3AG4B

Bovine heart cytochrome c oxidase in the cyanide ion-bound fully reduced state at 100 k
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag4B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag4B02
1T5KA 4P5RA 1JZIA 2RACA 1SJMA 3FSZA 1AANA 1RCYA 3NJHA 3H4HA 5E9NA 1UATA 2UX7A 5B1JA 3V9EA 3X1GA 4A2DA 4DP4X 5I5IA 3X1EA 2J56A 3WI9A 2GI0A 2XU9A 2XXFA 4KNTA 1AS7A 2GB2A 4YSOA 2P80A 4KO9A 1NINA 2FNWA 2XLLA 3CZUB 2FT8A 3PAUA 1PLAA 3AW5A 4HCIA 2NRDA 1EHKB 3FU9A 1F56A 2VM3A 2AFNA 1WA2X 2I85A 4E9TA 1PNDA 1J9TA 2QDWA 3IBOA 3KW7A 4DP2X 3NSDA 2GSMB 3FQYA 3QJSB 1AZBA 3ZBMA 4GP4B 2XV0A 2HZHA 3X1NA 2IH8A 5PAZA 1AR1B 1JOIA 1XB6A 3FSVA 1OCOB 2PCYA 1FFTB 1GYCA 3OM3B 4E9RA 2AZAA 2HXAA 2W8CA 2PP8A 3FT0A 1QLEB 4G70B 4HCFA 1OCZB 2UXGA 3UACA 4E9QA 1RZPA 1ZV2A 3AZUA 2GHZA 2PP7A 4E9YA 1E5YA 2PPCA 2VM4A 2YAHA 3FQ1A 1ZIBA 3EH4B 4GP5B 4YSTA 1WAEA 4GYBA 4DP8X 2CALA 3S3DB 3WKQA 4E9VA 1RZQA 3OMNB 4DP1X 1E65A 3ASNB 3CVBA 2XVBA 2DWSA 4AX3A 2BZ7A 2XX1A 5PCYA 5IY5B 1NIBA 2HRGA 1ZPUA 4CSZA 3ERXA 6PAZA 4KOBA 1IKOP 4TXVB 1AS8A 4A2FA 3HEIB 3MX0B 1XB3A 2CBPA 2YEVB 1NZRA 1WA0X 1SF5A 3JT2A 3NJFA 5ANHA 4GP8B 4KO7A 1OCCB 3S8GB 2VN3A 2ZXWB 5I6OA 2IWKA 1BQKA 1TEGA 1PF3A 3NJMA 5I6PA 3QJTB 3PAVA 2BP8B 1NDTA 1NIEA 4Q89A 1JZJA 3ABLB 4DP7X 1M57B 2I7SA 4A2HA 3TASA 2VMJA 5I6MA 2HLEB 1AZUA 2WO3B 2CUAA 3NYKA 1SHXA 2Y1AA 4YSDA 1BXVA 4KO6A 1KDIA 1CUOA 1X9UA 2R7EA 4YSEA 2BWIA 4KO5A 1WS8A 2AVFA 2XXGA 3T71A 2CAKA 3EF4A 3BVDB 1JZGA 2CCWA 1JXGA 5D4IA 1AIZA 3U25A 3UADA 1KV7A 4WTQA 1E67A 1QHQA 2B3IA 4CSPA 4DPCX 4G71B 3WNJA 5FC9A 3DKHA 2GC7C 1BYOA 4W1TA 4P5SA 5A7EA 4HCGA 2XYBA 3FYIB 3UAEA 1OE1A 3JTBA 3OMIB 1NWPA 1L9TA 3X1FA 1DZ0A 1L9RA 4BWWA 2BW5A 3WNIA 2Q9OA 1KCWA 3ABKB 4AKQA 4M4RB 1ET8A 3GXUB 4G7RB 5AZUA 2QPEB 5B3SB 3QJUB 4X4KA 3SBQA 1MG2C 2FT7A 1E30A 3NJJA 2UXFA 1A4CA 1OF0A 3OMAB 1OV8A 3PXLA 4BDVA 2IDFA 3T9WA 4ZK8A 3WIAA 5B1JC 4YSUA 4HIPA 1DYZA 4YVNA 4DP9X 4A2EA 1M56B 2BZCA 8PAZA 2DYRB 3IN2A 1L9OA 2X87A 4A67A 3S8FB 4K9JA 1J9QA 3X2QB 2FQGA 4NERA 3N2JA 1FA4A 1ZDSA 2IDUA 2LLNA 2QPDB 1W6LA 3QJRB 1I53A 2FWLB 4GXFA 5I6NA 4UANA 4HALA 5EHFA 4W9ZA 4NAJA 3DIVA 1KBVA 1SFHA 3BQVA 3IEAA 4A66A 1URIA 4F7KA 2BW4A 3NSCA 1NPNA 2N0MA 1ILSA 5TK2A 1N68A 2PCFA 2XUWA 1A4AA 3NJIA 2PLTA 1SNRA 1WA1X 2FT6A 2HX7A 1SHWA 1JXFA 1A8ZA 1IBZA 1JVLA 1KCBA 1GR7A 2XWZA 3NSYA 4A2GA 2EILB 2FQFA 1PNCA 4G7QB 1PZBA 3T6WA 4DP6X 2YARA 1OCRB 2P80D 2IDTA 3NJLA 1M9WA 4FA7B 1QNIA 2UX6A 3EH5B 3ASOB 3FPXA 1ADWA 3N55A 2TSAA 5AFAA 3CDZB 1NIAA 2J55A 3PAZA 5I6LA 3S3CB 4L0PB 2FQEA 1OOWA 3NT0A 4BXSV 5B1AB 1ET7A 2E86A 4EF3A 2UXVA 1ETJA 1CC3A 3IE9A 4BDVB 1JZHA 3CVDA 3H56A 1B3IA 1JXDA 2QDVA 2H47C 2EIMB 2J57A 3TBBA 2Y69B 2A3TA 1N70A 4WKXA 4AZUA 1WS7A 4KOCA 5B7FA 4DPBX 1AG0A 5I5MA 1BAWA 1NICA 3G5WA 3MBWB 2PP9A 1AACA 1JVOA 4DPAX 3S3BB 3T6XA 2FQDA 3TU6A 1OE3A 1PZCA 4JHUA 2IDSA 4UF7C 2EIJB 4DP5X 2DY2A 1AQ8A 3PPSA 1SDDB 1ASPA 2IWEA 4F2FA 2OJ1A 2YAMA 3QJQB 2PPEA 2H5UA 2Q5BA 2J5WA 1A65A 3AG4B 3DTUB 1MDAA 5B7EA 4YL4A 4HAKA 3TBCA 1CYXA 3PLYA 3KW8A 1ASQA 3SBPA 3T6VA 2YAPA 2VSMB 2DWTA 1V54B 2YAQA 2YXVA 4YSRA 3CDZA 3FU7A 4FAAB 4YSQA 1BYPA 1ZDQA 3UAAA 1IBYA 2FJSA 2ZOOA 4HHWA 4M3HA 2BHFA 2XV3A 2OCCB 1AG6A 3ABGA 1GSKA 2VW7A 2ZONA 1AZCA 1NWOA 2IAAC 3QQXA 4E9SA 1IUZA 5I6KA 1SFDA 3FPYA 4QLWA 3AG1B 2MTAA 3NJNA 3EHBB 1TU2A 4YSPA 1V55B 1R1CA 3NSFA 1OE2A 2VW4A 4YSAA 1BEXA 5B1KA 2JXMA 1AS6A 2WO2B 3T6ZA 1AOZA 1L9PA 2ZWNA 3TA4D 2X88A 3X1BA 3FS9A 3FSWA 3AG3B 2VSKB 1XMEB 2H3XC 2I7OA 1PAZA 2FTAA 4PAZA 1ID2A 3AY2A 3NJKA 1ZIAA 3OQRA 2HX8A 1KYAA 4DP0X 4NB7A 2XV2A 1PZAA 1ASOA 4N4YB 2VW6A 4BWUA 4JHVA 2B08A 2UXTA 1A4BA 2YQBA 3PCYA 4G7SB 2OV0A 3EH3B 1MG3C 2BP8A 1GY1A 3HB3B 1TKWA 2QT6A 4PCYA 1JERA 2IDQA 3SQRA 2GBAA 3QJVB 2AZUA 1GS8A 2CJ3A 1BQRA 1MZYA 1GY2A 2DV6A 1BXUA 1NPJA 3CVCA 3NP3A 1JZEA 5D4JA 2JFCA 4KNSA 3WKPA 4HZ1A 1GS6X 1W6WA 2AANA 3CG8A 2XX0A 3FU8A 3FQ2A 1E5ZA 1V10A 1HAUA 4HHGA 3FU7B 3NP4A 1GS7A 1VLXA 2PPFA 5TK4A 1J9RA 2WSDA 2GC4C 1L9SA 1BQ5A 4JKNA 1TEFA 1CYWA 5I5JA 1JZFA 4E9WA 1MZZA 3L45A 2MRYA 5B1BB 3FYEB 1FWXA 1J9SA 6PCYA 2BP0A 2BP0B 4AKOA 4ENZA 1CURA 1IC0A 2DYSB 2BO0A 2IH9A 3OD3A 5D4HA 7PAZA 2HRHA 1EZLA 2HX9A 1YLBB 1SDDA 2BWDA 2YAEA 3SBRA 1HAWA 1PLBA 1L9QA 3C75A 5B7MA 1J5CA 4MFHA 4KNUA 3QPKA 3AG2B 5F7BA 4BWTA 1BXAA 1GW0A 4GY4A 2YXWA 1SF3A 4AKPA 3NJGA 3ABMB 1PMYA 5I26A 3IN0A 3WG7B 4AI7A 4BXVA 2PPDA 1KDJA 5I28A 4BK5C 3GYRA 1AZNA 2GIMA 2TSBA 1NIDA 3H4FA 2YAFA 4G72B 9PCYA 4A68A 3UGEA 2W88A 1XB8A 3RYMA 4N8UA 3GDCA 2PPAA 4Q8BA 5AKRA 4QKTA 3V9CA 5F7AA 4YSCA 1NIFA 3D12B 1AAJA 1ILUA 4RH4A 1PY0A 4YSSA 1AZRA 1J5DA 7PCYA 2EINB 3UABA 1ET5A 4E9XA 1HFUA 1PCSA 1KBWA 1PLCA 1RKRA 4F2EA 4UAHA 4YVUA 3ZX1A 1W8EA 2EIKB 5LDUA 3FSAA 3ZDWA 2JKWA 3ZIYA 2IWFA 2YAOA 1A3ZA 1NTDA 1X9RA 1KGYE 2R7EB
chains in the Genus database with same CATH superfamily
2C9QA 1NLBL 4HMCA 4Y4FA 2FWOA 4IOIB 4UNVA 1BSMA 4GO6B 2P5PA 4LVNC 1KWKA 2VDQL 1CE6A 5H94B 5E9NA 2CH7B 5E08L 1HH9B 2P3YA 1XV8A 4BFIA 2DBLH 3FTGA 4D9LH 3T4YA 5JPMA 4ZJ9A 4AJVA 5H6QA 1SXAA 2O6CA 3FO2A 4DVRH 2KQXA 5J2TB 5CEZL 4CU6A 1QBZA 5BV7L 1FNSH 2DB8A 1ZANL 5AW7B 1OAQH 3E38A 5GHWH 1C5CH 1ZXKA 4JGNA 5IHWA 3B9KB 4NRZB 3DVNA 3LIUA 4Z76A 2G60L 4EUPB 2VXQA 2QTSA 2ARWA 2HJKB 5CHNA 3PXJA 5FUZL 5HGDB 4X6CB 5F7YC 1HL8A 3KW7A 5DEFA 4X7CC 4QHNA 1MIEH 1ZLWH 2GSMB 1X4ZA 3FUFA 4JJOA 5F3HB 2P49B 4WW2B 2AJZA 3BE1L 4P23B 4ZT1A 2ATKC 4LEOB 2YK1L 3LNGA 2ZKWA 3QPQC 1CDYA 3B9KA 3MRJA 4NRZA 5HGAB 3L71H 4QHMA 4KRPB 2MNJB 2X89A 1IBDA 3L4VA 4MT8A 1YJDC 1MXDA 1SQPH 2W8CA 4YPGB 4RMWA 4UIKL 5FYLE 2X0WA 3UYRH 4KVCL 5FO8A 4RRPM 4G70B 4ONOA 1JHLL 2KSDA 5DUJA 5BO0D 4WEBH 1U93B 3WLWC 3DXAD 3VD3A 4MXVF 4F33B 3M7FB 3F7VC 2PP7A 1AD9B 4X66O 2PPCA 3FQ1A 4X99A 4IOIA 3KPMB 4UQ3A 2EC9U 4UU9B 4UM9D 5ACMA 2QMJA 2J1ZA 1F3DH 4TNWK 3RILA 1EBOA 4X64B 4EI5D 3C6SA 2O5YL 4DP1X 4K8RC 3VA2C 2VABA 2IWGA 2X1WL 2E74B 4GI6A 5TQ2L 4MTGA 3WEXA 5FYJE 4JZOB 4K0OA 4ZMXA 4W6WB 3QIWD 2MOVA 1I8AA 4KVNL 4XMTA 5FDWB 3MFGB 4GUQA 4PREB 5E4IA 2GUZB 1HHJA 3T3ME 2WLZA 3TO4C 4G7VH 4WI7A 5GGVY 1RUQL 4DV4O 3II1A 2V17L 1NBYB 4DR3B 3AK1A 4JI5O 1UB6B 5I8OH 1K3IA 2G3ZA 4G80A 3UX9B 4PM1A 5A6LA 1CYGA 3NIDF 1NDTA 2OTPA 4NEHB 5SWSD 3ZSSA 2WA3A 4DZBB 1DVFC 2K3HA 2Z64C 1M57B 1ZVHA 2IFFL 3AITA 2CE4A 5LL6Y 3CXDH 4IQHA 5JTWA 2LFEA 4I0XA 3BWAA 2QKCA 4OJCA 1UD8A 4FF9A 4MYWB 1X4XA 5HYSG 3WE6A 1R3JA 4BIKA 3GS7A 1CR9H 2F74A 3L9EA 3L4YA 1R3HA 3MOAL 1IC5H 4JAUA 2J88L 3VYOA 4ODTH 4YEEA 2EYTB 1UVQA 4OLXH 3V0FA 2ERJC 2OULB 4G1MB 4S0HA 7CGTA 5GGRB 3ABLC 2G2RB 3T1YO 4OZ4A 4UT6H 1WUNT 1EEYA 2WN2A 4L4VD 1JVMA 1MHEA 3T2NH 3HS0C 3ZKNC 4Y4FB 3LY6A 1KTDB 4WTXA 3AY4C 1H2MA 3FYIB 1D5BB 1N4XH 3MUJA 5E8OB 1NWPA 5ICZB 1ID5I 2D03H 3ZBHA 2XBZA 2IM9A 2XICA 4WHTA 1YC8A 4JFYB 2OTWB 3N1PC 4MD0B 3NFSL 3KVDD 3TWCH 1XZ0B 4Q56A 2Y4UA 4O4HB 4DK1A 4KY1H 5JIIA 3TH4T 3AK3A 2OL3H 3O65A 2P24A 2VTFA 5I82A 3ZE2F 1MCEA 2W0LA 4OLZL 3GXPA 4AL8L 1RZJH 3BO8B 3CN2A 3IS0X 4KROD 1CTOA 4XPGL 5F9WB 4OM0L 4M5ZL 2LT9A 3WEOA 5AALA 3QO0B 4KUMA 2PWHA 1X5AA 3R06B 4WW1A 3MV7B 3KYNA 1G7JB 1MFCH 4XNXL 3ZHSA 4LASH 2ZKXA 4HCRA 2HTKD 1XHHA 3V0JA 1R3IH 1YNKL 4Y4KB 3D0VB 1YVLA 4ZX6A 4PY7A 1A0QL 3DGDA 4YVNA 2OJZL 3PABB 4NFDA 5KZCD 1WZ1H 3IXAA 4MX7B 2OTUB 1INEL 2YPLE 3QUXC 3VD9A 3UBXI 3QK0A 3BIAX 4NP4H 2WOBA 1UADC 5CZRA 2BSRA 2IALB 3H9SE 3II3A 3GMPB 2DDQL 1JF5A 2AEPH 2BIQA 2YD0A 3MREB 4IBTA 4JZJC 2NDFA 3HUJF 1NKDA 3ZE0F 4A5UB 5EEUA 3UO1H 4EXKA 3PWPB 2VDNH 5D6DA 1UEMA 3QIBD 1ZWIC 1NCJA 2ZG1A 4KK8D 3L17A 2JJUA 3FCSB 1WT5C 3HKCA 5I2IA 4HV8A 5F1NB 2BW4A 4XPGH 2WQXA 4KKBD 1LM8V 1WRFA 1F2QA 3KPRE 4M1DL 2ID5A 3MPCA 3HZMA 4P2QB 5GONB 1P7BA 2NXZB 3ZVVA 2X4NA 1QW9A 3AS0A 5BUGA 2GTAA 1A8ZA 3VMOA 4Y7OC 2DL9A 4OPHA 5D4QA 4YXLL 4B3SB 3TT3H 3H1HH 1HEHC 4HF5H 3IT8D 3O81A 4KU1A 3V5HA 4YQXL 1CEZA 5GS0D 3B1TA 4LSUH 4QKXB 5ID1B 2MMXA 4DP6X 1OCRB 4X4ZA 1JTTA 1PX4A 2IU3A 3RG1C 2Y3NA 4DW2L 2UX6A 3EH5B 1AKJA 3JWNC 1CD8A 3KKYA 1RJCA 3IGAC 2ZE5A 1B0RB 2X5PA 1DFXA 1SQVH 5K5YA 4MA3B 4OLWL 4MCYB 1WJ3A 1RSOB 4NQCB 4X6DE 2P7TB 1JYXA 1E5AA 3GJFH 4AMXA 1RI8A 3ECBB 4Z1VA 1IC5L 1KFAH 3ETTA 3IE4A 2Z9TA 2QGCA 4JI7B 1MJJA 4IOSA 4J1UA 5FYKD 1WV7T 2HP4A 3WJMA 5E5MB 4UCRA 3WEMA 4QRRD 2AJXL 1YMHA 2MHAB 3CD4A 1QTYT 1S77D 1TMQA 5HHOE 2WKOA 4FMFA 2V6HA 1HJBC 5HPOA 3EYOA 1HE8A 1OCZC 1NICA 3C5JA 2PP9A 2AQ1A 3F85A 3CVHB 2WAHA 1OGAD 2CTPA 2P44B 5INCA 3KPPA 4DK5A 3UJTH 5KBPA 1RUPL 4X4XB 2Q0ZX 4IU3A 5AOLA 5T5FL 3WD5H 5JPNA 3VGDA 4AILC 2B4CH 1B6DA 1Q9WB 3KYOA 1T2JA 1VA9A 4J4PA 4XXWA 5FOBA 4DHLA 4PJHB 4G7VL 4ANKA 1MIMH 5B4MC 3AG4B 1ED3B 5J1TC 4M6NH 3EGDA 2R8SH 1GKFA 1MCLA 3KM1A 2CM5A 3LEXA 2A7BA 5F93C 4WWKA 4NXMO 25C8L 4H8HA 2DWTA 3BFQG 2I60H 2DMGA 2VDPL 4H20L 4PJAA 4XCCL 2KLTA 3N9GL 1HZKA 1W0YT 1MIML 2YC1B 1AQKL 1QUNA 4I0CC 2VW7A 1QOKA 4H5SA 5C71A 1ODUA 5IK3B 3MUUA 2EEDA 5KJRH 1JPFA 3A4EA 4N0CC 1D2OA 2ATKA 3P9LB 3MO1A 5FYKU 1T04B 1KJMB 2H32H 1ACYH 1E3ZA 2F6AA 3OX8B 2WTRA 2NYKA 2YI9A 4PS8A 3S37H 2D0GA 1L6ZA 3ZHRA 4P4KC 4PQXA 1NDGA 3ARQA 1F90H 4KTYA 1CIUA 3IDGB 3R18A 2V5SA 5IB5B 5IB1A 3FSWA 5L88H 4FFYA 2YEVA 4ZHQA 1AHWB 4B3EA 1OALA 2W94A 5C2BH 1BZ9A 4OU3A 4AYDC 3MJ9H 1UZ8A 4ZFZB 3ZJZA 5I0WA 3BYTA 3X12A 1D7DA 1JGEA 2OMVA 5JOFA 1Z5YD 1R5IB 1UA3A 3AAZA 1Q82W 1EJFA 1MHHA 3OQRA 4O00A 4DO6A 5E8DL 5IQOA 1WVZA 2X70B 3F7PC 1DVZA 4CMMA 4PRNA 1ASOA 2Z4QB 1T1WA 1SLUA 2GCYB 2HG0A 4ZFQA 2MPAL 2X09A 4ZUUA 5C09E 4PI2A 3VTTA 4NQUA 1WAAE 2UXTA 3RKDC 3O2WH 1W2KT 2CU9A 1MAJA 2OX5B 4ZQTA 1R3KC 4DZBA 2GJRA 4YHYB 4O02L 5BY1A 4XMKL 1C5BH 2Q76B 1M2OA 5FNVA 3L6FB 4JZJA 2R9AA 4OJAA 4P57A 3UTZA 2QTOA 1OGAA 1UM6H 1JZ7A 5E6IA 4DNLA 2FE0A 5EU7C 4FL4B 4FZEL 4J6IA 2FSEA 3TBYA 2AS5M 4CH6A 1W6WA 2AANA 2YSUB 3H2PA 5F7EH 3VM5A 2YMOA 3FQ2A 4L4TD 5CFHA 1U8KA 2E46A 2UY6A 1XHZA 3FU7B 1CPYA 3DMMB 1SRYA 3VWKB 1JNLH 4X4YB 5KVGH 3ARDA 1UXMA 1PAMA 1R3LB 2BY2A 3CRRA 5T1LB 2Z0AA 3GRWH 4UQBA 2NZIA 3G9VA 3H1KH 1DLBA 2XA8H 2DLIA 1JV2B 4AMKH 5EBWB 1S7VA 3F64A 4P9HC 3EOAA 3L1OH 1BZ7B 3RIFF 3OD3A 4RQEA 4BHUA 1Y18B 1U8OA 3HC4H 4MD5A 1AQMA 5C0BE 3FH8A 3OC8A 1R3LA 4NZDA 2F08A 2HRPH 2ZINA 1K34A 3DO4A 2ZE7A 3KHOA 2NSQA 2Q8AH 1FVEB 3FOLB 4I9WD 4NKOB 4ZZFA 2HVKA 4ZS7L 1AROP 3WE6B 5KVDE 4AL8H 2ILMA 3D4CA 3QFJB 4JGJA 5T3ZD 3LS5L 1IX9A 4HC1L 1SRDA 5FKAB 1EEQA 1Y0LA 3IN0A 3EAKA 3HCVA 2IFGA 1HJCA 1A6ZA 3OAZH 4UIMB 1AYRA 3KPQA 4R8CA 4CVWA 2B1HL 5F3BA 3VXRA 4LAQL 1U3YA 2HLFD 1MVUA 4G80B 2D03L 4OZIF 1UWXH 2HUEA 3WKML 4LPVA 4GYCB 2FKXA 4Q8BA 2F1EA 1K73W 4F6RB 3D7PA 4B5EA 4JHAH 5ICXA 3LQZA 4UTAL 2QHLA 1QNZH 3IETB 1VEMA 2F58L 5ESQA 4F80A 2N74A 3AWEA 3GZQA 1MQ8A 1KN2H 4RH4A 1PSKL 4Z3IA 1L5GB 4K3GA 1W72B 3QI9C 3WHXB 5B3NA 4XNQB 1R0AL 5B5EZ 3I74A 4GUOA 5D2LE 3H1JH 3PNWA 3HG1B 2GJ6D 5AB1A 5T3XE 4Y2NA 1HNWO 2EIKB 3SGKC 3BPZA 1OF2B 1WD9A 3FRUA 3T8XB 3TNMA 2XPGB 4EN3D 4UOW0 3RYFB 2QLYA 1CU4H 2C1PB 1JNHB 1X9LA 4JRYB 1M7UA 3R7QA 4UU9A 3OKKA 1AFVL 3MRRB 3IKCA 3N44F 2VXVH 1D5MA 2O5XL 4JI4O 3LSSA 4OQ1A 1J8SA 1KPVB 5ITFB 2Y7NA 4LRIA 4BHUI 4ZQKB 1I9RH 1MLBB 1W91A 5E2VH 4XX1E 1KPRA 1NH2B 4LSRH 2XXFA 1YCSA 5L2KA 2EH7H 4MJIB 5D6DC 3MBWA 1M6UA 1OGAE 4GG6A 3V0DA 4FQXA 4E42B 1KEMH 1T2QL 2HT2C 2VN7A 3Q2VA 1E3XA 4PJIE 1RUKL 4TNVF 5KVDL 3SZ6A 3TJHC 4CADA 4OGYH 1HZHL 1N9PA 3HG0A 3PP4L 1N8RW 4YHHB 3CX2A 1O6SB 3O6ML 1XEDA 4JM2C 1OHQA 4X6EA 5LN4A 5BRPA 1I3VA 1N33O 4HDIA 4IT5A 1XH1A 1WAAA 4L4TE 4AGQA 4Q97A 5BZDA 2GJZB 2MCMA 3D3IA 3MODH 3B9VA 2EDHA 4ZD3L 2WBKA 5H37A 3U10A 1WH0A 1ADQH 2XN9A 1KLGB 1T0NA 5LHIA 2XV0A 2CRZA 3QR2A 5JW5B 3D06A 4UB0H 3STZA 2IGTA 4JYAO 5KHGA 3RWHB 2QADC 3DX8A 1M4UA 3Q6GH 4L9LA 5T1LA 1KG0A 1U95A 5DD1H 4DW2H 4HJJL 3C8DA 4PW4A 3O45A 2DRUA 3D39E 2O1AA 3LZQA 2ITDA 5DCCA 3SKOA 5IB3B 4KAQH 2CO4A 3PDGA 4D9RE 1U8KB 5TD4A 4MJ5A 4GAYB 4IBVA 1FPTL 4G8FA 1NEZA 4JFZH 5DD1L 4P5KA 5F6IC 2EUWA 1CVSC 2EIJC 4L3EB 4JO4L 1EAPB 4KKPA 3MV8A 2DEYX 4O2EB 4KHXH 5KYYA 4YJ3A 3BP5B 1VGKA 4HOZA 4G6MH 2YHGA 4FXGC 3OR7A 1A9EB 2WUBL 2V2TA 3KXFA 4XE5B 3CBKB 3WKQA 3D08A 4H8PA 5J8OA 5D7IE 1VQ6V 2DQHL 2ODHA 4G6FB 3U6RB 2WKOF 2XACC 3VI3E 2XX1A 3SODB 4JY5L 3ZE1F 3HW7A 1ORQB 5FCSH 1O9WA 1NOLA 5SWZA 4PBXA 5JZ7C 5MHSE 1HINL 2GJ6B 1IKOP 1BPVA 3US1A 12E8H 3ULUL 3DPBA 3B8NA 5CBGA 4X5XB 4ZI7A 3RL1A 2ICWB 1KBBA 3F7YA 3H9SD 4BQ8A 1RK1B 3VFWA 3Q2NA 1A4KB 4XNUH 2FBJH 4DEWA 1AMYA 5C3IA 2N4IA 1TQCB 1T1YB 2IPTL 2K9FB 4FD0A 1KTRL 4NQEB 5GGVL 4DVRL 2DMHA 3AB0B 2RMKB 2NNAB 4JBSA 1PPJH 1WFNA 2MSPA 3NJMA 5E2VL 5E1AC 1PS3A 1PFOA 2HWZL 1MVYA 3TVMA 1C1EL 5EUKA 1R3JC 3LCYA 1K4CC 4X0NA 1IVLA 1JZJA 1KYFA 1VQ7V 1I9IH 2O5XH 3EZ8A 4CGUB 4DW1A 1FBIH 4HIJB 3RFZA 3DOSA 5BW7A 2ZCEA 4IBLT 4DK0A 1FLRH 1XDTT 3ARGA 3EFFB 3DHJA 1AE6L 3EYVB 1IFHL 3QFJD 3DA0A 4QXUH 5K1XA 2VOTA 4JRFA 4MJIE 2MK3A 5HHVH 3AXLB 2CAKA 3PWNA 2HT4C 1IC1A 2VAAA 1KV7A 4OPAA 4IIQB 4OZHB 4ODBD 3W82A 3GSXA 5E99L 3BD3A 4KJQD 4FA8A 3NFSH 4ZSOB 1HR0O 1G4MA 2X1QA 4CN6A 1PYWB 2DJVA 3O4OB 2GBUA 2XWBB 4MMZA 1ETZA 5JMRA 2F19H 1IC7L 1MG1A 1A9EA 3SJAC 4HD5A 3P4MB 5TE7H 2QQQA 4FQLH 2OR7A 4Z1PA 5C0BD 1K9MW 2P52A 3CDFA 4FJCC 2N7AA 4P5MB 1NVPB 2R0KH 1ZLSL 3K2MC 5EF0A 1LXMA 1AR4A 3GSXB 5AKVA 5BV7B 4S1DD 3L4WA 4L8CA 2OTLV 3FB5A 4JRXD 3SKUD 1DCLA 4P3WA 3N2KA 2TAAA 4TSBL 3UTOA 4L4TB 3IDYB 3O6FB 4O4JB 1LO4L 5GSRA 3GHEL 3GSOA 3WN5A 2QPEB 4A04A 2I9LB 3UAFA 4AYBA 1F3JA 4LQ1A 4LF8B 2AZ0A 4ZS7H 1H2SB 4L37B 4J11A 4FQPA 1WBXA 5FYKH 4PW3A 3DURA 3G3LA 5DD6A 2EECA 5IROA 5BZBA 1A4CA 1DVSA 4B50A 4LCYA 5T8IA 2YSTA 1SY6L 4B0MB 4PV1C 3JSLA 4GPVA 5D7JD 3SOBH 5IDJA 1BL8A 2IIJA 1I94O 2ICEC 1BX2A 2BRRL 1EHNA 4F92B 3VU2A 1R3KA 3T0DA 4HIPA 4Z7QF 5E5MA 1GXEA 4WO4D 3LRHA 4HCRH 4OV5B 3VFWB 1R5VB 1OJHA 4PJFA 4WUUD 4OBSA 4TNEA 5JO5B 4EIUA 4JO1H 4ZOBA 2ZXGA 1XGTA 4LCCC 5IBUG 1WWWX 4ALAH 4FQXB 1YYMH 3WS3B 4QPJA 3DJSA 4YZFE 1CI3M 4JAMA 4GINA 1XH3B 2E47A 3OKYA 4AQEB 1WTGT 4JFUA 4R4BB 3BWAB 5E00A 1I9IL 2DYPD 4P2ZA 1P4IL 2QKAA 1FZKA 3P77A 1OPOA 4GIPD 4F7KA 4GG6E 3B34A 1NPNA 4DEPB 4S2SA 5B3SC 4TV9B 2AI0L 3KPSA 2Z7WA 4RFNC 1FV1A 5IYBO 1T5WA 5HYEA 1X5ZA 1A4AA 2YKKA 4M00A 3PG2A 4OVUA 3GSRA 4KJQC 5ACZB 4EI5A 3VG9B 3EYSH 4U6TA 3MCKA 1A9BB 1LK3L 3FTYA 3O2DA 2BSEA 3QDME 4LF9B 4OFYD 4G7QB 5T3XH 5CZVH 2M6YA 1RZ7H 4O2BA 3MUY1 1HEZB 3RFZC 3KMDA 2VLKB 3K46A 3NOIA 2GPZA 4ODHH 4K35A 4FA7B 4UIKH 4YZWA 3VD0A 4AUUA 2BTOA 2QQNL 1XO8A 1MJJB 1MNGA 2V4DA 2C8NA 3N55A 1OQXA 4DGIH 2J6EH 4NM8L 5I6LA 4APQA 2VLRD 5LMUO 5EB9A 2APBA 4GAJH 4YHOH 3ZUCA 1CC3A 4BDVB 1DGSA 3E1ZA 3TYGH 2JJSA 4U1GC 4KFZC 5IQ9B 3GSNB 4AYGA 2AGAA 1NCDL 4JPKL 2NY7H 1IMHC 2J57A 1NFDA 4JGMA 3ICXA 4GT0A 4NXKA 4UCUA 1QBAA 3S36H 2Q20A 1X5XA 2J6EA 2I25N 3MZGB 4LCIH 1R5WA 2GVYA 4WFGE 2CJSA 1D2DA 1A9VA 4B3MO 3KWUA 3FB8A 5G55A 2O4EA 3JT0A 4JVWA 3K3QA 2BHUA 2H2PD 1ZLUH 1IIIA 1UJWB 2FMLA 2GY7B 2ZWLT 3TJEH 5DJ0B 5CEXA 4ZFFB 3LZFH 3PQYD 1SDAB 5EIIB 1T0OA 2IH1B 1TNNA 4G3YH 5EC2C 1TTCA 3G04B 2P4KA 1NBMG 2IADB 4YY3B 3N9GH 4M61A 2A79B 3UCSC 4G43A 2O6PA 3SQOH 3N91A 2I60L 2FNBA 3GO1H 5CBEB 1DBKH 2EXYC 2R4RL 3P0GB 1FIGH 3ZX6A 4DR1B 1TZHB 2QQLL 1ZHKA 4RAUA 4AVHA 3BVXA 1U8NB 3K08A 1RL1A 1PGRB 2IBZH 4N9GB 3BAKA 2QVFB 5I1HH 3PJNA 5BMVA 1IAOA 2JJTC 3BSGA 4G5AA 1AZCA 2QHRL 3K4AA 4FFZA 2YC0A 3JV0A 1MCJA 5D7IA 5K9OA 3FPYA 2Q4PA 1IZJA 3V5KA 4H44C 1TU2A 2DQFB 1AJQA 1DANT 3QJZA 1A7OH 4KTEL 2WWKO 5B66Z 3GBML 1FAIL 5GISH 3QWOB 3F3HA 4TVPE 5C8JA 2CGRL 3E86A 5FIEA 5D1ZD 2A6KB 4QYAA 3QTCA 4ZUWA 4KHTL 4MJ4A 1F4MA 3IDNB 1FO0A 5DR5H 3DI2B 1XNRO 2NY0C 3D51A 2VSKB 1MJ7L 1XMEB 3BWUC 3FO9A 3QIUB 3QHZH 2FBRA 5HYQA 5C0CD 2XWJB 5C93A 1PAZA 2D2OA 4PAZA 3KWVA 4IIQC 3SE6A 3D3VD 1ZIAA 2WUCL 4YDMA 1DDHA 3VO0A 1HXYA 1CFVH 1DQMH 3N44B 4NSKA 3NIFF 2R9HC 4FJZA 5KMGB 2PYFB 4P46B 5AAWC 1WZAA 1GKEA 4RISH 3KBFA 3IGFA 3NFNB 4GO8A 3WIIL 5FEBA 1DE4B 4RMTA 4ETQA 1ZSDB 3PCYA 4FCAA 1U3JA 5DO2D 3SB3A 2Q8VA 3Q3GB 1T1XB 4IBSA 4BQ9A 2R0LL 2GJJA 3E3QE 1E2WA 1KECA 3QWRD 4MHHI 4MASA 4F7CB 4J3WA 3HJ0A 3QJVB 3THML 3X13B 3QPXL 4AV4A 1VMGA 2OSWA 3HZVA 3GMMA 4UNUA 2VERA 2UY6B 4LH6A 4GKKB 1BF2A 1AI6A 1JYVA 3NP3A 3CSBA 4R3SB 4KROB 4JO3L 5DZOA 4OI8A 4HEPG 5GW7A 5HHME 3MRCA 1XX9C 5C08B 5B39A 3WMSA 4P2RB 4QWWC 4DKEL 4MKTA 3CCSV 3V6BR 4FTVB 1ZANH 3X13A 3VFOA 4M6OH 4PV1B 4OZGA 5A2FA 4KX7A 1TZHA 3L1OL 2WSDA 4L1DA 4APQD 4XNAA 3O4LB 1IKFH 2RIKA 4H7VA 5B8CB 5B38A 2MRYA 5C3TA 5ICYB 3QZBA 4IGGA 1ZLWK 4NVPA 5I66B 3M8AA 4H1LH 2W60B 5CBFA 1Q72H 3RVTC 1IC0A 3L7EA 2AAAA 3QXAA 4H8WC 4UQ2A 5LGNA 2UUAO 3EJZD 3QXUA 4WW2A 1I31A 5KMGA 4P46A 3IMUA 5JCOA 4X7TA 4HGWA 1PLBA 1QG3A 4JQIH 2PF6A 1VFBA 3FUNA 1ETB1 3W0WB 3QNZB 3QPKA 3T4YB 3WU1A 4R83A 3CRCA 5F7BA 4GT1A 4V1DE 3K7UA 2EDOA 2ZSWB 5E9DA 2LQTA 1J5HA 1QSFE 4IRSA 1VFUA 4PB0L 4IHJB 3D39B 2P43B 3HS0B 1KDJA 3Q8CA 4LBAA 3IVKA 4AV0A 1J9CT 3QDJD 1XMQB 4L23A 5LAPA 2YAFA 1HIML 3MBEA 4G72B 3PHSA 5EZIH 3UMNA 4A68A 3V4VH 3DK0A 4JTCB 1RU9H 2RDCA 2FO8A 1TA8A 4DUZB 2WZAA 3ETSA 1Y6MR 4MMYB 1EGJH 4G5ZL 4O51B 5E2JA 4H5SB 3QW9A 2HKHL 1GRJA 1J5DA 4XNMB 5ABZA 2EINB 3VXMB 1ET5A 4Y2DD 3PWLB 3A8TA 5F9WC 2N7BA 3O4LE 4APXB 2IQAB 3Q6FA 1UCTA 1M90W 2Q69A 2UY7A 4JG5A 3OZ9L 2N05A 3VBBA 4JFSA 5DURB 4K94C 5L88L 1NEPA 4LDOB 5AWNL 2YD5A 4MA8L 3LB6C 3VD7A 2ZPKH 4NZJA 2YKLL 1W72L 3VACA 2HFGL 4YPJA 1AR1C 1IX2A 1OSYA 1KIQB 1SJMA 3D48R 4JKPH 2B5IC 4MA7L 1HC1A 5BQDA 3SJBC 2BIHA 1JN6A 4JKKA 3IAQA 4P59H 1WFMA 4MCZA 3GMRA 3EUUA 3X1GA 3W2DL 3U6XA 3X1EA 2APTA 3KPSE 2Y6SC 4KNTA 3LDDA 1IGJB 4OCMC 1QFWL 4JO8A 4GBXC 5HVWA 2P80A 3PREA 1U8IA 3BD5A 2CO7A 4B5ZA 5C0DA 1CE6B 4KKZA 3IDIA 2FD6L 4G42B 4LIQH 3IJEB 4RBPK 1XWVA 2FYVA 1KCRL 1BZKA 1Z5LB 2DI8A 2ZXQA 3HLKA 3H1LH 1CP9A 1HHKB 3C5ZB 4BE5A 1HHGB 4CJ1A 3L3IA 1RD6A 2J6WA 1G7IA 2G9HA 4Y19B 5IEKA 3LNDA 4DTGH 5JW4R 4M6NL 5GS1C 4JKMA 1KF9B 2KI6A 2VO5A 4AQ8A 4DP2X 1EJ6A 4MGXA 1BG1A 5LCVH 3QJSB 3EZJB 4LHQB 4RDQG 2AXFA 1XBDA 3WFBH 4PVNA 3WDHA 3HR0A 4UV7L 1B4RA 3QQ3B 1UJ3C 1D5AA 1BZQK 4IOFD 1OCRC 1XR8A 4GUCA 2NMSA 1T0MA 4XVUC 5ID1A 3ZN1A 1BW8A 1EFXB 2ZCHH 1QLEB 3TYFA 3VRIB 32C2B 1UGKA 1PG7X 3FT3B 2F53B 1A1MB 1OAZL 2V7NB 3N1QC 3QQ4B 4E9QA 1D5IH 4X2UA 3RWEB 1Z9SB 4LF6B 4G9FD 4HYTB 3QNEA 2NLJC 4ORGA 5C0NC 1FZOA 4OIAA 5B4MD 3UTTA 1EHLL 1YN7B 1MRDH 1X5YA 4Z3EA 1JYWA 3RTQD 4HKBB 2CA4A 1S78D 5I1LB 4UTCA 3CFIC 4A7VA 5IREA 1BEYH 1G94A 5I76B 4JDTL 2D9CA 3VQMA 3M07A 3L4ZA 1RM1B 1QFUL 4JS7A 5FYJU 3FFQA 4EQ3A 3S48A 5IM7A 2BNQA 4AENA 3UJJH 1SEQL 2BS71 2JTYA 3MYJB 1Z9MA 1MFMA 2GITB 1MCIA 4QHUB 4U2YA 3JUZA 1IAIH 3Q8AA 1ETA1 4U4BA 4WHDA 4U7SA 3WDJA 3QORA 1OL0A 4N8VB 2APWA 2GK2A 43CAB 5KG9A 4PJEE 4C56B 5HDQH 3LZFL 4FG6D 3F58H 1YSOA 4LPYA 1D5NA 2W59A 2IWKA 4FKHA 3QUZC 5IFAH 3HTLX 2IAMD 3KG5A 4P3DB 1FORH 4XH2A 5FPOA 3TF4A 1L7IH 1WFTA 4UV4L 1MCKA 2R23A 3CC4V 2VR5A 4K8RL 1WDAA 1KYDA 3FQNA 2J3SA 4B9IA 4NDMB 4YXKL 1FL6A 4PJIF 2CMRH 1KB5B 2BOBB 4MMXB 4EKJA 2Y1AA 3RWRD 2LO1A 3R0NA 4RAVA 4H0LC 1ZEAH 3V5DB 2YIBD 1K7DA 1KDIA 4HGKC 4DQOL 3AQZA 4M29A 3HIZA 4NCDA 2YEQA 5B21A 3FRPB 2VDKH 1KJ3H 1L0PA 1E67A 1SVBA 1W9XA 4HPYH 2WHVA 5BRZD 4XR8C 5HYIA 2WPDG 1TG8A 4FC3E 2CIKB 4K5NA 2V3FA 5C07B 5F9DC 3PWVA 5GGQL 2ZNWA 3DC5A 1MSPA 5FC9A 3QJHB 5C0ND 1JXKA 4OZFG 3ZHKA 2QPSA 3CLEH 3I56V 4RLDA 3OMIB 3NQIA 3P02A 2H3NB 3F05A 4HSCX 4OFIA 4NUJA 4WEUD 1NEZB 2VS0A 2R69H 4NBZB 1U93A 2N7SA 2PWEA 2WWKT 4OLZH 1LEKA 1S9KC 4B41A 3C5ZA 4RWYL 3WNIA 2XNAB 5B39B 2LGWA 1NQBA 1AXIB 5F2FA 2NXYB 3O8XA 3SOTA 4U3SA 3IJSA 5DZNA 3PJSB 2EDYA 5F2VO 3RX8A 3BUYB 5EIQA 5E79Z 4F2MB 4X4KA 1KB3A 4JQVC 5FFOA 3KAAA 3NJJA 1IQWH 1XF5B 3A0BZ 4K3AA 3SR2C 1AO7B 2PW1A 3GZKA 2HFFB 2E8YA 1OD7A 3PNRB 4ZYKA 5E4OA 1INDH 2ATPB 4XPBL 4MDJB 3CNKA 3WFHB 2R1XB 1JFQH 5LXGH 3VFVA 5F8RC 4LF7O 1DYZA 2A77L 3MRQA 2FRGP 4A2EA 1U6AL 2KUTA 2J88H 3LUTB 2P26A 2UZPA 1AI5A 5DS1A 3RTLA 1MH5A 1SHMA 1TQUA 3ZRSA 4OI9A 2A3QA 3KJ4B 3BAEL 1I82A 1MFVA 4GSUA 4NERA 1JFQL 4QRSA 5LXGL 4R6ZA 2HJFC 5DN6G 3NAAH 1W6LA 1F45A 4Z7VF 1G84A 3DETC 2AXGA 4G59C 3CH8A 3WIFA 1HH6A 1SN0A 3MGAA 1G0XA 2VABB 1H5BB 3S3JA 2E5EA 5HVHB 1SXZA 4M1GL 1N64H 4Z5RA 1H8LA 3LIZH 1NBZA 5ADPH 3VMPA 3DUUA 2A83A 1ILSA 3G5XB 2Z3YA 5CO1A 3RTQB 3RVWD 3KXFD 4K7PX 1UH3A 3TA3A 2DIAA 3FTZA 4WCYH 1Q9KA 4PRPA 2P6JA 4EN3B 5AW3B 1UXWA 4ZW5A 2FO4A 1BD2A 1WCBB 2YXFA 3EH2A 1NAMA 2AABL 4HD9A 4PMFA 4UT9H 1KG0B 2J1XA 4F37K 3DUUB 4TLSA 4K3HA 5EEYA 1Z1WA 5IMMB 2WW8A 4Q6IB 5KSAA 4CC1A 3LKNB 5DJYA 2Z31D 4MMZC 2F53E 3D85D 3ASOB 1P4BH 2OQJB 1FC2D 2X4OA 3EYUH 2FQEA 1AXTH 3KPNB 5LMNO 5JLZA 1FG9C 3SJVA 3ULVE 3KYKH 1RIVL 4LGRB 4Z7UF 1A8JH 1JXDA 1SKVA 2EDKA 2FATH 2XG5B 1TVBA 4HLJA 4MNQA 5CLZA 3SDCA 3U0WH 5D72L 2X9YA 3MLVL 4N0UA 2CUMA 4XC1H 1CF8L 4WBNA 3F83A 1AP5A 3FTWA 1CXFA 2J20A 2Y36L 3N42B 5LBSA 4NRYA 4PP2B 4JFQB 1TZIB 5I9QB 1HTYA 1A5FL 1IDSA 2NOYA 3LZOA 1PFCA 2F7OA 1JF1B 3ZTCC 4K8RH 1N0LB 1LK2B 5J89A 3MBWB 3L81A 2HFFA 3K81A 2YS4A 4OIBA 4NKGB 5E5UB 4FQ1H 1IEAA 1K8IA 4NPKA 2O57A 4UF7C 1HYRC 4TPRL 2JWYA 5DZAA 1GZQB 1HKLL 2H3NA 3P54A 2ZJSL 3TA3B 3LPOA 3TIDA 5JO5A 4LOUD 4U3XA 2A83B 3AG3C 1XBRA 3QULB 3OB0K 5IBTH 2IXQB 1DO6A 2VSDA 3R65A 4NC1C 1LUWA 4Z3HA 2AC0A 3FB6B 3VFPA 3G67A 3G5ZA 3PAYA 4I4TB 4R7LA 4IEFB 3ZKXC 3HG4A 3RYCA 1UZ6F 3UAAA 1ZY9A 2J8UF 4P5TD 3VRJA 4F3FA 4WDIB 3W3BA 3DARA 2VZTA 3C5SB 3HG5A 1IM9A 5D7LA 5GRYA 4Q2ZA 1N8ZA 5IBTL 2X7LA 3ABGA 3Q13A 1T5XB 3BAJA 3ZZSA 1G1XB 3MXVL 4I0PC 4NKDB 3GSOB 4ODXB 1P5UB 4PEEA 4Y2DB 5CP7B 3WN5B 3V0HA 4GW1A 4E9SA 1IUZA 1AGEA 2DLHA 5FUOH 1HL5A 1XVSA 1AJPA 2C2AA 5DMIL 4LPCA 2ZUVA 2EZPA 2G3MA 1MQKH 4R9HA 2PXYB 2C9VA 4H4NA 4JDZA 4P9ML 3FB5B 4TUUA 5L4MA 1FFOA 1BEXA 2Q3XA 3CSPA 2DIJA 4G8IA 3KPQB 3CFMA 3CX5F 4EI6A 2GUOA 1G7HA 2Z5UA 2WLIB 3CH1B 2J71A 3VVWA 2YZ1A 3IJ9A 4FTVE 4ILDA 1JTOA 4LKXB 5H6RA 3CCEV 2PYLA 4JFEB 3O8XC 3UPRA 3MLTB 3QO1A 4IKIA 3QYCA 1KNOB 1RIVH 2H3XC 5KHIA 3ZHNA 4LVHB 4ATTA 1MCFA 4LNUA 3RNKA 4KDVA 2GJ6E 5T3XD 1V5JA 1IE4A 3APQA 6FABH 3SHSA 5C0JA 5KA6A 2ZXCA 3VXQB 1UT1A 4LARL 4XBPB 3FOMA 5SX5K 1ZV5A 1HI6A 1BZ9B 2WLYA 1OAZH 1CFNB 2JGDA 1U3HB 4KUCD 3ILEA 3DJTA 3EUDA 4JGSA 3RVZA 4FLXA 5F9AC 4XPHL 4LARH 4ORGB 1BIHA 3P73B 3U82B 3D50A 3LSQA 5D5MB 5BO1H 2IH3B 1HEJC 1BM3L 3CEIA 5E2TL 2X6CA 1WEJL 2NY2C 1K33A 3FT4A 4LSRL 2ZXBA 2I32A 3JBG7 3CHPA 3ETBJ 1IM9D 1NPJA 1D7BA 2WM0A 2BJML 4XP4L 2QFRA 5CGYD 3ULAB 1I1CA 2PW2A 3TT1L 3MRNB 4PG2C 4H88L 3U9UA 3DXAE 5JVDB 2OMBA 3IFNH 4N5ED 1WB8A 4DVBA 1B4LA 1ZLVK 2H3KA 2ZPKL 2VLJA 4HHGA 5KJ4A 4HWBA 3GBDA 4L8CB 3FHEA 1PG7W 1SBBA 5J6GB 2BOCA 3DIDA 2DKSA 1ZMYA 3WFDH 5I71C 1M6OA 1MXGA 3E1F1 4HK3N 5FUOL 3RGVB 2EDRA 4X66B 3KCPB 1XNQB 4DUYB 5CEZD 4PRDB 4PJAE 1UYWH 3RWCA 5DHEA 3S5LB 1E50A 3LRKA 3LH9A 3W2DH 5K33A 1KN2L 4YLQT 4OZIB 4TSCH 5AD0A 4W4LA 2JKNA 5JPNB 2EADA 3K6OA 4QAMB 5F7DA 3NZ8B 2CWRA 1KWGA 1J5CA 5IW6A 1A47A 2QLVB 2QGEA 1CTMA 4FLYA 2WGXA 3BABA 3HBZA 3K04A 3LVEA 4FYSA 4J23A 4KKCC 4BWTA 2W6JG 4PGZA 3S3WA 1S7TB 1QFWM 4QGYA 1LO5A 1VHPA 5D71L 1F1GA 3A22A 1TQWA 5FW8A 4LVNB 4X50A 2A4CA 1C16A 3CX5K 4P9HH 2M26A 5E4EB 2YBRA 5LP6A 5IMOA 4NNPH 4O4IA 1FC1A 2AERT 3UG3A 3UGEA 4DR5B 5TDOA 5E94B 1U8MA 2NT0A 4NQCD 3G71V 1I7RA 3JVFC 3ZKSD 2HRPL 3BXNA 4JKWA 3ET9F 2BVPA 5E2UH 2Y5EA 2OLDA 4P5TA 3RBZA 3LH2H 2EDTA 1AAJA 1HIMH 1PP9H 1ILUA 1YHPA 4ZUTB 2GTQA 4W4NA 2WSSG 1YEGH 3FUJA 1GVIA 1CDIA 1W8NA 1N67A 2I26N 3HAEH 4UZUA 3WUWA 4YHLL 3L3OA 1VKXB 1GM9A 5LDUA 1UEYA 4YDIH 3QUMH 1T1ZB 4WFEA 5HFLA 4PJIB 2FUTA 4I18B 4R5TA 3VXMA 5CA1B 2VQEB 1GGTA 5GONA 1ZS2A 2PYED 4XBGB 4ZFGL 4GIOA 1P4LB 1QRNE 1RCYA 3RDJA 2ZIMA 3LKOA 2EZOA 1N59A 3ZL2A 4NC0B 4AMWA 1WWBX 2CO7B 4R5XA 4LCCB 1CJYA 3D18A 5CINH 3BPOB 3RYFA 1EX0A 1JV5A 2J56A 5B3JF 4BIOA 4FZ8L 2XU9A 4OGXH 4M62H 3ZDXE 5D7LE 3DSQA 2E7LC 2H0JA 1CZ8H 5KSBB 1FSKC 4JAVA 3BQUC 4KJWD 3GMRB 3BLPX 1DBJL 2RJMA 5D8JL 1KYOK 3PAUA 1WIOA 4TMPA 4HCIA 2QM4A 5DEZA 4MX7A 2O26U 5DFWH 3FU9A 5CD5C 1AR1D 4KQ3L 1OW0A 5H35A 4H88H 4E9TA 3J81N 1M93A 3QNZA 5FM5M 3EJUA 3V4PA 5LGUA 2BSKB 3FB7A 2X4PA 2BJMH 4NNYA 5HHOA 3CFCH 3H53A 1A3QA 3BN9D 5DQ9A 4LF7B 3PY9A 4AK2A 3ML8A 4EJ1C 2UY7B 3VFOB 4JNXA 4RGMB 4ENED 2VDRB 1BM3H 3BGFC 4NZUL 5E2TH 2FX8L 5FHAH 1HQRB 2FEJA 4I0PB 2KBGA 3JAWA 4Y2DC 5HYJD 5JHBA 2UV3A 3JZ7A 4PA3A 3MU3A 5E51A 3HNSL 2KDYA 3TN0B 1UZ6E 1AKJD 4F8LA 4Z7QB 3U46B 5ANMA 2FL4A 4F7PB 4FG0A 2LFRA 4FTVA 1XOUA 2J8OA 5KEZA 5D1ZI 1ZPLA 1ZT4A 2ENPA 5FO7B 3L3KB 1C9SA 1G1OA 5FLUA 3PHOB 3G08A 4TUOA 4Z7UA 4DESA 2KG7A 3MNWA 1TITA 1NGZB 3QDMB 5KSUB 2PABA 3CZSA 3BKML 4GAGL 2WXRA 3ES6A 4HWBL 4DP8X 4EIGB 4U0QB 2L7QA 5FA4B 4BFRA 5FFLA 1MW0A 3QZWB 1S7TA 3K3WA 4FFVC 4JN1H 4PTUA 3F7VA 1TJMA 3IBEA 1IFHH 4N5UA 1IAKA 3THOA 4DTGL 4Y9CA 3RYHA 2WY3B 4HJIA 4LLWB 3ERXA 4ODVL 1VEPA 3CLEL 2GSIA 4RZCB 1EHAA 4R96B 2IH1C 5F97E 3GI8L 4AE1A 5I1EH 1MQKL 1XB3A 2Z7YA 1ZLEA 4GP8B 5GRZA 5HHQA 2VSCA 2ZNIA 4MSWC 1I1AB 2FO1A 3WD5L 4JM4H 2IH3C 5CF3A 4XHJC 2JDIG 3D34A 4F15B 4NQDE 3K6DA 4UM8A 5E9AA 1PKQE 5EG6C 5I1JL 2F7IA 3CN1A 4DQOH 1NC2B 4PGJA 3K59A 1E3FA 1E7UA 2GY5A 5LOVA 12E8L 1X6NA 4FFKA 1BQLH 1NUGA 1QLFA 4QTHB 3SDAB 3SE4A 3W5MA 3TV3L 4Q20A 1I8LC 2LVCA 1YJDH 4NO5A 1W72H 2Z31B 4JUTA 3OXSB 3MJ8B 5CGTA 3V4PL 4YSCA 3TH3T 1JNHA 1XCWA 4XB8A 1QKZL 2BWIA 1D6EA 3VFRB 1H38A 4R5VA 3KDMA 1K5QA 3Q05A 2E74C 3T77B 1KPUA 4KRNA 4QY8A 4NYKA 1U9KA 1TU2B 3TJEL 3TPUB 5DO2C 3AS3A 2P42B 3FO1A 1NSNL 4MJHA 3FU3A 4NQQA 4LF5O 4TNFA 3QULA 2XTJB 5C9JA 4U7NA 2CRYA 2OYMA 1NOAA 3MKGA 3NRQA 3ISRA 4FFYH 3NPSB 1XIWB 3KGRA 4BELD 1DZ0A 1M5IA 3ARZA 3DXAB 3R66A 1MUJA 1NANH 4GUPB 3ZDYE 5GRJH 5L2KD 3TZVC 2ICEB 1US6A 4QHKJ 3VSTA 1ESOA 3H85A 4QIRA 1FHNA 1M57C 3HHRB 1F3DJ 4IJ3C 2IBZX 4R4FH 4M4RB 1ET8A 1U41A 2ZP8A 4XI5D 1X5HA 2CKBH 1YNTF 1L0YA 1W8OA 4ICWA 4KRPD 5CILH 4CAGA 3MRJB 2EIDA 2PO6B 4I3GA 4L29A 4QIWF 5I19L 1P6FA 4E0RA 3RHWF 2Z8WC 1C8QA 2J8UB 4LT7A 4HP5A 4MJIA 3LQMA 3WO4C 4G8GE 2CBQA 2XC8A 4BDVA 2J2ZA 4HWZA 1UD5A 2X4PB 4HA1A 5EZLB 2AABH 5SWSA 4Z7NF 4FQIH 2NNUA 3ZKQD 4WBNB 2F8IA 3QISA 1V9PA 1NFDF 1RV6X 3MACL 1EZVH 4NQED 2ZYIA 1TO4A 3LZNA 3QNXA 4PS4H 4KPHL 2VDML 1QWUA 2L3BA 3IGAB 2QSCH 3WMPA 4ZUVA 3LZRA 3FB7C 3OV6A 2R69A 5IESH 1MFCL 1H3TA 3M6DA 4XNXH 4LFAB 4OW6A 1F13A 3QA3B 3O3BB 4MW3A 3BW9A 2XHBA 3IEAA 3SDXF 3JCUZ 2JV6A 5JJEB 4FQCH 2H4EA 2IXQA 5E7FA 4X83A 3G04A 1BZOA 4S11A 1R6NA 3NIFB 3NIGF 4XBGA 5AVZB 1PL3A 4CGTA 4S0SD 5FM8A 4CBPA 2YA2A 3T0EA 5AG9A 2JKRM 4M7ZB 5L0QC 3EJQA 2FT6A 4PBDA 2NUPA 4LKCB 3SJVD 4EN2A 1GYUA 1I5YA 1IRAY 1UM5H 2YLHA 3W1ZA 1YUHA 3OZKA 2WGNB 4GEIA 1P7QB 5LG1A 5T3ZL 2WQ8A 3QR0A 3TN0A 5IJKC 4XOBA 3VI3B 3WG7C 4UT9A 3KPOA 5FM5O 1T1WB 3US9A 3I3BA 3IRCA 2E59A 2F19L 3SDCB 2AJZB 4P23A 5F1IB 1Z9OA 3CDZB 5AB0A 2DE0X 5IMKA 1BFVL 2XWTA 4BXSV 5HHPA 1OTTD 5CLWA 5LDSA 5A16B 5JR1H 4PJ8A 3F62A 3E8GA 4TTGA 3PL6B 4ZDHA 2OQJA 5FAAA 2QPUA 5HHVL 4J9YB 4YXWG 2CNYA 3BEWB 3QNYB 3HG1E 4JJHA 2C4FT 3ZHDA 1OZ0A 2MCPL 1RHFA 1N70A 5H9CA 4X6BA 4BIUA 4IRZL 1QLNA 4FQLL 5E0FA 1CBVL 2C3WA 3BT2L 2CXGA 2A0LA 2KQNA 4OKDA 2XAJA 3BLKA 3BZFB 3ARFD 3S3BB 2FQDA 1A3RH 1T22B 3P4NB 3KDMB 2Q1EA 5I8OL 4P5MA 5K9OB 5IOPB 2MKWA 2VDKL 3MGOB 4N2FA 4WY7L 4B9YA 5IFJA 2BK8A 5IHUH 2XT9A 1ZT1A 4MBOA 4NO0B 1JGIA 2XTJD 1RLWA 4UM9A 4ZPTA 4RGNC 3WB0A 4QF1A 4DUZO 1JZ6A 2WYTA 5IY5C 1SOSA 4J39A 3OJDA 1QTSA 1GZPB 2FB5A 1L0LH 2L35A 4YSQA 4XMZA 4F91B 1ZS8B 4TQEL 1T21A 3VWKD 4FNTA 1ZJBA 1UM6L 2A4EA 3QFDA 5JA9A 5CNHA 2WTPA 1NWOA 1CS6A 4JZNB 2NX5D 1FNGA 2NZ9C 4JDVB 3GM0A 2IAAC 1K3EA 4FLTA 5I6KA 3VD2A 4JCLA 1TJXA 4N21A 1CGSH 4IU3B 1R3KB 1O7VA 3CFKB 2NY1C 1NKGA 4KITB 3PHAA 4K8XA 3WFEH 4BFBD 2YGVA 2VWKA 3HE7B 1FPTH 3KPRB 4AQ1C 5IKCB 2CR6A 1SLVA 1U2CA 3RE0A 2WO2B 3W38A 4NQSA 1ADQA 1AOZA 2K7PA 2H3OA 3EIFA 1OIOA 1WPBA 5IB1B 3UC0L 2ZKMX 5H8DA 2Z65C 3GPSA 5JH7B 4HT1H 4NWUL 4WNQA 4HNAB 4HFUL 4LPXA 1F3RB 4JDTH 1KTKE 1F58L 2I7OA 4GMTH 3VXRE 4G6KH 1D7FA 2KZWA 2W80C 2IGLA 2ZT9C 3SQBB 3FX7A 3U4BH 3JAMN 3JWDL 2HX8A 3GMPA 2XWXA 2L6LA 3CWBH 2WXLA 2CSPA 3QZLA 4YUEH 3CHQA 1K8AW 1MCWM 1KNOA 4YBHA 4DV6O 4N5EC 4B9KC 2VW6A 5D1ZA 1FUNA 2H2SD 4K7PL 15C8L 5CKAA 4NUPA 1ZT1B 5GHWL 2DM4A 1QEWA 4IKJA 1FFXA 1FNSL 3CQQA 3MLRH 4IS6A 1CFVL 1MI5B 1WPCA 1LK3H 2CDGA 5HI3D 4R26H 1GY1A 2Y07L 4JI7O 2XRAH 5K39A 1NT2B 3O3EB 2HFTA 2NR6A 3K74B 4A1RA 4UV7H 3P4NA 1JCHA 2GBAA 3TXSA 2PXYA 5HYSB 4DVBB 4C47A 1ADQL 4U1LA 5AL0A 4HKXA 1DBMH 2ADJB 3V5DA 2Q10A 4FQJL 4JUSA 5KYYB 2HJDA 2B15A 4TQFA 5A2AA 1U91B 3Q2WA 4XMUA 4XX1G 3BA8A 2NNRA 1IGYA 3IDJA 1DSFH 3GFUA 3ZW3A 4DR4B 1IARB 4UCFA 4LIQL 2ZX8A 3QWNA 3VFTB 4LU5L 4Y5YA 3RBSA 3C5JB 4KUZH 4PLKC 4G7YH 1KACB 3N85L 2X0LA 4WLCA 1XGQA 2P7TA 3UQ8A 3CZGA 2GFBA 3P3YA 3LQAC 4WFEE 1EBPA 4I8DA 3FYEB 2PCFB 3BAWA 4L4JA 2DLTA 4I48B 3O9WC 2CDEB 2GQHA 4N85A 2BP0B 1RK1A 3NRFA 4FABL 4J1UB 4XNZB 1HI6B 5JOPD 3FC8A 4U0RC 1LNUB 1B4TA 1BHBA 4NYLA 1VF5C 5J9PC 1HKFA 3AQXA 3HNVL 5D2NE 4G1EA 1RSOA 4NQCA 1UB5B 5EN2B 5HYJE 1IGJA 4LVEA 3OXRA 1GW0A 2OMXB 3VDBA 4X80L 1H3GA 4OF0A 5CJBA 3AEIA 3N0AA 4JFEA 3UPRB 3OZ9H 3GHEH 4DF9A 4AI7A 3L3HB 3OSKA 2X6MA 4P4RB 1OSPL 3CGTA 4YJ3B 3BP5A 5KUMA 4IKKA 4MA1C 1USZA 4M1CC 2GT9A 1KXVC 3EOTL 4NQTA 3KDPB 4MD0A 5LNEA 4N2NA 1DFBH 1KGCD 4YXHL 2WZ0A 3WEBA 3ETGA 3H7BB 1DQVA 1XGPA 3N41F 3KPLB 4DO5A 1CD9B 5BS0E 3ULVH 3VNZA 3P4OA 1EZUA 1WD8A 5E1QA 3OPZH 1PJ9A 1YECH 1TGOA 2NY7L 4HV8B 5F1NA 3CC2V 1T0MB 5GZOA 4X9BA 1VAHA 1XR8B 1UM5L 4FA6A 3GBLA 2ZNJA 5BXZA 3E8BA 2IOOA 2FH6A 3M8OL 2NX5A 5FGRA 4DGWC 4E5XB 1CLOL 2EUVA 3NZUA 1TVHB 1YA5A 1JHKH 3GSNL 2DQIL 1S9WB 2VDNB 5T33H 3U1PA 1PX3A 1TTFA 3FH7A 4LNUB 1A3ZA 5EUOF 3RNKB 1A1NA 4KK9C 2BCKA 1X9RA 2VQFB 3D05A 3NESA 4IRJC 4FI7A 4JZGA 4F8TA 3QUYB 4UQ3B 4JI5B 2BXZA 4KWUA 1CXKA 5CZVL 4JM2D 3JD0A 4LNVA 5AW5B 2WINB 2B1AL 1N2RA 3CB2A 4K3JL 3ARRA 1U96A 1Q6IA 3QXVA 3NSJA 1UATA 1SM3H 3GIZH 4NGHH 3B7TA 1MPAH 1J1PH 4WFFA 4HLEA 5L4JA 4RQQA 5FA3A 2CLZA 1Q6UA 1AS7A 3TXQA 3D6GA 5FO8B 4I5BA 4JFFA 1REIA 2FNWA 3O8XD 2J8HA 5KVEE 1HWYA 1OCOC 1MCNA 3ARGD 1FVCA 4M43L 1X7QA 3V4UH 2JLLA 3QIUD 2LLLA 5D7EA 2YBGA 3CFUA 3L7EB 1A7RL 3QXAB 1CDCA 3T2LA 1ZHLB 3DGEA 1QRKA 2F18A 3G80A 3D87B 2G2RA 4HKZB 3WV0A 4OD3L 5KBNC 1TDQA 3H01A 2R1XA 2VC2L 3SJVB 4JO3H 3CCJV 3IBOA 5D5MA 2QE7G 3HHMA 4PJXE 2B9AA 4Y4KD 4Y5YC 4GFXA 5L2KE 4M03A 5T33L 2PY5A 3HG1A 3VWKA 3UFIA 1YNTB 4GP4B 1TUEB 3CIQA 3TF7C 5DZLA 2DQCL 4AT6A 2JQMA 2MQ3A 3GTTA 4DCQA 4RIRB 1YTFB 4HCRL 3GSUB 3L95A 1M1XB 2X1OA 3OM3B 4XPAL 1OAUL 3WKYA 1YECL 3NUKA 3QNFA 2EO9A 5G4OA 5LYJB 3GINA 1IGFH 2EVIA 3GK8H 1IEAB 3BLBA 4WO0A 4TQ8A 1MI5E 1UOLA 1KZQA 4UINL 4ZMAT 1B0GB 4P23C 1E5YA 1JAEA 4IIJB 1ZIBA 4Z7VB 3NDYE 4GP5B 2Q6WA 1BHAA 3C09B 3QJHA 4LOUC 4YHPB 3RNQB 3QPQD 4F37F 1BOGB 1KBGH 3C12A 3VQLA 4R96A 3SY6A 3S35H 4OZHF 4OIIH 2YJLA 2YOAA 1ZK9A 1YDPA 5DR5L 4AGLA 2DWEA 3KVQA 4FKKA 4BW9A 1BD2D 2ODIA 2ZYSA 3UTSE 2G3XA 4QXGL 4TXVB 1VF6A 4X8CA 2CG9X 1OOAA 1NCTA 1AGEB 2DICA 3K79A 3F7VB 3O4OC 4OM1H 1LE5B 2NW3A 3SBWC 5KVEL 1WC7A 3MX0B 2YEVB 4ZHQB 3R4RA 1S5HB 1UH4A 1HNWB 2PWGA 2WBJB 1SF5A 1ZHNB 3QUKA 1TQVA 3NTCL 1BQKA 2XAFA 3PDOA 4RRPA 1I9RL 4FI8A 1CXHA 1AGDA 5DHVB 4ZYKB 1EANA 4KUZL 2CUHA 1D5XB 3G5ZB 2KHAA 5BRZE 3OUFA 3B9DA 5T5FA 5EC1C 4O4LB 4Z6AT 3RDTB 5I5RA 1OKEA 1JP5A 4X8GA 3BT2H 4BH7B 1U58B 2VMJA 1G6UA 3IRZA 2L7UA 1OTSD 4P48A 2WIIA 4Z7UB 1KELH 5GJTL 1U97A 2BERA 4NZTL 5DQDL 2PF4E 4OIIL 3UCQA 2CHDA 4NFCA 1GM7A 3MYJA 1TZGH 2B1IA 3T2QA 3BVDB 1ANUA 1QFPA 5FNVB 3Q1SH 2VN4A 4EI5C 3CXHF 2RCVA 1DHKA 3AABA 1U8PA 4ETQB 3Q4HB 1X44A 3QEHA 3O9WB 4LLMB 3D3QA 5BMVB 4AJWA 4UVBA 2GC7C 1I7TB 1NC2D 5C8YA 4UTAH 3IU4L 5ALCH 5CN2A 4JW3A 4MNQB 5F3HA 3BXNB 2FR4A 1VF5B 3JTSA 2DYPB 1AOHA 2BVOA 1HCVA 2EXYD 2XHNA 4BSVB 5DA4A 3BDYH 4D94A 3P11H 4LF9O 1AD0B 5L3FA 1VZIA 3OBAA 2FIKB 4D3CH 3ZN6A 2CLZB 4M1CD 4TF4A 3IU3B 2H32A 4PRBA 1YNLH 4LSTH 2W81C 1A6WH 5H94A 1B2YA 3MXWH 4J27A 2BMKB 2EDXA 3LKOB 1KTCA 2XWCA 5KBDA 3V52H 5FUZH 3U11A 1MG2C 3SBQA 3CFEA 3PGDB 1I75A 1A6VL 2FT7A 1PL0A 3BSZL 4ZMTA 4A7SA 1R47A 2GJPA 5DVLA 4JFXA 3WNKA 2Y48A 1J5OL 3ECBA 1J8HE 2Y7OA 1UGNA 4MJ6A 1Z32X 4G9FE 4R97C 5BV7H 3DJRA 2R1YA 3C6LB 4XP1L 2PMZA 5EO9A 3GUTA 1DQKA 1SMOA 2Y25A 2JI2A 3QDGE 3ZDZE 1JNJA 3HRZA 2E75B 2XA8L 1SXCA 1VACB 2BZCA 3LMJH 4NP4L 3QHFH 4ZG1A 1PD1A 5AQ0A 3RTQC 3T0ED 2VZ3A 1IAOB 3O6LH 2GEEA 3HRZC 2YC1A 2WVTA 4KRMB 3CC7V 3BAIA 4NENB 4QE9A 2BOCC 3CE2A 4R4ND 4CRPA 4L8BB 2OXGB 2LLNA 2Q86B 1NCCL 2J44A 3DRQA 1GOFA 3DBXB 3GB7B 2P22C 2KZBA 3LXUX 3QXWA 4HH9B 4KQ0A 4U6YB 2Q3AA 4FOMA 2Y4SA 1NLBH 2YGOA 4FXKC 4PJ7E 5I1IL 2IADA 3UROR 4YDZA 3TEYA 3ABMC 5F0LB 4PJHA 5TK2A 2ADIB 1GTFA 1MABG 4I1RA 1D9KB 1ZT7B 3BSZA 3P4OB 2ICWI 3VDAA 1IBFA 2EH7L 3CMOH 2DI7A 2HX7A 4KP4A 1PZ5A 4KX8A 4A2MA 4PJDB 3QDJB 2X40A 1GR7A 3FBQA 4ZAKB 3MRHB 4LH7A 2RQEA 3LNIA 3PFUA 5IW6B 3CC1A 2YXLA 1KXHA 1PNCA 4OJDH 2VXVL 5D5MF 1XGRB 5CIPA 1SEBA 3VTMA 5CA0A 2VDPB 1LO5B 4HJ0D 3LXBA 3KXFE 2OMXA 4HJSA 4R2GB 3CC5B 5E4EC 1E5CA 4CZZA 1BVKA 1CBJA 1Q94A 4PJBA 2NSXA 5ANME 3SDDB 4E41D 1T7WA 2WXNA 3HC0A 1CF1A 4Q14A 4GKNB 3INUL 2DWEC 5HXMA 3QXTA 4M7KL 4TYUA 2IGFH 5FYJH 3BUTA 2MH4A 1PSKH 4LBEB 3SDYH 4BFEA 3FUKA 4HPOH 3KLAB 3U1SH 1YCIA 3E22A 2BMKA 4HOXA 4D6TH 5LAXB 5AVTB 4XMXA 3O4LD 1YN7A 5EFIB 5C07A 5D7JC 5B7FA 1BQLL 3E8FA 2VNCA 4MDIB 3SKNA 5I1AB 1J95A 2YICA 3ULSA 3ZRFC 2P90A 1U21A 4YFDB 3KCWA 2V33A 4PJCA 5B1AC 1BF8A 1CWVA 5AEAA 4JJ5A 4X98A 3TC9A 4PU2A 4HJUA 1UQSB 2AW9A 5EUOA 3JTSB 1A2YA 3OJVC 5KJRL 2CA3A 1KIUB 1P1ZA 3Q1SL 4K5PA 5DD5H 5EFIA 3FQUA 3WNMA 1T03L 5DJDA 4L4TA 2H5UA 1T7YA 3QQ9C 2X7LB 1A65A 1JI2A 1AZVA 2CIIB 3FTXA 5BUAA 1N0XL 4LLMA 2Y9RT 5EIVA 3JAKB 1JWSB 1XMQO 3ZRVA 1SYVB 1T80A 3BEVA 3G6JA 3ILPB 3T04D 3V8OA 5IUSA 1SOQA 1GKOA 4KMQA 2Q7AA 2N04A 3FQTB 3P73A 3RW0A 3DRQB 3GB7A 4HH9A 4JN2A 2LU5A 3EDDA 4YL9A 2W91A 4XP4H 1ZDQA 2VDRH 4R4NC 2AW2A 4FQJH 1MJUL 4HHWA 1P4UA 4XNMA 1OAYH 3K9SA 4AXWA 4S0TD 1MY5A 2UZIL 3AK2A 3ZL4H 1IC4H 3MRPB 4LFHG 3BCDA 1O9GA 2D7PA 2NQ3A 3PV7A 1K8IB 1CFSA 2BVTA 3A6OA 1FYHB 3B8YA 4FQ2H 3Q01A 1DQDH 1QTPA 4OF7A 1ZSDA 5LG6A 5GRVL 4D0BA 5IV2A 3O3UN 5L8KB 3GWOA 4BUQA 2H41A 3BUIA 3RDTA 3S35L 1A4KA 3IMRA 3ZCCA 4H8QA 1KBGL 2EYRA 4D7SA 4WFFD 1QHTA 5EUOB 2FECL 3EHBC 3ILQC 2FIKA 3MQIA 2VWEE 5A16A 4F3FB 2F9BT 2FLRT 3MUHL 5ESAA 5FYKE 3WY2A 4YIQA 1YHQV 3ZSTA 1XHXA 1Y6NR 5L2JA 1PZAA 1ZHNA 2BNQD 2RTTA 1QSVA 2W38A 3W11D 3U6XS 4GW1B 2J5LB 5KTEL 1JZ2A 3KCYA 4F57H 4LGPB 4KQ3H 2B7DT 4Z78B 4HAGA 4Z7IA 4IMLA 5KSBF 1J5IA 1Z3GL 4JG1L 4MJ2A 4OD1L 3VRJB 5IJVB 3BWZA 2NUTA 2CHWA 5AAWA 1CGTA 3MLPA 2VXUH 3QYNA 4YMPA 4WQOA 1C08A 4W9HC 2QT6A 4WTWA 5LBSL 3SGJC 1YAIA 4IIQA 3MDSA 4OZHA 5HJDA 3OTTA 4J28A 1IGTB 4Z0BL 3JYBA 2E7MA 4ODSL 1AKPA 3APDA 2KS0A 5DC2A 5ISZD 1MZYA 1GY2A 3ARGB 1FJ1A 2P5EE 3G5XA 3MTRA 4D8PB 4TNGA 2P48B 3KJ6L 3MLZH 4X99B 2E4FA 1M1XA 1SA0A 2D7NA 4NKMA 1MCSA 1AGBA 3BEWA 3P3UA 4B0MM 1LE9B 4DEUA 1DVFD 4LZKA 3TVMB 1U8NA 3CTTA 3A3YB 3BH9B 1S9VA 3MD0A 3HB3C 4L48A 4Y16C 5TK4A 3SPVB 3V9FA 1RUKH 5KVDH 5B1CA 5FYLD 5CHNB 1CGSL 4JFED 4H8WL 4M8QA 5BZDB 4NC1E 4XHQA 3L45A 1RZKC 4CC4A 2E75C 3HKEA 4Y1SA 4R90H 2Q67A 2AJUL 2BE3A 6PCYA 2W60A 4JYYA 4XDLA 2VH5L 2Z31C 3TO4D 5AG2A 1SM3L 1A3RL 4QR7A 2CBOA 4U2ZA 4A55A 4QRRA 1I9EA 2IV8A 3BQUA 3CV5A 5FW7A 2VLRB 1L9QA 1MZFA 1J7VR 3QIWC 3VD5A 2WMPB 2XWTB 1DQJB 2E9GA 1TO5A 3MSPA 2N1TE 4I4WA 4KK9D 3VXTB 4ZUSA 1Y74B 4O2AA 4XC1L 2YUWA 4K8RD 3FQ4A 2DMXA 2IQ9L 4BK5A 5GZOC 2Y6TE 2IVFC 2QTEA 5EU3A 4EZMA 4BFOA 4F8PA 4ZMQA 1XGUA 3TJHD 3FCBA 3NCJL 3UH8A 4RGOH 1D9KC 4QCIB 4YE4L 1S7SB 1W0JG 2FJGA 3MV8B 3GUTB 1I8MB 5LB1A 3ULVC 5DVKA 2AAVA 4U1IA 3F6LA 2VMCA 4ZAKC 4X64O 2AQ3A 4HC1A 4HIEA 2W88A 1XB8A 4N8UA 1NU1H 1NLDL 1PIGA 5EOTA 1OZTG 3T2NL 4QJ5B 1HCFX 1VB9A 4HPOL 1G9NL 4DUVA 4L9LB 5LGHH 4IMLB 1YC7A 1PY0A 4QHPA 4ZOCA 7PCYA 2BCKB 3REWA 3C3TA 3W5NA 4E9XA 1GYWA 3WIFB 1KFAL 3IU3A 1SQXH 1GGIL 2BSDA 4RBPH 3M7OA 3WO4B 2YA1A 4HC1H 3ARDD 1VFAB 1P7KA 2EVJA 5IJCC 5EA0H 1WAAF 3UTQB 4CNIB 1HESA 1NGPL 1XH0A 4N2AA 4GSRA 4Z76B 1VADB 2FECI 4P5RA 1XAKA 3CBRA 1BOGA 5KBKA 3OG6B 3FZUD 2C9RA 2I9TA 3C2AL 4RUEA 3L72H 5D7JB 1OPGL 5LGJA 2GI7A 3V9EA 1OCWH 1MREH 1N7MH 2VZVA 4WI9A 5K9QG 1JUFB 4LCWD 3WI9A 4QOKD 1ROPA 1N32B 4DV0O 1IGML 3B2DC 4ONHA 2A6IA 1SXBA 1NINA 3K72A 3N85H 3B2VH 3V6OE 2ARJB 3MRCB 5KANG 1AB3A 2NY0D 1JR9A 3OAYK 2HA1A 1E79G 2NRDA 1G1YA 3NK4A 5AVSB 2RJZA 3CAFA 4JV5O 2N1KA 1U8HA 3T1FB 2EUXA 3MOBL 4E4EA 3P3PA 4IRJD 1MCOH 3VXSE 3A6BH 3GIVA 4QJFB 4K73A 1FHGA 2YN5A 2ADPA 5LA6B 1FGNL 1HU8A 2X4RB 3Q3GA 1FFQA 4PJ9D 4OX9B 5EUOE 3VFTA 4BK8A 3O6LL 3X1NA 3ROLB 4QRQA 2XYCA 1YEGL 2IH8A 3H0TA 1UM4H 4WUUA 5PAZA 2P8PB 3IXTB 2ZOLA 1GYCA 3QEQA 1G9ML 2Z31A 3KNBA 4FDWA 2DQUH 4ODUA 1H6EA 1B06A 1FYTB 2EJ7A 2EE6A 4KI5C 4Y5VB 2DAVA 2FWSA 4F5CE 1A1MA 2F53A 3LRLA 3UACA 3MCKB 1CL7L 5J3HC 5C6TL 4ECNA 5KBLA 4WI2A 5C0RL 5AB2A 2KC0A 4LPWA 1WLEA 2HKFH 4J6RH 3LDBB 3OKOA 2G75A 4FG6C 3TFKC 3S88L 3GJEB 4FEIA 5KHKA 1DQIA 4W4OA 1I4FA 1ZTXE 2FZ3B 2BSBA 3K0DA 2H2PC 1EERB 1RZQA 1E27B 2OP4L 3OMNB 3BKYH 4K3EH 1I1AC 4MSWB 4BAYA 3ASNB 1MIEL 4OUOA 5GRJL 5IP4A 1QKZH 5EV7A 4AY0A 1A1NB 1F0LA 3K6SA 3DX9A 3NIGB 5EN2A 4X6FB 1I1AA 3WFCH 5IM7B 3BPLB 4J8RB 5GGUA 5MEQB 1OXYA 4YGVB 3IU4H 5ALCL 4R7CA 4NLHA 3D3VB 4JI6O 3MUGA 2W9LA 2A74C 1SYSB 5D96B 4PA4A 1YYLL 3ARXA 5TE6H 2QWQB 4WUKH 2J4WH 1RERA 4PWGA 3K4ZA 3NN8B 3T0EE 5D6CA 3ESNA 4JFPB 2KPWA 3DVGA 4XPFL 4HOMA 1J1XH 3FQXA 1LEIA 2GFBB 3LEYL 4K3DH 3S8GB 1JGLL 3UTTB 2JQZA 3OTOB 2NW2A 4LPUA 3SQBA 4NN5C 2OMUB 1Q3EA 2BP8B 4RSYA 1QR9A 4PRID 4YJ2B 4PJGA 5FGCE 3V4PH 1QSEA 5CKGA 1ZHLA 3IFNL 4RGND 1MEXL 3GUFA 1KGIA 4WFGA 1YJNV 4XP9H 1FZOB 5I73B 2BSSA 5E6IB 1NMBH 3MLYH 4WJ5A 2B0SH 5KW9L 4KO5A 3VFNA 1E0OB 1B90A 1UCBL 2AVFA 2HG5B 2D3JA 4JN1L 4NLAA 1EJ8A 2AJVL 1IXMA 4PB9H 1HYSD 3NTCH 1P84F 2HT4D 2ZCLH 3NIDE 3BUDA 1G7LA 3HI1A 2BNUB 5HI3C 5IBLC 1EHLH 2LV4A 4G8GA 4NJ9L 5T1KB 1QEWB 5KVEH 5EBLB 5EYPB 3IJEA 3POHA 2Z4QA 1RH8A 3SD5A 4EOWL 4MTFA 4U1HA 3HKBA 4XTRD 3DLQR 4X1YA 4UT9L 3TL5A 4PMEA 3SDCD 1PNLA 1DJGA 4QXTB 5DC0A 4NRXB 3PWPD 4LEBA 2D2CC 3V55A 2Q9LA 3H42H 4HWBH 1KXTA 2FVNA 1U95B 1GAFL 4F9PA 4QT5A 2C7UA 1KCWA 2EEFA 3IAGC 2XI9A 1NM9A 1UUSA 4Y9FA 3LRMA 5C0DB 5CUSL 4QUOA 1NR1A 2ZKYA 3WJMB 3B83A 4PRHA 1FO0H 3US0A 5CGBA 4HUWA 4I7ZB 4PIBA 3VH8B 3W0WA 3QEQE 1IGFL 4FHJA 5T1DL 2RB8A 4KTDL 4P9MH 3RL2B 1EBAA 3UJIH 5K39B 4B9ZA 4YSUA 3F12A 4JB9L 4GAFB 2CKNA 2WJ7A 4JL2A 1CCZA 1AP2B 2UWEF 4PY8J 2YEZA 3L3HA 1SQQH 4FXGA 4Q6IC 5D9SA 3EXLA 3S8FB 3TFKD 3QEHB 3M1CA 4XPFH 5D2NB 4DOHE 4HWEL 5JMOC 3JATA 4HBCL 1PZ2A 4JM0A 3HPLB 1NGXB 4Y16A 5I75C 4FQCL 5J3HD 2BIMA 2KH2B 4WW2F 4WWKB 3TH2T 1S8DA 4NM4H 1WZLA 3W7SA 4H8VA 3Q8FA 3N42F 3EGSA 2N0MA 2QADD 5LQBL 3RIAK 4C59B 2PCFA 3B43A 5CZKA 1I7RB 2K6YA 1CG9B 1SNRA 3T4AA 1WA1X 4YBQD 2XQ0A 4GAYA 4M3KB 4RWYH 5C09D 3BUPA 1SHWA 1CDHA 5J2UA 3K6NA 3BZEB 2HJFA 4AQ8C 1JG9A 3P0VL 3TTSA 3E2EA 3T2MA 1M3JA 3PDOB 4NGHL 2X3AA 2AXTZ 2LW3A 4IKNA 1NCBH 4LSQH 2FQFA 5TISZ 4B3TO 3HKDB 3PPEA 2UZYA 5DJAB 2YIHA 3EJZC 3EG9A 2EXSA 1JVKA 4DV4B 1R73A 2JK5B 4DV6B 2RALA 4XI5C 3VGFA 2NLJA 4F6RA 1ADWA 5CIPH 5GGQH 4G9DA 1K2DB 1AD0A 1UKQA 3S37L 4L0PB 5SWZB 5HFMA 3NT0A 2ICWJ 1M6OB 1FKAO 1OTTC 1EXUB 3IAYA 2CBMA 3CBJB 3K1KC 3LNMB 4P9HL 4R4FL 1ETJA 5DRXB 5C09B 3DYPA 3CLFH 1AHKA 3JALA 1MI5A 2B77A 1QW8A 4GG8B 4JO2L 5D1XA 3T3MF 2IANB 1P7GA 4GAAA 2Q73A 1NGQL 2QEJA 3FZUC 3OKDB 3QCTH 2NT1A 4NQDB 4ZO6A 5SWQA 5IHLB 5EF2A 4O2EA 2BNUA 4ZODA 2AF2A 5I5MA 4D2NA 3SE3A 3NA9H 3FU6A 3DX2A 2X7RB 4DV5O 4PJ7F 2PNDA 3FB5C 4EN3C 5BVPH 1JPTL 2JKXA 1PZCA 1FORL 3ZTDC 3H55A 2IDSA 4W9LC 4DP5X 3AS1A 3QG5A 4F9LA 5KN5A 1AMXA 3T0EB 5IQ7H 3IFPB 2WLKA 4PG2A 3MHSC 1PNKA 4I0PD 4N0FA 2QSVA 3GSUA 3L95B 2ENQA 3HKCB 3IMVA 4MXVE 4FLQA 4M6OL 4R0LC 4N3TA 4DFIA 4JRLA 3WSQH 1IO4C 1BOYA 2ZXWC 3ZDZF 1SEQH 2YUVA 3UDWC 5E8OA 3RZCB 3VGGA 2W0FB 5BOZG 2HLFC 3NAAL 3FU7A 3BP6A 1I0HA 4I9XA 3LKPB 4BV1A 1ULVA 2WBJD 1L5GA 1Q0YL 3CP1A 1NBQA 3N41B 3P0YH 3V0WL 3VXNB 4JRXE 4QRTB 5I8CB 3D4YA 4DGVL 1NCHA 1SYSA 2MNWA 1U6AH 3SDAA 4J2QA 4MJJA 1RK0A 2OR9L 3ZT7A 2W9DH 5BMFL 2P5OA 3MNMA 2R56H 4PRHD 2WK2A 3HKFA 4ZO7A 5AZ2H 2UXDB 3GKZA 5JW4M 2XTLA 1PEWA 1LK2A 3U7YH 3QC5X 5IVZA 3WU2Z 1GN2A 4PJEB 4QRAA 4C56E 1NBYA 4NO2A 1RZFL 1FPOA 3RNQA 1N2RB 3FS9A 3ESPA 1RK0B 4PGCA 1XUQA 2X89D 4KRPC 2I9TB 3PE9A 1JFFA 1U4FA 2HT2D 2CR0A 6FABL 5FLVA 1N32O 4L3EA 3OHXB 1CPUA 3BW9B 5ABDE 1N8ZB 2WLMA 2GSIB 3CXHJ 3ZMEA 1BWMA 1P2CA 3QHZL 4TV8A 5DRXA 5LCVL 5HGHB 1NKOA 3CCHB 3ECVA 3HR6A 3BDBA 1S7WA 4DP0X 3B6SB 4Y2LA 5MEOB 2O5ZL 4CL7A 2QKSA 5EOQH 4ACTA 4NHUB 4XCNB 5DJYB 1D5ZA 2P8MA 3DX8B 4V1DA 3C09C 3RWGA 3RWHA 5LCVA 5D7LB 3GBMH 1FYJA 2G2NA 2FD6H 3OW2U 2FAUA 3GBNL 4G1MA 1HZLA 4L3EE 2OR9H 1QCEA 2AHIA 4M7LT 3WS6C 2ZCKL 4CDHA 2V2XA 4RESB 5KVFE 2ZAIA 4E68A 2XZQL 3T4AB 5EWIH 3MMEB 5AB9A 5F1IA 2HFEC 5IEHA 4JI3B 3NEXA 1MFAL 2JE8A 2KG7B 3TPKA 3WKPA 4BZYA 2GUYA 4HZ1A 1A1OB 4AZ8B 4EMZA 1VQPV 4UVCA 4GRLD 4X4ME 5GGTH 1RMFH 3U36A 5D1XB 4LEOA 5JQIB 2Y7MA 3DETD 4I3RH 4JG0H 4YHHO 2ZX5A 3W11C 4KJWC 1GS7A 1WAPA 3QZW