3AG4B

Bovine heart cytochrome c oxidase in the cyanide ion-bound fully reduced state at 100 k
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag4B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag4B02
1V55B 3TU6A 1MG2C 1J5CA 1PCSA 2YAHA 2GIMA 5IY5B 2BHFA 1E5YA 3X1GA 2PCFA 3EHBB 5I6MA 5I6NA 4YSRA 4BWWA 2H5UA 4HHWA 4E9RA 4DPAX 2OV0A 1PF3A 1GR7A 2VMJA 2B3IA 3QJSB 1AZCA 3QJTB 2EIJB 1AS6A 4YVNA 2FQGA 3NJKA 4Q8BA 3AG2B 2QPEB 1WA1X 1OE1A 4ZK8A 4GYBA 3WG7B 4BDVA 4WKXA 5D4IA 3TA4D 1IC0A 1JERA 4JHUA 5B1JC 3TASA 1A65A 2P80A 4KOBA 1NIAA 3T9WA 4PCYA 1NIDA 2GSMB 3QJVB 4E9YA 4YSAA 1BYOA 1JZHA 1TEFA 1AG6A 1PY0A 3AW5A 2J5WA 1JZEA 3AG3B 1PNCA 1A3ZA 2YAPA 1ET8A 3KW7A 3PPSA 1JZFA 3ABMB 2XYBA 1FFTB 4UANA 2GHZA 3NJJA 3CVCA 2GC4C 4UF7C 4BDVB 1RCYA 1E67A 4DP6X 7PCYA 3X1FA 2JFCA 1HFUA 2XV3A 4FAAB 3H4FA 3NYKA 1B3IA 1KCBA 5I5JA 3NJHA 5B3SB 2VM3A 2PPEA 6PCYA 2NRDA 5B1AB 2RACA 2PPFA 4F2FA 1NPNA 1IBYA 2UX7A 2XWZA 3PXLA 4BWUA 3IN0A 1NTDA 1ZDQA 1ZPUA 4YL4A 3EF4A 2IDTA 1SDDA 9PCYA 4FA7B 1XMEB 2UX6A 4NB7A 2PP9A 2GI0A 4G7RB 2XX1A 4W9ZA 1CUOA 2VW7A 2MTAA 1RKRA 1SJMA 1MZZA 2W8CA 1KDIA 3NJNA 4YSSA 1W6WA 3FU7B 2CAKA 4GP5B 3TBCA 5I5MA 4GXFA 2IDQA 1N68A 3NT0A 4CSZA 1JZIA 1OV8A 1N70A 5PAZA 4WTQA 1PZAA 1ADWA 2BZ7A 1EZLA 2I7OA 1OCOB 1ZDSA 2EIKB 1AZNA 1L9PA 1SHXA 2VSMB 2B08A 4KOCA 2PPCA 1MG3C 1W8EA 2XXGA 1L9SA 5AKRA 1FA4A 2GC7C 3UADA 1NINA 4YSTA 2BP8A 2H47C 2HX8A 4DP5X 2FNWA 3NJFA 1OCRB 2VSKB 5D4HA 3NJGA 2UXVA 3DIVA 4MFHA 2YAMA 3WI9A 4HCGA 4GP8B 2MRYA 3JT2A 1ASPA 3BVDB 1JZJA 1PLBA 1UATA 1I53A 3N2JA 1E30A 1KV7A 5I26A 2VW6A 1ILUA 4YSEA 3OMAB 1PZBA 2BP0A 2JKWA 2P80D 3CG8A 2Q5BA 1JXFA 4AKQA 3OMNB 1TKWA 3NSFA 2VM4A 5F7BA 2BP8B 1F56A 2DYSB 3MX0B 4QLWA 8PAZA 5PCYA 2VN3A 3U25A 3EH5B 5B7EA 3FQ2A 1BQKA 3S3BB 2PP7A 1ID2A 4W1TA 4DP7X 2QDVA 2YAQA 4JHVA 1TEGA 4HAKA 4HIPA 1NICA 3N55A 3ERXA 1L9QA 2R7EA 2IDSA 1AAJA 2YAFA 5B1JA 4YSQA 3NP3A 2X88A 2X87A 2BWDA 1AQ8A 1T5KA 4HHGA 3G5WA 3ZIYA 1ET5A 3UABA 1M56B 2UXFA 3S8FB 2XV2A 1QHQA 2IDUA 2UXTA 3S3DB 1NZRA 2DYRB 3WKQA 1EHKB 4G71B 5B1BB 2A3TA 2HXAA 2FWLB 1WS8A 2IH9A 3X2QB 5B7MA 4F7KA 5AZUA 4DPCX 3T71A 4BWTA 3FYIB 3UAAA 2H3XC 1BXUA 1JVOA 2I7SA 4A2DA 4KNSA 2ZWNA 1WA0X 2R7EB 1J9QA 3T6VA 3CVDA 2XVBA 1ZIAA 2IWEA 3UAEA 5D4JA 3FPYA 2YXWA 3ZX1A 1AR1B 1HAUA 1NWPA 4YSCA 1PLAA 1GYCA 1CC3A 2BO0A 2XV0A 3NSCA 3SBRA 5E9NA 3NSDA 7PAZA 4KO7A 3T6ZA 4HZ1A 2TSBA 1SFHA 1OE3A 2HZHA 1PLCA 2YEVB 1GW0A 5I6PA 4A2HA 3GXUB 3NJLA 3PAUA 2IAAC 1PAZA 2AANA 4K9JA 4BXSV 2Y1AA 4A2FA 4Q89A 2W88A 1W6LA 3SBPA 3DTUB 1XB3A 1R1CA 1L9TA 3FU8A 3ABKB 1AZBA 2J55A 4NERA 1GSKA 1URIA 1V54B 4M4RB 4E9XA 4N8UA 1AACA 3FYEB 1CYXA 4AX3A 4A67A 2IDFA 3CDZA 3FSAA 3SBQA 3D12B 5EHFA 4HCFA 1WS7A 3QPKA 5FC9A 1SDDB 2FJSA 1OCCB 3EH4B 3V9CA 1HAWA 2QDWA 4HCIA 2CCWA 1BYPA 2YAOA 5I28A 2PPAA 4KO5A 1KBVA 1J9RA 1DZ0A 3WNIA 1IUZA 3NJIA 4E9WA 4AKPA 3HB3B 2PLTA 1A8ZA 5ANHA 2OJ1A 4YSPA 1QLEB 2CALA 1J9SA 3ASOB 1QNIA 3CDZB 3UGEA 3AY2A 4RH4A 1MZYA 1ZV2A 3OM3B 3FU9A 3KW8A 2PPDA 3QJUB 5LDUA 1SF5A 4YSUA 4PAZA 1ETJA 1IKOP 3FSWA 1AS8A 5I6LA 1E5ZA 2CJ3A 5I6OA 3GDCA 4A68A 2IH8A 1KGYE 2IWKA 3NJMA 4M3HA 4G70B 3JTBA 3QJQB 2VW4A 2TSAA 1CURA 4N4YB 3PAZA 4GP4B 2XUWA 3WKPA 4NAJA 1SHWA 2E86A 3OMIB 1WA2X 1AANA 4DP4X 1JVLA 1E65A 1NDTA 2AVFA 2CUAA 4F2EA 1XB8A 4E9QA 2CBPA 3FSZA 1AG0A 1AZRA 3OD3A 2WO2B 2OCCB 1XB6A 1SFDA 2BP0B 1ASOA 4DP9X 2GBAA 2HRHA 1NWOA 1NIFA 3FPXA 3AG4B 2FT6A 4YVUA 3S3CB 4BK5C 3S8GB 2I85A 3H56A 4AZUA 3DKHA 4E9VA 3QJRB 3CVBA 2BW5A 1CYWA 3QQXA 2PCYA 1GY2A 2QT6A 3WNJA 1ILSA 1VLXA 1KYAA 4AKOA 1AIZA 2Q9OA 2XLLA 1BEXA 4ENZA 1JZGA 2YAEA 3PCYA 1L9OA 2FQEA 2HRGA 2WO3B 4KNTA 5TK2A 5I6KA 1NIEA 1WAEA 2IWFA 1NPJA 4BXVA 1PNDA 3PAVA 4P5RA 3NSYA 4L0PB 3ZDWA 2FQDA 3T6WA 3TBBA 3X1EA 4CSPA 1M57B 1BQRA 3AG1B 1GS7A 2FT8A 2J57A 4E9SA 2HX9A 2ZONA 3C75A 4G7SB 2FT7A 3CZUB 1JXGA 3H4HA 4YSOA 5F7AA 4DP0X 3V9EA 4YSDA 4X4KA 3NP4A 1KCWA 4TXVB 3ABLB 2BWIA 2HX7A 4A2EA 1GY1A 2WSDA 4KO9A 2ZXWB 4G72B 2YARA 5TK4A 2AZUA 4KO6A 3FU7A 1ET7A 2GB2A 3IEAA 3L45A 4QKTA 1KBWA 2N0MA 5I5IA 5AFAA 1TU2A 2FTAA 3FQYA 3IN2A 3WIAA 3X1NA 2PP8A 5B7FA 4DP2X 1AS7A 1A4CA 2BZCA 2BW4A 4JKNA 3PLYA 5A7EA 1AOZA 3UACA 3OQRA 1JOIA 4KNUA 2DV6A 1DYZA 3BQVA 3AZUA 2FQFA 3EH3B 3T6XA 3HEIB 1FWXA 2DWTA 4DP8X 1OOWA 1AZUA 1X9UA 2UXGA 1KDJA 2HLEB 4DP1X 1MDAA 1BXVA 2LLNA 2XU9A 2YQBA 3X1BA 1A4BA 2J56A 2QPDB 5B1KA 1J9TA 1PMYA 1SNRA 4AI7A 3ABGA 3ZBMA 1L9RA 4E9TA 3ASNB 4HALA 1YLBB 2Y69B 1BXAA 2AZAA 1PZCA 3FT0A 1A4AA 1J5DA 1IBZA 3RYMA 1SF3A 1GS8A 2YXVA 2JXMA 1ASQA 4A66A 2EILB 2XX0A 2XXFA 1RZQA 1OE2A 6PAZA 3FSVA 4GY4A 3MBWB 2EIMB 1M9WA 3IE9A 1BAWA 4EF3A 4P5SA 2DY2A 1GS6X 4UAHA 1X9RA 2DWSA 3GYRA 1V10A 1OF0A 1JXDA 1ZIBA 1NIBA 3FQ1A 2ZOOA 4G7QB 1OCZB 2EINB 3SQRA 4DPBX 3FS9A 1BQ5A 2AFNA 3IBOA 4A2GA 1RZPA
chains in the Genus database with same CATH superfamily
3VXSA 3K08A 2FLBT 3TU6A 3TEZA 3V4UH 5LQBH 3BDYL 1RZFL 1XGQB 5BO1H 5KVFE 4D2NA 1C1EH 4PA7A 4HJ0C 3F7QA 3MOAL 2A77H 4FLTA 3H9VA 2LLGA 4MXWL 3ZE2F 4BWWA 5E4AA 4YJ2A 2EEAA 4Y5VA 3ZTEA 1E1RG 3RVVC 3VXQB 3MRNB 1KXQE 3VW3H 2JELL 4TPRH 3M8OH 5KVGH 2EIJB 2XRAL 4MX7B 5EZLA 2AK4A 4B96A 5MEOB 3ULUF 1NTZH 3NFPA 2CTPA 4ZK8A 1IBFA 2XI9A 2Z0BA 4IYIA 4K73A 1HVXA 5F93C 5JIQA 1I1FA 2BFVH 3KCWA 1IC0A 1FL6A 4KKLD 3LKRA 3RYHA 4WO4C 5JUEH 1E4KC 5JYMA 4MDIB 4R6UA 2WYIA 4DJMA 1RURL 4MAUL 5AYUH 5B1NA 1KCVL 5HGHA 2F18A 5JW3H 3OPZH 2O5XL 3FB5C 4JPSA 4WI4A 1UVQB 1YMHB 1KJMA 3OR7A 1UD5A 3K6IA 4F37K 4XDLA 3O3DB 4H88L 1MHHA 1JZEA 4ELME 4Y9GA 5HYSB 1AFVH 1I85A 4WJ5A 3A4FA 3A6CL 2P5OA 1GRWA 2XYBA 3NCYS 5L2KD 2O61A 3NJJA 3UPRB 1E27B 4OFQA 5LCVH 2GY7B 1RCYA 3L4TA 3FCGA 1RUQH 1IZJA 3CX5F 2J12B 4FZEL 5C92A 2W0XA 2X1OA 4UV9A 3H9HB 4F1ZA 4TUJB 1AIFB 4W9IC 4WW1A 3RFZC 2UUAB 1L0XA 2Z7YA 2F54D 5JO5B 3ZKMD 4G2KA 5DRWB 1R75A 3R1GL 2WQWA 2Y06L 4U0QB 1KP2A 3U11A 3AK2A 4KRNA 3QXVA 2PW2A 3AT8A 4ZX5A 1ZS8A 3FZUC 4FFZH 4U3HA 4Z78A 1I7RB 1ZE3C 5CKAA 4L8SA 4Q0XL 5LYJB 1G7IB 4MMXB 4Q56A 4OIIL 3AQDA 1XMEB 4NB7A 3UDWA 1MI5E 3UCRA 4CBCA 4W4LA 2EDWA 4B0MM 3BPCB 1N8RW 5L4IA 3BLKA 2VW7A 2O5NA 3HN5A 1CU4L 3CHQA 3QAQA 1MZZA 4RGOL 4UT9L 1XL4A 2MCAA 5BOPA 1H2KA 3MGTB 4J3TA 1P0SE 4ONHA 3HB3C 3STLA 3ASNC 1QLEC 1N70A 2BFGA 5IMMB 3EGSA 1OB0A 2V9RA 3VFSB 1U3JA 3A23A 5EO1B 2OWOA 5DHDA 4C4KO 2JB6B 4KQ4H 5C0NC 3V6OA 4LF8O 2X89A 4OV5B 4KQ3H 3TM6A 4IOIA 3V0IA 2H26A 4XDKA 4JYCA 4XZ4A 3GI8L 5D96C 1YYLL 3RTQA 1DQJA 4M61B 1MLBB 4PJXA 4DUVA 5FGSA 4KZEL 1X4XA 2GT9A 1JNHA 2ZKOA 2CR0A 2HX8A 3OBAA 4NOFA 4TOYL 4ZUSB 5GGTA 3THMH 3VG9B 1R6VA 4DFHA 2G2PA 5AD0A 4JAMA 4RUEA 2F61A 3FT9A 4GQRA 4WZ9A 1BPLB 4PJ8A 4XPGH 1U8HA 1TJXA 3I75A 3W11C 5CFHA 1A4JA 1SHSA 3D9AH 5GONA 4CADA 1ZOXA 3C8KA 3OB0H 1JFQL 3CWGA 4LLDA 5C0AB 3WNPA 1LP9A 2BERA 5I26A 5A2AA 2V9QA 5IWLC 3P9LB 1AMXA 2AAAA 1KN2L 1WGOA 3T4YA 1UOWA 2ED8A 4N8CH 4AKQA 3EJSA 3RWIA 3RWFB 4X7FC 4D9RD 1R3IC 3GT6A 3K1KC 2F7QA 4DV7O 4FLSA 5KVGE 4DO4A 3ZE1B 1TR7A 3V0HA 4QLWA 2BSCA 1KG0B 1WIUA 4Y2LA 4EN3B 43CAB 2X09A 4FG0A 1T6WA 1OTUC 1AVAA 2BHYA 4G6FD 4MD0B 5BXFA 3S97C 1KN4L 1NAMA 3Q44A 3QB7C 3WG7C 2ZJSL 3ROOA 5CA0A 3DVGA 2LGQA 2ERJB 2IG2L 1KTBA 5DZLA 1MSPA 3LZOA 1COWG 3G6BA 2EO1A 4PVNA 1TZGH 2DMXA 1I94B 2H3NB 4JUTA 5DD3H 3ATEA 5KVFL 3ZMVA 5FUOL 3HC3H 3Q05A 4L48A 3NUKA 1BT8A 3SKOB 3FAXA 4YXHH 1V7NL 1FE8H 1AGCB 1FNGA 3N42B 2IDUA 1RUKH 1CBVH 3PHAA 1P6WA 4MAYC 1I31A 4M62L 3UERA 3EO0B 5F9AC 2YA1A 5DLMH 4NENB 1A5FL 3MACL 1WS8A 2GJ6B 2X2HA 4PGCA 2GK0B 1TG8A 3BOVA 5ANMA 1JYXA 3L3IA 1R6KA 1HIMH 4PJAF 3O2DL 5SWZD 4BWTA 3PWJA 5JPNC 3MRGA 5FM8A 2QL1A 3FQXA 1L4IA 2W38A 3BDXA 2C3HA 4Y19E 2EH7H 3CDYA 5AVVB 1VEMA 3IXAA 4EI5D 4YDKL 4W9DC 1AR1B 4QIWF 4MTMA 5E8EB 1NANI 1QACA 2HSIA 3GXTA 2XV0A 1PL3A 3CDCA 3GXDA 3OXSB 1HYSD 5K93A 1Y74A 1S5HC 1MLCA 3K2IA 2VS0A 4JO3H 3NSDA 15C8H 1PKQB 1WPCA 4UM9D 4OX9O 4EZLA 4HZ1A 4QHMB 3HTLX 5IG7A 2A9DA 4OZHE 3HS0C 3V4VA 4AQ1C 1N18A 1QFPA 5I15H 1ZANH 2FAUA 3DRTA 2F1AA 3HBGA 3QISA 2G3MA 3H55A 1SLWA 4U1GB 5F9JB 4UNVA 3HPLC 1A2YA 3QDGE 4S0SD 8FABB 1ZA6B 4O4YH 3DTUB 3U9UB 4K3DH 4U1SB 4ZOBA 3TEUA 1X5IA 4NJAL 3EGXB 2ZYSA 4JO5A 5EG6C 4F6EA 3UM7A 4L9LC 4PA3A 5E6IC 2BY1A 2UXNA 4ABQA 3BVOA 2IDFA 4KXDA 1HHGA 4JFFD 4K8RD 3HE6D 3GSXA 5JOPD 1KYOK 2E56A 5EHFA 4H25B 1MREL 3VGDA 3KHQA 1ZLUH 4AYDC 5DJ2B 3FQRB 3TF4A 5AWNH 3SODB 4GSDH 5D1ZC 5EA0H 1P4BH 1KSRA 1OCCB 2F08A 4XCFH 4YDLB 3KXFB 2G5RA 3ZYIA 1AHWC 3L5WB 5HYJD 2WLMA 4GX0A 1XQ4A 5KYWA 2VXQH 3QWQB 4IMKC 4QPKA 2Z0UA 3TT3L 1VQMV 1KOAA 3OKOB 3VXUE 2UUBB 5C0CE 2OYKA 1KC8W 2D2CC 5HY9A 4ZD3L 3T1HO 4YSPA 3W38A 2PXYD 1G7HB 2CLZA 1OCZC 4QMEA 2EEFA 5KX5A 2YHGA 5EC2C 3T77B 1RK1B 1WD8A 2YA2A 4WEEA 4OKVA 2BNQE 4G5ZH 1QEWA 2IIJA 1ZS2A 1KTJA 3FSWA 3B6SA 5FM5O 1U3YA 2WOBA 2N59A 1E5ZA 4UVAA 3GSVB 4M7ZC 4WFFE 1Z5HA 3N2KA 3SDCC 2IANB 2A6KA 5TFSL 3DRQB 4R7DB 3TOPA 3QJQB 1GKFA 1NC4B 4JYAO 1UA3A 3D25A 4MS8D 4NGHH 3MLXL 4X0KA 4ZSOB 3RY5A 3T2NL 3NACH 4NQVB 3ZDXF 1O75A 2EEBA 4QE7A 2XNAA 5JORA 3F6IA 4QXUH 1A7QL 3V4UL 2VLLB 3BUTA 1HHKB 1YQVH 1NDTA 4QXWA 1GZHC 4N28A 4NRYA 3MLZH 2VERA 5I2IB 1C1EL 4JVUA 5DEFB 4L1DA 3PWUA 1BDYA 4NPJA 4ZPVB 2UXBB 2OCCB 4PJFB 5MENA 5IROD 4Z7AA 4WJKB 1DJXA 5DD6B 2O6PA 3GRGA 3VW3L 1NOFA 1I3GH 5DZOA 2YUXA 3P3UA 1OCWL 5CD5C 3LNFA 3SPCA 1ZJAA 3N40P 4I5BA 3DX4A 2J44A 4WFHA 3DX9A 3BP4B 1EJFA 3U9PH 5E4EB 3NIFF 1KKCA 1A7BA 4JGSA 3LNNA 3KZ8A 5JUEL 2YC0A 3P3SA 3QQXA 1CYWA 3L2NA 4KMTL 1GCFA 5AOJA 2AGJH 1DTUA 1X59A 1FPTL 4RGNE 3IGLA 4XMKH 5AYUL 4M8VA 1WYJA 3U10A 1TJIH 3OPZL 5C08D 5DRXA 1ECZA 1UA6L 2IADA 1FH2A 5LXGL 1U92A 4JO8A 2VDPH 2JKRM 4MDRA 2NW3A 4FQHA 2AEQH 3SGIA 2J4WH 1EZVY 2QKIA 3FT3A 3NA4A 4Q9BA 5ESVB 5CSZB 5A6LA 4B3MO 2WPGA 3DPDA 1KJ2H 3R18A 3L3KB 5KVEH 2ITFA 5SX5H 3ARBB 5FLUA 3OF6D 4PB0H 5IV2A 4R84A 1XGPB 1VQ7V 1FZMB 3PQYB 2GUOA 3QEQA 5LCVL 2HT2C 1Z5WA 1M57B 1AI1L 2FYYB 2QSCH 2YGNA 4LKXA 4F9LA 2VH5H 1OSEA 1A0QL 5B39G 2R2HA 3FH7A 3EJZD 3P3PA 1OW0C 3QNZA 4PWIA 5D7IF 3SIKA 5DHEA 3GIVB 1VZGA 2DS4A 1C5DA 3G5ZB 3LTVA 3CFUA 3WV0A 3ARRA 4DKEL 2VLKA 4NBYB 1U3HA 4HJGB 2VZOA 2BNRB 2WSDA 4NKQB 2QDOA 3OT7A 3ML0A 3J80N 1YN6B 5DZAA 4DEUA 5JW4Q 3IU4H 4GKSA 4HEPA 4D9LL 3BMVA 4PBVC 2Y25A 3DVIA 3K6SA 1TCMA 4F7PA 2WANA 4RRPA 4LAQH 1HINH 1V54C 4FFZL 3RDTB 3JD0A 2XTLA 5E2VH 1B2WH 3PUUA 4UCTA 2FZ3A 2VL4A 3KL0A 1YO4A 1WE5A 3X1NA 4DVRH 4JKNA 3WFDH 1E0OB 5C0DB 3HG5A 1HNZB 3EXAA 1BGXH 1MW0A 5BUGA 4GG6F 3KMDA 1KTLB 3OD4A 1XGUB 5FA3B 4HSAC 1NMBH 2VQ1A 4Y2DC 4B9ZA 2Q0AA 4HK0B 4G6AD 2CGRL 1VF5B 4HOWA 1CT8A 4Y1AB 5F9WB 1DQIA 4H4NA 4IHOB 4QRRA 5FO7A 4AGOA 1YPZA 4X5WA 4K0OA 4X6FB 4HBQA 4I0PD 4HXAH 4GUCA 1ED3B 2MSPA 4CH6A 1VFOA 5DSCB 2AW9A 1VFMA 5E1IA 1SNRA 5LOVA 3VQXA 4BH8B 4ISVA 1ID5I 3BD4A 1SF3A 3AXLA 2V9TA 3KBEA 2P8MB 4NQDD 4Z7QB 4G8IA 4NO0D 3THML 3JD2A 4OF5A 2B2XL 3E22A 1Y6NR 3IK2A 3TVMD 3F3HA 3MFFA 4JG9A 2K7QA 2DI8A 1FI8C 5AW7B 2KZWA 4XPGL 1XDCA 4PVLA 3H0TB 1ZGLB 1RZIA 4NS0A 3D9AL 1LEIA 4UVBA 2FEDC 3NCEB 2WIIA 2NZIA 2PO6A 1MXGA 4F7CA 4XZUA 4YL9A 4FXGA 4WWKD 4AVIA 3P4OB 2LHAA 1USQA 1MMMA 3CWBH 4N0YH 3S34H 1JPSH 3MLPA 2HP8A 4JJOA 4HK3N 4JRYA 1J05B 3QUXD 2ICEC 5D7LD 5LWYH 2W0FA 4KFZC 3MBEC 4OCYL 4NVPA 1QSEB 1S8DA 3FBKA 2ZOKB 4JDVA 4P2RD 4XP4H 4F7MB 4X4YA 4NN5C 4O2AB 4XMVA 4ZFOB 5K9OB 3LQZB 4HPOH 3QZOA 2NY4B 4DNLA 1RFYA 1LE9B 1C8QA 2ZWYA 4WUKH 2APFA 5IJ0B 1MCSA 3GMLA 2P90A 4FNLL 3CIQA 4APXB 2ZXDA 1J1OL 4IOFD 25C8H 4KRMB 4YXLL 2XN9D 1TFPA 1BFSA 2PUQT 3D06A 3MRCB 3N6YA 4KK5C 2HWZH 1X5JA 2D03H 2EDFA 2HJFB 3QULA 1VZHA 5DD3L 3VA2C 3S88H 3WTUA 5DDHB 3PWNB 3PDGA 2WQUA 3HC3L 4KHTH 5KVEE 4DZ8A 3X13B 1FE8L 2AQ3A 2X4UB 3KHOA 3FW6A 3DX3A 1TJHH 3PWVB 1QRND 2DQJH 1XFPA 3CXFA 5HVHC 3KDPB 2IU0A 1R3KA 3QIBA 5K1JA 2OZ4L 3WS6C 1YIJV 4B9GA 2IOIA 4I3RH 3DBXA 2J5WA 1A7PL 3TA3A 1C16A 1TQWA 4DK1A 3RNQA 1I7ZA 2F66C 3QXUA 4M48H 1OAYH 3F7LA 2H2PC 5IMLA 3IJ7A 1E67A 2OL3A 1K2DA 2VCOA 4IEFB 4YHNA 1NCOA 3A2FA 4JO3L 5LBQA 2NUPB 5I71C 4O2BA 5JQHC 3L9RA 1XCWA 2NW2A 3BHPA 1TIUA 3ZE2B 3NTCL 5I5JA 4JFUA 5KSAA 1CDCA 3MUY1 5E2TL 3HZYA 4IMLA 2RACA 5I8CA 2V5SA 4AT6A 2EXSA 4KKQA 3QIUB 3QRGH 1EHLL 2Q7EA 3F64A 1HC1A 1DN2A 3V55A 3EJUA 4AK1A 1CDHA 3D69A 5CA1B 3N9GH 1ZVYA 1YSOA 2WQXA 5I1HH 3O8XB 1IXMA 4N22A 2OTLV 2QQLL 2V4LA 2XX1A 4LLYA 3WY3A 2WWKT 2MTAA 4D8PA 4WFED 3NPZB 5JQGA 1SF9A 2PTMA 3Q6FB 5L3CA 1MW3A 3HVDA 1MQKL 2VRAA 4OZGE 4AV0A 1HI6B 3BUBA 4GXFA 4J7JA 3LNIA 4NUMA 2LFSA 3NCFB 5HHPA 5HFLA 1FV1A 1U58A 2VDOH 1G7LA 5CZXC 5AWNL 4A6YA 5GZND 1OV8A 2BHUA 3WJMB 1R5IA 5T33H 4EVNB 3QR2A 1P4BL 4XCFL 4CAGA 2DIBA 4WDIA 3H01A 3GJFK 4UB8Z 4B5ZA 2UZYA 4PVBA 4J10A 4KWUA 4YFLF 4FK5C 3LN5A 3G6AB 4LH7A 1OT2A 5IHZA 4LCCA 4NKOB 4YR6B 2WXOA 1TVDA 2K8MA 1NI8A 4KOCA 2PPCA 1S9KC 4KTYA 5DJ0B 2RQ8A 5J12B 3O3BB 1FN4B 2A2QT 1WA8B 1LNQA 4TVPD 4JG5A 4X1IB 1KPUB 3QQDA 2X4NA 4G6JH 5ECJE 3HR6A 4GW5B 5KWYC 4MCZA 4AQEB 5D7JA 4G5ZL 1E5CA 1ASPA 3GINA 4Y2OA 2ADPA 4U6XB 4WW2A 1SY6A 1K8IA 1GM7A 1QHOA 4S0TD 3QQ3B 3QUMA 5KYXA 3KL5A 1FZJB 3L6FB 3ARFD 3QPXH 5AZ2H 1K4DB 3EYFB 4BKLA 5DA0B 3VYNA 4FFVD 2WGNB 1JGIA 4NZRL 4BSWB 1L3NA 4YPJA 1JXFA 2B39A 1MWAH 1TKWA 4YDZA 4MJIE 3VQWA 1KYUA 5TH2A 1I8AA 1G0YR 4POZD 4URTB 1N0XH 1LEGA 3DYOA 4OFKA 1Q6UA 1SVCP 1G7QB 3HG1A 4JFFE 4LPCA 3U25A 3ZIMA 5DO2D 3L4VA 4RUFA 1N59B 1E90A 3MLZL 4I48A 5DS8A 1D9KC 4CJ1A 1NFIB 2JMRA 4DP7X 1N32B 1MF2H 2H4EA 1NTMH 2LU7A 3UTQB 2IQAB 5IDJA 3QUZD 4HAKA 3EJQA 4HV8B 3UGXA 3BQUC 5EN2A 5DRZA 3VH8B 2WINB 1ZT1B 4NC2B 4P2OC 4PGEB 5HYJE 5DFAA 4B3TO 4PP2A 4F7EB 2Z4QA 4PJGA 3FQWA 2O4EA 4ZT1A 4TRPL 4KV5E 3BT2L 4NT6B 5EU4B 1SESA 2AJ3B 5CEYB 2HVJB 1YEEL 2BSKA 5HDQL 2AGJL 3JV6B 4F33A 4XMKL 1MIEH 2NZ1A 4YS4A 5LGJB 1QQDA 2DQUH 2CR3A 1G6RA 5CZKA 4WI8A 3AG1C 1Y4MA 3L8QA 4GB9A 2FECI 2HXAA 3O6FA 2AEQL 4ZUVA 1XGZA 1H6UA 3M46A 4HJSA 4UOJA 1EVUA 4DVBA 4EI6B 5JMOC 1DQQB 5ID0A 1ZTEA 2HTLC 2R7EB 3T6VA 2ODIA 3OHXA 1PZ5B 3B5TA 2PWHA 3CFTA 4JFSA 3UAEA 2WQVA 3QG7H 3Q1SL 1AKPA 3BP6B 3MXWH 2VH5L 5FW6A 1JPXA 1YJWV 4Y5XC 4MZRA 5HHME 1P5UA 3KE0A 2VLJA 3I6GB 5IQLA 2BO0A 2ISDA 3KPQA 2EH8H 1YXBA 1XSKA 3CJJA 3GUTB 4W9EC 4KHXH 3JV0A 4UOZA 1IARB 1TJGL 2QVIA 1HDMB 1UD6A 2IFFH 5I0ZA 5GGQH 1ES0A 2YEVB 1EUTA 3ZN1A 1HSBB 4JFXA 5C0RH 1OT1A 5EF2A 4H44B 2IF7A 3FU0A 3HLAB 1J5HA 5AEAA 2Z8RA 4LAQL 2BPBA 2YSUB 4MMZB 2GIYA 2Q8BH 4Z7OF 4MXQC 2CO4A 3UPAA 1IZKA 3L5JA 4KC3B 4K5MA 4EDXB 5DHMC 1LK2B 2J8UF 3MHZA 3N43F 2J55A 3EJPA 1OALA 5HHOA 4JN2A 3ZLQC 4J3XA 3CPWU 3RG1C 5LP6B 2DWXA 2Y4TA 4LCIH 5C07D 1ULVA 1T1YB 5C08E 1F11B 4D7BA 4OLVH 1B0GA 1E9OB 2FRGP 3R66A 5MEPA 3TNMB 3TYFA 2FIKA 1MY5A 4CSSA 2R39A 4YFEA 4V1DE 5DZ9A 4HXAL 3N2GB 3GXPA 4ZW5A 4MTXA 4MYWB 4YHOH 5E23A 4CKVX 1MFBH 1V3MA 2OMXA 3SYQA 1P7QB 4DXWA 1RJZA 5MI0B 1JGUH 2BC4A 1MXDA 5GHWH 3KPOB 3OSKA 4WHTA 4C47A 3BVVA 4LP5A 3L9DA 4L1BA 1TVHB 4QRPD 2BIMA 2SEBA 3QUYA 1YEWA 1NM9A 3KBPA 5D1QA 3H2QA 4YDMA 5I9QB 1UFIA 4PJHA 4BFIB 1QNZH 1KPRA 3FU9A 1LO2L 2PPDA 3KPRD 4PRIB 1XMOO 2DJUA 4ELMF 4MCNA 2ZSWB 3BWUC 4KVCH 3ZTJH 4FFWC 5EZPA 3QYMA 4L3CA 43C9B 1D5MA 3ULVD 3DETD 4ZMOA 4FQ1L 3X3FL 3KLAB 2OBGA 3JXAA 4J12A 4X88A 4PGZA 5FUCE 2F93B 3VRIA 5LMNO 2Z93B 2QADC 3LSQA 2VW4A 4U2YA 3S34L 5HPOA 4H37A 1JI1A 2MEJB 1UD3A 4WEBH 3UBXB 4JFDE 4JI5O 4OZFA 1DGSA 2WKOA 4U3SA 2CH7B 3MKKA 4X9IA 5BUPA 1E7VA 2ITCC 1T5EA 5INCB 1KIPB 1G9ML 3B8MA 5K1PA 3VWKD 2CMRH 3W9EA 5LBSL 3MXVH 2E5LO 2Y23A 1PEWA 3GKWH 5AG2A 1A6VL 3H1JH 1N33O 4I0XB 1A47A 4WUKL 4R4ND 4KKRA 3MZGB 5I1GH 4ODXA 1E9QB 3OGIB 3BFOA 2ZXAA 3S3WA 2R0LH 3BVWA 3B9KC 2A0LA 4PW4A 4O2EA 2H6UA 3DOSA 1TNMA 1IT9L 4K8RL 1EEYA 1U8NA 2DWDC 3QDMA 3AG4B 1WLHA 5F44A 4HIXH 4N9GA 4JI4B 4AG4L 3UZVB 4KHTL 4X6EA 3OEEG 4EJ1C 3V6FA 1RFDL 3QORA 3ZMSA 4UWQB 4BEIA 3GDBA 1TJHL 1R6NA 3P3NA 2DQJL 2Q7GA 2BIHA 3JV4A 3IAQA 3BSZA 1VESA 3PCYA 4X64B 2N7SA 4HHAA 3RWCB 1EGJA 4X8JB 2E4TA 3LKPA 4I3RL 2XTAA 2XPZA 5EUKA 3V8CA 2WN2A 1I8LA 4Q6IC 1PKOA 1YEFL 5IB2B 2E8ZA 3OEHG 2EXWC 3FB5B 4FL4C 4O5LH 2X1WL 3ZDXB 1XEQA 3C8DA 2FQDA 4WU5A 4W70A 4C56A 4P46D 1XGTB 2FL5A 3ARQA 1AQMA 1PSKL 1F3JB 4TLSA 5FCUH 1WTLA 1BHAA 4ANVA 4F2MA 5CEXB 3WNNA 5HYEA 2FT7A 5C9JA 4IQHA 1JZ7A 5D7LE 5E8NB 4XNDA 4NDMA 3AQZA 4FQXA 4QOKE 4WSKA 1W0JG 3LY6A 3O2VL 1JRHI 3QARA 4AGLA 2G2RB 3D3VB 4L37A 5ICZA 5INDB 2GTSA 2KDYA 2XN2A 1FIGH 4EPSA 3MLSL 2IGTA 3V0GA 1D3CA 2IEPA 3BAAA 1DVUA 1YMMB 4OGXH 4P23A 2OK0L 4LL1A 1YVLA 3QRGL 4PA6A 5I75C 3RFZB 3CH1A 1I7UA 3DURB 1AP2A 1EANA 2HN7B 3MV7B 2VDQH 4Z2WA 2R4RL 3NIFB 3VI3E 4B7LA 2JGUA 3A0OA 5EFIB 3VFMB 3I50H 3ZKQD 4YHMH 3FO9A 2EQDA 3UTTA 2NQCA 4A55A 5I1HL 4DV1B 4G80B 4ZW7A 2W6JG 1HHHA 3IMTA 4UIMB 4Y16A 3U4EB 3PXJA 5T1KA 4JKPL 4I50B 4KX8A 1HU8A 4BIZA 1R3JB 2MNUA 3CFKB 4R4FH 3TFKC 2VJXA 3MMEA 1TTCA 5BPPA 1B6UA 3IF1B 2OMTB 2VDOL 4UQ2A 3D3QA 1VACB 4AV5A 4YNYB 2GBOA 3D36A 3ZKMC 1T1WA 5JQ6H 3DX6A 3IFLH 2YQBA 4PG2A 5EIIG 4CU6A 2Q0OC 2VJ8A 2UWEE 4JK0D 5AL0A 1A1MA 3X1BA 1NUFA 4OJFL 2K3TA 4DV0B 4GX2A 5D7IB 1XF5B 3ASNB 2ORBL 3FAVB 1T2QH 1N3NB 1HJCA 2YXVA 3MRPB 4JO1L 4PRBB 2I9TA 1ASQA 3ZYOA 5DVMA 3SE3A 5IBUB 2EILB 2IBGA 4HUVA 4NRXA 3DMMA 3T1CA 4YO0B 1E4JA 2GTWA 3CUPB 3KJ6H 3VQLA 3B2EE 1M05A 4NWUH 3UAFA 3RGVA 4WI7A 1FFXB 5D96B 2NSXA 3MR9B 4P5KB 3DDFA 2ZINA 5E70A 5LDSA 3M8AA 4WU7B 2NZ9D 3C6LD 1JGDB 5E1HB 1FFOA 3O4LA 1G7JB 5G4NA 3ZQ9A 1QR1A 3OAWA 2BVQA 3GYRA 3OKLA 1LD9B 4U2ZA 3A8TA 4CNIA 3MRJA 4GG6B 4AIZB 4U1KB 2UXDB 4DQOH 1I3UA 4JPKH 5I73B 2VQFB 3DK2A 5H94A 3SGEH 4OM1H 3VMPA 2HEPA 3RWRD 4RZKA 1Z5LB 2DIJA 3RNKB 2W60B 1BSIA 1MH5A 4UV4H 3HG3A 4MD5B 3FH5A 3J2PA 3HI6H 4OZHF 2X53A 4QGPA 2QTSA 1I8MB 1FXVA 3S48A 4V2CB 4Q52A 1Q38A 1S9WB 3RYCB 2EYSB 4HKBB 4TV9A 1WG3A 2JJ2G 1FZOB 5KSBE 3LYRA 4ANUA 5DJYB 3RX9A 2B77A 2I9LB 5BRZA 1M7IB 3RZCB 1GGCH 4NEHB 4NQCE 2BVEA 1TQCC 4LZKA 5D9SA 1DCLA 5J6SA 4ZI8A 1AR4A 3WG7B 2NR6D 3WXVL 3SGDH 2ZUVA 2B59B 1R4XA 1HH6B 4LRNL 1T5XA 3TASA 1MCOL 1JV2A 1NJ9A 2VGLM 4LCWB 1MIEL 1OD7A 3H2PA 5F89A 1FJ1B 1NBYA 3ATAA 2JJTC 3VXMA 4I7ZB 1XH1A 3QJVB 1JZHA 2ZXGA 1U97A 1OB1B 3GMMA 1Z0NA 2X42A 5F7HA 1IAOB 1U8JB 3D2UD 5H37A 4MAYB 2R1YA 2ED6A 2OMBA 4U6VH 1MN4A 1TZHA 1HEHC 3SPJA 5GSRA 4D9QD 3QG7L 2VDNH 1QUNA 2AVGA 3D09A 5D5MA 2Q6AA 2M2DA 2UY6B 1D7FA 2X6BA 3C2AL 7PCYA 2Y6TE 5AZEH 5JTWA 2EH8L 3VFNB 2NTSP 4HX1A 2CK2A 3DSQA 5TQ0H 2DM4A 3COOA 3FFCB 3MV8E 3CXHJ 1GMEA 2F43G 3NIGF 4FHKA 3E2HB 4YHIA 3RVUD 3L95B 2M6YA 2KBGA 4TNVK 5JXAH 3B43A 4GKZA 1CXIA 2IFFL 1SMAA 4TULL 1MAML 5BUAA 5ADPH 1Q82W 2FB4L 2XPGA 4YHPA 1KLGA 4HIEA 5MEQA 3ZHKA 5KW9L 4F2FA 2P4VA 5DC0A 2VSCA 4LF9O 4JFYB 5E56A 4AM0B 2W65A 1CD9B 4KTDH 4MHHI 1NTDA 4PY7B 4B9YA 2HKFH 2ED9A 2CH8A 4RGMB 3HS0B 2NY5L 4AQ1B 3BEHA 1ZAGA 3TONA 4TUYB 3HMXL 3DX7A 1CBJA 3W7UA 3E6FA 2NCEA 2Y1VA 3P40A 3P0VL 3BWUF 5EU6E 2HTKD 5IHUH 4EI5C 3SPIA 3GRBA 4M3JA 4QJ4B 3G04A 5HGBB 1CDIA 4S10A 3MRDA 5E6RB 3T4AA 1HYSC 2Q20A 3ZSSA 4PSPA 2L4OA 2J1ZA 2ROYA 5E6IB 5T1JA 4G8GE 1PGRB 3NRPA 2RMNA 2V2TA 2LW7A 3QCVH 1VGEL 4YHOL 1FNSL 1AZNA 1YQ2A 3D39B 1IFHL 3KPPA 2PW1A 1D5XA 1RZ8B 3DLQR 2LV4A 3U30B 1CVSC 3WIHA 2H7WA 3CFEA 1G9MC 1ZHNB 1DFBH 1KXTA 2R70A 3ZRWA 2XXGA 5EC1A 3K3WA 1NGZB 3TO2A 5GHWL 4P5TD 4TNEA 2D73A 1AHWB 4HZAA 3AMKA 3MRIB 2HJLA 3PGFH 4NUQA 4OCSL 1MFEH 2MMXA 3GHBH 5F1NA 4HCGA 2D2CB 3NA9L 1OF2A 5C0BB 2C2AA 1WBXB 5EPMB 1CB4A 5E4IA 4RMVA 1RHHB 4ELDA 1OWRM 1I1RA 4OJYA 5D7KD 1I94O 2I24N 1P4LA 1IL1A 1JGEA 2VW6A 1UH3A 1F5WA 1OAQH 4XWGH 3C3SA 3OR6C 3TK1A 1KGXA 1T66D 1U6AH 4TLUA 2P80D 2EYTB 4K3EL 4CN4A 4BW9A 3L3GB 3D7PA 4WEBL 3OMNB 1WEJL 3LEVL 5I66A 4QR7A 5IBLD 5F7BA 5E94A 1KJVB 3SDCB 4E68A 4KK8D 3GSUA 4MNGB 4OCMC 1M4UA 1OGAA 5EZIL 4NBXB 3MX0B 5CEZD 4GJTB 5EU3A 4B9JA 4FXKC 3GRWL 1GZQA 2CMRL 5B7EA 5C07E 4MNHB 2Q9LA 5MP6H 4O2CA 4AJ0A 3N27A 5CD3A 4FXLA 1Z9NA 2IFGA 4RDQG 4LO9A 1SXZA 2PXYC 4PM1A 2NY0D 3EDFA 3SZKC 3VG0H 3WTSA 1YTFD 3E86A 3UTZA 3P0GB 1QA9B 2Z7WA 1AI6A 4HGKC 3FTGB 2F5AL 1T22B 1QFWH 2JCCE 3HZKA 1VF7A 1GKEA 2AK1H 3ERXA 1RULH 2R0LL 3PL6A 3F7VA 4M1DL 3GJEA 5HPMA 1Y0LB 5ID1B 2Y2YA 4LLUA 5B1JA 2VKXA 1UQSA 2ZG2A 4ANKA 2VDMH 4CGTA 1AROP 1BLNB 1WBZB 1XHHA 2EULA 4HD9A 4IKLA 1LQSR 5GS3A 3DHPA 4HS3A 4MS8C 1B0RB 1SC5B 3TGUH 3S8FB 1DR9A 4MSWC 4PV8B 3MUJA 2A6IB 4X6BA 4QRPE 3AG3C 3U0WH 4YY3B 5EUOA 3JAWA 1OGPA 1URLA 2DKSA 3ETBJ 4JKMA 3U0PB 1EO5A 3O11A 3IAYA 3UTSB 1W2BU 2ATKA 4G71B 4LSTL 5JLZA 4JFHD 2IPUK 5J56B 3KPRE 4XBMA 2G5BA 2YUAA 1BQHB 4I3SH 4F3FA 3L3HA 3WTVA 2ODHA 4R2GD 3D85D 1DJYA 1DJWA 1RAMA 2P3YA 2J8OA 1KGUA 3FCUB 4Z7UA 4LSDA 5AG8A 3H1IH 1FYTA 5DJZB 4HS6A 2XVBA 3CLWA 4TVPL 3MJ8B 3SKMB 4LF5B 5HI3D 1XQ8A 4YPGB 5IROC 3HJEA 3CBKB 4WHYG 1H0DB 4P5MA 2YPLE 1DDHA 4LSSL 3NCJH 2VITA 1I1YA 2P5WB 5E9NA 4GMTH 1U8MA 1ND0A 2BOBA 4XNQB 5KMGB 1Z9PA 3CGTA 4HCRA 4JFED 5I23A 4UCOA 4I4WB 2P8PB 3KM2A 4L1TA 4A1RA 3MREA 1CMOA 2OULB 2C7UB 2BM3A 3L9EA 1EDQA 4JFZH 2A9MH 5HYSG 4A2HA 3EOBA 2WKLA 3M45A 2EUWA 1SJXA 1ACYL 2JQZA 2VDQL 5I1AB 4NQSB 2B8OT 3SBPA 2A73B 1EO7A 2W07B 4CH3A 4GS7B 4IBQA 1ZRUA 3GVMA 1URIA 1V54B 1I7TA 3BEWB 4UT7L 5GGSA 2FNBA 4MQTB 4WY7H 2WBJD 2ZWZA 2PYED 1SOXA 1BS3A 1TQVA 2DTSA 1NH2B 1S9VA 5HYQB 3EJZC 4GKLA 3DUHA 1XO8A 4XMTA 4OIAA 3BFRA 3MV11 3C9NA 5F1SA 3AEIA 1VA9A 1W72A 4QHUB 5LG6A 2DJ4A 2R29H 5B5EZ 1KLUA 4XBGA 3IFLL 5DMIL 4Y2DB 2ZQKA 5FPIA 2DICA 5I18L 4G9DA 4IBTA 4R96A 5D71H 3GJFA 3RKPA 1B4JH 1J9RA 5HI5D 3WNIA 3HFFA 5CLWA 1NCGA 3QQ9D 3BPOC 1E8ZA 5I1EH 1K3IA 2WQAA 1KC5L 3KVDD 3RBSA 1AGBA 4X4ZA 4AKPA 3I3DA 5FUCC 3BKJL 2HG5C 4FYRA 3RB7A 3IDYC 4MJ6A 4JLRA 4ZNEA 5IHBA 5CLYA 3T4DA 1J9SA 1HYRC 3ZQWA 3SKNB 3V4PH 4GBXA 5HFMA 1BVKB 4WUUD 2UXBO 2IGFL 4NWUL 4AITA 3L3OA 1WFJA 4WFBV 1SA0B 2BK8A 1DVYA 1B0IA 3IKKA 2K7PA 4KKBD 4Z7OB 1AS8A 2WHVA 3VI4E 4DR7B 4QTHA 4PGDB 3S5LA 4A68A 2CLVB 3EFFB 2CCVA 1GJUA 3OX8B 2J8UB 3BVNA 3N43B 4J4PD 4BCXA 4J3OG 1J5EB 2YD7A 3GMPB 4LLQB 5C6TH 2FLMA 4LSUH 3VXOA 4YX2H 4OZIA 3CCVV 4NUPA 4OM1L 5K9KB 2M26A 3W0WE 1QBLH 3IDIA 3K4AA 3OXRA 4KMQA 3OMIB 3U7YH 3EZ8A 5L0QC 3BLBA 4MMYB 1F4AA 5BO0D 3BAEL 3HI6L 3QWOB 3C5SA 1NKOA 1O7DE 4XRCA 5F7FA 1HP8A 5J8OA 1VFBB 1ZV9A 3CHXA 4FTDA 3T04D 3M7OA 1JWMB 2Q3ZA 4IU2A 4NTXA 2YD4A 3MBEB 5FYLD 3TVMC 5I0XA 5IUCA 4U3FH 3N44F 5DHYB 2CCLA 4MVQA 4NJ9L 1QFWM 1U91B 1ZSDA 1DQDL 1B06A 2XG5A 3CQFA 4XN8A 4GG8A 4DW1A 3EBHA 4XMXA 3HN8A 4BK5C 4P57A 3DTDA 2CDGB 2EXYD 5DQJB 4Y4HD 4R7XA 1BFVL 3QJRB 5LNGA 3QI9D 2X4TA 3K8MA 1EM1A 2X9ZA 2R59A 2QE7G 1ILSA 4OZGF 5KSVB 4YIPA 1SQBH 4XN7A 4Z8FL 4BRVA 1KIQB 4H1LH 2XG4B 2VR3A 3IKCA 3QO1B 3B7YA 3L3JA 2OZNA 4MJ2A 4TM9A 5EIBD 1L5GA 1F6AA 1PX3A 3C09C 3IDGA 3L3DB 4Z76B 1EH9A 5I8EA 2G60H 5A2KH 5C0JB 2PR9A 1Q1JL 3CCHB 1UM5H 5HVHB 2CXKA 3NSYA 4UCVA 3T6WA 1BAGA 2IQ9L 3FO1B 4ZG1A 4JFOB 2DQFB 4IOFC 4GPVA 1JK9A 5FOBB 1VB9A 2EEXA 1X9QA 4G7SB 3GZKA 3CZUB 3JASB 1QATA 4JMXA 3Q8EA 1KTCA 5T5FH 4UDTB 2XIBA 3ULVL 3TN0C 3O9WD 1W59A 4GCZA 3HLKA 4LL9A 1HNYA 3UZEC 1KGCD 5CO1A 4DW0A 3CVHB 5FHAL 4OLXL 1T03L 4KKAC 3X14B 5AL8A 3OKEB 3MCLH 1MFUA 1UXWB 1EAQA 3UTOA 1MI5B 4L3FA 1Q9OB 4QRUA 5LVEA 3EFOB 2PABA 4FHJA 4U1JB 1G84A 2QGCA 3HC4H 4MCMA 5LMUB 1DBJH 3CSBA 1LL1A 1JIBA 1FYHB 2BZCA 2BW4A 1ZTMA 2IW5A 5T1DH 2P45B 3NQIA 4EUPA 4IJTA 4PJ6A 3K03A 1WCBB 3UACA 2XNDG 1KUMA 2WTOA 3REVB 4WFGD 2DQEH 4HS8L 1SEQH 1NKGA 4GAYB 2ZX9A 3ESNA 2V0AA 1IAKA 2R2CA 1KBKA 4ZTPH 4MWFB 1QI4A 1YEIL 2ZE8A 1OOWA 1X9UA 3H9YA 4QT5B 4FM2A 2UXGA 3GSNB 1FL5A 3QO8A 1R3LC 1BBJB 4DR3B 2OYMA 2XDHA 2LLNA 3VBBA 3Q6GH 5C09E 32C2B 3C5JB 4OUUB 4LHUG 2EC9U 1NBVH 5KLVH 1PMYA 3CC1A 3DVFA 3UZQA 2FSEA 4KK6D 4D9QE 4DGVH 1H3PH 4KJPC 2V37A 2Y69B 1J1XL 4KV5F 4GZRB 1JGVH 3P4MB 3CXHF 1G5AA 3HKBA 3CSTA 4G8EA 3ZUNC 2R9RB 3F5WA 1CXEA 3G9AB 4BBWA 3FB8C 1BFOB 2F53A 4H2AA 4UT6A 4HKZA 1RZQA 2ZCLH 1Z32X 4NHCH 3VXSD 3BZ4B 3APQA 2CRIA 3ZDYE 2FHCA 1XGQA 5F7DA 2J3SA 2VXTL 4QRSA 4XP1H 5DT1H 3T0WA 4EF3A 4POYA 3AU1B 3DOHA 5F7WC 2W92A 2DH3A 5I28A 2X28A 4PJCA 4IBVA 1D6EB 2PF4E 3KCPB 4UAHA 5LHDA 2HFEC 2GBVA 4FD0A 5JXEA 1OAQL 4MX7A 5T3ZH 1EPFA 4RX4A 2VZUA 2ZNWA 3BVXA 2AK4D 2Q73A 5MEOA 3GFUA 5GSVA 3SQRA 4KROB 5E5MA 2EBOA 1DVFD 4QYOB 2O72A 4FJZA 3D51A 3THOA 3TO4D 2AEIT 1YVWA 2BX5A 2H32A 4M4PA 5EOQH 3I6KA 2XQYK 3L81A 2BY3A 3CSYA 3EJRA 2ZE0A 1EMTH 2IV8A 3FULA 1RMFL 5EEUA 1XTMA 1EFXB 4JZJA 4Z7VE 9CGTA 3VG0L 3BUPA 4O2FB 1H2NA 1KLFB 3O3DA 4ZUUA 1EJ8A 3V52H 5I0VA 4ZIBA 2VO5A 1J8HD 2AK1L 3GXIA 2JIXA 4UQAA 4FM1A 4LGSB 4JRXB 5T1LB 4JE4B 1D9KB 3P02A 4KVNL 3ZVVA 3TL5A 1DJSA 1PVHA 4O02H 4M6AA 3UPRA 1E4XI 1E27A 4KI1A 2ZT9B 1FG9C 4UINL 4P0DA 3ULAB 1I9EA 1JERA 4FFVC 2IAMC 1A65A 2DOCA 1KPVB 4XHJC 3ZYZA 2JQMA 3S4SG 1A6UL 3HS8A 1Q6IA 1IVLA 1RP3B 4YSAA 3I56V 5DRWA 3D4YA 4POZC 1NMAH 4Y19B 2CDYA 4DTGH 1CP9A 3ZT5A 4I3SL 3VD1A 3LXAA 4K3GA 4HZ3A 3QW9A 5D7KE 3W7WA 2HLAB 4IRZA 2BH0A 3VXNB 3Q0HA 1FG2B 3FTUA 2PWFA 1S6NA 1I7RA 1SUHA 1G7IA 2GHZA 3G08B 4MMXA 1TZIB 5EYPB 1OKEA 1U2YA 1S7QB 5JJJB 5EN3A 3WMSA 4FI8A 1IE5A 3BPCA 4L4TE 5AENA 1MHEB 1QSFA 1JVMA 4OZHB 2CIIA 5GZOA 2G3XA 5KS9A 3GBDA 4FAAB 1CFMA 2DF3A 4M7LH 4R90L 4JTAB 1W2KT 5EO0B 4P2QB 3PHOA 2X0LA 4XMLH 4HUUA 3T8MA 3NDYE 3ZS8C 4OVVA 4CH5A 1EAJA 5IYDO 1UFGA 4GT7A 4Y5XB 5IHLB 4P9OA 4L4VA 1CE1H 4GAFB 1RZKH 4N23A 1UYWH 2BMKB 4H7VA 3MAQA 4AGQA 1MRDH 3WCYA 4QYAA 2YPVL 5CINL 1CVRA 3VFTB 3LZNA 4NQXB 3IBEA 4OV5A 3CN0A 4NSKB 4JL2A 3CP1A 2K70A 1Z7JA 2PP9A 1GSMA 1FGVH 3RU8H 3ETBF 5JIMA 2YXHA 4M61A 5I8OH 1GYVA 1MLBA 2YLKA 4YHZH 3VGGA 4WY7L 2ETWA 5CP7B 5SWSE 4TS6A 4CC6A 3CVIL 3QO0B 4ZUSA 2L7QA 3QFJD 1IC1A 3CFCH 3SDDC 2MK3A 2O1AA 4XMZA 2O30A 3E8UL 4H8WH 4PJ8D 3MJ9H 2W91A 3MUZ1 4GW1B 4XO9A 5AB9A 3NT0A 3U2SB 3KLHD 1M7XA 1JZIA 4P4RB 5PAZA 4OI7A 4WTQA 1CGUA 4QTIL 4C58B 4WV1C 2BZ7A 3GZQA 3VXUB 5C0CB 3VTTA 5JDSA 5IW6B 2JJ1G 1B4JL 3I55V 1XZWA 5KBKA 5I1EL 1SHXA 3PIQA 3NEEA 4ZUTA 3NIGB 3WAKA 5CN1A 2BNQB 1G94A 2IC2A 2A74B 5T3ZE 1N32O 1BREA 3BAWA 2WXNA 4X66B 1CS6A 1S7UB 5K9JH 3GWOA 5C8JA 4EN3A 1A6WL 2PTTA 3K5RA 1XNQB 2E9BA 4PJBE 3RKDC 2CKBH 5EOCH 3S35X 1AQHA 1IEAB 3L74H 2J5LC 1CG9A 1IGYB 4L8CB 2RCSH 3PNWA 3QFGA 1KV7A 4JJHA 2AKRA 5IWAO 1AXSA 4TWKA 5C6TL 5JHMA 4YX2L 1XIWC 2CDEA 4ZRGA 1ZHLA 3QCUH 1VJSA 1U8OA 3I02B 4AGNA 1QBLL 4HWBH 2VXSH 4CSTA 1JR9A 2DB8A 1AGCA 2QADB 1NCCH 5IBTL 1GYWA 4G3YH 1HWGB 4GRWH 3ESMA 1RIUL 4BUQA 2JWYA 4G6ML 1JCKA 1CLOH 1CL7I 3BISA 3EO0A 2D9CA 4JDEA 2GJ6A 1XILA 1INEL 2GK0A 3C6SB 2ITCB 3CZJA 2E6PA 4U6HB 5HGAA 1T2XA 2ESVB 4JG1H 3VI3F 1KELH 2OI9C 35C8H 3DXAA 2XA3A 3GBNH 4JQVC 4XC1L 1EAPB 4Y5YA 2FATH 2G4GA 3K59A 4BKSC 4L3AA 2R0ZL 2APXA 4RGNB 3UFIA 5DUPL 3SE9H 4CS4A 3ULVC 1F2QA 5ES4B 4AMKH 5E8EA 4OJDH 1XD1A 3OKNB 4PJ5E 5BOZG 3GTVA 3OXSA 3HA0A 2CO2A 1GCYA 5I6XB 4WUUE 1UTDA 3K8KA 1EHKB 2EVFA 5BJTB 5I8KL 2XVLA 4TQHA 1XH3B 3QIWD 1FSKC 2F5BL 1W0KG 1OAXH 5B3NA 1NC2A 2W9EH 4ZTOL 3UAAA 2WXHA 2H3XC 3JD3A 2G60L 3JTTA 5I30L 3CVDA 1TVBB 5F9JA 1MCNA 1GGTA 5DUJA 3VAEA 4OLYL 1J5OH 1NWPA 2A6DB 3EO1A 4Q6IB 3T0XA 3U9UA 4N21A 2X0VA 4FL4B 4F9PC 1CD8A 2OP4H 5T5FL 2NUTB 3NCBB 4HQQL 2Q8VA 4E41D 2QQNH 1S7WB 2E74B 3HRZB 1KYDA 1K97A 4DN4H 4H25A 4JHBA 4BINA 2BS9A 2MJWA 1WBYB 4L23A 1ZKAA 3FQRA 2HAZA 5DJ2A 4PRPA 1O6SB 3K81A 3FUKA 4JBSA 3QDJD 4LF3B 1UZGA 3DGDA 5HDWA 4MA8L 4EEQA 3EF7A 4NQEE 3KXFA 2PYFB 1SETA 4HG4J 3L5WA 1DSWA 3HC4L 4FQLH 5CEZL 1FNLA 3MRHB 1N8ZB 3QZWB 5IJKA 5I75B 1A3RL 3ILEA 3BW9A 5GRJH 1KBHA 4RMBA 3SGJA 3TF7C 1AACA 2NN4A 3FNKA 1SEQL 1NLBH 3FT2B 4IHJB 2ZUUA 1TUBB 3ZQXA 2WQRA 1BMZA 4HZLB 5IVXA 2F15A 4M93B 4NRZB 3T77A 3U4AA 3FOLA 3LDEA 4S1RH 3ZHFA 4CRPA 4ZTPL 3WTWA 4RZCB 4HCFA 5G5DB 1H3GA 1TO5A 3DGCR 3RHWK 4FABH 5KSBF 4TUKL 3UEZA 1UT9A 1ZV5A 3VFGH 4F6RA 4TNFA 2XN1A 4B41A 3ZL4H 3CZSA 1HAWA 3MNZB 1ZPLA 2CCWA 2IANA 2YAOA 1HTYA 3FTWA 3L1OL 2VRZA 3DRQA 4PCTA 1KBVA 3IRCA 4WJG3 4DQAA 3D87B 1NC4A 3IVKA 1H3PL 4LQFH 2J88H 1FL3A 3D0LB 1MVFA 2JQAA 3WL9A 5A7BA 1NCAH 4LSQL 4WNSA 1BD2E 4N8VA 1RP9A 2WA3A 1IC4H 4MNQA 1KY7A 4NKIH 3JAKB 2Q86B 2A9NH 4NHCL 4R9HA 3SJCC 5IJ9A 2VLLA 4TTDC 4RH4A 2NDGA 3D48R 1BBDH 1KGCE 2R2BB 4KXZH 1HQRB 2J1XA 2ZIDA 5I2IA 3GUFA 2P7TC 4ZPVA 4L3EA 4H8HA 3SY0B 3F7YB 3IJHB 4PJFA 3E89A 3GDCA 1FRGH 5MEND 3LD8C 1O7DC 1T80A 4GRWE 1A1NA 1KGYE 1N64L 1G1KA 2A1WL 3QXWA 3MNMA 4BZ1L 3WD5L 5BV7H 4KGJA 2EVJA 1FFQA 1PFOA 3FQTA 3KWXA 4WFHD 4J5VA 3BP4A 1KFGA 3ME0B 5E9DE 1IJNA 3GBEA 1UD8A 3QS2A 1XEUA 3T08A 4PS8A 3S2AA 4GSQA 4AK2A 4X64O 3H7BB 1JVLA 4OFPA 4PD4J 5BVPH 4XXDB 3ZRSA 1H2SB 4O00A 4BYHA 1F90H 1S9YA 4ZODA 2NXZB 4FYSA 4ZFZB 3UYRL 4TT3G 2VDPB 3MNVB 5CSZA 1WAPA 3QHZH 1AO7E 3L3KA 1KJ2B 1LWRA 4OR1A 5BVJA 3U2IA 1J12A 5IEKB 1KECA 2NY7H 3LS4H 5FKPA 4Y88A 3PQYA 3QEQD 4YJ3B 5K1XA 1HX0A 5E6YA 2FYYA 3ARDB 5FGBA 4ZX3A 4WRLA 4P3DA 1ZWIA 3EYSH 3HCVB 1IBBA 3UAJA 5C6PB 3VMNA 3ABMC 1TQCB 3G5ZA 4R7NB 3UT5A 3ETDA 2E76C 3H9SA 1V3LA 2JB5L 3MJWA 1N12A 1U3HD 5F7UA 1NMAL 6FABH 1JF6A 1YN6A 1JNLH 3QNYB 2RALA 2X7LA 1F3RB 3F12A 3O6LH 4OD1L 5KYYA 1NGPL 1NPJA 2P4AB 2ZWKA 3B3BA 3UCQA 2DZEA 3PAVA 2EIZA 4NKMB 3RDTA 4DV1O 4Q9QH 3CXCU 1Z2KA 1PLGL 4JHWH 3E8BA 4JDZB 2YSSB 2D4DA 1OY3B 2XWEA 5C0DA 2J1YA 5DCCA 1AJ7L 1P1VA 1KP3A 2IALA 1ONQB 4D0BA 3K5NA 1KTLA 1MVUB 3V9EA 1LE5B 4JF3A 4LPYA 1XGUA 1FVCB 4YSDA 2GSGB 3ES6A 4DR5O 4GXUN 2FX9H 4Z0BH 3N44B 1HHJB 3P1VA 2X2YA 3HZMB 2ZUQC 4M5SA 4X2UA 1CE1L 1RZKL 4Y1AA 2AW2A 4HJUA 4GW4A 4IHOA 4QRRD 4DV0O 4K3JL 4X6FA 4N8PA 3IMUA 5GW7A 3ZRXA 1ED3A 4NP4L 1B9ZA 3MRFA 2ZCKH 3IN2A 1H9VA 1JPGB 4GO9A 5A6IA 1BQSA 2A38A 4OZGB 2VDKB 5ISZA 3RVWD 3PLYA 2CBMA 4JJ5B 4XPAH 2OR8A 2VISB 3W81A 1FGVL 3RU8L 1HXKA 3UL4A 2ARJQ 2IDCA 4DETA 1RZ7H 4FQPA 5FYLL 3H53A 4JHZA 3UJIH 4DEWA 2ICWJ 5FYJH 3WYRA 4KTEL 1S7RA 4ODSH 3MO1B 5ITFB 3LQAL 3GKZA 5J6GB 5A6MA 4H8WL 1JHLH 2F8OA 2CJSA 4I8DA 2AF2A 1I08A 2CO7A 1QFUH 1KDJA 3BFWA 2F54A 2JCCF 5HHVH 4AJWA 3AITA 3RVUC 2AXGB 4GRLC 5FYKH 3F83A 3RT3C 2UXDO 1BXVA 3H3KA 3JATB 5I1KL 1MFAH 3S3SA 2PO6D 1USZA 2YOCA 4MW8A 2VQEB 4E9TA 3P4OA 3O3UN 4UM9B 5C7XH 1GS8A 3TBSB 3I9PA 3V4VH 1J05A 1N7MH 2XX0A 2BNUA 5DWUH 5E5UB 1VERA 5IESL 4F7MA 1GAFL 5K9JL 5K1NA 2EKSA 2P44B 3OAZK 3OTOB 4FF9A 4O2AA 1MJ7H 4ODUB 3FL7A 5K9OA 3S2CA 2RAMA 3JSNA 1INDH 4I2XE 3X3GL 3WFCH 1LE9A 2HTKC 1E28B 4X7DC 2WAQA 5IJ0A 4RSVA 1IX9A 2Q8AL 2HPTA 3VWJD 4MJIB 4APXA 2DLGA 3G67A 1OEZW 5D93C 3V6OE 3V6ZB 3I6SA 2WBKA 2E75B 2CO6A 4N2BA 2X6UA 4DK6A 1FBIH 2HJFA 4JFFB 4LLWA 5DMJB 5DDHA 4EBQL 3QCUL 4FA6A 1XF2A 2F1BA 5DMKB 1DQML 5KN5A 5DZNA 3V8OA 4PJXE 3MDSA 4OGAD 1I0HA 4HLZG 4H5SA 3PWVA 3DV4B 1QKZH 4G1MB 1ETB1 4P5TC 1K4CC 1MRCL 5IY5B 4DW2H 1PV0A 1DANT 4G7YL 3G5YA 1CIDA 1BZ7B 5HYJB 3OJMB 3QIBD 1NGXB 1ZLEA 3ROLB 4LOEA 1WIPA 2H0FA 1URZA 2EDEA 2F6AA 5DMGC 5KJRH 4X7SL 1NTKH 2X4QB 1PF3A 4FXKB 2CUHA 1DVTA 4GIPD 3GBNL 5D6CB 2QWQB 5GQBA 3TA3D 3UPCA 2FATL 5KHKA 1LP9E 2Z6FA 1PS3A 3RVTC 3NJKA 4HA1A 1OSPH 1IURA 1FS0G 1CFNB 3NJXA 4NLHA 3UBXG 4R8WL 4AMKL 4FEMA 1X4ZA 3MDJA 5DA4A 1WVZA 4P04A 3ZKXB 4MA1C 4GXUM 4KOBA 4ONFL 3MROB 5DFVD 5DQDL 3OGCC 1X7SA 3MFGB 3UC0H 4KK8C 2FYUH 2VUOA 2JJSC 5EV7A 1AQDB 1YEDB 5KSAD 3NOIA 2ZX5A 2C4FT 4MSWB 5LN8A 3ZGIA 3CRRA 3AG3B 1L3WA 2FH6A 1H2LA 3BN9D 3IGAB 4LPXA 5HHMB 4X4XA 3WKNA 3CX2A 4JMNA 4E5XG 2J1KA 2NY0C 1WP7A 4H0LC 5CA1A 3MCG1 5IF0A 1YI2V 1HWWA 3VFUB 4BDVB 1JS4A 2YS4A 3O8XA 4DP6X 4XNBA 1DJZA 3ETGA 2V9UA 3KPSA 4TSCH 3MRKA 1DE4B 1D7DA 1PJ9A 1A6AB 3AREA 3QRLA 2V33A 2DAVA 3FQNB 3C87A 3Q6FA 2QQNL 4NNYB 1JTTA 2Q1EA 3PFUA 4MQSB 1HI6A 2OJZH 3BP7B 4B97A 2E7BA 4LT7A 5IB1B 3VI4F 5ESAB 2VDOB 1SBSL 5EEYA 2AJXH 3WJMA 2P4KA 1OTSC 2NY3C 3FONB 3OAYK 5ABAA 1AGFA 2C8NA 3PXLA 1X5AA 5FYJE 2XIIA 3VSUA 4BWUA 3N85H 4B60A 4ZMPA 2JI1A 2P46B 2DN9A 4HT1H 1HKFA 5SWZA 4OUOA 2UZIL 1IO4C 1TTFA 2IH1C 2XWCA 2ZXEB 4NKOA 1S5IH 1S7XB 3DUUB 4YR6A 1CDJA 1WT5C 3VD5A 5FYKE 5KTEH 4XE0A 5DJ0A 4GQ9L 3O3BA 2HLFD 2ARWA 5HI3C 4RNRB 4PIBA 1WA8A 5JHDA 4V1DB 1VDGA 4YSSA 2VERN 3UIYA 4S1RL 5A2CA 3MN8A 3VCLB 5BQ7B 2XWRA 4AQEA 5D7JD 1JV5B 3LIZL 2JJWA 1EO8L 4RFNC 4U6XA 2RGSA 5F71A 3ASOC 1KTDB 5DURD 1Q0XL 4LF4B 3QQ3A 5I1LB 3EFFK 4DV6B 4NYKA 1FZJA 3L6FA 3RIAK 4NYLB 3EYFA 2W9DH 2CDFB 2VR9A 1KXVC 3JD1A 3H9ZA 2J88L 2B08A 3GNMH 5T3XD 1Q86W 3Q8CA 4M1GH 1MWAB 1OD9A 4KI5D 1IC4L 4YSTA 4NKIL 3FD9A 2VN5A 3CRCA 4CH4A 3FU6A 1PD0A 1G7QA 3ZOAA 2QHRH 4BQ6A 5H4ZA 4K3AA 1G0XA 5F9OH 3STZC 2YAMA 1OARL 1XF1A 4PJ9C 1JDDA 2XZQH 1NFIA 4KZCA 3IDYB 1TAEA 3HE6A 2WBJC 3QYCA 5EBMC 4YBHA 2D0HA 1Q6HA 2MNJB 2NY2D 2IQAA 4CDGC 1G6UA 4NTYA 1PLBA 4HV8A 4JFDB 2DBLL 4GAGH 3VH8A 5I1IH 2PMZA 2X9XA 1ILUA 4JAUA 1ZT1A 4PI2A 4FCAA 1A6TB 4J1UA 3EOTH 3DSFH 1ZL8B 4KJYA 5EOCJ 5IT2L 5EU4A 3EUDA 4NT6A 1MJUH 5IBUG 2AJ3A 2W81C 4OLUH 4KVPA 4GX5A 2YRZA 3JV6A 3QQ9C 3MJ7A 2CHXA 5LGJA 2QR0A 2BCMA 3NCWA 2EDKA 4B53A 3I3EA 2ZOUA 1E8XA 2J7LA 2R1WA 4Q4EA 5JR1H 3FUHA 4UU9B 4CC5A 3KLSA 4UQDA 4LF5O 4EI6A 5J2TA 2WJ5A 5BZBA 1G1XB 4HKXB 4R7VA 2AJVL 2R7EA 2ZKXA 1KBPA 1Q0YL 1EXHA 4X65B 1IVSA 2NY7L 3RAJL 5GGTL 5KOVC 1T5KA 1H8NA 3TVMB 3BP6A 1IVTA 2J8HA 3DGGB 5CMUA 1ET5A 4J4PC 2WWOA 3EYSL 1DL7H 1SQFA 1IEBB 3CK0L 3AY4A 4X5RA 1RZKC 3QYNA 3S3XA 3ZMUA 2XQBH 1JN6B 2Z92B 1NZRA 2DYRB 4Z0XB 1GC1L 2H6PB 1NBZB 2LGWA 2I07B 4QO1B 3BX7C 1FC1A 3M6DA 4LK4A 5A2LH 4PW9A 1Y6XA 5SWQA 2DL9A 3BABA 3MRLA 1JNLL 1OM3H 1VAHA 4HAGA 5HDOA 5EMYA 4F7KA 1F02I 3T71A 5E6SB 1T0NB 1X5LA 2Z64C 1JVOA 2JK5C 2NLJC 1VFAA 5MENE 4KNSA 3VM5A 2W6IG 3ABTA 2Y3NA 3L73H 1M42A 3O6ML 3VQVA 4ZNCD 3P11L 1Q9LB 1UZ8B 4QOKB 3WJJC 3Q06A 2EABA 3VXPA 1GO3F 3C09B 4PD4F 3WLWC 4EDXA 4ZBJA 1IB5A 3H2WA 4M9PA 4RA3A 4H8WC 3P73B 1RY7B 3ZDYF 1NAML 3KKYA 4ETQB 5LP6A 2LU4A 3T8VA 4N6RB 4Y4HC 4WGWB 2FX9L 2V7HA 4CMMA 2MOQA 1F11A 1JUFB 3VI3B 1E9OA 1S72V 1J0HA 1QOKA 4WSJA 1ZHKB 3RRQA 4K94L 4JG0H 4XR8C 1Q94B 4QXTB 1MFVA 2O6EA 2QQQA 4FFYA 4M8UA 4XBPB 3TN0B 1VMGA 2ENPA 2ADFL 1GMGA 2A9HA 1P7QA 5EIBC 3NZHH 4HWEH 4K2UH 4XCYA 1UWEL 3B2XA 4UNUA 4YDNA 5GIRA 4NERA 4N2IA 1ZLVH 1YC7A 2VE6B 4OTXL 3UJIL 1RPOA 3WTTA 3BN3B 3EYQD 2LLLA 4KUZL 1IGIH 4ODSL 5KG9B 3KPMB 4Z7VF 4XN1A 4DR7O 2VLKE 5D1QD 1EN4A 2CTRA 1JHLL 3ALWA 2HR3A 3PG2A 1V9PA 1WS7A 5FKAB 2BSDA 4KDTA 3BH8B 2ZSWA 3O9WC 1J5EO 3TZVB 1B88A 3S35H 3UG4A 3F6JA 2OL3H 3B8NA 2KERA 4PTTB 3KLAA 2G30A 1H19A 1DBAH 1Z9MA 3AT0A 1R5VB 3DPBB 3APDA 5B66Z 4GT1A 3I5DA 4E9WA 2WCGA 2BDNH 1LO4L 5J9PC 1IBKB 3V4VL 5DLLA 4XPHH 4N0UA 1G1OA 3QZMA 5D72L 1ZK9A 1KIPA 5DUBB 1MJ7L 1ECYA 3K72B 2B5IB 4JO4H 3KW8A 1OTTD 2QEJA 3FB8B 1BM3H 4OQTL 4I0XA 4FLRA 3CV5A 4BFGA 1YPZE 1E9QA 1JWUB 1OLLA 3B2VH 1FPOA 1R33A 2P42B 4HDIB 1Q43A 4I0PA 5E1AC 2LW3A 2Z31D 2PCPA 4N4YB 4JASA 2KLTA 4YBLC 2HFEB 4TQ8A 4A6YH 4KK6C 3BRDA 1KUQA 3HC2A 2UVEA 3QORD 5KSBB 1N8OE 5F1IB 5FHBH 5ALBL 2QVKA 1QPXA 4NQDA 4GUQA 1NDGB 4BIUA 4NQCB 4NO0A 1IKFH 4PEEA 3RWCA 1F0LA 4HH9A 4DGYH 4XNYH 1E4KA 4X8JA 4D0DA 4NM8L 2G75B 3H6JA 2DE0X 3DI2B 5KJRL 5EIVA 2YDEA 1MFDL 5IB2A 3GMQB 2JTDA 4QHPA 5DGRA 4DP9X 5J1AA 2GBAA 2AJSH 3KCXA 4M7KH 4U33A 4JM2A 4F24A 2QBWA 1FAIH 2C4XA 4OD3L 1OSPL 1NQTA 1QW9A 2FT6A 4MD4A 1SZNA 2GYSA 4Y5VC 4NFDA 5B1BC 2VKWA 4P9HL 1UWGH 3GMOA 4WWKA 5CEXA 3CVBA 2BW5A 4GKNB 4JRYE 1SY6H 1ZLDA 2BTQA 1JG9A 1VADA 2VC2H 1P6FA 1N5AA 4FQXD 2XLLA 1FFNB 1EJ6A 5DECA 3D3VA 4Z5RB 1L9OA 5EEXA 4JI3O 4KBPA 2IAMB 3HNSL 4KNTA 5T3XH 2XAJA 5LMUO 1T20A 1THZA 5ERWB 3HKCB 3V2AR 1BL8A 3HMXA 3L2MA 4U1IB 3HE7B 3RFZA 4F15C 1TGOA 3BRFA 3DURA 2HN7A 3MV7A 4HUXB 4BA8A 3OR7C 4LDLB 2VDQB 4XODA 2ADQB 3MV8B 2CLRB 5EFIA 3VFMA 4AYFB 4ZZFA 3B9AA 3KNBB 3UTTD 3D2TA 1I85C 4UQCA 4B50A 1YYMH 1U8IB 4Y16D 5HDLA 5T1KD 4I50A 1A6PA 1R3JA 3TTYA 3AABA 3CFKA 1QD0A 3GBML 3CZFB 3I9GL 5E2UH 1TXKA 2HX7A 1CIUA 4PJBF 2ATAA 4DR3O 4JY5H 1K34A 3IF1A 3LS5H 2OMTA 4OB5H 4XI5D 2QM4A 1BQHG 2BSBA 3C60D 4QTFA 4YQXL 3FU7A 5GPRA 2Q3XA 2DLFL 2EUZA 3N85L 5SX4I 1JRHH 1KTRL 1RV6X 4HT1L 5EU6B 1NGWA 1HSAB 2FEEI 2WXQA 5D7IA 1XF5A 4NQQA 3PABB 3FAVA 4U3JB 1QVFU 3T2MA 4WAFA 3M1BB 5IFHL 1HHIB 2FHBA 4N0FA 1CLZL 3OQRA 4DKFL 1J5IA 4L8SC 3QQ4B 3DIFB 4JVPA 1V7MH 1LO5B 3LZFH 4G8GB 4MASA 3F7RA 1Q9KB 2OSLB 3T1FB 5TPWL 3T6XA 1YJ9V 3P4LA 4OF8A 1PY4A 2A5UA 5IFJB 1FFXA 2WZ0A 5IVZB 5C0GB 4XPFH 4ZBMA 1I1AD 3T2QA 3O45B 2WLYA 2Y6SD 2DQCL 1OP9A 1DZBA 4FGMA 4HWZB 4WU7A 2WVVA 2XU9A 1TU2B 1G7JA 3O4LD 2NXYC 3WLBA 4BE5A 3SDDB 5J7CC 2QKCA 1LD9A 4BA0A 4JKWA 2XIDA 2XWXA 3STLC 1XNRO 1RSYA 5I24A 4AIZA 2A4EA 4JR9L 4U1KA 2QWPB 2I27N 4FG2A 4ZS7H 3FT0A 1TEYA 4WV1B 5GS1B 1A4AA 3V6OC 2JXMA 2VLRE 3JZ7A 3W7TA 4OLZL 2H1LM 1U8KA 3RNKA 1WJ3A 4JHAH 1H9DA 2W60A 3AROA 2QHRL 3WNLA 1P4IL 4N68A 3JARB 1T0MB 3RTQC 1LDPH 3ELQA 2XZQL 4R5VA 1OAZH 2A79B 2CUGA 2NSMA 4RAIA 3DC5A 1S9WA 1RZGB 4D8OA 4HKBA 2CTWA 3M7FB 1CGSL 5DJYA 3RZCA 5BXZA 2DWSA 2ZKHH 4JRWA 4PJ8C 5GZNA 1JXDA 5BRZD 5EIQA 4AENB 3BP5B 2RTTA 5I1IL 3QO7A 3FQ1A 2ZOOA 2B9AA 5AOIA 2DQHH 1B3JA 3GM8A 1QG3A 4Q7DA 2B59A 4RAVB 2C9RA 1HH6A 3ARTA 1U0QA 4K3HA 4I1RA 4AMXA 3UBXI 1A4KB 1D6VH 1FJ1A 2OTJV 2Y7SA 1A7NH 4LWSB 1CFVL 2BIQA 2JCCB 1XIWB 4M6NH 4ELKA 4PGBB 5KZCD 3X1GA 4IHBA 4FMTA 2A9AA 5I6MA 2ZXBA 3CQPA 5IIEB 2ZG1A 4HWNA 4MZ3A 4P2YA 1MNGA 3C5ZC 2ZYHA 3M17B 5EWIH 4DCQA 1IAOA 1U8JA 1J0ZA 1UCBH 2YD8A 3GSRA 3BUDA 1BGYH 4S1SL 3A21A 1IX2A 4TN9A 1WA1X 5DJXB 3LV3B 2VDNB 5AAMA 3BZ5A 5T3XE 2UY6A 2OI9B 2WOYA 1Z9OA 4XXWC 3A6BH 2VMDA 4JHUA 4KI5E 4P4KD 5GGUB 3US9A 4MLIA 3VFNA 4N3TA 5ILTH 4K94C 3FFCA 3HG1E 1FLRH 2AEPH 2Z5UA 2DQ3A 1MPAL 2GJZB 3ZHVA 4UB0H 3KYNB 3OLIA 4F8QA 5ITBH 4JDTH 3TBVA 3QZPA 3Q5TA 4JFYA 2GSIB 5D4QA 1HILA 1XZ0B 2YPLB 1W9XA 2F68X 5E03A 2Z8WC 3ECQA 1U8QB 3QUZA 1HNFA 4QCIB 4WLCA 4HU8A 1ZGLP 2FR4A 2X12A 1FSKB 2FECL 3CVCA 3LRGA 4X9HA 5DS2A 1HK6A 1L6XA 4OT1H 4PJGE 4TUYA 1NEUA 4BFRA 4U7MA 2ITEA 2BXYA 3LN4B 4L5FH 2Z7UA 4NO2B 3T3ME 4APQB 2BJML 3NYKA 2H6OA 3OC8A 3LH2H 1NBQA 1UB6A 2X7RB 1KCBA 1S78D 2FJFB 5HGBA 4IOSA 1F3DH 3ARYA 5E6IA 1CQKA 4JG0L 5EBWC 4GRWF 1ZA3A 2UX7A 3P2BA 3UG5A 1C12B 4AIXA 1NVPD 1JOYA 2R2EA 4HC1A 1S5JA 3FCBA 4YL4A 4AEEA 2H3KA 1SDDA 3KG2A 1U8CB 2XXCB 2EX3A 1ZJBA 3Q2NA 2D0FA 4HWEL 2UX6A 4K2UL 3E3QE 3BPLC 1JNNH 2FBRA 4P49A 4X66O 1EZSA 4NN7C 2YIAA 5C0EB 2GJRA 3LMJL 1OIOA 2VLJE 1AHWA 2E27L 1RUML 3MUUA 3QEGL 4PRDA 1XNQO 2IMNA 5AB1A 1L7TL 3MRIA 3JAMN 2OX5B 1GZPB 2EKJA 5KYUA 1BA9A 2XKUA 3X12B 1ZCRA 3VD2A 2IDQA 5C0BA 3RX7A 1MCLA 2Z9TA 5EF1A 3FF7A 1WBXA 5EPMA 2P6JA 1S7SA 5BMVB 1RHHA 1YEGH 1UH4A 3S35L 1EZLA 4DH2A 1MKFA 2OL3L 5HVGB 1WZKA 1X4TA 2Y36H 1SJEA 3IFXA 2EE2A 1AGEA 2YI9A 1DBAL 1PZUB 4AE1A 4HUWA 1SOQA 1FXKB 1GHFL 3OTFA 2DWYA 2MQ3A 2FWOB 3AC0A 5F3BB 1MG3C 4DAGH 2APBA 4BGDA 4YIQB 4LVEA 3B2DC 2X6MA 3HR5B 1BX2A 5DEDA 4HMEA 1ZAUA 1KJVA 3JYBA 3DVNB 4XPHL 4XVTH 5HHOE 3W7XA 4MNGA 3WN5A 3P3YA 1OGAD 4N90D 3VI4B 2JI3A 3ZGHA 3QUHA 2UXVA 2Y22A 1KB5H 3DIVA 4NC0B 5LKNA 2CIKB 2RFXA 4UOW1 3JT2A 2FJHB 1BQLL 4JFQA 3VFWB 4TL4A 4ZFGH 1QA9A 2UY7B 5JPMA 3OTTA 5L6YH 1MCDA 1T22A 1ERNA 5SX5K 3W0WB 3B2VL 3IMWA 3MI6A 2BVOB 1CF8L 3PL6D 2SODB 2WXMA 3PWLB 5ID1A 5H2BB 1MNNA 3MV9E 4N2KA 1PZBA 2FMLA 2P7TB 1BLNA 2VDMB 1BZOA 5BRQA 1WBZA 1UUNA 4BK4A 1FORL 3MLUL 5EZOH 5AVUB 4IIZA 3VB8A 1YNTA 2BP8B 3ZN6A 5HJ3B 1B0RA 1G7PB 3APNA 1ZT4A 2A6IA 5PCYA 2OSXA 3CMEV 3U0PA 5LGNA 1JPTH 4ZDHB 1HQ4A 5D1QE 1ID2A 4W1TA 4PJHE 1HT6A 4KUCD 4M8QA 2Q7YB 2VQUA 3MYZA 4JHVA 3ZKSD 1D7CA 2CNZA 4I4TB 4MA7L 1F4XH 1XCXA 3P2DA 5EZJA 3BT0A 1EEQA 2CA4A 3IU3B 1LMKA 4TSBL 4NCC1 4DESA 1FAIL 1M2OA 5ETUA 4ERSH 2DBJA 4YPGA 4CBPA 4GMSH 2YQ2A 4HHGA 4A39A 4F7TB 3ZIYA 1UWGL 2Z8SA 4UCFA 5IB5B 4JTDB 4W4KA 1DBBH 2ADGA 5B21A 2KUTA 3EVKA 2MQGA 4LC1A 2PCFB 2P5WA 1YNLH 3QUML 3V0VA 5L4JA 4PQXA 1LNUB 4A2MA 1PJWA 2G9KA 4EAEA 1XEDA 5CNHA 5KMGA 4EIUA 4O4IB 4I4WA 2P8PA 4LSVH 2H8PA 2C7UA 2FX7H 2IH9A 4KRPD 3VWKA 5T3XL 5J5EA 1TQSA 1O9HA 3FYIB 1FVEB 2Y24A 5DEJA 4A2DA 2I7SA 5I17B 4KFMA 3S3PA 4LVHC 4YDJB 1E3FA 3KAAA 2WZPA 4NPKA 2IWEA 3K5MA 1X5YA 2JLPA 2QKIC 5I1AA 1IMHC 4ONOA 2YXYA 3ZX1A 3QDME 2A73A 1IKNA 4PREA 4XVSH 2E7DA 1JP5A 2FO4B 2HT4D 4N87A 4NAMA 1OQXA 3AB0C 3BEWA 1HN1A 4LSRH 4ODTH 5E8DH 3C08H 3IJYA 1IDSA 2K9PA 2J21A 3ZHLA 4DK5A 4F9LC 4YZFE 1FGNH 5F0PB 3KR3H 3N5AA 3LS5L 4JY5L 3ZT7A 3E1ZA 5DD1L 4Y9EA 4N2AA 3QE5A 2AI0L 2ZM6B 1W15A 2NDFA 3DXRA 4QHUA 4RQQA 1U3HC 2AITA 1N5YL 1NLDL 1GPOH 1JRHL 1YYCA 4NM4L 5GGSY 3U36B 1W91A 2WNKA 1FH5H 5CU5A 4TL5A 4HJJL 1G6RL 3BZFB 2QFRA 4C56E 3FU8A 3SPHA 2FHFA 3CHOA 1YAIA 4FJ6A 2VQTA 4PLJC 3KWTA 4NZJA 3DJZA 3B56A 1JAEA 5EZYA 5C09B 2IWGA 1J10A 3QHFL 1BVKA 3MOBL 4GBXD 3V4PB 3CC5A 3BCDA 3FU3A 5CB4B 3O4OC 4XCEB 5I1JL 1DCEA 1SA0A 5IVOA 4TYUA 5DHVH 4TUOB 3D52A 3RX5A 3NG5A 1LP9F 5CBHA 3MUGB 4I9WA 2YI8A 2K1EA 3EFFA 3H42H 2M1KA 3QUKB 2J8UA 4LEOB 3REWB 4LLQA 3GMPA 4N1EA 5LA6B 3ZDYB 4ZS7L 4GRLB 3ML8A 3UTTE 1FFRA 2Q0ZX 2QSVA 4J7KA 5K9KA 1A8JH 5E99H 4XXCA 4ZXBB 5F96L 3RVWC 3GHPA 5I76B 3LNEA 1X5XA 2CUMA 1ZE3H 3SD5A 1LDPL 1LWHA 4AQZA 2WLHA 3E2EA 1VFBA 5FAAA 2WTRB 2WSSG 4RQFA 1JWMA 1IRAY 2ILMA 1NEZB 2WYZA 1WWCA 2OMYB 4Q14A 4UUJA 1IGFL 1ADQA 5E08L 4FULA 5L88H 3IC7A 4X7CC 4OFVA 4NNXB 4PV9A 3HAEA 2EE3A 4C83A 1XCTB 4LU5H 2ZDIA 5IP4A 4Q2ZA 4YGVB 3R65A 1YY8B 3VD7A 5DQJA 5I16B 2PO6C 4YXKL 4Z7VB 1QLEH 4NZTL