 1HXMB 1HQRA 4HIJA 2F61A 1J0KA 3KCPB 2VW4A 4FFVD 2AVFA 4O51B 3ZU8A 3B4SA 5H37H 3KBHE 5TQ2H 1IC4H 1A1NB 3KLLA 4ZUWB 4XNYL 5IG7A 1DVQA 1FC2D 4KKPA 3NQKA 4HZAA 4APQA 2K9UA 2EEDA 3MCYA 3V5DA 5HDQH 5J2TB 3BD4A 3EHBC 5TQ2L 2G3ZA 3TIDB 1IC4L 3NGBB 4R9HA 3RL1A 5EN3A 3VFVB 3VXNA 4PRIB 3D48R 5CP7A 1XF3A 4IIQC 4IT5A 4K55A 2NT1A 2H0EA 2P46B 2ITDC 2FWOB 4ODUA 3S34H 4YPGA 1WAPA 2BCCH 3GSWB 1IM9A 4FHBD 4UMGA 4BD4A 5HDQL 3C8DA 5EEZA 2P5WE 3HC3H 4PJ9C 5KSUB 4JBSA 1KTBA 2VN4A 2WSDA 1AI6A 1CLYH 4PRPE 2G38A 3QPQD 3RZCD 4ZAKA 3DSNA 1E42A 3K4ZA 5JHLH 2C4FU 3J2PA 1IBLO 5E9DD 4AQ1A 2VLMD 4HW6A 3HC3L 5E2JA 5DN6G 3EFOB 2IANB 4DUYO 2JIXD 4X5XB 3IMBA 2X89D 2EUXA 1CLYL 3MUY1 4XNQB 1I7RB 3N40F 3OGCB 3Q6GH 1WSST 3ZE0E 3B56A 1ZGLM 1MCWW 2F0CA 4NN7B 4WFEA 3FO9A 4TPRL 5JHLL 3WY1A 1KY6A 1ZCRA 2QSVA 2WXLA 1I9EA 3QJVB 4IRZH 5DJ2A 4YHPA 2AEWA 4JFWA 1TEFA 1P6WA 3UTSD 3G71V 1MFNA 2AFNA 2YUVA 2EZOA 3N42B 5IHUH 3WUWB 3VDBA 3VD7A 2VXUL 3MJGX 2FKXA 2YUZA 5ABAA 4J12A 3Q6GL 4X6DE 2CMRH 2F68X 1RURH 1QI3A 1ND0B 4AK1A 2GB2A 2APFA 3GMMA 3T4YB 4GZRB 5D93B 4IRZL 1P4LB 4RAVA 4QPKA 2V6HA 5FX3A 5FO8B 1KLUA 2V33A 3C5ZC 3PXJA 4E5XG 2WA4A 3ZN1A 1KB5H 5IHUL 2FZ3A 4QMEA 4LSDA 4Z7WE 1T5WA 5EU5B 5FECA 3GUTB 5EORH 4JM2D 4KX7A 4C7UA 3DMMA 4KXAA 4NKIH 2CMRL 1RURL 3VXPA 4LDOB 1NFDA 1IBMB 4MRBA 5A2JH 4EO5A 1KLGB 4JPSA 3RPIA 3KYOA 1YN6B 2VW6A 4GMTH 3U83A 1KB5L 3VD5A 5CFHA 1W9XA 2V8MA 1XMWA 5EORL 3DJ9A 4ATWA 4NFDA 1UURA 4NKIL 2WKOF 2D4FA 2HP4A 5EC2A 2BVPA 1KGYE 2ZXWC 3OG6B 4ABUA 1M4UA 1JTPA 4F9PC 2Q7YA 1SHMA 3ZMNA 4I0XA 4X7SH 3ZRFC 1JJOA 2ATKC 3ZQ9A 4GMTL 5FL7G 1FSKB 3T6QC 4DR6B 2JLPA 2NY4C 3KYMA 3L81A 4HS6B 3EO9H 3NJNA 5HI4D 3AUVA 1SMAA 5HGDA 3PQYA 1HNXB 4GEIA 4HJ1A 3KPRD 4MRCA 2V1DA 2A99A 4LLYB 4B9KC 3T4DA 2XASA 2HYMA 3FAXA 4X7SL 1PD1A 2A6DA 1HHJB 5DJ0B 2WLIB 3DX2A 1NJ9A 1BIIB 3EO9L 3MU3A 4U1JB 1HKFA 4UI2A 5JLZA 4PJAE 3KH3A 3O45A 3DGGA 1VIWA 4Q4IA 4DHLA 4H25A 1MW2A 4C54A 5LA6A 3S3XA 3QUGA 1GSKA 4GSUA 4DERA 1BP3B 5DJAA 4LSSH 1BYNA 4N5EC 5ALBH 3SQBB 3EO0A 5F7KC 4PI2A 4X88A 4PA3A 1K7DA 5BMVB 1YDPA 5SX4H 2BSSA 2WPGA 4HALA 4NI6A 4PR5B 4MKTA 5TDNA 1B0RA 3OXSB 4ZMYA 5E0QA 1QKZH 5EIIG 3RX8A 3KLSA 4R96B 3GMRB 4JRLA 3AVEA 1SHSA 4LSSL 2XV3A 5ALBL 4AQYO 3BESR 1R6TA 4LFAB 2XLLA 1BQUA 3K5LA 1AKJB 1BYOA 2ZXEB 4NWTL 3FT0A 3NFPB 3UJJH 3W9DA 4Z7OB 5MEND 4A39A 1NC4D 5CCJA 3VFPA 1FNAA 1C12A 1H8OA 4OQTA 4NXNB 5EZOH 3VGAC 4KXBA 4E5XA 3US0A 3CVHA 5D4IA 1Q1JH 3MREB 1HHGB 1IL1A 1J8HD 2HTLD 2OBGA 5BRZD 3ULVC 4MT8A 1AZCA 3UT5B 3PUUA 5DS8A 2RGSA 5DWUH 1NI8A 5EB9A 3UJJL 1RULH 4U1LA 3TO4D 3PL6D 4UINL 3HKFA 5C7XL 3ZE1B 5C0JA 3P3SA 4AT6B 4B7LA 4ZZKA 3WGVB 3IJ8A 5EZOL 2AS5M 4HDIA 5CBEA 2ROYA 1RZGB 2B77A 3SE9H 1UWXH 3NCYS 1Q1JL 2IBZY 2VLJE 4R26H 3L75H 2OJEB 5I0XA 2CPCA 2Z7WA 1TOXA 4AYFB 1FFPB 1IAIM 4P2OD 5DWUL 3MI6A 2CAKA 4Y5YA 2OCCC 1RULL 2IIJA 2DQGH 4MA8H 1IB5A 4GG6A 4ZT1A 3E83A 4ZUVB 2DJ4A 4XOCA 2TRHA 1S7UA 3EFFK 3SE9L 5EEYA 3SDCD 5IFJB 4PLKD 4R26L 2WSKA 1Z5VA 2YUWA 1CP9A 3LJ3A 1LEKA 1QPXA 4FNPA 3TH4T 3D85D 1MDTA 2CJTA 4ZUSB 2FJFA 5FKAB 1TJXA 4BHUA 4BQCA 2DQGL 3D25B 2B5IB 1JQ0A 4FG6C 3ZW3A 3EYVA 3IU3A 4MCNA 3QH3A 3U36A 1RK1A 1K5NA 1TFPA 4NNPL 2DI9A 3JBG7 3DO7B 4AE0A 1GS8A 1TCRA 3QPKA 1BG9A 1KEGH 3NIDF 1ORSA 3SDAC 4KPHH 4QNHB 1K5QA 2D3NA 1C8PA 2N05A 1OSZA 1IM3B 1H8LA 3OTFA 3TBTA 4QRPB 4YO0A 3H9VA 4X4ME 3R65A 1VCAA 5JIHA 1D9KD 4GX2A 5TTRA 1NMCB 1A22B 2CNZA 4KX8A 3UYPA 5HDBB 4KOBA 1KEGL 1KBWA 4KPHL 4L3AA 2QVMA 1AH1A 4HJJH 2N01B 5DO2D 3JWNE 4WBNA 3L2NA 3LRHA 1QBBA 4I0KA 2L7JA 4NENB 4XCNB 1NTMH 3B7UX 5KUKA 4LRNH 3ARFD 2DD8H 4W6XB 3JT2A 3BJLA 1IBGH 3ZK0A 1R5VB 4LCVA 3CE2A 1NLBH 4BBWA 5B3JE 1R3IH 1XD1A 4GKJO 4L3ED 3STZC 5BZXA 4NM4H 4HJJL 1F23A 4FERA 1N12A 1Q72H 4LRNL 2BSTA 2DD8L 6TAAA 3MUGA 2GPZA 4DV5B 4YL4A 1H3TA 1IBGL 3PP4L 2A9NH 3LNFA 3W57A 1S8DB 2A0LA 1R3IL 3TBWA 1UCBH 3VMOA 2QQNH 5TISZ 3MXWH 1PAZA 2DYSB 3C6SA 1Q72L 1QI5A 5BZWA 1CD1A 1IQDA 4EDWH 1VMGA 5I0ZA 1JK9A 2YSSA 2NUTB 4OB5H 2A9NL 3VQ2C 2YA0A 2C2AA 2BVUA 4PCTA 1ZDQA 5LGUA 1QSFB 4XWGH 1UCBL 1RJYB 1JBJA 2OWOA 3JTSB 4IM8A 4YJ3B 5KLVH 3MXWL 2VE6B 5C0CB 2GSGB 4WFGE 4KKZA 3V0VB 3WUZA 3FQUB 5ICYA 4EDWL 3MRMA 1VHPA 3MA9H 4MNHA 5DWPA 1YDXA 3CQQA 4OB5L 1NKOA 5FM5M 3QF7A 1IARB 4LP5A 5I28A 4MB5A 5E7BA 4FZ0A 2ZXAA 2DTSA 4XWGL 5I17B 3DTUB 3VFTB 3DXAE 4AUYA 2BTOA 1JVOA 3QISA 4MDIA 4ODHH 2IH9A 2X1XR 5BS0A 1KPUA 4ODTH 1QRNE 1IAOB 3FTVA 5FHAH 3RVWD 2C3GA 2ERJB 4AYMC 2QELA 3MA9L 3U7WH 2CCLA 3MHSC 2AK4B 4ZS6C 4X7DC 2Q6WA 3ZZ1A 3CPLA 1JI2A 5KBDA 3DGCR 4BA8A 1QSEB 4BK4A 2JRIA 2ZUUA 3B5HA 5KSAD 3ZRCC 3EO1A 4GQZA 4ONHB 4ODHL 1K4DC 1U8KB 5BO1H 4KVPA 4XTRC 5LGHL 4ODTL 1NBYA 1SJVA 1SQPH 5FHAL 1HVXA 3MJ6A 1QW9A 1GYAA 1J1PL 3DX8A 2DWYA 1A4JB 2JJVA 1HOCB 2V5SA 2GW5A 3L5IA 3MBEB 4RZKA 1ZT7B 1EHNA 4FQXC 3OL2A 3ALPA 1JHKH 5IOKA 4NQED 2CQVA 2IJIA 3Q3GB 3Q8FA 5BO1L 3GGWA 2YIBD 2VB5A 1IZ3A 3TFKC 5LJYH 2R83A 2AAVA 4AE1A 4AJVA 2LFRA 4EZLA 2OJZH 5CKGA 2BOCA 1MCSA 3SDDD 3FQ4A 4TV9B 4DKDC 2GBOA 4DH2A 2K8QA 4I13B 4R2GB 1DDHA 5AVVB 4MNQD 4YHOH 5DD3H 1LO3H 2QR4A 2AGAA 1AVAA 2CPUA 1MDAA 3TV8A 2Y0IA 4ZW3A 4MVUA 2OJZL 1EZVX 1R3KB 2FHBA 4FQPA 4K8RD 4DGWC 4E42A 4NWUH 1BMZA 4G2KA 3I56V 4Y4HD 4JYCA 2F54D 5FYKH 3FQ2A 1WA0X 1CDIA 3BISA 4DUZO 4HVBA 4UCSA 3IJSB 5DD3L 4YHOL 1LO3L 4ONGH 1PNKA 4ADGA 4DKEH 5JYLA 1G9MC 1ILSA 4O4JB 1O9GA 1YJDH 2D3VA 1JXGA 3HB3C 2OTUA 2ODMA 4IKIA 4NWUL 2HX7A 4YDLB 4Z6AT 2HFGH 5IYZA 4GG8A 4R97B 5FYKL 4L18A 4Y1TA 1KPVA 5CWSB 3HFMH 1KTLA 2KQMA 1JDDA 4S0HA 4ONGL 3VFRB 4DR5B 3P4LA 1PFCA 2A4EA 4N87A 2DWEC 1YJDL 3OLEA 5SWZD 4F7TA 2E47A 1I85A 1XF4B 4TUJB 3KZIZ 2HFGL 4M9PA 4I5BA 3UDWA 2RA1A 3CDYA 3HFML 5A3ID 1SN2A 1XGPA 5F8RC 2VXQA 5C0NC 4LEOA 4Z7NE 1QZNA 2FSDA 1IAMA 2DQ3A 3H56A 1IUZA 3D2UA 3WL9B 2ZIMA 3IJYB 5E6IB 5DS1A 5J4MA 4QKTA 5CJBA 3HNTH 3L17A 5HFLA 5SWSB 4FADA 2VZUA 5EPMB 4P2RD 4HXAH 5L88H 4X65O 4LLUB 4P3DA 1MJJB 4DYLA 1QFUH 1SDAB 4CRPA 4HOWA 4YSCA 3HZMB 2JMRA 3FQYA 1S7XA 5GZOA 1XR9A 3CCLV 1KTKE 1GZPB 3RRQA 3T77B 5CM1A 3HNTL 4IGBA 2Q2EB 3SGDH 1GH6A 1U8HB 1BJ1J 1JZDC 4F8LA 2VLLB 4HXAL 4PLJD 5L88L 1XMQO 4U05A 5D2LA 2LGQA 2EXSA 4GBXC 5AW8B 4MJ5B 3QS2A 3CZJA 3GFUA 4N2KA 4QRRD 5TE4H 3M8AA 1QFUL 1ERNA 4RGND 1NGYA 2BSKB 4OIIH 1KEMH 2XZAL 3VYOA 1CDBA 4H1LH 2A3QA 2VWEE 3H55A 3A4AA 1KIPB 5G4OA 2YGVA 4AZ8A 43CAB 1E9OB 1RSYA 2JKWA 3CXDL 4TVUA 5TPWH 4G8GB 5D5ME 5K9JH 4W9JC 3MFGB 4WU7B 1RPRA 4NXSA 2EDRA 5GGUB 5AW4B 2X44D 1QWNA 5E5MB 5TE4L 3IVKB 4TWKA 3FTYA 2WKGA 3EFFB 3EYFA 4OIIL 2UXBO 4Y19D 5DMYA 4DGIL 5ITZB 5DJDB 3K0DA 2XV2A 3P0YH 4HUXA 5TPWL 3ARPA 2J88H 5K9JL 2IF7A 2GDSA 5CA0B 4YVUA 5I1IH 4Q58C 5KBMA 2E46A 3DC6A 3GI8H 5D96C 3IDGA 3BFRA 3QC5X 1Q8IA 4RAUA 3LDBC 3JV4B 4U3HA 1MOFA 4HJGA 1E6OH 3P0YL 1KGXA 4X1IB 4JKNA 1U97A 2QEXV 4EN3A 5JA8B 2J88L 4XXCC 3OHXA 4KKCC 4XH2B 1N32B 4JO4H 4FL4B 4LR3A 1JJ2U 1FGVH 3GI8L 4FX5A 4RWHA 2M7WA 5B1BB 1AP2A 5HHMB 2IPTH 4IHBA 2VJ0A 5IBTH 1MVYA 3F6JA 5DK2A 1E6OL 3E8FA 4LFCO 3T2NH 3ZYOA 4K0KO 2BS8A 3GSOA 3ZL2A 3DURB 1U3HC 3QUKA 1CXHA 3BDYH 3RE0A 4WENB 1JERA 4EUPA 4JO4L 2H6PB 4HEME 3A5VA 3PF2A 1FGVL 4WU5B 4UTAA 2OMNA 4ZMTA 4GEJA 4L8SB 4HWZB 3EXJA 1UG9A 2IH1A 5IBTL 5EU3A 3P9LB 4IHJB 3T2NL 5C0RH 1FJGO 3T1HO 2J7LA 2P5WD 3AT0A 3OEEG 3QFJE 4PGDB 2CJSA 4JRYA 3F5WC 5CMAB 3RI5K 3RVVC 3UBXG 3BDYL 2HJKB 5C1MB 1NFIA 4OZHA 1TVHB 2F1EA 2Q8AH 1FXHA 4HKXA 3ZN6A 5IMKA 1ETZA 1EAPB 4PJBE 2IQAA 2WYTA 1KTRL 1IE5A 3W7TA 3IJHB 1NUFA 2G5BB 1E28B 3N6YA 3P3NA 1ZV5A 3ZDXE 3UPRA 3BABA 3NEEA 3O4OB 2Y06H 3MRLB 4W9GC 5KHJA 4C55A 1SVBA 2AK1H 2J44A 5BOZG 1J9CT 1FYTB 2BSED 3KHOA 4JL1A 5F7HA 5EZYB 5HYJA 3CZNA 4GAAA 4DV4B 1JN6B 4B3RB 1A32A 1A6TA 4GRLD 5MI0B 3QWNA 2B9ZA 4C56E 1FVCB 2OTLV 1JR9A 2BOBA 1ADQH 4PA7A 1XB3A 4AKQA 4AUJA 3HI1B 2APBA 4Y2OB 5CLTA 2AK1L 5B8CB 2JKJA 4I3GA 3CH1A 1XH3B 3KD4A 3V2AR 3M1OA 2QPUA 2YLHA 2KQXA 1W8NA 3GPEA 3FQRA 1ADQL 2UUBO 3T8XB 1VQ8V 3KG5A 4KQ4H 5JHBA 1D2DA 3RY4A 1N6UA 1D5MB 4B41A 3GMNA 1JE6A 1M7XA 3LIZA 2Y69C 5BUPA 2HKAA 3FSVA 1JNLH 3JWDH 1WYJA 4EIZC 1P7BA 4ES8A 3T71A 4H8UA 1HJCA 1XUQA 15C8H 1E9PA 5BV7C 3BGMB 2EE0A 3OLIA 3TBYB 3DTXB 1TT6A 1U93B 2YXMA 3OB0K 5DJCA 3UMNA 2NXYB 4AXWA 2XY2A 4JDTH 3PHSA 2MIZA 1T0OA 2Q73A 1K3EA 1UD5A 2WXNA 3PAZA 3QDME 2JDIG 4AM0A 4D3CH 1JNLL 4JM4H 5HYFA 5FW6A 3N1FC 2CXGA 4E0RA 15C8L 2KB1A 4LLVA 5JOFB 1NBZB 4ALAH 3FB7C 2F8OA 4R4FL 1OCRB 2V2XA 4E4EA 4JDTL 3WFEH 3N27A 4D3CL 2DOCA 2EDFA 5EC1B 4JM4L 2D0GA 2QKIB 4IRSD 3UBXA 3AK1A 1EZLA 2HFFA 2PCFB 5D2NA 3B77A 5IBUB 1FZOB 3DV6A 5LB1A 3MV9E 5MP6H 3AXLA 4JI6B 5HGAA 4M61A 4ALAL 2I25N 3O41B 2NY1D 4KOCA 4Y4FC 3QUXD 1N8ZB 2YI8A 4BSJA 1G6RA 2CDEA 1A2YB 2MPVA 4K73A 2BK8A 5F8QC 1H8NA 4U3JB 1E4KA 1EO8H 5HD8C 3EKCA 5EDXA 3ULVH 5AYQA 1RZJH 3RVUD 4OGQB 4QHLA 4XCCH 4N2BA 5MP6L 3H4FA 2O57A 1HQ4A 1H15B 2GJ6B 1K6QL 5D1QB 1NVPB 3ZR6A 1FYJA 1PIFA 2X4TA 2EEFA 2QT6A 4I0PA 4NZUH 2B59B 4YC2B 1EHXA 3CS5A 3PWPB 5DC4B 2DRUA 2XV0A 2WQAA 1R4XA 4AYDC 3ULVL 5JHDB 4DV7B 1RZJL 4R0LC 1WFNA 3CZGA 3PXLA 4BIZA 4Y1AA 3NN8B 2YD3A 3OZ9H 1Q6HA 1CXFA 2ZNXA 5DK0A 2KG7A 3FTUA 1OGAB 2VZOA 2CAZC 4NZUL 1YY9C 1ZTEA 5HY9B 5F9AC 2WV3A 3ZZQA 1CFSA 1ZTXE 1PZBA 4L4VA 4DCQB 2UYLB 1RZFH 4NNXA 4XP4L 1CLZH 3T5WA 3RWGA 4Q97A 1E2ZA 1MCCA 3V6OC 2GBAA 3OZ9L 2H6UA 4LF8O 5LL6Y 5G4MA 2IDQA 4J42A 2LTQC 3UZEA 5FNVB 3H1KH 4UIMA 4OV5B 5INDA 4KTDH 3QNYB 4XOBA 3TO2B 5IUSA 2Z35A 1T83A 1RZFL 3MJWA 2VLJD 3X2QC 1CLZL 5GONB 4F1ZA 3I5DA 4TUOB 1G7LA 3V4PB 3ULAB 1FHNA 3T3MF 1ZWIA 4P9MH 5KVDH 3UEZA 3PREA 1XR8B 2B15A 5L4JA 3QIBA 4XMPH 4KTDL 3TZVB 4M5YH 1EXUA 2XIDA 1DVFC 4DOHE 5GGSA 1VAHA 2MNJB 3QUYD 3LY6A 1T03H 2QMKA 3HBQA 2LGWA 5CR1A 4KZDH 1QUNB 4GOSA 4N23A 4P9ML 3EVKA 1JG9A 5KVDL 3SO5A 4LCUC 3K5RA 4XMPL 4M5YL 4PA4A 4UCVA 5HYEA 5B38B 1GAFH 4CSSA 1T03L 4PJXF 3ULUD 4WFHA 2ETWA 5KWYC 4KZDL 4LLMA 1WZMA 3FOMB 5D7HA 3KPQA 4M1GL 2APTA 4XODA 2MCMA 5DRXA 1S9WB 2MH4A 3U4AA 2CNYA 4LNUA 4PJ8C 4X6EB 3WJJA 3DIFA 4Z7UB 4BFFA 3GSVB 1SF9A 2J8UA 2FIKB 1GAFL 3VXOB 4RA3A 1NAMA 4ZNEA 2JIZG 3MOBH 2R4SH 1IQWH 4Q56A 3PV6A 3FUDA 2X4NB 1ES0A 3P77A 3JD3A 2NY7H 5I6KA 4HQQH 1VZGA 1WC7A 3B9AA 4B95C 1CFNB 4WSKA 2ICWA 4GSRA 4X5WA 1E8WA 2R4SL 3MOBL 1IQWL 4O4YH 4P9OA 5FYLE 2EVGA 5IVOA 5LAPA 5IREA 1F00I 4FJ6A 4YXKL 4YHIA 2NY7L 3W37A 5C0GB 2MQ3A 1QQDA 3BWUF 4HQQL 1MJ8H 1QHQA 1WO2A 3HG4A 4E9QA 1G0XA 2P3YA 3B8NA 1TUEB 3FU7B 2RACA 4N2GA 3O8XC 2HT2D 3C8KA 4O4YL 5T5FH 3ZT7A 3FFCB 5D7IE 1FRGH 5D7JA 4JDVA 5L4FA 3CC2V 1DQMH 4XAWH 4W68A 1ED3B 1U8NA 5LBSH 4O58H 3LTVA 2RBLA 2DS4A 3OJDA 4FD0A 1MJ8L 3N43F 3MRBA 1PSKL 4JPKH 5DYOB 5K1VA 2XYBA 1AHWC 4K8XA 1FRGL 1T2XA 1Z5YD 3CHSA 4ZFZB 1DQML 3W38A 4XAWL 4WFGD 5LBSL 5I75B 3S5ZA 4LVOC 1DBJH 4DWHA 3VI3B 5F3BB 2R69A 4PY8I 3BVNB 5F1IA 2LV4A 4GAJH 5DHMC 4PJ0Z 4JPKL 4L05A 2PTVA 4G71B 2KZKA 5D1XC 1X5YA 5A2BA 3DXAD 1NWOA 4WWKD 3RKDC 3BAIA 1MCEA 1WFMA 3UO8B 1ORQB 1S7WB 1YQVH 3CE1A 3DPBA 4GLRH 3MLTA 4WI0A 1DBJL 1RZ7H 3ALWA 3OSVA 1FZMB 2VT0A 3L5HA 4V1DB 2D2OA 2OMZB 3CPUA 3LN4B 4Y4KB 4GAJL 5AL0A 3RI5F 2EACA 3HUJB 2YD6A 3AG3B 4GKNA 3AMKA 1FL3B 1XEDA 2H3NB 2OULB 1LO5B 3D87B 4BE5A 1G7HA 4C57C 3CCHB 3EH4B 1OPGH 2JB6B 3PAYA 2R39A 1YQVL 3V7AG 1UD2A 4G1MB 4HWBH 5FPIA 3B40A 1YTFB 5KSBF 5CGTA 1AJNA 4DV1B 1NUGA 4YSTA 5CEYA 4OAWA 4PMFA 3GTVA 3MV7A 4KAQH 2NLJB 5E1AC 2F19H 3IE4A 3QT2A 1JL8A 3BPNB 1OPGL 3Q44A 2WLJA 1TTAA 3S2AA 1WS7A 4W9IC 3ARRA 1G9MH 2J4WH 4PRDB 3RWEB 4HWBL 3ZYZA 3T0EC 3REWA 4HLZH 4YXWG 4LLWA 5T1MA 1RFDH 4NTYA 4KKRA 3MV8E 3ILQC 1JYXA 2JCCF 4KAQL 2AV7A 4XE0A 2F19L 2CGYA 3LKRB 4XBGB 4N2NA 1KBPA 2WUCH 3B5TA 4X6CB 1ZMYA 4MQSB 2I7SA 2EVHA 4WZ9A 4GXUM 1G9ML 2J4WL 5C0BD 4C58B 3RY6C 3QNZB 2FWOA 1JOIA 4GW5A 4EKXA 2XG4B 3T0DA 2ADJA 4IIZA 1RFDL 4HKJA 3LN9A 5ID0B 4QRBA 3A23A 4BCYA 1NGZB 3LKNB 3SGIA 3QO0B 5MEOB 4R7DB 4NQCB 2WUCL 5C09E 3QORA 4O02A 3VWKB 1VARA 4N3UA 1CI5A 2N4IA 2NTSP 3UTZA 1TMCB 5K9OB 4ILDA 1Q90A 3TTYA 1OAZH 4UTBH 3SBRA 3CVIH 1BS3A 4DAGH 3NJMA 3D3VB 1W59A 4KJPD 3SCMA 4FCHA 2Z7ZA 4N6RB 2CO2A 1KGUA 2E7LA 3FPXA 3TPUB 4FFBA 3ES6A 1I7RA 3CGTA 2PF4E 1EEZA 2VR3A 2OX5A 1FG9C 3VOUA 3GHBH 1V7MH 3GPSA 3IGFA 3K74B 1L5GB 3C5ZB 1YJ9V 2VDLB 4PVLA 1RP3B 1OAZL 3FRUA 4UTBL 4M6AA 3CVIL 4RISH 4DAGL 1MW1A 2P22C 4P2QB 4J1UA 3HRZC 5E1QA 2IAMA 4AC2A 1HH6B 4MCZA 4PBWD 1EZSA 3IDJB 2WZPA 3CC4V 1FZKA 4HCRA 3MLVL 4FFTA 4UQ2B 4K94C 3APMA 1V7ML 4AWJC 3CZSA 1MELA 3TASA 2J20A 2EIZA 1YAIA 1DUZA 3EH1A 4RISL 1OY3B 3HMXH 2VDOH 4Y2DC 2FX7H 2QQLH 3BFWA 4WUUD 3RYCB 2XETA 3O2WL 2DI7A 2HEPA 1PKQA 4NCC2 4M6MH 3E0GA 1CXIA 4I18A 1JZHA 2WKOA 1HW7A 3BZ4B 1GY2A 5HVWA 3APOA 3UYOD 1RPUA 3P30L 3RWFA 3CRMA 2EXWC 4JB9H 1FIEA 4WEMB 1UATA 4M02A 1F4HA 2ZUXA 3HMXL 2VDOL 4I7ZC 4HOXA 1Y18B 2FX7L 2CH8A 1RJLB 5JJJB 2QQLL 1KQSU 4QXVA 3TEUA 4FYRA 4PCKA 5KYXA 1EAQA 5I74C 2OMYB 4M6ML 3LVEA 4MTFA 4JFEB 1A3ZA 3VI4E 3D8MA 4O2BB 1SYVA 1FS0G 4RDQF 3WS6A 4JB9L 1JWSB 3BUQA 4NO0D 2OMWA 3UP1A 2HHHB 5GRJH 3V9FA 2YS4A 1DN0A 4JREB 1N6VA 2NY0C 5F70A 1SPDA 4AEIH 1X9UA 3JUZA 1G7MB 2ZG3A 1B6QA 3ELQA 1Q9LB 4OLYH 5LYJB 5GRJL 4KQ3L 4LF6O 2ZWLT 4QF1B 4M5SA 3ABKC 1GS6X 2VRZA 1T21B 1OJHA 5AALA 2CRZA 5TDPB 2R1YB 3NESA 4AEIL 3MRKA 3L3GB 1I7FA 3W7UA 3PDOB 1SY6H 4HZLA 1R5WA 5H2FZ 5GS1A 3MNDA 2EDDA 4OGZA 2BWQA 4OLYL 5ALCL 3AROA 1NUDA 3T6XA 3I9IA 1LD9A 3LXCA 3SQBA 4KNSA 3Q8CA 1S7QB 4I9WE 3WNKA 3IAGC 3OKMA 1G9EA 4BGDA 1QOKA 3B9DA 4UXNA 4RQQB 1H8EG 1INQB 4BIOA 4K7PX 2A83B 4U1IB 3HE6C 4DRXB 2C9UA 4OJFH 1OXYA 4UV7H 3L1FA 5KG9B 4WHDA 5EIVA 4F9LA 1AKJA 4AIEA 1B9ZA 3U0ZA 3MFFA 3DUSA 5I9QB 4LARH 3EW3B 5FGBC 4FLUA 1OWRM 5EYPA 5FLXN 2A06H 4X6BB 3EGSB 3V5HA 4B50A 6PAZA 3H9SA 1KIUB 3ULVF 1RUQH 4PG9B 3ZE2B 3SJVE 3MREA 1ZJAA 4OJFL 4UV7L 3TONA 2X4SB 2BVOB 3N85H 2E7BA 5GSVB 3QNXA 1QASA 5I6XC 1QCEA 3SE8H 2A73B 4KI5C 1BD2A 5DJXB 4LARL 5E9AA 3GZKA 3QFJD 1CICC 2Y6TE 4KZ0A 5CNHA 1RUQL 1WBXB 4YUEH 1IKNA 5DZPA 2LQTA 5HDBE 1UFGA 3N85L 2EIEA 2JCWA 4PCYA 2G5RA 1CDUA 3KBEA 3SE8L 2APXA 5KVFH 4JZJB 3IDIA 1BXVA 4KMQA 3ABMC 1AP5A 2XTLA 3W5NA 4MD5A 5E08H 5ITBH 3BQUA 3FONA 2C1OB 3GO1H 4R4ND 4YUEL 1MCJA 4J6RH 5DJ8A 2OL3B 4Y16C 3SQOH 3RB5A 1UFIA 4ZW8A 4R5VA 4JYAO 2EIKB 1WWCA 5KVFL 1VKXB 4BXVA 1DCEA 2CO7B 4JYBA 1XD0A 2YQ2A 4LKCA 5ABZA 1AXSB 3D25A 5E08L 2OMXB 2OSYA 1L3WA 2DL9A 4H33A 1XGRB 3TVMA 4C56D 5ITBL 3ZDYB 3GO1L 5AL8A 2OP4L 3QO1B 1UHVA 1T22A 3ARBB 4J6RL 4QR7A 1IJ9A 3DVNA 3SQOL 1ZL8B 2H94A 2XBZA 3L08A 4OFDA 3PFQA 4Q14A 2EDEA 1M57B 3MHHC 3TXSA 1L9RA 3K9SA 2IADA 3H0TB 4HISA 1T2JA 5KJ7E 2X9YA 1MREL 4TMPA 4L3CA 3MNMA 2CLRA 2R29A 3P9WB 2F1AA 1IRAY 2D4DA 3JZYA 3UEQA 1P49A 5FV2A 1Q0YH 4MS2A 2C3XA 3EGXB 3O11B 4RGMB 3X11A 4FVMA 4CU7A 2HCZX 2CDFB 5F9WB 3SE4C 5H4YA 4UIKH 2ZUSA 5JQ6H 2D7PA 2ZUQC 1SF5A 3AREA 5KX5B 2GJJA 2EZPA 1AGEB 2OKMA 4JFOA 2IFFH 3QIWC 5KAQF 3ZXAC 4XBFA 5L3GA 3IFLH 2F5AH 4C4KO 1EJFA 4L8BB 3OSKA 4IRJB 3C60A 3L4WA 5J1AA 5H35B 1RHHB 1ZS8B 4Y8AA 4GKOA 3QXAB 3MDJA 4PPTA 1M5IA 4UIKL 1BSMA 1JGDB 5JQ6L 3QR0A 2GCYA 4LF7O 2IFFL 4S1QH 4MQTB 2WW8A 3IFLL 1CPYA 2F5AL 4OI7A 4F2MA 3GJEB 5LBQA 5F0MB 5IW6B 3BYTA 4J39A 3L3OB 3ARGB 2JK5C 2OYQA 4R3SA 5J0BA 4NDMB 2BIOA 1KELH 1XQ4A 4D8PA 4S1QL 2C4FT 4BR6A 3MV9D 2XUWA 2WNWA 3UMTA 3CSBA 2XTJC 2VTFA 2Z92A 2DYPA 3QEGH 2YAQA 3QPQC 4IK6A 1QSFA 4JG5A 4BUQA 2KLTA 2DQHH 4MMXB 3LKQB 3DVGB 3D30A 4HU2A 5LHGA 1KELL 4GAFB 5JPMA 1MRCH 1OT4A 1IKFH 2EIJB 2QGEA 3FCBA 1FXKB 3GSUB 3KPSB 2BCMA 2MNWA 2XX0A 3ZT6A 1OP3K 4K4KA 3DOSB 1K4DB 4TTDD 4P9PA 1D5ZB 4K7FB 4P46B 3VRLE 4AYSA 4X20B 2X41A 1PZ3A 2DQHL 4IGGA 1MCKA 3WDJA 1N2RA 1ZY9A 4H8VA 3JTTA 2XV6B 1MRCL 4S10A 1IKFL 3ASOB 2NOYA 2BHZA 2VR9A 3G6DH 3MUHL 4H8QA 2PYEB 3KPOA 2BIQA 4BHUI 3G6JB 3D8CA 3KPMA 4RIRB 2F74B 3SKOA 2UX7A 4DGVL 3MRRA 5IJ0B 2B0SL 5F7YC 4WWID 5GS3A 3WIIH 4MKMA 3G6DL 2CR6A 4DR4O 2BW5A 4O4LA 5DJ6B 4MQXD 3SOTA 2WIMA 4KJWD 4JFHE 1TENA 3CWGA 5AB9A 5I0YA 4WNQB 4ENED 3E35A 4JM2C 4I4WB 2XY1A 3WNJA 4AH2B 3F7YC 3SGKC 3AZUA 4FC3E 1L0NH 5AW9B 2EO7A 2YOCA 2VSCA 3CVBA 1TJIH 2VDQH 3WIIL 4DZ8A 2HKFH 4Q6YA 5CXPA 3BAWA 3WMSA 5AFAA 5IVXE 1IBYA 4N90E 3OAUH 3QA3B 5H37A 2WLYA 4NQTA 3TN0A 3DUUB 3V4VH 5ID1B 4DV6O 2L7EA 3BO8B 1ZVSB 5K1PA 4RETB 3W0WB 1ZS2A 3J80N 2MOGA 2KPWA 2I9TB 2X10A 2VZSA 3PWLB 1TJIL 2VDQL 2Y2YA 2HKFL 2HUHA 3KLDA 1KIQB 4RZCA 2LOEA 5BUAA 2FECL 3OAUL 2RFXA 3V4VL 1AKPA 5H6RA 3POCA 5I71B 3IXAA 2VZVA 1FH5H 3K6IA 4HIEB 1Z9SA 3HZYA 3EOBB 1N0LB 4LHQB 5HI4C 4B5ZA 5I8CA 1PY0A 2YRPA 4LCYB 2Y4TA 2G4GA 4X1KB 3U1QA 1R3HA 4OR1A 2JKIS 4EMZA 2GUZA 5I0VA 5F1NA 1X5KA 2Z0UA 4NN5C 2EJRA 5HGBA 3SY0B 1EGJH 2GIMA 4TOIA 1FH5L 1BFTA 3BWSA 3GLAA 3JT0A 5JHLA 1IGIH 2NRDA 3P4NA 4N2LA 2HVKC 3UC2A 4C59B 3WFVA 3D0LB 2ESVA 4I2XA 4WI6A 1XZWA 5CIPH 5I76B 2EE3A 1N19A 2ZP8A 1EZUA 3L4ZA 1GRJA 2WN3A 4WEBH 2ED8A 1EGJL 1ROWA 3MOAH 3MBWB 2ARHA 2W6JG 5KHGA 3VMNA 3ZHFA 1OCWH 3MROA 1IGIL 2XWZA 2D31A 2YO3A 1CF8H 2X6MA 2AJSH 1AS7A 6FABH 5FR3A 1H6FA 3CTTA 4IRZA 2V5TA 3ISYA 3K57A 3SKNA 4CMHC 3P2TA 1RPKA 2XZQH 1H38A 4WEBL 4JFPB 2UUAO 2BX5A 3D09A 1T6BX 2HRPH 3MOAL 4PJ7B 3DYPA 1OCWL 1QNZH 4K9JA 4WFEE 5KBKA 1CF8L 2AJSL 2FNWA 5C6TL 2V5RA 1M7DA 6FABL 2NSQA 3LKSA 3PU7A 4ZD3H 2HTLC 4AQAA 3WTWA 1KB5A 2XZQL 1ZK5A 3O2DL 1PCXA 3CHOA 3CRAA 1OTUD 4PP1C 3TO4C 3UC0H 4AJ0A 3DOHA 3HZMA 2HRPL 5I1HH 4A04A 2Q76A 2BRRH 1QNZL 4DKEL 4HGMA 1A9BA 3A6BL 4G7YH 1X6LA 3OR6B 4FXKC 2OAAA 4UWQB 1PDKA 1BF2A 4ZD3L 2VLLA 3TYFB 4H0HB 4UT9L 2XZZA 3ZMEA 4LH6A 2Y23A 5JW5B 4MJ5A 3IEAA 1LEGB 4MYPA 3U4BH 3UC0L 2ZICA 3AEIA 4TT3G 1G7JB 1B0IA 4UM8A 2XAJA 5I1HL 2BRRL 4M1CD 1JZ7A 4J9ZB 5DVNA 1DBAH 2X12A 2LW7A 1NFDE 3T1YO 3EJRA 4G7YL 1TKWA 5DUMH 2YD0A 3IS0X 4PLKC 5JPNC 2K0RA 1B0GB 4FQ1H 3JYBA 4XRCB 1MHCB 1GSMA 2CCVA 4GW1A 3U4BL 3QI9D 2QA4V 4MA7H 7FABH 4AGQA 3A4DA 4HUCA 4UQDA 2P9RA 3P9MA 4NZDA 5D7LB 1UD3A 1AIZA 4P4KA 1DBAL 3G5XA 4Y5XB 5JIKA 5DUML 3WEBA 5E8OB 5BMFH 5LHDA 1E2WA 2COQA 2VKWA 4DJMA 4TOYH 2GUOB 3GRGA 4RFNC 4NNYA 4LVEA 2PR9A 7FABL 4MA7L 3RHWF 1QNIA 1THCA 1M1XA 1XF5A 1SS3A 3DX6A 4OW6A 3U48A 3PQYE 4C83A 1D9KC 4TL5A 5J13C 4CVZA 3I6SA 4HJSA 4TF4A 1F11A 3QCTH 4N1HB 1AJ7H 2H32H 4RRPM 4KK6C 2JTDA 3FQXB 5C08A 4HF5L 4G8IA 3U2SA 4GINA 2A9HA 1I1YA 4BAYA 3ARFC 2RIKA 1KTCA 3OBAA 2QM7A 3GZQA 4BFBD 5J1TC 1Z2GA 3MV8D 2DF3A 3QCTL 3U6RA 2Y36L 1MXGA 3PIQA 1AJ7L 2VQUA 3U0PB 5I73C 5B1OA 4RLDA 3DROB 4TV8B 4HCFA 4S2SA 2VC2H 2EIMC 2E8YA 3DX9A 3OE7G 4WEEA 5DVPA 4MLIA 2A77H 3QZWB 1WZAA 4QTHB 1B4TA 4J3VA 2K9PA 3ARUA 1UZ8B 2BCKA 4QY8A 1PZUB 1G7IB 3K91A 4EI5D 3VQWA 2D0HA 3QJFA 4K94H 5C09D 5JVDA 1OAXL 3NIGE 1O9VA 2VC2L 3QFDB 1I4FA 4NBYB 3FNKA 4P2YA 2A77L 1R75A 4TL4A 3S5LB 1N3NB 4ZUTA 4M4RA 3WELA 1Y6NR 2RQ8A 2EDKA 4DZBA 3KLKA 2Y3AA 5FF6A 1CQKA 3KWWB 1VFAB 1JV5A 1YUHB 2E9WA 4K94L 1J9TA 4JI7O 4PJGF 3V4LA