3AG4B

Bovine heart cytochrome c oxidase in the cyanide ion-bound fully reduced state at 100 k
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag4B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag4B02
2BWDA 3QJTB 3NSYA 4KO5A 3NSDA 3X1BA 1IUZA 1X9UA 2GI0A 3S8GB 3WNIA 2QDWA 4F2FA 4BXSV 2P80A 1WS8A 2QT6A 4YSDA 1XB3A 2BP0B 5PCYA 3PPSA 4HCGA 1JZIA 1CYWA 4BXVA 3EHBB 3UAEA 3RYMA 3WI9A 3AZUA 2X87A 2H47C 1JOIA 1A4CA 3PAVA 2PLTA 4BK5C 2XV2A 3T6VA 2PPDA 3X1EA 1WA1X 1DYZA 1JZGA 1OCZB 1JVOA 2QPEB 4YSUA 1BQRA 2BZCA 1NIDA 4NERA 3KW7A 4QKTA 4DPCX 1L9RA 4E9TA 1KDJA 5B7FA 4TXVB 1MDAA 2FQGA 5AKRA 3NSFA 2QDVA 3ZIYA 2EIKB 2FQEA 1MG2C 3L45A 4KNTA 3WG7B 1YLBB 3OQRA 3N2JA 1AS6A 1J5DA 2ZOOA 2IWEA 1I53A 3UGEA 2GSMB 1A4BA 4ZK8A 1ZIBA 2XVBA 3FU7B 4JKNA 2AANA 5AFAA 2JXMA 3SBRA 2W88A 1GY2A 2VSMB 4A68A 1TKWA 1N68A 4G71B 2BHFA 5D4IA 4UAHA 2IDTA 2BO0A 2DY2A 1XB8A 3NJHA 3QJUB 4BWUA 3QJSB 1HAUA 5I5MA 3OM3B 2IH9A 2VM4A 5TK4A 1JZJA 1PY0A 4AKQA 2HX9A 3T9WA 2WO2B 2XLLA 2H3XC 4HAKA 1AOZA 2YQBA 3QQXA 3GDCA 2LLNA 2XV3A 3IN0A 1BXVA 2GC7C 3T6WA 3ABKB 1JERA 5I6KA 4YSQA 4L0PB 4PCYA 1PLBA 4YVUA 1JXFA 5I5IA 4HCFA 2FQDA 2FT6A 2XXFA 1QLEB 4GXFA 1AS7A 5F7AA 4E9VA 1OV8A 2CALA 3FYEB 3FU8A 3FYIB 5D4JA 4AI7A 1EHKB 3ASOB 4A66A 2YXVA 3GXUB 1SJMA 1AACA 4GY4A 1KV7A 2DV6A 2JKWA 4E9WA 4DP5X 1GS6X 3ABMB 1AZRA 2XUWA 3U25A 2HRGA 1M9WA 5I26A 3H56A 2B3IA 3ZDWA 4YSRA 3UABA 1NDTA 1FA4A 3AW5A 2VSKB 1AZUA 2HX7A 2XX0A 3CZUB 1GS7A 3PAZA 2YEVB 2DWTA 4DP6X 2X88A 1GY1A 1QHQA 4HCIA 3WKPA 3FPXA 1OCCB 2XWZA 3NJMA 2AZAA 2UX6A 1J9QA 3AG4B 2PCFA 1NIAA 3NJIA 1SHXA 1OE2A 1A4AA 1AZCA 4QLWA 2P80D 3SBPA 2IDQA 3CVBA 5TK2A 1E5ZA 5B1JA 1ZDQA 4X4KA 5ANHA 1SNRA 4KOCA 1VLXA 3PAUA 3UAAA 1OOWA 3NJFA 1W6WA 3ABLB 1PLCA 1HFUA 1ET8A 1SHWA 1GR7A 1OE3A 3OD3A 6PAZA 2PPCA 3CVCA 1E67A 2YAPA 4NAJA 3G5WA 2GBAA 1FFTB 4BDVA 1J9SA 2IWFA 8PAZA 5I6MA 2A3TA 2CCWA 4RH4A 2DWSA 1T5KA 1BYOA 1ILSA 2UX7A 2BW5A 2VMJA 2GB2A 3TU6A 7PAZA 4EF3A 1CURA 4YSPA 1AG6A 1M56B 1SDDA 1W8EA 3X1GA 4DP2X 2XXGA 2RACA 2QPDB 1EZLA 3CDZA 1FWXA 4FAAB 3T6XA 3X2QB 3CVDA 3FSZA 4CSPA 3OMAB 1BXAA 1PLAA 2HZHA 5FC9A 4BWTA 1JZFA 4DP9X 3UADA 2I7SA 1BQ5A 1SFDA 1XMEB 2IH8A 4A2HA 1BEXA 2EINB 1XB6A 5B1KA 5E9NA 3FQ1A 2IDFA 2VW6A 3D12B 3NJKA 3JTBA 1AIZA 2J57A 4HZ1A 2XX1A 2FTAA 3EH4B 1HAWA 3NSCA 5I6NA 2HXAA 2VN3A 3ABGA 1CC3A 4ENZA 1JVLA 1WAEA 1CUOA 4CSZA 1ZDSA 4G7RB 2MRYA 2R7EA 4DP1X 1ET7A 1KGYE 3WKQA 1OCRB 5B1BB 3ERXA 1JZHA 4HALA 5I6OA 1TU2A 1V55B 2XV0A 1AANA 2EILB 3AG1B 3DTUB 2BW4A 2YAQA 1B3IA 4KNSA 1PZBA 1NPNA 1ASPA 3OMIB 5I6LA 4A67A 4FA7B 1L9OA 2J5WA 1ILUA 2FT8A 1BXUA 1ZV2A 2GIMA 1MG3C 1ET5A 1IC0A 2FWLB 1NTDA 5I6PA 2XU9A 1MZZA 1AS8A 1F56A 4JHVA 3X1FA 2IDUA 3TASA 2EIMB 2HRHA 2DYRB 4BDVB 1OE1A 1AR1B 3AG3B 3NP3A 2VW4A 4YSCA 1SFHA 2ZWNA 3WNJA 2AVFA 4E9XA 4A2EA 1SF3A 1SDDB 5D4HA 5PAZA 4UF7C 1BYPA 4KOBA 1V54B 3C75A 3CDZB 3NJGA 4P5RA 4DP4X 3IN2A 3V9EA 1L9TA 4G7QB 2UXTA 4GP4B 1IKOP 1BAWA 4YSAA 2Y69B 1WS7A 4P5SA 4Q89A 1E5YA 1PZAA 3SQRA 1ASOA 1NPJA 4WKXA 1PMYA 1RZQA 2BWIA 1KYAA 2IDSA 2FT7A 1KDIA 1NWPA 2W8CA 4K9JA 1AZBA 1NIBA 3FSAA 2WO3B 4E9QA 3QPKA 1E30A 4G70B 2PPAA 3KW8A 1IBZA 4YSSA 4AKPA 1AAJA 3QJRB 1W6LA 1ASQA 2DYSB 4GP8B 3NP4A 2R7EB 1J5CA 3AG2B 1NINA 2JFCA 4NB7A 1PAZA 2BZ7A 1KCWA 3FSVA 4YVNA 1GS8A 2OCCB 1TEGA 2CBPA 3FU9A 3FPYA 3EH5B 2YAOA 3IEAA 3TBBA 1PF3A 3FT0A 3UACA 4N8UA 1QNIA 1SF5A 3IBOA 2YAEA 2I7OA 3PLYA 4KNUA 2ZONA 1OF0A 1KBVA 5B3SB 3TA4D 1RZPA 2FJSA 1L9QA 3IE9A 3WIAA 2CAKA 4HHGA 3FQYA 2Y1AA 4G72B 4W9ZA 2BP8A 3S3DB 2OJ1A 5AZUA 2VM3A 1URIA 6PCYA 2GHZA 2N0MA 2PP8A 4HIPA 4YSEA 1JXDA 2YARA 2AFNA 2ZXWB 3SBQA 1L9SA 3N55A 3V9CA 3H4FA 5EHFA 1MZYA 3QJVB 9PCYA 5B7EA 2HLEB 1ETJA 1PNDA 2AZUA 1V10A 2PP7A 2B08A 3ZX1A 3DIVA 1AG0A 7PCYA 3NJNA 4YSTA 4UANA 1A3ZA 1R1CA 4GP5B 1NZRA 2MTAA 3BVDB 4A2DA 4AX3A 2NRDA 2E86A 4JHUA 2FQFA 2CJ3A 3MBWB 3GYRA 3FSWA 3TBCA 2HX8A 3NJJA 4W1TA 1TEFA 1BQKA 2FNWA 1N70A 2YAFA 1UATA 4E9YA 5F7BA 2J56A 5IY5B 2OV0A 1GYCA 1PNCA 4KO6A 4DPAX 2YXWA 2PPFA 3ZBMA 3NYKA 4G7SB 3FQ2A 2TSAA 1PZCA 1RCYA 5B1JC 1AQ8A 2TSBA 2PPEA 4E9RA 3OMNB 2I85A 3CG8A 3HEIB 4M4RB 1ZIAA 3H4HA 2PCYA 2UXGA 1J9TA 1NWOA 2PP9A 2BP0A 3T6ZA 2H5UA 1OCOB 1ADWA 1GSKA 1IBYA 1PCSA 2IWKA 2YAHA 4YL4A 3PCYA 5B1AB 3EH3B 3FS9A 2EIJB 4DP8X 1X9RA 2UXFA 1NIFA 1KBWA 3QJQB 2Q5BA 3BQVA 3AY2A 1E65A 2BP8B 4Q8BA 5B7MA 2UXVA 2XYBA 2IAAC 2GC4C 3S8FB 2WSDA 3PXLA 2Q9OA 3JT2A 1M57B 4DP7X 4F7KA 1CYXA 2YAMA 4KO9A 2J55A 4MFHA 4BWWA 3EF4A 4HHWA 1GW0A 1AZNA 1WA2X 3NT0A 4AZUA 3S3CB 1A8ZA 4WTQA 1ZPUA 5I28A 3S3BB 3HB3B 1NICA 5LDUA 1NIEA 3X1NA 4M3HA 1RKRA 2CUAA 3T71A 1WA0X 1A65A 1JZEA 3FU7A 3ASNB 1J9RA 1JXGA 4N4YB 2VW7A 4PAZA 1ID2A 4GYBA 4A2FA 4DP0X 5A7EA 5I5JA 4F2EA 3NJLA 4AKOA 3DKHA 4A2GA 1L9PA 1DZ0A 3MX0B 4YSOA 1KCBA 4E9SA 4DPBX 4KO7A
chains in the Genus database with same CATH superfamily
2A0LC 3OGOE 2VISB 3AY4A 4J7JA 1Q9KA 2ZX6A 3O41B 4WBNA 1C7TA 3WFHB 1Y67A 3MSPA 1GRWA 4XXWA 4J2XA 1AY1L 1KIQB 1XB3A 3HCVB 5PCYA 5B3SC 5LXVA 3FOLB 3MRRA 1UKTA 4CH5A 4J3OG 3EHBB 2A6KB 2IAMB 5IEHB 5J6GB 1LEIA 3GJFH 4X6FA 2OWOA 1JOIA 1N5YL 5CEYA 3H9VA 3U4BH 3W1ZA 4L8SA 1QRND 3B2VH 3CE2A 1DUYB 1VQLV 2CKNA 5AOKA 3BYTA 4I5BB 2XPYA 3FK3A 5EU4B 1ZGLB 1KPRB 1A3LH 2HWZH 3V79C 1P5VA 2Y6SD 5I75B 2GUOB 1YY9C 2RIKA 1I1FB 3NPZB 4NZDA 2EDFA 3N44B 3ZKNC 3KG2A 1YEDA 2IALA 4IBLT 3HG5A 4U1NA 4X80H 4D3CH 4Q6GA 3F7KA 4FQLH 4ZXBB 1MELA 4JPIA 1YYLL 5AZ2H 4X9QA 4YDMA 4PBVC 5B8CA 3BT2L 2EXYD 4IRSB 3VRJA 3K2UL 5FM5M 3RFRA 4KU1A 1RVFH 2DM7A 1TVDA 4QRRE 1I3RB 2F58H 1BPLB 1OP5K 1DN2A 3QO1A 1CXZB 5FDYA 1VHPA 1Y18B 3LZRA 5T3ZD 1UEMA 4MB3A 4AYBA 4EN3B 2LO1A 1XF1A 1PY9A 1YMMA 3HI1A 5C08B 4IGBB 4Z3TA 3HHSB 3WLBA 2FRGP 4X7DC 4L1SA 2K1EA 1PY0A 5CHNA 1YRKA 2OJEA 2BY3A 2HX9A 4QRPB 4TUOA 5CU5A 2O6PA 2NY5L 1TCRB 5CAYB 5L2KE 1S3JA 4V1DE 2XWJB 5IWAO 4G27B 2CDYA 2PXYC 2YQBA 4QCIB 1GM8A 4J7ZA 3T4YB 5IVZA 1BCCH 3BSGA 1BFSA 2A9NL 3L9RB 2X7RB 3L2LA 3ZT5A 1ZLWH 3IU4L 3T1HO 1N34B 2XFXA 4BH7B 3ABKC 1E27B 5AQ0A 1MI5D 4Q0XL 1QASA 4I13B 3P3SA 1RH8A 1U21A 4N0FB 1F58L 4K3HA 2E4TA 5C8YA 3DJSA 1MRDH 1HDJA 4NHCH 3Q3GB 1J0ZA 4GSDL 2BHZA 2CALA 2CMRH 4BIOA 2FJHA 3NCCB 1QFWH 3QRBA 4YJ3B 3TC9A 5I1JH 1XF4A 5DA0B 4ZS7L 3HUJE 1SJMA 2NY4D 3MYJA 4HS6B 5F6HJ 1MZFA 5E70A 1SQBH 2YBRA 4YDLB 1J88A 3E22B 1AZRA 4YXHL 2OP4L 3W2DH 2NTFB 1GXEA 1UZ6E 2FO1A 3UTTD 2BOBC 3AW5A 5FECA 1CG9B 2MHAB 3WEAA 2Y4TA 2UXNA 3KPQB 2WZPD 2ESVB 4XNBA 1T89A 4GIAA 2LJ2A 2YEVB 2BVPA 5IM7A 4MDRA 1C5CL 1KKCA 4PJIE 4DK3A 5LXGH 5IB5B 1XF3B 3CX5J 5F88A 2MQ0A 5HHQA 4LCCB 1FFXA 3QRGH 1N3NB 2UZIH 4OFYD 2UWEF 4PB9H 5HHVL 3QJFB 4XNZB 5ADPH 4P3CH 1OK8A 1DQJA 4Z76A 2JEUA 4UT7H 2HG5C 2BP3A 5LMUO 3MRCA 3T0XA 2DMGA 4NQQA 1DVFC 2WQRA 1UGKA 1YN7A 3ZKXB 3BPCB 4F9PC 5IROC 4AQZA 4JFYA 1XOUA 2R0ZH 4IIZA 4NXNO 3VVVA 3CRAA 1S5LZ 4AQYO 4HV8B 1E9OA 4DCQB 2OQJA 3N06B 3VQWA 2VQ1B 3AMKA 3EH2A 4OQTA 3CMEV 1JHKH 3G5XB 4XMXA 4LRIA 4M43L 4M93B 5TQ0H 3CLWA 2OKMA 1MF2L 3EH1A 1W2BU 2AEOA 2JI1A 2X7LB 3EUDA 2R4SL 4I3GA 1CGTA 3NCXA 3UTPE 4J4PD 4TTDD 1JXJA 1BQLL 1AO7E 1G1YA 1RJCA 1T5KA 4G9DB 3LPWA 4PA9A 4AW4A 2DB8A 2R29A 3D69B 3IJEB 4GBXB 3ML9A 4JJ5A 4LDOB 1JZ3A 3HE6D 4ZUTA 3WIHA 4ATWA 2VZTA 1EJ8A 1HS6A 1N8OE 3SDLA 2NY3D 4H25A 1QRNA 3DXRB 4PP1D 1F4XH 4QJFB 2A73A 4N2EA 4F58L 1A7RH 3TYGH 4F7MA 3MFFA 1JWMB 2XG5A 4QHNA 1HNYA 2HZHA 3EOBB 4MLSA 1JZFA 4DP9X 3K6SA 3L74H 1UENA 4M7ZC 3U7YH 2G75B 3P73B 2VDLL 5TF0A 2QQKH 2J44A 4F7TA 3JUYA 1E1QG 2E5LO 5F9DC 4WFBV 4KRLB 1F6AB 2GK0B 1WBZA 1F42A 5CN0A 2IQAA 1WBYB 4PLKC 4UQDA 3LB6C 3ABGA 5FWQA 4P46D 1USQA 1LUWA 2XIBA 3CFBA 3H6AA 1T4WA 2OJZL 3HN5A 5D7LD 5CILL 4KKAD 3U9PL 2CIIA 4BSVA 1FGNH 2RFXA 4OCNC 2WGXA 1JGDB 3MNZB 1OCRB 4DPRA 4JRXD 3ZDXE 1FPOA 1RK1A 1OHHG 2EH8H 4LOFA 4GSQA 2XKSA 3CH1A 3CN2A 3A5VA 3FX7A 4WEBH 5I6LA 3HUJF 5GONB 1B4RA 1IT9L 4L0ZA 4ZW5A 2E5EA 4JY6B 3T4DA 1D5XB 2IH3B 1A6PA 2CLZB 3D4YA 35C8H 1N36B 4X4XB 1IFRA 3O3DA 1T4KA 4ZFFA 5LMNB 1N6VA 4K35A 3FD9A 1UZ6F 3P77A 4GO9A 3GIZH 4B9ZA 3DO4A 5CS7A 1R24A 4Z7UB 3TJHC 1A4JA 2B1AH 4ORGB 2B5IB 4FFZL 4EIGB 3HPJB 4PJIF 5E4AA 5KSBB 2F4VB 4S0HA 3DX7A 2AVFA 3TZVC 2X6CA 7FABH 2IF7A 1SF3A 3M6DA 4KK8C 4S2SA 3QULB 4MS6A 2NXYB 4ZOCA 5EH1A 1GN4A 3W3BA 1ORQB 3QEQE 3IN2A 5DZ9A 1C08B 4KROC 3V8OA 1FNSH 4YJZL 3L71H 5TE7L 4TLSA 2X3CA 5CKAA 1UJ3B 4P5SA 1PZAA 4XBGB 1GW6A 3O6LL 1FRGH 2JKSA 2AQQA 4Z7UF 1I7FA 3R7RA 4P9PA 1RK0A 5HGAB 1X7QB 3WIFA 1Q8IA 3UTTA 1CICC 1L0XA 4OLUH 5KSBF 3ZTEA 1IQWH 1WZLA 3RWGA 5LGUA 3QA3A 1Q9OB 1E30A 2WZPA 1EBPA 1S7UB 3F00A 3ARGD 3G6JE 2WBWB 3GHBH 3BRDA 3JVFC 5EBGA 4NAMA 1K2DA 3C3TA 4X5XB 2R8SH 1G0DA 1KBKA 5L88L 3IMWA 5F70A 5KN5A 1DANT 3AVEA 1ZA3B 4DR4B 1U8OB 1W72L 2ZDIA 2JCCA 3IXTA 1LE5B 3T04D 4YGAB 1LDSA 3INOA 1S9VB 5L0QC 4PJ9C 4JPKH 4CC4A 3AUVA 3C6SB 3IS0X 4JZJA 1DTUA 5LNEA 3PLYA 2H0PA 3H2WA 4OCYL 3CHXA 3LNHA 4G5ZH 1BBJA 1OTTD 1AR1D 2GJ6B 2F7OA 3O11B 1WIOA 1R33A 4PWEA 3WIAA 1I1YB 4QHMB 4X5WA 3T2OA 1N64H 1T0NA 4BA8A 1MJUH 3CIAA 3H9HA 3VD2A 4I4TA 3MOBH 2R70A 3ATEA 2A74A 3CYOA 1WG3A 1Q6HA 3F7VB 5AW2B 2B4CC 1ZCRA 3SGDH 4D8PB 1IL1A 3DSQA 4JTAB 1XCQB 3E8UL 4ZNCD 1II4E 4L3EB 5GSRB 2JJVA 4YHNA 5HYSB 5AB1A 1NC2B 3MJGX 4J4PA 4UV4H 5D1XB 4NXKA 2IGTA 2OMUB 4Y19D 4U1GC 4OU3A 3VFGL 3HZVA 1FDLL 3HE6A 1E6OL 2HJFC 4LLAA 4ODXB 4UANA 3VXMB 3DV6A 1YEWA 2YIAA 3G6EV 3DTXA 4IKIA 1FZOB 1XHHA 3BMVA 4PRIE 8FABA 2E86A 3L95A 1P9MA 3ZDXF 1U41A 5AVTB 3IDYC 2ZIOA 4IBTA 2BCKB 1TENA 1DVSA 2EJ1A 3MBWB 4LNRB 3OUSA 3T77A 2VXVH 1TEFA 4K3AA 4KK6C 3WCYA 2J6EA 3BFWA 5DRXA 1WHOA 4O00A 1BL8A 3UJJH 3MLTB 4Z78B 3D2UB 3ML0A 3HZMA 5HYJB 1IGML 3L4YA 4MMZB 3R4DA 1GYCA 1ZLZA 4V2CB 3LSQA 1MIEH 1QWHA 2X3AA 1IGYB 1PG7X 4ILDA 4NN5C 4RCAA 2JB6B 1PGRB 1JCKA 4A2MA 4F7EB 3KBPA 2ENQA 2CM6A 4P46A 4R5TA 1N7ML 1VGKA 1PNLA 3K2IA 3N43B 4ZTEA 5DFTA 3BKJL 4MAUL 3FCUB 4LVOC 4I9XA 1IBYA 2YAHA 4F3FB 3SODB 4JRXA 1AGCA 1LE9B 1EDYA 2GSGA 3JYCA 2PTMA 1D5AA 3N85H 2YUAA 5BV7B 2LGQA 1HR0O 1NIFA 4GAJL 4DGYH 1HQRB 2ZR3A 2Q5BA 4Q4IA 3ZO9A 2ZIMA 1UG9A 4QOKB 3JTSB 3UC0L 1HNXB 4U4IA 4XI5C 4JI3B 1AB3A 3SE8L 3WJMA 4HIXH 2VT0A 4LR3A 3DETD 4K9EH 1SQVH 2WUBH 3GWJA 2X6AA 1TETH 1WC7A 3VYNA 3ZE2E 3JV6A 4Q6IA 4YDVA 2APSA 1HIML 4LFBO 1TYJA 4GAGL 3GMPB 4WW2B 1T66D 5BOJA 2VLKD 1H3TA 1XQ4A 4OF8A 3CS5A 2VR3A 3U46B 3N27A 4FC3E 3G6JF 3Q01A 4G2AA 3T0VA 3BDYH 3O3BA 3DVFA 4FQXB 2IH1A 4Y16B 2YSTA 1I8KB 1RZJC 4OM0L 1S7XB 5CINH 5D96B 1EXUB 4X7TA 3EFFB 2F1EA 3RVZA 2YMOA 2HB0A 4Z3JA 1F4HA 3BAWA 5ID0A 5B4MD 1S0VA 1F4WL 5E9DE 1E90A 2C4FT 3MOQA 2HJLB 2LQRA 2RMKB 1ROPA 3HS8A 1MWAL 4JMNA 3S96B 4H0LB 3VA6A 4DR2B 5K9JL 1KCBA 2Z1PA 4LFCO 4E41A 4U3CA 1GGBL 1R5IA 1NCDL 4MASA 2H45A 5E1QA 1W0WA 5HD8D 3ARDC 2HP8A 2DLHA 2J4WL 4CH4A 1FL6A 1T1XB 3X1BA 4NC1C 5AKSA 1YNLL 5EF2A 1WAAE 2GI0A 1L7IH 3P3RA 3ARGA 3SPGA 1BOGB 4F2FA 3QJZA 2YUZA 1ENVA 2ZKYA 3GSUB 1RJZB 1WNSA 2VWJA 4TUUA 5ILTH 2O5ZH 4LH7A 4BBWA 1ZVNA 5BO1H 4XWGH 2OPCA 1ONQA 2DI9A 2NY0B 5FGSA 2Z31C 1JJOA 1U3HB 3N3EA 4KJWD 5EYPA 1Q0EA 3B7SA 5CZXC 2OK0H 2ZKHH 1JPFB 4P57A 3QQ3A 4JI6B 4RRPG 2ZSVA 4GG6A 1JTTA 4NKIL 1XCWA 4Y1AE 3H3KA 3ZE1B 3DX6B 3LPOA 3Q6FB 1Z5WA 3VQYA 4JN2A 1W0VA 5LBQA 3BZFA 5E00A 3VD3A 4YUEH 4QHLB 4GH7B 1WCBB 4TOYL 2P06A 5TQ2H 3R1GL 1PAMA 1BQRA 1CIDA 4BFKA 5CFAA 1VGEH 3HKBA 1J9CT 2C1PB 2FLMA 3RIFF 1OP5H 2FB4H 5C0CD 5DRZA 5JPMC 3UGXA 3MHZA 2VRKA 2AKRA 1GAFH 2VUOA 4MD0B 3UMTA 1ACCA 2EZPA 2FLRT 5F6HI 1BZEA 1Z5LB 2FQEA 3FQUA 3GXMA 2D7QA 3CUPA 4XPGL 5K5YA 3F12B 3KDMA 2ZNJA 4PG2C 4PWIA 1I7TB 3IKKA 4WFHE 1I53A 3Q9QA 3ZE1F 2NZ9C 2V2XA 1J0IA 3MYZA 4Y19A 3ZJAA 4B9CA 1ND0B 2IPKB 2PO6A 1H3VA 1C12B 2QDOA 4LMQE 2R1YB 2O5YL 1LVEA 1GA2A 4LIQE 3ZHSA 1Q1PA 2VXUH 4HKBB 4MMXB 4KUMA 4W9IC 5DURB 3BAYA 1ETZB 2BHFA 4OZGB 4Q9BA 5LAPA 4HPOL 4FFTA 2QM8A 1UA3A 5JW4R 4H44C 2BO0A 2K9PA 5FO2A 2VZOA 3VD4A 2XBTA 1S2EA 1J0HA 1AP6A 2NR5A 2E0PA 3UJIL 1D6EB 3T4AC 4JYCA 1SERA 3ARQA 1L8DA 2QV4A 3BRFA 3WFEH 3QNEA 1E8WA 2H7WA 2BSKA 3OXRA 3T9WA 4AVJA 4QJ4B 1XGRB 3FT2A 2VLMD 2JQAA 3P4OA 5SWZD 1ZWIB 3JCUZ 2ORBL 3AREB 1BAFL 3BFOA 1PEZA 2WWMD 4M61B 1XAUA 1AOZA 2BSSB 3KYOB 2LLNA 2AEIT 3GK8H 4GMTH 3WAJA 1TLMA 3P4LA 5HYFA 1X4TA 2VR8A 1IVSA 3G6AB 5T1LD 4FVMA 5CSGA 4G6JL 3MRIA 3VXOB 1KF9B 1FO0A 1T5XB 1OAZL 3BI9X 1JXFA 4YQXH 1D2PA 4OLWL 4P2RD 4HX1A 3WS3B 1BJMA 3VFUA 2A9ML 5ECGA 4RMVA 1IGIH 2Y72A 3BGFC 3MRPA 3QO5A 3M07A 3DSFL 1Z5YD 1HVXA 5CN1A 1KYOK 1PCXA 1CFNB 3LZOA 2BS9A 5DK0A 1FG2B 4A5UB 3QW9A 1UWEH 5E4IA 3I9IA 5A2LH 3KR3L 3BSZH 1DJHA 2WVVA 3F5WC 1FNFA 2NNAA 4XMPH 1AILA 4PREA 1NDTA 2BWQA 2VSKB 1AQDB 5L6YH 4JI0O 1MCQA 1K7DA 5D1ZC 3ZYOA 1WAAF 2GJPA 3ZUNC 2O4EA 3L1GA 5J3HD 1JN6B 4MA7H 3EGXB 5JA9A 3GMMB 1HH6A 1KWKA 1KXQA 1ZX3A 2XTSA 1NA8A 3RNKA 5D4QA 3JZ7A 2AZAA 3CPWU 4GMSL 1OL0A 1PQZB 3RYCA 4Z6AT 2P4KA 1YECH 4Z0XB 3ABTA 1PU0A 3C90A 3EDKA 3F7YA 4X7EC 4AT6B 3A6CH 5C0BE 3SDAA 4K5OA 3IT8D 3TNMA 3WUZA 3REWA 5CJOL 3BH8B 2V3FA 1E5ZA 5GIRB 4AUJA 1FPTL 4P3DA 2GTAA 2X4TA 4RGNC 2F43G 2IAMC 1MCCA 4PLOB 2XQYA 5FKAB 5L7XH 3CCSV 5EU5B 4O2CB 1HQ4A 4NC0B 5ERWB 4ODUA 2OSWA 1GR7A 5M94B 2K9FB 2OTWB 1H38A 3I75B 1TTAA 2W59A 1FVDB 1ACYL 4GX0A 2I5YH 4Z7WE 1AHKA 3V10A 1FJ1B 1DVZA 1LO4H 1G1KA 5EU3A 4F2ME 4RWHA 1SEBA 1T6BX 3LDEA 2VITA 4RH4A 4Z7NE 5I75C 5FOJA 2LFSA 4F15B 2AW2A 3RYFA 1ZT1B 3B7UX 4DGWC 3II2A 4X0KA 3HR5A 1ERNA 3EJRA 4ZOLB 3K0GA 4ZXBC 4LPCA 1U58A 4IHOB 4UQ3B 1IEAA 2BOCC 5A2IH 1XF2B 2GUZA 3B9KB 5ACLA 4YY3O 3OMAB 1UA6L 4IRSC 4OZHE 3DBXB 1XT5A 4PJGB 1V7NH 1PLAA 1YEIL 5JHDA 5FC9A 2CK0H 5TJWK 2I7SA 2QVMA 2Y0SA 3QUML 4CDGC 5C0CA 4PJEA 4DV3O 3X14B 3PGCA 2OZ4H 4APQB 4B9JA 4JRYD 3T0EE 3LDCA 5I74B 5DD3H 5A3IC 2YKKA 2WLJA 3QXDA 1EHAA 2YK1H 3KAAA 2EDLA 2XVKA 3JTBA 5FX3A 5IB2A 4PDRA 3O4LD 5L2JA 3GEWB 3PU7A 4WDIA 4G7VL 4IGBC 4QRQA 3M99B 4DO5A 3VVWA 4U2YA 4X42A 1KEGL 5LNDA 4PV9A 1PD3A 1DBJL 1QRKA 1IQDA 3GGWB 4OLZL 2WXRA 5H37G 4JY5H 2DQCH 3BDBA 4PJGF 4U1IB 4X8XA 5DJ6A 1WCQA 1J5OL 1L6XA 1EO8L 3PNRB 5DJXB 2QFPA 2YGOA 3CPUA 3ERXA 3F6JA 4PSPA 5CSZB 5F0MB 3VFVA 3BH9A 4IU2B 4XP9H 2X4QA 4G7YH 3RWEB 2VC2L 5HJ3A 2YWYA 1EH9A 3KCPB 4UT9A 4LLYB 2PWEA 4NM8H 3RYHB 3HKEA 1MIMH 5I1EL 5C0EB 1K5NB 5B38A 1W15A 1L6PA 2FWLB 2Y36H 2Y06L 4XDJA 1RZ8B 4H37A 2H1LM 3BAIA 3MA7A 4N9GA 4PBWD 1K3ZA 4PTTB 1UWFA 4YHIB 5SWZA 3RTQB 4FOMA 2LTQB 4WI7A 4XPBH 3ZBHA 1UFGA 4KJYB 3H2QA 3LN5B 4Y5YC 1XZ0B 4FG6C 5DD6A 5JQHC 4E0RB 3TN0C 4HUKB 3PDDA 4K94L 2ZX5A 4YDLC 4U6YB 1SKVA 3GO1L 1UCTA 4OZFG 3IGFA 4RFOH 2N3JA 5T1LA 4L23A 4MJJA 4AL8L 1AY1H 5BOZG 2YSUB 1U36A 4MTOA 2DM2A 4QT5B 2NY6B 1WP7A 4IHBA 2H9GA 4P2RA 3IFPA 5KVFL 3IFXA 4AWJC 1SYSB 4IJ3B 2BC4B 4F7PB 1BFOB 1HH9B 5JO5A 1UT1A 3ET9F 1RIHH 3LKNB 2Y69B 2G4EA 1IAIL 4OF7A 1N5YH 1DFXA 5GRXG 3WS6A 1ASOA 1GJUA 4HETA 4M5SA 3AM8C 4BZ2L 4FLYA 4LCCC 1RL1A 3CFEA 43CAB 5HHPA 4GT0A 3FFCE 2F8XC 1SDAB 1GKEA 1JZ6A 3CSYB 5JW5A 4XNZC 1JGEA 1VIBA 3QK0A 3B37A 3FSAA 2HG0A 3QIUC 1EFXD 3JYBA 2MCPL 5HI5C 1A14L 2ED7A 2NNCA 2DF3A 5JIHA 4PTUA 1A3RL 1JNHA 1G7PB 1KYUA 2GTZB 1DQLH 3M88A 4D7BA 3K4ZA 3BWZA 5JH7A 1MA1A 5DEFA 3GRWA 1YYLH 1LL1A 2QE7G 3ZKXC 1OJHA 3QUZD 1S7RA 3BT2H 1WK0A 3VRIA 4J28A 1CE1H 3WFBH 5INCB 3V0JA 4RSYA 1UJTA 3WKNA 4G83A 2ATPA 4S10A 1N0XL 2JK5B 2DQDL 3HG1D 3OKMA 2Q7YB 4URTB 4ZMOA 2VL5B 5AAMA 3A0BZ 2ZOLA 2EE9A 1JNNH 2P5ED 3FQTB 1MFCH 2J8UE 2OMBA 4J3VA 4LK4A 5LGNA 4QXTB 4R4ND 3X12B 4MNHA 4X6EB 3ZLQC 4KH2A 3U7WH 2CDGA 4NENA 4GBXC 3D34A 2VZVA 1HXMA 5AD0A 5EO1B 3CAFA 4OCMC 2KUTA 4GQQA 3UZQA 2CCVA 4ZUVB 2GTWB 2NY5H 2EADA 4PLJC 3D4GA 5EHFA 5IJKC 2V7QG 2A7WA 3QJVB 2B16A 3CP1A 4W9GC 4HIQA 3J80N 5B7EA 1BS3A 4PBXA 4KKZA 4G6AD 5EUKB 3IU4H 5KVDE 1G6RA 2OXGA 3V4VA 3PJSB 2YD4A 4DV4B 1AG0A 2NSMA 3K1KC 5CD3A 4XOAA 4Q0XH 4EQ2A 4QTFA 1F58H 1A3ZA 4YWGH 3V0HA 4FLZA 4D0BB 1TITA 5E2WL 4YHZL 3T65B 2MKLC 4ZODA 1RUKL 1GM7A 3N41F 2J43A 1AGEA 1AKJD 1OTUC 4UTCA 4GKNA 5FV2A 3SPVA 4ZPTB 1ZT4B 4NPYB 4ZS7H 1TGOA 3ZRWA 3UYRL 4DEUA 3ZRVA 2FNBA 4ONHB 4DK6A 4HH9A 4HJ1A 4JRYA 4E9YA 2MOQA 4YXHH 3QEUA 1OCRC 4JQVC 3ES6A 4YGVB 1JHTA 3NFNB 3BXNA 2IMMA 4IBSA 1Z9OA 1EV2E 3PWLA 1HCVA 4M00A 4L4TD 4DZ8A 3O4LA 2FR4B 2GFBA 4OIAA 3R0MA 5K39B 3L5XL 3B5GA 3CVHH 5GS0L 1OPGH 3P2TA 1EN5A 4L3AA 3TA3C 2KG7B 2I85A 1KN4L 3CRQA 1J5IA 4CAGA 2H2SD 5JOPD 4JG9A 1KD1W 2R69A 5JHLA 4N2IA 3N1GC 3FQXA 4QWWC 5IQLA 2OMVB 3K71B 2AABL 4YDZA 3HKDB 3I6GB 4JCWA 5F7WC 1XHZA 2ERJC 1AMYA 2LAAA 1ITCA 5CD5D 3UBGA 3ZMSA 3IFOB 4ANXA 3QG5A 3L5WA 1LYQA 3BVNA 1VP7A 4QGPA 1QSFE 3CC5B 5SX4I 3Q7JA 3D87B 4GAFB 3ETSA 3GTTA 4I0KA 4ZUWA 5IB1B 5DMIL 3ZHVA 3UG5A 2NXYC 5DYFA 1ORQC 4AK2A 4E42A 2VDLB 3MGOA 3MRGB 3QIBB 4GX2A 1JNLL 3UYPB 5I16B 4KPHH 2TRHA 2G4GA 3KBEA 5T1MA 1UJ3C 1JRHI 2FATL 3L3HB 3BAEH 1ZPUA 4L9LA 1UB5B 2NN4A 4G8GE 1Y1DA 1A0QL 4M43H 4X9GA 5JMOC 5LDUA 3Q8BA 1MF2H 4G6FB 3ULSB 4JI5O 1KXVA 4OCRH 1Y6NR 2R4SH 3NCBB 3T71A 1HHJA 2WLIB 3K2MC 3L3GB 4EUPG 3VQVA 5F7UA 3S37L 4EVNA 2WLZA 1BQLH 2JKNA 3N40P 2DKSA 4X4YA 3RWHB 1CCZA 4N4YB 3CFJA 1ID2A 3RUGA 4B5EA 4XHJC 1KG0A 5MEQB 4PRDA 4R96B 4WQOA 3IJ4A 2QPSA 3D39E 4ONOA 4AK1A 4RMTA 4AQ8C 4F58H 1P1ZA 3H53A 4RNRB 5KG9A 1SQFA 1E2ZA 3WJLC 2Q76A 3OHXA 5DD0L 5EORH 3QNXB 3QJTB 5JYLA 3ESNA 4HOMA 3HTLX 3NSDA 3RPIA 2PTVA 4BQBA 3ZX6A 2VDLH 3NRQA 4GQRA 1EFXA 4KUZL 3AS0A 5KBMA 4JVPA 2WZAA 2QQLL 5E5LA 4B3SB 2DQGL 3ZMZA 4W81A 4XPFL 4HEPG 5DJ0B 3QDME 3PABB 3SN6N 4BXSV 4XBEH 3GBEA 3DV4A 3CZLA 1G7IB 1KCVL 2H6PA 3QUZA 3P4NB 2XV6B 5KJ7E 3WV0A 3RBSA 1A6UL 3RYMA 4DR5B 3QG6B 3TTSA 4RUFA 3RN4A 1N0NA 1OT4A 2MKWA 2OJZH 2H47C 2V5SA 4FCHA 3HG1A 2A77H 5CILH 4DO6A 3F7VC 3DJ9A 2XV2A 4MD5A 3TYFB 4EI5D 3HG4A 2ETWA 3ME0B 2R2CA 3LKSB 4CS3A 2P5EA 4PS7A 1BIIB 1DE4B 5D1XC 3E8BA 2XAGA 3AXHA 1NI8A 2L7UA 4OCXL 2X9ZA 2P8LA 4U6XA 3VFWB 4HXBL 5DS8B 3UBXA 5DCCA 4HP5A 3V5KA 4O4HA 1Z9MA 3FO1B 5HY9A 3LEXA 3HB3D 1IT9H 1TTBA 3OPZL 3OXSB 1MSDA 4DV6B 4CVXA 2FEEL 4M1CC 3HIZA 5JZ7D 4XVSH 4BW9A 3N2JA 4DH2A 1U3ZA 1JE6A 4FYQA 4L8BA 2K45A 3CMGA 2VXSL 4GKLA 1H15A 1AHMA 5IVNA 2FBJH 2V7HA 4XWOC 5IVXA 4FFZH 4K9EC 4MMZC 1N68A 4JCLA 3EO0A 3UTZA 2WJ5A 2Q2EB 1Q9WA 4Y4FB 4L1HA 4Z7VE 1W72B 5E1GA 5DJ2B 2YGNA 1BZ8A 5EN2B 1OOAA 5D1QD 3PWNA 3QPXL 4CVWA 5TE7H 1Q94A 5BS0E 4LF4B 4DR7B 3M17A 3U4KA 1CLYL 5HVHB 5I66B 4O5LL 3O6LH 4MYWB 5HJBA 1E1RG 3J7HA 4AKQA 4G8IA 4WI5A 1JUFA 2X2IA 1A5FH 4H0GA 4J3BA 1MUJA 1ZHBA 2NPLX 4L4TA 4OKVB 1T83C 1XF5B 2E7HA 3PS6A 4AYGA 2JKJA 3NA4A 2PYEB 1I7RA 3HI5L 4UNUA 2XQBL 2YXHA 4QXGL 4WUUB 5FKPA 4KZEH 2FUQA 4FJZA 3OX8B 5FGCB 1INQB 3MZTA 1LTXA 3PQYB 2DJ4A 4KKQA 4DOHB 4EFBA 2XNDG 1IGCH 1F86A 5EIBD 5L88H 2B7DT 2FQDA 2XXFA 3NESA 2R9IA 4KKBC 3FYIB 5AW4B 2ICEB 1Q1JL 1TA8A 1W72H 4WW2C 3VG9B 3W9EA 3PFUA 5L2KD 1OGAB 4V1DD 4MA3B 3VXQA 3SR2C 4NWTL 1TJHL 3L2NA 2SEBB 4FQXC 5EOQH 5E4OA 1H8EG 4Y16C 1WPCA 3O45A 3RL2B 3ZL4H 3S3WA 1G7LB 3TVMC 1CL7L 5D96C 3H9SD 2ZWKA 3FCSB 3KXFE 3SPCA 3QXAA 2Z64C 4YHOL 2K6ZA 1F7YA 4MQ7A 4WI0A 2LE9A 3A4DA 1XGTA 4YX2L 2X4OB 2XKUA 4AMKH 4H0LC 5CZVL 3OE7G 4P23B 3ZK0A 2GAZA 3CPLB 3D0VA 4P2QE 2BSED 4EE2A 5C0JB 3ECWA 1U96A 3VUAA 3ULVL 3RGHA 1YXBA 1KBBA 1D5NA 1X44A 2YUVA 3VFGH 5FLVA 1OQXA 3REVB 3UTSB 3HBPA 3QXTA 1FDLH 1MCPL 4C7UA 3MRJA 3FB7B 2IBZY 4LQFL 3VSVA 3ZGHA 1IO4C 1HHIA 1R3KB 1P7QD 2EDNA 2WXIA 1D2OA 1VFAB 2NY0C 2VO5A 1T3FB 3GMNA 3CCMV 3G5YA 3H1IH 2QBWA 3RY6C 1OOWA 1PL3A 1W6WA 2UXBO 3IXAA 4JI7B 1P4RA 1E5AA 3PWPB 1ET8A 2Z3FA 2NX5E 4TNVK 5K59E 1VCAA 1VFMA 4PUBL 4ZFOL 2AJXL 5K9KB 2C1OA 4XZUA 3HRPA 3CN1A 4NIKB 1MSPA 4UCRA 3C9NB 4OJEH 3HN8A 1CD1A 1NUFA 3EJTA 3U9UB 3PWJA 2ZQMA 2NXZC 2CK3G 3D36C 4LF8B 1VQ4V 4Z0BL 3VXRD 5J57B 4NT6A 3TU6A 3AT9A 5D71L 2BVEA 2ZP9A 2KMWA 3V0VB 3A4FA 1IM9D 3BKJH 4MAUH 4EI5A 1H2GA 1W8EA 2CIKA 3VMOA 2YD6A 4RAVA 4W4KA 1EZLA 3MV9E 1CLCA 2X2JA 5EBLA 5DRNA 1AD0B 4NBZB 1QUNB 3VTAA 1FCGA 4CBPA 4Z7VF 3A67L 4LF3A 3UTQB 3SDYL 5EBWA 1JRHL 2OMZA 4LPXA 4Z77A 2OTPA 1MWAB 4GAJH 1BQ5A 3SGEI 2WWWA 4MMXC 4RGNE 2ZNWA 3UC0H 1AO7D 4HWZB 2XN2A 1BE3H 3SE8H 5LCVH 5L3CA 2KERA 3FQWB 2VR9A 4K3JL 1G6UA 1AIZA 5SX5H 1NGXB 1N32O 3MNVA 2B8OT 3LZFL 5IMOA 1N6QH 3IJ9A 1E4JA 3NSCA 4MVBC 4NQSA 1HIMH 4WUKL 3AB0C 4GAGH 3PJLA 1G9EA 3F7LA 1JGIA 4P4KB 3ZXAC 4EN2A 3KWTA 3GHEH 1CDGA 2HVKA 2JQMA 2IM9A 1ZWIC 3T3PB 3AREC 5C0IB 1G7HA 5D93B 1FVEA 1TU2A 1C16B 1T2XA 1JF5A 3FT9A 5F9JA 4KNSA 5D1QA 2YAQA 3BHBB 3SPIA 5D5ME 1F4WH 4LBAA 1FFNB 5DTFA 2Z9TA 5CF3A 4WI3A 1KYFA 1MWAH 5DQJA 3LQMA 5FHAL 1VARA 1R3JB 1EK3A 1YZZA 3RL1B 4FLUA 1GPOH 1BQSA 1GGBH 1KIPA 2OCJA 3CFCH 3LPFA 3MTXA 1NCDH 3LKQB 3Q2LA 4LB8A 4ZYKB 4F5CA 2D3OW 1JZ8A 1S5HA 3OLIA 3VD7A 4DV5O 3JATB 1DEDA 2J4WH 2NDGA 2WMPA 5ESVB 1K5WA 2CH7B 3CC7V 1MY7A 1QW9A 3S4SA 4DERA 2OBGA 5T1KD 4FNTA 2F54B 4ORZC 3T3PF 3H3PH 1YPZB 1Q72L 3MZGB 4KXAA 4XNMA 1NANH 1SFHA 1LO2L 1ZHLB 3LKRB 1ZVYA 5CLXA 4HS3B 5E6YA 2VQFB 3OLEA 1FVCA 3HKFA 4IRZL 5ITBL 4ZI8A 2WZ6A 4G7QB 5LHDA 5L2KA 5IJ0B 1Q3EA 4NKIH 1DDHA 2A7BA 4MRBA 4V1DA 5JXAL 1SA0B 2WO4A 2WP3T 2MCAA 2YMXL 1U8JA 3S5LA 4JMXA 1NPJA 1ZS8A 3GHPA 1RZQA 1QBAA 3H9SA 4AYFA 1LD9A 4TOYH 2CBQA 5EZJB 2E9BA 3R1GH 4NO2B 3MO1A 5BRZE 1OCWL 1SJXA 3WEXB 4Z5RA 2X1OA 2WO3B 2ADPA 5JW4N 2I24N 5K59F 2WLKA 2DN7A 3QEQD 4A7VA 4PJ8D 1NM9A 1L5GB 1IBZA 2RDCA 1U8IA 2QR0B 2R9AA 2YSSB 2BSEA 3QZOA 5EN3A 4WV1C 2R56L 1NH2D 1PKQB 4JS7A 5D7IB 4URKA 3C2SA 4JFHE 4MKTA 3IPBA 3F04A 4U1LA 1MJJB 2F08A 3CSBA 4NB7A 4NO0B 2FO4B 5GS3A 2ZUTA 5I1DA 1TEGA 5B1OA 4ABQA 1SZXA 1JFQL 2O5YH 3O2DL 4J5VA 5DC2A 3BZDA 4IKJA 4W9KC 3O8XD 4HZLA 4HPOH 4U05A 4BCYA 4Z3EA 3TF7C 1I1AB 5K1JA 2NYYD 1P7QA 4U1SB 4HLEA 3CN0A 5LAXB 2O30A 2L04A 2K78A 2F1AA 3EJYC 1T1ZA 1L9QA 4HUXA 4RETB 4F15C 1IZ3A 2TAAA 3UJIH 5FYKU 1B3QA 2QKIA 3QUYB 5HHOB 3LYRA 2VH5L 4KH9A 4G2KA 5D7IF 1YQ2A 5HGGS 4ZUSA 5HDBB 4L9DA 1BQ0A 3B9KC 3E9UA 4J3OF 3V9CA 4M5YL 1DL7H 5AW9B 1QLRA 5DWPA 3C5ZD 3UROR 3RBZA 3BP4A 4KDTA 2R2EA 1USZA 2ORBH 1BAFH 3AJ7A 1AHWA 2YOCA 1D5BA 4OY9A 1MABG 4ISVA 4OCWL 2COQA 4A7GF 2ZUYA 1IGFL 3QFJE 3K8MA 1YAZA 4Q9QL 1OW0A 2GBUA 5CEZH 3MROB 3VXRA 4LH6A 1HDMB 4APQC 4J3OH 4FQ1H 3L1OL 4G6JH 5I74C 2X10A 1IM9A 2QWPB 2PETA 4PJDE 5DHVA 3HC0A 3HRZA 2Q69A 1H0DB 2FHFA 4I77L 4ZAKB 5F1IA 2C8NA 1LLAA 4OLWH 5DUBB 1WA8A 4PELA 1C7SA 2A9MH 2X0VA 3OAWA 1OZTG 2WXPA 2Z8RA 4HJGB 4K4KA 4P2OB 1K34A 1HNFA 3FT3A 1BF8A 4KAQL 4KK9C 1AP2B 4KJPC 2CLVA 1TQWA 4XN8A 3GYRA 1U33A 1FZMB 1OSZA 1W80A 4N23A 3T1YB 5D5MF 4HFWA 4HOZA 4BUGA 1VEPA 5C0AD 1AXSA 2X4PB 3GSVA 3LKOA 3RY4A 3NZHL 1VRSA 5LP6C 3KR3H 4TLUA 3WMPA 4LGPB 4HWBL 2EJ7A 4ODSL 1YC8A 4PRID 3E89A 4AQAB 2CGRL 4YDJA 3RIAK 4DUYO 2YRLA 4FM1A 3J7AU 1BJ1H 3T6ZA 2JIXB 2P8PA 5DJDB 2ZCEA 4PHZA 2VN5A 1FV1A 4R2GB 1E6JL 5MENB 5D6DC 5T3XL 1UWGL 1NJ9B 2C9PA 2BX5A 3DXAD 4PJ5B 3RTQC 4X1IB 1NLBL 3FS9A 3CWBH 4GMSH 2AXGB 2VR5A 3TBYA 1U4EA 2PUQT 1J05A 3AMLA 5A2AA 1KC5H 1CTOA 4QTIH 1V3JA 1E65A 4QY8A 4M3KB 1RP8A 5CJOH 1HCFX 2NY6C 2EVGA 2FCBA 3C8KB 1DBBL 3MODH 4OFYA 2WXMA 4WF9V 3BHPA 3S8FB 3QUMB 4IJ3C 3PHQA 5IJVA 2YAMA 3ESMA 3RA7L 4ZKIA 1MCDA 3KS0J 2EO9A 3MNWA 3PXJA 1YSOA 2Y69C 1EXGA 2VDNL 3L3DA 4J8RB 4ZDHA 5T1KA 3UFIA 3VB8A 2VLJE 3N42F 2P48B 4FADA 3RWJB 1EEYB 1ORSA 2H0EA 4AUYA 2DEXX 5FLXN 1WJ3A 3QRLA 2P3YA 5FK9B 2FMLA 4AGNA 4M9OA 1HE8A 4FN0A 1JF1A 4WHYH 3ENEA 4X1KB 2VQ4A 2UY6A 2VW7A 3DJTA 4GXUN 5FYJL 2LVEA 3CK0L 2NY5C 3N2KB 3BZEA 1UOKA 5LN4A 1A6AA 4WVRA 2RN9A 3QAZC 3RWCB 1RUAH 3CV5A 1SM3H 2XXCB 1QHTA 4LU5L 1X4XA 1H3UA 1N0LB 4UDTA 3LAFA 3Q4HA 2VAAB 1UA6H 2VC2B 5IHUH 4BFNA 1HT6A 2CHNA 4LFHD 1YEIH 3TFKC 2MPAH 2P49B 3S36L 5BR8O 4KO5A 1FN4B 4AEHL 3VQ2C 2JK5C 2P5WB 4B3VA 2C3XA 3CXDH 5FM4A 5FYLL 1JMKC 5GGSY 1GGYA 2OW6A 3P11L 4LEOA 3SJVE 2V5TA 3QEQA 5DA4A 3L3KB 2DQTL 4P59H 4DR6O 1VIWA 1SPDA 4PJ8A 3S2CA 3WNIA 4BZ1H 2DYPD 1CFTB 3BKMH 4Q6YA 1AQMA 5E9DD 4JI1B 5ISZE 3FF8A 3B7RL 4G7VH 4PGDB 2QQQA 5IEKB 4F92B 5D5PA 1H2NA 1GOGA 1OSYA 2P90A 2M1KA 3QDGB 4I1RA 5C0ND 1KEGH 3IMUA 3NZUA 5FYKD 5JW4M 3LX9A 4PJAA 1DBJH 4OLZH 3QEHA 3U4EA 3O3AB 3HE7B 1SQGA 5GRUH 3BZ4B 3VFNA 3U0PA 1PBYA 2AV1A 4CU7A 1KKDA 4WJ5A 1A7QH 1XI1A 3L16A 3O8XA 2XUMA 4PJDF 4PRNA 4C4KT 3JARB 4Y9CA 3GC3A 3BUBA 5MHSE 2UUDK 2KZWA 1NKDA 3VNZA 1NIDA 2LW3A 4MA1C 2EEDA 3QJXA 3TWCL 1Z66A 4K5LA 4YXWG 4Y4HD 3P30A 1H8SA 4XN9A 5K9OA 3U79A 1Z6JT 4X4MA 1OIOA 3VFSB 1Q8MA 2B2XL 4BAYA 4GNKB 5BUPA 2Y06H 2HAZA 1NU1H 4YAQB 3EOAA 3C5ZA 4KK5D 4ODVL 2AJVL 2JVDA 4JFED 3S5ZA 1R5WB 2KC0A 1KENL 3KKYA 3PL6C 4BFJA 2MWCA 4JAVA 3LDBB 4JFQB 4K94H 2X9YA 4MKMA 3GO1H 4JKNA 4P2CG 2DJMA 2LW1A 1RSYA 2VSMB 3US1A 1WFUA 1GH7A 3QWQB 2JJ1G 1AR5A 4K7FB 4JFFE 2CGOA 3DUHA 4JI2B 5ICZA 5KVFH 2NCMA 3KLAB 4F8OA 3DA0A 3M1BB 4PJFE 3D3VE 5DJCA 4K3DL 4FLQA 3HKZA 5DXWA 5FA3A 3RGVB 3TBTB 4AZ8B 3E1ZA 4TSBL 1A02N 5IHWA 3K59A 1EANA 3GXPA 1IAIH 4OJFH 5AVUB 4ELMB 3OM3B 3AT8A 3CLFL 5HFMA 4OV6F 1AXTH 4WFHD 2Q8AL 5C0AA 1N4XL 5DDHA 1A47A 3RJOA 4Z7QE 1KT2B 4GKOA 2LGWA 3ZE0E 1H5BA 1MHCB 1X4ZA 3BE1H 3II3A 1S9YB 3W0WE 5IB4B 4Y8DC 1INEL 4HUVA 3CX5F 1BM3L 3FAWA 4JQIL 4FD0A 5D2NC 2MCPH 4FG0A 5I8CA 2WN2A 4QJ3B 1QNZL 3CMOH 4ANWA 2XQYG 2J8HA 1A3RH 1BMFG 4NPJA 5AUMB 5IMMA 1GZQB 4OFPA 3NQKA 3KE0A 5IQ9B 3QIBC 3DXAA 4LF5O 4ELMF 5F7AA 4E9VA 1QBBA 2FVNA 1YY9D 3FYEB 4EIZC 5C8JB 5KYWB 3LEVL 1CZ8L 1T2JA 3ZKND 2XQ0A 4U3SB 2VXQH 1N0XH 4A66A 4LF7B 2DQDH 2YXVA 2ZKWA 5A7BA 4ZI7A 3T8MA 1NPUA 2FD6L 2VO8A 3DHMA 5DJAB 4KITB 2WNWA 1TZGH 1HEHC 1FIGL 2IJKA 2DWYA 3FRUB 1L9NA 3HNTH 4MJIE 4EEEA 2Y1YA 2HX7A 4XNDA 3HPLB 3KZIZ 3BRCA 2CGZA 5FUCE 1P5UA 3H55A 2QWOB 3QQDB 2CO4A 2DQHH 2ODIA 1QQDA 3EJSA 3RJQB 4BQ9A 5BJTA 5HVWA 3K6NA 3L6FB 2WKOF 4L3FA 1GY1A 5JQIB 1AQKL 2Q8VA 1OK0A 4JR9L 5D70L 3OAAG 1TKWB 3NN8A 3QCUL 4WY7H 5AL0A 1NS1A 3MLSH 1B9ZA 2OULB 5JPNB 3DVIA 3MHSC 2DWDA 2UX6A 3AGVA 4C8XA 3QHFL 3EUUA 1MW3A 4MD4B 3IVKB 1CGWA 4AXWB 2PCFA 1QHPA 3WFZA 3HG3A 3MA9H 2P24A 1MHHB 4BFIB 2WWKO 3RZWA 1ZVSA 2IADA 1YG9A 4MAZA 3IC9A 2E6QA 4IS6A 1YHQV 2AXFA 2C3HA 1RUKH 2VR7A 4PSRA 5TGBA 4ZNEE 5GS1B 2I9TA 1Y76A 5KYUA 1YUKB 2IV9A 3UYRH 4JFZL 3UXFA 1G8MA 4K3GA 2W0XA 4PJHA 4PRAB 4KP4A 3KPSE 2R9RB 1XGQA 4JO4L 1M6OB 4NQDE 4UB0L 2WBKA 3UZVB 4ES8A 4HBCL 3SO3C 4NLAA 1U3YA 1SXAA 3FFQA 3GTNA 2DYPA 2JKTM 4NAJA 3FO9B 3G5WA 2WQAA 3P9LA 5E9DA 1BQHG 3RVVC 2IWFA 4X98A 4LBEC 8PAZA 5I6MA 4UVAA 2WBJB 3HR6A 1KFAH 3S5YA 1KN4H 2EICA 4FA8A 1A1MA 2VMJA 5MERB 1KPUA 4JHAH 5BVJA 4L05A 2G9HA 4EF3A 1XH1A 1M3JA 1RV6X 1T03L 2K70A 4PD4K 2N01B 3GI9L 4F37F 2F53B 4XT1C 2OX5A 1UT2A 3CVDA 2R29L 4Z1VA 3FW6A 4MJ5B 3K4AA 4RMRA 1I9EA 1OAQL 3WIHL 4OF6A 2XIDA 4B9FA 1DVUA 3L3IA 3LNGA 3QFGA 3DYMA 3W7SA 4BWTA 5BXFB 2ZSWA 5D7SL 5LHHA 4Y4HA 1CGYA 3I02A 2PW1A 5IWLA 1KJVB 5T1JA 2LFEA 1WUNT 5I6XB 1V3KA 4TNGA 4QO1B 1O7DC 3K72B 2RJMA 5DMIH 4Y4FC 3BP5A 3UBHA 1H3XA 4IDJL 1DN0B 1K3EA 3MFGB 4B3MB 4TUYA 3K81A 5KZCB 1JNLH 5C3TA 5FOBB 3RFZB 4JFEA 5C0GA 3EO9L 5IJ9A 1FXKA 1F90L 3IFNL 5H4ZA 3SQBB 2DD8H 2W0FB 3TT3H 5BZBA 4CADA 3DDGA 3TO4B 1A0QH 1K6QH 5CCGE 2ZWZA 4TQPA 1DVFD 3TTYA 1HILB 3CCJV 3CZEA 3DGGB 3KNBA 3WKQA 1R1BA 3S37H 2XACC 4LF9B 4LFAO 3H2PA 1V55C 2FWOB 4HYOA 1KGIA 1TTCA 2UVEA 2QLYA 1OF2A 4N0CC 5E8PB 5F89A 1YC7A 5GRVL 4ETQA 3IGKA 1XR8B 3RP1A 4LHUB 4O4IB 4WFHA 2J5WA 2DQEL 2Z93A 1MH5B 2APXA 4FZEL 2KKWA 4BCXA 5SWSE 1IC0A 1OHZA 2GJRA 3EYVB 1OLLA 5DD1L 2HT4C 2DDQL 5I6PA 4K7PL 1K8DA 5DD0H 3RJDA 4M48L 2C34A 4MTFA 2A4ZA 4CMHB 4IBVA 3VG9C 2DYRC 3RT3C 4KUZH 3PWUB 4L1DA 1OE1A 3A8TA 4NO3A 3EFDL 4KX8A 2VW4A 3BWAB 2G5BA 2QQLH 4N28A 1B4TA 2AQSA 2DQGH 3L17A 3PV7A 4MJ6A 4XPFH 4XPAH 3WN5C 5CA0A 2K3TA 3C2AH 4DVBB 5ANMA 1FYJA 1KCVH 3GSWB 1SXZA 3GS0A 1VF5C 5PAZA 3IDXH 5F96L 2H2PC 3GB7B 1F11A 3ZS8C 1LK2B 1BD2D 3K06A 2G3XA 3VFPA 4XO5A 3OAYK 4EB6B 4B7EA 1THAA 2CR0A 1U91A 2HFGL 4QI3A 4K8RD 3W7XA 3KBHE 3JSNA 2QGEA 3FDWA 4P07A 5ID1A 3QNYA 25C8L 2Q73A 4WI2A 3APMA 4EI6B 4HZAA 3GWKC 3E8FA 1KB9J 3SSGA 5C6WH 4OCXH 4J10A 4HXBH 3B8SA 4PLKD 3CE1A 3LB6D 3VG0L 5LHGA 5JIPA 4YN3A 4ZX3A 1I7ZA 3OPZH 1UD6A 5E95B 3FFDB 3FB7C 3RYIA 2H32B 2MFNA 1JVKA 1QG3A 3JV4B 4WK4B 2EEXA 4AKPA 3MCLL 2B9BA 4HT1L 5D8JL 1FSKB 4O2BA 5GGUB 5T1DL 4DT2A 4JM4L 2VXSH 2R7EB 1J5CA 3SKNA 4YL9A 5DZOA 3E6FB 2E56A 2JFCA 1YJDL 3PHOA 4GKJO 3QORD 4OQ1A 3MR9B 5CM1A 3EJQA 1TJXA 3FFCD 1M05A 2OCCB 4RBPK 4ZQKA 4KKPA 3WO3B 4ZS6D 5JQGB 4O2FB 4FMFA 1QNIA 1NFDA 5EIIG 1FL5B 3ZDZB 4EFEA 3TJHD 2OS7A 2XPGA 5JJNB 1JFHA 5KX5B 1MKFA 3QPXH 1NSNH 4XP6L 1WT5C 2VM3A 2B59A 2ZUWA 1CLYH 1VFBB 4GRLD 1Y74A 1TCMA 3I6LE 4LARL 3UX9B 4NP9A 4N24A 3TZVD 2X28A 3WL9B 3UCQA 2FWSA 4X9FA 3DHJA 4KK8D 2H32H 3SBQA 4PGZA 4NNPL 1K5QA 2H6UA 3OKDA 1UXWB 1A9BA 3CTTA 4JAMA 4JFDE 1WAZA 4KROD 3T8XB 4AM0B 5CCJA 3GLEA 1ETJA 2YD0A 3HI5H 4QXGH 5E8OB 1YMHB 2VDRH 2W9LA 4R4FH 1BVLB 1NOLA 1P7HL 4UM8B 7PCYA 5KEZA 5JLZA 2J3SA 1DJIA 4KGJA 4R0LC 2OXHA 4X5PA 1AGBB 3KVDD 2EIEA 3LXAA 1OV9A 1ZL8B 2Q8BL 3MBEB 1CICD 1GYWA 1GZPA 2BOBA 3K6FA 5DZJA 2NRDA 2VDKH 1WGVA 4YXKH 1NL0L 3IGAB 2YD5A 3JD3A 4JHUA 1IBGL 4WLCA 5J0BA 4KQ4L 1TJHH 4ZMAT 3T1WA 1U92B 5IR1A 2DLIA 4AV5A 5C9JA 1FGVH 1RSOA 4ELKB 1CL7H 1IAKA 2ITCB 1BZ7A 1BVKB 5DT1L 5D93C 3P0YL 5A6MA 4YHOH 1HL4A 4GRMA 4ZFGL 3MNMA 4QR7A 4Y2OB 4UDUB 4JHBA 4ZFOB 3T3ME 4JKKA 4JDEB 2XKNB 1EZVH 4F27A 4YX2H 3ULVF 3T0DA 2AK4B 4HWEL 4OZHA 4PJ9D 2AJSL 3V0EA 1R3JC 3GXNA 2PP9A 1T1WB 2HG5A 4XE5B 5CZVH 4DUWA 2ICWB 1BGXL 4JPVL 5F1SA 1TUBA 1DVFA 1UJWB 1BQUA 2R15A 4R7NA 4NXMO 1I9RL 2OMYB 2W65B 2F74A 3MCKA 5IROA 4F9PA 5A2CA 3IYLW 3JAWA 2EXTA 1QBZA 4PRHE 4X8CA 4MMYB 1PSKL 4X9BA 5AVRB 1MCPH 2CM5A 3DX3A 5EF0A 3S98A 3ILQC 2Y07H 4N5UA 2MQCA 5CBEA 3IDMB 5A1AA 4LQFH 5J8OA 2BP8B 2BNUB 1HNGA 1SBSH 2ED8A 1ZTXE 4O2EB 5J12B 2R0WL 4XOCA 3F7RA 4EIBA 4CKVX 1WBXB 3MN8A 4JI8O 3KPTA 4LRNL 1AZNA 4PJCE 5I1KL 4PUBH 4WTQA 1UH2A 2AJXH 4ACTA 5ITZB 3FTZA 1F4AA 4LP5A 1NAMA 1TYRA 1HSAA 1MRCH 4I48B 4LSPH 1QSFD 5AKVA 2CE6A 4Y4KB 4B97A 1WA0X 1N5AB 4FTVE 3VWKB 1BD2A 1AYOA 4Z0BH 4X20B 4KK6D 1UFUA 2OMXA 1QYGL 3I50L 4N1EA 1QTSA 5D71H 4NGHL 2HR3A 1AI5A 1Y1UA 1RPQA 4AMXA 1PVHA 5E2VH 4Y1TA 1TZ8A 1DVXA 5TDPA 4X7FC 2QMJA 3LNMB 2F5AL 2FL4A 2O6CA 4QRUB 3GXIA 5DC9B 1I9JL 2C9UA 4G8GD 3OKNB 4J3OC 1LM8V 3DPBA 2L4OA 4C56E 4MJHA 4R84A 1S7VB 2BVUA 1O6TA 3UT5A 4WNJA 5EEXA 4NN7B 1XCTB 3KYNB 2PCPA 3M7OA 3F62A 4I0CC 2UUDH 3PN1A 3DO3A 4RZKA 3DRTB 1N8ZB 1I1AC 2Q7AA 4K3JH 1M1SA 4R4BA 4PI2A 4FFVC 1RM1B 2IANB 1Y6XA 5CGMA 1C8QA 3LZFH 1CGSH 3LZPA 4XMLH 4RIRB 3IJYA 4PGCA 2EC9U 2EDBA 3Q1SL 1E28B 1CYWA 1KTLB 2YRBA 3N50A 3QO0A 3UP6A 1X5MA 3QUYC 5IQ7L 4R3SB 3FFCA 4YO0B 4UQCA 4XN5A 5A2QN 1CBVL 2CCLA 1EBAA 4GKKB 1ETA1 4NSKA 3SY0A 4ES9A 4J2QA 1AI1H 4OFDA 3X3GL 3ALPA 3GMLB 3FUMA 5JJEB 1FYHB 2Z8WC 2FJUB 1R19A 3JTTB 5CJBA 1X59A 2YEZA 1QKZL 3BGMA 1FL3B 2ZUSA 3B43A 2ZOTA 5HDOA 4U1JA 5FHAH 3VQLA 1BQZA 3S97C 3DTDA 4ZAKC 1G9ML 1RZGA 2PW2B 3TZVA 2PYFB 1J12A 5JVDA 2ARJA 4J6RL 2P4VA 4I7ZB 3LMJL 4P2OC 2VYRE 1J5DA 1Z9PA 2Q10A 4RZCA 3LRLA 1IGJB 2YXFA 3TGUH 4QHPA 4DRXB 3CZGA 4O4JA 1L0PA 3T3MF 5HYIA 2J8UA 1YQVL 1EIBA 4YIQA 3H9ZA 1H3WM 2W88A 2YN5A 4XNYL 5GRVK 4N2BA 1CQYA 5MEOA 2QWNB 4JO3H 4U2ZA 4X8JB 4XPTL 4UAHA 2AJ3A 3V4PL 1CICA 1SN0A 1KCRL 3ARDD 4L5FE 2ISDA 1I8IB 2YPLE 4IRZH 1A1NB 4F8PA 5J89A 1XGUB 2JQZA 3TO2A 3SJBC 5KHHA 1CLOL 3PNWB 4KUCF 1VEMA 5CU9A 5TK4A 1U8KA 3ZRFC 4R2GC 4NXSA 2EE6A 3G5ZA 4Y2DB 2ED9A 5BMFH 2Y25A 2Z31D 5CZXD 5F7EL 3NCYP 1WV7T 4XC3L 4I55B 4MB5A 2BVOA 3VA2C 3GDCA 3IS1X 3BRGC 1XIWB 2WV3A 2XV3A 4UQAA 4ANVA 2X4SB 2C3VA 4X62O 2A4CA 4PJ9A 4K71C 4ZPVA 4OZFB 2ZKXA 5E23A 4HIEB 5IF0A 1HOCA 3Q44A 3G08B 3SO5A 5H37H 5BS0D 2R56H 1PLBA 3DIFB 2ADQB 4G3YL 5I0VA 5HHNB 1BHAA 3U82B 4YJ2A 1U8HA 1WFJA 3MJ8B 3BN9D 1BG1A 1B6QA 2IWGA 1FO0L 4TNFA 1JFQH 3LSOB 3O2DH 2BERA 4GY4A 4G1MA 5CIPA 3WIIH 4WHTA 4PRBA 5LQBL 2QVTA 3FH8A 2BDNL 4MVOA 1VENA 5J1AA 3UKMA 3G04A 3CCUV 2JI2A 2NZ9D 1NKGA 3FU0A 3H56A 3TM6A 1XNQB 3UABA 4DK1A 4UB6Z 4YDNA 4FNSA 4R26L 1TTFA 2HJFA 1L3WA 2X6UA 5EOTA 1MWOA 3NABL 3VX1A 4QGYA 5DO8A 4M5YH 1SOXA 1X4YA 3QEGL 4YBQD 5D2NE 5LA6A 4OZFH 1REIA 2YS4A 3GSOB 2H3OA 4HCIA 4KXDA 1QSFA 4PJBA 4DZBA 1PV0A 5EBMB 4N21A 4LZKA 2DI7A 4OCWH 5FM8A 1CB4A 3V7AE 1IGFH 2NTSP 2NT1A 3U36A 1LP9B 4OUUB 3KXFD 3L1OH 2OMNA 3DSNB 3GBLA 3MUGB 5EO9B 3NEOA 5LOVA 4NKGB 1WVZA 1OHQA 1SHXA 1PG7H 3VI4B 3S3XA 2JEXA 4G80A 1SC5B 1ES0B 1ZV9A 2ZD0A 3PAYA 4UMSA 5C7XL 1ITBB 2IDQA 4XXCC 4P4RB 4TVPE 1IC5H 3KPRD 4K94C 4X4KA 4L3CB 4G8GA 4CBZA 5ADOL 2X4RB 1B0WA 4KRNA 3N5AA 4P2QD 4C59B 4AL8C 1M1XB 1Z2KA 2H4EA 5IFJA 1T0MB 3ULUH 4P5MB 1OE3A 1O6SA 4ONFL 2NYKA 5KBDA 4HUMB 4MZRA 5HHME 3DNKA 3NZHH 1O9GA 3LIZL 3M7MX 1DQQB 1PD0A 3FB8B 3BUYA 4MA8H 1FFOB 1LP9F 4NCC2 2V9TA 5DRWB 2VDNB 4GPVA 3ULAB 5B3JE 2NNFA 2BVQB 4WU7B 5EZIH 5FO9A 3O2VH 2KPWA 1QAWA 5EC2B 2Q6WB 4ACPA 3SDCB 2J1ZA 5EMYA 4NYLB 2CGRH 2Z7WA 3S4SG 1J1XH 2VOTA 4LESA 3VGDA 2V4LA 5J2TA 4NBXB 6TAAA 1HNWB 2OFQA 1YDPB 4G42B 2RACA 2DWEB 2NX5D 1UWGH 1YMME 5T3XH 3MLZL 4KMQA 5EB9A 3APQA 1FLRL 1NLBH 3B3IA 4IU3B 2WW8A 1ZSPA 1VCBC 3ESVF 3HMXA 2FSEB 4U33A 4M6ML 3LDBC 3B2XA 2XWTA 5D1ZD 5ENWA 5B21A 3GSXB 3HJ0A 4FQQA 4LLMB 2YBGA 4XGZB 1U8LA 2XFGB 1EEQA 3FN0L 3EO1B 5FFLA 4BKLA 1DBBH 3IJHB 1M90W 1NC4B 2CD0A 4N87A 3S5LG 4JFPB 3LSUA 3RGVC 2NW3B 4PCSA 2C9XA 2CDEB 3SKJL 2AQNA 3MV9D 1NAKH 4PBDA 2VDNH 2ZE6A 2VN3A 3L9DA 3KEHA 4N8PA 5C0DA 3WDIA 1Q90D 2IPUG 3EGSB 5GGRA 3E6HB 2ZQKA 1RD6A 3C8HA 2Z3YA 1KMGA 1Z5VA 3T2PA 5BPPA 4YR6A 4RGND 3IDIA 2IAMD 3ARDA 3HZKA 3OR7B 4H1LH 4F7CB 2MK3A 1WUZA 4TV3A 1P7KA 2X70B 3D8MA 1VZIA 4NQCA 2WNKA 2C9SA 4H8WL 4IIQB 3U1QA 1XILA 4HK0B 3BW9B 1J7VR 1CFSA 3MREB 3C6EA 3HFFA 4LU5H 4NQXA 1EGJL 2VDPL 2J20A 3ILPA 4X6FB 3BP6A 4JUTA 3FQNB 5LGJB 1OGTA 4JKPL 3CCQV 4LCWE 5CEYB 2DWXA 1INDL 2HJKB 1Z9LA 4L8SB 5TE6H 5IJDC 2Z31A 1UOVA 4PJ7B 3RX5A 3S36H 2UYLA 1JK8B 2QADB 4AEHH 4TOIA 5JQ6H 2F61A 5BZZA 3PWVA 5IP4A 2UZXB 4UCFA 3K57A 1HZHL 2H3NA 3KPLA 5FYLH 3NIFB 4ZXBD 1BM7A 2DLFL 1X5KA 2DQTH 2I07B 2YEQA 2BJML 3BOVA 4NBYB 5ECJE 4UTAA 1YEDB 5BS0A 4IRSD 1PX3A 3UBXI 4EUPB 2UZYA 5D4HA 5TDOB 4P30A 4ICXA 5E94A 4NKOB 3HPLC 2UXCO 2J72A 4WJKB 6FABL 5JPMA 1TTRA 2J2ZB 2KZBA 3SZ6A 2UXTA 3UJTL 4KC3B 1YEGL 3VU2A 4BWAA 4LPWA 5A3ID 2BLFA 3CU7A 5JW3H 2IFFH 3LXBA 4PG2A 5MI0B 2IW5A 3BAKA 4GXVL 3KL3A 4IGBD 5IB3A 5FIEA 4QAMB 3Q5OA 5JPNC 3MRDB 3NMEA 4OI9A 1KDIA 4RBPH 4WFED 5BZDA 4NCC1 2YD7A 5LYJA 3WNNA 5CP3H 2D0GA 4E9QA 5JDSA 2J1YA 1S8DA 5GW7A 2B2XH 3BPNB 4G70B 2D7NA 1B4JL 4WAFA 3U83A 4RGMC 4Z3FA 5BVPL 5LGKA 5GS1C 1KCUH 5CHNB 1FKAO 1JV2B 1I1RA 2OJEB 4ODVH 5LXTB 2AJVH 2HKHH 4M4RA 2FJGA 4EUPH 1U42A 3T4AA 2YIBD 1U8QA 1FAKT 3KWWA 3KXFA 2Y1ZA 4DWHA 3FU9A 3FPYA 3IMSA 5AWNL 3FT0A 3DX9A 3QHZL 3Q06A 5LDSA 2Y22A 3T2LA 3UEZA 3KPRA 4ZRGA 3GBNL 3SE3C 2ZONA 4K3DH 1KBVA 1KGCE 3FZUC 3WHXA 2ZT9B 3BP7A 4FG6D 1QR9A 4P2QA 3TN0D 4JPWH 3FQ4A 4HHGA 5B39G 2R2BB 3WEBA 1Q0YL 2VUYA 3S3DB 4RUEA 1D2DA 5I17B 3W38A 2GHZA 4KKCC 1DP0A 2EDXA 3KM1A 2KH2B 1NEZG 2KI6A 4PQXA 4YMPA 3RWIA 1S72V 2V0AA 3W57A 1RUQL 2W60B 3MLYL 4LVEA 3GI8L 4IGGA 4XCNB 2D3NA 4NQTA 5CXPA 3TBSA 1INEH 4ZX4A 4NZRL 5F93C 2JLPA 2Y5TA 2ESVD 4N2MA 1JR9A 4LLDB 4JQIH 2HLEB 4AYID 4DQOL 1O0VA 2V7NB 5EULV 4FMVA 5HGDA 1QNZH 3ULUE 1U8NB 3BJLA 5I6XC 5FECB 3IF1A 4MCMA 4JFOB 1WISA 5T3ZE 3L4TA 2JKIS 2Z6FA 4UV9A 3OFNG 1VQMV 1N36O 1NFIA 2BVPB 2NX5A 1SY6H 2OL3L 3F5WA 3GJFA 4AGOA 1G6RL 3V4VL 4AX3A 3RFZC 4W4NA 5I71B 1IJNA 3OTOO 3DROA 3HAEG 1G87A 3LEVH 1CZ8H 3QIUD 1MQ8A 5F88B 5HI5D 2W0FC 1NGQH 4NKDA 3L3JB 2GPZA 5D1ZA 4OBRA 1AR2A 2WXFA 3TO4C 3EFOB 1F3DJ 1R73A 1A21A 2FD6H 1K33A 3KLKA 1CEZA 1UATA 2F4VO 3QFJD 5KTEH 5F7BA 1RIUL 4B9PA 2G60H 5IY5B 1FIGH 4OZIE 4KO6A 1PNCA 4JG5A 2YXWA 3EKCA 3TIDB 3GMOA 3BD5A 4G7SB 1SESA 4X65B 5DQDL 3ZTNL 1S9KC 1YY8B 2Z7ZA 3MV9A 3WFHA 1U95B 1XO8A 2KKQA 1Q90A 1KIQA 2VLRE 4KI5C 2OQJB 3UO1L 2P46B 5KSAB 3FOLA 1Q38A 2NNXA 1AQKH 4JR9H 5D70H 3AC0A 4HIHA 5AVSB 1QATA 3QCUH 2A6KA 2IAMA 5IEHA 5J6GA 1T7VA 3DX4A 4GBXD 4LL9A 4E4EA 1DJWA 1L0NH 4W9FC 5DZVA 3QHFH 2R69L 1WFIA 3KGRA 1QFUL 4EZMA 3MCYA 3VYPA 5EIVA 1DUYA 4DN3L 2DQIL 2EDEA 1MHPL 4PLJD 2AQTA 4E36A 3A6BH 5EU4A 4ZUTB 1ZGLA 3UTTE 2QSAA 1KPRA 2QSCL 2XYBA 1I8LC 1QRNB 2AQPA 3IU3B 2GUOA 4F7MB 1I1FA 4X7SL 2XG5B 2XN1A 4JO4H 4OFVA 4OT1L 1GW0A 4EDXB 1WA2X 3FHQA 3K6SB 4HBCH 1B0RB 4ZG1A 2E76C 4ZXBA 4OAWB 2EACA 3WLWC 2BOCA 3MRQA 1PM9A 2CJUL 4XVUC 1PNKA 1F1GA 3E7JA 4QXUL 2JV6A 5I15L 4IRSA 2ARHA 1OTUD 5DC4B 3ROOA 1SUHA 2JCCE 1GYVA 3LQAL 4P5TB 2HRPL 4JV5B 1RZ7L 1I3RA 3JXAA 1NJIW 5M7QA 3VI3B 1EHLH 1NCHA 4OUOA 1Z3RA 4ZUUB 1Y18A 3GI9H 1M3IA 3GEFA 3QCTL 1FSKC 4BSVB 1XSOA 1CXHA 3IC7A 2RFXB 4IGBA 4E9SA 4DPBX 4ZFZA 3TA3D 2LU3A 2OLDA 4CU6A 5KJRH 4WFEA 1OAYH 1RZFL 5DEGB 3NSYA 4ZSOB 2OCCC 4FABL 4FLVA 1U2CA 4W9EC 2Q7HA 1E4KC 3ATAA 4QWWD 1TCRA 2I25N 2XWJA 3B6SA 2P80A 5C92A 3CBRA 4QCIA 4F24A 4MAYC 2GHYA 1DJXA 3CD4A 1RUPH 3L9RA 4AJVA 3O3DB 1T4KB 1F90H 3IFNH 4ZFFB 5JORB 1IFGA 1E27A 5G4MA 1JI2A 1P6AB 3T0BA 2YIBA 4N0FA 3DX1A 1A4JB 1P49A 2C9VA 2XG4A 1IAOB 5CSBA 3VXUB 2EVIA 2NXYD 4AQ1B 3LNEA 4XC1L 3EYOA 1RAMA 3Q3GA 3D18B 4TSCL 3K6DA 5I30H 1ZGLM 1MI5B 3U6XA 4YJ3A 5DMKB 3IRCA 5BO0D 2KT6A 4B3TO 1OCZB 1IRAY 1CDBA 5A2FA 4HS6A 4Y5YA 3V0WL 4P04A 4TQFA 2AC0A 3TN0A 5ISZD 5CEZE 2EIZB 3L2MA 2A38A 2A6DB 1DLFL 2FQGA 2Y7OA 4FZEH 5IJBC 1NUDA 3IMRA 3BUPA 2NY4B 3MBEC 2QLVB 4RMBA 2DDQH 4YFDB 4M48H 3OQRA 3MOAL 4N2AA 2MHAA 3IGAC 5FDWB 4CH3A 1N59B 3KPQA 2ESVA 2F19L 4B7KA 3BESR 4ZW3A 3GKWL 4OIIL 2YEVA 2GABA 4ZZKA 4XHJD 1JWUB 1Z7JA 3B40A 3EFDH 1OVZA 2IEPA 2ZPKL 3FTVA 2N7BA 1LK3L 1XF3A 1HNXO 3B9VA 3QA3B 2IG2L 2ITCC 3AM8A 2VKWA 4MHHG 4JRXE 4I3RL 1E9QB 4KX9A 4PW9A 3AXLB 3ZHFA 3TWYA 3ZHUA 5F96H 4KKLC 3W39A 3UPRA 1D6VL 2FX8L 4R5XA 3KMDA 3QIUA 4H8QA 2HFGH 1DBKH 5KJRL 5I5MA 1CDIA 2NW2A 1S3KL 4XN4A 4G9FE 5FNVA 25C8H 4LSSL 1HJCA 3CHSA 4DYLA 3BPCA 1FNAA 2B0SH 3GSRB 4MS2A 3P3NA 4WGVB 1P7GA 5D2LB 4I3SL 4HV8A 4TVSa 2X42A 3UYOD 1N19A 3ZQ9A 4DCQA 1I08A 4QE7A 2VQ1A 4PJXB 4LFHG 2FH8A 1JYXA 1M2VB 3CCHA 3ETQA 3G5XA 3D3VD 3WSQH 3X3FL 4X5WB 3AS1A 2CHZA 2GSIB 2X7LA 4GIPD 4J41A 1AIFA 3MCLH 4JAUA 4HT1H 1HINL 4WKZB 5D8JH 5E5MB 2B1OA 2DAVA 4HGWA 4JM4H 5E4EB 1IL1B 5T1DH 3WY1A 1ANUA 4MRCA 2K1MA 4GBXA 3IJEA 5HSFA 1YJDH 4PMEA 1VZHA 2EEBA 1A7PH 5C09E 3VXMD 3DXRA 1AACA 4E9WA 3HZVB 4M1CD 4FQJH 4H88L 4E41E 4M7LL 4MW8A 1DVTA 5IJKA 4Y4KC 3EOBA 2LLLA 3VWKC 2NY3B 4QRFA 5E08L 5IWAB 1BBDL 2G75A 3DTXB 3IRZA 3ZDWA 4UIMB 4XWOD 3EJPA 4XP6H 3K5OA 2XSKA 8FABB 4JJHA 5DWUL 3LY6A 3D2UD 1GTFA 1J0YA 3CZSA 4LARH 3KLQA 3T1HB 3ECBB 3GT6A 1RP9A 4KWUA 5DI8B 3B56A 5DRXB 1QO3B 2XZQL 4Y5XB 3VD0A 2VDML 4NNPH 2PYJA 1F6AA 5F9OH 3LZLA 5KVGL 2GK0A 3HZMB 2GY7B 3A2FA 1WBYA 4N1CA 4XOEA 4A1RA 5HI4C 4GG6E 1HL5A 4KZ0A 2X1PA 1J8SA 3EDEA 4FHJA 4NN7C 4ABVA 1KNOB 4RA3A 4MJID 3MNZA 4JQVA 4XNAA 4LF6B 4TL4A 1RM1C 3AWEA 2Q8BH 5D7LB 3SIKA 2M6YA 3SCMB 1ZDQA 1P4LA 3HNVH 4L2LA 3R66A 5GONA 2IGLA 4YPGB 1Z0NA 4MXVF 5AYUL 3TA3A 2QGNA 4QOKD 1IBGH 4Y7OC 3ARZA 4PYHA 3VACA 4JY6A 1TF4A 4HXAL 3EF7A 3OUFA 2CLZA 4YXLL 1B0IA 4X4XA 2QGBA 4CC5A 4NNXB 1R3LB 3C08L 3HHMA 4LKCB 4P5KA 5DT1H 1EZJA 4GUQA 3P0YH 5DVLA 1WIUA 3X11B 4Y19E 4ZFGH 4BFRA 4DKTA 3WJMB 2YC1B 4ORGA 1EDQA 3BAJA 1ACZA 1H6EA 1BYOA 2VRQA 1X9QA 4FQXD 1WC7B 2HLFC 5HJDA 4HWEH 4Y16D 3HPJA 4Q6IB 2AJSH 4YDVB 3MLUH 5KSBA 1UH3A 4DEPB 3TVMD 1BGXH 4S1SL 1CURA 3X1GA 1Y0LA 3QULA 1T2QH 3KPSD 2XN9E 1ORQA 2YLHA 4FAAB 4DR1B 1C08A 1PZ5A 5F3HB 3FSZA 1MVUB 3O6FD 3VFOB 2J8OA 2EKSA 1PSKH 4H13B 2HN7A 2LV4A 2PR4L 1UJ3A 4OX9B 3I85A 4KXCA 3EBHA 5ISZA 2XTJC 3C8DA 5E6IC 3O81A 2ZAHA 3O6KL 2Y3AA 1X7QA 5DMGD 5HGAA 5GGTL 3I56V 3D12B 2R0WH 2IBZH 4IBYA 3FCTB 4M03A 1Q9OA 4AOFA 4R7CA 2VN6A 1MPAL 1S7UA 4AG4H 5I6NA 2W07A 3VCLB 4LRNH 2XN0A 2X9WA 3CSFA 2WZ5A 1FYTE 4AQ8A 3MLXL 4Y2DC 4DP1X 2NY0D 3WJLA 4P8QA 2CDFA 5EZYA 3D1MC 1U8OA 3B9EA 4PGJA 4HALA 4F7CA 3TBWB 1LE5A 2XV0A 4HJJL 3I50H 4JDZB 2AI0L 2YA1A 2HKOA 4BE5A 4NGHH 1PZBA 1S9VA 3Q6GL 2UUAB 3OC8A 3DJRA 4N2LA 3WNLA 2E7LC 2KQNA 5MP6L 2FECI 1CI5A 3UIYA 1ZV2A 3G9VA 4Y9BA 2F5AH 3O11A 3TF4A 3APOA 3QP3A 1I9JH 4DKEL 3IDNA 1AS8A 2HRLA 2E5LB 1I1YA 4JN2B 4QHMA 3VW3L 2NXZD 1W0VB 1KELH 5BOPA 1O9ZA 3MI6A 1QSEB 1AR1B 3MV8B 3AS2A 3HKBB 1NMAL 3F7VA 4D8PA 4PJFA 3D3VA 5I1HL 3K9SA 2YXMA 4L3EA 1H3GA 5GSRA 4S0SD 5HYSA 2ZWNA 5CBAB 1QHOA 1CF1A 2VSCA 2YD2A 4Z7IA 1TQTA 2OMUA 3BZ5A 3GLZA 4AVKA 4ODTL 3FQUB 4LLQB 4UF7C 2ZAGA 3ULUC 2BSCA 2ZUVA 3KDMB 4QD2E 5CFHA 5JIDA 3D3IA 4GG6F 3LN4B 4OTXH 1J86A 1AR4A 5DURD 3EBAA 4ODXA 5IQ7H 2CHDA 3ARUA 3VXMA 4PGBB 5D7JB 3V4PB 4YOKA 2VLLB 1FZOA 1IIIA 3SQRA 4X6DB 5EBMC 1ZS2A 5AW0B 2O61B 3A21A 4LNRA 3HBQA 4MVBD 1CN4A 1GGCL 3RG1C 4K9JA 3BYYA 4NP4L 3MTRA 4W4OC 3U1PA 1K4CB 1QKZH 3BUIA 4Z78A 1T04B 3MLTA 4AV4A 3D2UA 2YKLH 3EAKA 4MMZA 3ZRCC 2XWEA 4KY1H 3VO0A 2PPAA 1G9MH 4DF9A 2X1QA 5FB8B 4N26A 1A6VL 4J6RH 3LMJH 3ARED 4XHQA 2JB6A 5DQ9A 3K79A 4F7EA 2BSKB 3OXRB 1RU9L 3HHRB 3NP4A 4IBWA 2CRMA 3K04A 4N68A 4U6HA 3MRHA 4BIUA 1LWRA 1S77D 4G11A 2WUCL 3U30B 4X83A 3WFDL 2N0KA 2V5RA 1YQVH 2CXKA 3FUIA 3ESUF 4XNYH 4MJIA 2BM3A 4F3FA 1LE9A 2JDIG 2HJDA 1IM3D