2X6CA

Potassium channel from magnetospirillum magnetotacticum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
288
structure length
264
Chain Sequence
PRILNSDGSSNITRLGHYHDLLTVSWPVFITLITGLYLVTNALFALAYLAGDVIENAFFFSVQTMATIGYGKLIPTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLMMRLANLRIEAIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFLVLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords ATP-SENSITIVE INWARD RECTIFIER POTASSIUM CHANNEL 10
publication title Domain Reorientation and Rotation of an Intracellular Assembly Regulate Conduction in Kir Potassium Channels.
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
total genus 70
structure length 264
sequence length 288
ec nomenclature
pdb deposition date 2010-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2x6cA01
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 2x6cA02
1ZWIC 2WLHA 4R8CA 2OCCC 3AG1C 1ORQC 4R6ZA 2Q69A 2HG5C 1XL4A 4J9ZB 4MS2A 3SPCA 3FB6C 4XDJA 4QNHB 3JYCA 5EBLC 4CBCA 1OCZC 3K0GA 3LDCA 5E1AC 3VSQA 2Q6AA 3OUSA 3PJSK 4OXSA 3T2MA 1P7BA 2DYRC 4HYOA 5EBMC 4X88A 3SPJA 1U4EA 3ATFA 3ATBA 4GX0A 4WFEA 5EBWC 3R65A 3IGAC 4MSWC 2HVKC 4WFHA 3IFXA 2DWEC 3F7VC 2BOCC 2Y69C 2EINC 2QTOA 4PA3A 4R7CA 4RO2A 3ATDA 4PDMA 4RAIA 3FB8C 5KUKA 1M57C 3ASOC 4PDVA 3SJQC 1OCRC 3SYOA 2Q67A 4G28B 4G27B 3E83A 3E8BA 2K1EA 4WFGA 1U4FA 2DWDC 3ABLC 4JTDB 4R50A 1R3JC 2WLIA 4F4LA 2GIXA 3K06A 3ABKC 2EILC 4MW3A 4LP8A 4I9WA 3E89A 4H37A 2A0LA 3UM7A 3AG4C 3ABMC 3EFFK 4PA9A 2WLJA 4MW8A 3LDDA 2P7TC 3E8FA 3F5WC 5CBGA 1R3LC 4QE7A 2ITCC 3STLC 2IH1C 4XDKA 5B1AC 1XL6A 4MVRA 3T4ZA 4P2ZA 3T4DA 3AT9A 3ATEA 3OGCC 1V54C 4X89A 1K4DC 4PDRA 5B1BC 4KFMA 1QLEC 1M56C 3OUFA 2HVJC 2X6CA 3RBZA 1BL8A 4TWKA 2WLIB 5BZBA 2IH3C 4PA6A 2DYSC 2KB1A 4GX1A 4MVMA 3SPIA 5IY5C 3ATAA 4DXWA 2HFEC 4MVQA 4MTFA 3SPGA 3X2QC 5J9PC 3TCUA 4JTCB 3HPLC 4X8AA 4MVOA 3FB7C 2A79B 2WLKA 5CBHA 5EC1C 3GB7C 1V55C 3K03A 4LBEC 4MTGA 4WFFA 1KKDA 3K6NA 2BOBC 3RVZA 2Q68A 3E8GA 2WLMA 3VOUA 3ZJZA 3ASNC 4BW5A 3T1CA 3ZRSA 4GX2A 4HZ3A 3STZC 3SYQA 3KG2A 5KUMA 1JVMA 3E8HA 3AG2C 4LCUC 1S5HC 1LNQA 3LDEA 2QKSA 4P9PA 3SYCA 2JK5C 4QE9A 2AHYA 3E86A 2HJFC 2R9RB 4P9OA 3AUWB 4MVZA 2X6AA 2WLLA 3AG3C 2W0FC 5EK0A 4MTOA 5CBFA 4PA7A 3K08A 4XDLA 2NLJC 3F7YC 1N9PA 2YEVA 3UKMA 2E4FA 1R3IC 4EKWA 2X6BA 5B3SC 1K4CC 3K0DA 3LUTB 3OR6C 4RUEA 4MVSA 3K04A 3LNMB 3OR7C 3SPHA 2EIJC 4J9YB 4P30A 5EC2C 2ITDC 4UUJC 2AHZA 3FB5C 4H33A 1J95A 4ZBMA 1OCOC 3WG7C 3AGWA 3AT8A 4RUFA 2ZD9A 1R3KC 2ATKC 1G4YB 4PA4A 3BEHA 4MVUA 2A9HA 2EIKC 3SYPA 2H8PC 2ZXWC 4JTAB 2WLNA 3SYAA 1OCCC 3RVYA 4PDLA 2WLLB 4GX5A 3TETA 2EIMC 3RW0A
chains in the Genus database with same CATH superfamily
4GAYB 1LO3H 1KPVA 1EBOA 3DV4B 4U6XB 4KJWD 3UJJL 3VD3A 1AKJD 5F6HI 5IVOA 4ODWA 3JYBA 4OU3A 4LF5O 1JGUL 3KJ4C 4JHAL 2X38A 3VFTA 4J3WA 4LOUC 4J3OD 4I0XA 1TQWA 4P2RD 1U4EA 1P6FA 1ZA3B 4E0RA 1EM1A 4F9PC 1IBKB 4HJIA 4IMKC 2WWWA 2XV3A 3RP1A 4G59C 4UMGA 4DOHB 4DFHA 4P06A 3MRNA 4IOIB 2VLME 1DZBA 1ETB1 2HN7A 1NCDL 3CH1A 5IKCA 4U05A 2WB7A 3NRQA 1WA1X 3SCMD 1KULA 1XF1A 5A6MA 2V7QG 1T7WA 2YBGA 4JDEA 4ATWA 2W88A 1DQJA 5KMGA 4N3TA 1BVZA 4YUEL 43C9A 3PWVA 4U3JB 4NIYE 4HOMA 2BVQB 3HR5B 2VL5A 4F37K 1LEIB 3TCLB 1ZT7B 2HFTA 4AI7A 4PA9A 4QPJA 1NL0H 1WBXA 1ZPLA 3WLBB 1RUKH 3GKWH 3NFPA 4IK6A 4MB5A 3OKOA 5GS1C 5I6OA 4IGBC 3PGDB 5EZOH 5HHME 1DBBL 4Q9RH 3WEBA 3V6FB 4GKNA 1UURA 4HS6B 4BWUA 3DYOA 4KVCL 3BXNB 3ARGD 5F2FA 2QPFA 1S8DA 3Q9QA 4KFMA 2Q7NA 1UA3A 3DX4A 3GKZA 2OR8A 3VD5A 4EZKA 1CO1A 1P84F 4KDTC 4RAUA 1NSNL 5HHXL 5JWPA 3V5HA 5DRWB 5IVXB 1P53A 1SNRA 2ICWA 4YDJA 3ZY7A 3OTOB 1T0OA 1IC5H 5FUCC 3C08H 4ONHB 1ROPA 1S72V 4LSVL 3LS4L 5BMVB 4WGWB 2JKSA 1Q94B 3EHBD 3VJ6A 2CJUL 5BO1L 4ODVL 3WEOA 4KK9D 3K4DA 2F18A 5JOFB 3U1SH 4FZ1A 4FQPA 1MMMA 5EZJB 4ZXBB 3VACA 1U8LB 5LBQA 5BOJA 4H8UA 3L6FB 4HPOL 1NFIA 4X5LA 5FECA 4HJUA 3OHXB 3SDAC 1NIAA 1KJVB 3IGFA 5IJKA 2DD8L 3WNLA 4MMZA 4DP4X 3UAJA 5EYPB 1TZIA 3HBQA 2OZ4A 4IBSA 2YC1B 3SBWC 3T0EC 1EPFA 1QA9A 3UYRL 3DVNB 4Q6YA 2WVTA 3DNKA 4Z7WB 3VQ1C 2E9IA 3U46A 1R3IL 3CXHJ 2JKTM 1TMCB 5F6IC 1NIEA 1WTLA 3TBCA 3AWEA 1MHEA 4ZMXA 5DSCA 3A23A 1ITCA 4HFUH 2X7LA 3B77A 1OV9A 4GXUM 2JCCB 2BNRA 2OMTB 2HT3D 1JWUB 3ZDZB 1M05B 1KEML 2HZHA 4IT5A 1N0XH 4X6BB 3TFKC 5JLZB 2LO1A 4MVBD 3EOTH 5GS2D 2W07B 4B7LA 1D5IL 1J7VR 2Y7NA 3QORB 32C2B 4JY6B 3NJVA 1GM9A 4XX1G 3KPPA 4RVBA 2HYMA 1UM6L 4AW7A 5ITFB 2BX5A 4PJCB 1F4XH 4QRPA 4PI2A 5DJYA 4B7IA 5TE4L 1O9ZA 1TYRA 2H3KA 4NEHB 1G9EA 3VD1A 2B1GA 3G6DH 4QHMB 3O0LA 4LEOA 2J8HA 2R2HB 4FQQA 4X4YA 5JH7B 1K92A 4YWGL 5K9JL 3MUGA 4BSWA 4J23A 2E74C 2YIBA 4K3HA 2Q86A 2CDFA 5FA4B 3S7GA 2EIMB 4B53A 4B9IA 3AADB 1YEKL 1GTOA 1KJMB 3WXWL 5KANG 5AW6B 3FX7A 1AAJA 3MAWA 2HKHH 4A7TA 4LL9A 4B0MB 3D50A 2G9KA 3FB7A 1J10A 1NKGA 4MCMA 4XCCL 3RUGE 3VFMB 3VXPA 4A2LA 4D7BA 5I9QC 5IMLB 5FK9A 4YY3O 2A0LA 3CZLA 3LD8C 4OVUA 4AQYO 1QATA 3S5LA 2A9NL 5BS0B 4CL7A 3FT1A 4N8VA 3T2QA 1R1BA 1J9QA 5KSUA 2EACA 5KN5B 4UTBA 1MCNA 3KPTA 1QUNB 1EN4A 3GRGA 4KRPB 1UZGA 1E67A 2CGRL 3TIEA 1M53A 3EDJA 1N0LB 2FAUA 3WIAA 1WC7B 3BYTA 1ZOXA 3SGJC 2J4WH 4XNBA 5B1BC 4DW1A 2JXMB 2GJRA 2V3FA 5AVSB 3TL5A 3FO0L 2QADC 3MLYL 4LRIC 1KENH 3I3EA 1I1AA 4L48A 5ALCH 1NMAL 1BFSA 2AV1A 3P02A 2QR4A 4MVOA 1RZIB 5F0LB 3ZXAC 9PCYA 1KTKE 4QTHB 3I6KB 3WHXB 3AXIA 2XA8H 1AGEA 2DQIL 3IWVA 3MRHA 1NUNB 5D2LA 4KQ4H 1MQKH 2HFGH 1N33O 4TV8B 5IT2L 1JGVH 2YD5A 4OLXL 1NAKH 1AJPA 2P9RA 4KY2A 4MWFA 3UAAA 3W39A 1G1OA 4RFNC 4BAYA 2CE4A 4WK0B 4AIZA 5D93C 2W0FA 3CWGA 3O6KL 4KNQA 3LTVA 2IH3B 2NMSA 4P57B 5KJRL 4MS6A 1RPUA 5EIIG 3H7BB 2IMNA 3F7YA 2DQEL 4R8WL 1SQXH 1N9PA 5DVPA 2ZXEB 4OF3A 3HFFA 1BLNB 5J6GB 3W7XA 4H8PA 4NBXB 4C56B 5GZOC 4DV6O 3IDGA 4WWKC 1D7BA 3JUYA 3UCQA 4R7DB 1PQZA 5A2BA 5DUPL 2CCVA 4MD0B 2HTKD 3HG1A 5B3JF 2VDLH 3MOBH 3IDIB 3DETC 4YK4B 3TCTA 4JAUA 2NSMA 4TUOA 5DFAA 1VKXA 4XN8A 5J13B 1SYVA 4YX2L 2W92A 4FABL 4HEME 2WWMC 3L1FA 2ZCZA 4OCRL 4BIOA 3LJ3A 5I1DB 4UU9B 4Q0XL 3D39D 5GW7A 2CH7A 3CZEA 3MO1B 2VXVH 3HI1A 2R0ZH 3II1A 4I8DA 3F58L 4N4YB 4N6QA 4N0RA 5ECGA 4L4TD 2QPDB 4PRBA 3DVGA 3Q2VA 1A3LH 4JR9H 4X64B 3BQUA 3E1F1 4U6HB 4N2GA 4I3RH 5JORB 2ICWJ 4UQ3B 2DQUH 1GW0A 3LRHA 1KACB 1JZ3A 1MW2A 2YPKB 3LNGA 3VFWA 4FI7A 5CSGA 2DWEA 1REIA 1PKQB 2AJZA 3EYOB 3QUXD 3OAYK 3R4RA 2OMWA 3NZHH 1JHLH 1HSAA 2XN2A 2D9QB 2OZ4H 4QOKE 4UQ9A 3G6EV 1Y1DA 3US1A 1W80A 1OQXA 3TZVA 5I1AA 1R3JA 3RA7L 2JVDA 2AFNA 4MNQA 4D9LL 3BJ91 4R7NB 4ZOEA 2H1LM 5KYUA 3SKNB 4MXVE 3SZ6A 2IPUK 3O0RH 1YYLH 4O4JB 4XNUH 1IKFL 3PRZA 4NM4L 4WVRA 3H3PH 2ODHA 3H2PA 1G0YR 4K8RL 5PCYA 1C1EH 3QE5A 1M1XA 1RJZB 2AV7A 4H1LA 3E8FA 3E9TA 4EKXA 3ZTDC 2J3SA 3RTQC 3UZVB 4Y19E 5IWAO 4JI7O 1YJWV 4WHTB 4KXAA 5I1EH 3VCLB 4F15B 4UQBA 4FYTA 4UT7H 3FSVA 4IL6Z 5DYOB 5HDBE 2P49B 4X42A 3WY4A 1ZIAA 3EGSB 3P3TA 4D0CA 2DYPB 4G5ZH 2X42A 1NBVH 4ZX6A 1FI8C 2QELA 5LNDA 4MVMA 1MCOL 4AQ1C 2FBJH 3HPLA 3CCHB 5HGDB 3GTNA 4G5AA 2H3NB 5I8KH 1CU4L 3LZOA 1L9MA 4NKIH 3FAVB 5I1IH 1FE8L 3HVNA 2GTZB 4PJAA 4NJ9L 3ZSSA 1KXHA 1T66C 4K23H 1HQRB 4LFCO 3HG0A 3GWOA 3OMAB 4OIFA 4CGUB 1AJNA 2OMBA 3ZBHA 2E7LC 1T1ZB 4AV4A 1SVCP 3KWUA 1JPTL 1M1SA 2WQVA 3KYKL 3IFOA 4TUYB 4QYOB 3T6QC 3EYUH 2V4LA 5L4MA 3L48A 4O9HL 3NPSB 4JMXA 4JHZA 1ZHLA 2H1XA 2BIOA 1IM9D 3OX8B 4XBGA 3VWKA 4EI6A 2APXA 1AQMA 3PP3H 2DM2A 4TSAH 3D2UB 2A6JB 2EE6A 3NGBC 4WCYL 4WRLA 4DRXA 3VYNA 1FIGH 3M8OH 1J0JA 2DH3A 4ZW3A 5TE7L 5I0ZA 4PRIA 5IHWA 4KROB 4Y4HA 2CO7A 4JM4H 4RRPM 4X0KA 4PR5B 4UUJC 4UTBH 4BK8A 2F58L 4YHPA 3V4UH 2RA1A 4IDLA 5D1QD 3S35H 3HE6B 1MOFA 1HI6A 4AVKA 3LZPA 2R29L 3MRFA 4A2HA 1X5KA 2ARJA 4BH8A 2NNXA 4BSJA 3DUUA 2D8KA 4PJGE 3W5MA 3BRCA 4MZ3A 1TTAA 1XMQO 1S7XA 5JCOA 3E3QE 1Q81W 3G08A 3CTTA 4ZFQA 3L72H 3TETA 1NAMB 4YIPA 4YMPA 5L2KD 1Q82W 4NKMB 4OZIA 3HHSB 2N0MA 4JO2H 3ABGA 2ZXGA 5F93C 3U48A 2V5SA 4ZS6D 2CO3A 2X09A 1AE6L 3BPCA 2WQRA 2Q0ZX 3KLAB 3CFCL 3NSXA 3HZYA 1S7TA 3CFEB 4B97A 1I7FA 3HMXA 3ATBA 1MA1A 2YDEA 4EOWL 1UM5L 3UJIH 2LFGA 1N70A 4KKBC 3N2GB 4W68A 2XWBB 2AZ2A 3AU0A 5FDYA 1PAMA 3ILQC 1G7IB 4WEMB 3CVIL 3PIQB 2KKQA 2YRBA 1EHKB 1H3VA 3AWGA 3DTXA 5ISZA 1LQBC 2ESVD 3E38A 3MRPA 3VSTA 4IIJA 3GS7A 1EDQA 2AJUH 3HBGA 4WFGA 2GFBB 4Y5VA 5K9QI 1AQDA 4LCYA 3FFQA 4F4LA 1PG7H 4K15A 1ML0A 1D5MB 3CDYA 4N2KA 4ZW5A 4NKDA 4PJIE 2V0AA 5DVKA 4LKCB 3V9FA 1I8MB 3HNTH 1XEDA 4LVEA 4FNRA 2XV0A 1S7VB 3FT3B 1W72B 4R2GC 5KVDL 2UUAO 3EGDB 4EIBA 1FNEB 2DQHL 2VLKB 4R4FH 3BKML 2VMEA 1QSVA 1P1ZA 5JO5B 3UTSB 4KHTH 1I9JH 1QBZA 3KVPA 3QJFA 3RX9A 4L3EB 4LMQE 3GEWB 1OPGL 4HBNA 5TK4A 3BI9X 1WIUA 1TKWB 2MWCA 3TESA 1G7PB 4KJPD 1K34A 4D8OA 4WK2B 1G6UA 1NZRA 2CBOA 2YHGA 1LR1A 4G1EA 4PGEB 3TVMD 2WBKA 3MACH 4B9ZA 1EO8L 2AXFB 2G5BA 2TRYA 2H41A 1SN2A 3AB0B 1MKFA 5D5PA 3R0MA 5D71H 3F5WB 3JWNC 5J6HB 5BRZA 4ILDA 4UVCA 2YAHA 3U0WH 2F66C 1IGIL 3CX5J 4LCUA 3RKDD 3D0VA 1P1VA 3VXTB 3QFGA 1BZOA 3GRBA 3I50H 2Q7YB 1HEJC 3LMJH 2EH7H 4YHIB 2DLFL 4QRRD 5DURD 3CCUV 3IXTA 5DS8B 1CLOL 1HHIA 3HKDA 2V9RA 2DMCA 4JFZL 4AEIH 5ESVA 3KDMB 1QFWM 2LU3A 4G9FA 5FDWA 1T4KA 1A22B 3FOMB 4PWHA 2YS8A 1FCCA 3OR6A 5FB8B 1UEYA 1NC4B 4PRNA 1AHWB 4NQCD 4B9CA 3MAQA 1RK1B 1Y6NR 2WCSA 4GXFA 1IU1A 5F88B 3QHFH 3TN0B 1KYOJ 1CF8L 3ZIYA 5DEZA 5JHDB 1C5BH 4EN3C 1M3IA 5I5IA 1UACH 4HK0A 2GJJA 4JRYE 2NQDA 2WAHA 4XP9L 4E5XA 4X9GA 4RQEA 1MH5B 1TFPA 1KLGB 1GAXA 2A9AA 1JN6B 3IDNB 1KF9B 4B3TB 4GKJO 2F54A 5IOPA 1KKCA 4FLYA 2WHVA 3HKBA 3PYCA 4JM2F 4NRZB 1BGXL 2ZXDA 4HG4K 1HILB 3CD6V 2PUQT 5EC2B 4E9LA 3CHPA 2D3VA 4X5XA 3TEXA 4EXPX 3E80A 2EXWC 2BNUA 3UIZA 4S1SH 4UTAL 5I15H 4I85A 4TL4A 1UD6A 1H3WM 2ZP0T 3RWFB 4NP4H 4Y8AA 5GRZA 1OV8A 1L9PA 2GUOB 2MCPH 4JQIA 4QXTB 2WJ5A 3VWJB 3CC2V 3AK1A 3HKEA 3NSCA 4OQTH 4RAHA 4EO5A 4YXHH 5IWLC 1TPXB 1QBML 4MJJA 5C07D 1H2NA 1J0ZA 5F7YC 5HHNB 1PY9A 3QYCA 2CXKA 2OTUB 2WUCH 4H5SB 2IPUG 5L9DH 1EZVY 1BQ0A 1XBDA 4WUUE 1YC8A 1UWEH 4UIKH 3SDCD 1MCPL 2I32A 4BFEA 4WI3A 4AGLA 2F4VB 2CDYA 1JDDA 1QRKA 4X6DA 3RYHA 1DUZA 2NYYC 1MJJB 3DK2A 4V1DD 3VXQA 2AITA 3UDWA 2OTWB 1BQLL 4M8QB 4I2XB 2IJIA 3DGDA 5MEND 5KSBB 1W8OA 3B2DC 1TETH 1XIWD 5A1AA 3W0WD 4KNSA 3G5WA 1JG9A 1JZGA 1QHOA 3KR3H 3PWPE 4X99B 3PHSA 4A2EA 2DAVA 4P5TA 3F85A 3TYFA 1WAZA 2Z35B 3KNBB 2O4EA 1J0YA 2VJ0A 3KPLA 1J8HA 3P9LB 4AIXA 1TZAA 3S36X 3N27A 3DX2A 2WLKA 3NMEA 1KKDA 4LNUB 4MDIB 1UJWB 1WBZA 3EO9H 3NCYP 2J88L 1QSFE 3EH1A 2NXYD 2AEWA 3K46A 4YIQA 2X7RB 1EHLH 1UGNA 2BFGA 3A0HZ 1YEWA 2D4FA 3G4SV 4J8RA 1E4XH 2BJML 4NO3B 3TBWB 2BCCH 4OM1H 4U3HA 3OW2U 1FL5B 2YI8A 1ULVA 3ZLQC 3WEMA 2GTWB 4GINA 4NENB 1HTYA 2BY1A 5DQJB 5SX4I 4LMQI 2ERJC 3OM3B 5DA0B 3VXMA 2RALA 2ZUYA 3HZVA 2WMPB 4Y9BA 2B1HH 2VQ1B 2X4PA 4KRNA 2R8SL 4YJ2B 2OL3B 2DZEA 3RNQA 4ZTPH 4IJ3B 3QW9A 3WJMA 4BFBD 3GQFA 1NPNA 2ENJA 1S9VB 4D7TA 1AXSB 2JI2A 4BM7A 1ACYH 5AOZA 1GR7A 1Q86W 2OULB 4HJ0D 5GGRB 3VXRD 1H15B 1PLBA 2J8UF 3L3OB 4B5EA 4DGWC 1K8IB 5H2BB 1FUNA 3QO0A 2AJYL 2IBGA 5F7EL 1A3ZA 2WZPD 4I0PA 1YYML 2ATKC 2LVCA 5JPMA 3H1KH 4RBPK 5INDA 3MBEB 1ODUA 1WZMA 1UWGL 5C0RH 3ZDXB 1IMHC 3FH8A 5IEKB 1JFQL 1QG3A 2G0KA 4K94H 1OZTG 3SDDA 3UPRA 3BW9B 5B8CC 2VRQA 3CFUA 4WF7A 3NJHA 5C97A 3ZTNH 2OCCC 3WLWC 2ZONA 3SPCA 1ZX3A 2F43G 1G0DA 2EE2A 2JWYA 3H2QA 4JFFB 5DD6A 3BP6A 3NH7L 5CWSA 3VO0A 1DBAL 3GC3A 4LLVB 2DLIA 3E6HB 4K3JH 1QLFA 1HWGB 1J5IA 3U9PH 4LLUA 4PJBE 3LN4A 1UCBH 4BFIB 1CN4A 2QKIB 5EU5B 1AZRA 2EDEA 2NZ9C 1NUGA 4YSOA 1X7TA 2JJWA 4FQLH 1E5BA 5AVYB 4YJZL 1FYTE 3IDXH 3MCKA 4HIEA 2XWZA 3SE9H 4GT1A 2H1PL 4NGHL 4XNZC 4UCVA 2X05A 4CJ0A 4NXMO 4TKWA 4AI8A 1D7FA 4IBZA 4DV4B 4Y4KD 3MV8D 5F7WC 2LFRA 2VLRD 3A0OA 3FC8A 5JIQA 4LHUA 5FGBA 4YBHA 2QLVB 2Z4QB 1QVFU 1FNSH 1UZ6E 5K5YA 4AYFA 1MZEA 1HHJA 2P7TA 2Q5BA 2Y5EA 3QIUD 5AYTA 5GIRB 2F2HA 2QPEB 2H0FA 4ZDHB 1N8RW 5JOEA 2VERN 4O2BA 4LSUH 4U1KB 4YLCA 5DD1L 2ENPA 3QG7L 3ZHRA 4FS0A 1GGCL 2A77L 3H53A 4WV1B 1KDJA 3U83A 4LF3A 2B2XH 4NN7B 5DVNA 3MRGB 3RBZA 3IE4A 3RDTC 3S3BB 3MBWB 3FT2A 3K5SA 3EJRA 4ICXA 4N68A 5CINH 4DSYA 5IM7A 1MCQA 1YMMB 4NKQB 4PJDB 3FF7A 4OD3H 1BYOA 1CICA 3VFRB 5MEQA 3BZ4A 4KHXL 1R3LB 3PDGA 2Y0IA 3BVOA 2QGDA 5DTFB 3RPIB 3OAYH 4JX0A 5IQMA 4H88L 3VG0L 2C7UA 3RFZB 5ABDE 2WKOA 4Y4FA 4MMYB 4S2SA 1D5XB 5FM5M 1IBDA 4GW4A 1DDHA 2E9JA 2YD6A 4GSXA 5F3BB 4LOFA 4TLKA 2ZJSL 5HGAB 3C8KA 5EC1B 4GUQA 4J3OG 3GSRB 1V7NH 2Z31C 3C5SB 1A1NA 3PNWA 4KX9A 4AQZA 2D7TL 4NOBA 4M3JA 4YNYB 3MRLA 4HUUA 4IRSB 1HSBA 1TLMA 2R1WA 3CXFA 1ZE3H 5AKSA 3ZTCC 3WFZA 3M1OA 4X80L 1QNZL 1VIBA 4DV1B 2JK5B 4FQ2H 3IVKA 4RX4D 1OOWA 1T5WA 3IJSB 4JL1A 3UP6A 4CMMB 1N64H 4JYAO 1OF2B 1CQKA 5KHGA 2AJXH 4FFWC 2PO6D 4DNLA 1Z0MA 2DQCH 1OLZA 1EHNA 1QTPA 4J7RA 3OZKA 4FFZA 1SQGA 2Y4TA 3QH3B 3CMEV 2EC9T 3NIFF 4MAYC 3WDIA 2VXTL 3K59A 2VO8A 3C60D 3MLTA 5ID0A 4M7ZB 5E5MA 2AF2A 5TQ0L 4BIKA 5DMGC 5C70A 3ULVD 3Q8FA 5IVXE 3S96B 1A7RH 3DIDA 1IBBA 5EBWC 1ZGLP 4PWFA 2D3JA 3P4LA 3F6IA 4M7KH 4PJ5D 4S0TD 1MVYA 1UD8A 4I7ZC 3C6SB 4PY7A 3LZNA 1A7PL 1TNNA 1WZAA 2Y2YA 3KPRE 4F2FA 1PJ9A 5EN3A 1TMQA 1HXMB 1NCAL 5C7ZA 1FL3B 3ECQA 1Z2KA 5DHEA 4K71B 4L29A 5KA6A 4KJYB 1A8ZA 3WE1A 2BLFA 1E6JL 1KBVA 4IIQB 4Y16A 4HT1L 4Z95L 3FTGA 4YSPA 4A39A 4CKQA 1G4MA 4CSTA 1I9IL 2WCGA 4XMPH 5HI3C 3VH8G 2CUGA 3SE3C 5HSFA 4FG0A 5FFOA 5TDNB 2Q1EA 2V3DA 3L1OH 4R90L 3Q4HA 4QMEA 1BJ1H 4RISL 3QI9A 4GSRA 1ZGLM 4QGTA 4LFHD 2ADGA 5T33H 2BWQA 2P67A 3GFUA 5J3HC 1I9RL 3MLXL 4L9DA 2UXCB 4A6YB 1BJ1J 2JCCE 4EB6B 1LEGB 3KKYA 5DJ0A 5FYJH 1S9WA 1ZVSA 1FLRH 2XWCA 1WZ1H 2CRZA 4K5OA 4PRHA 4TVPL 2JGDA 4WI9A 3RWHB 5A3ID 4YDKL 4E9QA 1A7QL 4HK3J 1V9PA 3AT0A 4L8BB 2VR9A 2Z6FA 2JJ1G 5FOBB 3EVKA 3FU0A 3V5DB 2HLDG 3V4VA 3VI4B 3G04A 1E28B 3U0PA 2Q68A 4P3DB 3HB3C 4K3EH 5BW7C 4OF8A 4JJ5A 1MPAH 4WW1A 2G2RA 1CGSH 4FMVA 4J5VA 3MV9D 3V4PL 3ZPDA 4P9PA 2ZCHH 3OLGA 4JE0A 2AEOA 4ENEC 5I0DA 1ILUA 1J1OL 2Y6TE 3TYGH 1ZTXL 2WB1A 5F8RC 1IJNA 1FVEA 2ADIA 4U1GB 1Z5LB 3J8F7 5DO8A 3W7SA 3JZ7A 1I1FA 3DOSA 2CK3G 3OC5A 4N24A 5KBNC 3MX0B 4X5PA 5ID1A 2YC0A 1MFBL 2OPCA 4UV7L 2Z0UA 2FWOB 4RNRA 2OJZH 5KVEE 2NCMA 4X5WB 1XGRA 3HE7A 2I60L 1AROP 1T0NB 3MHSC 4FXTA 2EVIA 2ADQB 3RVWD 4LZKA 5C0DB 1BEXA 3BIKA 3DHMA 3VGHA 5I1LA 4ZX4A 3TK1A 2OJEB 1D5RA 1AJQA 2EEAA 3Q6FA 3EGXA 2VDRH 4FCAA 1OK0A 4PGCA 4RFEB 1F11A 2NQCA 3TEUA 2Y7MA 2AXWA 4WFBV 2JEUA 1ZLDA 3GYRA 4JPIB 5CN3A 3KWTA 3VYOA 1U3NA 4X1YB 1RZ7H 1MFDL 4P2OC 5E8OB 2YRPA 2QQNH 3KEDA 3IWUA 4CBCA 5EU4A 4D9RE 4BIZA 3CN1A 3N44F 1AB3A 5DRXB 3X12A 4M7JH 3TXQA 2K0RA 4OFQA 3NCCB 2AK1H 3ZL2A 2FE0A 3GS4A 2BIHA 3E3QC 3F7VC 1EUTA 4OW6A 3K72A 4FGMA 3MOAH 3EYSL 3D25B 4AJYV 3OPZL 1WZLA 4GIAA 4YL4A 3IMSA 4CH6A 3H9ZA 5TF1H 3CBRA 5E8DL 3AG1B 1JGDA 1U4FA 2PYED 3DO4A 2R69A 2VDQH 1M5IA 3VGBA 2GW5A 3SJVB 1KSRA 2GT9B 3DSNA 3LNFA 4KPHH 1YPZA 1IVSA 1HNZO 4OX9B 1NPJA 1QW9A 3QUYD 4ZUVB 4J3OH 1AG0A 3V55A 5E8NB 2M2DA 3JSSA 1GJWA 3AJ7A 4LF6O 4YZWA 2R51A 1VJSA 3GO1H 4KGLA 2AAAA 2NW3A 2ZR3A 1BWMA 1H2LA 3LQZB 2GCYA 3FCUB 4ZSOB 4KH2A 1OP5K 4OB5L 3FRPG 1N32O 1QQDB 1T20B 3RY4A 3UJTL 3TC9A 4JO4H 1OAYH 3FRPA 4UDTA 3MV7D 5GRUL 1TTCA 3UTTD 1U8IA 2W65A 1ZHNA 1ZA6B 4FFZH 4DUZB 3G5YB 1AMXA 2BRRH 1O7SA 1R46A 1AG6A 4MB3A 3ZE2F 1RLBA 1HINL 4RSVA 2H2PD 5K39A 1OAJA 4ZIBA 1DBML 2PW2B 1WA0X 1MI5B 1D9KA 3B2VH 4G43A 1HFUA 4M5ZL 1EZSA 4JBSA 2WN2A 3PQYD 2AQ2A 3ZO9A 1KG0A 3CE1A 1TCRA 1TCMA 4JM2D 4C4KO 5DS2A 2XPGA 5EWIL 5AD0A 2JELL 2GB2A 1MHPL 1BHBA 4XXWC 2FATH 5DR5L 4KHPO 1NDMA 3LIZA 4L8SC 4N0YH 4QRFA 1OTUD 2PKDA 4Z7AA 3ZMVA 4GKSA 4BBWA 2V17H 4ZYKA 3SDXF 4KZEH 2EQDA 3AUWB 3NACH 4N9GB 4OIBA 1VCBC 2P5PA 1P84K 4FQXD 2P5EA 1EZJA 2GBVA 1XHZA 1MAKA 1A4JB 2F74A 2OSXA 4A7SA 5C2BL 2AZ0A 5BXZA 4JFQA 4Y5XC 1NMCB 3L71H 5B3SC 1NJ9B 3WAKA 3BKYH 5C08B 3ILPB 3PJSA 4AG4H 2R1YA 1IAOB 4QTFA 1HAWA 5ICXB 4XP4L 5AAWC 5D96C 5SWSE 1MG3C 1QO3B 3PGCB 4DETA 5CCKH 3GHPA 5KTEL 4BFGA 5LYJA 2AXHA 3IS1X 2E46A 5CIPH 2BVYA 4FTVD 2A9MH 4LLMB 4MJID 1FXKA 1XR8B 2KLRA 2O5XH 4LARH 2G5RA 3AREB 2AEPH 4QIWF 3I02A 3PAZA 2YMXL 3K1KC 4GYCB 4L9LC 4M1CC 2WXGA 4N90D 1L6XA 3N85L 1ZLUK 3X3GH 1DJIA 1HCZA 4X62O 3RGBA 3QPKA 1FNGB 4BH7A 1UXLA 5JIMA 4YEEA 2LJ2A 1HOEA 2GJ6A 2XSKA 4X98A 1XF2A 3FONA 5E8EA 2X4QA 3FB6C 2NY2B 3IXAB 5CEYA 1AGBA 2BOLA 4YE0A 3V4VH 5JZ7C 4QIRA 4XP1H 4S0HA 4JZGA 1IM3A 1GY2A 1KNOA 1M3JA 2EXTA 1FGVH 1JFFA 2BSRB 4F7CB 4YSRA 5GS2H 1R3KB 3IFXA 2BHZA 1DLFH 4BZ1A 1WV7T 5DO2D 3IU4L 2NY5L 4GG6B 2CM5A 2WSKA 4KX8A 2FLRT 2LT9A 3LKSA 4JDZA 3QJVB 4WNJA 4GLXA 2ZINA 4XPAL 1NFAA 1TZOA 5FYKL 4JTDB 3N43B 5JW4N 1KPVB 1RUML 5HI4D 1Q1JL 5EU6E 4X7SL 3S88L 4GO9A 4W81A 4PCSA 4CH4A 1O9WA 4ODWB 4Z8FH 3IMBA 3E2HB 4Y1AD 1JZDC 1U2CA 3VFTB 2WWNA 5EUOA 4I0XB 2OTJV 2X4NA 3KBPA 3NOIA 5FHBH 3QNZB 2XN9E 4KKZA 4DR7B 1YNKH 4GRLB 1FG2A 4E0RB 3RL2A 2X6MA 1XZWA 3GMMB 2Y0SA 2X6UA 1AGDB 5D1XD 4RBPH 2WK2A 3O11A 1TQTA 2YKLL 2HN7B 3CH1B 5IKCB 1XDCA 2HH0H 4JY5L 3VI3A 1DLHA 4RZCA 3AABA 1FNHA 5DK2A 3AQXA 4OLUH 4KZDH 5HHPA 5KMGB 43C9B 3ARWA 5AZEH 2DS4A 3PWVB 3DX9A 2XAJA 3AG4B 3MHHC 4K0KB 3KL5A 2FTAA 5I5RA 2VL5B 4XMTA 2PXYC 2CO4A 4GSDH 4OUOA 1T83A 1WBXB 2OLDA 1XAUA 2E6PA 4CU8A 3NFPB 2VISA 2FT6A 3OKOB 1DFBH 1ZD6A 4KK6D 3MLZL 4YZFF 5E9DD 4WFED 3ZKMC 5FFLA 2NZIA 2VDLB 4GKNB 4M6MH 4Z7UF 5CGTA 2W9EH 3T2LA 4Z7OF 1T03L 3SDLA 1S8DB 3INUL 2R69H 4XPHL 3RVTC 2BO0A 4D94A 2BZ7A 4OKDA 3L2MA 5KS9F 2IADB 1FJGB 3V5HB 4YDJB 3M1CA 1MDTA 1IT9L 2Y7OA 2SODB 4K8RD 3UC0L 3VGGA 3VJ6B 5GGVY 4IMKA 1A7OH 3UBFA 2UUCO 1OXYA 4FQJL 3D3VB 4LSQL 2AAVA 4IBQA 3U7AA 4DT2A 2HKFL 4KKLC 4BCYA 1NCGA 2X40A 3SBRA 5C7XH 1CVSC 2YGPA 4GJTB 3JUZA 5F96L 3RWRD 3O2WL 4MMZB 4QRSB 4UV9A 3LS5H 1TZIB 3QUZD 3BCDA 5E2WL 3ZZQA 1C08A 5DUBA 2XZAL 2YLKA 4KKPA 4YIOA 4XAKD 1QA9B 2VLJD 5E51A 5IB4A 3UTSE 3WD5L 4ZQTA 2OK0L 4P46D 1SJEA 1WVZA 4L3EE 4DR6B 3U46B 4HA1A 4RMVA 4UWQB 3BPLB 5T1MA 3A4FA 2VQEB 2HLFC 1YEFL 3P40A 3PWUA 4UBDC 1JK8A 4HXAL 1MHEB 1PLGL 4PB0H 1A9BA 2WVVB 3BSGA 3LIZH 2NY7H 4IGBA 3GINA 4JHBA 4KO9A 5CBAB 2X7LB 3BISA 5K1VA 2FEDD 3IGLA 1R6VA 4MTXA 1G7JA 2J25A 3DXAD 1DTOA 1URFA 1FKAO 4UQCA 5DVOA 1YRKA 5FYLE 3UGUA 4JKWA 3IU3A 1ZWIB 3KPPB 3FO9A 2BVPB 1J9CT 3R06A 3ML9A 3D51A 1MRCL 2GEEA 3BD4A 2Y6SC 4GBXB 4J7ZA 2QGEA 4FPPA 5DJYB 1SJVA 4QLWA 1HH9B 3KHOA 1MEXH 2YGQA 4BUQA 2ZNXA 3SGEI 2ATAA 3ESOA 4KK5C 3SJAC 3ZIAG 2Q20A 2EO7A 2G3MA 4FQQB 4ZMAT 4X4YB 3ZKXB 1AZVA 2JCWA 5T3ZH 3LB6C 3Q06A 5KBPA 1GHFH 3MUGB 1LP9A 1NTZH 4LGPB 3TT3L 3ZT5A 3IFNL 1QHPA 4CUCA 5DZAA 2RR3A 2Q86B 3U4BH 1V54C 1QI3A 3LH2H 4X89A 2CO6A 3SBWA 3BDYL 2MNUA 3P9MA 4TLTA 1HNXO 2WXJA 4OPHA 1G6RL 1IAMA 4URKA 1A6UL 3ERXA 1HZLA 2WSDA 1UA6L 3KPSA 5FWQA 3VXPB 1BG1A 2MMXA 3I85A 3K6IA 1RZ8A 1CEZA 3BPOB 1X44A 4HHWA 4X66B 3U6RA 5FK9B 1FS0G 1I3UA 1S7WB 1RY7B 5D70H 3S5LB 3MLVH 3RVZA 4N0CC 5I73C 2JQZA 1BBDH 3GLAA 1GM7A 3PL6C 2YJQA 4Q9BA 5KSUB 1G87A 1PAZA 4BZ1H 1EAJA 1JRHI 3G9AB 5AZ2L 4LGRB 4KY1L 4M1DL 4XCFL 2H45A 1MW1A 3TIEB 2R0LL 4F91B 5LBSA 4ONFH 3O8XB 2K9FB 5GS0C 2CM6A 2MK3A 2PCFA 4G1MB 2DN7A 1WB8A 4P23D 3RQ3A 4IRJD 5IJBC 3SEPA 2XQ0A 4WSGA 1OAZL 2AV1B 4NQDE 2ED8A 1HZHL 4NVPA 4N8CL 4QHKI 3S0PA 2ZCKH 4YQXH 1D5AA 1NMBH 1MF2L 1X9QA 1AGEB 4N2LA 3VW3H 5E2VL 3MRHB 5EBGA 1DLBA 4GLRI 4Q6GA 2EDJA 4S1RH 5LHHA 5IREA 1NDTA 3NBNA 1U8OB 2X1WL 1B4JL 4EQ2A 1TAEA 2XCMC 1AIZA 2CA3A 4X1KB 2BZDA 4XC1H 2R0KH 5CGYD 3W39B 5J56B 2QQKL 4ZOAA 2D3OW 4GYBA 1KU9A 4NKGB 4AIZB 5KHIA 5F44A 4Z7NE 2CKBA 3W9EA 2W0FB 4I5BA 4I2XE 4GUPA 2IANA 2DQGH 4ZODA 4K5NA 3R19A 5E9AA 1SDYA 5KSBE 3SJCC 1H6UA 3F7YB 3P4OB 2Q8VA 3RGHA 5EIIB 5HGBA 3BO8A 1ETA1 1XMWA 3AM8A 3EJJX 5ACMA 3OC8A 2XWXA 1F3RB 1G5AA 4OQ1A 5E0FA 2DQDH 2ZIDA 1OK8A 3O9WD 1DQKA 4FNQA 4MD5A 3HG1B 1THCA 2P8LA 3QDJE 1KCRH 4KKCD 3FB8A 4TUOB 4M1GL 3RVUD 5BR8B 3TLRA 2IH8A 5C0IB 5SV3A 1VKXB 3CDGA 1HHHB 2H0PA 1M7DA 1SYVB 1AO7D 2ORBH 2Z8SA 1EJFA 4EPSA 3THML 1CE1L 2EUZA 1YNTF 3BA9A 3BKJH 4HMEA 4D8PA 1L5GA 1KBBA 1QSEB 2UWEB 2CH7B 2ADFL 1W59A 3HI1B 4XMKH 4YO0B 4G11A 3BUYB 3KLQA 3BT2L 1XVSA 3DVGB 4UXNA 1RKRA 3BQUB 1YY9D 4NZFA 2WIIA 3QJQB 3DI3B 3NA9H 4XVJL 1XBLA 1Z6JT 4PMFA 3VFWB 3CDZA 3GXDA 3WG7B 1VAHA 3II3A 2DWEB 1IRAY 1TVBB 5F70A 2B14A 2AJZB 1YDPB 2OMWB 4IBWA 2IDFA 2R7EA 2ZKHL 1E0OB 3AROA 4ZXBC 5AB2A 1HSAB 3OGCA 2GTSA 3DTDA 3V0WH 3EUDA 3OHXC 4LP4A 5AENA 5IB1A 1QUPA 3TZVB 3QDGA 1N7MH 1UFGA 1R3JB 3RJDA 3ZRVA 1DVSA 4MNQB 2PI4A 3VQMA 5KYUB 1RCYA 5E95B 1AY1H 1TTFA 5GZOA 4FXGA 1SA0A 1JZJA 4MTGA 1PTZA 3OD4A 3E8GA 4MKTA 2QGNA 4XXDB 5GJSL 4YHLL 1QABA 2AV7B 2EJ7A 4UINH 1QW8A 5T1JA 4U6YA 1K2DB 3CZFA 3MODL 3R1GH 4KK8D 2FX7H 3UBGA 3WJJC 1IAII 4NLAA 3L3IA 4Q4IA 4ODBD 4OKVB 1OM9A 4NN5B 3MN8A 4D0CB 1B4RA 5GRVL 3QIBA 3QRGL 4ES8A 1SLUA 3QORC 3UGEA 2Q7HA 1K85A 5CA1B 4TULH 3P2BA 4FA6A 5C1MB 1R5VB 5M7QA 2APWA 2KYIA 4U1NB 4IKJA 1IGTB 2XTJB 3PXJA 4CH5A 1VQLV 1F1AA 4RWYL 1VHPA 2FBRA 3IFLH 4HZLA 1KUQA 4PJAB 3HI5H 1FFPA 1MIMH 3KXFD 2QZ5A 5KVGE 1Q6HA 3JT0A 4Y2DD 3RWIB 4FA8A 1WAEA 2MJWA 4HCRH 5BVPL 3SE6A 4OCSL 4FLZA 3EBIA 2E3CA 3BN9C 2Q0OC 2X0LA 1TVKA 3K80A 3L7FA 1GN2A 3KMDA 1QHTA 2GTAA 1ZHLB 4XBGB 2EIMC 2VLLA 3VWKB 5L88L 5DUML 3QCTH 3TJEH 4GNKB 4KAQH 3WUWA 4DRXB 5JHMA 3QJRB 4APXA 2VDPL 3LDCA 4LRNH 1U0QA 2IJJA 4N0FA 4PRIB 4ZQKA 1EEQA 2CO7B 4X0KB 4XVOA 1DL7H 1OTTC 4YHPB 1Q6IA 1TO5A 2RMKB 4HC1A 4U2YA 1VQ4V 4ETYA 4KI5F 4PJDE 3QCVH 4XMZA 3ZO0A 2G0LA 2PTTA 2ARJB 4BH8B 2CO1A 3DUUB 4KRPC 1XF4A 2XNAA 3B1UA 4YJ3B 3QQ9C 4N2AA 4EE2A 4Z7VA 2K3TA 1OCCB 3OSKA 4JG1L 1TVHA 3G08B 2EDMA 1F58L 3K58A 2BSEA 4FF9A 4E9YA 3CFJB 2NY3B 2J5LB 1N67A 2HJLA 1FO0L 1YN7A 2EH8H 5T5FL 3BPCB 4NAJA 4A2GA 5C71A 2GK2A 5CJBA 1T5EA 3P3YA 2YEVB 2WXLA 3HZYB 3RKPA 4UT9L 1NANH 1UH3A 3ZRCC 1A7NH 2Y5QA 1N4XH 1P84J 1TLKA 3UBXA 3WFEH 4HQQH 3ABMC 5HJGA 1A7BA 1A65A 4ZHQA 4ZI7A 1BMZA 4XO9A 3ZE0E 4CN6A 5IW1B 2E7LA 3SBQA 3B7SA 5CAYB 1FRGH 1KTJA 5DMJB 2W5PA 3FUNA 1YVLA 3LEYH 3S36L 2WTRA 2I27N 3EO1B 3L17A 5KX5A 3MRPB 5ISZB 2RCSH 3N42B 4IIJB 1ZLUH 1F6LL 1Y0LB 2D7QA 4JZOB 3JWDH 2BY2A 3WIIL 2BHUA 5JXAL 3VUAA 3CRRA 1AQDB 3MYZA 4LCYB 4NO0D 1XCQB 4B3MB 3EFDH 4TRPL 4DGVL 2IH3C 5FUOL 4P5RA 4RMWA 1MHCA 2X9YA 4JTCB 3IK2A 2PCPB 4NKDB 4PBDA 2BFVH 4MZ2A 1VZHA 3VXUD 2A79B 2UXXA 1MZZA 5A2CA 1W0WB 4H25A 4CVUA 3VXOA 3CYOA 1Z9MA 1NOFA 5FV2A 2Y4SA 2BSSA 4ZZKA 1DVFD 2Y07H 1N34B 4OD2B 5EU3B 1P1ZB 3CPLA 2Q5ZA 4JMNA 4YK4C 3B6SA 4TV9A 1JZ5A 3GXFA 4TNWF 5J13C 2F7IA 4FG4A 3MLPA 3Q2CA 3TA4D 3TJHC 4TQPA 4M6OH 4G1EB 5J1TC 1BFOA 4FFVC 2J12B 3DX6B 2ILLA 5L2JA 3K04A 1KC8W 1OW0A 2D2CB 2G5UA 5BRZB 5D7EA 1UASA 4XO8A 2DTMH 3OKKA 1R3HB 4TTGA 4LCUB 5AEAA 3QG5A 1RFYA 2H32A 5JOPE 2RQ8A 2QHRH 3TBBA 4N2NA 3D52A 4LBAA 3I2CL 4CC4C 2OT5A 4D9QE 2Y1YA 3DGGA 3IXTB 2B15A 1HHIB 3HKDB 4JFDD 5ESVB 2V2WA 5JUEH 1KELL 1PD1A 1BBJA 3H9SD 5FDWB 1K33A 1UKQA 1T4KB 2Q7GA 3DV6A 4RDBA 4GT7A 5DDHA 4ZW7A 3UYPA 2A9BA 1JPSH 3OR6B 5I30H 4QHLA 4PRNB 4JHVA 1GKOA 4P4KA 3O4LD 4DTGH 4PRAA 4XP6L 2MNJB 3ME0A 4LFHG 1UM4L 5FCUH 4JI3B 1GSKA 4HK0B 4XAWL 3V0DA 1UVQA 1Z3GL 4X6CA 1J5CA 2Z8VC 1OAXH 4PJFF 2PETA 1PL3A 5E6IB 2WWKT 4E5XB 4F15C 3P30A 1ET5A 5FPIA 2F54B 3MRBA 1S6NA 1GIGL 3FN3A 2PPFA 3HKBB 4OLWH 5IV2A 2YR3A 1DJSA 1URZA 5D7IE 1E79G 1T80A 2WAMA 5CA3A 5LCVL 2DYRB 4IEFB 4YHKH 4X5XB 4EI0A 5I23A 5EZIL 1JUFB 1DJWA 3HC3H 3VTAA 2ZAIA 5EUKB 4D0DA 3V7AG 2CUAA 1A9EA 4UAOB 3VFUA 5I5JA 1KFAH 3SKOB 1X4TA 3QPXH 5C0CE 4HXBL 3F01A 3A2FA 2C4FT 3HKEB 5A7BA 4DUWA 1S7UB 4ABWA 3VRLF 2XX0A 1H6FA 2NY6B 3K71B 2QSTA 3NPSC 4LIQE 2C3VA 3REVA 4P2QA 3TCXA 3QA3B 1BQ5A 1S7QB 3NCYS 5LGHH 5KSVA 3QUMA 2QTSA 4M5YH 1T6VN 1NCCL 5C9KA 3M99B 1YECL 4R26L 4C83B 4HC1H 4EN3A 4KROC 3IETA 1NZ6A 3LAFA 2DBJA 3RYHB 3DROA 4QRAA 4X6DB 2FZ3A 3SQOH 4MA1B 3GMLA 2WJ7A 3C6LD 4DPCX 3HE6C 5EN2A 1AQHA 4DGIH 1VF5B 2DWYA 4QRUA 2C9PA 2KQXA 4PJ9B 4ELMA 2YFOA 1A2YA 4YH6A 1JL8A 4BV1A 3D9AL 4PJHF 4EJ1C 2D7MA 5IB5B 5IB3A 1TJIL 3QISA 3TYFB 3P2DA 5HP5A 1KCBA 4X7TA 3KPLB 5IIEA 4ZO9A 1J8HB 3AY4A 4OJDH 4TVSa 1CXIA 2C9QA 2VN4A 1QRNE 1A1OA 1VPOH 1NFKA 4HWZA 1WBZB 5GGTL 5I19L 3SJVE 2FX9H 1CCZA 1VESA 3S37H 3VXNB 3FHQA 4YIQB 3PGFL 1M1KW 4HUVA 1N36O 4J8RB 1TQCC 3PF2A 4NI3A 2OSYA 3LOWA 5C09D 3LHPL 2ALAA 4L4VD 2Z1KA 5EO0A 1WCBB 4DR6O 1CI5A 3MGAA 3NCXA 1FG9C 1QPPA 3HZVB 4IBYA 1SYSB 2KDYA 4YHZH 4ZSOE 4ZBJA 3G6AB 3WDHA 4R8CA 3QFJD 4XMVA 4TVPD 4JRLA 2PWHA 1YEHH 1H2GA 3RNQB 4XDJA 1S5LZ 2GBAA 3F7QA 4XNAA 4MCNA 3BGMA 5LP6C 5IROA 4NQEA 5MEOA 1AXTH 4K73A 4X88A 1GZPA 1KY7A 3QO0B 3COOA 2YK1L 1MI5E 4PJXF 3CC4V 5GTIZ 3ZL4H 4OJEH 1FORL 1U97A 2KQNA 5EO9A 2F53A 5JPMB 1T89C 3QZLA 4D2NA 3FZUD 1HVXA 1J11A 5IG7A 4R97B 2IAMA 3SDDB 3UPRB 3OQRA 4XRCA 1YMHA 3JWOC 3HS0A 3LNNA 3HZMA 5AVTB 2IQAA 2Z9TA 4TOYH 2LFEA 5C07E 4WI0A 2ROXA 4Z0XA 1KIUA 3D2TA 5DD6B 3BP6B 3K2IA 5CWSB 4UQIM 3O2DL 4H37A 1KBGH 3PV6B 4G7VL 1J88A 3T9WA 1QLFB 3AB0C 1FVDA 1X5YA 2H32H 3DX1A 1GGBL 2OR9L 3LN4B 4TUKL 1M7IA 5D7KE 3F5WC 4JFVA 1E7VA 3TV8A 4LWSA 5C08E 5ES4B 2B4CH 3CEIA 1L9TA 2I7OA 4QWWD 4HIEB 4OFYA 4PCKA 1NC2A 3IF1A 4JFOA 4PB9L 4JYYA 5D7LB 3ZN6A 4EN2A 4OT1H 1NVPD 5G2NA 3F7PC 3HN8A 1UYWL 4MDJA 1IC7L 4C4BA 4A55A 3RWCA 3QXUA 3B9VA 3B9KA 3G6JE 5CJQH 4DPBX 3GB7A 3N40F 5K33A 4MXWH 5L8KB 3QDHA 2XXCB 1AHWC 5FKAB 1HHJB 2P7TB 4AL8H 3FUEA 4FFYL 4UT6L 2XWRA 5IJ9A 3TN0C 3STZC 1OF0A 4IKLA 5DMIL 4O2BB 1WWCA 1TG8A 4XXCC 4LSDA 3P30H 5DZNA 4LF3B 3NN8A 5AKRA 4ZUSA 2VDRB 4J8QA 3A0BZ 4DV2O 2BP3A 3FT2B 5LMUO 2BIIA 3MRDA 4NC2B 1SZNA 4QD2E 5LXGL 1I9EA 2VZSA 4JHAH 5GGQL 5IM7B 2QJDA 2X6BA 3AFLA 1IVLA 5I5MA 5JW4R 2V5TA 2HLAA 5F97E 1G7MA 1CICB 1FV1A 3GBML 3NR7A 3E35A 5EC2C 4L1BA 5MEQB 3BZ4B 2JLLA 4BRVA 1CDCA 1ZS2A 3VXRE 3CSBA 4FXKA 2OTPA 1KB5L 3JXAA 1LE9A 1JTOA 1JD7A 2C7UB 1H2SB 3UT5A 1NCDH 1LGVA 2UVEA 4Y4FB 1OAKH 5E70A 4S2SB 5H94A 4AMKL 3VWJC 4G6AC 1MFCL 2CJ3A 2EXYC 3RW0A 1CL7H 1DDHB 2ZXBA 1TPXC 3FT4A 5IW6A 3BP7A 3ZMSA 4WKXA 1AKJB 3HG4A 2VDQB 5EO1A 3QUMH 2YRZA 1PNCA 1QEXA 3VQYA 2ZWKA 3C8KB 3NRFA 2GBUA 3PNWB 1A1NB 2F0CA 1D6EB 3K5RA 5BR8O 3FQUA 3PWLA 5CFAA 2R1WB 2R9HC 2VW7A 2BOCA 5JQ6H 5BOZG 3IVKB 5CD5D 2F15A 1T5WB 2FO4A 1JVOA 4UYPA 3CU1A 3SDAD 2KT6A 1NSNH 5HHXH 3CFDA 4DN4L 3T0ED 1MNGA 2NNUA 5AOIA 3WNKA 3LXAA 2DLHA 3POHA 1D2PA 2YPVL 4JLRA 2GJPA 5E6ZA 3AITA 5KBKA 2CJUH 5E5MB 5BO1H 4K35A 3GHEH 2ADJA 1ZV9A 3RGVA 5ACZB 3GIVB 4HPOH 4UM9A 3BSHA 5KG9A 4FLSA 4P2CG 4PY7B 4DP2X 2NTFA 1GA2A 1UFIA 1XEQA 3T4ZA 2EIKB 4OCWL 1HWWA 4E9WA 1YN6A 3P9WB 2ZOWA 4FERA 1P7QD 5TH2A 3MJGX 3UYRH 1D5NA 2H2SC 1XMEB 3B7TA 1GAFL 1RZJC 3CX2A 3U1PA 4GP4B 4L29B 3F6LA 1TJHL 3QO7A 2Z31A 2H0JA 4JRXA 5GGVL 2NN4A 4IJ3C 3GS0A 4QY8A 3K3WA 3VH8B 2B1AL 2PTVA 3IMWA 4ZX5A 4N8PA 2WPDG 3L3OC 1KEMH 3BE1L 3Q4HB 3CCEV 3HUJA 4DEWA 4PG2C 2UU9O 2CO2A 1D5IH 1UXSA 1WFJA 1HR0B 2YZ1A 2PTUA 4CC6A 1VARA 1B06A 3KGRA 2ITFA 3FFDB 4DO2A 4GUNA 1UM6H 2DQFB 3Q8CA 3MBEC 2BNRE 4I3SL 3E2EA 4Y9CA 2JGDB 3MA9L 4N1EA 5TE4H 2Q9LA 3UKMA 1IBLB 5E0QA 2UY6B 4BSVA 4GT0A 1GZQA 4R3SA 3V4VB 1E8XA 3BSZA 3G04B 1XILA 5DEDA 1UOVA 4QRPE 4BFNA 5IJVB 3QULA 4JJ5B 4WW1B 2G2RB 1WLEA 2RCVA 3LNHA 2R72A 2QKIC 3LPPA 4NDMA 2A4EA 2BRQA 1IEAB 2BNQD 1YEKH 3KBHE 1VQ6V 3K0YA 1IFHL 2YXHA 3I3BA 3L9EA 1FVEB 2ADIB 3H0TB 2XU9A 1UJ3A 1PPIA 2W38A 3BLBA 4KUCF 1SMOA 3DOSB 4WHDA 4HJJL 4R5VA 3JVFC 5DQDH 5ID1B 2A7BA 2JF1A 2A9NH 5JW4M 1PZUB 1KCLA 3FF8A 3LKRA 4FD0A 4RNRB 3SE3A 1T5XB 2VQFO 1E2ZA 3MUHL 5DK3A 3PXHA 3HE7B 5BZWB 4FJYA 1TXKA 4NUPA 5E99L 4UM8A 3BIKB 3LPFA 4ANVA 4WFHA 1H3PH 5I1LB 2FK9A 4PA3A 4HSAC 1ACXA 3EYQD 3DLQR 4QNPE 3EGXB 3VYPA 3FO0H 3K0WA 3MLYH 4PGCB 3WIFA 1F11B 3T2NL 1BZ8A 3OXRA 4WV1C 2QR0A 3SY6A 3B7YA 4NN7C 2ENSA 3NZSA 3N41B 1CE6A 2VS0A 4AJ0A 2DQIH 5EU4B 1XCWA 4B96A 1B4LA 3VMNA 5GRJL 2NYZA 4JZJB 2IV8A 3QWQB 3X12B 5IT2H 2ITDB 4OLXH 5FR3A 4F9LA 4WWKD 2HVKB 2SEBA 3FNKA 3O4OB 1F6AA 1R3LC 4N9OB 1ORSA 2BVOA 3ESPA 3CSPA 3DETD 1WDAA 1FL6A 1YSOA 3OKYA 2J1WA 3O6KH 5D2LE 4OI7A 5KJRH 1HNGA 4JVPA 3RUGF 4GB9A 1TUBA 2IFFL 1I5XA 1F00I 3OKDB 1J05A 3TTYA 3RFZC 2DQEH 4J3BA 2OWOA 5HGHB 4HIIB 1DVXA 3DECA 2WWMD 2Z0BA 1LO0H 4FDWA 5CSZA 2EZOA 1AR1D 3DSNB 2YUVA 3QQXA 1TSHA 1YPZB 5F1IA 2OBGA 1B04A 2UUDH 3UERA 1A47A 2XAFA 5EC1C 1OSPH 1XCXA 3K3QA 4PMEA 5DUPH 3UZQB 2OXHA 3IJHA 3EXAA 1UWYA 2NW3B 2JKXA 2ICWI 2VABA 4IRSC 4YXKL 3IAGC 2GCYB 2QV4A 2XJLA 4YDIH 4YX2H 5ITBL 2EKSB 5JMOC 2DQ6A 4FABH 3A24A 1Z5WA 2JK5C 2R4RL 5D4IA 5T3XD 3FRPB 4UDTB 4NQVA 1U8IB 2W65B 1ZHNB 2WPGA 3F58H 5I8CA 2K78A 4YHOL 1D9KB 4G43B 3IC7A 2BK8A 2XFXA 4OBRA 1V55B 1B6QA 1KG0B 4J3VA 1TCRB 1U8MA 1W0VA 4H8QA 1JXKA 2K6YA 3BAKA 4H26B 4M7ZC 1G7HA 3RT3C 1DQIA 4HWBA 1NDMB 2YSUB 3D85A 3RTQD 3KG5A 2PUSA 3B37A 1CI3M 2BSCA 5GGRY 4ZYKB 3ULUE 4MA3B 3Q7JA 1FZMB 3RA7H 4D9LH 3D39B 2E7CA 1E3XA 1GGTA 4XHQA 4DCQA 2P5EB 1JPXA 3RWDB 4R4ND 3BFQG 3PWNA 3ARQA 4K71C 4JFQB 1JWMA 2B1IA 4K8RH 1WFTA 4JUTA 4IIQC 5C0AA 4G8AC 1C12B 3PJSB 1P49A 4PJ8A 2R1YB 4MNQE 4WKZA 2VZ1A 2X9WA 1BQRA 4DV7O 1ED3B 3S3XA 2O57A 5LYJB 1Q1PA 1T66D 3QUXB 4N85A 3OB8A 2OXGA 5LXTA 1JF5A 2VM3A 4YHMH 3K81A 4F7EA 2XHBA 2YQ3A 3S4SG 2YD4A 5DD3L 4WGKA 1QLEL 2DMBA 1ZKAA 5BO0D 2O5ZH 1JMXA 3C2AH 2CNYA 2GJ6B 4X98B 5FF6A 2GIXA 3DGEA 3FONB 2F08A 3MRMB 5E8EB 2PYEE 2X4QB 1CU4H 1R5IB 3PPEA 3GI9L 4ZS7L 2YJLA 4TUUA 5D6DA 5CEYB 1FE8H 4G9DA 3WKNA 2C8NA 4NJ9H 5CXPA 5HD8C 3EYVB 1LWHA 3U36A 4YFDB 1XNQB 1IM3B 1KNOB 3RWEA 3BUDA 1RURL 4L8SA 3IT8D 3LDDA 3MGTA 3WFHA 5E5UB 2BDNL 3DTUB 1JPTH 3KYKH 2XTJE 3VFGL 1WT5C 2Y5TA 1DQQB 1RPOA 1U8NA 2DQTH 4N0UA 1B3QA 5BCAA 5DS1A 2P3YA 1YEIL 3LKSB 4JDZB 2WSSG 3BJLA 4RA3A 3JTSA 4Z1VA 1PDKB 1S9XB 3WO4B 3VB9A 4WCYH 3MV7E 3UTPD 4H0IA 1NKDA 1KECA 4NKOA 2WCPA 4U1GC 5TE7H 1XGYL 1W8NA 2EADA 4ICGA 5ETUA 5HPMB 3IRCA 2CPUA 2HJKA 5AAWA 5GGSB 3KJ6L 3PQYE 1UB5B 3L7EA 4OZHA 2R29H 4IKKA 1E5AA 4CBPA 1FG2B 3MJ7B 5HDBF 3RL2B 4BZ2A 1WTGT 3FTSA 15C8L 4KKBD 4PRIE 3HR6A 4B7EA 1OTSC 1RLWA 3RZCA 3O11B 4L9LA 2NR6C 1OCRB 2HJFA 4OTXL 5C0BD 5E4AA 5DJXA 1E5CA 2YPLA 5GS0L 1R33A 1OEZW 2H7WA 1AE6H 2I9LA 2FB4L 3VI3B 1QFOA 2XIBA 1DLHB 3CFCH 3HAEG 3QNYA 4RZCB 3GJFA 2XACC 2J72A 1A4KA 5F9OL 4A7GF 1RVFH 3WB0A 3OMNB 3I9GL 4NHCL 3B9AA 5HHPB 3RI5F 3WJLA 3DX9B 4PGDB 1EA9C 4FNPA 3ZE1B 4JFHE 4EOWH 1UM5H 4OZIE 3KCPB 1BVLA 1F90L 5D1QB 3TF4A 2R56H 3NTCL 3B2XA 3CVIH 2LABA 4R84A 4OI9A 5CJXA 1J9SA 1KTBA 2BSKB 4G6KL 1R75A 1MFEH 1VFBA 1CLVA 4BCZA 1HX0A 4XB3A 3SDXE 2APFA 2X4SA 4HP5A 4C54A 2AMGA 3SDXA 1NBZA 3HZKA 4F8QA 2ZAGA 3AG1C 1U36A 4KI1A 5ISZE 43CAA 5L7XH 4WSJA 5IOKA 1KGXA 1NM4A 1YO4A 2LHAA 4Q97A 4WFGE 1XZ0A 4XH2B 1A21A 5DJ2A 3T08A 3W56A 4JI4B 2DQHH 4FQ1L 5GJTH 3SPJA 3BKMH 4PJGF 1PMYA 4ANKA 1U8JB 3GIZL 1L3WA 3GJEA 3EZJB 4MJHA 1KN2H 1MFVA 4FNSA 3JZYA 3O6ML 4XVTH 1OPGH 1BMGA 1MFAL 2JB6B 2NX5D 2P5WA 3D0LB 5DWPA 3PAYA 4XMXA 1C08B 5DUBB 3RIAK 3HC2A 2EYTB 4JCWA 3BP5A 1IBGL 3MLRL 5AVZB 4CW1A 1JNJA 2VDMH 2VIRB 3HLAA 4TS6A 1IXBA 2YD1A 3V6OA 1F6FB 4HLZG 3HBPA 4B9JA 2Z7ZA 2DLEA 2BTOA 1F4HA 1U6AH 5T1MB 3CPWU 3ZHVA 3PWUB 1CB4A 1P6WA 3BIAX 3LXUX 4I18B 4WUKL 1A9BB 4U3SA 4UDUA 4UOJA 3CLFL 1P4LA 2Q0AA 2DLFH 2EINB 4QE7A 2E7DA 5EZLA 2AABH 1CLOH 4L37B 1AI1L 4Y5YA 4BA8A 2ZT9B 5BRZE 4AGOA 1LNUA 4PJIF 2FBOJ 3IU3B 3VE0B 3FO9B 3H9HA 2XOKG 2N59A 4G6FB 4UZSA 2GHWB 3OVUB 2EILB 2QWOB 3ZUCA 1CF8H 1NMCC 5I6KA 5MEPA 3OKEA 2D3LA 4WFFA 1NBYA 4G9FE 4NYLB 1BIIA 3L4XA 4G7SB 2G3ZA 2EXWD 3CK0L 5GXBB 3SYQA 3OLDA 4XP9H 2Y69B 5KHHA 4YHNB 5DCCA 1JS4A 1UENA 1LP9B 2EYRA 5AVWB 1FSKC 5DURB 5CU5A 1VACA 2V5YA 3ZMEA 1JFHA 1BX2A 4X65B 2CO6B 3AREC 3CZJA 3P9MB 1PEWA 1P69B 2IBZX 5IDJA 1R9FA 4XE5B 5CS7A 2I9TA 1BGXH 3SGDI 2JIZG 1XH3B 2PY5A 2X4OB 3KPSB 3T6WA 4RMRA 4Y2LA 1MXGA 1RZ8B 2HT2C 2A74A 3U9WA 3U6RB 2NY2C 3U82B 4P5MA 1E40A 3ZX1A 1P4RA 1F4WH 4I13B 3G3LA 2R0WL 5KJ4A 4UTAH 5JXEA 2F54E 1R0AH 3AMLA 2P80D 4BFKA 3HLKA 2DQJL 2FWUA 3SY0A 2NYYD 1N68A 2ITCB 1R3KC 4BQ8A 4PJEF 2JJ2G 3IPEA 4Z7UA 1QBMH 4JREB 5FUZL 2E59A 4LFBB 4CAGA 1L6ZA 2PCFB 4Z77B 4UCSA 4DK0A 3L5XL 2ZKWA 3B56A 3BAWA 2E6JA 2O72A 3VU1A 5KS9A 1MCPH 3QO1A 5KVEL 5HHQA 5DJAA 3JYCA 1EFRG 1OP9A 1IFRA 3QHZL 5TDOB 2L7UA 3VGAB 4RGNE 2OMXB 5DZJA 3E2HC 1BQLH 1YQVL 1FFNA 2AJ3A 5AFAA 4GRLC 3S9DB 1U8QA 2ISDA 1ACZA 2ZUWA 4YL9A 5AG2A 5E2TL 4X6DE 4ABVA 2ZOTA 3DXAE 3W9EB 1PW3A 4Z0BH 3GJFH 4GUPB 4JG0L 5ICUA 3VRIA 2VQUA 3CXCU 1JZ8A 4RRPA 4KQ0A 4LLQB 5HGBB 1VDGA 3BO8B 1E4XI 2YGNA 4JPKH 5ANMA 3FQWA 2JKNA 2J88H 2WBXA 4R6UA 4Z3TA 3WYRA 1ZTMA 3AG4C 5I1CL 4LCWD 3FOLB 4WW2A 4NB7A 1A4CA 4FKKA 4MD5B 1J8HE 2BJMH 5H35A 4EKJA 5MENB 4DKFL 1AP5A 1NEUA 3FB8B 3T77A 2CKNA 1QVOB 1Q72L 3CDGB 1IBMO 1M7DB 1LVEA 3R7QA 3X1EA 1J18A 1GKFA 4D8PB 2R8SH 4HKBA 3ABLB 1L5GB 2N7AA 1VFOA 1C7SA 2NRDA 2ZIOA 1D6VL 4AM0B 5LQBL 3WLWD 4XGZA 3LVTA 4XO4A 3H1IH 2NQ3A 3TBYA 4KUCD 4CN4A 2VM4A 2YUWA 3T1YB 3VXME 7CGTA 2AJYH 1WP8A 1IC4L 2VUKA 4HIHA 2C26A 1K6QL 1PZBA 1YYMH 4MT8A 2QV2A 2R1XB 3CDZB 4GUCA 2G9HB 3H42L 5JPNB 5L4JA 1UWGH 1SBSH 3GD1C 2ZP9A 2NZ9D 4ZFZB 1KBPA 1JFQH 2R7EB 3FQ1A 3MPCA 2DWXA 3OGCB 5IJKC 1OE2A 1MFUA 2WZAA 5IB1B 5D1ZA 2CALA 3QDGB 3TH2T 4MMZC 3UAJC 1Q7YW 2KPNA 1P7KA 3QDMA 4NC0B 4PGBA 4UVBA 3V5KB 3H4HA 3NCEB 3NH7H 1DBAH 4HLZH 4FHKA 2G60H 3FU7A 3OGOE 4LSSL 1GY1A 5AB0A 3UOAB 3ZS8C 4FXGB 4DIXA 1SA0B 1OANA 3ECBA 2Y06L 1JF6A 3HR5A 4OF5A 4PYGA 3DO7A 3BPLC 4J9YB 1GH7A 1RSYA 4CC0A 1UT9A 4YAQA 3UO3A 1Q9LA 1CPUA 4S0SD 1Z3RA 2GHZA 2R39A 4U7NA 5TGBA 1Z7JA 1XT5A 2CHNA 4IU3A 4QKXB 2WZ6A 4U6YB 3REWA 1F56A 3V4PA 5EEZA 1GW6A 2BTQA 4JPRA 2E7MA 4R7XA 1D5ZA 3L3IB 2H1PH 3ARDD 3BXNA 4K3DL 4NGHH 4Q9QH 3G71V 4OJFL 4TNWK 1K7DA 2Z64C 4QHNA 2LP7A 4YSAA 3DO3A 1H9VA 2XVLA 4WWNA 1JCKA 2D0FA 3WGUB 3RDTD 1ZWIC 2WTOA 3APNA 1FAFA 1BIHA 3B2MA 1OWWA 5DRWA 2QFPA 1AZCA 5FKPB 4GBXC 2UXGA 4OZGF 3M46A 3A5VA 3GI8L 1DFXA 1WPBA 3K2UL 5JJNB 3K1DA 4HZLB 5IFJA 2AS5M 1FFPB 1SQ2N 4G80A 2YXYA 1K9TA 1BREA 5E1IA 3T0VA 2QVFB 1DCEA 3NJLA 5DD1H 5EZJA 4AIEA 4H0LB 4ZXBA 1IGCL 3QG7H 2XFGB 1GGCH 2A77H 3ZKXC 4AE0A 5CM1A 2QKCA 1KJVA 2E5EA 5FLUA 1JYNA 2QJ1A 1XCTA 5EYPA 2EECA 5C2UB 5FO2A 4AQOA 4EI5A 5LXVA 2YC1A 4DHLA 4ZMTA 5CFHA 4M7LL 2A3QA 1OCZB 1DEDA 2OP4L 3A4AA 4PJBF 4Z7WA 4APXB 4GG8A 4F80A 3K8MA 4KHXH 4N0FB 3BPOC 2IWGA 1PM9A 2W6JG 2A0LC 2KZ1B 1U3YA 1XF5A 3WE6B 4NPJA 3O6FA 4F33A 4NWUL 4TQFA 1CIUA 1SXBA 2K6WA 4H88H 4B9FA 5IJ0A 3VG0H 2G75A 5B4MC 1RUAL 2M8XA 4YSSA 2OMTA 1KIRA 2PTTB 3DRQA 4J6RL 1M05A 4TSBL 5JLZA 4Z7VB 1FC2D 1XF4B 1MCCA 5FM4A 1SQBH 1TVHB 3V0HA 4JY6A 3QORA 4AVJA 1NR7A 2EDWA 5DVMA 1X4YA 2ZJSH 1UZ6F 5ITFA 2DKUA 2HJLB 2VN5A 3KLKA 4PJCA 1YN7B 4Z9KB 3ESNA 2VAAA 4JGMA 1BF8A 4LR3A 2OMNA 3MXWL 4MAYD 4OVVA 4FQIL 4YDVB 3UBXB 4KTYA 4ZHQB 4ZI7B 5DMGD 4X80H 4F5CE 1HDMB 1IE5A 1CT8A 4M4PA 2WKLA 1DJGA 4PLKC 1G9NH 2CCWA 2WTRB 2EX3A 1U8PA 2CBMA 1NKOA 4X5QA 4F2MA 3RX8A 2EE3A 4TQHA 5KYWA 3ESUF 3J81N 1KJMA 2DYSB 2W0FC 2VXTH 4H0GA 1G4RA 4IOSD 3ZVVA 2DDQL 2YSTA 1NAML 1DK1A 5HYJA 3F7YC 1MHCB 1OOAA 2C3GA 1BZ9A 4KTDL 5IMLA 4HALA 4PREA 5BS0A 4H25B 3QEQA 2C1PA 1Q38A 4O4HA 4QT5B 3C09B 5HI3D 1IBZA 4KUMA 2YARA 5KSAD 4ZNCD 3OLEA 1AFVL 4O02L 3KXFE 4GRWH 5DZVA 1S5HB 2X5PA 4QOKD 3SODB 3CPLB 1N0LA 2GI7A 1NCAH 3KYOA 3S3PA 1WC7A 3B6SB 3ZCCA 3N0AA 4MVUA 4UTCA 1OT2A 4ZW8A 3MLSH 4A67A 4FFKA 4IU2B 4LCIL 4MKMA 4QYAA 2NOYA 5J3HD 3CSGA 2JXMA 4ABQA 3R18A 2MPAL 1N8ZA 4AZ8A 4LC1A 1AQKL 1PG7X 3QZWG 4P59L 2IBBA 1N0JA 3B3IA 4Z95H 2IH9A 5JQIB 4K3AA 1I9IH 2EDBA 1BFOB 4TLUA 5H4ZA 5I17A 1ZVHA 4GAJL 5L2JB 3WHXA 5T1LA 4HS8L 4KO7A 4R90H 1FXVA 3BQUC 4H20L 4Y19D 4RISH 5ADPL 1C5CL 3HB3D 4PJ5B 3IGAA 3ULUC 4TV8A 2H32B 4DN3L 3FK3A 1QEWA 1QPXA 1E4KA 2DWEC 1W72L 1I9RH 1MLCA 5DFWH 3V52L 4C47A 4CSZA 4RETB 1J87A 3DGGB 4F7TA 3H1HH 1JXJA 3S34L 2K70A 5D7SL 1TTUA 4TVPH 2IDSA 4ENED 4YDKH 1F86A 2V2WB 3TZVC 4NERA 3H7BA 5FO7B 4F6EA 1R3JC 4PRPA 2FNBA 4TT3G 4QPKA 2X87A 3DV6B 5H4YA 3UYPB 5IVXF 2R4SL 4QHLB 1BLNA 5J6GA 2QWPB 4LLWB 4P4KB 1IV8A 4C56A 1IGJA 2X2JA 3FH5A 4KKNA 4PRHE 1OSEA 1ANUA 4PRAB 4R7DA 4JI8B 4ZTOL 3QNEA 2X4TB 3C5JA 3ROOA 3V4PH 1MCIA 2VMJA 4JEGB 3QR0A 1UVQB 1L9OA 5FYLL 1NGZB 1ZTXH 3AAZA 2OW6A 5HHVL 4BFRA 4PUBL 3T4YA 4TSFG 2W9DH 3T3PE 4NN5C 2NSXA 1MFBH 4UV7H 1NLBL 3GZQA 3MRBB 3V8CA 3F7KA 2J21A 1V8HA 3CLEH 1I3GL 1OY3B 1ROCA 4P2OD 5IV2B 3HPLC 2I60H 6CGTA 4OPAA 1L6PA 4PWKA 4U6HA 5JW5A 2XTJC 4DR3O 1XQ4A 1I94B 2YPKA 5DC0A 4D0DB 5ABAA 5M95B 1IAIL 1A9EB 4ZPTA 4LVOB 1PKQA 2JCCF 3VFUB 4ZG1A 4ZAKA 4CKVX 5E1HB 3DPDA 4P2AA 2XWEA 5T1KD 4LF9B 1ETZA 1W16A 1UD4A 1AP6A 3D4YA 1MFDH 1OLLA 4HLJA 2PN5A 2LW1A 1Q9KA 5JVDB 2C3VB 4F57H 1WAAA 5TE6L 3REVB 3GXNA 3VWKC 3CV5A 5BZDB 4UCOA 2D7OA 2DM7A 4JI2O 1I8LA 1WITA 1R5WB 3QUMB 2VN6A 7TAAA 5FLVA 1AIFA 4DW0A 4GXUN 2JEXA 1TNMA 4Y4HC 3IETB 2FZ3B 4XNMA 2HCZX 3EYSH 3OPZH 4IHOA 2JKJA 2X2IA 3DSFL 4JS7A 4WHTA 2V2XB 4ERSL 3DA0A 2JH2A 2WXOA 4FP8L 5FWRA 3VCLA 5E8DH 4W6YB 4QRUB 5DYOA 5GRVK 4ELMB 1B6UA 1A2YB 5AAMA 1OCCC 3D0AA 5JCOC 1P4UA 3JBG7 4XWOC 5IB3B 2JQAA 4O58L 4NFDA 1U21A 5CEZE 4X7TB 2NY3C 5IIEB 3CCHA 1VGEL 4U7OA 4FLRA 1NEZA 1A1OB 3VSQA 1D7CA 4HWZB 4LFAB 5E4OA 2GTZA 4YDLC 4HUVB 1OCOB 2GG1A 5F3HB 5H6QA 1YPZE 1HQRA 3JV5A 2KDGA 4Z7QF 4DV0B 1FC1A 1ZHKA 2J5WA 2VO5A 1RPRA 1XH0A 2ID5A 4QPEA 5GRUH 2QWRB 5IHZB 4ALAL 5J12B 1NCJA 5B7FA 1BXUA 2APBA 1OSZA 2KLTA 2ZE0A 3ZHUA 2RN9A 5EO0B 1S4IA 1HINH 1DBMH 2RH0A 2XV2A 4DAGL 4M5ZH 4Y5VC 1YTFD 2OI9B 2VZ3A 4PW3A 4RMSA 5D7JA 1JA8A 3SKUD 5EWIH 4DERA 3CCJV 2JELH 3TTSA 1MHPH 4HIXL 5DR5H 3BGMB 4HWEL 4PR5A 4NQEB 5MEOB 4Z1PA 2X1PA 4UOW1 2IH1A 2PR4L 4OCYL 2NSQA 5EO9B 2F53B 3ARXA 2ARJQ 1SQPH 3POCA 2DKSA 1WS8A 1LE5B 3AT9A 4TSCH 1Z1WA 5IG7B 2AQQA 2IAMB 3RLSA 1RZQA 4XRCB 2VR6A 4M1CD 1YMHB 1PBYA 4I4WA 5C2BH 2YFNA 2PWDA 3HS0B 4UOZA 1ZLVH 4KDVA 3JARB 4X4XB 4YHHO 3DX0A 4AEHH 1RZJL 5B7EA 3WL9A 3KLAA 4WI0B 3LSOA 4NZRL 1KIUB 4Z0XB 5I1KH 1YJDC 2HX8A 3GSOA 3CFEA 4JM2B 5KTEH 5FIEA 5K1PA 2X41A 5EIVA 3DJSA 1NKRA 2CMRL 3Q6GL 3QQ4A 2D2CC 3MNMA 3MNWA 4DR2B 3OBAA 1M7IB 4NQTA 4JRYD 4X65O 1KJ3L 4OZ4A 4LCUC 2YMXH 3GXMA 5AVQB 3SPVA 3N85H 2EUVA 3H56A 3O2VL 4HHAA 1XD1A 3NUKA 3E86A 1DQTA 3IF1B 1TZGL 4JFOB 4POZC 4ZPVA 5TJWK 2GFBA 1BVKA 2VKWA 2X6AA 4HOZA 5T3ZE 3CJHA 4MDJB 4JANB 3OWEA 4WTXA 3RWCB 3B9KB 4WEEA 2K3HA 3GB7B 1YZZA 2CG9X 3OR6C 4GW5A 4LKCA 1I8MA 4JV5O 1FNAA 2CBPA 3QC5X 3UG5A 1ADWA 2GJ6E 3VFVA 1ZGLA 3FB5A 1PVHA 1S7VA 1UUSA 1SJHA 3FT3A 3VDCA 4TMPA 1SQFA 3EGDA 2XBZA 1EH9A 1W91A 3IRPX 2NY5H 3IU4H 2VLKA 4JI5B 4FTVB 3VFSA 1UPGA 4MJIB 1SLVA 5JO5A 2Q10A 4LT7A 2UZXA 5G4NA 5K69A 4XPAH 1H19A 2PWEA 5FYKH 1L9SA 4P5SA 5E6IC 4Q74A 1Q1JH 2VMDA 2WQSA 1XUQA 4X7SH 3MRDB 3S88H 4WHYG 2OIEA 1RK0B 1TKWA 4GQRA 1G7PA 5EDXA 3GEFA 4WUUD 1EFXA 1RSFA 2F8IA 5CGBA 5DLLA 4PGEA 4TQ8A 2YMTA 2VWEE 4Q4EA 5KVGL 2AXFA 1ICTA 2HLAB 1G7MB 1FV1B 2FIRT 3MCYA 1SF9A 2F5BL 3DPBB 1XSIA 4BWTA 2DYRC 3A47A 5J6HA 3UP1A 3UG3A 2PXYD 4L1TA 1BD2D 4HUKB 4MB4A 5EOCL 3RPKA 1MABG 1CYGA 1ZLSL 1LE9B 3QG6A 2YKLH 1TA8A 3GLZA 4UAOC 3UT5B 3ZKMD 5EUOE 3PWPD 2VXUL 4JY5H 3ETQA 3OE7G 4XMWA 1N19A 2DQ0A 5H94B 4FM0A 5A6LA 2K1EA 3FT4B 4JPVL 2EIBA 2NY6C 2QZQA 4QHUA 3EUUA 2HPTA 4PS7A 4OFKA 5FB8A 4Y1AB 2Q73A 1AHWA 3PDDA 1QSFD 4OCNC 3WSQL 1RK1A 3W11C 3BP4A 3TN0A 3WN5A 4R0LA 4ZJ9A 2KSDA 3MLZH 3FQUB 3PWLB 4X4MA 2O61B 1DCLA 2KMWA 5JHDA 4NR1A 2BOCB 2Q2EB 5CZXC 4XXCA 1TIUA 4MA1C 3UDWC 2NY0B 4LCCB 2PP7A 4QKTA 1T03H 4XPHH 1KBHA 4KKLD 5HGGS 4EZJA 1ZE3C 2ZYHA 4P2ZA 2P42B 3UABA 5EEXA 2HHHB 2JJTA 4FRWA 1IC1A 1ENVA 1VF5C 2W80C 5KA5A 3IDNA 3CFDB 4PJ9C 5CGMA 4QGYA 1ZHBB 5EHFA 5ICZA 3CCLV 4HIJA 3ATAA 1MWAL 1IT9H 4P5TC 3D36A 4MTFA 1N5AB 2BMKB 4JLRB 3UC2A 3UC0H 1XFPA 5F72S 4JZNB 2HWZL 2PPCA 2YXWA 4APQA 1NLDL 3RGVB 2ADJB 2HLFD 4LSQH 3DOIA 5AB1A 2BS8A 4U1SA 4UM9B 4DR5O 1T2JA 2DJMA 1V3MA 4N28A 5E9DB 5KG9B 4LDCA 2YRLA 2XZAH 1YN6B 3NFNA 5CZRA 1BZKA 4X6FA 3WD5H 3VTTA 3EADA 2OK0H 3H55A 2V5MA 5L4IA 4H8HA 3SQBA 1JZIA 5E5RB 2WBJA 3FUFA 1YEFH 2OTUA 4H5SA 2XV6B 2Y6SD 4HXAH 3CU7A 2DBLL 1PLGH 1PCXA 5F7DA 5B1JC 2UXBB 4QY8B 3JWNG 2BHFA 5AVXB 4P30A 4U49A 3U2JA 3T09A 3MJWA 1TOXA 4KK5D 3BVWA 2OTWA 3HUJB 2Z93B 3B2UC 1FYTD 1UXSB 3LB6D 4I0PC 1T6WA 3UEQA 5JPMC 2AVGA 3PHQA 1YZBA 1X5LA 4QF1A 1XXFC 1MRCH 4E9VA 4GQZA 3WKML 3VMPA 4R97C 3SDDC 2BVEA 3PP4L 2WUBH 4WJG3 2Z35A 2DOSA 3FQNA 1CFNB 4ICWA 4BSVB 4NC1C 2LGQA 1GZQB 4R3SB 4OGQB 5L3EA 2ZUSA 4AKPA 4MDIA 2D03L 5CCJA 5IW3A 3MNZB 2F1MA 3EFFA 2ZX6A 2LAGB 1HH6A 3QULB 3CSYA 4JUSA 3PL6D 3TT3H 3K7UA 3L73H 3IFNH 4EF3A 1JV5B 2ZG1A 4L5FE 1AI5A 4NDMB 4NTXA 5JZ7D 3N91A 1BPLB 1CR9L 5K59E 3PREA 3UIYA 3V0EA 4HEPA 3BDYH 2GTWA 2QL1A 4OIIL 3SJQC 4YSDA 4KMTL 2E6QA 3CVBA 1A6UH 1K5NA 5IBUG 4ETQB 4DGYL 1DZ0A 1UA6H 2ZWSA 5GS0D 1UJ3B 2WMPA 4TLSA 1LP9E 3EYFA 4XHJC 4ZT1A 3CB2A 4IDJL 2EICA 3T0EE 4XVUC 1BE3H 2DEWX 1XSOA 2R2EA 4L1HA 5FGBC 3QZBA 4ELKB 4FJCC 5AZ2H 4NZJA 4ZFFA 4KY1H 4M1DH 4XCFH 4UM8B 4S1QH 2R0LH 2P7TC 4QUOA 3RWJA 4NUGL 2QTVA 4LDEB 4IBTA 4M61A 4H13B 4U7SA 4UB0L 4WSKA 3N9GL 5EPMA 4P8QA 6TAAA 5B21A 3WIFB 1J86A 3I84A 4KBPA 4BDVA 3OXRB 5CHNB 2QR0B 3BW9A 5ALBL 4WHYH 1OAZH 4K7PX 5IBTL 1HZHH 1FO0A 4N8CH 3TA3D 5D5QA 1PPJH 2FHBA 4JI6B 5TQ2L 1XGPA 1EJOL 1CE6B 3DC5A 1JNHB 5AG9A 2XQYK 1MF2H 4JFFA 4OF6A 1N59B 3UH8A 1XO8A 2AKRA 2BOBA 3S3WA 2Q6WA 2CR0A 1B4JH 2VSDA 2VZVA 4YDMA 1MCSA 4X9YA 1CICC 3WMSA 2MHAB 1HEZB 4BFIA 2QKIA 4BW5A 5EU5A 4UZGA 1F6AB 2K6ZA 2ICES 2QQKH 1ORSB 2BVOB 3KH3A 1FL6B 4FLVA 2O6DA 3CJJA 1QLRA 3ABTA 3AS2A 1QX1A 2PMZA 3OKMA 4WO4A 1TUBB 1CG9A 4LIQL 1J05B 4Y4FC 3S2CA 4P23B 2C5DC 4G7QB 5CSZB 5F9WB 5IB2B 1VB9A 4NT6B 2QQLL 4YOKA 5F1IB 4BQ9A 3K8KA 3GPSA 1CDBA 2Z4QA 5B39G 1I0HA 1A5FL 2IANE 2YA1A 4NZUH 2OXHB 3LY6A 3IJHB 4KJQC 4HUXB 2YIHA 4G7RB 4PLJC 5GIRA 3ARBA 2VABB 4BJLA 4A68A 3KPRD 3SZKC 4X6EA 1CE1H 3FUJA 1Q90D 4JKMA 2JKWA 3E8VA 4MZIA 1B0RA 5KVFE 4HD9A 4DPRA 2VWKA 4HAKA 4NQVB 2B5IB 4CH3A 2ADFH 2M1KA 3GSUB 3MRGA 4Q9RL 1KTRL 4PD4F 3OMIB 1ORQA 3TO4A 5F1NA 4MBRA 4XPGL