3AG4B

Bovine heart cytochrome c oxidase in the cyanide ion-bound fully reduced state at 100 k
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag4B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag4B02
1B3IA 4YL4A 3EH3B 5B3SB 2YAHA 2UXGA 2J55A 2P80D 3GDCA 2WSDA 1GY1A 2DY2A 3T6ZA 1HFUA 2IDUA 3EH4B 4HCGA 5D4JA 1AR1B 1NIDA 1R1CA 3UAAA 8PAZA 1XB8A 2CJ3A 4HHWA 1NIAA 1V54B 4A66A 2VN3A 3X1NA 4DP6X 3FU9A 2JFCA 3C75A 1KGYE 4AX3A 1J5CA 1MG2C 2Q5BA 2YAPA 3H4HA 4N4YB 3UAEA 1A4AA 1ASOA 1PZBA 1GS8A 1JZJA 1HAUA 1JZFA 2GC4C 3S8GB 4YSEA 4KO7A 1BXVA 1SF5A 2QDVA 1ETJA 2MRYA 3EF4A 3JT2A 5AFAA 1AQ8A 3BQVA 3WKQA 1ASPA 1PZAA 3HB3B 2BZ7A 3SBRA 5TK4A 5I6OA 1OV8A 2XV2A 1SF3A 3FU8A 1M9WA 2EILB 1KCWA 2PPAA 5I6MA 5AZUA 2XX0A 3FU7A 1PZCA 3OQRA 5FC9A 3SBQA 4CSPA 1V55B 4Q8BA 1OCCB 3AG3B 3FPXA 3FU7B 4DP1X 1CUOA 3QQXA 1E30A 5AKRA 1AG6A 1JXFA 2EIJB 2FQDA 2BP8A 5I6PA 4WKXA 1TKWA 3PXLA 1OE1A 5A7EA 1KDIA 2H5UA 2HZHA 1N68A 1F56A 3AG4B 3WIAA 3FPYA 2BP8B 1KBWA 2GI0A 1A4CA 5I28A 3NSCA 1KBVA 4BDVA 1KV7A 7PAZA 4YSPA 5PCYA 3S8FB 4L0PB 2TSAA 1OF0A 2TSBA 4E9XA 3PAVA 2H47C 1CURA 2Y1AA 4BDVB 4DPAX 3ABKB 2YXVA 4AKQA 3OD3A 3OMNB 3KW8A 1IBZA 1WA0X 2VW4A 4A2GA 2J56A 1GY2A 4PCYA 1J9TA 3QPKA 3WI9A 3T6VA 3BVDB 3T6WA 3D12B 2CALA 1AACA 4KO6A 2DYSB 4E9TA 2AANA 4G70B 4QKTA 1W6LA 1NICA 1JVOA 2AFNA 4YSCA 2BHFA 6PCYA 1PCSA 3NSYA 2XXFA 3UGEA 1E67A 2NRDA 2CAKA 3OM3B 3FYEB 3CVCA 1FFTB 1NIBA 2GC7C 6PAZA 4PAZA 1JZIA 4ZK8A 2PPFA 3V9EA 3QJVB 3TA4D 1BXUA 2ZWNA 1PMYA 1KDJA 3CVBA 2YAFA 1NDTA 4DPCX 2PCYA 3GYRA 4HALA 3ZIYA 4P5RA 1BYPA 1KYAA 2MTAA 2XUWA 2I7SA 3FSZA 5I6LA 1ASQA 1I53A 3NSFA 2FQFA 4DP7X 4N8UA 2DYRB 1IC0A 1QLEB 2UXVA 4KO9A 1BQRA 3V9CA 3L45A 4A2DA 1AZNA 1AS8A 1GSKA 1RKRA 3TASA 3DTUB 1EZLA 2IDSA 4WTQA 3FSWA 2QDWA 2LLNA 2YAOA 3CDZA 3NJNA 4A2EA 4G71B 2R7EA 5D4HA 3ASNB 1AS6A 4RH4A 3WNIA 1A4BA 5IY5B 4P5SA 5I5IA 2R7EB 2W8CA 1ILUA 5PAZA 1QHQA 3X2QB 1OOWA 4M4RB 1AZUA 1VLXA 3MBWB 1T5KA 2EIKB 1XB3A 1MZZA 2HRGA 3QJRB 4K9JA 1FWXA 1W6WA 4ENZA 3X1GA 2VW7A 4YVNA 1AIZA 1BAWA 1ET8A 2J5WA 3T9WA 1WS8A 3NJKA 3S3BB 1NPJA 3PAUA 2XV0A 1PAZA 1JXGA 3CZUB 4MFHA 1MG3C 1SDDA 2YAQA 5I5MA 2ZOOA 3SBPA 2VSKB 3EH5B 3TBBA 1SDDB 4AKOA 5F7BA 3T71A 1PLAA 2DWSA 4GP4B 1XB6A 3ASOB 3FSVA 3ABLB 3ERXA 4TXVB 4YSDA 1SHXA 1TEGA 2PP8A 1AAJA 3IN2A 1PNDA 4BXSV 4UAHA 2OJ1A 1CYXA 3WKPA 5B7MA 3AG1B 2BW4A 2BWDA 1L9PA 3PLYA 1NWOA 2B3IA 2XU9A 4BWWA 2HX7A 1V10A 4DP8X 2FTAA 1ADWA 1SHWA 2H3XC 2BZCA 1TEFA 2UXFA 1PLCA 1URIA 3IE9A 2UX6A 4G72B 2UXTA 5E9NA 2YARA 1NIEA 1A65A 3FT0A 2X87A 1BQKA 4HZ1A 4W1TA 2WO2B 4E9SA 2JKWA 2PPCA 4A2HA 2GB2A 4HHGA 3UABA 4DP5X 2XYBA 1W8EA 1L9TA 1PF3A 2BP0A 4KNTA 2IDFA 3MX0B 1SFHA 1ZIBA 1GW0A 3NT0A 4CSZA 1L9RA 3JTBA 2I7OA 2P80A 2DWTA 3FSAA 2X88A 4KO5A 2HX9A 2A3TA 2VM3A 3OMAB 5F7AA 4NERA 3ABMB 1CC3A 1GS6X 2GBAA 1JZGA 1NZRA 1M56B 2XLLA 1BYOA 3QJUB 1KCBA 2HXAA 3FQ2A 2HLEB 5I5JA 3X1BA 1J9SA 1NINA 3CG8A 4FAAB 4YVUA 2B08A 2VSMB 2XX1A 2QT6A 3SQRA 2YAMA 4A68A 2PLTA 3NP4A 4YSUA 1ZDSA 5LDUA 1TU2A 2QPDB 2ZXWB 2UX7A 1PNCA 2FQGA 3NSDA 2EINB 4UF7C 4Q89A 1AG0A 1ID2A 2GIMA 3S3CB 2PPDA 2BW5A 2FJSA 5TK2A 1J5DA 4JHUA 3FYIB 2RACA 4E9RA 1FA4A 1BQ5A 3NJJA 1IBYA 4BWUA 4JHVA 3X1EA 2IWKA 3U25A 3ZDWA 5I6NA 1J9QA 2XXGA 4HAKA 3CDZB 1JOIA 2OV0A 2FQEA 3ABGA 3QJQB 1A3ZA 3FQ1A 2VM4A 4A67A 4F2FA 4DP0X 1PY0A 2FNWA 3RYMA 2HX8A 4KOBA 1X9RA 1NPNA 2FT8A 3H56A 3S3DB 3HEIB 2VW6A 4X4KA 4YSTA 3H4FA 1AZCA 3NJMA 4AZUA 2VMJA 2FT7A 2CBPA 4EF3A 4E9WA 3AZUA 2GHZA 1E65A 3NJIA 3IEAA 2WO3B 4DP9X 2IWEA 2JXMA 4NAJA 4DP2X 1DYZA 3NJFA 1WA2X 2AZAA 4QLWA 1AOZA 2YQBA 3GXUB 1X9UA 2E86A 2W88A 1MZYA 1NIFA 4KOCA 3G5WA 2IAAC 1OCRB 1CYWA 2IDTA 3AW5A 1NTDA 4KNSA 4DP4X 1PLBA 2IH8A 9PCYA 1BEXA 1DZ0A 2N0MA 2OCCB 4G7QB 4HCFA 3UADA 4BWTA 1SFDA 4DPBX 2GSMB 1OCOB 5B1JC 3TU6A 2CUAA 5B1BB 1XMEB 3NP3A 4HIPA 4YSOA 5EHFA 4AKPA 1WAEA 1QNIA 2AZUA 2PP9A 4YSQA 4FA7B 1NWPA 1UATA 1WA1X 1L9QA 3ZX1A 3ZBMA 4G7RB 1GS7A 2FT6A 3NJGA 3TBCA 1ET5A 1ZIAA 1WS7A 2I85A 4GP5B 5I26A 2BO0A 3IN0A 2YXWA 1ET7A 2QPEB 5D4IA 3WNJA 1N70A 3FS9A 2HRHA 3QJSB 4UANA 3AG2B 5B1AB 2XWZA 2IH9A 3UACA 2XVBA 5ANHA 1L9OA 3NJHA 3OMIB 1A8ZA 1AS7A 2Y69B 4YSRA 2PP7A 2CCWA 3X1FA 1JERA 1ILSA 2AVFA 4G7SB 3NJLA 1ZPUA 5I6KA 2BWIA 2BP0B 3DIVA 4A2FA 3NYKA 4M3HA 4E9QA 1AZRA 1RZQA 2J57A 1MDAA 3CVDA 2EIMB 2XV3A 4W9ZA 1RCYA 4KNUA 4YSSA 5B7EA 2YAEA 4BXVA 4F7KA 4NB7A 3FQYA 1EHKB 4HCIA 3IBOA 2ZONA 5B1KA 3AY2A 1HAWA 4F2EA 3N55A 1OE3A 3QJTB 4BK5C 4JKNA 2FWLB 1M57B 3N2JA 4E9VA 2PCFA 3PAZA 1E5ZA 3DKHA 7PCYA 1BXAA 3WG7B 3EHBB 1L9SA 4GP8B 1RZPA 1AZBA 2YEVB 1ZDQA 4GYBA 1JZEA 5B1JA 1OE2A 1YLBB 3PCYA 3T6XA 1SJMA 3KW7A 1OCZB 1GR7A 1GYCA 1JZHA 1SNRA 1J9RA 1IUZA 2IDQA 4YSAA 4GY4A 2Q9OA 1E5YA 5B7FA 3PPSA 1JXDA 1JVLA 2DV6A 4E9YA 1IKOP 4AI7A 2PPEA 2IWFA 4GXFA 1AANA 1ZV2A
chains in the Genus database with same CATH superfamily
4GXUN 4NC1E 4KZCA 2FX8L 4ZMVA 4L0ZA 3QYCA 4CZZA 1E6JH 1W80A 3LZRA 5AW8B 2GK2A 1P4IH 1KPUA 2DLFH 1FN4A 1K3IA 2AAAA 4GKLA 3E2HB 4U31A 1QNZL 5KHIA 3ARYA 1R3JB 4UZUA 3MMEA 5EZJA 1R1CA 2VLJB 5F6IB 4Z7NB 4AGPA 2X38A 3LDBC 3LS4H 3FMGH 3GJFB 1NIAA 4LDCA 4R6ZA 4A2LA 4JDVB 4HF5H 3UJIH 1UXWA 4I7ZB 4Y5XC 3L5WB 5EEWA 1YJDC 3MLXL 5D7IA 5IMOA 3EYFA 3RJOA 3WGUB 1BZKA 3GBMH 2YAPA 2ZUYA 4PJXB 3I9GH 1NC2B 4YDIH 1S9KC 3R66A 2IADB 1C5DB 4OGYH 4FJCC 4PVNA 4TVUA 2GITB 4TUUA 2VUOA 1T7ZA 5JNYA 3SQBA 5J2UA 4Z1MG 1COWG 3WE6B 4NJ9H 1ASPA 4DUYO 5H37H 3BVUA 4GAJL 4JZJC 3V0GA 1Q9WA 2WLYA 3ROOA 1L8DA 5E4EB 3QFDB 5B38B 1PD1A 4NRXB 2B39A 1N5AA 1XGUB 4WGWB 4E2OA 1V55B 1KBBA 1ZANL 3CVHL 4X65B 1G9ML 4JZ2A 3VXSD 5C7XH 3E9UA 4JFOB 5D7LE 1EMTH 3D34A 3QXTA 1KDIA 1I3GL 1OAJA 1IIIA 1FVEB 4YHYC 3RAJL 1DUZB 3SDDD 3LQAC 4GOSA 1T1YA 1H2SB 2EIZB 5BUAA 4JHAL 4NNXB 1RZKL 4RLDA 3V4PB 1MFDL 4L0PB 3L3KB 2CJTA 4WFHE 4AM0B 4RMVA 3VJ6A 3T77A 1HVXA 1GYUA 1E8XA 2YXVA 2NZ1A 4H25B 3M1BB 1J0KA 4WZ9A 1EFQA 5IQOA 5CEXA 1DVUA 1E5UI 4AQ8A 4DR3O 1TETL 4ONOA 3ZYZA 5A1AA 4MVBD 5JQ6L 4Z7WF 2KS0A 5L2JA 5F96L 3MLRL 3VXOA 2EYSA 2ZXEB 4JM4L 1YQVL 4LSQH 2VKXA 4G42B 1PAMA 4KRPD 2OIGA 5D55A 5EBMC 5I1KH 3MV01 5FWRA 5GJSL 1OGPA 4JFDD 5D8JH 3MRNA 5EF1A 1BM3H 1KYUA 4Y5YC 4B3TB 4UT9A 3RB7A 4AYDC 4GKKO 1DTOA 5B39B 2DM2A 2OCCC 1I1AA 3T2NH 3VFUA 4MVBC 2BHFA 4HSQA 5SX4I 3RYHB 3V4UH 4FQCL 3V0DA 1AP2B 32C2B 3KCWA 3K06A 2G4EA 4KI5C 3UMNA 4ZZKA 4DGIL 3BABA 3CVCA 3U1SL 1RJCA 4BW5A 5TE6H 3MI6A 4W4KA 3PABB 2PPFA 3BPOB 4GBXD 3CFEB 4LCWB 5IFAL 2ZUSA 1EK3A 1KTRL 1RIHL 2UUBB 3L4YA 3O8XB 4FC3E 2V5MA 2YAFA 1U3NA 1ZHLA 2YD0A 3E8BA 4YJ3B 5BNXD 2KZWA 3IJYB 4DR1O 3LB6D 1EUTA 5LP6A 4FN0A 5CCJA 2QELA 4MVQA 3BFWA 2HPOA 4AV5A 3ULSB 2ZWKA 2UXVA 1M2VB 2R23A 3BWAB 3WAKA 5IESH 5K9QG 2Y69C 4LCUB 4DW2H 4GRLD 4OZFG 1EHAA 1T7YA 1RKRA 2KHAA 3F5WC 1VQ9V 3PV7A 4Y4FB 2NUPB 2WQ8A 2YN5A 4FRWA 2NUTB 4FLZA 3FT4B 1RUAH 5T33H 2WXFA 5I19L 1KTJA 3N6YA 3L7EA 1DUYB 4PJ5B 4DEPB 1BQ0A 1D5XB 3WNIA 2F9BT 1AGBA 4CVXA 1BZ9B 5T3XE 4LU5H 3HZ3A 3NUKA 2R2CA 3QCVH 3CX5K 4WK2B 3VFSA 2JKNA 1EFXA 4TVPL 1QHPA 1M71B 2G3XA 3PXHA 4MJ6B 4KX7A 3VXNB 4N68A 3C6LC 5CILL 3ABMC 3CH1B 5CSBA 3EOBB 1ZLUH 4UB6Z 2QVTA 4W9CC 2V8LA 5I8EB 1O9HA 4Q0XL 1Q9LA 4NXNO 1AE6L 1ZA6A 2WZPD 5EYPB 1SY6A 5ID0B 3VNZA 3ZUCA 1OAUL 4YDKL 3MJ9L 2PTTA 5C7ZA 5IG7B 1C5CL 3KCXA 1E2VA 3EYUH 3N50A 3T4ZA 2IF7A 4YVNA 2CDGB 4J7KA 3TK1A 3MKGA 4JRWA 5AVYB 3JALA 4HNAA 1QTYT 1EQWA 3BMWA 3T4AC 1HHGB 2FLRT 4IIQC 3FB8A 2JIZG 3BZFB 4J2QA 1SDDA 1BZOA 3GHEL 5ANME 4KK9C 4OCRH 1SJEA 4H20L 5JR1H 1RQ5A 3IDYB 5D4QA 1MNUH 4MXQD 2X4OB 1SQGA 1WWAX 3PGCA 5F7BA 1KGCE 4LF7B 4FLTA 1CXHA 4U7MA 1SYVA 3L73H 1FGNH 3CFBA 4TXVB 4RCAA 1PSKL 1TUBB 4PBVC 1MAMH 4FEIA 2J6EA 1OY3B 1SHXA 4R4BA 1WYJA 1QSFD 3CXFA 2H3OA 3OHXC 3K57A 4X4XB 4Y4KD 4FCHA 5DQJA 2WANA 3HCVA 5KS9B 2BNQA 3J2PA 2JE8A 1XXDC 1JFFB 3ZE0B 2GTZA 4QHUB 4EI5B 3IDGB 3AFLA 4RX4D 2PYFB 5HGDB 3SCMC 2ZAGA 3QHFL 3UCQA 5L9DH 4L18A 2BXZA 1JNNH 4ZUVB 3L5JA 4KZEL 1GZHC 1TEFA 2NT0A 4I0PB 3B7UX 5E9AA 1Q86W 2QE7G 3H6AA 1ROCA 5F3HB 3V9FA 5CGYC 5GZNA 2FCBA 1SMAA 4Q9BA 2VZUA 3LKSB 4YHMH 1YITV 4GRWB 2ERJB 4OJFH 4K0KB 3H1HH 2ZE5A 4S1QH 3CC4V 2WO2B 3MX0A 4IRSD 2JK5C 1YECL 4E9SA 5TQ2L 3CDGB 3O6FA 5CJOL 2L7UA 1QR9A 4KU1A 1TFHA 2JQMA 3GNMH 4MNHB 3UO1H 4AITA 4HOZA 2OMYB 2OXHB 4UQEA 1G6RH 3U4BH 4MCMA 4UINH 4MAYD 4A37A 1ZOXA 1GW0A 4B7IA 2HH0H 2DTMH 2FE0A 4JANA 1FO0B 4WEUD 4YBLB 5SWSE 1JGEB 2DJ4A 5I18H 2PYEE 5IJ0A 2HSIA 3AROA 5DFAA 4HSCX 5D2LE 2JJSA 2VM3A 3CDCA 2VRQA 5I0XA 3BH8B 4QTHA 1VQLV 1O5DT 5JOPE 1JPFA 5A6IA 5CZXD 4Z2WA 2FHBA 4PDMA 2KQMA 1BYOA 2BVQA 2F8OA 2HXAA 1IKFH 1PQZB 5BS0B 4BFNA 4LLYB 3DYMA 4PGCA 3WUWB 3D87B 1J9SA 3CG8A 5H6QA 2HTLD 1QSEE 1N5YL 4YSUA 4WEMB 3RA7H 1Q1PA 4NO3A 3AK2A 4LARH 2OTUB 2CKBL 2ARJQ 2R1YB 2JMRA 3KPNB 4N86A 1U2HA 3RX7A 3QYNA 1MZEA 3G67A 1AG0A 1V3KA 2GIMA 3A23A 4LT7A 1VB9A 2PPDA 2E7LC 1ETA1 4NUJB 3JWOH 2R29H 4XMLH 4DVRH 3C5SB 1MCJA 2P44B 1UXMA 5GSRB 1GGIH 3HPLB 1IB5A 1MDTA 3FO2A 2BOBA 4FFYA 4H1LH 4TQEL 1RZ8A 1ZVYA 4XXDA 2EULA 1DQJA 4QHMA 2OP4L 4U3JA 3ORJA 4DN4L 4DGUA 5KZCB 5GS1C 4JPSA 5JZ7D 3DSFL 4JGSA 4DUZO 4NZUL 1MH5B 4P23A 4Z7WA 5LN4A 3MN8A 1G1YA 4ONHB 4XE0A 4WY7L 1CF1A 2YPVL 3P4NB 2EXTA 1OW0A 1PNKA 1FFPB 3NJIA 5GGRY 2YSSA 5F6HJ 2WO3B 3LRSA 4NAJA 4BFKA 1A9EA 4CC5A 1T22A 2LLGA 3REWB 2K8MA 1TTCA 4HG4K 4LLUA 1NM4A 4FQLH 1NOAA 4NZTH 4KQ4H 3O4LB 4WV1B 4X1IA 5GS0H 3QQNA 1KGJA 1ULVA 2BDNL 5B21A 2LO1A 1ONQA 3QCUL 3GM8A 4LOEA 3F6LA 3SQOL 1WPCA 4KMLB 2CUAA 3NJXA 2EDBA 1U8NB 2J5LC 1D7BA 2ODMA 1CF8L 1F2XK 3B8SA 1CFNB 4QOKB 1S7SA 4ZQKA 5F7MC 5KVEH 2ZP0T 5AW1B 3ULUE 2OAAA 2PP9A 3NIDF 4D0BB 4U0QB 2B2XL 3NFPB 1U2YA 1ZK9A 2FX9H 4ZMYA 4J8RA 2I26N 4X99B 2K1EA 4ATTA 3F64A 4YBQC 1ZE3H 1OTUC 1RM1C 3MRDB 2B14A 4I18B 2DWXA 3MJ7B 2LQRA 4X98B 3VFGH 3FN3A 2BSKB 3ZTJH 3FUMA 1REIA 3MLVL 1XCTA 5E1AC 1AP6A 4K3DL 1RPOA 3D8CA 5GQBA 1KYOF 4G2KA 1Z6JT 2O4EA 2XQYG 2FBRA 3TFKC 3LEXB 1QWHA 3BFQG 4XPFL 4JI7B 2A9BA 1QHTA 2JJUA 4FNTA 1A8ZA 5GGTH 4MBOA 2NNCA 5AQ0A 3JYCA 3MPCA 1NLBH 3MAQA 4QIWF 3OW2U 4LOUC 2RB8A 3OTOB 1E9QA 4U0RB 1MCOH 3IF1A 1T1WA 3LN5A 3SDLA 3GWOA 3IGKA 4M6NH 4A2FA 4QJ5B 2DKSA 1GTFA 1TCMA 2XWJA 3N40P 2IALA 4JM2C 4P9HC 2CGYA 4Z7QB 3FTUA 2H32H 1MLBB 2VZ3A 4NI6A 2A79B 3B2MA 4YH6A 5JIHA 3PGFL 2F1BA 1XGQA 3K08A 4BFRA 3IRPX 4Q9CA 4ERSH 2Y0SA 3L54A 3P3UA 4F7KA 4QAMB 5L0QB 1IBHA 4HIEA 4NB7A 3S88L 3I56V 2GCYB 1GYVA 3QCTH 4R8WL 2DQGL 4OFYA 3WIHL 3DV6A 1TGOA 2DQHL 2LABA 5EORL 3VWKB 5D1XC 4YHNA 1NAKH 3MV7D 2CJUL 5LHIA 3O6KH 4OIAA 4JO4L 3D3VE 3TA3C 2Y1VA 3APQA 1TU2B 4WO0A 1WISA 1ZCRA 5BUGA 2CGNA 4IKJA 1AZBA 2YEVB 1IC1A 5E8EB 2X1QA 3G6JF 3PCYA 3VXTA 3RIAK 1LNUB 1CD8A 1XCWA 1MRCH 2Q3ZA 4U4BA 1U8QB 2A7WA 3I74A 4KKLC 4ZAKA 3GEWB 3VMPA 4Z76A 5B7FA 4M7JH 1YNKL 1FXHA 3DUHA 3GXTA 5ACZB 1EZVX 1Z9SB 3BIAX 5C0AA 3QUZB 3FFOA 1AANA 1NCNA 2DLGA 2WSDA 3THML 5AB9A 4PA7A 2DN9A 5B3SB 3PWVA 1SBSH 2ICCA 2DYSC 3EJSA 4WW2F 4Q56A 1FF5A 3VCLA 1UZ6E 5KBDA 4X0KA 4DN3H 4QXWA 4Z78A 3ZCCA 4EDWL 2GJPA 5EIIA 4PW4A 5G5DB 1NEUA 4M3JA 3QIUC 3BMVA 1KB3A 1L0XA 5FYLH 4P05A 5D4JA 2CIIB 1CVSC 5EDXA 1IU1A 1FUNA 1OARH 4ELME 5JJEB 2ED6A 3CFTA 3J27A 4JG1H 4TOYH 2NXYD 4EFEA 3W7UA 5EPMB 3FT3A 3ZDXB 4F2ME 1DQTA 5HHXH 1S9XA 2OTJV 3BEWA 3ESVF 2OZNA 4OGXL 4XVOA 1H6UA 5DXWA 3FRPB 3IJ7A 4UDUA 1WP7A 3CCEV 4O4IB 1PKQE 2VDNH 4RNRB 3VGGA 3S8GB 4E0RB 5EU6B 4LLVB 3G3LA 3TVMC 3ZE2F 3EF4A 1OSZA 4HH8A 3WKQA 4QJ4B 2DQEH 2BZ7A 4IBTA 2VWKA 2MNJB 4YLCA 4PRDA 1WFTA 2ZX7A 2NXYC 3FU8A 3B2VH 3KLDA 5C71A 4QWWC 3CXCU 1HEHC 4IS6B 1MUJA 3MRFA 4AY0A 1UWGL 2V7HA 3J80N 5L8KB 1SOSA 3MLYH 3EJZC 3T08A 3JARB 5BV7H 1F3JB 4PIBA 5E2VH 3HMWH 2YC0A 1M93A 1HI6B 3QIWC 1LD9B 3QF7A 3CBJB 4NKQB 4DKEL 3ZSTA 3TP4A 5CN2A 1TPXB 5E4IA 3ARGB 5H4YA 4OU3A 3HLAB 3BP4A 1TQCC 1UUNA 3RWCB 2E9BA 2N74A 3F7VB 4WK4B 2GK0B 1ZA3A 4CU6A 5F88A 3PP3H 5AAMA 2F18A 4JREB 5E5MA 5H6RA 4NN5C 1LL1A 3ML0A 4S0SD 4YXHL 5JQGA 1IGFL 4X6CB 3ULVD 2DQCH 1BF5A 2NXZD 3FCUB 3QG6A 3ARBA 4DEUA 5A2BA 4OD3L 3EIFA 4JE4B 3JTSA 3RILA 1ZGLB 4HC1H 4EXPX 3ZZLA 4Y2DC 2J71A 5D7KD 3DX6A 4K23H 2NW2B 2WXPA 4J3VA 5C0JB 5KOMC 4Y89A 1HCFX 4UTAH 3JD1A 1RIUH 2VW4A 2FIKB 5MEQB 5C0IA 1JF1B 2CM6A 5LKNA 2FWOA 3DRQB 4IGBD 2NXZC 2GUZA 4P3WA 2BY3A 1GC1C 3L3OB 1F6FB 3I02A 4CILA 4R26L 4JUSA 1KYOK 4X9FA 3L1OL 5AWNH 4LFCO 4EEQA 3VXQA 3GSUB 3PWNA 2A73B 4JYAO 2XXCB 4POUB 1CZ8L 1FH5L 4ZUWA 1OCOC 1LUVA 1SA0B 1UFGA 5JTWA 3V5HB 25C8L 1PCSA 1RUKL 1RZ7H 3D4YA 1U8JB 2VQEB 3JASB 3S4SA 4ZX3A 4IGBC 4NN7B 1KBGL 4NNPH 2DWDB 1KFGA 2X70A 3DHJA 3DOSA 1AD0B 3HAEG 4NQCD 4K2UL 1GGTA 3O4OB 4X7SL 5DC0A 4BIZA 1A14H 2OTWB 3UCSC 4DK0A 3TA4D 2JB6B 5ADOL 3M1OA 2SEBA 3O45A 4HX1B 1Q0XL 1PW3A 4UB0L 2H0JA 1YEEH 3CVBA 4G5ZH 1MJ8L 4WO4A 4N8CL 3TO2A 3RWJB 5JDJA 1H3GA 4OTXH 3SOBH 5GRWA 2X0UA 3BPLC 1Q7YW 1JPTL 4IBYA 1J0YA 2UXNA 1A9VA 4XPBL 3N41B 3U9UA 4FGMA 2Z31B 1G43A 3MUHL 3OVUB 4MZ3A 3CBRA 3DARA 3N1MC 1KELL 2E27L 3GXPA 4JFQA 4XNUH 4NVPA 3CQFA 1NCOA 1XSIA 2FYYA 4F9LA 5BRPA 1E5CA 2XIBA 1J05B 1M6OA 2UUAB 2G2NA 3BUDA 3II1A 4Y4KA 2NR6D 2GTWA 2UZXB 4MNGE 1ZXQA 3HBZA 3BN9D 4UAOC 1A6PA 2R9HC 4ANXA 3J7AU 4G1EB 2R7EB 2R51A 3NN8B 2ZUTA 2QR0A 2X4UB 4GS7C 4RX4A 1AXSB 3TF4A 1ILUA 3NDZE 3L2LA 1J1XL 3SYAA 4RIRA 2AXFB 2FATL 3E0GA 4W6YB 4LCWD 3WTSA 1VLXA 5FDWA 2EIKB 5GGRB 3O8XD 5BMFH 2A5UA 1VF5C 3EGSA 4I50B 5BMVA 4H8WL 3A4EA 2AK4B 2QKIB 3FCTB 5T1KD 1UADC 1GGYA 4DQOH 5F7DA 3MNZA 1DVFA 1XR8B 1A4KA 4IRSA 4KI5E 4OJYA 3GUTB 4FLXA 1GM9A 2YIHA 4G6ML 2X6VA 1BVKA 5IR1A 1H0DA 3N43B 4ODWA 3WNOA 3NK4A 1E5AA 4OM1H 3O0RL 3L75H 3SDCC 1WAAA 3E38A 5IUSA 4JFTA 3ME0B 2G2PA 1MCWW 1G7QA 3LH9A 4CS4A 1B90A 2J2ZA 4S1RL 4YHIA 4I8DA 4X7DC 3T71A 4YXWG 1WEJL 3K7UA 1SQXH 1KWKA 1UH2A 5JIPA 4BSWA 3S3JA 4WWKA 2XCMC 3POCA 5GIRB 4GAYB 2R0WH 4OZIE 4PJHE 4XCEA 1EBAA 1R0AH 3G6JA 4F80A 1ZVSB 5IW1A 4L9LC 4JI0O 1UWXK 4QHKI 1LTXA 2BSSB 5HYJA 1PNDA 1S7VB 2HWZL 1JZ7A 5FB8B 4QEGA 4B3RO 4DF9A 3OLEA 1CICA 2OS7A 1UZ8A 3QO1B 3U79A 1LEIB 4OUUB 5JORB 3KPPB 3LDDA 4IOIB 2XU9A 3FTVA 5DQ9A 4J3OH 1DBJL 3V8CA 2OTPA 4HJGA 4TQIA 5FA3A 4JQIA 4ZHQB 1IKNA 3ARFC 4WW2A 1OP5H 1L9NA 1F1AA 2OI9B 1XTLA 1PL4A 3S2CA 4MDIB 5EUKB 2UXFA 4Z7NF 5BPPA 1DE4B 5EBLA 5K1XA 4G72B 1E1QG 4CMHB 5KSBB 2RALA 2UXTA 4XNBA 1KY7A 5E9NA 4U1KB 1QRNB 2JELL 2QZQA 3TT3H 2WIIA 4QHLA 3ULVF 1NIEA 2NYZA 2HLDG 1L7TH 4PJXF 2X4SA 4M1GL 3RDTC 2GB2A 4GAAA 5F9WB 1I4FB 4DT2A 3FU6A 1A4JB 3FO0H 2EADA 1CIDA 4K55A 2J4WL 1LDSA 3E6HA 1HINL 3Q0HA 1AR2A 3RTQB 4PQXA 1U6AL 2EILC 3KPRB 4U1HA 4AVJA 5EU3B 4FLHA 4JHVA 4L3CB 5I30H 5IB2A 4QXGL 5KYYB 1N33B 4NO2A 3ZW3A 3Q6GH 4ZFGL 1B06A 4C57C 3SO5A 1A6UL 4FG6D 4G8GA 3JV4A 2CZNA 1C5BH 2JJTA 2DKUA 4MNQA 4Y7MA 5DI8A 3VXUA 3W38A 3TYGL 1EHLH 2CO2A 4KXCA 2X09A 4QI3A 3UBXG 1NFAA 1M56B 3ARDC 4EI5D 2DAVA 4NKIL 5ENWA 3NQKA 1K4CA 4LWSA 4X8AA 5LMUO 4NQSA 3FQ2A 2NTSP 2D3JA 3CZKA 3GHBL 1UKTA 3F5TA 5I15L 3B77A 4XB3A 3VI4B 3UBHA 3RDJA 3X17A 3LD8B 4GRMA 3NAAH 3OAYH 5DJAA 5BXZA 4I0PD 2GJ6B 2QWQB 3KXFA 4HZLB 5K33A 4PA6A 5I8OH 4XP9H 1CLCA 1XI1A 3S3CB 2HMIC 4R0LC 2IH3C 5ICYB 3A0BZ 4FXGC 5H2BA 3X3GH 1IGTB 3FYIB 3KYKH 4G7VL 3V4LA 3QEQE 4WLCA 5GTIZ 3UTPE 2W9DL 2LP7A 3C5XA 3ZDWA 3TNNB 1J9QA 1DZBA 2W38A 3QJFA 4LSPH 3B5GA 1AGEA 3QDGB 1XNQB 2QVIA 5L4FA 4LFHD 4NQDB 1KULA 4RMQA 3VD0A 3EBGA 1EWHA 3MLTA 1WA8B 1L0QA 3FB5B 4LL1A 1XEQA 3Q4HA 1INDH 1OP4A 5CSZA 1EERB 4B9GA 1MIEH 3G71V 3CTTA 5IHBA 2AXGA 3HJEA 3T0VA 1BEYL 2VQTA 3QRFM 2A7BA 5I1AA 1USZA 1TJHH 3PL6A 4KKCC 4YWGL 5HJ3A 1Z1WA 5BS0D 4RGMB 5E8OB 4I5BA 3WENA 3PHSA 2F68X 4X64O 2P5PA 1F1DA 1ORSA 1JRHI 1FPTH 1AI1L 2CLRA 1YSCA 4X66O 1H9VA 3S97C 2R0LH 1T0NA 3MR9A 3ZIAG 1K4DA 1UWYA 3TPKA 3NCJH 1CFQB 1RFDH 2JGUA 2GJJA 2WAQA 1U4FA 2NX5D 2EE3A 2KUTA 2YUWA 3H2QA 3PV6B 4NJAL 3B3BA 1OCZC 3M8AA 3P30A 1N36O 1TCRA 2CCVA 2NY5H 2ZOTA 3Q1SL 5IKCA 2N0MA 5J6GA 4BWTA 1OPOA 4ODVL 4AIZA 1XD1A 1I7ZA 4OD1L 5JDSB 1YEGL 1NOFA 3R06B 1YEJL 2P5OA 1HXMA 3EDFA 3ISRA 1XSOA 3AREC 1HNYA 3HZYB 1OEZW 4HIPA 5KZCD 2YQ2A 5C0GA 3U7WH 4HLZH 3MJ8A 1ED3B 1NGZB 4OLXH 3VGFA 3MBEC 3K4DA 3OB0K 3VD1A 1SN0A 1LEGB 4MQTB 3BFOA 5EC1C 2XFGB 3FHQA 2BIMA 5F1KC 5HYIA 4HFUH 3TBCA 4B9CA 3UQ8A 4MMZC 1LO5A 3GRWA 4H44C 4TLKA 4YHKH 3TNMA 2CTWA 1XCQB 1IAIH 3KZ8A 2QPEB 3D0LA 3WFDL 3WNJA 1N70A 3NVQA 1JFQL 5F7EH 3RI5F 4P2YA 2XWZA 2QEJA 3O3UN 2LGWA 2D31A 1P5VB 3K3QA 3N2KB 1XH1A 3CU1A 3EUDA 4ZMLA 3O4LD 1NR7A 4AG4H 1AXTL 1I7RB 3C5ZD 3L4XA 3PHQA 4PJ9B 5E9DE 4GUOA 1I8IA 4JFPA 3KWTA 3FC8A 3K2KA 1ND0B 4BZ2H 3D06A 2GBUA 3I9IA 2UXBO 4ANWA 4PD4J 4XODA 3WFBL 3HBGA 3BAXA 3BKCH 5MENE 4QOKD 2GBOA 1NDGB 4JY4B 4L3EE 1ACYL 4U6YA 4XNMB 1J8HA 2XG5B 3G4SV 4W68A 3QORC 3VGEA 1QZ1A 3GB7B 2VR3A 4YQXH 5JW5A 2VLMD 2WBXA 4JZOA 1IT9H 3EFDH 4FI7A 1FVCB 4L8BA 1UCBL 1QUNB 4OSUL 1OSPL 1WCQA 3DSQA 1A8JH 3UMTA 4K3EH 4AVKA 5ICZB 3FQXA 3DTXB 3J81N 2AEPH 2XY1A 4DSYA 4KVNH 4NM8L 4AJWA 1XGYL 1SESA 1BD2E 5E94B 1MREL 1NJ9B 2EH8L 3CXHK 2FWLB 2NTFB 5IBTH 4MCZA 3SGKA 4ZW6A 2R4RL 1L3NA 1I9JL 2X53A 4FJ6A 5LXTB 5I17A 2P5WB 4HKXA 3CHQA 4PMFA 2A9MH 1FGVH 1Q0YL 3NMEA 3ZE0F 2H0PA 4P3CH 5C08D 2XWRA 4S1SH 1XEUA 3OUFA 2OZ4A 4LEEA 3OBAA 2Q7GA 1A6TB 1QD0A 5E2TH 1E5YA 1ZLVH 5J4MA 2IJJA 4M6OH 2BNRB 3B9VA 4HCRL 1T66D 1EEYB 5JHDA 4OGQC 5EU4B 4AENA 4OQ1A 5C3IA 4HZ1A 5MEOB 4DV4B 4PREB 3P2DA 1RZGB 1ZHBB 2MKLC 2UXGA 3AS1A 3O2WH 4Z7IA 1SZTA 2XN9E 3QZWG 4JB9H 4A1RA 1R3JA 4GRWF 3L48A 2VLJA 2E7CA 4FG2A 1DLFL 3GJFA 5DD6B 1B0GB 2QTOA 3S36X 4JDVA 2IDUA 2YMXL 4I9QA 3L5WA 4N2EA 1I1AC 2QVFB 4R2GB 4MVOA 3FBQA 4YFLF 5ALCL 4YXKH 4X7TB 1Y74A 4FIPC 1A21A 4PJXA 1NC2A 2OSWA 1V54B 3VWKD 1C5DA 4AEHH 2AKRA 4M7LT 4Z3JA 3KYOB 1AI4A 2O30A 2FEDC 3QXVA 2HFGL 1MMMA 3G04B 3WE6A 4XC1H 2FEEL 4XOBA 2YSUB 1JZJA 1HAUA 2FK9A 3STZB 2QSQA 5IF0B 4G59C 4P46D 1B2WH 1DN0B 2Q5ZA 1G6RB 1N8RW 1P9MA 3MV8B 1ETJA 1AQ8A 2IANB 3JT2A 1K97A 4AWJC 4D3CL 3QFDA 2YLHA 1N0NA 4NRXA 1XGUA 3TOPA 2Q7EA 1OV8A 4GKNB 3RN4A 1HW7A 2H45A 5I6OA 3N3EA 4NPYB 4NYLB 3O41B 5LP6C 1A64A 4KTEH 1NCJA 2P5EB 5D7SL 3AITA 3UDWC 5B8CB 3S35X 3T0DA 1RULH 5L88H 4JFOA 5F70A 5EZLA 3PG2A 1N10A 3FQTB 3AG3B 3UJJL 4BH8B 3FUEA 1FRGH 1FVEA 2QV4A 4IRJB 5FUCE 4AYGA 4DGVL 1OSEA 3ZRSA 4DPRA 2YXHA 2EIZA 3CRQA 1BW8A 5IROC 1K3EA 4UU9A 2WXHA 4HUNB 3L3KA 2BP8B 4XPTL 4AM0A 1A4CA 5EU5A 3BRGC 4FQPA 3OKDB 2ZNXA 3T4YB 1SN5A 1VEPA 2JB5H 2OBGA 4H25A 1MFEL 3HS9A 2TSAA 3MRJB 1UXSB 4P49A 4Z0BH 4H1LB 1CURA 5DLML 4GPVA 4R7LA 4MT8A 1XF4B 2XASA 5EU6D 3LZFL 1GM7A 4Y19D 1XHXA 1CLOL 2ICWJ 2MKWA 3G9AB 4G42A 4PV1C 1P84K 4HUWB 2BVYA 4N22A 1OP3K 3FULA 1VQKV 1WBXA 3EOTH 3I50H 4XVTH 5BRQA 5ISZB 3S0PA 1J10A 4LIQE 1HNXB 3CHSA 3U48A 2R2HB 3S2AA 2NR6A 2Q76B 4B50A 3RYHA 2B9BA 2ZNJA 1N2RB 2Q0ZX 4N9GB 4XH2B 4N9OB 5IM7B 1AP2A 4MKTA 4NKGB 32C2A 4YSCA 4D9LL 3KCYA 4L4VB 4EUPG 3UGEA 2YPLD 3L74H 2DMCA 3ARVA 3UZVA 3PABA 1PGRB 1CGVA 4JAUA 3DK2A 2AC0A 4PBWD 4WHCA 1EH9A 3V55A 4RMWA 4LAJH 4N2AA 3O8XA 3C8DA 1UUSA 1G1OA 1XMQB 1T5XB 3X12B 1AC0A 4YJ3A 5CUSL 2XWBA 2B4CC 3A0OA 2CGRL 5IB5B 1X5ZA 1FQ9C 2Q8VA 1V7ML 3HFMH 4Y1AA 4IKKA 4OKDA 4B3SB 5J1AA 3C90A 3ZIYA 3F2LA 4P59L 2D7TH 2BOCB 1J12A 4YDZA 2XWDA 3ULSA 1YXBA 3BIBX 3CCQV 3RBSA 1HEZB 3BWAA 4JFYB 5B1AC 2JTYA 1DO5A 4JJOA 3ARUA 3FFCB 4GSXA 4OLZH 4QRSB 5HI5D 5I0ZA 3QJHB 1RMFL 4XWOD 2VLKB 1WB7A 4Y4FA 1N7ML 2NUPA 1IC0A 4KO9A 2XPZA 9CGTA 4H0IA 3FT4A 2NUTA 1MI5A 3P3SA 5GZNC 4AMWA 3QEHB 4M00A 1GPOL 1DUYA 2ED7A 1HHKB 2DWEB 1D5XA 3LEVL 4PJ5A 2IDSA 3N0AA 4RRPM 2EO9A 4QUOA 4NP9A 3BGAA 1BZ9A 1RIVL 4PR5A 3L9YA 4R7NA 4A2EA 3ASNB 3CCJV 3V95A 3QAZC 1M71A 3AWFA 4HEPG 5I0DA 3B2UD 3CH1A 4DR5O 1TNNA 5DK2B 5I5IA 5I8EA 2Q6WA 1HDMB 3TZVD 5KYUB 3D39B 1I75A 2BWQA 3OXSB 4K8RH 1TAEA 2N01B 3GMLA 2HJKA 2WQRA 4LEOB 4ZO6A 1GH7A 2VN4A 5IG7A 3V79C 1PG7H 1IBMO 3GGWA 1AZUA 3JATB 2JJSC 1H6TA 3O2DH 4XN1A 2V4LA 4QE9A 5J11B 1IEAB 1FWXA 2ADIB 4P2QB 1TZHB 1HHGA 1DQKA 4CKQA 3QUMH 4NFDA 3BZFA 1WICA 4U6XB 5DJ6B 3SPCA 2WCGA 4XX1E 3INUL 3PAUA 2UV3A 1M57C 2DMGA 4JRYE 4KJYB 1U3HB 4HISA 3RZWA 4YEFA 4NQXA 4X7CC 1Q4NX 1CTNA 2X4OA 2Z31D 3A6BH 1QQDB 3NDYE 3L72H 1KPRB 3WD5H 1S7QB 2OYQA 2F8XC 3IGUA 5B1OA 1ZJBA 2VSKB 4LIQH 1BZ8A 2X42A 1SC5B 3FX7A 2A3QA 2AHYA 4M6ML 1WFNA 4M9OA 2UWEE 1TUBA 4RDBA 4WFED 3U83A 1Y6XA 3P32A 1YN7A 3FOMB 3Q2NA 2QADC 4O58L 4A7GF 1XB6A 4X4XA 3SD2A 3ABLB 2BOBC 3CSGA 2XPYA 3BSZL 2AHIA 5H2FZ 1KJVB 1JFFA 1U2CA 4JPRA 4QHUA 3SGJA 2GY5A 3ZN6A 4EI5A 4N90E 2PYFA 3GRGA 4G9DB 4OFDA 3TEXA 5CLZA 4LPCA 3VB8A 1TJGL 2GAZB 2X4QB 1NWOA 4OBRA 3EYQD 4ZUVA 5LOVB 2EDKA 4YXLL 4P23C 1I1RA 4HAMA 3ILDA 4I0PA 1XGRA 2DQUH 1AR1C 2V4DA 1NCTA 5D5MB 5F3HA 3IAPA 1IX2A 1VSCA 4HMDA 4XCYB 1OW0C 2AK4D 3F84A 4PJ8B 2FWUA 5D70L 5DRZB 3V4VH 1KJ2A 4KRNA 4DW0A 3K6DA 1SKVA 2E74C 4OJCA 4K7PH 4X88A 1BOYA 2YKLL 1YEIL 1AQMA 4YR6B 4G43A 1YY8B 4ZUUB 4E36A 3CDGA 3S34L 3ZDXF 2GIXA 4MNHA 3QJZA 2VZVA 2OMYA 2OXHA 1Y6KR 4PVMA 2ADJB 1AJQA 2TRYA 1KXQA 2VLRB 4ODHL 1TFPA 1FO0A 3GXDA 1Q9KB 4OZFH 2VO5A 1JGEA 2HKFL 1N59B 2FX8H 2ZPKH 3U7AA 2ZAHA 3NT0A 3GMOB 4FQIL 3B9KB 1TJXA 4A63A 5IHHA 4FNQA 3NK3A 3OQ3B 3D51A 4MA3B 4PM1A 1QNZH 3FSAA 1KQSU 2VDNB 3V0IA 2K6YA 4ECNA 5I1LB 1OCCC 3MDSA 2HX9A 5A3IC 2FIRT 1T4KB 1PQZA 2Y7QB 3WUWA 4JNXA 1JPEA 2GBAA 4IU3A 2EO7A 3A0RA 4UQAA 4X9HA 4Z0XA 5CLWA 2NY6C 5JXAL 2LGNA 5DHYA 3MLZH 2DI8A 2QGEA 1M9SA 3KPSB 2OTUA 2R1YA 2OZ4L 2ZWZA 2VSMB 2Z7UA 3PDOB 3DNKA 2WYIA 3KBFA 4NUJA 5F7LB 5DMKB 5KAQG 3C5SA 2P8PB 5GSRA 4PRIE 5CBEB 2YMOA 1SF9A 4HEMA 4GAJH 1E4JA 1ZT4B 2XC8A 4X6CF 3S96A 4PSPA 3K1DA 4IIJB 4CH5A 1KZYA 2APXA 1MOFA 2AJ3B 3PJSK 3MDJA 2E7DA 4FNPA 4JI6O 2EE0A 5JW4N 1A47A 3F7YC 2LGQA 1ZANH 2H6OA 1FL5B 1G9MH 4MDJA 3ULVL 3OWRA 3WFCL 8FABB 2YXLA 3C09C 2V5YA 3KPRD 3AU1B 2HKOA 1MH5A 4GI8A 4ONHA 4W6XB 4F2FA 1ADQL 1SLWA 3WKYA 3P4NA 3D3QA 1I3GH 3EYSL 3DA0A 2FT8A 3TYFB 1M3IA 4FQXA 1FFPA 3RAJH 4AE0A 2X41A 3BXNB 3CSPA 4TVPE 5FO8B 4AZUA 4KQ0A 4RFNB 2QGBA 2PWEA 4JHAH 4MJIE 3K5MA 1E65A 1RSYA 1RZKH 4P4KD 3REWA 2LVEA 4I87A 1FCGA 3P4MB 3VFWB 3IPEA 3WO4B 3U2JA 1BVLB 5GZOC 2PO6B 4YX2L 3UG5A 3KKYA 3O4LA 4WV1A 4LFAO 1IIKA 5MEPB 5AVVB 2GJ6D 2ALAA 4X0NA 3H6JA 1N0LB 3ZQXA 1L4IA 4NQVB 1NU1H 3BD5A 3GXUB 3V8OA 2WBWB 2VABB 1MZYA 5JQ6H 2XAJA 3ZE1B 5C0FB 3QHTC 5F96H 1HH9B 3MLRH 2NNFA 1PLBA 3Q7JA 4JM4H 5IVXE 1DZ0A 1CFNA 5HHPA 3D36A 1IURA 4QOKA 3BW9B 3RP1A 3UADA 1SFDA 2X3AA 1WPXA 3LXUX 1NBZB 4JI1B 5GJSH 1EZUA 3BVNB 2WC7A 1VZHA 4NBZB 5FF6B 3CGTA 4NXMO 3FHAA 5GRYA 4D0BA 4HJJL 4UV9A 3V4PL 2QPSA 3QDGD 4ZAKC 5TF1L 3WY1A 2EC9T 4XCCL 3FUKA 3VDAA 1FNEB 2P4KA 4YHLL 3N41F 5I23A 4PJBE 1WA1X 4I18A 1WUZA 3MJ7A 4X98A 1IGJA 4FQCH 4GEJA 2BSKA 5CN0A 2XN2A 1HZKA 3SGEH 1AHWC 2Y07L 3FQ4A 2O1AA 5T1DL 5JHLA 2DZEA 3QO0B 1CR9L 2GFBB 3ZHLA 1WP8A 2CDYA 1R46A 3K74B 5DD3L 1ZV5A 4A39A 3U82B 1NC4D 4HAGA 5IFAH 1RIHH 1BFVL 3LTVA 1FYTD 4ZS7L 4Q6IB 1KB9K 3FK3A 3HG1A 1BQHG 3OMIB 1QFPA 1DLBA 1UA7A 3HVDA 3CRRA 4PP2B 3ZDZB 3QULA 3ZHUA 4NLHA 4YSRA 5C8YB 5I71C 3P9MA 4HGWB 1GKFA 1A1MB 4IYKA 3ILQD 1A9BB 5INDB 4CN6A 5JWPA 1H2NA 1MCFA 4KXRA 2WP3O 2V9TA 1ZPUA 4BGDA 3MQIA 5D1QB 2AMGA 1MLBA 4X62O 3UXFA 2C4FU 3DIVA 3DPBB 3QNXA 4KDWA 5IB1A 1JGDB 2FBOJ 4FYSA 5C0BE 5I19H 3M1CA 1SQQH 4JKKA 3ZDYB 1YSOA 3GI8L 5EO9B 5JYLA 4OQTA 1N8OE 1JS4A 2GCYA 3F3HA 1THAA 3IS0X 3WMQA 3KPLB 3N43F 4FHJA 3DETD 2ZR2A 1FKAO 1ERNA 3MZGB 3DC6A 2XT1B 5K59E 2H8PA 5CILH 4N2LA 1JYNA 4HCIA 1VDGA 3RYIA 3A5VA 2DYPB 2H9GA 5KHHA 4GSDH 4Q0XH 4ZXBB 2IPKB 1AE6H 1X5YA 3BUYA 4IOFC 4U6VL 3QUYB 4KJWC 3WS6C 1WIOA 4KWUA 1OAUH 5AAMC 4YDKH 3MJ9H 2YEVA 5E8EA 1UD8A 1GCYA 2Z4QB 4QRUA 2EUVA 3DETC 1S78D 1LNUA 3UM7A 4A7GA 4HIHB 4B6ZA 2JJVA 1K8DA 4MXWL 2ZXQA 5KVGL 3OJDA 1SGKA 1SXBA 2WWNA 3ARBC 4XN2A 3VU1A 2D03L 1J5OL 2ETWA 4LXFA 5C0CD 1T2QL 2GJRA 2I60L 3QUZA 4LSTL 4MJ4A 4U3HA 4PTUB 5CSGA 4BQ8A 3GHEH 3ECUA 1UD4A 5F7FA 4H20H 5CIPB 2BIPA 5D5PA 2VITB 3D09A 2A6DA 1OWRM 2Z34A 4HETA 1CG9B 3D07A 3L5XL 4RFEB 5FM5M 1F6AA 1S7XB 2V17H 2YKKA 5G5DA 5KSBF 4LLQB 2P80D 1PSKH 4X20B 2CIIA 1HWHB 5D7IE 3VGHA 4OR1A 2E5LO 2IBGA 3H3KA 3T6ZA 4Y9BA 3EH4B 3ESUF 4J3SA 3ZQWA 4NC0B 4UQ3A 4UMGA 2CJ3A 3MRGB 2EZ0D 1NKDA 3FRPA 4IOSD 1YEHH 2DLHA 4O4IA 2JFCA 3C75A 3MRQB 2VXQA 4LPXA 4RNRA 3STLB 2DL9A 3QHFH 5EU6A 2OMTA 4WFGA 1PZBA 1U42A 4KZEH 2FGWL 3WXWL 2WQAA 2P5WD 1OZ0A 4TUJB 3E8VA 4JI3O 3GJEB 3B8YA 3DC0A 4PHZA 2GSGB 2EJ7A 4IS6A 5AW2B 3GTNA 3HB3B 5F1NB 4DGYL 5AVUB 3TO4A 3LDEA 1F3DH 1MCWM 4MLIA 5H35B 4WO4C 5IW6B 3DX9A 4HUKB 3NRQA 1YECH 4Z3GA 4B3MB 3JARA 1J0HA 5GRUL 1F3JA 5CJOH 4NT6B 1TSRA 1HI6A 4UCUA 1LD9A 4HKBB 3ARGA 3NZHL 3CP1A 4IJ3C 3WIFB 3F7VA 1EEQA 1UOKA 2A9AA 3FW6A 5E2WH 2GK0A 5DJ0B 1PL0A 3JAKB 3QQ9C 3QISA 2EIJB 4QHNA 7TAAA 3CN1A 1KEGL 2HJLA 4WKXA 5K9OB 2I5YL 4DIXA 2BPBA 1T1ZB 3ZK0A 4R2GD 4B0MB 4X6CA 3P0YL 4GFTB 4F9LC 4JCLA 5HVGB 4A7SA 4PJIE 5ABZA 4WHYH 5A2JH 1F86A 3FQNB 1EJOL 1ACXA 3EJJX 3QRBA 1FD9A 4FXLA 3S8FB 2ZE0A 1OF0A 2NW2A 4NZDA 1N5YH 3L08A 3QZMA 2Y6SD 2CR6A 3SDXB 4BDVB 1FXKB 5MEQA 4AEIL 2V0AA 5DC9B 1JF1A 3MV8D 5DHEA 2IAND 2G9HB 1UT2A 3VFNB 4DZBA 1FO0L 5E99L 3L3OA 5CEZD 1MVYA 2R9RB 5E7BA 4GIOA 3OB8A 4NB5A 1FZOB 2KDYA 3IDNB 1X5IA 4JQVA 3QDMA 3T6WA 4TQEH 1DVFC 3T0EE 2ZM6O 2DM3A 4P2OB 2EUXA 1GRWA 4TMPA 1IBKB 3V5HA 4F8QA 2OP4H 1XGPB 1BZQK 5DDHB 4DN4H 1U8JA 4IL6Z 3T1YO 2OR7A 1E28B 2B15A 3AQYA 2AFNA 2Z35A 4IRJD 35C8L 2DWDA 4KV5F 4J4PD 5B1BC 1AD0A 3DSFH 4IEFB 4QMEA 5DJ2B 3HR6A 4NZUH 3CHOA 1R19A 4M93C 1MFVA 2AXHA 2YPVH 2JB6A 4WY7H 5AW7B 3UTTE 4HX1A 5LHHA 4YPGB 3GMMA 2LU4A 2J20A 1R5WB 2OMWB 3TBWB 4X4ZA 3DLQR 5DO8A 3RWJA 1KUMA 2ZUWA 4JW3A 4OLYH 1CICC 4JZNB 1KLGB 4I2XE 2A0LA 2MTAA 2Z31A 4WSKA 4PDVA 4GW5B 3R8BB 1DJWA 1AKJA 2YBRB 2CBQA 4DP7X 2BDNH 4LLWB 1IKNC 4UV7L 4CJ0A 2EDMA 1WZ1L 2WTOA 4N3UA 2OYKA 3ZKMD 3QCUH 4ALAC 3K0GA 2QVMA 3SQOH 3H9SB 1HDJA 5EBLC 4KHTL 5ISZD 1GSKA 4RRPA 3OUSA 4X89A 1CF8H 1TQBB 3DTUB 1J05A 2AJUL 2PW1B 4BK8A 3IMUA 3I3EA 3CDZA 2UZXA 4WFAV 2B1AL 3OEEG 4G1EA 5IOKA 2R7EA 3RWDA 2X4UA 2OCJA 4NC2B 2B2XH 3A8TA 5AW3B 1VEOA 5DT1L 2AXFA 1RSOB 4J3WA 1Z9MA 2N7AA 3RT3C 1MKFA 3AQZA 3HE6D 1NTKH 4W9DC 5DGRA 1CO1A 1YPZB 5GGRA 1OOWA 3MLVH 4FEMA 3IWUA 2BX5A 4K3DH 4I50A 2BIIA 4F7PB 2QKIA 5LG6A 3MBWB 2WLMA 5A6MA 3JWNC 4XPFH 2ZKYA 4GNKB 2IQ9L 2ICWB 5FHBL 1QVGU 1IARB 1XR8A 1SYSA 3IDJA 4CDGC 3GUTA 3WU1A 1K4CC 3L3JB 3GIZL 2VW7A 4FNUA 3ZGHA 4ETQB 4Q6KA 2X28A 2ZIOA 1T2XA 3FFCD 3HE6C 4N24A 2X4PA 2BSBA 1FBIL 3ME0A 5F44A 5BZDB 4KKAD 3WG7C 3BZ4B 1NCDL 2Q10A 2EVHA 1NLDL 3BQUD 3U4EB 5GIRA 1F4MA 4GAYA 4HFWB 3WKNA 3K5RA 4BFIB 3KWWB 4TWKA 5G4OA 1YYML 1ZVSA 3PGFH 1DVXA 3GSQB 4N2CA 1FAIL 1S7VA 5FB8A 2R2BB 3QO1A 1LEIA 1TKWB 1CJYA 3BAIA 4OUUA 2OMNA 4F9PC 2N56A 3B7YA 5JORA 3KPPA 3S88H 4IOIA 4RMUA 1AAJA 3D39D 3HR5B 3TJHD 1VARA 2QKSA 4R8WH 1JD7A 4LGPB 3BQUC 1RPKA 3AG1B 3WIHH 1NR1A 4O4LB 5EZOL 2DQHH 1TQTA 4ZHQA 5EORH 4C4KT 1KT2B 1SXAA 5DD0H 2HX7A 2CJUH 4MDIA 3FU5A 1KTLB 4IBQA 4MVZA 4PJAB 1DE4A 2NSMA 4JO4H 3A67L 1ESOA 4QF1A 2G38A 5KSBA 2HT3D 3RVVC 3PL6C 5FFLA 2D9CA 2BZCA 1QRNA 4U1KA 4UDTA 4AYFB 2C4XA 3GKZA 2Y36L 4K9EL 1U3HD 4MMXC 1SXSA 3IRCA 4F93B 1I4FA 1SDYA 1A4JA 5EFIA 2FDBP 1YNKH 1K4DC 5E1IA 3DC5A 3C60C 4EKJA 1ZAUA 3EFFK 4NO0B 2NNXA 2DH2A 3DV4B 5FGCB 3RTQA 3THMH 1D9KD 2XYBA 3B2XA 2X6AA 5EU3A 4L3CA 4PBXA 4OCMC 3UAFA 3IFOB 5KYYA 4U1JB 4HWZA 5E51A 3BHBA 2F53D 3QO8A 3G08B 3NSJA 4DFIA 1HILB 3DVGB 3VG9B 4XMKL 3GWKC 2AMUA 2VC2L 1V05A 2LFRA 4EDWH 3L4TA 3S36L 1NMBL 3TXQA 2EXYC 2ZUUA 3Q1EA 5H37A 3O6MH 3L3IB 2F23A 3EYOB 5FWQA 5CCKL 1KCSL 2BZDA 1D9KC 3NCFB 3FQUB 2X89A 5FL7G 1KV3A 3S5LB 4JFFB 1UOVA 4IHBA 4UYPA 4MZ2A 2V5SA 3VI4A 4BQ6A 3QJUB 4GKJO 3VM7A 3E8GA 1J0ZA 4R97B 1MW1A 2X3CA 4DR2O 4OGXH 4V1DB 5AW4B 3B7SA 2Y2TA 3SQRA 2CU9A 2GIYA 3AM8C 4PJ8D 2Q9LA 4HJSA 3DXAB 5ICYA 5C3LD 1IGTA 5JXEC 5M7QA 1E9OB 4JUTA 1EAPB 4S10A 3QNZB 3H0TA 3QK0A 1U33A 1RZIB 1JMKC 2RACA 4JFXB 5FYLD 2HUEA 4HW6A 1UWGH 4YDLB 2KT6A 3U25A 4YC2C 4NQDA 4Z7WE 1B9KA 4JRXB 1WA8A 3FB5A 5C9KA 4WU7A 4W9EC 1A3ZA 4DKEH 3MUUA 3B34A 4I77L 2EIMC 3KJ6L 3PJNA 5C0ND 1PY0A 5CXPA 3HE7B 1NPNA 5I9QB 3L3DA 4XZUA 2DQMA 4X4KA 4YSTA 1GZQA 1PLGL 2Q86B 4YXHH 5HHVL 1IGFH 1JZDC 1EN6A 4LF9B 4R3SB 4R83A 4TL5A 3UH8A 4OD3H 3G9VA 3NFSH 5TH2B 1CFQA 5LJYH 3BGFB 2ATKC 1AP5A 4H13B 1E8WA 3OAAG 4OIBA 1KLUA 1GN4A 3R1GL 2BM3A 3UP1A 1G84A 1F41A 4ES9A 3P9WB 5JDSA 3SGKC 4RGNB 1FNSL 4S2SB 3HW7A 1E9PB 2UXXA 3R06A 2XJKA 3FFDA 3FKUS 1K5NB 2NZIA 1D5IL 1SQPH 3LUTB 4R26H 1YJWV 1ED3A 1NGZA 5KHJA 2E75C 2YRPA 3A47A 1X9QA 3L1OH 3OJVC 3WYRA 1G9HA 2WV3A 1X4XA 4P99A 4J39A 2D9QB 1E4XI 2UU9B 5LCVL 5DS8A 4YSOA 1CZ8H 1FH5H 2CUMA 1IX9A 3EO9L 4AKPA 2AZUA 4XT1C 5CFAA 3JD4A 2YS4A 25C8H 5EEYA 1RUKH 1JRHL 4GKZB 2XSKA 4FDWA 3WDHA 5JHAA 1GS7A 1MHPL 1XCQA 3LXBA 3E2HC 1KBGH 2GKIA 5ES4B 3CLWA 3PUUA 5C97A 3BH9A 4K2UH 3U6XS 3ZHFA 4X7SH 3RHWK 4FX5A 3LNMB 5IY5C 4Y4HB 3BCCH 2EEAA 5ADOH 1QCEA 1P5VA 3N2KA 4FMFA 2DW4A 1Q0XH 4MQSB 4UB0H 4IGGA 2YIDA 1I7RA 1S5HA 4LLDB 4KRMB 4N8CH 4PJ9A 5ANHA 3MV9B 5CD5D 1ND0A 1AS7A 2XVKA 3FJTA 5G55A 1E27B 2DQIH 1JPTH 3QR2A 1TTRA 3OFNG 3QQ4B 4JO1L 4XPBH 4TL4A 2BXYA 1A3LL 1JHKL 4L29B 1NDGA 4LGSB 1KELH 3E35A 1KPVB 3FAVB 1MVUB 3KDPB 2E27H 3NJLA 1P9MC 3Q3GB 5C6WH 5F9JB 4XNMA 5LHDA 1JZ6A 4FFZH 4TRPL 5C93A 1ZTEA 2X6CA 4L8DB 3GB7A 2PXYD 1RJLB 3P3PA 3ZKXC 1JX9A 2ED9A 1FVCA 4MHHG 1QUNA 5KSUB 4D7SA 1JDDA 1YQ2A 5DFWH 4FYRA 5ICZA 2O5YH 4XRCA 5GJTL 1TUEB 5AVTB 4BA0A 1YNLL 5C1MB 4F5CA 2PY5A 3QUMB 2XHNA 4EN3B 2HA1A 5ESQB 1J1XH 1E1RG 2DMXA 1FNLA 4DVBB 1NJ9A 4RA3A 2NY3D 2FATH 3B40A 4F7CB 2PXYC 3UTQB 1WP6A 5EF3A 5LXTA 4LDLB 4HUXB 5AYUL 5JMRA 4GO9A 4H8WH 4KK5D 3H55A 3X13A 4X4MA 2VOTA 1D7FA 3O3AB 5D2NE 4JCMA 2Q7AA 3CX5J 4GP8B 1KIRB 4WI3A 5DEJA 1A6TA 4PS7A 5B1JA 4UOZA 4Z77B 4A04A 2BNRA 1EEYA 2VLLB 5EU4A 5EEZA 4G6MH 5MEOA 1J7VR 1R3LB 2HCZX 3BDYH 3HKFA 4PREA 4YSAA 3L81A 1X5JA 5D5MF 5TF0A 3ARTA 1Q43A 3O0RH 5D1QD 4PWGA 3KNBA 1VFUA 5GRJL 3IPBA 4HIQA 4S1RH 5DMJB 5AVRB 1ZV2A 1RJYB 1WEJH 2RIKA 3N44B 5DD6A 1B0GA 2YD9A 4IBZA 4UM9D 5DC2A 2YK1L 3THOA 1A32A 1QI3A 3JAMN 1SHMA 1KC5L 5LB1A 4L5FE 3K0WA 3V5DB 1I8LC 1OQOA 3FN9A 2HWZH 2AQ2A 4HCGA 1ACZA 3Q13A 1MSPA 5FPOA 2NLJB 3KYOA 5AOMA 4PSRA 3A3YB 2VN3A 3G04A 2AV7B 2W6JG 1HL4A 3GSVB 3QUYD 4WF9V 4PMEA 1KTDB 1XHHA 5E6IB 5IF0A 2IJIA 1KGYE 1DN0A 4AIEA 1G6RA 3H4HA 5A7BA 4JFDE 2IANA 5LNEA 4QRPD 2BRQA 4BWUA 2W0KA 3B43A 4GKNA 4OZFB 1BXVA 1N3NB 4HS8H 1SF5A 4ZFFB 4EBQL 4DW1A 4NPYA 5F8RC 2BHYA 4FM1A 3LKQB 2JELH 4NYLA 4CH4A 2P5EA 1DFXA 4TNWK 5FUOL 5HDLA 1I82A 3TBVB 5B8CA 1OM3L 1NGXA 1F11A 3FQTA 4M1GH 5IQ9A 1N32O 3FTSA 1HSAB 4BH8A 5AZUA 2IGFL 4OJEH 2DPKA 4AIXA 4CC6A 5FC9A 5A2FA 2J4WH 3FUHA 4WJKB 4TUKL 1HINH 1Z9OA 1BGYH 3W5NA 3FPXA 4G8EA 1U6AH 4RQFA 5EOTB 2XA8L 5E6RB 1CMOA 4QXGH 2YS8A 3G5YB 4EEEA 3O9OA 4ZFGH 1TF4A 1ZHKB 4FZ8L 4AL8L 4CRPA 2FQDA 2BP8A 1A6UH 2R29A 3HZKA 3T4YA 4L05A 3TYGH 3AG4B 4F6EA 1FFNB 1FZJB 3P2TA 5D93B 1UOWA 3L2MA 4HIJB 3OLIA 3MRJA 4JAMB 4NKIH 2X7RB 1T6VN 1UXSA 2WJ7A 4PB0L 5AW0B 4H1LA 1KBVA 1BQLL 1KV7A 3GHBH 1WZKA 4FKEA 3TN0C 1IXMA 5DCCA 1E3FA 1A7QL 5I15H 3JV6B 3B7TA 4BUGA 1EN4A 1QBLH 1YEKL 1K6QL 2RH0A 5HGBB 1QG3A 4IBSA 4N0UE 4UNTA 1XBRA 4EOWL 3PY9A 4HUWA 4UCSA 3I9GL 5K1VA 1KGXA 2E46A 2VUYA 3KPMB 4JY6B 2FO8A 5IBLD 4NUQA 5ISZA 2F4VO 3QR1A 1WLEA 4A2GA 5H94B 2R2HA 3ZRVA 4G7VH 4H7VA 2YD6A 2W9DH 1N2RA 4XH2A 4N9GA 3US9A 5IM7A 4O4JB 1OCRC 4RUEA 1CDHA 1C7SA 2AGJH 4KO6A 3G6AA 4L4VA 4TULH 1WZMA 3ZE1F 3IKKA 4XVJL 3V6OC 1EEUA 1X6NA 2XUMA 3HPJB 4MA8L 5GRVL 3WIIH 2VH5L 4JQXA 3IXTA 5C6PB 2IAMB 2EDDA 4B60A 4L4JA 1BEYH 2IXQB 1T5XA 1MCSA 3WE1A 4L3AA 3X12A 1S6NA 3HHSA 5J12B 1EO8L 3NIDE 5ERWB 4EI0A 2CK3G 5IB5A 1C9SA 1BS3A 4YWGH 1EMTL 5HFMA 4J2XA 3E9TA 2VDLL 3WFEL 1INEL 1M53A 4HIIA 2B8OT 1AI1H 4ODSH 5GS2H 2HT4D 4IMKC 1HEZA 3I3BA 4JFHD 4JFYA 5FECB 3P3RA 4MDRA 3F83A 3GYRA 4LMQI 1GKOA 5J8OA 3QJHA 4KQ3L 2VLKA 5ESAB 1USQA 1S7WA 3FQRB 2P7TB 3FHEA 5C92A 2FQFA 5D6CB 4NJAH 4N8UA 3QEHA 4WUUB 1QSFE 3TS8A 3Q1SH 1HHKA 3SKOB 4ODVH 2ERJC 4NP4L 5C09D 4OD1H 3WNNA 1UG9A 1YEGH 2XIDA 4NSKA 2HT4C 1IAIM 1MW0A 4P2OD 1GN2A 1I94B 2OPCA 3NGBC 5A2KH 3R0MA 4OCYL 4JHZA 4HG4J 1WHPA 2WA3A 1D2OA 3KGUA 3Q2WA 1M42A 3MO1A 5DK2A 1SMOA 2CO3A 3LS5L 5D4HA 5GGTA 1HDMA 5KYUA 3V7AG 2Z3FA 3VQXA 3RGVC 2JGDB 1HQ4A 3OXSA 4MSWA 4O00A 2EP6A 4YBLC 4IBUA 5JIDA 5DRNB 2W8CA 2X1PA 3JATA 3MNWB 4YAQB 3H01A 3IM1A 3Q2LA 1R1BA 4M4RB 1OCWH 2VMDA 3BIKB 3ZDYF 1IEAA 2ADIA 3WFDH 4P2QA 2HJFB 1ZT1B 3CPUA 4MJHA 1JJOA 1QMUA 2WWKO 5C07D 4U6XA 3N85L 1SHSA 2H32A 5DJ6A 4WJ5B 5TE7L 3HRZB 3GHPA 4WENB 1S9WB 4KJYA 3X1GA 2MMXA 1D5ZA 2OTLV 2Q8AL 3TCXA 1AXTH 2DBJA 1QQDA 1P7KA 4JR9L 4PI2A 2BMKB 1KPRA 3TBSB 3VA2C 1S7QA 4R6UA 1COBA 4FTVB 3KPOB 4M62L 1BQZA 3DGCR 5T5NG 1PAZA 1HL5A 4MFHA 3WFBH 2YEZB 1SBBA 2LU7A 4F37K 1WT5C 3G6JE 3FOMA 4LHQB 3MREB 1KNOB 43C9B 1FFOB 1YMHB 2HLAB 2BCKB 2PUSA 4QO1B 5ITZB 4YDVB 5HP5A 1ACYH 2AV1B 2WB1A 4QT5B 4TSBH 3CSTA 1TVKB 3UBFA 1FC1A 3AXHA 3ERXA 4G9DA 1LQBC 1JN6B 4O2CB 1QI5A 3C6SB 3GQFA 2A06H 1KGWA 3OHMB 4G8IB 2GAZA 1UCBH 2X4QA 4OSUH 3NIFB 1OSPH 4DKFL 3AGWA 4TNFA 5I1EL 4DUYB 1RXLA 3WHE0 4HD5A 3PS6A 5KHKA 3QBTB 4WI7A 4EUPH 1P5UA 1VQ5V 4NM8H 2J44A 1XGYH 3K1KC 1QPKA 5EC2B 5LYJB 2ZYIA 3GSOB 4J3OF 4OZHB 4XCYA 5DRZA 5BR8B 5AD0B 4PJ8A 5AOJA 2B5IC 1MREH 2EH8H 4FQXC 4TSFG 1JF5A 2N4IA 3A6CH 5HHQB 2OWOA 2R4RH 1G4YB 1L5GA 1I9JH 5ACLA 4ZUUA 4YR6A 1YY8A 1M7UA 4JZGA 4TV8A 2CD0A 5A9GA 1OF2A 1OD9A 1YVLA 5JPMB 1Q0YH 4PV9B 4BA8A 4UV8A 1RLWA 4PRAA 2ADPA 5LGUA 3U7YL 4G6JL 4PJBB 2ADJA 2H1LM 2VLRA 4YHHB 4W1TA 3L5HA 3PUCA 4HCRH 1Q9KA 4OF7A 4K8ZA 2XTJD 3ZE2E 3C9NB 1N59A 4HHGA 3T3PB 2I9TB 4G8GE 5HXMA 3VYPA 3GMOA 5KA6A 2F5AL 2G75B 3B9KA 1LWRA 4MA3A 3ZT6A 2ZKHL 5J13B 4X80H 5JIIA 3JWNE 1SFHA 4AEEA 4PD4F 3D36C 3VM5A 2V9RA 5E56A 2VMFA 3DJ9A 2I7OA 4QPEA 1T4KA 2EVIA 2QA4V 2Y7QA 5DYFA 1DLFH 2G30A 5TD4A 5BVPL 2FJGB 4DR3B 2YMXH 5BZWB 4BSVB 3EFOB 1VQ4V 1OGAB 4P9MH 4ZFZA 2O72A 3FL7A 5ALCH 4IK7A 3KPSA 1MNNA 1NZRA 5AW9B 5EIVA 1UJ3B 5FYKU 1U91B 2QFPA 2YUXA 5JQIB 3EBAA 4XC3H 1EHXA 2CTRA 1JTPA 3OC5A 3O3BB 5DMKA 3BUQA 2H2SC 3IDIB 3RL1B 2HFGH 3APMA 2BVTA 5K9QI 5A2LH 2XX1A 1I9RL 2LFGA 3M86A 3P4LA 3QZLA 5E95B 5CBEA 1UQSA 1X6LA 5LWYL 4OLUL 1ZT4A 4F7EA 5KJ4A 4XBPB 4D3CH 2CO6B 4UF7C 4IIJA 1FG2B 4Q89A 4X1KB 2ENPA 2AJ3A 2K45A 1A7PL 2XOKG 3RX9A 1XR9B 5DZOA 1FL5A 4UT6L 4R4FL 4N8PA 8FABA 1VFAB 2P52A 5D7SH 3SDXF 5E03A 3AU1A 3U10A 4N2GA 1B0RB 4TQPA 4TQDA 1SEQL 3AS0A 4GKSB 3D3VA 4MZIA 4HC1A 3SYPA 2YHGA 2YXMA 3UJJH 4B97A 1P53A 3QDAA 5E8NA 1QQCA 5CA0B 3FQ1A 3TYFA 3VI3B 3U46B 3BXNA 5FO8A 4UIKL 4DGVH 5LAPA 4OFKA 4D9RD 2QMJA 4UTAA 2FGZA 1AILA 4BFOA 3IMRA 2DI9A 3R65A 5BQ7A 2UUCO 4UINL 4ABMA 1W72B 3UGXA 1ZVNA 1AVMA 2GUOA 3P4MA 5L0QC 3CLFL 5CR1A 5HYQB 2XACC 2QV2A 1HJCA 3C2SA 2Z4TA 5AL0A 2PO6A 4JFFD 4G6AC 5CEZL 5MEPA 2WQSA 4UCRA 1HT6A 1MFEH 3IEAA 3N0PB 5CP7A 1MQKL 4GYCB 4V1DD 1NEZG 2Z9TA 5DLMH 2H8PC 1KIUB 5IW3A 3K79A 4WJG3 5C0FA 2L7QA 3MA7B 5FFOA 4QNPF 1YN6B 3DXAD 1HH9A 1XZWA 3LZFH 1AOZA 3QB7C 1CLOH 4JO2L 4AEFA 5AENA 3IMTA 1YHPA 3BW9A 2YC1B 1IBLO 1JTTA 2IAAC 4IJTA 5FM8A 4ADGA 5AAWA 1U96A 1NBZA 1H38A 5FF6A 3BVVA 3BWUC 1I85A 2W1NA 1G7JA 4CL7A 2F15A 5KWYC 5HFLA 1UWXH 2P49B 5EU7C 4R9HA 5DWUL 2BIOA 4G6FB 1CS6A 4NXNB 1BQUA 2R29L 4JRXD 4XMLL 4ZJ9A 3QUZC 3RVTD 4PGJA 1NAMB 4U1SB 4I55B 3MV7E 4OZGB 4XNZB 1QNIA 4JKPL 4D9LH 3QO0A 3Q2CA 4Y16C 3ZX1A 4Q2ZB 5AVXB 3WTTA 1CFSB 4KK8D 3RX5A 3IDUA 1BQSA 3OAZK 4GXUM 5CJXC 3JD3A 3BRFA 1ZGLP 1TZAA 4JY5L 5JW4R 2P4AB 4Q6IA 1KYOJ 4WEEA 5IB3B 1QWUA 4H4NA 3WELA 3S4SG 1AVAA 2CGRH 4PP2A 4AC4A 1K9TA 1V7MH 5C8YA 4HGWA 3O2VL 1A1MA 1MSDA 1LP9B 4P59H 3MRHB 3UG3A 3VSVA 3K3WA 1A9BA 1AGDB 3ZYOA 2VO8A 1B6DA 3WEAA 5SX4H 5J2TB 1RMFH 4RGND 1JDAA 1N7MH 4KKQA 3DPBA 3TL5A 4FQLL 3AB0C 4KQ4L 3VXPB 1XIWB 2V5RA 3COOA 3G6DL 1X4ZA 3DROB 1GPOH 5EO9A 5F0LB 2DN7A 3LEVH 5HDQL 2BP0B 3TO4C 3TETA 1WWBX 4Y5VA 4HK0B 1FJ1B 2DL2A 2EEFA 1RIVH 3BD3A 3VSUA 1AZRA 1VQOV 4PGEA 4AQYB 4FADA 3ZHNA 3CCHB 1JV2B 4PRHB 4Q97A 3L9EA 3BWSA 3VDBA 1RCYA 2LU3A 2PNDA 4JMNA 2EVGA 3ARGC 2DYPA 4TV3A 4ZXBA 2DW5A 2IPKA 2ROYA 4FQ1L 4KRLB 2NMSA 3F7VC 4I85A 3QUYA 1PP9H 2L7EA 2UY7A 2YD4A 5B3NA 3IBOA 4I4TB 4NQED 4Y4HD 2Z4QA 3EGDB 4RWYH 3KPQB 4HIHA 1Q72L 1F42A 4KK6C 1VZIA 3I55V 4BFEA 5LGNA 3LRKA 5I5RA 2NZ9C 1FG9C 3MV9D 4FKHA 5GRXG 4F8TA 3MKKA 2EE6A 3CFJB 4RMSA 4PTUA 1PG7X 3EDJA 3INUH 3RZCB 3VOUA 5AZEL 1SOQA 4MQXC 3DI3B 4XP1L 5A16B 3KLKA 1CDUA 4PJAF 5GGTL 2VLJE 1CG9A 4Z7NE 2N1KA 1AB3A 1S7XA 4LLQA 5LL6Y 2QQKL 2YQGA 3L3OC 4RZCB 4K8RD 4M6MH 4X20A 3ULVE 1GA2A 4JO5A 4I1NB 4JQVC 4O58H 4PJXE 5FCUL 3F8UB 3W7TA 2EEDA 3BSZH 3TURA 2FLBT 4JGMA 5D7KE 5E4OA 3MRGA 4TNVK 1S3JA 3VVWA 4JMXA 2Z1PA 4EN3D 1MJUL 3MRQA 1TJGH 1DQML 3STLA 1T1XB 2ZG1A 4UWQB 3KGSA 4X65O 2WLLA 1N0XL 3DXRB 4YXLH 4J8QA 4EJ1C 4KXZI 1U8OB 3VQMA 4DP6X 3VFMB 1FL6B 4TUJA 2AW2A 2Q5BA 1U8HB 3GJEA 5DQDL 5F1IB 2GSGA 4RDQG 3N2GB 5D70H 4M5ZH 5F1NA 5JA8B 4MNGA 2ZUQC 5H35A 3BVXA 1U58A 4HKZB 1FV1A 2VDQL 5IW6A 4Z7UB 1BLIA 2YKLH 3T0XA 1R9FA 5AG9A 1PZAA 3S34H 4QJFB 2R0ZL 1U8PB 3RQ3A 3IETB 1J8SA 4JFVA 3N1FC 3NSXA 4PJGB 3OB0H 4HKBA 5TK4A 1T03L 3U30B 3RFRA 3ZRFC 1KCWA 2XFXA 1YAIA 2DJSA 3OTFA 3WIFA 2XX0A 4ODHH 4WGVB 1OAKL 2J25A 2IPTL 5DJ0A 2OMZB 2ZXCA 2Z7YA 2HKFH 4M7JL 3B7RL 1EUUA 1CFTA 2ZXDA 5K9OA 4A2MA 1M5IA 4FQIH 5K1PA 1T1ZA 2XBTA 1QZNA 3DK0A 3CRMA 3HN8A 4N26A 1D3CA 1XH0A 2HZHA 1F4WL 3CIAA 1EVTC 5CF3A 4E5XG 5I66B 1UD3A 5B22A 5BCAA 4U6HB 2MW2B 1AMXA 2EDWA 1VP7A 1HIML 2HTKD 1XMWA 4BDVA 1FXKA 4GI9A 3J8F7 3US0A 1WIPA 3WHXA 1NH2D 1HL8A 2G9HA 3KL3A 2EIKC 1RI8A 3LSQA 4AKQA 3LRHA 3HKCB 4WQOA 5JVDB 4OZIA 5DUJA 2KB1A 1VQ6V 3QXDB 1FZOA 4WFBV 3IDNA 4HYTB 3GZQA 1FNHA 4XO8A 1YUKB 4BRJA 3ELAT 2YIBA 2EQDA 2HTKC 2WQWA 3KWXA 3AY4C 3FUJA 1JNHB 3VX0A 1VQNV 3D6GA 1FZKB 2W81C 3TEUA 4NUMA 3ZBHA 3UPRB 2UUBO 3I9AA 5SWZB 3WTYA 3D12B 1KC8W 3PP4L 2X4TB 3RL2B 3IPFA 5LUMA 5DJ2A 2WLIB 4IEFA 2CRZA 5BRZB 4LCWE 1GC1H 5AG2A 4G70B 1DL7L 1W6LA 2DEYX 4XN5A 5I16A 1ADQH 4UUJB 6PCYA 3TGXA 3EYSH 1ECZA 4I89A 5D7JC 3LY6A 1O0VA 3HMWL 3MXVH 1R5WA 2G3MA 4YO0B 2PN5A 4PAZA 4E9LA 1J0JA 1CLVA 1FSKC 1RK1B 1WIUA 4WTZA 4FVMA 3V9EA 2Z3YA 3MOAL 3QJVB 2G5RA 4JZNA 1RK0A 4XTRC 4IYIA 2V6HA 4YX2H 1KTKE 2CO7B 4GW5A 4FQ2L 1KGIA 3RUGB 4OKVA 3K2IA 2VDRH 2YBRA 2E6PA 1URLA 2XQ0A 3K6OA 3SYOA 1M05B 1TR7A 2DMKA 4LHJB 1UA3A 2OI9C 4PJ5E 5MP6L 2H3NA 2IQAB 3P3YA 2VERA 4UTCA 2DLIA 1NEPA 2Z64C 3H9SA 4HXBL 2WVSA 3HN5A 3ZQ9A 2KPWA 1QLEB 4PG9B 3ZZ1A 4JG5A 2NPLX 5L3BA 4LF8B 1NTMH 5ACMA 3TASA 5I8KL 4Z1PA 4HJJH 3V4PH 3C3TA 2YLKA 4C56B 4XCCH 3UBXB 1RSOA 4ZD3L 4YHLH 1J1OL 1MFUA 1KIPB 2OJEB 5F7KC 2IAMD 3IJHB 1FAFA 1YPZA 3JVGA 3KH3A 2Y07H 3HS0B 5T1DH 5FKPB 4BZ2A 5F3FA 1CR9H 3F12B 4KTDL 4F7PA 5JOFB 2JVUA 3RNQB 3MBWA 1U8KB 3QEQA 3OPZL 4DK6A 5DD3H 4RWUA 3H53A 4XAWL 4LVNC 2ICWA 5KAIZ 3VNYA 2XKUA 2I69A 3L3JA 1BFVH 4ZS7H 1XB3A 3UAJC 1JF6A 2HRGA 3QEUB 4ETQA 5GRZA 4WRLA 3IAYA 4PTTB 2WGXA 5LLIC 3PU7A 4ICWA 2H26A 4A6YL 4EZJA 1ITCA 4E42B 2D73A 3CBKB 3L4VA 3N40F 4NHUB 3BZ4A 3INOA 1JL8A 1H3VA 1H9DA 4WUUD 4DV6O 3BCFA 1U36A 3MTRA 2APVA 4X8CA 3VQYA 3AQXA 2XZCL 3LN9A 4BFIA 5EEVA 4C4BA 2D7PA 2YUVA 3KWWA 4LCCC 3SOBL 1DK1A 1I9IL 2WOYA 3ZE0E 1JZ4A 2ZXGA 4FPPA 2R2BA 1T6BX 4XWGL 1PLAA 1ZJAA 1NCCL 3NCMA 3GI8H 3QWRD 4Z3IA 4HJEA 3QH3B 5GGUB 4W9KC 1LK2B 3ASOB 3WY4A 2WD0A 3HR5A 2FBJL 4XNUL 4P5TA 3SDAB 2AK1H 4W9LC 1TEYA 1G7HB 3VFPB 1E79G 2QR4A 3QG5A 4XBGB 5FYJD 4O4LA 2MTPA 4LEBA 3LKOB 1I5YA 1WFOA 3SGDI 4APXB 3HKZA 1IDSA 3OT7A 1KT2A 2PWGA 2BSTB 4GRWE 4PJAA 4ZO8A 4PIRF 3GSNH 3ARXA 1P2CB 4U6VH 4JBSA 2VZ1A 1A7RL 5JPNB 4L3FA 1BBDH 3CC5B 2F19L 1HE7A 2DM7A 1DQVA 2XY2A 4HU2A 4RGMC 1IL1B 4H8PA 4F8OA 1EDYA 4F7TB 2PCPB 4XXWA 4F58L 1H8HG 4MW3A 1ADWA 2KKQA 4OD2B 4MXWH 1F51A 3IGAC 2WB7A 4Q4EA 2ZKWA 1J5OH 2D03H 3K0DA 1KXQE 3LKPB 3O9WD 4NC1C 3VH8G 2CQVA 4FTVD 4NO0A 1T2QH 1N6VA 3DV4A 3QI9D 4QPJA 4LSTH 4OGAD 1GL4B 2Z8VC 4XNQB 4TQ8A 4QRTB 4HBCH 3CFIC 1HZHL 5EG6C 4U1JA 3BP6A 1DJSA 3ILPB 4MA7H 3CXHJ 4GO6B 2ZD9A 3DVGA 3L5XH 4FFKA 4KNTA 2AW9A 5BS0E 3SYQA 4ENED 3VBBA 3V6FB 3O9WC 5FGSA 2X0WA 3L3IA 3LDBB 4RMRA 3UP6A 3VGDA 4ANVA 4BEIA 3M7OA 3ML8A 4GO8A 5I1DB 4Y5XB 4CKVX 1EXGA 3S5LA 2E47A 2W5PA 1DJZA 1MW2A 3N1PC 3CFQA 3DX3A 1ZS2A 4RSYA 4N0RA 5HI4D 3IMWA 1TZ8A 4ENEC 1WTLA 1D5MA 2RMKB 2YD7A 4HEME 3ULAB 4AYBA 1F3RB 5IBUG 3CZGA 2N05A 2HLEB 4W4NA 2YBGA 2FTKA 4HWBL 3DX2A 2BFVL 5AAPA 1EM1A 3RVYA 2FGWH 2QT6A 1E9OA 2ZDIC 3WXWH 3NP4A 1EAPA 2DRUA 3MOQA 4JZJB 4JYAB 5L4MA 2DBLL 3K91A 4M4PA 3BYTA 3QNZA 2R8SL 4X4YB 1VMGA 1IEBA 4FM2A 1RZIA 4Z7VB 4JFXA 4DGYH 4TYUA 1FNGA 1S5HC 5F2VO 1KCLA 5FK9B 5J56B 4PRPB 1VFBB 4DK1A 3SPIA 2OX5A 1R17A 2I25N 5GRUH 2HLFC 4WU5A 3QPQC 4GUQA 1H2GA 2PF4E 5I6NA 1NKGA 2A2QT 3QR0A 3NZHH 4NKMB 3EW3B 2Q4PA 1JOIA 1U92B 4V33A 3HE7A 4U4IA 2B1GA 1OTTD 4XZ4A 4YHYB 3NTCH 3BPCB 4KROC 4I13B 3NEEA 4G11A 5CBAB 3FO0L 1KEGH 1JPGB 2I5YH 1AR5A 1RP3B 1OGAD 3VXSB 3O4LE 3GMRB 3P0YH 1BJMA 2NY4D 4JG0L 4R3SA 4HLEA 4HYOA 2J8OA 1YIJV 1EJOH 3QIBC 2CBPA 3DO7B 3S37L 3EGXA