3AG4B

Bovine heart cytochrome c oxidase in the cyanide ion-bound fully reduced state at 100 k
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag4B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag4B02
1BAWA 4G7RB 1ZIAA 3OMAB 2PCYA 4QLWA 4E9TA 2BP8B 2BWDA 2H3XC 3CDZB 1ILSA 3UADA 1AS6A 1NZRA 1TU2A 1JVLA 2DV6A 2HX7A 4GYBA 8PAZA 2FTAA 4P5RA 2BP8A 4A68A 2JFCA 1AS8A 4G70B 3FSWA 3CDZA 2I7OA 4KO7A 4W1TA 4BWWA 1M56B 1QHQA 1SJMA 4GP8B 4HCGA 2XXFA 4E9QA 3T6XA 3AW5A 3V9EA 3FSVA 5I6OA 1V54B 2YXVA 1JXFA 3JTBA 1XB6A 1E5YA 2GB2A 2XX1A 1OE3A 3BQVA 3FQ1A 2QT6A 2YAPA 4M4RB 1W6WA 2UX6A 1SDDA 3H4HA 2Y1AA 1HAWA 4UANA 2DYRB 2BZCA 4A2EA 4CSPA 1PZCA 2TSAA 4KO9A 3QJRB 2CJ3A 3S8GB 2JXMA 3CVDA 4NB7A 2PLTA 3GDCA 5B7MA 7PAZA 1AOZA 3NJMA 1F56A 2IWFA 2GHZA 1MDAA 1IC0A 2AANA 2VMJA 3AG4B 2CUAA 1AACA 1TKWA 3ABGA 1MZYA 2FQFA 2UXGA 3V9CA 1AZNA 2CAKA 3H56A 3QJVB 1RZQA 4YSUA 1ETJA 2OJ1A 1OE2A 1WA2X 4K9JA 3PXLA 2B08A 3RYMA 3QJSB 3G5WA 2HLEB 4Q89A 2OV0A 3ZDWA 1DZ0A 3NSFA 3WNIA 4A2DA 1JZGA 4YSRA 3FT0A 2N0MA 2VN3A 3GXUB 4P5SA 1AQ8A 3CVCA 3AG3B 4E9SA 1FFTB 2XLLA 4G72B 3QJQB 2Q5BA 3IEAA 1A8ZA 2HZHA 3NSYA 2WO2B 3FU7B 2PP9A 4G71B 1N70A 4HCIA 3U25A 2XVBA 1CURA 2IDSA 1PNDA 3FYIB 2J56A 2JKWA 3JT2A 4GP4B 1GS6X 5AFAA 1PNCA 1ASPA 1TEGA 3CZUB 4YSEA 1OV8A 4BWUA 1GS8A 2MRYA 2HRGA 1PAZA 1T5KA 1ADWA 2IWEA 4DPAX 4YSCA 1KBVA 5I6PA 1AZCA 1ZDQA 3WKPA 1N68A 3T71A 2BW4A 3ASOB 3NP4A 1JZFA 3ASNB 2FT7A 5I5MA 1J5DA 2PPAA 2GBAA 1NWOA 1HFUA 1AG0A 1GY2A 1W8EA 2TSBA 4HIPA 2GC4C 5I5JA 2IH8A 2QPDB 2EIMB 1E67A 2YAHA 1AR1B 2X87A 4G7QB 2VW6A 3UAAA 5FC9A 4F7KA 1JZHA 3PAUA 3X1FA 1FWXA 1ILUA 2BP0B 3KW7A 1SNRA 1AAJA 3IE9A 1ET7A 4KO6A 2BZ7A 4KOCA 5E9NA 1PCSA 3OM3B 1J9RA 5B7FA 4NAJA 4KNSA 2H47C 3CG8A 2YEVB 2EIJB 1W6LA 5I6KA 2VSKB 2ZWNA 3IBOA 3DIVA 2XYBA 4RH4A 3ABMB 1JXDA 3UACA 1OCOB 5IY5B 2XXGA 2XV3A 4YSSA 3QPKA 4DP9X 4F2FA 3S3CB 2W8CA 2Q9OA 2XU9A 1MG3C 3WNJA 3TA4D 2DY2A 2QPEB 4A2HA 2OCCB 2R7EB 2UX7A 3FPXA 4E9XA 2GIMA 4AI7A 3AG2B 1PMYA 1A4AA 2DWSA 1EZLA 1BXAA 3AY2A 1URIA 1CYXA 2EINB 1QNIA 9PCYA 4DP4X 3UABA 3FPYA 3S3BB 2CCWA 5I5IA 2UXVA 4DP5X 2AZUA 1ASOA 1JZEA 4GP5B 2VSMB 2IWKA 2QDWA 4PCYA 4YVUA 5B1BB 4ZK8A 6PCYA 1AZRA 5B1JA 2VM3A 1XMEB 1AIZA 1ID2A 1WS8A 1L9TA 2XX0A 1GW0A 4KNTA 4M3HA 1ZIBA 2XV2A 2FT6A 4BWTA 5AZUA 1BQRA 4UAHA 5ANHA 3NJLA 3EH3B 3X1BA 1KCWA 2UXTA 1CUOA 5D4JA 5AKRA 1NIAA 3FU9A 2HRHA 3HEIB 3H4FA 3NJKA 2ZOOA 4DP2X 2HX9A 2EILB 3PAZA 2YAOA 4N8UA 2UXFA 3DTUB 3FSAA 2PPDA 5LDUA 3L45A 2GI0A 1QLEB 3GYRA 1NINA 2XWZA 1AANA 1KGYE 1A3ZA 1BYPA 4PAZA 1SF3A 3NJHA 1RCYA 4YL4A 1SFHA 2FQDA 3FSZA 3EH4B 3FS9A 4WTQA 2I85A 3X1GA 1ET8A 5B1JC 2B3IA 4F2EA 1WS7A 1RKRA 5EHFA 1SHWA 2IAAC 2E86A 4DP0X 4FA7B 1KBWA 1BXVA 1OCZB 1YLBB 1TEFA 3FU7A 2FJSA 5TK4A 2IDFA 3D12B 4GY4A 1DYZA 4DP8X 1J9TA 3SBQA 4BDVB 2IDUA 2IH9A 3WG7B 2GC7C 4FAAB 1PZAA 1BYOA 1J9SA 1NIDA 3NP3A 2XV0A 3MX0B 1KDJA 1KDIA 2AVFA 4AKPA 1A4CA 1JVOA 1OE1A 4AKQA 2BO0A 3SQRA 1AZUA 1NPJA 4L0PB 1IBYA 4E9RA 1A4BA 3FQ2A 1GY1A 1VLXA 2NRDA 3DKHA 3T6ZA 5I6LA 1PF3A 4HZ1A 7PCYA 4AX3A 4AZUA 3TU6A 3TASA 1BEXA 1PLCA 2ZONA 2WO3B 2X88A 2EIKB 3KW8A 1HAUA 1GS7A 2PP7A 2YAMA 3IN2A 3N55A 4KNUA 3CVBA 4DPBX 1CYWA 2YXWA 3OMIB 5B1AB 3FQYA 3EH5B 5I28A 3X1EA 4X4KA 6PAZA 5I6NA 4A2GA 1BXUA 2QDVA 1IBZA 1R1CA 5I6MA 1BQKA 1PY0A 3EHBB 4BK5C 3AG1B 5TK2A 3T9WA 1IKOP 1ZV2A 1BQ5A 5B1KA 3ZX1A 4E9WA 1MZZA 2PCFA 1UATA 2PP8A 3TBCA 1L9QA 2WSDA 1AZBA 2BP0A 1I53A 3N2JA 5PCYA 2RACA 1IUZA 3OQRA 4DP1X 4HALA 3X1NA 5D4HA 2VW4A 1PLAA 3NT0A 2XUWA 3X2QB 5A7EA 1JERA 2FQGA 1WA1X 1M57B 3FYEB 2LLNA 1J9QA 1CC3A 1GYCA 1ZPUA 3NSDA 3AZUA 1JZIA 3NJJA 1RZPA 2YARA 4BXVA 1GSKA 2FNWA 4HAKA 1KCBA 3ABLB 5PAZA 2HXAA 4A66A 2J5WA 2J55A 2R7EA 1SDDB 2PPFA 3UAEA 1NTDA 1M9WA 4Q8BA 3ZIYA 3QJTB 3S3DB 1L9PA 2ZXWB 2IDQA 4GXFA 2BWIA 1KYAA 2VM4A 3WIAA 4BXSV 3WI9A 1AS7A 1XB8A 1OOWA 2AFNA 2MTAA 2YQBA 3PPSA 3NJFA 4W9ZA 1KV7A 2A3TA 5I26A 5D4IA 4TXVB 1ZDSA 1E30A 2FT8A 4MFHA 1E65A 1L9SA 3MBWB 4DP7X 3NJNA 5F7AA 4KOBA 4YSPA 2BHFA 5B3SB 1A65A 1SFDA 1OF0A 1JOIA 1WA0X 3EF4A 1AG6A 2GSMB 1JZJA 1X9RA 4NERA 4JHVA 3T6WA 4EF3A 2YAEA 4A67A 1SF5A 1EHKB 1ET5A 1OCCB 1NWPA 2FQEA 3NYKA 1E5ZA 3PLYA 1XB3A 3SBRA 1X9UA 2DYSB 1SHXA 4JKNA 3WKQA 3PCYA 4E9YA 2VW7A 4YSTA 3TBBA 2CALA 4G7SB 4ENZA 2PPEA 2H5UA 4HCFA 2W88A 2AZAA 4YSAA 3FU8A 2CBPA 4WKXA 2P80D 3HB3B 1GR7A 3ERXA 3OMNB 3IN0A 4YSDA 4E9VA 1NDTA 1V55B 1J5CA 1OCRB 2J57A 1NPNA 1L9RA 3OD3A 4UF7C 3UGEA 3ZBMA 1MG2C 3T6VA 2FWLB 4YVNA 4CSZA 3QJUB 3QQXA 4DPCX 4AKOA 4BDVA 4YSOA 3C75A 4KO5A 1FA4A 2PPCA 2P80A 1L9OA 1WAEA 3NJGA 2IDTA 3NJIA 4JHUA 3S8FB 2HX8A 1PZBA 1V10A 5F7BA 2YAQA 4HHGA 5B7EA 2DWTA 1B3IA 1NIBA 1ASQA 2BW5A 2YAFA 2I7SA 1NIFA 4A2FA 1NICA 1JXGA 4N4YB 2Y69B 4HHWA 1PLBA 4DP6X 4QKTA 3SBPA 4YSQA 3NSCA 1NIEA 3BVDB 3PAVA 3ABKB
chains in the Genus database with same CATH superfamily
2NXYC 3MRRA 3QXTA 5CGBA 2A7WA 2IVFC 4ANUA 1G9NH 1V05A 3PWVA 5DYOA 4LF4B 4Z7UA 5EO0B 2XPGA 4BK4A 1OCZC 1KB5H 1CL7I 1O5DT 4A7QA 4Z7QB 1WFMA 1I1AC 3UADA 2VLJB 4UCRA 4DW1A 1DVFC 3LS5L 2FO1A 2GCYA 3FOLB 3QUZC 3VQ2C 2BOCB 3CJHB 5E8DH 4DCQA 4PG9B 3INOA 1NANI 2OWOA 3FTUA 3UG4A 5L2KA 4PR5A 1YJWV 4BWWA 2I7OA 4JREC 2F1MA 4LP8A 3S37X 4RMTA 4ODWA 4YWGL 2X4OB 4Z1MG 2PYEA 2YK1H 4TMPA 4ZDHA 1FNFA 1I4FA 3GSUB 3BJ91 1T22A 5CUSH 4X8JB 3HOGA 3PDGA 4JFZH 4POYA 1E5YA 2UXNA 1YVLA 2P8LB 3B3IA 3D69B 2XX1A 3M1OA 4OLZL 4ZXBC 4IBSA 1PIFA 3MLXH 4QRTB 3ULUL 3L3GB 3TJHC 1ORSA 5B1AC 1Z0MA 4OJFL 2QT6A 1S7TB 3NDZE 1F4XH 2I07B 3KPSB 2VQ4A 2AK1L 2FEEL 3GM0A 4FP8H 5MERB 4GNKB 1BW8A 4J5VA 3O2VH 1I9RH 3CVHH 3IFLH 1YF2A 1WBYA 1JUFA 2R8SL 4Y2LA 4NQQA 4LF6B 4PLOB 4B9CA 5C0EB 2GTQA 4PCTA 2X05A 5DUBA 4FMVA 3KBPA 1EFXA 2C1OB 4YR6A 9CGTA 4EFBA 3LDDA 3CC7V 4MD0A 4ES9A 1M6UA 1TKWA 1HHHA 1T7YA 3GMNB 3H56A 4BW9A 1E8XA 4WK4B 5GS1C 4L4VA 1GAFL 1TUBA 1RUML 2B5IC 5F93C 2G5BB 3PJSA 4XNUH 3UBXI 5D7IB 3FB6B 5I1GL 1O7DC 5F3HA 4HS6B 4AY0A 5LDSA 1AXIB 4QD2E 5EH1A 5FDWA 3HZVA 1S7SA 1RJLA 1ZLEA 3O0RH 4OZ4B 4QRRA 4H0HB 4V2CB 2EJRA 1U3HC 3CDGB 4JO3H 3UTZB 1AQMA 5HJBA 2Y2WA 1AO7D 4BE6A 5JUEL 4OLVH 5JHMA 3QJQB 5FA4A 4K9EL 2PYLA 2Q5BA 5CLZA 1J87A 3V52H 1AH1A 2NLJC 2AJYL 1UFGA 3GSRA 4DXWA 5K5YA 4OGQB 2CK2A 3WFEH 2CH8A 1XH3A 3TFKD 1CF8H 2YUZA 3D36A 2HTLD 3ARGB 3GSVA 4FMKA 4I2XE 4J4PA 4L1SA 3TXAA 2J56A 1AXSA 4XVSH 2NXZB 5FW7A 4DUYB 1BJ8A 2PYFB 3HKEB 2ILMA 3BWAB 1PEZA 3BWUF 2WKGA 3PQYE 3DJRA 1H2KA 1Z2GA 4J41A 1QBBA 3MOAL 3SYCA 2DQJH 1E50A 1H6UA 4FLOA 4ZHQB 5MENB 5I15L 1EEYA 3WLBA 1WISA 1DTUA 2DLEA 1A9BA 5E08L 3DHPA 2XTJB 2VRQA 4JI1O 3UQ8A 3VXMA 1KBVA 1E90A 2APTA 1N68A 4TNVF 4AJYV 4BKSC 4PSPA 4C57C 1UKSA 5ITBL 1QNZL 1V7ML 1G1XB 3FO2A 1E6JH 4MSWB 1AHMA 2Y5QA 1U8NA 3FT9A 4JB9H 1IBGH 4LHQB 2IDCA 1UTDA 4FQXB 1DUZA 2TSBA 2Q2LA 4X2UA 3ULSA 4J3TA 3SDDA 3FN0H 1KBGH 1O9VA 1UD6A 4DYLA 3MODH 1JK9A 3MJ7B 3HBQA 2RDCA 3IRCA 1FJ1A 1MJ8H 1N4XL 1TZGH 3MREA 4F6RB 2HPTA 3NCWA 4V11A 2ARWA 4ZJ9A 1ZRUA 3CQPA 4D0DB 4MD4A 4AUJA 3T8XA 3NFSH 4YLBA 2G5RA 2YD7A 3CK0L 1DUYA 2VXVH 2WNXA 5KW9L 3HB3C 4KK8C 4KOCA 2Y9RT 2Y6TE 4BH8A 4EN2A 5EBWA 3RYFB 1P7BA 1CBVL 3QUKB 5CLYA 1F51A 1XIWD 2F53A 4TQDA 3KGRA 1HOEA 3AK3A 4WFHD 3S4SB 1FL6A 1OCWH 5JW4Q 5ESQB 2W60B 5GISH 3S96A 4KUCD 4QHUB 3SYOA 2WQSA 3KPNA 2LU7A 2ADJB 3DVIA 3GSNL 4RWYH 3V2AR 1F1AA 3QUGA 3N1FC 3EDKA 2R7EB 4DGIH 1E1QG 5DMGD 4ODSL 1RMFH 1IAKB 3VX1A 3MRLA 4UILL 1M1XA 1ZVSA 1DJHA 4WFFD 5BO0D 1YZZA 2Q8VA 1LQBC 3FQRB 4LSSH 1HEZA 5F7YC 5HHMD 2AK4B 1W2BU 1Z5WA 2Y4SA 4X64O 2ZPKL 3NTCL 5IF0B 4NN6B 3ZHNA 2CTQA 1NBVL 2AZUA 4BFIB 3HVDA 2EIDA 4M4RA 3ES6B 5LBQA 3TFBA 4DVBA 5EO9B 2FO8A 3LTVA 4OZIF 1TTRA 3QB7C 5EC1B 1NSNL 4HMDA 4KZDL 5HGDA 4N1EA 2Q7NA 3V6FB 3DK2A 4TVPD 2MK3A 1JNHA 2V8MA 1ED3A 3O2WL 1HJCA 4P2QE 1XUQA 3QEHA 1QBZA 2QTSA 2WKOA 5FYJE 1IAOA 3OUSA 2BZDA 3O3AA 4LSQH 4Z0BL 2Q76A 3C6LD 4JRYD 3EYOA 4WO4A 2HKFH 4QJ3B 1BVNT 1FL5A 3W5MA 1CXZB 1XO8A 2V2XA 4X9HA 1OP5H 5J1AB 1VF7A 1DQJB 1DQML 4XCNB 5DO2D 2IOIA 1N10A 4WI0A 3HFML 1NAMB 2B8OT 4R8WL 4X7EC 3MRJA 5K93A 4C56B 3QA3A 1C8QA 4U3FH 3BI9X 5LDUA 2ATPB 2HRPH 3F12B 1OLZA 5KMGA 4X98A 4F8NA 2MPVA 3D08A 4JQVC 4UYPA 4IDLA 5TF1H 3OR7A 5CEXA 4PGEA 4PLJC 2Q0OC 3EUUA 4JDEA 4FLVA 1Q0XL 4NNXB 3UGUA 2W6IG 3BZ4A 1XXFC 5DMYA 1R5WB 3WEMA 4XNAA 1KWGA 1NCCH 3BIBX 3MTXA 1QFWL 2DJUA 5D96C 1I9JL 1M7IA 1U3ZA 2VABA 1H3UA 5ISZA 2LHAA 1BXVA 1BMFG 3TN0C 5TK4A 3G3LA 3MRPB 3IETA 4FQIH 4J2QA 5BNXD 2BOLA 5CJ8A 5E6YA 1TG8A 2C3GA 4BDVB 4K35A 4R0LB 1HXYA 3W9DA 4HWBL 4PJBA 1RU9L 2ZX6A 1TR7A 2PW1B 3T1FB 4JQIA 3C8KB 3AXIA 4XPAL 1P7KA 2X4PB 4XNXH 4HG4K 4X50A 3T4ZA 3CZFA 4ZFOB 3EDJA 3RLSA 3QO1B 3EH2A 1E9QA 4XP1L 2HVJC 1IBYA 2QR4A 1AR4A 5I8OH 2FCBA 1ZTXH 4Z7NB 3CFEA 3K71A 3TASA 4PJDF 3S3PA 2BNRD 1XXDC 3MNMA 1FVEA 2DMGA 2WLYA 4HOXA 3MV9B 4KTYA 3NH7H 2RBLA 1OAZL 5L3DA 1TZHB 1CYWA 1HCVA 4KI5D 5EOTA 4L1BA 4Z5RA 1GYAA 3X1EA 1NMBL 4U6VL 5EZLB 4JF3A 3CV5A 3LIZH 5LMNB 1Q3EA 5HDOA 5HHPB 1HIMH 3UL4A 2X40A 1F41A 4WW2F 3JZ7A 4YLCA 4TOIA 3TVMC 3QI9A 4O5LL 1IKOP 5I18L 5KVDE 1MLCB 2HJLA 4TPRL 1MZZA 4PA9A 3U0WL 3IGAB 2EH8L 3FBKA 3L70H 3PWPD 4G6KL 5JDSA 3VTMA 1IGYA 1YAIA 3DUSB 1I53A 1YIJV 5IBLC 3B7UX 3CFKA 3Q8AA 1U30A 3JV5A 3WLWD 5F2VO 1JMXA 1PG7W 2DJSA 5HI4D 4UB6Z 1KBBA 2NY6B 3B6SA 2QMJA 2YI9A 3RYCB 5DUML 5F89B 3VGGA 4JI6B 4GSDL 2F5BH 3RUGB 3VJ6A 4X5QA 3FZUD 1JDCA 4AGMA 2H1PH 3WL9A 3MRCB 5IBUB 4MZ3A 4Z7QF 1DEDA 1AO7E 4UOZA 5I1LB 5IWLC 4QTHA 5F6IC 5D70H 3L73H 1MCOH 1TO4A 3QR0A 3EYUL 4I48A 4ZMYA 1EAQA 3QAZB 3GB7A 2CUHA 3F5TA 1SVCP 1B0RA 3BGMB 5E8OA 1BQLL 3MKGA 4X5PA 3UBXG 4N5EC 2R0KL 3HI1B 3QPXH 2D7MA 3P4MA 5HY9A 3RWJB 1SPDA 4K3DL 4I18B 1HHKA 4TULL 4TSFG 1L9PA 4P46D 3QIBB 3HHSA 5I1EH 3P1VA 5IQOA 4HUWA 3GI8L 3QARA 2XZQL 1VGKA 1NTKH 4JDTH 3D39A 4TV3A 1KELL 1AS7A 1G87A 2K7PA 3MO1B 4PV8A 5KBLA 2VZTA 2OI9C 5EBMA 1MHCA 3LRKA 5K33A 4PHXA 2D0HA 2NDGA 2XFXA 5JIHA 2AKRA 2AXWA 4HWNA 4MTMA 1XGZA 1WQVT 3EJJX 1HN1A 3HR5B 1LE5B 1FV1A 4LSTH 5F8RC 1HZKA 3VXSB 4KDTC 4L9LA 3GRGA 5IHUH 4Z77B 4C83B 4JI8O 3VD4A 4HZAA 3M17B 4EDWL 3Q06A 2VSDA 5I2IA 1T20B 1T7XA 1X7SA 3U4EA 3UTTD 4CS4A 4XP6H 3O3DB 5HYSA 1QFUL 5KBNC 2OCCC 1PG7L 1I7UA 4PYHA 3K8MA 2KQMA 3U0PB 2E76B 4KHPO 3FN9A 3KXFB 1FJGO 1R3IC 3PCYA 3QWOA 5DEFA 3CVIH 2CALA 3CFMA 3K1KC 4U49A 3JSNA 1UOKA 5D7IF 5E2JA 2UZYB 1DQDL 1C5DB 3OC8A 1D9KD 3P4NA 3HS0B 4OU3A 2ZQKA 1QKZH 1DJIA 1Z9SB 3SBWA 1WWCA 4IIZA 2VDQL 2GFBB 1MRCL 1NH2D 1QPXA 2V3FA 3RYIB 4M6NL 3RWCA 1J5CA 2J57A 2EQDA 4FCHA 4S2SB 4CC6A 3A6CL 4GW1A 4WFHE 5KAQF 1EO7A 5BW7C 4U6HB 1GPOH 3BSGA 4YZFF 4DUZB 2H2PC 3UJTL 1I1AA 5LGYA 4YVNA 4CSZA 3LKRA 1DVFA 4IRSD 3EYVA 4E0RB 5TE4L 3GBMH 4B3RO 2J7LA 3Q1SH 3QUZA 1FPTH 3OF6D 4I55B 2Z31A 3IDMB 4H0LC 4XDKA 4P2CG 5IJDC 1TNMA 1DN0A 5CS7A 4XPGH 4WFFE 4K3EL 4F37F 3S88H 4CC1A 4RWUA 1YEEH 5HHME 2GSIB 4L05A 1P5VA 3J2PA 3MRIA 5ITFB 1ZSDA 5GS0D 4OIIL 4D8OA 2I60L 2V17H 2W9DH 4MXVE 4NN5C 1OB1B 4OSUH 1R24B 4ZXBA 4PD4F 4G1EA 1TUEB 4NKQB 4RMBA 2XA8L 4QKTA 5KWYC 1TTBA 3BWZA 3K72B 4W68A 4ZFQA 1MY7A 2BSDA 2FX8L 5D93C 1IZ3A 1S8DA 4TVPE 3ICXA 2FLRT 3BWUC 4K5PA 1B4TA 5EZOL 2R2CA 4WNQB 4YE4L 3VNYA 4H37A 3S36X 1T6BX 1YECL 5JXED 4Y19B 4G9FA 5I24A 1QWNA 4JRYE 3GIVA 4WHDA 1A14L 3E8BA 2RR3A 2H94A 4JN1L 3PGFH 4PD4J 3TH3T 3HCVB 2A9NH 1VF5C 3NCJL 2WQUA 3KH4A 5DO8A 2ZX7A 1S2EA 3NZ8B 2L04A 3F7QA 3V4PH 1JZ8A 4Q52A 2F54B 4ZSOE 1EGJH 4J6IA 1HHJB 3FCSB 5FFLA 1AS8A 4HFWA 4DEWA 2XT1B 4G80A 5GS1A 4E9QA 3AUVA 1NCUA 3L54A 2HT4D 4JMXA 4P9HL 1MCSA 4LEEA 2R56H 2APVA 2YD6A 4GXUN 1SQXH 3FSVA 2QKCA 4HHAA 1DJXA 1T1XB 2FECI 1F3RB 3MRNA 3OPZH 4MA7L 4Q9BA 3ETTA 4YS4A 1HNWO 2VXQL 2BRRL 4IBZA 5LCVL 3BGFC 4M9PA 4NQXA 4IS6B 2Y1AA 2E9WA 5F7DA 2XXMB 4MKMA 3L5JA 1MAJA 2DQ3A 4NNYA 4L4VD 2XQYA 3DRQB 2JXMA 1L3WA 4NB7A 4ONGH 2KG7A 1T04A 4WJKB 4XMWA 4QJ4B 1CDUA 2DQEL 3LKQA 3B2DC 4W9FC 4PGDA 1IBKO 2ZWKA 3SOBL 3CFBA 3IJHB 1N34O 3NA9H 4QRRD 3DETD 2F5AL 3EW3B 3ZUNC 4PN6A 5EZIL 5BJTB 2BNRE 2QQNH 2YS4A 3EJTA 3K6FA 2XAHA 4H5SA 2A9DA 4O2FA 3WUWA 1I8MA 2DBJA 4L37B 5F7MC 3GSOA 1EJOL 1UM6L 1MREH 4YHHO 4HAGA 5AYUL 3RYMA 4YHYB 2Y7QB 4PJEB 1M2VB 3G9AB 2OV0A 4PJCB 4I4WA 3NSFA 3BXNA 1NFIB 5C0RH 4P9ML 2BY2A 5JH7A 1T4KB 1S9XB 4NSKA 1AQ8A 1VP7A 3BKJH 3TXQA 2VTFA 5K1PA 4E9SA 3KPLA 3ROLA 4JI1B 5T33H 1PDKB 4YHKH 2FEDD 2OTPA 1FDLL 1LEKA 1N0NA 4ERSL 5J13C 1V27A 4ZI7B 2JSFA 4X65O 2UY6A 3FUJA 3PWPE 1MFEH 5ACZA 5I0XA 1II4E 2KS0A 1F90H 3OZLA 5J2TB 4NQCB 4U1IB 1JE6A 1OTTD 3LXUX 2XOTA 2RALA 4WENB 3GTNA 2WP3T 5C0AB 1L6XA 4QNHB 1K8AW 3K6OA 3US0A 3C5JB 1IM3B 4B9PA 4XMKH 2NZ9C 1MW3A 5DCCA 1YEFL 5AAWC 5IFAL 3KYNA 4W6WB 2UVEA 5D5MA 1L1FA 4M8QB 2O1AA 4FXGA 2BSCA 1PAZA 3GSXB 4HIXH 4IMLA 5EIIA 1EZUA 1JGIA 1FNAA 2Y0IA 3MACH 2GK2A 3O2DL 1I1RA 4ZS7H 4F9LC 1ZLVH 5F7HA 2ITEA 3LSSA 2VSCA 4JE4B 4U7KA 4ABWA 4FNRA 4AL8H 1YMMB 4UB8Z 1RZJH 1U8IB 2AXGA 1XZ0A 2H32B 2ZCEA 3CHPA 3FB7B 1IGML 2WD0A 4PRPB 5DWUL 5I1KL 5F71A 2FHFA 2VR8A 4UTAH 1A4JB 1PNKA 2GYSA 4Y5XB 4YIPA 2DQGL 1Q94A 2KZBA 2N56A 4MJID 2PWFA 2A74C 1JPTH 1ORQB 3HHMA 4QHKJ 5L9DH 5EBGA 4Q97A 3VMPA 2EYSB 2X0WA 4Z7NF 1JD9A 1E8ZA 2PXYB 4JANB 5GZND 2F53D 3X1FA 2PWEA 2EDRA 5EYPB 1KTDA 4GJTB 1PD1A 3INUL 4AQ8C 2ZX5A 4K7FB 1YJDH 4J3SA 1BS3A 3CFCH 3HRPA 2OXGB 5E9NA 3MROB 3NQKA 4NUGH 2B1HH 3ZHLA 3VRJA 1MCWW 4KKRA 4U3SB 3EFOB 2P8MA 2R83A 2R27A 4GSRA 4JVPA 2YEVB 2FIKA 1PKQB 2JJWA 4BH7A 3F7YC 3UTTE 4QRSB 5CWSA 5T1LD 3BAEH 2BXZA 2N1KA 3MRGA 5IY5B 3OZKA 4X7FC 5C07B 3WNMA 4JGNA 5ETUA 5FM4A 1XH2A 1ZHNB 2OXHA 2DM4A 4LBEB 3RPIA 4GFTB 3GQFA 3I3EA 1I8IB 1PZ3A 1O6VA 1RULH 4WW2C 3B09A 3T0WA 5KG9B 3LQAH 3TF7C 1FHNA 3RUGF 1G6RL 1P7QB 3ARDC 3O6FB 3T0AA 1BEYL 4UIKL 3V4VH 4JQVA 4CNIB 3QIWD 2EVFA 4Y9GA 1MCBA 4HUCA 2AABH 2IOMA 3V5HB 3SKJL 1ASOA 1TNNA 1QLEH 3LH2L 3SPJA 5SWSB 1CGVA 6PCYA 4J7ZA 1Z32X 1TENA 3WXVH 3OBAA 5GSVB 4F93B 1NDMB 1Q9WB 4WTXA 5GXBB 1ZAUA 1UWFA 5BUPA 2VXUL 2F66C 1XMEB 4GXUM 4NKDA 4XCEB 3B5TA 4RIRB 4DQOH 2ZYIA 4P5TB 3I6SA 4BK8A 4I4TB 1GKOA 2MH4A 2ZXDA 2YWZA 5KOMC 2XV2A 3V7MA 3DURA 2FT6A 2J8HA 4OBRA 4M6ML 2NW2A 2CBTA 1BZ9A 2OX5A 2DM2A 2XBZA 2WLIB 4QIRA 4I0XB 5T3ZL 1FORL 5CZXD 2BOCC 3ARBB 1K2DB 1RUPL 3NJVA 4L3EB 3X3GH 1BOGA 4H26A 2GQHA 2R23A 1NH6A 2W1NA 4JO5A 3WB1A 2WLKA 1YEJL 2HVJA 2NYYD 2X1XR 4U1HB 4QXTA 1XCTA 1MI5B 3DTUB 3LEVH 3FW6A 4D2NA 1S9YB 5FHAH 1T7VA 3T2NH 5ISZD 1B6UA 4U0RB 4ZPVA 1Z0NA 5D2NB 4GO8A 4OGXL 2DIJA 5EIQA 2ZM6O 3ESPA 4ZTOH 1N8ZB 3PXHA 2Z0UA 5I19L 1JDDA 1YPZB 3OB0H 3P30L 5DEZA 2WUBH 2Q8BH 4AT6A 3AY4C 4GYCB 1W0WB 4UBDC 1CICB 2WOBA 5KYWA 2UXCO 1TLMA 3C60B 4UV4L 4HLEA 3TVMA 3L9RA 3L3IA 1EEZB 1OGSA 3EDFA 4NJ9H 3FU7A 1YY8B 4TWKA 2X0LA 3NZUA 2AJSL 4QHKI 1HILA 1RSFA 1US6A 3QUXD 3UZVA 3VQ1C 1A3LL 3ZTDC 3EO0B 4NS0A 4JI0O 1HOCA 1D5AA 3C87A 1KBPA 3NQIA 1ZHBB 5IJ9A 1M7UA 5T1KB 1QR4A 4P05A 4JO8A 4R7DA 4MA8L 3HG2A 1RIUL 4FC3E 5F88B 5EOQL 1MFVA 1BCCH 1Z9NA 1G5AA 3QZWA 3RN4A 1RFDL 2OYLA 4DV1B 4Z0XA 3BPZA 4YFEA 1IB5A 7PCYA 5JOPD 3U7AA 5ICXA 2CD0A 4CVXA 3QFJA 3FB6C 3VGFA 2ICWA 2ZONA 3RY5A 4NM4L 5SX5H 5IWLA 2OFQA 2EIKB 1C08A 4JR9H 5IT9N 2PP7A 3IN2A 5CO1A 2R2BB 5A16B 1Y07A 3SPVB 5I1HH 2EACA 5JNYA 3K2IA 2Z7WA 4TKWA 2BC4B 1ZANL 4L4VE 5FECB 3M99B 2B1OA 1L0QA 3QCVL 4JGUA 1WWAX 1QHPA 3GO1H 4D0CB 1HNXO 4Z76B 5KVDL 3JAWB 1HCZA 3VWKB 1NCDL 3QDJB 5EF3A 1RIVH 3HBGA 5HHNA 4OGQC 1D6VH 3GZQA 1HHGB 4LSRH 3ZDZB 3FHAA 3ARGC 3P9MA 3SJBC 2F95B 1Z9MA 1YEDB 2DLFH 2CGRH 2RACA 3N2JA 4HJUA 5FYKD 4HNAB 1IUZA 5ALCL 3V0FA 2Y1ZA 4KROB 4DP1X 2WXJA 2DQFB 1ADQH 1HINL 1GMIA 1BL8A 2DI7A 4N24A 4N2LA 4Q58C 5BQDA 4PLKC 4N0CD 1KCKA 2NW3B 1BCIA 4H2AA 3FQTA 4MNHA 4XPFL 5F7KC 1KJ2H 4WSJA 4WU5A 4WJG3 2XTJC 3TYGH 3FTSA 4NTXA 4KDTA 1HSBA 1M57B 2BVTA 4AJ0A 3K2MC 4N3UA 2G60L 1J9QA 4HH9B 3CCJV 3TA3D 3BFWA 4I77L 4LLQA 4HKXB 4OD2B 5KUMA 3GMQB 4P3DB 2VDNB 2ICEC 4K3AA 4MSWC 2NQ3A 2GITA 3A4FA 5EC2B 4F91B 5JXAL 1BG1A 5DJAA 2Z4QB 4FQXC 4PWHA 5GTIZ 1MFAL 3NN8B 1DSWA 1RUAH 4DSYA 2P24B 4D6TH 4YDKH 3UAEA 2HG5C 1HW7A 3ARFB 4OFYD 2P3YA 1LE9A 5JHLH 5AWNH 1EZVX 4KHXH 4LAQH 2EDTA 4JI8B 4XH2A 1TQWA 1LMKA 4H1LB 2EDWA 2Q3ZA 4K8ZA 5IJ0B 5KN5A 2EJ1A 2VISA 4UQ9A 1SYSA 1CXFA 5CINL 3SOTA 3HMXH 1U8PA 1MJ7L 5IHBA 3FTZA 1KIRA 5CCKL 2EC8A 3PP4L 4MXQC 2YGQA 1KJVA 3I3BA 4RMSA 1SYVA 1DEEA 1MHHA 1E30A 1ZT1A 3X3FL 4KHPB 1FJGB 3HKZA 5KAQG 5BW7A 5C3IA 4Z95L 4S0HA 3OT7A 3OKOA 3T65A 4ZOCA 1JOIA 2DQTH 3EJZC 3ECWA 4FLXA 1LDPL 3ARPA 1ND0A 1G1CA 4F37K 2EJ7A 1I75A 3E2HC 4NKIH 1P4LA 4MJIE 5GRWA 1DANT 2HN7A 5ABZA 3MJ8A 3U6RB 3AG7A 1FGNH 3I84A 4QTFA 2NXYD 2JJ1G 1IBLO 1S5HB 3QXWA 1E5ZA 2F53E 4OM1H 3LPPA 2JCCA 3DIDA 1IZJA 3GJFK 4NP4L 4B3RB 3TTYA 3ZE2B 4CGTA 1VQKV 2JB6A 2QV2A 4NUJA 1N0XL 4ENZA 2V7QG 1PEWA 4PJEF 1XR8B 4PJCF 1BHGA 1DVFD 1A9VA 4PP1C 1FI8C 1OAKL 3I75B 4NN6C 4XMZA 4YUEL 2NSQA 3B5GA 1AQKH 3FCBA 4QTIH 2CWRA 3ESNA 3ATFA 2DI8A 4A2MA 3HRZB 1LO0H 5EC1C 1J0ZA 1HH9A 1LO2L 3OD3A 4LT7A 1V3LA 5I17B 2F8OA 4FZEL 4JPRA 2D0GA 2JKXA 3MZGB 4X99A 1N5AB 1CFQB 2VR4A 4N2OA 3ZDXE 4NQDA 5DI8A 3S9DB 3ZMZA 2VZ1A 3S5LB 3MCKA 1C12A 1WA8B 4ZXBD 4G59C 3FQXB 3G6BA 1YZBA 3W1ZA 3OHXB 3TJHD 5A9GA 1R9FA 2O5XL 5FLUA 1U93A 1OT4A 2SEBB 2E74B 3CFIC 4LASL 3GMPB 1MPAH 2X1OA 1T5WB 5HXMA 3C6SA 2VQEO 4NIYE 4G9FD 3Q6GL 1IKFL 1NEPA 1NICA 5DD0L 1KXQA 4G3YL 2R1XA 5CR8A 1RJCA 1N8OE 3D6GA 3QO5A 4W70A 1OSPL 2C9XA 2DJ4A 5BZDB 2NTFB 5EF0A 3E22B 3M8OH 4FLHA 5AVSB 3N43B 3MJ9L 4HIIB 4F57H 2XY2A 1QG3A 1BAWA 2ZNJA 5D7KD 4GUQA 5EU3A 3ZRXA 4CL7A 4KTDH 4G1MA 3OMAB 3TBWB 2PF4E 3MLRH 2H3XC 3L3JB 5AYTA 3IDJB 1R6KA 1QEWA 1HNWB 3DI3B 4FOMA 4QHNA 3V0AC 4RESB 2HX7A 1MH5A 4R9HA 4S1SL 3EJUA 2CIIA 4R0LC 4OV6F 4GAFB 4Q20A 1T89A 3D85A 3QEGL 5ISZE 1VQNV 1U3HD 3ILEA 4MJHA 4RNRA 1PNLA 3QAQA 4YJ2A 2XXFA 4GBXC 1MOEA 4MNGE 4FI7A 4N6QA 3OJVC 2HFTA 2FJHA 4WZ9A 3AT8A 3FO1A 4KRMB 4J1UA 4HXAH 4DR2O 2FYYB 2CHZA 3LXAA 3OWRA 4Y9EA 4N21A 4PJHF 4PJBE 4TL5A 1IBKB 1EV2E 2RGSA 3K2KA 4XP5L 3ZZ1A 4M7JH 4R84A 2QWQB 3DGEA 2WXLA 1N34B 3EFDH 4OCYL 1HNFA 4MWFA 3GT6A 4OZIA 5GRUL 1JQ0A 3NSJA 3GI9L 4H0GA 2HKAA 1HAWA 6FABH 1FBIL 1JYVA 3FFOA 4L3CB 5E6IB 5TDNB 2TSAA 2EUWA 4LQFH 1X7QB 2W0KA 3UPRA 5JQGB 1M05B 2B4CH 3QNXA 5EDXA 3IGAC 4R7XA 5F8QC 1KWKA 4PRAB 3TWCH 1Y18A 5AOJA 5JOPE 4X65B 3FF8A 4K94H 5ID1B 1AACA 2K9PA 1KYOK 1JFQL 5FK9B 5GGVY 2GIYA 4QRPB 1RZQA 1XF3B 4NAMA 5E99L 4OF8A 5DJ2A 1GIGL 2CA3A 4F9LA 3ELAT 1NVPD 3TGUH 4UDTB 3F05A 1WZKA 3GXUB 5CBEA 5KSUA 2Y48A 5EULV 1B4JL 2OR9H 1S3KL 2AV1B 1HQ4A 3HB3D 1NL0H 3BUYA 3QAZC 4KK8D 3BHPA 2XWCA 4F7MA 2A74A 2BVQA 4UINL 1C8PA 32C2B 5E4OA 4GG6B 5B1BC 1A8ZA 1LGVA 2G75A 3M1BA 5FYKE 4I18C 3FTXA 4JFVA 3QIBC 4WWOA 4P49A 2XVBA 5TH2A 5CP7A 1UZ8B 5C0IA 3WFZA 3FQWA 2IH1B 5FL7G 3BPOB 3CZSA 1FFRA 2ADFH 3JT2A 5GSRB 5H94A 5C1MB 3TCXA 1RZGB 4HS3B 2ZOUA 1JZ6A 3KBFA 1YPZF 2R29L 3AU1A 3MLYL 4UT6H 4X62O 2EUXA 4Y2OA 3GSNB 1I7TA 1IC4L 1GAFH 1TJGL 3UJJH 4UOQA 1SS3A 5E4EC 3ZVVA 5FPIA 1OJHA 3HNTH 4QRUB 5EUKB 5F0JB 5I1GH 4ORZC 3WHE0 2Z0AA 3SGEH 1QRNA 2H3NB 1JN6A 4NC1C 4S0TD 2V2TA 1MRDH 5CA1A 3TP4A 1MY5A 4JI4O 1NWOA 4YDZA 4AV5A 3N91A 2J1ZA 1NJ9A 3C12A 2C9UA 4LCIH 4KTEL 1JVMA 1VA9A 1P4UA 4WW2A 1H5BB 4QMEA 5MHSD 1JF6A 3H7BB 3I6GA 5KVEE 1AR1B 4NO2A 2GUZA 3B2XA 3ARDA 4M8RA 4C4BA 4UCTA 4KFZC 5MI0B 3IS0X 3HPJB 5FLVA 4HQQH 5IBUG 4JGMA 4ZTPL 1J1PL 1WT5A 2R9AA 4MVBC 3WDIA 4HUXB 3BVTA 5TE7H 4OJEH 2YC0A 3HMWL 3HS0C 4LLUA 4OCXL 6TAAA 3IDGB 5D72H 4APQA 2H7WA 1Y1UA 2VXSL 5E8EA 5DHVB 1ONQB 4EEQA 5E1AB 4L3FA 2W0XA 2NT0A 4DKTA 1TJMA 4GIPD 2Y25A 1WWBX 5J12B 4JNXA 1EAPB 3STBA 5EO0A 3OM3B 5B39B 2OZNA 1U8KB 1FXKB 4Z3FA 3E8VA 5KSBE 2DF3A 2VLJA 2UZPA 4A55A 3ZSSA 1IEBB 3APFA 2XV6B 3NIGB 4PFEA 1OSYA 3ZDZF 2XACC 1A0QL 1UM4L 2BOCA 3FOLA 2LVCA 4PLJD 1CK0L 4OF7A 2ADGB 5AVTB 1WTLA 2RCSL 4U3HA 3S3CB 1P1ZB 2BY0A 1GTFA 2FSDA 4B3MB 1A6VH 1HYRC 5DZJA 2FB4H 1QCEA 4A2HA 5HGGS 3TT1L 4AI7A 3GSUA 3LSQA 1NEZB 2DWSA 2R72A 1J9CT 1KCSH 1PTZA 4GQ9H 4X8JA 1R75A 3TN0D 1EDQA 3V0JA 2OSXA 3ZIMA 3DOSA 4BQCA 4Z3JA 4MQXC 1XTLA 2P8LA 1K8DB 4X6BB 2VMCA 4PCSA 9PCYA 5JOFB 4LWSB 4J7RA 1Q4NX 3L3GA 1X3DA 4NPYB 1G9MC 2WYHA 1S7TA 1CG9B 3AVEA 3AY4A 2I07A 3KPSA 3L5WB 1T6WA 3A0OA 4J3XA 1PFOA 4OFVA 4FN0A 3SE4A 5KVFH 5MERA 3B7TA 4OJDH 3CZJA 4RRPM 2QJ1A 5LP6A 1AI1H 2G5UA 3ATEA 2GIXA 3DVNB 1KJ3L 4M3HA 1ZIBA 2DYPB 1HP8A 3LZFH 2ENSA 3H01A 3EBAA 4Y9CA 5INDB 3I6KB 4X1KA 2JK5B 2VGLM 5ANHA 2C1OA 2B9BA 3X1BA 3GGWB 2J20A 4L1HA 2X6CA 4O2EB 1RUQL 2EEBA 2F1AA 4GX1A 5MEQB 2L4OA 3OXRB 4TNWK 2YUAA 4FQCL 2PO6B 4B7IA 5HGAB 4GMSL 3RWFB 3GMNA 3T0XA 4WI8A 4DGVL 3ZT6A 3PAZA 1NCWL 2YXHA 2VRAA 3TO2B 3OD4A 1H8SA 1JZDC 2CE6A 1Q6IA 2G5BA 1FRGH 3AACA 4P57A 4UILH 4AYEC 4JI0B 4PA6A 5IFHH 1BX2A 3TVMD 2J1KA 3K1DA 2Y6SC 1T03L 4HS6A 1URLA 3KM1A 3LQZB 5D7KE 3AQYA 1IT9H 2QR0A 4A6YH 3BLKA 4XCYB 2GTSA 5C09B 5IBLD 3PHOB 4H8HA 4OZ4A 4YL4A 1SFHA 3G5XA 2X4UB 3CDGA 5A2CA 3STLC 3UTZA 2RHEA 5E51A 1GGBL 3H8NA 1EHXA 1U2YA 3FH7A 2FZ3B 1GW6A 1O7DE 1M1KW 1I94O 4G5AA 4OT1L 2B3IA 4PJFA 4PWJA 3SDCB 1SOKA 2HP4A 3OAUL 5C0DB 3AS1A 3ZE2F 4ANXA 5ABAA 2IDFA 1VJSA 1KGIA 1DYZA 4DP8X 5IMOA 3ARGA 5LG1A 4MDIB 4TSBL 1QR9A 2VAAB 5IR1B 3BA8A 3FFDB 4N5UA 2BSKB 1WB7A 1YYLL 5D6DC 2EULA 2KMWA 3HKEA 2PYFA 1UT2A 1E2WA 3N27A 3SYQA 3BWAA 5G4NA 1HNXB 4LSPH 1HXKA 3ISYA 4ZHQA 3IM1A 5HDBB 5C8JA 5MENA 4AKQA 1UGKA 3BZ5A 3G6JB 4N5ED 4O2BB 5CJQH 1MWAL 4U6YB 3OWEA 2DW4A 5AL0A 4GAJL 4YHYC 4ZODA 1N33B 1RHFA 1LL1A 3H3KA 4NZTL 3S3XA 3K6DA 4MSWA 5JW3H 2DH2A 2PR4H 4LDEB 3R65A 3F7VB 3D0VB 1E9OB 5CN2A 4F9PA 4CMHB 2VN5A 3KLHC 3EYSH 4F8OA 2HLFC 4P3CL 3ULUF 3MJ7A 1R19A 3SGKA 3DHJA 3C5ZB 1N5YL 1MSWD 1MSDA 5I6MA 3SDXE 4F6RA 3C2AL 3WFCL 4AQOA 2O6CA 3LMJH 1I3GH 4H4NA 3QUYB 1IKNC 3MNZB 4D0DA 1OAUH 3ARYA 3DX8B 1OCRC 1DE4A 2ZF9A 2C4XA 4E9WA 3CCEV 4EZJA 1IVSA 3T4YB 1IGTB 2PI5A 5IT2L 1WFUA 2EDMA 4C55A 2D03L 2B1AL 2DD8L 1KC5H 3DX2A 2UUAO 5J6HB 3RYFA 1OSEA 1DANU 4EKWA 4F15B 2XZCH 3QUKA 1OHHG 4WI3A 2P45B 4UM9D 3T3PE 4ACPA 2AI0L 3DSQA 4DV6O 2WN3A 4XMUA 5BOJA 2OAAA 3ECVA 3F84A 1UYWH 4QXUL 5CIPB 2F58H 5ESQA 3S4SA 1S72V 4Y4FD 2W60A 4BSVB 4R4NC 3SEPA 2NSMA 4QHUA 4JFDD 2ADJA 3FB7C 4NC2B 1CLOH 1PIGA 4ATWA 4OLYH 2VDPL 2R7EA 4IU2A 2VDQB 3NFPB 4Y5XC 4LDCA 1CLZH 2FWOA 1IAKA 3HFFA 2ESVB 4X0NA 1GGIL 1RZKC 2K78A 5G4MA 1Z9LA 1CIDA 1ORQC 5C9JB 2H2PD 3K57A 1PLGL 3FQRA 4OD3L 4EIGB 1CR9L 4KY1H 4G42B 2PXYC 3HLAB 1KN4H 5IF0A 3GS7A 4AQEB 3NEOA 3VW3L 3L3DB 4FQ1H 4BFIA 1DHKA 2N74A 4B41A 4LEBA 3ES6A 3NJFA 5EO9A 15C8L 1J8HB 5JMOC 1TA8A 1A3QA 5DUMH 3VCLB 3WFHB 3V6FA 1OK0A 4BZ2A 4CU8A 2AJZB 4RMUA 3CLEH 3MRFB 5EF2A 2CUIA 5F3FA 4NERA 3ZXAC 4EPSA 4HJ1A 4NJAL 5MHSE 3LNFA 2G3ZA 3IMSA 4KMQA 1A47A 3MA7B 2IQAB 4PELA 1YHQV 4XNMA 1FZJB 5DD1H 2X09A 4FS0A 4NOFA 1TZAA 3D9AL 4JY5H 1E8WA 4UDUB 3U2SA 5BMFL 4XCNA 4LBEC 1COWG 4F3FB 3TNMB 3W2DH 1NAMA 4C56A 1IM9B 2WSSG 3IVKB 3SBRA 3ZMRA 1UWEL 4Y4HB 2ATPA 3H55A 2VN7A 4HZLA 3W7UA 3F12A 3NESA 2CG9X 3O6FC 2AQ1A 3L2NA 4TL4A 5IJVB 4GFXA 3GNMH 5KYYB 4MS8C 1PV0A 2WSPA 4NNXA 2XKUA 3KEDA 3W56A 4M5YH 5HHOB 5HFLA 3Q7JA 2HH0L 3LYRA 1R5WA 3JATB 3KCWA 4MVMA 2VQEB 4YDLB 4UTBA 5IB4B 1UM5L 4UQ3B 5JJJB 2FUTA 2ZOKB 4PTTB 3ZKXB 2X4TB 1L9RA 3AREB 3T8MA 5DF0A 3B4SA 1H3PH 4P5TC 1EX0A 2WNGA 2XHBA 4NZRH 4GG6F 3MRPA 1OO2A 3S5ZA 2YA2A 1XNRO 5FR3A 3QJUB 3QQXA 4BDVA 3H1KH 5F1NB 4A5UB 1U2HA 3HW7A 3K91A 1FZKB 1OZUA 4BSJA 4MJJA 5F96L 1M9SA 3C8KA 3MHHC 2X4PA 3ARBC 1UT9A 4UQAA 4ZFOA 3VFMB 2QGBA 2YJLA 3QO1A 2PYJA 1F5WA 1RQ5A 5T8IA 1OAXH 2OJZL 3LNDA 5IVXE 4KXRA 3HE6B 2G38A 3P9WB 5CIPH 5DK0B 2OSLB 5KS9E 1U3NA 4POZC 4L0YA 1QQCA 1KKCA 3BISA 4PDMA 1XCQA 4U0RC 3RNQB 1PLBA 4O9HL 3MV9A 5D2NC 5GIRB 2DQIH 3LUTB 1TZHA 1EHLL 4GSXA 2YN5A 3ZCCA 3BUTA 1KG0B 3US9A 2WTPA 2IJIA 3UC2A 5EZLA 5CJBA 2P22C 3V4UL 2BCCH 3D85D 3SPIA 2VLKB 4HFUL 1H2GA 1CICC 4PJ8B 4H0IA 4WHCA 3C60C 3IDUA 3QCTL 2HP8A 4JZGA 3SGDH 2PCYA 5F9JB 3K5RA 2VH5L 4OF5A 1MLCA 3CDZB 2NZIA 4WVRA 3N2KA 1U6AL 3O41B 1YEGL 3IGAA 3PNWB 4Y16B 3RP1A 2WXHA 1JVLA 3DUSA 3LB6C 3CBJB 1BM3H 4GYBA 4X8XA 5JQ6H 3N9GL 3GDBA 4TVSa 3UAFA 1AGBB 1OB0A 4BIZA 2CK0H 4QXGL 4EBQL 2OZ4A 4KXDA 3FSWA 4G6ML 4L5FE 4TF4A 3RYCA 5F89A 3W9EB 1OOAA 3L2MA 2BY1A 2VDRL 1GK9A 3RUGA 4WHYH 5DURB 4N87A 2NPLX 5E56A 3AGVA 3V9EA 4GUNA 2WWNA 3MRCA 3N40P 1YDXA 3L5HA 3MFGB 4KWUA 3TBTB 1EHAA 2YXVA 4XPBH 4KVPA 1K4CA 5DFVC 2EIKC 4ASUG 2ZP9A 4TV9A 1IVLA 1YY9D 3NIGF 4I2XB 1ECYA 4QOKA 3ZTJG 1SQFA 1YCIA 3HNVL 4G8GB 2QHLA 4QCIB 3IT8D 2NZ9D 4XRCB 1YECH 4JPKL 1DFBL 5TDPB 3BGMA 4ZQKB 4WTZG 1IFHL 2BSTA 3HI1A 3MCYA 1DN2A 4U1JA 1ZEAL 3RWJA 2O61B 4EZKA 1I8AA 1PZCA 4OD1H 1Z5LB 1ZXKA 5GZOD 2CJ3A 3VWKC 1JWUB 3QIBA 1CWVA 4WI7A 3BH9B 4GQPH 4FQQB 1W15A 4E42B 7PAZA 3VFVB 3ILQC 3EFFA 3QRFM 3MO1A 1ZGLB 1VDGA 3V4PA 3CN2A 2Z5UA 5L88L 4KROC 3AG4B 4PJIB 4U7MA 4P9HH 5BVPH 2Q8AH 4FHKA 5IVZB 5JHBA 3GRWH 3UT5B 1NC4D 1NBMG 1FKAO 4B3TO 3HR5A 1LE5A 4DR3O 1T1ZB 1OWWA 3CC1A 1BLIA 2HFEA 3VQMA 1M57C 3FULA 3ZHFA 4HOMA 4C83A 3BN9C 1P4BH 2XZAH 4X62B 2VN3A 1JCKA 2JDIG 1WEJH 1C1EH 3CVCA 1T20A 3K2UL 2J1YA 5EC2C 4LU5H 4GLRI 4QI3A 3SO3B 3VYNA 3O3DA 1Q43A 4NWUH 4R5VA 5DJ8B 4ODVH 1BBDH 5FYKL 1MRFH 2BWQA 3ARFC 3U0PA 4B3VA 3KXFA 2Q7YA 1D5RA 1OP3K 3CFTA 2UU9O 1P2CB 5CA3A 4JI4B 2OMTB 2UZYA 1C5DA 2HLAB 3PJNA 4TLSA 4PJ5D 1K73W 2J88H 1DSFL 4N86A 1HESA 1D2DA 3FYIB 5GQBA 3QYCA 4S1RL 4HC1A 2OL3H 1PNCA 1TEGA 3CZUB 1XH0A 3RYIA 3KLSA 4F6EA 4S2SA 4MXWL 4GKSB 1BJMA 3S37L 1O6SA 1YYMH 2DDQL 4U6HA 4QDGA 4JHWL 3MSPA 1YN6B 3WE1A 5IZ7A 2RQ6A 4JFDE 4OLEA 3WTTA 3R8BB 4LFHG 5T5FH 3ASOB 4MMZB 2I9TB 1G6RB 1MFBH 5LB1A 1CGSH 4WEEA 3O4OB 3A8TA 4I55A 2YIBA 2FT7A 1BPLB 2LAAA 3C9NB 2PPAA 4FXKC 4LSVL 2GBAA 2P46B 3OSVA 1AG0A 1K6QH 2XIIA 1UEYA 5AKVA 1TVKB 2EEXA 3LHPH 2CDYA 2GSIA 1A7OL 5KVEL 2CTPA 3BEVB 1WBXA 3GWJA 1VSCA 5HDBF 5ITFA 4G43B 4FYRA 1T7WA 3G6JF 5IB2A 4ZMTA 2SODB 1OB1A 1OHZA 3BIKB 4ZMAT 3CH8A 3MUY1 1R24A 4S0SD 1VQ6V 3MBXL 3K72A 5H2FZ 5CB4B 2PCFB 3KKYA 2DQUL 3TH4T 3CAFA 4AHCA 4CSTA 5FGCE 5I1DB 2YLHA 1JGLL 2ZWLT 2DQDL 1SNRA 3AQZA 4NAQA 1E3XA 4WNQA 3FSOA 4YC2B 3E83A 2IGFH 5CNHA 3FHEA 4YLQT 3FTVA 4AEFA 4B9IA 1E7VA 2IXQB 5H2BA 1LD9B 1UOWA 2H0JA 4DWHA 1W91A 3RWEB 3QNZB 1SQ2N 4NQVB 1D2OA 4EUPB 3H0TB 2BNQB 5I23A 4TYUA 1MA1A 1JPSH 3HCVA 4H1LG 3SQOL 3V8CA 2AJUL 3NZ8A 3BVOA 1JXDA 2F54A 4FNPA 1WPBA 1HHJA 1XQ8A 1YI2V 1J1OL 4AH2B 3FCSA 3HC4H 3OHXC 3FUKA 3ULUC 2E74C 5C93A 4PPTA 3ZDYB 4UBDD 3JD0A 4TUOB 5I71B 2Y24A 4XWGL 2QQLL 3O3EB 1TYEB 4R7VA 2CPCA 4Y2NA 3CMOL 3P69A 4MW8A 2OP4L 3RDTC 1P84F 2B14A 3QG5A 1T1XA 3N3EA 1URIA 1QNIA 3CSTA 1A4KB 1QFWI 2Z7YA 3PL6C 2CQVA 4NIKB 4I9XA 4BAYA 4E2OA 3TOPA 1LP9B 1WK0A 5BV7H 1YEIH 3GWKC 4IJTA 2DRUA 4IS6A 1NCJA 4Z3EA 1M71B 1A32A 2AP2A 2YC1B 2WCGA 3LRSB 5IW6B 4H8WH 4XVJH 1HH6B 1KXQE 3V5KB 3HZKA 3BPNB 1KNOA 1P84J 1VFBB 3DRQA 5H6QA 3P0VL 4BWTA 1N64L 5JYMA 1OGTB 3HKDB 5TFSL 5JLZB 4FJCC 5KTEL 4XAWH 2A9MH 3LZRA 3K59A 4UAHA 4AENB 3UJIH 3L3HB 5D6DA 4TSAH 2BSRB 2H6OA 3KCPB 1CUOA 1I94B 3JWDC 1INEL 3IJHA 4RLDA 2GAZB 4B0MB 3DC5A 4PI2A 5BJTA 2MEJB 1KCUH 4GSQA 2FBJH 2A7BA 2BCMA 3KWWB 4LDLB 5ICYB 2QGCA 4FFZL 1MJJB 5FNVB 1UB5B 3J80N 3T1CA 4K9EC 4X83A 1WZ1L 2Y7QA 4PJCA 1M2VA 4PJEA 2ZD0A 1NFIA 4U1NB 2DW5A 3C3SA 4OZFH 2ZWZA 2OMXB 1BYPA 4PTUB 2ZE5A 3WDHA 5JPNB 1JI2A 1S9XA 4LNUB 3ARGD 1SF3A 4N8VB 5JMRA 3WAJA 4RMQA 4ALAL 5A2FA 4OKDA 3L4ZA 3X14B 2AJXH 1GYWA 3CMEV 3IGFA 3WKNA 4ZI7A 5DTFB 1ACYL 3ILDA 2JE8A 4F1SA 1WS7A 4NXMB 1N67A 3HG1A 4FA7B 2V7HA 5FYJH 2Q87A 5J2TA 1AD0A 1CT8B 2GTZB 2XTJD 3IMTA 2KBGA 4NQCA 4M6MH 4PS4H 4U1IA 4KTGA 3L1OH 4W4LA 5C0AA 5HDQH 2WINB 1CE1L 4FNLH 1AO7B 1R34A 3SQBA 3SPCA 5F1OB 2APFA 3WIHH 1AE6L 1IM3A 1RUPH 3UERA 3B2UC 3MX0B 4FQXD 3M45A 4HWZB 1VKXB 4M8QA 2BVEA 4TQPA 3H42H 2K1EA 2XN2A 3GSXA 2MCAA 1JGVH 3QTCA 2QKIB 1Q6UA 1PY4A 1K92A 2DQHH 5H37A 1GH6A 4LF8O 5BOZG 3CCUV 3ETGA 4EB6B 1DBAH 5FUZL 2UUAB 1HAUA 1YMMA 1U8IA 4PRPA 2H32A 1SGKA 5KSAC 4MXQD 1XF2A 1A4JA 1X9LA 4ODHH 4Y5XA 4JFEB 4ONHB 4I0KA 4JPVL 4DV6B 1KD1W 4YGVB 4A2GA 4ANKA 4MJ2A 2A83A 2HUEA 3N1PC 3HUJE 1ERNA 2WO4A 2EYSA 4NQED 2VL4A 1A3LH 3EJZD 4JANA 4LQ1A 4DV2B 5B1KA 3U6XS 4IU3B 3WUZA 1PBYA 4YEFA 2HCZX 3LKOB 4JQXC 2GHWB 4NYLA 4FCAA 3CJJA 1FN4B 2IH1C 4K8RH 1E6OL 2Y2TA 4KQ4L 3RW0A 4MA8H 4URTB 4K7FA 4Z9KB 2ZE8A 1UWXK 4OVVA 3JARB 1BQUA 1JRHL 3L8QA 3V10A 2OXGA 1BPVA 5AOKA 5DD6B 4XAKD 2R2HB 3MROA 2CIKB 5KAIZ 1FZOB 3NK3A 4HAFA 4U3SA 2ATKB 4YDNA 4LIQE 3EFOA 4NO0B 3KJ6H 1YMHB 3LKSB 4NN7B 2YEVA 1PQZB 1PKQA 4N2KA 4AIZA 4QRSA 3E2EA 2BHYA 3A3YB 4FTDA 5JR1L 4K73A 3NSDA 3PGCB 2WVVB 2AK4D 3IJEA 2MWCA 2I27N 4PP1D 1DQLL 2YARA 1ZHNA 2OR7A 1T0NA 4LBEA 1LEIB 5PAZA 5EA0H 4PJDE 2EUVA 1NBCA 1I8IA 3U7WH 4UQEA 5T1JA 1H5BC 4GQZA 3OG6B 4PJ5E 2D3OW 5KG9A 1X5LA 1AR1C 2OMZB 2VDKH 5C92A 3CX5K 2AC0A 3O6FA 4AQ1B 2BOBB 1S5IL 5IGXH 4CNIA 2HWZL 2L7QA 2R4RL 1UD5A 1MIMH 3CSGA 3U30B 1TTUA 3H9HB 3K79A 1VHPA 5F0MB 5FHBH 4N8PA 3V5HA 3MRHB 5KHJA 4X7SH 1OOWA 5SWSA 5J11B 1HJBC 5GSVA 1NDMA 1Q9WA 5E1AC 4YQXL 3QPQC 4MFHA 5ACLA 4XCEA 5KJRL 1E65A 4RIRA 2LFEA 4DP7X 1CMOA 4I4TA 5DRZB 5J12C 4WY7L 2MQCA 4QHLA 2KI6A 1CFSB 2BHFA 1IGFH 1KJ2A 3RPBA 1FXKC 2BSSB 3LEYH 3KPRB 1Q0YH 1EN6A 2WLIA 2XCMC 4I0XA 3LNHA 5FYLD 5LWYL 3UAJA 1T4WA 3A6OA 5AVZB 3ARBA 1Q8MA 3VM5A 4L3EA 1CLYL 3DUUB 5AW7B 2MCMA 5IG7B 2XAQA 4FQJH 4PJIF 4Z1VA 4U1HA 4Z7QE 1J0JA 4IBVA 3R1GH 1XNRB 4PA4A 1NGPH 1KQSU 1MI5A 3NSXA 4OCSL 3UO1L 4HVBA 1RK0B 1S9YA 1O0VA 5CP3A 3S48A 3WKQA 4B96A 1NKDA 3IAPA 4PB9H 4E9YA 2H1LM 5D2NA 5ENWB 2W65B 4Y2DB 2YUXA 2XN9B 2E5EA 2B7DT 1N8ZA 2WN2A 1A3RH 1U3YA 3IMUA 4HCFA 4S1QL 4RGND 1TVHB 1YPZA 4LF3B 4PGCA 4WKXA 5EOCL 4ZSOB 3WENA 5D1ZI 2B0SL 3HMXA 1W0WA 1Q1JL 3KR3L 1DGSA 1CBJA 2QELA 4QAWA 4E9VA 3C60A 4CW1A 1MAMH 3BCFA 2V37A 1IJNA 2OLDA 4GBXD 1A9EB 4OPHA 4R97B 4P3WA 3WFDH 1EEZA 3PS6A 1CN4A 4LLMB 1YY8A 2E6JA 5E8NB 4H88H 2QSTA 3GIZL 4JKPH 1HHIA 4DH2A 3EO0A 3GXNA 1YUHB 3VGAB 3UROR 5ADOH 1JJOA 4M7LH 5E1GA 5T1KA 4P2AA 3B83A 1KCLA 1KXTB 5F88A 3TV3L 2WAHA 2J6WA 2O30A 2PO6C 2VQFO 3AMKA 3WHXB 5J8OA 4N0RA 3E6HA 1B3IA 5B39G 5E00B 4I3GA 4F4LA 2QSCH 1I8KA 2FO4B 2CXKA 2VDLH 1REIA 5A16A 1AI5A 3NCMA 2R2BA 5KLVH 1CDGA 3SPVA 5AKSA 4DGYH 5LN8A 3KWTA 2OYPA 1Y0LB 3BVDB 1MFCH 4CMMB 2BC4A 5FECA 3ABKB 2AQTA 5D7IE 4WHTA 3G5ZB 2VZOA 4D0CA 2LOEA 3SDCC 2AERT 2E3CA 2GBVA 2IG2H 4Z76A 1NEZG 4O02H 3JAWA 3VWKA 3OLGA 3QDJA 4AGOA 3VRLE 3V55A 3QVNA 2L35A 2IC2A 2DWDB 2XBTA 3MYZA 1HHGA 4EO5A 3OJDB 5A40E 5LQBL 1G7HA 2OKMA 3RA7H 3THMH 4LEOB 1YEDA 4HNAA 5IQMA 3LNEA 4NBZB 4R96B 4JFYB 4G70B 2NW3A 2HVBA 1XV8A 5FO7B 1EAOA 3PWPB 3Q6GH 1WHOA 1X9QA 2R0LL 4QJ5B 2GBOA 1BZEA 1D7CA 4HH9A 5DHYA 3JTBA 3QIBD 4LVNB 4TVPH 4OD2A 2AJVL 4ZZFA 4L4TD 4P3DA 4GAGL 4HXBL 5EC2A 3FHQA 2C7UA 5L6YL 3F7VC 4B3TB 2XTJE 3O9WD 3QUML 4J27A 1AVAA 4JFFB 4DR3B 4CMHC 2P24A 3S34L 3ARFA 4LF7O 4UANA 4WFGA 1XMQB 2ZYSA 2DYRB 3EXAA 2LP7A 1UJ3C 3UP6A 2PW2B 1XMOB 4GKZB 4KV5E 3HE7B 1KU9A 4H1LA 2DIEA 3I50H 3M7OA 3LZPA 5IJ0A 4Q9CA 1YITV 4WJ5B 3Q8EA 1MIEH 3VXSD 1NUDA 4WGVB 1UD2A 3OQ3B 2W5PA 4MD5B 4OTXL 2R0ZH 1MCKA 1MDAA 1EVUA 1LP9F 3OAYH 1MHPH 3KPTA 3VFTB 4HV8B 1PJWA 1THZA 2P48B 1CFMA 5GJSH 4GSUA 3ABGA 2UU9B 3PUCA 2CE4A 3KVDD 1AZNA 3KS0H 1U9KA 3SY6A 4F15C 3QXDA 4IOSA 3A4AA 4JTAB 2BIQA 3UTPD 3GMLB 4E68A 1FO0L 1WA2X 3KXFD 3ZL1A 3U2IA 2XWXA 1EMTL 1T0MB 1TT6A 3QR2A 4MVBD 4AJWA 3GBNH 2UZXA 3RVVC 1UGNA 3FFCD 3SE8H 3U6RA 2HR3A 4NQEE 4PUBL 5F1IA 4G11A 4MVSA 1S5HA 1NMCB 3EGDB 4LKXB 4NUPA 1RUKL 5F7LB 2VC2L 3S36L 1GHFH 4DTGH 4LL9A 1PD0A 4LHUB 2ZIOA 2DBLH 5FF6B 1MXDA 3TEZA 1XR8A 4G8EB 5K9JH 2EE2A 5BRZD 1JWMA 4XAKE 1XGQB 4B6ZA 4DN4H 1SOQA 3I75A 3TETA 3L4TA 3BAWA 2X4SB 2YIBD 3W7SA 3WS3B 1P4IH 3ZO9A 5J9PB 5JTWA 2Q20A 3HRZA 1E3FA 4FEMA 4YXKH 5FUCC 4YK4B 3SR2C 2A77L 5H2BB 1NFKA 4OF0A 4UFZA 2IH3B 2AK4E 1TMCB 5LNDA 1ADWA 1FD9A 3FTYA 1N5AA 3ZRWB 1CFQA 3PP3H 5EBLB 1BXXA 1GN6A 1KZYA 4MQXD 3S5LA 1BAFH 1JZFA 4HA1A 1NH2B 2R9RB 2WWMC 1WA8A 3SPHA 3FQXA 4CS3A 4X9GA 4ZQTA 3OHXA 4XGZB 3KLLA 1P84K 3GMPA 2VMFA 1FE8H 4YDVA 1BOYA 2ZXEB 3HZYB 3O11B 5AVWB 4IRSB 3RILA 4HKJB 4Y19D 5DS2A 1R47A 5B5EZ 4Y4HC 2Y4UA 1FFXB 4FLZA 3FN3A 2CKBL 2FBOJ 5FCUL 2NTFA 1E5AA 5BZDA 2YFOA 5JIDA 5D1ZC 1B9KA 4HIIA 2DLGA 2F54D 5IV2B 3IKCB 3JWOL 3LNGA 4FQLH 3IDIB 5E23A 5C6PB 5FYLE 3TPUB 4DZ8B 1N6UA 2OCJA 3ZKXC 3AREC 1IE4A 3D30A 4F24A 3L3JA 3IDJA 1KN2H 1YQVL 4N90D 2Y6SD 3VG0L 8FABA 2HG0A 4KKZA 4I7ZB 3LPOA 1A7NL 2IBZH 1LJMA 2XYBA 3JV4B 5IOPB 4XBPB 4XVOA 2W8CA 4KKAC 5DC9B 5AVQB 5BXFA 4MASA 3F00A 1CZ8L 4I3RH 4RVBA 3WIIH 2GIMA 5K39B 4PB0L 2K0RA 3HE6C 1NAKL 5L4MA 5LMUO 4RGNE 1FPOA 4AGPA 3II1A 5JWPA 4EI5A 1GZQB 3DUHA 3P2TA 1E5CA 1MAKA 3UO8B 2K6YA 2UXVA 3PWUB 1FQ9C 3NVQA 4I9QA 2IPTH 4P23B 2FL4A 5BZWB 4Z78A 4Z7NE 5LNEA 3BZEA 2O6PA 4MW3A 4PWFA 3C08H 1GO3F 1XGTA 1E40A 4L3CA 1ID2A 5E6IA 5TDNA 1X7QA 3QG6B 1I9IL 2G9HB 2NDFA 3M1CA 1M9NA 3LEXB 5B1OA 1OD9A 1HVXA 4KNQA 5JQGA 1U96A 1M05A 3WKYA 1MWAB 4Y16C 2H6UA 2X3CA 3VH8G 4KU1A 4PRAA 2ZOWA 2E46A 3ARVA 3NJLA 3VD9A 3HLKA 4EFEA 3F7LA 3VA2C 2XSKA 5M7QA 5GGSB 2KKQA 5IQLA 1HWYA 2ZOOA 2BSEA 3IU4H 3KLHD 2VYRE 3S8WA 3WB0A 2HLFD 4QRPA 1U36A 2I5YH 3AXHA 1XF3A 4NI6A 4LF9O 4KGLA 1Q9OB 2NY0B 3RWGB 1J86A 4XHJC 1MCPL 1DQKA 4NQCD 4UDTA 5CN1A 5JHDB 4D94A 1A3ZA 2F8XC 4G6JH 2XRAL 3IPEA 3OPUA 4N0YH 1W0KG 1MDTA 3NZHL 3IWVA 1O75A 3IPFA 1DQQB 2AV1A 2QEJA 3VFOB 1IM3D 3OKNB 3N06B 3VA6A 2QWRB 5DM6V 5EU7E 3X1GA 3IF1B 32C2A 3OAZK 1ZVNA 2J43A 2QL1A 4OH2A 4L48A 4CBZA 1ZA3B 1DBMH 4GG6A 3VWJB 3Q9PA 2J6EH 1Q5OA 1U8HB 1EJFA 1KCRL 1M2OA 1TEFA 1TPXB 3OTOO 1XF1A 4IHOB 4X4MA 1OL0A 2TRHA 1F58L 1R5IB 2JB5H 3TZVA 1UZ8A 4D3CL 3HC3H 5GS0H 2IH1A 1UC6A 4R4ND 5C6TH 4G9DB 5GSRA 1YMMD 5CD3A 1RZGA 4PRPD 5CBHA 3E8UL 3GSNA 3MRDA 1SXBA 1IGCL 3M7MX 2VDPB 3KWVA 4TUJB 4GKKO 1VZIA 1MELA 4M8VA 4W9EC 3FQ2A 5D8JL 4E9RA 4RO2A 4L4TE 4RISL 4QRUA 5EUKA 1JAEA 3SE9L 4A39A 4F33B 4EXPX 2H3NA 2M6YA 4X7CC 1OANA 4PVMA 2PXYD 2MPAL 2YAMA 2OTJV 5KANI 1HNYA 3ZMVA 1IXBA 2Q7AA 4J2XA 2LAGB 4EOWL 1BIIB 4N1CA 1H5BA 3SO3C 6PAZA 2CK3G 2VR9A 1EDYA 3H7BA 3K0YA 4NC1E 3VXSE 2WZPD 4DEPC 1SMDA 3CN3A 4AM0B 2ZG1A 3JWDL 4OCMC 3EHBB 4D0BB 1WHPA 3HPJA 3NACH 2XXCB 4JJ5B 1XR9B 3A0BZ 3ZQWA 2VCOA 4WDIB 4OUUB 4JKWA 3IDGA 4OJYA 1YSOA 5EFIB 4X6EB 4MJIB 5DHVA 5C07D 3UTPE 1L0LH 5LYJB 4FFBB 1J8SA 3X1NA 3KXFE 3PHQB 5F72S 5BPPA 1PLAA 4FNQA 1BFVH 3L4UA 4HMEA 4WUKH 1EAPA 3VOUA 1U8KA 2DEYX 1CJYA 1T5XB 1EQWA 4KUZL 5B38B 1FXKA 3K3WA 3FFCE 5TD4A 3FYEB 1P7QD 3E1ZA 3ASOC 1HXMB 2A6KB 4MMZC 2D8KA 4MS8D 4BZ1H 3O4OC 2K70A 3KZ8A 4NCC2 2F19L 2ADGA 2E9JA 4BXVA 1QBLH 3MLZL 1P7GA 1P1ZA 3GS0A 1KENL 3ABLB 5CZRA 5EU5B 3BKCH 3GUTA 2J55A 3SGJC 1Z3GH 4X8CA 4ABUA 3OGOE 4LL4A 5BRZE 4C47A 1A7RL 1KY6A 1NEZA 1UZ6F 4ZMWA 3HNSL 4P5TD 4NRYB 1H2LA 4WEMB 4X6BA 1K8DA 5JOFA 4QJFB 2MQ3A 4LWSA 5CILH 3ZDXB 3NAAL 1XSOA 2PWDA 1KYAA 4BQBA 4Y5YC 1F2XK 3VQXA 4NPYA 1CG9A 3QFGA 3D0LB 3L5WA 1GTOA 4AG4H 2MW2B 1DL7H 1ZE3H 2IAND 3CD6V 3ARBD 2WQXA 4GMTL 4KQ3H 4L3ED 4YC2C 1R17A 3EXLA 4XC1L 2D7NA 5IJCC 3MBWB 2ZCHL 3EG9A 3IJ8A 3DVNA 2JQZA 5BVJB 2DYPA 1JGDA 3EIFA 3MFFB 1MI5D 4YFDB 1A65A 4POZD 4Z18A 5GHWH 1RZ8B 3BP5B 2R69H 5INDA 4B60A 3I6KA 5DZOA 1GGCL 1GJUA 2JK5A 2RQEA 3II2A 3KYKH 4JPQA 3GGWA 5C2UB 1AHWB 4O2EA 4Y19E 1UH3A 1U4FA 2VDPH 5MEQA 3OXRA 1ET5A 1NUNB 2PO6A 5HGAA 4UCSA 4G7YL 4H20L 3RWFA 3P0GB 5F9OL 3TO2A 2QQKH 3FAWA 4FQHB 5HYJB 1CICD 3GINA 5ABDE 5I71C 5CU5A 4FZ8H 4P0DA 4EQ3A 1DBBH 2BMKB 5DJZB 1SHXA 1CR9H 1LO3L 5D7JD 2F54E 4W6YB 5DZAA 3SJVD 1KJMB 5KBKA 1SJEB 3LQZA 1U8MB 3DO3A 1FIGL 3IXAB 2ZQMA 5GS0L 5C09A 2DE0X 4OBSA 5IB5B 2X4UA 3SJCC 2Q9LA 3FU8A 1TYJA 4CU7A 2CBPA 2MSPA 3JWNC 5T1KD 1UD4A 3B9DA 3HI5L 2HKOA 3OMNB 4N90E 1FL3B 1AGDB 2FZ3A 3WHE1 3SDCA 5AZ2H 3EOAB 4MNGB 1KKDA 5C0DA 1U92B 1QSEB 1AJQA 5GS2D 2VDRB 3D3IA 3P9LB 1MG2C 1FH5L 1R0AH 4FQ2L 4N9GB 3P3NA 2ILLA 4MDIA 4KO5A 5DFVD 2EZOA 2VAAA 5IR1A 4NT6B 2NYZA 1BM7A 3FFDA 4XO8A 1BGXL 1OARH 1H2MA 3X13A 4JZJB 4MHHI 4XE5B 2P5OA 1UHVA 1D5IH 2ZUXA 3AGWA 3FQNB 5FA3B 3AXLB 1INDL 4HCRH 2YAQA 2X1PA 3Q01A 3KHOA 3QUXB 2LQRA 1GA2A 5I8CB 4EUPG 5ADPH 2YAFA 1NIFA 4U6YA 1AQDB 4E5XG 2P5PA 4KK5C 4Z7WB 3VWKD 3QDJD 1SQPH 1W0JG 2Y69B 4N2IA 4LFHD 2A73B 4BBWA 5LXGL 4JO4H 4PDRA 1E3ZA 2V5TA 5JPNC 1CVSC 3ILQD 5KZCB 3F7VA 1E9OA 4DV4O 3U83A 3K74B 5CEZD 4HT1L 4OFQA 4KROD 1TU2B 2A0LD 3B8YA 3C5ZA 3UDWC 4PJEE 3NRQA 3S2AA 4ZMXA 5GGQH 3QUYA 5CD5C 5A2JH 2X4QB 2M1KA 3AC0A 3DX8A 3MNZA 4R4BB 3VI3E 1KEGH 4ES8A 1UURA 2X89A 4A7GF 4RDBA 3T4YA 3UMNA 1IGTA 1Y76B 1VRSA 4FNUA 4WW1B 1A5FH 3B8SA 3BN9D 2A6DB 3DSFH 4M5ZL 4H7VA 4ZFGL 3JWNG 4LF7B 4XPTL 4FA6A 2LVEA 1RZFH 2Q86B 5J6HA 2BP8A 3T4AB 4A68A 1JFHA 4NQCE 3CSYB 2E27H 1HZHH 1Z9OA 2XNAA 3PDOB 3FQUA 3RHWK 4CDHA 1PGRB 3ARFD 3K6SB 4WFGD 4XXCC 2QKIC 1ODUA 4AYSA 1NCAH 5CBAB 4LAJH 1PAMA 3IRPX 4LCUB 4LL1A 4O9HH 3FUFA 5CIPA 3X11B 4XNDA 1VEOA 4BSVA 2FDBP 1JXFA 1LVEA 3HZMB 2Q7HA 2ZT9B 3JD2A 4GUPA 4C4KO 5I66A 3FAVB 4OKVA 5IVOA 3BQVA 1L0PA 1UXWB 2RN9A 1M53A 3RB5A 3TJEL 3NCYS 2ITCC 3NBNA 2XWJB 2AMGA 3DO4A 5LUMA 2LGQA 3CC5B 2ESVA 4QYAA 3GHBL 3I6LD 3TA3B 1SBBA 3ECUA 2VJ0A 2FGZA 3QQ3A 1SRYA 3RVXD 5C9JA 1O9HA 3GZOA 1YMME 1PW3A 4WNJA 2XICA 4KX9A 2YICA 1FLTX 4PRPE 5D55A 3VNZA 1J5OH 3HLAA 4ONOA 1S5JA 4AQEA 3H3PL 1IC7H 3L3DA 1K97A 3V95A 3NABH 1JL8A 5CAYB 1BQHA 3RI5K 2WZAA 3LS4H 4QXGH 1J8HA 1E4WH 4CC0A 2VMJA 3CDYA 4BCYA 3VCLA 2X3BA 3WFHA 1JGUH 2XN1A 4FNSA 1JPGB 1SF9A 5FO2A 2ATKC 4NQSA 2UZIH 2AJZA 3F62A 3MRFA 4NN7C 5ID0B 4NHCH 4JQIH 1LO4L 2HLEB 5DQDL 1EN4A 2ZSWB 2E9IA 2IQAA 4YSRA 3U7YH 4JS7A 1FZJA 2VLMD 4UDUA 4XOEA 5CSBA 3BCDA 4HMCA 4F3FA 4JZNB 4X9QA 2ED9A 3TNMA 3QNYA 3MA9L 1FFTB 4AI8A 2OJEB 4PJHE 3F58L 2C26A 1PKQE 3QULB 4I88A 1LK3H 3IVKA 1RURL 2ZE0A 4Y4HA 4HPOL 4FFYL 4WSGA 1SKVA 4PDLA 4NGHL 4X80L 3MNVB 1LDSA 2FGWL 3OKMB 1W72L 4LOFA 4Q0XH 4RX4D 5C07E 3FMGH 2BOBC 2YZ8A 2I9LA 4AQ1C 5LVEA 5D6CA 1X5GA 5KANG 5KSBB 3U30C 4KAQL 2R4SH 4GRLB 5IM7B 3L9BA 3W39A 3G80A 2NTSP 4HPYH 1P6AB 2AEQH 5J11C 1S7WB 3NFNB 3JATA 5IB4A 2IU3A 1BF2A 1G94A 1UVQB 4JFPB 4KMTH 1T2QL 2VITB 2ZOKA 4PTTA 1CXHA 1RV6X 1USQA 1L8DA 5CBGA 4UQ3A 4P30A 5ECGA 3ULUD 2X4TA 3AREA 1ZLVK 1AGCA 5IESH 4ELME 1ITBB 5JW4R 3WU2Z 3GRWA 5E5MA 3RDTD 4O2AB 2JGDB 1AZCA 4JO2H 4KL1A 4M7KH 1XBLA 3NP4A 1L7IH 2JKLA 5F1NA 1N26A 3PL6D 3WBDA 5L8JB 1FZKA 4U6XB 2YGOA 5I5MA 5EF1A 1WGOA 2EH7L 3ZR5A 3G9VA 4M6OH 3IJYB 2JV6A 4P59L 4XMPL 3I2CH 2VXQA 5LCVA 2VZSA 1CTOA 3A4EA 3VFMA 1DDTA 1T6VN 3L17A 1E67A 2VRKA 3MV7E 3C2SA 4NUQA 3HE6A 4P4RB 4JL1A 1SN2A 2OSLA 4JFTA 4WEUD 4H8VA 1NFDE 1IXMA 4JFUA 1DZBA 4RGMC 3RNQA 1Y6XA 2IANE 5GIRA 5AW4B 3QHFH 5EO1B 4Y2DC 4L3EE 5DD3H 5IBTH 5J5EA 1DVXA 2H8PB 2HA1A 3IC9A 1XHHA 1KG0A 2D31A 2ED7A 2O57A 3MXWL 2WTOA 3B2VH 3V6BR 3D18B 2BP0B 1AZZC 5T1MB 1MI5E 1ET7A 4JFOB 2WXFA 4JAAA 2VLKA 3V8OA 3ZMSA 4PJ8A 1DBJL 5D2NE 5F9JA 3TURA 4U1KB 4R97C 4PJGF 3AS2A 1KB9K 2YD3A 4LRIC 1GZHA 3O41A 3D2UD 3PNWA 4HK0B 4JN2B 1V3MA 4LMQI 5DZ9A 5HHXH 1YPZE 4JO1L 3JUZA 2NY5L 1QTYT 1IFGA 3VGAC 3Q3GB 5T5FA 1AGBA 4YHLH 3IPBA 1S9VB 1BV8A 4LFBB 1KPUB 3MV8D 3OLDA 1I3RB 3D3VB 4PG2A 4IDJH 4WEBL 3SJVE 3W9EA 4YIOA 3FKSG 2UX7A 4JYCA 1U8CB 5HYSG 5JORB 3ECQA 2YN3A 4P9OA 5E6ID 3TBTA 5E70A 1K5NB 3JZYA 5E94B 5IQ7L 4HUKB 4ZO8A 2CPUA 1UD3A 3S3BB 4I2XA 3QORB 4M62L 1CEZA 4DP5X 3ZO0A 4G8GA 4HBCL 1G0DA 1L0YA 4GRMB 5L2JB 4QCIA 4M1DH 4XRCA 1D7FA 4LF9B 2Z7UA 3B2UD 2P6JA 2N0KA 3PQYA 1JHKH 3ABKC 2NLJB 1J88A 3I9PA 4L29B 5E6IC 4ZQKA 5TDPA 4OIFA 2HEPA 3X12B 3BE1H 1HU8A 1ACCA 3LH8A 3OG4B 4OM0L 4QRPD 1Z5LA 1WS8A 3DWTA 3G6DL 4OJCA 2NZ1A 1BT8A 1CU4L 4FQQA 1IEHA 3D52A 1G6UA 2DWDC 1S7RB 3VFVA 1T66C 2R9HC 3ZDXF 3DV4B 1JIBA 2BCKB 1RVFL 1WAAE 2BFVL 3JT0A 4LVEA 4N6RA 1VFMA 5DEGB 3ZKMC 1H19A 3SKUD 2E47A 3U6XA 3QDJE 5IVZA 4M48H 4JM4H 3UT5A 3UH8A 3OTOB 2YAOA 3IFNL 3BDYH 3ZDZE 5JW4N 2AGAA 5ILTL 3L9EA 2GI0A 5CEZE 2D7TL 2YSTA 4MHHG 1HTYA 4LVNC 1R4XA 1X5HA 3WLWC 4BV1A 1AC6A 5DXWA 1J05B 3RGBA 5DMIL 2YGPA 1YYCA 3NCXA 1DJWA 1EANA 2CBMA 4G5ZH 4GH7B 3SHSA 2KPWA 3FS9A 2PZSA 4KVNL 4MB5A 5DJ8A 3TEUA 3WTYA 4TVUA 4LCVA 3TYFB 2FX7L 2NX5B 5LGHL 1P2CA 3REWA 1B9ZA 3ML0A 1YLBB 2OMTA 3HE7C 1RLWA 2A6JA 1OAQL 3CC2V 3T09A 2YD5A 3BFQG 1KLFB 2IH9A 4NB5A 2GC7C 4UU9B 2Q1EA 3QT2A 2UUBB 2Y36L 5D7LB 1IQDB 2XUMA 1E4XH 3MKKA 2O5ZH 3UXFA 5C0GB 2EDJA 4P5KB 4MNQB 2X2JA 2WXNA 1AR1D 4H40A 3ZT7A 2JJVA 4HWUA 1UADC 4N23A 1CP9A 1BEXA 4FZ1A 1PSKH 3SODB 2I9TA 1PLCA 2WO3B 4PVNA 5D5PA 1TQCB 2DJVA 3AB0C 1PL0A 4K23L 3C9NA 4AK2A 1AGEB 3CVBA 4MRCA 2W9LA 2WB1A 3I6LE 4OZFA 1TVKA 4R90H 3QDMB 5KA5A 3SZKC 3EH5B 3FO0H 1UFIA 2A3QA 4M56A 1PKXA 1M3IA 2ITFA 3IFOB 4OGAC 5EZPA 4HJEA 3BEVA 4X66O 3QPQD 1NMCC 2QDVA 2CNZA 1E79G 5I1AB 1I5XA 4LR3A 1RZ7H 4LHJB 1HI6A 1PY0A 3MR9B 5FV2A 1X5YA 3RIFF 4P2QA 4G8FB 4A7UA 2XA3A 3VFWB 3HN5A 4Z7WF 4UXNA 4IMKC 2PCFA 2XWBB 4OCWL 5IHLB 4C58B 5I1DA 1AFVL 1L9QA 2D73A 2WSDA 2J4WH 5SWZB 5K9QI 5PCYA 1J0IA 3QCUH 3R66A 2HFGH 3EADA 4PH8A 3ZE2E 3TCUA 5J9PC 2EDHA 2IXQA 1LD9A 3HBPA 3P3YA 2QPSA 3FCTB 3QNZA 2YKLL 4NQVA 2DTSA 4YK4C 5HJGA 2DL9A 4P2OC